4DNTB

Crystal structure of the cusba heavy-metal efflux complex from escherichia coli, mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Cation efflux system protein CusB
total genus 58
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00529 HlyD HlyD membrane-fusion protein of T1SS
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4dntB02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dntB03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 4dntB01
1K8OA 2PCFB 3QG1A 3A8IE 1H9KA 1CFMA 1GUGA 2A69C 2A68D 1Q90A 2NN6G 4XIGS 1IW7C 2E75C 3MXUA 2D5DA 1BDOA 1Q12A 3VR3A 2JXMB 1PMRA 5JEAH 1IYUA 3W3AA 3TZUA 1HPCA 1LABA 3IFTA 1CTMA 3N6RA 3PUYA 3D4RA 1GUSA 3ND9A 3IKJA 3QJYA 1ZKOA 1VDZA 2LMCB 1FYCA 2K32A 1Z7TA 4PV1C 5K36H 3H94A 2EDGA 2F1MA 1E2ZA 2EJGC 4IQZA 1IW7D 4XTCS 3M85A 3A7AB 3P20A 1V43A 5C0XG 1GJXA 2A68C 2BE5D 2EJMA 2B8FA 5K36G 1E2WA 2K33A 2NN6I 4G7HC 2PPBC 2JEBI 3HGBA 2AUJD 3PV0A 2DNEA 4HR7B 4LJZC 3KLRA 3GD7A 4KI0A 2JE6I 5KNDA 5KNBA 3VR4A 3CRLC 2Q8IB 4G7ZC 4DK1A 2IT1A 4KHZA 3A8JE 4H44C 3VR6A 3I72A 1OXUA 4KN7C 4BA2I 3T56B 1GHKA 2V4DA 3WDNA 1H9JA 3LNNA 5BN5A 1Q1EA 1HCZA 2R6GA 4L8JA 2BDOA 5BN4A 2A6EC 1VF5C 2D2CC 1EWHA 1O78A 1V8QA 1QJOA 1H9SA 1Y69U 1Y8OB 2E74C 3ND8A 3U9SA 1GUOA 2A69D 2DNCA 3I4LA 3OPOA 3SDZA 3PUZA 4DNTB 4TKOB 3PUVA 1DCZA 1I6VC 2ZT9C 3BDOA 1YNJC 3L7ZC 4KN4C 1LACA 4G7OC 3T51B 2NN6H 2D62A 4H13C 4I7ZC 5A35A 2K7VA 2O5JC 2BA1A 1GUTA 2O5IC 1GUNA 3BG3A 1G291 4OO1H 2AWOA 2BE5C 3VA7A 1E2VA 3M4YA 2YYZA 4KKTA 4TQUS 3I73A 2QF7A 5C0XH 1HQMC 2KA7A 4IFDH 3T53B 3OOCA 3OW7A 2AUKA 4KKUA 3PUWA 1TKWB 2BA0A 2E76C 1GHJA 1K8MA 1VCIA 4KKSA 1Y8PB 3A8KE 1DD2A 1FR3A 4GZYC 3A7LA 1YNNC 1TU2B 4LK1C 1H9RA 2EJFC 3CRKC 3VR5A 1O7LA 1CI3M 2JEAI 3NE5B 1Z6HA 3AB9A 3QIAA 4OGQC 3SE0A 3VR2A 2EVBA 1A6XA 2KCCA 4H0LC 2PNRC 2L5TA 3LWUA 4DNRB 1HTPA 1OXSC 5JEAG 2A6ED 3FMCA 1OXVA 1Q1BA 4JK1C 1B9NA 2CW0C 4OO1G 1H9SB 1OXTA 5BN3A 1ZYRC 2A6HD 2DN8A 3EQLC 4JBWA 4BA1I 3GQBA 1VF7A 1DXMA 3FPPA 1H9MA 4RCNA 3RLFA 2B8GA 3MFYA 5KNCA 4IFDG 1SMYC 3PUXA 2A6HC 3D31A 1Y8NB 1B9MA 3DXJC 4DK0A 4KMUC 1OXXK 1IYVA 3M7NA 1ONLA 1T5EA
chains in the Genus database with same CATH superfamily
4ROXA 4XT3B 1K8OA 4QY7A 2BSAA 2PCFB 3Q6SA 4ZV4A 3TSSA 4DV7L 4DR2L 4DR6Q 1IW7C 1K0RA 1KDBA 3MXUA 3HRZC 4RGTA 1QVFA 1OHHA 3WXMA 1TVXA 1VQCA 2K5VA 3N6RA 1K9MD 1S4ZA 1QVGA 1TS4A 4JI6L 2XSCA 4B4DA 3C46A 1RODA 4G1VA 2YWEA 2CW5A 1KABA 1LYLA 1UE1A 2RDFA 1V43A 4DR7Q 2MGSA 4J6HA 2B8FA 3D6WA 2K01A 1MD2D 2DY8A 2WKCA 1HFNA 2QA4B 1PDQA 2PZUA 2ZL7A 1PRTB 5L37A 2RBMA 2HLDA 3OWFA 4DV2Q 4JI7Q 2JE6I 4MZ9A 5LMUL 4LFCL 3A8JE 2SNMA 1IKLA 4GKKQ 4KN7C 4ZRZA 1Q9SA 2QDXA 1SMXA 4JI7L 3NWSA 4H9GA 1HCZA 2AQ3B 1JWUD 1OB5A 3U50C 1VQ9B 3ASRA 5LMNW 2UXBQ 1UUPA 4AF6A 4X05A 1J9OA 4B3SL 4Y52H 2NTTA 2Z1CA 2E8GA 3I4LA 1ICFB 1U2RA 3QFSA 3OTOL 1XMOQ 3GTPB 4TKOB 1S72A 2R9VA 2XRSD 4OWTB 3CCVB 4HIMA 1X6OA 3NP8A 5FLXc 1K73C 1CNFA 4MN3A 1UD5A 1PJ7A 2D62A 4NMZA 5TRDA 1KLUD 3GVJA 2VNUD 1KXLA 2VBSA 4X62Q 3BYYB 4LBZA 3CCQB 1GD7A 1PH2A 3CP0A 4OO1H 1K3BC 3CP2A 3FKIH 1W87A 4CDEC 4IPCA 1KDCA 1EFRA 3K81C 4MIUA 1GUWA 1GHJA 4TMWA 1XB2A 2K52A 5FIUA 2K14A 4RKLA 5M3MH 2OWOA 1U0LA 3QIAA 3SE0A 4A3BB 1Q82D 1T5XD 3H91A 4B3XA 4U9UA 3CCRA 4K0KQ 3IL8A 1IBKL 4X06A 1VJSA 1OXVA 1P4MA 1JOKA 1SRUA 4OEMB 3RN2A 1X55A 1I4GA 5LMNL 3IRBA 4L5TA 5FLMG 2ZZQA 1V1OA 5A89A 1PZJD 1Y1VG 2EE1A 4EX5A 2Z6BD 4XDXA 1ENFA 3TP8A 3FPPA 3CQZH 1YZ6A 3D31A 2RVLA 1Y8NB 5G3LF 1JC7A 1VQ6A 4A93H 2FFKB 1OXXK 2ICEC 5H1SE 1R4QB 4A3GG 3DWAA 4BY1G 5HURA 5M9OA 5GAGC 3QG1A 1GO2A 4DAYB 4GKKL 1A0IA 1QILA 2I5HA 1SYBA 1BNZA 5GAHC 1LABA 2X69A 4YY3Q 2Q6IA 4ZGQB 4M2LA 4TMTA 3IKJA 1IBLQ 1C8CA 4LUZA 1VDZA 1KD1C 1WFQA 3FKSA 4HSVA 1JWMD 2WV6D 1IW7D 1VQBA 5E3FA 1VQ4B 2Q6OA 3X3NA 2WACA 4P22A 4HMJA 4TVAB 2VQEQ 3BY1A 3FRPB 5KYIA 4LFAL 3EROA 1CA6A 4AVZA 4P26A 4KI0A 1TUIA 3QFCA 4FF1A 3STBD 2PQEA 2GJRA 1EZ6A 4Z1MA 4FVMA 4GN5A 4K14A 2VQFQ 3S16H 1NMFA 3J7A5 1R5BA 2CKZB 3GV3A 1DZ1A 1FJGQ 3ZJYC 2UXCQ 3RMHA 5EPJA 1YJWA 1SJHD 1VQ7B 1UD4A 1EIYB 4DUYL 2A74C 4GOPC 2C4TA 1FJGL 5M5WH 4A3EB 4FF2A 1B8AA 2OBRA 3TS2A 4TT3A 1U4MA 2Q2TA 2NV4A 3KDFA 4DNTB 4PG3A 3TRZA 2I5MX 1RHPA 2ZT9C 5M5YH 2JA6B 4BXXH 4YALA 4XM3A 5FO1A 1KL9A 3AU7A 1TWGB 5BR8Q 1TWHB 4NCNA 4A3JH 2XZOA 3AEVA 5FLXL 2R7ZB 2M00A 3MVVA 1BF4A 1KC8D 3VA7A 1I50B 5LMZA 1VS0A 3RNUA 1HQMC 1UE7A 5LL6X 3A54A 3PUZA 3AFPA 4PC3A 2LXKA 4O1NA 1WTOA 4OPSA 1KK2A 3P7JA 4PZ7A 2PYKA 4ZCIA 3UI2A 5FA6A 2L5TA 4LBVA 1FD7D 2QGQA 2C77A 3S2HH 5C3EH 5EKIA 2CFMA 2KUMA 2A19A 2AKWB 1RL2A 2K5WA 1JJ2B 1STHA 4YELA 5TR9A 1JB3A 1PFBA 2NTSA 2GJKA 4ACBA 2KBNA 4GNXB 1WI5A 4B3TL 4OOVA 1NRKA 3J80i 3NENA 3W2HA 1BPLA 3Q3AA 4RCNA 4F87A 4NDXA 4DAYA 5KNCA 1HH2P 1VQ9A 4XR6A 1DDGA 2UUAL 1J5EQ 2B63B 1ONLA 2P5ZX 3ONYA 3J81i 4PC2A 3AGQA 5T1IA 3JU4A 3VO2A 2ZXIA 2NN6G 3NTKA 1XPRA 3RZOH 4LFCQ 5JJLA 4K8IA 1YIJA 1IYUA 1HZAA 2OTLB 1SNMA 2K04A 3TZUA 3CCJB 2BN4A 3TEHB 2JA5B 4IUUA 1DG1G 1BCPD 1HZCA 4ME3A 1E43A 4PMBA 4WJWA 3H94A 4LF8L 3AGPA 2EJGC 3GTJB 4Z4SA 3GSIA 3P20A 2E2JB 4CKBA 4IPHA 1IYJB 5K36G 1YIJB 5D3IB 2NN6I 2UXCL 4DQKA 4BBRH 2F0NA 2E5LQ 1W34A 3NEMA 2EIXA 4RDLA 1YX2A 2DNEA 3S17B 3CC4A 5I9PA 1ZM9A 1G51A 3CPWA 1YLOA 3I72A 1IBMQ 4E0FA 1EZ8A 3A5ZB 2RCFA 2JK8A 4HE5A 3GTGB 2D9RA 1BCPB 1UMKA 2NVXH 1STNA 1WDTA 4JI3L 4HIKA 4CDCC 1IZ6A 2C4UA 1EFUA 2NZHA 3U9SA 1KLGD 1PLFA 4QUZA 3JAMc 5A2QE 1E1QA 4IUVA 4A3GH 2ZXPA 4P9SA 1VQNA 3SEBA 5KRUA 4F7XA 5IGCA 1PH8A 4WZTA 3BDOA 4A3IB 2QEJC 4KN4C 1KMHA 2O5JC 4V0BA 2O5IC 4X8IA 4X3TA 2PLFA 1VQDA 4A3KB 1DGSA 4DV0L 4DR3Q 4CJ2C 1HR0Q 4ZAIA 2JA6H 1EQVA 4IW3B 2I0QA 1TWGH 1Q81C 2OQ0A 1S40A 3G71B 2FINB 3I73A 2C2WA 4P25A 2R61A 2OXPA 3ZIAA 3H9NA 2BA0A 4MTNA 5J22A 4Y7CA 3HOWB 2ZJQA 4DKAC 4J8QA 1CI3M 3R2TA 1XQBA 1G6PA 1PH6A 2EVBA 2ZZFA 2VW9A 5FJ8H 4OPOA 1N32Q 4KJOA 4YXWA 3KJOA 1JT8A 3S1QH 1EY0A 3S2DH 1YJ9A 1JB9A 1X32A 1PTOH 3DM3A 2R92B 1HQRD 2ZBUA 4YWLA 5CBEE 4OP7A 1YITA 4JBWA 2HD3A 4DV5L 3OWEB 3D26A 4UZEA 3P26A 4P75A 4LF6L 2MQHA 4HCEA 5IYCG 1D1IA 3ZZTA 1R5NA 1YHQA 2VUMB 3M7NA 2BH8A 2M9VA 4JMQA 2QW7A 3KBXA 2L11A 1IBML 2QDLA 4Z4RA 3A0JA 4A93G 3ZZ0A 2N3SA 2E75C 1KRSA 1F60A 1X54A 2WB1E 3E5SA 3VR3A 1K8GA 2XTIA 1X56A 5C44B 2RHQB 3W3AA 3PENA 3S1RB 3D4RA 4LF5Q 5FLMH 3I4MB 1EQQA 3F8TA 3AVXA 2JIZA 3FPUB 4NKLA 4PV1C 5IP7H 3JQPA 2K5QA 4AF7A 4R8IA 4DV7Q 4DR2Q 2BE5D 3S2HB 5AFWA 1SROA 2K33A 2QKIC 2C78A 4X7FA 5CGKA 3I91A 1PH4A 3QOLA 4XKWA 4B3RQ 3SLDA 2E2JH 4POGA 4MNOA 1KQSA 1TWAB 4G5GA 4J1MA 5IGEA 4UZUA 2GA4B 4XORA 3MXPA 3WDNA 3EBEA 3OE7A 2KHJA 3FHWA 4NP5A 3H0GB 1LTLA 5GAEC 4WZLA 2E2DC 3LQ6A 5KSWB 4CGYB 2EXDA 2SNSA 4C3IG 3LWEA 5M3FG 4UZFA 3NPPA 1KAAA 1Y8OB 2MO0A 4QCLA 1ET6A 3K5MA 2FVGA 2FXQA 5H59A 2K4KA 4JI2Q 5C4ZA 5DN6A 4RCZA 4GOPA 1PJ5A 3OSOA 5C0XI 4OOSA 3UDGA 1Q7YD 4Z4ZA 1NCVA 4BY1B 2B29A 4X3KA 4I7ZC 2L55A 4JC0A 3PF5A 3UE1A 3W2GA 2SOBA 2HCIA 3GDEA 5ISRA 1U4PA 3HFZB 4QL5A 1E62A 4RGMA 4IUQA 4ZUJA 5C4JB 1FNBA 4PGOA 3BVGA 3W2DA 2EY1A 2HIXA 1AE3A 4LF4L 1FGUA 1LO5D 1N9WA 1PH9A 4FXDA 1S5BD 1YJWB 3ISXA 1B23P 