5IYRA

Protruding domain of gii.4 human norovirus chdc2094 in complex with 2-fucosyllactose (2'fl)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
305
structure length
303
Chain Sequence
KPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTTQLSAVNICNFRGDVTRVGISHDYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGLLTQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDGHQNEPQQWVLPNYSGTSGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDCLLPQEWVSHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVIPPNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for GII.4 norovirus inhibition by human milk oligosaccharides.
rcsb
source organism Norovirus hu/gii.4/chdc2094/1974/us
molecule tags Viral protein
molecule keywords GII.4 norovirus CHDC2094 capsid
total genus 68
structure length 303
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5iyrA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5iyrA01
5F4JA 3ONYA 4WZLA 3ASRA 3Q39A 3PA1A 3BY1A 4WZTA 4P12A 4OPSA 4Z4TA 4X05A 4X7EA 3D26A 3RY8A 4RM0A 3PUNA 2ZL5A 3PUMA 5BSYA 3R6JA 3SKBA 5E6TA 4QVJA 3SEJA 3V7AA 4Z4SA 3ASPA 4ROXA 5F4OA 5BSXA 4X7DA 3ASQA 5J35A 3R6KA 3Q3AA 3SLNA 5IYQA 4X7CA 4WZKA 4QV2A 5J3OA 2OBSA 3BY2A 4Z4ZA 1IHMA 4P1VA 3Q6RA 3SJPA 4QUZA 2OBRA 5HZAA 3BQJA 4OPVA 4OP7A 4OOSA 4OPOA 5IYWA 4Z4YA 3Q38A 4RPDA 3SLDA 5IYPA 3LQEA 5IYRA 4RLZA 3Q6QA 4RDJA 4Z4WA 4X06A 5HZBA 4X7FA 4WZEA 4OOVA 5KW9A 4QVAA 4P2NA 4P26A 3ASSA 4Z4UA 4OOXA 3LQ6A 2OBTA 4P25A 5IYNA 4Z4RA 3ONUA 4Z4VA 4X0CA 3ASTA 3PA2A 4X07A 2ZL6A 5F4MA 4RDKA 2ZL7A 4P3IA 4RPBA 4RDLA 3PVDA
chains in the Genus database with same CATH superfamily
4EH1A 1CNFA 1UD8A 1WTHD 2VZLA 1E43A 1QGYA 3OOCA 1IB0A 4B3XA 4AF7A 1QGAA 1PJ6A 2M5SA 2KVOA 4XOPA 1KK3A 5THXA 2DETA 2GK6A 4Z4TA 4QFMA 4TMZA 1D2EA 4X7EA 1T6ZA 2BM1A 3QFTA 1I8DA 1V0FA 1H85A 4DQKA 3RY8A 3T56B 1BJKA 1Q82D 2HCJB 3MCAA 4TKOB 2V7WA 1SM4A 4RM0A 3KEWA 3A8JA 1WP6A 3PUNA 5CDFA 1JNYA 2ZL5A 2ZZGA 3JQPA 3R6JA 3CXCB 1Q86D 3SKBA 4ACBA 3V7AA 3AVWA 4ZCLA 3WXMA 1QX4A 1M90D 4Z4SA 3ASPA 5BSXA 5F4OA 1QVFB 4RJLA 3LNNA 1BPLA 2R6HA 2V7XA 3ASQA 4PABA 3ZZ0A 3CD6B 2HLDA 1N08A 1SKYB 4B47A 4P6VF 4WQMA 1SKQA 1R5OA 