5IYRA

Protruding domain of gii.4 human norovirus chdc2094 in complex with 2-fucosyllactose (2'fl)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
305
structure length
303
Chain Sequence
KPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTTQLSAVNICNFRGDVTRVGISHDYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGLLTQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDGHQNEPQQWVLPNYSGTSGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDCLLPQEWVSHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVIPPNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GII.4 norovirus CHDC2094 capsid
publication title Structural basis for GII.4 norovirus inhibition by human milk oligosaccharides.
rcsb
source organism Norovirus hu/gii.4/chdc2094/1974/us
molecule tags Viral protein
total genus 68
structure length 303
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5iyrA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5iyrA01
5J3OA 4Z4YA 5BSYA 3ONUA 5BSXA 1IHMA 4OOSA 4RM0A 3BY1A 4X05A 3R6JA 4WZEA 4X07A 3PUNA 4OPOA 3SLDA 4P3IA 3PA2A 4P26A 2OBSA 3ASQA 4X0CA 3PA1A 4P12A 4RDKA 5KW9A 5F4JA 5IYRA 3ASPA 4Z4UA 5IYQA 4Z4WA 5F4OA 4P1VA 3Q6RA 3Q6QA 4X7DA 3LQEA 4ROXA 2OBRA 3D26A 4RDJA 3SKBA 4QUZA 4WZKA 3Q38A 4OPVA 3Q3AA 4Z4SA 3V7AA 5IYWA 4X7FA 4Z4TA 3BQJA 3ASSA 4X7EA 3RY8A 4Z4ZA 5E6TA 4X06A 4QV2A 3SLNA 5IYPA 2ZL5A 3ASRA 4Z4VA 4X7CA 3SJPA 2OBTA 4RPBA 4OOVA 3LQ6A 3PUMA 4OP7A 4OOXA 4QVAA 3R6KA 4QVJA 3ONYA 4RPDA 2ZL6A 3BY2A 4P2NA 4WZLA 5HZBA 2ZL7A 3PVDA 4RLZA 3SEJA 3ASTA 4P25A 5IYNA 4WZTA 5F4MA 5J35A 5HZAA 3Q39A 4OPSA 4RDLA 4Z4RA
chains in the Genus database with same CATH superfamily
5J3OA 4Z4YA 1TVCA 1QFZA 2X85A 1UD6A 1Q86D 2Q6LA 4RM0A 3BY1A 2WSSA 1U2RA 1JA1A 3CP8A 1W34A 4RD6A 2Q6OA 1R5BA 4P6VF 2C4UA 3FPKA 2AHOA 4B3XA 3G4SB 3PA2A 2X53S 4P9SA 1AIPA 2OBSA 3ASQA 1ZM3A 3A8JA 1QH0A 2BF4A 2XGJA 1FNDA 5FA6A 1K9MD 4ZCLA 2YWFA 1VQ6B 4XLEA 1VQ8B 3OW7A 3CCQB 3OEHA 1HA3A 1FDRA 2ZITA 3OKXA 5KW9A 3J81k 2PMDA 3JQRA 4TMWA 1CQXA 4M4SA 1XQBA 2CF4A 1ZM4A 3P26A 2BVNA 3OZWA 5IYQA 3OW2B 2DEUA 1VJSA 4Z4WA 3WBKA 3U6KA 1BQEA 3LNNA 4B48A 4UZEA 4XNFA 3Q6RA 2V31A 4LC0A 1NBMA 1W35A 3OZUA 1YJWB 