4Z4UA

Crystal structure of gii.10 p domain in complex with 37.5mm fucose
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
314
structure length
310
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The sweet quartet: Binding of fucose to the norovirus capsid.
pubmed doi rcsb
source organism Norovirus gii.10
molecule tags Viral protein
molecule keywords Capsid protein
total genus 70
structure length 310
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4z4uA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4z4uA01
4WZEA 3PA1A 3ASSA 4X7DA 4OOSA 4RM0A 3RY8A 4X7FA 3PA2A 4Z4WA 3LQ6A 3Q3AA 5IYNA 2OBRA 3SLDA 4ROXA 4RPDA 5KW9A 3V7AA 3SEJA 3SKBA 4Z4YA 3Q38A 4WZKA 3Q6QA 4P12A 1IHMA 4P26A 3Q6RA 5IYWA 3SJPA 5E6TA 3PUNA 3LQEA 4P1VA 5F4OA 3ONYA 3BQJA 4WZLA 4OPOA 5J3OA 5IYPA 3D26A 3R6JA 5J35A 5HZAA 4WZTA 4X05A 5IYQA 2OBSA 4RDJA 3ASPA 4RLZA 2ZL5A 3ASQA 5HZBA 4QVJA 3ASRA 4QUZA 5BSXA 3SLNA 4QVAA 3Q39A 4OOXA 2ZL6A 3BY1A 3ONUA 5F4JA 5F4MA 2OBTA 4X07A 4RDLA 3ASTA 4Z4SA 4X7CA 4X06A 4X0CA 4OOVA 4Z4UA 3PVDA 4QV2A 4P2NA 4RDKA 4Z4TA 3BY2A 4Z4VA 5IYRA 4OP7A 4RPBA 4OPVA 5BSYA 4Z4ZA 4X7EA 3R6KA 2ZL7A 4OPSA 4P25A 3PUMA 4Z4RA 4P3IA
chains in the Genus database with same CATH superfamily
2R9VA 3BC9A 1KD1D 3FJOA 1BJKA 1VQ4B 1AIPA 4Z4WA 1VQLB 4B43A 3ES9A 4RD6A 1W9XA 3Q3AA 2OBRA 4NNJA 1ELOA 5KW9A 2QN6A 3V7AA 3HAGA 2GJKA 1IJFA 2M5SA 4TMXA 4G7WA 2CC2A 2DCUA 4B47A 4G1VA 2XZOA 2V31A 3OJXA 1BMFA 4WZKA 3Q6QA 1K28D 3VR6A 1K73D 2GREA 5CDFA 1WSVA 2OK8A 3CB4A 4UZFA 1QVGB 1WOOA 5FIUA 3ZBTA 1VQKB 2XZLA 2X6WA 1YITB 3WXMA 2J7KA 3CPXA 3LQEA 3OP1A 3PUNA 1WPCA 2AHOA 3CCMB 3CCRB 4RJLA 3W2FA 4P9SA 3CP8A 1I8DA 3LO8A 1YJWB 3CXCB 4ACBA 2QA4B 4M2LA 4XN0A 4ZCIA 1QG0A 2VBTA 2V7QA 2XOKA 5IYPA 3OW7A 2PMDA 3G6EB 1XB2A 3OZVA 1A8PA 3CCLB 4DNTB 3R6JA 1NDHA 2XZPA 4NBSA 2YWFA 1TLLA 5JBQA 3U6BA 4N3GA 1FX0A 1G7TA 2CRVA 1KC8D 4B3XA 1VQOB 2OBSA 5TRDA 3QFCA 1W34A 1WDTA 2QEXB 2ZBVA 4RLZA 2X6XA 2ZL5A 3ASQA 5FNZA 4DQKA 2OTLB 4XOPA 1VQ7B 2DETA 1V0FA 1EP2B 4XM3A 3JQPA 3PENA 4TKOB 4RCYA 3Q39A 2B5OA 3CESA 1GR1A 2X8KA 2ZL6A 4XLHA 4B4DA 3ONUA 5F4JA 1F20A 1RQRA 4LC0A 1FRNA 