2VBTA

Riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with cdp and po4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
136
structure length
136
Chain Sequence
MVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGDKDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RIBOFLAVIN KINASE
publication title A Ctp-Dependent Archaeal Riboflavin Kinase Forms a Bridge in the Evolution of Cradle-Loop Barrels.
pubmed doi rcsb
source organism Methanococcus jannaschii
total genus 22
structure length 136
sequence length 136
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2vbtA01
1T6XA 1N08A 1P4MA 3ZUGA 1N06A 2P3MA 1N07A 5TRDA 4UZEA 1MRZA 1N05A 2VBTA 1T6ZA 3BNWA 4UZFA 1T6YA 2X0KA 3OP1A 1S4MA 2VBVA 2I1LA 1NB0A 2VBSA 5A8AA 5FNZA 5A89A 3CTAA 2VBUA 5A88A 2OYNA 1NB9A 5FO1A 5FO0A 1Q9SA
chains in the Genus database with same CATH superfamily
2Q6IA 3SJZA 2NV4A 3R6JA 3CP8A 2JJ2A 2E1BA 5CDFA 3CCMB 2OTLB 1YLOA 4X7DA 1E64A 4ZGQB 1MABA 2WR8A 1QFJA 1UD6A 4IW3B 4P26A 3VNUA 4X7CA 3JQQA 2J7KA 1XFOA 2ZTNA 3GVKA 2X3UA 3Q39A 4FN5A 2CW5A 4YEJA 5DS0A 2Q6LA 3QFCA 3ZBUA 4DQKA 3RY8A 4AC9A 3CPWB 4TN1A 4K1XA 3CTAA 2EFGA 1QUEA 2WYRA 4J0QA 2DIEA 1QX4A 4PGOA 3OW7A 3CMAB 3PA2A 5DSZA 4XOPA 2GJPA 2JDIA 1N08A 2DY1A 4OOVA 2BMWA 4XN0A 1FNCA 3I56B 3CD6B 1YITB 4TMTA 1FNBA 2OBSA 2ZZFA 1BMFA 1QFZA 1RQPA 3LNNA 4RPBA 5F4OA 1YX2A 1E63A 1YJ9B 2RC5A 3A3BA 4TMWA 3KL9A 4RJLA 2V31A 5A89A 4P3YA 4HE6A 2QTZA 2ZZEA 1NJID 1RQRA 2E1RA 4TMXA 1EXMA 1FDRA 2CC2A 2WJVA 1GAWA 4Z4WA 3G4SB 3OEHA 3AVWA 2XNDA 1N05A 1V0EA 1T6ZA 3P26A 4N3GA 2RC6A 2QGGA 4Y7CA 1VF7A 1AIPA 4RD2A 2PE3A 3A3GA 1BQEA 1QGYA 4YELA 3AGPA 3BC9A 3AVXA 4XLHA 2HLDA 3ASTA 4QVJA 1VQLB 1VQ8B 2Q6KA 5JBQA 1HZEA 1VQ5B 2KVOA 4GQNA 1G7SA 3BCFA 3WNBA 3T53B 4L8JA 1H8HA 4P3IA 2OTJB 1AMOA 3ZBTA 4AF7A 2DEUA 4ZCMA 5HZBA 3U2QA 2VNJA 3CP2A 2XZOA 4QHYA 2GK7A 4XKWA 2BGJA 3Q38A 4KKTA 4NCNA 5TV2A 3CCRB 3A8JA 2BF4A 2XNCA 1K9MD 2F1MA 2DYIA 3PA1A 1W2BB 4CQJA 2V7UA 2CF4A 1Q9SA 3BQJA 1PJ6A 1G7RA 1P4MA 1R5BA 1VQNB 2VJIA 4M2LA 4Z4YA 5KSWB 4MYTA 3SLDA 3W5UA 4UZUA 1FNDA 1FX0A 3FKSA 1DDIA 2X0KA 1YJWB 1KK3A 3GSIA 1JJ2B 4M1KA 4QVAA 5IYRA 4XMYA 1W35A 4Z1MA 4TT3A 4XNFA 5FNZA 4RCYA 1WOOA 1U2RA 1V0FA 1J9ZA 2BV3A 5H5JA 4X0CA 1NRKA 4PC7A 3LVBA 2D9RA 1D8TA 2OYNA 5AN9A 1M1KD 5KW9A 3DDYA 2QDXA 1KRHA 2C77A 3BY1A 1XE1A 3QE2A 4M53A 5IYQA 1N8RD 3CCUB 1HVXA 1ELOA 1YHQB 1Q86D 1WTHD 4ACAA 1KQSB 5BSXA 5TRDA 3VO2A 4G5GA 4XR6A 2EIXA 3ZPNA 4P1VA 3B8HA 1KK1A 4UZFA 5IK2A 4P2NA 1SM4A 3G6EB 3OP1A 2YWHA 1VQKB 1KC8D 3W2IA 5A8AA 4ROXA 1Y0YA 1EFRA 1PJ7A 2QEXB 2C5BA 2GJRA 2VNIA 5GV8A 5A88A 4XM3A 1EWYA 4RCZA 4G1VA 3CC4B 3W5HA 4KKUA 5HKKA 3PUNA 3OAAA 4XL9A 1B2RA 4BPRA 5BSYA 5L46A 4XLEA 4Y9RA 4XONA 1F20A 3OZVA 4P9SA 1COWA 2GJKA 4PC1A 3H9NA 2ZTGA 1OB0A 1QVGB 3BCDA 2F43A 1VHEA 4DQLA 2C4UA 4XD7A 2QTLA 3SKBA 3CESA 3OOCA 1HA3A 1VHOA 1DG1G 3ASSA 2BVNA 4G7XA 4RDLA 1UD5A 3WBKA 4G7WA 3I55B 4G6IA 4Q7JB 3OKXA 3VNVA 2GPJA 1GJRA 5FO0A 3SLNA 3QSYA 3OJWA 1SKQA 4PC6A 3GVJA 1CNEA 4RD6A 2OK7A 2Z6BD 3ES9A 3P27A 4YALA 4YHBA 1FRNA 1N0VC 1W87A 3LQ6A 4RD4A 3LQEA 3OZUA 1OB2A 4AF6A 3AVYA 4RD1A 1D1NA 4N3NA 3CXCB 2I1LA 4M4SA 1KK0A 4XORA 3WQZA 1V5VA 1W0KA 1VQ6B 1WSVA 1FRQA 4ZGNB 3CCQB 1ZUNB 1JNYA 4YAUA 2ZXHA 1H42A 1ZM9A 4TMVA 1WOSA 4B3GA 2VZLA 4QUZA 1ZM2A 3B82A 2W6IA 1NB9A 3A8IA 3T51B 3SEJA 2CBXA 2ZBUA 3MHPA 4QV2A 1T6XA 2XZPA 4WZLA 4DNTB 2P3MA 1NDHA 1N07A 2V7WA 3OZWA 1BPLA 5FA6A 2R6HA 3A8KA 1KMHA 3QFRA 1YIJB 2DERA 2CNDA 3FPKA 1KJZA 3OEEA 3PENA 4WQMA 3W5VA 2F4NA 4X06A 3CCSB 4OOXA 4U9UA 1CQXA 1WDTA 3OE7A 3CB4A 3A1PA 3ONYA 1BX0A 1E62A 1TLLA 1XB2A 2V7QA 3FPPA 2X8KA 4B3XA 1B23P 3AGQA 4XLAA 3I1FA 2V7XA 3ISXA 1OB5A 2QE7A 2C2WA 2ZBVA 1BX1A 1EP2B 1K28D 4LBWA 3V76A 1EP1B 4XQFA 4X7EA 3ZZ0A 4DNRB 3OFNA 1GVHA 1I8DA 3ONUA 4C43A 3G71B 4TMZA 1N06A 3ZC3A 4XKVA 2C5HA 4X8IA 5J35A 3GIRA 3G05A 1R5NA 2D3NA 2OK8A 1OGJA 3WNDA 1EFUA 5IYPA 4FWTA 1EP3B 2ZL7A 4LC0A 1WORA 2V7TA 2B5OA 1Y0RA 5FIUA 2B7CA 2V7VA 2GK6A 1VQOB 3AVVA 3CCLB 5H59A 1R5OA 5F4JA 1DDGA 2R9VA 3NE5B 4X07A 1I18A 1UD4A 3ASPA 4RDJA 2YWGA 3AVUA 3GVLA 3R6KA 1GO2A 3PVDA 1ZM4A 2F1LA 2YWEA 4B4DA 2XOKA 1S0UA 2QN6A 1PKVA 2JN9A 4LBYA 4X7FA 2BGIA 1TUIA 2VNKA 3MCAA 2BN4A 2JIZA 4B3FX 4Z4VA 1QH0A 4E0FA 1S72B 1E3ZA 3W2GA 1NB0A 4TSFA 1FNMA 2VBSA 1TVCA 2LZJA 4Y9UA 1QFYA 3D26A 1E79A 4C0SA 5TR9A 2HMAA 