4RPDA

Crystal structure of p domain of 485 norovirus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
302
structure length
302
Chain Sequence
b'SKPFTLPILTIGELSNSRFPAPIDELYTSPNEGLVVQPQNGRSTLDGELLGTTQLVPSNICSLRGRINAHLPDNQHRWNMQVTNANGTPFDPTEDVPAPLGTPDFLANIYGVTSQRNPDNTCRAHDGILATWSPKFTPKLGSVVLGTWEDRDFDINQPTRFTPVGLYDTDHFNQWALPNYSGALTLNMNLAPSVAPLFPGEQLLFFRSHIPLKGGTSNGAIDCLLPQEWVQHFYQESAPSSTDVALIRYTNPDTGRVLFEAKLHRQGFITVANSGSRPIVVPPNGYFRFDSWVNQFYSLAPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Structural Constraints on Human Norovirus Binding to Histo-Blood Group Antigens.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 71
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rpdA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rpdA01
4RPDA 4Z4UA 4Z4VA 3Q38A 4X05A 3PVDA 5HZAA 5E6TA 3ASRA 4X07A 2ZL7A 3ASPA 2OBTA 5HZBA 3BY1A 5KW9A 4X0CA 4RPBA 1IHMA 3ASTA 4QV2A 3Q6RA 3BQJA 4WZEA 4P3IA 5J3OA 2OBSA 4OPSA 5J35A 3PUMA 4P12A 4P25A 4ROXA 3Q39A 3BY2A 3SJPA 4Z4SA 4RLZA 3SLNA 5F4JA 4Z4ZA 3LQEA 5IYRA 4Z4WA 3SKBA 4X7FA 4X7DA 4Z4TA 5IYNA 3R6JA 3ONYA 4WZTA 3RY8A 4P1VA 5BSYA 2ZL6A 3V7AA 4OOVA 2ZL5A 4WZKA 4WZLA 3Q3AA 3SLDA 4Z4YA 4QVAA 3ASSA 5IYQA 5BSXA 4OP7A 3D26A 4X7EA 3Q6QA 4X06A 4RDLA 4OOSA 4P26A 2OBRA 5IYWA 3LQ6A 4QVJA 5IYPA 3ONUA 4RDJA 4Z4RA 4OPVA 4P2NA 3ASQA 4QUZA 4OPOA 3SEJA 3R6KA 4RDKA 5F4OA 4OOXA 3PUNA 4X7CA 3PA2A 5F4MA 4RM0A 3PA1A
chains in the Genus database with same CATH superfamily
1QVGB 3OPOA 1F20A 3PENA 2ZTNA 1UMKA 2LZJA 4Z4VA 4RD4A 4TMZA 2DY1A 1MABA 2VZLA 4XLCA 2VJIA 4HE6A 4KKUA 3PVDA 2F1MA 5HZAA 4G7WA 2ZL7A 4PC6A 4Q7JB 1VQMB 3W2EA 3CESA 4TKOB 1BJKA 2X0KA 4IW3B 3CP2A 4M1KA 3BY1A 4C43A 2W6JA 2JDIA 2ZZGA 1I7PA 3U6KA 1IHMA 4XL9A 3VO2A 1WDTA 2XGJA 3BQJA 4WZEA 2VYQA 3W2HA 1Q81D 1QUFA 2C5BA 4YALA 1QH0A 1UD8A 1W35A 3DDYA 4AF6A 2PLFA 1IJFA 5TR9A 1N8RD 2BN4A 3CCSB 1QGYA 4XQFA 2NPFA 4DNRB 2X6YA 1WP6A 3BC9A 4II2A 3MMPA 2I1LA 4Z4ZA 2XNJA 4HIZA 2Q6LA 1VLYA 1YI2B 2XZLA 2CK3A 3OOCA 1H42A 1W0JA 3ZIAA 3QFSA 3JQRA 3MCAA 4UZUA 4FWTA 5A88A 3WXMA 3QSYA 5IYNA 1K73D 1RQRA 2V31A 1QVFB 1FNDA 2ZBUA 2QTZA 1VQPB 4J0QA 1B23P 1KK2A 4TT3A 2ZXHA 4RD2A 