5IYRA

Protruding domain of gii.4 human norovirus chdc2094 in complex with 2-fucosyllactose (2'fl)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
305
structure length
303
Chain Sequence
KPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTTQLSAVNICNFRGDVTRVGISHDYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGLLTQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDGHQNEPQQWVLPNYSGTSGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDCLLPQEWVSHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVIPPNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GII.4 norovirus CHDC2094 capsid
publication title Structural basis for GII.4 norovirus inhibition by human milk oligosaccharides.
rcsb
source organism Norovirus hu/gii.4/chdc2094/1974/us
molecule tags Viral protein
total genus 68
structure length 303
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5iyrA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5iyrA01
1IHMA 4RDKA 4X7FA 3SEJA 4X7CA 5HZAA 4RDLA 4P1VA 3Q6RA 3SLNA 4RLZA 3ASQA 4Z4RA 3D26A 5IYRA 4QVAA 4X7EA 5HZBA 5F4JA 3PA1A 5J3OA 4OP7A 5F4OA 4RM0A 4X06A 4Z4ZA 4P26A 2ZL6A 4X0CA 3RY8A 4Z4YA 5IYWA 3BY1A 4WZEA 3Q6QA 3SJPA 4OPOA 4WZLA 2ZL7A 4OOXA 5KW9A 3ASPA 4OPSA 5IYNA 3SKBA 3PUMA 3R6KA 3PA2A 4OOSA 4Z4VA 4RPBA 5BSXA 2OBSA 3SLDA 4RPDA 4OOVA 3LQ6A 4Z4WA 5J35A 3BY2A 4X07A 4P25A 3Q39A 2OBRA 4P3IA 3V7AA 4WZKA 3ASRA 3ASSA 5E6TA 3PUNA 3Q3AA 3PVDA 5BSYA 4X7DA 3ONUA 4Z4SA 4QVJA 5F4MA 5IYQA 4QV2A 4QUZA 3BQJA 4P12A 4X05A 3R6JA 4ROXA 3LQEA 4P2NA 4RDJA 2OBTA 4WZTA 4Z4TA 4OPVA 5IYPA 3ASTA 3Q38A 2ZL5A 3ONYA 4Z4UA
chains in the Genus database with same CATH superfamily
2VBTA 4ZV4A 3BNWA 3QSYA 1IHMA 3CESA 2BM1A 2XOKA 1N8RD 1D8TA 2PMDA 4RDLA 3VO2A 4P1VA 4MYTA 3U2QA 2X3UA 3ZBTA 1PJ5A 2BV3A 2VNJA 2FX3A 4RD4A 3I55B 1UD8A 1SKQA 2YWFA 4LBYA 4RJLA 4XLFA 2QA4B 5L46A 5IYRA 1OGIA 4QVAA 4X7EA 3OP1A 1VQ8B 5F4JA 1EP1B 3B78A 1VQNB 1EFTA 2ZBVA 4IW3B 1XQBA 1R5NA 2GQFA 1BX0A 3BCDA 2AHOA 3OEEA 3WY9A 2EIXA 1H8EA 2JJ1A 3AVXA 1NDHA 4Z4ZA 4HE6A 2HLDA 1JJ2B 2D3NA 1FNBA 2BPOA 4JMQA 5DN6A 5IYWA 1W0KA 2WZNA 1K8AD 1Q81D 1SM4A 1QH0A 4ZGNB 3LNNA 3ZIAA 3Q6QA 2DY1A 4OOXA 3ASPA 3SKBA 