4Z4UA

Crystal structure of gii.10 p domain in complex with 37.5mm fucose
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
314
structure length
310
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title The sweet quartet: Binding of fucose to the norovirus capsid.
pubmed doi rcsb
source organism Norovirus gii.10
molecule tags Viral protein
total genus 70
structure length 310
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4z4uA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4z4uA01
3SKBA 3SLNA 4OPOA 4Z4RA 2OBRA 4OOVA 4QVJA 4P1VA 3ASTA 4Z4YA 4RLZA 4X7EA 5F4MA 2ZL5A 3PUNA 4OOSA 5BSXA 4Z4VA 5IYRA 4WZEA 4RDKA 4Z4ZA 4P25A 4P26A 4Z4TA 3R6KA 2OBTA 2ZL6A 3Q38A 4X05A 4QVAA 5BSYA 5IYNA 5IYQA 5IYPA 5IYWA 3ASPA 3ONUA 3LQ6A 4X0CA 4RDLA 4OOXA 3ASSA 4RDJA 3ASQA 4Z4WA 3BQJA 3LQEA 3Q6QA 4ROXA 4X7CA 3BY2A 4P12A 3PA1A 5J3OA 4WZTA 4RPDA 5J35A 3V7AA 3D26A 4Z4UA 4OPVA 4X06A 4Z4SA 3PVDA 4X07A 3BY1A 4QUZA 5HZBA 3Q6RA 4P2NA 1IHMA 4P3IA 4X7FA 4RPBA 4OP7A 3SJPA 2ZL7A 3PA2A 5E6TA 4OPSA 3Q39A 2OBSA 5F4JA 3SEJA 5F4OA 4X7DA 4WZLA 3Q3AA 3RY8A 4RM0A 4WZKA 3ASRA 3ONYA 3SLDA 5KW9A 3R6JA 5HZAA 3PUMA 4QV2A
chains in the Genus database with same CATH superfamily
1KK3A 1OHHA 4IW3B 3U6BA 4OOVA 2V7UA 1K9MD 1A8PA 1WPCA 1KJZA 3MMPA 4XKWA 4MYTA 1GVHA 3VR6A 1GAWA 1KRHA 1FDRA 4XD7A 4BPRA 4PGOA 1WSVA 4H9GA 1BX0A 1KK2A 1EFTA 2PMDA 1VHOA 4M4SA 4ASUA 3OFNA 3CCLB 2EIXA 4TMXA 3PUNA 3OEHA 1TVCA 4P9SA 2JDIA 2VNJA 4OOSA 4YHBA 1RQPA 1N0VC 4II2A 4AF7A 1E64A 4Z4VA 4XNFA 2I1LA 2GJRA 3VO2A 2E1RA 1UD4A 4HE6A 3A35A 3HAGA 5IYRA 5TRDA 4TMZA 4YEJA 3E1YE 4RD3A 2V7WA 4RDKA 1CNEA 1UD6A 1YJWB 1ZM3A 3U6KA 1CNFA 1WP6A 3R6KA 2OBTA 3CTAA 4WWVA 3GIRA 4AF6A 3OZVA 4Y9UA 4LBWA 1KK0A 1W0KA 1QFYA 5FIUA 1VQLB 1FRNA 1G7CA 1R5OA 3P26A 2CNDA 5IYPA 1K73D 3ZUGA 1JJ2B 2C2WA 3WNBA 5AN9A 1VHEA 2F1MA 1SKYB 4LBZA 1BJKA 2VNHA 1E1RA 2ZZQA 2Z6BD 4LBVA 4OOXA 3AVUA 1W35A 1MRZA 4TSFA 1QX4A 4Z1MA 4Z4WA 1PJ5A 4F7DA 1R5NA 2CF4A 3QFRA 3Q6QA 2B5OA 1M90D 1EP3B 2DY1A 1I7PA 4HE5A 3ZC3A 2DERA 5J3OA 2RC6A 2RC5A 5J35A 3V7AA 5DSZA 3FKSA 1UD8A 2BMWA 1Y0YA 2XZLA 2R9VA 2OK7A 1JA0A 2XNJA 1NDHA 