4DNTB

Crystal structure of the cusba heavy-metal efflux complex from escherichia coli, mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Cation efflux system protein CusB
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
total genus 58
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00529 HlyD HlyD membrane-fusion protein of T1SS
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4dntB02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dntB03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 4dntB01
3FPPA 1SMYC 3DXJC 5C0XG 4DNTB 3BG3A 4OO1G 3PUXA 3I73A 4DK1A 3U9SA 1Z7TA 1GUOA 3PUVA 5BN4A 1DCZA 1E2ZA 1G291 2A69C 3ND9A 2KCCA 5BN3A 3PV0A 1Y69U 2AUKA 1ZYRC 2B8GA 2PNRC 3A8IE 1O78A 4KKUA 3IFTA 3D4RA 1CTMA 2PPBC 1LACA 1Y8OB 5K36H 1IW7D 1GHJA 2CW0C 1QJOA 2AWOA 2A69D 1VF7A 3CRLC 3PUWA 4HR7B 2A68C 1VF5C 1PMRA 3QG1A 2JEBI 3I72A 2JEAI 1GUTA 1Y8PB 4IFDG 3N6RA 2DNCA 1GJXA 3VR2A 1CFMA 1GUSA 2EJFC 4XTCS 3SDZA 5BN5A 3PUZA 1IYUA 1BDOA 4LJZC 2Q8IB 1E2WA 5KNCA 1CI3M 1B9NA 3SE0A 3AB9A 1DD2A 2E75C 4GZYC 2R6GA 1E2VA 2A6HC 2QF7A 1VCIA 3BDOA 1TU2B 2ZT9C 2JE6I 2AUJD 2BE5C 2EDGA 3VR4A 4XIGS 1V43A 3KLRA 1I6VC 1Q12A 2EJMA 3PUYA 2A6EC 4IQZA 2KA7A 4DNRB 4JBWA 5A35A 2F1MA 1GUGA 1K8OA 2BA0A 1B9MA 2NN6I 4KMUC 1Q1EA 1Q90A 3GD7A 5KNBA 1OXTA 2BDOA 3T53B 1K8MA 1EWHA 1T5EA 2DN8A 2K32A 3QIAA 1ZKOA 2O5IC 1Y8NB 3T56B 1A6XA 1H9SA 1VDZA 3A7LA 3FMCA 5JEAH 3VR5A 3LWUA 5K36G 3D31A 3VR3A 4KI0A 2EVBA 1GUNA 4G7HC 1O7LA 4KKTA 1OXUA 4BA1I 2E74C 3I4LA 2A68D 4KKSA 2NN6H 4DK0A 2D2CC 1OXVA 2YYZA 3MXUA 3VA7A 3W3AA 3P20A 1OXXK 1YNJC 4PV1C 1FYCA 5KNDA 1ONLA 1FR3A 1YNNC 1HPCA 2LMCB 3T51B 3CRKC 3OW7A 4L8JA 2PCFB 5C0XH 1HTPA 4OO1H 3A8KE 2BA1A 2A6HD 3VR6A 1H9RA 4BA2I 4KN7C 1H9MA 2BE5D 3L7ZC 1H9SB 1H9JA 3H94A 3ND8A 1HCZA 3OOCA 2D62A 2EJGC 1IYVA 2A6ED 1GHKA 2E76C 2B8FA 2JXMB 2K7VA 4JK1C 4KN4C 3QJYA 1LABA 3LNNA 4H0LC 1IW7C 1OXSC 4G7OC 3M7NA 4TKOB 3RLFA 2O5JC 1HQMC 4G7ZC 2D5DA 4LK1C 4TQUS 3IKJA 3TZUA 5JEAG 3WDNA 4IFDH 3HGBA 3MFYA 3M85A 3NE5B 4H13C 1Z6HA 3A7AB 4KHZA 4RCNA 3EQLC 2K33A 3GQBA 1V8QA 2NN6G 4OGQC 1DXMA 1Q1BA 2V4DA 4I7ZC 3OPOA 1TKWB 2IT1A 4H44C 3A8JE 2DNEA 3M4YA 2L5TA 1H9KA
chains in the Genus database with same CATH superfamily
3BZKA 4NPSA 4B3SQ 4PC6A 1ESFA 1S72B 1TWFB 2C2WA 2F0SA 3CTAA 1PLFA 3OP1A 5L46A 4DV2L 2F0OA 4GLVB 5C44H 4RHSA 1K8GA 2UXBQ 1G2SA 3Q39A 3T1HQ 4GN3B 2FFKB 4YY3Q 3OZVA 3UDGA 4JYAQ 3ISXA 1HR0Q 3CPFA 4K5VA 4X05A 1CTMA 2JSOA 1HNXQ 1NJID 4FK8A 1I4PA 2A74C 1VF7A 1T9HA 4MNOA 1OB0A 2JQOA 2WAQB 1VF5C 3MHBA 4RH6A 3GTKB 1HNWQ 4IFDG 1I5FA 3PVDA 4JI3Q 4A3GB 4XTCS 5BN5A 2B2VC 4ODGA 3Q6RA 2Q8IB 1RTNA 1S5CD 2KVOA 3GTOB 4YAOA 3SHLA 1B2RA 1LT6D 4RFBA 4A3LH 1NB0A 1KMHA 2F4VL 4AH6A 1WCMG 1CM9A 2HHHL 3K5LA 1UD2A 2WB1E 2N78A 2BVNA 3EJIA 4C3JB 2F1MA 2ZBUA 1EEFD 4PZ7A 2OXPA 4KMUC 1QUFA 3ZBTA 2J4XA 1OXTA 2K32A 2TMPA 1Q86D 1PFBA 1I94Q 3KBGA 3CCLA 5C4ZA 1YITB 1Y8NB 5FJ8G 4B3RQ 4BBRB 4B3TQ 2JA8H 2W6JA 2G5DA 3BY1A 1BQEA 3EN2A 1GUNA 1HFNA 4KKTA 2L4NA 3J7ZC 2A68D 1PTOB 1EFCA 2VNUD 1MI2A 2JA6B 3NXWA 1G91A 4X6AH 2BDNA 3MZ5A 5C6AA 1BBXC 4JI7Q 4XQNA 4APVA 3TDQA 3RN5A 1M8AA 4UAIA 2OQ0A 3P1HA 1HR0W 1FR3A 4DR5Q 3PO3G 4DV7L 3AEVA 1WTHA 1CQXA 2A6HD 1BCPB 2JP1A 1TQOA 4XKWA 2OTLB 1TLLA 1PRTF 2TSSA 4K8JA 5A2QE 1HZAA 2YV5A 3HOUH 4OEMB 2WV6D 4NKLA 1EXMA 1P16A 1JJ2B 3A35A 2A6ED 1X6OA 1HZBA 5CV5A 2R7DA 4P26A 2BCOA 2HQLA 1GO2A 4GS3A 4TKOB 3GV3A 4Z1MA 3DDYA 4Z4VA 3J7AV 3S16H 2D9RA 3IKJA 3WWVA 4JI4Q 2HDNB 1NRKA 5IYCG 2ZITA 3W5OA 4LF4L 2L9HA 1PJ5A 1YJWA 1X3PA 1DGSA 2F3IA 1D8TA 3CW2C 2IL8A 2D0OA 3GSIA 4CKCA 2IX0A 2AKWB 4K6LA 1X3QA 3A8JE 1XMOQ 1UE7A 2VB3X 3I1FA 1KK2A 1YHQB 4KHVA 1N34Q 5IODA 4P12A 5I2YA 4ZAIA 1K0SA 1G291 1UNSA 2Z8LA 1NY4A 2X6GA 4LMQD 4B43A 3FP9A 4JOIC 1A2TA 2X6WA 3GO5A 4MZ9A 4RGNA 4WZTA 1JCKB 1IW7D 3I4MG 4DR7Q 2NVQB 1VJSA 3AVVA 4OIJA 3SR1A 5LHY1 3CMMA 3MCAA 2PMZB 4GKKL 1CKOA 1VQEA 1OGJA 4HCSA 5IP9H 2E8GA 1GUTA 1LO5D 4C3IB 4CDEC 5C3XA 1F20A 4XNFA 3I56A 2Z6KC 3Q8DA 1VQNA 1Q7YD 3OJWA 2AMCB 2F0VA 4BY1G 4IALA 3F2CA 4L5RC 4Q0FA 5FLMH 5JJLA 4X64Q 3G4SA 3ER0A 1I4RA 4XQFA 4LFAL 5M3FG 1GOZA 1YHBA 2K50A 4ME3A 1U4PA 4DV1L 1GUGA 1BX0A 3MEHA 4AYBB 4A75A 5EBCA 4JI0L 1PYWD 4MTNA 1AE2A 4R4IA 4P25A 2E2DC 1K8MA 3QIAA 2PMDA 1ZKOA 2H1EA 3CCQA 2O5IC 1UE5A 2Q6LA 2KUMA 5C3EB 1JJCB 1VQ7A 2WR8A 4K8IA 5IGEA 4P2NA 2Z9HA 1KK1A 1XPUA 4EX5A 2B39A 3V2TA 1Z9FA 1JMCA 1VQCA 3MFGA 3U6KA 3HKZG 1ZM2A 1C4QA 1WTPA 5FLXE 3BY2A 4ASUA 4RMFA 2R3ZA 2RHSB 4HJ5A 3GTQB 1N06A 4PV1C 4DN4M 1F2ZA 4DR2L 1OB2A 3HOYH 1C0AA 4RGTA 2PCFB 3RY8A 3S9WA 2PLFA 3R8BA 4Z4TA 2B2WA 4CDCC 1KDBA 2I5MX 3EIVA 3JC66 2IY5B 1K73D 3U9OA 2EJGC 1HVXA 2CBXA 5IP7G 1JNYA 1D1IA 1EQRA 4ZCKA 1FRNA 4UP9A 1Y14B 1WOPA 3A8KA 2K52A 4KY6A 1RD9D 1HNZL 1STAA 2JN9A 4LF7L 4X7DA 3QO2A 2KBNA 1E64A 4RLZA 1SKYB 4P3IA 1L2FA 1SYCA 4H13C 5EGTA 3DM3A 3ZZ0A 2VY3A 4G4KA 3KLSA 4J1MA 4KHZA 4BY7G 2YWEA 4C2MH 1X3GA 2K33A 3S1NB 3W2FA 2R7ZB 2WKDA 2PQEA 3ITPA 4MTKA 2K6AA 1M90D 3QB3A 1HQRD 1QCBD 1VQ5B 3I4NH 3L9AX 1JWUD 3BG3A 1SNMA 3H09A 5KSWB 1DCZA 1GD7A 4I65A 5BN3A 3TRZA 2N55A 5NUCA 3PV0A 3TREA 4UY8C 2Q2IA 3U4VA 3SK6A 1O78A 1EWYA 3NBHB 4XYOA 2EY1A 2WKCA 5K36H 2C4UA 2N49A 1V5VA 2EY5A 4DUZQ 3TS0A 3VYSA 3MHPA 1AZPA 3CRLC 3QFRA 4A3IG 4YWMA 2R7FA 3OHXC 1FRQA 1J8IA 3OMGA 2JEAI 1IBKQ 3N6RA 5AFWA 4IUUA 4OPOA 2E2JB 5JJIA 3KUPA 1JICA 4LJZC 2JIZA 1FNUA 3J80c 1CI3M 1T6XA 3HOWB 3MXNA 3TP6A 5CBEE 2F52A 2OK7A 2LSSA 1YIJB 2EXDA 4LF8L 4RCOA 2UXDL 2CWPA 4DR1Q 1WD1A 1WSVA 4LBVA 4XIGS 2ZZGA 3Q6QA 4DV0L 2Q8TA 1ESRA 2Z4IA 1SMYD 4IQZA 4AIMA 1GUWA 4DNRB 4JI2L 1SM4A 4PZ6A 5C44B 1MJCA 1XMQQ 4ZCMA 3ULPA 2ZTEA 1LTBD 1X65A 5FOBB 2A19A 2A8VA 1VQIA 1BPLA 3K80C 1LTRD 3HOXH 3C2QA 4AF7A 2X6LA 1J5EL 1W2BA 1ET6A 1EZ6A 4DV3Q 3L2PA 3CP8A 3GTJH 1TWCH 1SYEA 4NBSA 2VQFQ 4FF4A 5CV6A 2IJ0A 3K58A 1CA5A 1GAQA 2ZZFA 3LQEA 1JB3A 3PUNA 4OOSA 2PZWA 3M3YB 1HTPA 4OO1H 5M5YH 4PMCA 3LVBA 1IXRA 1JWMD 4R71A 4XT3B 3L3OC 1VQGA 4UZUA 2EXZA 5EJWA 3S1QB 2QA4A 4G6IA 3BDLA 5F4OA 1KDAA 5IT9L 4EGVA 1EFWA 3AFPA 2HT1A 2JA5B 4DR4L 3DWAA 3RNUA 2JA8B 1V0EA 2PI2A 1EYGA 5C4XG 4M1KA 3AYHB 4EVOA 2XGJA 3SKBA 4UAJA 3OEEA 3WY9A 3AVUA 1LYLA 2B2WC 4A3EB 3PA2A 1YI2A 4F7DA 3RZOB 3CPWB 2L0CA 1DXMA 4B47A 2LKVA 3ULJA 5BR8Q 4ZKCB 1N05A 5CMDA 1X32A 4NMZA 1BO0A 1P4MA 3M4YA 1XNRQ 2Z6BD 1JE5A 3I73A 1F77A 4DK1A 4JI6L 3HOUB 4IURA 2L15A 2F3WA 1QVGA 4Y52H 2Q6OA 2EY6A 1DM0B 2DUDA 4XLHA 3DWQA 1SE4A 4MIUA 3GTKH 5IGDA 2R92B 5IYBH 1VQMA 3NWSA 4A3GH 3S16B 3MTSA 1W0KA 1WTOA 2VBSA 2V7WA 3GTOH 4MN3A 1YX2A 4RD2A 1VQDA 2XZLA 3CD6B 3J81i 2V7QA 1AH9A 1DDIA 5D3IB 3CC2A 4C3JH 3BDOA 1PH6A 5TY0A 1Q81D 1EWIA 3T1YQ 3NELA 3LWEA 1QG0A 2VBUA 4LF6Q 4JC0A 1EY9A 3L0OA 1FNVA 1B9MA 2QTZA 4B3XA 5A8AA 1G7SA 2ZTCA 1UD4A 3H0GG 1I8DA 5EPJA 4BBRH 2E1RA 1UE6A 1Q1EA 1I50H 1G6PA 5KNBA 3BCFA 4U68A 1T5EA 1JT8A 3PIP3 2CFMA 4ZK9B 1I4XA 2GPJA 1AFPA 3CXCB 2XSCA 4XL9A 1VQNB 1PTOH 4C56C 2VNJA 5AJ3L 2JA6H 3OYYA 4XDXA 1STGA 4G5GA 2NZHA 4YIJA 3J7YW 2KHJA 1PXUA 3FJOA 3C2PA 2DIEA 4DUYQ 4DK0A 3TP7A 4GLXA 3OZUA 1QWYA 4YHHL 3HOVH 3E5SA 5KNDA 4V0BA 1RHPA 1TWHB 4X3UA 4X66Q 4L8JA 2UXCL 4KHPL 2SNSA 2OBRA 3A8KE 1SR3A 3HKZE 4BBSG 3CCQB 3AVYA 2PW5A 3HOWG 1VQ7B 1IJEA 4HAEA 1I6HB 1KTKA 4YEJA 2LY7A 1S5DD 4PC3A 4B3FX 3PIO3 1IYVA 3JAML 2QE7A 2NVYB 1PZJD 4K2LA 1G2TA 4C3HB 4DU9A 1NJIC 1UWVA 2DJGC 5J22A 4DR3Q 1UD5A 4AVZA 2QDBA 3FPUB 1K8AD 1PZKD 2CW5A 5EQ0A 5IYPA 4XM3A 3CMEA 2VS1A 4TN1A 4II2A 3H3VH 2ZTNA 1V1PA 5A88A 4GOPB 1HUMA 3A74A 4LUZA 4PQXA 2L55A 1WJJA 2E1BA 4O1NA 5C5LA 5JJKA 4Q7JB 1BJKA 1VLOA 3G6JB 5CV4A 4G1VA 4XMYA 3SGIA 1XFOA 1YNJD 2K01A 4HJ9A 3CCMB 5IYQA 3OE7A 1H9KA 3G6EA 3P27A 5F4JA 4QL5A 2UUCQ 2D74A 2ZM6Q 1NAPA 5IGBA 3TP5A 2XZOA 2EOTA 1Q86C 4LF5Q 5M3MB 1WDTA 3AU7A 4RGMA 4Z4ZA 2AQ2B 2RCNA 4PC2A 1E43A 4KTAA 1KQSA 1ZM9A 3CKIB 5GADC 1BCPF 1KD1D 2WPDA 3E9IA 2HIVA 4ILWA 1Y1WG 1BOSA 2R9VA 2A68C 2UU9L 4DAPA 3G71A 1HZCA 3VR2A 4DV4Q 4C3IG 4M2LA 1STYA 4R8IA 2NUCA 1PH3A 1MSGA 3B8HA 3CESA 5CV9A 4JV5Q 1QGAA 2A6HC 3A5ZB 3MC0B 4JI5L 5IWAQ 3S14H 2B2VA 3GVJA 2KHSA 5TV2A 3A8JA 1WPCA 2IHEA 1FVIA 3DEOA 2A6EC 1N36L 2HUGA 3CCUA 1RIPA 4AYBG 1MHWC 4P72A 5IYWA 3H6MA 3H91A 4HIDA 3AVWA 2EPBA 3VR5A 2V31A 5C3EG 4OO1I 3MXNB 1H95A 1QGZA 3ES9A 5DEHA 3KF8A 4RD4A 4WORA 3VDYA 3CPXA 1SRUA 4KKSA 5HZBA 2D2CC 2FVGA 4MYTA 4QUFA 3W3AA 2JDIA 3CP0A 1QH0A 3QWNA 2OYNA 4P3YA 3OEHA 1IZ6A 1ONLA 2CWAA 2M2LA 1STEA 2NV4A 5ELCA 4P74A 1J9ZA 4IN3A 4CBVA 3W1GA 1NE3A 1VQ9A 2YWHA 3RLNA 2PYKA 2XNJA 4ZLTF 1JQYD 4G1BA 4JI8Q 2VNKA 1WTQA 1CA6A 1IW7C 3JAMi 1W6KA 2A73B 3S2HB 3OWFA 1GVHA 1HQMC 4G7ZC 1K9MD 4A3DB 3S1NH 2EYJA 2IPKD 3RMHA 1IBLL 2R7ZH 3M85A 4GNXA 1YJNA 1TUIA 3BZDB 1R5OA 3Q24A 1TWCB 4R4OA 1OO9B 1Q7YC 3EQLC 3GP7A 1D5MC 2DYIA 4DR6L 4UDUC 1HNWL 1QZHA 3TP8A 5GAGC 1A3TA 5E4WC 4P2CB 3S2DB 3CW2A 1Q8IA 2PW7A 1KK0A 1YNND 3DXJC 3ONUA 1EIYB 5JEAJ 1DOLA 4WJWA 3C1EA 1IB0A 1DYQA 1R4QB 3MVVA 4X65L 4B4DA 5IYDG 2QGGA 3E3XA 2N8NA 1GXDC 2SNMA 2AUKA 2B8GA 1JA1A 1YI2B 2PNRC 3P75A 1SLJA 2JA7H 4QIWB 4IFDJ 2MNAA 4P73A 2F43A 3HZXA 1EP3B 4OPVA 1CZWA 3QFCA 3OW2A 2E2JH 2AWOA 3PUWA 4JOIA 1EQVA 2NZOA 5C0XJ 1Y8PB 5E1FA 3SJPA 3HOWH 1E7ZA 4C1NK 2ZXPA 3R2IA 3J81j 3PUZA 1Q46A 2A1AA 3HEJA 4IOCA 2XIWA 1E2WA 2ATWA 1V1QA 3MWYW 4HN7A 3SVMA 2BPOA 2F0GA 1N33L 1PKVA 2BGIA 3J80E 4GN5A 3BYYB 3NTKA 2JE6I 4A3KB 2Z6KA 3KOJA 4ZYSA 2XWJB 1K73C 1EFRA 1L1OB 4FWTA 2EJMA 3PUYA 1VQMB 3EFXD 3DWPA 3CU7A 1E0BA 5C44G 2ICIA 4WFN3 1KIXA 2B7CA 4JBJA 3W2DA 4C1NI 2HMAA 2F0QA 4CDDC 2F03A 2BOSA 1EFTA 2Z6BA 5JEAH 3SK8A 1MIUA 1A62A 4GKJQ 4II3A 3CC2B 2CW0D 4YAUA 1I3QB 3AFQA 3E1YE 4P6YA 3M3YH 1TT2A 5THXA 4BXXH 2YYZA 3GVKA 1M90C 4XOPA 5H5JA 3CC4B 1AZQA 4TMWA 2KEDA 1JWSD 2HCJB 1BF4A 3BYTB 2LMCB 4WJ4A 3S1QH 1TS4A 2WIIB 2JYOA 4PZ8A 3LGJA 5C0XH 3CHBD 4KD4A 1NTGA 4A3LG 2AQ1B 1G7RA 3NSWA 3OMCA 4X7CA 1WTWA 3H3VI 2JA5H 4M53A 4XYQA 1I50B 5KNLA 2UUAL 2N88A 4A3EH 1OGIA 4RG1A 1J9OA 2NYZD 4IUTA 3BVGA 4DV6L 4LK1C 4TQUS 4X3KA 4ZCLA 2JA8G 1IL8A 3RZOH 4HIKA 1GR1A 1Z6HA 3GTLB 4DR7L 1DOMA 5C4JH 1B2TA 2DERA 2B2UA 3UDXA 1CZGA 1PH5A 2EZVA 3HOVB 1K28D 4YCWA 3FKSA 1SYBA 2DNEA 1K83B 1TVXA 2WB1B 4K1XA 2K5HA 1LTSD 1SMYC 1CT1D 3PA1A 2I5HA 4DV2Q 1WD0A 1YBYA 1Z7TA 4GNXC 3PUVA 2K5QA 3MA2B 3NBIA 2DCUA 2RC5A 2R92H 3HOUG 1R9TH 2MJ8A 1T6YA 4TMZA 5GAEC 1QB5D 1E3PA 4IOAA 5A2QL 4C43A 3O13A 1V9PA 4A3MH 5JPMC 1VQLA 2J0TD 5HY6A 1LACA 1KDCA 4RM0A 5GV7A 3DMUA 4C0SA 1DJRD 2YTXA 2A69D 3VA5A 3WQZA 2Y0SE 2J7ZA 2EY2A 