1QG0A 2BPOA 2QE7A 4QV2A 2OBSA 1G7SA 2QDXA 3BY2A 4DNTB 4Z4ZA 4B44A 2HDNB 1N8RD 2QTZA 4NBSA 3AVYA 4KKSA 3SJPA 1W2BB 4LBZA 2Z6BD 4FWTA 3MHPA 3BQJA 1GO2A 4OP7A 1KK2A 2YWFA 1GAWA 1N07A 2WJYA 4LBYA 2NV4A 1JA1A 1UD2A 2XGJA 2V4DA 3U6BA 1F60A 1N0UA 1GVHA 2ZTGA 2BGJA 2WZNA 1IJFA 1Q9SA 4TMXA 3LQEA 1WSVA 2F43A 3WY9A 4Y9UA 1N06A 3B8HA 1H8EA 1QFZA 3AVXA 4DQLA 1HZEA 4RD0A 1G7RA 4RLZA 4RDJA 1DDIA 2VBSA 3SJZA 1OGIA 1VQNB 1KK1A 4X7FA 1NB0A 2QTLA 1FNMA 4XORA 1KJZA 5KW9A 2DEUA 5A88A 2GQFA 3FPKA 4K1XA 3ASSA 5L46A 1JB9A 1QGZA 3W5VA 4U9UA 2CNDA 4OOXA 2QMUA 3W2HA 1YIJB 3GIRA 3CESA 2ZZEA 2PIAA 1J9ZA 3GQBA 1QFYA 1MRZA 4TMTA 4XKWA 3ZPNA 2VJJA 1CNEA 2X85A 2DOGA 3OP1A 4X0CA 3CB4A 1W9XA 2V7UA 2VJIA 1NRKA 1GAQA 3E20A 3AVUA 4YAWA 1VQKB 3I1FA 3JU4A 4P3IA 4ACAA 3ZC3A 3ZZUA 4XLHA 4RPBA 1YX2A 4R71A 3CCJB 4E0FA 4ZCIA 1VQ6B 3JQQA 4LBWA 2CK3A 4XLCA 4Y9RA 1XFOA 4QHYA 4G1VA 4RCZA 1OHHA 3E1YE 4L8JA 4PC7A 4M2LA 3QFCA 4RD1A 3W5UA 3NE5B 2ZZQA 1YJ9B 1W34A 1CQXA 2CW5A 4UAJA 4YHBA 4RD2A 2V7VA 2BGIA 5IK2A 2ZBUA 1I18A 2F4NA 2XEXA 3CPXA 3OW7A 2GJPA 5FNZA 1T6XA 1VQ8B 2NPFA 5AN9A 5E6TA 4HIZA 4XOTA 4FN5A 1ZM3A 2B7BA 4XN0A 4X7DA 4XL9A 1KMHA 2C4TA 2GJKA 5H5JA 1VLOA 3Q3AA 3CCLB 1DG1G 4PC2A 2C5BA 4YAUA 2C77A 4X7CA 2QA4B 1GJRA 4WZKA 2BM0A 1KC8D 1FNCA 1FRQA 1K28D 2LZJA 4P1VA 2V7TA 3OE7A 1VQLB 2JJ2A 1YLOA 3AVVA 1W0JA 1B23P 3ES9A 4RCYA 5GV8A 3W2EA 2XOKA 2V31A 4II3A 5HZAA 3CMMA 1RQPA 2PMDA 4OOSA 3WNCA 3A1PA 4YAFA 3JQRA 5DS0A 4J0QA 2CC2A 4TMWA 5TV2A 2QEXB 1YJNB 2EFGA 1P4MA 1WOOA 1W35A 3SLDA 3T53B 3CCEB 1UD3A 4DK1A 5IYPA 2XZLA 3A8IA 4DK0A 1COWA 1K8AD 5A89A 1E79A 2QGGA 1PJ7A 1UD5A 1EFTA 2BMWA 4MYTA 4Z4WA 3AVTA 4X06A 1TLLA 2GJRA 2JIZA 4B3FX 4WZEA 1UMKA 1I7PA 4B43A 4P2NA 4N3GA 3OPOA 3BNWA 4PC1A 4XONA 1UD6A 4TN1A 5FIUA 2WJVA 2DCUA 1S0UA 3GVJA 3WBJA 4P22A 4P9SA 2V7QA 4NNJA 2D3NA 1WSRA 1PKVA 3ISXA 2D9RA 4Z1MA 1F20A 3OW2B 1WU8A 2JN9A 4BPRA 2W6JA 1D1NA 4G5GA 1U2RA 2OBTA 1FDRA 2B5OA 2OYNA 2PE3A 4Z4RA 4X8IA 3PA2A 4P6YA 2XNJA 5F4MA 4CQJA 4HE5A 3VO2A 4C43A 1RQRA 3VMFA 3HAGA 3WNDA 1S72B 3H94A 2C2WA 1DARA 2F1LA 5DSZA 2XZOA 4XKVA 3CP8A 2BF4A 4ZGQB 4II2A 3OFNA 1OGJA 4M0LA 4B48A 1VQ4B 1KQSB 1EFCA 1AMOA 1W0KA 3PVDA 3DDYA 4G6IA 3QE2A 4WZLA 