1SM4A 1QVFB 2OTLB 4M0LA 1IJEA 2GJRA 2QA4B 3W2GA 4H9GA 2ZTGA 3OEEA 1PKVA 2OBRA 2QEXB 4TT3A 4UAJA 4C43A 3H9NA 2ZZGA 3OAAA 4E0FA 3GVKA 1XFOA 4XQFA 4N3NA 3WNCA 2DERA 3W2EA 1CNEA 2V7UA 3CC2B 2GJPA 2VNKA 4G7XA 4Q7JB 2B5OA 2VBTA 1H8EA 3BQJA 3CMMA 3ASSA 3MMPA 2VBVA 4Z4ZA 5E6TA 3QE2A 3SLNA 2X6YA 2ZBUA 3I1FA 4X7CA 1E1RA 1QFYA 2DOGA 2BPOA 3HAGA 2ZXIA 2WZPP 3QFCA 3SJPA 3CC7B 4XN0A 2B7BA 4WQMA 1VLYA 3FPPA 2R6HA 3QFRA 4MYTA 4P3YA 2F1LA 4PC6A 4PGOA 3ZBUA 1Y0YA 4DQLA 5DS0A 3QSYA 4Z1MA 3VMFA 1WSVA 2ZZQA 2Q6KA 3CB4A 3I55B 2WJVA 1VQ9B 3CCMB 4NNJA 5TR9A 1MRZA 4P6YA 2CRVA 3OJWA 2WR8A 2M5SA 1DDGA 3BY2A 4P2NA 4PC2A 2CC2A 4ZGNB 2W6IA 4M1KA 1EFRA 3PVDA 2XNJA 4YELA 1SKYB 1D2EA 3QFSA 4G7WA 4RLZA 2Q6IA 3OFNA 1E64A 3OE7A 3A1PA 1K8AD 5IYNA 3W5VA 3OOCA 3CP2A 3JQPA 1VQKB 2X6WA 5HZAA 3Q39A 4OPSA 2JJ1A 4RDLA 1QGYA 3AVYA 1UD8A 5BSYA 2BM1A 1IHMA 2D9RA 2YWEA 1BJKA 4XKWA 5BSXA 4J0QA 4UZFA 1K28D 3R6JA 4WZEA 3CMAB 2PLFA 2V7QA 1S72B 2ZXHA 1NRKA 3ZZTA 1OGJA 2ZZFA 4AVZA 4TMZA 3ZIAA 1EXMA 4CQJA 1VQ4B 5HXBA 4RD1A 3G6EB 3U2QA 1WOSA 2GK6A 3A8IA 1S0UA 4FK8A 4P12A 4FXUA 2F43A 1KRHA 3CXCB 1CNFA 5DSZA 2V7TA 3WYAA 1P4MA 2HMAA 4YEJA 4B44A 4Z4UA 5TV2A 1W2BB 4TN1A 2CBXA 1VQ7B 4B4DA 3CD6B 2BV3A 3CC4B 4AF7A 2F1MA 3CMEB 4Y7CA 4TMTA 4ZV4A 2NV4A 2X3UA 3D26A 2DYIA 1YIJB 1I8DA 3SKBA 4QUZA 3NE5B 1BLIA 4WZKA 2E1RA 1HVXA 2BSAA 2C5HA 4Z4SA 1D8TA 3V7AA 5IYWA 4PC3A 4Z4TA 4ZCMA 2VNIA 1TUIA 2V4DA 3CCJB 3FJOA 4QHYA 1YLOA 1N0UA 1EP1B 1KK3A 1YX2A 2YWHA 4Z4VA 3CCVB 1PJ5A 2GQFA 2C77A 1OB5A 3CPXA 2C78A 2QTLA 1JA0A 3A35A 3OJXA 4DK1A 1E62A 3GSIA 1M1KD 2V7XA 2QGGA 3CPWB 1UD5A 1VF7A 1VHEA 5A89A 4TKOB 2OTJB 3LQ6A 3CCLB 1AMOA 3E20A 1WP6A 2DIEA 1KK2A 3U6BA 3BNWA 5GV8A 4EH1A 1UD2A 3H94A 4M53A 4QVAA 4C0SA 1WSRA 1TTTA 1N06A 3WNBA 2I1LA 4II3A 2XOKA 2ZL7A 4RD4A 5HZBA 4FN5A 1IJFA 1FNMA 4XOTA 2HDNB 3ZC3A 2C5BA 2RC6A 3ASTA 1V0EA 1KK0A 1IB0A 2RC5A 5F4MA 1ZM2A 2QTZA 1RQRA 4ZCIA 2X6XA 1UMKA 1E43A 3W2FA 3MCAA 4PAAA 4B3FX 5HKKA 2WPDA 1R5NA 4XLCA 1YJNB 1BX1A 1KZLA 4OOSA 4DNRB 1WU8A 3BCDA 4U9UA 4KKTA 2E1BA 2P3MA 1Q82D 4YALA 1FNCA 3PUNA 1KQSB 3B78A 1B2RA 3SJZA 4YAWA 3SLDA 4GQNA 1BPLA 1QFJA 4F7DA 1FX0A 1E3ZA 4ZGQB 1H85A 2PE3A 2EIXA 1OGIA 2D74A 2HCJB 