4Z4UA

Crystal structure of gii.10 p domain in complex with 37.5mm fucose
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
314
structure length
310
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein
publication title The sweet quartet: Binding of fucose to the norovirus capsid.
pubmed doi rcsb
source organism Norovirus gii.10
total genus 70
structure length 310
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4z4uA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4z4uA01
3BY1A 4OOXA 3Q39A 4OPVA 5F4OA 4Z4VA 5IYNA 3Q38A 3ASQA 4QV2A 4OOSA 2ZL6A 4RM0A 4WZLA 4Z4ZA 3D26A 2ZL5A 5HZAA 4Z4YA 2ZL7A 4RDJA 3SKBA 3RY8A 4X0CA 4P12A 4X05A 4P1VA 4Z4TA 2OBSA 3ASPA 4Z4SA 5F4MA 4P26A 4QUZA 5HZBA 4QVJA 5KW9A 4RLZA 3ASTA 3PUMA 5IYPA 3SLDA 4Z4RA 3ONUA 4RPBA 4QVAA 4RPDA 4OOVA 3Q6QA 4OPOA 2OBTA 4P25A 3LQEA 4X06A 3ONYA 4RDLA 4Z4UA 3PUNA 4OP7A 2OBRA 3LQ6A 3PA2A 3BQJA 5IYQA 3V7AA 4WZKA 4WZEA 3ASSA 3Q6RA 3SJPA 4X7FA 4WZTA 3R6JA 5BSYA 4OPSA 4P2NA 3PVDA 4ROXA 5F4JA 3SLNA 4P3IA 4Z4WA 5J35A 1IHMA 3SEJA 5IYWA 5E6TA 4X7DA 4RDKA 5J3OA 3BY2A 4X7EA 5BSXA 3Q3AA 4X07A 3PA1A 3ASRA 3R6KA 4X7CA 5IYRA
chains in the Genus database with same CATH superfamily
2ZZFA 2GK6A 5F4OA 3JQRA 4ZCMA 1N8RD 1TUIA 2BGIA 3Q38A 1RQPA 2QTZA 3W2IA 2BGJA 2XOKA 3AVXA 5FIUA 4YAOA 1VQ5B 1VQ8B 1GJRA 4F7DA 4ZGNB 3WBJA 4B4DA 2E1RA 4XONA 3ZZUA 3VR6A 3CW2A 3CCRB 1FNMA 3OFNA 2PIAA 1D8TA 1UD6A 2BV3A 2JDIA 5GV8A 1XB2A 3FJOA 4XLCA 2OK8A 3OE7A 4RDJA 5DN6A 4NNJA 2VBSA 3JQQA 3P26A 1Q7YD 1D1NA 2CW5A 1E79A 1NRKA 3CESA 4YALA 1QGYA 3VO1A 1EXMA 4X05A 2XZPA 4P1VA 5FA6A 3ZBUA 3GVJA 2OBSA 3WNDA 3ASPA 1B23P 4Z4SA 3CXCB 1H8HA 3BCDA 4B44A 1T5EA 1V5VA 1W2BB 5H5JA 4LBYA 2HLDA 2QN6A 3B78A 3FKSA 3OOCA 5FO1A 2V7QA 1VQ4B 3OJWA 3J81k 4TMVA 5KW9A 1TVCA 4ASUA 1YX2A 3ASTA 4ZGQB 2WSSA 4N3GA 4RPBA 1XQBA 3CCJB 1KC8D 1VHOA 2P3MA 3DDYA 4OOVA 2EIXA 3WYAA 1OB2A 4RD6A 4XN0A 3LQEA 4X06A 1IJFA 3GSIA 4FK8A 2D9RA 1BQEA 2ZXIA 1UD5A 1KMHA 1PJ7A 3PA2A 3OKXA 3U2QA 3G4SB 4LC0A 1WTHD 2Q6OA 4RD1A 4G5GA 4TMWA 2W6JA 4EH1A 5DS0A 3I55B 1NDHA 3Q6RA 1YJNB 3BC9A 2B7BA 2X85A 3CMAB 1VQLB 4G7WA 1BJKA 2LZJA 1YI2B 