4DNTB

Crystal structure of the cusba heavy-metal efflux complex from escherichia coli, mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein CusB
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 58
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00529 HlyD HlyD membrane-fusion protein of T1SS
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4dntB02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dntB03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 4dntB01
1H9RA 3VA7A 4I7ZC 3L7ZC 1VF5C 2BE5D 2A6ED 1OXUA 4KKSA 1FYCA 4H13C 1CTMA 3QG1A 1H9MA 1Y8PB 1I6VC 1H9SA 3IKJA 3GQBA 2EJFC 3M4YA 1E2WA 4HR7B 2EDGA 2A69D 3GD7A 5KNBA 3PUVA 3OW7A 2D5DA 2F1MA 4TKOB 3I73A 3NE5B 1B9MA 4OO1H 3T51B 1ZKOA 3CRKC 1OXTA 1Z6HA 3VR4A 4KN4C 1LABA 2D2CC 4KN7C 4DK1A 3SE0A 1E2VA 5C0XG 5K36H 3ND8A 1B9NA 2NN6I 3H94A 1PMRA 2KA7A 2L5TA 3MFYA 4DNRB 4OGQC 1V43A 3LWUA 1IYUA 1YNNC 3I4LA 4XIGS 3P20A 1IW7C 2A68C 4BA1I 4GZYC 1E2ZA 1HCZA 3QIAA 5BN5A 1Z7TA 2JEAI 5KNCA 1GHJA 4L8JA 1DXMA 1V8QA 3VR6A 3T53B 1GUSA 3FPPA 5KNDA 2D62A 1OXSC 1H9SB 1IW7D 2A68D 3EQLC 3QJYA 3TZUA 1A6XA 1GUNA 4DNTB 1HQMC 1O7LA 2EJGC 4PV1C 4RCNA 2JEBI 2O5JC 5C0XH 4KKUA 5K36G 4H44C 2AWOA 2ZT9C 3VR3A 5BN4A 1T5EA 1Q12A 1GHKA 1DCZA 4G7OC 2K32A 1GJXA 1BDOA 4KKTA 2A6HC 2E74C 2E76C 3VR5A 2PPBC 2CW0C 3U9SA 4KHZA 2O5IC 2JE6I 1K8MA 3OPOA 3DXJC 1FR3A 4G7ZC 2R6GA 2AUJD 2EJMA 2PNRC 3IFTA 3PUZA 4XTCS 3PUWA 2A6HD 2EVBA 1G291 1TU2B 1Y8OB 3M7NA 2BA0A 1GUTA 1ZYRC 1VCIA 2PCFB 4IFDG 3KLRA 1QJOA 2BE5C 2A6EC 1H9JA 4KMUC 3AB9A 1TKWB 3MXUA 5JEAG 1DD2A 3LNNA 1Q1BA 2DNCA 2E75C 2AUKA 3BDOA 1Q90A 4H0LC 2NN6G 3N6RA 1SMYC 2K33A 3WDNA 1K8OA 3PUYA 3T56B 3D31A 3PV0A 5A35A 1Q1EA 1HTPA 2DN8A 3CRLC 4TQUS 3W3AA 3RLFA 2JXMB 3HGBA 3D4RA 4LK1C 2YYZA 1EWHA 1GUGA 1HPCA 2QF7A 1YNJC 3FMCA 3VR2A 1ONLA 1Y69U 2B8FA 2V4DA 3A8KE 4JK1C 5BN3A 4LJZC 2K7VA 1OXXK 3SDZA 3PUXA 1GUOA 2LMCB 1LACA 3ND9A 3A8JE 4IQZA 4BA2I 3A7LA 1H9KA 4OO1G 3A7AB 4IFDH 1Y8NB 2BDOA 1VF7A 4DK0A 2DNEA 3A8IE 1CFMA 2KCCA 2B8GA 2BA1A 4JBWA 4KI0A 1OXVA 5JEAH 3M85A 1VDZA 1IYVA 2Q8IB 2NN6H 3I72A 4G7HC 3BG3A 1O78A 2A69C 1CI3M 2IT1A 3OOCA
chains in the Genus database with same CATH superfamily
1EFID 4X3KA 3GTPH 1H95A 2Q6OA 2BE5D 4K1XA 5C3EG 3W1BA 3W5HA 5IYDH 3VYSA 3Q22A 1EY9A 1CZGA 2HIXA 1UNSA 1VQMB 4LWCA 4IFDJ 4RCYA 1UE1A 1WOCA 3RMHA 3A35A 1WU8A 5C44B 3PENA 2NTTA 5EBDA 3BH4A 1IZ6A 3I55B 2KEDA 1JT8A 1PH7A 2NVQB 3I2ZA 3OFNA 4IUTA 5E3FA 5EAYA 4ZCIA 4DNRB 3I3CA 1V1OA 2G9HD 2VQEL 1A3VA 2B2YC 3DWAA 3RR5A 4DV4L 3FRPB 2B39A 5FJ8H 1IBLQ 1LM0A 1SYCA 1QGAA 2B7BA 3WBJA 4JI3L 1XYIA 1EZ6A 1KNAA 3KFUA 2BMWA 2ICEC 4BXXH 4XOPA 1JWUD 4XORA 3MXNB 4ME3A 3EA6A 1DG1G 1KHIA 3T1HQ 3VR6A 3GTOB 2ZTNA 1BCPD 1JJCB 2E8GA 4XMYA 4B9XA 4YCWA 1GUNA 5CV6A 5A89A 1KAWA 4PV1C 3U4ZA 3R93A 1D2BA 1U4PA 4ABNA 2V7UA 1O7IA 2UUCQ 3E0EA 2GJKA 2WIIB 1STNA 3HOVH 1SKQA 1RKNA 2VJJA 2MUYA 2ZZGA 4L6TB 2F43A 1BQQT 3U4VA 2VUMH 1Q81C 3J81i 4A3GB 1KQSA 1JJ2B 3AVXA 4R1JA 5EGTA 1BOSA 4FYDA 2N8NA 4GKKQ 1X3FA 1HFGA 5M3MH 4CBVA 1PYWD 2CQAA 2A5HA 3OTOL 4PC3A 1L1OB 4C3JB 3LNNA 2E75C 3LWEA 1S4ZA 4NKLA 1QCBD 2G9DA 1CUKA 5IGDA 3UDIA 1WSRA 3MVVA 1RQRA 3PCOB 1JA1A 3J80c 3CMAA 4B3TQ 4BBSB 3CW2C 4NDXA 1EWHA 4QVJA 3L0OA 1UD4A 4IUVA 2ATWA 2PLFA 1KDCA 1L2FA 3KF8B 4C1NI 1YLOA 3MHPA 4ZUJA 4HSPA 4YWMA 1UMKA 1KXLA 2E2JH 1Y1VG 1SYBA 2CVRA 3L3OC 4PMWA 4DN4M 3C1FA 5ELCA 1ZM3A 4ME5A 3G71B 3R8BA 4DAPA 5FLMH 5EPJA 3CRZA 2PI2A 2EPBA 2DNEA 1VQIA 4DV7L 1G7CA 2QEXA 3MCAA 4A3DG 2NVXB 4IJLA 3CQZH 2F0KA 4TN1A 5I4DA 3GTLH 2JJQA 4LFAL 2YTXA 4AYBE 3WNDA 2EYJA 4I7ZC 4X3SA 3CXCA 2GK6A 2OBTA 1WVLA 3S14H 4CDEC 1PZJD 1EP1B 4LFBL 1BCPF 1H9SA 3IKJA 4XLEA 4A75A 2ZL6A 4C43A 2VQEQ 3VO2A 4DV4Q 2OYNA 1DOMA 1D5MC 3GTKB 2EYPA 1LUZA 1ZKOA 4JI3Q 3CF5A 5KSWB 2CH4A 1LT5D 1STAA 2B2UC 3L2PA 4CQJA 1E1QA 4QFMA 4FK8A 2ZXPA 1LTSD 2R7FA 4ZLTF 1BUVT 2E2DC 1IL2A 1N9WA 2IJ0A 3I4LA 1O7ZA 4GZYC 4WFN3 1E43A 4EVOA 5IYPA 5BN5A 2XRSD 5ELNA 2PW7A 1U0LA 2ZZEA 1W0JA 5GROA 3SHLA 1VQPB 3TEHB 5IYWA 3OZUA 5C4HA 1VQ7A 1TR5A 5EPKA 4PABA 1BBUA 4OO1I 4X7FA 3TRZA 1MIUA 3NBIA 2E1BA 4KKUA 1C4QA 5T1IA 2D9UA 3Q24A 3HKSA 1QGZA 3M9BA 2JIZA 1UE7A 5AFWA 5EKLA 4A3BH 3SGIA 3OTOQ 1YJWB 3DXJC 4LW1A 1QVFB 3SEBA 1G6PA 3RY8A 2L0CA 1KC8C 2D74A 1TWHB 3D6CA 2PNRC 1QILA 3S9WA 2QA4B 5M3FG 5KRUA 1Y0RA 3WQZA 2A6HD 1G291 5I6YA 1F60A 4F87A 5FO0A 2K5QA 4YCUA 4KMUC 3PUMA 2ZXHA 3C3LA 1W34A 1SYDA 3D4WA 3BY2A 4X65L 2WINB 1PTOC 1W35A 3QSYA 4DR7L 3ITPA 3K0YA 4R71A 4O1NA 4DPGA 4JC0A 4YHBA 4DV7Q 4NBSA 1RJTA 2RCNA 1H85A 2RF4A 3I56A 2B8FA 1I4QA 3BS1A 1TWAH 4XD7A 1B70B 2IL8A 2RDGA 3NTHA 3RNUA 1EQTA 1UUPA 4LFAQ 4OPVA 4QUFA 2MO1A 3PA1A 2EOTA 4QB4A 1VQCA 1BQEA 1B44D 1HTLD 4LFBQ 1KC8D 1CFMA 3Q3AA 5C4JH 4DUZL 3HOYH 2DJGC 3HZXA 2JK8A 4A3EB 1YI2A 2X85A 1T6YA 5CV4A 1WP6A 1LT6D 1L0XB 2YV5A 3BVMA 5EJWA 4B3ML 1XXGA 2X6XA 3LX0A 3S1NB 4YAWA 1YX2A 1TXYA 3OWFA 1QGYA 1FYCA 5IP7G 2N78A 1OB2A 3PMFA 1F9RA 3EN2A 3KLSX 2GN5A 1VQ8B 3I4OA 1CA5A 1PTOD 4XDXA 1K9MC 4JI0Q 3EJIA 2R7ZG 2A74C 3I4MG 1PZID 4FN5A 1BKBA 2BOSA 4OO1H 1MRZA 2CF4A 1SXTA 1GKHA 4EQOA 1PJ7A 3S1RH 1B53A 3MWYW 1LTAD 1CM9A 3WBKA 2RSNA 1JWMD 3PSIA 2RSOA 2XOKA 2IHEA 4CKCA 1WOPA 2ICIA 4ZGQB 2JA6B 3S17H 4RFBA 5D3DA 4GNXA 4OWTB 4DR3L 1I6HH 1BLIA 2EY5A 4RHSA 3GTMH 1KRSA 3MZ5A 1JA0A 5IYRA 1QVGB 5KNDA 2ZBVA 1YIJB 1TLLA 3BCFA 4DNTB 3STBD 2ZTDA 3B8HA 2JEBI 5CV7A 4LUZA 5C3WA 1TVXA 2CK3A 2ZL7A 1DCZA 1GHKA 1PXUA 2K5WA 4BS9A 1K9MD 2VYQA 4G5GA 4M53A 1VQ4A 1T5XD 1Z9FA 1M90D 2K5VA 1DM0B 2N49A 2NTSA 1SYGA 1Y1WH 4X65Q 3CCSB 4A3LG 5DM63 4DR6L 4XTCS 4LBYA 2RHQB 3PUWA 1S4MA 1DOKA 4UP8A 2ZJRA 1VQ9B 3I55A 4DR7Q 4JI6L 1I50B 2PQAA 3H91A 4MIUA 4ID6A 4LF9L 3OIQA 5DSZA 4YEJA 4N8FA 3SKBA 3NHHA 1TWCH 4RH6A 1AZPA 1QUQB 4YAUA 1C0AA 2QE7A 4Z4WA 1SYEA 1TWFB 2WB1G 1SNOA 2EYMA 1X3PA 3KK7A 2HLDA 4AVZA 2R61A 5IYQA 3T56B 4ZV4A 1NMFA 2GK7A 1VQLB 3CB4A 3OJWA 1ZYRD 5KYIA 4DXGA 1WTOA 2F3WA 4HIOA 3S16B 1PTOF 4DUZQ 1HPCA 4WJWA 4EX5A 3VR2A 4I65A 3HOWB 1SMYD 1L0WA 2F03A 2I1LA 2F0GA 2MFIA 3OIPA 1VS0A 2NZOA 3ASSA 3ZBUA 1LACA 3MA2B 4HEDA 4KLKA 1SNMA 3ZZUA 1KDBA 2XZPA 2H1EA 4C3IB 3R2TA 1W87A 3ZPNA 1HZEA 3CCRB 1I3QH 1VQ6A 4MNOA 3IFTA 5CV9A 1JB7A 1FNCA 1EEFD 4XKWA 3QG1A 3CMEB 5FNZA 3H15A 2EY1A 4P6VF 4FF1A 2K4KA 2SNSA 4MTKA 1CA6A 2LS01 3AFQA 2PQEA 1VQKB 3OW7A 1UEAB 4RWSC 4P72A 4FF2A 5L37A 4P3IA 1I7PA 3AVVA 4DR3Q 2HT1A 3GTQB 2Q6LA 1E2VA 4QGUA 1S5BD 3TS2A 4A3DH 3BDLA 2QDBA 4OGQC 3E9IA 5C4XB 4EQNA 4IUUA 3P20A 3W2GA 2AMCB 1H42A 3KF6B 3G4SB 2M00A 4RD0A 2I5LX 1NBMA 2DYIA 1WORA 1N32L 1QH0A 4KY6A 1IHMA 2C4TA 2UXCL 1UE6A 2NV4A 4DU9A 3FPPA 3K7AB 4TMZA 3FHWA 2QCPX 5IT9c 1PLFA 4GOPA 1H8EA 4DR6Q 4PMCA 1T5EA 1OB0A 1BNZA 1AFPA 1E64A 4JV5L 1V1QA 4JI6Q 1CHPD 1RTOA 2GA4B 1GAQA 4LF9Q 1YITA 3HOVG 4L5SA 2WFWA 2OBSA 3KYHC 3NWSA 4G1BA 4JI5L 2DERA 5NUCA 3EBEA 3KJOA 1FX0A 3VYUA 3PA2A 1JQYD 2OTJA 3I7FA 2GQFA 3E3XA 2KCTA 3BZCA 1PZKD 3NELA 5JJKA 3PIOA 2B63B 3W2DA 5M3MG 3H3VC 2ZXOA 3NPPA 1UE5A 2VL6A 2JP1A 3JU4A 2MP1A 2X6GA 5JPNC 4X66L 3GTPB 4H0LC 1LT3D 1NE3A 1C8CA 1MJCA 1Y14B 5DS0A 2AQ2B 5THXA 1IB0A 4N3GA 2R9VA 1PYBA 1CKNB 3AEVA 4FXKC 4NXNL 3NSWA 3HGBA 4BY7B 1WTXA 1BBXC 2JA7B 2JQOA 1GUGA 1F2MA 1YNJC 1B3QA 3OJXA 1ZM9A 2K7VA 3OSOA 1EEID 1TS2A 1PH8A 3ND9A 3A8JE 3UE0A 1U9RA 1PFMA 2BDOA 4DGZA 1S5DD 3MTSA 4R4IA 1HA5A 5AJ3L 4A3IG 4KJOA 4OIKA 1QVFA 1TTTA 3NTIA 3HS0C 4QF4A 1I18A 4K2LA 2EIXA 4HIKA 3PIP3 3V76A 2PW5A 1U4RA 3QFSA 3CCJA 4B4DA 4LMQD 4G6IA 2XZOA 4L5QA 1Y8PB 4EGVA 4PC6A 2NUCA 4N8X1 1GO2A 4FWTA 3HOXG 1YJ9A 2K6AA 2R92G 3PO3B 3CTAA 4IURA 4FVMA 2VXWA 1U4LA 3W2HA 3T51B 2VQFL 1BR9A 3UDXA 1Z6HA 1S72A 1KIXA 4ZAIA 3ND8A 3KEWA 4B9WA 2Q6KA 3Q39A 5JPMC 4A3FG 2UXCQ 2VUMB 1F9SA 2FINB 2XTIA 2JN4A 1VQOA 3QB3A 4PZ6A 2BSAA 3K5MA 3S2DH 2HMAA 1HA6A 2MHVA 4TMWA 2KVOA 2I5MX 1JJGA 4QJFA 2Y0SE 4A3JG 4JV5Q 4XLFA 3LGJA 1FVIA 3J81L 1RD9D 3PF4A 2X6WA 3PQIA 1QOHA 2K1BA 4Z4VA 2R7ZH 1EFCA 4LF7L 3GP7A 1KLUD 3I4MH 3U6BA 1YHQA 4JI5Q 3HEJA 3DWQA 3AMUA 5C5MA 1D2EA 2K32A 2LXKA 1GJXA 4HTHA 5FK9C 1JE5A 1HQRD 1A62A 3OHXC 4K0KL 2E76C 4AYBG 1VQNA 1STEA 4YY3L 1R4PB 1KK3A 4IPHA 2JE6I 5KGUA 2V7TA 5A2QL 2JA5G 2WSSA 4X66Q 4G7ZC 1JORA 4CKBA 1TUIA 4GN3B 4APVA 3FVQA 4KV6A 1TS5A 3W5OA 3CC4B 5I2YA 4IFDG 3CQZB 2K14A 4C56C 1EP2B 3CD6A 3GTLB 2Q2HA 1E3XA 5DEHA 1ICFB 4P71A 2J4XA 2NZ1D 3AYHB 5JBQA 2V7VA 3M4PA 3B82A 3A55A 5D14A 4WZLA 5H5JA 2A73B 1E3PA 1FJGL 3HOUG 5KYLA 5AJ3Q 1E24A 1ONLA 4UZEA 2V4DA 1OB5A 3A8KE 2BM1A 1M1KD 4A3KH 1PH2A 2WAQE 3V7AA 1DGSA 1HVXA 1OO9B 1X65A 4N3NA 1FNWA 1BCPB 1LT4D 2PZTA 3BVGA 2WYRA 3NXWA 1NR4A 1ZXTA 3GDEA 4YWKA 1DONA 2QDXA 3GVLA 4IOCA 1SROA 1I94L 3HOYG 3A74A 5E4WC 5IYCG 2EQSA 3CCSA 3WNCA 1M4VA 2F4VL 1WJJA 2QGQA 3AU7A 3MC0B 4PGOA 2VQFQ 1QWYA 3ERSX 3L7ZC 3H6MA 3HG9A 1EWCA 1NSNS 4B48A 2EIFA 1MGSA 4B3SL 2QKIC 4GLAC 4XQNA 1BXTA 1N06A 2PNHA 1G2TA 1PFBA 3H0GG 1TIID 2V7XA 3CPWA 2D5DA 1PFNA 1MSHA 2F0TA 3BJUA 3KDFA 3K58A 4WZTA 1IKLA 1SFOH 1X55A 1A2TA 4JYAQ 4KTAA 4A3BB 1ASZA 3TS0A 1MD2D 2RVLA 1N36L 4YAFA 1E62A 4LF7Q 4B3FX 3P75A 1GR1A 4O2DA 5B6IA 1CQVA 1ELOA 2IX3A 4DV5L 2F0FA 2A8VA 1ZM4A 4P3YA 1EY4A 2BVNA 4RD4A 2C35B 1BBWA 3GV3A 2D0PA 5KNCA 1Q46A 2YWGA 5CV5A 1J5EL 2F0MA 3M4OH 1X54A 4K0KQ 1G7SA 2RDHA 3G6EB 4J8QA 4PC1A 4WORA 4YY3Q 1EFWA 2QW7A 1ET9A 2PMDA 3QJYA 1HZBA 4RKLA 4L5TA 1UD8A 2F0SA 1PRTD 4RD6A 4ACAA 2EJGC 4UDUC 1MBYA 1SNDA 2CRVA 2GVBA 4H9GA 1RCVD 2O2LD 4RPBA 1GAWA 4RHRA 5FOBB 3VR5A 1SE8A 1KNEA 2PIAA 1OGJA 3Q6RA 3SXHA 1Y1WG 1W2BA 3A3GA 3CP2A 5J3BA 4OPOA 3TREA 4WZEA 1JICA 3HKZB 3BQJA 1SMXA 1C9OA 1MHWC 2Q2IA 3I8ZA 4DAYA 4AF6A 2B2VA 1SJED 5HXBA 2M2LA 2A6EC 4WJ3M 2F3IA 1RDPD 5C0XJ 3VDYA 4UAIA 2AUKA 4TMTA 3IFDA 2OTLA 5G3LF 3GIRA 3CCLB 4AH6A 3WDNA 3ASRA 4GNXC 4GLXA 2KUMA 3D31A 3RZOH 1X6OA 4HN7A 2ZZQA 2E2HH 3CCUB 3J7AV 1K3RA 1STBA 5DAUA 1A0IA 1XX8A 2QF7A 1I94Q 5KEEA 4GS3A 4JI8L 3S1RB 2BF4A 2HCIA 2F4VQ 4LBWA 2PMZB 2YWHA 4M1KA 1SDFA 3GO5A 1Y0YA 1LTTD 4UP9A 5GAEC 3WYAA 4CHTB 4B3SQ 2IY5B 3A8KA 2BA1A 2JN9A 3CPFA 3R6KA 1EYAA 2F0HA 4V190 3ASQA 1AE2A 1G51A 1IBKL 3S1MH 4RPDA 1SRUA 2F0PA 3QFRA 5C3EB 2FMCA 3ONUA 1EYDA 2P5ZX 2JJ1A 2V7QA 4KJNA 4YXWA 1VF5C 4LBVA 3CC7B 2A6ED 5JJIA 3ZJYC 1P8LA 2OQ0A 3I91A 3F2DA 1N36Q 4TMXA 4DFAA 1N0VC 4P22A 3W1GA 1YJNA 2OK8A 3H9NA 1EWIA 2A69D 4QQBX 2GPJA 3TDQA 4U68A 4IFDI 4DV5Q 1VLYA 3BVZA 2KCNA 1BX0A 4J15A 2NVTH 3PIPA 2RKSA 3ER0A 3ZZ0A 1J5EQ 4A3IH 3H94A 4E6IA 2KJXA 4P1VA 3ISXA 1TS4A 1UAPA 3O13A 1EY6A 2VNIA 1GVHA 