5IYRA

Protruding domain of gii.4 human norovirus chdc2094 in complex with 2-fucosyllactose (2'fl)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
305
structure length
303
Chain Sequence
KPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTTQLSAVNICNFRGDVTRVGISHDYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGLLTQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDGHQNEPQQWVLPNYSGTSGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDCLLPQEWVSHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVIPPNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords GII.4 norovirus CHDC2094 capsid
publication title Structural basis for GII.4 norovirus inhibition by human milk oligosaccharides.
rcsb
source organism Norovirus hu/gii.4/chdc2094/1974/us
total genus 68
structure length 303
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5iyrA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5iyrA01
2ZL5A 3PA2A 5J3OA 4RLZA 5KW9A 4QVAA 3Q3AA 5BSYA 1IHMA 4X7CA 4X7FA 4WZTA 4X06A 4QVJA 4Z4UA 3V7AA 3R6KA 3ASPA 2OBSA 4RDKA 4Z4ZA 4OP7A 4OOVA 4X7EA 4X05A 5J35A 4RPBA 3PVDA 3LQEA 3ASQA 3ASTA 4OOXA 4ROXA 5HZBA 5E6TA 4X7DA 4Z4SA 5IYRA 4OPSA 3Q39A 4X0CA 3PUMA 3LQ6A 3Q6RA 4RDJA 3RY8A 3SKBA 3Q38A 3ONYA 5IYQA 4P2NA 3BY1A 3Q6QA 5IYNA 3ASRA 4WZEA 5IYPA 5HZAA 5IYWA 4WZLA 3SEJA 3ONUA 4Z4TA 3SJPA 3ASSA 4Z4RA 4RDLA 4P1VA 5F4JA 4OPOA 4Z4WA 3BY2A 3SLNA 4QUZA 5F4OA 4P25A 4P3IA 5BSXA 2OBRA 2ZL7A 2ZL6A 4Z4YA 4RPDA 3PUNA 4WZKA 3PA1A 3R6JA 4RM0A 4X07A 4P12A 4OOSA 4Z4VA 3SLDA 4QV2A 3D26A 4P26A 2OBTA 4OPVA 5F4MA 3BQJA
chains in the Genus database with same CATH superfamily
4YXWA 2BV3A 4PGOA 4ZCIA 1BMFA 3WBJA 1EFUA 3A8JA 4ZCMA 1VQPB 1RQPA 1Q7YD 1G7RA 4XNFA 1EFCA 5J3OA 2BVNA 2BMWA 2YWGA 3A1PA 3FPKA 2DETA 4G1BA 4LBZA 1UD8A 2ZBUA 1VQ7B 1QH0A 3B82A 5B6IA 3CCMB 3WQZA 1KJZA 1XFOA 4WZTA 4X06A 2DERA 1WP6A 3ZUGA 1ZM4A 4ZGNB 4RD1A 4E0FA 2QA4B 4B3XA 1B23P 1VHEA 3VR6A 4YEJA 4RCZA 3R6KA 3WY9A 4LBWA 1DARA 4Z4ZA 4M2LA 2DY1A 2D74A 1PJ6A 3SJZA 1UMKA 3E20A 3G6EB 3OZWA 4X05A 2ZZEA 5J35A 2ZITA 2VBVA 1XE1A 4AC9A 3LQEA 3ASTA 4OOXA 3QFSA 4XLHA 2YWFA 1W0JA 1WPCA 3WYAA 1Q82D 4RD4A 2BM0A 4UAJA 1KC8D 