4RPDA

Crystal structure of p domain of 485 norovirus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
302
structure length
302
Chain Sequence
SKPFTLPILTIGELSNSRFPAPIDELYTSPNEGLVVQPQNGRSTLDGELLGTTQLVPSNICSLRGRINAHLPDNQHRWNMQVTNANGTPFDPTEDVPAPLGTPDFLANIYGVTSQRNPDNTCRAHDGILATWSPKFTPKLGSVVLGTWEDRDFDINQPTRFTPVGLYDTDHFNQWALPNYSGALTLNMNLAPSVAPLFPGEQLLFFRSHIPLKGGTSNGAIDCLLPQEWVQHFYQESAPSSTDVALIRYTNPDTGRVLFEAKLHRQGFITVANSGSRPIVVPPNGYFRFDSWVNQFYSLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Constraints on Human Norovirus Binding to Histo-Blood Group Antigens.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
molecule keywords Capsid protein
total genus 71
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rpdA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rpdA01
3ASTA 5HZBA 5J35A 3BY2A 5E6TA 5J3OA 3ASQA 3V7AA 4RDLA 4RDKA 5IYRA 4WZLA 4RLZA 4Z4VA 4X7EA 4X07A 3BY1A 4Z4YA 3Q6RA 5F4OA 3ASPA 5IYQA 4Z4TA 4Z4ZA 5IYWA 3R6KA 4X0CA 3SLNA 3ONYA 5HZAA 4OOSA 4P3IA 3D26A 3PUMA 3SEJA 5IYPA 2ZL7A 2OBRA 3Q3AA 5F4JA 4QV2A 5BSYA 4X7CA 3LQEA 5F4MA 5KW9A 3SJPA 4RDJA 4OP7A 3ASSA 3SKBA 3BQJA 3Q38A 4P1VA 4OPOA 4Z4RA 4WZTA 1IHMA 4OPVA 4QVAA 3Q6QA 3PVDA 4Z4UA 2ZL6A 4WZEA 4Z4SA 4X06A 4P2NA 4OOXA 4X7DA 3LQ6A 4P25A 4X05A 4RPDA 4OOVA 3ONUA 4P12A 3PUNA 5IYNA 4QVJA 4ROXA 4P26A 4RPBA 2ZL5A 3Q39A 3RY8A 4RM0A 2OBSA 2OBTA 5BSXA 3R6JA 4WZKA 4Z4WA 3ASRA 4OPSA 4X7FA 3PA2A 3SLDA 3PA1A 4QUZA
chains in the Genus database with same CATH superfamily
1QVFB 3AVYA 2X6WA 2VBSA 5HZBA 4H9GA 1XQBA 3FPKA 3FKSA 3E1YE 5DSZA 2C2WA 3ISXA 4RDKA 5HXBA 4XLFA 2V7WA 3ZPNA 1F20A 2RC5A 4DK0A 4AVZA 1T5EA 1NBMA 1ZM9A 5HKKA 1FNDA 1KK1A 3G71B 2ZTGA 1E3XA 1B23P 4LBZA 2YWHA 4PC3A 1UD2A 2D74A 4Z4ZA 1S72B 5A89A 4XORA 1T6XA 2I1LA 1YX2A 3W2HA 2XEXA 4LBYA 1WP6A 4HIZA 4F7DA 1YJWB 4N3NA 2DIEA 3BCFA 1F60A 1SKQA 1XFOA 3OEHA 2BGIA 4XKWA 2OBRA 3Q3AA 4B44A 3LQEA 3AGQA 5TV2A 2JIZA 4ZCLA 1VQ6B 5GV7A 1WOPA 2YWGA 1QX4A 1KK3A 1ELOA 4B4DA 4ZGNB 2DOGA 1K28D 1UD5A 4P3YA 4DK1A 2WSSA 5FO1A 4KKUA 3Q38A 3OW2B 4RD2A 4YXWA 1OHHA 1WORA 4Z4RA 4ZV4A 1N0VC 3W5VA 1I8DA 3A8KA 1VLOA 1VHOA 4PC2A 1IHMA 5FA6A 4CQJA 1ZM2A 4QVAA 