1TTTA 4ZCLA 4HE5A 1IJEA 1WOPA 2WR8A 1E3XA 4ZGQB 3CPXA 1S72B 2ZTGA 4G7XA 4Z4YA 2XOKA 3ASSA 2ZBVA 3ISXA 4RD3A 4XLHA 2M5SA 2WYRA 1FRNA 3CW2A 1DARA 3Q6QA 4RDLA 1FNBA 3W2FA 3H9NA 2V7QA 5IYWA 4PC1A 2BGJA 1E1QA 4B3XA 2QN6A 1NBMA 2R9VA 4B48A 4XN3A 1T6XA 1GAWA 1QFYA 1BPLA 3T56B 4Z1MA 1PJ7A 3WNCA 4XONA 1JNYA 3A8JA 1N06A 2DIEA 3OFNA 1UD2A 2Q6OA 5L46A 2XNDA 1GAQA 2HDNB 2WPDA 3CCMB 1SM4A 3PA2A 3WNBA 4E0FA 4UZEA 4PC2A 3PA1A 4II3A 1BLIA 2ZITA 1D1NA 4Z4UA 1VQ9B 3HAGA 2HLDA 3CC2B 4YAUA 2Z6BD 1J9ZA 3CCUB 1OB0A 1KK1A 1KRHA 1P4MA 4BPRA 1BX0A 1MRZA 4X07A 4PAAA 2BVNA 3CMEB 2C78A 2OBTA 3WNDA 3ZBUA 1XFOA 1ZUNB 2PIAA 5HZBA 5KW9A 1W2BB 1VQLB 4RPBA 4TMTA 3T51B 3P27A 3VNVA 3ASTA 1KTVA 2QMUA 1HA3A 1NRKA 2GREA 2YWHA 1KK0A 4XORA 5FO1A 3CMAB 5AN9A 1PJ5A 1G7SA 2VNKA 3OJXA 4XMYA 5J3OA 3BCFA 2OBSA 3OZVA 3V76A 2W6IA 4G6IA 2QEXB 2GJPA 2D9RA 4FK8A 4NBSA 2WSSA 4WQMA 5THXA 4MYUA 4TN1A 3WQZA 3B8HA 2XNCA 2V7TA 3WBJA 4C0SA 4XLFA 3SJPA 2VBTA 2GK7A 1HVXA 2DOGA 3OP1A 1CNFA 3CCLB 4Z4SA 1SKYB 5HKKA 4M53A 4RLZA 1G7TA 1K9MD 3CCEB 1QFJA 3SLNA 2KVOA 5F4JA 3OW7A 1QUEA 2B5OA 1ZM9A 2OTLB 3VR6A 1VJSA 4M4SA 4KKSA 2F1LA 1EP3B 4XD7A 1OGIA 4PABA 3BNWA 2GJRA 3OW2B 4NCNA 3CCRB 5JBQA 4RCZA 4UAJA 1OGJA 2X8KA 1BQEA 4YELA 1KD1D 1JJ2B 2C2WA 4TMXA 3W2IA 4P6YA 3FPKA 3ONYA 1WTHD 1XE1A 5KSWB 3QFRA 3RY8A 1PJ6A 3W5VA 1OHHA 1W0KA 3V7AA 3ZZUA 2BF4A 1YJNB 4X8IA 3ZC3A 3AVXA 1D2EA 4RD1A 3FKSA 2D3NA 3CC4B 3GVJA 3FJOA 1BX1A 1Q86D 3LO8A 2VBVA 5KNLA 4K1XA 2DEUA 2XZPA 1Y0YA 2PE3A 4AC9A 1E1RA 1R5OA 4OP7A 4B44A 3D26A 4QHYA 1VQ5B 4DK1A 2XZOA 1T6YA 2V7VA 4X7EA 3BCDA 2VJJA 1VQ6B 1CNEA 2OBRA 3OEEA 3ZUGA 1WSRA 2VBSA 3E20A 5FA6A 4RD6A 5IYPA 3AVVA 3B82A 2BPOA 3ONUA 1QG0A 1ELOA 3VNUA 3G71B 5CDFA 1W34A 1XQBA 3QFTA 2WJVA 4B43A 4ASUA 2Q6KA 2D74A 3ASQA 4QUZA 2DCUA 2WJYA 5A89A 3SEJA 3JQQA 4RDKA 1N0VC 1H85A 2ZZQA 5F4OA 1FX0A 1T5EA 3WY9A 1VQ4B 2EIXA 2DETA 3PUNA 4X7CA 4R71A 3H94A 5DSZA 1KC8D 2BM0A 4RM0A 1I8DA 4P9SA 1VHOA 2NV4A 1N07A 2RC5A 3KL9A 1I18A 3CB4A 3Q38A 1VHEA 3J81k 5FO0A 2B7CA 1T6ZA 1YX2A 3OKXA 2RC6A 3FPPA 4LC0A 4ZGNB 1VF7A 1YHQB 2F4NA 1IB0A 2F43A 2B7BA 5DS0A 3OZUA 4Y7CA 1EWYA 4KKTA 4M0LA 2VNIA 2V7UA 4ZCMA 3G6EB 1TLLA 1G7CA 