5F4MA 1M1KD 2HCJB 4X07A 3MHPA 5DN6A 4ASUA 2D9RA 3JU4A 4X06A 4PABA 2X85A 3W5UA 3A1PA 2CNDA 1QGZA 4OOVA 2CBXA 4RD1A 1CNFA 1KK1A 1QFZA 1TVCA 4N3NA 2ZTNA 2ZZEA 4P2NA 1W2BB 4B44A 4ZGQB 1G7SA 1HZEA 3AVUA 4Q7JB 3GVJA 4XN3A 1Y0RA 5EMNA 1H85A 1VJSA 1T6XA 1WP6A 2F1LA 3BY2A 1KJZA 3BNWA 2D74A 1WU8A 2DERA 1VQ9B 2BN4A 2LZJA 3GVKA 4B3GA 3R6KA 1E3ZA 3CMMA 2GQFA 3AGQA 3CTAA 4P25A 3FPKA 4Z1MA 5A8AA 1GJRA 3AGPA 1Q81D 3PA1A 3ASSA 2V7UA 3BCDA 4X7DA 2GK7A 3WNCA 1Q86D 1ZM4A 2Q6OA 4X7FA 3PA2A 1DG1G 1B2RA 4II3A 3W2IA 4BPRA 1QH0A 2I1LA 1FNDA 2VNKA 3AVWA 1EFRA 5GV7A 4RPDA 3P26A 5DS0A 3WYAA 3I1FA 4LBZA 4YXWA 4XNFA 3SEJA 5HKKA 4DNRB 2DEUA 2GJPA 2VBUA 4G6IA 4UZEA 1W0KA 2JJ1A 2Q6IA 1ZM9A 3H94A 2QE7A 4H9GA 3CMEB 4FXUA 1D2EA 3Q6RA 1FRQA 1UMKA 2W6JA 2YWEA 1UD3A 1SKYB 5FO1A 1Y0YA 4HE5A 1T6ZA 2F1MA 1DARA 2HDNB 1EP3B 2KVOA 3ZPNA 4MYTA 3JQQA 4UAJA 3BH4A 2WPDA 1BX0A 3JQRA 1GVHA 2W6IA 5FO0A 1BLIA 3FPPA 1QX4A 5KSWB 2X3UA 4WZLA 2VYQA 4OPOA 1ZUNB 2EFGA 2YWGA 5J3OA 4DQLA 4AVZA 4ACAA 4M0LA 1M90D 2WJYA 2Q6KA 3WNBA 3LNNA 3A3BA 1JB9A 1VQ5B 5A89A 4XD7A 3GQBA 2X6YA 5J35A 5HZAA 3AVXA 2PE3A 4ZV4A 3W2EA 4MYUA 1DDGA 1VHOA 2JN9A 4RDJA 1K8AD 1EXMA 2VJIA 4LBYA 2VNJA 3ASPA 1AMOA 2NPFA 1V5VA 2BM0A 2FVGA 1JNYA 1UD8A 3WQZA 1Q7YD 2C5BA 3GSIA 3CCJB 4QVJA 3A3GA 1EFCA 1PKVA 1KK0A 4QHYA 4ZGNB 1KZLA 1S0UA 4QVAA 4II2A 2CW5A 3I55B 2DYIA 3OE7A 1QFJA 4TSFA 1G7RA 4Y7CA 4YAOA 1CNEA 1YLOA 2BMWA 4RDLA 3ASTA 4J0QA 4RD3A 2XNDA 2NV4A 1W87A 2DIEA 3T51B 4FN5A 1D1NA 1W0JA 1QVFB 2PLFA 4TMWA 1KRHA 4XLCA 4C0SA 5TY0A 2C4TA 1GO2A 1OGJA 4XKWA 2V7VA 4TMVA 3WBJA 3P27A 1VQPB 2E1RA 3OOCA 3CC2B 1F60A 3FKSA 1HA3A 4KKSA 4RCZA 3ZZ0A 4Z4VA 3CCQB 3ZZTA 3G4SB 3AVVA 2ZL7A 1TUIA 4XL9A 5TV2A 3PUMA 3OPOA 4P3IA 3MMPA 1JA0A 3ISXA 1V0EA 1YJNB 4B3FX 2WZPP 4OOSA 4RM0A 1G7CA 2FX3A 4XLAA 1N8RD 2D3LA 1JA1A 3LQ6A 4IW3B 4P22A 2R6HA 5IYNA 4TMTA 2BSAA 2DOGA 3CC7B 1OGIA 1S4MA 1FNMA 2C77A 3KL9A 3WNDA 3ZBUA 5L46A 4QFMA 1SM4A 1WSRA 2ZZGA 3OKXA 3SKBA 1H8HA 1EFUA 1KMHA 4Z4YA 4PC7A 4G7XA 4K1XA 2GPJA 4P12A 3A8IA 1IHMA 3KEWA 3OJWA 2WR8A 4YHBA 1BX1A 1W35A 4XMYA 1IJEA 1XFOA 3CCSB 1RQPA 2XEXA 5KNLA 3SJPA 1PJ6A 1NB9A 1E1QA 5E6TA 