2CWAA 2XGTA 5EQ0A 4DV2L 1KNAA 2KOLA 2Q2HA 2QTLA 3ZPNA 1C48A 1I8DA 1EWCA 1AN8A 2Z9HA 3GTLH 1A6XA 1DDIA 1B4OA 2Q8RE 1QVGB 3BZDB 4P6YA 1EQTA 2F4VL 4H02A 3EIVA 3PIP3 4JK1C 4ALPA 4K5WA 1F2LA 1WTHD 2WAQE 5ELNA 1Y1WB 1N33Q 1SFOH 2O2LD 2WZNA 1L0WA 3E9IA 1QGAA 1DXMA 3S1QB 2ENBA 1D1NA 1UNSA 4IUTA 1PYWD 2ZM6L 1FNMA 4A3KH 4IUNA 1YITB 2PI2A 3C1EA 2WB1B 3Q24A 1GM5A 1VQJA 2DUDA 1I5FA 1EU4A 4UP7A 2K1BA 2VUMH 2VNHA 3KYHC 2D5DA 1S3OA 1B2RA 1PMRA 5I4DA 4FO2A 2VNKA 4CKCA 4X65L 5C3EG 4DV3L 2XNDA 1AE2A 1LT3D 3VO1A 1WCMH 2NUCA 3CXCA 1YI2B 2KCMA 4MYUA 2ZJRA 2K32A 5KW9A 2ID0A 3Q38A 3HOVH 3S1RH 4II2A 4RAUC 2KEDA 3M85A 5IYBG 3BDCA 5E1FA 1GJXA 4WJ3M 4RDKA 4XLAA 4YAFA 4JOIC 3CC7B 1NE3A 4B08A 4HSPA 3N52A 2JA8B 2CW0D 1SSOA 4JI4L 1O7YA 4B3GA 1M1KD 1STYA 1TS5A 3I8ZA 5FLXE 4XN0A 1PH3A 5FO9B 1I4QA 2K75A 3TP7A 1X3GA 2EYLA 5JPMC 1S4MA 1E3ZA 1Q1EA 2CH4W 1SN8A 5TSSA 1F9PA 2D2CC 5GADC 2X53S 3RD4A 1YJ9B 2LXJA 3GTMB 4A3BG 4LF7Q 3W5OA 2E74C 3LVBA 4Y7NH 2R93B 1G8ZD 1SEBD 4X66L 4DV6L 4APVA 3VMFA 2NZ1D 4EQNA 1Q81D 3CAMA 3BZKA 1M8AA 4A3JB 4BWGB 3HG9A 2DYIA 1AFPA 3CCEB 1L1OA 1M4VA 1V0EA 1ESRA 2BMWA 5T1GA 1AZPA 3S1NB 4QJFA 4DR4L 2VBUA 4K1XA 2X6WA 3FKIG 4N3NA 1XTDA 2KQ3A 2K03A 1KK1A 1TR5A 1ZEQX 4DAMA 5A2QL 2D74A 1C7YA 1LTTD 1LT6D 4KLKA 1V1PA 3RY8A 5HZBA 3W5VA 4L5RC 2UUBL 4X3SA 4LNQA 1ZXTA 1QFYA 4O0AA 4A4IA 1I4PA 3GTKH 4NXML 4XONA 3CRKC 3GVKA 4XLFA 1W0KA 2EYFA 1EY4A 4X0CA 4XNFA 1EYDA 3A3BA 2Q8TA 4Z4WA 1VQNB 3LWUA 1N06A 1L0XB 5FL7A 1HTPA 1CKNB 1XYIA 2AMCB 2VJIA 2PZWA 4UP8A 3B8HA 3L0OA 1RTNA 4OL7A 1KDAA 1I7PA 4AH6A 1H9SB 1TVCA 1XNRQ 5CV8A 4OWWB 2RF4A 4RD3A 3BYTB 1H85A 4CHTB 5FOBB 3RLFA 5IYPA 1PYBA 3UE0A 2ICIA 4NBSA 2V1CC 4JV5L 3X3MA 1LTRD 3W1GA 3E20A 1PTOF 2PZTA 5DLQE 4OELB 2UU9Q 3BDLA 1Q12A 1TWFB 3PA2A 2EY2A 2JXMB 2F0EA 2Y0SE 1DOKA 4GOPB 3R8BA 1MSHA 2UXDQ 3BVMA 1EXMA 1CTMA 3KUPA 4RCOA 4ZCLA 4A3DG 5D14A 3A8IA 4FXGC 3H3VH 1W0JA 1Z7TA 4GLAC 1BQEA 4Z9CB 4BBRB 1E2ZA 5GQOA 4DR5Q 2IX1A 3OZVA 4XTCS 3A7AB 1QUEA 4E6IA 2EJMA 4K8JA 2RC6A 4YAOA 5IP7G 1N05A 1N33L 1XMQL 3JQRA 3HOWG 4JCVE 3T1YL 1NMGA 4GN3B 1GJRA 1JNYA 4G7ZC 3GTGH 3V7AA 1V5VA 3OHXC 2WJVA 2JA8H 1O80A 1ZM2A 3WBKA 1TS3A 1VHEA 4X3UA 2M2LA 1BQQT 2P3MA 4CJ1B 4GN4B 1VQ5B 3P27A 3VNUA 4JOIA 1GAWA 2XN9C 1EWHA 1IHZA 4GNXA 1XPUA 3L9AX 1BJKA 1YEZA 2WZPP 4OONA 2R7ZH 2VNIA 2ZZEA 2D0OA 4QIWE 1UAPA 4A3IH 2CNDA 1STGA 1WCMB 4KK7A 3UDFA 4A3FH 1EFWA 4QMGA 1KC8C 4M1UB 4JI5L 1ESFA 1YNJC 2JSOA 4LBWA 1UEBA 4YCUA 1SKQA 3KF8A 1SDFA 1A15A 2RDHA 4N8FA 5IP9H 4JI0Q 2CC2A 4Z4TA 1RJTA 1K73D 1G291 4XYQA 4JI1Q 3OKXA 1WTRA 3PO2G 1MABA 1LT5D 2AWOA 1I3QB 2F0TA 4BY7H 1SE3A 2VZAA 1W2BA 3CXCB 1VQPB 1PRTF 5GV8A 2ZXRA 2UUCQ 1SJED 2YTVA 4B3MQ 4R4QA 1TKWB 1VCIA 1Y8PB 2G9HD 3L2PA 1IHMA 1MI2A 2IW3A 5BSYA 3H0GG 1BOSA 1LV9A 5HXBA 1CZGA 3G05A 4OO1I 1D8LA 5JOBA 4R4TA 4XD7A 3I4NB 4PMWA 2Y0SG 3CB4A 3S1MB 1W6KA 3KDFB 1WTPA 4DR7L 3FP9A 4RMFA 3E3XA 4Y7NB 2WJYA 5FO8B 2B63H 4HE6A 2XRQD 3PO3G 4O2DA 1S5CD 2EYOA 5F4JA 2TMPA 1TQOA 3SK6A 4HN7A 5GV7A 4R71A 2WFWA 3S15B 2F1LA 1T6XA 1BCPF 3SEJA 2V7UA 2ZTEA 4KY7A 3URYA 2BVNA 1HR0W 1WOOA 4A3CH 4J15A 1LTAD 2JA7B 2HHHQ 1HUNA 2A69C 3SHLA 1Q90A 2F0MA 3FKIB 1QCBD 2BV3A 3Q39A 3GTQB 1PFMA 3A55A 2IWHA 3NQTA 1GUSA 3PIPA 3J7AF 4HJ9A 1G7RA 1FNDA 2FJ2A 1FYCA 3OEHA 3HKZG 1I4HA 3ITPA 3K80C 5K36H 5KNLA 2EDGA 4DV3Q 1VQAA 2PMDA 3J81c 4X6AH 2A68C 2G9DA 3DM1A 3PA1A 1JJCB 2B2TC 3JAME 1HNWL 4X62L 1D8TA 2QILA 1Y1WG 4P3IA 1EP2B 3KLRA 1RF2D 2OBSA 1MSGA 4PABA 1X65A 3QB3A 3J80E 2Q8IB 4R1JA 1Y0YA 3PUMA 4P12A 1QB5D 1SYDA 5A88A 3HOUG 4JBJA 1QVCA 2KCTA 4ZUIA 4P73A 3EA6A 2B2UA 2BOSA 2JDIA 2B2VC 1EFCA 2EYMA 3C3LA 4QIWB 3MFGA 4NPSA 4DXGA 1V9PA 5HGTA 1EY9A 4YWKA 1H9SA 3ND8A 1CHPD 2VB3X 4BBSH 1PJ6A 3H15A 3CP8A 4KHVA 1PKVA 1E1TA 5C5MA 1TY0A 4I7AA 3CD6A 2M5SA 3R6KA 5GROA 4L5SA 2X85A 2K05A 4FF3A 3WQZA 3ULJA 2NN6H 4X7EA 4DR6L 2CQOA 1UD8A 2K28A 1F20A 3F1ZA 2XWJB 3TQYA 3OW2A 2ALYB 4QF4A 5JAVA 3Q0AA 2E1BA 2Z6KC 2WSSA 5L46A 4KD4A 3M4YA 2HMAA 4WJ4A 3SR1A 1VQ6B 3WBJA 2BPOA 3OOCA 4A93B 2CHBD 3VA5A 5ELDA 4P72A 2HT1A 2EFGA 2CCZA 4A76A 2X6YA 3I1FA 1TU2B 3S16B 1J9ZA 2A73B 1X9NA 1Z6HA 5LMNQ 4GQNA 2I5LX 5IWAL 2V7XA 5IGBA 1L0YB 4KTAA 1Z9FA 1RDPD 3K58A 5JVH3 2JQOA 2JA8G 3EVQA 3AFQA 1R4PB 3VYRA 3CCEA 1E0BA 2HHHL 1DONA 3SK4A 2WKDA 2MO1A 3DUZA 2RSNA 2AWNA 5M3FB 4C3HB 2F3IA 1FRNA 2EY5A 3T1HL 4DK6C 1K8AD 5JBQA 4II3A 5AN9A 1E1OA 3ULLA 3MXGA 1PHJA 1WORA 2DOGA 3QE2A 4TN1A 2RA4A 1S72B 1SLJA 4A3FG 5EAYA 1N34L 2OQKA 1CUKA 3U4VA 1MHWC 4YHBA 5M3MB 3CC2B 1M90C 1BDOA 1C9OA 3U58A 1JMCA 3BC9A 1XJVA 3PO2B 2E2IB 1B50A 2F0DA 2HQLA 2B5OA 4BY7G 4DA2A 3HZXA 3DDYA 4B43A 4P71A 3SVMA 2OK8A 3WYAA 4XN3A 4DUZQ 1M90D 4A3EH 1AH9A 3M4OH 2QGGA 5I2YA 4NXNQ 5M5XH 2N8NA 3NTHA 1Q7YC 3AVYA 3CQZB 2L12A 1IJEA 1ZM4A 3ICEA 1CQFA 3LX0A 4G6IA 3NBHA 1ZYRD 3OYYA 2YV5A 2FX3A 3GD7A 4FNFA 2Q2UA 4HTHA 3HOYG 3VR4A 5C6AA 1EP1B 3BCDA 3OJWA 5FJ8G 2DJGC 4BA2I 1LTBD 1KK0A 3T56B 2V4DA 2BDNA 1DARA 1VQ4A 1YHAA 3AYHB 4JI1L 1K83H 4ZQ3A 2A6EC 1UE6A 2VB2X 3MCAA 2X6LA 2LKVA 1YJNB 1B7YB 2ZL6A 1Q86D 1C4QA 2WB1G 3HKSA 2JA7G 1JOOA 4X7CA 1GR1A 2CBXA 2ZTCA 3I56A 1XE1A 4BBRG 1JICA 3FVQA 3ASPA 1QG7A 4JG2A 1NB0A 2A5HA 4H13C 3CMMA 4V190 4RLZA 1KJZA 2VJJA 5E4XA 3CD6B 1QG0A 5IYRA 4LW1A 3G6JB 5CR3A 3A5UA 4KD3A 1F77A 3CTAA 1CM9A 4RFBA 2B7CA 1K9MC 4KKTA 3VNVA 1E24A 3GTKB 5IP9G 4A3DB 1S5ED 2VY3A 4LC0A 4IFDH 1VLYA 4KKUA 3AMUA 1HNXL 1G6ZA 4Y9UA 2UXBL 2CQAA 2RHSB 5IY0A 2OT2A 2V7TA 3QFTA 1IB0A 3W1BA 2GQFA 3CPFA 1XMQQ 1Q86C 3HOUB 5C3XA 2GPJA 2DY1A 2PNRC 3Q6RA 1D1KA 3JC66 4G57A 3CMAB 4RJLA 5BSXA 1HUMA 4LUVA 1K0SA 2A6ED 1QUFA 1BBUA 1Q1BA 3D3RA 1J8IA 5FO0A 4IALA 2VQFL 2VQEL 1MJCA 5D65A 2F4VQ 1H9MA 4WORA 1II3A 2A6HC 5HY6A 4M53A 3BY2A 4IPDA 4ULLA 3J80L 1FX0A 4QHYA 4K2KA 2L15A 3HOVB 3BJUA 3CC4B 1I4RA 2IPKD 4K5XA 3JAML 2A68D 5HGQA 1WCMG 1EY7A 4TMXA 2DY7A 1Q8IA 1WOCA 3KF6B 4A3MG 1E22A 3PQIA 3VYUA 5F4MA 3D4DA 4IOAA 3AQQA 4FYDA 4HMIA 5K5PA 1F9QA 1CSQA 4EQ5A 2Q6LA 2LFNA 1SNPA 1JORA 2C5BA 3D0FA 1EWYA 4RGOS 4JPBW 1S0UA 1W35A 1MIUA 4DV1Q 1N36Q 4DV4L 1N08A 1LTSD 4C1NK 5IYCH 4LJZC 4AQYQ 1EFTA 1A8PA 1EY5A 1GVHA 1HA5A 3E1YE 4ZLTF 4PC7A 4N9PA 3DEOA 1OXUA 2RDGA 4GS3A 3NBHB 1BO0A 1X3PA 3AVUA 3RZOB 4FWTA 1OGIA 1VQ8A 2KVOA 2I07B 2XNAC 1YVCA 5IGGA 2PQAA 1EEFD 2YWFA 1QJOA 2YWHA 3G4SB 1K83B 4EVOA 4POFA 3DHQA 1GUOA 1BLIA 2JA5G 4RM0A 1PTOD 3DWQA 5TY0A 2RCNA 4DV0Q 4DR3L 1JB7A 1HR0L 3NUCA 4QFMA 1I6VC 4BS9A 4LF4Q 4LMQD 1VQLA 4F88A 4BY7B 3MXNB 1QE6A 1A63A 2EPBA 1K8AC 1IL8A 1TIID 4IOCA 3K5OA 5EJWA 2PW5A 1RCVD 3ZC3A 5C4HA 4RDJA 1B1ZA 4R4IA 5F4OA 4GLXA 2FMCA 5J3BA 2F0FA 2NVXB 3FEWX 3HKZB 3A8KE 3S24A 3KK7A 2OCEA 3S1MH 2F0GA 2EYHA 3A8KA 1O7LA 4Y9RA 3G6EA 2MNAA 4QQBX 1AW7A 1VQKA 2XNCA 1DM0B 3VR2A 5LHY1 2I46A 4XOTA 1BKBA 1UD6A 1QGYA 1WOSA 2OBTA 2ZXHA 1E63A 2AHOA 3MEHA 1COWA 1KTKA 1SE8A 3R93A 2RSOA 2IX3A 4OO1G 3ES9A 2IX0A 4LBYA 1TWFH 3G6EB 4HAEA 1UWVA 1FGBD 3KBGA 4A3BH 1XNQL 1ZM3A 4DK0A 2EYJA 1NJIC 1IYVA 3KF6A 2C35B 4C3JH 2N88A 2V7WA 3GTQH 2D3LA 1WTQA 2JJ2A 3I55B 4CDDC 1SM4A 1VQ5A 2HDLA 1WSRA 2B39A 3NELA 1HPCA 