2LZJA 3LVBA 4XQFA 1E79A 1KZLA 3BY1A 2CRVA 4QUZA 1JA1A 5L46A 2GQFA 2X0KA 2X6YA 1EFUA 3A3BA 1HVXA 4P3IA 3KEWA 4X7FA 4N3NA 4XLCA 3AVXA 1WOOA 2XZPA 4Y7CA 3PA2A 2WZPP 2V31A 1GR1A 3AGQA 3OW7A 1WDTA 5KNLA 2M5SA 1H42A 5F4JA 3GQBA 2VBSA 4KKUA 1DDGA 5FL7A 1SM4A 2XGJA 1EXMA 1UMKA 4M0LA 3FPKA 3Q3AA 1NJID 2OTJB 2VBVA 1VQNB 1FNBA 2Q6OA 4ZCLA 4XLAA 3ISXA 3CC7B 3ZPNA 3ZZUA 2C78A 1WSRA 4Z4SA 2X8KA 4MYUA 5HZAA 1I18A 3CW2A 1Q7YD 3BNWA 4OPOA 4Z4RA 2YWEA 4GQNA 2C5HA 4P1VA 4NNJA 1CQXA 4TMVA 4E0FA 3CP8A 2VNIA 4XMYA 2EFGA 4CQJA 2JIZA 2P3MA 2QE7A 2X3UA 2J7KA 2JJ2A 3W2GA 1FX0A 3OZWA 1JNYA 3WYAA 2VNKA 1UD5A 3BC9A 3KL9A 1F60A 4QFMA 5CDFA 3T56B 4TMTA 4B44A 3A8IA 5KSWB 4WZEA 1N08A 3I55B 5GV7A 2V7QA 3OKXA 3G05A 4PC3A 2HDNB 1T6XA 4JMQA 1E43A 4XONA 1W9XA 1VQKB 4XL9A 4U9UA 3OP1A 4YAWA 2ZL6A 3B8HA 4X05A 4UAJA 4ZV4A 1AIPA 5BSYA 2C4TA 5IYNA 5IYQA 3AVTA 3A8KA 1COWA 4X8IA 1ZM4A 2F43A 2W6IA 3H9NA 4ACBA 1YJ9B 2OTLB 3WNDA 4TMWA 2VBTA 2BSAA 2VJIA 2YWHA 4NBSA 1NB9A 4UZUA 4B3FX 4C0SA 2AHOA 1W34A 2X6XA 4RCZA 1G7SA 5EMNA 1YIJB 3PENA 3DDYA 4II3A 4RDJA 4NCNA 1IJEA 1S4MA 2BM0A 1G7RA 3LO8A 3BQJA 3LQEA 3CCVB 4ROXA 1I8DA 3BY2A 2QTLA 4P12A 3PA1A 4B4DA 1YX2A 1H8HA 1QFJA 3OEEA 3OJXA 4WZTA 5JBQA 3VNUA 4Z4UA 2VYQA 1DG1G 4DNRB 1EP1B 1WOPA 4DK1A 4B3GA 4J0QA 1V0EA 5LMZA 1N05A 1PJ7A 3Q6RA 4P2NA 4ACAA 1J9ZA 3VNVA 1T6ZA 2Q6LA 3T53B 4RPBA 2CC2A 3CPXA 4P3YA 1WORA 1QGZA 3OE7A 3OJWA 3CPWB 3W2HA 4RJLA 4XOTA 5A8AA 2V7XA 1H85A 2OBSA 1GO2A 3BCDA 1VQ7B 2Q6KA 2ZBVA 2HMAA 4WZLA 1BLIA 1XB2A 3CESA 3CC2B 3ZZTA 2DEUA 3OPOA 2GK6A 3WQZA 4RCYA 4RM0A 4WZKA 1WTHD 3ASRA 2B7CA 3BH4A 5KW9A 2WJVA 3R6JA 2ZZGA 3PUMA 2ZZEA 3CCRB 1E3XA 3SKBA 3MCAA 3ES9A 4Q7JB 1QGAA 4XKVA 1W2BB 2OBRA 2PIAA 2OK8A 3CD6B 2WPDA 1H8EA 1N06A 2CK3A 1ZM9A 3P27A 1ELOA 1GAQA 1QUFA 2YWGA 4QHYA 4Z4YA 1N07A 4PC2A 4UZEA 3SJZA 3CRZA 5F4MA 2ZL5A 2C4UA 1N0UA 2F4NA 3QFCA 3CCJB 3CCQB 5TV2A 3WBJA 1IB0A 3E20A 2VJJA 2B7BA 3ZBUA 1ZM2A 2D9RA 2NV4A 2Q6IA 3I1FA 2C5BA 2JN9A 5BSXA 4Y9RA 5FNZA 3WBKA 2D3LA 4G1VA 3CMMA 4M53A 1NB0A 4KKTA 4XM3A 5DS0A 3GVKA 2V7TA 2YWFA 1K8AD 3W5VA 3NE5B 2BF4A 4Z4ZA 1BQEA 4P6YA 4P25A 3MHPA 1B23P 4P26A 4B47A 4P6VF 