1E63A 3VO1A 3A35A 2C78A 5F4OA 3W5HA 1KTVA 2BV3A 2JDIA 4L8JA 1UD4A 2HMAA 3ONYA 5H59A 2PIAA 2RC5A 2WSSA 2QTLA 1N0VC 3B82A 3BQJA 1H42A 2Q6LA 2HLDA 4DK0A 3SJZA 4P3YA 1S72B 4R71A 3AVTA 2C4UA 2V7TA 1DDIA 5LMZA 1JJ2B 2V4DA 4YAUA 2YWHA 1COWA 4YELA 4KKTA 5IYQA 5DSZA 3MCAA 1QFYA 1VF7A 3QFSA 1QUEA 3G05A 1EFTA 4X8IA 1MABA 1UD6A 2V7XA 3B78A 5HXBA 5B6IA 5HZBA 2CK3A 3CCEB 1GAWA 2DY1A 3CW2A 3OEEA 3ASRA 5BSXA 1WORA 4WWVA 4TMZA 1QUFA 1PJ7A 1WOSA 4AC9A 4ZCMA 4RD2A 2OYNA 2F4NA 1OB5A 1QGYA 4OOXA 3OZUA 1R5BA 1P4MA 4UZUA 3BY1A 1Q9SA 4WQMA 2CF4A 3ZUGA 3ZZUA 1SKQA 1E43A 1FNBA 4PC3A 1E64A 1VLOA 2ZTGA 3WBKA 4Z4SA 2ZZQA 4XORA 3BCFA 1I7PA 1Q82D 4HIZA 3GIRA 3CMAB 1TTTA 2ZITA 3ZIAA 1YHQB 4M1KA 4XLEA 1N06A 2BVNA 5FL7A 2C5HA 4PC2A 2VNIA 3CC4B 1UD5A 3ZC3A 1VQ6B 2XGJA 1YIJB 2RC6A 4YALA 2XNCA 4TT3A 3OZWA 1N0UA 1ZM3A 2VJJA 1HVXA 5IYRA 2ZZFA 4RPBA 2QTZA 5AN9A 2B7BA 4OPSA 4CQJA 2ZBUA 4Z4RA 3OFNA 4E0FA 4WZEA 4HE6A 3V76A 1VQ8B 1YJ9B 5FA6A 1E79A 2QDXA 2QMUA 3W2GA 3RY8A 4C43A 2Z6BD 3A8JA 1QGAA 4G1BA 4ROXA 3SLDA 3E1YE 2B7CA 4XQFA 3CPWB 4PAAA 2V7WA 3QFRA 4AF7A 2JIZA 2VNHA 1VHEA 1VQNB 3Q38A 4XONA 3T53B 1T5EA 1WTHD 4P26A 2XNJA 4RD0A 4PGOA 1U2RA 1R5OA 4XKVA 5IK2A 5H5JA 4YAFA 3CCVB 5IYWA 3A8KA 3DDYA 4YAWA 1B23P 4FK8A 2BGIA 4P6YA 1EWYA 3CD6B 2OTJB 3G71B 2JJ2A 1BPLA 4P1VA 1EP1B 4Y9RA 2WJVA 4FWTA 4M53A 1H8EA 4XLFA 3NE5B 4ZCLA 5THXA 1CQXA 2EIXA 3QFTA 4XOTA 1FNCA 1D8TA 3VO2A 3D26A 2VBSA 1YI2B 1WOPA 3U6KA 3QSYA 1OB0A 3J81k 2D3NA 3QE2A 4GQNA 5TR9A 2C2WA 1XQBA 1K9MD 4KKUA 1N05A 4WZTA 4X05A 3E20A 1I18A 1NRKA 1N08A 2BF4A 1E62A 3B8HA 4G5GA 4B48A 4Y9UA 4QUZA 3GVLA 3OEHA 1OHHA 4RD4A 4YEJA 3SLNA 4JMQA 1J9ZA 3OAAA 3W5VA 4EH1A 3U2QA 1GAQA 2VZLA 1OB2A 5GV8A 3VNUA 2BM1A 2E1BA 1E1RA 3CRZA 2ZXIA 2OBTA 1E3XA 2GK6A 3H9NA 3VNVA 1MRZA 1NJID 1VLYA 4LBWA 4F7DA 4X7CA 1VQMB 4X0CA 1FDRA 2WZNA 4TN1A 1PJ5A 1IB0A 1T6YA 3VMFA 1NB0A 4Z4UA 1XE1A 1N07A 1ZM2A 3PVDA 2WYRA 1KK3A 4QV2A 2F43A 1YX2A 2OK7A 2X0KA 4LBVA 3CCUB 2P3MA 3I56B 2BGJA 4AF6A 2BPOA 4PC6A 4RDKA 4Z4TA 3W2HA 1KK2A 4XR6A 3WY9A 1NBMA 3CP2A 2ZXHA 2VBVA 5A88A 1UD2A 4NCNA 4U9UA 1BQEA 4OP7A 3LVBA 4OPVA 4PC1A 3OW2B 4M4SA 3T56B 4Z4ZA 5BSYA 4X7EA 2QGGA 2X53S 1KQSB 4P6VF 4DK1A 3AVYA 1R5NA 2GJRA
