4RPDA

Crystal structure of p domain of 485 norovirus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
302
structure length
302
Chain Sequence
SKPFTLPILTIGELSNSRFPAPIDELYTSPNEGLVVQPQNGRSTLDGELLGTTQLVPSNICSLRGRINAHLPDNQHRWNMQVTNANGTPFDPTEDVPAPLGTPDFLANIYGVTSQRNPDNTCRAHDGILATWSPKFTPKLGSVVLGTWEDRDFDINQPTRFTPVGLYDTDHFNQWALPNYSGALTLNMNLAPSVAPLFPGEQLLFFRSHIPLKGGTSNGAIDCLLPQEWVQHFYQESAPSSTDVALIRYTNPDTGRVLFEAKLHRQGFITVANSGSRPIVVPPNGYFRFDSWVNQFYSLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein
publication title Structural Constraints on Human Norovirus Binding to Histo-Blood Group Antigens.
pubmed doi rcsb
source organism Norwalk virus
total genus 71
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rpdA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rpdA01
3Q6QA 4RLZA 3PUNA 4P25A 4WZKA 3V7AA 4OP7A 3ASRA 4WZLA 3Q6RA 3ONUA 5IYWA 4WZTA 3SKBA 3ASQA 4X7FA 5J35A 5IYQA 5HZAA 4P26A 3PA2A 4RPBA 5HZBA 5F4MA 4RM0A 5IYRA 3PUMA 5F4JA 3PA1A 4Z4YA 4OOVA 5IYNA 3Q3AA 4QV2A 4P12A 4Z4SA 3BQJA 2OBRA 4QUZA 5BSXA 4X7EA 4X7DA 4OPVA 3ASPA 4Z4RA 3R6JA 4QVAA 2OBTA 3SEJA 3ASTA 3SJPA 5KW9A 4RDLA 4OPOA 3BY2A 4P2NA 3RY8A 4Z4TA 1IHMA 4P3IA 4Z4WA 4RDJA 4Z4UA 4RDKA 2ZL7A 4QVJA 3Q38A 3D26A 4P1VA 4Z4ZA 5E6TA 3LQEA 4X07A 4X05A 5IYPA 4OPSA 4RPDA 3R6KA 4OOXA 3LQ6A 5J3OA 5BSYA 4ROXA 3PVDA 3SLDA 3Q39A 2ZL5A 3SLNA 4Z4VA 5F4OA 4X0CA 4X7CA 4OOSA 4WZEA 4X06A 3BY1A 3ASSA 2OBSA 3ONYA 2ZL6A
chains in the Genus database with same CATH superfamily
2XNDA 4PGOA 4HE5A 4WZKA 1QUFA 3CRZA 4G5GA 3ASRA 4WZLA 5IK2A 2C78A 3B8HA 3ONUA 3W5HA 1QVFB 3ASQA 4TMVA 2FX3A 1ZM2A 2HLDA 1WOOA 1D1NA 1T5EA 2E1RA 1UD6A 2CBXA 2ZITA 1H85A 4RD4A 1WDTA 3VR6A 2ZZQA 3OEHA 4PC1A 4YALA 1YJ9B 4AVZA 1EFTA 2CW5A 1UD2A 2NV4A 5F4MA 1W35A 1OHHA 1ZM4A 3JU4A 3AGPA 1W87A 4Z4YA 3U6BA 2PIAA 2V31A 1FDRA 2RC5A 1WTHD 3BQJA 1PJ5A 1VQ8B 1N0VC 4UZFA 1WOPA 4MYUA 4U9UA 1TVCA 3MCAA 2X8KA 4OPVA 1UD3A 3LVBA 4ZGQB 3ASPA 1OB5A 1EXMA 2VNKA 2OBTA 1BQEA 1VQNB 2R9VA 1Q81D 3CCVB 4YEJA 4B43A 3CTAA 1H8EA 4RDLA 5EMNA 3AVTA 4FN5A 4PABA 2DEUA 5CDFA 2KVOA 4P2NA 3QFRA 2XZLA 1PJ6A 2C5HA 2CK3A 1T6YA 2JN9A 1HZEA 1FNMA 2BGJA 1KJZA 3CB4A 1OGIA 