1CNFA 5KNLA 2OBTA 3JQRA 2ZITA 2D74A 2PMDA 4F7DA 2DOGA 4MYUA 3WNCA 2PIAA 2WZNA 4Z4ZA 2ZZGA 4WZKA 4FXUA 1OGIA 1WU8A 3PUMA 3ZUGA 3AVTA 1ZM3A 4II3A 2XZLA 2WSSA 3CPXA 3SJPA 4PABA 1WPCA 1JB9A 1KK2A 3B78A 4Z4TA 2M5SA 2YWFA 4X05A 2VBVA 4R71A 1BJKA 3JU4A 3GQBA 1WP6A 3FJOA 3BH4A 3CCVB 2XGJA 3CMMA 2BM1A 1YI2B 4OP7A 1E3XA 1IB0A 1OHHA 4OPSA 4B48A 1EFTA 2QA4B 3VR6A 1UD3A 2FX3A 5FO1A 3V7AA 4B44A 4XLCA 3Q6RA 1SKYB 1N0UA 4YAFA 1W0JA 2ZL5A 4PC2A 1D2EA 3W2HA 2WPDA 2GQFA 2WJYA 1VQ7B 2ZXIA 4ACBA 3Q6QA 4RLZA 3QFTA 2DETA 4DK1A 1I7PA 4M0LA 1TTTA 5LMZA 1Q81D 4OOSA 1WSRA 4RD3A 4Z4SA 4QFMA 1BLIA 1T5EA 4Z4RA 4ASUA 3QFSA 2VBUA 3VO1A 4PAAA 1VQMB 2OBRA 2Q6OA 1M90D 1DARA 3CC7B 1E1RA 1G7TA 5HXBA 3W2FA 2PLFA 4XOTA 1EFCA 3OW2B 1VJSA 2X6YA 3OPOA 3LO8A 2GREA 2V4DA 2C4TA 1VQ9B 3E20A 4ZV4A 4DK0A 2VBTA 1UD2A 2X6XA 3HAGA 4LBZA 5HZAA 1T6YA 1G7CA 5F4MA 3KEWA 1NBMA 4AVZA 3CW2A 4HE5A 1JA1A 4UAJA 1VQ4B 3JQPA 4RDKA 1E1QA 1QGZA 1VLYA 3ZIAA 1IJEA 3WBJA 4B43A 2HCJB 4YAOA 3WYAA 4LBVA 1Q82D 3MMPA 1H8EA 2JJ1A 4PC3A 3T56B 1UMKA 3CRZA 4EH1A 2W6JA 4RPDA 2VJJA 5GV7A 2C78A 5J3OA 3CMEB 2BM0A 3CCEB 1XQBA 5TY0A 3E1YE 1WOPA 1QUFA 1IJFA 1VLOA 3W2EA 3U6BA 1UD8A 4P6VF 3H94A 5THXA 2HDNB 4UZEA 1MRZA 1VQPB 1H85A 1Q7YD 5B6IA 3VMFA 3WXMA 3ZZUA 4RD0A 2ZL6A 2FVGA 1S4MA 3ASQA 3U6KA 4YXWA 1JA0A 1GAQA 4HIZA 2NPFA 4NBSA 4OPOA 4XN3A 1E43A 4ZCLA 2D3LA 2DCUA 3A35A 2WZPP 1K8AD 5FL7A 4KKSA 1PJ5A 4WZEA 2B7BA 4NNJA 5IYWA 1KTVA 3WY9A 4P12A 3ZZTA 1IHMA 5IYNA 5E6TA 2AHOA 4G1BA 2QMUA 3J81k 4ZCIA 2X53S 2BPOA 1KZLA 1QG0A 3BY2A 4B47A 3OJXA 4XLFA 1F60A 1W9XA 2CK3A 3BNWA 2XEXA 2X85A 4YAWA 2XNJA 5EMNA 4II2A 2CRVA 4TKOB 2ZZQA 1K73D 1QVFB 5DN6A 4FK8A 2BSAA 4OPVA 1GR1A 3CCJB 1W34A 2VNHA 2X6WA 1QGAA 1YJNB 1A8PA 4P6YA 1KD1D 4P25A 4P22A 4WZTA 4RM0A 4JMQA 3ASRA 3Q3AA 4Z4UA 4H9GA 3CC2B 4WWVA 2VYQA
chains in the Genus database with same CATH topology