1SJHD 3IL8A 4TRDA 3ASRA 3S1MH 1JORA 4P22A 2K28A 3G6EB 3WNDA 3K57A 2XEXA 4L5QA 5JVH3 1N07A 4P6VF 1FL0A 2DOGA 1PA6A 1UD6A 1VS0A 1EIFA 2PMZE 1Y1VH 1Y0YA 2F4VQ 1C9OA 1YNXA 4XLCA 2HHHQ 4DAYA 4DAVA 1EQQA 1I7PA 4LW1A 4CJ1B 5IIFA 2E5LQ 2LXKA 5EKLA 3FKIH 4BWGB 1TS5A 4H7BA 1EWHA 1VMPA 1VQKA 1ENCA 1SROA 2CCZA 4RPDA 3A54A 3CCEA 4KY7A 5FO0A 1G6ZA 4QJFA 2E74C 3I4LA 3BS1A 1FNWA 1KXLA 4ZUIA 1VQ8A 5IP9G 2NN6H 1C8CA 4Y7NH 1X3FA 1TWHH 5HURA 2VZAA 4L5SA 3HOZH 2BV3A 3KF6B 1PTOD 1S4MA 5FL7A 3BVMA 3DEPA 3CCUB 4DV7Q 4A93H 2CQOA 1PH2A 1I6HH 3PO2H 3S14B 4IO9A 1D5XC 3JQQA 2E2IB 5FLMG 2LXJA 3DLLA 3LX0A 2NVYH 5F2DA 2BE5D 4C3HH 3L7ZC 3SLDA 4Y7CA 4YWKA 1BCPD 2CH4W 4QUCA 3F2UA 2B8FA 4WJ3M 3BU2A 2NPFA 2B3GA 3KF8B 4H0LC 1U4MA 1XE1A 5DN6A 3CC7A 1PHJA 4DK3C 4A3BH 2V7VA 2X53S 2LFNA 1NMFA 2ZJQA 3T4AC 4RDKA 3AGPA 5M5XH 4LF4Q 5TR9A 4EQPA 1E1RA 1N32L 3J7AF 1KHIA 1PRTC 1JOQA 4JG2A 3B78A 3HRZC 5LL6X 2D3NA 1PV4A 2HQEA 4L6TB 1DARA 1Q81C 1B53A 2RDHA 5ELBA 4HMIA 5FLXL 4UPAA 4FP5D 3HOYG 4OELB 3BVZA 3V7AA 1SNPA 5M3MH 1EP1B 1F60A 3W5UA 1SNOA 5FO9B 1BLIA 3GIRA 2CRVA 1CSPA 4QMGA 3TZDA 4XLFA 4RCYA 2AWNA 2B2UC 1F2MA 1XYIA 4K0KL 3R2TA 2KECA 4K5XA 4POFA 2EIXA 3R93A 4GQNA 1N0UA 1W9XA 3C46A 4IW3B 4R1JA 1NDHA 4B48A 1W87A 1QUEA 4B3GA 4HMJA 4YAFA 4N8X1 4GKKQ 3X3NA 3KFUA 1W35A 4RCZA 5J3BA 2XNCA 1E1OA 1EYCA 4K2KA 1SAPA 4IUQA 1BDOA 2EYHA 4TSSA 1JE4A 3URYA 3AB9A 2F0PA 3VNUA 2ES2A 4B44A 4JBKA 2ZZEA 4WWVA 1TU2B 4CJ0B 4LFAQ 3VYRA 3KK7A 1AEXA 2EDGA 3D3RA 4RA8A 3I4NG 3PCOB 4FXGC 4ALPA 4DV1Q 1ENFA 1BVSA 2IHFA 4FO2A 3OW2B 4GN4B 5JPNC 4JI0Q 1DOKA 2BH2A 1XJVA 1KJZA 5J1ZA 4HIZA 1CKNA 4IFDI 1Q90A 2K5DA 1KRTA 4U673 2WYRA 2VUMB 1K8AC 2JA7B 2DEUA 1DONA 4DQLA 1A6XA 1U5KA 1VDZA 4ZGQB 5C0XI 4DNIA 5K36G 3KLSX 1Q9SA 3OAAA 5FO8B 3OZWA 1BMFA 5E7NA 4OWWB 2WJYA 2VJJA 1WI5A 5IGCA 2LZJA 1Q82D 1S0UA 1KLUD 5FA6A 1YNJC 2VQEQ 1FYCA 4G7XA 1D7QA 4DR2Q 1EIGA 2FMCA 3BNWA 1KC8D 1HPCA 3RUZA 4HE5A 5H1SE 4ACBA 1UUPA 1XNQL 2OTJA 2R61A 2L12A 3A55A 1SE3A 4NNJA 1I4QA 4Z4WA 4TSFA 3S2HH 1FNCA 2NVTB 5DSZA 3ERQA 4A3DH 3GTPB 1R4PB 1KD1C 1XPOA 5COYA 2GVBA 4L63B 1HNZQ 1FJGL 3RLFA 2ZL6A 5EPLA 4LFCL 5FK9C 2JJQA 1BXTA 4F8MA 3HOXG 1F9QA 4RD1A 4LF9L 2PNHA 2B2TC 2CF4A 3S2DH 1QILA 2CHBD 4NDXA 4OGQC 5B6IA 4YALA 2ZJRA 3OPOA 1PYSB 5D14A 3CCLB 3DHQA 1PRTB 4ABNA 2XTIA 3BH4A 2V1CC 4OO1G 1F2LA 4M0LA 1A63A 1GUOA 3ICEA 1WCMB 1E2ZA 1JC7A 3EROA 1F9PA 3HP3A 1TR5A 3A8IE 2VNIA 2NTTA 1DZ1A 1NMGA 4UP7A 2BM0A 2DY8A 3QE2A 5I6YA 2GJKA 4HR7B 4LWCA 5FKAC 1IBML 1ASYA 3QG1A 2VW9A 3I72A 4IPCA 1WFQA 2GA4B 3MXPA 5C4JB 2M9VA 5TRDA 1STHA 4A3KH 2EYOA 1KL9A 5KNCA 4N9TA 4FDBA 2HD3A 2E75C 4NCNA 3GVLA 5M5WH 4LF8Q 2UXDQ 2XRQD 4DV0Q 3VYUA 4HIOA 1EY5A 1F9SA 3PO3B 4JI2Q 1Q3LA 4HSPA 2YWGA 1YJWB 1IHMA 4AQYL 1YJ9A 1U2RA 3E0EA 3Q22A 2NN6I 1R9TB 2OK8A 2MO1A 3V05A 1VQ6A 3GD7A 5IE8A 1GKHA 2ZTGA 5JAVA 3F2DA 3T53B 2DN8A 3QR8A 2ZJPA 4A3MB 2E2HB 2BH8A 3PGZA 1K9MC 3T56B 1ZYRD 2WAQG 3VMFA 1I3QH 4JMQA 4DF7A 3WNCA 5IYBG 4CKBA 1J5EQ 3VR3A 4A3GG 2EVBA 3S1MB 4HTHA 1F2YA 4IPGA 4M4SA 4NXML 1W34A 1CHPD 3W2HA 5DAUA 3Q0AA 2OBTA 4X3SA 3U2QA 1YNNC 1KLGD 1Y1VB 3T51B 5LL6S 4TMVA 2B63H 1CK1A 1RTOA 4C3JG 3JQRA 2QW7A 3M4QA 4F88A 5T1GA 1U4LA 4J8QA 1EIHA 1VQKB 1ILQA 1H9JA 3ND8A 1ICFB 1OTCA 4FF2A 3CCRA 3I56B 1NUCA 3CCEB 5IK2A 4XORA 3OJXA 4RGOS 5LMUL 3FKIB 4PNYA 4BBRG 1LABA 1VQ8B 1N9WA 1LTID 2MO0A 1SYGA 1Y0RA 1HFGA 2Z1CA 3UI2A 4DR4Q 3UE1A 4ME5A 1D5ZC 3W2IA 3G4SB 5ISRA 1JA0A 3JU4A 3RD4A 3GTLH 3QOLA 1QFZA 1I4HA 2CQAA 4JI1L 4CGYB 2JA6G 3I4MB 2CC2A 1EL0A 3KLWA 1W3SA 1LTTD 4Y7NB 1K83H 4LFBL 2P5ZX 1WTRA 3OWEB 2I46A 3HOZB 5J3OA 3J81k 3MMPA 2KVMA 2RDFA 3FVQA 4N9PA 4OWTB 2OEOA 4X62L 2YU9B 3HOVG 1COWA 4A93B 1YITA 4F87A 3PO2B 2K4KA 1R5BA 1E1QA 2B2YC 4BY1B 2X6YA 2C35B 4DKAC 4JI6Q 3ZPNA 5GAHC 4JV5L 1QUQA 1STNA 3IFDA 5M3FB 1T5XD 3B6YA 3RLOA 2KCCA 3R6KA 1ILPA 2QDXA 1VQOA 2ZL7A 1WTXA 1EY4A 1TTTA 3IFTA 1A8VA 4H02A 4A3BB 1GHJA 3V96A 4PMWA 2CW0C 2A5HA 2IW3A 5M5XB 4JVZA 3TS2A 3OIQA 4HE6A 5LMNL 1B23P 1TWGB 1JJ2A 2WINB 2VZLA 4LUVA 2UUBQ 5CV7A 3WOEA 3MXGA 4CHTB 3NHHA 1BX1A 3WNBA 3HKZB 4PAAA 2VL6A 1HA5A 1PTOF 2ZXHA 1HHVA 3WXMA 2VJIA 1WOOA 2VBTA 2QDLA 3KLRA 2GVAA 1QFYA 3Q3AA 3FDTA 3OTOL 1XTCD 1HXYD 2BA0A 3U6BA 4QVJA 1D1KA 5EPKA 2JA9A 5BSYA 4OX9L 4YELA 4L5TA 3KJPA 4OP7A 2RBMA 1LT5D 2B7BA 1H9SA 5AJ3Q 5I6WA 5KW9A 3NQTA 1EYAA 5C3WA 3HKSA 3KJOA 1YHQA 4POGA 4G7HC 1BR9A 1OXUA 4A3FH 1YLOA 4RD0A 4YHHQ 1KRHA 3VA7A 4BY7B 5KYLA 5T1IA 3BQJA 2E2IH 4DXGA 2J7KA 1RQPA 1B3AA 5KGUA 1EUJA 4KHPQ 2UXCQ 1W0JA 1CKNB 1E1TA 4P9SA 3VR6A 2KQ3A 1H9RA 3SJZA 4NB3A 1KNEA 3PENA 3JQPA 4F7XA 1TIID 4OXPA 4J15A 1GHKA 2K7VA 1LT4D 2NBFA 1T6ZA 1EY8A 1TWAH 4G7OC 3J81c 4N8FA 2CKZB 2GREA 4QV2A 2VNHA 3ZJYC 2HDLA 4IZ8A 4UZEA 1PH1A 3G05A 1IHZA 3HGBA 2QN6A 4DV5L 1SDFA 3AMUA 4JBMA 4FXKC 4A3IB 3GQBA 2OTJB 1KTVA 1QGYA 1V8QA 5ELEA 1M1KD 1B1ZA 2O4XA 2EQSA 2ID0A 4HJ8A 1SXTA 2OT2A 2DETA 1IJFA 4S3SA 3FPPA 3RN2A 4A76A 2GJRA 4B3SL 1W2BB 1LUZA 1BQQT 2D9UA 2CK3A 3BC9A 4QY7A 2G9HD 1VQPA 2EYMA 4HIMA 4FN5A 4U9UA 2UXBL 3T1HL 4QCLA 4YY3L 4JYAL 4KKUA 4X07A 1HR0L 1L0WA 2FINB 5CGKA 1SEBD 4R9WA 3PMFA 2BGJA 4A3CH 1HNXL 3TSSA 3BZCA 2UU9Q 1UAPA 3KYHC 1E22A 1PMRA 4R4TA 2F0LA 1SFOB 2R7ZG 3QOJA 1NR2A 3K6OA 1B7YB 1UE1A 1G8ZD 4JI3L 1IYUA 1PTOC 1D8LA 2QA4B 4RDJA 4XLEA 1PYBA 1HZEA 2C5BA 4AC9A 1N8RD 2JK8A 3UE0A 2CVRA 2QEXA 2Q2UA 5JOBA 4JI5Q 4GZYC 2PZTA 4RWSC 1A0IA 1S5ED 2AUJD 2BE5C 4QB4A 2G9DA 4O42A 3FHWA 3AVXA 1YVCA 5IT9c 5JVG3 1BCPC 1K0RA 1Q12A 3ONYA 1HJPA 4A3JH 1N36Q 1G51A 4B3MQ 1QVFA 2VUMH 3D6CA 4QQBX 1EFUA 4Z4UA 2SOBA 2Z4HA 4WRDA 1TY0A 1I94L 4RAUC 1B8AA 1E79A 2LS01 2JA7G 4B3RL 1SYFA 3ULLA 4B3TL 4G7WA 1MRZA 2ZXIA 1YZ6A 2GK6A 1O7LA 2YWFA 5C4XB 1QVGB 4XR6A 3VNVA 5HKKA 2R93H 4NXNQ 2WAQE 2CNDA 2Q6IA 2R6HA 2X3UA 1PZID 1OXVA 3S1RB 1WP6A 5HGQA 1VHEA 4EQOA 1OXXK 4JI7L 4OHJA 3CP2A 3WYAA 2DGYA 4P71A 3NBHA 1EY0A 5M5WB 4TVAB 4DR5L 1NNXA 3GDEA 1SN8A 2X6XA 4PABA 1EU3A 3NTIA 2NVTH 1BBWA 1TXYA 3GTPH 1D6EC 3J80L 5J39A 1C7YA 3CCJA 2XOKA 1E62A 4OOVA 3OFNA 1XQBA 2EYFA 2FHTA 3OSOA 2IX1A 4IUNA 1KAWA 5ELOA 1RF2D 2OQKA 1QVCA 4Y9UA 1LT3D 1L0XB 2JJ1A 2RSNA 4HEDA 5KRUA 4IUVA 1YIJA 2O5JC 1KAAA 3F8TA 4DA2A 1IBLQ 1HA6A 3TZUA 2KENA 2OCEA 5JEAG 4IFDH 4JI4L 2F0NA 4WQMA 1Q8KA 5ELNA 2XVSA 5I9PA 4X7EA 3N52A 4DR6Q 2F1LA 5FO7B 1LV9A 1K3RA 4FF3A 2XNDA 4RD3A 1Q1BA 4BXXG 1EQTA 2NZ1D 1JB7A 3CCRB 1SNDA 1XMOL 1WCMH 2B63B 1PVOA 1J6QA 1RKNA 4IJLA 5C0XG 1EZ8A 2XWBB 2DY7A 3PUXA 2AQ3B 1UEAB 1N34L 3CB4A 4AF6A 1S5BD 2I1LA 1ML0D 5BN4A 4X65Q 4ID6A 3PIPA 2Q2HA 1ZM3A 1CQVA 1O7YA 1BNZA 2JA5G 3OKXA 3I2ZA 1X3EA 3H0GB 5FJ8H 2JN4A 4E6IA 2SDFA 1OHHA 2GN5A 4A3EG 2E5LL 1B50A 3F2BA 1EU4A 5C5MA 2ZXRA 1Q82C 2PIAA 1SE8A 1ENAA 4R4QA 4TT3A 4PG3A 4TMXA 5IGFA 1KC8C 1QUQB 1N33Q 5I2XA 2F0UA 3PO3H 4XT1B 5C4HA 3SEBA 3P7JA 3JAMc 2FX3A 3NP8A 1EWCA 2ZT9C 1CSQA 5EMNA 4CQJA 5H59A 1VQOB 2XNAC 4X64L 2XN9C 3PIOA 1FDRA 3S17H 3CMEB 1I6VC 1U0LA 1V1PB 1AMOA 3VO1A 2E2HH 3NPPA 4BBSB 1YEZA 4ZGNB 4WZEA 2K5NA 2R92G 1ICWA 1E24A 3HG9A 2V7XA 3CPWA 4N3GA 4RPBA 4IPDA 2F0HA 2KCNA 4A3MG 2DJFC 1MGSA 4IUPA 4X06A 3A8IA 3LWUA 3D31A 5IYCH 4ZUJA 2H5XA 3IAYA 3HFZB 3I91A 3F1ZA 1WYDA 4BA1I 3ZC3A 3A3GA 1PJ6A 3PF5A 2KHIA 2KJXA 4OOXA 1C48A 1STBA 4JPBW 2GQFA 1CNFA 2QCPX 1KQSB 4XQQA 2XGTA 1SNQA 1DG1G 2C77A 1VQJA 1Y1VG 1NSNS 2OF1A 2H4OA 2F0DA 3ASPA 3G71B 1ZXTA 1H9SB 1LTAD 3TEHB 1S40A 3B82A 4X8IA 1EY6A 1JOKA 4RKBA 3J80i 3NUCA 4YCVA 1PH8A 3STBD 2UUAQ 2D0PA 2F0IA 3QJYA 1XB2A 5KEEA 3CD6A 3GTMH 2EFGA 2WZNA 2WP8J 3FKIG 1M4VA 2L1BA 1HA3A 2Y0SB 4IJHA 4AYBE 3I4MH 3M7NA 3VYTA 4DV6Q 3MEFA 3U4ZA 3I7FA 5JBQA 2EYPA 4A3FB 2YU9H 1Y1WB 3I8ZA 4M8AA 1UMKA 2NN6G 5G3LF 3GTGH 3W2EA 4BY1H 2IT1A 4XQJA 2YTVA 4Y9RA 1H85A 4J6HA 4R8NA 3HOZG 5HZAA 3G7LA 2B2TA 3BJUA 2MFIA 4LAAA 3CXCA 3WDNA 3ZIAA 5M3FH 4A93G 2F0MA 3PO2G 4R4CA 4DK6C 2QTLA 2OBSA 2ZL5A 2RKSA 3D0FA 3NK9A 1EY7A 4XD7A 5KIXA 4C3HG 4RKLA 2F4NA 2K03A 4NW2A 3ONAB 2ZZQA 3A1PA 1CHQD 4H9GA 1Y69U 2DY1A 1ZYRC 2NWGA 2HCIA 1TWAB 1QNUA 1Y8OB 4EH1A 1VQ4A 4KJOA 4RDLA 1TWGH 3D6WA 1R5NA 4DUZL 4A3BG 1VQ9B 4KY5A 1GJXA 2DNCA 3ASSA 1IBKL 3SDZA 1BUVT 2VYQA 2ZXOA 2B5OA 2K5VA 1VQPB 2R6GA 1VCIA 1O7ZA 1B3QA 4DPGA 3CMAA 4A4IA 4DAMA 4JW0A 3ZBUA 4DR1L 2FMMA 4GNXB 2VQEL 1YJNB 4HJAA 2O2LD 3QSYA 4TMTA 5M3MG 1IKMA 4JBWA 2ICEC 2KCMA 1FNMA 1WORA 3NWTA 1QG7A 4GOPA 5IP7H 3D4DA 4PC1A 1UD8A 1XMQL 1ZUNB 5CORA 1TY2A 3K81C 3LO8A 1I4GA 3ERSX 1JOOA 3A0JA 3RZDB 2C9OA 2WJVA 3FMCA 4KK7A 4XONA 3CCMA 2IX3A 4BY7H 2QEXB 2K1BA 2M5SA 5M9OA 2Q2TA 2MQHA 1N0VC 3K7AH 2HDMA 1OB5A 4NP5A 4DV3L 5FIUA 2Q8RE 2AHOA 1CUKA 2VQFL 3MXUA 3KDFA 5LMZA 1QVFB 3CRKC 1RODA 4YHBA 1G7CA 2X0KA 3OIPA 1SNCA 4A3JB 1X56A 3BDCA 1EOTA 1ET9A 4ZRZA 3W5VA 3OOCA 1HCZA 3SEJA 1QOHA 2X69A 1PFSA 1RCVD 2JXMB 1XPRA 1S5FD 5D3DA 3S15B 2MHVA 3LNNA 2F0EA 1OXSC 2PZUA 3CQZH 2F4IA 5K5PA 2ASBA 3U58A 4A3IH 3J81E 2RHQB 1WOCA 4YXWA 3MFYA 3A7AB 1N32Q 1KRSA 1KK3A 3PSIA 1NR4A 3T16A 1CNEA 2F3VA 4BS9A 2R93B 2F0KA 4P75A 2ENBA 4ACAA 3K5NA 4GLAC 1MJEA 1TKWB 3I55A 3CCJB 4J0QA 5AN9A 3P26A 1VQHA 4H44C 5BR8L 1SSOA 3J81L 3R3OA 1O80A 3CCSA 4YAWA 2L5TA 5DS0A 5CDFA 1FD7D 5I9OA 1X9NA 1GJRA 4LBZA 1XNRL 2FXQA 2I5LX 2GK7A 4UZFA 4X3TA 1S4ZA 3A56A 4K5WA 1HTLD 4CJ2C 4LF7Q 3M4OH 2B2YA 2F0JA 4K0KQ 3CCVA 4A3DG 1SFOH 4RHRA 3G48A 3HS0C 1LTGD 5DLQE 1RJTA 3CF5A 1TS3A 1PH4A 4LC0A 1E3XA 1FNBA 2JEBI 2RVLA 2NTSA 1H8HA 2SEBD 4LUOA 4ZKBB 4UP8A 2K5WA 3I90A 4KD3A 3SE0A 2BSAA 1DD2A 1H8EA 3A5UA 1FNDA 4HSVA 1E2VA 4HJ7A 2XRSD 2PQAA 1A3VA 3SK4A 4PC7A 3VR4A 3T1YL 1KZLA 4QFMA 5EKIA 5IGGA 5A35A 1X55A 1K8OA 1SE2A 4LF6L 3KEWA 1L0YB 5IT9E 5J35A 1JJGA 5D65A 2BDOA 2MGSA 2BM1A 5C4XH 4X7FA 5E3FA 5CR3A 1AP0A 1VMCA 3S1RH 1MKHA 2F0TA 5I4DA 1MABA 2QMUA 4K6DA 2QKIC 1UEBA 1M1KC 4DUYL 4GOPC 1WOSA 1WU8A 3H9NA 3RR5A 2P3MA 5IYRA 1VQLB 2QEJC 2RA4A 4A3KG 4Z4SA 4UHVA 2NVXH 3ASQA 1UD3A 3CRZA 5IYNA 2WACA 4X66L 1K28A 4YWLA 1XNQQ 2ZBVA 3WBJA 3EBEA 1TWFH 3S17B 1JR0D 1A3UA 3NTHA 3H94A 1VQFA 3K8AA 1EP2B 3W5HA 4K14A 3E0JA 1U9RA 1YHAA 3MAQA 1JB9A 1AW7A 2Z0SA 1WVLA 2FJ2A 1S72A 3K5MA 1FJGQ 4E0FA 1XTDA 1XXGA 3PUMA 4DR3L 1D1NA 1MD2D 3EVQA 4LFCQ 4CDFC 4DAYB 5CV8A 3NE5B 1L1OA 1RDPD 1RQRA 4DXFA 4LF9Q 4OIKA 1SMXA 1E63A 3D8GA 4LBYA 4IPHA 1N8RC 1TVCA 3LQ6A 2F0WA 1MBYA 2V7UA 1SJED 1D2BA 4HCEA 1A8PA 4DQKA 4Z9CB 1PFMA 2UUBL 1CQFA 1LM0A 1ZEQX 3WOFA 2PE3A 4DNTB 1PRTD 2B63G 1QX4A 1HH2P 4N3NA 2GJPA 3H0GH 3M9BA 5GROA 2UUCL 2B29A 2ZM6L 2Q6KA 1IL2A 2K14A 3EA6A 4LF5L 2L11A 1W6JA 3GTMB 3CC4A 3QFSA 2W6IA 4CKEA 