4Q5VA 1STAA 1W3SA 3QJYA 1ZKOA 1CT1D 1HNXQ 1PH5A 3J81k 2JA9A 2KJXA 3ULPA 2WINB 5I9OA 5IGFA 4ACAA 3MC0B 1WOPA 1OB0A 2Y0SB 1S5FD 1G2TA 4XQQA 2E5LL 4QVJA 2GREA 4DFAA 1CKMA 1YJNA 3CCLA 3SLNA 1BBXC 4KHZA 1RIPA 4OXPA 1L2FA 1RTOA 3PSIA 4A3FB 2YWGA 1GHKA 1H42A 1A2TA 3T4AC 5BN5A 2V31A 1SE4A 2N55A 3KLSX 1B70B 5AJ3Q 3NXWA 1A3TA 3D4WA 2X6GA 3L3OC 3HOXB 4ZCKA 4OOXA 1KD1D 1JJGA 3T1YQ 5J3OA 3BS1A 2PO4A 5CV9A 2W6JA 3PUVA 2CK3A 1B53A 3OFNA 5FKAC 2WP8J 1SYGA 1WSVA 3HOYH 5DM63 2IHEA 3OAAA 1HZBA 1G7CA 1D5MC 3HS0C 5E4WC 1GUNA 5IIFA 1VQEA 3V2TA 2GVAA 5M5WB 5IE8A 1RQRA 4WFN3 2UXDL 3P75A 3CMAA 4M4SA 3KLWA 3H0GH 2QF7A 5JPNC 5CBAE 1JCKB 5JJZA 1B2TA 2KA7A 1P16A 1SXTA 1MRZA 4X64L 4KKSA 3SGIA 4GZYC 3A7LA 4JV5Q 4J0QA 3HKZE 4JI6Q 1EOTA 4P3YA 2JEAI 1EOVA 4XLCA 3AB9A 1CQVA 4YEJA 1TTTA 1X3QA 3U6BA 1QX4A 1PFNA 5C4XB 3FPKA 3OIPA 4K6DA 2QTZA 5JEAG 4Z4YA 3DLLA 3MA2B 1TWCB 1PH1A 3SJZA 2XOKA 2IL8A 1NJID 4DR1Q 5CYUA 4HIOA 2JJ1A 2K5DA 5CC4A 4C1NI 1FNWA 4I65A 4RD4A 1K28D 1Z47A 2NWGA 1U4LA 2B8GA 3IFDA 3MFYA 5LMUQ 3Q6QA 1OO9B 2F0KA 3M3YH 3I55A 2F3VA 3ASSA 3PUXA 2R7ZG 3S1NH 3GP7A 1S5DD 1FDRA 2TSSA 4YHHQ 1SNOA 2F0WA 2V7QA 4A3IG 1KTVA 4X07A 3BVZA 1GKHA 3M4PA 4M1KA 2K5HA 4AYBB 5JVG3 1FL0A 1N8RD 1GOZA 4RD1A 1FNUA 1NSNS 2QE7A 1QFJA 4OPVA 1HFGA 4X66Q 1I94L 2SEBD 4BPRA 4HJAA 2KHSA 3K7AB 1KRHA 3ASTA 3WOFA 4HJ7A 2PE3A 1YBYA 3IFTA 2YU9B 2FMMA 5NUCA 2QMUA 1D6EC 4LF5L 3GTMH 1ML0D 5IYQA 5M5XB 1TT2A 1VQGA 2R93H 5THXA 2F0VA 5DSZA 4IQZA 1HRJA 5IYWA 3HAGA 1B3AA 1SFOB 1CK1A 1CHQD 5DS0A 4G1BA 4B9XA 4IFDJ 2XNJA 2A1AA 2NYZD 3I90A 2ZL5A 2VL6A 4HCSA 1QUQA 2HCCA 3DMUA 2Q6KA 1AEXA 3PV0A 1K28A 2HCJB 5FK9C 4QVAA 1A8VA 1XNQQ 1NUCA 3G7LA 2A8VA 4H44C 4DUZL 4IFDI 2NB0A 4LFBL 3SXHA 3V05A 1QOHA 3F2BA 1ENCA 3NWTA 2MHVA 1OB2A 4WRDA 1R9TH 3MXNA 1EYCA 4RPDA 1GAQA 3MHPA 3LGJA 4X65Q 2DERA 3S17H 4JVZA 1NBMA 3CMEA 2BGIA 1CNEA 4CKEA 4EQOA 3M4QA 2Z0SA 2AQ1B 4YWMA 2KCNA 4C3JG 3CPWB 5IYDG 4G4KA 5E6TA 4C3HG 3OIQA 2R92G 3OZWA 3HOZG 2QN6A 1KRTA 3WWVA 2ZJPA 2B63G 3L7ZC 4DF7A 2X6XA 4K5VA 1GUTA 2LS01 4AYBE 1YNXA 4DV1L 1JR0D 3PGZA 4KY5A 1PTOC 3BQJA 4R9WA 2F0PA 4XMYA 4PMCA 1HHVA 4P2NA 3VYTA 5DAUA 3J7ZC 3JAMi 2EQSA 1WTHA 4LK1C 3RUZA 2ZZGA 3VR5A 3MAQA 1E7ZA 2F0JA 3NE5B 4MHEA 4ODGA 1HNWQ 2NPFA 4H0LC 4H7BA 3OMCA 3G71A 4QV2A 1HNZQ 1G7TA 1VQHA 2B2YA 2WAQB 5FNZA 3M7GA 1WJJA 4PZ8A 4GLVB 1E3XA 2ZBVA 3CW2C 1LUZA 2HQEA 3CPXA 2A6HD 5EBCA 1GO3E 1ILPA 3NHHA 1KIXA 4CQJA 2JJQA 2RQXA 1M1KC 5G3LD 3RLNA 2PIAA 4EGVA 1DYQA 1BX0A 4KMUC 5EBDA 3R3OA 4MTKA 3U9OA 1IXRA 5TV2A 2OTLA 4IPGA 3M3YB 5EPLA 4B9WA 2WR8A 1H9KA 1W9XA 2I1LA 1EU3A 1G91A 2BGJA 2PI2E 2QEXB 5CDFA 1NY4A 1XTCD 3PO3H 3CC7A 3K7AH 2Z6BA 4YAUA 3I7FA 4FP5D 3Q23A 3J81E 2UUCL 3QFRA 1DOLA 5DEHA 3A35A 3SJPA 5C0XG 4RD0A 1QNUA 4DXFA 1NAPA 4G7XA 3U6KA 3T13A 3KJPA 2PPBC 5M5YB 5C4XG 2ZM6Q 1HTLD 2AUJD 2Q2IA 3J80c 3E0JA 5IT9E 1Q46A 4A3CG 1FNCA 1JE5A 1PYSB 3KF8B 4ILWA 3VR6A 1SE2A 2VZLA 2VYQA 3S14B 3RR5A 2XGJA 3LNNA 1UD2A 3EJIA 3H3VC 2B2VA 2BDOA 2EZVA 4XQFA 2CVRA 1N36L 2JA7H 1YNND 5CORA 3PMFA 5ELBA 1F2ZA 2D0PA 1W6JA 2CH4A 3JQQA 5C44G 2PNHA 3KEWA 2L9HA 3U2QA 2JN9A 2DNCA 1R9TB 2YU9H 1LLRD 3PIOA 4DR1L 2IHFA 3LO8A 1U9RA 4PNYA 4EQPA 5C3EB 3RZDB 3CMEB 1SNCA 2QDBA 4RKBA 3WOEA 1BUVT 3T51B 1V1PB 4DNIA 3NSWA 4DAVA 4RD6A 5J35A 2UU9L 4HIZA 2LSSA 5C3WA 3C1FA 2FHTA 3SK8A 3H3VI 2F3WA 2EIFA 3R2IA 2F4NA 2B2WC 1IL2A 1H8HA 1PRTD 2E76C 4MYTA 2RC5A 4X7DA 4BY1H 3AVWA 4AQYL 1YNNC 4A3MB 2GK7A 1VQ7A 2R6HA 2XZPA 3NK9A 2KECA 4R8NA 1QZGA 4XLHA 4C3IB 2F0UA 3NBIA 1D2BA 4XQJA 1MKHA 1EY6A 2KCCA 1VQIA 3ZZUA 4HIDA 4DNRB 5C4JH 2ZTGA 5CV7A 4BBSB 4DR5L 3WY9A 5KGUA 4PAAA 2H5XA 2SDFA 1UD3A 4OIKA 1CKOA 3CW2A 1HXYD 2Z8LA 2W6IA 4IURA 1HZEA 3GVLA 1CKNA 3I70A 3J81L 4LF9L 3CRZA 3CCJA 2NVQB 4UPAA 3DXJC 4WWVA 3H09A 5CV6A 4JBKA 4C2MH 3I3CA 3C2QA 3RLOA 2OYNA 2NVTH 1PRTC 1Q3LA 1LTGD 3ERQA 4P2CB 2MFIA 4FXKC 5JEAH 2OK7A 2N49A 5I6YA 3QOJA 4P74A 3K57A 5EKKA 3PUYA 2RKSA 1EY8A 3ND9A 3MMPA 4DPGA 1G2SA 3KFUA 2LMCB 2EYPA 1KAWA 3MWYW 2ASBA 1QNKA 1Q8KA 1SBBB 3AVVA 1SR3A 1VQMB 3CHBD 2IY5B 1V1QA 3PO3B 2OTJB 4QB4A 1STEA 1E2WA 4FXUA 1E3PA 2R7DA 2WYRA 4ZYSA 4A3KG 4A3LH 3CCSB 1CSPA 2C9OA 2F0IA 1HJPA 5KNDA 4HJ5A 2BH2A 1CQXA 4WZKA 2J0TD 3EFXD 4ABNA 1OTCA 4L5QA 2F03A 1WP6A 3PVDA 4JI4Q 3A8JA 1VQMA 1EP3B 2NBFA 3TBIB 3V96A 1J5EL 2O4XA 4AYBG 1NBWA 4ZCMA 1VF5C 1V8QA 4DV6Q 2KENA 1AP0A 2HDMA 3E0EA 2JA5H 1TY2A 1XXGA 1Y69U 1H8EA 1G7SA 1XWEA 4JI8L 1LT4D 2XZLA 5J39A 3GTJH 2A69D 2G5DA 4C0SA 4PQXA 1CZWA 2JYOA 4JI2L 1OGJA 3A74A 3GV6A 4JW0A 1QVFB 1QWYA 1DCZA 3CCUA 4OIJA 4UY8C 3WNCA 5JJIA 1ENAA 4B3FX 1I94Q 4RA8A 4C3HH 2X8KA 1ELOA 1V0FA 2OEOA 4Q0FA 2R92H 2BCOA 1IKMA 2X0KA 3BG3A 2B2UC 2GVBA 1VMPA 3SK5A 2QCPX 4JYAQ 2D9UA 4RD2A 1E2VA 4UAIA 5C0XH 2R7FA 1YNJD 3T53B 1WTVA 3OW7A 4ZKCB 3PUWA 3Q8DA 2KHIA 1K8MA 1T9HA 1DD2A 1FR3A 1XX8A 4CBVA 1STBA 5C4XH 3G4SA 1H9RA 2EJFC 4ID6A 4F7DA 2F0HA 4O42A 1AMOA 2K6AA 4A3MH 5ELCA 4IZ8A 2E2IH 4NXNL 1OXSC 5JJKA 1VQ8B 3ZYYX 1YHQB 3BCFA 1XNRL 1EUJA 2PMZE 3FMCA 1UEAB 4C3JB 4ZKBB 1GXDC 1PV4A 1NTGA 2E1RA 1N34Q 3HOZB 4JI0L 4DUYQ 4BA1I 1HNZL 3GQBA 1VF7A 4K0KL 3RZDH 1PXUA 2BM0A 1BXTA 1D5XC 4TSSA 4CJ0B 4GNXC 4GKJQ 1PH7A 3GTOB 4L63B 3HOWH 2J7KA 1JA0A 1TLLA 4YAWA 4GKJL 1HA6A 4XIGS 3D8GA 2BM1A 3T16A 2ATWA 3VDYA 1F9SA 1RD9D 1L1OC 4A3JG 3OW2B 3A1PA 3HOXG 3B78A 1BCPC 1EFID 3K7UC 3ONAB 4Z4UA 1F2MA 2F0LA 4AIMA 2DJFC 4XQNA 1EL0A 4C43A 1CA5A 3ZBTA 1YHBA 3CKIB 3K5NA 3KL9A 4X64Q 4XOPA 2F1MA 2CRVA 1AIPA 3WNBA 1U5KA 3K0YA 4K6LA 4LAAA 1N32L 3CU7A 5IK2A 4QGUA 3WNDA 1RQPA 2DCUA 1VQKB 1SYEA 4KY6A 3S9WA 1IBLL 2J7ZA 4IUPA 4S3SA 4XL9A 5EMNA 4AC9A 3KOJA 5KNBA 4UHVA 4DK1A 2IT1A 1WVLA 2MP1A 4KV6A 2NVQH 1FVIA 4FK8A 1A62A 2R6GA 4UDUC 4A3DH 3W2IA 1WPCA 2B2TA 1JJ2A 3IAYA 3A3GA 3FDTA 1AZQA 4HJ8A 3PO2H 4C2MB 1A3UA 1O78A 3NTIA 5I6WA 1MGSA 3I4MH 2L0CA 1Y1VB 3CCMA 3CCUB 1L1OB 3J7YW 4M0LA 4JI5Q 3W5UA 1K3RA 4RH6A 1HVXA 3OPOA 4N3GA 5DNFA 4LWCA 3DEPA 5KYLA 2V7VA 1JE4A 5IODA 3F2CA 4G7OC 2VXWA 3GTPH 2D3NA 1I18A 2MPMA 4FDBA 1EIHA 4OX9L 3UDIA 4B44A 2YYZA 5BR8L 1YI2A 3KLSA 3I56B 1VMCA 4KJNA 1TWCH 2BF4A 2XEXA 5C44H 4LF9Q 1ET9A 1TXYA 3RN5A 2N78A 1N8RC 1KHIA 4A3LG 2LZJA 1D2EA 1HA3A 3I4OA 3K5LA 2HDNB 3OMGA 4Z4VA 5LL6S 2B2YC 1FNVA 4DK3C 4JI8Q 1KNEA 1EIFA 3CCSA 1I50H 1VQOA 2DGYA 2GK6A 1VLOA 4UAJA 1B9NA 3TDQA 2UUAQ 3W5HA 4RPBA 1TWAH 2OF1A 2DN8A 3EQLC 4PC1A 1PZKD 2JA6G 2E2HB 3STBC 3MTSA 4DR4Q 2B3GA 2F43A 3I4NH 1E1RA 4WZEA 5IWAQ 3NQIA 4B3TQ 1H95A 1RKNA 1NR2A 4JYAL 3TN2A 3SKBA 1T5EA 3BNWA 1J6QA 3G48A 2EXZA 4XYOA 3TP6A 4KHPL 3A8IE 1CFMA 3A56A 2LY7A 1EWIA 1SAPA 1EYAA 3GTLB 4NB3A 1MJEA 3HOUH 4PC6A 2Z4IA 1GVPA 2R93G 1WTXA 4DN4M 2F0SA 3OP1A 3LQEA 1P8LA 2DETA 2HUGA 1BX1A 4CDFC 2Z6KA 5CMDA 4LFBQ 2H1EA 3B82A 4PZ6A 3MZ5A 4RHSA 1TS2A 2JP1A 4YHHL 4BBSG 5COYA 4IN3A 5ELOA 5J1ZA 5KIXA 3T1HQ 2C5CA 2L1BA 3V76A 2XIWA 1SNDA 5AJ3L 3I2ZA 5IYNA 2JEBI 3HGBA 1NDHA 3S14H 4HR7B 3VYSA 1NB9A 3CRLC 3O13A 4YCVA 1I6HB 2UUBQ 3CCQA 3TZDA 2ZITA 1B44D 4DU9A 2NVYB 3F2DA 3TS0A 3PIO3 1EQRA 1SKYB 3M9BA 4ZK9B 4RGNA 2XVSA 2ZXOA 4LF6Q 1LTID 3GO5A 