4Z4UA

Crystal structure of gii.10 p domain in complex with 37.5mm fucose
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
314
structure length
310
Chain Sequence
b'KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title The sweet quartet: Binding of fucose to the norovirus capsid.
pubmed doi rcsb
source organism Norovirus gii.10
molecule tags Viral protein
total genus 70
structure length 310
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4z4uA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4z4uA01
5J35A 4OOXA 4X7FA 4OPVA 4OPSA 4OP7A 5F4JA 4Z4YA 4P3IA 2OBTA 4WZEA 5HZAA 3D26A 4RDLA 4Z4VA 4RLZA 5IYRA 2ZL7A 4QUZA 5F4MA 5IYPA 3PA2A 1IHMA 3LQEA 4X0CA 3BY1A 3Q6QA 4RPBA 4RPDA 3ASQA 4X7DA 3SEJA 4WZKA 3Q38A 4P12A 4QVJA 4RDJA 3SJPA 2ZL6A 4Z4SA 4P1VA 3ASTA 3Q39A 4WZLA 3PVDA 4RM0A 4WZTA 4Z4UA 4X06A 3Q6RA 5IYWA 4X05A 5HZBA 3R6JA 4P26A 4X7CA 4Z4TA 4QV2A 4X7EA 4QVAA 3PUNA 4ROXA 3PA1A 3SLNA 5J3OA 4P2NA 3PUMA 4OPOA 3ASSA 4X07A 5BSYA 3V7AA 3SKBA 3R6KA 3ASRA 3ONUA 3BQJA 4Z4RA 3BY2A 3LQ6A 4OOSA 3SLDA 3Q3AA 2OBRA 3ONYA 5BSXA 4Z4WA 3RY8A 4Z4ZA 5IYNA 2ZL5A 5E6TA 4OOVA 5KW9A 4P25A 2OBSA 3ASPA 5F4OA 4RDKA 5IYQA
chains in the Genus database with same CATH superfamily
5H5JA 1WSVA 4KKTA 5FIUA 2VBTA 4BPRA 2VNJA 2DCUA 4EH1A 2WZNA 3W5HA 2YWEA 2VJIA 1JA0A 4OP7A 4DK0A 1SM4A 4FWTA 4RD0A 5F4JA 1I8DA 3W2FA 4RD3A 4P3IA 2AHOA 5HZAA 1CQXA 4RDLA 4XNFA 2V7QA 4M0LA 2F1MA 1VQNB 1VHEA 2PIAA 3QSYA 1IJFA 1N08A 1QGAA 2FVGA 2V7TA 2CNDA 1EWYA 2DIEA 1VQ4B 4RPDA 3A3BA 2X3UA 2VBVA 2JDIA 4XLFA 4II3A 1DG1G 1OB0A 3Q38A 1VQ9B 4XLHA 2V7WA 2X6WA 1M1KD 4ZCLA 1FNDA 4C43A 3KL9A 1W35A 2VZLA 2BSAA 1VLYA 3WNDA 1RQRA 4ZCIA 4P1VA 5FO0A 2BF4A 2WSSA 1S0UA 3G6EB 3BC9A 1NB0A 4RM0A 2J7KA 4X06A 3E1YE 1R5BA 2CC2A 2QE7A 3A3GA 3Q6RA 4PC1A 2X6XA 2BPOA 3R6JA 4RCZA 2OTJB 1YJ9B 3OZVA 1Q81D 4TN1A 4LBWA 1K28D 2QTZA 3CCLB 3WNCA 1HVXA 3W2IA 1R5NA 1B2RA 4B44A 4DQLA 1VQ7B 1COWA 1ZM9A 4P2NA 4U9UA 1QUEA 1GO2A 2QEXB 3BCDA 2ZBVA 4OPOA 3CCUB 2DERA 2QGGA 2ZZFA 3T53B 1ZUNB 3ZC3A 2Q6OA 2GK6A 2XNCA 3QFTA 4JMQA 2OYNA 1DARA 2DYIA 3SKBA 4XL9A 3ASRA 3OP1A 5GV7A 3BH4A 3LNNA 4XD7A 