3BH4A 1J9ZA 1E1QA 1W87A 2V7VA 4JMQA 3BCFA 4RD3A 1GVHA 4XN3A 3ZPNA 2J7KA 3PA1A 4B47A 1QGZA 2PIAA 2YWGA 3AVXA 1WPCA 1DARA 4HE5A 3ZUGA 1N8RD 1GJRA 4Y9UA 3CW2A 5EMNA 3G05A 5F4JA 1B23P 1WORA 3ASPA 4XL9A 1T6YA 1KMHA 4IW3B 1D1NA 5F4OA 4X8IA 2BGJA 1EWYA 1VQNB 3AGQA 4ACBA 1W0KA 4ACAA 3Q6QA 2VNJA 2F4NA 2WZNA 4DNTB 1G7RA 4TSFA 4P22A 3LVBA 1N0VC 2DCUA 2OK7A 4XLFA 5H59A 1KJZA 4N3GA 3ZZUA 3JQQA 2DETA 2C4TA 1ELOA 1JNYA 3A3BA 4RDJA 1T5EA 1KD1D 3CCSB 2GJKA 3WNDA 4RJLA 1FRNA 2WYRA 4NBSA 1OB0A 2V7WA 1DG1G 1MABA 5THXA 1JJ2B 4X7FA 1VQPB 1WOPA 1OHHA 1W0JA 5FIUA 1GAWA 4TMXA 1QX4A 3AGPA 1SKQA 2R9VA 3LO8A 3W5UA 2QDXA 4X7EA 4XMYA 3RY8A 3W2HA 1YI2B 4X06A 4QV2A 5IYPA 2XZPA 1F60A 3KL9A 3ASRA 1Q7YD 1G7SA 5TRDA 3CCEB 2QN6A 4XLAA 1G7TA 4XONA 1QVGB 2ZBVA 1HZEA 4XLHA 2OBTA 3VR6A 4BPRA 4HE6A 4XKVA 4OOVA 3G71B 3CCRB 4PABA 4G1VA 3WBJA 2XZOA 2Z6BD 4OP7A 2D3NA 4XORA 1VQOB 2BN4A 3A8KA 4OOXA 1KTVA 3CRZA 3GVLA 4KKUA 3AVTA 4KKSA 1M90D 4LBYA 1NB9A 3CESA 3R6KA 1BX0A 3T56B 5JBQA 5KSWB 1V5VA 3ONYA 1XE1A 2ZTNA 1PJ7A 4WZLA 1FNBA 4FWTA 2QMUA 2JIZA 4YAFA 1QGAA 1Y0RA 4ASUA 3GIRA 4XR6A 1VHOA 1ZUNB 2LZJA 4MYUA 2CK3A 2VJIA 4UZUA 3AVUA 1VLOA 3A3GA 3SEJA 3JU4A 1GR1A 5FL7A 1YJ9B 4WZTA 3DDYA 2OYNA 1QUEA 5AN9A 5J35A 1E3XA 1VQ5B 5DN6A 4LBZA 3WY9A 1WDTA 2HLDA 4Z4RA 2FX3A 4RD2A 3I56B 2BGIA 2XNDA 3ONUA 1K73D 5FO0A 3VO1A 1T6XA 4LBVA 1RQPA 1NB0A 5A88A 5FO1A 2NPFA 4X05A 1XB2A 2EFGA 2QE7A 2JDIA 4X07A 1F20A 1VQMB 4DK0A 1KK1A 4OPOA 4B43A 2X8KA 2CW5A 4P3IA 3FKSA 4P26A 4G1BA 2DY1A 1UD3A 1FRQA 1W9XA 3GQBA 4L8JA 4WWVA 4X0CA 1N08A 1QUFA 5TY0A 3ZZ0A 2D3LA 1N07A 4RDKA 2GPJA 1EP3B 4XOPA 2BMWA 3PENA 5A8AA 1GO2A 3V76A 3ZBTA 5IYRA 4RCZA 4QFMA 3AVWA 4TMVA 3OZVA 3W5HA 4P1VA 1NJID 5L46A 3VNUA 1WOOA 1DDIA 1ZM9A 4G6IA 4YXWA 4X7DA 2VYQA 4AF6A 5LMZA 3CTAA 1A8PA 3LQEA 5B6IA 5CDFA 3E1YE 1EFCA 4YAUA 3P27A 4ROXA 1OB2A 3B82A 4NCNA 1UD4A 1JB9A 1YHQB 4YAOA 3OPOA 3Q38A 2VNHA 4OPVA 3Q3AA 1Q9SA 2XNCA 3ES9A 1COWA 2ZZEA 2WJYA 4II2A 4PC1A 5FNZA 2BM0A 4Y9RA 2C2WA 3W2IA 2GK7A 1G7CA 4DQKA 4B3GA 1V0FA 4RD0A 3T53B 2ZL5A 2CNDA 3VO2A 4R71A 2XZLA 2JJ2A 3CCUB 4XD7A 5GV7A 1QG0A 1Q81D 4LBWA 5H5JA 1EFTA 1E79A 1R5OA 1I7PA 4RPBA 5KNLA 3T51B 1N05A 1WTHD 1EFUA 4PC7A 3WQZA 