1UD4A 2BM1A 2XEXA 4H9GA 4Y9RA 1DDIA 3LNNA 4QV2A 1E63A 3Q6RA 1Q9SA 4P3IA 1UD5A 3LVBA 1WPCA 4YAWA 5FNZA 2WZNA 1KK3A 4RJLA 1W87A 5TRDA 1UD3A 2HMAA 4LBZA 4OPSA 1E62A 5A8AA 1G7RA 4N3NA 4P12A 3GIRA 2JN9A 4P25A 2GPJA 5EMNA 4AF7A 2BV3A 2CW5A 3JU4A 3KEWA 3P26A 4N3GA 4XLAA 2DERA 4WWVA 1TUIA 3W2GA 1WORA 2P3MA 5GV8A 2DYIA 4B47A 3I55B 3ZZ0A 4XNFA 2V4DA 3G05A 3LQEA 1SKQA 3JQPA 4Y9UA 4YEJA 2C4TA 1GJRA 5DN6A 2V7WA 1GO2A 1NDHA 1B2RA 2X3UA 4P22A 4Z4TA 1VQ7B 3QFCA 3R6JA 4ACAA 2HCJB 5BSYA 4DK0A 2ZL6A 4QFMA 4OOVA 3W5HA 4GQNA 4WZKA 4YHBA 4JMQA 1ZM2A 2E1RA 4LBYA 4XOTA 1QFZA 3W5UA 2C77A 3A3GA 5LMZA 3G4SB 1TVCA 4M2LA 5B6IA 4QVAA 2QA4B 4ACBA 5BSXA 5IYQA 2YWGA 2ZZFA 4DQLA 1OB5A 2QDXA 2GJKA 3CXCB 1WOSA 4P26A 3CP8A 2QGGA 2YWFA 2QE7A 1JA1A 4QVJA 2JJ1A 3AGPA 4G1BA 1R5BA 3CD6B 1S4MA 1Y0RA 3AVTA 3OJWA 3CMMA 2X85A 1QX4A 4P2NA 5IK2A 5TY0A 2OK7A 5FL7A 4OPOA 3R6KA 1KJZA 2Q6IA 3WBKA 4NNJA 1WSVA 5H59A 1V0EA 4DNTB 4XM3A 4OOXA 1N05A 2OTJB 1VQ8B 3A1PA 4XLEA 1E3ZA 2BMWA 4PC7A 1K28D 3GSIA 2GQFA 2ZXIA 4RPDA 1HZEA 2CC2A 1VQKB 3E1YE 4L8JA 1WOOA 4AVZA 3BH4A 3GVLA 4PC3A 3A8IA 4X05A 3MHPA 2BGIA 2QTLA 3ASRA 5E6TA 3WYAA 4P3YA 3GQBA 3CCVB 3CCQB 3ASPA 1Q7YD 1AIPA 1S0UA 1XB2A 2PMDA 1QGZA 1AMOA 4X0CA 2R6HA 3VMFA 1EFUA 1CQXA 1VLOA 4XKWA 5TV2A 3CRZA 3ZPNA 4MYTA 3OZWA 4PGOA 4CQJA 1E43A 1EFTA 1M1KD 1EP2B 1FNCA 1RQPA 1A8PA 1KZLA 1WU8A 1R5NA 4YXWA 2E1BA 2OYNA 1BMFA 1EXMA 2BSAA 4FN5A 1Q82D 3ES9A 1F60A 2GK6A 3AVUA 5J35A 3PUMA 1NJID 4ROXA 3Q39A 3BY2A 2C5HA 2X53S 1COWA 1GR1A 1DG1G 4XN0A 2AHOA 2C4UA 3SJZA 5HXBA 3U6BA 1ZM3A 1M90D 3I56B 3NE5B 2CF4A 2V7XA 1FNMA 1JA0A 1N08A 5IYRA 4YAFA 4EH1A 3CTAA 4Z4WA 1N0UA 1E79A 3ZBTA 4FXUA 3T53B 2VBUA 5GV7A 3SKBA 2CRVA 2JIZA 4X7FA 2CNDA 4U9UA 1ZM4A 4X7DA 1W9XA 4TSFA 1VQOB 4B3FX 3ZZTA 2EFGA 4G1VA 4WZTA 4P1VA 1D8TA 3AGQA 3AVYA 1U2RA 3U2QA 2ZL5A 2ZZEA 2J7KA 4WZLA 3Q3AA 4XOPA 3OEHA 4TMVA 4ZCIA 1YJ9B 5H5JA 3SLDA 4DQKA 1K8AD 1YIJB 4YAOA 2OK8A 3OAAA 1EFCA 4TMWA 1DDGA 3VO1A 1H8EA 1OB2A 3CPWB 1VQNB 3QE2A 4X06A 1E64A 3CCJB 4OOSA 1FRQA 2FX3A 4UZFA 2X6WA 1PKVA 3OE7A 5FIUA 1FDRA 3LQ6A 4F7DA 1JB9A 1NB0A 4B4DA 4ZV4A 3AVWA 4RCYA 4RDJA 1GVHA 4B3GA 4Z4RA 1H8HA 2X6XA 3I1FA 1YITB 2YWEA 3CC7B 4OPVA 3A8KA 2D3LA 1YLOA 1YJWB 2VNJA 4XKVA 4LBVA 2JJ2A 2FVGA 1EFRA 1NB9A 3GVKA 4RD0A 3A35A 2CBXA 2VNHA 1EP1B 3A3BA 1UD6A 4G5GA 1QGAA 1V0FA 4LBWA 4P6VF 4XR6A 1KQSB 2WZPP 1V5VA 5F4MA 1KMHA 3B78A