2OTJB 1MABA 1H42A 1FNDA 1E62A 5FA6A 1VQ7B 4G5GA 2F1LA 2PE3A 3QFRA 5CDFA 4B3FX 2ZZEA 1KZLA 2DYIA 2XEXA 2RC5A 1VQLB 3WQZA 1YLOA 4N3NA 1WSVA 2R9VA 3SJZA 3W2GA 1HVXA 1QX4A 1WORA 2E1RA 4TKOB 4E0FA 2XNCA 1K28D 1UD5A 2DEUA 2Q6KA 1W35A 1ZUNB 4L8JA 4P22A 4P3IA 1RQPA 1ELOA 4WZKA 3OJXA 3ASRA 3T56B 5FNZA 3ZBUA 1OB0A 3JQRA 3ZPNA 4AC9A 3CMAB 1Q82D 1B23P 1XE1A 2P3MA 2XGJA 2NV4A 4M53A 3NE5B 3AGQA 4Z4SA 4B43A 2VJIA 2I1LA 4XOPA 2GPJA 2ZTNA 4P12A 4X05A 1VQ5B 3CC2B 1PJ6A 3R6JA 4LBWA 3JU4A 3ZC3A 4XLEA 2JN9A 2VNHA 4WZTA 4DK1A 4G6IA 4ACAA 4PC3A 2KVOA 3W5HA 5IYPA 4YALA 3T51B 4P6YA 3ONYA 4PGOA 1QVGB 2OK7A 3CCVB 2X53S 1YJWB 3SEJA 4GQNA 1SKYB 4TMZA 4X7CA 3G6EB 1WDTA 2XNDA 1KK1A 1M1KD 4N3GA 1RQRA 2F4NA 2CW5A 4XOTA 2DOGA 3CTAA 1G7TA 3OFNA 4UZFA 1E43A 3AVWA 4AF7A 1KRHA 4G7XA 2GK6A 3BC9A 4DK0A 1GR1A 1BLIA 3D26A 1WTHD 3ZZUA 3ISXA 1S72B 2QTZA 4XLHA 2NPFA 4AF6A 3OPOA 3PA1A 4H9GA 3GVKA 1T5EA 1DDGA 5FL7A 5J3OA 5JBQA 2WJYA 4RM0A 1W2BB 2W6JA 1J9ZA 1YI2B 4XLCA 3W2FA 3A8JA 2X6XA 3CP2A 4HE5A 4II2A 4P3YA 3W5VA 3CCLB 1H8HA 1UD4A 1K73D 1EWYA 1IJEA 1IJFA 1PKVA 3BH4A 1EFRA 3H94A 2GK7A 3RY8A 3CPWB 4K1XA 4Z4YA 2XZOA 3BY1A 1QFJA 4WZEA 2VJJA 2HDNB 4TMTA 1UD3A 4B47A 4Y9RA 3QFTA 3WBKA 4DQLA 2YWGA 3CCMB 3PUMA 2CK3A 3WYAA 1F20A 3PA2A 3DDYA 1XFOA 1V5VA 3B82A 4ASUA 4NCNA 1FDRA 3OZWA 1FRQA 2C5HA 5THXA 2X8KA 2ZZGA 4M4SA 1NJID 3OKXA 5DS0A 1U2RA 2PLFA 2Q6OA 5TR9A 4EH1A 1QGYA 1WOSA 1HA3A 2C77A 2QDXA 4Z4WA 3QFCA 3G4SB 1E1RA 3CPXA 2R6HA 2WPDA 1A8PA 4M0LA 1V0EA 4XKWA 4ZGQB 1OB5A 1ZM3A 3BY2A 4X07A 1ZM4A 4P25A 4LC0A 3Q39A 1FNCA 3QE2A 2OBRA 4TMVA 4PAAA 4B48A 4XORA 1KK3A 2GJPA 4WWVA 3ASSA 4MYUA 2OK8A 5E6TA 3CCJB 3CD6B 1E1QA 1FRNA 3Q3AA 4QHYA 1COWA 1JB9A 1BPLA 2BGJA 5BSYA 3KL9A 4XONA 2CRVA 3H9NA 1N06A 4DNTB 1VQ9B 4QVJA 2Q6IA 2V31A 4C43A 3A35A 1GAWA 1TUIA 3AGPA 3E1YE 4KKUA 3WXMA 3VO1A 1T6YA 1PJ7A 2BMWA 1S0UA 2BVNA 1M90D 1TLLA 1VQKB 5TRDA 3CCQB 2D9RA 1GO2A 3MHPA 4TMXA 1CQXA 2C78A 4C0SA 4OPVA 1CNEA 1W0JA 1JNYA 2ZL5A 1ZM2A 4XLAA 2HCJB 4NBSA 3CCEB 3AVYA 4RDKA 3VNUA 1VLYA 1FX0A 4X7FA 2VYQA 2DCUA 4YAFA 5IK2A 3U6KA 4XN3A 5HZAA 3GVLA 2C4TA 1W34A 3OZVA 4RCZA 3Q6RA 3J81k 2BM0A 2WJVA 2X6WA 4M1KA 5HKKA 1KK0A 1Q86D 2XZLA 1OHHA 5A89A 