2GK6A 4B47A 3I56B 1VQPB 2LZJA 2JDIA 3G4SB 3GVJA 2WR8A 1V0FA 1JA1A 3ZZUA 3QFSA 3ONUA 3ZBUA 4P12A 1JA0A 2Z6BD 3GIRA 2V7XA 4XQFA 2VBTA 4ROXA 4XLAA 5EMNA 4P26A 1W87A 4BPRA 4M1KA 4G7XA 1D8TA 1PJ7A 3VR6A 4B48A 1OGIA 2VNIA 2ZL5A 5L46A 1GAWA 2OBSA 1WSRA 2E1RA 5GV8A 5H59A 3ZC3A 1H42A 2OBTA 5BSXA 1VQ7B 4WZKA 4Y7CA 1BJKA 1VJSA 3CXCB 1H85A 4TMZA 1VQ8B 3MMPA 3FPPA 2CK3A 1S0UA 4Y9RA 4J0QA 3SLDA 3PA2A 2ZXHA 4ZGQB 5A88A 1OB2A 3CCQB 3ASTA 2F4NA 2NPFA 3P27A 1W34A 3QE2A 1KZLA 2OTJB 1QUEA 2PMDA 1Y0YA 1CNEA 3BY2A 3G6EB 1HVXA 4MYUA 5E6TA 4RD1A 2BGJA 3AVVA 1COWA 1E3ZA 1VQKB 3ASQA 1OGJA 4RDLA 4X8IA 1R5BA 1UD6A 2C5BA 1EP2B 5IYRA 2D3NA 2XZLA 2KVOA 2R9VA 1FNBA 1FRQA 1TLLA 3AGPA 4WWVA 4Z4VA 1E1QA 3A1PA 4TKOB 2VBUA 4TMWA 4X07A 5TRDA 3I55B 1KRHA 3GQBA 3W5HA 3ASPA 4B3FX 1YITB 1T6YA 2HDNB 4K1XA 3R6KA 3H9NA 2GJRA 4P22A 4MYTA 4XLHA 3CCMB 1NB9A 3A8IA 3SLNA 4PC6A 3JQRA 3JU4A 3OJXA 4PC7A 1QG0A 4RD4A 4FK8A 4UAJA 1KMHA 3D26A 3P26A 4TSFA 1W2BB 4C43A 4G5GA 3I1FA 3WBKA 3HAGA 2F43A 1E63A 2CF4A 2ZXIA 3W2EA 1Q9SA 2X6YA 2F1LA 2FX3A 5BSYA 5F4MA 2D3LA 5KW9A 1K9MD 1E1RA 1W0JA 2BV3A 1B2RA 2CW5A 4Y9UA 4RDJA 1ZM4A 4OP7A 3H94A 2WJYA 4PC1A 4ZCIA 4U9UA 3OW7A 1JB9A 3GVLA 3BQJA 4RCZA 1BX0A 3V76A 1MRZA 3KL9A 1ZUNB 1EFCA 1G7SA 3CW2A 4HE6A 1CQXA 1V5VA 3LO8A 4WZTA 4ACAA 4OPVA 2CBXA 4PAAA 3W2IA 1VQ5B 3WQZA 3T56B 1N08A 2C77A 3G05A 1YJNB 3PVDA 1WPCA 5B6IA 4WZEA 3CCEB 2EIXA 4X06A 2QE7A 1YHQB 5FNZA 4DNRB 3OE7A 2OYNA 1FNCA 1NDHA 4P25A 2B5OA 4X05A 1WSVA 3OEEA 1QVGB 2GREA 4YAUA 3W2FA 1TTTA 1DDGA 1SM4A 2QMUA 3OZVA 1K73D 4XLCA 5IYNA 4YAFA 4QVJA 2ZITA 2FVGA 5A8AA 1FX0A 2JJ2A 4QHYA 3A3GA 1VQLB 3Q39A 1UD4A 1J9ZA 1EXMA 2F1MA 1FNMA 3OAAA 4XNFA 3SJZA 1EP1B 2V31A 3OP1A 3QFCA 5TR9A 3VO2A 4G1BA 3WNBA 2GK7A 2PIAA 2VZLA 2WZPP 4UZFA 1PJ6A 1H8HA 4FXUA 4QFMA 1G7RA 2VNHA 4N3GA 1QGYA 1KC8D 1I7PA 4M0LA 3OZUA 4LC0A 1R5NA 3B78A 1EP3B 4M2LA 1DDIA 2JN9A 4PGOA 3CC2B 3AVUA 3CP2A 1NRKA 1HZEA 1QFYA 4TN1A 1IJFA 4XR6A 1UMKA 2C78A 4X7EA 2C4TA 1IJEA 3A35A 1QH0A 3ZBTA 3BY1A 1RQPA 4AC9A 1K8AD 2XZPA 4AF6A 5FIUA 2ZBVA 5F4OA 2W6IA 3J81k 1G7CA 3WBJA 1JNYA 1VQ9B 2VJJA 2E1BA 1Q82D 5CDFA 1KK2A 1CNFA 2ZZQA 2X53S 4M53A 3CPXA 2BSAA 3SEJA 4L8JA 5IYPA 