3ASRA 4AC9A 3G71B 4KKTA 3CMAB 3Q39A 1EP2B 2I1LA 3BY1A 4YAOA 2JDIA 1JA0A 2Q6OA 2E1RA 4P12A 4OPSA 3A3GA 4XMYA 4XNFA 2F1MA 4RD4A 4X05A 2OTJB 3FJOA 1EP1B 3P26A 1N0VC 1G7CA 3D26A 2XNDA 4UZFA 1T5EA 3G05A 3CCRB 4YXWA 5B6IA 1BX1A 1HA3A 5FA6A 2DERA 2X0KA 2QN6A 3AGQA 3PUMA 3BCFA 4XQFA 2X3UA 3SEJA 4HE6A 1VJSA 4AF6A 4ROXA 1KTVA 5FO1A 2VNIA 4M4SA 3CC2B 3VO1A 5J35A 5HKKA 3B78A 4TSFA 2ZTNA 3SLNA 3W2IA 1ZM9A 5IYQA 1TUIA 3U6KA 1Y0RA 1FX0A 3CCUB 2YWEA 5J3OA 2CF4A 1IHMA 3G6EB 2AHOA 3Q6RA 4ZV4A 1BX0A 5KNLA 2VNKA 2WSSA 3H9NA 1OB0A 3OEHA 2BSAA 4OPVA 2VBVA 3I55B 3LVBA 4YEJA 3A35A 5TRDA 1M1KD 2C4UA 1WDTA 3OZWA 3AGPA 4M1KA 1QFJA 3WBKA 2X53S 1Y0YA 2HMAA 4FXUA 3P27A 3OKXA 1N05A 3CCVB 2DIEA 4RPDA 1ELOA 2VNHA 4G7WA 2J7KA 4WWVA 2B7CA 2C78A 5EMNA 1YJWB 5IYRA 2X6YA 3WQZA 3GVLA 1JJ2B 3Q6QA 2X6WA 1B2RA 5HZBA 2XZPA 2JJ1A 3ZIAA 1YI2B 4OOVA 4RD3A 2X8KA 2DYIA 2VBUA 2X6XA 4QVAA 1E3XA 1ZUNB 1K73D 1XB2A 1Q81D 4Z4UA 1EWYA 2EIXA 1BMFA 3GSIA 5TY0A 3CCSB 3LQ6A 4LBVA 1A8PA 3CCQB 4P25A 4XN3A 3BC9A 1R5BA 4TMVA 2DY1A 3ASTA 1MABA 2BV3A 3V76A 4PC3A 4X07A 2ZL6A 3LO8A 1R5NA 1KD1D 5TR9A 1E3ZA 4PAAA 2WR8A 4RDKA 2OK7A 1BLIA 1QUEA 4ASUA 1VQMB 1S4MA 2BN4A 4M53A 1QVGB 1BQEA 4YELA 1WOSA 1H8HA 2ZITA 1E1RA 4C0SA 5FO0A 2FX3A 1WOPA 4MYUA 1VQ5B 3I56B 1E62A 4RDLA 4P3YA 4Y7CA 2R9VA 2RC6A 3GVKA 1EP3B 5F4JA 3ONYA 1D8TA 5H59A 1VQ9B 5FL7A 2Q6LA 1H42A 2OTLB 3PA1A 1NBMA 2RC5A 5A8AA 5KSWB 3A3BA 3FKSA 4WZTA 1OB5A 4LC0A 1TTTA 2D74A 2PLFA 5GV7A 1W87A 4Q7JB 2WYRA 2W6IA 2WZPP 3OZUA 1KRHA 3CTAA 3MMPA 2YWGA 3VNVA 1PJ5A 2OK8A 1TVCA 4G1BA 4XLEA 3ZBTA 5BSYA 2VBTA 2WPDA 3KL9A 3ZZTA 4QVJA 1OB2A 3G4SB 1K9MD 1XQBA 3OZVA 1FNDA 3W2GA 1FNBA 2BVNA 3CCMB 3U2QA 3R6KA 1Q7YD 2GPJA 1FRNA 3VNUA 1EXMA 2GREA 4ZGNB 3OAAA 1KK0A 1DDGA 2GK7A 1EFUA 4UZEA 1T6YA 1E63A 3QFRA 4XLAA 4XLFA 3CC4B 3BH4A 4ZCMA 1QH0A 4QUZA 4FK8A 3VR6A 2OBRA 2C5HA 3J81k 4PC6A 1IJEA 2Q6IA 4OPOA 5IYWA 4AVZA 2D3LA 4Z4YA 1VLYA 1EFRA 2E1BA 3Q38A 3PENA 1VHEA 4JMQA 5JBQA 2ZXHA 1G7TA 4N3NA 3WYAA 4XR6A 1KZLA 4IW3B 2ZBVA 3ZBUA 4YALA 4GQNA 3CP2A 1VQ7B 1NJID 1YHQB 3CPWB 1VQPB 1VHOA 2VNJA 4NCNA 3T51B 4B3GA 1V5VA 2CBXA 3OJXA 3OJWA 1ZM4A 3ZUGA 1AIPA 1XE1A 4P26A 4KKUA 1UD4A 3B82A 3CW2A 1QUFA 3W2FA 3CRZA 1GR1A 4H9GA 3CMEB 2ZZFA 1ZM2A 2YWHA 1YITB 4DNRB 1V0EA 2VYQA 3QFSA 3A8KA 3W5HA 5IYNA 4RD6A 4PGOA 3QSYA 3ONUA 4Z4VA 4UZUA 1WORA 2CRVA 4B4DA 2FVGA 5LMZA 1HVXA 2XNCA 2ZL7A 3FPPA 1E1QA 1VF7A 3CC7B 1NB9A 2Q6KA 4F7DA 1NDHA 3OEEA 4TT3A 4XM3A 3WNBA 1VQOB 1E64A 4G7XA 3BCDA 4XD7A 1WPCA 5DN6A 2P3MA 5HXBA 2ZXIA