2VBSA 2P3MA 1VQPB 4HIZA 1YI2B 1FRNA 1E64A 2W6IA 4G5GA 1T5EA 3FPKA 3LQ6A 1HZEA 3SLDA 3OEHA 1UD4A 2VJJA 1TUIA 3Q3AA 2YWGA 1W34A 2PLFA 3QE2A 3CW2A 4Z1MA 1WTHD 1VHOA 1WP6A 2XZLA 3P26A 4GQNA 5FL7A 2C78A 1V0FA 5THXA 1KK0A 2ZZQA 2V4DA 3QFCA 2WJVA 1GJRA 1OGJA 1N06A 2OBSA 4YAWA 1MRZA 2DY1A 1VQ8B 1H8HA 4ZGQB 3W5UA 4PAAA 2V7VA 1D1NA 3OPOA 4RDKA 4TMVA 1KRHA 4RD4A 3CCQB 4RD2A 3W5VA 1WPCA 1UD2A 1T6YA 2E1BA 2OK7A 4TMXA 1QGYA 4OPVA 2D3LA 2QTLA 2ZITA 3ZBTA 4XN0A 1KK2A 1U2RA 3I55B 2DOGA 4FK8A 3OKXA 1WU8A 2Q6KA 2ZXHA 4N3NA 4Z4YA 2ZZEA 1FNMA 1FNBA 3BNWA 1D2EA 4LC0A 4Z4VA 1NBMA 5IYRA 2X6YA 5TR9A 3WBJA 5IYPA 3PA2A 2E1RA 3J81k 3BY1A 4ACBA 2ZXIA 1QUFA 3Q6QA 3WBKA 4MYTA 3ASQA 2PMDA 1W0KA 4PC6A 3GIRA 1WOPA 3SEJA 4P22A 1P4MA 5HXBA 1VF7A 5CDFA 3ZPNA 3W2EA 1YLOA 1VLOA 1V0EA 4RDJA 2Q6IA 3PENA 2PE3A 3OZWA 2WJYA 1K73D 2B7BA 2BM1A 1UD5A 3CP8A 1A8PA 1N07A 1PJ7A 3ASTA 4H9GA 3Q39A 3W2GA 3AGPA 4PGOA 2WPDA 3PVDA 1E3ZA 4WZLA 1EP1B 4WZTA 4Z4UA 3I56B 5IK2A 1K9MD 4ZGNB 1M90D 5IYWA 2C4TA 4X05A 5HZBA 2XOKA 4FXUA 1Q7YD 1G7RA 3MCAA 2VNIA 3QFRA 3VNUA 4MYUA 3LO8A 2W6JA 1WOOA 2R6HA 3U6KA 3CESA 4X7EA 2R9VA 3ZZUA 4F7DA 4QVAA 3PUNA 1KK3A 2D9RA 4ROXA 4XONA 4Y9RA 3U6BA 3SLNA 4XM3A 4ZV4A 5J3OA 2V7XA 1EFUA 2C4UA 4J0QA 4RD6A 1YIJB 1FDRA 3PUMA 3CCSB 4DQKA 3ASSA 1PJ6A 3OZUA 4AVZA 5L46A 3ZIAA 1EP2B 1H85A 3OEEA 2KVOA 3LVBA 3ZZTA 2XGJA 5FA6A 3CMAB 3ONUA 4G7XA 3BQJA 3ES9A 4B43A 1OHHA 4LBVA 4B3XA 3A35A 4PC7A 1AMOA 1Q9SA 4NCNA 3I1FA 2Q6LA 3CPWB 2BGIA 3AVYA 1YHQB 1N8RD 5TRDA 4XORA 4YAOA 1J9ZA 1JNYA 1YITB 3ONYA 3VO1A 5DS0A 1E62A 1ZM3A 4YALA 2Z6BD 3G4SB 2FX3A 3RY8A 4Z4WA 4Z4ZA 5IYNA 2C77A 1FX0A 4XOPA 4AC9A 5E6TA 5TV2A 1IJEA 1T6XA 2QDXA 1NB9A 5KW9A 3E20A 3GVKA 2GREA 3B78A 1XQBA 2NV4A 3ASPA 4XLEA 4TMZA 1I18A 4DNRB 4B3GA 5F4OA 1JB9A 3VR6A 1GR1A 1Q82D 1E79A 1N0VC 3ZZ0A 3AVUA 3CC4B 2DEUA 4B47A 2F43A 3OJWA 3WQZA 5J35A 1K8AD 1XE1A 4OOXA 3AVWA 2D3NA 4X7FA 1KTVA 1WORA 4XN3A 4II2A 2BV3A 2X8KA 2BMWA 2D74A 1E1RA 2XNJA 4OPSA 3A8JA 1QVGB 2BVNA 1E63A 3CRZA 4YAFA 3ISXA 3B8HA 1N0UA 4DNTB 1QG0A 3D26A 1VQKB 5JBQA 4XQFA 1YX2A 4L8JA 2ZTGA 4P3YA 1HA3A 2ZL7A 5EMNA 1S4MA 1IHMA 3LQEA 1EFRA 3H94A 