4EH1A 3IRBA 4C3HG 4U673 1HRJA 2K01A 2UUAL 2LFNA 2V7WA 4PZ8A 4CDFC 2I0QA 3A56A 5LL6S 3ZZTA 2F0EA 1R5NA 4Z4TA 4IW3B 1W9XA 3I70A 3HOXH 1RHPA 1GHJA 2R92H 3B6YA 3RZDH 1Q7YC 3NUCA 3W5VA 2GVAA 1WOOA 2DETA 2KQ3A 3UDFA 2VZAA 1X3EA 2AWOA 3VR3A 1VQ5A 2A19A 3PO2H 2XIWA 1QFJA 4A3FH 1A63A 3K0XA 3SK6A 3K81C 1T6XA 5JAVA 2A6HC 4RAUC 2E1RA 4C2MH 3SK4A 4OX9L 3TP7A 3QFCA 5I9PA 4AQYL 1FR3A 3CC2B 3QO2A 1E63A 5CMDA 1PA6A 4A3JH 4OWXB 4J6HA 3K6OA 1PTOB 1K8AC 4RD2A 1QUFA 1SN8A 1OHHA 2NVYH 1JWSD 3DEOA 5C4ZA 3KLRA 3G48A 3JAMc 1F77A 1I3QB 4II2A 3QR8A 2YWFA 2L12A 4X06A 1HUNA 1Q86C 5H59A 4JI8Q 2NWGA 5J22A 1A15A 1W6JA 2CQOA 2WJVA 1FNBA 2O4XA 3F1ZA 1VLOA 3FEWX 4IUQA 3PIO3 3BCDA 4DR5L 1JE4A 1HTPA 5IE8A 1Q7YD 4YHHL 1Y1VB 3ICEA 4LAAA 2D3LA 4IPGA 2JA5H 2Z9HA 3OW2B 4Z9CB 3A5ZB 1CHQD 1LYLA 2ENBA 4LJZC 1F9QA 4F7DA 3CCVB 3NBHB 1D6EC 2ZZFA 5HKKA 4CKEA 4A3DB 4IFDH 2J7ZA 4ZK9B 1R5OA 3HKZE 4RD3A 1LLRD 3R2IA 1XFOA 3AVWA 4P9SA 4KI0A 3AVYA 1AZQA 2JA8G 3D26A 1E7ZA 2PO4A 2E5LL 2AHOB 1K8AD 4X07A 1XQBA 4MHEA 3T4AC 4RGMA 2N55A 3KJPA 1K28A 3E5SA 4K8JA 5M5YH 3CCMB 1QZGA 3OEEA 4FF4A 3U58A 1NRKA 3HOUH 1VMPA 2MO0A 4JPBW 1I5FA 4BBRB 1Q86D 1WTHA 2B2WC 2CNDA 4IO9A 3CCQA 4ZUIA 5KNBA 4XONA 4R4TA 1K73D 1TVCA 1FNDA 3SK5A 2W6IA 2UUAQ 2FFKB 4B47A 3CCEB 2XRQD 5IP9H 1PKVA 4JBMA 4IPDA 5JEAJ 1QFYA 4P26A 4A93G 1HZAA 1HZ9A 1QZHA 1ZEQX 1R9TB 5IYCH 5IK2A 2F0VA 3D0FA 2KENA 1XPUA 1HHVA 4X64L 1ICWA 3OZVA 4X3UA 3DWPA 3STBC 3QIAA 2QGGA 2XWJB 2VBTA 4YELA 5M5WH 1N07A 3R6JA 4H02A 5TR9A 3H0GH 1VJSA 3T53B 5KNLA 2D62A 3NK9A 4OX9Q 1YNXA 4AQYQ 1A6XA 1M90C 1DJRD 2HUGA 2R3ZA 4H44C 3GTOH 2RC5A 2WACA 1CSPA 4M8AA 2XGTA 1SNCA 1XTDA 1G2SA 1VQHA 4JI1L 4B3GA 4XXEA 3VYTA 4BY1G 1NDHA 3GSIA 5M3FB 1BX1A 3BZDB 3NWTA 1EFRA 1P4MA 2OCEA 2TMPA 2VJIA 4TVAB 1I4HA 3JAML 1FJGQ 4G57A 4DR5Q 3MMPA 3E6ZX 5FIUA 4YHHQ 1Y8OB 4K5VA 1ZYRC 2MNAA 4B08A 4M4SA 5CR3A 1ESFA 3BDOA 2CFMA 4RJLA 4OXPA 3J80E 2BN4A 1SMYC 2LKVA 1K8OA 5EQ0A 1IYJB 3PUYA 1VQFA 2M9VA 1KK1A 5HGTA 3CRLC 1CSQA 1S5FD 4O42A 3J7ZC 3RLFA 2JXMB 4ZKBB 2DIEA 1B7YB 1EXMA 2Y0SG 4IALA 4IJHA 2Q2TA 2L9HA 1VQMA 1XMOL 2E5LQ 5C3XA 1EU3A 3Q8DA 4POFA 2C78A 5KW9A 1V1PB 3SDZA 1S40A 4BPRA 1GUOA 4A3KG 2MJ8A 3TMEA 1UD2A 3F8TA 1N34L 3WOEA 3PVDA 3BC9A 3IL8A 4G4KA 1JB3A 1FNVA 1QNUA 1EY7A 5ELOA 3ASPA 1G8ZD 3ZBTA 3BG3A 2C4UA 1STGA 2ZTGA 1U2RA 4UP7A 1PH9A 1H9RA 1RL2A 1KRHA 3MXNA 4O0AA 2NVXH 1MKHA 2R7ZB 1D5ZC 4N9PA 3KBGA 3I4MB 5C4XG 1E1OA 2CC2A 1WDTA 1EU4A 3CW2A 1E2WA 1J9OA 4B3MQ 1IHZA 4TKOB 2BDNA 3H09A 4X64Q 5E4XA 4HMJA 5IIFA 1F2LA 3GTJB 2OF1A 4P74A 1LABA 2AWNA 1EQVA 3U50C 4HJ7A 1QB5D 2F0OA 3W5UA 2KA7A 3GTKH 4GKJL 5E6TA 4OIJA 3NQTA 4KK7A 1TY0A 1IYUA 1YNNC 1EOVA 4L63B 5HY6A 1JJ2A 3KOJA 2R93G 2ZITA 1PYSB 3RUZA 5IYNA 2E2IB 2H5XA 4L5RC 2F0QA 4XL9A 4IUNA 2JA7G 3SLDA 2FX3A 1EIGA 1L1OA 2WAQG 2YU9B 4XN3A 3G05A 1GUSA 4A3MB 5FLXc 1BJKA 2FJ2A 1IW7D 3EQLC 3HRZC 3TBIB 4OELB 1HQMC 1STYA 4RKBA 1FD7D 5CGKA 2I46A 4E0FA 2O5JC 4LBZA 2D9RA 4DV1L 1OGIA 2B63G 4FNFA 1K83H 2B2UA 3GTGB 5CYUA 1STHA 3KF8A 2DUDA 1SAPA 4JVZA 3PUNA 2B2TA 4C3HH 4HJ9A 2O5IC 3OEHA 1V5VA 3TQYA 3V2TA 2CWAA 1NMGA 4IZ8A 4TRDA 1SNQA 5CBEE 4X3TA 5IGGA 1PDQA 3G71A 4BY7G 2WB1B 2WKCA 4RLZA 1Q8IA 1EY8A 1SE3A 2HHHL 4HIMA 1YNND 1CNFA 4LF8L 2IX0A 3WNBA 3J80i 2WPDA 1H9JA 1FGUA 1X3QA 4WWVA 3J81c 1XMOQ 1Q90A 1G91A 2NN6G 4DV2L 2Z6BA 2UXDL 3D6WA 2UXBL 4S3SA 1Q1EA 1N34Q 4TQUS 1F9PA 1G6ZA 4OWWB 1MI2A 4YAOA 2A1AA 3CKIB 4HAEA 4J1MA 2MQHA 1A3TA 2HQEA 5EMNA 2HDLA 3J7YW 4Q7JB 4IPCA 3UI2A 4JK1C 4ZYSA 1SFOB 1UD6A 1Q3LA 1ET6A 2KECA 2GJRA 1B3AA 2KHSA 4OOVA 5IGFA 1TWGH 1A8VA 1JC7A 3S1QH 1KQSB 1XNQL 2LZJA 1A3UA 2ZL5A 4XKVA 1I4PA 2WV6D 4HIDA 3K5LA 2B8GA 3C2PA 2VBVA 1E1RA 2BGIA 1D7QA 4K5WA 3QOJA 4DF7A 3VA7A 2QTLA 1V9PA 1VQPA 1IJFA 5TSSA 2VS1A 2K5HA 4P2NA 2XWBB 3CESA 1CTMA 1S5CD 4ZKCB 3CMAB 1WD0A 4GKJQ 1JOQA 4HR7B 2EDGA 4RGTA 3ZYYX 3S1NH 1VQAA 4F8MA 3K7UC 2DGYA 2Z1CA 5E1FA 1B8AA 2NYZD 3EFXD 3HOZG 1OXTA 4IOAA 4R4OA 4PC2A 2FVGA 2JA8H 4RDKA 3TP5A 1YJWA 3M3YH 3EIVA 2VNJA 3ULJA 1V43A 1X56A 2F4IA 5H1SE 2NPFA 3HFZB 2QEXB 4PQXA 4Y9UA 2QA4A 2F0UA 1D1KA 1QUEA 4DV1Q 2XNJA 4PMBA 5FLXL 3M4QA 3CXCB 2CCZA 2VBUA 1SJHD 4TSSA 5HGQA 5GV7A 4NPSA 3Q23A 5IODA 5ELBA 4Y7NH 3DM3A 1IBML 2B3GA 1H9SB 2A68D 2EFGA 4FXGC 3OYYA 1WYDA 4X8IA 5COYA 1N32Q 2CWPA 3CAMA 3HOVB 1GOZA 4A93H 2OK7A 3PO2G 2XSCA 2HHHQ 2SDFA 1DARA 4LF8Q 2VB3X 1ESRA 4OL7A 3B78A 4OHJA 1JB9A 3KUPA 1XB2A 2C5HA 1DOLA 3KLSA 4CDDC 5KIXA 5M3MB 4YALA 2UXDQ 3VA5A 5F4OA 2UXBQ 2WJYA 4XNFA 3UDGA 3ZUGA 3TSSA 3FKIG 1RIPA 1XNRL 3M7NA 4X6AH 2PCFB 1XJVA 4KHPL 3S15H 3CMMA 1JOKA 3I4NG 1MJEA 1VQ7B 1DD2A 3I1FA 3U2QA 4RG1A 1WCMG 2GJPA 2I07B 3N6RA 1JCKB 1EYCA 1KD1D 1M1KC 4X0CA 1FNMA 1XNQQ 4R8IA 4BY1H 1C7YA 3TZDA 4PAAA 2E2JB 1VQ8A 1GUWA 4XLCA 3SVMA 1FL0A 1FRNA 4DQKA 1Y69U 1HR0L 4HMIA 5DLQE 2NVTB 3PUXA 4NB3A 5I6WA 3EROA 4A3IB 2F0NA 1D8LA 2X69A 2HDNB 4NXNQ 3C2QA 4XN0A 4RM0A 1EOTA 3DEPA 5IYBG 3CP8A 2F1LA 1PRTB 1VF7A 3A8IE 5K36G 4Z4YA 2Z4IA 2L15A 3CU7A 4GLVB 4JBWA 1VMCA 2X3UA 1IYVA 3S14B 1EZ8A 1LV9A 2LXJA 1Z47A 2IT1A 3HOXB 3K5NA 4DK6C 1E3ZA 4HJ5A 1KTKA 4H13C 4ZRZA 1G7TA 3U9OA 1QVGA 1YIJA 2C5BA 4QMGA 2DY8A 1F20A 3FDTA 4A3FB 3I56B 1EL0A 2XNDA 5IP9G 2DEUA 4ILWA 4KN4C 5C0XG 4TMVA 5A88A 1PFSA 1D1IA 2OBRA 2WKDA 2K5NA 1SNPA 1AEXA 2K04A 2Z6KA 2NN6I 1PMRA 2L5TA 5E7NA 1IBMQ 3V96A 5C44G 3A8JA 1B1ZA 4DV3L 2ZXIA 1YI2B 5LMNL 4ZCLA 1PH1A 2YTYA 5DM73 1VQ9A 1PRTC 4UPAA 5C4XH 2DCUA 4QV2A 5GAHC 2BGJA 1QUQA 5IWAL 3SJZA 5IT9E 1NTGA 2RBMA 2Q2UA 2DY1A 1E79A 3HKZG 4PG3A 2RQXA 1CQFA 2CBXA 1SM4A 2XGJA 1VQLA 2ES2A 2VNUD 5BN4A 1KK2A 1Q12A 2IW3A 1H8HA 4KY7A 1NJIC 2JA5B 3F2UA 3LQ6A 4DQLA 1VQDA 1XNRQ 4YWLA 4KHPQ 1GXDC 1SYFA 4X7CA 2R93H 1QNKA 3K8AA 1K3BC 5A2QE 1HH2P 1TQOA 2XVSA 2KBNA 1VQGA 1KRTA 4RCOA 3BU2A 2CW5A 4GNXB 2JA7H 1TT2A 3BDCA 3QFTA 5LMZA 3A54A 1L0YB 2RA4A 4A3GG 2BV3A 4FF3A 4JMQA 3CCRA 1HNZL 3AB9A 4XT3B 2YTVA 1HXYD 2KOLA 1HR0Q 3VNUA 3J81k 2QMUA 2KHJA 1QG0A 5M9OA 3HOUB 2B63H 1ILPA 1VQBA 3PV0A 2J0TD 3CMEA 2PZUA 4C3JG 1TWAB 1LTBD 3OZWA 5J3OA 1M8AA 4M1UB 4FXUA 1VQKA 5BSXA 5FKAC 2EY6A 3BY1A 3MAQA 1VQ4B 4JOIA 1K28D 4B43A 4DR1L 1NJID 4OPSA 3GVKA 1XWEA 5TY0A 4BY7H 4BBSG 5C4JB 3LQEA 3HOYB 2L55A 4ACBA 1WTHD 3E0JA 4R9WA 2EZVA 3E9HA 1DDGA 4C1NK 2PQAB 2X6YA 3M85A 4Z1MA 3KF6A 1NB0A 2NN6H 3G4SA 3OKXA 3JQRA 1O78A 5M5WB 2A69C 1JOOA 5C5LA 4POGA 3QE2A 4WZKA 2K75A 1VQJA 1UD5A 3H0GB 1PH5A 3BYTB 2PE3A 3A8IA 3ULLA 5FL7A 3K5OA 1H9MA 1I6VC 4JCVE 1EQQA 1ZUNB 3QWNA 5EKIA 1WTRA 4DV3Q 1YHAA 5LMNQ 1GM5A 3NE5B 4A3CG 3W2EA 1B4OA 3CRKC 1AW7A 3AVTA 1EY5A 1HA3A 3ERQA 3TP8A 3PO3H 3SE0A 1VHOA 1VQEA 2DY7A 1O80A 3ONAB 5JVG3 3K80C 3S17B 3ZC3A 5IWAQ 2X0KA 3JQPA 3MFYA 1I6HB 4B3XA 1FNUA 3LWUA 4DXFA 3MXPA 1PHJA 2CKZB 1WTQA 3Q6QA 3GTMB 3OWEB 1ASYA 1HCZA 1VQ6B 1Z7TA 2L4NA 3SEJA 1LTRD 1GO3E 1W0KA 4L8JA 1DXMA 1NB9A 2BM0A 3VMFA 1PRTF 5T1GA 1C48A 2EY2A 2X8KA 2HQLA 3SJPA 3FKSA 3TP6A 3HOZH 2Z0SA 1CKNA 1ML0D 4EQPA 2D0OA 3ONYA 2K50A 4CGYB 3S2HH 1Y1WB 5I9OA 3ES9A 3WY9A 4UZUA 2E74C 2W6JA 4Y9RA 2CW0C 3NQIA 2SNMA 4GN4B 1HNZQ 1K8MA 3E1YE 3T1YL 3HP3A 2WR8A 1KDAA 1AE3A 2EXZA 5IOCA 2HCCA 1NUCA 5GV8A 3P1HA 1N8RC 1D8TA 1X9NA 3PUZA 5EBCA 2NBFA 1TWCB 5LHY1 1EIFA 3KL9A 1SE2A 4RGOS 4LF5L 4G1VA 4HE5A 3CHBD 4KY5A 2ALYB 4FO2A 1Q81D 2LY7A 5C0XI 2HCJB 5CBAE 3Q0AA 1WSVA 5JEAG 4DKAC 4DR1Q 1N33L 2XNCA 2ASBA 4RDJA 4G7WA 4ULLA 4GOPB 3NTKA 4LF4L 4DA2A 4M0LA 4UAJA 2IPKD 1LO5D 4NXML 1L1OC 2BCOA 1EFUA 1Q9SA 3VNVA 5BSYA 3FMCA 2VNKA 1YITB 2L1BA 3DHQA 1PV4A 3ULPA 2F0LA 4BBRG 3FKIH 1H9KA 3A0JA 2OTJB 2CW0D 4GN5A 1D1NA 2X53S 1Q82C 3I4NH 4R4QA 1E1TA 1OXVA 1RF2D 1N8RD 1WCMH 2B2TC 4C0SA 2SOBA 4PC7A 1PH6A 1XMQL 4DR4L 1RQPA 4ZQ3A 4JI0L 1EIHA 1MSGA 5A8AA 3LVBA 1K73C 1GD7A 2QILA 5JVH3 1EIYB 3LO8A 2KHIA 3I90A 4QCLA 1OXUA 4A3EG 1EYGA 2QEJC 2FHTA 2XZLA 1WTVA 5D65A 2K5DA 3GQBA 2UU9L 5EPLA 1IBKQ 3PUVA 3OMGA 2FXQA 4GOPC 3FJOA 1K83B 4UHVA 3D8GA 2K28A 5IYBH 2EYHA 4JBJA 4KN7C 5FO1A 3P27A 4A4IA 4C3HB 4DR2L 5K36H 5AN9A 1KL9A 5ELEA 3X3MA 4OOSA 1E0BA 5M5XH 2OXPA 3G7LA 1QE6A 1GVPA 2OWOA 2RHSB 1QG7A 1A2UA 1SSOA 1Q82D 1QX4A 2XEXA 3CC4A 3SK8A 2WZPP 1S0UA 3PGZA 3CCJB 1QVCA 5JOBA 2JA6G 1DDIA 4JG2A 1O7YA 4JI2L 4XR6A 1FDRA 3OE7A 3BYYB 2QDLA 2BH8A 3T1YQ 1N08A 4YIJA 1YJ9B 4II3A 3FP9A 5C0XH 3J80L 2ZT9C 3DMUA 2PMZE 1N05A 4DV6L 3MFGA 5FO8B 4G7OC 4UY8C 1S72B 1EUJA 4HCSA 4LF5Q 1W3SA 5C44H 1SR3A 2D3NA 2Z4HA 1PH3A 4P6YA 1UD3A 1TWGB 2Z6BD 3OPOA 4JI4L 3S1QB 1N33Q 2ZBUA 1VQOB 2NVQH 1F2ZA 1YBYA 5FO9B 5IGCA 3DUZA 1AMOA 4XM3A 3D3RA 5HURA 1CT1D 1LTGD 4LF4Q 1GUTA 4XYOA 4NXMQ 2IHFA 2KEEA 3MXUA 3AGQA 1NCVA 4OP7A 2B7CA 1SEBD 1YHQB 1CKMA 3ZIAA 1YZ6A 4LFCL 1HJPA 2DN8A 3J81j 1K0RA 4ODGA 2YWEA 2VBSA 3MEHA 5F4MA 4P2CB 2RC6A 4DR4Q 1VQNB 2B2YA 1XMQQ 1PJ6A 2J7KA 2MGSA 2VW9A 1NBWA 5TV2A 1EP3B 4RCZA 4ZGNB 2HDMA 2LMCB 2JA8B 1KK0A 2GREA 3G6JB 3DM1A 1JR0D 3M3YB 1WOSA 4A3GH 3HOWG 3N52A 2DOGA 1CK1A 5CORA 3A1PA 2UU9Q 4B3RL 3DDYA 3CD6B 1J9ZA 1CI3M 4IQZA 3OOCA 4C3JH 3S24A 2C77A 1UEBA 2EE1A 1DZ1A 2F0DA 4Y7NB 4DR2Q 4C3IG 2Z8LA 2JSOA 5C3EH 3G6EA 3J7AF 2Q8TA 3WXMA 4XQQA 4WJ4A 2C9OA 3AVUA 3M4YA 2BH2A 4FXDA 2C5CA 4QL5A 4HCEA 4K6LA 4BBSH 4A93B 1SBBB 5IGEA 1F2YA 3I73A 1ENCA 4QVAA 2XNAC 4F88A 1U5KA 5C6AA 4AC9A 3S2DB 1OTCA 1KAAA 4A3MG 4OONA 4JI2Q 2ZJPA 2Q6IA 1AP0A 4KD3A 2PYKA 4K5XA 1I4RA 5CDFA 2AQ3B 1IW7C 3BZKA 4DUYL 2UUBL 2X6LA 1KJZA 1HNWL 4NNJA 1U4MA 5ELDA 4DV6Q 5HZAA 2F0JA 2ZJQA 4K2KA 3S15B 1QFZA 4XQFA 4RMFA 4HJ8A 1BO0A 1J8IA 1PJ5A 4QUCA 1K0SA 1WTWA 1E22A 3CCLA 4A3CH 3TZUA 4JI4Q 1O7LA 4RCNA 3CPWB 4BY1B 3E20A 4PZ7A 2DJFC 3CCUA 4P12A 3NP8A 1D5XC 1PH4A 3KDFB 3W2IA 1T9HA 2H4OA 1CQXA 3SR1A 4ALPA 1NY4A 1JNYA 2OQKA 1S5ED 2VY3A 1NAPA 5DN6A 4Z4ZA 1GJRA 2EJMA 2MPMA 2TSSA 4AIMA 3JAME 5L46A 4LNQA 2EXDA 4LFCQ 4JI1Q 4X05A 4X7EA 2Z6KC 3NENA 1BPLA 2Q8RE 1PTOH 1X3GA 4V0BA 1LTLA 1IXRA 1XTCD 5K5PA 4H7BA 1B50A 2K33A 4FDBA 3CC7A 4DV0L 4J0QA 2Y0SB 4FP5D 4HIZA 2OT2A 1ZM2A 4JI7L 5J35A 1EQRA 4LK1C 4A3KB 3D4RA 4YCVA 1Q8KA 4LF6L 2WZNA 4X7DA 4HE6A 4B3RQ 1KLGD 5IYDG 1VHEA 1Y1VH 2AQ1B 5LL6X 1COWA 5IY0A 3CPXA 4MYTA 1J6QA 1V0EA 1W2BB 1W6KA 4F7XA 1TWHH 2VZLA 4XOTA 1IL8A 2ID0A 4DAYB 5JEAH 2KCCA 2R6HA 3RD4A 1VDZA 2M5SA 1B23P 2Q8IB 1EFTA 3RN5A 1SKYB 3P26A 3AGPA 4G7HC 4RD1A 3R3OA 4CJ2C 5F4JA 2OTLB 2N3SA 3OMCA 5FJ8G 1AN8A 5EKKA 4GQNA 1LTID 4BXXG 1A8PA 1DYQA 2JDIA 1I4GA 2LSSA 1T6ZA 1B2TA 1NR2A 2HD3A 4BBRH 4DUYQ 2UUBQ 1B9MA 2F52A 1HNWQ 4DAMA 4DNIA 1IKMA 3PO3G 4NCNA 2AKWB 3K59A 5CV8A 2R93B 4XLAA 4XLHA 4P25A 5J1ZA 