1EP2B 2B7CA 4XM3A 5IK2A 2OK8A 3PUMA 4RCYA 2XEXA 2VBUA 1PJ6A 1E63A 4M2LA 4QVJA 1TLLA 3KEWA 2X0KA 4RPDA 1VQLB 3WXMA 3QFTA 2ZL6A 1S4MA 3OP1A 3VNVA 3MHPA 1YITB 3ISXA 1I18A 1H42A 2W6JA 4AC9A 1NDHA 1KC8D 2KVOA 3B8HA 2VBSA 2VZLA 2GREA 2VJJA 4P25A 3AVVA 4K1XA 3BC9A 4G5GA 1H8HA 1T6ZA 2JN9A 2FVGA 4YHBA 4HIZA 1GAQA 1BMFA 3GVJA
chains in the Genus database with same CATH topology
5J3OA 4Z4YA 5BSYA 3ONUA 5BSXA 1IHMA 4OOSA 4RM0A 3BY1A 4X05A 3R6JA 4WZEA 4X07A 3PUNA 4OPOA 3SLDA 4P3IA 3PA2A 4P26A 2OBSA 3ASQA 4X0CA 3PA1A 4P12A 4RDKA 5KW9A 5F4JA 5IYRA 3ASPA 4Z4UA 5IYQA 4Z4WA 5F4OA 4P1VA 3Q6RA 3Q6QA 4X7DA 3LQEA 4ROXA 2OBRA 3D26A 4RDJA 3SKBA 4QUZA 4WZKA 3Q38A 4OPVA 3Q3AA 4Z4SA 3V7AA 5IYWA 4X7FA 4Z4TA 3BQJA 3ASSA 4X7EA 3RY8A 4Z4ZA 5E6TA 4X06A 4QV2A 3SLNA 5IYPA 2ZL5A 3ASRA 4Z4VA 4X7CA 3SJPA 2OBTA 4RPBA 4OOVA 3LQ6A 3PUMA 4OP7A 4OOXA 4QVAA 3R6KA 4QVJA 3ONYA 4RPDA 2ZL6A 3BY2A 4P2NA 4WZLA 5HZBA 2ZL7A 3PVDA 4RLZA 3SEJA 3ASTA 4P25A 5IYNA 4WZTA 5F4MA 5J35A 5HZAA 3Q39A 4OPSA 4RDLA 4Z4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3O A;  4Z4Y A;  5BSY A;  3ONU A;  5BSX A;  1IHM A;  4OOS A;  4RM0 A;  3BY1 A;  4X05 A;  3R6J A;  4WZE A;  4X07 A;  3PUN A;  4OPO A;  3SLD A;  4P3I A;  3PA2 A;  4P26 A;  2OBS A;  3ASQ A;  4X0C A;  3PA1 A;  4P12 A;  4RDK A;  5KW9 A;  5F4J A;  5IYR A;  3ASP A;  4Z4U A;  5IYQ A;  4Z4W A;  5F4O A;  4P1V A;  3Q6R A;  3Q6Q A;  4X7D A;  3LQE A;  4ROX A;  2OBR A;  3D26 A;  4RDJ A;  3SKB A;  4QUZ A;  4WZK A;  3Q38 A;  4OPV A;  3Q3A A;  4Z4S A;  3V7A A;  5IYW A;  4X7F A;  4Z4T A;  3BQJ A;  3ASS A;  4X7E A;  3RY8 A;  4Z4Z A;  5E6T A;  4X06 A;  4QV2 A;  3SLN A;  5IYP A;  2ZL5 A;  3ASR A;  4Z4V A;  4X7C A;  3SJP A;  2OBT A;  4RPB A;  4OOV A;  3LQ6 A;  3PUM A;  4OP7 A;  4OOX A;  4QVA A;  3R6K A;  4QVJ A;  3ONY A;  4RPD A;  2ZL6 A;  3BY2 A;  4P2N A;  4WZL A;  5HZB A;  2ZL7 A;  3PVD A;  4RLZ A;  3SEJ A;  3AST A;  4P25 A;  5IYN A;  4WZT A;  5F4M A;  5J35 A;  5HZA A;  3Q39 A;  4OPS A;  4RDL A;  4Z4R A; 
#chains in the Genus database with same CATH topology