2KEEA 4B08A 1QJOA 2KOLA 1IBMQ 1I18A 1HUNA 4QHYA 1WTHD 2WZPP 2CH4A 2EJFC 4ULLA 4XLAA 4M1UB 5JJZA 4DV4L 3FRPB 3GTGB 3KL9A 2PO4A 2WB1G 2NB0A 3DUZA 1B9NA 3K0YA 3CC7B 3FEWX 3IRBA 5HXBA 1G7TA 1B4OA 2QF7A 2QGQA 5KYIA 1PH7A 5IWAL 3E9HA 4BBSH 4FYDA 2YTYA 3PF4A 3JAME 1FX0A 3A3BA 1NCVA 1V43A 1TS2A 5IY0A 2ZTDA 1ZM4A 4WZKA 1VQ4B 4ROXA 3K5OA 4AQYQ 1V1OA 2K75A 3WBKA 1QZGA 1A15A 2C5CA 4FXDA 2VXWA 2EYLA 3PQIA 5CC4A 2OTLA 3A7LA 4MHEA 3E6ZX 5FO1A 1VQBA 5IOCA 2EIFA 2OWOA 4KI0A 5G3LD 3DM1A 4QF4A 5DM73 5GV8A 3CAMA 1B70B 2QILA 3GV6A 4NXMQ 5EAYA 3H15A 4I7AA 1QE6A 5E6TA 5FLXc 3CMAB 1PFNA 1AN8A 1FGUA 4FXUA 1RL2A 3ZYYX 4OONA 1Z47A 2N3SA 4WZLA 3Q23A 1X54A 3BCDA 3OW7A 2C5HA 1PDQA 1NB9A 2HCCA 4BA2I 1H9MA 3X3MA 3HOYB 1DDGA 1N08A 2M00A 1HZ9A 5LMUQ 2I07B 2RF4A 3R6JA 2D3LA 2BMWA 3D26A 4RD6A 3T13A 4JI8L 2C78A 3QFTA 4OPSA 2AHOB 3Q6SA 3KDFB 1Y1WH 2Y0SG 4JI1Q 2NVQH 4Z4RA 2D5DA 1MSHA 2WFWA 1VQAA 1AIPA 4KLKA 1GVPA 4DGZA 5ELFA 4RCNA 4O2DA 5DM63 3K7AB 1PJ7A 2BF4A 3SLNA 4C3IH 4V190 4LFBQ 2ALYB 5DNFA 4A3FG 3J7A5 3S24A 1BKBA 1WTVA 1II3A 4I7ZC 3V76A 1WSRA 2C4TA 4P1VA 4QVAA 5TSSA 4X62Q 4C2MB 4RJLA 3E20A 4OWXB 4Q5VA 2MP1A 3ZZTA 1NBWA 1EYDA 1ASZA 1EFID 2RCFA 1PH9A 3U9SA 3TMEA 1L1OC 3ZUGA 3I4NB 3TN2A 2A69C 1S3OA 3ND9A 3W2GA 2VBVA 3C3LA 3NEMA 2BN4A 1AE3A 4XN0A 3M4PA 4XXEA 3KF6A 3CQZB 4B3ML 2V7TA 5BSXA 3D4RA 2PPBC 5C3EH 3C1FA 4LBWA 4B9XA 4DFAA 4G57A 3I55B 1O7IA 4YCUA 3NQIA 5LMNQ 5HGTA 5A89A 3CCSB 5E4XA 2MPMA 1CFMA 2X85A 1GUSA 4KJNA 3VO2A 5EKKA 1SBBB 1BBUA 3D4WA 3GTQH 4EQNA 3K7UC 1GO3E 3K0XA 4ZV4A 4NXNL 4LNQA 4O0AA 3CCVB 4BPRA 1QNKA 4KV6A 1LLRD 5CBAE 1SYDA 2X8KA 4QUZA 5EBDA 1GAWA 4QGUA 3OTOQ 2KA7A 3K59A 3STBC 3TQYA 1IKLA 3ASTA 1EEID 3RZDH 3M4OB 1VLYA 1XX8A 2RQXA 4OX9Q 2PI2E 2HLDA 5F4MA 4PMBA 3W1BA 1B44D 3I3CA 3I4OA 3TBIB 3SK5A 2RC6A 1HRJA 2RSOA 3I70A 4A3CG 4QIWE 2VB2X 4GKJL 1VHOA 1KNAA 1IYJB 5L37A 2PQAB 1KABA 4XN3A 2HIXA 3HOXB 4ZQ3A 3SXHA 1H42A 4X0CA 3P20A 3AGQA 5FNZA 1P8LA 3GTJB 4PGOA 2K05A 1ELOA 2IWHA 1K3BC 4FNFA 3NENA 2KCTA 4FVMA 2BA1A 3S15H 4KN7C 3Q38A 3HAGA 4Z4YA 1EOVA 5LMNW 1GM5A 2MUYA 4A3JG 4JCVE 5IYDH 1V0FA 2D62A 1FGBD 3AQQA 3U50C 4XKVA 2VUMG 5M5YB 2E76C 3M7GA 4JK1C 4OL7A 4KN4C 1VQ5A 5CYUA 4FF1A 2K04A 4MYUA 3KBXA 1SKQA 2I0QA 1E3ZA 2JJ2A 2F0FA 4EQ5A 1D2EA 5ELDA 3ZZUA 2WSSA 2RDGA 4B9WA 4DV5Q 1CKMA 1F9RA 1YJ9B 1NBMA 4XOTA 2EE1A 5GQOA 3AVTA 3H3VC 1QFJA 3UDFA 2XZPA 1VQ6B 1LTLA 2R93G 2V4DA 1A2UA 3FPKA 2NVXB 1U4RA 3UDIA 4ZCIA 1XWEA
chains in the Genus database with same CATH topology
1ESFA 1TWFB 2F0SA 1PLFA 2F0OA 4RHSA 1G2SA 2FFKB 4K5VA 1CTMA 2JSOA 1I4PA 2A74C 1VF7A 1OB0A 2WAQB 1VF5C 3MHBA 4RH6A 3GTKB 4IFDG 4A3GB 4XTCS 5BN5A 2B2VC 4ODGA 2Q8IB 1RTNA 1S5CD 2KVOA 3GTOB 3SHLA 1LT6D 4RFBA 1KMHA 1CM9A 3K5LA 1UD2A 4C3JB 3EJIA 2F1MA 1EEFD 2OXPA 4KMUC 2J4XA 1OXTA 2K32A 2TMPA 1PFBA 3KBGA 5C4ZA 1Y8NB 4BBRB 2W6JA 1GUNA 1HFNA 4KKTA 2L4NA 2A68D 1PTOB 2VNUD 1MI2A 2JA6B 3NXWA 1G91A 2BDNA 3MZ5A 5C6AA 1BBXC 4XQNA 3TDQA 1M8AA 4UAIA 3P1HA 1FR3A 2A6HD 1BCPB 2JP1A 1TQOA 4XKWA 4K8JA 2TSSA 1PRTF 5A2QE 2WV6D 4NKLA 3A35A 2A6ED 5CV5A 2BCOA 4TKOB 3GV3A 4Z1MA 3DDYA 3J7AV 3IKJA 1NRKA 2L9HA 1X3PA 2IL8A 4CKCA 2IX0A 4K6LA 1X3QA 3A8JE 2VB3X 4KHVA 5IODA 5I2YA 4ZAIA 1G291 1UNSA 2Z8LA 2X6GA 4LMQD 1A2TA 2X6WA 3GO5A 4RGNA 1JCKB 1IW7D 2NVQB 1VJSA 3SR1A 4OIJA 5LHY1 3CMMA 2PMZB 4HCSA 1GUTA 1LO5D 4C3IB 5C3XA 4XNFA 2F0VA 4IALA 4Q0FA 1I4RA 4XQFA 1GOZA 1U4PA 1GUGA 3MEHA 4AYBB 5EBCA 1PYWD 2E2DC 1K8MA 3QIAA 2H1EA 1ZKOA 2O5IC 5C3EB 2KUMA 4K8IA 5IGEA 2B39A 3V2TA 3MFGA 1C4QA 1WTPA 5FLXE 4ASUA 2R3ZA 3GTQB 4PV1C 4DN4M 1F2ZA 4RGTA 2PCFB 3S9WA 3R8BA 2B2WA 1KDBA 3U9OA 2EJGC 1HVXA 1D1IA 4KY6A 1RD9D 1STAA 3QO2A 1SKYB 1SYCA 4H13C 5EGTA 4G4KA 4J1MA 3KLSA 4KHZA 2K33A 3S1NB 2R7ZB 2WKDA 2PQEA 3ITPA 2K6AA 3QB3A 1HQRD 1QCBD 3L9AX 1JWUD 3BG3A 1SNMA 3H09A 1DCZA 4I65A 5BN3A 2N55A 5NUCA 3PV0A 3SK6A 1O78A 4XYOA 2EY1A 2WKCA 5K36H 2EY5A 3VYSA 1AZPA 3CRLC 3OHXC 1J8IA 3OMGA 2JEAI 3N6RA 5AFWA 4IUUA 2E2JB 3KUPA 1JICA 4LJZC 2JIZA 1FNUA 1CI3M 3HOWB 3MXNA 3TP6A 5CBEE 4RCOA 1WD1A 4XIGS 2ZZGA 2Q8TA 1ESRA 2Z4IA 1SMYD 4IQZA 1GUWA 4DNRB 5C44B 1LTBD 5FOBB 1BPLA 1LTRD 2X6LA 1ET6A 1EZ6A 3CP8A 1SYEA 4FF4A 5CV6A 2IJ0A 3K58A 1CA5A 2ZZFA 1JB3A 2PZWA 3M3YB 1HTPA 4OO1H 4PMCA 4XT3B 1JWMD 3L3OC 4UZUA 2EXZA 5EJWA 3S1QB 4G6IA 3BDLA 1KDAA 5IT9L 4EGVA 2JA5B 3DWAA 2JA8B 1V0EA 4EVOA 2XGJA 3OEEA 4A3EB 2B2WC 3RZOB 2L0CA 1DXMA 2LKVA 4ZKCB 5CMDA 1X32A 4NMZA 1BO0A 3M4YA 2Z6BD 3I73A 1F77A 4DK1A 3HOUB 4IURA 2F3WA 2EY6A 1DM0B 4XLHA 3DWQA 1SE4A 4MIUA 5IGDA 2R92B 3NWSA 3S16B 3MTSA 1W0KA 1WTOA 4MN3A 2XZLA 2V7QA 5D3IB 3BDOA 3LWEA 1EY9A 1FNVA 1B9MA 1UD4A 5EPJA 1I8DA 1Q1EA 5KNBA 3BCFA 4U68A 1T5EA 3PIP3 4ZK9B 1I4XA 1AFPA 2XSCA 4XL9A 1PTOH 4C56C 4XDXA 3J7YW 1STGA 4YIJA 1PXUA 3C2PA 2DIEA 4DK0A 3TP7A 1QWYA 3E5SA 5KNDA 4V0BA 1RHPA 1TWHB 4X3UA 4L8JA 2SNSA 3A8KE 2PW5A 4HAEA 1I6HB 1KTKA 4YEJA 2LY7A 1S5DD 4B3FX 3PIO3 1IYVA 3JAML 2QE7A 2NVYB 1PZJD 4K2LA 1G2TA 4C3HB 4DU9A 5J22A 1UD5A 4AVZA 2QDBA 3FPUB 1PZKD 5EQ0A 4XM3A 4II2A 2ZTNA 1V1PA 1HUMA 4PQXA 2L55A 4O1NA 2E1BA 5C5LA 3G6JB 5CV4A 4XMYA 1YNJD 2K01A 3OE7A 1H9KA 1NAPA 5IGBA 3TP5A 2XZOA 2EOTA 5M3MB 3AU7A 4RGMA 2AQ2B 1E43A 4KTAA 3CKIB 1BCPF 2WPDA 4ILWA 1BOSA 2R9VA 2A68C 4DAPA 3VR2A 4C3IG 1STYA 4R8IA 2NUCA 1MSGA 3CESA 5CV9A 2A6HC 3MC0B 2B2VA 3GVJA 2KHSA 1WPCA 3DEOA 2A6EC 2HUGA 3H6MA 3H91A 2EPBA 3VR5A 2V31A 4OO1I 5DEHA 3KF8A 4WORA 4KKSA 2D2CC 4QUFA 3W3AA 2JDIA 3QWNA 3OEHA 2M2LA 1ONLA 1STEA 5ELCA 4IN3A 4CBVA 2PYKA 4ZLTF 1JQYD 1WTQA 1CA6A 1IW7C 1W6KA 2A73B 3S2HB 3OWFA 1HQMC 4G7ZC 4A3DB 2EYJA 2IPKD 3RMHA 3M85A 3BZDB 3Q24A 1TWCB 1OO9B 3EQLC 3GP7A 1D5MC 4UDUC 3TP8A 1A3TA 5E4WC 4P2CB 3S2DB 1Q8IA 2PW7A 1YNND 3DXJC 5JEAJ 1DOLA 4WJWA 3C1EA 1DYQA 1R4QB 3MVVA 1GXDC 2SNMA 2AUKA 2B8GA 2PNRC 3P75A 4IFDJ 4QIWB 2F43A 3HZXA 1CZWA 2AWOA 3PUWA 1EQVA 5C0XJ 1Y8PB 5E1FA 4C1NK 2ZXPA 3R2IA 3PUZA 3HEJA 2XIWA 1E2WA 3MWYW 3SVMA 4HN7A 2F0GA 1PKVA 3J80E 3BYYB 3NTKA 2JE6I 4A3KB 4ZYSA 2XWJB 1EFRA 2EJMA 3PUYA 3EFXD 3DWPA 3CU7A 1E0BA 2ICIA 4WFN3 3W2DA 4C1NI 2F0QA 2F03A 2BOSA 5JEAH 3SK8A 4II3A 2CW0D 1I3QB 1TT2A 2YYZA 3GVKA 4XOPA 1AZQA 2KEDA 1JWSD 1BF4A 3BYTB 2LMCB 1TS4A 2WIIB 2JYOA 5C0XH 3CHBD 4KD4A 2AQ1B 3NSWA 3OMCA 1WTWA 4XYQA 1I50B 5KNLA 2N88A 1J9OA 2NYZD 4IUTA 3BVGA 4LK1C 4TQUS 4X3KA 1IL8A 1Z6HA 3GTLB 1DOMA 1B2TA 2B2UA 1CZGA 2EZVA 3HOVB 1K28D 3FKSA 1SYBA 2DNEA 1K83B 1TVXA 2WB1B 1LTSD 1SMYC 1CT1D 1WD0A 1Z7TA 3PUVA 2K5QA 3MA2B 3NBIA 2MJ8A 1QB5D 5A2QL 3O13A 5JPMC 2J0TD 1LACA 1KDCA 3DMUA 1DJRD 3VA5A 2A69D 3WQZA 2J7ZA 2EY2A 1SJHD 3IL8A 4TRDA 1JORA 4P22A 2K28A 3K57A 5JVH3 1UD6A 4XLCA 4DAYA 4DAVA 5IIFA 4CJ1B 5EKLA 4BWGB 1TS5A 4H7BA 1EWHA 1VMPA 1ENCA 3A54A 4KY7A 1G6ZA 2E74C 3I4LA 3BS1A 1FNWA 4ZUIA 2NN6H 1C8CA 5HURA 1PTOD 3BVMA 5FL7A 3DEPA 3S14B 1D5XC 2E2IB 3LX0A 5F2DA 2BE5D 3L7ZC 1BCPD 4QUCA 3F2UA 2B8FA 4H0LC 1U4MA 5DN6A 2X53S 2LFNA 3T4AC 4EQPA 1E1RA 3J7AF 1JOQA 1PRTC 3HRZC 5LL6X 2D3NA 2HQEA 4L6TB 1B53A 2RDHA 5ELBA 4HMIA 5FLXL 4FP5D 3BVZA 1SNPA 1SNOA 5FO9B 1BLIA 4QMGA 3TZDA 4XLFA 2AWNA 2B2UC 1F2MA 1XYIA 3R2TA 2KECA 4K5XA 3R93A 4GQNA 1W9XA 3C46A 4B3GA 4HMJA 3X3NA 1EYCA 4K2KA 1SAPA 4IUQA 1BDOA 2EYHA 4TSSA 1JE4A 3URYA 3AB9A 2F0PA 2ZZEA 1TU2B 4CJ0B 3VYRA 3KK7A 1AEXA 2EDGA 3D3RA 4RA8A 4FXGC 1ENFA 5JPNC 4FO2A 1DOKA 5J1ZA 4HIZA 4IFDI 1Q90A 2K5DA 4U673 2VUMB 2JA7B 1DONA 1A6XA 1VDZA 5C0XI 5K36G 3KLSX 3OAAA 5FO8B 1BMFA 2WJYA 2VJJA 5IGCA 2LZJA 1KLUD 1YNJC 1FYCA 4G7XA 1EIGA 2FMCA 1HPCA 3RUZA 1UUPA 2R61A 2L12A 3A55A 1SE3A 4NNJA 1I4QA 4TSFA 2NVTB 3ERQA 3GTPB 1R4PB 5COYA 4L63B 3RLFA 5EPLA 5FK9C 1BXTA 4F8MA 1F9QA 2B2TC 1QILA 2CHBD 4NDXA 4OGQC 3OPOA 5D14A 3DHQA 1PRTB 4ABNA 3BH4A 4OO1G 1F2LA 1GUOA 1WCMB 1E2ZA 1JC7A 3EROA 1F9PA 3HP3A 1TR5A 3A8IE 2NTTA 1DZ1A 2DY8A 5I6YA 2GJKA 4HR7B 5FKAC 3QG1A 3I72A 2GA4B 3MXPA 5C4JB 2M9VA 1STHA 2EYOA 5KNCA 4N9TA 2E75C 3GVLA 2XRQD 3VYUA 1EY5A 1F9SA 3PO3B 1Q3LA 4HSPA 3Q22A 2NN6I 1R9TB 3V05A 3GD7A 2ZTGA 5JAVA 3T53B 2DN8A 4A3MB 2E2HB 3T56B 1ZYRD 4DF7A 4JMQA 4CKBA 3VR3A 2EVBA 3S1MB 4HTHA 1F2YA 1CHPD 5DAUA 3Q0AA 4X3SA 1YNNC 1KLGD 1Y1VB 3T51B 5LL6S 1CK1A 1RTOA 4C3JG 4F88A 5T1GA 1U4LA 4J8QA 1EIHA 1ILQA 1H9JA 3ND8A 4FF2A 1NUCA 5IK2A 4XORA 4RGOS 3FKIB 4PNYA 1LABA 1LTID 1SYGA 1HFGA 2Z1CA 3UI2A 4ME5A 1D5ZC 5ISRA 3RD4A 3JU4A 3QOLA 1I4HA 2CQAA 4CGYB 3I4MB 1EL0A 1LTTD 4Y7NB 1WTRA 3OWEB 2I46A 3HOZB 2KVMA 2RDFA 4N9PA 2YU9B 3FVQA 2OEOA 1COWA 4A93B 4F87A 3PO2B 1E1QA 2B2YC 4BY1B 2X6YA 3ZPNA 1STNA 3IFDA 5M3FB 1T5XD 2KCCA 1ILPA 1WTXA 1EY4A 3IFTA 4A3BB 1GHJA 3V96A 4PMWA 2CW0C 2A5HA 2IW3A 5M5XB 3OIQA 1TWGB 2WINB 5CV7A 3WOEA 3MXGA 4CHTB 3NHHA 3HKZB 1HA5A 1PTOF 2ZXHA 1HHVA 2VJIA 3KLRA 3FDTA 1XTCD 1HXYD 2BA0A 1D1KA 5EPKA 4YELA 2RBMA 1LT5D 1H9SA 5I6WA 3NQTA 1EYAA 5C3WA 4G7HC 1BR9A 1OXUA 4BY7B 3VA7A 5KYLA 5T1IA 4DXGA 1B3AA 5KGUA 1W0JA 3VR6A 2KQ3A 1H9RA 1KNEA 4F7XA 1TIID 1GHKA 2K7VA 1LT4D 2NBFA 1EY8A 4G7OC 2HDLA 4IZ8A 3G05A 1IHZA 3HGBA 1SDFA 3AMUA 4FXKC 4A3IB 3GQBA 1V8QA 5ELEA 1B1ZA 2O4XA 2ID0A 1SXTA 2OT2A 4S3SA 3FPPA 2GJRA 1BQQT 2D9UA 2CK3A 3BC9A 2G9HD 2EYMA 4QCLA 4KKUA 5CGKA 2FINB 1SEBD 4R9WA 3PMFA 3TSSA 1UAPA 1PMRA 2F0LA 1SFOB 3QOJA 1NR2A 3K6OA 1G8ZD 1IYUA 1PTOC 4XLEA 1HZEA 2CVRA 4GZYC 5JOBA 2PZTA 4RWSC 1S5ED 2AUJD 2BE5C 4QB4A 2G9DA 4O42A 5JVG3 1BCPC 1Q12A 3D6CA 2Z4HA 2SOBA 4WRDA 1TY0A 4RAUC 1E79A 2LS01 1SYFA 4G7WA 2ZXIA 2GK6A 1O7LA 5C4XB 4XR6A 5HKKA 3S1RB 1PZID 1OXVA 1WP6A 4EQOA 1OXXK 4OHJA 3CP2A 3NBHA 1EY0A 5M5WB 2X6XA 1EU3A 3NTIA 1D6EC 3J80L 5J39A 2XOKA 3OFNA 2EYFA 2FHTA 3OSOA 2IX1A 4IUNA 1RF2D 1LT3D 2RSNA 1L0XB 2JJ1A 4HEDA 5KRUA 4IUVA 2O5JC 1KAAA 4DA2A 1HA6A 3TZUA 5JEAG 4IFDH 2F0NA 2XVSA 5I9PA 3N52A 5FO7B 1LV9A 4FF3A 2XNDA 1Q1BA 1EQTA 2NZ1D 1SNDA 2B63B 1RKNA 5C0XG 1EZ8A 2XWBB 2DY7A 3PUXA 2AQ3B 1UEAB 1S5BD 1ML0D 5BN4A 4ID6A 1CQVA 1O7YA 1BNZA 3H0GB 4E6IA 2SDFA 1OHHA 1B50A 1EU4A 5C5MA 2ZXRA 1ENAA 4TT3A 5IGFA 5I2XA 2F0UA 4XT1B 5C4HA 3SEBA 3P7JA 3NP8A 1EWCA 2ZT9C 2XNAC 2XN9C 1I6VC 1V1PB 3NPPA 4BBSB 1ICWA 3HG9A 2F0HA 2KCNA 1MGSA 4IUPA 3LWUA 3D31A 4ZUJA 3IAYA 3I91A 4BA1I 3A3GA 2KJXA 1C48A 1STBA 2QCPX 4XQQA 1SNQA 1NSNS 2OF1A 2H4OA 2F0DA 1ZXTA 1H9SB 1LTAD 1EY6A 4RKBA 1JOKA 3NUCA 5KEEA 2F0IA 3QJYA 2WP8J 1M4VA 2L1BA 3M7NA 2Y0SB 3VYTA 2EYPA 4A3FB 1Y1WB 3I8ZA 4M8AA 2NN6G 5G3LF 2IT1A 4XQJA 4J6HA 4R8NA 3G7LA 2B2TA 4LAAA 3WDNA 3ZIAA 2F0MA 2RKSA 3NK9A 1EY7A 4XD7A 5KIXA 4C3HG 4RKLA 2K03A 4NW2A 3ONAB 2ZZQA 1CHQD 1Y69U 1ZYRC 2NWGA 2HCIA 