2VBTA

Riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with cdp and po4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
136
structure length
136
Chain Sequence
b'MVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGDKDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN KINASE
publication title A Ctp-Dependent Archaeal Riboflavin Kinase Forms a Bridge in the Evolution of Cradle-Loop Barrels.
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
total genus 22
structure length 136
sequence length 136
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2vbtA01
3BNWA 1P4MA 2VBVA 3CTAA 5A8AA 1N05A 2I1LA 2VBTA 4UZFA 2VBSA 2X0KA 1Q9SA 1N08A 5FNZA 1N06A 1N07A 1MRZA 3OP1A 5A89A 4UZEA 5FO1A 1NB0A 5TRDA 2P3MA 1T6XA 1T6ZA 2VBUA 1NB9A 2OYNA 5FO0A 1S4MA 1T6YA 3ZUGA 5A88A
chains in the Genus database with same CATH superfamily
4CQJA 1TTTA 1NRKA 1B23P 4MYTA 1DDGA 1VQ7B 2Q6KA 3ASTA 4TMTA 4QHYA 4ZV4A 4UZFA 1I7PA 2X0KA 3LNNA 2ZZFA 2DY1A 4ROXA 3MMPA 4RPBA 4XOPA 3U6KA 2FX3A 1Q82D 1VQ8B 4PABA 4P25A 3I55B 2R6HA 1IJEA 3I56B 1YI2B 4Z4WA 1W87A 5IYNA 2D3LA 3CCJB 4X7DA 3OE7A 2BMWA 3B78A 1QVFB 4C43A 3ISXA 2VNJA 1NB9A 2OYNA 3U6BA 1R5NA 5DN6A 2YWHA 1QUEA 2BSAA 5J35A 4B47A 3OW2B 1OB0A 4LC0A 2NPFA 1H8HA 1V0EA 4ZCIA 4B3XA 1VLOA 4QFMA 2YWEA 4FXUA 2CK3A 1Q9SA 1E3ZA 3CCUB 1ELOA 4F7DA 3FPPA 1KJZA 3H94A 3CCQB 2Q6IA 2QTLA 4IW3B 3A8JA 3CCSB 1VQ9B 1K28D 1D8TA 5FIUA 3CB4A 5BSXA 2XEXA 3A8IA 2QA4B 3ONUA 4JMQA 5TY0A 2CC2A 1ZM9A 2XOKA 1E62A 4XONA 3QE2A 2RC5A 3CP8A 2VNHA 2PMDA 4U9UA 5GV8A 1GJRA 2YWGA 1G7SA 1S0UA 4ZGQB 4Y7CA 1Q81D 4Z1MA 3T51B 4B48A 1EFTA 3PA1A 1SKYB 2W6IA 3ZIAA 2DOGA 2BGJA 3WNDA 1KK3A 2F43A 3CESA 4P6YA 4Z4TA 2XNDA 1AMOA 2ZBVA 4P3YA 1EXMA 2JDIA 3WBJA 2WSSA 1E64A 2C77A 2BV3A 3Q38A 3CCMB 4EH1A 2ZXHA 1XB2A 1W0JA 4LBVA 4RD1A 4J0QA 1ZUNB 2BM0A 3JQRA 4RLZA 3QFRA 1VQLB 2BN4A 3ZC3A 1VQKB 4RPDA 2D74A 3OW7A 4G7WA 2XGJA 4MYUA 2JN9A 1COWA 1HZEA 1E63A 4P2NA 4YELA 4XD7A 1K73D 4B4DA 1JNYA 4G1BA 1VQ6B 2I1LA 2X53S 4QVAA 2B7CA 2DCUA 1VQ4B 1VQPB 3G4SB 4L8JA 3CC2B 4YXWA 4AF7A 3ONYA 4P6VF 2E1BA 4RD3A 1ZM3A 3VO1A 1I18A 5HZAA 5L46A 1T6XA 1KK2A 2XNCA 3Q39A 