4RGNA 1KZLA 4MZ9A 2ZTEA 4TT3A 3CC2A 4JOIC 1R4QB 2A68C 1WFQA 2FMMA 2WAQB 4NMZA 4BA1I 1E2ZA 4HJAA 2VUMG 4A3EH 1R9TH 3M4OB 4CJ0B 2HIVA 4I7AA 4QY7A 1BF4A 5J39A 2B2VC 2V31A 1PVOA 4M2LA 4Z4RA 2CHBD 1V8QA 1XE1A 1ILQA 2KVMA 5CC4A 2B2WA 2ZM6L 2XN9C 3W2FA 1OXSC 3M7GA 3P7JA 4MYUA 4R4CA 1YJNB 3BNWA 3D4DA 2K03A 3VYRA 4BWGB 5ISRA 4QIWB 4A76A 1HZCA 5DNFA 2B29A 2VB2X 3RLNA 3CP0A 3F2BA 4N9TA 2C2WA 4KKTA 3OW2A 1I4XA 5GAGC 1KTVA 2PPBC 2ZTCA 4KHZA 3JAMi 3CCVA 5JJLA 3NBHA 4DK3C 1HFNA 2EYFA 4Y7CA 2R6GA 2AUJD 4DV0Q 5M3FH 1AH9A 1KD1C 2JA6H 3F2CA 4TSFA 1S3OA 4JI7Q 1ENAA 2BA0A 3DLLA 1VCIA 4X62L 5FLMG 1QJOA 2KCMA 4LF6Q 3WWVA 2AHOA 1NNXA 2B5OA 2F0WA 1HNXL 3RZOB 4WRDA 4Z4UA 1XPOA 3OAAA 1Q1BA 2DNCA 4K14A 2E2HB 4MN3A 1BVSA 1YHBA 2NB0A 3CCMA 1AIPA 4CDCC 3C46A 3A3BA 5A35A 3X3NA 1HR0W 1VQ5B 4ZCMA 2PZWA 1B2RA 3MEFA 4K6DA 5GQOA 3CCEA 2EYOA 4DV2Q 4QHYA 2K05A 2L11A 3H3VI 4ROXA 4LC0A 1ENFA 1WPCA 1CNEA 1I8DA 2F0IA 3A5UA 3A7AB 3S1MB 4Z4SA 5D3IB 3GV6A 4XYQA 5FA6A 1YNJD 1I50H 3MXGA 3I72A 1EWYA 2CH4W 3URYA 3FPUB 1K8GA 3J7A5 1TWFH 4DAVA 4WQMA 5IP7H 4KKSA 5LMUL 4AF7A 1SLJA 2K52A 4JYAL 3MHBA 1N0UA 1CKOA 3HOZB 2EJFC 4IN3A 2RDFA 1FGBD 5IT9L 4EQ5A 3GD7A 4JW0A 3QOLA 3S16H 2F1MA 1YVCA 3S2HB 5BR8L 4LUVA 3K57A 5I2XA 1CZWA 3GVJA 3HOWH 4OEMB 4JBKA 3VR4A 4U9UA 2D2CC 4DK1A 2WB1E 2WP8J 3FPKA 5ELFA 5LMNW 1B9NA 2BPOA 1TY2A 3GTJH 2IX1A 2ZM6Q 4OOXA 3AQQA 4XIGS 3TN2A 4A3BG 4HSVA 2R92B 1TS3A 3Q38A 4C3IH 3RZDB 2JEAI 5FLXE 3V05A 2V1CC 2F3VA 4PNYA 5F2DA 3JC66 4P75A 4KHVA 4B44A 4RDLA 5FO7B 3PO2B 3UE1A 1YEZA 2E2IH 5IGBA 3CCQB 1WI5A 1IBLL 1WTPA 2F4NA 1SE4A 1KABA 4C2MB 3PF5A 2YU9H 3IAYA 4A3MH 2N88A 4Y52H 4G7XA 2QTZA 2JA9A 1BDOA 2SEBD 4LUOA 2OEOA 4R8NA 4XT1B 3T13A 1MABA 4KD4A 4NP5A 3WOFA 4X62Q 3T1HL 4A3JB 3U9SA 1HNXQ 3GTQH 4Q0FA 1V1PA 1HUMA 3FKIB 2NVYB 3GTGH 4A3LH 3T16A 4Q5VA 3AFPA 2G5DA 3I4NB 2I5HA 3H3VH 2EVBA 3J81E 1WCMB 3NEMA 1TU2B 1JMCA 2UUCL 4ZCKA 5JJZA 5TRDA 2BE5C 3RN2A 4MTNA 1TKWB 3EVQA 2R7DA 3RLOA 1RODA 1UWVA 4IUPA 4AYBB 1G7RA 3K7AH 3U6KA 3KLWA 2EYLA 1R5BA 1XPRA 1V0FA 3VO1A 4QUZA 5HZBA 5G3LD 4GKKL 3W3AA 4QIWE 2YYZA 3OP1A 1KMHA 2JJ2A 2QN6A 2PI2E 1WD1A 5BN3A 2P3MA 3L9AX 4UZFA 1OXXK 3HAGA 2ZXRA 4P73A 4RA8A 4BA2I 1EY0A 4ASUA 3A7LA 2IWHA 3SLNA 4OO1G 5M5XB 5LMUQ 1FRQA 1II3A 1Y8NB 4K8IA 3KBXA 4B3TL 1RTNA 3Q6SA 2VNHA 2RCFA 1BMFA 4DK0A 4CJ1B 2NZHA 4NW2A 5M5YB 1P16A 3JQQA 1IJEA 1X32A 3C1EA 5GADC 2JYOA 5BR8Q 4XQJA 1BCPC 3ASTA
chains in the Genus database with same CATH topology
1EFID 4X3KA 2BE5D 3VYSA 3Q22A 1EY9A 1CZGA 1UNSA 4IFDJ 3RMHA 3A35A 5C44B 2NTTA 5EBDA 3BH4A 2KEDA 2NVQB 4IUTA 3OFNA 5E3FA 4DNRB 3I3CA 1V1OA 2G9HD 1A3VA 2B2YC 3DWAA 3FRPB 2B39A 1SYCA 1XYIA 1EZ6A 1KNAA 2ICEC 4XOPA 1JWUD 4XORA 3EA6A 3VR6A 3GTOB 2ZTNA 1BCPD 4XMYA 4B9XA 5CV6A 1GUNA 4PV1C 3R93A 1D2BA 1U4PA 4ABNA 2GJKA 2WIIB 1STNA 1RKNA 2VJJA 2MUYA 2ZZGA 4L6TB 2F43A 1BQQT 4A3GB 5EGTA 1BOSA 4FYDA 1HFGA 4CBVA 1PYWD 2CQAA 2A5HA 4C3JB 3LNNA 2E75C 3LWEA 1S4ZA 4NKLA 1QCBD 2G9DA 5IGDA 3MVVA 4BBSB 4NDXA 1EWHA 1UD4A 4IUVA 1KDCA 4C1NI 4ZUJA 4HSPA 1SYBA 2CVRA 3L3OC 4PMWA 4DN4M 3C1FA 5ELCA 4ME5A 3R8BA 4DAPA 5EPJA 2EPBA 2DNEA 2NVXB 2F0KA 5I4DA 2EYJA 4I7ZC 4X3SA 2GK6A 1WVLA 1PZJD 1BCPF 1H9SA 3IKJA 4XLEA 1DOMA 1D5MC 3GTKB 2EYPA 1ZKOA 1LT5D 1STAA 2B2UC 1E1QA 2ZXPA 1LTSD 4ZLTF 1BUVT 2E2DC 2IJ0A 3I4LA 1O7ZA 4GZYC 4WFN3 1E43A 4EVOA 5BN5A 2XRSD 2PW7A 2ZZEA 1W0JA 3SHLA 5C4HA 1TR5A 5EPKA 4OO1I 3NBIA 2E1BA 4KKUA 1C4QA 5T1IA 2D9UA 3Q24A 2JIZA 5EKLA 5AFWA 3SEBA 3DXJC 2L0CA 1TWHB 3D6CA 2PNRC 1QILA 3S9WA 5KRUA 3WQZA 2A6HD 1G291 5I6YA 4F87A 2K5QA 4KMUC 2ZXHA 3C3LA 1SYDA 3D4WA 2WINB 1PTOC 3ITPA 3K0YA 4O1NA 1RJTA 2B8FA 1I4QA 3BS1A 4XD7A 2RDGA 2IL8A 3NTHA 1EQTA 1UUPA 4QUFA 2EOTA 4QB4A 1B44D 1HTLD 1CFMA 3HZXA 4A3EB 2X85A 5CV4A 1WP6A 1LT6D 1L0XB 3BVMA 5EJWA 1XXGA 2X6XA 3LX0A 3S1NB 3OWFA 1FYCA 3PMFA 1F9RA 3KLSX 1CA5A 1PTOD 4XDXA 3EJIA 2A74C 1PZID 2BOSA 4OO1H 1SXTA 4EQOA 1B53A 3MWYW 1LTAD 1CM9A 2RSNA 1JWMD 2RSOA 2XOKA 4CKCA 2ICIA 2JA6B 4RFBA 5D3DA 1BLIA 2EY5A 4RHSA 3MZ5A 5KNDA 3BCFA 4DNTB 2JEBI 5CV7A 5C3WA 1TVXA 2CK3A 1GHKA 1DCZA 1PXUA 2K5WA 4BS9A 1T5XD 1DM0B 2NTSA 1SYGA 5DM63 4XTCS 3PUWA 1DOKA 1I50B 3H91A 4MIUA 4ID6A 3OIQA 4YEJA 4RH6A 1AZPA 3NHHA 2QE7A 1SYEA 1TWFB 1SNOA 2EYMA 1X3PA 3KK7A 2HLDA 4AVZA 2R61A 3T56B 2GK7A 1ZYRD 5KYIA 4DXGA 1WTOA 2F3WA 3S16B 1PTOF 1HPCA 4WJWA 3VR2A 4I65A 3HOWB 1SMYD 2F03A 2F0GA 3OIPA 1LACA 3MA2B 4HEDA 1SNMA 1KDBA 2XZPA 2H1EA 4C3IB 3R2TA 3ZPNA 1HZEA 3IFTA 5CV9A 1EEFD 4XKWA 3QG1A 2EY1A 4FF1A 2SNSA 1CA6A 2LS01 2PQEA 3OW7A 1UEAB 4RWSC 4FF2A 3GTQB 1E2VA 1S5BD 3BDLA 2QDBA 4OGQC 5C4XB 4EQNA 4IUUA 3P20A 2M00A 1NBMA 4KY6A 4DU9A 3FPPA 3K7AB 2QCPX 1PLFA 1H8EA 4PMCA 1T5EA 1OB0A 1BNZA 1AFPA 1CHPD 1RTOA 2GA4B 3NWSA 5NUCA 1FX0A 3VYUA 1JQYD 1PZKD 2B63B 3W2DA 3H3VC 2ZXOA 3NPPA 2JP1A 3JU4A 2MP1A 2X6GA 5JPNC 3GTPB 4H0LC 1LT3D 1C8CA 2AQ2B 2R9VA 4FXKC 3NSWA 3HGBA 4BY7B 1WTXA 1BBXC 1GUGA 1F2MA 1YNJC 2K7VA 3OSOA 1EEID 1TS2A 3ND9A 3A8JE 1U9RA 1PFMA 2BDOA 4DGZA 1S5DD 3MTSA 1HA5A 4KJOA 4OIKA 3NTIA 3HS0C 4QF4A 1I18A 4K2LA 3PIP3 2PW5A 1U4RA 4LMQD 4G6IA 2XZOA 1Y8PB 4EGVA 2NUCA 3PO3B 2K6AA 4IURA 4FVMA 2VXWA 1U4LA 3T51B 1BR9A 1Z6HA 4ZAIA 3ND8A 3KEWA 4B9WA 5JPMC 2VUMB 1F9SA 2FINB 3QB3A 3K5MA 1HA6A 2MHVA 2KVOA 4XLFA 3J81L 1RD9D 2X6WA 1QOHA 2K1BA 3GP7A 1KLUD 3HEJA 3DWQA 3AMUA 5C5MA 2K32A 1GJXA 4HTHA 5FK9C 1HQRD 3OHXC 2E76C 1STEA 1R4PB 2JE6I 5KGUA 5A2QL 2WSSA 4G7ZC 1JORA 4CKBA 3FVQA 4KV6A 1TS5A 5I2YA 4IFDG 3CQZB 4C56C 3GTLB 1E3XA 5DEHA 2J4XA 2NZ1D 5D14A 3A55A 2A73B 5KYLA 1ONLA 2V4DA 3A8KE 1OO9B 1HVXA 2PZTA 1FNWA 1BCPB 1LT4D 3BVGA 3NXWA 1NR4A 1ZXTA 1DONA 3GVLA 5E4WC 1M4VA 3AU7A 3MC0B 1QWYA 3L7ZC 3H6MA 3HG9A 1EWCA 1NSNS 1MGSA 2QKIC 4XQNA 1BXTA 1G2TA 1PFBA 1TIID 2D5DA 1PFNA 1MSHA 2F0TA 3K58A 1IKLA 1A2TA 4KTAA 4A3BB 1MD2D 2RVLA 4B3FX 3P75A 1CQVA 2IX3A 2F0FA 1EY4A 3GV3A 5KNCA 5CV5A 2F0MA 2RDHA 4J8QA 4WORA 1ET9A 3QJYA 4RKLA 1UD8A 2F0SA 1PRTD 2EJGC 4UDUC 1MBYA 1SNDA 1RCVD 2O2LD 4RHRA 5FOBB 3VR5A 1KNEA 3SXHA 3A3GA 3CP2A 1JICA 3HKZB 3I8ZA 4DAYA 2B2VA 1SJED 2M2LA 2A6EC 1RDPD 5C0XJ 4UAIA 2AUKA 3IFDA 5G3LF 3WDNA 2KUMA 3D31A 4HN7A 2ZZQA 3J7AV 1STBA 5DAUA 1XX8A 2QF7A 5KEEA 3S1RB 2HCIA 2PMZB 1SDFA 3GO5A 1LTTD 4CHTB 2BA1A 1EYAA 2F0HA 4V190 2F0PA 5C3EB 2FMCA 1EYDA 2JJ1A 2V7QA 4KJNA 4YXWA 1VF5C 2A6ED 3I91A 4DFAA 4P22A 2A69D 3TDQA 4U68A 4IFDI 1VLYA 3BVZA 2KCNA 2RKSA 3H94A 4E6IA 2KJXA 1TS4A 1UAPA 3O13A 1EY6A 4C3HG 4U673 1HRJA 2K01A 2LFNA 3A56A 5LL6S 2F0EA 1W9XA 3I70A 1RHPA 1GHJA 3NUCA 2KQ3A 2AWOA 3VR3A 2XIWA 3SK6A 5JAVA 2A6HC 4RAUC 3SK4A 3TP7A 5I9PA 1FR3A 3QO2A 5CMDA 4J6HA 3K6OA 1PTOB 1OHHA 1JWSD 3DEOA 5C4ZA 3KLRA 1F77A 1I3QB 4II2A 2L12A 1HUNA 2NWGA 5J22A 1A15A 1W6JA 2O4XA 2WJVA 3FEWX 4IUQA 3PIO3 3BCDA 1JE4A 1HTPA 1Y1VB 4LAAA 2D3LA 4Z9CB 1CHQD 2ENBA 4LJZC 1F9QA 1D6EC 2ZZFA 5HKKA 4CKEA 4A3DB 4IFDH 2J7ZA 4ZK9B 1LLRD 3R2IA 4KI0A 1AZQA 2PO4A 4MHEA 3T4AC 4RGMA 2N55A 3E5SA 4K8JA 3OEEA 4FF4A 1NRKA 1VMPA 4BBRB 2B2WC 4ZUIA 5KNBA 4XONA 3SK5A 2W6IA 2FFKB 2XRQD 1PKVA 5JEAJ 1ZEQX 1R9TB 5IK2A 2F0VA 1HHVA 1ICWA 4X3UA 3DWPA 3QIAA 2XWJB 4YELA 1VJSA 3T53B 5KNLA 2D62A 3NK9A 1A6XA 1DJRD 2HUGA 2R3ZA 4H44C 2WACA 4M8AA 1SNCA 1G2SA 3VYTA 4B3GA 4XXEA 5M3FB 3BZDB 3NWTA 1EFRA 2TMPA 2VJIA 1I4HA 3JAML 4G57A 3E6ZX 1Y8OB 4K5VA 1ZYRC 4B08A 5CR3A 1ESFA 3BDOA 3J80E 1SMYC 2LKVA 1K8OA 5EQ0A 3PUYA 2M9VA 5HGTA 3CRLC 1S5FD 4O42A 3RLFA 2JXMB 4ZKBB 2DIEA 4IALA 2L9HA 5C3XA 1EU3A 1V1PB 3SDZA 1GUOA 2MJ8A 3TMEA 1UD2A 3WOEA 3BC9A 3IL8A 4G4KA 1JB3A 1FNVA 1QNUA 1EY7A 1G8ZD 3BG3A 1STGA 2ZTGA 1H9RA 3MXNA 2R7ZB 1D5ZC 4N9PA 3KBGA 3I4MB 1EU4A 1E2WA 1J9OA 1IHZA 4TKOB 2BDNA 3H09A 5E4XA 4HMJA 5IIFA 1F2LA 3GTJB 2OF1A 1LABA 2AWNA 1EQVA 1QB5D 2F0OA 2KA7A 4OIJA 3NQTA 4KK7A 1TY0A 1IYUA 1YNNC 4L63B 3RUZA 2E2IB 2F0QA 4XL9A 4IUNA 1EIGA 2YU9B 4XN3A 3G05A 1GUSA 4A3MB 2FJ2A 1IW7D 3EQLC 3HRZC 3TBIB 1HQMC 1STYA 4RKBA 1FD7D 5CGKA 2I46A 4E0FA 2O5JC 4FNFA 2B2UA 3GTGB 5CYUA 1STHA 3KF8A 1SAPA 2B2TA 2O5IC 3OEHA 3V2TA 4IZ8A 4TRDA 1SNQA 5CBEE 4X3TA 5IGGA 1PDQA 2WB1B 2WKCA 1Q8IA 1EY8A 1SE3A 1YNND 2IX0A 2WPDA 1H9JA 1X3QA 1Q90A 1G91A 2NN6G 3D6WA 4S3SA 1Q1EA 4TQUS 1F9PA 1G6ZA 1MI2A 3CKIB 4HAEA 4J1MA 1A3TA 2HQEA 2HDLA 3J7YW 3UI2A 4JK1C 4ZYSA 1SFOB 1UD6A 1Q3LA 1ET6A 2KECA 2GJRA 1B3AA 2KHSA 5IGFA 1JC7A 2LZJA 1A3UA 4XKVA 1I4PA 2WV6D 3K5LA 2B8GA 3C2PA 1E1RA 4K5WA 3QOJA 4DF7A 3VA7A 5TSSA 2XWBB 3CESA 1CTMA 1S5CD 4ZKCB 1WD0A 1JOQA 4HR7B 2EDGA 4RGTA 3ZYYX 4F8MA 2Z1CA 5E1FA 3EFXD 2NYZD 1OXTA 3TP5A 1V43A 2F4IA 4PQXA 2F0UA 1D1KA 4PMBA 5FLXL 1SJHD 4TSSA 3Q23A 5IODA 5ELBA 1H9SB 2A68D 4FXGC 5COYA 3HOVB 1GOZA 2XSCA 2SDFA 2VB3X 1ESRA 4OL7A 4OHJA 3KUPA 1DOLA 3KLSA 5KIXA 5M3MB 3VA5A 2WJYA 4XNFA 3TSSA 3M7NA 2PCFB 3CMMA 1JOKA 1DD2A 2GJPA 2I07B 3N6RA 1JCKB 1EYCA 4R8IA 3TZDA 2E2JB 1GUWA 4XLCA 3SVMA 1Y69U 4HMIA 2NVTB 3PUXA 5I6WA 3EROA 4A3IB 2F0NA 2X69A 4XN0A 3DEPA 1EOTA 3CP8A 1PRTB 1VF7A 3A8IE 5K36G 4JBWA 2Z4IA 3CU7A 1VMCA 1IYVA 3S14B 1EZ8A 1LV9A 1Z47A 2IT1A 3HOXB 3K5NA 1E3ZA 1KTKA 4H13C 4ZRZA 3U9OA 4QMGA 2DY8A 3FDTA 4A3FB 1EL0A 2XNDA 4ILWA 4KN4C 5C0XG 1D1IA 2WKDA 1SNPA 1AEXA 2K04A 2NN6I 1PMRA 2L5TA 3V96A 1B1ZA 2ZXIA 5DM73 1PRTC 5IT9E 2RBMA 1E79A 2RQXA 1CQFA 2XGJA 2VNUD 5BN4A 1Q12A 2IW3A 2JA5B 1H8HA 4KY7A 3F2UA 1GXDC 1SYFA 1QNKA 5A2QE 1TQOA 2XVSA 4RCOA 1TT2A 3BDCA 3A54A 1L0YB 2RA4A 4FF3A 4JMQA 3AB9A 4XT3B 1HXYD 2KOLA 5M9OA 1ILPA 3HOUB 3PV0A 2J0TD 2PZUA 4C3JG 1TWAB 1LTBD 1M8AA 4M1UB 4FXUA 5FKAC 2EY6A 3MAQA 1K28D 3GVKA 1XWEA 5C4JB 3HOYB 2L55A 1WTHD 3E0JA 4R9WA 2EZVA 4C1NK 2X6YA 3M85A 4Z1MA 2NN6H 5M5WB 1O78A 2A69C 1JOOA 5C5LA 1UD5A 3H0GB 3BYTB 5FL7A 3K5OA 1H9MA 1I6VC 3QWNA 5EKIA 1WTRA 3NE5B 1B4OA 3CRKC 1AW7A 1EY5A 3ERQA 3TP8A 3SE0A 2DY7A 1O80A 3ONAB 5JVG3 3S17B 3MFYA 1I6HB 1FNUA 3LWUA 4DXFA 3MXPA 1WTQA 3GTMB 3OWEB 1HCZA 1Z7TA 2L4NA 1LTRD 1W0KA 4L8JA 1DXMA 5T1GA 1PRTF 1C48A 2EY2A 2X8KA 3FKSA 3TP6A 1ML0D 4EQPA 4CGYB 1Y1WB 5I9OA 4UZUA 2E74C 2W6JA 2CW0C 3NQIA 2SNMA 1K8MA 3HP3A 1KDAA 2EXZA 5IOCA 2HCCA 1NUCA 3P1HA 3PUZA 5EBCA 2NBFA 1TWCB 5LHY1 1SE2A 4RGOS 3CHBD 4KY5A 4FO2A 2LY7A 5C0XI 5CBAE 3Q0AA 5JEAG 4G7WA 4ULLA 3NTKA 4DA2A 2IPKD 1LO5D 2BCOA 3FMCA 2L1BA 3DHQA 2F0LA 1H9KA 2CW0D 2X53S 1OXVA 1RF2D 2SOBA 2B2TC 4ZQ3A 1EIHA 1MSGA 2QILA 5JVH3 3I90A 4QCLA 1OXUA 2QEJC 2FHTA 2XZLA 1WTVA 5D65A 2K5DA 3GQBA 5EPLA 3PUVA 3OMGA 1K83B 3D8GA 2K28A 2EYHA 4KN7C 4C3HB 5K36H 5ELEA 3X3MA 1E0BA 2OXPA 3G7LA 1QE6A 1QG7A 1A2UA 1SSOA 3SK8A 2WZPP 