3ASQA 4PABA 4DQKA 4Z4RA 3HAGA 5LMZA 1VHOA 1YITB 4Y9UA 5HZBA 2CNDA 3B8HA 3MCAA 2YWHA 4TSFA 5A88A 5H5JA 5F4OA 4P9SA 3FJOA 1YHQB 1DG1G 1W9XA 1B2RA 1UMKA 4QFMA 1EP3B 1R5OA 3CCUB 3GIRA 3KEWA 2ZL6A 3GSIA 3BCFA 3QFSA 3W2EA 4CQJA 4X0CA 2ZBUA 1XB2A 3AVTA 4UAJA 1E64A 4XD7A 4R71A 3CCRB 5DSZA 3VR6A 3W5UA 2OTLB 2ZXHA 4LBZA 4ZCIA 3SJPA 4OPOA 1KK2A 4G1VA 4WZLA 1VLOA 4TN1A 4BPRA 5KW9A 4OPSA 3WNBA 1VQ6B 4KKSA 1E3XA 1Y0RA 2BSAA 2VBVA 1E3ZA 1QFYA 4XN0A 5AN9A 1VQMB 1VQPB 4J0QA 4X8IA 4Z4VA 2V4DA 2JDIA 1CNFA 3A8KA 5FO1A 2J7KA 5KSWB 1QVFB 4YAUA 2OBSA 4UZEA 4RPDA 1BJKA 2VNKA 1QGAA 1TTTA 3OEHA 1VQOB 4B4DA 3P26A 4YEJA 3V76A 4II3A 4Z1MA 5J35A 2HMAA 4B3GA 2BF4A 2XZPA 3GVJA 1KC8D 2QGGA 3OW7A 1QUEA 3V7AA 1BX1A 1WSRA 1I8DA 1D2EA 3A1PA 2GREA 1W87A 3OE7A 2QEXB 1EFUA 1JA1A 1JA0A 1GVHA 3ZUGA 3PVDA 2X0KA 1R5BA 2V7QA 4Y7CA 1KQSB 2B7BA 2DERA 3ONUA 3CW2A 5IYQA 5F4MA 4FK8A 2V7UA 4TMWA 5B6IA 2F43A 4QUZA 3OAAA 3BQJA 2WYRA 3P27A 1GAQA 2GJKA 2V7XA 1QUFA 2Z6BD 3LQEA 2BGIA 5EMNA 2OBTA 2V7VA 1N05A 3CC7B 1Q9SA 4Z4TA 2WZPP 4XNFA 4FN5A 3I56B 1IB0A 1N07A 5FIUA 1E79A 2JIZA 3AVVA 5TY0A 3Q38A 2ZITA 2OYNA 3GQBA 4PC6A 1N0UA 4F7DA 1KMHA 3JQQA 2X85A 4B44A 3CC4B 1G7SA 2CBXA 4PC7A 1YJ9B 2W6IA 3PENA 4LBVA 3A8IA 1V0FA 5FO0A 3SLNA 4YXWA 4RLZA 1D1NA 2WSSA 3VNVA 3T53B 4P6VF 2QTLA 1K9MD 4WQMA 1BMFA 1YIJB 4RD1A 3ES9A 1QG0A 3U6BA 4YAWA 5GV7A 5A8AA 2VZLA 4RD6A 3W2HA 2LZJA 4PC2A 4YELA 3WNCA 4B3XA 3G05A 2GJRA 4OP7A 3OJWA 4XMYA 1WP6A 2C4UA 4X06A 4YHBA 1WOOA 3WNDA 4P26A 3CMMA 2QE7A 1S4MA 3MMPA 4XR6A 2ZTGA 1OGJA 3VMFA 1ZM9A 3CXCB 1WPCA 4TT3A 1AMOA 1F60A 4Q7JB 1BQEA 1H85A 3LO8A 3CB4A 2D74A 2D3LA 2XNJA 4FXUA 1QGZA 1VHEA 2QN6A 2ZL7A 1EFCA 2FVGA 5IYNA 1HZEA 5GV8A 3G71B 2E1BA 1KD1D 3R6KA 3CRZA 4OOSA 1GJRA 3ZZTA 2CC2A 1TVCA 2M5SA 3CMEB 1VJSA 2CF4A 3LVBA 1Y0YA 4RPBA 5BSXA 3A3BA 3SLDA 4RD2A 2VBUA 4UZUA 1YX2A 4OOVA 4PC1A 3FPPA 3LQ6A 1Q7YD 2V7TA 4G7WA 4ZCMA 2BN4A 3OW2B 5TV2A 1I18A 4YAOA 1QFZA 2VBSA 3CP8A 2EFGA 4KKTA 4XL9A 3AVUA 3E20A 3JQPA 2QMUA 2JJ2A 2ZZFA 1AIPA 1KTVA 4FWTA 1E63A 2VNIA 4U9UA 4ZCLA 4ACBA 1UD6A 4HIZA 1T6XA 3OOCA 2F1MA 3FKSA 1N08A 1EXMA 4RCYA 5KNLA 3CCSB 5HXBA 1WU8A 2X6YA 3PUNA 1NB9A 2PIAA 5H59A 1WOPA 1DARA 2Q6LA 4X7DA 2C5BA 