chains in the Genus database with same CATH topology
4WZEA 3PA1A 3ASSA 4X7DA 4OOSA 4RM0A 3RY8A 4X7FA 3PA2A 4Z4WA 3LQ6A 3Q3AA 5IYNA 2OBRA 3SLDA 4ROXA 4RPDA 5KW9A 3V7AA 3SEJA 3SKBA 4Z4YA 3Q38A 4WZKA 3Q6QA 4P12A 1IHMA 4P26A 3Q6RA 5IYWA 3SJPA 5E6TA 3PUNA 3LQEA 4P1VA 5F4OA 3ONYA 3BQJA 4WZLA 4OPOA 5J3OA 5IYPA 3D26A 3R6JA 5J35A 5HZAA 4WZTA 4X05A 5IYQA 2OBSA 4RDJA 3ASPA 4RLZA 2ZL5A 3ASQA 5HZBA 4QVJA 3ASRA 4QUZA 5BSXA 3SLNA 4QVAA 3Q39A 4OOXA 2ZL6A 3BY1A 3ONUA 5F4JA 5F4MA 2OBTA 4X07A 4RDLA 3ASTA 4Z4SA 4X7CA 4X06A 4X0CA 4OOVA 4Z4UA 3PVDA 4QV2A 4P2NA 4RDKA 4Z4TA 3BY2A 4Z4VA 5IYRA 4OP7A 4RPBA 4OPVA 5BSYA 4Z4ZA 4X7EA 3R6KA 2ZL7A 4OPSA 4P25A 3PUMA 4Z4RA 4P3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZE A;  3PA1 A;  3ASS A;  4X7D A;  4OOS A;  4RM0 A;  3RY8 A;  4X7F A;  3PA2 A;  4Z4W A;  3LQ6 A;  3Q3A A;  5IYN A;  2OBR A;  3SLD A;  4ROX A;  4RPD A;  5KW9 A;  3V7A A;  3SEJ A;  3SKB A;  4Z4Y A;  3Q38 A;  4WZK A;  3Q6Q A;  4P12 A;  1IHM A;  4P26 A;  3Q6R A;  5IYW A;  3SJP A;  5E6T A;  3PUN A;  3LQE A;  4P1V A;  5F4O A;  3ONY A;  3BQJ A;  4WZL A;  4OPO A;  5J3O A;  5IYP A;  3D26 A;  3R6J A;  5J35 A;  5HZA A;  4WZT A;  4X05 A;  5IYQ A;  2OBS A;  4RDJ A;  3ASP A;  4RLZ A;  2ZL5 A;  3ASQ A;  5HZB A;  4QVJ A;  3ASR A;  4QUZ A;  5BSX A;  3SLN A;  4QVA A;  3Q39 A;  4OOX A;  2ZL6 A;  3BY1 A;  3ONU A;  5F4J A;  5F4M A;  2OBT A;  4X07 A;  4RDL A;  3AST A;  4Z4S A;  4X7C A;  4X06 A;  4X0C A;  4OOV A;  4Z4U A;  3PVD A;  4QV2 A;  4P2N A;  4RDK A;  4Z4T A;  3BY2 A;  4Z4V A;  5IYR A;  4OP7 A;  4RPB A;  4OPV A;  5BSY A;  4Z4Z A;  4X7E A;  3R6K A;  2ZL7 A;  4OPS A;  4P25 A;  3PUM A;  4Z4R A;  4P3I A; 
#chains in the Genus database with same CATH topology
 2R9V A;  3BC9 A;  1KD1 D;  3FJO A;  1BJK A;  1VQ4 B;  1AIP A;  4Z4W A;  1VQL B;  4B43 A;  3ES9 A;  4RD6 A;  1W9X A;  3Q3A A;  2OBR A;  4NNJ A;  1ELO A;  5KW9 A;  2QN6 A;  3V7A A;  3HAG A;  2GJK A;  1IJF A;  2M5S A;  4TMX A;  4G7W A;  2CC2 A;  2DCU A;  4B47 A;  4G1V A;  2XZO A;  2V31 A;  3OJX A;  1BMF A;  4WZK A;  3Q6Q A;  1K28 