5JOBA 1O7YA 4XR6A 3OE7A 3BYYB 4YIJA 4II3A 5C0XH 3J80L 2ZT9C 3DMUA 3MFGA 5FO8B 4G7OC 4HCSA 2D3NA 2Z4HA 1UD3A 1TWGB 2Z6BD 3OPOA 3S1QB 1F2ZA 5FO9B 5IGCA 3DUZA 4XM3A 3D3RA 5HURA 1CT1D 1LTGD 1GUTA 4XYOA 2KEEA 3MXUA 1NCVA 1SEBD 3ZIAA 2DN8A 4ODGA 3MEHA 4P2CB 2B2YA 2MGSA 2HDMA 2LMCB 2JA8B 3G6JB 3DM1A 1JR0D 3M3YB 3N52A 1CK1A 5CORA 3DDYA 1CI3M 4IQZA 3OOCA 2EE1A 1DZ1A 2F0DA 4Y7NB 4C3IG 2Z8LA 2JSOA 3J7AF 2Q8TA 4XQQA 2C9OA 3M4YA 4FXDA 2C5CA 4HCEA 4K6LA 4A93B 1SBBB 5IGEA 1F2YA 3I73A 1ENCA 2XNAC 4F88A 5C6AA 3S2DB 1KAAA 1AP0A 4KD3A 2PYKA 4K5XA 1I4RA 5CDFA 2AQ3B 1IW7C 2X6LA 4NNJA 1U4MA 5ELDA 2F0JA 4K2KA 3S15B 4XQFA 1BO0A 1J8IA 4QUCA 1WTWA 3TZUA 1O7LA 4RCNA 4BY1B 3NP8A 1D5XC 2H4OA 3SR1A 1S5ED 1NAPA 5DN6A 2EJMA 2MPMA 2TSSA 3JAME 1BPLA 2Q8RE 1PTOH 4V0BA 1XTCD 5K5PA 4H7BA 1B50A 2K33A 2Y0SB 4FP5D 4HIZA 2OT2A 4LK1C 4A3KB 3D4RA 1KLGD 2AQ1B 5LL6X 1COWA 1V0EA 1W6KA 4F7XA 1IL8A 4XOTA 2ID0A 5JEAH 2KCCA 3RD4A 1VDZA 2M5SA 2Q8IB 1SKYB 4G7HC 3R3OA 4CJ2C 3OMCA 1AN8A 5EKKA 4GQNA 1LTID 1DYQA 2JDIA 1I4GA 1B2TA 1NR2A 1B9MA 1IKMA 3K59A 5CV8A 2R93B 4XLAA 4XLHA 5J1ZA 4RGNA 1KZLA 4TT3A 1R4QB 2A68C 2FMMA 2WAQB 4NMZA 4BA1I 2JA7B 1E2ZA 3M4OB 4CJ0B 1BF4A 5J39A 2B2VC 2V31A 2CHBD 1V8QA 1ILQA 2KVMA 5CC4A 2B2WA 2XN9C 1OXSC 3M7GA 3P7JA 3D4DA 2K03A 3VYRA 4BWGB 5ISRA 4QIWB 5DNFA 2VB2X 4N9TA 4KKTA 1I4XA 2PPBC 4KHZA 3NBHA 1HFNA 2EYFA 2R6GA 2AUJD 4TSFA 1ENAA 2BA0A 1VCIA 1QJOA 2F0WA 3RZOB 4WRDA 3OAAA 1Q1BA 2DNCA 4K14A 2E2HB 4MN3A 2NB0A 3C46A 3A3BA 5A35A 3X3NA 2PZWA 4K6DA 2EYOA 2L11A 2K05A 1ENFA 1WPCA 1I8DA 2F0IA 3A7AB 3S1MB 5D3IB 3GV6A 4XYQA 1YNJD 3MXGA 3I72A 3URYA 3FPUB 4DAVA 4KKSA 3MHBA 3HOZB 2EJFC 4IN3A 2RDFA 1FGBD 5IT9L 3GD7A 3QOLA 2F1MA 3S2HB 3K57A 5I2XA 1CZWA 3GVJA 3VR4A 2D2CC 4DK1A 2WP8J 5ELFA 1B9NA 1TY2A 2IX1A 4XIGS 3TN2A 4HSVA 2R92B 1TS3A 3RZDB 2JEAI 5FLXE 3V05A 2F3VA 4PNYA 5F2DA 4KHVA 5FO7B 3PO2B 5IGBA 1WTPA 1SE4A 1KABA 4C2MB 3IAYA 2N88A 4G7XA 4XT1B 1BDOA 2SEBD 2OEOA 4R8NA 3T13A 1MABA 4KD4A 4NP5A 3WOFA 4A3JB 3U9SA 4Q0FA 1V1PA 1HUMA 3FKIB 2NVYB 3T16A 4Q5VA 3I4NB 2EVBA 3J81E 1WCMB 1TU2B 5JJZA 2BE5C 1TKWB 3EVQA 1RODA 4IUPA 4AYBB 2EYLA 1V0FA 5G3LD 3W3AA 2YYZA 1KMHA 2JJ2A 1WD1A 5BN3A 3L9AX 1OXXK 3HAGA 2ZXRA 4RA8A 4BA2I 1EY0A 4ASUA 3A7LA 2IWHA 4OO1G 5M5XB 1II3A 1Y8NB 4K8IA 3KBXA 1RTNA 3Q6SA 1BMFA 4DK0A 4CJ1B 4NW2A 5M5YB 1X32A 3C1EA 2JYOA 4XQJA 1BCPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H9R A;  3VA7 A;  4I7Z C;  3L7Z C;  1VF5 C;  2BE5 D;  2A6E D;  1OXU A;  4KKS A;  1FYC A;  4H13 C;  1CTM A;  3QG1 A;  1H9M A;  1Y8P B;  1I6V C;  1H9S A;  3IKJ A;  3GQB A;  2EJF C;  3M4Y A;  1E2W A;  4HR7 B;  2EDG A;  2A69 D;  3GD7 A;  5KNB A;  3PUV A;  3OW7 A;  2D5D A;  2F1M A;  4TKO B;  3I73 A;  3NE5 B;  1B9M A;  4OO1 H;  3T51 B;  1ZKO A;  3CRK C;  1OXT A;  1Z6H A;  3VR4 A;  4KN4 C;  1LAB A;  2D2C C;  4KN7 C;  4DK1 A;  3SE0 A;  1E2V A;  5C0X G;  5K36 H;  3ND8 A;  1B9N A;  2NN6 I;  3H94 A;  1PMR A;  2KA7 A;  2L5T A;  3MFY A;  4DNR B;  4OGQ C;  1V43 A;  3LWU A;  1IYU A;  1YNN C;  3I4L A;  4XIG S;  3P20 A;  1IW7 C;  2A68 C;  4BA1 I;  4GZY C;  1E2Z A;  1HCZ A;  3QIA A;  5BN5 A;  1Z7T A;  2JEA I;  5KNC A;  1GHJ A;  4L8J A;  1DXM A;  1V8Q A;  3VR6 A;  3T53 B;  1GUS A;  3FPP A;  5KND A;  2D62 A;  1OXS C;  1H9S B;  1IW7 D;  2A68 D;  3EQL C;  3QJY A;  3TZU A;  1A6X A;  1GUN A;  4DNT B;  1HQM C;  1O7L A;  2EJG C;  4PV1 C;  4RCN A;  2JEB I;  2O5J C;  5C0X H;  4KKU A;  5K36 G;  4H44 C;  2AWO A;  2ZT9 C;  3VR3 A;  5BN4 A;  1T5E A;  1Q12 A;  1GHK A;  1DCZ A;  4G7O C;  2K32 A;  1GJX A;  1BDO A;  4KKT A;  2A6H C;  2E74 C;  2E76 C;  3VR5 A;  2PPB C;  2CW0 C;  3U9S A;  4KHZ A;  2O5I C;  2JE6 I;  1K8M A;  3OPO A;  3DXJ C;  1FR3 A;  4G7Z C;  2R6G A;  2AUJ D;  2EJM A;  2PNR C;  3IFT A;  3PUZ A;  4XTC S;  3PUW A;  2A6H D;  2EVB A;  1G29 1;  1TU2 B;  1Y8O B;  3M7N A;  2BA0 A;  1GUT A;  1ZYR C;  1VCI A;  2PCF B;  4IFD G;  3KLR A;  1QJO A;  2BE5 C;  2A6E C;  1H9J A;  4KMU C;  3AB9 A;  1TKW B;  3MXU A;  5JEA G;  1DD2 A;  3LNN A;  1Q1B A;  2DNC A;  2E75 C;  2AUK A;  3BDO A;  1Q90 A;  4H0L C;  2NN6 G;  3N6R A;  1SMY C;  2K33 A;  3WDN A;  1K8O A;  3PUY A;  3T56 B;  3D31 A;  3PV0 A;  5A35 A;  1Q1E A;  1HTP A;  2DN8 A;  3CRL C;  4TQU S;  3W3A A;  3RLF A;  2JXM B;  3HGB A;  3D4R A;  4LK1 C;  2YYZ A;  1EWH A;  1GUG A;  1HPC A;  2QF7 A;  1YNJ C;  3FMC A;  3VR2 A;  1ONL A;  1Y69 U;  2B8F A;  2V4D A;  3A8K E;  4JK1 C;  5BN3 A;  4LJZ C;  2K7V A;  1OXX K;  3SDZ A;  3PUX A;  1GUO A;  2LMC B;  1LAC A;  3ND9 A;  3A8J E;  4IQZ A;  4BA2 I;  3A7L A;  1H9K A;  4OO1 G;  3A7A B;  4IFD H;  1Y8N B;  2BDO A;  1VF7 A;  4DK0 A;  2DNE A;  3A8I E;  1CFM A;  2KCC A;  2B8G A;  2BA1 A;  4JBW A;  4KI0 A;  1OXV A;  5JEA H;  3M85 A;  1VDZ A;  1IYV A;  2Q8I B;  2NN6 H;  3I72 A;  4G7H C;  3BG3 A;  1O78 A;  2A69 C;  1CI3 M;  2IT1 A;  3OOC A; 
#chains in the Genus database with same CATH topology
 1EFI D;  4X3K A;  3GTP H;  1H95 A;  2Q6O A;  2BE5 D;  4K1X A;  5C3E G;  3W1B A;  3W5H A;  5IYD H;  3VYS A;  3Q22 A;  1EY9 A;  1CZG A;  2HIX A;  1UNS A;  1VQM B;  4LWC A;  4IFD J;  4RCY A;  1UE1 A;  1WOC A;  3RMH A;  3A35 A;  1WU8 A;  5C44 B;  3PEN A;  2NTT A;  5EBD A;  3BH4 A;  1IZ6 A;  3I55 B;  2KED A;  1JT8 A;  1PH7 A;  2NVQ B;  3I2Z A;  3OFN A;  4IUT A;  5E3F A;  5EAY A;  4ZCI A;  4DNR B;  3I3C A;  1V1O A;  2G9H D;  2VQE L;  1A3V A;  2B2Y C;  3DWA A;  3RR5 A;  4DV4 L;  3FRP B;  2B39 A;  5FJ8 H;  1IBL Q;  1LM0 A;  1SYC A;  1QGA A;  2B7B A;  3WBJ A;  4JI3 L;  1XYI A;  1EZ6 A;  1KNA A;  3KFU A;  2BMW A;  2ICE C;  4BXX H;  4XOP A;  1JWU D;  4XOR A;  3MXN B;  4ME3 A;  3EA6 A;  1DG1 G;  1KHI A;  3T1H Q;  3VR6 A;  3GTO B;  2ZTN A;  1BCP D;  1JJC B;  2E8G A;  4XMY A;  4B9X A;  4YCW A;  1GUN A;  5CV6 A;  5A89 A;  1KAW A;  4PV1 C;  3U4Z A;  3R93 A;  1D2B A;  1U4P A;  4ABN A;  2V7U A;  1O7I A;  2UUC Q;  3E0E A;  2GJK A;  2WII B;  1STN A;  3HOV H;  1SKQ A;  1RKN A;  2VJJ A;  2MUY A;  2ZZG A;  4L6T B;  2F43 A;  1BQQ T;  3U4V A;  2VUM H;  1Q81 C;  3J81 i;  4A3G B;  1KQS A;  1JJ2 B;  3AVX A;  4R1J A;  5EGT A;  1BOS A;  4FYD A;  2N8N A;  4GKK Q;  1X3F A;  1HFG A;  5M3M H;  4CBV A;  1PYW D;  2CQA A;  2A5H A;  3OTO L;  4PC3 A;  1L1O B;  4C3J B;  3LNN A;  2E75 C;  3LWE A;  1S4Z A;  4NKL A;  1QCB D;  2G9D A;  1CUK A;  5IGD A;  3UDI A;  1WSR A;  3MVV A;  1RQR A;  3PCO B;  1JA1 A;  3J80 c;  3CMA A;  4B3T Q;  4BBS B;  3CW2 C;  4NDX A;  1EWH A;  4QVJ A;  3L0O A;  1UD4 A;  4IUV A;  2ATW A;  2PLF A;  1KDC A;  1L2F A;  3KF8 B;  4C1N I;  1YLO A;  3MHP A;  4ZUJ A;  4HSP A;  4YWM A;  1UMK A;  1KXL A;  2E2J H;  1Y1V G;  1SYB A;  2CVR A;  3L3O C;  4PMW A;  4DN4 M;  3C1F A;  5ELC A;  1ZM3 A;  4ME5 A;  3G71 B;  3R8B A;  4DAP A;  5FLM H;  5EPJ A;  3CRZ A;  2PI2 A;  2EPB A;  2DNE A;  1VQI A;  4DV7 L;  1G7C A;  2QEX A;  3MCA A;  4A3D G;  2NVX B;  4IJL A;  3CQZ H;  2F0K A;  4TN1 A;  5I4D A;  3GTL H;  2JJQ A;  4LFA L;  2YTX A;  4AYB E;  3WND A;  2EYJ A;  4I7Z C;  4X3S A;  3CXC A;  2GK6 A;  2OBT A;  1WVL A;  3S14 H;  4CDE C;  1PZJ D;  1EP1 B;  4LFB L;  1BCP F;  1H9S A;  3IKJ A;  4XLE A;  4A75 A;  2ZL6 A;  4C43 A;  2VQE Q;  3VO2 A;  4DV4 Q;  2OYN A;  1DOM A;  1D5M C;  3GTK B;  2EYP A;  1LUZ A;  1ZKO A;  4JI3 Q;  3CF5 A;  5KSW B;  2CH4 A;  1LT5 D;  1STA A;  2B2U C;  3L2P A;  4CQJ A;  1E1Q A;  4QFM A;  4FK8 A;  2ZXP A;  1LTS D;  2R7F A;  4ZLT F;  1BUV T;  2E2D C;  1IL2 A;  1N9W A;  2IJ0 A;  3I4L A;  1O7Z A;  4GZY C;  4WFN 3;  1E43 A;  4EVO A;  5IYP A;  5BN5 A;  2XRS D;  5ELN A;  2PW7 A;  1U0L A;  2ZZE A;  1W0J A;  5GRO A;  3SHL A;  1VQP B;  3TEH B;  5IYW A;  3OZU A;  5C4H A;  1VQ7 A;  1TR5 A;  5EPK A;  4PAB A;  1BBU A;  4OO1 I;  4X7F A;  3TRZ A;  1MIU A;  3NBI A;  2E1B A;  4KKU A;  1C4Q A;  5T1I A;  2D9U A;  3Q24 A;  3HKS A;  1QGZ A;  3M9B A;  2JIZ A;  1UE7 A;  5AFW A;  5EKL A;  4A3B H;  3SGI A;  3OTO Q;  1YJW B;  3DXJ C;  4LW1 A;  1QVF B;  3SEB A;  1G6P A;  3RY8 A;  2L0C A;  1KC8 C;  2D74 A;  1TWH B;  3D6C A;  2PNR C;  1QIL A;  3S9W A;  2QA4 B;  5M3F G;  5KRU A;  1Y0R A;  3WQZ A;  2A6H D;  1G29 1;  5I6Y A;  1F60 A;  4F87 A;  5FO0 A;  2K5Q A;  4YCU A;  4KMU C;  3PUM A;  2ZXH A;  3C3L A;  1W34 A;  1SYD A;  3D4W A;  3BY2 A;  4X65 L;  2WIN B;  1PTO C;  1W35 A;  3QSY A;  4DR7 L;  3ITP A;  3K0Y A;  4R71 A;  4O1N A;  4DPG A;  4JC0 A;  4YHB A;  4DV7 Q;  4NBS A;  1RJT A;  2RCN A;  1H85 A;  2RF4 A;  3I56 A;  2B8F A;  1I4Q A;  3BS1 A;  1TWA H;  4XD7 A;  1B70 B;  2IL8 A;  2RDG A;  3NTH A;  3RNU A;  1EQT A;  1UUP A;  4LFA Q;  4OPV A;  4QUF A;  2MO1 A;  3PA1 A;  2EOT A;  4QB4 A;  1VQC A;  1BQE A;  1B44 D;  1HTL D;  4LFB Q;  1KC8 D;  1CFM A;  3Q3A A;  5C4J H;  4DUZ L;  3HOY H;  2DJG C;  3HZX A;  2JK8 A;  4A3E B;  1YI2 A;  2X85 A;  1T6Y A;  5CV4 A;  1WP6 A;  1LT6 D;  1L0X B;  2YV5 A;  3BVM A;  5EJW A;  4B3M L;  1XXG A;  2X6X A;  3LX0 A;  3S1N B;  4YAW A;  1YX2 A;  1TXY A;  3OWF A;  1QGY A;  1FYC A;  5IP7 G;  2N78 A;  1OB2 A;  3PMF A;  1F9R A;  3EN2 A;  3KLS X;  2GN5 A;  1VQ8 B;  3I4O A;  1CA5 A;  1PTO D;  4XDX A;  1K9M C;  4JI0 Q;  3EJI A;  2R7Z G;  2A74 C;  3I4M G;  1PZI D;  4FN5 A;  1BKB A;  2BOS A;  4OO1 H;  1MRZ A;  2CF4 A;  1SXT A;  1GKH A;  4EQO A;  1PJ7 A;  3S1R H;  1B53 A;  3MWY W;  1LTA D;  1CM9 A;  3WBK A;  2RSN A;  1JWM D;  3PSI A;  2RSO A;  2XOK A;  2IHE A;  4CKC A;  1WOP A;  2ICI A;  4ZGQ B;  2JA6 B;  3S17 H;  4RFB A;  5D3D A;  4GNX A;  4OWT B;  4DR3 L;  1I6H H;  1BLI A;  2EY5 A;  4RHS A;  3GTM H;  1KRS A;  3MZ5 A;  1JA0 A;  5IYR A;  1QVG B;  5KND A;  2ZBV A;  1YIJ B;  1TLL A;  3BCF A;  4DNT B;  3STB D;  2ZTD A;  3B8H A;  2JEB I;  5CV7 A;  4LUZ A;  5C3W A;  1TVX A;  2CK3 A;  2ZL7 A;  1DCZ A;  1GHK A;  1PXU A;  2K5W A;  4BS9 A;  1K9M D;  2VYQ A;  4G5G A;  4M53 A;  1VQ4 A;  1T5X D;  1Z9F A;  1M90 D;  2K5V A;  1DM0 B;  2N49 A;  2NTS A;  1SYG A;  1Y1W H;  4X65 Q;  3CCS B;  4A3L G;  5DM6 3;  4DR6 L;  4XTC S;  4LBY A;  2RHQ B;  3PUW A;  1S4M A;  1DOK A;  4UP8 A;  2ZJR A;  1VQ9 B;  3I55 A;  4DR7 Q;  4JI6 L;  1I50 B;  2PQA A;  3H91 A;  4MIU A;  4ID6 A;  4LF9 L;  3OIQ A;  5DSZ A;  4YEJ A;  4N8F A;  3SKB A;  3NHH A;  1TWC H;  4RH6 A;  1AZP A;  1QUQ B;  4YAU A;  1C0A A;  2QE7 A;  4Z4W A;  1SYE A;  1TWF B;  2WB1 G;  1SNO A;  2EYM A;  1X3P A;  3KK7 A;  2HLD A;  4AVZ A;  2R61 A;  5IYQ A;  3T56 B;  4ZV4 A;  1NMF A;  