4Z4UA

Crystal structure of gii.10 p domain in complex with 37.5mm fucose
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
314
structure length
310
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title The sweet quartet: Binding of fucose to the norovirus capsid.
pubmed doi rcsb
source organism Norovirus gii.10
molecule tags Viral protein
total genus 70
structure length 310
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4z4uA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4z4uA01
2ZL5A 3SKBA 5F4MA 3V7AA 4P3IA 3RY8A 5IYPA 4QUZA 3Q6QA 3LQEA 4WZEA 4X7FA 4OPSA 5BSXA 4Z4ZA 4ROXA 3BQJA 4WZKA 4P26A 3ONYA 4Z4WA 5IYQA 5BSYA 4P1VA 4QV2A 4Z4TA 3R6KA 3BY1A 3PUNA 3SEJA 5F4JA 3LQ6A 3R6JA 2OBSA 3ASQA 4OOSA 4OP7A 4X05A 5KW9A 2OBRA 5HZBA 3Q38A 3SLNA 4OOXA 4X07A 3Q3AA 5HZAA 4RDKA 4Z4YA 2ZL6A 4X7DA 5IYRA 4OPVA 3ASTA 4X06A 3BY2A 4OPOA 3D26A 3ASRA 4X7EA 4RPBA 3Q39A 3PA1A 3SJPA 4Z4VA 5IYNA 4RM0A 5E6TA 5J35A 3PUMA 5IYWA 4RDLA 4RDJA 5F4OA 4Z4RA 5J3OA 4QVJA 4P25A 4RLZA 4WZTA 4P12A 3ASPA 3ASSA 4X0CA 3PA2A 3PVDA 4Z4SA 2ZL7A 1IHMA 4X7CA 4WZLA 4RPDA 3SLDA 4P2NA 3ONUA 4OOVA 2OBTA 4QVAA 3Q6RA 4Z4UA
chains in the Genus database with same CATH superfamily
4UZFA 1YJNB 4RD6A 3VNVA 3V7AA 3ISXA 4P3IA 2LZJA 4AF6A 3RY8A 3WXMA 4FXUA 3QFRA 4TT3A 4M0LA 4WWVA 4P6YA 1KC8D 3G4SB 2QTZA 4AF7A 1TTTA 4ZGQB 4DNTB 2X6YA 4JMQA 1VJSA 3BQJA 1W34A 4FN5A 4WZKA 2ZTNA 3CC4B 5BSYA 3J81k 4P9SA 4QV2A 3OW7A 2C5BA 3U2QA 3SEJA 3QE2A 2BV3A 2BSAA 4N3GA 3ASQA 1OB0A 3A8KA 3OJWA 3A1PA 1FNCA 1ZUNB 5DSZA 4XN0A 2Q6OA 3OEEA 4M1KA 2OYNA 1VQNB 1SM4A 3FJOA 3NE5B 1H85A 2BF4A 3OFNA 3OZVA 3PENA 4U9UA 1FNMA 3SLNA 3T51B 3BC9A 4RCZA 1VHEA 4XKVA 1SKYB 1B2RA 1KK0A 1N0UA 4YALA 3W2GA 3CMAB 3SJZA 2V7UA 2BPOA 2D9RA 5KSWB 3W5UA 1F60A 4X7DA 4F7DA 2QN6A 2ZZEA 1JJ2B 1WTHD 2ZZFA 4ASUA 1KQSB 1T6ZA 1G7SA 3ASRA 4EH1A 1QH0A 2BN4A 3OEHA 3AVXA 1KK2A 1KZLA 2PE3A 4X7EA 4ZGNB 2W6IA 1K73D 1AIPA 2QA4B 2W6JA 3Q39A 1E1RA 2JIZA 3SJPA 1BQEA 1K8AD 1DDIA 2WZNA 2XEXA 2OTLB 2WSSA 3A35A 3OW2B 2ZTGA 1DARA 4ZCIA 4PC3A 3W5VA 4MYUA 1QUEA 1YHQB 4RDJA 3CCRB 2JJ2A 5A8AA 2R6HA 3I55B 2V7TA 4YHBA 2ZXIA 