4Z4UA

Crystal structure of gii.10 p domain in complex with 37.5mm fucose
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
314
structure length
310
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The sweet quartet: Binding of fucose to the norovirus capsid.
pubmed doi rcsb
source organism Norovirus gii.10
molecule tags Viral protein
molecule keywords Capsid protein
total genus 70
structure length 310
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4z4uA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4z4uA01
4P3IA 4X7DA 4RPBA 4P1VA 4Z4YA 5BSYA 1IHMA 4WZKA 4RLZA 5BSXA 5J3OA 3ASSA 3R6JA 5HZAA 2ZL7A 3SLNA 5F4JA 4WZLA 4OP7A 3SEJA 4WZEA 4OPSA 5F4OA 4Z4TA 3PUNA 4P12A 3Q6QA 4P26A 3ASRA 3ASQA 4RPDA 3ASPA 3R6KA 4WZTA 4X7EA 4X7FA 4QUZA 4X7CA 4Z4VA 4P25A 3LQ6A 3Q39A 4RDJA 4Z4ZA 3RY8A 4OOXA 3PVDA 3PA1A 3BY1A 4RM0A 3BY2A 4X0CA 4Z4WA 5IYQA 3Q6RA 3SLDA 3ASTA 5J35A 2OBTA 3PUMA 4QV2A 2OBSA 3SKBA 4P2NA 4QVJA 4OOVA 3D26A 3V7AA 3LQEA 3ONYA 4ROXA 4OPOA 3Q3AA 5E6TA 5IYPA 2OBRA 2ZL6A 4OPVA 5IYRA 4OOSA 3BQJA 3Q38A 3ONUA 4RDLA 5HZBA 4RDKA 4X05A 3SJPA 5KW9A 4X06A 4Z4UA 4Z4SA 5IYNA 4QVAA 4X07A 3PA2A 4Z4RA 5IYWA 2ZL5A 5F4MA
chains in the Genus database with same CATH superfamily
1QUFA 3ZIAA 1UD5A 4P3IA 2WR8A 4X7DA 2CBXA 4PC6A 3P27A 5BSYA 5BSXA 1G7CA 2JDIA 3QFSA 2QN6A 4G1VA 4B3FX 1NB9A 5B6IA 3LO8A 4YEJA 1N08A 2VNJA 2XEXA 5FNZA 1B23P 4J0QA 1Y0YA 4P3YA 3CCEB 3AVUA 1KC8D 5THXA 5F4OA 3ZZ0A 5CDFA 4PGOA 3W5HA 1YIJB 3PUNA 2WJVA 4XD7A 3CCLB 4B3GA 4P12A 1VQ6B 1BJKA 3QE2A 2F4NA 4ASUA 1GO2A 2DERA 1PKVA 1BMFA 2VBTA 3ASRA 1QVFB 2PMDA 2V31A 3KEWA 3W2EA 1FRQA 2GK6A 3ASQA 2YWEA 2BVNA 2I1LA 3W2IA 1EFUA 2DOGA 4XR6A 4TMVA 4AVZA 1XB2A 4YAUA 3BCFA 1K8AD 2JIZA 5EMNA 4LBVA 5DSZA 3WYAA 3H94A 3Q39A 4XN0A 3RY8A 1Q9SA 4TMXA 3WNCA 1UD3A 1Q7YD 2HCJB 3HAGA 1QFZA 1OB2A 1PJ7A 3FKSA 3BY1A 1OB0A 1E1QA 3WQZA 1E1RA 1G7RA 4RM0A 1N0VC 1NJID 5IYQA 1KJZA 2D9RA 4YHBA 3SLDA 4YAOA 1E3XA 5J35A 2F1MA 3ISXA 1VQ4B 2BM0A 3PUMA 2B7CA 2F1LA 4Y7CA 2VBUA 3WNDA 2BPOA 2OTLB 4G1BA 2VYQA 1VQMB 4QV2A 3OAAA 1AIPA 2OYNA 1F60A 2QDXA 3WBKA 3A8KA 1TLLA 1VQ8B 2OBSA 1IJFA 4DNTB 