2GK7 A;  1VQL B;  3CB4 A;  3OJW A;  1ZYR D;  5KYI A;  4DXG A;  1WTO A;  2F3W A;  4HIO A;  3S16 B;  1PTO F;  4DUZ Q;  1HPC A;  4WJW A;  4EX5 A;  3VR2 A;  4I65 A;  3HOW B;  1SMY D;  1L0W A;  2F03 A;  2I1L A;  2F0G A;  2MFI A;  3OIP A;  1VS0 A;  2NZO A;  3ASS A;  3ZBU A;  1LAC A;  3MA2 B;  4HED A;  4KLK A;  1SNM A;  3ZZU A;  1KDB A;  2XZP A;  2H1E A;  4C3I B;  3R2T A;  1W87 A;  3ZPN A;  1HZE A;  3CCR B;  1I3Q H;  1VQ6 A;  4MNO A;  3IFT A;  5CV9 A;  1JB7 A;  1FNC A;  1EEF D;  4XKW A;  3QG1 A;  3CME B;  5FNZ A;  3H15 A;  2EY1 A;  4P6V F;  4FF1 A;  2K4K A;  2SNS A;  4MTK A;  1CA6 A;  2LS0 1;  3AFQ A;  2PQE A;  1VQK B;  3OW7 A;  1UEA B;  4RWS C;  4P72 A;  4FF2 A;  5L37 A;  4P3I A;  1I7P A;  3AVV A;  4DR3 Q;  2HT1 A;  3GTQ B;  2Q6L A;  1E2V A;  4QGU A;  1S5B D;  3TS2 A;  4A3D H;  3BDL A;  2QDB A;  4OGQ C;  3E9I A;  5C4X B;  4EQN A;  4IUU A;  3P20 A;  3W2G A;  2AMC B;  1H42 A;  3KF6 B;  3G4S B;  2M00 A;  4RD0 A;  2I5L X;  1NBM A;  2DYI A;  1WOR A;  1N32 L;  1QH0 A;  4KY6 A;  1IHM A;  2C4T A;  2UXC L;  1UE6 A;  2NV4 A;  4DU9 A;  3FPP A;  3K7A B;  4TMZ A;  3FHW A;  2QCP X;  5IT9 c;  1PLF A;  4GOP A;  1H8E A;  4DR6 Q;  4PMC A;  1T5E A;  1OB0 A;  1BNZ A;  1AFP A;  1E64 A;  4JV5 L;  1V1Q A;  4JI6 Q;  1CHP D;  1RTO A;  2GA4 B;  1GAQ A;  4LF9 Q;  1YIT A;  3HOV G;  4L5S A;  2WFW A;  2OBS A;  3KYH C;  3NWS A;  4G1B A;  4JI5 L;  2DER A;  5NUC A;  3EBE A;  3KJO A;  1FX0 A;  3VYU A;  3PA2 A;  1JQY D;  2OTJ A;  3I7F A;  2GQF A;  3E3X A;  2KCT A;  3BZC A;  1PZK D;  3NEL A;  5JJK A;  3PIO A;  2B63 B;  3W2D A;  5M3M G;  3H3V C;  2ZXO A;  3NPP A;  1UE5 A;  2VL6 A;  2JP1 A;  3JU4 A;  2MP1 A;  2X6G A;  5JPN C;  4X66 L;  3GTP B;  4H0L C;  1LT3 D;  1NE3 A;  1C8C A;  1MJC A;  1Y14 B;  5DS0 A;  2AQ2 B;  5THX A;  1IB0 A;  4N3G A;  2R9V A;  1PYB A;  1CKN B;  3AEV A;  4FXK C;  4NXN L;  3NSW A;  3HGB A;  4BY7 B;  1WTX A;  1BBX C;  2JA7 B;  2JQO A;  1GUG A;  1F2M A;  1YNJ C;  1B3Q A;  3OJX A;  1ZM9 A;  2K7V A;  3OSO A;  1EEI D;  1TS2 A;  1PH8 A;  3ND9 A;  3A8J E;  3UE0 A;  1U9R A;  1PFM A;  2BDO A;  4DGZ A;  1S5D D;  3MTS A;  4R4I A;  1HA5 A;  5AJ3 L;  4A3I G;  4KJO A;  4OIK A;  1QVF A;  1TTT A;  3NTI A;  3HS0 C;  4QF4 A;  1I18 A;  4K2L A;  2EIX A;  4HIK A;  3PIP 3;  3V76 A;  2PW5 A;  1U4R A;  3QFS A;  3CCJ A;  4B4D A;  4LMQ D;  4G6I A;  2XZO A;  4L5Q A;  1Y8P B;  4EGV A;  4PC6 A;  2NUC A;  4N8X 1;  1GO2 A;  4FWT A;  3HOX G;  1YJ9 A;  2K6A A;  2R92 G;  3PO3 B;  3CTA A;  4IUR A;  4FVM A;  2VXW A;  1U4L A;  3W2H A;  3T51 B;  2VQF L;  1BR9 A;  3UDX A;  1Z6H A;  1S72 A;  1KIX A;  4ZAI A;  3ND8 A;  3KEW A;  4B9W A;  2Q6K A;  3Q39 A;  5JPM C;  4A3F G;  2UXC Q;  2VUM B;  1F9S A;  2FIN B;  2XTI A;  2JN4 A;  1VQO A;  3QB3 A;  4PZ6 A;  2BSA A;  3K5M A;  3S2D H;  2HMA A;  1HA6 A;  2MHV A;  4TMW A;  2KVO A;  2I5M X;  1JJG A;  4QJF A;  2Y0S E;  4A3J G;  4JV5 Q;  4XLF A;  3LGJ A;  1FVI A;  3J81 L;  1RD9 D;  3PF4 A;  2X6W A;  3PQI A;  1QOH A;  2K1B A;  4Z4V A;  2R7Z H;  1EFC A;  4LF7 L;  3GP7 A;  1KLU D;  3I4M H;  3U6B A;  1YHQ A;  4JI5 Q;  3HEJ A;  3DWQ A;  3AMU A;  5C5M A;  1D2E A;  2K32 A;  2LXK A;  1GJX A;  4HTH A;  5FK9 C;  1JE5 A;  1HQR D;  1A62 A;  3OHX C;  4K0K L;  2E76 C;  4AYB G;  1VQN A;  1STE A;  4YY3 L;  1R4P B;  1KK3 A;  4IPH A;  2JE6 I;  5KGU A;  2V7T A;  5A2Q L;  2JA5 G;  2WSS A;  4X66 Q;  4G7Z C;  1JOR A;  4CKB A;  1TUI A;  4GN3 B;  4APV A;  3FVQ A;  4KV6 A;  1TS5 A;  3W5O A;  3CC4 B;  5I2Y A;  4IFD G;  3CQZ B;  2K14 A;  4C56 C;  1EP2 B;  3CD6 A;  3GTL B;  2Q2H A;  1E3X A;  5DEH A;  1ICF B;  4P71 A;  2J4X A;  2NZ1 D;  3AYH B;  5JBQ A;  2V7V A;  3M4P A;  3B82 A;  3A55 A;  5D14 A;  4WZL A;  5H5J A;  2A73 B;  1E3P A;  1FJG L;  3HOU G;  5KYL A;  5AJ3 Q;  1E24 A;  1ONL A;  4UZE A;  2V4D A;  1OB5 A;  3A8K E;  2BM1 A;  1M1K D;  4A3K H;  1PH2 A;  2WAQ E;  3V7A A;  1DGS A;  1HVX A;  1OO9 B;  1X65 A;  4N3N A;  1FNW A;  1BCP B;  1LT4 D;  2PZT A;  3BVG A;  2WYR A;  3NXW A;  1NR4 A;  1ZXT A;  3GDE A;  4YWK A;  1DON A;  2QDX A;  3GVL A;  4IOC A;  1SRO A;  1I94 L;  3HOY G;  3A74 A;  5E4W C;  5IYC G;  2EQS A;  3CCS A;  3WNC A;  1M4V A;  2F4V L;  1WJJ A;  2QGQ A;  3AU7 A;  3MC0 B;  4PGO A;  2VQF Q;  1QWY A;  3ERS X;  3L7Z C;  3H6M A;  3HG9 A;  1EWC A;  1NSN S;  4B48 A;  2EIF A;  1MGS A;  4B3S L;  2QKI C;  4GLA C;  4XQN A;  1BXT A;  1N06 A;  2PNH A;  1G2T A;  1PFB A;  3H0G G;  1TII D;  2V7X A;  3CPW A;  2D5D A;  1PFN A;  1MSH A;  2F0T A;  3BJU A;  3KDF A;  3K58 A;  4WZT A;  1IKL A;  1SFO H;  1X55 A;  1A2T A;  4JYA Q;  4KTA A;  4A3B B;  1ASZ A;  3TS0 A;  1MD2 D;  2RVL A;  1N36 L;  4YAF A;  1E62 A;  4LF7 Q;  4B3F X;  3P75 A;  1GR1 A;  4O2D A;  5B6I A;  1CQV A;  1ELO A;  2IX3 A;  4DV5 L;  2F0F A;  2A8V A;  1ZM4 A;  4P3Y A;  1EY4 A;  2BVN A;  4RD4 A;  2C35 B;  1BBW A;  3GV3 A;  2D0P A;  5KNC A;  1Q46 A;  2YWG A;  5CV5 A;  1J5E L;  2F0M A;  3M4O H;  1X54 A;  4K0K Q;  1G7S A;  2RDH A;  3G6E B;  4J8Q A;  4PC1 A;  4WOR A;  4YY3 Q;  1EFW A;  2QW7 A;  1ET9 A;  2PMD A;  3QJY A;  1HZB A;  4RKL A;  4L5T A;  1UD8 A;  2F0S A;  1PRT D;  4RD6 A;  4ACA A;  2EJG C;  4UDU C;  1MBY A;  1SND A;  2CRV A;  2GVB A;  4H9G A;  1RCV D;  2O2L D;  4RPB A;  1GAW A;  4RHR A;  5FOB B;  3VR5 A;  1SE8 A;  1KNE A;  2PIA A;  1OGJ A;  3Q6R A;  3SXH A;  1Y1W G;  1W2B A;  3A3G A;  3CP2 A;  5J3B A;  4OPO A;  3TRE A;  4WZE A;  1JIC A;  3HKZ B;  3BQJ A;  1SMX A;  1C9O A;  1MHW C;  2Q2I A;  3I8Z A;  4DAY A;  4AF6 A;  2B2V A;  1SJE D;  5HXB A;  2M2L A;  2A6E C;  4WJ3 M;  2F3I A;  1RDP D;  5C0X J;  3VDY A;  4UAI A;  2AUK A;  4TMT A;  3IFD A;  2OTL A;  5G3L F;  3GIR A;  3CCL B;  4AH6 A;  3WDN A;  3ASR A;  4GNX C;  4GLX A;  2KUM A;  3D31 A;  3RZO H;  1X6O A;  4HN7 A;  2ZZQ A;  2E2H H;  3CCU B;  3J7A V;  1K3R A;  1STB A;  5DAU A;  1A0I A;  1XX8 A;  2QF7 A;  1I94 Q;  5KEE A;  4GS3 A;  4JI8 L;  3S1R B;  2BF4 A;  2HCI A;  2F4V Q;  4LBW A;  2PMZ B;  2YWH A;  4M1K A;  1SDF A;  3GO5 A;  1Y0Y A;  1LTT D;  4UP9 A;  5GAE C;  3WYA A;  4CHT B;  4B3S Q;  2IY5 B;  3A8K A;  2BA1 A;  2JN9 A;  3CPF A;  3R6K A;  1EYA A;  2F0H A;  4V19 0;  3ASQ A;  1AE2 A;  1G51 A;  1IBK L;  3S1M H;  4RPD A;  1SRU A;  2F0P A;  3QFR A;  5C3E B;  2FMC A;  3ONU A;  1EYD A;  2P5Z X;  2JJ1 A;  2V7Q A;  4KJN A;  4YXW A;  1VF5 C;  4LBV A;  3CC7 B;  2A6E D;  5JJI A;  3ZJY C;  1P8L A;  2OQ0 A;  3I91 A;  3F2D A;  1N36 Q;  4TMX A;  4DFA A;  1N0V C;  4P22 A;  3W1G A;  1YJN A;  2OK8 A;  3H9N A;  1EWI A;  2A69 D;  4QQB X;  2GPJ A;  3TDQ A;  4U68 A;  4IFD I;  4DV5 Q;  1VLY A;  3BVZ A;  2KCN A;  1BX0 A;  4J15 A;  2NVT H;  3PIP A;  2RKS A;  3ER0 A;  3ZZ0 A;  1J5E Q;  4A3I H;  3H94 A;  4E6I A;  2KJX A;  4P1V A;  3ISX A;  1TS4 A;  1UAP A;  3O13 A;  1EY6 A;  2VNI A;  1GVH A;  4EH1 A;  3IRB A;  4C3H G;  4U67 3;  1HRJ A;  2K01 A;  2UUA L;  2LFN A;  2V7W A;  4PZ8 A;  4CDF C;  2I0Q A;  3A56 A;  5LL6 S;  3ZZT A;  2F0E A;  1R5N A;  4Z4T A;  4IW3 B;  1W9X A;  3I70 A;  3HOX H;  1RHP A;  1GHJ A;  2R92 H;  3B6Y A;  3RZD H;  1Q7Y C;  3NUC A;  3W5V A;  2GVA A;  1WOO A;  2DET A;  2KQ3 A;  3UDF A;  2VZA A;  1X3E A;  2AWO A;  3VR3 A;  1VQ5 A;  2A19 A;  3PO2 H;  2XIW A;  1QFJ A;  4A3F H;  1A63 A;  3K0X A;  3SK6 A;  3K81 C;  1T6X A;  5JAV A;  2A6H C;  4RAU C;  2E1R A;  4C2M H;  3SK4 A;  4OX9 L;  3TP7 A;  3QFC A;  5I9P A;  4AQY L;  1FR3 A;  3CC2 B;  3QO2 A;  1E63 A;  5CMD A;  1PA6 A;  4A3J H;  4OWX B;  4J6H A;  3K6O A;  1PTO B;  1K8A C;  4RD2 A;  1QUF A;  1SN8 A;  1OHH A;  2NVY H;  1JWS D;  3DEO A;  5C4Z A;  3KLR A;  3G48 A;  3JAM c;  1F77 A;  1I3Q B;  4II2 A;  3QR8 A;  2YWF A;  2L12 A;  4X06 A;  1HUN A;  1Q86 C;  5H59 A;  4JI8 Q;  2NWG A;  5J22 A;  1A15 A;  1W6J A;  2CQO A;  2WJV A;  1FNB A;  2O4X A;  3F1Z A;  1VLO A;  3FEW X;  4IUQ A;  3PIO 3;  3BCD A;  4DR5 L;  1JE4 A;  1HTP A;  5IE8 A;  1Q7Y D;  4YHH L;  1Y1V B;  3ICE A;  4LAA A;  2D3L A;  4IPG A;  2JA5 H;  2Z9H A;  3OW2 B;  4Z9C B;  3A5Z B;  1CHQ D;  1LYL A;  2ENB A;  4LJZ C;  1F9Q A;  4F7D A;  3CCV B;  3NBH B;  1D6E C;  2ZZF A;  5HKK A;  4CKE A;  4A3D B;  4IFD H;  2J7Z A;  4ZK9 B;  1R5O A;  3HKZ E;  4RD3 A;  1LLR D;  3R2I A;  1XFO A;  3AVW A;  4P9S A;  4KI0 A;  3AVY A;  1AZQ A;  2JA8 G;  3D26 A;  1E7Z A;  2PO4 A;  2E5L L;  2AHO B;  1K8A D;  4X07 A;  1XQB A;  4MHE A;  3T4A C;  4RGM A;  2N55 A;  3KJP A;  1K28 A;  3E5S A;  4K8J A;  5M5Y H;  3CCM B;  1QZG A;  3OEE A;  4FF4 A;  3U58 A;  1NRK A;  3HOU H;  1VMP A;  2MO0 A;  4JPB W;  1I5F A;  4BBR B;  1Q86 D;  1WTH A;  2B2W C;  2CND A;  4IO9 A;  3CCQ A;  4ZUI A;  5KNB A;  4XON A;  4R4T A;  1K73 D;  1TVC A;  1FND A;  3SK5 A;  2W6I A;  2UUA Q;  2FFK B;  4B47 A;  3CCE B;  2XRQ D;  5IP9 H;  1PKV A;  4JBM A;  4IPD A;  5JEA J;  1QFY A;  4P26 A;  4A93 G;  1HZA A;  1HZ9 A;  1QZH A;  1ZEQ X;  1R9T B;  5IYC H;  5IK2 A;  2F0V A;  3D0F A;  2KEN A;  1XPU A;  1HHV A;  4X64 L;  1ICW A;  3OZV A;  4X3U A;  3DWP A;  3STB C;  3QIA A;  2QGG A;  2XWJ B;  2VBT A;  4YEL A;  5M5W H;  1N07 A;  3R6J A;  4H02 A;  5TR9 A;  3H0G H;  1VJS A;  3T53 B;  5KNL A;  2D62 A;  3NK9 A;  4OX9 Q;  1YNX A;  4AQY Q;  1A6X A;  1M90 C;  1DJR D;  2HUG A;  2R3Z A;  4H44 C;  3GTO H;  2RC5 A;  2WAC A;  1CSP A;  4M8A A;  2XGT A;  1SNC A;  1XTD A;  1G2S A;  1VQH A;  4JI1 L;  4B3G A;  4XXE A;  3VYT A;  4BY1 G;  1NDH A;  3GSI A;  5M3F B;  1BX1 A;  3BZD B;  3NWT A;  1EFR A;  1P4M A;  2OCE A;  2TMP A;  2VJI A;  4TVA B;  1I4H A;  3JAM L;  1FJG Q;  4G57 A;  4DR5 Q;  3MMP A;  3E6Z X;  5FIU A;  4YHH Q;  1Y8O B;  4K5V A;  1ZYR C;  2MNA A;  4B08 A;  4M4S A;  5CR3 A;  1ESF A;  3BDO A;  2CFM A;  4RJL A;  4OXP A;  3J80 E;  2BN4 A;  1SMY C;  2LKV A;  1K8O A;  5EQ0 A;  1IYJ B;  3PUY A;  1VQF A;  2M9V A;  1KK1 A;  5HGT A;  3CRL C;  1CSQ A;  1S5F D;  4O42 A;  3J7Z C;  3RLF A;  2JXM B;  4ZKB B;  2DIE A;  1B7Y B;  1EXM A;  2Y0S G;  4IAL A;  4IJH A;  2Q2T A;  2L9H A;  1VQM A;  1XMO L;  2E5L Q;  5C3X A;  1EU3 A;  3Q8D A;  4POF A;  2C78 A;  5KW9 A;  1V1P B;  3SDZ A;  1S40 A;  4BPR A;  1GUO A;  4A3K G;  2MJ8 A;  3TME A;  1UD2 A;  3F8T A;  1N34 L;  3WOE A;  3PVD A;  3BC9 A;  3IL8 A;  4G4K A;  1JB3 A;  1FNV A;  1QNU A;  1EY7 A;  5ELO A;  3ASP A;  1G8Z D;  3ZBT A;  3BG3 A;  2C4U A;  1STG A;  2ZTG A;  1U2R A;  4UP7 A;  1PH9 A;  1H9R A;  1RL2 A;  1KRH A;  3MXN A;  4O0A A;  2NVX H;  1MKH A;  