4N3NA 2B7BA 1ZM9A 2DY1A 4G6IA 1UD4A 3VMFA 2X53S 4XORA 2VNKA 3KEWA 4Z1MA 4XLFA 4Z4SA 4J0QA 4LBYA 4P3YA 1QGAA 4XONA 1IHMA 3CPXA 1G7CA 3WNCA 3OKXA 2VJIA 2ZXHA 2DIEA 4B4DA 1S72B 3BCDA 4RPDA 2D3NA 1N06A 3A3BA 2V7VA 2XNJA 4FK8A 4B43A 4CQJA 1VQPB 1GR1A 2P3MA 2EIXA 3W2EA 4C43A 3OP1A 2ZL5A 1QUFA 2CNDA 1WU8A 3ZZTA 1BLIA 3OAAA 1R5NA 1T6YA 1OGJA 1VLOA 1G7RA 4G1VA 4R71A 4II3A 4YXWA 1EWYA 2C78A 3WBKA 3G6EB 1VF7A 2VYQA 4G7XA 4P22A 3ZBUA 2YWGA 4B3FX 3CP2A 3Q6QA 1OGIA 4WZEA 1B23P 4YEJA 3B8HA 4KKUA 4DNRB 1UD6A 4Z4WA 3CMEB 2CRVA 1R5BA 1EFCA 3R6KA 4IW3B 2X8KA 3CTAA 2OK7A 2VBVA 2BVNA 3R6JA 3ZBTA 4DQLA 3CCUB 1EFUA 1WOOA 4OP7A 2ZBUA 1VQKB 1BPLA 2HMAA 1COWA 2BMWA 2OBRA 1IJFA 4UAJA 3MMPA 1A8PA 5HZBA 1M90D 2Q6IA 3MHPA 4YAOA 1DDGA 1H8EA 4TMXA 2VBTA 2XZLA 1WORA 4X8IA 3AGQA 4II2A 4LBWA 1HZEA 3Q3AA 1T6XA 1WSRA 4ZCLA 3OJXA 4RDKA 4XNFA 4XL9A 3OE7A 1UD3A 2XNCA 1FNDA 1P4MA 2RC5A 5IYRA 1E3ZA 3OPOA 5FO0A 2HCJB 3CXCB 3AVYA 2M5SA 2XZPA 3H9NA 1YITB 2VZLA 4RPBA 1EP2B 2CC2A 4RD1A 3WBJA 3MCAA 3ZIAA 5TY0A 5FA6A 3CP8A 4B47A 3OZUA 3I56B 2VNHA 1KJZA 4PAAA 1PJ6A 5E6TA 4PGOA 1Q9SA 2FVGA 1Y0RA 3QFCA 2V31A 5J35A 3GSIA 5IYWA 1CNFA 1MABA 3BCFA 4RDLA 3AVUA 2ZITA 2CF4A 3VR6A 4ZCMA 4Z4RA 1FDRA 4UZEA 4QVJA 4P25A 2X6WA 1NJID 4XR6A 2X3UA 1EFRA 3CMMA 1QVFB 1KK3A 4WZTA 4DK1A 2F1LA 1M1KD 1TLLA 2E1BA 3FPPA 1Y0YA 3ZZ0A 5GV8A 2CBXA 2YWEA 3V76A 5DS0A 2GPJA 2ZL7A 4HIZA 1D8TA 2YWFA 1QVGB 4RJLA 1H42A 4E0FA 1MRZA 3CB4A 3B82A 5AN9A 1YLOA 4DQKA 3SLDA 1W0JA 4YAWA 1VQ9B 2X6XA 5A88A 1K28D 5HKKA 1YX2A 1NB9A 1E63A 3P26A 4NCNA 1TUIA 1QFZA 3G71B 1U2RA 1GAWA 1WOPA 4LC0A 4TMWA 5H5JA 1XFOA 3CESA 5FL7A 2OBTA 4G1BA 1BJKA 1TVCA 4XOPA 3LO8A 1UD8A 1V5VA 3Q6RA 1NDHA 2GJPA 4Y7CA 4Z4ZA 4TSFA 1Q7YD 1FRNA 1I18A 2CK3A 4ACBA 1E1QA 1VQ8B 3OZWA 1BX1A 1WDTA 4UZUA 3CCQB 1G7TA 1UD5A 3LQEA 1EFTA 4MYTA 4X7FA 1RQRA 2ZBVA 1S4MA 4RD0A 4XMYA 5CDFA 5BSXA 1E64A 1V0FA 4GQNA 1DG1G 4B48A 2DOGA 3ONYA 5TV2A 5IYQA 1W0KA 1VHOA 2OTJB 4P1VA 3GIRA 4NBSA 4PC2A 4Z4TA 1WP6A 2JDIA 4TMZA 2I1LA 3PUNA 1I7PA 2XZOA 1VQ6B 3A8IA 5F4JA 3VNUA 1XE1A 5HXBA 4OOSA 4X05A 1N0VC 1QFYA 2DEUA 2GQFA 2V7XA 3QSYA 3VO2A 2DYIA 3GVLA 2QDXA 4RCYA 