5ELFA 1PFSA 1Q82C 1VQFA 1O7ZA 1QFZA 2GJPA 1DOMA 3K6OA 3QSYA 5CV5A 4DGZA 5FO7B 2WAQG 4U673 3SDZA 4EH1A 5M3MG 5IOCA 1NR4A 4ME5A 1Y1WH 4FN5A 2DEUA 3QWNA 4XKVA 3K0XA 1WYDA 4NW2A 1R5OA 3QR8A 1QUQB 1F9RA 4TRDA 2XWBB 1F2YA 2ES2A 2IJ0A 4DV4Q 5EKLA 1Y14B 4OX9Q 2PW7A 5JEAJ 4R4CA 1TWHH 1IJFA 2F0OA 2KVMA 3AVTA 4TQUS 4TSFA 1HZ9A 2F4IA 4R4OA 2AUKA 4B3SQ 4U68A 3R6JA 3HEJA 4C3IH 5IGDA 4LF8Q 5M3FH 4B47A 4QUFA 5C0XJ 4IJHA 1E79A 3ZBUA 3PCOB 1ILQA 3OTOQ 3F2UA 3ERSX 2NZOA 3PF4A 3C2PA 1BBWA 2J4XA 1ZUNB 2R3ZA 3MHBA 4RWSC 1KQSB 4DV5Q 1Y1VH 4L6TB 1SYCA 3BZCA 4KHPQ 3GIRA 4LUOA 3BH4A 1XMOL 2CW0C 1B3QA 4XLEA 1OXTA 1A3VA 4DAPA 1ZYRC 5HZAA 2ZTNA 1ICWA 2L4NA 1BVSA 2WIIB 5CV4A 5HKKA 3TREA 4A3EG 4IJLA 4UP9A 3ZUGA 1SMYC 2VS1A 4JI3Q 1WD1A 2K50A 1B9MA 2NVTB 3OEEA 3HP3A 5IT9L 1ASZA 3CCLB 4G7WA 2K5NA 3ASQA 1BR9A 2JN4A 1LM0A 2PMZB 5IYDH 1D7QA 1PTOB 1GUGA 1N0UA 2VBTA 2GN5A 1JQYD 4Q7JB 4YIJA 1PVOA 4XT1B 3U4ZA 4NXMQ 2AQ2B 1PZID 4C56C 4P1VA 3HOXH 2YTYA 5B6IA 1N07A 1DJRD 1I4XA 1IBKQ 5C5LA 3E6ZX 4TMZA 2EOTA 5ELEA 2H4OA 1VQPA 1SYFA 4G7HC 1T6ZA 1EEID 3DWPA 4P6VF 3UDXA 3PUNA 4TMVA 1UE5A 1X3FA 2MUYA 1SMYD 1WTWA 4BXXG 2E2HH 4YCWA 4JBMA 1E64A 1XFOA 2CWPA 2QA4A 3FJOA 2VUMG 3J7AV 4OHJA 1H9JA 3M4OB 1XPOA 1VQOB 4K2LA 3Q22A 2VNJA 3EN2A 4L8JA 5BN4A 1I6HH 3TMEA 4RCYA 5H5JA 4ASUA 1T6YA 3MEFA 1QGZA 5KEEA 3I4NG 3CCVA 4QUCA 2F0QA 4RG1A 4B3ML 4M8AA 5D3DA 3HOVG 4DQLA 1FRQA 4FF4A 3I4MG 3J81j 1PA6A 1ASYA 1W2BB 2PQAB 2WPDA 5EPKA 5IT9c 3ONUA 1JA1A 5EGTA 5I2XA 1U4RA 3P1HA 4A3GB 1LACA 1X3EA 5A35A 2QEXA 4A75A 2X3UA 2K7VA 2BA1A 4LF7L 4N8X1 1Y0RA 4LFAQ 4WQMA 3S15H 1VQLB 3W2FA 2C5HA 2BE5C 3E9HA 1KZLA 4IO9A 5IYBH 1VHOA 1SNQA 1EIGA 2MJ8A 2VBVA 3K59A 4B48A 1WD0A 1KK3A 2CF4A 4ZGNB 3BU2A 2AHOB 2NVYH 3CCMB 2Z4HA 2B7BA 1WU8A 3W2EA 2OTJA 2ZTDA 4YY3L 3QO2A 2KEEA 4XXEA 4OGQC 3ER0A 5DM73 1NNXA 1A2UA 4NNJA 4OWXB 1JOQA 1BMFA 2HIVA 1N0VC 4N9TA 1C0AA 3HOZH 3CF5A 5F2DA 5E7NA 1O7IA 3HOYB 3CESA 4HEDA 2DIEA 4F8MA 5BN3A 3TP5A 3CCRB 2EY6A 2F52A 3OZUA 4RHRA 2B2WA 3GTOH 3S2DB 3D6CA 1QZHA 4IFDG 1I3QH 3H6MA 1QH0A 3CC2A 3K8AA 2YTXA 1JWSD 5A8AA 1EYGA 1D5ZC 4B3RL 1MBYA 3B6YA 3OJXA
chains in the Genus database with same CATH topology
4XT3B 1K8OA 2PCFB 3Q6SA 3TSSA 1IW7C 1KDBA 3MXUA 3HRZC 4RGTA 1OHHA 1TVXA 3N6RA 1S4ZA 1TS4A 2XSCA 3C46A 1RODA 1KABA 2RDFA 1V43A 2MGSA 4J6HA 2B8FA 3D6WA 2K01A 1MD2D 2DY8A 2WKCA 1HFNA 1PDQA 2PZUA 1PRTB 2RBMA 2HLDA 3OWFA 2JE6I 3A8JE 2SNMA 1IKLA 4KN7C 4ZRZA 3NWSA 1HCZA 2AQ3B 1JWUD 1UUPA 1J9OA 2NTTA 2Z1CA 3I4LA 3GTPB 4TKOB 2R9VA 2XRSD 3NP8A 4MN3A 1UD5A 2D62A 4NMZA 1KLUD 3GVJA 2VNUD 3BYYB 4OO1H 3CP2A 1KDCA 1EFRA 4MIUA 1GUWA 1GHJA 4RKLA 3QIAA 3SE0A 4A3BB 1T5XD 3H91A 3IL8A 1VJSA 1OXVA 1JOKA 1I4GA 2ZZQA 1V1OA 1PZJD 2EE1A 2Z6BD 4XDXA 1ENFA 3TP8A 3FPPA 3D31A 2RVLA 1Y8NB 5G3LF 1JC7A 2FFKB 1OXXK 2ICEC 1R4QB 3DWAA 5HURA 5M9OA 3QG1A 1QILA 1SYBA 1BNZA 1LABA 2X69A 3IKJA 1C8CA 1VDZA 3FKSA 4HSVA 1JWMD 2WV6D 1IW7D 5E3FA 3X3NA 2WACA 4P22A 4HMJA 3FRPB 5KYIA 3EROA 1CA6A 4AVZA 4KI0A 4FF1A 2PQEA 2GJRA 1EZ6A 4Z1MA 4FVMA 4K14A 3GV3A 1DZ1A 3RMHA 5EPJA 1SJHD 1UD4A 2A74C 4A3EB 4FF2A 4TT3A 1U4MA 4DNTB 1RHPA 2ZT9C 2JA6B 4XM3A 3AU7A 1TWGB 1TWHB 2XZOA 5FLXL 2R7ZB 2M00A 3MVVA 1BF4A 3VA7A 1I50B 1HQMC 5LL6X 3A54A 3PUZA 4O1NA 1WTOA 3P7JA 2PYKA 3UI2A 2L5TA 1FD7D 5EKIA 2KUMA 2K5WA 1STHA 4YELA 1JB3A 1PFBA 2NTSA 2GJKA 1NRKA 1BPLA 4RCNA 4F87A 4NDXA 4DAYA 5KNCA 4XR6A 2B63B 1ONLA 5T1IA 3JU4A 2ZXIA 2NN6G 3NTKA 4K8IA 1IYUA 3TZUA 1SNMA 2K04A 2JA5B 4IUUA 1BCPD 1E43A 4PMBA 4WJWA 3H94A 2EJGC 3GTJB 3P20A 2E2JB 4CKBA 5K36G 5D3IB 2NN6I 2F0NA 2DNEA 3S17B 5I9PA 3I72A 4E0FA 1EZ8A 3GTGB 1BCPB 1STNA 3U9SA 1KLGD 1PLFA 5A2QE 1E1QA 4IUVA 2ZXPA 3SEBA 5KRUA 4F7XA 5IGCA 3BDOA 4A3IB 2QEJC 4KN4C 1KMHA 2O5JC 4V0BA 2O5IC 4X3TA 4A3KB 4CJ2C 4ZAIA 1EQVA 2FINB 3I73A 2R61A 2OXPA 3ZIAA 2BA0A 5J22A 3HOWB 4J8QA 1CI3M 3R2TA 2EVBA 2ZZFA 4KJOA 4YXWA 1EY0A 1X32A 1PTOH 2R92B 1HQRD 5CBEE 4JBWA 3OWEB 4HCEA 1D1IA 2VUMB 3M7NA 2M9VA 4JMQA 3KBXA 2L11A 2E75C 3E5SA 3VR3A 5C44B 3W3AA 3S1RB 3D4RA 3I4MB 2JIZA 3FPUB 4NKLA 4PV1C 2K5QA 4R8IA 2BE5D 3S2HB 5AFWA 2K33A 2QKIC 5CGKA 3I91A 3QOLA 4XKWA 1TWAB 4J1MA 5IGEA 4UZUA 2GA4B 4XORA 3MXPA 3WDNA 3OE7A 4NP5A 3H0GB 2E2DC 4CGYB 2SNSA 4C3IG 3LWEA 3NPPA 1KAAA 1Y8OB 4QCLA 1ET6A 3K5MA 5C4ZA 5DN6A 5C0XI 3OSOA 1NCVA 4BY1B 4X3KA 4I7ZC 2L55A 2SOBA 2HCIA 5ISRA 1U4PA 4RGMA 4IUQA 4ZUJA 5C4JB 3BVGA 3W2DA 2EY1A 1LO5D 4FXDA 1S5BD 5EQ0A 1KNAA 2KOLA 3ZPNA 1C48A 1I8DA 1EWCA 1AN8A 1A6XA 1B4OA 2Q8RE 3BZDB 1EQTA 3PIP3 4JK1C 4K5WA 1F2LA 1WTHD 1Y1WB 2O2LD 1DXMA 3S1QB 2ENBA 4IUTA 1PYWD 4IUNA 3C1EA 2WB1B 3Q24A 1EU4A 2K1BA 2D5DA 1PMRA 5I4DA 4FO2A 4CKCA 2XNDA 1LT3D 2NUCA 2K32A 2ID0A 4II2A 4RAUC 2KEDA 3M85A 3BDCA 5E1FA 1GJXA 4XLAA 4B08A 4HSPA 3N52A 2JA8B 2CW0D 1SSOA 1O7YA 4B3GA 1STYA 5FLXE 1TS5A 3I8ZA 4XN0A 5FO9B 1I4QA 3TP7A 2EYLA 5JPMC 1E3ZA 1Q1EA 5TSSA 1F9PA 2D2CC 2X53S 3RD4A 3GTMB 2E74C 2R93B 1G8ZD 1SEBD 2NZ1D 4EQNA 1M8AA 4A3JB 4BWGB 3HG9A 1AFPA 1M4VA 1V0EA 1ESRA 5T1GA 1AZPA 3S1NB 2X6WA 2KQ3A 2K03A 1TR5A 1ZEQX 5A2QL 1LTTD 1LT6D 1V1PA 4X3SA 1ZXTA 1I4PA 4XONA 3CRKC 3GVKA 4XLFA 1W0KA 2EYFA 1EY4A 4XNFA 1EYDA 3A3BA 2Q8TA 3LWUA 1L0XB 5FL7A 1HTPA 1XYIA 2VJIA 2PZWA 1RTNA 4OL7A 1KDAA 1H9SB 5CV8A 4CHTB 3BYTB 5FOBB 3RLFA 2ICIA 3X3MA 1LTRD 1PTOF 2PZTA 3BDLA 1Q12A 1TWFB 2EY2A 2JXMB 2F0EA 1DOKA 3R8BA 1MSHA 3BVMA 3KUPA 1CTMA 4RCOA 5D14A 4FXGC 1W0JA 1Z7TA 4Z9CB 4BBRB 1E2ZA 2IX1A 4XTCS 3A7AB 4E6IA 2EJMA 4K8JA 4G7ZC 3OHXC 2WJVA 1O80A 1TS3A 4X3UA 2M2LA 1BQQT 4CJ1B 2XN9C 1EWHA 1IHZA 3L9AX 2WZPP 2ZZEA 1UAPA 1STGA 1WCMB 4KK7A 4QMGA 4M1UB 1ESFA 1YNJC 2JSOA 3KF8A 1SDFA 1A15A 2RDHA 1RJTA 4XYQA 1G291 1WTRA 1MABA 1LT5D 2AWOA 1I3QB 2F0TA 1SE3A 1PRTF 2ZXRA 1SJED 1TKWB 1VCIA 1Y8PB 2G9HD 1MI2A 2IW3A 1BOSA 1LV9A 1CZGA 3G05A 4OO1I 5JOBA 4XD7A 3I4NB 4PMWA 3S1MB 1W6KA 1WTPA 4Y7NB 2WJYA 5FO8B 2XRQD 1S5CD 2EYOA 2TMPA 1TQOA 3SK6A 4HN7A 3S15B 1BCPF 4KY7A 3URYA 1LTAD 2JA7B 1HUNA 2A69C 3SHLA 1Q90A 2F0MA 3FKIB 1QCBD 3GTQB 1PFMA 3A55A 2IWHA 3NQTA 1GUSA 3J7AF 2FJ2A 1FYCA 3OEHA 5K36H 1I4HA 3ITPA 5KNLA 2EDGA 2A68C 2G9DA 3DM1A 2B2TC 3JAME 2QILA 3KLRA 1RF2D 1MSGA 3QB3A 3J80E 2Q8IB 1QB5D 1SYDA 4ZUIA 3EA6A 2B2UA 2BOSA 2JDIA 2B2VC 2EYMA 3C3LA 4QIWB 3MFGA 4DXGA 5HGTA 1EY9A 1H9SA 3ND8A 1CHPD 2VB3X 3CP8A 4KHVA 1PKVA 5C5MA 1TY0A 2M5SA 2X85A 2K05A 4FF3A 3WQZA 2NN6H 1UD8A 2K28A 2XWJB 4QF4A 5JAVA 3Q0AA 2E1BA 2WSSA 4KD4A 3M4YA 3SR1A 3OOCA 4A93B 2CHBD 3VA5A 5ELDA 2X6YA 1TU2B 3S16B 2A73B 1Z6HA 4GQNA 5IGBA 1L0YB 4KTAA 1RDPD 3K58A 5JVH3 3EVQA 1R4PB 3VYRA 1E0BA 1DONA 3SK4A 2WKDA 3DUZA 2RSNA 2AWNA 5M3FB 4C3HB 2EY5A 4II3A 3MXGA 2RA4A 5M3MB 1BDOA 3BC9A 3PO2B 2E2IB 1B50A 2F0DA 4DA2A 3HZXA 3DDYA 3SVMA 4XN3A 5I2YA 3NTHA 3CQZB 2L12A 1CQFA 3LX0A 4G6IA 3NBHA 1ZYRD 3GD7A 4FNFA 4HTHA 3VR4A 5C6AA 3BCDA 4BA2I 1LTBD 3T56B 2V4DA 2BDNA 4ZQ3A 2A6EC 2VB2X 2X6LA 2LKVA 1C4QA 1JOOA 1JICA 3FVQA 1QG7A 2A5HA 4H13C 3CMMA 4V190 2VJJA 5E4XA 5CR3A 3G6JB 4KD3A 1F77A 1CM9A 4RFBA 4KKTA 4A3DB 3GTKB 1S5ED 4IFDH 1VLYA 4KKUA 3AMUA 1G6ZA 2CQAA 2OT2A 3HOUB 5C3XA 