2BM1A 2V4DA 4PABA 4Z4TA 2D74A 4YXWA 1V5VA 2F1LA 1OB2A 1VLYA 3Q38A 1EP2B 4QVAA 1QGYA 1VQ8B 1WOSA 1Q86D 4K1XA 2QA4B 4UZFA 4PC7A 5IYWA 1HZEA 3ASPA 2BV3A 3ONUA 3CB4A 2GK7A 1W87A 5DN6A 2OYNA 2XNDA 4X0CA 4RDLA 4R71A 1XFOA 3OW2B 4ZGQB 5A89A 3W2FA 2NPFA 3ASSA 4PC6A 3FJOA 3ASQA 3CC4B 1K28D 4G5GA 3AVWA 1G7TA 1U2RA 3ZIAA 4FWTA 2WYRA 4XR6A 1KTVA 1JB9A 1XQBA 3GSIA 3OAAA 1Q9SA 1UD3A 2BPOA 1VJSA 3W2IA 5TY0A 2GREA 1FNCA 4RD1A 4RPDA 3D26A 2VBUA 4YAOA 2QMUA 1T6YA 4OPVA 5HKKA 4FXUA 4X06A 5GV8A 3PVDA 1VQOB 4XLEA 1QFZA 1VQMB 4PAAA 4XN3A 1E62A 4C43A 1QVGB 1VQ4B 1VLOA 3JU4A 3OOCA 5HZBA 1YI2B 2R6HA 5H5JA 1BPLA 2WR8A 3U2QA 2PE3A 1EWYA 3JQRA 3SJPA 2FX3A 4B43A 1VQ6B 1TTTA 4LBYA 4TN1A 3G6EB 3CXCB 2V7VA 1SKQA 1P4MA 1KC8D 4P22A 4XLHA 4N3GA 2WZNA 4OPSA 4XN0A 4L8JA 1RQRA 2KVOA 2XNCA 3SEJA 5F4OA 2HLDA 3JQQA 4XORA 2GJKA 1E3ZA 1D8TA 3FPPA 1PJ6A 4X7DA 3J81k 1YHQB 1YITB 3LNNA 4B3XA 2DYIA 3VMFA 2BVNA 1FNMA 2WSSA 3CCEB 1Y0RA 1XE1A 4B48A 3WY9A 3VO1A 3CCSB 3ONYA 4ZCIA 5FO0A 3SLNA 4G7WA 1M1KD 1S72B 4ZCMA 2E1BA 4QVJA 1FRQA 2GPJA 4HIZA 2QGGA 3ASTA 3A1PA 2CBXA 1F20A 4RLZA 3W2EA 3CP2A 4X7EA 1D2EA 2FVGA 1R5BA 4XOPA 1QG0A 5HXBA 2XZOA 3QSYA 4TKOB 1KMHA 1PKVA 2X53S 1QUEA 4YALA 2DCUA 5TR9A 3T51B 1AMOA 3AVVA 1FNDA 1TLLA 5A88A 4PC1A 1KQSB 4DQLA 3QFSA 4RD2A 1WU8A 2BGJA 4YELA 3QFTA 1DARA 4WQMA 1QH0A 4LC0A 4M1KA 3B78A 2XEXA 2VZLA 3WXMA 1OB0A 1TUIA 1B2RA 1BMFA 1S0UA 3A8JA 1IJFA 1HA3A 4G1BA 1YJNB 1Q82D 2QDXA 2X85A 2WJYA 2X6WA 5FO1A 2PLFA 4FK8A 1OB5A 2DOGA 5IK2A 2QN6A 4DNTB 3CCUB 3CMEB 1KD1D 3G71B 3LQ6A 2DETA 1UD2A 1VF7A 4YAUA 1VQPB 4M2LA 2ZXHA 2ZZFA 1VQ9B 1D1NA 4ZGNB 4YAFA 3GVLA 2C77A 4X7CA 3W5UA 3ZBTA 3V76A 2XOKA 3ZZ0A 1E1QA 2CW5A 1YLOA 4RD4A 2D3NA 3G4SB 4G6IA 1N8RD 3I56B 2ZITA 1V0FA 2ZTGA 1W0JA 1GJRA 1E63A 4RD0A 4XLFA 3A3GA 1T5EA 4X07A 1QVFB 3WNCA 2DIEA 1OGIA 1MABA 4DQKA 3W5HA 3CMAB 1IHMA 4OP7A 2ZL7A 1DDIA 1NRKA 3QE2A 3H94A 1EFCA 5E6TA 4DK0A 3GVJA 4KKSA 3Q39A 3CCMB 2ZBUA 1ZUNB 4EH1A 5B6IA 3AVYA 3AGPA 2QTZA 2BN4A 2BGIA 5FA6A 4AC9A 2QEXB 1EFRA 2W6JA 2ZTNA 2GJPA 1VQ5B 1Q81D 5THXA 1NBMA 2JJ1A 1BX1A 1OGJA 2ZXIA 3RY8A 5H59A 3BCFA 3OZUA 4G7XA 1KK1A 3JQPA 4TT3A 3SLDA 4AVZA 4FN5A 4RD6A 3B82A 4QV2A 2HCJB