chains in the Genus database with same CATH topology
4RPDA 4Z4UA 4Z4VA 3Q38A 4X05A 3PVDA 5HZAA 5E6TA 3ASRA 4X07A 2ZL7A 3ASPA 2OBTA 5HZBA 3BY1A 5KW9A 4X0CA 4RPBA 1IHMA 3ASTA 4QV2A 3Q6RA 3BQJA 4WZEA 4P3IA 5J3OA 2OBSA 4OPSA 5J35A 3PUMA 4P12A 4P25A 4ROXA 3Q39A 3BY2A 3SJPA 4Z4SA 4RLZA 3SLNA 5F4JA 4Z4ZA 3LQEA 5IYRA 4Z4WA 3SKBA 4X7FA 4X7DA 4Z4TA 5IYNA 3R6JA 3ONYA 4WZTA 3RY8A 4P1VA 5BSYA 2ZL6A 3V7AA 4OOVA 2ZL5A 4WZKA 4WZLA 3Q3AA 3SLDA 4Z4YA 4QVAA 3ASSA 5IYQA 5BSXA 4OP7A 3D26A 4X7EA 3Q6QA 4X06A 4RDLA 4OOSA 4P26A 2OBRA 5IYWA 3LQ6A 4QVJA 5IYPA 3ONUA 4RDJA 4Z4RA 4OPVA 4P2NA 3ASQA 4QUZA 4OPOA 3SEJA 3R6KA 4RDKA 5F4OA 4OOXA 3PUNA 4X7CA 3PA2A 5F4MA 4RM0A 3PA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RPD A;  4Z4U A;  4Z4V A;  3Q38 A;  4X05 A;  3PVD A;  5HZA A;  5E6T A;  3ASR A;  4X07 A;  2ZL7 A;  3ASP A;  2OBT A;  5HZB A;  3BY1 A;  5KW9 A;  4X0C A;  4RPB A;  1IHM A;  3AST A;  4QV2 A;  3Q6R A;  3BQJ A;  4WZE A;  4P3I A;  5J3O A;  2OBS A;  4OPS A;  5J35 A;  3PUM A;  4P12 A;  4P25 A;  4ROX A;  3Q39 A;  3BY2 A;  3SJP A;  4Z4S A;  4RLZ A;  3SLN A;  5F4J A;  4Z4Z A;  3LQE A;  5IYR A;  4Z4W A;  3SKB A;  4X7F A;  4X7D A;  4Z4T A;  5IYN A;  3R6J A;  3ONY A;  4WZT A;  3RY8 A;  4P1V A;  5BSY A;  2ZL6 A;  3V7A A;  4OOV A;  2ZL5 A;  4WZK A;  4WZL A;  3Q3A A;  3SLD A;  4Z4Y A;  4QVA A;  3ASS A;  5IYQ A;  5BSX A;  4OP7 A;  3D26 A;  4X7E A;  3Q6Q A;  4X06 A;  4RDL A;  4OOS A;  4P26 A;  2OBR A;  5IYW A;  3LQ6 A;  4QVJ A;  5IYP A;  3ONU A;  4RDJ A;  4Z4R A;  4OPV A;  4P2N A;  3ASQ A;  4QUZ A;  4OPO A;  3SEJ A;  3R6K A;  4RDK A;  5F4O A;  4OOX A;  3PUN A;  4X7C A;  3PA2 A;  5F4M A;  4RM0 A;  3PA1 A; 
#chains in the Genus database with same CATH topology