2PNRC 1D1KA 4G57A 1HUMA 2A6ED 1Q1BA 3D3RA 1J8IA 4IALA 5D65A 1H9MA 4WORA 1II3A 2A6HC 4ULLA 3J80L 1FX0A 4K2KA 3HOVB 1I4RA 2IPKD 4K5XA 3JAML 2A68D 1EY7A 2DY7A 1Q8IA 3VYUA 3D4DA 4FYDA 4HMIA 5K5PA 1F9QA 2LFNA 1SNPA 1JORA 4RGOS 1LTSD 4C1NK 4LJZC 1EY5A 4ZLTF 1HA5A 4N9PA 3DEOA 1OXUA 2RDGA 1BO0A 1X3PA 3RZOB 2KVOA 2I07B 2XNAC 5IGGA 1EEFD 1QJOA 1K83B 4EVOA 3DHQA 1GUOA 1BLIA 1PTOD 3DWQA 3NUCA 1I6VC 4BS9A 4LMQD 4F88A 4BY7B 1QE6A 2EPBA 1IL8A 1TIID 3K5OA 5EJWA 2PW5A 1RCVD 5C4HA 1B1ZA 2FMCA 2F0FA 2NVXB 3FEWX 3HKZB 3A8KE 3KK7A 2F0GA 2EYHA 1O7LA 1AW7A 3VR2A 1DM0B 5LHY1 2I46A 4XOTA 1UD6A 2ZXHA 3MEHA 1COWA 1KTKA 3R93A 2RSOA 2IX3A 4OO1G 2IX0A 4HAEA 1FGBD 3KBGA 4DK0A 2EYJA 1IYVA 2N88A 2D3LA 1WTQA 2JJ2A 2HDLA 2B39A 4Q5VA 1HPCA 1STAA 3QJYA 1ZKOA 1CT1D 2KJXA 2WINB 5I9OA 5IGFA 3MC0B 1OB0A 2Y0SB 1S5FD 1G2TA 4XQQA 4DFAA 1BBXC 4KHZA 1RTOA 1GHKA 4A3FB 1A2TA 3T4AC 5BN5A 2V31A 1SE4A 2N55A 3KLSX 3NXWA 1A3TA 3D4WA 2X6GA 3L3OC 3HOXB 3BS1A 2PO4A 5CV9A 2W6JA 3PUVA 2CK3A 1B53A 3OFNA 5FKAC 2WP8J 1SYGA 5DM63 3OAAA 1D5MC 3HS0C 5E4WC 1GUNA 5IIFA 3V2TA 5M5WB 4WFN3 3P75A 5JPNC 2QF7A 1B2TA 5CBAE 1JCKB 5JJZA 2KA7A 1SXTA 4KKSA 4GZYC 3A7LA 1EOTA 2JEAI 3AB9A 4XLCA 1CQVA 4YEJA 1X3QA 1PFNA 5C4XB 3OIPA 4K6DA 5JEAG 3MA2B 1TWCB 2XOKA 2IL8A 5CYUA 2JJ1A 5CC4A 2K5DA 4C1NI 1FNWA 4I65A 1K28D 1Z47A 2NWGA 1U4LA 2B8GA 3IFDA 3MFYA 1OO9B 2F0KA 2F3VA 3PUXA 3GP7A 1S5DD 2TSSA 1SNOA 2F0WA 2V7QA 3BVZA 5JVG3 4AYBB 1GOZA 1FNUA 1NSNS 2QE7A 1HFGA 2SEBD 2KHSA 3K7AB 3WOFA 3IFTA 2YU9B 2FMMA 5NUCA 1D6EC 1ML0D 5M5XB 1TT2A 2F0VA 4IQZA 1HRJA 1B3AA 3HAGA 1SFOB 1CK1A 1CHQD 4B9XA 4IFDJ 2NYZD 3I90A 4HCSA 2HCCA 3DMUA 1AEXA 3PV0A 5FK9C 1NUCA 3G7LA 4H44C 4IFDI 2NB0A 3SXHA 3V05A 1QOHA 1ENCA 3NWTA 2MHVA 4WRDA 3MXNA 1EYCA 1NBMA 4CKEA 4EQOA 2AQ1B 2KCNA 4C3JG 4G4KA 4C3HG 3OIQA 3L7ZC 4DF7A 2X6XA 4K5VA 1GUTA 2LS01 1JR0D 4KY5A 1PTOC 4R9WA 2F0PA 4XMYA 4PMCA 1HHVA 3VYTA 5DAUA 4LK1C 3RUZA 2ZZGA 3VR5A 3MAQA 2F0JA 3NE5B 4MHEA 4ODGA 4H0LC 4H7BA 3OMCA 2B2YA 2WAQB 3M7GA 1E3XA 2HQEA 2A6HD 5EBCA 1ILPA 3NHHA 2RQXA 5G3LD 4EGVA 1DYQA 4KMUC 5EBDA 3R3OA 3U9OA 3M3YB 5EPLA 4B9WA 1H9KA 1W9XA 1EU3A 1G91A 5CDFA 1XTCD 4FP5D 3Q23A 3J81E 1DOLA 5DEHA 3A35A 5C0XG 1QNUA 4DXFA 1NAPA 4G7XA 3T13A 2PPBC 5M5YB 1HTLD 2AUJD 3E0JA 5IT9E 4ILWA 3VR6A 1SE2A 3S14B 2XGJA 3LNNA 1UD2A 3EJIA 3H3VC 2B2VA 2BDOA 2EZVA 4XQFA 2CVRA 1YNND 5CORA 3PMFA 5ELBA 1F2ZA 1W6JA 3KEWA 2L9HA 2DNCA 1R9TB 1LLRD 1U9RA 4PNYA 4EQPA 5C3EB 3RZDB 4RKBA 1SNCA 2QDBA 3WOEA 1BUVT 3T51B 1V1PB 3NSWA 4DAVA 4HIZA 5C3WA 3C1FA 2FHTA 3SK8A 2F3WA 3R2IA 2B2WC 1H8HA 1PRTD 2E76C 1YNNC 4A3MB 2GK7A 2XZPA 3NK9A 2KECA 4R8NA 1D2BA 4C3IB 4XLHA 2F0UA 3NBIA 4XQJA 1EY6A 2KCCA 4DNRB 2ZTGA 5CV7A 4BBSB 5KGUA 2SDFA 1UD3A 4OIKA 1HXYD 2Z8LA 2W6IA 4IURA 1HZEA 3GVLA 3I70A 3J81L 2NVQB 3DXJC 3H09A 5CV6A 3I3CA 1PRTC 1Q3LA 1LTGD 3ERQA 4P2CB 4FXKC 5JEAH 5I6YA 3QOJA 3K57A 5EKKA 3PUYA 2RKSA 1EY8A 3ND9A 1G2SA 2LMCB 2EYPA 3MWYW 1QNKA 1SBBB 3CHBD 3PO3B 4QB4A 1STEA 1E2WA 4FXUA 4ZYSA 2C9OA 2F0IA 5KNDA 2J0TD 3EFXD 4ABNA 2F03A 1WP6A 2NBFA 3TBIB 3V96A 2O4XA 1VF5C 1V8QA 1AP0A 2HDMA 1TY2A 1XXGA 1Y69U 1H8EA 1XWEA 1LT4D 2XZLA 5J39A 2A69D 4PQXA 1CZWA 2JYOA 3GV6A 1QWYA 1DCZA 4OIJA 1ENAA 4B3FX 4RA8A 2X8KA 1V0FA 4Q0FA 2OEOA 2BCOA 1IKMA 3BG3A 2B2UC 1VMPA 3SK5A 2QCPX 2D9UA 1E2VA 4UAIA 5C0XH 1YNJD 3T53B 1WTVA 3OW7A 4ZKCB 3PUWA 1K8MA 1DD2A 1FR3A 1XX8A 4CBVA 1STBA 1H9RA 2EJFC 4ID6A 2F0HA 4O42A 2K6AA 5ELCA 4IZ8A 1OXSC 3ZYYX 3BCFA 3FMCA 1UEAB 4C3JB 4ZKBB 1GXDC 3HOZB 4BA1I 3GQBA 1VF7A 1PXUA 1BXTA 1D5XC 4TSSA 4CJ0B 3GTOB 4L63B 1HA6A 4XIGS 3D8GA 3T16A 1F9SA 1RD9D 1BCPC 1EFID 3ONAB 1F2MA 2F0LA 4XQNA 1EL0A 1CA5A 3K5NA 3CKIB 4XOPA 2F1MA 3K0YA 4K6LA 4LAAA 3CU7A 5IK2A 4KY6A 1SYEA 3S9WA 2J7ZA 4IUPA 4S3SA 4XL9A 5KNBA 4DK1A 2IT1A 1WVLA 2MP1A 4KV6A 2R6GA 4UDUC 1WPCA 2B2TA 3IAYA 3A3GA 3FDTA 1AZQA 4C2MB 1A3UA 1O78A 3NTIA 5I6WA 1MGSA 2L0CA 1Y1VB 3J7YW 4RH6A 1HVXA 3OPOA 5DNFA 3DEPA 5KYLA 1JE4A 5IODA 4G7OC 2VXWA 2D3NA 1I18A 2MPMA 1EIHA 2YYZA 3KLSA 1VMCA 4KJNA 1ET9A 2LZJA 3K5LA 3OMGA 5LL6S 2B2YC 1FNVA 1KNEA 2GK6A 3TDQA 1B9NA 2OF1A 2DN8A 3EQLC 1PZKD 2E2HB 3MTSA 2F43A 1E1RA 3NQIA 1RKNA 1NR2A 3TN2A 1T5EA 4XYOA 2EXZA 3TP6A 3A8IE 1CFMA 3A56A 2LY7A 1SAPA 1EYAA 3GTLB 2Z4IA 1WTXA 4DN4M 2F0SA 2HUGA 5CMDA 2H1EA 4RHSA 3MZ5A 1TS2A 2JP1A 5COYA 4IN3A 5KIXA 5J1ZA 2C5CA 2L1BA 2XIWA 1SNDA 2JEBI 3HGBA 4HR7B 3VYSA 3CRLC 3O13A 1I6HB 3TZDA 1B44D 4DU9A 2NVYB 3PIO3 1SKYB 4ZK9B 4RGNA 2XVSA 2ZXOA 1LTID 3GO5A 5ELFA 1O7ZA 2GJPA 1DOMA 3K6OA 5CV5A 4DGZA 5FO7B 4U673 3SDZA 5IOCA 1NR4A 4ME5A 3QWNA 4XKVA 4NW2A 1F9RA 4TRDA 2XWBB 1F2YA 2IJ0A 5EKLA 2PW7A 5JEAJ 2F0OA 2KVMA 4TQUS 4TSFA 2F4IA 2AUKA 4U68A 3HEJA 5IGDA 4QUFA 5C0XJ 1E79A 1ILQA 3F2UA 3C2PA 2J4XA 2R3ZA 3MHBA 4RWSC 4L6TB 1SYCA 3BH4A 2CW0C 4XLEA 1OXTA 1A3VA 4DAPA 1ZYRC 1ICWA 2ZTNA 2L4NA 2WIIB 5CV4A 5HKKA 1SMYC 1WD1A 1B9MA 2NVTB 3OEEA 3HP3A 5IT9L 4G7WA 2PMZB 1BR9A 1PTOB 1GUGA 1JQYD 4YIJA 4XT1B 2AQ2B 1PZID 4C56C 1DJRD 1I4XA 5C5LA 3E6ZX 2EOTA 5ELEA 2H4OA 1SYFA 4G7HC 1EEID 3DWPA 2MUYA 1SMYD 1WTWA 3J7AV 4OHJA 1H9JA 3M4OB 4K2LA 3Q22A 4L8JA 5BN4A 3TMEA 4ASUA 5KEEA 4QUCA 2F0QA 4M8AA 5D3DA 4FF4A 2WPDA 5EPKA 5EGTA 5I2XA 1U4RA 3P1HA 4A3GB 1LACA 5A35A 2K7VA 2BA1A 2BE5C 1KZLA 1SNQA 1EIGA 2MJ8A 3K59A 1WD0A 2Z4HA 3QO2A 4XXEA 2KEEA 4OGQC 5DM73 1A2UA 4NNJA 1JOQA 1BMFA 4N9TA 5F2DA 3HOYB 3CESA 4HEDA 2DIEA 4F8MA 5BN3A 3TP5A 2EY6A 4RHRA 2B2WA 3S2DB 3D6CA 4IFDG 3H6MA 1JWSD 1D5ZC 1MBYA 1UNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8O A;  2PCF B;  3QG1 A;  3A8I E;  1H9K A;  1CFM A;  1GUG A;  2A69 C;  2A68 D;  1Q90 A;  2NN6 G;  4XIG S;  1IW7 C;  2E75 C;  3MXU A;  2D5D A;  1BDO A;  1Q12 A;  3VR3 A;  2JXM B;  1PMR A;  5JEA H;  1IYU A;  3W3A A;  3TZU A;  1HPC A;  1LAB A;  3IFT A;  1CTM A;  3N6R A;  3PUY A;  3D4R A;  1GUS A;  3ND9 A;  3IKJ A;  3QJY A;  1ZKO A;  1VDZ A;  2LMC B;  1FYC A;  2K32 A;  1Z7T A;  4PV1 C;  5K36 H;  3H94 A;  2EDG A;  2F1M A;  1E2Z A;  2EJG C;  4IQZ A;  1IW7 D;  4XTC S;  3M85 A;  3A7A B;  3P20 A;  1V43 A;  5C0X G;  1GJX A;  2A68 C;  2BE5 D;  2EJM A;  2B8F A;  5K36 G;  1E2W A;  2K33 A;  2NN6 I;  4G7H C;  2PPB C;  2JEB I;  3HGB A;  2AUJ D;  3PV0 A;  2DNE A;  4HR7 B;  4LJZ C;  3KLR A;  3GD7 A;  4KI0 A;  2JE6 I;  5KND A;  5KNB A;  3VR4 A;  3CRL C;  2Q8I B;  4G7Z C;  4DK1 A;  2IT1 A;  4KHZ A;  3A8J E;  4H44 C;  3VR6 A;  3I72 A;  1OXU A;  4KN7 C;  4BA2 I;  3T56 B;  1GHK A;  2V4D A;  3WDN A;  1H9J A;  3LNN A;  5BN5 A;  1Q1E A;  1HCZ A;  2R6G A;  4L8J A;  2BDO A;  5BN4 A;  2A6E C;  1VF5 C;  2D2C C;  1EWH A;  1O78 A;  1V8Q A;  1QJO A;  1H9S A;  1Y69 U;  1Y8O B;  2E74 C;  3ND8 A;  3U9S A;  1GUO A;  2A69 D;  2DNC A;  3I4L A;  3OPO A;  3SDZ A;  3PUZ A;  4DNT B;  4TKO B;  3PUV A;  1DCZ A;  1I6V C;  2ZT9 C;  3BDO A;  1YNJ C;  3L7Z C;  4KN4 C;  1LAC A;  4G7O C;  3T51 B;  2NN6 H;  2D62 A;  4H13 C;  4I7Z C;  5A35 A;  2K7V A;  2O5J C;  2BA1 A;  1GUT A;  2O5I C;  1GUN A;  3BG3 A;  1G29 1;  4OO1 H;  2AWO A;  2BE5 C;  3VA7 A;  1E2V A;  3M4Y A;  2YYZ A;  4KKT A;  4TQU S;  3I73 A;  2QF7 A;  5C0X H;  1HQM C;  2KA7 A;  4IFD H;  3T53 B;  3OOC A;  3OW7 A;  2AUK A;  4KKU A;  3PUW A;  1TKW B;  2BA0 A;  2E76 C;  1GHJ A;  1K8M A;  1VCI A;  4KKS A;  1Y8P B;  3A8K E;  1DD2 A;  1FR3 A;  4GZY C;  3A7L A;  1YNN C;  1TU2 B;  4LK1 C;  1H9R A;  2EJF C;  3CRK C;  3VR5 A;  1O7L A;  1CI3 M;  2JEA I;  3NE5 B;  1Z6H A;  3AB9 A;  3QIA A;  4OGQ C;  3SE0 A;  3VR2 A;  2EVB A;  1A6X A;  2KCC A;  4H0L C;  2PNR C;  2L5T A;  3LWU A;  4DNR B;  1HTP A;  1OXS C;  5JEA G;  2A6E D;  3FMC A;  1OXV A;  1Q1B A;  4JK1 C;  1B9N A;  2CW0 C;  4OO1 G;  1H9S B;  1OXT A;  5BN3 A;  1ZYR C;  2A6H D;  2DN8 A;  3EQL C;  4JBW A;  4BA1 I;  3GQB A;  1VF7 A;  1DXM A;  3FPP A;  1H9M A;  4RCN A;  3RLF A;  2B8G A;  3MFY A;  5KNC A;  4IFD G;  1SMY C;  3PUX A;  2A6H C;  3D31 A;  1Y8N B;  1B9M A;  3DXJ C;  4DK0 A;  4KMU C;  1OXX K;  1IYV A;  3M7N A;  1ONL A;  1T5E A; 