2BM1A 3U6KA 4YALA 4FWTA 3WXMA 2GQFA 2DY1A 1R5OA 4QV2A 1QGZA 1AMOA 2V7UA 1FRNA 4X7CA 5DS0A 3CCVB 5FL7A 1YLOA 1A8PA 1N8RD 2M5SA 2C4UA 1DARA 4XD7A 1E64A 1GO2A 3JQQA 2CNDA 3BCDA 3NE5B 3QSYA 3ASSA 1Q86D 2BPOA 3CMMA 2Q6LA 2VJIA 3SKBA 4ACBA 4ZCMA 3CTAA 5DN6A 3JQPA 3AVTA 4KKTA 2HCJB 4TT3A 2X8KA 3KEWA 2VNKA 1Y0RA 2V7VA 5JBQA 4ASUA 4DQLA 1E79A 1N0UA 1QUFA 3OOCA 3DDYA 5THXA 3Q6QA 2GJKA 5TY0A 1BX1A 2BVNA 1YIJB 4G7WA 5H5JA 4Z4SA 4P2NA 4OOXA 4B3XA 4X7DA 3GVKA 1QGAA 1D2EA 2V4DA 4OOVA 3OZWA 1N06A 4KKSA 2DETA 4LBWA 3PUNA 1AIPA 2X6XA 1I18A 2R6HA 2EFGA 3CCSB 2GJPA 2WZNA 1KK0A 4EH1A 5KSWB 4P6YA 1OB5A 3LVBA 2QA4B 2JJ1A 2XNDA 1UD8A 3OPOA 3RY8A 4RM0A 4IW3B 1OB0A 1DG1G 1BQEA 2CC2A 2XNJA 3R6JA 3AVXA 3VMFA 3ZZTA 4NBSA 4RCYA 2VNJA 2XZOA 1VF7A 2OTLB 1N07A 4WQMA 4Z4WA 1TUIA 4YELA 3ES9A 3PA1A 2PE3A 2B7BA 4QUZA 1KD1D 2WYRA 3CCJB 1YI2B 1M90D 2RC6A 1U2RA 3QFTA 1P4MA 4UZEA 5J35A 3WYAA 4JMQA 1BPLA 2BMWA 4XOTA 4Z1MA 5J3OA 3U2QA 4XN3A 2C5HA 3ZZ0A 1VLYA 3OKXA 2BF4A 1EWYA 4AF7A 4E0FA 1EFUA 3V7AA 2D9RA 4HE5A 2X3UA 2Q6IA 1W9XA 3PENA 2B7CA 4RLZA 4WZLA 4NCNA 1KQSB 4G1VA 1E62A 4XKVA 5FO0A 3AVWA 2VYQA 3QFRA 1EFRA 3B82A 4TMVA 2X85A 1VHEA 2Q6KA 2DYIA 4Z4YA 3BH4A 4YAWA 2WJVA 3Q6RA 1PJ5A 4B3GA 3MCAA 4Z4TA 5IYQA 5IYWA 3CCLB 3CD6B 2WPDA 2XNCA 3CC7B 4M4SA 3CPWB 1GVHA 3CMAB 4X0CA 4C0SA 1S4MA 1E43A 4XMYA 1QFZA 2QN6A 4II3A 2VBVA 3ONYA 5HZAA 2DCUA 4OOSA 3BC9A 1KJZA 4P3IA 1BMFA 3PUMA 2YWFA 3CMEB 1XE1A 1YJ9B 4R71A 1VQNB 3W5UA 4UZUA 1PKVA 2ZTNA 4PABA 3T51B 2ZL7A 1W0KA 4YAOA 2QGGA 1NJID 3BNWA 5F4JA 3VNVA 1FDRA 4RD6A 3SJPA 3WY9A 1WU8A 4LBVA 2W6JA 3CB4A 2HLDA 5LMZA 1BLIA 3E20A 2HMAA 2V7QA 3CC4B 2XGJA 4FN5A 2ZZEA 4RD3A 3WNDA 4B43A 1XB2A 2Q6OA 1WDTA 2QDXA 1D1NA 3ZIAA 4P1VA 4XL9A 1RQRA 2NV4A 5IK2A 4RD0A 2OK7A 3B8HA 4OPOA 1GAQA 1EFTA 1NB0A 2XOKA 3CCUB 3CP8A 3T53B 1GJRA 2QTLA 4XLEA 2QTZA 3MHPA 1Q81D 1V0EA 1G7TA 1W35A 4XM3A 2ZZFA 4II2A 3CCRB 3VNUA 2GPJA 2DEUA 4YHBA 4Z4UA 2ZL6A 2BM0A 3A8JA 3LNNA 3W2GA 1ZM3A 1WOOA 3OJWA 3LQ6A 4RJLA 1GR1A 4RPDA 2ZBUA 3GSIA 1WTHD 1VQMB 2OK8A 1UD3A 3OFNA 4Q7JB 3A3BA 4DNTB 5AN9A 1KTVA 2ZZGA 4DQKA 4P6VF 1T6ZA 2P3MA 3FJOA 5KNLA 4GQNA 1H8EA 3CRZA 3U6BA 2YWEA 2V7TA 3CESA 4RPBA 4XONA 2CRVA 3WNCA 2QEXB 1SKYB 2PLFA 4TMXA 4G6IA 1N05A 3VO1A 1JJ2B 1VQ4B 4XOPA 1Q7YD 1HA3A 3ZUGA 1WOSA 1MABA 2J7KA 2AHOA 2X0KA 1TVCA 4NNJA 1IB0A 4TMTA 1VQOB 2BN4A 1QFJA 3ASRA 4OPSA 2DERA 4P9SA 4X7FA 4XN0A 1M1KD 4YEJA