1T6XA 1N08A 1P4MA 3ZUGA 1N06A 2P3MA 1N07A 5TRDA 4UZEA 1MRZA 1N05A 2VBTA 1T6ZA 3BNWA 4UZFA 1T6YA 2X0KA 3OP1A 1S4MA 2VBVA 2I1LA 1NB0A 2VBSA 5A8AA 5FNZA 5A89A 3CTAA 2VBUA 5A88A 2OYNA 1NB9A 5FO1A 5FO0A 1Q9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6X A;  1N08 A;  1P4M A;  3ZUG A;  1N06 A;  2P3M A;  1N07 A;  5TRD A;  4UZE A;  1MRZ A;  1N05 A;  2VBT A;  1T6Z A;  3BNW A;  4UZF A;  1T6Y A;  2X0K A;  3OP1 A;  1S4M A;  2VBV A;  2I1L A;  1NB0 A;  2VBS A;  5A8A A;  5FNZ A;  5A89 A;  3CTA A;  2VBU A;  5A88 A;  2OYN A;  1NB9 A;  5FO1 A;  5FO0 A;  1Q9S A; 
#chains in the Genus database with same CATH topology
 2Q6I A;  3SJZ A;  2NV4 A;  3R6J A;  3CP8 A;  2JJ2 A;  2E1B A;  5CDF A;  3CCM B;  2OTL B;  1YLO A;  4X7D A;  1E64 A;  4ZGQ B;  1MAB A;  2WR8 A;  1QFJ A;  1UD6 A;  4IW3 B;  4P26 A;  3VNU A;  4X7C A;  3JQQ A;  2J7K A;  1XFO A;  2ZTN A;  3GVK A;  2X3U A;  3Q39 A;  4FN5 A;  2CW5 A;  4YEJ A;  5DS0 A;  2Q6L A;  3QFC A;  3ZBU A;  4DQK A;  3RY8 A;  4AC9 A;  3CPW B;  4TN1 A;  4K1X A;  3CTA A;  2EFG A;  1QUE A;  2WYR A;  4J0Q A;  2DIE A;  1QX4 A;  4PGO A;  3OW7 A;  3CMA B;  3PA2 A;  5DSZ A;  4XOP A;  2GJP A;  2JDI A;  1N08 A;  2DY1 A;  4OOV A;  2BMW A;  4XN0 A;  1FNC A;  3I56 B;  3CD6 B;  1YIT B;  4TMT A;  1FNB A;  2OBS A;  2ZZF A;  1BMF A;  1QFZ A;  1RQP A;  3LNN A;  4RPB A;  5F4O A;  1YX2 A;  1E63 A;  1YJ9 B;  2RC5 A;  3A3B A;  4TMW A;  3KL9 A;  4RJL A;  2V31 A;  5A89 A;  4P3Y A;  4HE6 A;  2QTZ A;  2ZZE A;  1NJI D;  1RQR A;  2E1R A;  4TMX A;  1EXM A;  1FDR A;  2CC2 A;  2WJV A;  1GAW A;  4Z4W A;  3G4S B;  3OEH A;  3AVW A;  2XND A;  1N05 A;  1V0E A;  1T6Z A;  3P26 A;  4N3G A;  2RC6 A;  2QGG A;  4Y7C A;  1VF7 A;  1AIP A;  4RD2 A;  2PE3 A;  3A3G A;  1BQE A;  1QGY A;  4YEL A;  3AGP A;  3BC9 A;  3AVX A;  4XLH A;  2HLD A;  3AST A;  4QVJ A;  1VQL B;  1VQ8 B;  2Q6K A;  5JBQ A;  1HZE A;  1VQ5 B;  2KVO A;  4GQN A;  1G7S A;  3BCF A;  3WNB A;  3T53 B;  4L8J A;  1H8H A;  4P3I A;  2OTJ B;  1AMO A;  3ZBT A;  4AF7 A;  2DEU A;  4ZCM A;  5HZB A;  3U2Q A;  2VNJ A;  3CP2 A;  2XZO A;  4QHY A;  2GK7 A;  4XKW A;  2BGJ A;  3Q38 A;  4KKT A;  4NCN A;  5TV2 A;  3CCR B;  3A8J A;  2BF4 A;  2XNC A;  1K9M D;  2F1M A;  2DYI A;  3PA1 A;  1W2B B;  4CQJ A;  2V7U A;  2CF4 A;  1Q9S A;  3BQJ A;  1PJ6 A;  1G7R A;  1P4M A;  1R5B A;  1VQN B;  2VJI A;  4M2L A;  4Z4Y A;  5KSW B;  4MYT A;  3SLD A;  3W5U A;  4UZU A;  1FND A;  1FX0 A;  3FKS A;  1DDI