4P2NA 4HIZA 3D26A 1N05A 1HZEA 3OJWA 2X53S 4XLHA 5JBQA 1XQBA 3Q3AA 3J81k 4LC0A 2OBRA 1T6YA 3CC4B 5IYRA 1T5EA 1EFTA 3BQJA 2CW5A 3Q38A 2VNHA 3VNUA 2E1BA 1K9MD 1W34A 2Z6BD 2M5SA 1RQPA 1VHEA 4B43A 3CW2A 4RJLA 4YALA 3CPWB 2V7QA 5DN6A 2F43A 1FNCA 4TSFA 1UD6A 3I55B 4X07A 1S4MA 3G05A 1T6XA 4Z4RA 5IYWA 4II3A 2GJKA 3JU4A 2R9VA 2DCUA 1WTHD 4P1VA 2CC2A 4XLEA 1AMOA 1IHMA 4XLAA 4WZKA 1WDTA 3ZBUA 3B8HA 5J3OA 3CCUB 3GSIA 4YAWA 3SLNA 3CCVB 4UZEA 1N06A 4II2A 3G4SB 1SKYB 3SEJA 5IK2A 4WZEA 2C5HA 1K28D 2X6WA 1W9XA 2C77A 5KSWB 1E79A 4OPSA 3OW2B 1E62A 1OHHA 2HLDA 2V7TA 3OZUA 4Z4TA 1XFOA 2Q6OA 2C5BA 2V7WA 4AF7A 2YWHA 1JJ2B 1EP3B 3CMEB 2WZNA 3VNVA 3G6EB 5HKKA 4B44A 3OZVA 3CCMB 3CP8A 2X3UA 3CCQB 4RPDA 5FO0A 3OP1A 5HXBA 4B4DA 1VQLB 3R6KA 1VLYA 4RD2A 1IB0A 4X7FA 2Q6LA 2OK8A 2QGGA 2VBVA 1KK0A 2BGIA 3LQ6A 4P25A 4RDJA 4XLFA 3A3GA 4B48A 2E1RA 1RQRA 4Z4ZA 1Q82D 3DDYA 4RD4A 3PVDA 2XGJA 2R6HA 4ZV4A 3GIRA 2X6XA 2DIEA 3BNWA 3OJXA 4KKUA 1EXMA 4PC1A 1F20A 4EH1A 4YELA 1GJRA 1JA0A 2QEXB 1H85A 3BY2A 5KNLA 4Z4WA 5FO1A 1QUEA 1WP6A 3CXCB 3Q6RA 2GREA 4XMYA 4U9UA 2V4DA 4ZGNB 4P22A 4MYUA 4RD6A 2OBTA 5FIUA 3VR6A 3CPXA 1YI2B 2FX3A 3B82A 2BMWA 3H9NA 5LMZA 1VQ7B 4M0LA 3PENA 3AGQA 1D8TA 4G7WA 3ZUGA 2J7KA 3U6KA 1M1KD 1UMKA 4XOTA 3WXMA 5FA6A 4CQJA 2CF4A 1GAWA 3AVVA 1QGAA 4QVJA 5L46A 1FDRA 3A3BA 3VO2A 5A8AA 2ZZEA 3LQEA 3U2QA 2XZLA 4Y9RA 2CNDA 3A8IA 4KKTA 4ROXA 3WBJA 4C0SA 1FNMA 2BN4A 3OOCA 3E1YE 2XNJA 4ACAA 2ZL6A 4BPRA 1I8DA 2ZTNA 3JQRA 1YJWB 1M90D 1S72B 3VO1A 4RDLA 1WU8A 1KD1D 3BCDA 3AGPA 4YXWA 1P4MA 4RD3A 1WOSA 2QE7A 2JN9A 4X05A 4Y9UA 5TY0A 1H8EA 4PAAA 3SJZA 1DDIA 5FL7A 1ZUNB 3SJPA 4DQKA 1WSRA 1V0EA 4Z4UA 2XZPA 4Z4SA 2C4TA 4QVAA 2RC5A 1E64A 1KMHA 3AVWA 4PC2A 1N07A 4RPBA 4XL9A 2KVOA 3CC7B 1W0JA 2BSAA 1Q86D 4RLZA 1EWYA 1ZM3A 2OTJB 2D74A 3ASSA 3R6JA 5HZAA 1JNYA 2XNCA 2ZL7A 1ZM2A 4IW3B 3W5UA 3ZZTA 3G71B 5A89A 1OB5A 1YITB 2FVGA 5F4JA 3NE5B 4OP7A 1QFYA 4G6IA 3GVLA 1HA3A 2QMUA 4P6VF 1VQOB 1KK3A 3CC2B 2BGJA 4DNRB 1W35A 4HE6A 4UZFA 4H9GA 2WZPP 3QFCA 2ZBVA 5AN9A 2ZZFA 2VZLA 1EP1B 2VJIA 1D1NA 1NBMA 2V7VA 3Q6QA 1KZLA 2BM1A 4M2LA 2ZBUA 4M1KA 4P26A 2PIAA 1R5NA 1R5OA 4M53A 