1TWAB 1QNUA 1Y8OB 4KJOA 3D6WA 4KY5A 1GJXA 2DNCA 3SDZA 1BUVT 2ZXOA 2R6GA 1VCIA 1O7ZA 2FMMA 2O2LD 1IKMA 4JBWA 2ICEC 3NWTA 1QG7A 3D4DA 1UD8A 5CORA 1TY2A 1I4GA 1JOOA 3RZDB 2C9OA 2WJVA 3FMCA 4KK7A 4XONA 2IX3A 2K1BA 2M5SA 5M9OA 4NP5A 2HDMA 2Q8RE 3MXUA 3CRKC 1RODA 3OIPA 1SNCA 4A3JB 3BDCA 1ET9A 1EOTA 4ZRZA 1HCZA 3OOCA 1QOHA 2X69A 3S15B 1RCVD 2JXMB 1S5FD 5D3DA 2MHVA 3LNNA 2F0EA 1OXSC 2PZUA 2F4IA 5K5PA 3J81E 4YXWA 3MFYA 3A7AB 1NR4A 3T16A 4BS9A 2F3VA 2R93B 2F0KA 2ENBA 3K5NA 1TKWB 4H44C 1SSOA 3J81L 3R3OA 1O80A 2L5TA 5CDFA 1FD7D 5I9OA 2GK7A 4X3TA 1S4ZA 3A56A 4K5WA 1HTLD 4CJ2C 2B2YA 2F0JA 4RHRA 3HS0C 1LTGD 1RJTA 1TS3A 2JEBI 1E3XA 2RVLA 2NTSA 1H8HA 2SEBD 4ZKBB 2K5WA 3I90A 4KD3A 3SE0A 1DD2A 1H8EA 4HSVA 1E2VA 2XRSD 1A3VA 3SK4A 3VR4A 1KZLA 5EKIA 5IGGA 5A35A 1K8OA 1SE2A 3KEWA 1L0YB 5IT9E 5D65A 2BDOA 2MGSA 5E3FA 5CR3A 1AP0A 1VMCA 2F0TA 5I4DA 1MABA 4K6DA 2QKIC 2RA4A 2QEJC 1UD3A 2WACA 3S17B 1JR0D 1A3UA 3NTHA 3H94A 4K14A 3E0JA 1U9RA 3MAQA 1AW7A 1WVLA 2FJ2A 3K5MA 4E0FA 1XXGA 1MD2D 3EVQA 5CV8A 3NE5B 1RDPD 4DXFA 4OIKA 3D8GA 2F0WA 1MBYA 1SJED 1D2BA 4HCEA 4Z9CB 1PFMA 1CQFA 1ZEQX 3WOFA 4DNTB 1PRTD 2GJPA 3EA6A 2L11A 1W6JA 3GTMB 2W6IA 4CKEA 2KEEA 4B08A 1QJOA 2KOLA 1I18A 1HUNA 1WTHD 2WZPP 2EJFC 4ULLA 4XLAA 4M1UB 5JJZA 3FRPB 3GTGB 2PO4A 2NB0A 3DUZA 1B9NA 3K0YA 3FEWX 2QF7A 1B4OA 5KYIA 4FYDA 3JAME 1FX0A 3A3BA 1NCVA 1V43A 1TS2A 3K5OA 1V1OA 1A15A 2C5CA 4FXDA 2VXWA 2EYLA 5CC4A 3A7LA 4MHEA 3E6ZX 5IOCA 4KI0A 5G3LD 3DM1A 4QF4A 5DM73 2QILA 3GV6A 1QE6A 1PFNA 1AN8A 4FXUA 3ZYYX 1Z47A 3Q23A 3BCDA 3OW7A 1PDQA 2HCCA 4BA2I 1H9MA 3X3MA 3HOYB 2M00A 2I07B 2D3LA 3T13A 3Q6SA 2D5DA 1MSHA 4DGZA 5ELFA 4RCNA 5DM63 3K7AB 4V190 5DNFA 1WTVA 1II3A 4I7ZC 5TSSA 4C2MB 4Q5VA 2MP1A 1EYDA 1EFID 3U9SA 3TMEA 3I4NB 3TN2A 2A69C 3ND9A 3C3LA 4XN0A 4XXEA 3CQZB 3D4RA 2PPBC 3C1FA 4DFAA 4B9XA 4G57A 3NQIA 5HGTA 5E4XA 2MPMA 1CFMA 2X85A 1GUSA 4KJNA 5EKKA 1SBBB 3D4WA 4EQNA 1QNKA 4KV6A 1LLRD 5CBAE 1SYDA 2X8KA 5EBDA 2KA7A 3K59A 1IKLA 1EEID 3M4OB 1VLYA 1XX8A 2RQXA 2HLDA 4PMBA 1B44D 3I3CA 3TBIB 3SK5A 1HRJA 2RSOA 3I70A 2VB2X 1KNAA 1KABA 4XN3A 3HOXB 4ZQ3A 3SXHA 3P20A 3GTJB 2K05A 2IWHA 4FNFA 4FVMA 2BA1A 4KN7C 3HAGA 2MUYA 1V0FA 2D62A 1FGBD 5M5YB 4XKVA 2E76C 3M7GA 4JK1C 4OL7A 4KN4C 5CYUA 4FF1A 2K04A 3KBXA 1E3ZA 2JJ2A 2F0FA 5ELDA 2WSSA 2RDGA 4B9WA 1F9RA 1NBMA 4XOTA 2EE1A 3H3VC 2XZPA 2V4DA 1A2UA 2NVXB 1U4RA 1XWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPP A;  1SMY C;  3DXJ C;  5C0X G;  4DNT B;  3BG3 A;  4OO1 G;  3PUX A;  3I73 A;  4DK1 A;  3U9S A;  1Z7T A;  1GUO A;  3PUV A;  5BN4 A;  1DCZ A;  1E2Z A;  1G29 1;  2A69 C;  3ND9 A;  2KCC A;  5BN3 A;  3PV0 A;  1Y69 U;  2AUK A;  1ZYR C;  2B8G A;  2PNR C;  3A8I E;  1O78 A;  4KKU A;  3IFT A;  3D4R A;  1CTM A;  2PPB C;  1LAC A;  1Y8O B;  5K36 H;  1IW7 D;  1GHJ A;  2CW0 C;  1QJO A;  2AWO A;  2A69 D;  1VF7 A;  3CRL C;  3PUW A;  4HR7 B;  2A68 C;  1VF5 C;  1PMR A;  3QG1 A;  2JEB I;  3I72 A;  2JEA I;  1GUT A;  1Y8P B;  4IFD G;  3N6R A;  2DNC A;  1GJX A;  3VR2 A;  1CFM A;  1GUS A;  2EJF C;  4XTC S;  3SDZ A;  5BN5 A;  3PUZ A;  1IYU A;  1BDO A;  4LJZ C;  2Q8I B;  1E2W A;  5KNC A;  1CI3 M;  1B9N A;  3SE0 A;  3AB9 A;  1DD2 A;  2E75 C;  4GZY C;  2R6G A;  1E2V A;  2A6H C;  2QF7 A;  1VCI A;  3BDO A;  1TU2 B;  2ZT9 C;  2JE6 I;  2AUJ D;  2BE5 C;  2EDG A;  3VR4 A;  4XIG S;  1V43 A;  3KLR A;  1I6V C;  1Q12 A;  2EJM A;  3PUY A;  2A6E C;  4IQZ A;  2KA7 A;  4DNR B;  4JBW A;  5A35 A;  2F1M A;  1GUG A;  1K8O A;  2BA0 A;  1B9M A;  2NN6 I;  4KMU C;  1Q1E A;  1Q90 A;  3GD7 A;  5KNB A;  1OXT A;  2BDO A;  3T53 B;  1K8M A;  1EWH A;  1T5E A;  2DN8 A;  2K32 A;  3QIA A;  1ZKO A;  2O5I C;  1Y8N B;  3T56 B;  1A6X A;  1H9S A;  1VDZ A;  3A7L A;  3FMC A;  5JEA H;  3VR5 A;  3LWU A;  5K36 G;  3D31 A;  3VR3 A;  4KI0 A;  2EVB A;  1GUN A;  4G7H C;  1O7L A;  4KKT A;  1OXU A;  4BA1 I;  2E74 C;  3I4L A;  2A68 D;  4KKS A;  2NN6 H;  4DK0 A;  2D2C C;  1OXV A;  2YYZ A;  3MXU A;  3VA7 A;  3W3A A;  3P20 A;  1OXX K;  1YNJ C;  4PV1 C;  1FYC A;  5KND A;  1ONL A;  1FR3 A;  1YNN C;  1HPC A;  2LMC B;  3T51 B;  3CRK C;  3OW7 A;  4L8J A;  2PCF B;  5C0X H;  1HTP A;  4OO1 H;  3A8K E;  2BA1 A;  2A6H D;  3VR6 A;  1H9R A;  4BA2 I;  4KN7 C;  1H9M A;  2BE5 D;  3L7Z C;  1H9S B;  1H9J A;  3H94 A;  3ND8 A;  1HCZ A;  3OOC A;  2D62 A;  2EJG C;  1IYV A;  2A6E D;  1GHK A;  2E76 C;  2B8F A;  2JXM B;  2K7V A;  4JK1 C;  4KN4 C;  3QJY A;  1LAB A;  3LNN A;  4H0L C;  1IW7 C;  1OXS C;  4G7O C;  3M7N A;  4TKO B;  3RLF A;  2O5J C;  1HQM C;  4G7Z C;  2D5D A;  4LK1 C;  4TQU S;  3IKJ A;  3TZU A;  5JEA G;  3WDN A;  4IFD H;  3HGB A;  3MFY A;  3M85 A;  3NE5 B;  4H13 C;  1Z6H A;  3A7A B;  4KHZ A;  4RCN A;  3EQL C;  2K33 A;  3GQB A;  1V8Q A;  2NN6 G;  4OGQ C;  1DXM A;  1Q1B A;  2V4D A;  4I7Z C;  3OPO A;  1TKW B;  2IT1 A;  4H44 C;  3A8J E;  2DNE A;  3M4Y A;  2L5T A;  1H9K A; 
#chains in the Genus database with same CATH topology
 3BZK A;  4NPS A;  4B3S Q;  4PC6 A;  1ESF A;  1S72 B;  1TWF B;  2C2W A;  2F0S A;  3CTA A;  1PLF A;  3OP1 A;  5L46 A;  4DV2 L;  2F0O A;  4GLV B;  5C44 H;  4RHS A;  1K8G A;  2UXB Q;  1G2S A;  3Q39 A;  3T1H Q;  4GN3 B;  2FFK B;  4YY3 Q;  3OZV A;  3UDG A;  4JYA Q;  3ISX A;  1HR0 Q;  3CPF A;  4K5V A;  4X05 A;  1CTM A;  2JSO A;  1HNX Q;  1NJI D;  4FK8 A;  1I4P A;  2A74 C;  1VF7 A;  1T9H A;  4MNO A;  1OB0 A;  2JQO A;  2WAQ B;  1VF5 C;  3MHB A;  4RH6 A;  3GTK B;  1HNW Q;  4IFD G;  1I5F A;  3PVD A;  4JI3 Q;  4A3G B;  4XTC S;  5BN5 A;  2B2V C;  4ODG A;  3Q6R A;  2Q8I B;  1RTN A;  1S5C D;  2KVO A;  3GTO B;  4YAO A;  3SHL A;  1B2R A;  1LT6 D;  4RFB A;  4A3L H;  1NB0 A;  1KMH A;  2F4V L;  4AH6 A;  1WCM G;  1CM9 A;  2HHH L;  3K5L A;  1UD2 A;  2WB1 E;  2N78 A;  2BVN A;  3EJI A;  4C3J B;  2F1M A;  2ZBU A;  1EEF D;  4PZ7 A;  2OXP A;  4KMU C;  1QUF A;  3ZBT A;  2J4X A;  1OXT A;  2K32 A;  2TMP A;  1Q86 D;  1PFB A;  1I94 Q;  3KBG A;  3CCL A;  5C4Z A;  1YIT B;  1Y8N B;  5FJ8 G;  4B3R Q;  4BBR B;  4B3T Q;  2JA8 H;  2W6J A;  2G5D A;  3BY1 A;  1BQE A;  3EN2 A;  1GUN A;  1HFN A;  4KKT A;  2L4N A;  3J7Z C;  2A68 D;  1PTO B;  1EFC A;  2VNU D;  1MI2 A;  2JA6 B;  3NXW A;  1G91 A;  4X6A H;  2BDN A;  3MZ5 A;  5C6A A;  1BBX C;  4JI7 Q;  4XQN A;  4APV A;  3TDQ A;  3RN5 A;  1M8A A;  4UAI A;  2OQ0 A;  3P1H A;  1HR0 W;  1FR3 A;  4DR5 Q;  3PO3 G;  4DV7 L;  3AEV A;  1WTH A;  1CQX A;  2A6H D;  1BCP B;  2JP1 A;  1TQO A;  4XKW A;  2OTL B;  1TLL A;  1PRT F;  2TSS A;  4K8J A;  5A2Q E;  1HZA A;  2YV5 A;  3HOU H;  4OEM B;  2WV6 D;  4NKL A;  1EXM A;  1P16 A;  1JJ2 B;  3A35 A;  2A6E D;  1X6O A;  1HZB A;  5CV5 A;  2R7D A;  4P26 A;  2BCO A;  2HQL A;  1GO2 A;  4GS3 A;  4TKO B;  3GV3 A;  4Z1M A;  3DDY A;  4Z4V A;  3J7A V;  3S16 H;  2D9R A;  3IKJ A;  3WWV A;  4JI4 Q;  2HDN B;  1NRK A;  5IYC G;  2ZIT A;  3W5O A;  4LF4 L;  2L9H A;  1PJ5 A;  1YJW A;  1X3P A;  1DGS A;  2F3I A;  1D8T A;  3CW2 C;  2IL8 A;  2D0O A;  3GSI A;  4CKC A;  2IX0 A;  2AKW B;  4K6L A;  1X3Q A;  3A8J E;  1XMO Q;  1UE7 A;  2VB3 X;  3I1F A;  1KK2 A;  1YHQ B;  4KHV A;  1N34 Q;  5IOD A;  4P12 A;  5I2Y A;  4ZAI A;  1K0S A;  1G29 1;  1UNS A;  2Z8L A;  1NY4 A;  2X6G A;  4LMQ D;  4B43 A;  3FP9 A;  4JOI C;  1A2T A;  2X6W A;  3GO5 A;  4MZ9 A;  4RGN A;  4WZT A;  1JCK B;  1IW7 D;  3I4M G;  4DR7 Q;  2NVQ B;  1VJS A;  3AVV A;  4OIJ A;  3SR1 A;  5LHY 1;  3CMM A;  3MCA A;  2PMZ B;  4GKK L;  1CKO A;  1VQE A;  1OGJ A;  4HCS A;  5IP9 H;  2E8G A;  1GUT A;  1LO5 D;  4C3I B;  4CDE C;  5C3X A;  1F20 A;  4XNF A;  3I56 A;  2Z6K C;  3Q8D A;  1VQN A;  1Q7Y D;  3OJW A;  2AMC B;  2F0V A;  4BY1 G;  4IAL A;  3F2C A;  4L5R C;  4Q0F A;  5FLM H;  5JJL A;  4X64 Q;  3G4S A;  3ER0 A;  1I4R A;  4XQF A;  4LFA L;  5M3F G;  1GOZ A;  1YHB A;  2K50 A;  4ME3 A;  1U4P A;  4DV1 L;  1GUG A;  1BX0 A;  3MEH A;  4AYB B;  4A75 A;  5EBC A;  4JI0 L;  1PYW D;  4MTN A;  1AE2 A;  4R4I A;  4P25 A;  2E2D C;  1K8M A;  3QIA A;  2PMD A;  1ZKO A;  2H1E A;  3CCQ A;  2O5I C;  1UE5 A;  2Q6L A;  2KUM A;  5C3E B;  1JJC B;  1VQ7 A;  2WR8 A;  4K8I A;  5IGE A;  4P2N A;  2Z9H A;  1KK1 A;  1XPU A;  4EX5 A;  2B39 A;  3V2T A;  1Z9F A;  1JMC A;  1VQC A;  3MFG A;  3U6K A;  3HKZ G;  1ZM2 A;  1C4Q A;  1WTP A;  5FLX E;  3BY2 A;  4ASU A;  4RMF A;  2R3Z A;  2RHS B;  4HJ5 A;  3GTQ B;  1N06 A;  4PV1 C;  4DN4 M;  1F2Z A;  4DR2 L;  1OB2 A;  3HOY H;  1C0A A;  4RGT A;  2PCF B;  3RY8 A;  3S9W A;  2PLF A;  3R8B A;  4Z4T A;  2B2W A;  4CDC C;  1KDB A;  2I5M X;  3EIV A;  3JC6 6;  2IY5 B;  1K73 D;  3U9O A;  2EJG C;  1HVX A;  2CBX A;  5IP7 G;  1JNY A;  1D1I A;  1EQR A;  4ZCK A;  1FRN A;  4UP9 A;  1Y14 B;  1WOP A;  3A8K A;  2K52 A;  4KY6 A;  1RD9 D;  1HNZ L;  1STA A;  2JN9 A;  4LF7 L;  4X7D A;  3QO2 A;  2KBN A;  1E64 A;  4RLZ A;  1SKY B;  4P3I A;  1L2F A;  1SYC A;  4H13 C;  5EGT A;  3DM3 A;  3ZZ0 A;  2VY3 A;  4G4K A;  3KLS A;  4J1M A;  4KHZ A;  4BY7 G;  2YWE A;  4C2M H;  1X3G A;  2K33 A;  3S1N B;  3W2F A;  2R7Z B;  2WKD A;  2PQE A;  3ITP A;  4MTK A;  2K6A A;  1M90 D;  3QB3 A;  1HQR D;  1QCB D;  1VQ5 B;  3I4N H;  3L9A X;  1JWU D;  3BG3 A;  1SNM A;  3H09 A;  5KSW B;  1DCZ A;  1GD7 A;  4I65 A;  5BN3 A;  3TRZ A;  2N55 A;  5NUC A;  3PV0 A;  3TRE A;  4UY8 C;  2Q2I A;  3U4V A;  3SK6 A;  1O78 A;  1EWY A;  3NBH B;  4XYO A;  2EY1 A;  2WKC A;  5K36 H;  2C4U A;  2N49 A;  1V5V A;  2EY5 A;  4DUZ Q;  3TS0 A;  3VYS A;  3MHP A;  1AZP A;  3CRL C;  3QFR A;  4A3I G;  4YWM A;  2R7F A;  3OHX C;  1FRQ A;  1J8I A;  3OMG A;  2JEA I;  1IBK Q;  3N6R A;  5AFW A;  4IUU A;  4OPO A;  2E2J B;  5JJI A;  3KUP A;  1JIC A;  4LJZ C;  2JIZ A;  1FNU A;  3J80 c;  1CI3 M;  1T6X A;  3HOW B;  3MXN A;  3TP6 A;  5CBE E;  2F52 A;  2OK7 A;  2LSS A;  1YIJ B;  2EXD A;  4LF8 L;  4RCO A;  2UXD L;  2CWP A;  4DR1 Q;  1WD1 A;  1WSV A;  4LBV A;  4XIG S;  2ZZG A;  3Q6Q A;  4DV0 L;  2Q8T A;  1ESR A;  2Z4I A;  1SMY D;  4IQZ A;  4AIM A;  1GUW A;  4DNR B;  4JI2 L;  1SM4 A;  4PZ6 A;  5C44 B;  1MJC A;  1XMQ Q;  4ZCM A;  3ULP A;  2ZTE A;  1LTB D;  1X65 A;  5FOB B;  2A19 A;  2A8V A;  1VQI A;  1BPL A;  3K80 C;  1LTR D;  3HOX H;  3C2Q A;  4AF7 A;  2X6L A;  1J5E L;  1W2B A;  1ET6 A;  1EZ6 A;  4DV3 Q;  3L2P A;  3CP8 A;  3GTJ H;  1TWC H;  1SYE A;  4NBS A;  2VQF Q;  4FF4 A;  5CV6 A;  2IJ0 A;  3K58 A;  1CA5 A;  1GAQ A;  2ZZF A;  3LQE A;  1JB3 A;  3PUN A;  4OOS A;  2PZW A;  3M3Y B;  1HTP A;  