chains in the Genus database with same CATH topology
5F4JA 3ONYA 4WZLA 3ASRA 3Q39A 3PA1A 3BY1A 4WZTA 4P12A 4OPSA 4Z4TA 4X05A 4X7EA 3D26A 3RY8A 4RM0A 3PUNA 2ZL5A 3PUMA 5BSYA 3R6JA 3SKBA 5E6TA 4QVJA 3SEJA 3V7AA 4Z4SA 3ASPA 4ROXA 5F4OA 5BSXA 4X7DA 3ASQA 5J35A 3R6KA 3Q3AA 3SLNA 5IYQA 4X7CA 4WZKA 4QV2A 5J3OA 2OBSA 3BY2A 4Z4ZA 1IHMA 4P1VA 3Q6RA 3SJPA 4QUZA 2OBRA 5HZAA 3BQJA 4OPVA 4OP7A 4OOSA 4OPOA 5IYWA 4Z4YA 3Q38A 4RPDA 3SLDA 5IYPA 3LQEA 5IYRA 4RLZA 3Q6QA 4RDJA 4Z4WA 4X06A 5HZBA 4X7FA 4WZEA 4OOVA 5KW9A 4QVAA 4P2NA 4P26A 3ASSA 4Z4UA 4OOXA 3LQ6A 2OBTA 4P25A 5IYNA 4Z4RA 3ONUA 4Z4VA 4X0CA 3ASTA 3PA2A 4X07A 2ZL6A 5F4MA 4RDKA 2ZL7A 4P3IA 4RPBA 4RDLA 3PVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F4J A;  3ONY A;  4WZL A;  3ASR A;  3Q39 A;  3PA1 A;  3BY1 A;  4WZT A;  4P12 A;  4OPS A;  4Z4T A;  4X05 A;  4X7E A;  3D26 A;  3RY8 A;  4RM0 A;  3PUN A;  2ZL5 A;  3PUM A;  5BSY A;  3R6J A;  3SKB A;  5E6T A;  4QVJ A;  3SEJ A;  3V7A A;  4Z4S A;  3ASP A;  4ROX A;  5F4O A;  5BSX A;  4X7D A;  3ASQ A;  5J35 A;  3R6K A;  3Q3A A;  3SLN A;  5IYQ A;  4X7C A;  4WZK A;  4QV2 A;  5J3O A;  2OBS A;  3BY2 A;  4Z4Z A;  1IHM A;  4P1V A;  3Q6R A;  3SJP A;  4QUZ A;  2OBR A;  5HZA A;  3BQJ A;  4OPV A;  4OP7 A;  4OOS A;  4OPO A;  5IYW A;  4Z4Y A;  3Q38 A;  4RPD A;  3SLD A;  5IYP A;  3LQE A;  5IYR A;  4RLZ A;  3Q6Q A;  4RDJ A;  4Z4W A;  4X06 A;  5HZB A;  4X7F A;  4WZE A;  4OOV A;  5KW9 A;  4QVA A;  4P2N A;  4P26 A;  3ASS A;  4Z4U A;  4OOX A;  3LQ6 A;  2OBT A;  4P25 A;  5IYN A;  4Z4R A;  3ONU A;  4Z4V A;  4X0C A;  3AST A;  3PA2 A;  4X07 A;  2ZL6 A;  5F4M A;  4RDK A;  2ZL7 A;  4P3I A;  4RPB A;  4RDL A;  3PVD A; 
#chains in the Genus database with same CATH topology