1KRHA 4Q7JB 4QFMA 4ZCLA 1VLOA 3I1FA 1W87A 4WZTA 4X7EA 4XNFA 1JB9A 3JQPA 4XKVA 3WNBA 4XN3A 3T53B 4RCYA 3V76A 4Z4VA 1VQ9B 4XKWA 1G7TA 2ZZGA 1I7PA 3T56B 4OOXA 1UD4A 3KL9A 2JJ2A 2YWGA 3OE7A 3OEHA 2DEUA 3MMPA 3CESA 4HE5A 4DK1A 1SM4A 3GVJA 4N3GA 1SKQA 4B47A 1QX4A 4XLCA 2X8KA 4X0CA 2WYRA 1TVCA 2CK3A 1BPLA 1PJ5A 3BH4A 1FNDA 1T6ZA 3QSYA 3VMFA 4WWVA 4LBWA 2C78A 3OEEA 4JMQA 2QTZA 4P9SA 2CRVA 1G7SA 2W6JA 2DYIA 2WSSA 1EFCA 2RC6A 4MYTA 3CD6B 2V7XA 1CNFA 1V5VA 3V7AA 2QTLA 3CMAB 2QA4B 4GQNA 4OPOA 1I18A 1WPCA 4P6YA 1COWA 5E6TA 5IYPA 1CQXA 1QGYA 4XONA 4LBZA 4OPVA 2W6IA 1VF7A 5H59A 1VQKB 2GJRA 4PABA 4XORA 4M4SA 2NPFA 4DK0A 1NDHA 1N0UA 1K73D 5DS0A 5GV8A 1Q81D 3W2FA 5HZBA 1YLOA 1PJ6A 4NBSA 3QFTA 2VNIA 1ELOA 5KW9A 4WQMA 4NNJA 1YJ9B 4XOPA 1IJEA 5IYNA 1W2BB 4RD0A 3A35A 1H42A 3PA2A 2PLFA 2ZL5A 1H8HA 4C43A 1BX1A 2NV4A 1U2RA 4Z4YA 1J9ZA 1GAQA 1WOOA 3AVTA 2EFGA 2JJ1A 2WJYA 1KQSB 3B78A 3FPPA 3U6BA 1XE1A 2ZXHA 2GPJA 4RCZA 4TMTA 2YWFA 5TR9A 1JA1A 1WSVA 1QVGB 4WZLA 3QFRA 1KTVA 3WY9A 2C2WA 1ZM4A 1WORA 5GV7A 3AVYA 1EP2B 2B7BA 3T51B 3P26A 3CRZA 4KKSA 2XNDA 3MCAA 1TTTA 1VQNB 1MRZA 1E3ZA 2Q6KA 1NB0A 4G5GA 4PC7A 2V7UA 1W0KA 2ZITA 5H5JA 2C4UA 4DQLA 4AF6A 1DG1G 4X8IA 1B2RA 3W2GA 1HVXA 2ZTGA 2XZOA 1VHOA 1QGZA 4Z1MA 2AHOA 3JQQA 3LVBA 4E0FA 3W5VA 3ASPA 3I56B 1GR1A 4ACBA 3BC9A 4FWTA 4FN5A 1QG0A 1FX0A 2X85A 1VJSA 4QHYA 2ZZQA 5TV2A 4QUZA 2ZXIA 3OKXA 3FPKA 4X7CA 1A8PA 2LZJA 3ZBTA 4F7DA 3CCJB 4N3NA 2P3MA 1FRNA 2D3LA 4YAFA 1VQPB 3PA1A 1DARA 3ZZUA 4B3XA 3OPOA 1CNEA 1E63A 3OZWA 4UZUA 1S0UA 1Y0RA 4NCNA 1KK2A 1FNBA 3OFNA 4LBYA 4R71A 1EFRA 2HDNB 1YX2A 3MHPA 2GJPA 3CCSB 3ZC3A 3ASTA 1GVHA 1D2EA 2VBSA 3CTAA 1KK1A 1WOPA 3GQBA 3GVKA 4L8JA 1OGJA 4FK8A 3CP2A 2XOKA 1BQEA 1BX0A 1QFJA 3A8JA 4XM3A 1UD2A 1TUIA 2DETA 3OW7A 4ZCMA 4XQFA 4ZGQB 1YHQB 2B5OA 2DY1A 1DDGA 2GK7A 1VQ5B 4ZCIA 1E43A 3SKBA 4AC9A 4OOVA 3LNNA 1R5BA 1OGIA 3CMMA 2VNKA 4G7XA 3W2HA 5A88A 4UAJA 4TKOB 4FXUA 3E20A 4PC3A 3ONYA 3A1PA 4K1XA 2EIXA 3ZPNA 2OK7A 1V0FA 2GQFA 2PE3A 1QH0A 1UD8A 2BV3A 3AVXA 1BLIA 2D3NA 4OOSA 3ES9A 4TN1A 2X6YA 4TT3A 2VJJA 2WPDA 3ONUA 2Q6IA 1ZM9A 1YJNB 4RD1A 2X0KA 4RDKA 3CCRB 5TRDA 4X06A 4TMZA 1N8RD 1NRKA 3CB4A 2HMAA 1MABA 4TMWA 3FJOA 2BF4A 5F4MA