3A3GA 3W2IA 4RD0A 1EP2B 1KJZA 2YWEA 4QV2A 2WR8A 2ZZQA 4XKVA 3ZZ0A 2B5OA 2V7WA 4DNRB 2DETA 4G1BA 4ROXA 3I1FA 1MRZA 1N0VC 1VF7A 1NBMA 4XQFA 4P2NA 4RDJA 1NRKA 2B7CA 3OZUA 3FPKA 4NNJA 1YJNB 1G7RA 4RD3A 4XM3A 1UD2A 2ZXIA 1G7CA 2C2WA 1I7PA 1T6ZA 2RC6A 2DIEA 4M2LA 3WBJA 1VQ4B 1FNMA 3ASTA 1OB2A 4AVZA 1P4MA 1DDIA 1NB0A 4Z4UA
chains in the Genus database with same CATH topology
1IHMA 4RDKA 4X7FA 3SEJA 4X7CA 5HZAA 4RDLA 4P1VA 3Q6RA 3SLNA 4RLZA 3ASQA 4Z4RA 3D26A 5IYRA 4QVAA 4X7EA 5HZBA 5F4JA 3PA1A 5J3OA 4OP7A 5F4OA 4RM0A 4X06A 4Z4ZA 4P26A 2ZL6A 4X0CA 3RY8A 4Z4YA 5IYWA 3BY1A 4WZEA 3Q6QA 3SJPA 4OPOA 4WZLA 2ZL7A 4OOXA 5KW9A 3ASPA 4OPSA 5IYNA 3SKBA 3PUMA 3R6KA 3PA2A 4OOSA 4Z4VA 4RPBA 5BSXA 2OBSA 3SLDA 4RPDA 4OOVA 3LQ6A 4Z4WA 5J35A 3BY2A 4X07A 4P25A 3Q39A 2OBRA 4P3IA 3V7AA 4WZKA 3ASRA 3ASSA 5E6TA 3PUNA 3Q3AA 3PVDA 5BSYA 4X7DA 3ONUA 4Z4SA 4QVJA 5F4MA 5IYQA 4QV2A 4QUZA 3BQJA 4P12A 4X05A 3R6JA 4ROXA 3LQEA 4P2NA 4RDJA 2OBTA 4WZTA 4Z4TA 4OPVA 5IYPA 3ASTA 3Q38A 2ZL5A 3ONYA 4Z4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IHM A;  4RDK A;  4X7F A;  3SEJ A;  4X7C A;  5HZA A;  4RDL A;  4P1V A;  3Q6R A;  3SLN A;  4RLZ A;  3ASQ A;  4Z4R A;  3D26 A;  5IYR A;  4QVA A;  4X7E A;  5HZB A;  5F4J A;  3PA1 A;  5J3O A;  4OP7 A;  5F4O A;  4RM0 A;  4X06 A;  4Z4Z A;  4P26 A;  2ZL6 A;  4X0C A;  3RY8 A;  4Z4Y A;  5IYW A;  3BY1 A;  4WZE A;  3Q6Q A;  3SJP A;  4OPO A;  4WZL A;  2ZL7 A;  4OOX A;  5KW9 A;  3ASP A;  4OPS A;  5IYN A;  3SKB A;  3PUM A;  3R6K A;  3PA2 A;  4OOS A;  4Z4V A;  4RPB A;  5BSX A;  2OBS A;  3SLD A;  4RPD A;  4OOV A;  3LQ6 A;  4Z4W A;  5J35 A;  3BY2 A;  4X07 A;  4P25 A;  3Q39 A;  2OBR A;  4P3I A;  3V7A A;  4WZK A;  3ASR A;  3ASS A;  5E6T A;  3PUN A;  3Q3A A;  3PVD A;  5BSY A;  4X7D A;  3ONU A;  4Z4S A;  4QVJ A;  5F4M A;  5IYQ A;  4QV2 A;  4QUZ A;  3BQJ A;  4P12 A;  4X05 A;  3R6J A;  4ROX A;  3LQE A;  4P2N A;  4RDJ A;  2OBT A;  4WZT A;  4Z4T A;  4OPV A;  5IYP A;  3AST A;  3Q38 A;  2ZL5 A;  3ONY A;  4Z4U A; 
#chains in the Genus database with same CATH topology