chains in the Genus database with same CATH topology
3ASTA 5HZBA 5J35A 3BY2A 5E6TA 5J3OA 3ASQA 3V7AA 4RDLA 4RDKA 5IYRA 4WZLA 4RLZA 4Z4VA 4X7EA 4X07A 3BY1A 4Z4YA 3Q6RA 5F4OA 3ASPA 5IYQA 4Z4TA 4Z4ZA 5IYWA 3R6KA 4X0CA 3SLNA 3ONYA 5HZAA 4OOSA 4P3IA 3D26A 3PUMA 3SEJA 5IYPA 2ZL7A 2OBRA 3Q3AA 5F4JA 4QV2A 5BSYA 4X7CA 3LQEA 5F4MA 5KW9A 3SJPA 4RDJA 4OP7A 3ASSA 3SKBA 3BQJA 3Q38A 4P1VA 4OPOA 4Z4RA 4WZTA 1IHMA 4OPVA 4QVAA 3Q6QA 3PVDA 4Z4UA 2ZL6A 4WZEA 4Z4SA 4X06A 4P2NA 4OOXA 4X7DA 3LQ6A 4P25A 4X05A 4RPDA 4OOVA 3ONUA 4P12A 3PUNA 5IYNA 4QVJA 4ROXA 4P26A 4RPBA 2ZL5A 3Q39A 3RY8A 4RM0A 2OBSA 2OBTA 5BSXA 3R6JA 4WZKA 4Z4WA 3ASRA 4OPSA 4X7FA 3PA2A 3SLDA 3PA1A 4QUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AST A;  5HZB A;  5J35 A;  3BY2 A;  5E6T A;  5J3O A;  3ASQ A;  3V7A A;  4RDL A;  4RDK A;  5IYR A;  4WZL A;  4RLZ A;  4Z4V A;  4X7E A;  4X07 A;  3BY1 A;  4Z4Y A;  3Q6R A;  5F4O A;  3ASP A;  5IYQ A;  4Z4T A;  4Z4Z A;  5IYW A;  3R6K A;  4X0C A;  3SLN A;  3ONY A;  5HZA A;  4OOS A;  4P3I A;  3D26 A;  3PUM A;  3SEJ A;  5IYP A;  2ZL7 A;  2OBR A;  3Q3A A;  5F4J A;  4QV2 A;  5BSY A;  4X7C A;  3LQE A;  5F4M A;  5KW9 A;  3SJP A;  4RDJ A;  4OP7 A;  3ASS A;  3SKB A;  3BQJ A;  3Q38 A;  4P1V A;  4OPO A;  4Z4R A;  4WZT A;  1IHM A;  4OPV A;  4QVA A;  3Q6Q A;  3PVD A;  4Z4U A;  2ZL6 A;  4WZE A;  4Z4S A;  4X06 A;  4P2N A;  4OOX A;  4X7D A;  3LQ6 A;  4P25 A;  4X05 A;  4RPD A;  4OOV A;  3ONU A;  4P12 A;  3PUN A;  5IYN A;  4QVJ A;  4ROX A;  4P26 A;  4RPB A;  2ZL5 A;  3Q39 A;  3RY8 A;  4RM0 A;  2OBS A;  2OBT A;  5BSX A;  3R6J A;  4WZK A;  4Z4W A;  3ASR A;  4OPS A;  4X7F A;  3PA2 A;  3SLD A;  3PA1 A;  4QUZ A; 
#chains in the Genus database with same CATH topology