chains in the Genus database with same CATH topology
4P3IA 4X7DA 4RPBA 4P1VA 4Z4YA 5BSYA 1IHMA 4WZKA 4RLZA 5BSXA 5J3OA 3ASSA 3R6JA 5HZAA 2ZL7A 3SLNA 5F4JA 4WZLA 4OP7A 3SEJA 4WZEA 4OPSA 5F4OA 4Z4TA 3PUNA 4P12A 3Q6QA 4P26A 3ASRA 3ASQA 4RPDA 3ASPA 3R6KA 4WZTA 4X7EA 4X7FA 4QUZA 4X7CA 4Z4VA 4P25A 3LQ6A 3Q39A 4RDJA 4Z4ZA 3RY8A 4OOXA 3PVDA 3PA1A 3BY1A 4RM0A 3BY2A 4X0CA 4Z4WA 5IYQA 3Q6RA 3SLDA 3ASTA 5J35A 2OBTA 3PUMA 4QV2A 2OBSA 3SKBA 4P2NA 4QVJA 4OOVA 3D26A 3V7AA 3LQEA 3ONYA 4ROXA 4OPOA 3Q3AA 5E6TA 5IYPA 2OBRA 2ZL6A 4OPVA 5IYRA 4OOSA 3BQJA 3Q38A 3ONUA 4RDLA 5HZBA 4RDKA 4X05A 3SJPA 5KW9A 4X06A 4Z4UA 4Z4SA 5IYNA 4QVAA 4X07A 3PA2A 4Z4RA 5IYWA 2ZL5A 5F4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P3I A;  4X7D A;  4RPB A;  4P1V A;  4Z4Y A;  5BSY A;  1IHM A;  4WZK A;  4RLZ A;  5BSX A;  5J3O A;  3ASS A;  3R6J A;  5HZA A;  2ZL7 A;  3SLN A;  5F4J A;  4WZL A;  4OP7 A;  3SEJ A;  4WZE A;  4OPS A;  5F4O A;  4Z4T A;  3PUN A;  4P12 A;  3Q6Q A;  4P26 A;  3ASR A;  3ASQ A;  4RPD A;  3ASP A;  3R6K A;  4WZT A;  4X7E A;  4X7F A;  4QUZ A;  4X7C A;  4Z4V A;  4P25 A;  3LQ6 A;  3Q39 A;  4RDJ A;  4Z4Z A;  3RY8 A;  4OOX A;  3PVD A;  3PA1 A;  3BY1 A;  4RM0 A;  3BY2 A;  4X0C A;  4Z4W A;  5IYQ A;  3Q6R A;  3SLD A;  3AST A;  5J35 A;  2OBT A;  3PUM A;  4QV2 A;  2OBS A;  3SKB A;  4P2N A;  4QVJ A;  4OOV A;  3D26 A;  3V7A A;  3LQE A;  3ONY A;  4ROX A;  4OPO A;  3Q3A A;  5E6T A;  5IYP A;  2OBR A;  2ZL6 A;  4OPV A;  5IYR A;  4OOS A;  3BQJ A;  3Q38 A;  3ONU A;  4RDL A;  5HZB A;  4RDK A;  4X05 A;  3SJP A;  5KW9 A;  4X06 A;  4Z4U A;  4Z4S A;  5IYN A;  4QVA A;  4X07 A;  3PA2 A;  4Z4R A;  5IYW A;  2ZL5 A;  5F4M A; 
#chains in the Genus database with same CATH topology
 1QUF A;  3ZIA A;  1UD5 A;  4P3I A;  2WR8 A;  4X7D A;  2CBX A;  4PC6 A;  3P27 A;  5BSY A;  5BSX A;  1G7C A;  2JDI A;  3QFS A;  2QN6 A;  4G1V A;  4B3F X;  1NB9 A;  5B6I A;  3LO8 A;  4YEJ A;  1N08 A;  2VNJ A;  2XEX A;  5FNZ A;  1B23 P;  4J0Q A;  1Y0Y A;  4P3Y A;  3CCE B;  3AVU A;  1KC8 D;  5THX A;  5F4O A;  3ZZ0 A;  5CDF A;  4PGO A;  3W5H A;  1YIJ B;  3PUN A;  2WJV A;  4XD7 A;  3CCL B;  4B3G A;  4P12 A;  1VQ6 B;  1BJK A;  3QE2 A;  2F4N A;  4ASU A;  1GO2 A;  2DER A;  1PKV A;  1BMF A;  2VBT A;  3ASR A;  1QVF B;  2PMD A;  2V31 A;  3KEW A;  3W2E A;  1FRQ A;  2GK6 A;  3ASQ A;  2YWE A;  2BVN A;  2I1L A;  3W2I A;  1EFU A;  2DOG A;  4XR6 A;  4TMV A;  4AVZ A;  1XB2 A;  4YAU A;  3BCF A;  1K8A D;  2JIZ A;  5EMN A;  4LBV A;  5DSZ A;  3WYA A;  3H94 A;  3Q39 A;  4XN0 A;  3RY8 A;  1Q9S A;  4TMX A;  3WNC A;  1UD3 A;  1Q7Y D;  2HCJ B;  3HAG A;  1QFZ A;  1OB2 A;  1PJ7 A;  3FKS A;  3BY1 A;  1OB0 A;  1E1Q A;  3WQZ A;  1E1R A;  1G7R A;  4RM0 A;  1N0V C;  1NJI D;  5IYQ A;  1KJZ A;  2D9R A;  4YHB A;  3SLD A;  4YAO A;  1E3X A;  5J35 A;  2F1M A;  3ISX A;  1VQ4 B;  2BM0 A;  3PUM A;  2B7C A;  2F1L A;  4Y7C A;  2VBU A;  3WND A;  2BPO A;  2OTL B;  4G1B A;  2VYQ A;  1VQM B;  4QV2 A;  3OAA A;  1AIP A;  2OYN A;  1F60 A;  2QDX A;  3WBK A;  3A8K A;  1TLL A;  1VQ8 B;  2OBS A;  1IJF A;  4DNT B;  4P2N A;  4HIZ A;  3D26 A;  1N05 A;  1HZE A;  3OJW A;  2X53 S;  4XLH A;  5JBQ A;  1XQB A;  3Q3A A;  3J81 k;  4LC0 A;  2OBR A;  1T6Y A;  3CC4 B;  5IYR A;  1T5E A;  1EFT A;  3BQJ A;  2CW5 A;  3Q38 A;  2VNH A;  3VNU A;  2E1B A;  1K9M D;  1W34 A;  2Z6B D;  2M5S A;  1RQP A;  1VHE A;  4B43 A;  3CW2 A;  4RJL A;  4YAL A;  3CPW B;  2V7Q A;  5DN6 A;  2F43 A;  1FNC A;  4TSF A;  1UD6 A;  3I55 B;  4X07 A;  1S4M A;  3G05 A;  1T6X A;  4Z4R A;  5IYW A;  4II3 A;  2GJK A;  3JU4 A;  2R9V A;  2DCU A;  1WTH D;  4P1V A;  2CC2 A;  4XLE A;  1AMO A;  1IHM A;  4XLA A;  4WZK A;  1WDT A;  3ZBU A;  3B8H A;  5J3O A;  3CCU B;  3GSI A;  4YAW A;  3SLN A;  3CCV B;  4UZE A;  1N06 A;  4II2 A;  3G4S B;  1SKY B;  3SEJ A;  5IK2 A;  4WZE A;  2C5H A;  1K28 D;  2X6W A;  1W9X A;  2C77 A;  5KSW B;  1E79 A;  4OPS A;  3OW2 B;  1E62 A;  1OHH A;  2HLD A;  2V7T A;  3OZU A;  4Z4T A;  1XFO A;  2Q6O A;  2C5B A;  2V7W A;  4AF7 A;  2YWH A;  1JJ2 B;  1EP3 B;  3CME B;  2WZN A;  3VNV A;  3G6E B;  5HKK A;  4B44 A;  3OZV A;  3CCM B;  3CP8 A;  2X3U A;  3CCQ B;  4RPD A;  5FO0 A;  3OP1 A;  5HXB A;  4B4D A;  1VQL B;  3R6K A;  1VLY A;  