 2VBT A;  4ZV4 A;  3BNW A;  3QSY A;  1IHM A;  3CES A;  2BM1 A;  2XOK A;  1N8R D;  1D8T A;  2PMD A;  4RDL A;  3VO2 A;  4P1V A;  4MYT A;  3U2Q A;  2X3U A;  3ZBT A;  1PJ5 A;  2BV3 A;  2VNJ A;  2FX3 A;  4RD4 A;  3I55 B;  1UD8 A;  1SKQ A;  2YWF A;  4LBY A;  4RJL A;  4XLF A;  2QA4 B;  5L46 A;  5IYR A;  1OGI A;  4QVA A;  4X7E A;  3OP1 A;  1VQ8 B;  5F4J A;  1EP1 B;  3B78 A;  1VQN B;  1EFT A;  2ZBV A;  4IW3 B;  1XQB A;  1R5N A;  2GQF A;  1BX0 A;  3BCD A;  2AHO A;  3OEE A;  3WY9 A;  2EIX A;  1H8E A;  2JJ1 A;  3AVX A;  1NDH A;  4Z4Z A;  4HE6 A;  2HLD A;  1JJ2 B;  2D3N A;  1FNB A;  2BPO A;  4JMQ A;  5DN6 A;  5IYW A;  1W0K A;  2WZN A;  1K8A D;  1Q81 D;  1SM4 A;  1QH0 A;  4ZGN B;  3LNN A;  3ZIA A;  3Q6Q A;  2DY1 A;  4OOX A;  3ASP A;  3SKB A;  2OTJ B;  1MAB A;  1H42 A;  1FND A;  1E62 A;  5FA6 A;  1VQ7 B;  4G5G A;  2F1L A;  2PE3 A;  3QFR A;  5CDF A;  4B3F X;  2ZZE A;  1KZL A;  2DYI A;  2XEX A;  2RC5 A;  1VQL B;  3WQZ A;  1YLO A;  4N3N A;  1WSV A;  2R9V A;  3SJZ A;  3W2G A;  1HVX A;  1QX4 A;  1WOR A;  2E1R A;  4TKO B;  4E0F A;  2XNC A;  1K28 D;  1UD5 A;  2DEU A;  2Q6K A;  1W35 A;  1ZUN B;  4L8J A;  4P22 A;  4P3I A;  1RQP A;  1ELO A;  4WZK A;  3OJX A;  3ASR A;  3T56 B;  5FNZ A;  3ZBU A;  1OB0 A;  3JQR A;  3ZPN A;  4AC9 A;  3CMA B;  1Q82 D;  1B23 P;  1XE1 A;  2P3M A;  2XGJ A;  2NV4 A;  4M53 A;  3NE5 B;  3AGQ A;  4Z4S A;  4B43 A;  2VJI A;  2I1L A;  4XOP A;  2GPJ A;  2ZTN A;  4P12 A;  4X05 A;  1VQ5 B;  3CC2 B;  1PJ6 A;  3R6J A;  4LBW A;  3JU4 A;  3ZC3 A;  4XLE A;  2JN9 A;  2VNH A;  4WZT A;  4DK1 A;  4G6I A;  4ACA A;  4PC3 A;  2KVO A;  3W5H A;  5IYP A;  4YAL A;  3T51 B;  4P6Y A;  3ONY A;  4PGO A;  1QVG B;  2OK7 A;  3CCV B;  2X53 S;  1YJW B;  3SEJ A;  4GQN A;  1SKY B;  4TMZ A;  4X7C A;  3G6E B;  1WDT A;  2XND A;  1KK1 A;  1M1K D;  4N3G A;  1RQR A;  2F4N A;  2CW5 A;  4XOT A;  2DOG A;  3CTA A;  1G7T A;  3OFN A;  4UZF A;  1E43 A;  3AVW A;  4AF7 A;  1KRH A;  4G7X A;  2GK6 A;  3BC9 A;  4DK0 A;  1GR1 A;  1BLI A;  3D26 A;  1WTH D;  3ZZU A;  3ISX A;  1S72 B;  2QTZ A;  4XLH A;  2NPF A;  4AF6 A;  3OPO A;  3PA1 A;  4H9G A;  3GVK A;  1T5E A;  1DDG A;  5FL7 A;  5J3O A;  5JBQ A;  2WJY A;  4RM0 A;  1W2B B;  2W6J A;  1J9Z A;  1YI2 B;  4XLC A;  3W2F A;  3A8J A;  2X6X A;  3CP2 A;  4HE5 A;  4II2 A;  4P3Y A;  3W5V A;  