4K1XA 1Q9SA 1E62A 1YX2A 1D2EA 1QUEA 4PC3A 3Q38A 3CCLB 3MMPA 1Q82D 1FNBA 1EWYA 2VNIA 2X53S 1W34A 5FNZA 4G6IA 4AC9A 5FIUA 5TY0A 2YWEA 4XLEA 1AIPA 4JMQA 2X85A 5IYPA 1VQLB 2Q6OA 4OPSA 3R6KA 3WXMA 3CCSB 5J3OA 2GK7A 3GQBA 1OB2A 4ACBA 2VNJA 1SKQA 3ISXA 1V0FA 3PVDA 3Q39A 4Z4VA 4Y9UA 1VHOA 3AVXA 1N06A 3BCDA 4XORA 4TKOB 4XLAA 1G7TA 4M53A 4OOSA 1JJ2B 1D8TA 1WSRA 1BX0A 2I1LA 3A1PA 3OZWA 1E43A 3QE2A 4G7XA 1HA3A 4NCNA 1OGJA 2P3MA 2OBSA 3GSIA 4ACAA 1BJKA 2ZL6A 4MYTA 2M5SA 2QDXA 4UZEA 1XB2A 2ZXIA 4RLZA 3PENA 3B78A 5DN6A 1K8AD 2D3NA 3PUNA 2WSSA 4KKSA 2WZPP 3CMMA 2JJ2A 2BM1A 3ZBTA 2QGGA 1WOSA 3OE7A 2BN4A 3CCQB 2JIZA 1EP2B 3AGQA 5A8AA 3CCEB 4B3GA 5KSWB 3QFTA 1CNEA 2Q6IA 2VJJA 5IYWA 1MRZA 1H42A 3BH4A 1E3XA 4UAJA 1E63A 1KMHA 2DYIA 4DK0A 2XZPA 1FNCA 4DK1A 3CD6B 1VHEA 4P26A 1NJID 3E20A 4RPBA 5IYRA 2QA4B 4XOTA 2AHOA 1NBMA 4XM3A 1KZLA 4LC0A 3T56B 1N05A 1YIJB 1DDIA 3W2IA 1E1RA 1UD5A 5IYNA 3JQQA 3OAAA 4TSFA 3W5VA 1KQSB 1QGYA 4II2A 4P12A 1NB9A 1QGAA 4QV2A 4FXUA 3FJOA 1YITB 1UD4A 2JDIA 1QFZA 3WNCA 1I8DA 1COWA 2CC2A 3QSYA 3OZUA 3AVUA 1QH0A 4NNJA 1QVGB 1IJEA 1VQKB 1HVXA 4XR6A 2DY1A 4B44A 2WR8A 1FNDA 2B5OA 2C2WA 5A88A 1FX0A 3SEJA 3ASTA 2WPDA 2OYNA 1J9ZA 4IW3B 3W2HA 2BPOA 1ZM9A 1B2RA 3WNDA 1GAQA 1N07A 4OPOA 5TRDA 4DNRB 3U6KA 3A3GA 4FWTA 4QFMA 3FKSA 3CP8A 3AVYA 2PLFA 4B3XA 4ZCLA 4TMXA 3RY8A 4P9SA 5THXA 4P3IA 1A8PA 2V7XA 2VBVA 2ZL7A 1EFRA 2VBTA 4DNTB 4UZUA 3D26A 4P1VA 4Z4ZA 4KKUA 1VQPB 2C5BA 4RJLA 1TLLA 2QTZA 3GIRA 3VO2A 3G71B 4XLFA 1WPCA 3OEEA 3BC9A 3OOCA 3LQEA 1S4MA 1E3ZA 2BVNA 4X05A 1GVHA 2EFGA 4HE6A 5H59A 1T6ZA 3OJXA 2ZZEA 1YHQB 3OW7A 3CC7B 4GQNA 4PC6A 2OTLB 2JJ1A 1BLIA 1M90D 2F43A 4BPRA 1VQ9B 2VJIA 3WQZA 4RD0A 2W6IA 3CMEB 3A8JA 3I1FA 5FA6A 1IB0A 1KRHA 4ZCIA 3SLDA 3U2QA 2GK6A 4RCZA 1VQOB 1SM4A 3OPOA 3CW2A 2GJRA 1KK0A 3OZVA 1NRKA 3P26A 1VQ7B 1IJFA 4X7CA 1S72B 1BX1A 1RQPA 2RC6A 4P6VF 4YAOA 3ZZTA 1N08A 3BY1A 1ZUNB 3ASSA 1DG1G 3FPPA 2D9RA 1JA1A 1KK3A 4B4DA 2GJKA 3Q6QA 4G1BA 1XQBA 1S0UA 2LZJA 2VNHA 4RD2A 4OP7A 3ZBUA 1KK1A 4XQFA 3OKXA 1SKYB 1JA0A 2GJPA 1QFYA 2HDNB 2ZZGA 4XKVA 5FL7A 1W0KA 4AF7A 3LO8A 4NBSA 1VF7A 3AVWA 2CF4A 5J35A 2CNDA 2V7QA 2BGIA 4ZCMA 5HZAA 4C0SA 4P6YA 