4RD2 A;  1IB0 A;  4X7F A;  2Q6L A;  2OK8 A;  2QGG A;  2VBV A;  1KK0 A;  2BGI A;  3LQ6 A;  4P25 A;  4RDJ A;  4XLF A;  3A3G A;  4B48 A;  2E1R A;  1RQR A;  4Z4Z A;  1Q82 D;  3DDY A;  4RD4 A;  3PVD A;  2XGJ A;  2R6H A;  4ZV4 A;  3GIR A;  2X6X A;  2DIE A;  3BNW A;  3OJX A;  4KKU A;  1EXM A;  4PC1 A;  1F20 A;  4EH1 A;  4YEL A;  1GJR A;  1JA0 A;  2QEX B;  1H85 A;  3BY2 A;  5KNL A;  4Z4W A;  5FO1 A;  1QUE A;  1WP6 A;  3CXC B;  3Q6R A;  2GRE A;  4XMY A;  4U9U A;  2V4D A;  4ZGN B;  4P22 A;  4MYU A;  4RD6 A;  2OBT A;  5FIU A;  3VR6 A;  3CPX A;  1YI2 B;  2FX3 A;  3B82 A;  2BMW A;  3H9N A;  5LMZ A;  1VQ7 B;  4M0L A;  3PEN A;  3AGQ A;  1D8T A;  4G7W A;  3ZUG A;  2J7K A;  3U6K A;  1M1K D;  1UMK A;  4XOT A;  3WXM A;  5FA6 A;  4CQJ A;  2CF4 A;  1GAW A;  3AVV A;  1QGA A;  4QVJ A;  5L46 A;  1FDR A;  3A3B A;  3VO2 A;  5A8A A;  2ZZE A;  3LQE A;  3U2Q A;  2XZL A;  4Y9R A;  2CND A;  3A8I A;  4KKT A;  4ROX A;  3WBJ A;  4C0S A;  1FNM A;  2BN4 A;  3OOC A;  3E1Y E;  2XNJ A;  4ACA A;  2ZL6 A;  4BPR A;  1I8D A;  2ZTN A;  3JQR A;  1YJW B;  1M90 D;  1S72 B;  3VO1 A;  4RDL A;  1WU8 A;  1KD1 D;  3BCD A;  3AGP A;  4YXW A;  1P4M A;  4RD3 A;  1WOS A;  2QE7 A;  2JN9 A;  4X05 A;  4Y9U A;  5TY0 A;  1H8E A;  4PAA A;  3SJZ A;  1DDI A;  5FL7 A;  1ZUN B;  3SJP A;  4DQK A;  1WSR A;  1V0E A;  4Z4U A;  2XZP A;  4Z4S A;  2C4T A;  4QVA A;  2RC5 A;  1E64 A;  1KMH A;  3AVW A;  4PC2 A;  1N07 A;  4RPB A;  4XL9 A;  2KVO A;  3CC7 B;  1W0J A;  2BSA A;  1Q86 D;  4RLZ A;  1EWY A;  1ZM3 A;  2OTJ B;  2D74 A;  3ASS A;  3R6J A;  5HZA A;  1JNY A;  2XNC A;  2ZL7 A;  1ZM2 A;  4IW3 B;  3W5U A;  3ZZT A;  3G71 B;  5A89 A;  1OB5 A;  1YIT B;  2FVG A;  5F4J A;  3NE5 B;  4OP7 A;  1QFY A;  4G6I A;  3GVL A;  1HA3 A;  2QMU A;  4P6V F;  1VQO B;  1KK3 A;  3CC2 B;  2BGJ A;  4DNR B;  1W35 A;  4HE6 A;  4UZF A;  4H9G A;  2WZP P;  3QFC A;  2ZBV A;  5AN9 A;  2ZZF A;  2VZL A;  1EP1 B;  2VJI A;  1D1N A;  1NBM A;  2V7V A;  3Q6Q A;  1KZL A;  2BM1 A;  4M2L A;  2ZBU A;  4M1K A;  4P26 A;  2PIA A;  1R5N A;  1R5O A;  4M53 A;  1KRH A;  4Q7J B;  4QFM A;  4ZCL A;  1VLO A;  3I1F A;  1W87 A;  4WZT A;  