3CCL B;  1H8H A;  1UD4 A;  1K73 D;  1EWY A;  1IJE A;  1IJF A;  1PKV A;  3BH4 A;  1EFR A;  3H94 A;  2GK7 A;  3RY8 A;  3CPW B;  4K1X A;  4Z4Y A;  2XZO A;  3BY1 A;  1QFJ A;  4WZE A;  2VJJ A;  2HDN B;  4TMT A;  1UD3 A;  4B47 A;  4Y9R A;  3QFT A;  3WBK A;  4DQL A;  2YWG A;  3CCM B;  3PUM A;  2CK3 A;  3WYA A;  1F20 A;  3PA2 A;  3DDY A;  1XFO A;  1V5V A;  3B82 A;  4ASU A;  4NCN A;  1FDR A;  3OZW A;  1FRQ A;  2C5H A;  5THX A;  2X8K A;  2ZZG A;  4M4S A;  1NJI D;  3OKX A;  5DS0 A;  1U2R A;  2PLF A;  2Q6O A;  5TR9 A;  4EH1 A;  1QGY A;  1WOS A;  1HA3 A;  2C77 A;  2QDX A;  4Z4W A;  3QFC A;  3G4S B;  1E1R A;  3CPX A;  2R6H A;  2WPD A;  1A8P A;  4M0L A;  1V0E A;  4XKW A;  4ZGQ B;  1OB5 A;  1ZM3 A;  3BY2 A;  4X07 A;  1ZM4 A;  4P25 A;  4LC0 A;  3Q39 A;  1FNC A;  3QE2 A;  2OBR A;  4TMV A;  4PAA A;  4B48 A;  4XOR A;  1KK3 A;  2GJP A;  4WWV A;  3ASS A;  4MYU A;  2OK8 A;  5E6T A;  3CCJ B;  3CD6 B;  1E1Q A;  1FRN A;  3Q3A A;  4QHY A;  1COW A;  1JB9 A;  1BPL A;  2BGJ A;  5BSY A;  3KL9 A;  4XON A;  2CRV A;  3H9N A;  1N06 A;  4DNT B;  1VQ9 B;  4QVJ A;  2Q6I A;  2V31 A;  4C43 A;  3A35 A;  1GAW A;  1TUI A;  3AGP A;  3E1Y E;  4KKU A;  3WXM A;  3VO1 A;  1T6Y A;  1PJ7 A;  2BMW A;  1S0U A;  2BVN A;  1M90 D;  1TLL A;  1VQK B;  5TRD A;  3CCQ B;  2D9R A;  1GO2 A;  3MHP A;  4TMX A;  1CQX A;  2C78 A;  4C0S A;  4OPV A;  1CNE A;  1W0J A;  1JNY A;  2ZL5 A;  1ZM2 A;  4XLA A;  2HCJ B;  4NBS A;  3CCE B;  3AVY A;  4RDK A;  3VNU A;  1VLY A;  1FX0 A;  4X7F A;  2VYQ A;  2DCU A;  4YAF A;  5IK2 A;  3U6K A;  4XN3 A;  5HZA A;  3GVL A;  2C4T A;  1W34 A;  3OZV A;  4RCZ A;  3Q6R A;  3J81 k;  2BM0 A;  2WJV A;  2X6W A;  4M1K A;  5HKK A;  1KK0 A;  1Q86 D;  2XZL A;  1OHH A;  5A89 A;  3ASQ A;  4PAB A;  4DQK A;  4Z4R A;  3HAG A;  5LMZ A;  1VHO A;  1YIT B;  4Y9U A;  5HZB A;  2CND A;  3B8H A;  3MCA A;  2YWH A;  4TSF A;  5A88 A;  5H5J A;  5F4O A;  4P9S A;  3FJO A;  1YHQ B;  1DG1 G;  1W9X A;  1B2R A;  1UMK A;  4QFM A;  1EP3 B;  1R5O A;  3CCU B;  3GIR A;  3KEW A;  2ZL6 A;  3GSI A;  3BCF A;  3QFS A;  3W2E A;  4CQJ A;  4X0C A;  2ZBU A;  1XB2 A;  3AVT A;  4UAJ A;  1E64 A;  4XD7 A;  4R71 A;  3CCR B;  5DSZ A;  3VR6 A;  3W5U