 4EH1 A;  1CNF A;  1UD8 A;  1WTH D;  2VZL A;  1E43 A;  1QGY A;  3OOC A;  1IB0 A;  4B3X A;  4AF7 A;  1QGA A;  1PJ6 A;  2M5S A;  2KVO A;  4XOP A;  1KK3 A;  5THX A;  2DET A;  2GK6 A;  4Z4T A;  4QFM A;  4TMZ A;  1D2E A;  4X7E A;  1T6Z A;  2BM1 A;  3QFT A;  1I8D A;  1V0F A;  1H85 A;  4DQK A;  3RY8 A;  3T56 B;  1BJK A;  1Q82 D;  2HCJ B;  3MCA A;  4TKO B;  2V7W A;  1SM4 A;  4RM0 A;  3KEW A;  3A8J A;  1WP6 A;  3PUN A;  5CDF A;  1JNY A;  2ZL5 A;  2ZZG A;  3JQP A;  3R6J A;  3CXC B;  1Q86 D;  3SKB A;  4ACB A;  3V7A A;  3AVW A;  4ZCL A;  3WXM A;  1QX4 A;  1M90 D;  4Z4S A;  3ASP A;  5BSX A;  5F4O A;  1QVF B;  4RJL A;  3LNN A;  1BPL A;  2R6H A;  2V7X A;  3ASQ A;  4PAB A;  3ZZ0 A;  3CD6 B;  2HLD A;  1N08 A;  1SKY B;  4B47 A;  4P6V F;  4WQM A;  1SKQ A;  1R5O A;  1QG0 A;  2BPO A;  2QE7 A;  4QV2 A;  2OBS A;  1G7S A;  2QDX A;  3BY2 A;  4DNT B;  4Z4Z A;  4B44 A;  2HDN B;  1N8R D;  2QTZ A;  4NBS A;  3AVY A;  4KKS A;  3SJP A;  1W2B B;  4LBZ A;  2Z6B D;  4FWT A;  3MHP A;  3BQJ A;  1GO2 A;  4OP7 A;  1KK2 A;  2YWF A;  1GAW A;  1N07 A;  2WJY A;  4LBY A;  2NV4 A;  1JA1 A;  1UD2 A;  2XGJ A;  2V4D A;  3U6B A;  1F60 A;  1N0U A;  1GVH A;  2ZTG A;  2BGJ A;  2WZN A;  1IJF A;  1Q9S A;  4TMX A;  3LQE A;  1WSV A;  2F43 A;  3WY9 A;  4Y9U A;  1N06 A;  3B8H A;  1H8E A;  1QFZ A;  3AVX A;  4DQL A;  1HZE A;  4RD0 A;  1G7R A;  4RLZ A;  4RDJ A;  1DDI A;  2VBS A;  3SJZ A;  1OGI A;  1VQN B;  1KK1 A;  4X7F A;  1NB0 A;  2QTL A;  1FNM A;  4XOR A;  1KJZ A;  5KW9 A;  2DEU A;  5A88 A;  2GQF A;  3FPK A;  4K1X A;  3ASS A;  5L46 A;  1JB9 A;  1QGZ A;  3W5V A;  4U9U A;  2CND A;  4OOX A;  2QMU A;  3W2H A;  1YIJ B;  3GIR A;  3CES A;  2ZZE A;  2PIA A;  1J9Z A;  3GQB A;  1QFY A;  1MRZ A;  4TMT A;  4XKW A;  3ZPN A;  2VJJ A;  1CNE A;  2X85 A;  2DOG A;  3OP1 A;  4X0C A;  3CB4 A;  1W9X A;  2V7U A;  2VJI A;  1NRK A;  1GAQ A;  3E20 A;  3AVU A;  4YAW A;  1VQK B;  3I1F A;  3JU4 A;  4P3I A;  4ACA A;  3ZC3 A;  3ZZU A;  4XLH A;  4RPB A;  1YX2 A;  4R71 A;  3CCJ B;  4E0F A;  4ZCI A;  1VQ6 B;  3JQQ A;  4LBW A;  2CK3 A;  4XLC A;  4Y9R A;  1XFO A;  4QHY A;  4G1V A;  4RCZ A;  1OHH A;  3E1Y E;  4L8J A;  4PC7 A;  4M2L A;  3QFC A;  4RD1 A;  3W5U A;  3NE5 B;  2ZZQ A;  1YJ9 B;  1W34 A;  1CQX A;  2CW5 A;  4UAJ A;  4YHB A;  4RD2 A;  2V7V A;  2BGI A;  5IK2 A;  2ZBU