1MABA 2VNHA 1YJ9B 2C77A 2D3LA 2XZLA 4X0CA 2CNDA 2LZJA 3LQ6A 3Q6RA 1K8AD 1V0FA 3CPWB 3ZBTA 4YALA 3B8HA 1KK2A 3P26A 3OOCA 2W6JA 3V76A 4R71A 1D1NA 5CDFA 1YI2B 4BPRA 2VBUA 4YAFA 1YJNB 2QE7A 2XNDA 1VHOA 1JA1A 2WZPP 4TN1A 1R5NA 4XQFA 4XKWA 1N08A 4C0SA 3ASRA 4WZEA 3AGPA 4DNTB 4XR6A 1V0EA 3DDYA 1VQNB 3OFNA 2WSSA 1GAWA 4TMXA 2OTLB 1FRNA 3SEJA 4PC7A 1ZM9A 4XN0A 4GQNA 4Z4TA 3T53B 2XZPA 1IJEA 2HLDA 4AF6A 1GO2A 2V4DA 1WOOA 1M1KD 2QMUA 4ZCLA 4Z4RA 2V7QA 4RDLA 4XONA 4Z1MA 1ZM3A 1N07A 1BQEA 4Z4WA 3AVWA 3OEEA 4P3IA 2ZZQA 1T6ZA 2XNJA 2PE3A 4ACBA 4L8JA 3PUNA 3PA1A 1EP3B 4HE6A 2C78A 4P9SA 4ASUA 3MCAA 4YAOA 5L46A 1BPLA 3CMEB 2OTJB 4G7WA 3GQBA 4AVZA 2X3UA 1W0KA 2WR8A 1KTVA 3HAGA 1T5EA 3P27A 3SLDA 2M5SA 4QV2A 1UD4A 1KD1D 2NPFA 4P26A 1SKYB 1OGJA 2JJ2A 1E43A 1SKQA 1EWYA 2OBTA 1N0UA 1HZEA 4Y7CA 5F4MA 3WXMA 1COWA 4J0QA 2QN6A 4B44A 2C5HA 1MRZA 2C5BA 2E1RA 1KK3A 3G71B 3QFCA 2F1MA 4TMZA 1I8DA 3PENA 5KW9A 2BN4A 1N0VC 4QVAA 4HE5A 5TR9A 1E79A 5IK2A 2VJJA 4PC3A 1Y0RA 4ACAA 4X7CA 4X7FA 1E3XA 3CCEB 1EP1B 1EP2B 4XLAA 3U6BA 1FNMA 4TSFA 4QVJA 4Z4UA 3V7AA 3AVUA 1WU8A 3ASPA 4RD0A 4G1VA 1NB0A 2NV4A 4YELA 3CP2A 1YHQB 3BH4A 4OP7A 4DK0A 1NDHA 3ZC3A 4WQMA 1G7CA 1H42A 1WSVA 2B7CA 2PIAA 2JJ1A 3GVJA 2X6WA 4P6VF 4WWVA 2X0KA 4Q7JB 2R9VA 3ASQA 4YHBA 3CESA 3ZZTA 4B43A 4B48A 4X8IA 4P6YA 1T6YA 1I7PA 2HDNB 1IB0A 2P3MA 3H9NA 1E64A 1Y0YA 5H5JA 3CC7B 2VBTA 3OKXA 2HMAA 4NBSA 4OPSA 4XLEA 4MYUA 3PUMA 1WOSA 1E63A 3SKBA 4XN3A 3B78A 3CPXA 1WOPA 2CC2A 1UD5A 2JIZA 2QTLA 3CC2B 2C2WA 3VO2A 1VQMB 4YAUA 2DCUA 2JN9A 2OYNA 2ZXHA 3QE2A 5GV7A 1UD2A 1FNDA 1BX0A 3VO1A 4XM3A 4DNRB 1E3ZA 1QFZA 1U2RA 3QFTA 2GQFA 2VNJA 3WNDA 3AVYA 3AVXA 2KVOA 4DQLA 1VQ4B 4N3NA 2FX3A 2ZXIA 3OPOA 2X6YA 4XL9A 1N05A 3CCQB 1F60A 2GK7A 4KKSA 3FPPA 5FA6A 2V7VA 2XNCA 3KL9A 2B7BA 1WORA 1GR1A 2GK6A 4YAWA 4OPOA 4TKOB 2JDIA 3ES9A 2V31A 3I55B 4RD3A 3SLNA 4U9UA 2VJIA 1CNFA 5FNZA 1VQKB 1JA0A 2OK8A 1F20A 2ZL6A 3A3GA 4RPDA 4RD2A 1JJ2B 2YWEA 3LO8A 2F4NA 4HIZA 1H8HA 4RM0A 1WTHD 4UZFA 3W2EA 1VLYA 1OB0A 1W34A 1GAQA 2QEXB 4G5GA 2Z6BD 3OZUA 4P12A 1SM4A 2ZTGA 3OE7A 1KK1A 1QFJA 5GV8A 5FL7A 2QDXA 2R6HA 2X8KA 4M1KA 3OAAA 3LNNA 5KSWB 1QX4A 2XOKA 1BJKA 3CTAA 1G7SA 4B47A 1AIPA 