2YWHA 1TTTA 2FVGA 3HAGA 3PA2A 3W5UA 1N0UA 4LBWA 4XKWA 2VYQA 4CQJA 3VNVA 5F4JA 4B3FX 3PA1A 1Q7YD 3BCFA 3W2FA 3CESA 3H94A 2PMDA 4F7DA 4OOVA 1KD1D 2HCJB 1TUIA 1F60A 1MABA 1G7CA 4Z4SA 4Y7CA 1F20A 4Z1MA 3QFSA 5BSXA 4RCYA 4X7EA 5L46A 1T6XA 4XLCA 1PKVA 3WBKA 4X7DA 2DIEA 5GV7A 3T53B 4Z4RA 2ZTGA 3ZC3A 3SJPA 2OK7A 3CCUB 1GO2A 4N3GA 2D74A 2QTLA 3GVLA 3CPXA 3KEWA 3BY2A 2X6YA 5H5JA 1KC8D 2DETA 3CC4B 1WSVA 1K28D 1R5OA 1EP3B 1I18A 1AMOA 1QGZA 1XE1A 1ZM3A 1IHMA 3NE5B 4Z4WA 5TV2A 4X8IA 2EIXA 5HKKA 1ELOA 4HIZA 5FO0A 3T51B 3H9NA 3AVVA 4LBZA 4R71A 4M1KA 3OP1A 4RD1A 3WYAA 2XNJA 4Y9RA 4B47A 3CPWB 4X07A 3ZZ0A 3G05A 1GAWA 1KK2A 5FO1A 5B6IA 4TMZA 4XN0A 2GREA 3A35A 5DSZA 2VZLA 2C4TA 2B7CA 4XONA 3CMAB 3J81k 4EH1A 4TN1A 4WQMA 5BSYA 4P22A 2VBUA 4M4SA 4ROXA 2XGJA 1G7SA 2R6HA 1VLYA 1QFJA 2WYRA 1VQ4B 1YJWB 1Q86D 3G4SB 3G6EB 4YAWA 4XD7A 4G7WA 1CQXA 1EFUA 3ES9A 3ZZUA 1U2RA 1EP1B 4WZEA 1K9MD 1UD8A 2V7UA 2V7VA 4X06A 5A89A 3OJWA 1E1QA 3ONYA 5JBQA 1W2BB 2DOGA 1NDHA 2Q6KA 3OW2B 4LBVA 2QEXB 2D3LA 4YAFA 3V76A 4L8JA 4P25A 2DERA 3CCJB 3V7AA 2WJVA 1VQ5B 4XLHA 1VQ6B 1G7RA 2BSAA 2VBSA 3MHPA 3Q6RA 4C43A 2GQFA 4DQLA 1Y0YA 3VO1A 1YJNB 1P4MA 4WZTA 3SKBA 1QX4A 4AF6A 1UMKA 1R5BA 2XOKA 4X7FA 1K73D 2X6WA 1E79A 4J0QA 1M1KD 5IYQA 3JQRA 2WJYA 2X3UA 2F1LA 1YI2B 3GVJA 3JQPA 3CCRB 3LNNA 1B23P 5HZBA 2E1BA 4RM0A 2NPFA 4YHBA 3CXCB 3PUMA 2Z6BD 2Q6LA 4P3YA 2V7TA 2X0KA 4Q7JB 5HXBA 4ZV4A 2F4NA 2QE7A 2ZBUA 3KL9A 3Q3AA 1W9XA 1PJ7A 2OBRA 3ZUGA 4QUZA 2ZTNA 4DQKA 5LMZA 1N8RD 3WNBA 3ZIAA 5GV8A 3VNUA 4KKTA 5TR9A 2BMWA 3R6JA 4QVAA 4RD6A 2F1MA 4FK8A 1Y0RA 1WORA 2PE3A 2C77A 2ZZFA 2BV3A 4PAAA 4TT3A 1BPLA 5KW9A 3SJZA 1VJSA 2YWFA 1V5VA 3A8KA 4G1VA 2J7KA 4XN3A 1FRQA 1XFOA 3GVKA 4II3A 4N3NA 3VMFA 2OK8A 3I56B 2V4DA 1KTVA 3P27A 4M0LA 4TMWA 4YXWA 4Z4TA 4Z4UA 1W0JA 1GR1A 2QMUA 4QHYA 2W6JA 4RDJA 2C4UA 4YAUA 4RDKA 1FRNA 2HMAA 2BM0A 4QVJA 1WU8A 1EFCA 5DS0A 1GJRA 2CRVA 4H9GA 2XEXA 5AN9A 4E0FA 1DARA 2X6XA 2GPJA 1E64A 5KNLA 2ZXHA 4RD3A 5E6TA 4XOPA 4TMTA 1H8HA 3WY9A 3A3BA 2XZOA 1RQRA 2XNCA 1I7PA 1NB0A 1R5NA 3W2EA 4M2LA 4RPDA 2BF4A 3WBJA 4OOXA 1OB0A 3LQ6A 3I55B 3FPKA 2OTJB 4YELA 4XL9A 3OFNA 3QFCA 4PC7A 1VLOA 2V7WA 3ZPNA 2DCUA 3BNWA 4PC2A 1VQMB 2ZL5A 1DDGA 3SLNA 3B82A 2ZBVA 1CNFA 3DDYA 5F4OA 3CCMB 1JB9A 1QG0A 1JNYA 3E1YE 4WWVA 3CC2B 4LBYA 4X0CA 4B48A 3W2GA 4ZGNB 4XNFA 3A8IA 4XMYA 1YLOA 2QN6A 1V0EA 1WP6A 2WZNA 3CP2A 2YWGA 4ASUA 1BMFA 2B7BA