 1QVG B;  3OPO A;  1F20 A;  3PEN A;  2ZTN A;  1UMK A;  2LZJ A;  4Z4V A;  4RD4 A;  4TMZ A;  2DY1 A;  1MAB A;  2VZL A;  4XLC A;  2VJI A;  4HE6 A;  4KKU A;  3PVD A;  2F1M A;  5HZA A;  4G7W A;  2ZL7 A;  4PC6 A;  4Q7J B;  1VQM B;  3W2E A;  3CES A;  4TKO B;  1BJK A;  2X0K A;  4IW3 B;  3CP2 A;  4M1K A;  3BY1 A;  4C43 A;  2W6J A;  2JDI A;  2ZZG A;  1I7P A;  3U6K A;  1IHM A;  4XL9 A;  3VO2 A;  1WDT A;  2XGJ A;  3BQJ A;  4WZE A;  2VYQ A;  3W2H A;  1Q81 D;  1QUF A;  2C5B A;  4YAL A;  1QH0 A;  1UD8 A;  1W35 A;  3DDY A;  4AF6 A;  2PLF A;  1IJF A;  5TR9 A;  1N8R D;  2BN4 A;  3CCS B;  1QGY A;  4XQF A;  2NPF A;  4DNR B;  2X6Y A;  1WP6 A;  3BC9 A;  4II2 A;  3MMP A;  2I1L A;  4Z4Z A;  2XNJ A;  4HIZ A;  2Q6L A;  1VLY A;  1YI2 B;  2XZL A;  2CK3 A;  3OOC A;  1H42 A;  1W0J A;  3ZIA A;  3QFS A;  3JQR A;  3MCA A;  4UZU A;  4FWT A;  5A88 A;  3WXM A;  3QSY A;  5IYN A;  1K73 D;  1RQR A;  2V31 A;  1QVF B;  1FND A;  2ZBU A;  2QTZ A;  1VQP B;  4J0Q A;  1B23 P;  1KK2 A;  4TT3 A;  2ZXH A;  4RD2 A;  1TTT A;  4ZCL A;  4HE5 A;  1IJE A;  1WOP A;  2WR8 A;  1E3X A;  4ZGQ B;  3CPX A;  1S72 B;  2ZTG A;  4G7X A;  4Z4Y A;  2XOK A;  3ASS A;  2ZBV A;  3ISX A;  4RD3 A;  4XLH A;  2M5S A;  2WYR A;  1FRN A;  3CW2 A;  1DAR A;  3Q6Q A;  4RDL A;  1FNB A;  3W2F A;  3H9N A;  2V7Q A;  5IYW A;  4PC1 A;  2BGJ A;  1E1Q A;  4B3X A;  2QN6 A;  1NBM A;  2R9V A;  4B48 A;  4XN3 A;  1T6X A;  1GAW A;  1QFY A;  1BPL A;  3T56 B;  4Z1M A;  1PJ7 A;  3WNC A;  4XON A;  1JNY A;  3A8J A;  1N06 A;  2DIE A;  3OFN A;  1UD2 A;  2Q6O A;  5L46 A;  2XND A;  1GAQ A;  2HDN B;  2WPD A;  3CCM B;  1SM4 A;  3PA2 A;  3WNB A;  4E0F A;  4UZE A;  4PC2 A;  3PA1 A;  4II3 A;  1BLI A;  2ZIT A;  1D1N A;  4Z4U A;  1VQ9 B;  3HAG A;  2HLD A;  3CC2 B;  4YAU A;  2Z6B D;  1J9Z A;  3CCU B;  1OB0 A;  1KK1 A;  1KRH A;  1P4M A;  4BPR A;  1BX0 A;  1MRZ A;  4X07 A;  4PAA A;  2BVN A;  3CME B;  2C78 A;  2OBT A;  3WND A;  3ZBU A;  1XFO A;  1ZUN B;  2PIA A;  5HZB A;  5KW9 A;  1W2B B;  1VQL B;  4RPB A;  4TMT A;  3T51 B;  3P27 A;  3VNV A;  3AST A;  1KTV A;  2QMU A;  1HA3 A;  1NRK A;  2GRE A;  2YWH A;  1KK0 A;  4XOR A;  5FO1 A;  3CMA B;  5AN9 A;  1PJ5 A;  1G7S A;  2VNK A;  3OJX A;  4XMY A;  5J3O A;  3BCF A;  2OBS A;  3OZV A;  3V76 A;  2W6I A;  4G6I A;  2QEX B;  2GJP A;  2D9R A;  4FK8 A;  4NBS A;  2WSS A;  4WQM A;  5THX A;  4MYU A;  4TN1 A;  3WQZ A;  3B8H A;  