3CCRB 5IYQA 4QVJA 1IB0A 3V7AA 3OEHA 5FA6A 4XL9A 2JJ1A 4Z4VA 1GO2A 2VBUA 2ZL6A 4TMVA 1YJ9B 4RDLA 1FNBA 3CXCB 2V4DA 4QV2A 3ZUGA 1TVCA 4YHBA 3I1FA 4G5GA 1XE1A 3W5UA 3PENA 1WP6A 1WPCA 2C5BA 1W9XA 1VHEA 1UD4A 2Z6BD 3ZZTA 1CNFA 2CBXA 3BY2A 4N3GA 4RDJA 3R6JA 4XN3A 4AF6A 4E0FA 3OOCA 3R6KA 3JQQA 1A8PA 5BSYA 3NE5B 2QDXA 4P26A 4PC2A 5B6IA 3PUMA 1V5VA 4G6IA 4K1XA 1JA1A 2OBRA 5JBQA 5H5JA 3W2IA 2X6WA 3FPKA 3BQJA 1NBMA 2VZLA 2QGGA 4M53A 5KW9A 5FNZA 4X7EA 4WZKA 2OBSA 3OP1A 4HIZA 2WJYA 3OJXA 1QGAA 2LZJA 3ZBTA 3VNVA 4XLAA 2Q6LA 1T6ZA 1I8DA 4YAUA 4XLCA 3CP2A 4AVZA 4XM3A 4XR6A 1GAWA 2CNDA 2DYIA 4TMWA 2ZXIA 1WDTA 4FN5A 1FNCA 4DK1A 2EFGA 2GREA 4YAFA 2HDNB 1BQEA 2C5HA 3LVBA 2D3NA 3CTAA 5TR9A 1WOPA 4X7FA 1QVGB 1KQSB 2NV4A 2C78A 2M5SA 5TV2A 2ZL5A 3V76A 1E3XA 1W35A 3BY1A 4LBYA 4ACBA 3LQEA 2X85A 3WQZA 1XQBA 5CDFA 2VNIA 1HVXA 3T56B 1E43A 1YJNB 3ZZ0A 4B3GA 1EP3B 4XKVA 1BMFA 1HA3A 4KKSA 1AIPA 3G05A 3ASSA 1FRQA 3ASQA 4X05A 5A88A 2V7XA 5F4JA 2VBVA 1N0UA 1G7CA 3SLDA 4FWTA 3QFCA 3ZPNA 3OKXA 1T5EA 2DEUA 1UMKA 3SEJA 3A3BA 1RQRA 4HE6A 3DDYA 4NBSA 1VHOA 2E1RA 4UZEA 2WZPP 1JJ2B 5FO1A 3CPWB 2ZBUA 3P26A 2ZZQA 2DIEA 1BPLA 3GSIA 4XOTA 1K9MD 3Q6RA 4WQMA 2GPJA 4WZEA 4DNRB 2QEXB 2ZZGA 1EFRA 2GJPA 2BM1A 1MABA 2V7WA 1YX2A 1S4MA 3QFTA 3CCEB 1KK0A 4Y9UA 4X8IA 4NNJA 1ZM2A 5IK2A 4RDKA 2R9VA 2OK8A 5A8AA 1PJ5A 5IYPA 1Q7YD 3CW2A 2QTZA 3A35A 3OPOA 1N08A 4XQFA 1N06A 2ZZEA 2ZTGA 1CQXA 4YEJA 1N8RD 3W2HA 2C4TA 3OJWA 3D26A 4R71A 3A3GA 1H8EA 1WORA 4YAOA 2F1MA 4ZCLA 1EFUA 3E1YE 2V31A 1JA0A 3BCFA 3JU4A 1R5OA 2QE7A 1OB5A 1QH0A 1QFZA 4P1VA 4X07A 1N0VC 3BCDA 3T53B 2QN6A 2V7TA 3PVDA 4HE5A 2GJKA 4TN1A 1MRZA 2B7BA 1Y0RA 1VQMB 4G7XA 3W5HA 5TRDA 3CCVB 3AVYA 1UD6A 4Q7JB 1IJFA 4XLHA 5J3OA 3OZWA 1CNEA 1F60A 5H59A 4M4SA 3CMAB 1KRHA 3U2QA 1E1RA 3WNCA 4WZLA 4QUZA 4RD6A 3ASRA 1KC8D 2YWFA 2DETA 4TMZA 3A1PA 5DSZA 1VLYA 3CMMA 4RM0A 3WYAA 1B2RA 3G6EB 4Z4SA 3Q6QA 1WTHD 1N07A 4XLEA 1M90D 3JQPA 3HAGA 4WWVA 2V7QA 5AN9A 4XORA 3OZUA 4PC6A 5KSWB 4YALA 2P3MA 5F4MA 1WSVA 4ASUA 1QFJA 3GIRA 1W0KA 1PKVA 2AHOA 3MHPA 4TKOB 3CD6B 1QGYA 1U2RA 2KVOA 4P9SA 2J7KA 1OHHA 1H42A 4PGOA 4Z4ZA 3VMFA 2X3UA 3OAAA 3WXMA 1WOSA 1BJKA 