chains in the Genus database with same CATH topology
3Q6QA 4RLZA 3PUNA 4P25A 4WZKA 3V7AA 4OP7A 3ASRA 4WZLA 3Q6RA 3ONUA 5IYWA 4WZTA 3SKBA 3ASQA 4X7FA 5J35A 5IYQA 5HZAA 4P26A 3PA2A 4RPBA 5HZBA 5F4MA 4RM0A 5IYRA 3PUMA 5F4JA 3PA1A 4Z4YA 4OOVA 5IYNA 3Q3AA 4QV2A 4P12A 4Z4SA 3BQJA 2OBRA 4QUZA 5BSXA 4X7EA 4X7DA 4OPVA 3ASPA 4Z4RA 3R6JA 4QVAA 2OBTA 3SEJA 3ASTA 3SJPA 5KW9A 4RDLA 4OPOA 3BY2A 4P2NA 3RY8A 4Z4TA 1IHMA 4P3IA 4Z4WA 4RDJA 4Z4UA 4RDKA 2ZL7A 4QVJA 3Q38A 3D26A 4P1VA 4Z4ZA 5E6TA 3LQEA 4X07A 4X05A 5IYPA 4OPSA 4RPDA 3R6KA 4OOXA 3LQ6A 5J3OA 5BSYA 4ROXA 3PVDA 3SLDA 3Q39A 2ZL5A 3SLNA 4Z4VA 5F4OA 4X0CA 4X7CA 4OOSA 4WZEA 4X06A 3BY1A 3ASSA 2OBSA 3ONYA 2ZL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6Q A;  4RLZ A;  3PUN A;  4P25 A;  4WZK A;  3V7A A;  4OP7 A;  3ASR A;  4WZL A;  3Q6R A;  3ONU A;  5IYW A;  4WZT A;  3SKB A;  3ASQ A;  4X7F A;  5J35 A;  5IYQ A;  5HZA A;  4P26 A;  3PA2 A;  4RPB A;  5HZB A;  5F4M A;  4RM0 A;  5IYR A;  3PUM A;  5F4J A;  3PA1 A;  4Z4Y A;  4OOV A;  5IYN A;  3Q3A A;  4QV2 A;  4P12 A;  4Z4S A;  3BQJ A;  2OBR A;  4QUZ A;  5BSX A;  4X7E A;  4X7D A;  4OPV A;  3ASP A;  4Z4R A;  3R6J A;  4QVA A;  2OBT A;  3SEJ A;  3AST A;  3SJP A;  5KW9 A;  4RDL A;  4OPO A;  3BY2 A;  4P2N A;  3RY8 A;  4Z4T A;  1IHM A;  4P3I A;  4Z4W A;  4RDJ A;  4Z4U A;  4RDK A;  2ZL7 A;  4QVJ A;  3Q38 A;  3D26 A;  4P1V A;  4Z4Z A;  5E6T A;  3LQE A;  4X07 A;  4X05 A;  5IYP A;  4OPS A;  4RPD A;  3R6K A;  4OOX A;  3LQ6 A;  5J3O A;  5BSY A;  4ROX A;  3PVD A;  3SLD A;  3Q39 A;  2ZL5 A;  3SLN A;  4Z4V A;  5F4O A;  4X0C A;  4X7C A;  4OOS A;  4WZE A;  4X06 A;  3BY1 A;  3ASS A;  2OBS A;  3ONY A;  2ZL6 A; 
#chains in the Genus database with same CATH topology