A;  2X0K A;  1YJW B;  1KK3 A;  3GSI A;  1JJ2 B;  4M1K A;  4QVA A;  5IYR A;  4XMY A;  1W35 A;  4Z1M A;  4TT3 A;  4XNF A;  5FNZ A;  4RCY A;  1WOO A;  1U2R A;  1V0F A;  1J9Z A;  2BV3 A;  5H5J A;  4X0C A;  1NRK A;  4PC7 A;  3LVB A;  2D9R A;  1D8T A;  2OYN A;  5AN9 A;  1M1K D;  5KW9 A;  3DDY A;  2QDX A;  1KRH A;  2C77 A;  3BY1 A;  1XE1 A;  3QE2 A;  4M53 A;  5IYQ A;  1N8R D;  3CCU B;  1HVX A;  1ELO A;  1YHQ B;  1Q86 D;  1WTH D;  4ACA A;  1KQS B;  5BSX A;  5TRD A;  3VO2 A;  4G5G A;  4XR6 A;  2EIX A;  3ZPN A;  4P1V A;  3B8H A;  1KK1 A;  4UZF A;  5IK2 A;  4P2N A;  1SM4 A;  3G6E B;  3OP1 A;  2YWH A;  1VQK B;  1KC8 D;  3W2I A;  5A8A A;  4ROX A;  1Y0Y A;  1EFR A;  1PJ7 A;  2QEX B;  2C5B A;  2GJR A;  2VNI A;  5GV8 A;  5A88 A;  4XM3 A;  1EWY A;  4RCZ A;  4G1V A;  3CC4 B;  3W5H A;  4KKU A;  5HKK A;  3PUN A;  3OAA A;  4XL9 A;  1B2R A;  4BPR A;  5BSY A;  5L46 A;  4XLE A;  4Y9R A;  4XON A;  1F20 A;  3OZV A;  4P9S A;  1COW A;  2GJK A;  4PC1 A;  3H9N A;  2ZTG A;  1OB0 A;  1QVG B;  3BCD A;  2F43 A;  1VHE A;  4DQL A;  2C4U A;  4XD7 A;  2QTL A;  3SKB A;  3CES A;  3OOC A;  1HA3 A;  1VHO A;  1DG1 G;  3ASS A;  2BVN A;  4G7X A;  4RDL A;  1UD5 A;  3WBK A;  4G7W A;  3I55 B;  4G6I A;  4Q7J B;  3OKX A;  3VNV A;  2GPJ A;  1GJR A;  5FO0 A;  3SLN A;  3QSY A;  3OJW A;  1SKQ A;  4PC6 A;  3GVJ A;  1CNE A;  4RD6 A;  2OK7 A;  2Z6B D;  3ES9 A;  3P27 A;  4YAL A;  4YHB A;  1FRN A;  1N0V C;  1W87 A;  3LQ6 A;  4RD4 A;  3LQE A;  3OZU A;  1OB2 A;  4AF6 A;  3AVY A;  4RD1 A;  1D1N A;  4N3N A;  3CXC B;  2I1L A;  4M4S A;  1KK0 A;  4XOR A;  3WQZ A;  1V5V A;  1W0K A;  1VQ6 B;  1WSV A;  1FRQ A;  4ZGN B;  3CCQ B;  1ZUN B;  1JNY A;  4YAU A;  2ZXH A;  1H42 A;  1ZM9 A;  4TMV A;  1WOS A;  4B3G A;  2VZL A;  4QUZ A;  1ZM2 A;  3B82 A;  2W6I A;  1NB9 A;  3A8I A;  3T51 B;  3SEJ A;  2CBX A;  2ZBU A;  3MHP A;  4QV2 A;  1T6X A;  2XZP A;  4WZL A;  4DNT B;  2P3M A;  1NDH A;  1N07 A;  2V7W A;  3OZW A;  1BPL A;  5FA6 A;  2R6H A;  3A8K A;  1KMH A;  3QFR A;  1YIJ B;  2DER A;  2CND A;  3FPK A;  1KJZ A;  3OEE A;  3PEN A;  4WQM A;  3W5V A;  2F4N A;  4X06 A;  3CCS B;  4OOX A;  4U9U A;  1CQX A;  