 1QVF B;  3AVY A;  2X6W A;  2VBS A;  5HZB A;  4H9G A;  1XQB A;  3FPK A;  3FKS A;  3E1Y E;  5DSZ A;  2C2W A;  3ISX A;  4RDK A;  5HXB A;  4XLF A;  2V7W A;  3ZPN A;  1F20 A;  2RC5 A;  4DK0 A;  4AVZ A;  1T5E A;  1NBM A;  1ZM9 A;  5HKK A;  1FND A;  1KK1 A;  3G71 B;  2ZTG A;  1E3X A;  1B23 P;  4LBZ A;  2YWH A;  4PC3 A;  1UD2 A;  2D74 A;  4Z4Z A;  1S72 B;  5A89 A;  4XOR A;  1T6X A;  2I1L A;  1YX2 A;  3W2H A;  2XEX A;  4LBY A;  1WP6 A;  4HIZ A;  4F7D A;  1YJW B;  4N3N A;  2DIE A;  3BCF A;  1F60 A;  1SKQ A;  1XFO A;  3OEH A;  2BGI A;  4XKW A;  2OBR A;  3Q3A A;  4B44 A;  3LQE A;  3AGQ A;  5TV2 A;  2JIZ A;  4ZCL A;  1VQ6 B;  5GV7 A;  1WOP A;  2YWG A;  1QX4 A;  1KK3 A;  1ELO A;  4B4D A;  4ZGN B;  2DOG A;  1K28 D;  1UD5 A;  4P3Y A;  4DK1 A;  2WSS A;  5FO1 A;  4KKU A;  3Q38 A;  3OW2 B;  4RD2 A;  4YXW A;  1OHH A;  1WOR A;  4Z4R A;  4ZV4 A;  1N0V C;  3W5V A;  1I8D A;  3A8K A;  1VLO A;  1VHO A;  4PC2 A;  1IHM A;  5FA6 A;  4CQJ A;  1ZM2 A;  4QVA A;  2GK6 A;  4B47 A;  3I56 B;  1VQP B;  2LZJ A;  2JDI A;  3G4S B;  3GVJ A;  2WR8 A;  1V0F A;  1JA1 A;  3ZZU A;  3QFS A;  3ONU A;  3ZBU A;  4P12 A;  1JA0 A;  2Z6B D;  3GIR A;  2V7X A;  4XQF A;  2VBT A;  4ROX A;  4XLA A;  5EMN A;  4P26 A;  1W87 A;  4BPR A;  4M1K A;  4G7X A;  1D8T A;  1PJ7 A;  3VR6 A;  4B48 A;  1OGI A;  2VNI A;  2ZL5 A;  5L46 A;  1GAW A;  2OBS A;  1WSR A;  2E1R A;  5GV8 A;  5H59 A;  3ZC3 A;  1H42 A;  2OBT A;  5BSX A;  1VQ7 B;  4WZK A;  4Y7C A;  1BJK A;  1VJS A;  3CXC B;  1H85 A;  4TMZ A;  1VQ8 B;  3MMP A;  3FPP A;  2CK3 A;  1S0U A;  4Y9R A;  4J0Q A;  3SLD A;  3PA2 A;  2ZXH A;  4ZGQ B;  5A88 A;  1OB2 A;  3CCQ B;  3AST A;  2F4N A;  2NPF A;  3P27 A;  1W34 A;  3QE2 A;  1KZL A;  2OTJ B;  1QUE A;  2PMD A;  1Y0Y A;  1CNE A;  3BY2 A;  3G6E B;  1HVX A;  4MYU A;  5E6T A;  4RD1 A;  2BGJ A;  3AVV A;  1COW A;  1E3Z A;  1VQK B;  3ASQ A;  1OGJ A;  4RDL A;  4X8I A;  1R5B A;  1UD6 A;  2C5B A;  1EP2 B;  5IYR A;  2D3N A;  2XZL A;  2KVO A;  2R9V A;  1FNB A;  1FRQ A;  1TLL A;  3AGP A;  4WWV A;  4Z4V A;  1E1Q A;  3A1P A;  4TKO B;  2VBU A;  4TMW A;  4X07 A;  5TRD A;  3I55 B;  1KRH A;  3GQB A;  3W5H A;  3ASP A;  4B3F X;  1YIT B;  1T6Y A;  2HDN B;  4K1X A;  3R6K A;  3H9N A;  2GJR A;  4P22 A;  4MYT A;  4XLH A;  3CCM B;  1NB9 A;  3A8I A;  3SLN A;  4PC6 A;  3JQR A;  3JU4 A;  3OJX A;  4PC7 A;  1QG0 A;  4RD4 A;  4FK8 A;  4UAJ A;  1KMH A;  3D26 A;  3P26 A;  4TSF A;  1W2B B;  4C43 A;  4G5G A;  3I1F A;  3WBK A;  3HAG A;  2F43 A;  1E63 A;  2CF4 A;  2ZXI A;  3W2E A;  1Q9S A;  2X6Y A;  2F1L A;  2FX3 A;  5BSY A;  5F4M A;  2D3L A;  5KW9 A;  1K9M D;  1E1R A;  1W0J A;  2BV3 A;  1B2R A;  2CW5 A;  4Y9U A;  4RDJ A;  1ZM4 A;  4OP7 A;  3H94 A;  2WJY A;  4PC1 A;  4ZCI A;  4U9U A;  3OW7 A;  1JB9 A;  3GVL A;  3BQJ A;  4RCZ A;  1BX0 A;  3V76 A;  1MRZ A;  3KL9 A;  1ZUN B;  1EFC A;  1G7S A;  3CW2 A;  4HE6 A;  1CQX A;  1V5V A;  3LO8 A;  4WZT A;  4ACA A;  4OPV A;  2CBX A;  4PAA A;  3W2I A;  1VQ5 B;  3WQZ A;  3T56 B;  1N08 A;  2C77 A;  3G05 A;  1YJN B;  3PVD A;  1WPC A;  5B6I A;  4WZE A;  3CCE B;  2EIX A;  4X06 A;  2QE7 A;  1YHQ B;  5FNZ A;  4DNR B;  3OE7 A;  2OYN A;  1FNC A;  1NDH A;  4P25 A;  2B5O A;  4X05 A;  1WSV A;  3OEE A;  1QVG B;  2GRE A;  4YAU A;  3W2F A;  1TTT A;  1DDG A;  1SM4 A;  2QMU A;  3OZV A;  1K73 D;  4XLC A;  5IYN A;  4YAF A;  4QVJ A;  2ZIT A;  2FVG A;  5A8A A;  1FX0 A;  2JJ2 A;  4QHY A;  3A3G A;  1VQL B;  3Q39 A;  1UD4 A;  1J9Z A;  1EXM A;  2F1M A;  1FNM A;  3OAA A;  4XNF A;  3SJZ A;  1EP1 B;  2V31 A;  3OP1 A;  3QFC A;  5TR9 A;  3VO2 A;  4G1B A;  3WNB A;  2GK7 A;  2PIA A;  2VZL A;  2WZP P;  4UZF A;  1PJ6 A;  1H8H A;  4FXU A;  4QFM A;  1G7R A;  2VNH A;  4N3G A;  1QGY A;  1KC8 D;  1I7P A;  4M0L A;  3OZU A;  4LC0 A;  1R5N A;  3B78 A;  1EP3 B;  4M2L A;  1DDI A;  2JN9 A;  4PGO A;  3CC2 B;  3AVU A;  3CP2 A;  1NRK A;  1HZE A;  1QFY A;  4TN1 A;  1IJF A;  4XR6 A;  1UMK A;  2C78 A;  4X7E A;  2C4T A;  1IJE A;  3A35 A;  1QH0 A;  3ZBT A;  3BY1 A;  1RQP A;  4AC9 A;  1K8A D;  2XZP A;  4AF6 A;  5FIU A;  2ZBV A;  5F4O A;  2W6I A;  3J81 k;  1G7C A;  3WBJ A;  1JNY A;  1VQ9 B;  2VJJ A;  2E1B A;  1Q82 D;  5CDF A;  1KK2 A;  1CNF A;  2ZZQ A;  2X53 S;  4M53 A;  3CPX A;  2BSA A;  3SEJ A;  4L8J A;  5IYP A;  2BM1 A;  3U6K A;  4YAL A;  4FWT A;  3WXM A;  2GQF A;  2DY1 A;  1R5O A;  4QV2 A;  1QGZ A;  1AMO A;  2V7U A;  1FRN A;  4X7C A;  5DS0 A;  3CCV B;  5FL7 A;  1YLO A;  1A8P A;  1N8R D;  2M5S A;  2C4U A;  1DAR A;  4XD7 A;  1E64 A;  1GO2 A;  3JQQ A;  2CND A;  3BCD A;  3NE5 B;  3QSY A;  3ASS A;  