3H94A 2XNDA 4P2NA 4LBVA 5AN9A 5A8AA 2BF4A 4DQLA 4HE6A 2Q6LA 4XN3A 3ZC3A 1FDRA 4G1BA 3NE5B 1IHMA 1BPLA 1QH0A 1MABA 1BX0A 5E6TA 4X7DA 3ZZ0A 4PC7A 2X0KA 3WBKA 5J3OA 3QE2A 4U9UA 4XKVA 3BY2A 4X7EA 3VO2A 1TTTA 1JNYA 2GQFA 2C4UA 1R5OA 3T51B 3AGQA 2WYRA 4PC1A 4B3FX 3G6EB 2WZPP 3OJXA 1QVFB 3W5UA 3R6KA 1SKYB 1KK0A 1E3ZA 5FL7A 3MMPA 4X7CA 5JBQA 5IYRA 4M2LA 1VQOB 2DIEA 1WOSA 2DCUA 3BY1A 3Q39A 1N06A 3A3BA 3KL9A 3WNBA 5IYNA 3QFTA 5TV2A 5LMZA 3GQBA 1OB5A 3OAAA 4CQJA 1QG0A 4PC3A 1SKQA 1KTVA 4RM0A 2X8KA 1E63A 2BM1A 5FO0A 2I1LA 2F1LA 3OEEA 2C4TA 4II2A 2GJRA 3VNVA 1WORA 1FNCA 1UD4A 5TY0A 4G6IA 3CPWB 4M0LA 4RCZA 3CCQB 2ZL7A 1G7TA 3G05A 1Q86D 5FNZA 2CF4A 3AGPA 3JQPA 1W34A 3A8IA 3CCSB 3WXMA 3T56B 4JMQA 1Q9SA 1YITB 4AF6A 2C77A 1DDGA 1G7CA 2CRVA 3BCFA 5HXBA 4XKWA 3CTAA 4Y9UA 2AHOA 4P26A 2JN9A 3LO8A 4QUZA 1YLOA 4QVJA 4RD0A 5HZBA 4RLZA 3WQZA 4DQKA 2YWHA 3A3GA 2XEXA 3SLDA 2VNHA 2E1BA 4QVAA 2DERA 2DETA 1E43A 1EP1B 1SM4A 2DY1A 1W35A 5KNLA 3LNNA 4RDLA 2C2WA 5B6IA 4C43A 1S72B 1W87A 2V7UA 1E62A 2WJVA 2Z6BD 4P9SA 4Z4UA 4KKTA 2CNDA 1YJWB 3PENA 3LQ6A 3BQJA 4QHYA 2X3UA 3ZPNA 4M1KA 3OZVA 4WQMA 1GVHA 3B8HA 1D2EA 2JJ1A 1QUFA 2QGGA 2BVNA 4GQNA 1VQ7B 1Y0RA 3AVVA 4AC9A 3BH4A 3VMFA 4E0FA 4WZTA 1HA3A 1WDTA 1ELOA 5BSYA 4OPSA 2X6XA 4ROXA 2PE3A 2WJYA 3OZUA 3OPOA 1Q81D 3CMMA 5J35A 1PJ6A 4DNRB 1BX1A 1RQRA 3SEJA 4RD4A 2XNJA 4XORA 2JIZA 5THXA 1DARA 1JB9A 2V31A 2ZITA 4RDKA 4MYTA 4XLEA 1NB0A 1QUEA 2JJ2A 3V76A 3A35A 4XOPA 1N0VC 4ZCLA 4X07A 4UAJA 4YEJA 2X6YA 3CCLB 1ZM3A 2YWGA 1FNBA 4XR6A 1G7SA 4XNFA 2OTLB 1UMKA 2QTLA 3AVYA 1DG1G 1I8DA 2X6WA 2ZZQA 1WSRA 4P6YA 4OOXA 1OHHA 4R71A 2NV4A 2Q6KA 4TN1A 2GK7A 2VNKA 1T6YA 4QV2A 2XZLA 4UZEA 3GIRA 4FXUA 1GR1A 1K28D 2ZL6A 5H59A 4XQFA 2EFGA 2RC5A 3D26A 1QVGB 5HZAA 3QFCA 1KK1A 3QFRA 3H9NA 4Z4YA 3MHPA 4G1VA 1EP2B 4XMYA 1JA0A 4PAAA 3SKBA 1BLIA 2FVGA 4QFMA 1NBMA 1KQSB 2XGJA 4X0CA 1FRNA 4P12A 2NPFA 2HDNB 1E3XA 3P27A 3CC7B 2D3NA 4TMTA 1K9MD 4TT3A 4Z4TA 3ZIAA 3AVTA 4P6VF 1WSVA 4L8JA 5TR9A 2XNCA 4YHBA 4TMZA 1V0FA 1ZM4A 4M4SA 3OW2B 1HVXA 4NBSA 1E64A 4RCYA 3CCEB 2VBVA 2BM0A 5IYPA 4II3A 4Z4RA 3LVBA 1YHQB 3CC4B 4BPRA 2V7WA 1N07A 