 5J3O A;  4Z4Y A;  1TVC A;  1QFZ A;  2X85 A;  1UD6 A;  1Q86 D;  2Q6L A;  4RM0 A;  3BY1 A;  2WSS A;  1U2R A;  1JA1 A;  3CP8 A;  1W34 A;  4RD6 A;  2Q6O A;  1R5B A;  4P6V F;  2C4U A;  3FPK A;  2AHO A;  4B3X A;  3G4S B;  3PA2 A;  2X53 S;  4P9S A;  1AIP A;  2OBS A;  3ASQ A;  1ZM3 A;  3A8J A;  1QH0 A;  2BF4 A;  2XGJ A;  1FND A;  5FA6 A;  1K9M D;  4ZCL A;  2YWF A;  1VQ6 B;  4XLE A;  1VQ8 B;  3OW7 A;  3CCQ B;  3OEH A;  1HA3 A;  1FDR A;  2ZIT A;  3OKX A;  5KW9 A;  3J81 k;  2PMD A;  3JQR A;  4TMW A;  1CQX A;  4M4S A;  1XQB A;  2CF4 A;  1ZM4 A;  3P26 A;  2BVN A;  3OZW A;  5IYQ A;  3OW2 B;  2DEU A;  1VJS A;  4Z4W A;  3WBK A;  3U6K A;  1BQE A;  3LNN A;  4B48 A;  4UZE A;  4XNF A;  3Q6R A;  2V31 A;  4LC0 A;  1NBM A;  1W35 A;  3OZU A;  1YJW B;  1SM4 A;  1QVF B;  2OTL B;  4M0L A;  1IJE A;  2GJR A;  2QA4 B;  3W2G A;  4H9G A;  2ZTG A;  3OEE A;  1PKV A;  2OBR A;  2QEX B;  4TT3 A;  4UAJ A;  4C43 A;  3H9N A;  2ZZG A;  3OAA A;  4E0F A;  3GVK A;  1XFO A;  4XQF A;  4N3N A;  3WNC A;  2DER A;  3W2E A;  1CNE A;  2V7U A;  3CC2 B;  2GJP A;  2VNK A;  4G7X A;  4Q7J B;  2B5O A;  2VBT A;  1H8E A;  3BQJ A;  3CMM A;  3ASS A;  3MMP A;  2VBV A;  4Z4Z A;  5E6T A;  3QE2 A;  3SLN A;  2X6Y A;  2ZBU A;  3I1F A;  4X7C A;  1E1R A;  1QFY A;  2DOG A;  2BPO A;  3HAG A;  2ZXI A;  2WZP P;  3QFC A;  3SJP A;  3CC7 B;  4XN0 A;  2B7B A;  4WQM A;  1VLY A;  3FPP A;  2R6H A;  3QFR A;  4MYT A;  4P3Y A;  2F1L A;  4PC6 A;  4PGO A;  3ZBU A;  1Y0Y A;  4DQL A;  5DS0 A;  3QSY A;  4Z1M A;  3VMF A;  1WSV A;  2ZZQ A;  2Q6K A;  3CB4 A;  3I55 B;  2WJV A;  1VQ9 B;  3CCM B;  4NNJ A;  5TR9 A;  1MRZ A;  4P6Y A;  2CRV A;  3OJW A;  2WR8 A;  2M5S A;  1DDG A;  3BY2 A;  4P2N A;  4PC2 A;  2CC2 A;  4ZGN B;  2W6I A;  4M1K A;  1EFR A;  3PVD A;  2XNJ A;  4YEL A;  1SKY B;  1D2E A;  3QFS A;  4G7W A;  4RLZ A;  2Q6I A;  3OFN A;  1E64 A;  3OE7 A;  3A1P A;  1K8A D;  5IYN A;  3W5V A;  3OOC A;  3CP2 A;  3JQP A;  1VQK B;  2X6W A;  5HZA A;  3Q39 A;  4OPS A;  2JJ1 A;  4RDL A;  1QGY A;  3AVY A;  1UD8 A;  5BSY A;  2BM1 A;  1IHM A;  2D9R A;  2YWE A;  1BJK A;  4XKW A;  5BSX A;  4J0Q A;  4UZF A;  1K28 D;  3R6J A;  4WZE A;  3CMA B;  2PLF A;  2V7Q A;  1S72 B;  2ZXH A;  1NRK A;  3ZZT A;  1OGJ A;  2ZZF A;  4AVZ A;  4TMZ A;  3ZIA A;  1EXM A;  4CQJ A;  1VQ4 B;  5HXB A;  4RD1 A;  