A;  1I18 A;  2F4N A;  2XEX A;  3CPX A;  3OW7 A;  2GJP A;  5FNZ A;  1T6X A;  1VQ8 B;  2NPF A;  5AN9 A;  5E6T A;  4HIZ A;  4XOT A;  4FN5 A;  1ZM3 A;  2B7B A;  4XN0 A;  4X7D A;  4XL9 A;  1KMH A;  2C4T A;  2GJK A;  5H5J A;  1VLO A;  3Q3A A;  3CCL B;  1DG1 G;  4PC2 A;  2C5B A;  4YAU A;  2C77 A;  4X7C A;  2QA4 B;  1GJR A;  4WZK A;  2BM0 A;  1KC8 D;  1FNC A;  1FRQ A;  1K28 D;  2LZJ A;  4P1V A;  2V7T A;  3OE7 A;  1VQL B;  2JJ2 A;  1YLO A;  3AVV A;  1W0J A;  1B23 P;  3ES9 A;  4RCY A;  5GV8 A;  3W2E A;  2XOK A;  2V31 A;  4II3 A;  5HZA A;  3CMM A;  1RQP A;  2PMD A;  4OOS A;  3WNC A;  3A1P A;  4YAF A;  3JQR A;  5DS0 A;  4J0Q A;  2CC2 A;  4TMW A;  5TV2 A;  2QEX B;  1YJN B;  2EFG A;  1P4M A;  1WOO A;  1W35 A;  3SLD A;  3T53 B;  3CCE B;  1UD3 A;  4DK1 A;  5IYP A;  2XZL A;  3A8I A;  4DK0 A;  1COW A;  1K8A D;  5A89 A;  1E79 A;  2QGG A;  1PJ7 A;  1UD5 A;  1EFT A;  2BMW A;  4MYT A;  4Z4W A;  3AVT A;  4X06 A;  1TLL A;  2GJR A;  2JIZ A;  4B3F X;  4WZE A;  1UMK A;  1I7P A;  4B43 A;  4P2N A;  4N3G A;  3OPO A;  3BNW A;  4PC1 A;  4XON A;  1UD6 A;  4TN1 A;  5FIU A;  2WJV A;  2DCU A;  1S0U A;  3GVJ A;  3WBJ A;  4P22 A;  4P9S A;  2V7Q A;  4NNJ A;  2D3N A;  1WSR A;  1PKV A;  3ISX A;  2D9R A;  4Z1M A;  1F20 A;  3OW2 B;  1WU8 A;  2JN9 A;  4BPR A;  2W6J A;  1D1N A;  4G5G A;  1U2R A;  2OBT A;  1FDR A;  2B5O A;  2OYN A;  2PE3 A;  4Z4R A;  4X8I A;  3PA2 A;  4P6Y A;  2XNJ A;  5F4M A;  4CQJ A;  4HE5 A;  3VO2 A;  4C43 A;  1RQR A;  3VMF A;  3HAG A;  3WND A;  1S72 B;  3H94 A;  2C2W A;  1DAR A;  2F1L A;  5DSZ A;  2XZO A;  4XKV A;  3CP8 A;  2BF4 A;  4ZGQ B;  4II2 A;  3OFN A;  1OGJ A;  4M0L A;  4B48 A;  1VQ4 B;  1KQS B;  1EFC A;  1AMO A;  1W0K A;  3PVD A;  3DDY A;  4G6I A;  3QE2 A;  4WZL A;  3ASR A;  4AC9 A;  3G71 B;  4KKT A;  3CMA B;  3Q39 A;  1EP2 B;  2I1L A;  3BY1 A;  4YAO A;  2JDI A;  1JA0 A;  2Q6O A;  2E1R A;  4P12 A;  4OPS A;  3A3G A;  4XMY A;  4XNF A;  2F1M A;  4RD4 A;  4X05 A;  2OTJ B;  3FJO A;  1EP1 B;  3P26 A;  1N0V C;  1G7C A;  3D26 A;  2XND A;  4UZF A;  1T5E A;  3G05 A;  3CCR B;  4YXW A;  5B6I A;  1BX1 A;  1HA3 A;  5FA6 A;  2DER A;  2X0K A;  2QN6 A;  3AGQ A;  3PUM A;  3BCF A;  4XQF A;  