2ZL5A 3PA2A 2C4UA 3U2QA 3CCLB 3KEWA 4ZV4A 3CCRB 1S0UA 2EFGA 3AVVA 4P22A 4RLZA 1FX0A 5THXA 2ZZFA 4TMWA 1FDRA 3VNVA 4LC0A 2Q6LA 5BSYA 1IHMA 3JQQA 1P4MA 4RD6A 2V7UA 4NNJA 2AHOA 1HVXA 4II3A 4QFMA 2C4TA 4PC6A 3A8KA 2CW5A 2DEUA 2V7XA 1S4MA 1WSRA 3E1YE 4RDKA 3AVTA 4NCNA 1W9XA 3OW2B 1VQ5B 1Q86D 2RC6A 4OOVA 2ZTNA 1D2EA 3CW2A 4XLCA 4RPBA 3PVDA 1YX2A 1W35A 3NE5B 3W5VA 2YWHA 1YIJB 2X6XA 2BGIA 4XD7A 5A89A 5HKKA 4ROXA 4KKTA 1AMOA 1GJRA 5HZBA 5E6TA 1BX1A 2VBSA 3OW7A 4X7DA 1OHHA 4FXUA 4XMYA 2FVGA 1M90D 5IYRA 4ZGQB 1E1RA 1Q81D 3Q39A 2Q6IA 1S72B 5FIUA 3OP1A 2CRVA 2ZZGA 4RDJA 3QSYA 1ELOA 1EFTA 5DS0A 3JQRA 4PABA 4RCYA 1WDTA 1QGYA 4TMTA 1KQSB 3ISXA 3I1FA 5HXBA 4KKUA 3GVKA 3OEHA 2D9RA 4CQJA 3J81k 3QFRA 1EFRA 5HZAA 2BM1A 3FKSA 3WNCA 3G4SB 2QGGA 3AGQA 4N3GA 1ZUNB 1KZLA 3ZIAA 1A8PA 1FRQA 1IJFA 4AF7A 3ONUA 1N06A 4Y9RA 2Q6KA 4QHYA 3T56B 4LBYA 2XZOA 1VLOA 3ASSA 1GVHA 1OB2A 4FWTA 4JMQA 4XORA 4P1VA 1YLOA 5F4JA 3A35A 1KK0A 3BY2A 4XOPA 2CBXA 5FO0A 2Q6OA 4XKVA 5F4OA 4P25A 3W2FA 1KMHA 1DG1G 1VQ6B 2OBRA 3CB4A 4F7DA 5DSZA 3ZPNA 4Z4YA 2V7TA 4WZKA 3I56B 4II2A 2EIXA 1VJSA 4C43A 1NB9A 1CNEA 3CD6B 1XB2A 1PJ7A 1R5BA 1W87A 4Y9UA 3JQPA 2VNKA 3BCDA 1VQLB 4OOSA 1JNYA 4Z4VA 1H85A 1YJWB 3GVLA 1PJ5A 2XGJA 2WZNA 3T51B 3D26A 3CCSB 1YITB 1NBMA 3OZVA 3CRZA 5EMNA 2W6IA 3OJXA 5H59A 4H9GA 5DN6A 1NJID 2ZBVA 4B4DA 5JBQA 1OGIA 1UD3A 2F43A 4M0LA 4P3YA 4TT3A 1QVGB 1H8EA 3GSIA 1OB5A 2WPDA 5TRDA 4XLFA 2X53S 4MYTA 1DDIA 1JB9A 3Q3AA 2DOGA 2PLFA 2WJVA 2XEXA 1KRHA 3ZBUA 1BLIA 1V5VA 4UZUA 1G7TA 1Q9SA 3W5HA 3WBKA 1QGAA 3W2HA 1DDGA 1HA3A 2OBSA 1E62A 2X85A 2BGJA 2J7KA 4PAAA 4X7EA 4B3FX 2DYIA 4DK1A 4K1XA 1XQBA 1K28D 2GJPA 2V7WA 2GPJA 1TVCA 1B2RA 4G6IA 2GJRA 4LBVA 4EH1A 1VQ9B 1VF7A 4Z4SA 1PKVA 1QUEA 4M4SA 1D8TA 1ZM2A 3CP8A 3RY8A 2BF4A 5A88A 1R5OA 3Q38A 4M53A 3MMPA 3CCJB 3ONYA 5IYQA 1QG0A 2OK7A 1EXMA 5TY0A 4P2NA 2HCJB 3BY1A 1TTTA 1VQ8B 3Q6QA 1E1QA 2GJKA 1CQXA 4UZEA 3W2GA 3VNUA 1W2BB 2WYRA 1QFYA 5IYNA 1I18A 2PMDA 3WNBA 3BC9A 3CC4B 5IYPA 3BNWA 4RJLA 3H94A 1FNCA 2B5OA 2F1LA 2VYQA 1J9ZA 5AN9A 3MHPA 3GIRA 5IYWA 3ZZUA 4WZLA 1TUIA 3A3BA 4G7XA 1QGZA 1T6XA 2CK3A 5FO1A 2GREA 2RC5A 3W5UA 2BSAA 4FK8A 2VZLA 3SJPA 1QVFB 3G05A 1QUFA 2CF4A 5A8AA 2I1LA 3FJOA 3CCVB 3VMFA 3JU4A 2WJYA 4QUZA 5BSXA 2E1BA 3W2IA 4DQKA 3OJWA 5KNLA 2ZL7A 4PC2A 2QTZA 3A8IA 3ZZ0A 2BPOA 3CMMA 1N8RD 1NRKA 3R6JA 1VQOB 4B3GA 4IW3B 1FNBA 1RQRA 3LVBA 4TMVA 3BCFA 3CMAB 3CCUB 3U6KA 4X07A 1K73D 1TLLA 4FN5A 1K9MD 3CXCB 5LMZA 5TV2A 2D3NA 1UD6A 2DIEA 4OPVA 4XOTA 4PC1A 2VNIA 3BQJA