3G6E B;  3U2Q A;  1WOS A;  2GK6 A;  3A8I A;  1S0U A;  4FK8 A;  4P12 A;  4FXU A;  2F43 A;  1KRH A;  3CXC B;  1CNF A;  5DSZ A;  2V7T A;  3WYA A;  1P4M A;  2HMA A;  4YEJ A;  4B44 A;  4Z4U A;  5TV2 A;  1W2B B;  4TN1 A;  2CBX A;  1VQ7 B;  4B4D A;  3CD6 B;  2BV3 A;  3CC4 B;  4AF7 A;  2F1M A;  3CME B;  4Y7C A;  4TMT A;  4ZV4 A;  2NV4 A;  2X3U A;  3D26 A;  2DYI A;  1YIJ B;  1I8D A;  3SKB A;  4QUZ A;  3NE5 B;  1BLI A;  4WZK A;  2E1R A;  1HVX A;  2BSA A;  2C5H A;  4Z4S A;  1D8T A;  3V7A A;  5IYW A;  4PC3 A;  4Z4T A;  4ZCM A;  2VNI A;  1TUI A;  2V4D A;  3CCJ B;  3FJO A;  4QHY A;  1YLO A;  1N0U A;  1EP1 B;  1KK3 A;  1YX2 A;  2YWH A;  4Z4V A;  3CCV B;  1PJ5 A;  2GQF A;  2C77 A;  1OB5 A;  3CPX A;  2C78 A;  2QTL A;  1JA0 A;  3A35 A;  3OJX A;  4DK1 A;  1E62 A;  3GSI A;  1M1K D;  2V7X A;  2QGG A;  3CPW B;  1UD5 A;  1VF7 A;  1VHE A;  5A89 A;  4TKO B;  2OTJ B;  3LQ6 A;  3CCL B;  1AMO A;  3E20 A;  1WP6 A;  2DIE A;  1KK2 A;  3U6B A;  3BNW A;  5GV8 A;  4EH1 A;  1UD2 A;  3H94 A;  4M53 A;  4QVA A;  4C0S A;  1WSR A;  1TTT A;  1N06 A;  3WNB A;  2I1L A;  4II3 A;  2XOK A;  2ZL7 A;  4RD4 A;  5HZB A;  4FN5 A;  1IJF A;  1FNM A;  4XOT A;  2HDN B;  3ZC3 A;  2C5B A;  2RC6 A;  3AST A;  1V0E A;  1KK0 A;  1IB0 A;  2RC5 A;  5F4M A;  1ZM2 A;  2QTZ A;  1RQR A;  4ZCI A;  2X6X A;  1UMK A;  1E43 A;  3W2F A;  3MCA A;  4PAA A;  4B3F X;  5HKK A;  2WPD A;  1R5N A;  4XLC A;  1YJN B;  1BX1 A;  1KZL A;  4OOS A;  4DNR B;  1WU8 A;  3BCD A;  4U9U A;  4KKT A;  2E1B A;  2P3M A;  1Q82 D;  4YAL A;  1FNC A;  3PUN A;  1KQS B;  3B78 A;  1B2R A;  3SJZ A;  4YAW A;  3SLD A;  4GQN A;  1BPL A;  1QFJ A;  4F7D A;  1FX0 A;  1E3Z A;  4ZGQ B;  1H85 A;  2PE3 A;  2EIX A;  1OGI A;  2D74 A;  2HCJ B;  3BH4 A;  1J9Z A;  1E1Q A;  1W87 A;  2V7V A;  4JMQ A;  3BCF A;  4RD3 A;  1GVH A;  4XN3 A;  3ZPN A;  2J7K A;  3PA1 A;  4B47 A;  1QGZ A;  2PIA A;  2YWG A;  3AVX A;  1WPC A;  1DAR A;  4HE5 A;  3ZUG A;  1N8R D;  1GJR A;  4Y9U A;  3CW2 A;  5EMN A;  3G05 A;  5F4J A;  1B23 P;  1WOR A;  3ASP A;  4XL9 A;  1T6Y A;  1KMH A;  4IW3 B;  1D1N A;  5F4O A;  4X8I A;  2BGJ A;  1EWY A;  1VQN B;  3AGQ A;  4ACB A;  1W0K A;  4ACA A;  3Q6Q A;  2VNJ A;  2F4N