4P25A 2OBTA 4KKSA 2V7VA 3ZUGA 1VF7A 3ONYA 3GVLA 2VJIA 5GV7A 1WU8A 3PUNA 4OP7A 1KK2A 2C5BA 3G71B 1S0UA 4YELA 1E1RA 1K8AD 1UD3A 5KSWB 1DDIA 4WZKA 2ZTGA 1KJZA 2CK3A 4ZV4A 3CC2B 1YJ9B 1GO2A 3ASSA 3OZWA 3ZBTA 2QDXA 4RJLA 2V4DA 1VHEA 1HZEA 5A89A 1I7PA 5HKKA 4PABA 4IW3B 1VQMB 1EFTA 2V7TA 1W0JA 4XLHA 1EFCA 3B82A 3W2FA 2R9VA 1KK3A 1EP3B 3PVDA 2F43A 4HIZA 2ZBUA 5F4JA 2QA4B 1H42A 1CNEA 1PKVA 4PGOA 3W2GA 1UD8A 2CBXA 1JJ2B 1COWA 2B7CA 4XLFA 3CCUB 5CDFA 1BMFA 2GPJA 2GREA 4B43A 1E1QA 3CB4A 1Q82D 1VQ6B 4B3XA 1GAQA 1K73D 2HCJB 1H85A 2FX3A 5A88A 1UD2A 1T6ZA 3JU4A 2GJPA 4YAFA 1J9ZA 1PJ5A 3ES9A 2BMWA 4H9GA 2HMAA 1ZM9A 2B5OA 2D3LA 4M53A 4RD2A 2F1MA 5DSZA 4B48A 1WOPA 2QEXB 1W9XA 3HAGA 1QFJA 3OW7A 3CD6B 1JA1A 1R5BA 4XL9A 4J0QA 1MRZA 3E1YE 2VJJA 3FPKA 4TMXA 4AF7A 3W5HA 1I18A 2X53S 2PMDA 4OPVA 4Z4VA 1Y0YA 4YXWA 3FPPA 2PLFA 3ASQA 4MYUA 4NCNA 4OOSA 2OK7A 1KRHA 4DK0A 3A1PA 3AVUA 4ACAA 4WZLA 4Z4ZA 2J7KA 1VQ9B 2VBUA 1F60A 2ZL5A 4C0SA 4G7XA 1KZLA 3MCAA 3BNWA 1WOOA 4XM3A 1GAWA 3WNCA 3CMEB 2DYIA 1FRQA 2ZXHA 3RY8A 4FWTA 1N05A 1M90D 4TSFA 1CNFA 1QGZA 2V7XA 2M5SA 2WZNA 2XZOA 3WY9A 4Q7JB 2C78A 1WPCA 4RD3A 2ZZGA 4HE5A 1YIJB 1OGIA 1XFOA 2D74A 5F4MA 1VJSA 4ZCIA 4LBZA 1V0EA 3I1FA 1P4MA 1R5NA 4DK1A 3PUMA 1FNDA 1KD1D 1EWYA 1QFYA 3ISXA 1VQPB 3W5VA 3ONUA 3CRZA 4Y9RA 4LBWA 2WR8A 4Z1MA 4RPDA 3E20A 4B3GA 1AMOA 2YWEA 3Q6QA 1QGAA 2RC6A 2DOGA 4DNTB 1EFRA 2CC2A 4OPOA 3VNUA 3GVKA 2ZTNA 4P22A 5EMNA 3ZZTA 4ACBA 2F4NA 4P3YA 1WP6A 1QFZA 2QMUA 5L46A 2OTJB 2ZBVA 1U2RA 3W2HA 3W2EA 4B47A 3A8KA 1VQNB 3OEHA 2BN4A 2OBRA 5IYQA 5IK2A 4UZFA 2OYNA 1NJID 2YWFA 3CPXA 1TLLA 3V7AA 1F20A 5TRDA 1VLOA 2VNJA 2WPDA 1EFUA 4WZEA 3U6KA 1QX4A 3QFSA 1CQXA 3CP8A 2W6IA 3OP1A 3SJPA 1H8EA 1B2RA 4X7FA 3KEWA 1NB9A 2KVOA 1T6XA 3R6JA 4AVZA 1AIPA 1N0UA 1W0KA 4PC6A 3A8JA 1XE1A 3SLNA 4P3IA 1VQKB 1S4MA 3CP2A 4Z4WA 1IJEA 4UZUA 4XLAA 1ZM2A 3U6BA 2BSAA 5IYWA 2BPOA 4XOTA 2ZZEA 2VZLA 1OGJA 2C5HA 2GJKA 2DEUA 2VNIA 4KKUA 4X8IA 3I56B 4N3NA 4K1XA 1OB0A 1VLYA 3CCMB 4YAUA 1G7RA 1M1KD 4PC2A 2VBTA 5BSXA 3T53B 3Q3AA 1ZUNB 1N08A 3ASRA 3PA1A 2QE7A 4WWVA 2R6HA 3SJZA 4FN5A 3QSYA 4YAWA 4XD7A 3AVWA 4Y7CA 1A8PA 1IB0A 1FX0A 4TKOB 2Q6IA 3CCVB 2VYQA