#chains in the Genus database with same CATH topology
 4ROX A;  4XT3 B;  1K8O A;  4QY7 A;  2BSA A;  2PCF B;  3Q6S A;  4ZV4 A;  3TSS A;  4DV7 L;  4DR2 L;  4DR6 Q;  1IW7 C;  1K0R A;  1KDB A;  3MXU A;  3HRZ C;  4RGT A;  1QVF A;  1OHH A;  3WXM A;  1TVX A;  1VQC A;  2K5V A;  3N6R A;  1K9M D;  1S4Z A;  1QVG A;  1TS4 A;  4JI6 L;  2XSC A;  4B4D A;  3C46 A;  1ROD A;  4G1V A;  2YWE A;  2CW5 A;  1KAB A;  1LYL A;  1UE1 A;  2RDF A;  1V43 A;  4DR7 Q;  2MGS A;  4J6H A;  2B8F A;  3D6W A;  2K01 A;  1MD2 D;  2DY8 A;  2WKC A;  1HFN A;  2QA4 B;  1PDQ A;  2PZU A;  2ZL7 A;  1PRT B;  5L37 A;  2RBM A;  2HLD A;  3OWF A;  4DV2 Q;  4JI7 Q;  2JE6 I;  4MZ9 A;  5LMU L;  4LFC L;  3A8J E;  2SNM A;  1IKL A;  4GKK Q;  4KN7 C;  4ZRZ A;  1Q9S A;  2QDX A;  1SMX A;  4JI7 L;  3NWS A;  4H9G A;  1HCZ A;  2AQ3 B;  1JWU D;  1OB5 A;  3U50 C;  1VQ9 B;  3ASR A;  5LMN W;  2UXB Q;  1UUP A;  4AF6 A;  4X05 A;  1J9O A;  4B3S L;  4Y52 H;  2NTT A;  2Z1C A;  2E8G A;  3I4L A;  1ICF B;  1U2R A;  3QFS A;  3OTO L;  1XMO Q;  3GTP B;  4TKO B;  1S72 A;  2R9V A;  2XRS D;  4OWT B;  3CCV B;  4HIM A;  1X6O A;  3NP8 A;  5FLX c;  1K73 C;  1CNF A;  4MN3 A;  1UD5 A;  1PJ7 A;  2D62 A;  4NMZ A;  5TRD A;  1KLU D;  3GVJ A;  2VNU D;  1KXL A;  2VBS A;  4X62 Q;  3BYY B;  4LBZ A;  3CCQ B;  1GD7 A;  1PH2 A;  3CP0 A;  4OO1 H;  1K3B C;  3CP2 A;  3FKI H;  1W87 A;  4CDE C;  4IPC A;  1KDC A;  1EFR A;  3K81 C;  4MIU A;  1GUW A;  1GHJ A;  4TMW A;  1XB2 A;  2K52 A;  5FIU A;  2K14 A;  4RKL A;  5M3M H;  2OWO A;  1U0L A;  3QIA A;  3SE0 A;  4A3B B;  1Q82 D;  1T5X D;  3H91 A;  4B3X A;  4U9U A;  3CCR A;  4K0K Q;  3IL8 A;  1IBK L;  4X06 A;  1VJS A;  1OXV A;  1P4M A;  1JOK A;  1SRU A;  4OEM B;  3RN2 A;  1X55 A;  1I4G A;  5LMN L;  3IRB A;  4L5T A;  5FLM G;  2ZZQ A;  1V1O A;  5A89 A;  1PZJ D;  1Y1V G;  2EE1 A;  4EX5 A;  2Z6B D;  4XDX A;  1ENF A;  3TP8 A;  3FPP A;  3CQZ H;  1YZ6 A;  3D31 A;  2RVL A;  1Y8N B;  5G3L F;  1JC7 A;  1VQ6 A;  4A93 H;  2FFK B;  1OXX K;  2ICE C;  5H1S E;  1R4Q B;  4A3G G;  3DWA A;  4BY1 G;  5HUR A;  5M9O A;  5GAG C;  3QG1 A;  1GO2 A;  4DAY B;  4GKK L;  1A0I A;  1QIL A;  2I5H A;  1SYB A;  1BNZ A;  5GAH C;  1LAB A;  2X69 A;  4YY3 Q;  2Q6I A;  4ZGQ B;  4M2L A;  4TMT A;  3IKJ A;  1IBL Q;  1C8C A;  4LUZ A;  1VDZ A;  1KD1 C;  1WFQ A;  3FKS A;  4HSV A;  1JWM D;  2WV6 D;  1IW7 D;  1VQB A;  5E3F A;  1VQ4 B;  2Q6O A;  3X3N A;  2WAC A;  4P22 A;  4HMJ A;  4TVA B;  2VQE Q;  3BY1 A;  3FRP B;  5KYI A;  4LFA L;  3ERO A;  1CA6 A;  4AVZ A;  4P26 A;  4KI0 A;  1TUI A;  3QFC A;  4FF1 A;  3STB D;  2PQE A;  2GJR A;  1EZ6 A;  4Z1M A;  4FVM A;  4GN5 A;  4K14 A;  2VQF Q;  3S16 H;  1NMF A;  3J7A 5;  1R5B A;  2CKZ B;  3GV3 A;  1DZ1 A;  1FJG Q;  3ZJY C;  2UXC Q;  3RMH A;  5EPJ A;  1YJW A;  1SJH D;  1VQ7 B;  1UD4 A;  1EIY B;  4DUY L;  2A74 C;  4GOP C;  2C4T A;  1FJG L;  5M5W H;  4A3E B;  4FF2 A;  1B8A A;  2OBR A;  3TS2 A;  4TT3 A;  1U4M A;  2Q2T A;  2NV4 A;  3KDF A;  4DNT B;  4PG3 A;  3TRZ A;  2I5M X;  1RHP A;  2ZT9 C;  5M5Y H;  2JA6 B;  4BXX H;  4YAL A;  4XM3 A;  5FO1 A;  1KL9 A;  3AU7 A;  1TWG B;  5BR8 Q;  1TWH B;  4NCN A;  4A3J H;  2XZO A;  3AEV A;  5FLX L;  2R7Z B;  2M00 A;  3MVV A;  1BF4 A;  1KC8 D;  3VA7 A;  1I50 B;  5LMZ A;  1VS0 A;  3RNU A;  1HQM C;  1UE7 A;  5LL6 X;  3A54 A;  3PUZ A;  3AFP A;  4PC3 A;  2LXK A;  4O1N A;  1WTO A;  4OPS A;  1KK2 A;  3P7J A;  4PZ7 A;  2PYK A;  4ZCI A;  3UI2 A;  5FA6 A;  2L5T A;  4LBV A;  1FD7 D;  2QGQ A;  2C77 A;  3S2H H;  5C3E H;  5EKI A;  2CFM A;  2KUM A;  2A19 A;  2AKW B;  1RL2 A;  2K5W A;  1JJ2 B;  1STH A;  4YEL A;  5TR9 A;  1JB3 A;  1PFB A;  2NTS A;  2GJK A;  4ACB A;  2KBN A;  4GNX B;  1WI5 A;  4B3T L;  4OOV A;  1NRK A;  3J80 i;  3NEN A;  3W2H A;  1BPL A;  3Q3A A;  4RCN A;  4F87 A;  4NDX A;  4DAY A;  5KNC A;  1HH2 P;  1VQ9 A;  4XR6 A;  1DDG A;  2UUA L;  1J5E Q;  2B63 B;  1ONL A;  2P5Z X;  3ONY A;  3J81 i;  4PC2 A;  3AGQ A;  5T1I A;  3JU4 A;  3VO2 A;  2ZXI A;  2NN6 G;  3NTK A;  1XPR A;  3RZO H;  4LFC Q;  5JJL A;  4K8I A;  1YIJ A;  1IYU A;  1HZA A;  2OTL B;  1SNM A;  2K04 A;  3TZU A;  3CCJ B;  2BN4 A;  3TEH B;  2JA5 B;  4IUU A;  1DG1 G;  1BCP D;  1HZC A;  4ME3 A;  1E43 A;  4PMB A;  4WJW A;  3H94 A;  4LF8 L;  3AGP A;  2EJG C;  3GTJ B;  4Z4S A;  3GSI A;  3P20 A;  2E2J B;  4CKB A;  4IPH A;  1IYJ B;  5K36 G;  1YIJ B;  5D3I B;  2NN6 I;  2UXC L;  4DQK A;  4BBR H;  2F0N A;  2E5L Q;  1W34 A;  3NEM A;  2EIX A;  4RDL A;  1YX2 A;  2DNE A;  3S17 B;  3CC4 A;  5I9P A;  1ZM9 A;  1G51 A;  3CPW A;  1YLO A;  3I72 A;  1IBM Q;  4E0F A;  1EZ8 A;  3A5Z B;  2RCF A;  2JK8 A;  4HE5 A;  3GTG B;  2D9R A;  1BCP B;  1UMK A;  2NVX H;  1STN A;  1WDT A;  4JI3 L;  4HIK A;  4CDC C;  1IZ6 A;  2C4U A;  1EFU A;  2NZH A;  3U9S A;  1KLG D;  1PLF A;  4QUZ A;  3JAM c;  5A2Q E;  1E1Q A;  4IUV A;  4A3G H;  2ZXP A;  4P9S A;  1VQN A;  3SEB A;  5KRU A;  4F7X A;  5IGC A;  1PH8 A;  4WZT A;  3BDO A;  4A3I B;  2QEJ C;  4KN4 C;  1KMH A;  2O5J C;  4V0B A;  2O5I C;  4X8I A;  4X3T A;  2PLF A;  1VQD A;  4A3K B;  1DGS A;  4DV0 L;  4DR3 Q;  4CJ2 C;  1HR0 Q;  4ZAI A;  2JA6 H;  1EQV A;  4IW3 B;  2I0Q A;  1TWG H;  1Q81 C;  2OQ0 A;  1S40 A;  3G71 B;  2FIN B;  3I73 A;  2C2W A;  4P25 A;  2R61 A;  2OXP A;  3ZIA A;  3H9N A;  2BA0 A;  4MTN A;  5J22 A;  4Y7C A;  3HOW B;  2ZJQ A;  4DKA C;  4J8Q A;  1CI3 M;  3R2T A;  1XQB A;  1G6P A;  1PH6 A;  2EVB A;  2ZZF A;  2VW9 A;  5FJ8 H;  4OPO A;  1N32 Q;  4KJO A;  4YXW A;  3KJO A;  1JT8 A;  3S1Q H;  1EY0 A;  3S2D H;  1YJ9 A;  1JB9 A;  1X32 A;  1PTO H;  3DM3 A;  2R92 B;  1HQR D;  2ZBU A;  4YWL A;  5CBE E;  4OP7 A;  1YIT A;  4JBW A;  2HD3 A;  4DV5 L;  3OWE B;  3D26 A;  4UZE A;  3P26 A;  4P75 A;  4LF6 L;  2MQH A;  4HCE A;  5IYC G;  1D1I A;  3ZZT A;  1R5N A;  1YHQ A;  2VUM B;  3M7N A;  2BH8 A;  2M9V A;  4JMQ A;  2QW7 A;  3KBX A;  2L11 A;  1IBM L;  2QDL A;  4Z4R A;  3A0J A;  4A93 G;  3ZZ0 A;  2N3S A;  2E75 C;  1KRS A;  1F60 A;  1X54 A;  2WB1 E;  3E5S A;  3VR3 A;  1K8G A;  2XTI A;  1X56 A;  5C44 B;  2RHQ B;  3W3A A;  3PEN A;  3S1R B;  3D4R A;  