chains in the Genus database with same CATH topology
3SKBA 3SLNA 4OPOA 4Z4RA 2OBRA 4OOVA 4QVJA 4P1VA 3ASTA 4Z4YA 4RLZA 4X7EA 5F4MA 2ZL5A 3PUNA 4OOSA 5BSXA 4Z4VA 5IYRA 4WZEA 4RDKA 4Z4ZA 4P25A 4P26A 4Z4TA 3R6KA 2OBTA 2ZL6A 3Q38A 4X05A 4QVAA 5BSYA 5IYNA 5IYQA 5IYPA 5IYWA 3ASPA 3ONUA 3LQ6A 4X0CA 4RDLA 4OOXA 3ASSA 4RDJA 3ASQA 4Z4WA 3BQJA 3LQEA 3Q6QA 4ROXA 4X7CA 3BY2A 4P12A 3PA1A 5J3OA 4WZTA 4RPDA 5J35A 3V7AA 3D26A 4Z4UA 4OPVA 4X06A 4Z4SA 3PVDA 4X07A 3BY1A 4QUZA 5HZBA 3Q6RA 4P2NA 1IHMA 4P3IA 4X7FA 4RPBA 4OP7A 3SJPA 2ZL7A 3PA2A 5E6TA 4OPSA 3Q39A 2OBSA 5F4JA 3SEJA 5F4OA 4X7DA 4WZLA 3Q3AA 3RY8A 4RM0A 4WZKA 3ASRA 3ONYA 3SLDA 5KW9A 3R6JA 5HZAA 3PUMA 4QV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SKB A;  3SLN A;  4OPO A;  4Z4R A;  2OBR A;  4OOV A;  4QVJ A;  4P1V A;  3AST A;  4Z4Y A;  4RLZ A;  4X7E A;  5F4M A;  2ZL5 A;  3PUN A;  4OOS A;  5BSX A;  4Z4V A;  5IYR A;  4WZE A;  4RDK A;  4Z4Z A;  4P25 A;  4P26 A;  4Z4T A;  3R6K A;  2OBT A;  2ZL6 A;  3Q38 A;  4X05 A;  4QVA A;  5BSY A;  5IYN A;  5IYQ A;  5IYP A;  5IYW A;  3ASP A;  3ONU A;  3LQ6 A;  4X0C A;  4RDL A;  4OOX A;  3ASS A;  4RDJ A;  3ASQ A;  4Z4W A;  3BQJ A;  3LQE A;  3Q6Q A;  4ROX A;  4X7C A;  3BY2 A;  4P12 A;  3PA1 A;  5J3O A;  4WZT A;  4RPD A;  5J35 A;  3V7A A;  3D26 A;  4Z4U A;  4OPV A;  4X06 A;  4Z4S A;  3PVD A;  4X07 A;  3BY1 A;  4QUZ A;  5HZB A;  3Q6R A;  4P2N A;  1IHM A;  4P3I A;  4X7F A;  4RPB A;  4OP7 A;  3SJP A;  2ZL7 A;  3PA2 A;  5E6T A;  4OPS A;  3Q39 A;  2OBS A;  5F4J A;  3SEJ A;  5F4O A;  4X7D A;  4WZL A;  3Q3A A;  3RY8 A;  4RM0 A;  4WZK A;  3ASR A;  3ONY A;  3SLD A;  5KW9 A;  3R6J A;  5HZA A;  3PUM A;  4QV2 A; 
#chains in the Genus database with same CATH topology
 1KK3 A;  1OHH A;  4IW3 B;  3U6B A;  4OOV A;  2V7U A;  1K9M D;  1A8P A;  1WPC A;  1KJZ A;  3MMP A;  4XKW A;  4MYT A;  1GVH A;  3VR6 A;  1GAW A;  1KRH A;  1FDR A;  4XD7 A;  4BPR A;  4PGO A;  1WSV A;  4H9G A;  1BX0 A;  1KK2 A;  1EFT A;  2PMD A;  1VHO A;  4M4S A;  4ASU A;  3OFN A;  3CCL B;  2EIX A;  4TMX A;  3PUN A;  3OEH A;  1TVC A;  4P9S A;  