A;  2WZN A;  4DNT B;  1G7R A;  4TSF A;  4P22 A;  3LVB A;  1N0V C;  2DCU A;  2OK7 A;  4XLF A;  5H59 A;  1KJZ A;  4N3G A;  3ZZU A;  3JQQ A;  2DET A;  2C4T A;  1ELO A;  1JNY A;  3A3B A;  4RDJ A;  1T5E A;  1KD1 D;  3CCS B;  2GJK A;  3WND A;  4RJL A;  1FRN A;  2WYR A;  4NBS A;  1OB0 A;  2V7W A;  1DG1 G;  1MAB A;  5THX A;  1JJ2 B;  4X7F A;  1VQP B;  1WOP A;  1OHH A;  1W0J A;  5FIU A;  1GAW A;  4TMX A;  1QX4 A;  3AGP A;  1SKQ A;  2R9V A;  3LO8 A;  3W5U A;  2QDX A;  4X7E A;  4XMY A;  3RY8 A;  3W2H A;  1YI2 B;  4X06 A;  4QV2 A;  5IYP A;  2XZP A;  1F60 A;  3KL9 A;  3ASR A;  1Q7Y D;  1G7S A;  5TRD A;  3CCE B;  2QN6 A;  4XLA A;  1G7T A;  4XON A;  1QVG B;  2ZBV A;  1HZE A;  4XLH A;  2OBT A;  3VR6 A;  4BPR A;  4HE6 A;  4XKV A;  4OOV A;  3G71 B;  3CCR B;  4PAB A;  4G1V A;  3WBJ A;  2XZO A;  2Z6B D;  4OP7 A;  2D3N A;  4XOR A;  1VQO B;  2BN4 A;  3A8K A;  4OOX A;  1KTV A;  3CRZ A;  3GVL A;  4KKU A;  3AVT A;  4KKS A;  1M90 D;  4LBY A;  1NB9 A;  3CES A;  3R6K A;  1BX0 A;  3T56 B;  5JBQ A;  5KSW B;  1V5V A;  3ONY A;  1XE1 A;  2ZTN A;  1PJ7 A;  4WZL A;  1FNB A;  4FWT A;  2QMU A;  2JIZ A;  4YAF A;  1QGA A;  1Y0R A;  4ASU A;  3GIR A;  4XR6 A;  1VHO A;  1ZUN B;  2LZJ A;  4MYU A;  2CK3 A;  2VJI A;  4UZU A;  3AVU A;  1VLO A;  3A3G A;  3SEJ A;  3JU4 A;  1GR1 A;  5FL7 A;  1YJ9 B;  4WZT A;  3DDY A;  2OYN A;  1QUE A;  5AN9 A;  5J35 A;  1E3X A;  1VQ5 B;  5DN6 A;  4LBZ A;  3WY9 A;  1WDT A;  2HLD A;  4Z4R A;  2FX3 A;  4RD2 A;  3I56 B;  2BGI A;  2XND A;  3ONU A;  1K73 D;  5FO0 A;  3VO1 A;  1T6X A;  4LBV A;  1RQP A;  1NB0 A;  5A88 A;  5FO1 A;  2NPF A;  4X05 A;  1XB2 A;  2EFG A;  2QE7 A;  2JDI A;  4X07 A;  1F20 A;  1VQM B;  4DK0 A;  1KK1 A;  4OPO A;  4B43 A;  2X8K A;  2CW5 A;  4P3I A;  3FKS A;  4P26 A;  4G1B A;  2DY1 A;  1UD3 A;  1FRQ A;  1W9X A;  3GQB A;  4L8J A;  4WWV A;  4X0C A;  1N08 A;  1QUF A;  5TY0 A;  3ZZ0 A;  2D3L A;  1N07 A;  4RDK A;  2GPJ A;  1EP3 B;  4XOP A;  2BMW A;  3PEN A;  5A8A A;  1GO2 A;  3V76 A;  3ZBT A;  5IYR A;  4RCZ A;  4QFM A;  3AVW A;  4TMV A;  3OZV A;  3W5H A;  4P1V A;  1NJI D;  5L46 A;  3VNU A;  1WOO A;  1DDI A;  1ZM9 A;  4G6I A;  4YXW A;  4X7D A;  2VYQ A;  4AF6 A;  