chains in the Genus database with same CATH topology
2ZL5A 3PA2A 5J3OA 4RLZA 5KW9A 4QVAA 3Q3AA 5BSYA 1IHMA 4X7CA 4X7FA 4WZTA 4X06A 4QVJA 4Z4UA 3V7AA 3R6KA 3ASPA 2OBSA 4RDKA 4Z4ZA 4OP7A 4OOVA 4X7EA 4X05A 5J35A 4RPBA 3PVDA 3LQEA 3ASQA 3ASTA 4OOXA 4ROXA 5HZBA 5E6TA 4X7DA 4Z4SA 5IYRA 4OPSA 3Q39A 4X0CA 3PUMA 3LQ6A 3Q6RA 4RDJA 3RY8A 3SKBA 3Q38A 3ONYA 5IYQA 4P2NA 3BY1A 3Q6QA 5IYNA 3ASRA 4WZEA 5IYPA 5HZAA 5IYWA 4WZLA 3SEJA 3ONUA 4Z4TA 3SJPA 3ASSA 4Z4RA 4RDLA 4P1VA 5F4JA 4OPOA 4Z4WA 3BY2A 3SLNA 4QUZA 5F4OA 4P25A 4P3IA 5BSXA 2OBRA 2ZL7A 2ZL6A 4Z4YA 4RPDA 3PUNA 4WZKA 3PA1A 3R6JA 4RM0A 4X07A 4P12A 4OOSA 4Z4VA 3SLDA 4QV2A 3D26A 4P26A 2OBTA 4OPVA 5F4MA 3BQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZL5 A;  3PA2 A;  5J3O A;  4RLZ A;  5KW9 A;  4QVA A;  3Q3A A;  5BSY A;  1IHM A;  4X7C A;  4X7F A;  4WZT A;  4X06 A;  4QVJ A;  4Z4U A;  3V7A A;  3R6K A;  3ASP A;  2OBS A;  4RDK A;  4Z4Z A;  4OP7 A;  4OOV A;  4X7E A;  4X05 A;  5J35 A;  4RPB A;  3PVD A;  3LQE A;  3ASQ A;  3AST A;  4OOX A;  4ROX A;  5HZB A;  5E6T A;  4X7D A;  4Z4S A;  5IYR A;  4OPS A;  3Q39 A;  4X0C A;  3PUM A;  3LQ6 A;  3Q6R A;  4RDJ A;  3RY8 A;  3SKB A;  3Q38 A;  3ONY A;  5IYQ A;  4P2N A;  3BY1 A;  3Q6Q A;  5IYN A;  3ASR A;  4WZE A;  5IYP A;  5HZA A;  5IYW A;  4WZL A;  3SEJ A;  3ONU A;  4Z4T A;  3SJP A;  3ASS A;  4Z4R A;  4RDL A;  4P1V A;  5F4J A;  4OPO A;  4Z4W A;  3BY2 A;  3SLN A;  4QUZ A;  5F4O A;  4P25 A;  4P3I A;  5BSX A;  2OBR A;  2ZL7 A;  2ZL6 A;  4Z4Y A;  4RPD A;  3PUN A;  4WZK A;  3PA1 A;  3R6J A;  4RM0 A;  4X07 A;  4P12 A;  4OOS A;  4Z4V A;  3SLD A;  4QV2 A;  3D26 A;  4P26 A;  2OBT A;  4OPV A;  5F4M A;  3BQJ A; 
#chains in the Genus database with same CATH topology