2JDI A;  2VNJ A;  4OOS A;  4YHB A;  1RQP A;  1N0V C;  4II2 A;  4AF7 A;  1E64 A;  4Z4V A;  4XNF A;  2I1L A;  2GJR A;  3VO2 A;  2E1R A;  1UD4 A;  4HE6 A;  3A35 A;  3HAG A;  5IYR A;  5TRD A;  4TMZ A;  4YEJ A;  3E1Y E;  4RD3 A;  2V7W A;  4RDK A;  1CNE A;  1UD6 A;  1YJW B;  1ZM3 A;  3U6K A;  1CNF A;  1WP6 A;  3R6K A;  2OBT A;  3CTA A;  4WWV A;  3GIR A;  4AF6 A;  3OZV A;  4Y9U A;  4LBW A;  1KK0 A;  1W0K A;  1QFY A;  5FIU A;  1VQL B;  1FRN A;  1G7C A;  1R5O A;  3P26 A;  2CND A;  5IYP A;  1K73 D;  3ZUG A;  1JJ2 B;  2C2W A;  3WNB A;  5AN9 A;  1VHE A;  2F1M A;  1SKY B;  4LBZ A;  1BJK A;  2VNH A;  1E1R A;  2ZZQ A;  2Z6B D;  4LBV A;  4OOX A;  3AVU A;  1W35 A;  1MRZ A;  4TSF A;  1QX4 A;  4Z1M A;  4Z4W A;  1PJ5 A;  4F7D A;  1R5N A;  2CF4 A;  3QFR A;  3Q6Q A;  2B5O A;  1M90 D;  1EP3 B;  2DY1 A;  1I7P A;  4HE5 A;  3ZC3 A;  2DER A;  5J3O A;  2RC6 A;  2RC5 A;  5J35 A;  3V7A A;  5DSZ A;  3FKS A;  1UD8 A;  2BMW A;  1Y0Y A;  2XZL A;  2R9V A;  2OK7 A;  1JA0 A;  2XNJ A;  1NDH A;  2LZJ A;  3LVB A;  4XQF A;  1E79 A;  1KZL A;  3BY1 A;  2CRV A;  4QUZ A;  1JA1 A;  5L46 A;  2GQF A;  2X0K A;  2X6Y A;  1EFU A;  3A3B A;  1HVX A;  4P3I A;  3KEW A;  4X7F A;  4N3N A;  4XLC A;  3AVX A;  1WOO A;  2XZP A;  4Y7C A;  3PA2 A;  2WZP P;  2V31 A;  1GR1 A;  3AGQ A;  3OW7 A;  1WDT A;  5KNL A;  2M5S A;  1H42 A;  5F4J A;  3GQB A;  2VBS A;  4KKU A;  1DDG A;  5FL7 A;  1SM4 A;  2XGJ A;  1EXM A;  1UMK A;  4M0L A;  3FPK A;  3Q3A A;  1NJI D;  2OTJ B;  2VBV A;  1VQN B;  1FNB A;  2Q6O A;  4ZCL A;  4XLA A;  3ISX A;  3CC7 B;  3ZPN A;  3ZZU A;  2C78 A;  1WSR A;  4Z4S A;  2X8K A;  4MYU A;  5HZA A;  1I18 A;  3CW2 A;  1Q7Y D;  3BNW A;  4OPO A;  4Z4R A;  2YWE A;  4GQN A;  2C5H A;  4P1V A;  4NNJ A;  1CQX A;  4TMV A;  4E0F A;  3CP8 A;  2VNI A;  4XMY A;  2EFG A;  4CQJ A;  2JIZ A;  2P3M A;  2QE7 A;  2X3U A;  2J7K A;  2JJ2 A;  3W2G A;  1FX0 A;  3OZW A;  1JNY A;  3WYA A;  2VNK A;  1UD5 A;  3BC9 A;  3KL9 A;  1F60 A;  4QFM A;  5CDF A;  3T56 B;  4TMT A;  4B44 A;  3A8I A;  5KSW B;  4WZE A;  1N08 A;  3I55 B;  5GV7 A;  2V7Q A;  3OKX A;  3G05 A;  4PC3 A;  2HDN B;  1T6X A;  4JMQ A;  1E43 A;  4XON A;  1W9X A;  1VQK B;  4XL9 A;  4U9U A;  3OP1 A;  4YAW A;  2ZL6 A;  3B8H A;  4X05 A;  4UAJ A;  4ZV4 A;  1AIP A;  5BSY A;  2C4T A;  5IYN A;  5IYQ A;  3AVT A;  3A8K A;  1COW A;  4X8I A;  1ZM4 A;  2F43 A;  2W6I A;  3H9N A;  4ACB A;  1YJ9 B;  2OTL B;  3WND A;  4TMW A;  2VBT A;  2BSA A;  2VJI A;  2YWH A;  4NBS A;  1NB9 A;  4UZU A;  4B3F X;  4C0S A;  2AHO A;  1W34 A;  2X6X A;  4RCZ A;  1G7S A;  5EMN A;  1YIJ B;  3PEN A;  3DDY A;  4II3 A;  4RDJ A;  4NCN A;  1IJE A;  1S4M A;  2BM0 A;  1G7R A;  3LO8 A;  3BQJ A;  3LQE A;  3CCV B;  4ROX A;  1I8D A;  3BY2 A;  2QTL A;  4P12 A;  3PA1 A;  4B4D A;  1YX2 A;  1H8H A;  1QFJ A;  3OEE A;  3OJX A;  4WZT A;  5JBQ A;  3VNU A;  4Z4U A;  2VYQ A;  1DG1 G;  4DNR B;  1EP1 B;  1WOP A;  4DK1 A;  4B3G A;  4J0Q A;  1V0E A;  5LMZ A;  1N05 A;  1PJ7 A;  3Q6R A;  4P2N A;  4ACA A;  1J9Z A;  3VNV A;  1T6Z A;  2Q6L A;  3T53 B;  4RPB A;  2CC2 A;  3CPX A;  4P3Y A;  1WOR A;  1QGZ A;  3OE7 A;  3OJW A;  3CPW B;  3W2H A;  4RJL A;  4XOT A;  5A8A A;  2V7X A;  1H85 A;  2OBS A;  1GO2 A;  3BCD A;  1VQ7 B;  2Q6K A;  2ZBV A;  2HMA A;  4WZL A;  1BLI A;  1XB2 A;  3CES A;  3CC2 B;  3ZZT A;  2DEU A;  3OPO A;  2GK6 A;  3WQZ A;  4RCY A;  4RM0 A;  4WZK A;  1WTH D;  3ASR A;  2B7C A;  3BH4 A;  5KW9 A;  2WJV A;  3R6J A;  2ZZG A;  3PUM A;  2ZZE A;  3CCR B;  1E3X A;  3SKB A;  3MCA A;  3ES9 A;  4Q7J B;  1QGA A;  4XKV A;  1W2B B;  2OBR A;  2PIA A;  2OK8 A;  3CD6 B;  2WPD A;  1H8E A;  1N06 A;  2CK3 A;  1ZM9 A;  3P27 A;  1ELO A;  1GAQ A;  1QUF A;  2YWG A;  4QHY A;  4Z4Y A;  1N07 A;  4PC2 A;  4UZE A;  3SJZ A;  3CRZ A;  5F4M A;  2ZL5 A;  2C4U A;  1N0U A;  2F4N A;  3QFC A;  3CCJ B;  3CCQ B;  5TV2 A;  3WBJ A;  1IB0 A;  3E20 A;  2VJJ A;  2B7B A;  3ZBU A;  1ZM2 A;  2D9R A;  2NV4 A;  2Q6I A;  3I1F A;  2C5B A;  2JN9 A;  5BSX A;  4Y9R A;  5FNZ A;  3WBK A;  2D3L A;  4G1V A;  3CMM A;  4M53 A;  1NB0 A;  4KKT A;  4XM3 A;  5DS0 A;  3GVK A;  2V7T A;  2YWF A;  1K8A D;  3W5V A;  3NE5 B;  2BF4 A;  4Z4Z A;  1BQE A;  4P6Y A;  4P25 A;  3MHP A;  1B23 P;  4P26 A;  4B47 A;  4P6V F;  2BM1 A;  2V4D A;  4PAB A;  4Z4T A;  2D74 