2X3U A;  3SEJ A;  4HE6 A;  1VJS A;  4AF6 A;  4ROX A;  1KTV A;  5FO1 A;  2VNI A;  4M4S A;  3CC2 B;  3VO1 A;  5J35 A;  5HKK A;  3B78 A;  4TSF A;  2ZTN A;  3SLN A;  3W2I A;  1ZM9 A;  5IYQ A;  1TUI A;  3U6K A;  1Y0R A;  1FX0 A;  3CCU B;  2YWE A;  5J3O A;  2CF4 A;  1IHM A;  3G6E B;  2AHO A;  3Q6R A;  4ZV4 A;  1BX0 A;  5KNL A;  2VNK A;  2WSS A;  3H9N A;  1OB0 A;  3OEH A;  2BSA A;  4OPV A;  2VBV A;  3I55 B;  3LVB A;  4YEJ A;  3A35 A;  5TRD A;  1M1K D;  2C4U A;  1WDT A;  3OZW A;  3AGP A;  4M1K A;  1QFJ A;  3WBK A;  2X53 S;  1Y0Y A;  2HMA A;  4FXU A;  3P27 A;  3OKX A;  1N05 A;  3CCV B;  2DIE A;  4RPD A;  1ELO A;  2VNH A;  4G7W A;  2J7K A;  4WWV A;  2B7C A;  2C78 A;  5EMN A;  1YJW B;  5IYR A;  2X6Y A;  3WQZ A;  3GVL A;  1JJ2 B;  3Q6Q A;  2X6W A;  1B2R A;  5HZB A;  2XZP A;  2JJ1 A;  3ZIA A;  1YI2 B;  4OOV A;  4RD3 A;  2X8K A;  2DYI A;  2VBU A;  2X6X A;  4QVA A;  1E3X A;  1ZUN B;  1K73 D;  1XB2 A;  1Q81 D;  4Z4U A;  1EWY A;  2EIX A;  1BMF A;  3GSI A;  5TY0 A;  3CCS B;  3LQ6 A;  4LBV A;  1A8P A;  3CCQ B;  4P25 A;  4XN3 A;  3BC9 A;  1R5B A;  4TMV A;  2DY1 A;  3AST A;  1MAB A;  2BV3 A;  3V76 A;  4PC3 A;  4X07 A;  2ZL6 A;  3LO8 A;  1R5N A;  1KD1 D;  5TR9 A;  1E3Z A;  4PAA A;  2WR8 A;  4RDK A;  2OK7 A;  1BLI A;  1QUE A;  4ASU A;  1VQM B;  1S4M A;  2BN4 A;  4M53 A;  1QVG B;  1BQE A;  4YEL A;  1WOS A;  1H8H A;  2ZIT A;  1E1R A;  4C0S A;  5FO0 A;  2FX3 A;  1WOP A;  4MYU A;  1VQ5 B;  3I56 B;  1E62 A;  4RDL A;  4P3Y A;  4Y7C A;  2R9V A;  2RC6 A;  3GVK A;  1EP3 B;  5F4J A;  3ONY A;  1D8T A;  5H59 A;  1VQ9 B;  5FL7 A;  2Q6L A;  1H42 A;  2OTL B;  3PA1 A;  1NBM A;  2RC5 A;  5A8A A;  5KSW B;  3A3B A;  3FKS A;  4WZT A;  1OB5 A;  4LC0 A;  1TTT A;  2D74 A;  2PLF A;  5GV7 A;  1W87 A;  4Q7J B;  2WYR A;  2W6I A;  2WZP P;  3OZU A;  1KRH A;  3CTA A;  3MMP A;  2YWG A;  3VNV A;  1PJ5 A;  2OK8 A;  1TVC A;  4G1B A;  4XLE A;  3ZBT A;  5BSY A;  2VBT A;  2WPD A;  3KL9 A;  3ZZT A;  4QVJ A;  1OB2 A;  3G4S B;  1K9M D;  1XQB A;  3OZV A;  1FND A;  3W2G A;  1FNB A;  2BVN A;  3CCM B;  3U2Q A;  3R6K A;  1Q7Y D;  2GPJ A;  1FRN A;  3VNU A;  1EXM A;  2GRE A;  4ZGN B;  3OAA A;  1KK0 A;  1DDG A;  2GK7 A;  1EFU