 2XND A;  4PGO A;  4HE5 A;  4WZK A;  1QUF A;  3CRZ A;  4G5G A;  3ASR A;  4WZL A;  5IK2 A;  2C78 A;  3B8H A;  3ONU A;  3W5H A;  1QVF B;  3ASQ A;  4TMV A;  2FX3 A;  1ZM2 A;  2HLD A;  1WOO A;  1D1N A;  1T5E A;  2E1R A;  1UD6 A;  2CBX A;  2ZIT A;  1H85 A;  4RD4 A;  1WDT A;  3VR6 A;  2ZZQ A;  3OEH A;  4PC1 A;  4YAL A;  1YJ9 B;  4AVZ A;  1EFT A;  2CW5 A;  1UD2 A;  2NV4 A;  5F4M A;  1W35 A;  1OHH A;  1ZM4 A;  3JU4 A;  3AGP A;  1W87 A;  4Z4Y A;  3U6B A;  2PIA A;  2V31 A;  1FDR A;  2RC5 A;  1WTH D;  3BQJ A;  1PJ5 A;  1VQ8 B;  1N0V C;  4UZF A;  1WOP A;  4MYU A;  4U9U A;  1TVC A;  3MCA A;  2X8K A;  4OPV A;  1UD3 A;  3LVB A;  4ZGQ B;  3ASP A;  1OB5 A;  1EXM A;  2VNK A;  2OBT A;  1BQE A;  1VQN B;  2R9V A;  1Q81 D;  3CCV B;  4YEJ A;  4B43 A;  3CTA A;  1H8E A;  4RDL A;  5EMN A;  3AVT A;  4FN5 A;  4PAB A;  2DEU A;  5CDF A;  2KVO A;  4P2N A;  3QFR A;  2XZL A;  1PJ6 A;  2C5H A;  2CK3 A;  1T6Y A;  2JN9 A;  1HZE A;  1FNM A;  2BGJ A;  1KJZ A;  3CB4 A;  1OGI A;  4K1X A;  1Q9S A;  1E62 A;  1YX2 A;  1D2E A;  1QUE A;  4PC3 A;  3Q38 A;  3CCL B;  3MMP A;  1Q82 D;  1FNB A;  1EWY A;  2VNI A;  2X53 S;  1W34 A;  5FNZ A;  4G6I A;  4AC9 A;  5FIU A;  5TY0 A;  2YWE A;  4XLE A;  1AIP A;  4JMQ A;  2X85 A;  5IYP A;  1VQL B;  2Q6O A;  4OPS A;  3R6K A;  3WXM A;  3CCS B;  5J3O A;  2GK7 A;  3GQB A;  1OB2 A;  4ACB A;  2VNJ A;  1SKQ A;  3ISX A;  1V0F A;  3PVD A;  3Q39 A;  4Z4V A;  4Y9U A;  1VHO A;  3AVX A;  1N06 A;  3BCD A;  4XOR A;  4TKO B;  4XLA A;  1G7T A;  4M53 A;  4OOS A;  1JJ2 B;  1D8T A;  1WSR A;  1BX0 A;  2I1L A;  3A1P A;  3OZW A;  1E43 A;  3QE2 A;  4G7X A;  1HA3 A;  4NCN A;  1OGJ A;  2P3M A;  2OBS A;  3GSI A;  4ACA A;  1BJK A;  2ZL6 A;  4MYT A;  2M5S A;  2QDX A;  4UZE A;  1XB2 A;  2ZXI A;  4RLZ A;  3PEN A;  3B78 A;  5DN6 A;  1K8A D;  2D3N A;  3PUN A;  2WSS A;  4KKS A;  2WZP P;  3CMM A;  2JJ2 A;  2BM1 A;  3ZBT A;  2QGG A;  1WOS A;  3OE7 A;  2BN4 A;  3CCQ B;  2JIZ A;  1EP2 B;  3AGQ A;  5A8A A;  3CCE B;  4B3G A;  5KSW B;  3QFT A;  1CNE A;  2Q6I A;  2VJJ A;  5IYW A;  1MRZ A;  1H42 A;  3BH4 A;  1E3X A;  4UAJ A;  1E63 A;  1KMH A;  2DYI A;  4DK0 A;  2XZP A;  1FNC A;  4DK1 A;  3CD6 B;  1VHE A;  4P26 A;  1NJI D;  3E20 A;  4RPB A;  5IYR A;  2QA4 B;  4XOT A;  2AHO A;  1NBM A;  4XM3 A;  1KZL A;  4LC0 A;  3T56 B;  1N05 A;  1YIJ B;  1DDI A;  3W2I A;  1E1R A;  1UD5 A;  5IYN A;  3JQQ A;  