4OO1 H;  5M5Y H;  4PMC A;  3LVB A;  1IXR A;  1JWM D;  4R71 A;  4XT3 B;  3L3O C;  1VQG A;  4UZU A;  2EXZ A;  5EJW A;  3S1Q B;  2QA4 A;  4G6I A;  3BDL A;  5F4O A;  1KDA A;  5IT9 L;  4EGV A;  1EFW A;  3AFP A;  2HT1 A;  2JA5 B;  4DR4 L;  3DWA A;  3RNU A;  2JA8 B;  1V0E A;  2PI2 A;  1EYG A;  5C4X G;  4M1K A;  3AYH B;  4EVO A;  2XGJ A;  3SKB A;  4UAJ A;  3OEE A;  3WY9 A;  3AVU A;  1LYL A;  2B2W C;  4A3E B;  3PA2 A;  1YI2 A;  4F7D A;  3RZO B;  3CPW B;  2L0C A;  1DXM A;  4B47 A;  2LKV A;  3ULJ A;  5BR8 Q;  4ZKC B;  1N05 A;  5CMD A;  1X32 A;  4NMZ A;  1BO0 A;  1P4M A;  3M4Y A;  1XNR Q;  2Z6B D;  1JE5 A;  3I73 A;  1F77 A;  4DK1 A;  4JI6 L;  3HOU B;  4IUR A;  2L15 A;  2F3W A;  1QVG A;  4Y52 H;  2Q6O A;  2EY6 A;  1DM0 B;  2DUD A;  4XLH A;  3DWQ A;  1SE4 A;  4MIU A;  3GTK H;  5IGD A;  2R92 B;  5IYB H;  1VQM A;  3NWS A;  4A3G H;  3S16 B;  3MTS A;  1W0K A;  1WTO A;  2VBS A;  2V7W A;  3GTO H;  4MN3 A;  1YX2 A;  4RD2 A;  1VQD A;  2XZL A;  3CD6 B;  3J81 i;  2V7Q A;  1AH9 A;  1DDI A;  5D3I B;  3CC2 A;  4C3J H;  3BDO A;  1PH6 A;  5TY0 A;  1Q81 D;  1EWI A;  3T1Y Q;  3NEL A;  3LWE A;  1QG0 A;  2VBU A;  4LF6 Q;  4JC0 A;  1EY9 A;  3L0O A;  1FNV A;  1B9M A;  2QTZ A;  4B3X A;  5A8A A;  1G7S A;  2ZTC A;  1UD4 A;  3H0G G;  1I8D A;  5EPJ A;  4BBR H;  2E1R A;  1UE6 A;  1Q1E A;  1I50 H;  1G6P A;  5KNB A;  3BCF A;  4U68 A;  1T5E A;  1JT8 A;  3PIP 3;  2CFM A;  4ZK9 B;  1I4X A;  2GPJ A;  1AFP A;  3CXC B;  2XSC A;  4XL9 A;  1VQN B;  1PTO H;  4C56 C;  2VNJ A;  5AJ3 L;  2JA6 H;  3OYY A;  4XDX A;  1STG A;  4G5G A;  2NZH A;  4YIJ A;  3J7Y W;  2KHJ A;  1PXU A;  3FJO A;  3C2P A;  2DIE A;  4DUY Q;  4DK0 A;  3TP7 A;  4GLX A;  3OZU A;  1QWY A;  4YHH L;  3HOV H;  3E5S A;  5KND A;  4V0B A;  1RHP A;  1TWH B;  4X3U A;  4X66 Q;  4L8J A;  2UXC L;  4KHP L;  2SNS A;  2OBR A;  3A8K E;  1SR3 A;  3HKZ E;  4BBS G;  3CCQ B;  3AVY A;  2PW5 A;  3HOW G;  1VQ7 B;  1IJE A;  4HAE A;  1I6H B;  1KTK A;  4YEJ A;  2LY7 A;  1S5D D;  4PC3 A;  4B3F X;  3PIO 3;  1IYV A;  3JAM L;  2QE7 A;  2NVY B;  1PZJ D;  4K2L A;  1G2T A;  4C3H B;  4DU9 A;  1NJI C;  1UWV A;  2DJG C;  5J22 A;  4DR3 Q;  1UD5 A;  4AVZ A;  2QDB A;  3FPU B;  1K8A D;  1PZK D;  2CW5 A;  5EQ0 A;  5IYP A;  4XM3 A;  3CME A;  2VS1 A;  4TN1 A;  4II2 A;  3H3V H;  2ZTN A;  1V1P A;  5A88 A;  4GOP B;  1HUM A;  3A74 A;  4LUZ A;  4PQX A;  2L55 A;  1WJJ A;  2E1B A;  4O1N A;  5C5L A;  5JJK A;  4Q7J B;  1BJK A;  1VLO A;  3G6J B;  5CV4 A;  4G1V A;  4XMY A;  3SGI A;  1XFO A;  1YNJ D;  2K01 A;  4HJ9 A;  3CCM B;  5IYQ A;  3OE7 A;  1H9K A;  3G6E A;  3P27 A;  5F4J A;  4QL5 A;  2UUC Q;  2D74 A;  2ZM6 Q;  1NAP A;  5IGB A;  3TP5 A;  2XZO A;  2EOT A;  1Q86 C;  4LF5 Q;  5M3M B;  1WDT A;  3AU7 A;  4RGM A;  4Z4Z A;  2AQ2 B;  2RCN A;  4PC2 A;  1E43 A;  4KTA A;  1KQS A;  1ZM9 A;  3CKI B;  5GAD C;  1BCP F;  1KD1 D;  2WPD A;  3E9I A;  2HIV A;  4ILW A;  1Y1W G;  1BOS A;  2R9V A;  2A68 C;  2UU9 L;  4DAP A;  3G71 A;  1HZC A;  3VR2 A;  4DV4 Q;  4C3I G;  4M2L A;  1STY A;  4R8I A;  2NUC A;  1PH3 A;  1MSG A;  3B8H A;  3CES A;  5CV9 A;  4JV5 Q;  1QGA A;  2A6H C;  3A5Z B;  3MC0 B;  4JI5 L;  5IWA Q;  3S14 H;  2B2V A;  3GVJ A;  2KHS A;  5TV2 A;  3A8J A;  1WPC A;  2IHE A;  1FVI A;  3DEO A;  2A6E C;  1N36 L;  2HUG A;  3CCU A;  1RIP A;  4AYB G;  1MHW C;  4P72 A;  5IYW A;  3H6M A;  3H91 A;  4HID A;  3AVW A;  2EPB A;  3VR5 A;  2V31 A;  5C3E G;  4OO1 I;  3MXN B;  1H95 A;  1QGZ A;  3ES9 A;  5DEH A;  3KF8 A;  4RD4 A;  4WOR A;  3VDY A;  3CPX A;  1SRU A;  4KKS A;  5HZB A;  2D2C C;  2FVG A;  4MYT A;  4QUF A;  3W3A A;  2JDI A;  3CP0 A;  1QH0 A;  3QWN A;  2OYN A;  4P3Y A;  3OEH A;  1IZ6 A;  1ONL A;  2CWA A;  2M2L A;  1STE A;  2NV4 A;  5ELC A;  4P74 A;  1J9Z A;  4IN3 A;  4CBV A;  3W1G A;  1NE3 A;  1VQ9 A;  2YWH A;  3RLN A;  2PYK A;  2XNJ A;  4ZLT F;  1JQY D;  4G1B A;  4JI8 Q;  2VNK A;  1WTQ A;  1CA6 A;  1IW7 C;  3JAM i;  1W6K A;  2A73 B;  3S2H B;  3OWF A;  1GVH A;  1HQM C;  4G7Z C;  1K9M D;  4A3D B;  3S1N H;  2EYJ A;  2IPK D;  3RMH A;  1IBL L;  2R7Z H;  3M85 A;  4GNX A;  1YJN A;  1TUI A;  3BZD B;  1R5O A;  3Q24 A;  1TWC B;  4R4O A;  1OO9 B;  1Q7Y C;  3EQL C;  3GP7 A;  1D5M C;  2DYI A;  4DR6 L;  4UDU C;  1HNW L;  1QZH A;  3TP8 A;  5GAG C;  1A3T A;  5E4W C;  4P2C B;  3S2D B;  3CW2 A;  1Q8I A;  2PW7 A;  1KK0 A;  1YNN D;  3DXJ C;  3ONU A;  1EIY B;  5JEA J;  1DOL A;  4WJW A;  3C1E A;  1IB0 A;  1DYQ A;  1R4Q B;  3MVV A;  4X65 L;  4B4D A;  5IYD G;  2QGG A;  3E3X A;  2N8N A;  1GXD C;  2SNM A;  2AUK A;  2B8G A;  1JA1 A;  1YI2 B;  2PNR C;  3P75 A;  1SLJ A;  2JA7 H;  4QIW B;  4IFD J;  2MNA A;  4P73 A;  2F43 A;  3HZX A;  1EP3 B;  4OPV A;  1CZW A;  3QFC A;  3OW2 A;  2E2J H;  2AWO A;  3PUW A;  4JOI A;  1EQV A;  2NZO A;  5C0X J;  1Y8P B;  5E1F A;  3SJP A;  3HOW H;  1E7Z A;  4C1N K;  2ZXP A;  3R2I A;  3J81 j;  3PUZ A;  1Q46 A;  2A1A A;  3HEJ A;  4IOC A;  2XIW A;  1E2W A;  2ATW A;  1V1Q A;  3MWY W;  4HN7 A;  3SVM A;  2BPO A;  2F0G A;  1N33 L;  1PKV A;  2BGI A;  3J80 E;  4GN5 A;  3BYY B;  3NTK A;  2JE6 I;  4A3K B;  2Z6K A;  3KOJ A;  4ZYS A;  2XWJ B;  1K73 C;  1EFR A;  1L1O B;  4FWT A;  2EJM A;  3PUY A;  1VQM B;  3EFX D;  3DWP A;  3CU7 A;  1E0B A;  5C44 G;  2ICI A;  4WFN 3;  1KIX A;  2B7C A;  4JBJ A;  3W2D A;  4C1N I;  2HMA A;  2F0Q A;  4CDD C;  2F03 A;  2BOS A;  1EFT A;  2Z6B A;  5JEA H;  3SK8 A;  1MIU A;  1A62 A;  4GKJ Q;  4II3 A;  3CC2 B;  2CW0 D;  4YAU A;  1I3Q B;  3AFQ A;  3E1Y E;  4P6Y A;  3M3Y H;  1TT2 A;  5THX A;  4BXX H;  2YYZ A;  3GVK A;  1M90 C;  4XOP A;  5H5J A;  3CC4 B;  1AZQ A;  4TMW A;  2KED A;  1JWS D;  2HCJ B;  1BF4 A;  3BYT B;  2LMC B;  4WJ4 A;  3S1Q H;  1TS4 A;  2WII B;  2JYO A;  4PZ8 A;  3LGJ A;  5C0X H;  3CHB D;  4KD4 A;  1NTG A;  4A3L G;  2AQ1 B;  1G7R A;  3NSW A;  3OMC A;  4X7C A;  1WTW A;  3H3V I;  2JA5 H;  4M53 A;  4XYQ A;  1I50 B;  5KNL A;  2UUA L;  2N88 A;  4A3E H;  1OGI A;  4RG1 A;  1J9O A;  2NYZ D;  4IUT A;  3BVG A;  4DV6 L;  4LK1 C;  4TQU S;  4X3K A;  4ZCL A;  2JA8 G;  1IL8 A;  3RZO H;  4HIK A;  1GR1 A;  1Z6H A;  3GTL B;  4DR7 L;  1DOM A;  5C4J H;  1B2T A;  2DER A;  2B2U A;  3UDX A;  1CZG A;  1PH5 A;  2EZV A;  3HOV B;  1K28 D;  4YCW A;  3FKS A;  1SYB A;  2DNE A;  1K83 B;  1TVX A;  2WB1 B;  4K1X A;  2K5H A;  1LTS D;  1SMY C;  1CT1 D;  3PA1 A;  2I5H A;  4DV2 Q;  1WD0 A;  1YBY A;  1Z7T A;  4GNX C;  3PUV A;  2K5Q A;  3MA2 B;  3NBI A;  2DCU A;  2RC5 A;  2R92 H;  3HOU G;  1R9T H;  2MJ8 A;  1T6Y A;  4TMZ A;  5GAE C;  1QB5 D;  1E3P A;  4IOA A;  5A2Q L;  4C43 A;  3O13 A;  1V9P A;  4A3M H;  5JPM C;  1VQL A;  2J0T D;  5HY6 A;  1LAC A;  1KDC A;  4RM0 A;  5GV7 A;  3DMU A;  4C0S A;  1DJR D;  2YTX A;  2A69 D;  3VA5 A;  3WQZ A;  2Y0S E;  2J7Z A;  2EY2 A;  1SJH D;  3IL8 A;  4TRD A;  3ASR A;  3S1M H;  1JOR A;  4P22 A;  2K28 A;  3G6E B;  3WND A;  3K57 A;  2XEX A;  4L5Q A;  5JVH 3;  1N07 A;  4P6V F;  1FL0 A;  2DOG A;  1PA6 A;  1UD6 A;  1VS0 A;  1EIF A;  2PMZ E;  1Y1V H;  1Y0Y A;  2F4V Q;  1C9O A;  1YNX A;  4XLC A;  2HHH Q;  4DAY A;  4DAV A;  1EQQ A;  1I7P A;  4LW1 A;  4CJ1 B;  5IIF A;  2E5L Q;  2LXK A;  5EKL A;  3FKI H;  4BWG B;  1TS5 A;  4H7B A;  1EWH A;  1VMP A;  1VQK A;  1ENC A;  1SRO A;  2CCZ A;  4RPD A;  3A54 A;  3CCE A;  4KY7 A;  5FO0 A;  1G6Z A;  4QJF A;  2E74 C;  3I4L A;  3BS1 A;  1FNW A;  1KXL A;  4ZUI A;  1VQ8 A;  5IP9 G;  2NN6 H;  1C8C A;  4Y7N H;  1X3F A;  1TWH H;  5HUR A;  2VZA A;  4L5S A;  3HOZ H;  2BV3 A;  3KF6 B;  1PTO D;  1S4M A;  5FL7 A;  3BVM A;  3DEP A;  3CCU B;  4DV7 Q;  4A93 H;  2CQO A;  1PH2 A;  1I6H H;  3PO2 H;  3S14 B;  4IO9 A;  1D5X C;  3JQQ A;  2E2I B;  5FLM G;  2LXJ A;  3DLL A;  3LX0 A;  2NVY H;  5F2D A;  2BE5 D;  4C3H H;  3L7Z C;  3SLD A;  4Y7C A;  4YWK A;  1BCP D;  2CH4 W;  4QUC A;  3F2U A;  2B8F A;  4WJ3 M;  3BU2 A;  2NPF A;  2B3G A;  3KF8 B;  4H0L C;  1U4M A;  1XE1 A;  5DN6 A;  3CC7 A;  1PHJ A;  4DK3 C;  4A3B H;  2V7V A;  2X53 S;  2LFN A;  1NMF A;  2ZJQ A;  3T4A C;  4RDK A;  3AGP A;  5M5X H;  4LF4 Q;  5TR9 A;  4EQP A;  1E1R A;  1N32 L;  3J7A F;  1KHI A;  1PRT C;  1JOQ A;  4JG2 A;  3B78 A;  3HRZ C;  5LL6 X;  2D3N A;  1PV4 A;  2HQE A;  4L6T B;  1DAR A;  1Q81 C;  1B53 A;  2RDH A;  5ELB A;  4HMI A;  5FLX L;  4UPA A;  4FP5 D;  3HOY G;  4OEL B;  3BVZ A;  3V7A A;  1SNP A;  5M3M H;  1EP1 B;  1F60 A;  3W5U A;  1SNO A;  5FO9 B;  1BLI A;  3GIR A;  2CRV A;  1CSP A;  4QMG A;  3TZD A;  4XLF A;  4RCY A;  2AWN A;  2B2U C;  1F2M A;  1XYI A;  4K0K L;  3R2T A;  2KEC A;  4K5X A;  4POF A;  2EIX A;  3R93 A;  4GQN A;  1N0U A;  1W9X A;  3C46 A;  4IW3 B;  4R1J A;  1NDH A;  4B48 A;  1W87 A;  1QUE A;  4B3G A;  4HMJ A;  4YAF A;  4N8X 1;  4GKK Q;  3X3N A;  3KFU A;  1W35 A;  4RCZ A;  5J3B A;  2XNC A;  1E1O A;  1EYC A;  4K2K A;  1SAP A;  4IUQ A;  1BDO A;  2EYH A;  4TSS A;  1JE4 A;  3URY A;  3AB9 A;  2F0P A;  3VNU A;  2ES2 A;  4B44 A;  4JBK A;  2ZZE A;  4WWV A;  1TU2 B;  4CJ0 B;  4LFA Q;  3VYR A;  3KK7 A;  1AEX A;  2EDG A;  3D3R A;  4RA8 A;  3I4N G;  3PCO B;  4FXG C;  4ALP A;  4DV1 Q;  1ENF A;  1BVS A;  2IHF A;  4FO2 A;  3OW2 B;  4GN4 B;  5JPN C;  4JI0 Q;  1DOK A;  2BH2 A;  1XJV A;  1KJZ A;  5J1Z A;  4HIZ A;  1CKN A;  4IFD I;  1Q90 A;  2K5D A;  1KRT A;  4U67 3;  2WYR A;  2VUM B;  1K8A C;  2JA7 B;  2DEU A;  1DON A;  4DQL A;  1A6X A;  1U5K A;  1VDZ A;  4ZGQ B;  5C0X I;  4DNI A;  5K36 G;  3KLS X;  1Q9S A;  3OAA A;  5FO8 B;  3OZW A;  1BMF A;  5E7N A;  4OWW B;  2WJY A;  2VJJ A;  1WI5 A;  5IGC A;  2LZJ A;  1Q82 D;  1S0U A;  1KLU D;  5FA6 A;  1YNJ C;  2VQE Q;  1FYC A;  4G7X A;  1D7Q A;  4DR2 Q;  1EIG A;  2FMC A;  3BNW A;  1KC8 D;  1HPC A;  3RUZ A;  4HE5 A;  5H1S E;  4ACB A;  1UUP A;  1XNQ L;  2OTJ A;  2R61 A;  2L12 A;  3A55 A;  1SE3 A;  4NNJ A;  1I4Q A;  4Z4W A;  4TSF A;  3S2H H;  1FNC A;  2NVT B;  5DSZ A;  3ERQ A;  4A3D H;  3GTP B;  1R4P B;  1KD1 C;  1XPO A;  5COY A;  2GVB A;  4L63 B;  1HNZ Q;  1FJG L;  3RLF A;  2ZL6 A;  5EPL A;  4LFC L;  5FK9 C;  2JJQ A;  1BXT A;  4F8M A;  3HOX G;  1F9Q A;  4RD1 A;  4LF9 L;  2PNH A;  2B2T C;  2CF4 A;  3S2D H;  1QIL A;  2CHB D;  4NDX A;  4OGQ C;  5B6I A;  4YAL A;  2ZJR A;  3OPO A;  1PYS B;  5D14 A;  3CCL B;  3DHQ A;  1PRT B;  4ABN A;  2XTI A;  3BH4 A;  2V1C C;  4OO1 G;  1F2L A;  4M0L A;  1A63 A;  1GUO A;  3ICE A;  1WCM B;  1E2Z A;  1JC7 A;  3ERO A;  1F9P A;  3HP3 A;  1TR5 A;  3A8I E;  2VNI