1F20A 3OAAA 3OOCA 1W87A 4PABA 4Y9UA 1JJ2B 3CPXA 4HE6A 1VQLB 1KMHA 4YXWA 1V5VA 2F4NA 2OTLB 2EIXA 4XOTA 3BCFA 1EFTA 2CBXA 3G05A 4P9SA 5A8AA 1G7TA 4E0FA 1BQEA 2CF4A 5TY0A 2QMUA 1OB2A 1QFYA 4XLCA 1ZM2A 4X7CA 1DDIA 1RQPA 2I1LA 4Z4TA 2OK8A 3GQBA 3KEWA 5A89A 1E3XA 1G7SA 4P6YA 1TTTA 3AVTA 3CC7B 3PA1A 1BX0A 3QFSA 4UZEA 4AF6A 1QGZA 3GVLA 3HAGA 4YELA 3W2HA 4Q7JB 1WDTA 1AIPA 4CQJA 1NRKA 4X07A 3T56B 1BJKA 2V31A 1WOSA 4WWVA 5LMZA 2QA4B 1BLIA 3V7AA 1WSRA 1BPLA 3JQRA 4XKVA 4M4SA 4Z4RA 4B4DA 4DK1A 5AN9A 1N05A 1E1QA 4OOSA 3CMMA 1S72B 1D8TA 3V76A 4RJLA 2B7CA 1UD6A 3AGQA 3CTAA 2VNHA 3NE5B 4TKOB 1W0JA 4XKWA 1VQ5B 1EFCA 2M5SA 3B82A 4N3GA 3CXCB 4OOVA 4NNJA 4C0SA 2BGJA 3OE7A 3GSIA 1ZM4A 4P25A 1W9XA 3MHPA 4G1VA 1UD3A 1FRQA 5KNLA 2VBUA 4KKSA 3CB4A 3VMFA 4ASUA 4TSFA 1CNEA 3FKSA 2LZJA 4XLAA 4XR6A 1E43A 5IYQA 1YJWB 4KKUA 4UZFA 3VNVA 2HLDA 2CRVA 4B48A 4RCYA 1H8EA 1EXMA 4AF7A 3JQPA 5DSZA 1SKYB 2JJ1A 1VQOB 5B6IA 5A88A 1JA1A 2DETA 4TMTA 3A8IA 2OBTA 4WZEA 3ZUGA 5DN6A 4ZCMA 3FPPA 3CC2B 3U2QA 4RLZA 1TVCA 1DDGA 4YEJA 4UAJA 3JU4A 1VJSA 3A8KA 3P27A 4G7WA 4QUZA 2GJRA 5F4MA 2VYQA 1KC8D 1NJID 2B5OA 4X0CA 1T6ZA 1QVFB 2RC6A 1PJ5A 4RPBA 5FNZA 4X7DA 4M2LA 4M1KA 1XB2A 1H42A 2HMAA 4WZKA 1KK1A 2JJ2A 4IW3B 1G7CA 4LBZA 1KJZA 4LBYA 4YHBA 1NDHA 4K1XA 4P12A 3CCJB 1QX4A 1R5OA 2JN9A 5GV8A 5HKKA 4QVJA 4ACAA 4FN5A 3OW7A 2ZL6A 3SJPA 1VQ6B 3GVJA 4UZUA 5H59A 2X53S 2XNDA 4Z4SA 2JIZA 3WNBA 3DDYA 1Y0YA 1BMFA 4QHYA 4WQMA 1GVHA 2WZPP 2WYRA 2YWHA 2GK7A 1OGIA 3VO2A 2CW5A 4PC3A 4R71A 1QFJA 4G1BA 4P26A 3CMEB 5KSWB 1UMKA 1Y0RA 1I7PA 4QV2A 4TT3A 4HE5A 1GAQA 4P6VF 1IB0A 3OW2B 3MMPA 2GJPA 1OB5A 3CCVB 1YJNB 4NBSA 1QFZA 1KZLA 1SKQA 1CNFA 1UD8A 1TLLA 4QFMA 3OFNA 3H9NA 1KD1D 2GJKA 3OJXA 3AVVA 2ZZGA 2CK3A 2BM0A 1GAWA 2C2WA 3A1PA 3T51B 3ZBUA 5BSYA 1PKVA 2C5HA 3R6KA 2WR8A 2RC5A 2XZPA 3WXMA 2BN4A 2V7UA 3CCEB 2XEXA 3CD6B 4YAUA 3SJZA 2VNKA 4Y7CA 1W2BB 2HDNB 2YWFA 3BY2A 1QH0A 2X0KA 4PC2A 2NPFA 1VQMB 2ZTNA 3CCRB 3WY9A 3G71B 1MABA 2XZOA 2OBRA 2GPJA 1BX1A 5BSXA 4TMWA 2QN6A 5FO1A 3CP2A 2ZL5A 2ZBUA 1FNCA 2GQFA 3FJOA 2X85A 2HCJB 1ELOA 4G6IA 3WYAA 3JQQA 4B3FX 2F1LA 1B23P 2EFGA 1F60A 4XMYA 4X8IA 3CCMB 3AVXA 1EP3B 4RD1A 1XFOA 1Q86D 2C5BA 4M53A 1KQSB