1EXMA 3JU4A 1JNYA 2B7CA 4OOXA 1VQMB 2KVOA 3T53B 1S0UA 1OB2A 1UMKA 3GVJA 1YJ9B 2C2WA 1UD2A 1SKQA 3LNNA 3H94A 1N07A 4XD7A 2BGIA 4TKOB 5FNZA 3ASTA 1ZM3A 5L46A 1KMHA 4OPOA 1CNEA 1ZM4A 2PLFA 5FIUA 4BPRA 4B44A 4QFMA 1CQXA 2X0KA 1N8RD 2BGJA 1NB0A 4P6VF 2QMUA 4B3XA 3CCJB 1WSVA 3PA1A 3JQPA 4Z4VA 1E3XA 5IYNA 3CCSB 1WOSA 3OOCA 5TRDA 3B78A 2VBSA 4M53A 2WR8A 2YWHA 1IB0A 4AC9A 3CCEB 3CPWB 3P27A 5GV7A 2Q6LA 1YJWB 1VQ7B 3W5HA 1BX0A 4RLZA 2HLDA 5IK2A 3A3GA 5A89A 4PC1A 2D3LA 4P12A 2C77A 3ASPA 2HDNB 1N08A 4XLHA 3E1YE 5DN6A 3ZPNA 1KD1D 1W35A 5B6IA 1NBMA 3WYAA 1JA0A 2GK7A 5JBQA 4FWTA 3FPKA 5TR9A 1H8HA 3CCMB 4XM3A 2V4DA 3CD6B 3AVVA 1OB5A 2VBUA 3BNWA 1WPCA 2RC6A 2WYRA 3BH4A 2WJVA 1VQ5B 1XQBA 4XLAA 2JN9A 3ZZUA 2R9VA 1EP1B 2XOKA 3ONUA 4C0SA 2ZZGA 2DCUA 3CC2B 1E62A 3LVBA 1KTVA 2X85A 2WJYA 2C4UA 2PIAA 4HE5A 3HAGA 3WNDA 2QEXB 4Y9RA 3SKBA 5KNLA 1N05A 4M2LA 5F4MA 4RD3A 3CW2A 1KK1A 5IYPA 1W87A 3GQBA 4TMTA 1GAQA 5EMNA 2QE7A 4QUZA 3U6KA 4OPSA 1QGZA 2XNDA 1GO2A 1Q86D 1E79A 4ROXA 1JA1A 1D1NA 2B5OA 3U6BA 1Q81D 4KKSA 4P26A 4Q7JB 2GREA 1V0EA 2WPDA 1VQ4B 2PMDA 1PJ5A 2BM0A 3BY1A 2GJKA 4YELA 1Q82D 2F1MA 4HE6A 2ZZQA 1EP3B 3KL9A 2OBSA 3LQ6A 3CRZA 1I8DA 5KW9A 4YAUA 4M4SA 3AGPA 2WZPP 4XLEA 1R5OA 4RD2A 3A8JA 1QG0A 2FX3A 1FRQA 1NRKA 1BMFA 4TMVA 4XLCA 1KRHA 3Q38A 3QFTA 1OHHA 4X07A 2GK6A 1PKVA 3WNBA 5HZAA 4ACAA 5LMZA 1ELOA 1VQOB 4XN3A 4Z4YA 1T5EA 3CCVB 2ZL6A 3CCLB 3ES9A 4QHYA 4OPVA 4PABA 1FX0A 4X06A 3W2FA 2NV4A 3BY2A 4YAFA 3D26A 3AVWA 2AHOA 2QTLA 1FNBA 3JQQA 1RQPA 3WY9A 1HVXA 1E43A 1IJEA 2QGGA 4KKTA 5H59A 4L8JA 4RM0A 3W2IA 4PC6A 1JB9A 1XB2A 4DK0A 1F20A 3DDYA 3PUMA 1D2EA 2VJJA 4G5GA 2DERA 4XKWA 2CW5A 5F4OA 2F4NA 3G05A 1QFJA 4ZV4A 2XGJA 2VNIA 5J3OA 1VQLB 3JQRA 2GJRA 1VLYA 1GJRA 3VO1A 2F43A 4AVZA 4B3GA 2NPFA 5THXA 2V7WA 1HA3A 3AVTA 2JJ1A 2Z6BD 3ASSA 4K1XA 2EFGA 4X0CA 3PA2A 2D74A 3PVDA 4Y9UA 3ZUGA 2VNJA 4PC7A 2J7KA 4G7WA 2OK8A 4NNJA 4XQFA 4RD4A 3W2HA 3CC7B 1W9XA 1QGYA 1GVHA 4WQMA 3FKSA 4X7CA 3GVKA 1W2BB 4LBZA 1J9ZA 4WZLA 1AMOA 5FO1A 3WQZA 2BM1A 3I1FA 4P2NA 2C5HA 4TN1A 2C4TA 2Q6KA 3T56B 1ZM2A 2E1RA 4H9GA 2DETA 4OOVA 1YI2B 3E20A 4XOTA 3ZC3A 1K9MD 4QVAA 3QFSA 4LBVA 1QX4A 1YIJB 2V7QA 4Z4UA 1PJ7A