2XNC A;  2V7T A;  3WBJ A;  4C0S A;  4XLF A;  3SJP A;  2VBT A;  2GK7 A;  1HVX A;  2DOG A;  3OP1 A;  1CNF A;  3CCL B;  4Z4S A;  1SKY B;  5HKK A;  4M53 A;  4RLZ A;  1G7T A;  1K9M D;  3CCE B;  1QFJ A;  3SLN A;  2KVO A;  5F4J A;  3OW7 A;  1QUE A;  2B5O A;  1ZM9 A;  2OTL B;  3VR6 A;  1VJS A;  4M4S A;  4KKS A;  2F1L A;  1EP3 B;  4XD7 A;  1OGI A;  4PAB A;  3BNW A;  2GJR A;  3OW2 B;  4NCN A;  3CCR B;  5JBQ A;  4RCZ A;  4UAJ A;  1OGJ A;  2X8K A;  1BQE A;  4YEL A;  1KD1 D;  1JJ2 B;  2C2W A;  4TMX A;  3W2I A;  4P6Y A;  3FPK A;  3ONY A;  1WTH D;  1XE1 A;  5KSW B;  3QFR A;  3RY8 A;  1PJ6 A;  3W5V A;  1OHH A;  1W0K A;  3V7A A;  3ZZU A;  2BF4 A;  1YJN B;  4X8I A;  3ZC3 A;  3AVX A;  1D2E A;  4RD1 A;  3FKS A;  2D3N A;  3CC4 B;  3GVJ A;  3FJO A;  1BX1 A;  1Q86 D;  3LO8 A;  2VBV A;  5KNL A;  4K1X A;  2DEU A;  2XZP A;  1Y0Y A;  2PE3 A;  4AC9 A;  1E1R A;  1R5O A;  4OP7 A;  4B44 A;  3D26 A;  4QHY A;  1VQ5 B;  4DK1 A;  2XZO A;  1T6Y A;  2V7V A;  4X7E A;  3BCD A;  2VJJ A;  1VQ6 B;  1CNE A;  2OBR A;  3OEE A;  3ZUG A;  1WSR A;  2VBS A;  3E20 A;  5FA6 A;  4RD6 A;  5IYP A;  3AVV A;  3B82 A;  2BPO A;  3ONU A;  1QG0 A;  1ELO A;  3VNU A;  3G71 B;  5CDF A;  1W34 A;  1XQB A;  3QFT A;  2WJV A;  4B43 A;  4ASU A;  2Q6K A;  2D74 A;  3ASQ A;  4QUZ A;  2DCU A;  2WJY A;  5A89 A;  3SEJ A;  3JQQ A;  4RDK A;  1N0V C;  1H85 A;  2ZZQ A;  5F4O A;  1FX0 A;  1T5E A;  3WY9 A;  1VQ4 B;  2EIX A;  2DET A;  3PUN A;  4X7C A;  4R71 A;  3H94 A;  5DSZ A;  1KC8 D;  2BM0 A;  4RM0 A;  1I8D A;  4P9S A;  1VHO A;  2NV4 A;  1N07 A;  2RC5 A;  3KL9 A;  1I18 A;  3CB4 A;  3Q38 A;  1VHE A;  3J81 k;  5FO0 A;  2B7C A;  1T6Z A;  1YX2 A;  3OKX A;  2RC6 A;  3FPP A;  4LC0 A;  4ZGN B;  1VF7 A;  1YHQ B;  2F4N A;  1IB0 A;  2F43 A;  2B7B A;  5DS0 A;  3OZU A;  4Y7C A;  1EWY A;  4KKT A;  4M0L A;  2VNI A;  2V7U A;  4ZCM A;  3G6E B;  1TLL A;  1G7C A;  1UD4 A;  2BM1 A;  2XEX A;  4H9G A;  4Y9R A;  1DDI A;  3LNN A;  4QV2 A;  1E63 A;  3Q6R A;  1Q9S A;  4P3I A;  1UD5 A;  3LVB A;  1WPC A;  4YAW A;  5FNZ A;  2WZN A;  1KK3 A;  4RJL A;  1W87 A;  5TRD A;  1UD3 A;  2HMA A;  4LBZ A;  4OPS A;  1E62 A;  5A8A A;  1G7R A;  4N3N A;  