D;  3VR6 A;  1K73 D;  2GRE A;  5CDF A;  1WSV A;  2OK8 A;  3CB4 A;  4UZF A;  1QVG B;  1WOO A;  5FIU A;  3ZBT A;  1VQK B;  2XZL A;  2X6W A;  1YIT B;  3WXM A;  2J7K A;  3CPX A;  3LQE A;  3OP1 A;  3PUN A;  1WPC A;  2AHO A;  3CCM B;  3CCR B;  4RJL A;  3W2F A;  4P9S A;  3CP8 A;  1I8D A;  3LO8 A;  1YJW B;  3CXC B;  4ACB A;  2QA4 B;  4M2L A;  4XN0 A;  4ZCI A;  1QG0 A;  2VBT A;  2V7Q A;  2XOK A;  5IYP A;  3OW7 A;  2PMD A;  3G6E B;  1XB2 A;  3OZV A;  1A8P A;  3CCL B;  4DNT B;  3R6J A;  1NDH A;  2XZP A;  4NBS A;  2YWF A;  1TLL A;  5JBQ A;  3U6B A;  4N3G A;  1FX0 A;  1G7T A;  2CRV A;  1KC8 D;  4B3X A;  1VQO B;  2OBS A;  5TRD A;  3QFC A;  1W34 A;  1WDT A;  2QEX B;  2ZBV A;  4RLZ A;  2X6X A;  2ZL5 A;  3ASQ A;  5FNZ A;  4DQK A;  2OTL B;  4XOP A;  1VQ7 B;  2DET A;  1V0F A;  1EP2 B;  4XM3 A;  3JQP A;  3PEN A;  4TKO B;  4RCY A;  3Q39 A;  2B5O A;  3CES A;  1GR1 A;  2X8K A;  2ZL6 A;  4XLH A;  4B4D A;  3ONU A;  5F4J A;  1F20 A;  1RQR A;  4LC0 A;  1FRN A;  5F4M A;  1M1K D;  2HCJ B;  4X07 A;  3MHP A;  5DN6 A;  4ASU A;  2D9R A;  3JU4 A;  4X06 A;  4PAB A;  2X85 A;  3W5U A;  3A1P A;  2CND A;  1QGZ A;  4OOV A;  2CBX A;  4RD1 A;  1CNF A;  1KK1 A;  1QFZ A;  1TVC A;  4N3N A;  2ZTN A;  2ZZE A;  4P2N A;  1W2B B;  4B44 A;  4ZGQ B;  1G7S A;  1HZE A;  3AVU A;  4Q7J B;  3GVJ A;  4XN3 A;  1Y0R A;  5EMN A;  1H85 A;  1VJS A;  1T6X A;  1WP6 A;  2F1L A;  3BY2 A;  1KJZ A;  3BNW A;  2D74 A;  1WU8 A;  2DER A;  1VQ9 B;  2BN4 A;  2LZJ A;  3GVK A;  4B3G A;  3R6K A;  1E3Z A;  3CMM A;  2GQF A;  3AGQ A;  3CTA A;  4P25 A;  3FPK A;  4Z1M A;  5A8A A;  1GJR A;  3AGP A;  1Q81 D;  3PA1 A;  3ASS A;  2V7U A;  3BCD A;  4X7D A;  2GK7 A;  3WNC A;  1Q86 D;  1ZM4 A;  2Q6O A;  4X7F A;  3PA2 A;  1DG1 G;  1B2R A;  4II3 A;  3W2I A;  4BPR A;  1QH0 A;  2I1L A;  1FND A;  2VNK A;  3AVW A;  1EFR A;  5GV7 A;  4RPD A;  3P26 A;  5DS0 A;  3WYA A;  3I1F A;  4LBZ A;  4YXW A;  4XNF A;  3SEJ A;  5HKK A;  4DNR B;  2DEU A;  2GJP A;  2VBU A;  4G6I A;  4UZE A;  1W0K A;  2JJ1 A;  2Q6I A;  1ZM9 A;  3H94 A;  2QE7 A;  4H9G A;  3CME B;  4FXU A;  1D2E A;  3Q6R A;  1FRQ A;  1UMK A;  2W6J A;  