chains in the Genus database with same CATH topology
5J35A 4OOXA 4X7FA 4OPVA 4OPSA 4OP7A 5F4JA 4Z4YA 4P3IA 2OBTA 4WZEA 5HZAA 3D26A 4RDLA 4Z4VA 4RLZA 5IYRA 2ZL7A 4QUZA 5F4MA 5IYPA 3PA2A 1IHMA 3LQEA 4X0CA 3BY1A 3Q6QA 4RPBA 4RPDA 3ASQA 4X7DA 3SEJA 4WZKA 3Q38A 4P12A 4QVJA 4RDJA 3SJPA 2ZL6A 4Z4SA 4P1VA 3ASTA 3Q39A 4WZLA 3PVDA 4RM0A 4WZTA 4Z4UA 4X06A 3Q6RA 5IYWA 4X05A 5HZBA 3R6JA 4P26A 4X7CA 4Z4TA 4QV2A 4X7EA 4QVAA 3PUNA 4ROXA 3PA1A 3SLNA 5J3OA 4P2NA 3PUMA 4OPOA 3ASSA 4X07A 5BSYA 3V7AA 3SKBA 3R6KA 3ASRA 3ONUA 3BQJA 4Z4RA 3BY2A 3LQ6A 4OOSA 3SLDA 3Q3AA 2OBRA 3ONYA 5BSXA 4Z4WA 3RY8A 4Z4ZA 5IYNA 2ZL5A 5E6TA 4OOVA 5KW9A 4P25A 2OBSA 3ASPA 5F4OA 4RDKA 5IYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J35 A;  4OOX A;  4X7F A;  4OPV A;  4OPS A;  4OP7 A;  5F4J A;  4Z4Y A;  4P3I A;  2OBT A;  4WZE A;  5HZA A;  3D26 A;  4RDL A;  4Z4V A;  4RLZ A;  5IYR A;  2ZL7 A;  4QUZ A;  5F4M A;  5IYP A;  3PA2 A;  1IHM A;  3LQE A;  4X0C A;  3BY1 A;  3Q6Q A;  4RPB A;  4RPD A;  3ASQ A;  4X7D A;  3SEJ A;  4WZK A;  3Q38 A;  4P12 A;  4QVJ A;  4RDJ A;  3SJP A;  2ZL6 A;  4Z4S A;  4P1V A;  3AST A;  3Q39 A;  4WZL A;  3PVD A;  4RM0 A;  4WZT A;  4Z4U A;  4X06 A;  3Q6R A;  5IYW A;  4X05 A;  5HZB A;  3R6J A;  4P26 A;  4X7C A;  4Z4T A;  4QV2 A;  4X7E A;  4QVA A;  3PUN A;  4ROX A;  3PA1 A;  3SLN A;  5J3O A;  4P2N A;  3PUM A;  4OPO A;  3ASS A;  4X07 A;  5BSY A;  3V7A A;  3SKB A;  3R6K A;  3ASR A;  3ONU A;  3BQJ A;  4Z4R A;  3BY2 A;  3LQ6 A;  4OOS A;  3SLD A;  3Q3A A;  2OBR A;  3ONY A;  5BSX A;  4Z4W A;  3RY8 A;  4Z4Z A;  5IYN A;  2ZL5 A;  5E6T A;  4OOV A;  5KW9 A;  4P25 A;  2OBS A;  3ASP A;  5F4O A;  4RDK A;  5IYQ A; 
#chains in the Genus database with same CATH topology
 5H5J A;  1WSV A;  4KKT A;  5FIU A;  2VBT A;  4BPR A;  2VNJ A;  2DCU A;  4EH1 A;  2WZN A;  3W5H A;  2YWE A;  2VJI A;  1JA0 A;  4OP7 A;  4DK0 A;  1SM4 A;  4FWT A;  4RD0 A;  5F4J A;  1I8D A;  3W2F A;  4RD3 A;  4P3I A;  2AHO A;  5HZA A;  1CQX A;  4RDL A;  4XNF A;  2V7Q A;  4M0L A;  2F1M A;  1VQN B;  1VHE A;  2PIA A;  3QSY A;  1IJF A;  