1Q86 D;  2BPO A;  3CMM A;  2Q6L A;  2VJI A;  3SKB A;  4ACB A;  4ZCM A;  3CTA A;  5DN6 A;  3JQP A;  3AVT A;  4KKT A;  2HCJ B;  4TT3 A;  2X8K A;  3KEW A;  2VNK A;  1Y0R A;  2V7V A;  5JBQ A;  4ASU A;  4DQL A;  1E79 A;  1N0U A;  1QUF A;  3OOC A;  3DDY A;  5THX A;  3Q6Q A;  2GJK A;  5TY0 A;  1BX1 A;  2BVN A;  1YIJ B;  4G7W A;  5H5J A;  4Z4S A;  4P2N A;  4OOX A;  4B3X A;  4X7D A;  3GVK A;  1QGA A;  1D2E A;  2V4D A;  4OOV A;  3OZW A;  1N06 A;  4KKS A;  2DET A;  4LBW A;  3PUN A;  1AIP A;  2X6X A;  1I18 A;  2R6H A;  2EFG A;  3CCS B;  2GJP A;  2WZN A;  1KK0 A;  4EH1 A;  5KSW B;  4P6Y A;  1OB5 A;  3LVB A;  2QA4 B;  2JJ1 A;  2XND A;  1UD8 A;  3OPO A;  3RY8 A;  4RM0 A;  4IW3 B;  1OB0 A;  1DG1 G;  1BQE A;  2CC2 A;  2XNJ A;  3R6J A;  3AVX A;  3VMF A;  3ZZT A;  4NBS A;  4RCY A;  2VNJ A;  2XZO A;  1VF7 A;  2OTL B;  1N07 A;  4WQM A;  4Z4W A;  1TUI A;  4YEL A;  3ES9 A;  3PA1 A;  2PE3 A;  2B7B A;  4QUZ A;  1KD1 D;  2WYR A;  3CCJ B;  1YI2 B;  1M90 D;  2RC6 A;  1U2R A;  3QFT A;  1P4M A;  4UZE A;  5J35 A;  3WYA A;  4JMQ A;  1BPL A;  2BMW A;  4XOT A;  4Z1M A;  5J3O A;  3U2Q A;  4XN3 A;  2C5H A;  3ZZ0 A;  1VLY A;  3OKX A;  2BF4 A;  1EWY A;  4AF7 A;  4E0F A;  1EFU A;  3V7A A;  2D9R A;  4HE5 A;  2X3U A;  2Q6I A;  1W9X A;  3PEN A;  2B7C A;  4RLZ A;  4WZL A;  4NCN A;  1KQS B;  4G1V A;  1E62 A;  4XKV A;  5FO0 A;  3AVW A;  2VYQ A;  3QFR A;  1EFR A;  3B82 A;  4TMV A;  2X85 A;  1VHE A;  2Q6K A;  2DYI A;  4Z4Y A;  3BH4 A;  4YAW A;  2WJV A;  3Q6R A;  1PJ5 A;  4B3G A;  3MCA A;  4Z4T A;  5IYQ A;  5IYW A;  3CCL B;  3CD6 B;  2WPD A;  2XNC A;  3CC7 B;  4M4S A;  3CPW B;  1GVH A;  3CMA B;  4X0C A;  4C0S A;  1S4M A;  1E43 A;  4XMY A;  1QFZ A;  2QN6 A;  4II3 A;  2VBV A;  3ONY A;  5HZA A;  2DCU A;  4OOS A;  3BC9 A;  1KJZ A;  4P3I A;  1BMF A;  3PUM A;  2YWF A;  3CME B;  1XE1 A;  1YJ9 B;  4R71 A;  1VQN B;  3W5U A;  4UZU A;  1PKV A;  2ZTN A;  4PAB A;  3T51 B;  2ZL7 A;  1W0K A;  4YAO A;  2QGG A;  1NJI D;  3BNW A;  5F4J A;  3VNV A;  1FDR A;  4RD6 A;  3SJP A;  3WY9 A;  1WU8 A;  4LBV A;  2W6J A;  3CB4 A;  2HLD A;  5LMZ A;  1BLI A;  3E20 A;  2HMA A;  2V7Q A;  3CC4 B;  2XGJ A;  4FN5 A;  2ZZE