2YWE A;  1UD3 A;  1SKY B;  5FO1 A;  1Y0Y A;  4HE5 A;  1T6Z A;  2F1M A;  1DAR A;  2HDN B;  1EP3 B;  2KVO A;  3ZPN A;  4MYT A;  3JQQ A;  4UAJ A;  3BH4 A;  2WPD A;  1BX0 A;  3JQR A;  1GVH A;  2W6I A;  5FO0 A;  1BLI A;  3FPP A;  1QX4 A;  5KSW B;  2X3U A;  4WZL A;  2VYQ A;  4OPO A;  1ZUN B;  2EFG A;  2YWG A;  5J3O A;  4DQL A;  4AVZ A;  4ACA A;  4M0L A;  1M90 D;  2WJY A;  2Q6K A;  3WNB A;  3LNN A;  3A3B A;  1JB9 A;  1VQ5 B;  5A89 A;  4XD7 A;  3GQB A;  2X6Y A;  5J35 A;  5HZA A;  3AVX A;  2PE3 A;  4ZV4 A;  3W2E A;  4MYU A;  1DDG A;  1VHO A;  2JN9 A;  4RDJ A;  1K8A D;  1EXM A;  2VJI A;  4LBY A;  2VNJ A;  3ASP A;  1AMO A;  2NPF A;  1V5V A;  2BM0 A;  2FVG A;  1JNY A;  1UD8 A;  3WQZ A;  1Q7Y D;  2C5B A;  3GSI A;  3CCJ B;  4QVJ A;  3A3G A;  1EFC A;  1PKV A;  1KK0 A;  4QHY A;  4ZGN B;  1KZL A;  1S0U A;  4QVA A;  4II2 A;  2CW5 A;  3I55 B;  2DYI A;  3OE7 A;  1QFJ A;  4TSF A;  1G7R A;  4Y7C A;  4YAO A;  1CNE A;  1YLO A;  2BMW A;  4RDL A;  3AST A;  4J0Q A;  4RD3 A;  2XND A;  2NV4 A;  1W87 A;  2DIE A;  3T51 B;  4FN5 A;  1D1N A;  1W0J A;  1QVF B;  2PLF A;  4TMW A;  1KRH A;  4XLC A;  4C0S A;  5TY0 A;  2C4T A;  1GO2 A;  1OGJ A;  4XKW A;  2V7V A;  4TMV A;  3WBJ A;  3P27 A;  1VQP B;  2E1R A;  3OOC A;  3CC2 B;  1F60 A;  3FKS A;  1HA3 A;  4KKS A;  4RCZ A;  3ZZ0 A;  4Z4V A;  3CCQ B;  3ZZT A;  3G4S B;  3AVV A;  2ZL7 A;  1TUI A;  4XL9 A;  5TV2 A;  3PUM A;  3OPO A;  4P3I A;  3MMP A;  1JA0 A;  3ISX A;  1V0E A;  1YJN B;  4B3F X;  2WZP P;  4OOS A;  4RM0 A;  1G7C A;  2FX3 A;  4XLA A;  1N8R D;  2D3L A;  1JA1 A;  3LQ6 A;  4IW3 B;  4P22 A;  2R6H A;  5IYN A;  4TMT A;  2BSA A;  2DOG A;  3CC7 B;  1OGI A;  1S4M A;  1FNM A;  2C77 A;  3KL9 A;  3WND A;  3ZBU A;  5L46 A;  4QFM A;  1SM4 A;  1WSR A;  2ZZG A;  3OKX A;  3SKB A;  1H8H A;  1EFU A;  1KMH A;  4Z4Y A;  4PC7 A;  4G7X A;  4K1X A;  2GPJ A;  4P12 A;  3A8I A;  1IHM A;  3KEW A;  3OJW A;  2WR8 A;  4YHB A;  1BX1 A;  1W35 A;  4XMY A;  1IJE A;  1XFO A;  3CCS B;  1RQP A;  2XEX A;  5KNL A;  3SJP A;  1PJ6 A;  1NB9 A;  1E1Q A;  5E6T A;  1E63 A;  3VO1 A;  3A35 A;  2C78 A;  5F4O A;  3W5H A;  1KTV A;  2BV3 A;  