2R7Z B;  1D5Z C;  4N9P A;  3KBG A;  3I4M B;  5C4X G;  1E1O A;  2CC2 A;  1WDT A;  1EU4 A;  3CW2 A;  1E2W A;  1J9O A;  4B3M Q;  1IHZ A;  4TKO B;  2BDN A;  3H09 A;  4X64 Q;  5E4X A;  4HMJ A;  5IIF A;  1F2L A;  3GTJ B;  2OF1 A;  4P74 A;  1LAB A;  2AWN A;  1EQV A;  3U50 C;  4HJ7 A;  1QB5 D;  2F0O A;  3W5U A;  2KA7 A;  3GTK H;  4GKJ L;  5E6T A;  4OIJ A;  3NQT A;  4KK7 A;  1TY0 A;  1IYU A;  1YNN C;  1EOV A;  4L63 B;  5HY6 A;  1JJ2 A;  3KOJ A;  2R93 G;  2ZIT A;  1PYS B;  3RUZ A;  5IYN A;  2E2I B;  2H5X A;  4L5R C;  2F0Q A;  4XL9 A;  4IUN A;  2JA7 G;  3SLD A;  2FX3 A;  1EIG A;  1L1O A;  2WAQ G;  2YU9 B;  4XN3 A;  3G05 A;  1GUS A;  4A3M B;  5FLX c;  1BJK A;  2FJ2 A;  1IW7 D;  3EQL C;  3HRZ C;  3TBI B;  4OEL B;  1HQM C;  1STY A;  4RKB A;  1FD7 D;  5CGK A;  2I46 A;  4E0F A;  2O5J C;  4LBZ A;  2D9R A;  4DV1 L;  1OGI A;  2B63 G;  4FNF A;  1K83 H;  2B2U A;  3GTG B;  5CYU A;  1STH A;  3KF8 A;  2DUD A;  1SAP A;  4JVZ A;  3PUN A;  2B2T A;  4C3H H;  4HJ9 A;  2O5I C;  3OEH A;  1V5V A;  3TQY A;  3V2T A;  2CWA A;  1NMG A;  4IZ8 A;  4TRD A;  1SNQ A;  5CBE E;  4X3T A;  5IGG A;  1PDQ A;  3G71 A;  4BY7 G;  2WB1 B;  2WKC A;  4RLZ A;  1Q8I A;  1EY8 A;  1SE3 A;  2HHH L;  4HIM A;  1YNN D;  1CNF A;  4LF8 L;  2IX0 A;  3WNB A;  3J80 i;  2WPD A;  1H9J A;  1FGU A;  1X3Q A;  4WWV A;  3J81 c;  1XMO Q;  1Q90 A;  1G91 A;  2NN6 G;  4DV2 L;  2Z6B A;  2UXD L;  3D6W A;  2UXB L;  4S3S A;  1Q1E A;  1N34 Q;  4TQU S;  1F9P A;  1G6Z A;  4OWW B;  1MI2 A;  4YAO A;  2A1A A;  3CKI B;  4HAE A;  4J1M A;  2MQH A;  1A3T A;  2HQE A;  5EMN A;  2HDL A;  3J7Y W;  4Q7J B;  4IPC A;  3UI2 A;  4JK1 C;  4ZYS A;  1SFO B;  1UD6 A;  1Q3L A;  1ET6 A;  2KEC A;  2GJR A;  1B3A A;  2KHS A;  4OOV A;  5IGF A;  1TWG H;  1A8V A;  1JC7 A;  3S1Q H;  1KQS B;  1XNQ L;  2LZJ A;  1A3U A;  2ZL5 A;  4XKV A;  1I4P A;  2WV6 D;  4HID A;  3K5L A;  2B8G A;  3C2P A;  2VBV A;  1E1R A;  2BGI A;  1D7Q A;  4K5W A;  3QOJ A;  4DF7 A;  3VA7 A;  2QTL A;  1V9P A;  1VQP A;  1IJF A;  5TSS A;  2VS1 A;  2K5H A;  4P2N A;  2XWB B;  3CES A;  1CTM A;  1S5C D;  4ZKC B;  3CMA B;  1WD0 A;  4GKJ Q;  1JOQ A;  4HR7 B;  2EDG A;  4RGT A;  3ZYY X;  3S1N H;  1VQA A;  4F8M A;  3K7U C;  2DGY A;  2Z1C A;  5E1F A;  1B8A A;  2NYZ D;  3EFX D;  3HOZ G;  1OXT A;  4IOA A;  4R4O A;  4PC2 A;  2FVG A;  2JA8 H;  4RDK A;  3TP5 A;  1YJW A;  3M3Y H;  3EIV A;  2VNJ A;  3ULJ A;  1V43 A;  1X56 A;  2F4I A;  5H1S E;  2NPF A;  3HFZ B;  2QEX B;  4PQX A;  4Y9U A;  2QA4 A;  2F0U A;  1D1K A;  1QUE A;  4DV1 Q;  2XNJ A;  4PMB A;  5FLX L;  3M4Q A;  3CXC B;  2CCZ A;  2VBU A;  1SJH D;  4TSS A;  5HGQ A;  5GV7 A;  4NPS A;  3Q23 A;  5IOD A;  5ELB A;  4Y7N H;  3DM3 A;  1IBM L;  2B3G A;  1H9S B;  2A68 D;  2EFG A;  4FXG C;  3OYY A;  1WYD A;  4X8I A;  5COY A;  1N32 Q;  2CWP A;  3CAM A;  3HOV B;  1GOZ A;  4A93 H;  2OK7 A;  3PO2 G;  2XSC A;  2HHH Q;  2SDF A;  1DAR A;  4LF8 Q;  2VB3 X;  1ESR A;  4OL7 A;  3B78 A;  4OHJ A;  1JB9 A;  3KUP A;  1XB2 A;  2C5H A;  1DOL A;  3KLS A;  4CDD C;  5KIX A;  5M3M B;  4YAL A;  2UXD Q;  3VA5 A;  5F4O A;  2UXB Q;  2WJY A;  4XNF A;  3UDG A;  3ZUG A;  3TSS A;  3FKI G;  1RIP A;  1XNR L;  3M7N A;  4X6A H;  2PCF B;  1XJV A;  4KHP L;  3S15 H;  3CMM A;  1JOK A;  3I4N G;  1MJE A;  1VQ7 B;  1DD2 A;  3I1F A;  3U2Q A;  4RG1 A;  1WCM G;  2GJP A;  2I07 B;  3N6R A;  1JCK B;  1EYC A;  1KD1 D;  1M1K C;  4X0C A;  1FNM A;  1XNQ Q;  4R8I A;  4BY1 H;  1C7Y A;  3TZD A;  4PAA A;  2E2J B;  1VQ8 A;  1GUW A;  4XLC A;  3SVM A;  1FL0 A;  1FRN A;  4DQK A;  1Y69 U;  1HR0 L;  4HMI A;  5DLQ E;  2NVT B;  3PUX A;  4NB3 A;  5I6W A;  3ERO A;  4A3I B;  2F0N A;  1D8L A;  2X69 A;  2HDN B;  4NXN Q;  3C2Q A;  4XN0 A;  4RM0 A;  1EOT A;  3DEP A;  5IYB G;  3CP8 A;  2F1L A;  1PRT B;  1VF7 A;  3A8I E;  5K36 G;  4Z4Y A;  2Z4I A;  2L15 A;  3CU7 A;  4GLV B;  4JBW A;  1VMC A;  2X3U A;  1IYV A;  3S14 B;  1EZ8 A;  1LV9 A;  2LXJ A;  1Z47 A;  2IT1 A;  3HOX B;  3K5N A;  4DK6 C;  1E3Z A;  4HJ5 A;  1KTK A;  4H13 C;  4ZRZ A;  1G7T A;  3U9O A;  1QVG A;  1YIJ A;  2C5B A;  4QMG A;  2DY8 A;  1F20 A;  3FDT A;  4A3F B;  3I56 B;  1EL0 A;  2XND A;  5IP9 G;  2DEU A;  4ILW A;  4KN4 C;  5C0X G;  4TMV A;  5A88 A;  1PFS A;  1D1I A;  2OBR A;  2WKD A;  2K5N A;  1SNP A;  1AEX A;  2K04 A;  2Z6K A;  2NN6 I;  1PMR A;  2L5T A;  5E7N A;  1IBM Q;  3V96 A;  5C44 G;  3A8J A;  1B1Z A;  4DV3 L;  2ZXI A;  1YI2 B;  5LMN L;  4ZCL A;  1PH1 A;  2YTY A;  5DM7 3;  1VQ9 A;  1PRT C;  4UPA A;  5C4X H;  2DCU A;  4QV2 A;  5GAH C;  2BGJ A;  1QUQ A;  5IWA L;  3SJZ A;  5IT9 E;  1NTG A;  2RBM A;  2Q2U A;  2DY1 A;  1E79 A;  3HKZ G;  4PG3 A;  2RQX A;  1CQF A;  2CBX A;  1SM4 A;  2XGJ A;  1VQL A;  2ES2 A;  2VNU D;  5BN4 A;  1KK2 A;  1Q12 A;  2IW3 A;  1H8H A;  4KY7 A;  1NJI C;  2JA5 B;  3F2U A;  3LQ6 A;  4DQL A;  1VQD A;  1XNR Q;  4YWL A;  4KHP Q;  1GXD C;  1SYF A;  4X7C A;  2R93 H;  1QNK A;  3K8A A;  1K3B C;  5A2Q E;  1HH2 P;  1TQO A;  2XVS A;  2KBN A;  1VQG A;  1KRT A;  4RCO A;  3BU2 A;  2CW5 A;  4GNX B;  2JA7 H;  1TT2 A;  3BDC A;  3QFT A;  5LMZ A;  3A54 A;  1L0Y B;  2RA4 A;  4A3G G;  2BV3 A;  4FF3 A;  4JMQ A;  3CCR A;  1HNZ L;  3AB9 A;  4XT3 B;  2YTV A;  1HXY D;  2KOL A;  1HR0 Q;  3VNU A;  3J81 k;  2QMU A;  2KHJ A;  1QG0 A;  5M9O A;  3HOU B;  2B63 H;  1ILP A;  1VQB A;  3PV0 A;  2J0T D;  3CME A;  2PZU A;  4C3J G;  1TWA B;  1LTB D;  3OZW A;  5J3O A;  1M8A A;  4M1U B;  4FXU A;  1VQK A;  5BSX A;  5FKA C;  2EY6 A;  3BY1 A;  3MAQ A;  1VQ4 B;  4JOI A;  1K28 D;  4B43 A;  4DR1 L;  1NJI D;  4OPS A;  3GVK A;  1XWE A;  5TY0 A;  4BY7 H;  4BBS G;  5C4J B;  3LQE A;  3HOY B;  2L55 A;  4ACB A;  1WTH D;  3E0J A;  4R9W A;  2EZV A;  3E9H A;  1DDG A;  4C1N K;  2PQA B;  2X6Y A;  3M85 A;  4Z1M A;  3KF6 A;  1NB0 A;  2NN6 H;  3G4S A;  3OKX A;  3JQR A;  1O78 A;  5M5W B;  2A69 C;  1JOO A;  5C5L A;  4POG A;  3QE2 A;  4WZK A;  2K75 A;  1VQJ A;  1UD5 A;  3H0G B;  1PH5 A;  3BYT B;  2PE3 A;  3A8I A;  3ULL A;  5FL7 A;  3K5O A;  1H9M A;  1I6V C;  4JCV E;  1EQQ A;  1ZUN B;  3QWN A;  5EKI A;  1WTR A;  4DV3 Q;  1YHA A;  5LMN Q;  1GM5 A;  3NE5 B;  4A3C G;  3W2E A;  1B4O A;  3CRK C;  1AW7 A;  3AVT A;  1EY5 A;  1HA3 A;  3ERQ A;  3TP8 A;  3PO3 H;  3SE0 A;  1VHO A;  1VQE A;  2DY7 A;  1O80 A;  3ONA B;  5JVG 3;  3K80 C;  3S17 B;  3ZC3 A;  5IWA Q;  2X0K A;  3JQP A;  3MFY A;  1I6H B;  4B3X A;  1FNU A;  3LWU A;  4DXF A;  3MXP A;  1PHJ A;  2CKZ B;  1WTQ A;  3Q6Q A;  3GTM B;  3OWE B;  1ASY A;  1HCZ A;  1VQ6 B;  1Z7T A;  2L4N A;  3SEJ A;  1LTR D;  1GO3 E;  1W0K A;  4L8J A;  1DXM A;  1NB9 A;  2BM0 A;  3VMF A;  1PRT F;  5T1G A;  1C48 A;  2EY2 A;  2X8K A;  2HQL A;  3SJP A;  3FKS A;  3TP6 A;  3HOZ H;  2Z0S A;  1CKN A;  1ML0 D;  4EQP A;  2D0O A;  3ONY A;  2K50 A;  4CGY B;  3S2H H;  1Y1W B;  5I9O A;  3ES9 A;  3WY9 A;  4UZU A;  2E74 C;  2W6J A;  4Y9R A;  2CW0 C;  3NQI A;  2SNM A;  4GN4 B;  1HNZ Q;  1K8M A;  3E1Y E;  3T1Y L;  3HP3 A;  2WR8 A;  1KDA A;  1AE3 A;  2EXZ A;  5IOC A;  2HCC A;  1NUC A;  5GV8 A;  3P1H A;  1N8R C;  1D8T A;  1X9N A;  3PUZ A;  5EBC A;  2NBF A;  1TWC B;  5LHY 1;  1EIF A;  3KL9 A;  1SE2 A;  4RGO S;  4LF5 L;  4G1V A;  4HE5 A;  3CHB D;  4KY5 A;  2ALY B;  4FO2 A;  1Q81 D;  2LY7 A;  5C0X I;  2HCJ B;  5CBA E;  3Q0A A;  1WSV A;  5JEA G;  4DKA C;  4DR1 Q;  1N33 L;  2XNC A;  2ASB A;  4RDJ A;  4G7W A;  4ULL A;  4GOP B;  3NTK A;  4LF4 L;  4DA2 A;  4M0L A;  4UAJ A;  2IPK D;  1LO5 D;  4NXM L;  1L1O C;  2BCO A;  1EFU A;  1Q9S A;  3VNV A;  5BSY A;  3FMC A;  2VNK A;  1YIT B;  2L1B A;  3DHQ A;  1PV4 A;  3ULP A;  2F0L A;  4BBR G;  3FKI H;  1H9K A;  3A0J A;  2OTJ B;  2CW0 D;  4GN5 A;  1D1N A;  2X53 S;  1Q82 C;  3I4N H;  4R4Q A;  1E1T A;  1OXV A;  1RF2 D;  1N8R D;  1WCM H;  2B2T C;  4C0S A;  2SOB A;  4PC7 A;  1PH6 A;  1XMQ L;  4DR4 L;  1RQP A;  4ZQ3 A;  4JI0 L;  1EIH A;  1MSG A;  5A8A A;  3LVB A;  1K73 C;  1GD7 A;  2QIL A;  5JVH 3;  1EIY B;  3LO8 A;  2KHI A;  3I90 A;  4QCL A;  1OXU A;  4A3E G;  1EYG A;  2QEJ C;  2FHT A;  2XZL A;  1WTV A;  5D65 A;  2K5D A;  3GQB A;  2UU9 L;  5EPL A;  1IBK Q;  3PUV A;  3OMG A;  2FXQ A;  4GOP C;  3FJO A;  1K83 B;  4UHV A;  3D8G A;  2K28 A;  5IYB H;  2EYH A;  4JBJ A;  4KN7 C;  5FO1 A;  3P27 A;  4A4I A;  4C3H B;  4DR2 L;  5K36 H;  5AN9 A;  1KL9 A;  5ELE A;  3X3M A;  4OOS A;  1E0B A;  5M5X H;  2OXP A;  3G7L A;  1QE6 A;  1GVP A;  2OWO A;  2RHS B;  1QG7 A;  1A2U A;  1SSO A;  1Q82 D;  1QX4 A;  2XEX A;  3CC4 A;  3SK8 A;  2WZP P;  1S0U A;  3PGZ A;  3CCJ B;  1QVC A;  5JOB A;  2JA6 G;  1DDI A;  4JG2 A;  1O7Y A;  4JI2 L;  4XR6 A;  1FDR A;  3OE7 A;  3BYY B;  2QDL A;  2BH8 A;  3T1Y Q;  1N08 A;  4YIJ A;  1YJ9 B;  4II3 A;  3FP9 A;  5C0X H;  3J80 L;  2ZT9 C;  3DMU A;  2PMZ E;  1N05 A;  4DV6 L;  3MFG A;  5FO8 B;  4G7O C;  4UY8 C;  1S72 B;  1EUJ A;  4HCS A;  4LF5 Q;  1W3S A;  5C44 H;  1SR3 A;  2D3N A;  2Z4H A;  1PH3 A;  4P6Y A;  1UD3 A;  1TWG B;  2Z6B D;  3OPO A;  4JI4 L;  3S1Q B;  1N33 Q;  2ZBU A;  1VQO B;  2NVQ H;  1F2Z A;  1YBY A;  5FO9 B;  5IGC A;  3DUZ A;  1AMO A;  4XM3 A;  3D3R A;  5HUR A;  1CT1 D;  1LTG D;  4LF4 Q;  1GUT A;  4XYO A;  4NXM Q;  2IHF A;  2KEE A;  3MXU A;  3AGQ A;  1NCV A;  4OP7 A;  2B7C A;  1SEB D;  1YHQ B;  1CKM A;  3ZIA A;  1YZ6 A;  4LFC L;  1HJP A;  2DN8 A;  3J81 j;  1K0R A;  4ODG A;  2YWE A;  2VBS A;  3MEH A;  5F4M A;  4P2C B;  2RC6 A;  4DR4 Q;  1VQN B;  2B2Y A;  1XMQ Q;  1PJ6 A;  2J7K A;  2MGS A;  2VW9 A;  1NBW A;  5TV2 A;  1EP3 B;  4RCZ A;  4ZGN B;  2HDM A;  2LMC B;  2JA8 B;  1KK0 A;  2GRE A;  3G6J B;  3DM1 A;  1JR0 D;  3M3Y B;  1WOS A;  4A3G H;  3HOW G;  3N52 A;  2DOG A;  1CK1 A;  5COR A;  3A1P A;  2UU9 Q;  4B3R L;  3DDY A;  3CD6 B;  1J9Z A;  1CI3 M;  4IQZ A;  3OOC A;  4C3J H;  3S24 A;  2C77 A;  1UEB A;  2EE1 A;  1DZ1 A;  2F0D A;  4Y7N B;  4DR2 Q;  4C3I G;  2Z8L A;  2JSO A;  5C3E H;  3G6E A;  3J7A F;  2Q8T A;  3WXM A;  4XQQ A;  4WJ4 A;  2C9O A;  3AVU A;  3M4Y A;  2BH2 A;  4FXD A;  2C5C A;  4QL5 A;  4HCE A;  4K6L A;  4BBS H;  4A93 B;  1SBB B;  5IGE A;  1F2Y A;  3I73 A;  1ENC A;  4QVA A;  2XNA C;  4F88 A;  1U5K A;  5C6A A;  4AC9 A;  3S2D B;  1OTC A;  1KAA A;  4A3M G;  4OON A;  4JI2 Q;  2ZJP A;  2Q6I A;  1AP0 A;  4KD3 A;  2PYK A;  4K5X A;  1I4R A;  5CDF A;  2AQ3 B;  1IW7 C;  3BZK A;  4DUY L;  2UUB L;  2X6L A;  1KJZ A;  1HNW L;  4NNJ A;  1U4M A;  5ELD A;  4DV6 Q;  5HZA A;  2F0J A;  