 4YXW A;  2BV3 A;  4PGO A;  4ZCI A;  1BMF A;  3WBJ A;  1EFU A;  3A8J A;  4ZCM A;  1VQP B;  1RQP A;  1Q7Y D;  1G7R A;  4XNF A;  1EFC A;  5J3O A;  2BVN A;  2BMW A;  2YWG A;  3A1P A;  3FPK A;  2DET A;  4G1B A;  4LBZ A;  1UD8 A;  2ZBU A;  1VQ7 B;  1QH0 A;  3B82 A;  5B6I A;  3CCM B;  3WQZ A;  1KJZ A;  1XFO A;  4WZT A;  4X06 A;  2DER A;  1WP6 A;  3ZUG A;  1ZM4 A;  4ZGN B;  4RD1 A;  4E0F A;  2QA4 B;  4B3X A;  1B23 P;  1VHE A;  3VR6 A;  4YEJ A;  4RCZ A;  3R6K A;  3WY9 A;  4LBW A;  1DAR A;  4Z4Z A;  4M2L A;  2DY1 A;  2D74 A;  1PJ6 A;  3SJZ A;  1UMK A;  3E20 A;  3G6E B;  3OZW A;  4X05 A;  2ZZE A;  5J35 A;  2ZIT A;  2VBV A;  1XE1 A;  4AC9 A;  3LQE A;  3AST A;  4OOX A;  3QFS A;  4XLH A;  2YWF A;  1W0J A;  1WPC A;  3WYA A;  1Q82 D;  4RD4 A;  2BM0 A;  4UAJ A;  1KC8 D;  1MAB A;  2VNH A;  1YJ9 B;  2C77 A;  2D3L A;  2XZL A;  4X0C A;  2CND A;  2LZJ A;  3LQ6 A;  3Q6R A;  1K8A D;  1V0F A;  3CPW B;  3ZBT A;  4YAL A;  3B8H A;  1KK2 A;  3P26 A;  3OOC A;  2W6J A;  3V76 A;  4R71 A;  1D1N A;  5CDF A;  1YI2 B;  4BPR A;  2VBU A;  4YAF A;  1YJN B;  2QE7 A;  2XND A;  1VHO A;  1JA1 A;  2WZP P;  4TN1 A;  1R5N A;  4XQF A;  4XKW A;  1N08 A;  4C0S A;  3ASR A;  4WZE A;  3AGP A;  4DNT B;  4XR6 A;  1V0E A;  3DDY A;  1VQN B;  3OFN A;  2WSS A;  1GAW A;  4TMX A;  2OTL B;  1FRN A;  3SEJ A;  4PC7 A;  1ZM9 A;  4XN0 A;  4GQN A;  4Z4T A;  3T53 B;  2XZP A;  1IJE A;  2HLD A;  4AF6 A;  1GO2 A;  2V4D A;  1WOO A;  1M1K D;  2QMU A;  4ZCL A;  4Z4R A;  2V7Q A;  4RDL A;  4XON A;  4Z1M A;  1ZM3 A;  1N07 A;  1BQE A;  4Z4W A;  3AVW A;  3OEE A;  4P3I A;  2ZZQ A;  1T6Z A;  2XNJ A;  2PE3 A;  4ACB A;  4L8J A;  3PUN A;  3PA1 A;  1EP3 B;  4HE6 A;  2C78 A;  4P9S A;  4ASU A;  3MCA A;  4YAO A;  5L46 A;  1BPL A;  3CME B;  2OTJ B;  4G7W A;  3GQB A;  4AVZ A;  2X3U A;  1W0K A;  2WR8 A;  1KTV A;  3HAG A;  1T5E A;  3P27 A;  3SLD A;  2M5S A;  4QV2 A;  1UD4 A;  1KD1 D;  2NPF A;  4P26 A;  1SKY B;  1OGJ A;  2JJ2 A;  1E43 A;  1SKQ A;  1EWY A;  2OBT A;  1N0U A;  1HZE A;  4Y7C A;  5F4M A;  3WXM A;  1COW A;  4J0Q A;  2QN6 A;  4B44 A;  2C5H A;  1MRZ A;  2C5B A;  2E1R A;  1KK3 A;  3G71 B;  3QFC A;  2F1M A;  4TMZ A;  1I8D A;  3PEN A;  5KW9 A;  2BN4 A;  1N0V C;  4QVA A;  4HE5 A;  5TR9 A;  1E79 A;  5IK2 A;  2VJJ A;  4PC3 A;  1Y0R A;  4ACA A;  4X7C A;  4X7F A;  1E3X A;  