3OAA A;  4TSF A;  3W5V A;  1KQS B;  1QGY A;  4II2 A;  4P12 A;  1NB9 A;  1QGA A;  4QV2 A;  4FXU A;  3FJO A;  1YIT B;  1UD4 A;  2JDI A;  1QFZ A;  3WNC A;  1I8D A;  1COW A;  2CC2 A;  3QSY A;  3OZU A;  3AVU A;  1QH0 A;  4NNJ A;  1QVG B;  1IJE A;  1VQK B;  1HVX A;  4XR6 A;  2DY1 A;  4B44 A;  2WR8 A;  1FND A;  2B5O A;  2C2W A;  5A88 A;  1FX0 A;  3SEJ A;  3AST A;  2WPD A;  2OYN A;  1J9Z A;  4IW3 B;  3W2H A;  2BPO A;  1ZM9 A;  1B2R A;  3WND A;  1GAQ A;  1N07 A;  4OPO A;  5TRD A;  4DNR B;  3U6K A;  3A3G A;  4FWT A;  4QFM A;  3FKS A;  3CP8 A;  3AVY A;  2PLF A;  4B3X A;  4ZCL A;  4TMX A;  3RY8 A;  4P9S A;  5THX A;  4P3I A;  1A8P A;  2V7X A;  2VBV A;  2ZL7 A;  1EFR A;  2VBT A;  4DNT B;  4UZU A;  3D26 A;  4P1V A;  4Z4Z A;  4KKU A;  1VQP B;  2C5B A;  4RJL A;  1TLL A;  2QTZ A;  3GIR A;  3VO2 A;  3G71 B;  4XLF A;  1WPC A;  3OEE A;  3BC9 A;  3OOC A;  3LQE A;  1S4M A;  1E3Z A;  2BVN A;  4X05 A;  1GVH A;  2EFG A;  4HE6 A;  5H59 A;  1T6Z A;  3OJX A;  2ZZE A;  1YHQ B;  3OW7 A;  3CC7 B;  4GQN A;  4PC6 A;  2OTL B;  2JJ1 A;  1BLI A;  1M90 D;  2F43 A;  4BPR A;  1VQ9 B;  2VJI A;  3WQZ A;  4RD0 A;  2W6I A;  3CME B;  3A8J A;  3I1F A;  5FA6 A;  1IB0 A;  1KRH A;  4ZCI A;  3SLD A;  3U2Q A;  2GK6 A;  4RCZ A;  1VQO B;  1SM4 A;  3OPO A;  3CW2 A;  2GJR A;  1KK0 A;  3OZV A;  1NRK A;  3P26 A;  1VQ7 B;  1IJF A;  4X7C A;  1S72 B;  1BX1 A;  1RQP A;  2RC6 A;  4P6V F;  4YAO A;  3ZZT A;  1N08 A;  3BY1 A;  1ZUN B;  3ASS A;  1DG1 G;  3FPP A;  2D9R A;  1JA1 A;  1KK3 A;  4B4D A;  2GJK A;  3Q6Q A;  4G1B A;  1XQB A;  1S0U A;  2LZJ A;  2VNH A;  4RD2 A;  4OP7 A;  3ZBU A;  1KK1 A;  4XQF A;  3OKX A;  1SKY B;  1JA0 A;  2GJP A;  1QFY A;  2HDN B;  2ZZG A;  4XKV A;  5FL7 A;  1W0K A;  4AF7 A;  3LO8 A;  4NBS A;  1VF7 A;  3AVW A;  2CF4 A;  5J35 A;  2CND A;  2V7Q A;  2BGI A;  4ZCM A;  5HZA A;  4C0S A;  4P6Y A;  2YWH A;  1TTT A;  2FVG A;  3HAG A;  3PA2 A;  3W5U A;  1N0U A;  4LBW A;  4XKW A;  2VYQ A;  4CQJ A;  3VNV A;  5F4J A;  4B3F X;  3PA1 A;  1Q7Y D;  3BCF A;  3W2F A;  3CES A;  3H94 A;  2PMD A;  4F7D A;  4OOV A;  1KD1 D;  2HCJ B;  1TUI A;  1F60 A;  1MAB A;  1G7C A;  4Z4S A;  4Y7C A;  1F20 A;  