1N08 A;  1QGA A;  2FVG A;  2V7T A;  2CND A;  1EWY A;  2DIE A;  1VQ4 B;  4RPD A;  3A3B A;  2X3U A;  2VBV A;  2JDI A;  4XLF A;  4II3 A;  1DG1 G;  1OB0 A;  3Q38 A;  1VQ9 B;  4XLH A;  2V7W A;  2X6W A;  1M1K D;  4ZCL A;  1FND A;  4C43 A;  3KL9 A;  1W35 A;  2VZL A;  2BSA A;  1VLY A;  3WND A;  1RQR A;  4ZCI A;  4P1V A;  5FO0 A;  2BF4 A;  2WSS A;  1S0U A;  3G6E B;  3BC9 A;  1NB0 A;  4RM0 A;  2J7K A;  4X06 A;  3E1Y E;  1R5B A;  2CC2 A;  2QE7 A;  3A3G A;  3Q6R A;  4PC1 A;  2X6X A;  2BPO A;  3R6J A;  4RCZ A;  2OTJ B;  1YJ9 B;  3OZV A;  1Q81 D;  4TN1 A;  4LBW A;  1K28 D;  2QTZ A;  3CCL B;  3WNC A;  1HVX A;  3W2I A;  1R5N A;  1B2R A;  4B44 A;  4DQL A;  1VQ7 B;  1COW A;  1ZM9 A;  4P2N A;  4U9U A;  1QUE A;  1GO2 A;  2QEX B;  3BCD A;  2ZBV A;  4OPO A;  3CCU B;  2DER A;  2QGG A;  2ZZF A;  3T53 B;  1ZUN B;  3ZC3 A;  2Q6O A;  2GK6 A;  2XNC A;  3QFT A;  4JMQ A;  2OYN A;  1DAR A;  2DYI A;  3SKB A;  4XL9 A;  3ASR A;  3OP1 A;  5GV7 A;  3BH4 A;  3LNN A;  4XD7 A;  2VBS A;  2P3M A;  1VQP B;  4HIZ A;  1YI2 B;  1FRN A;  1E64 A;  2W6I A;  4G5G A;  1T5E A;  3FPK A;  3LQ6 A;  1HZE A;  3SLD A;  3OEH A;  1UD4 A;  2VJJ A;  1TUI A;  3Q3A A;  2YWG A;  1W34 A;  2PLF A;  3QE2 A;  3CW2 A;  4Z1M A;  1WTH D;  1VHO A;  1WP6 A;  2XZL A;  3P26 A;  4GQN A;  5FL7 A;  2C78 A;  1V0F A;  5THX A;  1KK0 A;  2ZZQ A;  2V4D A;  3QFC A;  2WJV A;  1GJR A;  1OGJ A;  1N06 A;  2OBS A;  4YAW A;  1MRZ A;  2DY1 A;  1VQ8 B;  1H8H A;  4ZGQ B;  3W5U A;  4PAA A;  2V7V A;  1D1N A;  3OPO A;  4RDK A;  4TMV A;  1KRH A;  4RD4 A;  3CCQ B;  4RD2 A;  3W5V A;  1WPC A;  1UD2 A;  1T6Y A;  2E1B A;  2OK7 A;  4TMX A;  1QGY A;  4OPV A;  2D3L A;  2QTL A;  2ZIT A;  3ZBT A;  4XN0 A;  1KK2 A;  1U2R A;  3I55 B;  2DOG A;  4FK8 A;  3OKX A;  1WU8 A;  2Q6K A;  2ZXH A;  4N3N A;  4Z4Y A;  2ZZE A;  1FNM A;  1FNB A;  3BNW A;  1D2E A;  4LC0 A;  4Z4V A;  1NBM A;  5IYR A;  2X6Y A;  5TR9 A;  3WBJ A;  5IYP A;  3PA2 A;  2E1R A;  3J81 k;  3BY1 A;  4ACB A;  2ZXI A;  1QUF A;  3Q6Q A;  3WBK A;  4MYT A;  3ASQ A;  2PMD A;  1W0K A;  4PC6 A;  3GIR A;  1WOP A;  3SEJ A;  4P22 A;  1P4M A;  5HXB A;  1VF7 A;  5CDF