chains in the Genus database with same CATH topology
2ZL5A 3SKBA 5F4MA 3V7AA 4P3IA 3RY8A 5IYPA 4QUZA 3Q6QA 3LQEA 4WZEA 4X7FA 4OPSA 5BSXA 4Z4ZA 4ROXA 3BQJA 4WZKA 4P26A 3ONYA 4Z4WA 5IYQA 5BSYA 4P1VA 4QV2A 4Z4TA 3R6KA 3BY1A 3PUNA 3SEJA 5F4JA 3LQ6A 3R6JA 2OBSA 3ASQA 4OOSA 4OP7A 4X05A 5KW9A 2OBRA 5HZBA 3Q38A 3SLNA 4OOXA 4X07A 3Q3AA 5HZAA 4RDKA 4Z4YA 2ZL6A 4X7DA 5IYRA 4OPVA 3ASTA 4X06A 3BY2A 4OPOA 3D26A 3ASRA 4X7EA 4RPBA 3Q39A 3PA1A 3SJPA 4Z4VA 5IYNA 4RM0A 5E6TA 5J35A 3PUMA 5IYWA 4RDLA 4RDJA 5F4OA 4Z4RA 5J3OA 4QVJA 4P25A 4RLZA 4WZTA 4P12A 3ASPA 3ASSA 4X0CA 3PA2A 3PVDA 4Z4SA 2ZL7A 1IHMA 4X7CA 4WZLA 4RPDA 3SLDA 4P2NA 3ONUA 4OOVA 2OBTA 4QVAA 3Q6RA 4Z4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZL5 A;  3SKB A;  5F4M A;  3V7A A;  4P3I A;  3RY8 A;  5IYP A;  4QUZ A;  3Q6Q A;  3LQE A;  4WZE A;  4X7F A;  4OPS A;  5BSX A;  4Z4Z A;  4ROX A;  3BQJ A;  4WZK A;  4P26 A;  3ONY A;  4Z4W A;  5IYQ A;  5BSY A;  4P1V A;  4QV2 A;  4Z4T A;  3R6K A;  3BY1 A;  3PUN A;  3SEJ A;  5F4J A;  3LQ6 A;  3R6J A;  2OBS A;  3ASQ A;  4OOS A;  4OP7 A;  4X05 A;  5KW9 A;  2OBR A;  5HZB A;  3Q38 A;  3SLN A;  4OOX A;  4X07 A;  3Q3A A;  5HZA A;  4RDK A;  4Z4Y A;  2ZL6 A;  4X7D A;  5IYR A;  4OPV A;  3AST A;  4X06 A;  3BY2 A;  4OPO A;  3D26 A;  3ASR A;  4X7E A;  4RPB A;  3Q39 A;  3PA1 A;  3SJP A;  4Z4V A;  5IYN A;  4RM0 A;  5E6T A;  5J35 A;  3PUM A;  5IYW A;  4RDL A;  4RDJ A;  5F4O A;  4Z4R A;  5J3O A;  4QVJ A;  4P25 A;  4RLZ A;  4WZT A;  4P12 A;  3ASP A;  3ASS A;  4X0C A;  3PA2 A;  3PVD A;  4Z4S A;  2ZL7 A;  1IHM A;  4X7C A;  4WZL A;  4RPD A;  3SLD A;  4P2N A;  3ONU A;  4OOV A;  2OBT A;  4QVA A;  3Q6R A;  4Z4U A; 
#chains in the Genus database with same CATH topology
 4UZF A;  1YJN B;  4RD6 A;  3VNV A;  3V7A A;  3ISX A;  4P3I A;  2LZJ A;  4AF6 A;  3RY8 A;  3WXM A;  4FXU A;  3QFR A;  4TT3 A;  4M0L A;  4WWV A;  4P6Y A;  1KC8 D;  3G4S B;  2QTZ A;  4AF7 A;  1TTT A;  4ZGQ B;  4DNT B;  2X6Y A;  4JMQ A;  1VJS A;  3BQJ A;  1W34 A;  4FN5 A;  4WZK A;  2ZTN A;  3CC4 B;  5BSY A;  3J81 k;  4P9S A;  4QV2 A;  3OW7 A;  