1WDT A;  3OE7 A;  3CB4 A;  3A1P A;  3ONY A;  1BX0 A;  1E62 A;  1TLL A;  1XB2 A;  2V7Q A;  3FPP A;  2X8K A;  4B3X A;  1B23 P;  3AGQ A;  4XLA A;  3I1F A;  2V7X A;  3ISX A;  1OB5 A;  2QE7 A;  2C2W A;  2ZBV A;  1BX1 A;  1EP2 B;  1K28 D;  4LBW A;  3V76 A;  1EP1 B;  4XQF A;  4X7E A;  3ZZ0 A;  4DNR B;  3OFN A;  1GVH A;  1I8D A;  3ONU A;  4C43 A;  3G71 B;  4TMZ A;  1N06 A;  3ZC3 A;  4XKV A;  2C5H A;  4X8I A;  5J35 A;  3GIR A;  3G05 A;  1R5N A;  2D3N A;  2OK8 A;  1OGJ A;  3WND A;  1EFU A;  5IYP A;  4FWT A;  1EP3 B;  2ZL7 A;  4LC0 A;  1WOR A;  2V7T A;  2B5O A;  1Y0R A;  5FIU A;  2B7C A;  2V7V A;  2GK6 A;  1VQO B;  3AVV A;  3CCL B;  5H59 A;  1R5O A;  5F4J A;  1DDG A;  2R9V A;  3NE5 B;  4X07 A;  1I18 A;  1UD4 A;  3ASP A;  4RDJ A;  2YWG A;  3AVU A;  3GVL A;  3R6K A;  1GO2 A;  3PVD A;  1ZM4 A;  2F1L A;  2YWE A;  4B4D A;  2XOK A;  1S0U A;  2QN6 A;  1PKV A;  2JN9 A;  4LBY A;  4X7F A;  2BGI A;  1TUI A;  2VNK A;  3MCA A;  2BN4 A;  2JIZ A;  4B3F X;  4Z4V A;  1QH0 A;  4E0F A;  1S72 B;  1E3Z A;  3W2G A;  1NB0 A;  4TSF A;  1FNM A;  2VBS A;  1TVC A;  2LZJ A;  4Y9U A;  1QFY A;  3D26 A;  1E79 A;  4C0S A;  5TR9 A;  2HMA A;  1CNF A;  5KNL A;  2OBT A;  3JQR A;  2ZIT A;  2D74 A;  2PMD A;  4F7D A;  2DOG A;  4MYU A;  3WNC A;  2PIA A;  2WZN A;  4Z4Z A;  2ZZG A;  4WZK A;  4FXU A;  1OGI A;  1WU8 A;  3PUM A;  3ZUG A;  3AVT A;  1ZM3 A;  4II3 A;  2XZL A;  2WSS A;  3CPX A;  3SJP A;  4PAB A;  1WPC A;  1JB9 A;  1KK2 A;  3B78 A;  4Z4T A;  2M5S A;  2YWF A;  4X05 A;  2VBV A;  4R71 A;  1BJK A;  3JU4 A;  3GQB A;  1WP6 A;  3FJO A;  3BH4 A;  3CCV B;  2XGJ A;  3CMM A;  2BM1 A;  1YI2 B;  4OP7 A;  1E3X A;  1IB0 A;  1OHH A;  4OPS A;  4B48 A;  1EFT A;  2QA4 B;  3VR6 A;  1UD3 A;  2FX3 A;  5FO1 A;  3V7A A;  4B44 A;  4XLC A;  3Q6R A;  1SKY B;  1N0U A;  4YAF A;  1W0J A;  2ZL5 A;  4PC2 A;  1D2E A;  3W2H A;  2WPD A;  2GQF A;  2WJY A;  1VQ7 B;  2ZXI A;  4ACB A;  3Q6Q A;  4RLZ A;  3QFT A;  2DET A;  4DK1 A;  1I7P A;  4M0L A;  1TTT A;  5LMZ A;  1Q81 D;  4OOS A;  1WSR A;  4RD3 A;  4Z4S A;  4QFM A;  1BLI A;  1T5E A;  4Z4R A;  4ASU A;  3QFS A;  2VBU A;  3VO1 A;  4PAA A;  1VQM B;  2OBR A;  