A;  3ZPN A;  3W2E A;  1YLO A;  1VLO A;  1V0E A;  4RDJ A;  2Q6I A;  3PEN A;  2PE3 A;  3OZW A;  2WJY A;  1K73 D;  2B7B A;  2BM1 A;  1UD5 A;  3CP8 A;  1A8P A;  1N07 A;  1PJ7 A;  3AST A;  4H9G A;  3Q39 A;  3W2G A;  3AGP A;  4PGO A;  2WPD A;  3PVD A;  1E3Z A;  4WZL A;  1EP1 B;  4WZT A;  4Z4U A;  3I56 B;  5IK2 A;  1K9M D;  4ZGN B;  1M90 D;  5IYW A;  2C4T A;  4X05 A;  5HZB A;  2XOK A;  4FXU A;  1Q7Y D;  1G7R A;  3MCA A;  2VNI A;  3QFR A;  3VNU A;  4MYU A;  3LO8 A;  2W6J A;  1WOO A;  2R6H A;  3U6K A;  3CES A;  4X7E A;  2R9V A;  3ZZU A;  4F7D A;  4QVA A;  3PUN A;  1KK3 A;  2D9R A;  4ROX A;  4XON A;  4Y9R A;  3U6B A;  3SLN A;  4XM3 A;  4ZV4 A;  5J3O A;  2V7X A;  1EFU A;  2C4U A;  4J0Q A;  4RD6 A;  1YIJ B;  1FDR A;  3PUM A;  3CCS B;  4DQK A;  3ASS A;  1PJ6 A;  3OZU A;  4AVZ A;  5L46 A;  3ZIA A;  1EP2 B;  1H85 A;  3OEE A;  2KVO A;  3LVB A;  3ZZT A;  2XGJ A;  5FA6 A;  3CMA B;  3ONU A;  4G7X A;  3BQJ A;  3ES9 A;  4B43 A;  1OHH A;  4LBV A;  4B3X A;  3A35 A;  4PC7 A;  1AMO A;  1Q9S A;  4NCN A;  3I1F A;  2Q6L A;  3CPW B;  2BGI A;  3AVY A;  1YHQ B;  1N8R D;  5TRD A;  4XOR A;  4YAO A;  1J9Z A;  1JNY A;  1YIT B;  3ONY A;  3VO1 A;  5DS0 A;  1E62 A;  1ZM3 A;  4YAL A;  2Z6B D;  3G4S B;  2FX3 A;  3RY8 A;  4Z4W A;  4Z4Z A;  5IYN A;  2C77 A;  1FX0 A;  4XOP A;  4AC9 A;  5E6T A;  5TV2 A;  1IJE A;  1T6X A;  2QDX A;  1NB9 A;  5KW9 A;  3E20 A;  3GVK A;  2GRE A;  3B78 A;  1XQB A;  2NV4 A;  3ASP A;  4XLE A;  4TMZ A;  1I18 A;  4DNR B;  4B3G A;  5F4O A;  1JB9 A;  3VR6 A;  1GR1 A;  1Q82 D;  1E79 A;  1N0V C;  3ZZ0 A;  3AVU A;  3CC4 B;  2DEU A;  4B47 A;  2F43 A;  3OJW A;  3WQZ A;  5J35 A;  1K8A D;  1XE1 A;  4OOX A;  3AVW A;  2D3N A;  4X7F A;  1KTV A;  1WOR A;  4XN3 A;  4II2 A;  2BV3 A;  2X8K A;  2BMW A;  2D74 A;  1E1R A;  2XNJ A;  4OPS A;  3A8J A;  1QVG B;  2BVN A;  1E63 A;  3CRZ A;  4YAF A;  3ISX A;  3B8H A;  1N0U A;  4DNT B;  1QG0 A;  3D26 A;  1VQK B;  5JBQ A;  4XQF A;  1YX2 A;  4L8J A;  2ZTG A;  4P3Y A;  1HA3 A;  2ZL7 A;  5EMN A;  1S4M A;  1IHM A;  3LQE A;  1EFR A;  3H94 A;  1F20 A;  3OAA A;  3OOC A;  1W87 A;  4PAB A;  4Y9U A;  1JJ2 B;  