A;  4UZE A;  1T6Y A;  1E63 A;  3QFR A;  4XLA A;  4XLF A;  3CC4 B;  3BH4 A;  4ZCM A;  1QH0 A;  4QUZ A;  4FK8 A;  3VR6 A;  2OBR A;  2C5H A;  3J81 k;  4PC6 A;  1IJE A;  2Q6I A;  4OPO A;  5IYW A;  4AVZ A;  2D3L A;  4Z4Y A;  1VLY A;  1EFR A;  2E1B A;  3Q38 A;  3PEN A;  1VHE A;  4JMQ A;  5JBQ A;  2ZXH A;  1G7T A;  4N3N A;  3WYA A;  4XR6 A;  1KZL A;  4IW3 B;  2ZBV A;  3ZBU A;  4YAL A;  4GQN A;  3CP2 A;  1VQ7 B;  1NJI D;  1YHQ B;  3CPW B;  1VQP B;  1VHO A;  2VNJ A;  4NCN A;  3T51 B;  4B3G A;  1V5V A;  2CBX A;  3OJX A;  3OJW A;  1ZM4 A;  3ZUG A;  1AIP A;  1XE1 A;  4P26 A;  4KKU A;  1UD4 A;  3B82 A;  3CW2 A;  1QUF A;  3W2F A;  3CRZ A;  1GR1 A;  4H9G A;  3CME B;  2ZZF A;  1ZM2 A;  2YWH A;  1YIT B;  4DNR B;  1V0E A;  2VYQ A;  3QFS A;  3A8K A;  3W5H A;  5IYN A;  4RD6 A;  4PGO A;  3QSY A;  3ONU A;  4Z4V A;  4UZU A;  1WOR A;  2CRV A;  4B4D A;  2FVG A;  5LMZ A;  1HVX A;  2XNC A;  2ZL7 A;  3FPP A;  1E1Q A;  1VF7 A;  3CC7 B;  1NB9 A;  2Q6K A;  4F7D A;  1NDH A;  3OEE A;  4TT3 A;  4XM3 A;  3WNB A;  1VQO B;  1E64 A;  4G7X A;  3BCD A;  4XD7 A;  1WPC A;  5DN6 A;  2P3M A;  5HXB A;  2ZXI A; 
#chains in the Genus database with same CATH homology
 5F4J A;  3ONY A;  4WZL A;  3ASR A;  3Q39 A;  3PA1 A;  3BY1 A;  4WZT A;  4P12 A;  4OPS A;  4Z4T A;  4X05 A;  4X7E A;  3D26 A;  3RY8 A;  4RM0 A;  3PUN A;  2ZL5 A;  3PUM A;  5BSY A;  3R6J A;  3SKB A;  5E6T A;  4QVJ A;  3SEJ A;  3V7A A;  4Z4S A;  3ASP A;  4ROX A;  5F4O A;  5BSX A;  4X7D A;  3ASQ A;  5J35 A;  3R6K A;  3Q3A A;  3SLN A;  5IYQ A;  4X7C A;  4WZK A;  4QV2 A;  5J3O A;  2OBS A;  3BY2 A;  4Z4Z A;  1IHM A;  4P1V A;  3Q6R A;  3SJP A;  4QUZ A;  2OBR A;  5HZA A;  3BQJ A;  4OPV A;  4OP7 A;  4OOS A;  4OPO A;  5IYW A;  4Z4Y A;  3Q38 A;  4RPD A;  3SLD A;  5IYP A;  3LQE A;  5IYR A;  4RLZ A;  3Q6Q A;  4RDJ A;  4Z4W A;  4X06 A;  5HZB A;  4X7F A;  4WZE A;  4OOV A;  5KW9 A;  4QVA A;  4P2N A;  4P26 A;  3ASS A;  4Z4U A;  4OOX A;  3LQ6 A;  2OBT A;  4P25 A;  5IYN A;  4Z4R A;  3ONU A;  4Z4V A;  4X0C A;  3AST A;  3PA2 A;  4X07 A;  2ZL6 A;  5F4M A;  4RDK A;  2ZL7 A;  4P3I A;  4RPB A;  4RDL A;  3PVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...