3CCE B;  1EP1 B;  1EP2 B;  4XLA A;  3U6B A;  1FNM A;  4TSF A;  4QVJ A;  4Z4U A;  3V7A A;  3AVU A;  1WU8 A;  3ASP A;  4RD0 A;  4G1V A;  1NB0 A;  2NV4 A;  4YEL A;  3CP2 A;  1YHQ B;  3BH4 A;  4OP7 A;  4DK0 A;  1NDH A;  3ZC3 A;  4WQM A;  1G7C A;  1H42 A;  1WSV A;  2B7C A;  2PIA A;  2JJ1 A;  3GVJ A;  2X6W A;  4P6V F;  4WWV A;  2X0K A;  4Q7J B;  2R9V A;  3ASQ A;  4YHB A;  3CES A;  3ZZT A;  4B43 A;  4B48 A;  4X8I A;  4P6Y A;  1T6Y A;  1I7P A;  2HDN B;  1IB0 A;  2P3M A;  3H9N A;  1E64 A;  1Y0Y A;  5H5J A;  3CC7 B;  2VBT A;  3OKX A;  2HMA A;  4NBS A;  4OPS A;  4XLE A;  4MYU A;  3PUM A;  1WOS A;  1E63 A;  3SKB A;  4XN3 A;  3B78 A;  3CPX A;  1WOP A;  2CC2 A;  1UD5 A;  2JIZ A;  2QTL A;  3CC2 B;  2C2W A;  3VO2 A;  1VQM B;  4YAU A;  2DCU A;  2JN9 A;  2OYN A;  2ZXH A;  3QE2 A;  5GV7 A;  1UD2 A;  1FND A;  1BX0 A;  3VO1 A;  4XM3 A;  4DNR B;  1E3Z A;  1QFZ A;  1U2R A;  3QFT A;  2GQF A;  2VNJ A;  3WND A;  3AVY A;  3AVX A;  2KVO A;  4DQL A;  1VQ4 B;  4N3N A;  2FX3 A;  2ZXI A;  3OPO A;  2X6Y A;  4XL9 A;  1N05 A;  3CCQ B;  1F60 A;  2GK7 A;  4KKS A;  3FPP A;  5FA6 A;  2V7V A;  2XNC A;  3KL9 A;  2B7B A;  1WOR A;  1GR1 A;  2GK6 A;  4YAW A;  4OPO A;  4TKO B;  2JDI A;  3ES9 A;  2V31 A;  3I55 B;  4RD3 A;  3SLN A;  4U9U A;  2VJI A;  1CNF A;  5FNZ A;  1VQK B;  1JA0 A;  2OK8 A;  1F20 A;  2ZL6 A;  3A3G A;  4RPD A;  4RD2 A;  1JJ2 B;  2YWE A;  3LO8 A;  2F4N A;  4HIZ A;  1H8H A;  4RM0 A;  1WTH D;  4UZF A;  3W2E A;  1VLY A;  1OB0 A;  1W34 A;  1GAQ A;  2QEX B;  4G5G A;  2Z6B D;  3OZU A;  4P12 A;  1SM4 A;  2ZTG A;  3OE7 A;  1KK1 A;  1QFJ A;  5GV8 A;  5FL7 A;  2QDX A;  2R6H A;  2X8K A;  4M1K A;  3OAA A;  3LNN A;  5KSW B;  1QX4 A;  2XOK A;  1BJK A;  3CTA A;  1G7S A;  4B47 A;  1AIP A;  2ZL5 A;  3PA2 A;  2C4U A;  3U2Q A;  3CCL B;  3KEW A;  4ZV4 A;  3CCR B;  1S0U A;  2EFG A;  3AVV A;  4P22 A;  4RLZ A;  1FX0 A;  5THX A;  2ZZF A;  4TMW A;  1FDR A;  3VNV A;  4LC0 A;  2Q6L A;  5BSY A;  1IHM A;  3JQQ A;  1P4M A;  4RD6 A;  2V7U A;  4NNJ A;  2AHO A;  1HVX A;  4II3 A;  4QFM A;  2C4T A;  4PC6 A;  3A8K A;  2CW5 A;  2DEU A;  2V7X A;  1S4M A;  1WSR A;  3E1Y E;  4RDK A;  3AVT A;  4NCN A;  1W9X A;  3OW2 B;  