chains in the Genus database with same CATH topology
3BY1A 4OOXA 3Q39A 4OPVA 5F4OA 4Z4VA 5IYNA 3Q38A 3ASQA 4QV2A 4OOSA 2ZL6A 4RM0A 4WZLA 4Z4ZA 3D26A 2ZL5A 5HZAA 4Z4YA 2ZL7A 4RDJA 3SKBA 3RY8A 4X0CA 4P12A 4X05A 4P1VA 4Z4TA 2OBSA 3ASPA 4Z4SA 5F4MA 4P26A 4QUZA 5HZBA 4QVJA 5KW9A 4RLZA 3ASTA 3PUMA 5IYPA 3SLDA 4Z4RA 3ONUA 4RPBA 4QVAA 4RPDA 4OOVA 3Q6QA 4OPOA 2OBTA 4P25A 3LQEA 4X06A 3ONYA 4RDLA 4Z4UA 3PUNA 4OP7A 2OBRA 3LQ6A 3PA2A 3BQJA 5IYQA 3V7AA 4WZKA 4WZEA 3ASSA 3Q6RA 3SJPA 4X7FA 4WZTA 3R6JA 5BSYA 4OPSA 4P2NA 3PVDA 4ROXA 5F4JA 3SLNA 4P3IA 4Z4WA 5J35A 1IHMA 3SEJA 5IYWA 5E6TA 4X7DA 4RDKA 5J3OA 3BY2A 4X7EA 5BSXA 3Q3AA 4X07A 3PA1A 3ASRA 3R6KA 4X7CA 5IYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY1 A;  4OOX A;  3Q39 A;  4OPV A;  5F4O A;  4Z4V A;  5IYN A;  3Q38 A;  3ASQ A;  4QV2 A;  4OOS A;  2ZL6 A;  4RM0 A;  4WZL A;  4Z4Z A;  3D26 A;  2ZL5 A;  5HZA A;  4Z4Y A;  2ZL7 A;  4RDJ A;  3SKB A;  3RY8 A;  4X0C A;  4P12 A;  4X05 A;  4P1V A;  4Z4T A;  2OBS A;  3ASP A;  4Z4S A;  5F4M A;  4P26 A;  4QUZ A;  5HZB A;  4QVJ A;  5KW9 A;  4RLZ A;  3AST A;  3PUM A;  5IYP A;  3SLD A;  4Z4R A;  3ONU A;  4RPB A;  4QVA A;  4RPD A;  4OOV A;  3Q6Q A;  4OPO A;  2OBT A;  4P25 A;  3LQE A;  4X06 A;  3ONY A;  4RDL A;  4Z4U A;  3PUN A;  4OP7 A;  2OBR A;  3LQ6 A;  3PA2 A;  3BQJ A;  5IYQ A;  3V7A A;  4WZK A;  4WZE A;  3ASS A;  3Q6R A;  3SJP A;  4X7F A;  4WZT A;  3R6J A;  5BSY A;  4OPS A;  4P2N A;  3PVD A;  4ROX A;  5F4J A;  3SLN A;  4P3I A;  4Z4W A;  5J35 A;  1IHM A;  3SEJ A;  5IYW A;  5E6T A;  4X7D A;  4RDK A;  5J3O A;  3BY2 A;  4X7E A;  5BSX A;  3Q3A A;  4X07 A;  3PA1 A;  3ASR A;  3R6K A;  4X7C A;  5IYR A; 
#chains in the Genus database with same CATH topology
 2ZZF A;  2GK6 A;  5F4O A;  3JQR A;  4ZCM A;  1N8R D;  1TUI A;  2BGI A;  3Q38 A;  1RQP A;  2QTZ A;  3W2I A;  2BGJ A;  2XOK A;  3AVX A;  5FIU A;  4YAO A;  1VQ5 B;  1VQ8 B;  1GJR A;  4F7D A;  4ZGN B;  3WBJ A;  4B4D A;  2E1R A;  4XON A;  3ZZU A;  3VR6 A;  3CW2 A;  3CCR B;  1FNM A;  3OFN A;  2PIA A;  1D8T A;  1UD6 A;  2BV3 A;  2JDI A;  5GV8 A;  1XB2 A;  3FJO A;  4XLC A;  2OK8 A;  3OE7 A;  4RDJ A;  5DN6 A;  4NNJ A;  2VBS A;  3JQQ A;  3P26 A;  1Q7Y D;  1D1N A;  2CW5 A;  1E79 A;  1NRK A;  3CES A;  4YAL A;  1QGY A;  3VO1 A;  1EXM A;  4X05 A;  2XZP A;  4P1V A;  5FA6 A;  3ZBU A;  3GVJ A;  2OBS A;  3WND A;  3ASP A;  1B23 P;  4Z4S A;  3CXC B;  1H8H A;  3BCD A;  4B44 A;  1T5E A;  1V5V A;  1W2B B;  5H5J A;  4LBY A;  2HLD A;  2QN6 A;  3B78 A;  3FKS A;  3OOC A;  5FO1 A;  2V7Q A;  1VQ4 B;  3OJW A;  3J81 k;  4TMV A;  5KW9 A;  1TVC A;  4ASU A;  1YX2 A;  3AST A;  4ZGQ B;  2WSS A;  4N3G A;  4RPB A;  1XQB A;  3CCJ B;  1KC8 D;  1VHO A;  2P3M A;  3DDY A;  4OOV A;  2EIX A;  3WYA A;  1OB2 A;  4RD6 A;  4XN0 A;  3LQE A;  4X06 A;  1IJF A;  3GSI A;  4FK8 A;  2D9R A;  1BQE A;  2ZXI A;  1UD5 A;  1KMH A;  1PJ7 A;  3PA2 A;  3OKX A;  3U2Q A;  3G4S B;  4LC0 A;  1WTH D;  2Q6O A;  4RD1 A;  4G5G A;  4TMW A;  2W6J A;  4EH1 A;  5DS0 A;  3I55 B;  1NDH A;  3Q6R A;  1YJN B;  3BC9 A;  2B7B A;  2X85 A;  3CMA B;  1VQL B;  4G7W A;  1BJK A;  2LZJ A;  1YI2 B;  3H94 A;  2XND A;  4P2N A;  4LBV A;  5AN9 A;  5A8A A;  2BF4 A;  4DQL A;  4HE6 A;  2Q6L A;  4XN3 A;  3ZC3 A;  1FDR A;  4G1B A;  3NE5 B;  1IHM A;  1BPL A;  1QH0 A;  1MAB A;  1BX0 A;  5E6T A;  4X7D A;  3ZZ0 A;  4PC7 A;  2X0K A;  3WBK A;  5J3O A;  3QE2 A;  4U9U A;  4XKV A;  3BY2 A;  4X7E A;  3VO2 A;  1TTT A;  1JNY A;  2GQF A;  2C4U A;  1R5O A;  3T51 B;  3AGQ A;  2WYR A;  4PC1 A;  4B3F X;  3G6E B;  2WZP P;  3OJX A;  1QVF B;  3W5U A;  3R6K A;  1SKY B;  1KK0 A;  1E3Z A;  5FL7 A;  3MMP A;  4X7C A;  5JBQ A;  5IYR A;  4M2L A;  1VQO B;  2DIE A;  1WOS A;  2DCU A;  3BY1 A;  3Q39 A;  1N06 A;  3A3B A;  3KL9 A;  3WNB A;  5IYN A;  3QFT A;  5TV2 A;  5LMZ A;  3GQB A;  1OB5 A;  3OAA A;  4CQJ A;  1QG0 A;  4PC3 A;  1SKQ A;  1KTV A;  4RM0 A;  2X8K A;  1E63 A;  2BM1 A;  5FO0 A;  2I1L A;  2F1L A;  3OEE A;  2C4T A;  4II2 A;  2GJR A;  3VNV A;  1WOR A;  1FNC A;  1UD4 A;  5TY0 A;  4G6I A;  3CPW B;  4M0L A;  4RCZ A;  3CCQ B;  2ZL7 A;  1G7T A;  3G05 A;  1Q86 D;  5FNZ A;  2CF4 A;  3AGP A;  3JQP A;  1W34 A;  3A8I A;  3CCS B;  3WXM A;  3T56 B;  4JMQ A;  1Q9S A;  1YIT B;  