A;  2NTT A;  1DZ1 A;  1NMG A;  4UP7 A;  2BM0 A;  2DY8 A;  3QE2 A;  5I6Y A;  2GJK A;  4HR7 B;  4LWC A;  5FKA C;  1IBM L;  1ASY A;  3QG1 A;  2VW9 A;  3I72 A;  4IPC A;  1WFQ A;  2GA4 B;  3MXP A;  5C4J B;  2M9V A;  5TRD A;  1STH A;  4A3K H;  2EYO A;  1KL9 A;  5KNC A;  4N9T A;  4FDB A;  2HD3 A;  2E75 C;  4NCN A;  3GVL A;  5M5W H;  4LF8 Q;  2UXD Q;  2XRQ D;  4DV0 Q;  3VYU A;  4HIO A;  1EY5 A;  1F9S A;  3PO3 B;  4JI2 Q;  1Q3L A;  4HSP A;  2YWG A;  1YJW B;  1IHM A;  4AQY L;  1YJ9 A;  1U2R A;  3E0E A;  3Q22 A;  2NN6 I;  1R9T B;  2OK8 A;  2MO1 A;  3V05 A;  1VQ6 A;  3GD7 A;  5IE8 A;  1GKH A;  2ZTG A;  5JAV A;  3F2D A;  3T53 B;  2DN8 A;  3QR8 A;  2ZJP A;  4A3M B;  2E2H B;  2BH8 A;  3PGZ A;  1K9M C;  3T56 B;  1ZYR D;  2WAQ G;  3VMF A;  1I3Q H;  4JMQ A;  4DF7 A;  3WNC A;  5IYB G;  4CKB A;  1J5E Q;  3VR3 A;  4A3G G;  2EVB A;  3S1M B;  4HTH A;  1F2Y A;  4IPG A;  4M4S A;  4NXM L;  1W34 A;  1CHP D;  3W2H A;  5DAU A;  3Q0A A;  2OBT A;  4X3S A;  3U2Q A;  1YNN C;  1KLG D;  1Y1V B;  3T51 B;  5LL6 S;  4TMV A;  2B63 H;  1CK1 A;  1RTO A;  4C3J G;  3JQR A;  2QW7 A;  3M4Q A;  4F88 A;  5T1G A;  1U4L A;  4J8Q A;  1EIH A;  1VQK B;  1ILQ A;  1H9J A;  3ND8 A;  1ICF B;  1OTC A;  4FF2 A;  3CCR A;  3I56 B;  1NUC A;  3CCE B;  5IK2 A;  4XOR A;  3OJX A;  4RGO S;  5LMU L;  3FKI B;  4PNY A;  4BBR G;  1LAB A;  1VQ8 B;  1N9W A;  1LTI D;  2MO0 A;  1SYG A;  1Y0R A;  1HFG A;  2Z1C A;  3UI2 A;  4DR4 Q;  3UE1 A;  4ME5 A;  1D5Z C;  3W2I A;  3G4S B;  5ISR A;  1JA0 A;  3JU4 A;  3RD4 A;  3GTL H;  3QOL A;  1QFZ A;  1I4H A;  2CQA A;  4JI1 L;  4CGY B;  2JA6 G;  3I4M B;  2CC2 A;  1EL0 A;  3KLW A;  1W3S A;  1LTT D;  4Y7N B;  1K83 H;  4LFB L;  2P5Z X;  1WTR A;  3OWE B;  2I46 A;  3HOZ B;  5J3O A;  3J81 k;  3MMP A;  2KVM A;  2RDF A;  3FVQ A;  4N9P A;  4OWT B;  2OEO A;  4X62 L;  2YU9 B;  3HOV G;  1COW A;  4A93 B;  1YIT A;  4F87 A;  3PO2 B;  2K4K A;  1R5B A;  1E1Q A;  2B2Y C;  4BY1 B;  2X6Y A;  2C35 B;  4DKA C;  4JI6 Q;  3ZPN A;  5GAH C;  4JV5 L;  1QUQ A;  1STN A;  3IFD A;  5M3F B;  1T5X D;  3B6Y A;  3RLO A;  2KCC A;  3R6K A;  1ILP A;  2QDX A;  1VQO A;  2ZL7 A;  1WTX A;  1EY4 A;  1TTT A;  3IFT A;  1A8V A;  4H02 A;  4A3B B;  1GHJ A;  3V96 A;  4PMW A;  2CW0 C;  2A5H A;  2IW3 A;  5M5X B;  4JVZ A;  3TS2 A;  3OIQ A;  4HE6 A;  5LMN L;  1B23 P;  1TWG B;  1JJ2 A;  2WIN B;  2VZL A;  4LUV A;  2UUB Q;  5CV7 A;  3WOE A;  3MXG A;  4CHT B;  3NHH A;  1BX1 A;  3WNB A;  3HKZ B;  4PAA A;  2VL6 A;  1HA5 A;  1PTO F;  2ZXH A;  1HHV A;  3WXM A;  2VJI A;  1WOO A;  2VBT A;  2QDL A;  3KLR A;  2GVA A;  1QFY A;  3Q3A A;  3FDT A;  3OTO L;  1XTC D;  1HXY D;  2BA0 A;  3U6B A;  4QVJ A;  1D1K A;  5EPK A;  2JA9 A;  5BSY A;  4OX9 L;  4YEL A;  4L5T A;  3KJP A;  4OP7 A;  2RBM A;  1LT5 D;  2B7B A;  1H9S A;  5AJ3 Q;  5I6W A;  5KW9 A;  3NQT A;  1EYA A;  5C3W A;  3HKS A;  3KJO A;  1YHQ A;  4POG A;  4G7H C;  1BR9 A;  1OXU A;  4A3F H;  1YLO A;  4RD0 A;  4YHH Q;  1KRH A;  3VA7 A;  4BY7 B;  5KYL A;  5T1I A;  3BQJ A;  2E2I H;  4DXG A;  2J7K A;  1RQP A;  1B3A A;  5KGU A;  1EUJ A;  4KHP Q;  2UXC Q;  1W0J A;  1CKN B;  1E1T A;  4P9S A;  3VR6 A;  2KQ3 A;  1H9R A;  3SJZ A;  4NB3 A;  1KNE A;  3PEN A;  3JQP A;  4F7X A;  1TII D;  4OXP A;  4J15 A;  1GHK A;  2K7V A;  1LT4 D;  2NBF A;  1T6Z A;  1EY8 A;  1TWA H;  4G7O C;  3J81 c;  4N8F A;  2CKZ B;  2GRE A;  4QV2 A;  2VNH A;  3ZJY C;  2HDL A;  4IZ8 A;  4UZE A;  1PH1 A;  3G05 A;  1IHZ A;  3HGB A;  2QN6 A;  4DV5 L;  1SDF A;  3AMU A;  4JBM A;  4FXK C;  4A3I B;  3GQB A;  2OTJ B;  1KTV A;  1QGY A;  1V8Q A;  5ELE A;  1M1K D;  1B1Z A;  2O4X A;  2EQS A;  2ID0 A;  4HJ8 A;  1SXT A;  2OT2 A;  2DET A;  1IJF A;  4S3S A;  3FPP A;  3RN2 A;  4A76 A;  2GJR A;  4B3S L;  1W2B B;  1LUZ A;  1BQQ T;  2D9U A;  2CK3 A;  3BC9 A;  4QY7 A;  2G9H D;  1VQP A;  2EYM A;  4HIM A;  4FN5 A;  4U9U A;  2UXB L;  3T1H L;  4QCL A;  4YY3 L;  4JYA L;  4KKU A;  4X07 A;  1HR0 L;  1L0W A;  2FIN B;  5CGK A;  1SEB D;  4R9W A;  3PMF A;  2BGJ A;  4A3C H;  1HNX L;  3TSS A;  3BZC A;  2UU9 Q;  1UAP A;  3KYH C;  1E22 A;  1PMR A;  4R4T A;  2F0L A;  1SFO B;  2R7Z G;  3QOJ A;  1NR2 A;  3K6O A;  1B7Y B;  1UE1 A;  1G8Z D;  4JI3 L;  1IYU A;  1PTO C;  1D8L A;  2QA4 B;  4RDJ A;  4XLE A;  1PYB A;  1HZE A;  2C5B A;  4AC9 A;  1N8R D;  2JK8 A;  3UE0 A;  2CVR A;  2QEX A;  2Q2U A;  5JOB A;  4JI5 Q;  4GZY C;  2PZT A;  4RWS C;  1A0I A;  1S5E D;  2AUJ D;  2BE5 C;  4QB4 A;  2G9D A;  4O42 A;  3FHW A;  3AVX A;  1YVC A;  5IT9 c;  5JVG 3;  1BCP C;  1K0R A;  1Q12 A;  3ONY A;  1HJP A;  4A3J H;  1N36 Q;  1G51 A;  4B3M Q;  1QVF A;  2VUM H;  3D6C A;  4QQB X;  1EFU A;  4Z4U A;  2SOB A;  2Z4H A;  4WRD A;  1TY0 A;  1I94 L;  4RAU C;  1B8A A;  1E79 A;  2LS0 1;  2JA7 G;  4B3R L;  1SYF A;  3ULL A;  4B3T L;  4G7W A;  1MRZ A;  2ZXI A;  1YZ6 A;  2GK6 A;  1O7L A;  2YWF A;  5C4X B;  1QVG B;  4XR6 A;  3VNV A;  5HKK A;  2R93 H;  4NXN Q;  2WAQ E;  2CND A;  2Q6I A;  2R6H A;  2X3U A;  1PZI D;  1OXV A;  3S1R B;  1WP6 A;  5HGQ A;  1VHE A;  4EQO A;  1OXX K;  4JI7 L;  4OHJ A;  3CP2 A;  3WYA A;  2DGY A;  4P71 A;  3NBH A;  1EY0 A;  5M5W B;  4TVA B;  4DR5 L;  1NNX A;  3GDE A;  1SN8 A;  2X6X A;  4PAB A;  1EU3 A;  3NTI A;  2NVT H;  1BBW A;  1TXY A;  3GTP H;  1D6E C;  3J80 L;  5J39 A;  1C7Y A;  3CCJ A;  2XOK A;  1E62 A;  4OOV A;  3OFN A;  1XQB A;  2EYF A;  2FHT A;  3OSO A;  2IX1 A;  4IUN A;  1KAW A;  5ELO A;  1RF2 D;  2OQK A;  1QVC A;  4Y9U A;  1LT3 D;  1L0X B;  2JJ1 A;  2RSN A;  4HED A;  5KRU A;  4IUV A;  1YIJ A;  2O5J C;  1KAA A;  3F8T A;  4DA2 A;  1IBL Q;  1HA6 A;  3TZU A;  2KEN A;  2OCE A;  5JEA G;  4IFD H;  4JI4 L;  2F0N A;  4WQM A;  1Q8K A;  5ELN A;  2XVS A;  5I9P A;  4X7E A;  3N52 A;  4DR6 Q;  2F1L A;  5FO7 B;  1LV9 A;  1K3R A;  4FF3 A;  2XND A;  4RD3 A;  1Q1B A;  4BXX G;  1EQT A;  2NZ1 D;  1JB7 A;  3CCR B;  1SND A;  1XMO L;  1WCM H;  2B63 B;  1PVO A;  1J6Q A;  1RKN A;  4IJL A;  5C0X G;  1EZ8 A;  2XWB B;  2DY7 A;  3PUX A;  2AQ3 B;  1UEA B;  1N34 L;  3CB4 A;  4AF6 A;  1S5B D;  2I1L A;  1ML0 D;  5BN4 A;  4X65 Q;  4ID6 A;  3PIP A;  2Q2H A;  1ZM3 A;  1CQV A;  1O7Y A;  1BNZ A;  2JA5 G;  3OKX A;  3I2Z A;  1X3E A;  3H0G B;  5FJ8 H;  2JN4 A;  4E6I A;  2SDF A;  1OHH A;  2GN5 A;  4A3E G;  2E5L L;  1B50 A;  3F2B A;  1EU4 A;  5C5M A;  2ZXR A;  1Q82 C;  2PIA A;  1SE8 A;  1ENA A;  4R4Q A;  4TT3 A;  4PG3 A;  4TMX A;  5IGF A;  1KC8 C;  1QUQ B;  1N33 Q;  5I2X A;  2F0U A;  3PO3 H;  4XT1 B;  5C4H A;  3SEB A;  3P7J A;  3JAM c;  2FX3 A;  3NP8 A;  1EWC A;  2ZT9 C;  1CSQ A;  5EMN A;  4CQJ A;  5H59 A;  1VQO B;  2XNA C;  4X64 L;  2XN9 C;  3PIO A;  1FDR A;  3S17 H;  3CME B;  1I6V C;  1U0L A;  1V1P B;  1AMO A;  3VO1 A;  2E2H H;  3NPP A;  4BBS B;  1YEZ A;  4ZGN B;  4WZE A;  2K5N A;  2R92 G;  1ICW A;  1E24 A;  3HG9 A;  2V7X A;  3CPW A;  4N3G A;  4RPB A;  4IPD A;  2F0H A;  2KCN A;  4A3M G;  2DJF C;  1MGS A;  4IUP A;  4X06 A;  3A8I A;  3LWU A;  3D31 A;  5IYC H;  4ZUJ A;  2H5X A;  3IAY A;  3HFZ B;  3I91 A;  3F1Z A;  1WYD A;  4BA1 I;  3ZC3 A;  3A3G A;  1PJ6 A;  3PF5 A;  2KHI A;  2KJX A;  4OOX A;  1C48 A;  1STB A;  4JPB W;  2GQF A;  1CNF A;  2QCP X;  1KQS B;  4XQQ A;  2XGT A;  1SNQ A;  1DG1 G;  2C77 A;  1VQJ A;  1Y1V G;  1NSN S;  2OF1 A;  2H4O A;  2F0D A;  3ASP A;  3G71 B;  1ZXT A;  1H9S B;  1LTA D;  3TEH B;  1S40 A;  3B82 A;  4X8I A;  1EY6 A;  1JOK A;  4RKB A;  3J80 i;  3NUC A;  4YCV A;  1PH8 A;  3STB D;  2UUA Q;  2D0P A;  2F0I A;  3QJY A;  1XB2 A;  5KEE A;  3CD6 A;  3GTM H;  2EFG A;  2WZN A;  2WP8 J;  3FKI G;  1M4V A;  2L1B A;  1HA3 A;  2Y0S B;  4IJH A;  4AYB E;  3I4M H;  3M7N A;  3VYT A;  4DV6 Q;  3MEF A;  3U4Z A;  3I7F A;  5JBQ A;  2EYP A;  4A3F B;  2YU9 H;  1Y1W B;  3I8Z A;  4M8A A;  1UMK A;  2NN6 G;  5G3L F;  3GTG H;  3W2E A;  4BY1 H;  2IT1 A;  4XQJ A;  2YTV A;  4Y9R A;  1H85 A;  4J6H A;  4R8N A;  3HOZ G;  5HZA A;  3G7L A;  2B2T A;  3BJU A;  2MFI A;  4LAA A;  3CXC A;  3WDN A;  3ZIA A;  5M3F H;  4A93 G;  2F0M A;  3PO2 G;  4R4C A;  4DK6 C;  2QTL A;  2OBS A;  2ZL5 A;  2RKS A;  3D0F A;  3NK9 A;  1EY7 A;  4XD7 A;  5KIX A;  4C3H G;  4RKL A;  2F4N A;  2K03 A;  4NW2 A;  3ONA B;  2ZZQ A;  3A1P A;  1CHQ D;  4H9G A;  1Y69 U;  2DY1 A;  1ZYR C;  2NWG A;  2HCI A;  1TWA B;  1QNU A;  1Y8O B;  4EH1 A;  1VQ4 A;  4KJO A;  4RDL A;  1TWG H;  3D6W A;  1R5N A;  4DUZ L;  4A3B G;  1VQ9 B;  4KY5 A;  1GJX A;  2DNC A;  3ASS A;  1IBK L;  3SDZ A;  1BUV T;  2VYQ A;  2ZXO A;  2B5O A;  2K5V A;  1VQP B;  2R6G A;  1VCI A;  1O7Z A;  1B3Q A;  4DPG A;  3CMA A;  4A4I A;  4DAM A;  4JW0 A;  3ZBU A;  4DR1 L;  2FMM A;  4GNX B;  2VQE L;  1YJN B;  4HJA A;  2O2L D;  3QSY A;  4TMT A;  5M3M G;  1IKM A;  4JBW A;  2ICE C;  2KCM A;  1FNM A;  1WOR A;  3NWT A;  1QG7 A;  4GOP A;  5IP7 H;  3D4D A;  4PC1 A;  1UD8 A;  1XMQ L;  1ZUN B;  5COR A;  1TY2 A;  3K81 C;  3LO8 A;  1I4G A;  3ERS X;  1JOO A;  3A0J A;  3RZD B;  2C9O A;  2WJV A;  3FMC A;  4KK7 A;  4XON A;  3CCM A;  2IX3 A;  4BY7 H;  2QEX B;  2K1B A;  2M5S A;  5M9O A;  2Q2T A;  2MQH A;  1N0V C;  3K7A H;  2HDM A;  1OB5 A;  4NP5 A;  4DV3 L;  5FIU A;  2Q8R E;  2AHO A;  1CUK A;  2VQF L;  3MXU A;  3KDF A;  5LMZ A;  1QVF B;  3CRK C;  1ROD A;  4YHB A;  1G7C A;  2X0K A;  3OIP A;  1SNC A;  4A3J B;  1X56 A;  3BDC A;  1EOT A;  1ET9 A;  4ZRZ A;  3W5V A;  3OOC A;  1HCZ A;  3SEJ A;  1QOH A;  2X69 A;  1PFS A;  1RCV D;  2JXM B;  1XPR A;  1S5F D;  5D3D A;  3S15 B;  2MHV A;  3LNN A;  2F0E A;  1OXS C;  2PZU A;  3CQZ H;  2F4I A;  5K5P A;  2ASB A;  3U58 A;  4A3I H;  3J81 E;  2RHQ B;  1WOC A;  4YXW A;  3MFY A;  3A7A B;  1N32 Q;  1KRS A;  1KK3 A;  3PSI A;  1NR4 A;  3T16 A;  1CNE A;  2F3V A;  4BS9 A;  2R93 B;  2F0K A;  4P75 A;  2ENB A;  4ACA A;  3K5N A;  4GLA C;  1MJE A;  1TKW B;  3I55 A;  3CCJ B;  4J0Q A;  5AN9 A;  3P26 A;  1VQH A;  4H44 C;  5BR8 L;  1SSO A;  3J81 L;  3R3O A;  1O80 A;  3CCS A;  4YAW A;  2L5T A;  5DS0 A;  5CDF A;  1FD7 D;  5I9O A;  1X9N A;  1GJR A;  4LBZ A;  1XNR L;  2FXQ A;  2I5L X;  2GK7 A;  4UZF A;  4X3T A;  1S4Z A;  3A56 A;  4K5W A;  1HTL D;  4CJ2 C;  4LF7 Q;  3M4O H;  2B2Y A;  2F0J A;  4K0K Q;  3CCV A;  4A3D G;  1SFO H;  4RHR A;  3G48 A;  3HS0 C;  1LTG D;  5DLQ E;  1RJT A;  3CF5 A;  1TS3 A;  1PH4 A;  4LC0 A;  1E3X A;  1FNB A;  2JEB I;  2RVL A;  2NTS A;  1H8H A;  2SEB D;  4LUO A;  4ZKB B;  4UP8 A;  2K5W A;  3I90 A;  4KD3 A;  3SE0 A;  2BSA A;  