1VQ5 B;  1Q86 D;  2RC6 A;  4OOV A;  2ZTN A;  1D2E A;  3CW2 A;  4XLC A;  4RPB A;  3PVD A;  1YX2 A;  1W35 A;  3NE5 B;  3W5V A;  2YWH A;  1YIJ B;  2X6X A;  2BGI A;  4XD7 A;  5A89 A;  5HKK A;  4ROX A;  4KKT A;  1AMO A;  1GJR A;  5HZB A;  5E6T A;  1BX1 A;  2VBS A;  3OW7 A;  4X7D A;  1OHH A;  4FXU A;  4XMY A;  2FVG A;  1M90 D;  5IYR A;  4ZGQ B;  1E1R A;  1Q81 D;  3Q39 A;  2Q6I A;  1S72 B;  5FIU A;  3OP1 A;  2CRV A;  2ZZG A;  4RDJ A;  3QSY A;  1ELO A;  1EFT A;  5DS0 A;  3JQR A;  4PAB A;  4RCY A;  1WDT A;  1QGY A;  4TMT A;  1KQS B;  3ISX A;  3I1F A;  5HXB A;  4KKU A;  3GVK A;  3OEH A;  2D9R A;  4CQJ A;  3J81 k;  3QFR A;  1EFR A;  5HZA A;  2BM1 A;  3FKS A;  3WNC A;  3G4S B;  2QGG A;  3AGQ A;  4N3G A;  1ZUN B;  1KZL A;  3ZIA A;  1A8P A;  1FRQ A;  1IJF A;  4AF7 A;  3ONU A;  1N06 A;  4Y9R A;  2Q6K A;  4QHY A;  3T56 B;  4LBY A;  2XZO A;  1VLO A;  3ASS A;  1GVH A;  1OB2 A;  4FWT A;  4JMQ A;  4XOR A;  4P1V A;  1YLO A;  5F4J A;  3A35 A;  1KK0 A;  3BY2 A;  4XOP A;  2CBX A;  5FO0 A;  2Q6O A;  4XKV A;  5F4O A;  4P25 A;  3W2F A;  1KMH A;  1DG1 G;  1VQ6 B;  2OBR A;  3CB4 A;  4F7D A;  5DSZ A;  3ZPN A;  4Z4Y A;  2V7T A;  4WZK A;  3I56 B;  4II2 A;  2EIX A;  1VJS A;  4C43 A;  1NB9 A;  1CNE A;  3CD6 B;  1XB2 A;  1PJ7 A;  1R5B A;  1W87 A;  4Y9U A;  3JQP A;  2VNK A;  3BCD A;  1VQL B;  4OOS A;  1JNY A;  4Z4V A;  1H85 A;  1YJW B;  3GVL A;  1PJ5 A;  2XGJ A;  2WZN A;  3T51 B;  3D26 A;  3CCS B;  1YIT B;  1NBM A;  3OZV A;  3CRZ A;  5EMN A;  2W6I A;  3OJX A;  5H59 A;  4H9G A;  5DN6 A;  1NJI D;  2ZBV A;  4B4D A;  5JBQ A;  1OGI A;  1UD3 A;  2F43 A;  4M0L A;  4P3Y A;  4TT3 A;  1QVG B;  1H8E A;  3GSI A;  1OB5 A;  2WPD A;  5TRD A;  4XLF A;  2X53 S;  4MYT A;  1DDI A;  1JB9 A;  3Q3A A;  2DOG A;  2PLF A;  2WJV A;  2XEX A;  1KRH A;  3ZBU A;  1BLI A;  1V5V A;  4UZU A;  1G7T A;  1Q9S A;  3W5H A;  3WBK A;  1QGA A;  3W2H A;  1DDG A;  1HA3 A;  2OBS A;  1E62 A;  2X85 A;  2BGJ A;  2J7K A;  4PAA A;  4X7E A;  4B3F X;  2DYI A;  4DK1 A;  4K1X A;  1XQB A;  1K28 D;  2GJP A;  2V7W A;  2GPJ A;  1TVC A;  1B2R A;  4G6I A;  2GJR A;  4LBV A;  4EH1 A;  1VQ9 B;  1VF7 A;  4Z4S A;  1PKV A;  1QUE A;  4M4S A;  1D8T A;  1ZM2 