A;  2OTL B;  2ZXH A;  4LBZ A;  4ZCI A;  3SJP A;  4OPO A;  1KK2 A;  4G1V A;  4WZL A;  1VLO A;  4TN1 A;  4BPR A;  5KW9 A;  4OPS A;  3WNB A;  1VQ6 B;  4KKS A;  1E3X A;  1Y0R A;  2BSA A;  2VBV A;  1E3Z A;  1QFY A;  4XN0 A;  5AN9 A;  1VQM B;  1VQP B;  4J0Q A;  4X8I A;  4Z4V A;  2V4D A;  2JDI A;  1CNF A;  3A8K A;  5FO1 A;  2J7K A;  5KSW B;  1QVF B;  4YAU A;  2OBS A;  4UZE A;  4RPD A;  1BJK A;  2VNK A;  1QGA A;  1TTT A;  3OEH A;  1VQO B;  4B4D A;  3P26 A;  4YEJ A;  3V76 A;  4II3 A;  4Z1M A;  5J35 A;  2HMA A;  4B3G A;  2BF4 A;  2XZP A;  3GVJ A;  1KC8 D;  2QGG A;  3OW7 A;  1QUE A;  3V7A A;  1BX1 A;  1WSR A;  1I8D A;  1D2E A;  3A1P A;  2GRE A;  1W87 A;  3OE7 A;  2QEX B;  1EFU A;  1JA1 A;  1JA0 A;  1GVH A;  3ZUG A;  3PVD A;  2X0K A;  1R5B A;  2V7Q A;  4Y7C A;  1KQS B;  2B7B A;  2DER A;  3ONU A;  3CW2 A;  5IYQ A;  5F4M A;  4FK8 A;  2V7U A;  4TMW A;  5B6I A;  2F43 A;  4QUZ A;  3OAA A;  3BQJ A;  2WYR A;  3P27 A;  1GAQ A;  2GJK A;  2V7X A;  1QUF A;  2Z6B D;  3LQE A;  2BGI A;  5EMN A;  2OBT A;  2V7V A;  1N05 A;  3CC7 B;  1Q9S A;  4Z4T A;  2WZP P;  4XNF A;  4FN5 A;  3I56 B;  1IB0 A;  1N07 A;  5FIU A;  1E79 A;  2JIZ A;  3AVV A;  5TY0 A;  3Q38 A;  2ZIT A;  2OYN A;  3GQB A;  4PC6 A;  1N0U A;  4F7D A;  1KMH A;  3JQQ A;  2X85 A;  4B44 A;  3CC4 B;  1G7S A;  2CBX A;  4PC7 A;  1YJ9 B;  2W6I A;  3PEN A;  4LBV A;  3A8I A;  1V0F A;  5FO0 A;  3SLN A;  4YXW A;  4RLZ A;  1D1N A;  2WSS A;  3VNV A;  3T53 B;  4P6V F;  2QTL A;  1K9M D;  4WQM A;  1BMF A;  1YIJ B;  4RD1 A;  3ES9 A;  1QG0 A;  3U6B A;  4YAW A;  5GV7 A;  5A8A A;  2VZL A;  4RD6 A;  3W2H A;  2LZJ A;  4PC2 A;  4YEL A;  3WNC A;  4B3X A;  3G05 A;  2GJR A;  4OP7 A;  3OJW A;  4XMY A;  1WP6 A;  2C4U A;  4X06 A;  4YHB A;  1WOO A;  3WND A;  4P26 A;  3CMM A;  2QE7 A;  1S4M A;  3MMP A;  4XR6 A;  2ZTG A;  1OGJ A;  3VMF A;  1ZM9 A;  3CXC B;  1WPC A;  4TT3 A;  1AMO A;  1F60 A;  4Q7J B;  1BQE A;  1H85 A;  3LO8 A;  3CB4 A;  2D74 A;  2D3L A;  2XNJ A;  4FXU A;  1QGZ A;  1VHE A;  2QN6 A;  2ZL7 A;  1EFC A;  2FVG A;  5IYN A;  1HZE A;  5GV8 A;  3G71 B;  2E1B A;  1KD1 D;  3R6K A;  3CRZ A;  4OOS A;  1GJR A;  3ZZT A;  2CC2 A;  1TVC A;  2M5S A;  3CME B;  