2C5B A;  3U2Q A;  3SEJ A;  3QE2 A;  2BV3 A;  2BSA A;  4N3G A;  3ASQ A;  1OB0 A;  3A8K A;  3OJW A;  3A1P A;  1FNC A;  1ZUN B;  5DSZ A;  4XN0 A;  2Q6O A;  3OEE A;  4M1K A;  2OYN A;  1VQN B;  1SM4 A;  3FJO A;  3NE5 B;  1H85 A;  2BF4 A;  3OFN A;  3OZV A;  3PEN A;  4U9U A;  1FNM A;  3SLN A;  3T51 B;  3BC9 A;  4RCZ A;  1VHE A;  4XKV A;  1SKY B;  1B2R A;  1KK0 A;  1N0U A;  4YAL A;  3W2G A;  3CMA B;  3SJZ A;  2V7U A;  2BPO A;  2D9R A;  5KSW B;  3W5U A;  1F60 A;  4X7D A;  4F7D A;  2QN6 A;  2ZZE A;  1JJ2 B;  1WTH D;  2ZZF A;  4ASU A;  1KQS B;  1T6Z A;  1G7S A;  3ASR A;  4EH1 A;  1QH0 A;  2BN4 A;  3OEH A;  3AVX A;  1KK2 A;  1KZL A;  2PE3 A;  4X7E A;  4ZGN B;  2W6I A;  1K73 D;  1AIP A;  2QA4 B;  2W6J A;  3Q39 A;  1E1R A;  2JIZ A;  3SJP A;  1BQE A;  1K8A D;  1DDI A;  2WZN A;  2XEX A;  2OTL B;  2WSS A;  3A35 A;  3OW2 B;  2ZTG A;  1DAR A;  4ZCI A;  4PC3 A;  3W5V A;  4MYU A;  1QUE A;  1YHQ B;  4RDJ A;  3CCR B;  2JJ2 A;  5A8A A;  2R6H A;  3I55 B;  2V7T A;  4YHB A;  2ZXI A;  4N3N A;  2B7B A;  1ZM9 A;  2DY1 A;  4G6I A;  1UD4 A;  3VMF A;  2X53 S;  4XOR A;  2VNK A;  3KEW A;  4Z1M A;  4XLF A;  4Z4S A;  4J0Q A;  4LBY A;  4P3Y A;  1QGA A;  4XON A;  1IHM A;  3CPX A;  1G7C A;  3WNC A;  3OKX A;  2VJI A;  2ZXH A;  2DIE A;  4B4D A;  1S72 B;  3BCD A;  4RPD A;  2D3N A;  1N06 A;  3A3B A;  2V7V A;  2XNJ A;  4FK8 A;  4B43 A;  4CQJ A;  1VQP B;  1GR1 A;  2P3M A;  2EIX A;  3W2E A;  4C43 A;  3OP1 A;  2ZL5 A;  1QUF A;  2CND A;  1WU8 A;  3ZZT A;  1BLI A;  3OAA A;  1R5N A;  1T6Y A;  1OGJ A;  1VLO A;  1G7R A;  4G1V A;  4R71 A;  4II3 A;  4YXW A;  1EWY A;  2C78 A;  3WBK A;  3G6E B;  1VF7 A;  2VYQ A;  4G7X A;  4P22 A;  3ZBU A;  2YWG A;  4B3F X;  3CP2 A;  3Q6Q A;  1OGI A;  4WZE A;  1B23 P;  4YEJ A;  3B8H A;  4KKU A;  4DNR B;  1UD6 A;  4Z4W A;  3CME B;  2CRV A;  1R5B A;  1EFC A;  3R6K A;  4IW3 B;  2X8K A;  3CTA A;  2OK7 A;  2VBV A;  2BVN A;  3R6J A;  3ZBT A;  4DQL A;  3CCU B;  1EFU A;  1WOO A;  4OP7 A;  2ZBU A;  1VQK B;  1BPL A;  2HMA A;  1COW A;  2BMW A;  2OBR A;  1IJF A;  4UAJ A;  3MMP A;  1A8P A;  5HZB A;  1M90 D;  2Q6I A;  3MHP A;  4YAO A;  1DDG