4Z1M A;  3QFS A;  5BSX A;  4RCY A;  4X7E A;  5L46 A;  1T6X A;  4XLC A;  1PKV A;  3WBK A;  4X7D A;  2DIE A;  5GV7 A;  3T53 B;  4Z4R A;  2ZTG A;  3ZC3 A;  3SJP A;  2OK7 A;  3CCU B;  1GO2 A;  4N3G A;  2D74 A;  2QTL A;  3GVL A;  3CPX A;  3KEW A;  3BY2 A;  2X6Y A;  5H5J A;  1KC8 D;  2DET A;  3CC4 B;  1WSV A;  1K28 D;  1R5O A;  1EP3 B;  1I18 A;  1AMO A;  1QGZ A;  1XE1 A;  1ZM3 A;  1IHM A;  3NE5 B;  4Z4W A;  5TV2 A;  4X8I A;  2EIX A;  5HKK A;  1ELO A;  4HIZ A;  5FO0 A;  3T51 B;  3H9N A;  3AVV A;  4LBZ A;  4R71 A;  4M1K A;  3OP1 A;  4RD1 A;  3WYA A;  2XNJ A;  4Y9R A;  4B47 A;  3CPW B;  4X07 A;  3ZZ0 A;  3G05 A;  1GAW A;  1KK2 A;  5FO1 A;  5B6I A;  4TMZ A;  4XN0 A;  2GRE A;  3A35 A;  5DSZ A;  2VZL A;  2C4T A;  2B7C A;  4XON A;  3CMA B;  3J81 k;  4EH1 A;  4TN1 A;  4WQM A;  5BSY A;  4P22 A;  2VBU A;  4M4S A;  4ROX A;  2XGJ A;  1G7S A;  2R6H A;  1VLY A;  1QFJ A;  2WYR A;  1VQ4 B;  1YJW B;  1Q86 D;  3G4S B;  3G6E B;  4YAW A;  4XD7 A;  4G7W A;  1CQX A;  1EFU A;  3ES9 A;  3ZZU A;  1U2R A;  1EP1 B;  4WZE A;  1K9M D;  1UD8 A;  2V7U A;  2V7V A;  4X06 A;  5A89 A;  3OJW A;  1E1Q A;  3ONY A;  5JBQ A;  1W2B B;  2DOG A;  1NDH A;  2Q6K A;  3OW2 B;  4LBV A;  2QEX B;  2D3L A;  4YAF A;  3V76 A;  4L8J A;  4P25 A;  2DER A;  3CCJ B;  3V7A A;  2WJV A;  1VQ5 B;  4XLH A;  1VQ6 B;  1G7R A;  2BSA A;  2VBS A;  3MHP A;  3Q6R A;  4C43 A;  2GQF A;  4DQL A;  1Y0Y A;  3VO1 A;  1YJN B;  1P4M A;  4WZT A;  3SKB A;  1QX4 A;  4AF6 A;  1UMK A;  1R5B A;  2XOK A;  4X7F A;  1K73 D;  2X6W A;  1E79 A;  4J0Q A;  1M1K D;  5IYQ A;  3JQR A;  2WJY A;  2X3U A;  2F1L A;  1YI2 B;  3GVJ A;  3JQP A;  3CCR B;  3LNN A;  1B23 P;  5HZB A;  2E1B A;  4RM0 A;  2NPF A;  4YHB A;  3CXC B;  3PUM A;  2Z6B D;  2Q6L A;  4P3Y A;  2V7T A;  2X0K A;  4Q7J B;  5HXB A;  4ZV4 A;  2F4N A;  2QE7 A;  2ZBU A;  3KL9 A;  3Q3A A;  1W9X A;  1PJ7 A;  2OBR A;  3ZUG A;  4QUZ A;  2ZTN A;  4DQK A;  5LMZ A;  1N8R D;  3WNB A;  3ZIA A;  5GV8 A;  3VNU A;  4KKT A;  5TR9 A;  2BMW A;  3R6J A;  4QVA A;  4RD6 A;  2F1M A;  4FK8 A;  1Y0R A;  1WOR A;  2PE3 A;  2C77 A;  2ZZF A;  2BV3 A;  4PAA A;  4TT3 A;  1BPL A;  5KW9 A;  3SJZ A;  1VJS A;  2YWF