A;  4RD3 A;  3WND A;  4B43 A;  1XB2 A;  2Q6O A;  1WDT A;  2QDX A;  1D1N A;  3ZIA A;  4P1V A;  4XL9 A;  1RQR A;  2NV4 A;  5IK2 A;  4RD0 A;  2OK7 A;  3B8H A;  4OPO A;  1GAQ A;  1EFT A;  1NB0 A;  2XOK A;  3CCU B;  3CP8 A;  3T53 B;  1GJR A;  2QTL A;  4XLE A;  2QTZ A;  3MHP A;  1Q81 D;  1V0E A;  1G7T A;  1W35 A;  4XM3 A;  2ZZF A;  4II2 A;  3CCR B;  3VNU A;  2GPJ A;  2DEU A;  4YHB A;  4Z4U A;  2ZL6 A;  2BM0 A;  3A8J A;  3LNN A;  3W2G A;  1ZM3 A;  1WOO A;  3OJW A;  3LQ6 A;  4RJL A;  1GR1 A;  4RPD A;  2ZBU A;  3GSI A;  1WTH D;  1VQM B;  2OK8 A;  1UD3 A;  3OFN A;  4Q7J B;  3A3B A;  4DNT B;  5AN9 A;  1KTV A;  2ZZG A;  4DQK A;  4P6V F;  1T6Z A;  2P3M A;  3FJO A;  5KNL A;  4GQN A;  1H8E A;  3CRZ A;  3U6B A;  2YWE A;  2V7T A;  3CES A;  4RPB A;  4XON A;  2CRV A;  3WNC A;  2QEX B;  1SKY B;  2PLF A;  4TMX A;  4G6I A;  1N05 A;  3VO1 A;  1JJ2 B;  1VQ4 B;  4XOP A;  1Q7Y D;  1HA3 A;  3ZUG A;  1WOS A;  1MAB A;  2J7K A;  2AHO A;  2X0K A;  1TVC A;  4NNJ A;  1IB0 A;  4TMT A;  1VQO B;  2BN4 A;  1QFJ A;  3ASR A;  4OPS A;  2DER A;  4P9S A;  4X7F A;  4XN0 A;  1M1K D;  4YEJ A; 
#chains in the Genus database with same CATH homology
 3AST A;  5HZB A;  5J35 A;  3BY2 A;  5E6T A;  5J3O A;  3ASQ A;  3V7A A;  4RDL A;  4RDK A;  5IYR A;  4WZL A;  4RLZ A;  4Z4V A;  4X7E A;  4X07 A;  3BY1 A;  4Z4Y A;  3Q6R A;  5F4O A;  3ASP A;  5IYQ A;  4Z4T A;  4Z4Z A;  5IYW A;  3R6K A;  4X0C A;  3SLN A;  3ONY A;  5HZA A;  4OOS A;  4P3I A;  3D26 A;  3PUM A;  3SEJ A;  5IYP A;  2ZL7 A;  2OBR A;  3Q3A A;  5F4J A;  4QV2 A;  5BSY A;  4X7C A;  3LQE A;  5F4M A;  5KW9 A;  3SJP A;  4RDJ A;  4OP7 A;  3ASS A;  3SKB A;  3BQJ A;  3Q38 A;  4P1V A;  4OPO A;  4Z4R A;  4WZT A;  1IHM A;  4OPV A;  4QVA A;  3Q6Q A;  3PVD A;  4Z4U A;  2ZL6 A;  4WZE A;  4Z4S A;  4X06 A;  4P2N A;  4OOX A;  4X7D A;  3LQ6 A;  4P25 A;  4X05 A;  4RPD A;  4OOV A;  3ONU A;  4P12 A;  3PUN A;  5IYN A;  4QVJ A;  4ROX A;  4P26 A;  4RPB A;  2ZL5 A;  3Q39 A;  3RY8 A;  4RM0 A;  2OBS A;  2OBT A;  5BSX A;  3R6J A;  4WZK A;  4Z4W A;  3ASR A;  4OPS A;  4X7F A;  3PA2 A;  3SLD A;  3PA1 A;  4QUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...