4X7E A;  4XNF A;  1JB9 A;  3JQP A;  4XKV A;  3WNB A;  4XN3 A;  3T53 B;  4RCY A;  3V76 A;  4Z4V A;  1VQ9 B;  4XKW A;  1G7T A;  2ZZG A;  1I7P A;  3T56 B;  4OOX A;  1UD4 A;  3KL9 A;  2JJ2 A;  2YWG A;  3OE7 A;  3OEH A;  2DEU A;  3MMP A;  3CES A;  4HE5 A;  4DK1 A;  1SM4 A;  3GVJ A;  4N3G A;  1SKQ A;  4B47 A;  1QX4 A;  4XLC A;  2X8K A;  4X0C A;  2WYR A;  1TVC A;  2CK3 A;  1BPL A;  1PJ5 A;  3BH4 A;  1FND A;  1T6Z A;  3QSY A;  3VMF A;  4WWV A;  4LBW A;  2C78 A;  3OEE A;  4JMQ A;  2QTZ A;  4P9S A;  2CRV A;  1G7S A;  2W6J A;  2DYI A;  2WSS A;  1EFC A;  2RC6 A;  4MYT A;  3CD6 B;  2V7X A;  1CNF A;  1V5V A;  3V7A A;  2QTL A;  3CMA B;  2QA4 B;  4GQN A;  4OPO A;  1I18 A;  1WPC A;  4P6Y A;  1COW A;  5E6T A;  5IYP A;  1CQX A;  1QGY A;  4XON A;  4LBZ A;  4OPV A;  2W6I A;  1VF7 A;  5H59 A;  1VQK B;  2GJR A;  4PAB A;  4XOR A;  4M4S A;  2NPF A;  4DK0 A;  1NDH A;  1N0U A;  1K73 D;  5DS0 A;  5GV8 A;  1Q81 D;  3W2F A;  5HZB A;  1YLO A;  1PJ6 A;  4NBS A;  3QFT A;  2VNI A;  1ELO A;  5KW9 A;  4WQM A;  4NNJ A;  1YJ9 B;  4XOP A;  1IJE A;  5IYN A;  1W2B B;  4RD0 A;  3A35 A;  1H42 A;  3PA2 A;  2PLF A;  2ZL5 A;  1H8H A;  4C43 A;  1BX1 A;  2NV4 A;  1U2R A;  4Z4Y A;  1J9Z A;  1GAQ A;  1WOO A;  3AVT A;  2EFG A;  2JJ1 A;  2WJY A;  1KQS B;  3B78 A;  3FPP A;  3U6B A;  1XE1 A;  2ZXH A;  2GPJ A;  4RCZ A;  4TMT A;  2YWF A;  5TR9 A;  1JA1 A;  1WSV A;  1QVG B;  4WZL A;  3QFR A;  1KTV A;  3WY9 A;  2C2W A;  1ZM4 A;  1WOR A;  5GV7 A;  3AVY A;  1EP2 B;  2B7B A;  3T51 B;  3P26 A;  3CRZ A;  4KKS A;  2XND A;  3MCA A;  1TTT A;  1VQN B;  1MRZ A;  1E3Z A;  2Q6K A;  1NB0 A;  4G5G A;  4PC7 A;  2V7U A;  1W0K A;  2ZIT A;  5H5J A;  2C4U A;  4DQL A;  4AF6 A;  1DG1 G;  4X8I A;  1B2R A;  3W2G A;  1HVX A;  2ZTG A;  2XZO A;  1VHO A;  1QGZ A;  4Z1M A;  2AHO A;  3JQQ A;  3LVB A;  4E0F A;  3W5V A;  3ASP A;  3I56 B;  1GR1 A;  4ACB A;  3BC9 A;  4FWT A;  4FN5 A;  1QG0 A;  1FX0 A;  2X85 A;  1VJS A;  4QHY A;  2ZZQ A;  5TV2 A;  4QUZ A;  2ZXI A;  3OKX A;  3FPK A;  4X7C A;  1A8P A;  2LZJ A;  3ZBT A;  4F7D A;  3CCJ B;  4N3N A;  2P3M A;  1FRN A;  2D3L A;  4YAF A;  1VQP B;  3PA1 A;  