4AF6 A;  2C77 A;  1DDG A;  1G7C A;  2CRV A;  3BCF A;  5HXB A;  4XKW A;  3CTA A;  4Y9U A;  2AHO A;  4P26 A;  2JN9 A;  3LO8 A;  4QUZ A;  1YLO A;  4QVJ A;  4RD0 A;  5HZB A;  4RLZ A;  3WQZ A;  4DQK A;  2YWH A;  3A3G A;  2XEX A;  3SLD A;  2VNH A;  2E1B A;  4QVA A;  2DER A;  2DET A;  1E43 A;  1EP1 B;  1SM4 A;  2DY1 A;  1W35 A;  5KNL A;  3LNN A;  4RDL A;  2C2W A;  5B6I A;  4C43 A;  1S72 B;  1W87 A;  2V7U A;  1E62 A;  2WJV A;  2Z6B D;  4P9S A;  4Z4U A;  4KKT A;  2CND A;  1YJW B;  3PEN A;  3LQ6 A;  3BQJ A;  4QHY A;  2X3U A;  3ZPN A;  4M1K A;  3OZV A;  4WQM A;  1GVH A;  3B8H A;  1D2E A;  2JJ1 A;  1QUF A;  2QGG A;  2BVN A;  4GQN A;  1VQ7 B;  1Y0R A;  3AVV A;  4AC9 A;  3BH4 A;  3VMF A;  4E0F A;  4WZT A;  1HA3 A;  1WDT A;  1ELO A;  5BSY A;  4OPS A;  2X6X A;  4ROX A;  2PE3 A;  2WJY A;  3OZU A;  3OPO A;  1Q81 D;  3CMM A;  5J35 A;  1PJ6 A;  4DNR B;  1BX1 A;  1RQR A;  3SEJ A;  4RD4 A;  2XNJ A;  4XOR A;  2JIZ A;  5THX A;  1DAR A;  1JB9 A;  2V31 A;  2ZIT A;  4RDK A;  4MYT A;  4XLE A;  1NB0 A;  1QUE A;  2JJ2 A;  3V76 A;  3A35 A;  4XOP A;  1N0V C;  4ZCL A;  4X07 A;  4UAJ A;  4YEJ A;  2X6Y A;  3CCL B;  1ZM3 A;  2YWG A;  1FNB A;  4XR6 A;  1G7S A;  4XNF A;  2OTL B;  1UMK A;  2QTL A;  3AVY A;  1DG1 G;  1I8D A;  2X6W A;  2ZZQ A;  1WSR A;  4P6Y A;  4OOX A;  1OHH A;  4R71 A;  2NV4 A;  2Q6K A;  4TN1 A;  2GK7 A;  2VNK A;  1T6Y A;  4QV2 A;  2XZL A;  4UZE A;  3GIR A;  4FXU A;  1GR1 A;  1K28 D;  2ZL6 A;  5H59 A;  4XQF A;  2EFG A;  2RC5 A;  3D26 A;  1QVG B;  5HZA A;  3QFC A;  1KK1 A;  3QFR A;  3H9N A;  4Z4Y A;  3MHP A;  4G1V A;  1EP2 B;  4XMY A;  1JA0 A;  4PAA A;  3SKB A;  1BLI A;  2FVG A;  4QFM A;  1NBM A;  1KQS B;  2XGJ A;  4X0C A;  1FRN A;  4P12 A;  2NPF A;  2HDN B;  1E3X A;  3P27 A;  3CC7 B;  2D3N A;  4TMT A;  1K9M D;  4TT3 A;  4Z4T A;  3ZIA A;  3AVT A;  4P6V F;  1WSV A;  4L8J A;  5TR9 A;  2XNC A;  4YHB A;  4TMZ A;  1V0F A;  1ZM4 A;  4M4S A;  3OW2 B;  1HVX A;  4NBS A;  1E64 A;  4RCY A;  3CCE B;  2VBV A;  2BM0 A;  5IYP A;  4II3 A;  4Z4R A;  3LVB A;  1YHQ B;  3CC4 B;  4BPR A;  2V7W A;  1N07 A;  4P25 A;  2OBT A;  4KKS A;  2V7V A;  