3CPX A;  4HE6 A;  1VQL B;  1KMH A;  4YXW A;  1V5V A;  2F4N A;  2OTL B;  2EIX A;  4XOT A;  3BCF A;  1EFT A;  2CBX A;  3G05 A;  4P9S A;  5A8A A;  1G7T A;  4E0F A;  1BQE A;  2CF4 A;  5TY0 A;  2QMU A;  1OB2 A;  1QFY A;  4XLC A;  1ZM2 A;  4X7C A;  1DDI A;  1RQP A;  2I1L A;  4Z4T A;  2OK8 A;  3GQB A;  3KEW A;  5A89 A;  1E3X A;  1G7S A;  4P6Y A;  1TTT A;  3AVT A;  3CC7 B;  3PA1 A;  1BX0 A;  3QFS A;  4UZE A;  4AF6 A;  1QGZ A;  3GVL A;  3HAG A;  4YEL A;  3W2H A;  4Q7J B;  1WDT A;  1AIP A;  4CQJ A;  1NRK A;  4X07 A;  3T56 B;  1BJK A;  2V31 A;  1WOS A;  4WWV A;  5LMZ A;  2QA4 B;  1BLI A;  3V7A A;  1WSR A;  1BPL A;  3JQR A;  4XKV A;  4M4S A;  4Z4R A;  4B4D A;  4DK1 A;  5AN9 A;  1N05 A;  1E1Q A;  4OOS A;  3CMM A;  1S72 B;  1D8T A;  3V76 A;  4RJL A;  2B7C A;  1UD6 A;  3AGQ A;  3CTA A;  2VNH A;  3NE5 B;  4TKO B;  1W0J A;  4XKW A;  1VQ5 B;  1EFC A;  2M5S A;  3B82 A;  4N3G A;  3CXC B;  4OOV A;  4NNJ A;  4C0S A;  2BGJ A;  3OE7 A;  3GSI A;  1ZM4 A;  4P25 A;  1W9X A;  3MHP A;  4G1V A;  1UD3 A;  1FRQ A;  5KNL A;  2VBU A;  4KKS A;  3CB4 A;  3VMF A;  4ASU A;  4TSF A;  1CNE A;  3FKS A;  2LZJ A;  4XLA A;  4XR6 A;  1E43 A;  5IYQ A;  1YJW B;  4KKU A;  4UZF A;  3VNV A;  2HLD A;  2CRV A;  4B48 A;  4RCY A;  1H8E A;  1EXM A;  4AF7 A;  3JQP A;  5DSZ A;  1SKY B;  2JJ1 A;  1VQO B;  5B6I A;  5A88 A;  1JA1 A;  2DET A;  4TMT A;  3A8I A;  2OBT A;  4WZE A;  3ZUG A;  5DN6 A;  4ZCM A;  3FPP A;  3CC2 B;  3U2Q A;  4RLZ A;  1TVC A;  1DDG A;  4YEJ A;  4UAJ A;  3JU4 A;  1VJS A;  3A8K A;  3P27 A;  4G7W A;  4QUZ A;  2GJR A;  5F4M A;  2VYQ A;  1KC8 D;  1NJI D;  2B5O A;  4X0C A;  1T6Z A;  1QVF B;  2RC6 A;  1PJ5 A;  4RPB A;  5FNZ A;  4X7D A;  4M2L A;  4M1K A;  1XB2 A;  1H42 A;  2HMA A;  4WZK A;  1KK1 A;  2JJ2 A;  4IW3 B;  1G7C A;  4LBZ A;  1KJZ A;  4LBY A;  4YHB A;  1NDH A;  4K1X A;  4P12 A;  3CCJ B;  1QX4 A;  1R5O A;  2JN9 A;  5GV8 A;  5HKK A;  4QVJ A;  4ACA A;  4FN5 A;  3OW7 A;  2ZL6 A;  3SJP A;  1VQ6 B;  3GVJ A;  4UZU A;  5H59 A;  2X53 S;  2XND A;  4Z4S A;  2JIZ A;  3WNB A;  3DDY A;  1Y0Y A;  1BMF A;  4QHY A;  4WQM A;  1GVH A;  2WZP P;  2WYR A;  2YWH A;  