A;  1V5V A;  3A8K A;  4G1V A;  2J7K A;  4XN3 A;  1FRQ A;  1XFO A;  3GVK A;  4II3 A;  4N3N A;  3VMF A;  2OK8 A;  3I56 B;  2V4D A;  1KTV A;  3P27 A;  4M0L A;  4TMW A;  4YXW A;  4Z4T A;  4Z4U A;  1W0J A;  1GR1 A;  2QMU A;  4QHY A;  2W6J A;  4RDJ A;  2C4U A;  4YAU A;  4RDK A;  1FRN A;  2HMA A;  2BM0 A;  4QVJ A;  1WU8 A;  1EFC A;  5DS0 A;  1GJR A;  2CRV A;  4H9G A;  2XEX A;  5AN9 A;  4E0F A;  1DAR A;  2X6X A;  2GPJ A;  1E64 A;  5KNL A;  2ZXH A;  4RD3 A;  5E6T A;  4XOP A;  4TMT A;  1H8H A;  3WY9 A;  3A3B A;  2XZO A;  1RQR A;  2XNC A;  1I7P A;  1NB0 A;  1R5N A;  3W2E A;  4M2L A;  4RPD A;  2BF4 A;  3WBJ A;  4OOX A;  1OB0 A;  3LQ6 A;  3I55 B;  3FPK A;  2OTJ B;  4YEL A;  4XL9 A;  3OFN A;  3QFC A;  4PC7 A;  1VLO A;  2V7W A;  3ZPN A;  2DCU A;  3BNW A;  4PC2 A;  1VQM B;  2ZL5 A;  1DDG A;  3SLN A;  3B82 A;  2ZBV A;  1CNF A;  3DDY A;  5F4O A;  3CCM B;  1JB9 A;  1QG0 A;  1JNY A;  3E1Y E;  4WWV A;  3CC2 B;  4LBY A;  4X0C A;  4B48 A;  3W2G A;  4ZGN B;  4XNF A;  3A8I A;  4XMY A;  1YLO A;  2QN6 A;  1V0E A;  1WP6 A;  2WZN A;  3CP2 A;  2YWG A;  4ASU A;  1BMF A;  2B7B A; 
#chains in the Genus database with same CATH homology
 3Q6Q A;  4RLZ A;  3PUN A;  4P25 A;  4WZK A;  3V7A A;  4OP7 A;  3ASR A;  4WZL A;  3Q6R A;  3ONU A;  5IYW A;  4WZT A;  3SKB A;  3ASQ A;  4X7F A;  5J35 A;  5IYQ A;  5HZA A;  4P26 A;  3PA2 A;  4RPB A;  5HZB A;  5F4M A;  4RM0 A;  5IYR A;  3PUM A;  5F4J A;  3PA1 A;  4Z4Y A;  4OOV A;  5IYN A;  3Q3A A;  4QV2 A;  4P12 A;  4Z4S A;  3BQJ A;  2OBR A;  4QUZ A;  5BSX A;  4X7E A;  4X7D A;  4OPV A;  3ASP A;  4Z4R A;  3R6J A;  4QVA A;  2OBT A;  3SEJ A;  3AST A;  3SJP A;  5KW9 A;  4RDL A;  4OPO A;  3BY2 A;  4P2N A;  3RY8 A;  4Z4T A;  1IHM A;  4P3I A;  4Z4W A;  4RDJ A;  4Z4U A;  4RDK A;  2ZL7 A;  4QVJ A;  3Q38 A;  3D26 A;  4P1V A;  4Z4Z A;  5E6T A;  3LQE A;  4X07 A;  4X05 A;  5IYP A;  4OPS A;  4RPD A;  3R6K A;  4OOX A;  3LQ6 A;  5J3O A;  5BSY A;  4ROX A;  3PVD A;  3SLD A;  3Q39 A;  2ZL5 A;  3SLN A;  4Z4V A;  5F4O A;  4X0C A;  4X7C A;  4OOS A;  4WZE A;  4X06 A;  3BY1 A;  3ASS A;  2OBS A;  3ONY A;  2ZL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...