4X06A 2PE3A 2X6YA 2EIXA 2VJIA 4P22A 3LQ6A 4ACAA 5IYRA 1W34A 3P27A 4ZCMA 1DDIA 2VBTA 2CF4A 2WYRA 4KKTA 3CRZA 4XNFA 3BH4A 5HKKA 1EWYA 2OBTA 5A89A 3ZZUA 5KNLA 1FRNA 1TLLA 2PLFA 4OOSA 3VO2A 1S72B 5FL7A 3OFNA 5HZBA 4Y9RA 2BPOA 2FVGA 4Z4RA 3CC7B 4II3A 2DERA 4P12A 4OP7A 4II2A 4KKUA 3SJPA 4OOVA 3AVWA 2B5OA 1K8AD 1DARA 1QG0A 4OOXA 2WPDA 3BC9A 4RD4A 1EP2B 3SJZA 5DS0A 4B43A 1VQ5B 4GQNA 4UZUA 4LBWA 4AC9A 1KMHA 1M1KD 4DQLA 1OGIA 2VYQA 4UAJA 3AVTA 1Y0YA 3RY8A 1WSRA 4RCZA 2F1LA 3GVJA 1F20A 1ZM4A 3PA2A 1GAQA 1OGJA 4B3FX 4DK0A 1H85A 3KL9A 4M1KA 1D1NA 2CRVA 1VF7A 2WJVA 1WU8A 3Q3AA 2C2WA 1NDHA 3W5VA 1UD8A 3OEEA 3AVXA 4LBZA 5LMZA 2JJ2A 2JIZA 4OPVA 1KZLA 2X6XA 4NCNA 3FJOA 1PJ7A 4PC1A 3WY9A 4XMYA 3W2FA 4X7CA 4Z4YA 3J81k 1UD2A 1YITB 2OTJB 1OB2A 3GQBA 2XZLA 4M0LA 3ES9A 1YJWB 3BNWA 1P4MA 2VJJA 1N05A 2QMUA 3B8HA 2C4UA 4TMXA 4H9GA 4BPRA 5THXA 1VQOB 3H9NA 4TSFA 1NB0A 1SKQA 1KK1A 4RCYA 3CPXA 2ZITA 5EMNA 4PC7A 1KTVA 4B44A 3E20A 4RJLA 1UD5A 1DG1G 3FKSA 3LO8A 3QSYA 5GV7A 2VNKA 3A8KA 3KEWA 5E6TA 3AVVA 2HMAA 1JB9A 1FX0A 1XFOA 4X0CA 3VR6A 1NJID 1FNMA 3W2GA 3SKBA 4C0SA 4M2LA 4XLFA 3PUNA 4Z4UA 1YIJB 1FDRA 2BGIA 3ASPA 1E1QA 1YLOA 1D2EA 2BVNA 1QFYA 1R5BA 1WOOA 2VBSA 3G71B 1BX1A 1G7TA 2XNJA 3CC4B 2BF4A 1E79A 1G7RA 1VQNB 4P3IA 1FNDA 5F4OA 3WBKA 1TUIA 3SLNA 2HCJB 4YAWA 3ZBUA 1BLIA 4PAAA 2HLDA 3CCLB 2V7UA 2XZOA 2OK7A 3WNBA 1SM4A 2WZNA 4TT3A 4DNTB 2OTLB 1RQPA 2V7VA 5FO0A 1GR1A 1V0FA 3AGQA 1T6YA 1QX4A 1YHQB 3QFSA 3OZVA 3VNUA 1QUFA 1Q86D 1GVHA 3GVKA 3W2EA 3AGPA 2X8KA 1BX0A 3GVLA 3AVUA 2GQFA 4G1VA 2Q6OA 1W2BB 2CW5A 1J9ZA 2D9RA 1PJ6A 3B82A 4OPOA 1EFCA 1VJSA 1IHMA 2GK7A 4N3NA 2F4NA 4OPSA 1QGZA 2ZTNA 5HXBA 2WR8A 4XN0A 4ZGNB 2PIAA 3CMEB 5IYWA 3MCAA 4WZTA 2GJRA 2GK6A 4XKWA 2XZPA 4RD0A 4PC3A 2W6JA 1EP1B 2RC6A 4FK8A 1UD3A 2ZL7A 4DQKA 4RD2A 1KD1D
chains in the Genus database with same CATH topology
3BNWA 1P4MA 2VBVA 3CTAA 5A8AA 1N05A 2I1LA 2VBTA 4UZFA 2VBSA 2X0KA 1Q9SA 1N08A 5FNZA 1N06A 1N07A 1MRZA 3OP1A 5A89A 4UZEA 5FO1A 1NB0A 5TRDA 2P3MA 1T6XA 1T6ZA 2VBUA 1NB9A 2OYNA 5FO0A 1S4MA 1T6YA 3ZUGA 5A88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BNW A;  1P4M A;  2VBV A;  3CTA A;  5A8A A;  1N05 A;  2I1L A;  2VBT A;  4UZF A;  2VBS A;  2X0K A;  1Q9S A;  1N08 A;  5FNZ A;  1N06 A;  1N07 A;  1MRZ A;  3OP1 A;  5A89 A;  4UZE A;  5FO1 A;  1NB0 A;  5TRD A;  2P3M A;  1T6X A;  1T6Z A;  2VBU A;  1NB9 A;  2OYN A;  5FO0 A;  1S4M A;  1T6Y A;  3ZUG A;  5A88 A; 