1DD2 A;  1H8E A;  3A5U A;  1FND A;  4HSV A;  1E2V A;  4HJ7 A;  2XRS D;  2PQA A;  1A3V A;  3SK4 A;  4PC7 A;  3VR4 A;  3T1Y L;  1KZL A;  4QFM A;  5EKI A;  5IGG A;  5A35 A;  1X55 A;  1K8O A;  1SE2 A;  4LF6 L;  3KEW A;  1L0Y B;  5IT9 E;  5J35 A;  1JJG A;  5D65 A;  2BDO A;  2MGS A;  2BM1 A;  5C4X H;  4X7F A;  5E3F A;  5CR3 A;  1AP0 A;  1VMC A;  3S1R H;  1MKH A;  2F0T A;  5I4D A;  1MAB A;  2QMU A;  4K6D A;  2QKI C;  1UEB A;  1M1K C;  4DUY L;  4GOP C;  1WOS A;  1WU8 A;  3H9N A;  3RR5 A;  2P3M A;  5IYR A;  1VQL B;  2QEJ C;  2RA4 A;  4A3K G;  4Z4S A;  4UHV A;  2NVX H;  3ASQ A;  1UD3 A;  3CRZ A;  5IYN A;  2WAC A;  4X66 L;  1K28 A;  4YWL A;  1XNQ Q;  2ZBV A;  3WBJ A;  3EBE A;  1TWF H;  3S17 B;  1JR0 D;  1A3U A;  3NTH A;  3H94 A;  1VQF A;  3K8A A;  1EP2 B;  3W5H A;  4K14 A;  3E0J A;  1U9R A;  1YHA A;  3MAQ A;  1JB9 A;  1AW7 A;  2Z0S A;  1WVL A;  2FJ2 A;  1S72 A;  3K5M A;  1FJG Q;  4E0F A;  1XTD A;  1XXG A;  3PUM A;  4DR3 L;  1D1N A;  1MD2 D;  3EVQ A;  4LFC Q;  4CDF C;  4DAY B;  5CV8 A;  3NE5 B;  1L1O A;  1RDP D;  1RQR A;  4DXF A;  4LF9 Q;  4OIK A;  1SMX A;  1E63 A;  3D8G A;  4LBY A;  4IPH A;  1N8R C;  1TVC A;  3LQ6 A;  2F0W A;  1MBY A;  2V7U A;  1SJE D;  1D2B A;  4HCE A;  1A8P A;  4DQK A;  4Z9C B;  1PFM A;  2UUB L;  1CQF A;  1LM0 A;  1ZEQ X;  3WOF A;  2PE3 A;  4DNT B;  1PRT D;  2B63 G;  1QX4 A;  1HH2 P;  4N3N A;  2GJP A;  3H0G H;  3M9B A;  5GRO A;  2UUC L;  2B29 A;  2ZM6 L;  2Q6K A;  1IL2 A;  2K14 A;  3EA6 A;  4LF5 L;  2L11 A;  1W6J A;  3GTM B;  3CC4 A;  3QFS A;  2W6I A;  4CKE A;  2KEE A;  4B08 A;  1QJO A;  2KOL A;  1IBM Q;  1I18 A;  1HUN A;  4QHY A;  1WTH D;  2WZP P;  2CH4 A;  2EJF C;  4ULL A;  4XLA A;  4M1U B;  5JJZ A;  4DV4 L;  3FRP B;  3GTG B;  3KL9 A;  2PO4 A;  2WB1 G;  2NB0 A;  3DUZ A;  1B9N A;  3K0Y A;  3CC7 B;  3FEW X;  3IRB A;  5HXB A;  1G7T A;  1B4O A;  2QF7 A;  2QGQ A;  5KYI A;  1PH7 A;  5IWA L;  3E9H A;  4BBS H;  4FYD A;  2YTY A;  3PF4 A;  3JAM E;  1FX0 A;  3A3B A;  1NCV A;  1V43 A;  1TS2 A;  5IY0 A;  2ZTD A;  1ZM4 A;  4WZK A;  1VQ4 B;  4ROX A;  3K5O A;  4AQY Q;  1V1O A;  2K75 A;  3WBK A;  1QZG A;  1A15 A;  2C5C A;  4FXD A;  2VXW A;  2EYL A;  3PQI A;  5CC4 A;  2OTL A;  3A7L A;  4MHE A;  3E6Z X;  5FO1 A;  1VQB A;  5IOC A;  2EIF A;  2OWO A;  4KI0 A;  5G3L D;  3DM1 A;  4QF4 A;  5DM7 3;  5GV8 A;  3CAM A;  1B70 B;  2QIL A;  3GV6 A;  4NXM Q;  5EAY A;  3H15 A;  4I7A A;  1QE6 A;  5E6T A;  5FLX c;  3CMA B;  1PFN A;  1AN8 A;  1FGU A;  4FXU A;  1RL2 A;  3ZYY X;  4OON A;  1Z47 A;  2N3S A;  4WZL A;  3Q23 A;  1X54 A;  3BCD A;  3OW7 A;  2C5H A;  1PDQ A;  1NB9 A;  2HCC A;  4BA2 I;  1H9M A;  3X3M A;  3HOY B;  1DDG A;  1N08 A;  2M00 A;  1HZ9 A;  5LMU Q;  2I07 B;  2RF4 A;  3R6J A;  2D3L A;  2BMW A;  3D26 A;  4RD6 A;  3T13 A;  4JI8 L;  2C78 A;  3QFT A;  4OPS A;  2AHO B;  3Q6S A;  3KDF B;  1Y1W H;  2Y0S G;  4JI1 Q;  2NVQ H;  4Z4R A;  2D5D A;  1MSH A;  2WFW A;  1VQA A;  1AIP A;  4KLK A;  1GVP A;  4DGZ A;  5ELF A;  4RCN A;  4O2D A;  5DM6 3;  3K7A B;  1PJ7 A;  2BF4 A;  3SLN A;  4C3I H;  4V19 0;  4LFB Q;  2ALY B;  5DNF A;  4A3F G;  3J7A 5;  3S24 A;  1BKB A;  1WTV A;  1II3 A;  4I7Z C;  3V76 A;  1WSR A;  2C4T A;  4P1V A;  4QVA A;  5TSS A;  4X62 Q;  4C2M B;  4RJL A;  3E20 A;  4OWX B;  4Q5V A;  2MP1 A;  3ZZT A;  1NBW A;  1EYD A;  1ASZ A;  1EFI D;  2RCF A;  1PH9 A;  3U9S A;  3TME A;  1L1O C;  3ZUG A;  3I4N B;  3TN2 A;  2A69 C;  1S3O A;  3ND9 A;  3W2G A;  2VBV A;  3C3L A;  3NEM A;  2BN4 A;  1AE3 A;  4XN0 A;  3M4P A;  4XXE A;  3KF6 A;  3CQZ B;  4B3M L;  2V7T A;  5BSX A;  3D4R A;  2PPB C;  5C3E H;  3C1F A;  4LBW A;  4B9X A;  4DFA A;  4G57 A;  3I55 B;  1O7I A;  4YCU A;  3NQI A;  5LMN Q;  5HGT A;  5A89 A;  3CCS B;  5E4X A;  2MPM A;  1CFM A;  2X85 A;  1GUS A;  4KJN A;  3VO2 A;  5EKK A;  1SBB B;  1BBU A;  3D4W A;  3GTQ H;  4EQN A;  3K7U C;  1GO3 E;  3K0X A;  4ZV4 A;  4NXN L;  4LNQ A;  4O0A A;  3CCV B;  4BPR A;  1QNK A;  4KV6 A;  1LLR D;  5CBA E;  1SYD A;  2X8K A;  4QUZ A;  5EBD A;  1GAW A;  4QGU A;  3OTO Q;  2KA7 A;  3K59 A;  3STB C;  3TQY A;  1IKL A;  3AST A;  1EEI D;  3RZD H;  3M4O B;  1VLY A;  1XX8 A;  2RQX A;  4OX9 Q;  2PI2 E;  2HLD A;  5F4M A;  4PMB A;  3W1B A;  1B44 D;  3I3C A;  3I4O A;  3TBI B;  3SK5 A;  2RC6 A;  1HRJ A;  2RSO A;  3I70 A;  4A3C G;  4QIW E;  2VB2 X;  4GKJ L;  1VHO A;  1KNA A;  1IYJ B;  5L37 A;  2PQA B;  1KAB A;  4XN3 A;  2HIX A;  3HOX B;  4ZQ3 A;  3SXH A;  1H42 A;  4X0C A;  3P20 A;  3AGQ A;  5FNZ A;  1P8L A;  3GTJ B;  4PGO A;  2K05 A;  1ELO A;  2IWH A;  1K3B C;  4FNF A;  3NEN A;  2KCT A;  4FVM A;  2BA1 A;  3S15 H;  4KN7 C;  3Q38 A;  3HAG A;  4Z4Y A;  1EOV A;  5LMN W;  1GM5 A;  2MUY A;  4A3J G;  4JCV E;  5IYD H;  1V0F A;  2D62 A;  1FGB D;  3AQQ A;  3U50 C;  4XKV A;  2VUM G;  5M5Y B;  2E76 C;  3M7G A;  4JK1 C;  4OL7 A;  4KN4 C;  1VQ5 A;  5CYU A;  4FF1 A;  2K04 A;  4MYU A;  3KBX A;  1SKQ A;  2I0Q A;  1E3Z A;  2JJ2 A;  2F0F A;  4EQ5 A;  1D2E A;  5ELD A;  3ZZU A;  2WSS A;  2RDG A;  4B9W A;  4DV5 Q;  1CKM A;  1F9R A;  1YJ9 B;  1NBM A;  4XOT A;  2EE1 A;  5GQO A;  3AVT A;  3H3V C;  1QFJ A;  3UDF A;  2XZP A;  1VQ6 B;  1LTL A;  2R93 G;  2V4D A;  1A2U A;  3FPK A;  2NVX B;  1U4R A;  3UDI A;  4ZCI A;  1XWE A; 
#chains in the Genus database with same CATH homology
 1ESF A;  1TWF B;  2F0S A;  1PLF A;  2F0O A;  4RHS A;  1G2S A;  2FFK B;  4K5V A;  1CTM A;  2JSO A;  1I4P A;  2A74 C;  1VF7 A;  1OB0 A;  2WAQ B;  1VF5 C;  3MHB A;  4RH6 A;  3GTK B;  4IFD G;  4A3G B;  4XTC S;  5BN5 A;  2B2V C;  4ODG A;  2Q8I B;  1RTN A;  1S5C D;  2KVO A;  3GTO B;  3SHL A;  1LT6 D;  4RFB A;  1KMH A;  1CM9 A;  3K5L A;  1UD2 A;  4C3J B;  3EJI A;  2F1M A;  1EEF D;  2OXP A;  4KMU C;  2J4X A;  1OXT A;  2K32 A;  2TMP A;  1PFB A;  3KBG A;  5C4Z A;  1Y8N B;  4BBR B;  2W6J A;  1GUN A;  1HFN A;  4KKT A;  2L4N A;  2A68 D;  1PTO B;  2VNU D;  1MI2 A;  2JA6 B;  3NXW A;  1G91 A;  2BDN A;  3MZ5 A;  5C6A A;  1BBX C;  4XQN A;  3TDQ A;  1M8A A;  4UAI A;  3P1H A;  1FR3 A;  2A6H D;  1BCP B;  2JP1 A;  1TQO A;  4XKW A;  4K8J A;  2TSS A;  1PRT F;  5A2Q E;  2WV6 D;  4NKL A;  3A35 A;  2A6E D;  5CV5 A;  2BCO A;  4TKO B;  3GV3 A;  4Z1M A;  3DDY A;  3J7A V;  3IKJ A;  1NRK A;  2L9H A;  1X3P A;  2IL8 A;  4CKC A;  2IX0 A;  4K6L A;  1X3Q A;  3A8J E;  2VB3 X;  4KHV A;  5IOD A;  5I2Y A;  4ZAI A;  1G29 1;  1UNS A;  2Z8L A;  2X6G A;  4LMQ D;  1A2T A;  2X6W A;  3GO5 A;  4RGN A;  1JCK B;  1IW7 D;  2NVQ B;  1VJS A;  3SR1 A;  4OIJ A;  5LHY 1;  3CMM A;  2PMZ B;  4HCS A;  1GUT A;  1LO5 D;  4C3I B;  5C3X A;  4XNF A;  2F0V A;  4IAL A;  4Q0F A;  1I4R A;  4XQF A;  1GOZ A;  1U4P A;  1GUG A;  3MEH A;  4AYB B;  5EBC A;  1PYW D;  2E2D C;  1K8M A;  3QIA A;  2H1E A;  1ZKO A;  2O5I C;  5C3E B;  2KUM A;  4K8I A;  5IGE A;  2B39 A;  3V2T A;  3MFG A;  1C4Q A;  1WTP A;  5FLX E;  4ASU A;  2R3Z A;  3GTQ B;  4PV1 C;  4DN4 M;  1F2Z A;  4RGT A;  2PCF B;  3S9W A;  3R8B A;  2B2W A;  1KDB A;  3U9O A;  2EJG C;  1HVX A;  1D1I A;  4KY6 A;  1RD9 D;  1STA A;  3QO2 A;  1SKY B;  1SYC A;  4H13 C;  5EGT A;  4G4K A;  4J1M A;  3KLS A;  4KHZ A;  2K33 A;  3S1N B;  2R7Z B;  2WKD A;  2PQE A;  3ITP A;  2K6A A;  3QB3 A;  1HQR D;  1QCB D;  3L9A X;  1JWU D;  3BG3 A;  1SNM A;  3H09 A;  1DCZ A;  4I65 A;  5BN3 A;  2N55 A;  5NUC A;  3PV0 A;  3SK6 A;  1O78 A;  4XYO A;  2EY1 A;  2WKC A;  5K36 H;  2EY5 A;  3VYS A;  1AZP A;  3CRL C;  3OHX C;  1J8I A;  3OMG A;  2JEA I;  3N6R A;  5AFW A;  4IUU A;  2E2J B;  3KUP A;  1JIC A;  4LJZ C;  2JIZ A;  1FNU A;  1CI3 M;  3HOW B;  3MXN A;  3TP6 A;  5CBE E;  4RCO A;  1WD1 A;  4XIG S;  2ZZG A;  2Q8T A;  1ESR A;  2Z4I A;  1SMY D;  4IQZ A;  1GUW A;  4DNR B;  5C44 B;  1LTB D;  5FOB B;  1BPL A;  1LTR D;  2X6L A;  1ET6 A;  1EZ6 A;  3CP8 A;  1SYE A;  4FF4 A;  5CV6 A;  2IJ0 A;  3K58 A;  1CA5 A;  2ZZF A;  1JB3 A;  2PZW A;  3M3Y B;  1HTP A;  4OO1 H;  4PMC A;  4XT3 B;  1JWM D;  3L3O C;  4UZU A;  2EXZ A;  5EJW A;  3S1Q B;  4G6I A;  3BDL A;  1KDA A;  5IT9 L;  4EGV A;  2JA5 B;  3DWA A;  2JA8 B;  1V0E A;  4EVO A;  2XGJ A;  3OEE A;  4A3E B;  2B2W C;  3RZO B;  2L0C A;  1DXM A;  2LKV A;  4ZKC B;  5CMD A;  1X32 A;  4NMZ A;  1BO0 A;  3M4Y A;  2Z6B D;  3I73 A;  1F77 A;  4DK1 A;  3HOU B;  4IUR A;  2F3W A;  2EY6 A;  1DM0 B;  4XLH A;  3DWQ A;  1SE4 A;  4MIU A;  5IGD A;  2R92 B;  3NWS A;  3S16 B;  3MTS A;  1W0K A;  1WTO A;  4MN3 A;  2XZL A;  2V7Q A;  5D3I B;  3BDO A;  3LWE A;  1EY9 A;  1FNV A;  1B9M A;  1UD4 A;  5EPJ A;  1I8D A;  1Q1E A;  5KNB A;  3BCF A;  4U68 A;  1T5E A;  3PIP 3;  4ZK9 B;  1I4X A;  1AFP A;  2XSC A;  4XL9 A;  1PTO H;  4C56 C;  4XDX A;  3J7Y W;  1STG A;  4YIJ A;  1PXU A;  3C2P A;  2DIE A;  4DK0 A;  3TP7 A;  1QWY A;  3E5S A;  5KND A;  4V0B A;  1RHP A;  1TWH B;  4X3U A;  4L8J A;  2SNS A;  3A8K E;  2PW5 A;  4HAE A;  1I6H B;  1KTK A;  4YEJ A;  2LY7 A;  1S5D D;  4B3F X;  3PIO 3;  1IYV A;  3JAM L;  2QE7 A;  2NVY B;  1PZJ D;  4K2L A;  1G2T A;  4C3H B;  4DU9 A;  5J22 A;  1UD5 A;  4AVZ A;  2QDB A;  3FPU B;  1PZK D;  5EQ0 A;  4XM3 A;  4II2 A;  2ZTN A;  1V1P A;  1HUM A;  4PQX A;  2L55 A;  4O1N A;  2E1B A;  5C5L A;  3G6J B;  5CV4 A;  4XMY A;  1YNJ D;  2K01 A;  3OE7 A;  1H9K A;  1NAP A;  5IGB A;  3TP5 A;  2XZO A;  2EOT A;  5M3M B;  3AU7 A;  4RGM A;  2AQ2 B;  1E43 A;  4KTA A;  3CKI B;  1BCP F;  2WPD A;  4ILW A;  1BOS A;  2R9V A;  2A68 C;  4DAP A;  3VR2 A;  4C3I G;  1STY A;  4R8I A;  2NUC A;  1MSG A;  3CES A;  5CV9 A;  2A6H C;  3MC0 B;  2B2V A;  3GVJ A;  2KHS A;  1WPC A;  3DEO A;  2A6E C;  2HUG A;  3H6M A;  3H91 A;  2EPB A;  3VR5 A;  2V31 A;  4OO1 I;  5DEH A;  3KF8 A;  4WOR A;  4KKS A;  2D2C C;  4QUF A;  3W3A A;  2JDI A;  3QWN A;  3OEH A;  2M2L A;  1ONL A;  1STE A;  5ELC A;  4IN3 A;  4CBV A;  2PYK A;  4ZLT F;  1JQY D;  1WTQ A;  1CA6 A;  1IW7 C;  1W6K A;  2A73 B;  3S2H B;  3OWF A;  1HQM C;  4G7Z C;  4A3D B;  2EYJ A;  2IPK D;  3RMH A;  3M85 A;  3BZD B;  3Q24 A;  1TWC B;  1OO9 B;  3EQL C;  3GP7 A;  1D5M C;  4UDU C;  3TP8 A;  1A3T A;  5E4W C;  4P2C B;  3S2D B;  1Q8I A;  2PW7 A;  1YNN D;  3DXJ C;  5JEA J;  1DOL A;  4WJW A;  3C1E A;  1DYQ A;  1R4Q B;  3MVV A;  1GXD C;  2SNM A;  2AUK A;  2B8G A;  2PNR C;  3P75 A;  4IFD J;  4QIW B;  2F43 A;  3HZX A;  1CZW A;  2AWO A;  3PUW A;  1EQV A;  5C0X J;  1Y8P B;  5E1F A;  4C1N K;  2ZXP A;  3R2I A;  3PUZ A;  3HEJ A;  2XIW A;  1E2W A;  3MWY W;  