1VJS A;  2CF4 A;  3LVB A;  1Y0Y A;  4RPB A;  5BSX A;  3A3B A;  3SLD A;  4RD2 A;  2VBU A;  4UZU A;  1YX2 A;  4OOV A;  4PC1 A;  3FPP A;  3LQ6 A;  1Q7Y D;  2V7T A;  4G7W A;  4ZCM A;  2BN4 A;  3OW2 B;  5TV2 A;  1I18 A;  4YAO A;  1QFZ A;  2VBS A;  3CP8 A;  2EFG A;  4KKT A;  4XL9 A;  3AVU A;  3E20 A;  3JQP A;  2QMU A;  2JJ2 A;  2ZZF A;  1AIP A;  1KTV A;  4FWT A;  1E63 A;  2VNI A;  4U9U A;  4ZCL A;  4ACB A;  1UD6 A;  4HIZ A;  1T6X A;  3OOC A;  2F1M A;  3FKS A;  1N08 A;  1EXM A;  4RCY A;  5KNL A;  3CCS B;  5HXB A;  1WU8 A;  2X6Y A;  3PUN A;  1NB9 A;  2PIA A;  5H59 A;  1WOP A;  1DAR A;  2Q6L A;  4X7D A;  2C5B A;  3A3G A;  3W2I A;  4RD0 A;  1EP2 B;  1KJZ A;  2YWE A;  4QV2 A;  2WR8 A;  2ZZQ A;  4XKV A;  3ZZ0 A;  2B5O A;  2V7W A;  4DNR B;  2DET A;  4G1B A;  4ROX A;  3I1F A;  1MRZ A;  1N0V C;  1VF7 A;  1NBM A;  4XQF A;  4P2N A;  4RDJ A;  1NRK A;  2B7C A;  3OZU A;  3FPK A;  4NNJ A;  1YJN B;  1G7R A;  4RD3 A;  4XM3 A;  1UD2 A;  2ZXI A;  1G7C A;  2C2W A;  1I7P A;  1T6Z A;  2RC6 A;  2DIE A;  4M2L A;  3WBJ A;  1VQ4 B;  1FNM A;  3AST A;  1OB2 A;  4AVZ A;  1P4M A;  1DDI A;  1NB0 A;  4Z4U A; 
#chains in the Genus database with same CATH homology
 1IHM A;  4RDK A;  4X7F A;  3SEJ A;  4X7C A;  5HZA A;  4RDL A;  4P1V A;  3Q6R A;  3SLN A;  4RLZ A;  3ASQ A;  4Z4R A;  3D26 A;  5IYR A;  4QVA A;  4X7E A;  5HZB A;  5F4J A;  3PA1 A;  5J3O A;  4OP7 A;  5F4O A;  4RM0 A;  4X06 A;  4Z4Z A;  4P26 A;  2ZL6 A;  4X0C A;  3RY8 A;  4Z4Y A;  5IYW A;  3BY1 A;  4WZE A;  3Q6Q A;  3SJP A;  4OPO A;  4WZL A;  2ZL7 A;  4OOX A;  5KW9 A;  3ASP A;  4OPS A;  5IYN A;  3SKB A;  3PUM A;  3R6K A;  3PA2 A;  4OOS A;  4Z4V A;  4RPB A;  5BSX A;  2OBS A;  3SLD A;  4RPD A;  4OOV A;  3LQ6 A;  4Z4W A;  5J35 A;  3BY2 A;  4X07 A;  4P25 A;  3Q39 A;  2OBR A;  4P3I A;  3V7A A;  4WZK A;  3ASR A;  3ASS A;  5E6T A;  3PUN A;  3Q3A A;  3PVD A;  5BSY A;  4X7D A;  3ONU A;  4Z4S A;  4QVJ A;  5F4M A;  5IYQ A;  4QV2 A;  4QUZ A;  3BQJ A;  4P12 A;  4X05 A;  3R6J A;  4ROX A;  3LQE A;  4P2N A;  4RDJ A;  2OBT A;  4WZT A;  4Z4T A;  4OPV A;  5IYP A;  3AST A;  3Q38 A;  2ZL5 A;  3ONY A;  4Z4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...