#chains in the Genus database with same CATH topology
 4CQJ A;  1TTT A;  1NRK A;  1B23 P;  4MYT A;  1DDG A;  1VQ7 B;  2Q6K A;  3AST A;  4TMT A;  4QHY A;  4ZV4 A;  4UZF A;  1I7P A;  2X0K A;  3LNN A;  2ZZF A;  2DY1 A;  4ROX A;  3MMP A;  4RPB A;  4XOP A;  3U6K A;  2FX3 A;  1Q82 D;  1VQ8 B;  4PAB A;  4P25 A;  3I55 B;  2R6H A;  1IJE A;  3I56 B;  1YI2 B;  4Z4W A;  1W87 A;  5IYN A;  2D3L A;  3CCJ B;  4X7D A;  3OE7 A;  2BMW A;  3B78 A;  1QVF B;  4C43 A;  3ISX A;  2VNJ A;  1NB9 A;  2OYN A;  3U6B A;  1R5N A;  5DN6 A;  2YWH A;  1QUE A;  2BSA A;  5J35 A;  4B47 A;  3OW2 B;  1OB0 A;  4LC0 A;  2NPF A;  1H8H A;  1V0E A;  4ZCI A;  4B3X A;  1VLO A;  4QFM A;  2YWE A;  4FXU A;  2CK3 A;  1Q9S A;  1E3Z A;  3CCU B;  1ELO A;  4F7D A;  3FPP A;  1KJZ A;  3H94 A;  3CCQ B;  2Q6I A;  2QTL A;  4IW3 B;  3A8J A;  3CCS B;  1VQ9 B;  1K28 D;  1D8T A;  5FIU A;  3CB4 A;  5BSX A;  2XEX A;  3A8I A;  2QA4 B;  3ONU A;  4JMQ A;  5TY0 A;  2CC2 A;  1ZM9 A;  2XOK A;  1E62 A;  4XON A;  3QE2 A;  2RC5 A;  3CP8 A;  2VNH A;  2PMD A;  4U9U A;  5GV8 A;  1GJR A;  2YWG A;  1G7S A;  1S0U A;  4ZGQ B;  4Y7C A;  1Q81 D;  4Z1M A;  3T51 B;  4B48 A;  1EFT A;  3PA1 A;  1SKY B;  2W6I A;  3ZIA A;  2DOG A;  2BGJ A;  3WND A;  1KK3 A;  2F43 A;  3CES A;  4P6Y A;  4Z4T A;  2XND A;  1AMO A;  2ZBV A;  4P3Y A;  1EXM A;  2JDI A;  3WBJ A;  2WSS A;  1E64 A;  2C77 A;  2BV3 A;  3Q38 A;  3CCM B;  4EH1 A;  2ZXH A;  1XB2 A;  1W0J A;  4LBV A;  4RD1 A;  4J0Q A;  1ZUN B;  2BM0 A;  3JQR A;  4RLZ A;  3QFR A;  1VQL B;  2BN4 A;  3ZC3 A;  1VQK B;  4RPD A;  2D74 A;  3OW7 A;  4G7W A;  2XGJ A;  4MYU A;  2JN9 A;  1COW A;  1HZE A;  1E63 A;  4P2N A;  4YEL A;  4XD7 A;  1K73 D;  4B4D A;  1JNY A;  4G1B A;  1VQ6 B;  2I1L A;  2X53 S;  4QVA A;  2B7C A;  2DCU A;  1VQ4 B;  1VQP B;  3G4S B;  4L8J A;  3CC2 B;  4YXW A;  4AF7 A;  3ONY A;  4P6V F;  2E1B A;  