2JDI A;  4L8J A;  1UD4 A;  2HMA A;  3ONY A;  5H59 A;  2PIA A;  2RC5 A;  2WSS A;  2QTL A;  1N0V C;  3B82 A;  3BQJ A;  1H42 A;  2Q6L A;  2HLD A;  4DK0 A;  3SJZ A;  4P3Y A;  1S72 B;  4R71 A;  3AVT A;  2C4U A;  2V7T A;  1DDI A;  5LMZ A;  1JJ2 B;  2V4D A;  4YAU A;  2YWH A;  1COW A;  4YEL A;  4KKT A;  5IYQ A;  5DSZ A;  3MCA A;  1QFY A;  1VF7 A;  3QFS A;  1QUE A;  3G05 A;  1EFT A;  4X8I A;  1MAB A;  1UD6 A;  2V7X A;  3B78 A;  5HXB A;  5B6I A;  5HZB A;  2CK3 A;  3CCE B;  1GAW A;  2DY1 A;  3CW2 A;  3OEE A;  3ASR A;  5BSX A;  1WOR A;  4WWV A;  4TMZ A;  1QUF A;  1PJ7 A;  1WOS A;  4AC9 A;  4ZCM A;  4RD2 A;  2OYN A;  2F4N A;  1OB5 A;  1QGY A;  4OOX A;  3OZU A;  1R5B A;  1P4M A;  4UZU A;  3BY1 A;  1Q9S A;  4WQM A;  2CF4 A;  3ZUG A;  3ZZU A;  1SKQ A;  1E43 A;  1FNB A;  4PC3 A;  1E64 A;  1VLO A;  2ZTG A;  3WBK A;  4Z4S A;  2ZZQ A;  4XOR A;  3BCF A;  1I7P A;  1Q82 D;  4HIZ A;  3GIR A;  3CMA B;  1TTT A;  2ZIT A;  3ZIA A;  1YHQ B;  4M1K A;  4XLE A;  1N06 A;  2BVN A;  5FL7 A;  2C5H A;  4PC2 A;  2VNI A;  3CC4 B;  1UD5 A;  3ZC3 A;  1VQ6 B;  2XGJ A;  1YIJ B;  2RC6 A;  4YAL A;  2XNC A;  4TT3 A;  3OZW A;  1N0U A;  1ZM3 A;  2VJJ A;  1HVX A;  5IYR A;  2ZZF A;  4RPB A;  2QTZ A;  5AN9 A;  2B7B A;  4OPS A;  4CQJ A;  2ZBU A;  4Z4R A;  3OFN A;  4E0F A;  4WZE A;  4HE6 A;  3V76 A;  1VQ8 B;  1YJ9 B;  5FA6 A;  1E79 A;  2QDX A;  2QMU A;  3W2G A;  3RY8 A;  4C43 A;  2Z6B D;  3A8J A;  1QGA A;  4G1B A;  4ROX A;  3SLD A;  3E1Y E;  2B7C A;  4XQF A;  3CPW B;  4PAA A;  2V7W A;  3QFR A;  4AF7 A;  2JIZ A;  2VNH A;  1VHE A;  1VQN B;  3Q38 A;  4XON A;  3T53 B;  1T5E A;  1WTH D;  4P26 A;  2XNJ A;  4RD0 A;  4PGO A;  1U2R A;  1R5O A;  4XKV A;  5IK2 A;  5H5J A;  4YAF A;  3CCV B;  5IYW A;  3A8K A;  3DDY A;  4YAW A;  1B23 P;  4FK8 A;  2BGI A;  4P6Y A;  1EWY A;  3CD6 B;  2OTJ B;  3G71 B;  2JJ2 A;  1BPL A;  4P1V A;  1EP1 B;  4Y9R A;  2WJV A;  4FWT A;  4M53 A;  1H8E A;  4XLF A;  3NE5 B;  4ZCL A;  5THX A;  1CQX A;  2EIX A;  3QFT A;  4XOT A;  1FNC A;  1D8T A;  3VO2 A;  3D26 A;  2VBS A;  1YI2 B;  1WOP A;  3U6K A;  3QSY A;  1OB0 A;  3J81 k;  2D3N A;  3QE2 A;  4GQN A;  