3SVM A;  4HN7 A;  2F0G A;  1PKV A;  3J80 E;  3BYY B;  3NTK A;  2JE6 I;  4A3K B;  4ZYS A;  2XWJ B;  1EFR A;  2EJM A;  3PUY A;  3EFX D;  3DWP A;  3CU7 A;  1E0B A;  2ICI A;  4WFN 3;  3W2D A;  4C1N I;  2F0Q A;  2F03 A;  2BOS A;  5JEA H;  3SK8 A;  4II3 A;  2CW0 D;  1I3Q B;  1TT2 A;  2YYZ A;  3GVK A;  4XOP A;  1AZQ A;  2KED A;  1JWS D;  1BF4 A;  3BYT B;  2LMC B;  1TS4 A;  2WII B;  2JYO A;  5C0X H;  3CHB D;  4KD4 A;  2AQ1 B;  3NSW A;  3OMC A;  1WTW A;  4XYQ A;  1I50 B;  5KNL A;  2N88 A;  1J9O A;  2NYZ D;  4IUT A;  3BVG A;  4LK1 C;  4TQU S;  4X3K A;  1IL8 A;  1Z6H A;  3GTL B;  1DOM A;  1B2T A;  2B2U A;  1CZG A;  2EZV A;  3HOV B;  1K28 D;  3FKS A;  1SYB A;  2DNE A;  1K83 B;  1TVX A;  2WB1 B;  1LTS D;  1SMY C;  1CT1 D;  1WD0 A;  1Z7T A;  3PUV A;  2K5Q A;  3MA2 B;  3NBI A;  2MJ8 A;  1QB5 D;  5A2Q L;  3O13 A;  5JPM C;  2J0T D;  1LAC A;  1KDC A;  3DMU A;  1DJR D;  3VA5 A;  2A69 D;  3WQZ A;  2J7Z A;  2EY2 A;  1SJH D;  3IL8 A;  4TRD A;  1JOR A;  4P22 A;  2K28 A;  3K57 A;  5JVH 3;  1UD6 A;  4XLC A;  4DAY A;  4DAV A;  5IIF A;  4CJ1 B;  5EKL A;  4BWG B;  1TS5 A;  4H7B A;  1EWH A;  1VMP A;  1ENC A;  3A54 A;  4KY7 A;  1G6Z A;  2E74 C;  3I4L A;  3BS1 A;  1FNW A;  4ZUI A;  2NN6 H;  1C8C A;  5HUR A;  1PTO D;  3BVM A;  5FL7 A;  3DEP A;  3S14 B;  1D5X C;  2E2I B;  3LX0 A;  5F2D A;  2BE5 D;  3L7Z C;  1BCP D;  4QUC A;  3F2U A;  2B8F A;  4H0L C;  1U4M A;  5DN6 A;  2X53 S;  2LFN A;  3T4A C;  4EQP A;  1E1R A;  3J7A F;  1JOQ A;  1PRT C;  3HRZ C;  5LL6 X;  2D3N A;  2HQE A;  4L6T B;  1B53 A;  2RDH A;  5ELB A;  4HMI A;  5FLX L;  4FP5 D;  3BVZ A;  1SNP A;  1SNO A;  5FO9 B;  1BLI A;  4QMG A;  3TZD A;  4XLF A;  2AWN A;  2B2U C;  1F2M A;  1XYI A;  3R2T A;  2KEC A;  4K5X A;  3R93 A;  4GQN A;  1W9X A;  3C46 A;  4B3G A;  4HMJ A;  3X3N A;  1EYC A;  4K2K A;  1SAP A;  4IUQ A;  1BDO A;  2EYH A;  4TSS A;  1JE4 A;  3URY A;  3AB9 A;  2F0P A;  2ZZE A;  1TU2 B;  4CJ0 B;  3VYR A;  3KK7 A;  1AEX A;  2EDG A;  3D3R A;  4RA8 A;  4FXG C;  1ENF A;  5JPN C;  4FO2 A;  1DOK A;  5J1Z A;  4HIZ A;  4IFD I;  1Q90 A;  2K5D A;  4U67 3;  2VUM B;  2JA7 B;  1DON A;  1A6X A;  1VDZ A;  5C0X I;  5K36 G;  3KLS X;  3OAA A;  5FO8 B;  1BMF A;  2WJY A;  2VJJ A;  5IGC A;  2LZJ A;  1KLU D;  1YNJ C;  1FYC A;  4G7X A;  1EIG A;  2FMC A;  1HPC A;  3RUZ A;  1UUP A;  2R61 A;  2L12 A;  3A55 A;  1SE3 A;  4NNJ A;  1I4Q A;  4TSF A;  2NVT B;  3ERQ A;  3GTP B;  1R4P B;  5COY A;  4L63 B;  3RLF A;  5EPL A;  5FK9 C;  1BXT A;  4F8M A;  1F9Q A;  2B2T C;  1QIL A;  2CHB D;  4NDX A;  4OGQ C;  3OPO A;  5D14 A;  3DHQ A;  1PRT B;  4ABN A;  3BH4 A;  4OO1 G;  1F2L A;  1GUO A;  1WCM B;  1E2Z A;  1JC7 A;  3ERO A;  1F9P A;  3HP3 A;  1TR5 A;  3A8I E;  2NTT A;  1DZ1 A;  2DY8 A;  5I6Y A;  2GJK A;  4HR7 B;  5FKA C;  3QG1 A;  3I72 A;  2GA4 B;  3MXP A;  5C4J B;  2M9V A;  1STH A;  2EYO A;  5KNC A;  4N9T A;  2E75 C;  3GVL A;  2XRQ D;  3VYU A;  1EY5 A;  1F9S A;  3PO3 B;  1Q3L A;  4HSP A;  3Q22 A;  2NN6 I;  1R9T B;  3V05 A;  3GD7 A;  2ZTG A;  5JAV A;  3T53 B;  2DN8 A;  4A3M B;  2E2H B;  3T56 B;  1ZYR D;  4DF7 A;  4JMQ A;  4CKB A;  3VR3 A;  2EVB A;  3S1M B;  4HTH A;  1F2Y A;  1CHP D;  5DAU A;  3Q0A A;  4X3S A;  1YNN C;  1KLG D;  1Y1V B;  3T51 B;  5LL6 S;  1CK1 A;  1RTO A;  4C3J G;  4F88 A;  5T1G A;  1U4L A;  4J8Q A;  1EIH A;  1ILQ A;  1H9J A;  3ND8 A;  4FF2 A;  1NUC A;  5IK2 A;  4XOR A;  4RGO S;  3FKI B;  4PNY A;  1LAB A;  1LTI D;  1SYG A;  1HFG A;  2Z1C A;  3UI2 A;  4ME5 A;  1D5Z C;  5ISR A;  3RD4 A;  3JU4 A;  3QOL A;  1I4H A;  2CQA A;  4CGY B;  3I4M B;  1EL0 A;  1LTT D;  4Y7N B;  1WTR A;  3OWE B;  2I46 A;  3HOZ B;  2KVM A;  2RDF A;  4N9P A;  2YU9 B;  3FVQ A;  2OEO A;  1COW A;  4A93 B;  4F87 A;  3PO2 B;  1E1Q A;  2B2Y C;  4BY1 B;  2X6Y A;  3ZPN A;  1STN A;  3IFD A;  5M3F B;  1T5X D;  2KCC A;  1ILP A;  1WTX A;  1EY4 A;  3IFT A;  4A3B B;  1GHJ A;  3V96 A;  4PMW A;  2CW0 C;  2A5H A;  2IW3 A;  5M5X B;  3OIQ A;  1TWG B;  2WIN B;  5CV7 A;  3WOE A;  3MXG A;  4CHT B;  3NHH A;  3HKZ B;  1HA5 A;  1PTO F;  2ZXH A;  1HHV A;  2VJI A;  3KLR A;  3FDT A;  1XTC D;  1HXY D;  2BA0 A;  1D1K A;  5EPK A;  4YEL A;  2RBM A;  1LT5 D;  1H9S A;  5I6W A;  3NQT A;  1EYA A;  5C3W A;  4G7H C;  1BR9 A;  1OXU A;  4BY7 B;  3VA7 A;  5KYL A;  5T1I A;  4DXG A;  1B3A A;  5KGU A;  1W0J A;  3VR6 A;  2KQ3 A;  1H9R A;  1KNE A;  4F7X A;  1TII D;  1GHK A;  2K7V A;  1LT4 D;  2NBF A;  1EY8 A;  4G7O C;  2HDL A;  4IZ8 A;  3G05 A;  1IHZ A;  3HGB A;  1SDF A;  3AMU A;  4FXK C;  4A3I B;  3GQB A;  1V8Q A;  5ELE A;  1B1Z A;  2O4X A;  2ID0 A;  1SXT A;  2OT2 A;  4S3S A;  3FPP A;  2GJR A;  1BQQ T;  2D9U A;  2CK3 A;  3BC9 A;  2G9H D;  2EYM A;  4QCL A;  4KKU A;  5CGK A;  2FIN B;  1SEB D;  4R9W A;  3PMF A;  3TSS A;  1UAP A;  1PMR A;  2F0L A;  1SFO B;  3QOJ A;  1NR2 A;  3K6O A;  1G8Z D;  1IYU A;  1PTO C;  4XLE A;  1HZE A;  2CVR A;  4GZY C;  5JOB A;  2PZT A;  4RWS C;  1S5E D;  2AUJ D;  2BE5 C;  4QB4 A;  2G9D A;  4O42 A;  5JVG 3;  1BCP C;  1Q12 A;  3D6C A;  2Z4H A;  2SOB A;  4WRD A;  1TY0 A;  4RAU C;  1E79 A;  2LS0 1;  1SYF A;  4G7W A;  2ZXI A;  2GK6 A;  1O7L A;  5C4X B;  4XR6 A;  5HKK A;  3S1R B;  1PZI D;  1OXV A;  1WP6 A;  4EQO A;  1OXX K;  4OHJ A;  3CP2 A;  3NBH A;  1EY0 A;  5M5W B;  2X6X A;  1EU3 A;  3NTI A;  1D6E C;  3J80 L;  5J39 A;  2XOK A;  3OFN A;  2EYF A;  2FHT A;  3OSO A;  2IX1 A;  4IUN A;  1RF2 D;  1LT3 D;  2RSN A;  1L0X B;  2JJ1 A;  4HED A;  5KRU A;  4IUV A;  2O5J C;  1KAA A;  4DA2 A;  1HA6 A;  3TZU A;  5JEA G;  4IFD H;  2F0N A;  2XVS A;  5I9P A;  3N52 A;  5FO7 B;  1LV9 A;  4FF3 A;  2XND A;  1Q1B A;  1EQT A;  2NZ1 D;  1SND A;  2B63 B;  1RKN A;  5C0X G;  1EZ8 A;  2XWB B;  2DY7 A;  3PUX A;  2AQ3 B;  1UEA B;  1S5B D;  1ML0 D;  5BN4 A;  4ID6 A;  1CQV A;  1O7Y A;  1BNZ A;  3H0G B;  4E6I A;  2SDF A;  1OHH A;  1B50 A;  1EU4 A;  5C5M A;  2ZXR A;  1ENA A;  4TT3 A;  5IGF A;  5I2X A;  2F0U A;  4XT1 B;  5C4H A;  3SEB A;  3P7J A;  3NP8 A;  1EWC A;  2ZT9 C;  2XNA C;  2XN9 C;  1I6V C;  1V1P B;  3NPP A;  4BBS B;  1ICW A;  3HG9 A;  2F0H A;  2KCN A;  1MGS A;  4IUP A;  3LWU A;  3D31 A;  4ZUJ A;  3IAY A;  3I91 A;  4BA1 I;  3A3G A;  2KJX A;  1C48 A;  1STB A;  2QCP X;  4XQQ A;  1SNQ A;  1NSN S;  2OF1 A;  2H4O A;  2F0D A;  1ZXT A;  1H9S B;  1LTA D;  1EY6 A;  4RKB A;  1JOK A;  3NUC A;  5KEE A;  2F0I A;  3QJY A;  2WP8 J;  1M4V A;  2L1B A;  3M7N A;  2Y0S B;  3VYT A;  2EYP A;  4A3F B;  1Y1W B;  3I8Z A;  4M8A A;  2NN6 G;  5G3L F;  2IT1 A;  4XQJ A;  4J6H A;  4R8N A;  3G7L A;  2B2T A;  4LAA A;  3WDN A;  3ZIA A;  2F0M A;  2RKS A;  3NK9 A;  1EY7 A;  4XD7 A;  5KIX A;  4C3H G;  4RKL A;  2K03 A;  4NW2 A;  3ONA B;  2ZZQ A;  1CHQ D;  1Y69 U;  1ZYR C;  2NWG A;  2HCI A;  1TWA B;  1QNU A;  1Y8O B;  4KJO A;  3D6W A;  4KY5 A;  1GJX A;  2DNC A;  3SDZ A;  1BUV T;  2ZXO A;  2R6G A;  1VCI A;  1O7Z A;  2FMM A;  2O2L D;  1IKM A;  4JBW A;  2ICE C;  3NWT A;  1QG7 A;  3D4D A;  1UD8 A;  5COR A;  1TY2 A;  1I4G A;  1JOO A;  3RZD B;  2C9O A;  2WJV A;  3FMC A;  4KK7 A;  4XON A;  2IX3 A;  2K1B A;  2M5S A;  5M9O A;  4NP5 A;  2HDM A;  2Q8R E;  3MXU A;  3CRK C;  1ROD A;  3OIP A;  1SNC A;  4A3J B;  3BDC A;  1ET9 A;  1EOT A;  4ZRZ A;  1HCZ A;  3OOC A;  1QOH A;  2X69 A;  3S15 B;  1RCV D;  2JXM B;  1S5F D;  5D3D A;  2MHV A;  3LNN A;  2F0E A;  1OXS C;  2PZU A;  2F4I A;  5K5P A;  3J81 E;  4YXW A;  3MFY A;  3A7A B;  1NR4 A;  3T16 A;  4BS9 A;  2F3V A;  2R93 B;  2F0K A;  2ENB A;  3K5N A;  1TKW B;  4H44 C;  1SSO A;  3J81 L;  3R3O A;  1O80 A;  2L5T A;  5CDF A;  1FD7 D;  5I9O A;  2GK7 A;  4X3T A;  1S4Z A;  3A56 A;  4K5W A;  1HTL D;  4CJ2 C;  2B2Y A;  2F0J A;  4RHR A;  3HS0 C;  1LTG D;  1RJT A;  1TS3 A;  2JEB I;  1E3X A;  2RVL A;  2NTS A;  1H8H A;  2SEB D;  4ZKB B;  2K5W A;  3I90 A;  4KD3 A;  3SE0 A;  1DD2 A;  1H8E A;  4HSV A;  1E2V A;  2XRS D;  1A3V A;  3SK4 A;  3VR4 A;  1KZL A;  5EKI A;  5IGG A;  5A35 A;  1K8O A;  1SE2 A;  3KEW A;  1L0Y B;  5IT9 E;  5D65 A;  2BDO A;  2MGS A;  5E3F A;  5CR3 A;  1AP0 A;  1VMC A;  2F0T A;  5I4D A;  1MAB A;  4K6D A;  2QKI C;  2RA4 A;  2QEJ C;  1UD3 A;  2WAC A;  3S17 B;  1JR0 D;  1A3U A;  3NTH A;  3H94 A;  4K14 A;  3E0J A;  1U9R A;  3MAQ A;  1AW7 A;  1WVL A;  2FJ2 A;  3K5M A;  4E0F A;  1XXG A;  1MD2 D;  3EVQ A;  5CV8 A;  3NE5 B;  1RDP D;  4DXF A;  4OIK A;  3D8G A;  2F0W A;  1MBY A;  1SJE D;  1D2B A;  4HCE A;  4Z9C B;  1PFM A;  1CQF A;  1ZEQ X;  3WOF A;  4DNT B;  1PRT D;  2GJP A;  3EA6 A;  2L11 A;  1W6J A;  3GTM B;  2W6I A;  4CKE A;  2KEE A;  4B08 A;  1QJO A;  2KOL A;  1I18 A;  1HUN A;  1WTH D;  2WZP P;  2EJF C;  4ULL A;  4XLA A;  4M1U B;  5JJZ A;  3FRP B;  3GTG B;  2PO4 A;  2NB0 A;  3DUZ A;  1B9N A;  3K0Y A;  3FEW X;  2QF7 A;  1B4O A;  5KYI A;  4FYD A;  3JAM E;  1FX0 A;  3A3B A;  1NCV A;  1V43 A;  1TS2 A;  3K5O A;  1V1O A;  1A15 A;  2C5C A;  4FXD A;  2VXW A;  2EYL A;  5CC4 A;  3A7L A;  4MHE A;  3E6Z X;  5IOC A;  4KI0 A;  5G3L D;  3DM1 A;  4QF4 A;  5DM7 3;  2QIL A;  3GV6 A;  1QE6 A;  1PFN A;  1AN8 A;  4FXU A;  3ZYY X;  1Z47 A;  3Q23 A;  3BCD A;  3OW7 A;  1PDQ A;  2HCC A;  4BA2 I;  1H9M A;  3X3M A;  3HOY B;  2M00 A;  2I07 B;  2D3L A;  3T13 A;  3Q6S A;  2D5D A;  1MSH A;  4DGZ A;  5ELF A;  4RCN A;  5DM6 3;  3K7A B;  4V19 0;  5DNF A;  1WTV A;  1II3 A;  4I7Z C;  5TSS A;  4C2M B;  4Q5V A;  2MP1 A;  1EYD A;  1EFI D;  3U9S A;  3TME A;  3I4N B;  3TN2 A;  2A69 C;  3ND9 A;  3C3L A;  4XN0 A;  4XXE A;  3CQZ B;  3D4R A;  2PPB C;  3C1F A;  4DFA A;  4B9X A;  4G57 A;  3NQI A;  5HGT A;  5E4X A;  2MPM A;  1CFM A;  2X85 A;  1GUS A;  4KJN A;  5EKK A;  1SBB B;  3D4W A;  4EQN A;  1QNK A;  4KV6 A;  1LLR D;  5CBA E;  1SYD A;  2X8K A;  5EBD A;  2KA7 A;  3K59 A;  1IKL A;  1EEI D;  3M4O B;  1VLY A;  1XX8 A;  2RQX A;  2HLD A;  4PMB A;  1B44 D;  3I3C A;  3TBI B;  3SK5 A;  1HRJ A;  2RSO A;  3I70 A;  2VB2 X;  1KNA A;  1KAB A;  4XN3 A;  3HOX B;  4ZQ3 A;  3SXH A;  3P20 A;  3GTJ B;  2K05 A;  2IWH A;  4FNF A;  4FVM A;  2BA1 A;  4KN7 C;  3HAG A;  2MUY A;  1V0F A;  2D62 A;  1FGB D;  5M5Y B;  4XKV A;  2E76 C;  3M7G A;  4JK1 C;  4OL7 A;  4KN4 C;  5CYU A;  4FF1 A;  2K04 A;  3KBX A;  1E3Z A;  2JJ2 A;  2F0F A;  5ELD A;  2WSS A;  2RDG A;  4B9W A;  1F9R A;  1NBM A;  4XOT A;  2EE1 A;  3H3V C;  2XZP A;  2V4D A;  1A2U A;  2NVX B;  1U4R A;  1XWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...