A;  1H8E A;  4TMX A;  2VBT A;  2XZL A;  1WOR A;  4X8I A;  3AGQ A;  4II2 A;  4LBW A;  1HZE A;  3Q3A A;  1T6X A;  1WSR A;  4ZCL A;  3OJX A;  4RDK A;  4XNF A;  4XL9 A;  3OE7 A;  1UD3 A;  2XNC A;  1FND A;  1P4M A;  2RC5 A;  5IYR A;  1E3Z A;  3OPO A;  5FO0 A;  2HCJ B;  3CXC B;  3AVY A;  2M5S A;  2XZP A;  3H9N A;  1YIT B;  2VZL A;  4RPB A;  1EP2 B;  2CC2 A;  4RD1 A;  3WBJ A;  3MCA A;  3ZIA A;  5TY0 A;  5FA6 A;  3CP8 A;  4B47 A;  3OZU A;  3I56 B;  2VNH A;  1KJZ A;  4PAA A;  1PJ6 A;  5E6T A;  4PGO A;  1Q9S A;  2FVG A;  1Y0R A;  3QFC A;  2V31 A;  5J35 A;  3GSI A;  5IYW A;  1CNF A;  1MAB A;  3BCF A;  4RDL A;  3AVU A;  2ZIT A;  2CF4 A;  3VR6 A;  4ZCM A;  4Z4R A;  1FDR A;  4UZE A;  4QVJ A;  4P25 A;  2X6W A;  1NJI D;  4XR6 A;  2X3U A;  1EFR A;  3CMM A;  1QVF B;  1KK3 A;  4WZT A;  4DK1 A;  2F1L A;  1M1K D;  1TLL A;  2E1B A;  3FPP A;  1Y0Y A;  3ZZ0 A;  5GV8 A;  2CBX A;  2YWE A;  3V76 A;  5DS0 A;  2GPJ A;  2ZL7 A;  4HIZ A;  1D8T A;  2YWF A;  1QVG B;  4RJL A;  1H42 A;  4E0F A;  1MRZ A;  3CB4 A;  3B82 A;  5AN9 A;  1YLO A;  4DQK A;  3SLD A;  1W0J A;  4YAW A;  1VQ9 B;  2X6X A;  5A88 A;  1K28 D;  5HKK A;  1YX2 A;  1NB9 A;  1E63 A;  3P26 A;  4NCN A;  1TUI A;  1QFZ A;  3G71 B;  1U2R A;  1GAW A;  1WOP A;  4LC0 A;  4TMW A;  5H5J A;  1XFO A;  3CES A;  5FL7 A;  2OBT A;  4G1B A;  1BJK A;  1TVC A;  4XOP A;  3LO8 A;  1UD8 A;  1V5V A;  3Q6R A;  1NDH A;  2GJP A;  4Y7C A;  4Z4Z A;  4TSF A;  1Q7Y D;  1FRN A;  1I18 A;  2CK3 A;  4ACB A;  1E1Q A;  1VQ8 B;  3OZW A;  1BX1 A;  1WDT A;  4UZU A;  3CCQ B;  1G7T A;  1UD5 A;  3LQE A;  1EFT A;  4MYT A;  4X7F A;  1RQR A;  2ZBV A;  1S4M A;  4RD0 A;  4XMY A;  5CDF A;  5BSX A;  1E64 A;  1V0F A;  4GQN A;  1DG1 G;  4B48 A;  2DOG A;  3ONY A;  5TV2 A;  5IYQ A;  1W0K A;  1VHO A;  2OTJ B;  4P1V A;  3GIR A;  4NBS A;  4PC2 A;  4Z4T A;  1WP6 A;  2JDI A;  4TMZ A;  2I1L A;  3PUN A;  1I7P A;  2XZO A;  1VQ6 B;  3A8I A;  5F4J A;  3VNU A;  1XE1 A;  5HXB A;  4OOS A;  4X05 A;  1N0V C;  1QFY A;  2DEU A;  2GQF A;  2V7X A;  3QSY A;  3VO2 A;  2DYI A;  3GVL A;  2QDX A;  4RCY A;  1EXM A;  3JU4 A;  1JNY A;  2B7C A;  4OOX