2ZJQ A;  4K2K A;  3S15 B;  1QFZ A;  4XQF A;  4RMF A;  4HJ8 A;  1BO0 A;  1J8I A;  1PJ5 A;  4QUC A;  1K0S A;  1WTW A;  1E22 A;  3CCL A;  4A3C H;  3TZU A;  4JI4 Q;  1O7L A;  4RCN A;  3CPW B;  4BY1 B;  3E20 A;  4PZ7 A;  2DJF C;  3CCU A;  4P12 A;  3NP8 A;  1D5X C;  1PH4 A;  3KDF B;  3W2I A;  1T9H A;  2H4O A;  1CQX A;  3SR1 A;  4ALP A;  1NY4 A;  1JNY A;  2OQK A;  1S5E D;  2VY3 A;  1NAP A;  5DN6 A;  4Z4Z A;  1GJR A;  2EJM A;  2MPM A;  2TSS A;  4AIM A;  3JAM E;  5L46 A;  4LNQ A;  2EXD A;  4LFC Q;  4JI1 Q;  4X05 A;  4X7E A;  2Z6K C;  3NEN A;  1BPL A;  2Q8R E;  1PTO H;  1X3G A;  4V0B A;  1LTL A;  1IXR A;  1XTC D;  5K5P A;  4H7B A;  1B50 A;  2K33 A;  4FDB A;  3CC7 A;  4DV0 L;  4J0Q A;  2Y0S B;  4FP5 D;  4HIZ A;  2OT2 A;  1ZM2 A;  4JI7 L;  5J35 A;  1EQR A;  4LK1 C;  4A3K B;  3D4R A;  4YCV A;  1Q8K A;  4LF6 L;  2WZN A;  4X7D A;  4HE6 A;  4B3R Q;  1KLG D;  5IYD G;  1VHE A;  1Y1V H;  2AQ1 B;  5LL6 X;  1COW A;  5IY0 A;  3CPX A;  4MYT A;  1J6Q A;  1V0E A;  1W2B B;  1W6K A;  4F7X A;  1TWH H;  2VZL A;  4XOT A;  1IL8 A;  2ID0 A;  4DAY B;  5JEA H;  2KCC A;  2R6H A;  3RD4 A;  1VDZ A;  2M5S A;  1B23 P;  2Q8I B;  1EFT A;  3RN5 A;  1SKY B;  3P26 A;  3AGP A;  4G7H C;  4RD1 A;  3R3O A;  4CJ2 C;  5F4J A;  2OTL B;  2N3S A;  3OMC A;  5FJ8 G;  1AN8 A;  5EKK A;  4GQN A;  1LTI D;  4BXX G;  1A8P A;  1DYQ A;  2JDI A;  1I4G A;  2LSS A;  1T6Z A;  1B2T A;  1NR2 A;  2HD3 A;  4BBR H;  4DUY Q;  2UUB Q;  1B9M A;  2F52 A;  1HNW Q;  4DAM A;  4DNI A;  1IKM A;  3PO3 G;  4NCN A;  2AKW B;  3K59 A;  5CV8 A;  2R93 B;  4XLA A;  4XLH A;  4P25 A;  5J1Z A;  4RGN A;  1KZL A;  4MZ9 A;  2ZTE A;  4TT3 A;  3CC2 A;  4JOI C;  1R4Q B;  2A68 C;  1WFQ A;  2FMM A;  2WAQ B;  4NMZ A;  4BA1 I;  1E2Z A;  4HJA A;  2VUM G;  4A3E H;  1R9T H;  3M4O B;  4CJ0 B;  2HIV A;  4I7A A;  4QY7 A;  1BF4 A;  5J39 A;  2B2V C;  2V31 A;  1PVO A;  4M2L A;  4Z4R A;  2CHB D;  1V8Q A;  1XE1 A;  1ILQ A;  2KVM A;  5CC4 A;  2B2W A;  2ZM6 L;  2XN9 C;  3W2F A;  1OXS C;  3M7G A;  3P7J A;  4MYU A;  4R4C A;  1YJN B;  3BNW A;  3D4D A;  2K03 A;  3VYR A;  4BWG B;  5ISR A;  4QIW B;  4A76 A;  1HZC A;  5DNF A;  2B29 A;  2VB2 X;  3RLN A;  3CP0 A;  3F2B A;  4N9T A;  2C2W A;  4KKT A;  3OW2 A;  1I4X A;  5GAG C;  1KTV A;  2PPB C;  2ZTC A;  4KHZ A;  3JAM i;  3CCV A;  5JJL A;  3NBH A;  4DK3 C;  1HFN A;  2EYF A;  4Y7C A;  2R6G A;  2AUJ D;  4DV0 Q;  5M3F H;  1AH9 A;  1KD1 C;  2JA6 H;  3F2C A;  4TSF A;  1S3O A;  4JI7 Q;  1ENA A;  2BA0 A;  3DLL A;  1VCI A;  4X62 L;  5FLM G;  1QJO A;  2KCM A;  4LF6 Q;  3WWV A;  2AHO A;  1NNX A;  2B5O A;  2F0W A;  1HNX L;  3RZO B;  4WRD A;  4Z4U A;  1XPO A;  3OAA A;  1Q1B A;  2DNC A;  4K14 A;  2E2H B;  4MN3 A;  1BVS A;  1YHB A;  2NB0 A;  3CCM A;  1AIP A;  4CDC C;  3C46 A;  3A3B A;  5A35 A;  3X3N A;  1HR0 W;  1VQ5 B;  4ZCM A;  2PZW A;  1B2R A;  3MEF A;  4K6D A;  5GQO A;  3CCE A;  2EYO A;  4DV2 Q;  4QHY A;  2K05 A;  2L11 A;  3H3V I;  4ROX A;  4LC0 A;  1ENF A;  1WPC A;  1CNE A;  1I8D A;  2F0I A;  3A5U A;  3A7A B;  3S1M B;  4Z4S A;  5D3I B;  3GV6 A;  4XYQ A;  5FA6 A;  1YNJ D;  1I50 H;  3MXG A;  3I72 A;  1EWY A;  2CH4 W;  3URY A;  3FPU B;  1K8G A;  3J7A 5;  1TWF H;  4DAV A;  4WQM A;  5IP7 H;  4KKS A;  5LMU L;  4AF7 A;  1SLJ A;  2K52 A;  4JYA L;  3MHB A;  1N0U A;  1CKO A;  3HOZ B;  2EJF C;  4IN3 A;  2RDF A;  1FGB D;  5IT9 L;  4EQ5 A;  3GD7 A;  4JW0 A;  3QOL A;  3S16 H;  2F1M A;  1YVC A;  3S2H B;  5BR8 L;  4LUV A;  3K57 A;  5I2X A;  1CZW A;  3GVJ A;  3HOW H;  4OEM B;  4JBK A;  3VR4 A;  4U9U A;  2D2C C;  4DK1 A;  2WB1 E;  2WP8 J;  3FPK A;  5ELF A;  5LMN W;  1B9N A;  2BPO A;  1TY2 A;  3GTJ H;  2IX1 A;  2ZM6 Q;  4OOX A;  3AQQ A;  4XIG S;  3TN2 A;  4A3B G;  4HSV A;  2R92 B;  1TS3 A;  3Q38 A;  4C3I H;  3RZD B;  2JEA I;  5FLX E;  3V05 A;  2V1C C;  2F3V A;  4PNY A;  5F2D A;  3JC6 6;  4P75 A;  4KHV A;  4B44 A;  4RDL A;  5FO7 B;  3PO2 B;  3UE1 A;  1YEZ A;  2E2I H;  5IGB A;  3CCQ B;  1WI5 A;  1IBL L;  1WTP A;  2F4N A;  1SE4 A;  1KAB A;  4C2M B;  3PF5 A;  2YU9 H;  3IAY A;  4A3M H;  2N88 A;  4Y52 H;  4G7X A;  2QTZ A;  2JA9 A;  1BDO A;  2SEB D;  4LUO A;  2OEO A;  4R8N A;  4XT1 B;  3T13 A;  1MAB A;  4KD4 A;  4NP5 A;  3WOF A;  4X62 Q;  3T1H L;  4A3J B;  3U9S A;  1HNX Q;  3GTQ H;  4Q0F A;  1V1P A;  1HUM A;  3FKI B;  2NVY B;  3GTG H;  4A3L H;  3T16 A;  4Q5V A;  3AFP A;  2G5D A;  3I4N B;  2I5H A;  3H3V H;  2EVB A;  3J81 E;  1WCM B;  3NEM A;  1TU2 B;  1JMC A;  2UUC L;  4ZCK A;  5JJZ A;  5TRD A;  2BE5 C;  3RN2 A;  4MTN A;  1TKW B;  3EVQ A;  2R7D A;  3RLO A;  1ROD A;  1UWV A;  4IUP A;  4AYB B;  1G7R A;  3K7A H;  3U6K A;  3KLW A;  2EYL A;  1R5B A;  1XPR A;  1V0F A;  3VO1 A;  4QUZ A;  5HZB A;  5G3L D;  4GKK L;  3W3A A;  4QIW E;  2YYZ A;  3OP1 A;  1KMH A;  2JJ2 A;  2QN6 A;  2PI2 E;  1WD1 A;  5BN3 A;  2P3M A;  3L9A X;  4UZF A;  1OXX K;  3HAG A;  2ZXR A;  4P73 A;  4RA8 A;  4BA2 I;  1EY0 A;  4ASU A;  3A7L A;  2IWH A;  3SLN A;  4OO1 G;  5M5X B;  5LMU Q;  1FRQ A;  1II3 A;  1Y8N B;  4K8I A;  3KBX A;  4B3T L;  1RTN A;  3Q6S A;  2VNH A;  2RCF A;  1BMF A;  4DK0 A;  4CJ1 B;  2NZH A;  4NW2 A;  5M5Y B;  1P16 A;  3JQQ A;  1IJE A;  1X32 A;  3C1E A;  5GAD C;  2JYO A;  5BR8 Q;  4XQJ A;  1BCP C;  3AST A; 
#chains in the Genus database with same CATH homology
 1EFI D;  4X3K A;  2BE5 D;  3VYS A;  3Q22 A;  1EY9 A;  1CZG A;  1UNS A;  4IFD J;  3RMH A;  3A35 A;  5C44 B;  2NTT A;  5EBD A;  3BH4 A;  2KED A;  2NVQ B;  4IUT A;  3OFN A;  5E3F A;  4DNR B;  3I3C A;  1V1O A;  2G9H D;  1A3V A;  2B2Y C;  3DWA A;  3FRP B;  2B39 A;  1SYC A;  1XYI A;  1EZ6 A;  1KNA A;  2ICE C;  4XOP A;  1JWU D;  4XOR A;  3EA6 A;  3VR6 A;  3GTO B;  2ZTN A;  1BCP D;  4XMY A;  4B9X A;  5CV6 A;  1GUN A;  4PV1 C;  3R93 A;  1D2B A;  1U4P A;  4ABN A;  2GJK A;  2WII B;  1STN A;  1RKN A;  2VJJ A;  2MUY A;  2ZZG A;  4L6T B;  2F43 A;  1BQQ T;  4A3G B;  5EGT A;  1BOS A;  4FYD A;  1HFG A;  4CBV A;  1PYW D;  2CQA A;  2A5H A;  4C3J B;  3LNN A;  2E75 C;  3LWE A;  1S4Z A;  4NKL A;  1QCB D;  2G9D A;  5IGD A;  3MVV A;  4BBS B;  4NDX A;  1EWH A;  1UD4 A;  4IUV A;  1KDC A;  4C1N I;  4ZUJ A;  4HSP A;  1SYB A;  2CVR A;  3L3O C;  4PMW A;  4DN4 M;  3C1F A;  5ELC A;  4ME5 A;  3R8B A;  4DAP A;  5EPJ A;  2EPB A;  2DNE A;  2NVX B;  2F0K A;  5I4D A;  2EYJ A;  4I7Z C;  4X3S A;  2GK6 A;  1WVL A;  1PZJ D;  1BCP F;  1H9S A;  3IKJ A;  4XLE A;  1DOM A;  1D5M C;  3GTK B;  2EYP A;  1ZKO A;  1LT5 D;  1STA A;  2B2U C;  1E1Q A;  2ZXP A;  1LTS D;  4ZLT F;  1BUV T;  2E2D C;  2IJ0 A;  3I4L A;  1O7Z A;  4GZY C;  4WFN 3;  1E43 A;  4EVO A;  5BN5 A;  2XRS D;  2PW7 A;  2ZZE A;  1W0J A;  3SHL A;  5C4H A;  1TR5 A;  5EPK A;  4OO1 I;  3NBI A;  2E1B A;  4KKU A;  1C4Q A;  5T1I A;  2D9U A;  3Q24 A;  2JIZ A;  5EKL A;  5AFW A;  3SEB A;  3DXJ C;  2L0C A;  1TWH B;  3D6C A;  2PNR C;  1QIL A;  3S9W A;  5KRU A;  3WQZ A;  2A6H D;  1G29 1;  5I6Y A;  4F87 A;  2K5Q A;  4KMU C;  2ZXH A;  3C3L A;  1SYD A;  3D4W A;  2WIN B;  1PTO C;  3ITP A;  3K0Y A;  4O1N A;  1RJT A;  2B8F A;  1I4Q A;  3BS1 A;  4XD7 A;  2RDG A;  2IL8 A;  3NTH A;  1EQT A;  1UUP A;  4QUF A;  2EOT A;  4QB4 A;  1B44 D;  1HTL D;  1CFM A;  3HZX A;  4A3E B;  2X85 A;  5CV4 A;  1WP6 A;  1LT6 D;  1L0X B;  3BVM A;  5EJW A;  1XXG A;  2X6X A;  3LX0 A;  3S1N B;  3OWF A;  1FYC A;  3PMF A;  1F9R A;  3KLS X;  1CA5 A;  1PTO D;  4XDX A;  3EJI A;  2A74 C;  1PZI D;  2BOS A;  4OO1 H;  1SXT A;  4EQO A;  1B53 A;  3MWY W;  1LTA D;  1CM9 A;  2RSN A;  1JWM D;  2RSO A;  2XOK A;  4CKC A;  2ICI A;  2JA6 B;  4RFB A;  5D3D A;  1BLI A;  2EY5 A;  4RHS A;  3MZ5 A;  5KND A;  3BCF A;  4DNT B;  2JEB I;  5CV7 A;  5C3W A;  1TVX A;  2CK3 A;  1GHK A;  1DCZ A;  1PXU A;  2K5W A;  4BS9 A;  1T5X D;  1DM0 B;  2NTS A;  1SYG A;  5DM6 3;  4XTC S;  3PUW A;  1DOK A;  1I50 B;  3H91 A;  4MIU A;  4ID6 A;  3OIQ A;  4YEJ A;  4RH6 A;  1AZP A;  3NHH A;  2QE7 A;  1SYE A;  1TWF B;  1SNO A;  2EYM A;  1X3P A;  3KK7 A;  2HLD A;  4AVZ A;  2R61 A;  3T56 B;  2GK7 A;  1ZYR D;  5KYI A;  4DXG A;  1WTO A;  2F3W A;  3S16 B;  1PTO F;  1HPC A;  4WJW A;  3VR2 A;  4I65 A;  3HOW B;  1SMY D;  2F03 A;  2F0G A;  3OIP A;  1LAC A;  3MA2 B;  4HED A;  1SNM A;  1KDB A;  2XZP A;  2H1E A;  4C3I B;  3R2T A;  3ZPN A;  1HZE A;  3IFT A;  5CV9 A;  1EEF D;  4XKW A;  3QG1 A;  2EY1 A;  4FF1 A;  2SNS A;  1CA6 A;  2LS0 1;  2PQE A;  3OW7 A;  1UEA B;  4RWS C;  4FF2 A;  3GTQ B;  1E2V A;  1S5B D;  3BDL A;  2QDB A;  4OGQ C;  5C4X B;  4EQN A;  4IUU A;  3P20 A;  2M00 A;  1NBM A;  4KY6 A;  4DU9 A;  3FPP A;  3K7A B;  2QCP X;  1PLF A;  1H8E A;  4PMC A;  1T5E A;  1OB0 A;  1BNZ A;  1AFP A;  1CHP D;  1RTO A;  2GA4 B;  3NWS A;  5NUC A;  1FX0 A;  3VYU A;  1JQY D;  1PZK D;  2B63 B;  3W2D A;  3H3V C;  2ZXO A;  3NPP A;  2JP1 A;  3JU4 A;  2MP1 A;  2X6G A;  5JPN C;  3GTP B;  4H0L C;  1LT3 D;  1C8C A;  2AQ2 B;  2R9V A;  4FXK C;  3NSW A;  3HGB A;  4BY7 B;  1WTX A;  1BBX C;  1GUG A;  1F2M A;  1YNJ C;  2K7V A;  3OSO A;  1EEI D;  1TS2 A;  3ND9 A;  3A8J E;  1U9R A;  1PFM A;  2BDO A;  4DGZ A;  1S5D D;  3MTS A;  1HA5 A;  4KJO A;  4OIK A;  3NTI A;  3HS0 C;  4QF4 A;  1I18 A;  4K2L A;  3PIP 3;  2PW5 A;  1U4R A;  4LMQ D;  4G6I A;  2XZO A;  1Y8P B;  4EGV A;  2NUC A;  3PO3 B;  2K6A A;  4IUR A;  4FVM A;  2VXW A;  1U4L A;  3T51 B;  1BR9 A;  1Z6H A;  4ZAI A;  3ND8 A;  3KEW A;  4B9W A;  5JPM C;  2VUM B;  1F9S A;  2FIN B;  3QB3 A;  3K5M A;  1HA6 A;  2MHV A;  2KVO A;  4XLF A;  3J81 L;  1RD9 D;  2X6W A;  1QOH A;  2K1B A;  3GP7 A;  1KLU D;  3HEJ A;  3DWQ A;  3AMU A;  5C5M A;  2K32 A;  1GJX A;  4HTH A;  5FK9 C;  1HQR D;  3OHX C;  2E76 C;  1STE A;  1R4P B;  2JE6 I;  5KGU A;  5A2Q L;  2WSS A;  4G7Z C;  1JOR A;  4CKB A;  3FVQ A;  4KV6 A;  1TS5 A;  5I2Y A;  4IFD G;  3CQZ B;  4C56 C;  3GTL B;  1E3X A;  5DEH A;  2J4X A;  2NZ1 D;  5D14 A;  3A55 A;  2A73 B;  5KYL A;  1ONL A;  2V4D A;  3A8K E;  1OO9 B;  1HVX A;  2PZT A;  1FNW A;  1BCP B;  1LT4 D;  3BVG A;  3NXW A;  1NR4 A;  1ZXT A;  1DON A;  3GVL A;  5E4W C;  1M4V A;  3AU7 A;  3MC0 B;  1QWY A;  3L7Z C;  3H6M A;  3HG9 A;  1EWC A;  1NSN S;  1MGS A;  2QKI C;  4XQN A;  1BXT A;  1G2T A;  1PFB A;  1TII D;  2D5D A;  1PFN A;  1MSH A;  2F0T A;  3K58 A;  1IKL A;  1A2T A;  4KTA A;  4A3B B;  1MD2 D;  2RVL A;  4B3F X;  3P75 A;  1CQV A;  2IX3 A;  2F0F A;  1EY4 A;  3GV3 A;  5KNC A;  5CV5 A;  2F0M A;  2RDH A;  4J8Q A;  