2GK7 A;  1OGI A;  3VO2 A;  2CW5 A;  4PC3 A;  4R71 A;  1QFJ A;  4G1B A;  4P26 A;  3CME B;  5KSW B;  1UMK A;  1Y0R A;  1I7P A;  4QV2 A;  4TT3 A;  4HE5 A;  1GAQ A;  4P6V F;  1IB0 A;  3OW2 B;  3MMP A;  2GJP A;  1OB5 A;  3CCV B;  1YJN B;  4NBS A;  1QFZ A;  1KZL A;  1SKQ A;  1CNF A;  1UD8 A;  1TLL A;  4QFM A;  3OFN A;  3H9N A;  1KD1 D;  2GJK A;  3OJX A;  3AVV A;  2ZZG A;  2CK3 A;  2BM0 A;  1GAW A;  2C2W A;  3A1P A;  3T51 B;  3ZBU A;  5BSY A;  1PKV A;  2C5H A;  3R6K A;  2WR8 A;  2RC5 A;  2XZP A;  3WXM A;  2BN4 A;  2V7U A;  3CCE B;  2XEX A;  3CD6 B;  4YAU A;  3SJZ A;  2VNK A;  4Y7C A;  1W2B B;  2HDN B;  2YWF A;  3BY2 A;  1QH0 A;  2X0K A;  4PC2 A;  2NPF A;  1VQM B;  2ZTN A;  3CCR B;  3WY9 A;  3G71 B;  1MAB A;  2XZO A;  2OBR A;  2GPJ A;  1BX1 A;  5BSX A;  4TMW A;  2QN6 A;  5FO1 A;  3CP2 A;  2ZL5 A;  2ZBU A;  1FNC A;  2GQF A;  3FJO A;  2X85 A;  2HCJ B;  1ELO A;  4G6I A;  3WYA A;  3JQQ A;  4B3F X;  2F1L A;  1B23 P;  2EFG A;  1F60 A;  4XMY A;  4X8I A;  3CCM B;  3AVX A;  1EP3 B;  4RD1 A;  1XFO A;  1Q86 D;  2C5B A;  4M53 A;  1KQS B; 
#chains in the Genus database with same CATH homology
 5J35 A;  4OOX A;  4X7F A;  4OPV A;  4OPS A;  4OP7 A;  5F4J A;  4Z4Y A;  4P3I A;  2OBT A;  4WZE A;  5HZA A;  3D26 A;  4RDL A;  4Z4V A;  4RLZ A;  5IYR A;  2ZL7 A;  4QUZ A;  5F4M A;  5IYP A;  3PA2 A;  1IHM A;  3LQE A;  4X0C A;  3BY1 A;  3Q6Q A;  4RPB A;  4RPD A;  3ASQ A;  4X7D A;  3SEJ A;  4WZK A;  3Q38 A;  4P12 A;  4QVJ A;  4RDJ A;  3SJP A;  2ZL6 A;  4Z4S A;  4P1V A;  3AST A;  3Q39 A;  4WZL A;  3PVD A;  4RM0 A;  4WZT A;  4Z4U A;  4X06 A;  3Q6R A;  5IYW A;  4X05 A;  5HZB A;  3R6J A;  4P26 A;  4X7C A;  4Z4T A;  4QV2 A;  4X7E A;  4QVA A;  3PUN A;  4ROX A;  3PA1 A;  3SLN A;  5J3O A;  4P2N A;  3PUM A;  4OPO A;  3ASS A;  4X07 A;  5BSY A;  3V7A A;  3SKB A;  3R6K A;  3ASR A;  3ONU A;  3BQJ A;  4Z4R A;  3BY2 A;  3LQ6 A;  4OOS A;  3SLD A;  3Q3A A;  2OBR A;  3ONY A;  5BSX A;  4Z4W A;  3RY8 A;  4Z4Z A;  5IYN A;  2ZL5 A;  5E6T A;  4OOV A;  5KW9 A;  4P25 A;  2OBS A;  3ASP A;  5F4O A;  4RDK A;  5IYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...