3ZUG A;  1VF7 A;  3ONY A;  3GVL A;  2VJI A;  5GV7 A;  1WU8 A;  3PUN A;  4OP7 A;  1KK2 A;  2C5B A;  3G71 B;  1S0U A;  4YEL A;  1E1R A;  1K8A D;  1UD3 A;  5KSW B;  1DDI A;  4WZK A;  2ZTG A;  1KJZ A;  2CK3 A;  4ZV4 A;  3CC2 B;  1YJ9 B;  1GO2 A;  3ASS A;  3OZW A;  3ZBT A;  2QDX A;  4RJL A;  2V4D A;  1VHE A;  1HZE A;  5A89 A;  1I7P A;  5HKK A;  4PAB A;  4IW3 B;  1VQM B;  1EFT A;  2V7T A;  1W0J A;  4XLH A;  1EFC A;  3B82 A;  3W2F A;  2R9V A;  1KK3 A;  1EP3 B;  3PVD A;  2F43 A;  4HIZ A;  2ZBU A;  5F4J A;  2QA4 B;  1H42 A;  1CNE A;  1PKV A;  4PGO A;  3W2G A;  1UD8 A;  2CBX A;  1JJ2 B;  1COW A;  2B7C A;  4XLF A;  3CCU B;  5CDF A;  1BMF A;  2GPJ A;  2GRE A;  4B43 A;  1E1Q A;  3CB4 A;  1Q82 D;  1VQ6 B;  4B3X A;  1GAQ A;  1K73 D;  2HCJ B;  1H85 A;  2FX3 A;  5A88 A;  1UD2 A;  1T6Z A;  3JU4 A;  2GJP A;  4YAF A;  1J9Z A;  1PJ5 A;  3ES9 A;  2BMW A;  4H9G A;  2HMA A;  1ZM9 A;  2B5O A;  2D3L A;  4M53 A;  4RD2 A;  2F1M A;  5DSZ A;  4B48 A;  1WOP A;  2QEX B;  1W9X A;  3HAG A;  1QFJ A;  3OW7 A;  3CD6 B;  1JA1 A;  1R5B A;  4XL9 A;  4J0Q A;  1MRZ A;  3E1Y E;  2VJJ A;  3FPK A;  4TMX A;  4AF7 A;  3W5H A;  1I18 A;  2X53 S;  2PMD A;  4OPV A;  4Z4V A;  1Y0Y A;  4YXW A;  3FPP A;  2PLF A;  3ASQ A;  4MYU A;  4NCN A;  4OOS A;  2OK7 A;  1KRH A;  4DK0 A;  3A1P A;  3AVU A;  4ACA A;  4WZL A;  4Z4Z A;  2J7K A;  1VQ9 B;  2VBU A;  1F60 A;  2ZL5 A;  4C0S A;  4G7X A;  1KZL A;  3MCA A;  3BNW A;  1WOO A;  4XM3 A;  1GAW A;  3WNC A;  3CME B;  2DYI A;  1FRQ A;  2ZXH A;  3RY8 A;  4FWT A;  1N05 A;  1M90 D;  4TSF A;  1CNF A;  1QGZ A;  2V7X A;  2M5S A;  2WZN A;  2XZO A;  3WY9 A;  4Q7J B;  2C78 A;  1WPC A;  4RD3 A;  2ZZG A;  4HE5 A;  1YIJ B;  1OGI A;  1XFO A;  2D74 A;  5F4M A;  1VJS A;  4ZCI A;  4LBZ A;  1V0E A;  3I1F A;  1P4M A;  1R5N A;  4DK1 A;  3PUM A;  1FND A;  1KD1 D;  1EWY A;  1QFY A;  3ISX A;  1VQP B;  3W5V A;  3ONU A;  3CRZ A;  4Y9R A;  4LBW A;  2WR8 A;  4Z1M A;  4RPD A;  3E20 A;  4B3G A;  1AMO A;  2YWE A;  3Q6Q A;  1QGA A;  2RC6 A;  2DOG A;  4DNT B;  1EFR A;  2CC2 A;  4OPO A;  3VNU A;  3GVK A;  2ZTN A;  4P22 A;  5EMN A;  3ZZT A;  4ACB A;  2F4N