4P12 A;  3GIR A;  2JN9 A;  4P25 A;  2GPJ A;  5EMN A;  4AF7 A;  2BV3 A;  2CW5 A;  3JU4 A;  3KEW A;  3P26 A;  4N3G A;  4XLA A;  2DER A;  4WWV A;  1TUI A;  3W2G A;  1WOR A;  2P3M A;  5GV8 A;  2DYI A;  4B47 A;  3I55 B;  3ZZ0 A;  4XNF A;  2V4D A;  3G05 A;  3LQE A;  1SKQ A;  3JQP A;  4Y9U A;  4YEJ A;  2C4T A;  1GJR A;  5DN6 A;  2V7W A;  1GO2 A;  1NDH A;  1B2R A;  2X3U A;  4P22 A;  4Z4T A;  1VQ7 B;  3QFC A;  3R6J A;  4ACA A;  2HCJ B;  5BSY A;  4DK0 A;  2ZL6 A;  4QFM A;  4OOV A;  3W5H A;  4GQN A;  4WZK A;  4YHB A;  4JMQ A;  1ZM2 A;  2E1R A;  4LBY A;  4XOT A;  1QFZ A;  3W5U A;  2C77 A;  3A3G A;  5LMZ A;  3G4S B;  1TVC A;  4M2L A;  5B6I A;  4QVA A;  2QA4 B;  4ACB A;  5BSX A;  5IYQ A;  2YWG A;  2ZZF A;  4DQL A;  1OB5 A;  2QDX A;  2GJK A;  3CXC B;  1WOS A;  4P26 A;  3CP8 A;  2QGG A;  2YWF A;  2QE7 A;  1JA1 A;  4QVJ A;  2JJ1 A;  3AGP A;  4G1B A;  1R5B A;  3CD6 B;  1S4M A;  1Y0R A;  3AVT A;  3OJW A;  3CMM A;  2X85 A;  1QX4 A;  4P2N A;  5IK2 A;  5TY0 A;  2OK7 A;  5FL7 A;  4OPO A;  3R6K A;  1KJZ A;  2Q6I A;  3WBK A;  4NNJ A;  1WSV A;  5H59 A;  1V0E A;  4DNT B;  4XM3 A;  4OOX A;  1N05 A;  2OTJ B;  1VQ8 B;  3A1P A;  4XLE A;  1E3Z A;  2BMW A;  4PC7 A;  1K28 D;  3GSI A;  2GQF A;  2ZXI A;  4RPD A;  1HZE A;  2CC2 A;  1VQK B;  3E1Y E;  4L8J A;  1WOO A;  4AVZ A;  3BH4 A;  3GVL A;  4PC3 A;  3A8I A;  4X05 A;  3MHP A;  2BGI A;  2QTL A;  3ASR A;  5E6T A;  3WYA A;  4P3Y A;  3GQB A;  3CCV B;  3CCQ B;  3ASP A;  1Q7Y D;  1AIP A;  1S0U A;  1XB2 A;  2PMD A;  1QGZ A;  1AMO A;  4X0C A;  2R6H A;  3VMF A;  1EFU A;  1CQX A;  1VLO A;  4XKW A;  5TV2 A;  3CRZ A;  3ZPN A;  4MYT A;  3OZW A;  4PGO A;  4CQJ A;  1E43 A;  1EFT A;  1M1K D;  1EP2 B;  1FNC A;  1RQP A;  1A8P A;  1KZL A;  1WU8 A;  1R5N A;  4YXW A;  2E1B A;  2OYN A;  1BMF A;  1EXM A;  2BSA A;  4FN5 A;  1Q82 D;  3ES9 A;  1F60 A;  2GK6 A;  3AVU A;  5J35 A;  3PUM A;  1NJI D;  4ROX A;  3Q39 A;  3BY2 A;  2C5H A;  2X53 S;  1COW A;  1GR1 A;  1DG1 G;  4XN0 A;  2AHO A;  2C4U A;  3SJZ A;  5HXB A;  3U6B A;  1ZM3 A;  1M90 D;  3I56 B;  3NE5 B;  2CF4 A;  2V7X A;  1FNM A;  1JA0 A;  1N08 A;  5IYR A;  4YAF A;  4EH1 A;  3CTA A;  4Z4W