A;  3CP8 A;  3RY8 A;  2BF4 A;  5A88 A;  1R5O A;  3Q38 A;  4M53 A;  3MMP A;  3CCJ B;  3ONY A;  5IYQ A;  1QG0 A;  2OK7 A;  1EXM A;  5TY0 A;  4P2N A;  2HCJ B;  3BY1 A;  1TTT A;  1VQ8 B;  3Q6Q A;  1E1Q A;  2GJK A;  1CQX A;  4UZE A;  3W2G A;  3VNU A;  1W2B B;  2WYR A;  1QFY A;  5IYN A;  1I18 A;  2PMD A;  3WNB A;  3BC9 A;  3CC4 B;  5IYP A;  3BNW A;  4RJL A;  3H94 A;  1FNC A;  2B5O A;  2F1L A;  2VYQ A;  1J9Z A;  5AN9 A;  3MHP A;  3GIR A;  5IYW A;  3ZZU A;  4WZL A;  1TUI A;  3A3B A;  4G7X A;  1QGZ A;  1T6X A;  2CK3 A;  5FO1 A;  2GRE A;  2RC5 A;  3W5U A;  2BSA A;  4FK8 A;  2VZL A;  3SJP A;  1QVF B;  3G05 A;  1QUF A;  2CF4 A;  5A8A A;  2I1L A;  3FJO A;  3CCV B;  3VMF A;  3JU4 A;  2WJY A;  4QUZ A;  5BSX A;  2E1B A;  3W2I A;  4DQK A;  3OJW A;  5KNL A;  2ZL7 A;  4PC2 A;  2QTZ A;  3A8I A;  3ZZ0 A;  2BPO A;  3CMM A;  1N8R D;  1NRK A;  3R6J A;  1VQO B;  4B3G A;  4IW3 B;  1FNB A;  1RQR A;  3LVB A;  4TMV A;  3BCF A;  3CMA B;  3CCU B;  3U6K A;  4X07 A;  1K73 D;  1TLL A;  4FN5 A;  1K9M D;  3CXC B;  5LMZ A;  5TV2 A;  2D3N A;  1UD6 A;  2DIE A;  4OPV A;  4XOT A;  4PC1 A;  2VNI A;  3BQJ A; 
#chains in the Genus database with same CATH homology
 2ZL5 A;  3PA2 A;  5J3O A;  4RLZ A;  5KW9 A;  4QVA A;  3Q3A A;  5BSY A;  1IHM A;  4X7C A;  4X7F A;  4WZT A;  4X06 A;  4QVJ A;  4Z4U A;  3V7A A;  3R6K A;  3ASP A;  2OBS A;  4RDK A;  4Z4Z A;  4OP7 A;  4OOV A;  4X7E A;  4X05 A;  5J35 A;  4RPB A;  3PVD A;  3LQE A;  3ASQ A;  3AST A;  4OOX A;  4ROX A;  5HZB A;  5E6T A;  4X7D A;  4Z4S A;  5IYR A;  4OPS A;  3Q39 A;  4X0C A;  3PUM A;  3LQ6 A;  3Q6R A;  4RDJ A;  3RY8 A;  3SKB A;  3Q38 A;  3ONY A;  5IYQ A;  4P2N A;  3BY1 A;  3Q6Q A;  5IYN A;  3ASR A;  4WZE A;  5IYP A;  5HZA A;  5IYW A;  4WZL A;  3SEJ A;  3ONU A;  4Z4T A;  3SJP A;  3ASS A;  4Z4R A;  4RDL A;  4P1V A;  5F4J A;  4OPO A;  4Z4W A;  3BY2 A;  3SLN A;  4QUZ A;  5F4O A;  4P25 A;  4P3I A;  5BSX A;  2OBR A;  2ZL7 A;  2ZL6 A;  4Z4Y A;  4RPD A;  3PUN A;  4WZK A;  3PA1 A;  3R6J A;  4RM0 A;  4X07 A;  4P12 A;  4OOS A;  4Z4V A;  3SLD A;  4QV2 A;  3D26 A;  4P26 A;  2OBT A;  4OPV A;  5F4M A;  3BQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...