4RD3 A;  1ZM3 A;  3VO1 A;  1I18 A;  5HZA A;  5L46 A;  1T6X A;  1KK2 A;  2XNC A;  3Q39 A;  3CCR B;  5IYQ A;  4QVJ A;  1IB0 A;  3V7A A;  3OEH A;  5FA6 A;  4XL9 A;  2JJ1 A;  4Z4V A;  1GO2 A;  2VBU A;  2ZL6 A;  4TMV A;  1YJ9 B;  4RDL A;  1FNB A;  3CXC B;  2V4D A;  4QV2 A;  3ZUG A;  1TVC A;  4YHB A;  3I1F A;  4G5G A;  1XE1 A;  3W5U A;  3PEN A;  1WP6 A;  1WPC A;  2C5B A;  1W9X A;  1VHE A;  1UD4 A;  2Z6B D;  3ZZT A;  1CNF A;  2CBX A;  3BY2 A;  4N3G A;  4RDJ A;  3R6J A;  4XN3 A;  4AF6 A;  4E0F A;  3OOC A;  3R6K A;  3JQQ A;  1A8P A;  5BSY A;  3NE5 B;  2QDX A;  4P26 A;  4PC2 A;  5B6I A;  3PUM A;  1V5V A;  4G6I A;  4K1X A;  1JA1 A;  2OBR A;  5JBQ A;  5H5J A;  3W2I A;  2X6W A;  3FPK A;  3BQJ A;  1NBM A;  2VZL A;  2QGG A;  4M53 A;  5KW9 A;  5FNZ A;  4X7E A;  4WZK A;  2OBS A;  3OP1 A;  4HIZ A;  2WJY A;  3OJX A;  1QGA A;  2LZJ A;  3ZBT A;  3VNV A;  4XLA A;  2Q6L A;  1T6Z A;  1I8D A;  4YAU A;  4XLC A;  3CP2 A;  4AVZ A;  4XM3 A;  4XR6 A;  1GAW A;  2CND A;  2DYI A;  4TMW A;  2ZXI A;  1WDT A;  4FN5 A;  1FNC A;  4DK1 A;  2EFG A;  2GRE A;  4YAF A;  2HDN B;  1BQE A;  2C5H A;  3LVB A;  2D3N A;  3CTA A;  5TR9 A;  1WOP A;  4X7F A;  1QVG B;  1KQS B;  2NV4 A;  2C78 A;  2M5S A;  5TV2 A;  2ZL5 A;  3V76 A;  1E3X A;  1W35 A;  3BY1 A;  4LBY A;  4ACB A;  3LQE A;  2X85 A;  3WQZ A;  1XQB A;  5CDF A;  2VNI A;  1HVX A;  3T56 B;  1E43 A;  1YJN B;  3ZZ0 A;  4B3G A;  1EP3 B;  4XKV A;  1BMF A;  1HA3 A;  4KKS A;  1AIP A;  3G05 A;  3ASS A;  1FRQ A;  3ASQ A;  4X05 A;  5A88 A;  2V7X A;  5F4J A;  2VBV A;  1N0U A;  1G7C A;  3SLD A;  4FWT A;  3QFC A;  3ZPN A;  3OKX A;  1T5E A;  2DEU A;  1UMK A;  3SEJ A;  3A3B A;  1RQR A;  4HE6 A;  3DDY A;  4NBS A;  1VHO A;  2E1R A;  4UZE A;  2WZP P;  1JJ2 B;  5FO1 A;  3CPW B;  2ZBU A;  3P26 A;  2ZZQ A;  2DIE A;  1BPL A;  3GSI A;  4XOT A;  1K9M D;  3Q6R A;  4WQM A;  2GPJ A;  4WZE A;  4DNR B;  2QEX B;  2ZZG A;  1EFR A;  2GJP A;  2BM1 A;  1MAB A;  2V7W A;  1YX2 A;  1S4M A;  3QFT A;  3CCE B;  1KK0 A;  4Y9U A;  4X8I A;  4NNJ A;  1ZM2 A;  5IK2 A;  4RDK A;  2R9V A;  2OK8 A;  5A8A A;  1PJ5 A;  5IYP A;  1Q7Y D;  3CW2 A;  2QTZ A;  3A35 A;  3OPO