5TR9 A;  2C2W A;  1XQB A;  1K9M D;  4KKU A;  1N05 A;  4WZT A;  4X05 A;  3E20 A;  1I18 A;  1NRK A;  1N08 A;  2BF4 A;  1E62 A;  3B8H A;  4G5G A;  4B48 A;  4Y9U A;  4QUZ A;  3GVL A;  3OEH A;  1OHH A;  4RD4 A;  4YEJ A;  3SLN A;  4JMQ A;  1J9Z A;  3OAA A;  3W5V A;  4EH1 A;  3U2Q A;  1GAQ A;  2VZL A;  1OB2 A;  5GV8 A;  3VNU A;  2BM1 A;  2E1B A;  1E1R A;  3CRZ A;  2ZXI A;  2OBT A;  1E3X A;  2GK6 A;  3H9N A;  3VNV A;  1MRZ A;  1NJI D;  1VLY A;  4LBW A;  4F7D A;  4X7C A;  1VQM B;  4X0C A;  1FDR A;  2WZN A;  4TN1 A;  1PJ5 A;  1IB0 A;  1T6Y A;  3VMF A;  1NB0 A;  4Z4U A;  1XE1 A;  1N07 A;  1ZM2 A;  3PVD A;  2WYR A;  1KK3 A;  4QV2 A;  2F43 A;  1YX2 A;  2OK7 A;  2X0K A;  4LBV A;  3CCU B;  2P3M A;  3I56 B;  2BGJ A;  4AF6 A;  2BPO A;  4PC6 A;  4RDK A;  4Z4T A;  3W2H A;  1KK2 A;  4XR6 A;  3WY9 A;  1NBM A;  3CP2 A;  2ZXH A;  2VBV A;  5A88 A;  1UD2 A;  4NCN A;  4U9U A;  1BQE A;  4OP7 A;  3LVB A;  4OPV A;  4PC1 A;  3OW2 B;  4M4S A;  3T56 B;  4Z4Z A;  5BSY A;  4X7E A;  2QGG A;  2X53 S;  1KQS B;  4P6V F;  4DK1 A;  3AVY A;  1R5N A;  2GJR A; 
#chains in the Genus database with same CATH homology
 4WZE A;  3PA1 A;  3ASS A;  4X7D A;  4OOS A;  4RM0 A;  3RY8 A;  4X7F A;  3PA2 A;  4Z4W A;  3LQ6 A;  3Q3A A;  5IYN A;  2OBR A;  3SLD A;  4ROX A;  4RPD A;  5KW9 A;  3V7A A;  3SEJ A;  3SKB A;  4Z4Y A;  3Q38 A;  4WZK A;  3Q6Q A;  4P12 A;  1IHM A;  4P26 A;  3Q6R A;  5IYW A;  3SJP A;  5E6T A;  3PUN A;  3LQE A;  4P1V A;  5F4O A;  3ONY A;  3BQJ A;  4WZL A;  4OPO A;  5J3O A;  5IYP A;  3D26 A;  3R6J A;  5J35 A;  5HZA A;  4WZT A;  4X05 A;  5IYQ A;  2OBS A;  4RDJ A;  3ASP A;  4RLZ A;  2ZL5 A;  3ASQ A;  5HZB A;  4QVJ A;  3ASR A;  4QUZ A;  5BSX A;  3SLN A;  4QVA A;  3Q39 A;  4OOX A;  2ZL6 A;  3BY1 A;  3ONU A;  5F4J A;  5F4M A;  2OBT A;  4X07 A;  4RDL A;  3AST A;  4Z4S A;  4X7C A;  4X06 A;  4X0C A;  4OOV A;  4Z4U A;  3PVD A;  4QV2 A;  4P2N A;  4RDK A;  4Z4T A;  3BY2 A;  4Z4V A;  5IYR A;  4OP7 A;  4RPB A;  4OPV A;  5BSY A;  4Z4Z A;  4X7E A;  3R6K A;  2ZL7 A;  4OPS A;  4P25 A;  3PUM A;  4Z4R A;  4P3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...