A;  4P3Y A;  1WP6 A;  1QFZ A;  2QMU A;  5L46 A;  2OTJ B;  2ZBV A;  1U2R A;  3W2H A;  3W2E A;  4B47 A;  3A8K A;  1VQN B;  3OEH A;  2BN4 A;  2OBR A;  5IYQ A;  5IK2 A;  4UZF A;  2OYN A;  1NJI D;  2YWF A;  3CPX A;  1TLL A;  3V7A A;  1F20 A;  5TRD A;  1VLO A;  2VNJ A;  2WPD A;  1EFU A;  4WZE A;  3U6K A;  1QX4 A;  3QFS A;  1CQX A;  3CP8 A;  2W6I A;  3OP1 A;  3SJP A;  1H8E A;  1B2R A;  4X7F A;  3KEW A;  1NB9 A;  2KVO A;  1T6X A;  3R6J A;  4AVZ A;  1AIP A;  1N0U A;  1W0K A;  4PC6 A;  3A8J A;  1XE1 A;  3SLN A;  4P3I A;  1VQK B;  1S4M A;  3CP2 A;  4Z4W A;  1IJE A;  4UZU A;  4XLA A;  1ZM2 A;  3U6B A;  2BSA A;  5IYW A;  2BPO A;  4XOT A;  2ZZE A;  2VZL A;  1OGJ A;  2C5H A;  2GJK A;  2DEU A;  2VNI A;  4KKU A;  4X8I A;  3I56 B;  4N3N A;  4K1X A;  1OB0 A;  1VLY A;  3CCM B;  4YAU A;  1G7R A;  1M1K D;  4PC2 A;  2VBT A;  5BSX A;  3T53 B;  3Q3A A;  1ZUN B;  1N08 A;  3ASR A;  3PA1 A;  2QE7 A;  4WWV A;  2R6H A;  3SJZ A;  4FN5 A;  3QSY A;  4YAW A;  4XD7 A;  3AVW A;  4Y7C A;  1A8P A;  1IB0 A;  1FX0 A;  4TKO B;  2Q6I A;  3CCV B;  2VYQ A; 
#chains in the Genus database with same CATH homology
 3BY1 A;  4OOX A;  3Q39 A;  4OPV A;  5F4O A;  4Z4V A;  5IYN A;  3Q38 A;  3ASQ A;  4QV2 A;  4OOS A;  2ZL6 A;  4RM0 A;  4WZL A;  4Z4Z A;  3D26 A;  2ZL5 A;  5HZA A;  4Z4Y A;  2ZL7 A;  4RDJ A;  3SKB A;  3RY8 A;  4X0C A;  4P12 A;  4X05 A;  4P1V A;  4Z4T A;  2OBS A;  3ASP A;  4Z4S A;  5F4M A;  4P26 A;  4QUZ A;  5HZB A;  4QVJ A;  5KW9 A;  4RLZ A;  3AST A;  3PUM A;  5IYP A;  3SLD A;  4Z4R A;  3ONU A;  4RPB A;  4QVA A;  4RPD A;  4OOV A;  3Q6Q A;  4OPO A;  2OBT A;  4P25 A;  3LQE A;  4X06 A;  3ONY A;  4RDL A;  4Z4U A;  3PUN A;  4OP7 A;  2OBR A;  3LQ6 A;  3PA2 A;  3BQJ A;  5IYQ A;  3V7A A;  4WZK A;  4WZE A;  3ASS A;  3Q6R A;  3SJP A;  4X7F A;  4WZT A;  3R6J A;  5BSY A;  4OPS A;  4P2N A;  3PVD A;  4ROX A;  5F4J A;  3SLN A;  4P3I A;  4Z4W A;  5J35 A;  1IHM A;  3SEJ A;  5IYW A;  5E6T A;  4X7D A;  4RDK A;  5J3O A;  3BY2 A;  4X7E A;  5BSX A;  3Q3A A;  4X07 A;  3PA1 A;  3ASR A;  3R6K A;  4X7C A;  5IYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...