A;  1N08 A;  4XQF A;  1N06 A;  2ZZE A;  2ZTG A;  1CQX A;  4YEJ A;  1N8R D;  3W2H A;  2C4T A;  3OJW A;  3D26 A;  4R71 A;  3A3G A;  1H8E A;  1WOR A;  4YAO A;  2F1M A;  4ZCL A;  1EFU A;  3E1Y E;  2V31 A;  1JA0 A;  3BCF A;  3JU4 A;  1R5O A;  2QE7 A;  1OB5 A;  1QH0 A;  1QFZ A;  4P1V A;  4X07 A;  1N0V C;  3BCD A;  3T53 B;  2QN6 A;  2V7T A;  3PVD A;  4HE5 A;  2GJK A;  4TN1 A;  1MRZ A;  2B7B A;  1Y0R A;  1VQM B;  4G7X A;  3W5H A;  5TRD A;  3CCV B;  3AVY A;  1UD6 A;  4Q7J B;  1IJF A;  4XLH A;  5J3O A;  3OZW A;  1CNE A;  1F60 A;  5H59 A;  4M4S A;  3CMA B;  1KRH A;  3U2Q A;  1E1R A;  3WNC A;  4WZL A;  4QUZ A;  4RD6 A;  3ASR A;  1KC8 D;  2YWF A;  2DET A;  4TMZ A;  3A1P A;  5DSZ A;  1VLY A;  3CMM A;  4RM0 A;  3WYA A;  1B2R A;  3G6E B;  4Z4S A;  3Q6Q A;  1WTH D;  1N07 A;  4XLE A;  1M90 D;  3JQP A;  3HAG A;  4WWV A;  2V7Q A;  5AN9 A;  4XOR A;  3OZU A;  4PC6 A;  5KSW B;  4YAL A;  2P3M A;  5F4M A;  1WSV A;  4ASU A;  1QFJ A;  3GIR A;  1W0K A;  1PKV A;  2AHO A;  3MHP A;  4TKO B;  3CD6 B;  1QGY A;  1U2R A;  2KVO A;  4P9S A;  2J7K A;  1OHH A;  1H42 A;  4PGO A;  4Z4Z A;  3VMF A;  2X3U A;  3OAA A;  3WXM A;  1WOS A;  1BJK A;  4X06 A;  2PE3 A;  2X6Y A;  2EIX A;  2VJI A;  4P22 A;  3LQ6 A;  4ACA A;  5IYR A;  1W34 A;  3P27 A;  4ZCM A;  1DDI A;  2VBT A;  2CF4 A;  2WYR A;  4KKT A;  3CRZ A;  4XNF A;  3BH4 A;  5HKK A;  1EWY A;  2OBT A;  5A89 A;  3ZZU A;  5KNL A;  1FRN A;  1TLL A;  2PLF A;  4OOS A;  3VO2 A;  1S72 B;  5FL7 A;  3OFN A;  5HZB A;  4Y9R A;  2BPO A;  2FVG A;  4Z4R A;  3CC7 B;  4II3 A;  2DER A;  4P12 A;  4OP7 A;  4II2 A;  4KKU A;  3SJP A;  4OOV A;  3AVW A;  2B5O A;  1K8A D;  1DAR A;  1QG0 A;  4OOX A;  2WPD A;  3BC9 A;  4RD4 A;  1EP2 B;  3SJZ A;  5DS0 A;  4B43 A;  1VQ5 B;  4GQN A;  4UZU A;  4LBW A;  4AC9 A;  1KMH A;  1M1K D;  4DQL A;  1OGI A;  2VYQ A;  4UAJ A;  3AVT A;  1Y0Y A;  3RY8 A;  1WSR A;  4RCZ A;  2F1L A;  3GVJ A;  1F20 A;  1ZM4 A;  3PA2 A;  1GAQ A;  1OGJ A;  4B3F X;  4DK0 A;  1H85 A;  3KL9 A;  4M1K A;  1D1N A;  2CRV A;  1VF7 A;  2WJV A;  1WU8 A;  3Q3A A;  2C2W A;  1NDH A;  3W5V A;  1UD8 A;  3OEE A;  3AVX A;  4LBZ A;  5LMZ A;  2JJ2 A;  