2Q6O A;  1M90 D;  1DAR A;  3CC7 B;  1E1R A;  1G7T A;  5HXB A;  3W2F A;  2PLF A;  4XOT A;  1EFC A;  3OW2 B;  1VJS A;  2X6Y A;  3OPO A;  3LO8 A;  2GRE A;  2V4D A;  2C4T A;  1VQ9 B;  3E20 A;  4ZV4 A;  4DK0 A;  2VBT A;  1UD2 A;  2X6X A;  3HAG A;  4LBZ A;  5HZA A;  1T6Y A;  1G7C A;  5F4M A;  3KEW A;  1NBM A;  4AVZ A;  3CW2 A;  4HE5 A;  1JA1 A;  4UAJ A;  1VQ4 B;  3JQP A;  4RDK A;  1E1Q A;  1QGZ A;  1VLY A;  3ZIA A;  1IJE A;  3WBJ A;  4B43 A;  2HCJ B;  4YAO A;  3WYA A;  4LBV A;  1Q82 D;  3MMP A;  1H8E A;  2JJ1 A;  4PC3 A;  3T56 B;  1UMK A;  3CRZ A;  4EH1 A;  2W6J A;  4RPD A;  2VJJ A;  5GV7 A;  2C78 A;  5J3O A;  3CME B;  2BM0 A;  3CCE B;  1XQB A;  5TY0 A;  3E1Y E;  1WOP A;  1QUF A;  1IJF A;  1VLO A;  3W2E A;  3U6B A;  1UD8 A;  4P6V F;  3H94 A;  5THX A;  2HDN B;  4UZE A;  1MRZ A;  1VQP B;  1H85 A;  1Q7Y D;  5B6I A;  3VMF A;  3WXM A;  3ZZU A;  4RD0 A;  2ZL6 A;  2FVG A;  1S4M A;  3ASQ A;  3U6K A;  4YXW A;  1JA0 A;  1GAQ A;  4HIZ A;  2NPF A;  4NBS A;  4OPO A;  4XN3 A;  1E43 A;  4ZCL A;  2D3L A;  2DCU A;  3A35 A;  2WZP P;  1K8A D;  5FL7 A;  4KKS A;  1PJ5 A;  4WZE A;  2B7B A;  4NNJ A;  5IYW A;  1KTV A;  3WY9 A;  4P12 A;  3ZZT A;  1IHM A;  5IYN A;  5E6T A;  2AHO A;  4G1B A;  2QMU A;  3J81 k;  4ZCI A;  2X53 S;  2BPO A;  1KZL A;  1QG0 A;  3BY2 A;  4B47 A;  3OJX A;  4XLF A;  1F60 A;  1W9X A;  2CK3 A;  3BNW A;  2XEX A;  2X85 A;  4YAW A;  2XNJ A;  5EMN A;  4II2 A;  2CRV A;  4TKO B;  2ZZQ A;  1K73 D;  1QVF B;  5DN6 A;  4FK8 A;  2BSA A;  4OPV A;  1GR1 A;  3CCJ B;  1W34 A;  2VNH A;  2X6W A;  1QGA A;  1YJN B;  1A8P A;  4P6Y A;  1KD1 D;  4P25 A;  4P22 A;  4WZT A;  4RM0 A;  4JMQ A;  3ASR A;  3Q3A A;  4Z4U A;  4H9G A;  3CC2 B;  4WWV A;  2VYQ A; 
#chains in the Genus database with same CATH homology
 1T6X A;  1N08 A;  1P4M A;  3ZUG A;  1N06 A;  2P3M A;  1N07 A;  5TRD A;  4UZE A;  1MRZ A;  1N05 A;  2VBT A;  1T6Z A;  3BNW A;  4UZF A;  1T6Y A;  2X0K A;  3OP1 A;  1S4M A;  2VBV A;  2I1L A;  1NB0 A;  2VBS A;  5A8A A;  5FNZ A;  5A89 A;  3CTA A;  2VBU A;  5A88 A;  2OYN A;  1NB9 A;  5FO1 A;  5FO0 A;  1Q9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...