A;  4YXW A;  1V5V A;  2F1L A;  1OB2 A;  1VLY A;  3Q38 A;  1EP2 B;  4QVA A;  1QGY A;  1VQ8 B;  1WOS A;  1Q86 D;  4K1X A;  2QA4 B;  4UZF A;  4PC7 A;  5IYW A;  1HZE A;  3ASP A;  2BV3 A;  3ONU A;  3CB4 A;  2GK7 A;  1W87 A;  5DN6 A;  2OYN A;  2XND A;  4X0C A;  4RDL A;  4R71 A;  1XFO A;  3OW2 B;  4ZGQ B;  5A89 A;  3W2F A;  2NPF A;  3ASS A;  4PC6 A;  3FJO A;  3ASQ A;  3CC4 B;  1K28 D;  4G5G A;  3AVW A;  1G7T A;  1U2R A;  3ZIA A;  4FWT A;  2WYR A;  4XR6 A;  1KTV A;  1JB9 A;  1XQB A;  3GSI A;  3OAA A;  1Q9S A;  1UD3 A;  2BPO A;  1VJS A;  3W2I A;  5TY0 A;  2GRE A;  1FNC A;  4RD1 A;  4RPD A;  3D26 A;  2VBU A;  4YAO A;  2QMU A;  1T6Y A;  4OPV A;  5HKK A;  4FXU A;  4X06 A;  5GV8 A;  3PVD A;  1VQO B;  4XLE A;  1QFZ A;  1VQM B;  4PAA A;  4XN3 A;  1E62 A;  4C43 A;  1QVG B;  1VQ4 B;  1VLO A;  3JU4 A;  3OOC A;  5HZB A;  1YI2 B;  2R6H A;  5H5J A;  1BPL A;  2WR8 A;  3U2Q A;  2PE3 A;  1EWY A;  3JQR A;  3SJP A;  2FX3 A;  4B43 A;  1VQ6 B;  1TTT A;  4LBY A;  4TN1 A;  3G6E B;  3CXC B;  2V7V A;  1SKQ A;  1P4M A;  1KC8 D;  4P22 A;  4XLH A;  4N3G A;  2WZN A;  4OPS A;  4XN0 A;  4L8J A;  1RQR A;  2KVO A;  2XNC A;  3SEJ A;  5F4O A;  2HLD A;  3JQQ A;  4XOR A;  2GJK A;  1E3Z A;  1D8T A;  3FPP A;  1PJ6 A;  4X7D A;  3J81 k;  1YHQ B;  1YIT B;  3LNN A;  4B3X A;  2DYI A;  3VMF A;  2BVN A;  1FNM A;  2WSS A;  3CCE B;  1Y0R A;  1XE1 A;  4B48 A;  3WY9 A;  3VO1 A;  3CCS B;  3ONY A;  4ZCI A;  5FO0 A;  3SLN A;  4G7W A;  1M1K D;  1S72 B;  4ZCM A;  2E1B A;  4QVJ A;  1FRQ A;  2GPJ A;  4HIZ A;  2QGG A;  3AST A;  3A1P A;  2CBX A;  1F20 A;  4RLZ A;  3W2E A;  3CP2 A;  4X7E A;  1D2E A;  2FVG A;  1R5B A;  4XOP A;  1QG0 A;  5HXB A;  2XZO A;  3QSY A;  4TKO B;  1KMH A;  1PKV A;  2X53 S;  1QUE A;  4YAL A;  2DCU A;  5TR9 A;  3T51 B;  1AMO A;  3AVV A;  1FND A;  1TLL A;  5A88 A;  4PC1 A;  1KQS B;  4DQL A;  3QFS A;  4RD2 A;  1WU8 A;  2BGJ A;  4YEL A;  3QFT A;  1DAR A;  4WQM A;  1QH0 A;  4LC0 A;  4M1K A;  3B78 A;  2XEX A;  2VZL A;  3WXM A;  1OB0 A;  1TUI A;  1B2R A;  1BMF A;  1S0U A;  3A8J A;  1IJF A;  1HA3 A;  4G1B A;  1YJN B;  1Q82 D;  2QDX A;  2X85 A;  2WJY A;  