A;  1VQM B;  2KVO A;  3T53 B;  1S0U A;  1OB2 A;  1UMK A;  3GVJ A;  1YJ9 B;  2C2W A;  1UD2 A;  1SKQ A;  3LNN A;  3H94 A;  1N07 A;  4XD7 A;  2BGI A;  4TKO B;  5FNZ A;  3AST A;  1ZM3 A;  5L46 A;  1KMH A;  4OPO A;  1CNE A;  1ZM4 A;  2PLF A;  5FIU A;  4BPR A;  4B44 A;  4QFM A;  1CQX A;  2X0K A;  1N8R D;  2BGJ A;  1NB0 A;  4P6V F;  2QMU A;  4B3X A;  3CCJ B;  1WSV A;  3PA1 A;  3JQP A;  4Z4V A;  1E3X A;  5IYN A;  3CCS B;  1WOS A;  3OOC A;  5TRD A;  3B78 A;  2VBS A;  4M53 A;  2WR8 A;  2YWH A;  1IB0 A;  4AC9 A;  3CCE B;  3CPW B;  3P27 A;  5GV7 A;  2Q6L A;  1YJW B;  1VQ7 B;  3W5H A;  1BX0 A;  4RLZ A;  2HLD A;  5IK2 A;  3A3G A;  5A89 A;  4PC1 A;  2D3L A;  4P12 A;  2C77 A;  3ASP A;  2HDN B;  1N08 A;  4XLH A;  3E1Y E;  5DN6 A;  3ZPN A;  1KD1 D;  1W35 A;  5B6I A;  1NBM A;  3WYA A;  1JA0 A;  2GK7 A;  5JBQ A;  4FWT A;  3FPK A;  5TR9 A;  1H8H A;  3CCM B;  4XM3 A;  2V4D A;  3CD6 B;  3AVV A;  1OB5 A;  2VBU A;  3BNW A;  1WPC A;  2RC6 A;  2WYR A;  3BH4 A;  2WJV A;  1VQ5 B;  1XQB A;  4XLA A;  2JN9 A;  3ZZU A;  2R9V A;  1EP1 B;  2XOK A;  3ONU A;  4C0S A;  2ZZG A;  2DCU A;  3CC2 B;  1E62 A;  3LVB A;  1KTV A;  2X85 A;  2WJY A;  2C4U A;  2PIA A;  4HE5 A;  3HAG A;  3WND A;  2QEX B;  4Y9R A;  3SKB A;  5KNL A;  1N05 A;  4M2L A;  5F4M A;  4RD3 A;  3CW2 A;  1KK1 A;  5IYP A;  1W87 A;  3GQB A;  4TMT A;  1GAQ A;  5EMN A;  2QE7 A;  4QUZ A;  3U6K A;  4OPS A;  1QGZ A;  2XND A;  1GO2 A;  1Q86 D;  1E79 A;  4ROX A;  1JA1 A;  1D1N A;  2B5O A;  3U6B A;  1Q81 D;  4KKS A;  4P26 A;  4Q7J B;  2GRE A;  1V0E A;  2WPD A;  1VQ4 B;  2PMD A;  1PJ5 A;  2BM0 A;  3BY1 A;  2GJK A;  4YEL A;  1Q82 D;  2F1M A;  4HE6 A;  2ZZQ A;  1EP3 B;  3KL9 A;  2OBS A;  3LQ6 A;  3CRZ A;  1I8D A;  5KW9 A;  4YAU A;  4M4S A;  3AGP A;  2WZP P;  4XLE A;  1R5O A;  4RD2 A;  3A8J A;  1QG0 A;  2FX3 A;  1FRQ A;  1NRK A;  1BMF A;  4TMV A;  4XLC A;  1KRH A;  3Q38 A;  3QFT A;  1OHH A;  4X07 A;  2GK6 A;  1PKV A;  3WNB A;  5HZA A;  4ACA A;  5LMZ A;  1ELO A;  1VQO B;  4XN3 A;  4Z4Y A;  1T5E A;  3CCV B;  2ZL6 A;  3CCL B;  3ES9 A;  4QHY A;  4OPV A;  4PAB A;  1FX0 A;  4X06 A;  3W2F A;  2NV4 A;  