5LMZ A;  3CTA A;  1A8P A;  3LQE A;  5B6I A;  5CDF A;  3E1Y E;  1EFC A;  4YAU A;  3P27 A;  4ROX A;  1OB2 A;  3B82 A;  4NCN A;  1UD4 A;  1JB9 A;  1YHQ B;  4YAO A;  3OPO A;  3Q38 A;  2VNH A;  4OPV A;  3Q3A A;  1Q9S A;  2XNC A;  3ES9 A;  1COW A;  2ZZE A;  2WJY A;  4II2 A;  4PC1 A;  5FNZ A;  2BM0 A;  4Y9R A;  2C2W A;  3W2I A;  2GK7 A;  1G7C A;  4DQK A;  4B3G A;  1V0F A;  4RD0 A;  3T53 B;  2ZL5 A;  2CND A;  3VO2 A;  4R71 A;  2XZL A;  2JJ2 A;  3CCU B;  4XD7 A;  5GV7 A;  1QG0 A;  1Q81 D;  4LBW A;  5H5J A;  1EFT A;  1E79 A;  1R5O A;  1I7P A;  4RPB A;  5KNL A;  3T51 B;  1N05 A;  1WTH D;  1EFU A;  4PC7 A;  3WQZ A;  1EP2 B;  2B7C A;  4XM3 A;  5IK2 A;  2OK8 A;  3PUM A;  4RCY A;  2XEX A;  2VBU A;  1PJ6 A;  1E63 A;  4M2L A;  4QVJ A;  1TLL A;  3KEW A;  2X0K A;  4RPD A;  1VQL B;  3WXM A;  3QFT A;  2ZL6 A;  1S4M A;  3OP1 A;  3VNV A;  3MHP A;  1YIT B;  3ISX A;  1I18 A;  1H42 A;  2W6J A;  4AC9 A;  1NDH A;  1KC8 D;  2KVO A;  3B8H A;  2VBS A;  2VZL A;  2GRE A;  2VJJ A;  4P25 A;  3AVV A;  4K1X A;  3BC9 A;  4G5G A;  1H8H A;  1T6Z A;  2JN9 A;  2FVG A;  4YHB A;  4HIZ A;  1GAQ A;  1BMF A;  3GVJ A; 
#chains in the Genus database with same CATH homology
 5J3O A;  4Z4Y A;  5BSY A;  3ONU A;  5BSX A;  1IHM A;  4OOS A;  4RM0 A;  3BY1 A;  4X05 A;  3R6J A;  4WZE A;  4X07 A;  3PUN A;  4OPO A;  3SLD A;  4P3I A;  3PA2 A;  4P26 A;  2OBS A;  3ASQ A;  4X0C A;  3PA1 A;  4P12 A;  4RDK A;  5KW9 A;  5F4J A;  5IYR A;  3ASP A;  4Z4U A;  5IYQ A;  4Z4W A;  5F4O A;  4P1V A;  3Q6R A;  3Q6Q A;  4X7D A;  3LQE A;  4ROX A;  2OBR A;  3D26 A;  4RDJ A;  3SKB A;  4QUZ A;  4WZK A;  3Q38 A;  4OPV A;  3Q3A A;  4Z4S A;  3V7A A;  5IYW A;  4X7F A;  4Z4T A;  3BQJ A;  3ASS A;  4X7E A;  3RY8 A;  4Z4Z A;  5E6T A;  4X06 A;  4QV2 A;  3SLN A;  5IYP A;  2ZL5 A;  3ASR A;  4Z4V A;  4X7C A;  3SJP A;  2OBT A;  4RPB A;  4OOV A;  3LQ6 A;  3PUM A;  4OP7 A;  4OOX A;  4QVA A;  3R6K A;  4QVJ A;  3ONY A;  4RPD A;  2ZL6 A;  3BY2 A;  4P2N A;  4WZL A;  5HZB A;  2ZL7 A;  3PVD A;  4RLZ A;  3SEJ A;  3AST A;  4P25 A;  5IYN A;  4WZT A;  5F4M A;  5J35 A;  5HZA A;  3Q39 A;  4OPS A;  4RDL A;  4Z4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...