2X6W A;  5FO1 A;  2PLF A;  4FK8 A;  1OB5 A;  2DOG A;  5IK2 A;  2QN6 A;  4DNT B;  3CCU B;  3CME B;  1KD1 D;  3G71 B;  3LQ6 A;  2DET A;  1UD2 A;  1VF7 A;  4YAU A;  1VQP B;  4M2L A;  2ZXH A;  2ZZF A;  1VQ9 B;  1D1N A;  4ZGN B;  4YAF A;  3GVL A;  2C77 A;  4X7C A;  3W5U A;  3ZBT A;  3V76 A;  2XOK A;  3ZZ0 A;  1E1Q A;  2CW5 A;  1YLO A;  4RD4 A;  2D3N A;  3G4S B;  4G6I A;  1N8R D;  3I56 B;  2ZIT A;  1V0F A;  2ZTG A;  1W0J A;  1GJR A;  1E63 A;  4RD0 A;  4XLF A;  3A3G A;  1T5E A;  4X07 A;  1QVF B;  3WNC A;  2DIE A;  1OGI A;  1MAB A;  4DQK A;  3W5H A;  3CMA B;  1IHM A;  4OP7 A;  2ZL7 A;  1DDI A;  1NRK A;  3QE2 A;  3H94 A;  1EFC A;  5E6T A;  4DK0 A;  3GVJ A;  4KKS A;  3Q39 A;  3CCM B;  2ZBU A;  1ZUN B;  4EH1 A;  5B6I A;  3AVY A;  3AGP A;  2QTZ A;  2BN4 A;  2BGI A;  5FA6 A;  4AC9 A;  2QEX B;  1EFR A;  2W6J A;  2ZTN A;  2GJP A;  1VQ5 B;  1Q81 D;  5THX A;  1NBM A;  2JJ1 A;  1BX1 A;  1OGJ A;  2ZXI A;  3RY8 A;  5H59 A;  3BCF A;  3OZU A;  4G7X A;  1KK1 A;  3JQP A;  4TT3 A;  3SLD A;  4AVZ A;  4FN5 A;  4RD6 A;  3B82 A;  4QV2 A;  2HCJ B; 
#chains in the Genus database with same CATH homology
 3SKB A;  3SLN A;  4OPO A;  4Z4R A;  2OBR A;  4OOV A;  4QVJ A;  4P1V A;  3AST A;  4Z4Y A;  4RLZ A;  4X7E A;  5F4M A;  2ZL5 A;  3PUN A;  4OOS A;  5BSX A;  4Z4V A;  5IYR A;  4WZE A;  4RDK A;  4Z4Z A;  4P25 A;  4P26 A;  4Z4T A;  3R6K A;  2OBT A;  2ZL6 A;  3Q38 A;  4X05 A;  4QVA A;  5BSY A;  5IYN A;  5IYQ A;  5IYP A;  5IYW A;  3ASP A;  3ONU A;  3LQ6 A;  4X0C A;  4RDL A;  4OOX A;  3ASS A;  4RDJ A;  3ASQ A;  4Z4W A;  3BQJ A;  3LQE A;  3Q6Q A;  4ROX A;  4X7C A;  3BY2 A;  4P12 A;  3PA1 A;  5J3O A;  4WZT A;  4RPD A;  5J35 A;  3V7A A;  3D26 A;  4Z4U A;  4OPV A;  4X06 A;  4Z4S A;  3PVD A;  4X07 A;  3BY1 A;  4QUZ A;  5HZB A;  3Q6R A;  4P2N A;  1IHM A;  4P3I A;  4X7F A;  4RPB A;  4OP7 A;  3SJP A;  2ZL7 A;  3PA2 A;  5E6T A;  4OPS A;  3Q39 A;  2OBS A;  5F4J A;  3SEJ A;  5F4O A;  4X7D A;  4WZL A;  3Q3A A;  3RY8 A;  4RM0 A;  4WZK A;  3ASR A;  3ONY A;  3SLD A;  5KW9 A;  3R6J A;  5HZA A;  3PUM A;  4QV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...