2JIZ A;  4OPV A;  1KZL A;  2X6X A;  4NCN A;  3FJO A;  1PJ7 A;  4PC1 A;  3WY9 A;  4XMY A;  3W2F A;  4X7C A;  4Z4Y A;  3J81 k;  1UD2 A;  1YIT B;  2OTJ B;  1OB2 A;  3GQB A;  2XZL A;  4M0L A;  3ES9 A;  1YJW B;  3BNW A;  1P4M A;  2VJJ A;  1N05 A;  2QMU A;  3B8H A;  2C4U A;  4TMX A;  4H9G A;  4BPR A;  5THX A;  1VQO B;  3H9N A;  4TSF A;  1NB0 A;  1SKQ A;  1KK1 A;  4RCY A;  3CPX A;  2ZIT A;  5EMN A;  4PC7 A;  1KTV A;  4B44 A;  3E20 A;  4RJL A;  1UD5 A;  1DG1 G;  3FKS A;  3LO8 A;  3QSY A;  5GV7 A;  2VNK A;  3A8K A;  3KEW A;  5E6T A;  3AVV A;  2HMA A;  1JB9 A;  1FX0 A;  1XFO A;  4X0C A;  3VR6 A;  1NJI D;  1FNM A;  3W2G A;  3SKB A;  4C0S A;  4M2L A;  4XLF A;  3PUN A;  4Z4U A;  1YIJ B;  1FDR A;  2BGI A;  3ASP A;  1E1Q A;  1YLO A;  1D2E A;  2BVN A;  1QFY A;  1R5B A;  1WOO A;  2VBS A;  3G71 B;  1BX1 A;  1G7T A;  2XNJ A;  3CC4 B;  2BF4 A;  1E79 A;  1G7R A;  1VQN B;  4P3I A;  1FND A;  5F4O A;  3WBK A;  1TUI A;  3SLN A;  2HCJ B;  4YAW A;  3ZBU A;  1BLI A;  4PAA A;  2HLD A;  3CCL B;  2V7U A;  2XZO A;  2OK7 A;  3WNB A;  1SM4 A;  2WZN A;  4TT3 A;  4DNT B;  2OTL B;  1RQP A;  2V7V A;  5FO0 A;  1GR1 A;  1V0F A;  3AGQ A;  1T6Y A;  1QX4 A;  1YHQ B;  3QFS A;  3OZV A;  3VNU A;  1QUF A;  1Q86 D;  1GVH A;  3GVK A;  3W2E A;  3AGP A;  2X8K A;  1BX0 A;  3GVL A;  3AVU A;  2GQF A;  4G1V A;  2Q6O A;  1W2B B;  2CW5 A;  1J9Z A;  2D9R A;  1PJ6 A;  3B82 A;  4OPO A;  1EFC A;  1VJS A;  1IHM A;  2GK7 A;  4N3N A;  2F4N A;  4OPS A;  1QGZ A;  2ZTN A;  5HXB A;  2WR8 A;  4XN0 A;  4ZGN B;  2PIA A;  3CME B;  5IYW A;  3MCA A;  4WZT A;  2GJR A;  2GK6 A;  4XKW A;  2XZP A;  4RD0 A;  4PC3 A;  2W6J A;  1EP1 B;  2RC6 A;  4FK8 A;  1UD3 A;  2ZL7 A;  4DQK A;  4RD2 A;  1KD1 D; 
#chains in the Genus database with same CATH homology
 3BNW A;  1P4M A;  2VBV A;  3CTA A;  5A8A A;  1N05 A;  2I1L A;  2VBT A;  4UZF A;  2VBS A;  2X0K A;  1Q9S A;  1N08 A;  5FNZ A;  1N06 A;  1N07 A;  1MRZ A;  3OP1 A;  5A89 A;  4UZE A;  5FO1 A;  1NB0 A;  5TRD A;  2P3M A;  1T6X A;  1T6Z A;  2VBU A;  1NB9 A;  2OYN A;  5FO0 A;  1S4M A;  1T6Y A;  3ZUG A;  5A88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...