3BY2 A;  4YAF A;  3D26 A;  3AVW A;  2AHO A;  2QTL A;  1FNB A;  3JQQ A;  1RQP A;  3WY9 A;  1HVX A;  1E43 A;  1IJE A;  2QGG A;  4KKT A;  5H59 A;  4L8J A;  4RM0 A;  3W2I A;  4PC6 A;  1JB9 A;  1XB2 A;  4DK0 A;  1F20 A;  3DDY A;  3PUM A;  1D2E A;  2VJJ A;  4G5G A;  2DER A;  4XKW A;  2CW5 A;  5F4O A;  2F4N A;  3G05 A;  1QFJ A;  4ZV4 A;  2XGJ A;  2VNI A;  5J3O A;  1VQL B;  3JQR A;  2GJR A;  1VLY A;  1GJR A;  3VO1 A;  2F43 A;  4AVZ A;  4B3G A;  2NPF A;  5THX A;  2V7W A;  1HA3 A;  3AVT A;  2JJ1 A;  2Z6B D;  3ASS A;  4K1X A;  2EFG A;  4X0C A;  3PA2 A;  2D74 A;  3PVD A;  4Y9U A;  3ZUG A;  2VNJ A;  4PC7 A;  2J7K A;  4G7W A;  2OK8 A;  4NNJ A;  4XQF A;  4RD4 A;  3W2H A;  3CC7 B;  1W9X A;  1QGY A;  1GVH A;  4WQM A;  3FKS A;  4X7C A;  3GVK A;  1W2B B;  4LBZ A;  1J9Z A;  4WZL A;  1AMO A;  5FO1 A;  3WQZ A;  2BM1 A;  3I1F A;  4P2N A;  2C5H A;  4TN1 A;  2C4T A;  2Q6K A;  3T56 B;  1ZM2 A;  2E1R A;  4H9G A;  2DET A;  4OOV A;  1YI2 B;  3E20 A;  4XOT A;  3ZC3 A;  1K9M D;  4QVA A;  3QFS A;  4LBV A;  1QX4 A;  1YIJ B;  2V7Q A;  4Z4U A;  1PJ7 A; 
#chains in the Genus database with same CATH homology
 2ZL5 A;  3SKB A;  5F4M A;  3V7A A;  4P3I A;  3RY8 A;  5IYP A;  4QUZ A;  3Q6Q A;  3LQE A;  4WZE A;  4X7F A;  4OPS A;  5BSX A;  4Z4Z A;  4ROX A;  3BQJ A;  4WZK A;  4P26 A;  3ONY A;  4Z4W A;  5IYQ A;  5BSY A;  4P1V A;  4QV2 A;  4Z4T A;  3R6K A;  3BY1 A;  3PUN A;  3SEJ A;  5F4J A;  3LQ6 A;  3R6J A;  2OBS A;  3ASQ A;  4OOS A;  4OP7 A;  4X05 A;  5KW9 A;  2OBR A;  5HZB A;  3Q38 A;  3SLN A;  4OOX A;  4X07 A;  3Q3A A;  5HZA A;  4RDK A;  4Z4Y A;  2ZL6 A;  4X7D A;  5IYR A;  4OPV A;  3AST A;  4X06 A;  3BY2 A;  4OPO A;  3D26 A;  3ASR A;  4X7E A;  4RPB A;  3Q39 A;  3PA1 A;  3SJP A;  4Z4V A;  5IYN A;  4RM0 A;  5E6T A;  5J35 A;  3PUM A;  5IYW A;  4RDL A;  4RDJ A;  5F4O A;  4Z4R A;  5J3O A;  4QVJ A;  4P25 A;  4RLZ A;  4WZT A;  4P12 A;  3ASP A;  3ASS A;  4X0C A;  3PA2 A;  3PVD A;  4Z4S A;  2ZL7 A;  1IHM A;  4X7C A;  4WZL A;  4RPD A;  3SLD A;  4P2N A;  3ONU A;  4OOV A;  2OBT A;  4QVA A;  3Q6R A;  4Z4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...