A;  1N0U A;  1E79 A;  3ZBT A;  4FXU A;  3T53 B;  2VBU A;  5GV7 A;  3SKB A;  2CRV A;  2JIZ A;  4X7F A;  2CND A;  4U9U A;  1ZM4 A;  4X7D A;  1W9X A;  4TSF A;  1VQO B;  4B3F X;  3ZZT A;  2EFG A;  4G1V A;  4WZT A;  4P1V A;  1D8T A;  3AGQ A;  3AVY A;  1U2R A;  3U2Q A;  2ZL5 A;  2ZZE A;  2J7K A;  4WZL A;  3Q3A A;  4XOP A;  3OEH A;  4TMV A;  4ZCI A;  1YJ9 B;  5H5J A;  3SLD A;  4DQK A;  1K8A D;  1YIJ B;  4YAO A;  2OK8 A;  3OAA A;  1EFC A;  4TMW A;  1DDG A;  3VO1 A;  1H8E A;  1OB2 A;  3CPW B;  1VQN B;  3QE2 A;  4X06 A;  1E64 A;  3CCJ B;  4OOS A;  1FRQ A;  2FX3 A;  4UZF A;  2X6W A;  1PKV A;  3OE7 A;  5FIU A;  1FDR A;  3LQ6 A;  4F7D A;  1JB9 A;  1NB0 A;  4B4D A;  4ZV4 A;  3AVW A;  4RCY A;  4RDJ A;  1GVH A;  4B3G A;  4Z4R A;  1H8H A;  2X6X A;  3I1F A;  1YIT B;  2YWE A;  3CC7 B;  4OPV A;  3A8K A;  2D3L A;  1YLO A;  1YJW B;  2VNJ A;  4XKV A;  4LBV A;  2JJ2 A;  2FVG A;  1EFR A;  1NB9 A;  3GVK A;  4RD0 A;  3A35 A;  2CBX A;  2VNH A;  1EP1 B;  3A3B A;  1UD6 A;  4G5G A;  1QGA A;  1V0F A;  4LBW A;  4P6V F;  4XR6 A;  1KQS B;  2WZP P;  1V5V A;  5F4M A;  1KMH A;  3B78 A; 
#chains in the Genus database with same CATH homology
 4RPD A;  4Z4U A;  4Z4V A;  3Q38 A;  4X05 A;  3PVD A;  5HZA A;  5E6T A;  3ASR A;  4X07 A;  2ZL7 A;  3ASP A;  2OBT A;  5HZB A;  3BY1 A;  5KW9 A;  4X0C A;  4RPB A;  1IHM A;  3AST A;  4QV2 A;  3Q6R A;  3BQJ A;  4WZE A;  4P3I A;  5J3O A;  2OBS A;  4OPS A;  5J35 A;  3PUM A;  4P12 A;  4P25 A;  4ROX A;  3Q39 A;  3BY2 A;  3SJP A;  4Z4S A;  4RLZ A;  3SLN A;  5F4J A;  4Z4Z A;  3LQE A;  5IYR A;  4Z4W A;  3SKB A;  4X7F A;  4X7D A;  4Z4T A;  5IYN A;  3R6J A;  3ONY A;  4WZT A;  3RY8 A;  4P1V A;  5BSY A;  2ZL6 A;  3V7A A;  4OOV A;  2ZL5 A;  4WZK A;  4WZL A;  3Q3A A;  3SLD A;  4Z4Y A;  4QVA A;  3ASS A;  5IYQ A;  5BSX A;  4OP7 A;  3D26 A;  4X7E A;  3Q6Q A;  4X06 A;  4RDL A;  4OOS A;  4P26 A;  2OBR A;  5IYW A;  3LQ6 A;  4QVJ A;  5IYP A;  3ONU A;  4RDJ A;  4Z4R A;  4OPV A;  4P2N A;  3ASQ A;  4QUZ A;  4OPO A;  3SEJ A;  3R6K A;  4RDK A;  5F4O A;  4OOX A;  3PUN A;  4X7C A;  3PA2 A;  5F4M A;  4RM0 A;  3PA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...