1DAR A;  3ZZU A;  4B3X A;  3OPO A;  1CNE A;  1E63 A;  3OZW A;  4UZU A;  1S0U A;  1Y0R A;  4NCN A;  1KK2 A;  1FNB A;  3OFN A;  4LBY A;  4R71 A;  1EFR A;  2HDN B;  1YX2 A;  3MHP A;  2GJP A;  3CCS B;  3ZC3 A;  3AST A;  1GVH A;  1D2E A;  2VBS A;  3CTA A;  1KK1 A;  1WOP A;  3GQB A;  3GVK A;  4L8J A;  1OGJ A;  4FK8 A;  3CP2 A;  2XOK A;  1BQE A;  1BX0 A;  1QFJ A;  3A8J A;  4XM3 A;  1UD2 A;  1TUI A;  2DET A;  3OW7 A;  4ZCM A;  4XQF A;  4ZGQ B;  1YHQ B;  2B5O A;  2DY1 A;  1DDG A;  2GK7 A;  1VQ5 B;  4ZCI A;  1E43 A;  3SKB A;  4AC9 A;  4OOV A;  3LNN A;  1R5B A;  1OGI A;  3CMM A;  2VNK A;  4G7X A;  3W2H A;  5A88 A;  4UAJ A;  4TKO B;  4FXU A;  3E20 A;  4PC3 A;  3ONY A;  3A1P A;  4K1X A;  2EIX A;  3ZPN A;  2OK7 A;  1V0F A;  2GQF A;  2PE3 A;  1QH0 A;  1UD8 A;  2BV3 A;  3AVX A;  1BLI A;  2D3N A;  4OOS A;  3ES9 A;  4TN1 A;  2X6Y A;  4TT3 A;  2VJJ A;  2WPD A;  3ONU A;  2Q6I A;  1ZM9 A;  1YJN B;  4RD1 A;  2X0K A;  4RDK A;  3CCR B;  5TRD A;  4X06 A;  4TMZ A;  1N8R D;  1NRK A;  3CB4 A;  2HMA A;  1MAB A;  4TMW A;  3FJO A;  2BF4 A;  5F4M A; 
#chains in the Genus database with same CATH homology
 4P3I A;  4X7D A;  4RPB A;  4P1V A;  4Z4Y A;  5BSY A;  1IHM A;  4WZK A;  4RLZ A;  5BSX A;  5J3O A;  3ASS A;  3R6J A;  5HZA A;  2ZL7 A;  3SLN A;  5F4J A;  4WZL A;  4OP7 A;  3SEJ A;  4WZE A;  4OPS A;  5F4O A;  4Z4T A;  3PUN A;  4P12 A;  3Q6Q A;  4P26 A;  3ASR A;  3ASQ A;  4RPD A;  3ASP A;  3R6K A;  4WZT A;  4X7E A;  4X7F A;  4QUZ A;  4X7C A;  4Z4V A;  4P25 A;  3LQ6 A;  3Q39 A;  4RDJ A;  4Z4Z A;  3RY8 A;  4OOX A;  3PVD A;  3PA1 A;  3BY1 A;  4RM0 A;  3BY2 A;  4X0C A;  4Z4W A;  5IYQ A;  3Q6R A;  3SLD A;  3AST A;  5J35 A;  2OBT A;  3PUM A;  4QV2 A;  2OBS A;  3SKB A;  4P2N A;  4QVJ A;  4OOV A;  3D26 A;  3V7A A;  3LQE A;  3ONY A;  4ROX A;  4OPO A;  3Q3A A;  5E6T A;  5IYP A;  2OBR A;  2ZL6 A;  4OPV A;  5IYR A;  4OOS A;  3BQJ A;  3Q38 A;  3ONU A;  4RDL A;  5HZB A;  4RDK A;  4X05 A;  3SJP A;  5KW9 A;  4X06 A;  4Z4U A;  4Z4S A;  5IYN A;  4QVA A;  4X07 A;  3PA2 A;  4Z4R A;  5IYW A;  2ZL5 A;  5F4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...