4WOR A;  1ET9 A;  3QJY A;  4RKL A;  1UD8 A;  2F0S A;  1PRT D;  2EJG C;  4UDU C;  1MBY A;  1SND A;  1RCV D;  2O2L D;  4RHR A;  5FOB B;  3VR5 A;  1KNE A;  3SXH A;  3A3G A;  3CP2 A;  1JIC A;  3HKZ B;  3I8Z A;  4DAY A;  2B2V A;  1SJE D;  2M2L A;  2A6E C;  1RDP D;  5C0X J;  4UAI A;  2AUK A;  3IFD A;  5G3L F;  3WDN A;  2KUM A;  3D31 A;  4HN7 A;  2ZZQ A;  3J7A V;  1STB A;  5DAU A;  1XX8 A;  2QF7 A;  5KEE A;  3S1R B;  2HCI A;  2PMZ B;  1SDF A;  3GO5 A;  1LTT D;  4CHT B;  2BA1 A;  1EYA A;  2F0H A;  4V19 0;  2F0P A;  5C3E B;  2FMC A;  1EYD A;  2JJ1 A;  2V7Q A;  4KJN A;  4YXW A;  1VF5 C;  2A6E D;  3I91 A;  4DFA A;  4P22 A;  2A69 D;  3TDQ A;  4U68 A;  4IFD I;  1VLY A;  3BVZ A;  2KCN A;  2RKS A;  3H94 A;  4E6I A;  2KJX A;  1TS4 A;  1UAP A;  3O13 A;  1EY6 A;  4C3H G;  4U67 3;  1HRJ A;  2K01 A;  2LFN A;  3A56 A;  5LL6 S;  2F0E A;  1W9X A;  3I70 A;  1RHP A;  1GHJ A;  3NUC A;  2KQ3 A;  2AWO A;  3VR3 A;  2XIW A;  3SK6 A;  5JAV A;  2A6H C;  4RAU C;  3SK4 A;  3TP7 A;  5I9P A;  1FR3 A;  3QO2 A;  5CMD A;  4J6H A;  3K6O A;  1PTO B;  1OHH A;  1JWS D;  3DEO A;  5C4Z A;  3KLR A;  1F77 A;  1I3Q B;  4II2 A;  2L12 A;  1HUN A;  2NWG A;  5J22 A;  1A15 A;  1W6J A;  2O4X A;  2WJV A;  3FEW X;  4IUQ A;  3PIO 3;  3BCD A;  1JE4 A;  1HTP A;  1Y1V B;  4LAA A;  2D3L A;  4Z9C B;  1CHQ D;  2ENB A;  4LJZ C;  1F9Q A;  1D6E C;  2ZZF A;  5HKK A;  4CKE A;  4A3D B;  4IFD H;  2J7Z A;  4ZK9 B;  1LLR D;  3R2I A;  4KI0 A;  1AZQ A;  2PO4 A;  4MHE A;  3T4A C;  4RGM A;  2N55 A;  3E5S A;  4K8J A;  3OEE A;  4FF4 A;  1NRK A;  1VMP A;  4BBR B;  2B2W C;  4ZUI A;  5KNB A;  4XON A;  3SK5 A;  2W6I A;  2FFK B;  2XRQ D;  1PKV A;  5JEA J;  1ZEQ X;  1R9T B;  5IK2 A;  2F0V A;  1HHV A;  1ICW A;  4X3U A;  3DWP A;  3QIA A;  2XWJ B;  4YEL A;  1VJS A;  3T53 B;  5KNL A;  2D62 A;  3NK9 A;  1A6X A;  1DJR D;  2HUG A;  2R3Z A;  4H44 C;  2WAC A;  4M8A A;  1SNC A;  1G2S A;  3VYT A;  4B3G A;  4XXE A;  5M3F B;  3BZD B;  3NWT A;  1EFR A;  2TMP A;  2VJI A;  1I4H A;  3JAM L;  4G57 A;  3E6Z X;  1Y8O B;  4K5V A;  1ZYR C;  4B08 A;  5CR3 A;  1ESF A;  3BDO A;  3J80 E;  1SMY C;  2LKV A;  1K8O A;  5EQ0 A;  3PUY A;  2M9V A;  5HGT A;  3CRL C;  1S5F D;  4O42 A;  3RLF A;  2JXM B;  4ZKB B;  2DIE A;  4IAL A;  2L9H A;  5C3X A;  1EU3 A;  1V1P B;  3SDZ A;  1GUO A;  2MJ8 A;  3TME A;  1UD2 A;  3WOE A;  3BC9 A;  3IL8 A;  4G4K A;  1JB3 A;  1FNV A;  1QNU A;  1EY7 A;  1G8Z D;  3BG3 A;  1STG A;  2ZTG A;  1H9R A;  3MXN A;  2R7Z B;  1D5Z C;  4N9P A;  3KBG A;  3I4M B;  1EU4 A;  1E2W A;  1J9O A;  1IHZ A;  4TKO B;  2BDN A;  3H09 A;  5E4X A;  4HMJ A;  5IIF A;  1F2L A;  3GTJ B;  2OF1 A;  1LAB A;  2AWN A;  1EQV A;  1QB5 D;  2F0O A;  2KA7 A;  4OIJ A;  3NQT A;  4KK7 A;  1TY0 A;  1IYU A;  1YNN C;  4L63 B;  3RUZ A;  2E2I B;  2F0Q A;  4XL9 A;  4IUN A;  1EIG A;  2YU9 B;  4XN3 A;  3G05 A;  1GUS A;  4A3M B;  2FJ2 A;  1IW7 D;  3EQL C;  3HRZ C;  3TBI B;  1HQM C;  1STY A;  4RKB A;  1FD7 D;  5CGK A;  2I46 A;  4E0F A;  2O5J C;  4FNF A;  2B2U A;  3GTG B;  5CYU A;  1STH A;  3KF8 A;  1SAP A;  2B2T A;  2O5I C;  3OEH A;  3V2T A;  4IZ8 A;  4TRD A;  1SNQ A;  5CBE E;  4X3T A;  5IGG A;  1PDQ A;  2WB1 B;  2WKC A;  1Q8I A;  1EY8 A;  1SE3 A;  1YNN D;  2IX0 A;  2WPD A;  1H9J A;  1X3Q A;  1Q90 A;  1G91 A;  2NN6 G;  3D6W A;  4S3S A;  1Q1E A;  4TQU S;  1F9P A;  1G6Z A;  1MI2 A;  3CKI B;  4HAE A;  4J1M A;  1A3T A;  2HQE A;  2HDL A;  3J7Y W;  3UI2 A;  4JK1 C;  4ZYS A;  1SFO B;  1UD6 A;  1Q3L A;  1ET6 A;  2KEC A;  2GJR A;  1B3A A;  2KHS A;  5IGF A;  1JC7 A;  2LZJ A;  1A3U A;  4XKV A;  1I4P A;  2WV6 D;  3K5L A;  2B8G A;  3C2P A;  1E1R A;  4K5W A;  3QOJ A;  4DF7 A;  3VA7 A;  5TSS A;  2XWB B;  3CES A;  1CTM A;  1S5C D;  4ZKC B;  1WD0 A;  1JOQ A;  4HR7 B;  2EDG A;  4RGT A;  3ZYY X;  4F8M A;  2Z1C A;  5E1F A;  3EFX D;  2NYZ D;  1OXT A;  3TP5 A;  1V43 A;  2F4I A;  4PQX A;  2F0U A;  1D1K A;  4PMB A;  5FLX L;  1SJH D;  4TSS A;  3Q23 A;  5IOD A;  5ELB A;  1H9S B;  2A68 D;  4FXG C;  5COY A;  3HOV B;  1GOZ A;  2XSC A;  2SDF A;  2VB3 X;  1ESR A;  4OL7 A;  4OHJ A;  3KUP A;  1DOL A;  3KLS A;  5KIX A;  5M3M B;  3VA5 A;  2WJY A;  4XNF A;  3TSS A;  3M7N A;  2PCF B;  3CMM A;  1JOK A;  1DD2 A;  2GJP A;  2I07 B;  3N6R A;  1JCK B;  1EYC A;  4R8I A;  3TZD A;  2E2J B;  1GUW A;  4XLC A;  3SVM A;  1Y69 U;  4HMI A;  2NVT B;  3PUX A;  5I6W A;  3ERO A;  4A3I B;  2F0N A;  2X69 A;  4XN0 A;  3DEP A;  1EOT A;  3CP8 A;  1PRT B;  1VF7 A;  3A8I E;  5K36 G;  4JBW A;  2Z4I A;  3CU7 A;  1VMC A;  1IYV A;  3S14 B;  1EZ8 A;  1LV9 A;  1Z47 A;  2IT1 A;  3HOX B;  3K5N A;  1E3Z A;  1KTK A;  4H13 C;  4ZRZ A;  3U9O A;  4QMG A;  2DY8 A;  3FDT A;  4A3F B;  1EL0 A;  2XND A;  4ILW A;  4KN4 C;  5C0X G;  1D1I A;  2WKD A;  1SNP A;  1AEX A;  2K04 A;  2NN6 I;  1PMR A;  2L5T A;  3V96 A;  1B1Z A;  2ZXI A;  5DM7 3;  1PRT C;  5IT9 E;  2RBM A;  1E79 A;  2RQX A;  1CQF A;  2XGJ A;  2VNU D;  5BN4 A;  1Q12 A;  2IW3 A;  2JA5 B;  1H8H A;  4KY7 A;  3F2U A;  1GXD C;  1SYF A;  1QNK A;  5A2Q E;  1TQO A;  2XVS A;  4RCO A;  1TT2 A;  3BDC A;  3A54 A;  1L0Y B;  2RA4 A;  4FF3 A;  4JMQ A;  3AB9 A;  4XT3 B;  1HXY D;  2KOL A;  5M9O A;  1ILP A;  3HOU B;  3PV0 A;  2J0T D;  2PZU A;  4C3J G;  1TWA B;  1LTB D;  1M8A A;  4M1U B;  4FXU A;  5FKA C;  2EY6 A;  3MAQ A;  1K28 D;  3GVK A;  1XWE A;  5C4J B;  3HOY B;  2L55 A;  1WTH D;  3E0J A;  4R9W A;  2EZV A;  4C1N K;  2X6Y A;  3M85 A;  4Z1M A;  2NN6 H;  5M5W B;  1O78 A;  2A69 C;  1JOO A;  5C5L A;  1UD5 A;  3H0G B;  3BYT B;  5FL7 A;  3K5O A;  1H9M A;  1I6V C;  3QWN A;  5EKI A;  1WTR A;  3NE5 B;  1B4O A;  3CRK C;  1AW7 A;  1EY5 A;  3ERQ A;  3TP8 A;  3SE0 A;  2DY7 A;  1O80 A;  3ONA B;  5JVG 3;  3S17 B;  3MFY A;  1I6H B;  1FNU A;  3LWU A;  4DXF A;  3MXP A;  1WTQ A;  3GTM B;  3OWE B;  1HCZ A;  1Z7T A;  2L4N A;  1LTR D;  1W0K A;  4L8J A;  1DXM A;  5T1G A;  1PRT F;  1C48 A;  2EY2 A;  2X8K A;  3FKS A;  3TP6 A;  1ML0 D;  4EQP A;  4CGY B;  1Y1W B;  5I9O A;  4UZU A;  2E74 C;  2W6J A;  2CW0 C;  3NQI A;  2SNM A;  1K8M A;  3HP3 A;  1KDA A;  2EXZ A;  5IOC A;  2HCC A;  1NUC A;  3P1H A;  3PUZ A;  5EBC A;  2NBF A;  1TWC B;  5LHY 1;  1SE2 A;  4RGO S;  3CHB D;  4KY5 A;  4FO2 A;  2LY7 A;  5C0X I;  5CBA E;  3Q0A A;  5JEA G;  4G7W A;  4ULL A;  3NTK A;  4DA2 A;  2IPK D;  1LO5 D;  2BCO A;  3FMC A;  2L1B A;  3DHQ A;  2F0L A;  1H9K A;  2CW0 D;  2X53 S;  1OXV A;  1RF2 D;  2SOB A;  2B2T C;  4ZQ3 A;  1EIH A;  1MSG A;  2QIL A;  5JVH 3;  3I90 A;  4QCL A;  1OXU A;  2QEJ C;  2FHT A;  2XZL A;  1WTV A;  5D65 A;  2K5D A;  3GQB A;  5EPL A;  3PUV A;  3OMG A;  1K83 B;  3D8G A;  2K28 A;  2EYH A;  4KN7 C;  4C3H B;  5K36 H;  5ELE A;  3X3M A;  1E0B A;  2OXP A;  3G7L A;  1QE6 A;  1QG7 A;  1A2U A;  1SSO A;  3SK8 A;  2WZP P;  5JOB A;  1O7Y A;  4XR6 A;  3OE7 A;  3BYY B;  4YIJ A;  4II3 A;  5C0X H;  3J80 L;  2ZT9 C;  3DMU A;  3MFG A;  5FO8 B;  4G7O C;  4HCS A;  2D3N A;  2Z4H A;  1UD3 A;  1TWG B;  2Z6B D;  3OPO A;  3S1Q B;  1F2Z A;  5FO9 B;  5IGC A;  3DUZ A;  4XM3 A;  3D3R A;  5HUR A;  1CT1 D;  1LTG D;  1GUT A;  4XYO A;  2KEE A;  3MXU A;  1NCV A;  1SEB D;  3ZIA A;  2DN8 A;  4ODG A;  3MEH A;  4P2C B;  2B2Y A;  2MGS A;  2HDM A;  2LMC B;  2JA8 B;  3G6J B;  3DM1 A;  1JR0 D;  3M3Y B;  3N52 A;  1CK1 A;  5COR A;  3DDY A;  1CI3 M;  4IQZ A;  3OOC A;  2EE1 A;  1DZ1 A;  2F0D A;  4Y7N B;  4C3I G;  2Z8L A;  2JSO A;  3J7A F;  2Q8T A;  4XQQ A;  2C9O A;  3M4Y A;  4FXD A;  2C5C A;  4HCE A;  4K6L A;  4A93 B;  1SBB B;  5IGE A;  1F2Y A;  3I73 A;  1ENC A;  2XNA C;  4F88 A;  5C6A A;  3S2D B;  1KAA A;  1AP0 A;  4KD3 A;  2PYK A;  4K5X A;  1I4R A;  5CDF A;  2AQ3 B;  1IW7 C;  2X6L A;  4NNJ A;  1U4M A;  5ELD A;  2F0J A;  4K2K A;  3S15 B;  4XQF A;  1BO0 A;  1J8I A;  4QUC A;  1WTW A;  3TZU A;  1O7L A;  4RCN A;  4BY1 B;  3NP8 A;  1D5X C;  2H4O A;  3SR1 A;  1S5E D;  1NAP A;  5DN6 A;  2EJM A;  2MPM A;  2TSS A;  3JAM E;  1BPL A;  2Q8R E;  1PTO H;  4V0B A;  1XTC D;  5K5P A;  4H7B A;  1B50 A;  2K33 A;  2Y0S B;  4FP5 D;  4HIZ A;  2OT2 A;  4LK1 C;  4A3K B;  3D4R A;  1KLG D;  2AQ1 B;  5LL6 X;  1COW A;  1V0E A;  1W6K A;  4F7X A;  1IL8 A;  4XOT A;  2ID0 A;  5JEA H;  2KCC A;  3RD4 A;  1VDZ A;  2M5S A;  2Q8I B;  1SKY B;  4G7H C;  3R3O A;  4CJ2 C;  3OMC A;  1AN8 A;  5EKK A;  4GQN A;  1LTI D;  1DYQ A;  2JDI A;  1I4G A;  1B2T A;  1NR2 A;  1B9M A;  1IKM A;  3K59 A;  5CV8 A;  2R93 B;  4XLA A;  4XLH A;  5J1Z A;  4RGN A;  1KZL A;  4TT3 A;  1R4Q B;  2A68 C;  2FMM A;  2WAQ B;  4NMZ A;  4BA1 I;  2JA7 B;  1E2Z A;  3M4O B;  4CJ0 B;  1BF4 A;  5J39 A;  2B2V C;  2V31 A;  2CHB D;  1V8Q A;  1ILQ A;  2KVM A;  5CC4 A;  2B2W A;  2XN9 C;  1OXS C;  3M7G A;  3P7J A;  3D4D A;  2K03 A;  3VYR A;  4BWG B;  5ISR A;  4QIW B;  5DNF A;  2VB2 X;  4N9T A;  4KKT A;  1I4X A;  2PPB C;  4KHZ A;  3NBH A;  1HFN A;  2EYF A;  2R6G A;  2AUJ D;  4TSF A;  1ENA A;  2BA0 A;  1VCI A;  1QJO A;  2F0W A;  3RZO B;  4WRD A;  3OAA A;  1Q1B A;  2DNC A;  4K14 A;  2E2H B;  4MN3 A;  2NB0 A;  3C46 A;  3A3B A;  5A35 A;  3X3N A;  2PZW A;  4K6D A;  2EYO A;  2L11 A;  2K05 A;  1ENF A;  1WPC A;  1I8D A;  2F0I A;  3A7A B;  3S1M B;  5D3I B;  3GV6 A;  4XYQ A;  1YNJ D;  3MXG A;  3I72 A;  3URY A;  3FPU B;  4DAV A;  4KKS A;  3MHB A;  3HOZ B;  2EJF C;  4IN3 A;  2RDF A;  1FGB D;  5IT9 L;  3GD7 A;  3QOL A;  2F1M A;  3S2H B;  3K57 A;  5I2X A;  1CZW A;  3GVJ A;  3VR4 A;  2D2C C;  4DK1 A;  2WP8 J;  5ELF A;  1B9N A;  1TY2 A;  2IX1 A;  4XIG S;  3TN2 A;  4HSV A;  2R92 B;  1TS3 A;  3RZD B;  2JEA I;  5FLX E;  3V05 A;  2F3V A;  4PNY A;  5F2D A;  4KHV A;  5FO7 B;  3PO2 B;  5IGB A;  1WTP A;  1SE4 A;  1KAB A;  4C2M B;  3IAY A;  2N88 A;  4G7X A;  4XT1 B;  1BDO A;  2SEB D;  2OEO A;  4R8N A;  3T13 A;  1MAB A;  4KD4 A;  4NP5 A;  3WOF A;  4A3J B;  3U9S A;  4Q0F A;  1V1P A;  1HUM A;  3FKI B;  2NVY B;  3T16 A;  4Q5V A;  3I4N B;  2EVB A;  3J81 E;  1WCM B;  1TU2 B;  5JJZ A;  2BE5 C;  1TKW B;  3EVQ A;  1ROD A;  4IUP A;  4AYB B;  2EYL A;  1V0F A;  5G3L D;  3W3A A;  2YYZ A;  1KMH A;  2JJ2 A;  1WD1 A;  5BN3 A;  3L9A X;  1OXX K;  3HAG A;  2ZXR A;  4RA8 A;  4BA2 I;  1EY0 A;  4ASU A;  3A7L A;  2IWH A;  4OO1 G;  5M5X B;  1II3 A;  1Y8N B;  4K8I A;  3KBX A;  1RTN A;  3Q6S A;  1BMF A;  4DK0 A;  4CJ1 B;  4NW2 A;  5M5Y B;  1X32 A;  3C1E A;  2JYO A;  4XQJ A;  1BCP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...