4LF5 Q;  5FLM H;  3I4M B;  1EQQ A;  3F8T A;  3AVX A;  2JIZ A;  3FPU B;  4NKL A;  4PV1 C;  5IP7 H;  3JQP A;  2K5Q A;  4AF7 A;  4R8I A;  4DV7 Q;  4DR2 Q;  2BE5 D;  3S2H B;  5AFW A;  1SRO A;  2K33 A;  2QKI C;  2C78 A;  4X7F A;  5CGK A;  3I91 A;  1PH4 A;  3QOL A;  4XKW A;  4B3R Q;  3SLD A;  2E2J H;  4POG A;  4MNO A;  1KQS A;  1TWA B;  4G5G A;  4J1M A;  5IGE A;  4UZU A;  2GA4 B;  4XOR A;  3MXP A;  3WDN A;  3EBE A;  3OE7 A;  2KHJ A;  3FHW A;  4NP5 A;  3H0G B;  1LTL A;  5GAE C;  4WZL A;  2E2D C;  3LQ6 A;  5KSW B;  4CGY B;  2EXD A;  2SNS A;  4C3I G;  3LWE A;  5M3F G;  4UZF A;  3NPP A;  1KAA A;  1Y8O B;  2MO0 A;  4QCL A;  1ET6 A;  3K5M A;  2FVG A;  2FXQ A;  5H59 A;  2K4K A;  4JI2 Q;  5C4Z A;  5DN6 A;  4RCZ A;  4GOP A;  1PJ5 A;  3OSO A;  5C0X I;  4OOS A;  3UDG A;  1Q7Y D;  4Z4Z A;  1NCV A;  4BY1 B;  2B29 A;  4X3K A;  4I7Z C;  2L55 A;  4JC0 A;  3PF5 A;  3UE1 A;  3W2G A;  2SOB A;  2HCI A;  3GDE A;  5ISR A;  1U4P A;  3HFZ B;  4QL5 A;  1E62 A;  4RGM A;  4IUQ A;  4ZUJ A;  5C4J B;  1FNB A;  4PGO A;  3BVG A;  3W2D A;  2EY1 A;  2HIX A;  1AE3 A;  4LF4 L;  1FGU A;  1LO5 D;  1N9W A;  1PH9 A;  4FXD A;  1S5B D;  1YJW B;  3ISX A;  1B23 P;  2CWA A;  2XGT A;  5EQ0 A;  4DV2 L;  1KNA A;  2KOL A;  2Q2H A;  2QTL A;  3ZPN A;  1C48 A;  1I8D A;  1EWC A;  1AN8 A;  2Z9H A;  3GTL H;  1A6X A;  1DDI A;  1B4O A;  2Q8R E;  1QVG B;  3BZD B;  4P6Y A;  1EQT A;  2F4V L;  4H02 A;  3EIV A;  3PIP 3;  4JK1 C;  4ALP A;  4K5W A;  1F2L A;  1WTH D;  2WAQ E;  5ELN A;  1Y1W B;  1N33 Q;  1SFO H;  2O2L D;  2WZN A;  1L0W A;  3E9I A;  1QGA A;  1DXM A;  3S1Q B;  2ENB A;  1D1N A;  1UNS A;  4IUT A;  1PYW D;  2ZM6 L;  1FNM A;  4A3K H;  4IUN A;  1YIT B;  2PI2 A;  3C1E A;  2WB1 B;  3Q24 A;  1GM5 A;  1VQJ A;  2DUD A;  1I5F A;  1EU4 A;  4UP7 A;  2K1B A;  2VUM H;  2VNH A;  3KYH C;  2D5D A;  1S3O A;  1B2R A;  1PMR A;  5I4D A;  4FO2 A;  2VNK A;  4CKC A;  4X65 L;  5C3E G;  4DV3 L;  2XND A;  1AE2 A;  1LT3 D;  3VO1 A;  1WCM H;  2NUC A;  3CXC A;  1YI2 B;  2KCM A;  4MYU A;  2ZJR A;  2K32 A;  5KW9 A;  2ID0 A;  3Q38 A;  3HOV H;  3S1R H;  4II2 A;  4RAU C;  2KED A;  3M85 A;  5IYB G;  3BDC A;  5E1F A;  1GJX A;  4WJ3 M;  4RDK A;  4XLA A;  4YAF A;  4JOI C;  3CC7 B;  1NE3 A;  4B08 A;  4HSP A;  3N52 A;  2JA8 B;  2CW0 D;  1SSO A;  4JI4 L;  1O7Y A;  4B3G A;  1M1K D;  1STY A;  1TS5 A;  3I8Z A;  5FLX E;  4XN0 A;  1PH3 A;  5FO9 B;  1I4Q A;  2K75 A;  3TP7 A;  1X3G A;  2EYL A;  5JPM C;  1S4M A;  1E3Z A;  1Q1E A;  2CH4 W;  1SN8 A;  5TSS A;  1F9P A;  2D2C C;  5GAD C;  2X53 S;  3RD4 A;  1YJ9 B;  2LXJ A;  3GTM B;  4A3B G;  4LF7 Q;  3W5O A;  2E74 C;  3LVB A;  4Y7N H;  2R93 B;  1G8Z D;  1SEB D;  4X66 L;  4DV6 L;  4APV A;  3VMF A;  2NZ1 D;  4EQN A;  1Q81 D;  3CAM A;  3BZK A;  1M8A A;  4A3J B;  4BWG B;  3HG9 A;  2DYI A;  1AFP A;  3CCE B;  1L1O A;  1M4V A;  1V0E A;  1ESR A;  2BMW A;  5T1G A;  1AZP A;  3S1N B;  4QJF A;  4DR4 L;  2VBU A;  4K1X A;  2X6W A;  3FKI G;  4N3N A;  1XTD A;  2KQ3 A;  2K03 A;  1KK1 A;  1TR5 A;  1ZEQ X;  4DAM A;  5A2Q L;  2D74 A;  1C7Y A;  1LTT D;  1LT6 D;  4KLK A;  1V1P A;  3RY8 A;  5HZB A;  3W5V A;  4L5R C;  2UUB L;  4X3S A;  4LNQ A;  1ZXT A;  1QFY A;  4O0A A;  4A4I A;  1I4P A;  3GTK H;  4NXM L;  4XON A;  3CRK C;  3GVK A;  4XLF A;  1W0K A;  2EYF A;  1EY4 A;  4X0C A;  4XNF A;  1EYD A;  3A3B A;  2Q8T A;  4Z4W A;  1VQN B;  3LWU A;  1N06 A;  1L0X B;  5FL7 A;  1HTP A;  1CKN B;  1XYI A;  2AMC B;  2VJI A;  2PZW A;  4UP8 A;  3B8H A;  3L0O A;  1RTN A;  4OL7 A;  1KDA A;  1I7P A;  4AH6 A;  1H9S B;  1TVC A;  1XNR Q;  5CV8 A;  4OWW B;  2RF4 A;  4RD3 A;  3BYT B;  1H85 A;  4CHT B;  5FOB B;  3RLF A;  5IYP A;  1PYB A;  3UE0 A;  2ICI A;  4NBS A;  2V1C C;  4JV5 L;  3X3M A;  1LTR D;  3W1G A;  3E20 A;  1PTO F;  2PZT A;  5DLQ E;  4OEL B;  2UU9 Q;  3BDL A;  1Q12 A;  1TWF B;  3PA2 A;  2EY2 A;  2JXM B;  2F0E A;  2Y0S E;  1DOK A;  4GOP B;  3R8B A;  1MSH A;  2UXD Q;  3BVM A;  1EXM A;  1CTM A;  3KUP A;  4RCO A;  4ZCL A;  4A3D G;  5D14 A;  3A8I A;  4FXG C;  3H3V H;  1W0J A;  1Z7T A;  4GLA C;  1BQE A;  4Z9C B;  4BBR B;  1E2Z A;  5GQO A;  4DR5 Q;  2IX1 A;  3OZV A;  4XTC S;  3A7A B;  1QUE A;  4E6I A;  2EJM A;  4K8J A;  2RC6 A;  4YAO A;  5IP7 G;  1N05 A;  1N33 L;  1XMQ L;  3JQR A;  3HOW G;  4JCV E;  3T1Y L;  1NMG A;  4GN3 B;  1GJR A;  1JNY A;  4G7Z C;  3GTG H;  3V7A A;  1V5V A;  3OHX C;  2WJV A;  2JA8 H;  1O80 A;  1ZM2 A;  3WBK A;  1TS3 A;  1VHE A;  4X3U A;  2M2L A;  1BQQ T;  2P3M A;  4CJ1 B;  4GN4 B;  1VQ5 B;  3P27 A;  3VNU A;  4JOI A;  1GAW A;  2XN9 C;  1EWH A;  1IHZ A;  4GNX A;  1XPU A;  3L9A X;  1BJK A;  1YEZ A;  2WZP P;  4OON A;  2R7Z H;  2VNI A;  2ZZE A;  2D0O A;  4QIW E;  1UAP A;  4A3I H;  2CND A;  1STG A;  1WCM B;  4KK7 A;  3UDF A;  4A3F H;  1EFW A;  4QMG A;  1KC8 C;  4M1U B;  4JI5 L;  1ESF A;  1YNJ C;  2JSO A;  4LBW A;  1UEB A;  4YCU A;  1SKQ A;  3KF8 A;  1SDF A;  1A15 A;  2RDH A;  4N8F A;  5IP9 H;  4JI0 Q;  2CC2 A;  4Z4T A;  1RJT A;  1K73 D;  1G29 1;  4XYQ A;  4JI1 Q;  3OKX A;  1WTR A;  3PO2 G;  1MAB A;  1LT5 D;  2AWO A;  1I3Q B;  2F0T A;  4BY7 H;  1SE3 A;  2VZA A;  1W2B A;  3CXC B;  1VQP B;  1PRT F;  5GV8 A;  2ZXR A;  2UUC Q;  1SJE D;  2YTV A;  4B3M Q;  4R4Q A;  1TKW B;  1VCI A;  1Y8P B;  2G9H D;  3L2P A;  1IHM A;  1MI2 A;  2IW3 A;  5BSY A;  3H0G G;  1BOS A;  1LV9 A;  5HXB A;  1CZG A;  3G05 A;  4OO1 I;  1D8L A;  5JOB A;  4R4T A;  4XD7 A;  3I4N B;  4PMW A;  2Y0S G;  3CB4 A;  3S1M B;  1W6K A;  3KDF B;  1WTP A;  4DR7 L;  3FP9 A;  4RMF A;  3E3X A;  4Y7N B;  2WJY A;  5FO8 B;  2B63 H;  4HE6 A;  2XRQ D;  3PO3 G;  4O2D A;  1S5C D;  2EYO A;  5F4J A;  2TMP A;  1TQO A;  3SK6 A;  4HN7 A;  5GV7 A;  4R71 A;  2WFW A;  3S15 B;  2F1L A;  1T6X A;  1BCP F;  3SEJ A;  2V7U A;  2ZTE A;  4KY7 A;  3URY A;  2BVN A;  1HR0 W;  1WOO A;  4A3C H;  4J15 A;  1LTA D;  2JA7 B;  2HHH Q;  1HUN A;  2A69 C;  3SHL A;  1Q90 A;  2F0M A;  3FKI B;  1QCB D;  2BV3 A;  3Q39 A;  3GTQ B;  1PFM A;  3A55 A;  2IWH A;  3NQT A;  1GUS A;  3PIP A;  3J7A F;  4HJ9 A;  1G7R A;  1FND A;  2FJ2 A;  1FYC A;  3OEH A;  3HKZ G;  1I4H A;  3ITP A;  3K80 C;  5K36 H;  5KNL A;  2EDG A;  4DV3 Q;  1VQA A;  2PMD A;  3J81 c;  4X6A H;  2A68 C;  2G9D A;  3DM1 A;  3PA1 A;  1JJC B;  2B2T C;  3JAM E;  1HNW L;  4X62 L;  1D8T A;  2QIL A;  1Y1W G;  4P3I A;  1EP2 B;  3KLR A;  1RF2 D;  2OBS A;  1MSG A;  4PAB A;  1X65 A;  3QB3 A;  3J80 E;  2Q8I B;  4R1J A;  1Y0Y A;  3PUM A;  4P12 A;  1QB5 D;  1SYD A;  5A88 A;  3HOU G;  4JBJ A;  1QVC A;  2KCT A;  4ZUI A;  4P73 A;  3EA6 A;  2B2U A;  2BOS A;  2JDI A;  2B2V C;  1EFC A;  2EYM A;  3C3L A;  4QIW B;  3MFG A;  4NPS A;  4DXG A;  1V9P A;  5HGT A;  1EY9 A;  4YWK A;  1H9S A;  3ND8 A;  1CHP D;  2VB3 X;  4BBS H;  1PJ6 A;  3H15 A;  3CP8 A;  4KHV A;  1PKV A;  1E1T A;  5C5M A;  1TY0 A;  4I7A A;  3CD6 A;  2M5S A;  3R6K A;  5GRO A;  4L5S A;  2X85 A;  2K05 A;  4FF3 A;  3WQZ A;  3ULJ A;  2NN6 H;  4X7E A;  4DR6 L;  2CQO A;  1UD8 A;  2K28 A;  1F20 A;  3F1Z A;  2XWJ B;  3TQY A;  3OW2 A;  2ALY B;  4QF4 A;  5JAV A;  3Q0A A;  2E1B A;  2Z6K C;  2WSS A;  5L46 A;  4KD4 A;  3M4Y A;  2HMA A;  4WJ4 A;  3SR1 A;  1VQ6 B;  3WBJ A;  2BPO A;  3OOC A;  4A93 B;  2CHB D;  3VA5 A;  5ELD A;  4P72 A;  2HT1 A;  2EFG A;  2CCZ A;  4A76 A;  2X6Y A;  3I1F A;  1TU2 B;  3S16 B;  1J9Z A;  2A73 B;  1X9N A;  1Z6H A;  5LMN Q;  4GQN A;  2I5L X;  5IWA L;  2V7X A;  5IGB A;  1L0Y B;  4KTA A;  1Z9F A;  1RDP D;  3K58 A;  5JVH 3;  2JQO A;  2JA8 G;  3EVQ A;  3AFQ A;  1R4P B;  3VYR A;  3CCE A;  1E0B A;  2HHH L;  1DON A;  3SK4 A;  2WKD A;  2MO1 A;  3DUZ A;  2RSN A;  2AWN A;  5M3F B;  4C3H B;  2F3I A;  1FRN A;  2EY5 A;  3T1H L;  4DK6 C;  1K8A D;  5JBQ A;  4II3 A;  5AN9 A;  1E1O A;  3ULL A;  3MXG A;  1PHJ A;  1WOR A;  2DOG A;  3QE2 A;  4TN1 A;  2RA4 A;  1S72 B;  1SLJ A;  4A3F G;  5EAY A;  1N34 L;  2OQK A;  1CUK A;  3U4V A;  1MHW C;  4YHB A;  5M3M B;  3CC2 B;  1M90 C;  1BDO A;  1C9O A;  3U58 A;  1JMC A;  3BC9 A;  1XJV A;  3PO2 B;  2E2I B;  1B50 A;  2F0D A;  2HQL A;  2B5O A;  4BY7 G;  4DA2 A;  3HZX A;  3DDY A;  4B43 A;  4P71 A;  3SVM A;  2OK8 A;  3WYA A;  4XN3 A;  4DUZ Q;  1M90 D;  4A3E H;  1AH9 A;  3M4O H;  2QGG A;  5I2Y A;  4NXN Q;  5M5X H;  2N8N A;  3NTH A;  1Q7Y C;  3AVY A;  3CQZ B;  2L12 A;  1IJE A;  1ZM4 A;  3ICE A;  1CQF A;  3LX0 A;  4G6I A;  3NBH A;  1ZYR D;  3OYY A;  2YV5 A;  2FX3 A;  3GD7 A;  4FNF A;  2Q2U A;  4HTH A;  3HOY G;  3VR4 A;  5C6A A;  1EP1 B;  3BCD A;  3OJW A;  5FJ8 G;  2DJG C;  4BA2 I;  1LTB D;  1KK0 A;  3T56 B;  2V4D A;  2BDN A;  1DAR A;  1VQ4 A;  1YHA A;  3AYH B;  4JI1 L;  1K83 H;  4ZQ3 A;  2A6E C;  1UE6 A;  2VB2 X;  3MCA A;  2X6L A;  2LKV A;  1YJN B;  1B7Y B;  2ZL6 A;  1Q86 D;  1C4Q A;  2WB1 G;  3HKS A;  2JA7 G;  1JOO A;  4X7C A;  1GR1 A;  2CBX A;  2ZTC A;  3I56 A;  1XE1 A;  4BBR G;  1JIC A;  3FVQ A;  3ASP A;  1QG7 A;  4JG2 A;  1NB0 A;  2A5H A;  4H13 C;  3CMM A;  4V19 0;  4RLZ A;  1KJZ A;  2VJJ A;  5E4X A;  3CD6 B;  1QG0 A;  5IYR A;  4LW1 A;  3G6J B;  5CR3 A;  3A5U A;  4KD3 A;  1F77 A;  3CTA A;  1CM9 A;  4RFB A;  2B7C A;  1K9M C;  4KKT A;  3VNV A;  1E24 A;  3GTK B;  5IP9 G;  4A3D B;  1S5E D;  2VY3 A;  4LC0 A;  4IFD H;  1VLY A;  4KKU A;  3AMU A;  1HNX L;  1G6Z A;  4Y9U A;  2UXB L;  2CQA A;  2RHS B;  5IY0 A;  2OT2 A;  2V7T A;  3QFT A;  1IB0 A;  3W1B A;  2GQF A;  3CPF A;  1XMQ Q;  1Q86 C;  3HOU B;  5C3X A;  2GPJ A;  2DY1 A;  2PNR C;  3Q6R A;  1D1K A;  3JC6 6;  4G57 A;  3CMA B;  4RJL A;  5BSX A;  1HUM A;  4LUV A;  1K0S A;  2A6E D;  1QUF A;  1BBU A;  1Q1B A;  3D3R A;  1J8I A;  5FO0 A;  4IAL A;  2VQF L;  2VQE L;  1MJC A;  5D65 A;  2F4V Q;  1H9M A;  4WOR A;  1II3 A;  2A6H C;  5HY6 A;  4M53 A;  3BY2 A;  4IPD A;  4ULL A;  3J80 L;  1FX0 A;  4QHY A;  4K2K A;  2L15 A;  3HOV B;  3BJU A;  3CC4 B;  1I4R A;  2IPK D;  4K5X A;  3JAM L;  2A68 D;  5HGQ A;  1WCM G;  1EY7 A;  4TMX A;  2DY7 A;  1Q8I A;  1WOC A;  3KF6 B;  4A3M G;  1E22 A;  3PQI A;  3VYU A;  5F4M A;  3D4D A;  4IOA A;  3AQQ A;  4FYD A;  4HMI A;  5K5P A;  1F9Q A;  1CSQ A;  4EQ5 A;  2Q6L A;  2LFN A;  1SNP A;  1JOR A;  2C5B A;  3D0F A;  1EWY A;  4RGO S;  4JPB W;  1S0U A;  1W35 A;  1MIU A;  4DV1 Q;  1N36 Q;  4DV4 L;  1N08 A;  1LTS D;  4C1N K;  5IYC H;  4LJZ C;  4AQY Q;  1EFT A;  1A8P A;  1EY5 A;  1GVH A;  1HA5 A;  3E1Y E;  4ZLT F;  4PC7 A;  4N9P A;  3DEO A;  1OXU A;  2RDG A;  4GS3 A;  3NBH B;  1BO0 A;  1X3P A;  3AVU A;  3RZO B;  4FWT A;  1OGI A;  1VQ8 A;  2KVO A;  2I07 B;  2XNA C;  1YVC A;  5IGG A;  2PQA A;  1EEF D;  2YWF A;  1QJO A;  2YWH A;  3G4S B;  1K83 B;  4EVO A;  4POF A;  3DHQ A;  1GUO A;  1BLI A;  2JA5 G;  4RM0 A;  1PTO D;  3DWQ A;  5TY0 A;  2RCN A;  4DV0 Q;  4DR3 L;  1JB7 A;  1HR0 L;  3NUC A;  4QFM A;  1I6V C;  4BS9 A;  4LF4 Q;  4LMQ D;  1VQL A;  4F88 A;  4BY7 B;  3MXN B;  1QE6 A;  1A63 A;  2EPB A;  1K8A C;  1IL8 A;  1TII D;  4IOC A;  3K5O A;  5EJW A;  2PW5 A;  1RCV D;  3ZC3 A;  5C4H A;  4RDJ A;  1B1Z A;  4R4I A;  5F4O A;  4GLX A;  2FMC A;  5J3B A;  2F0F A;  2NVX B;  3FEW X;  3HKZ B;  3A8K E;  3S24 A;  3KK7 A;  2OCE A;  3S1M H;  2F0G A;  2EYH A;  3A8K A;  1O7L A;  4Y9R A;  3G6E A;  2MNA A;  4QQB X;  1AW7 A;  1VQK A;  2XNC A;  1DM0 B;  3VR2 A;  5LHY 1;  2I46 A;  4XOT A;  1BKB A;  1UD6 A;  1QGY A;  1WOS A;  2OBT A;  2ZXH A;  1E63 A;  2AHO A;  3MEH A;  1COW A;  1KTK A;  1SE8 A;  3R93 A;  2RSO A;  2IX3 A;  4OO1 G;  3ES9 A;  2IX0 A;  4LBY A;  1TWF H;  3G6E B;  4HAE A;  1UWV A;  1FGB D;  3KBG A;  4A3B H;  1XNQ L;  1ZM3 A;  4DK0 A;  2EYJ A;  1NJI C;  1IYV A;  3KF6 A;  2C35 B;  4C3J H;  2N88 A;  2V7W A;  3GTQ H;  2D3L A;  1WTQ A;  2JJ2 A;  3I55 B;  4CDD C;  1SM4 A;  1VQ5 A;  2HDL A;  1WSR A;  2B39 A;  3NEL A;  1HPC A;  4Q5V A;  1STA A;  1W3S A;  3QJY A;  1ZKO A;  1CT1 D;  1HNX Q;  1PH5 A;  3J81 k;  2JA9 A;  2KJX A;  3ULP A;  2WIN B;  5I9O A;  5IGF A;  4ACA A;  3MC0 B;  1WOP A;  1OB0 A;  2Y0S B;  1S5F D;  1G2T A;  4XQQ A;  2E5L L;  4QVJ A;  2GRE A;  4DFA A;  1CKM A;  1YJN A;  3CCL A;  3SLN A;  1BBX C;  4KHZ A;  1RIP A;  4OXP A;  1L2F A;  1RTO A;  3PSI A;  4A3F B;  2YWG A;  1GHK A;  1H42 A;  1A2T A;  3T4A C;  5BN5 A;  2V31 A;  1SE4 A;  2N55 A;  3KLS X;  1B70 B;  5AJ3 Q;  3NXW A;  1A3T A;  3D4W A;  2X6G A;  3L3O C;  3HOX B;  4ZCK A;  4OOX A;  1KD1 D;  1JJG A;  3T1Y Q;  5J3O A;  3BS1 A;  2PO4 A;  5CV9 A;  2W6J A;  3PUV A;  2CK3 A;  1B53 A;  3OFN A;  5FKA C;  2WP8 J;  1SYG A;  1WSV A;  3HOY H;  5DM6 3;  2IHE A;  3OAA A;  1HZB A;  1G7C A;  1D5M C;  3HS0 C;  5E4W C;  1GUN A;  5IIF A;  1VQE A;  3V2T A;  2GVA A;  5M5W B;  5IE8 A;  1RQR A;  4WFN 3;  2UXD L;  3P75 A;  3CMA A;  4M4S A;  3KLW A;  3H0G H;  2QF7 A;  5JPN C;  5CBA E;  1JCK B;  5JJZ A;  1B2T A;  2KA7 A;  1P16 A;  1SXT A;  1MRZ A;  4X64 L;  4KKS A;  3SGI A;  4GZY C;  3A7L A;  4JV5 Q;  4J0Q A;  3HKZ E;  4JI6 Q;  1EOT A;  4P3Y A;  2JEA I;  1EOV A;  4XLC A;  3AB9 A;  1CQV A;  4YEJ A;  1TTT A;  1X3Q A;  3U6B A;  1QX4 A;  1PFN A;  5C4X B;  3FPK A;  3OIP A;  4K6D A;  2QTZ A;  5JEA G;  4Z4Y A;  3DLL A;  3MA2 B;  1TWC B;  1PH1 A;  3SJZ A;  2XOK A;  2IL8 A;  1NJI D;  4DR1 Q;  5CYU A;  4HIO A;  2JJ1 A;  2K5D A;  5CC4 A;  4C1N I;  1FNW A;  4I65 A;  4RD4 A;  1K28 D;  1Z47 A;  2NWG A;  1U4L A;  2B8G A;  3IFD A;  3MFY A;  5LMU Q;  3Q6Q A;  1OO9 B;  2F0K A;  3M3Y H;  3I55 A;  2F3V A;  3ASS A;  3PUX A;  2R7Z G;  3S1N H;  3GP7 A;  1S5D D;  1FDR A;  2TSS A;  4YHH Q;  1SNO A;  2F0W A;  2V7Q A;  4A3I G;  1KTV A;  4X07 A;  3BVZ A;  1GKH A;  3M4P A;  4M1K A;  2K5H A;  4AYB B;  5JVG 3;  1FL0 A;  1N8R D;  1GOZ A;  4RD1 A;  1FNU A;  1NSN S;  2QE7 A;  1QFJ A;  4OPV A;  1HFG A;  4X66 Q;  1I94 L;  2SEB D;  4BPR A;  4HJA A;  2KHS A;  3K7A B;  1KRH A;  3AST A;  3WOF A;  4HJ7 A;  2PE3 A;  1YBY A;  3IFT A;  2YU9 B;  2FMM A;  5NUC A;  2QMU A;  1D6E C;  4LF5 L;  3GTM H;  1ML0 D;  5IYQ A;  5M5X B;  1TT2 A;  1VQG A;  2R93 H;  5THX A;  2F0V A;  5DSZ A;  4IQZ A;  1HRJ A;  5IYW A;  3HAG A;  1B3A A;  1SFO B;  1CK1 A;  1CHQ D;  5DS0 A;  4G1B A;  4B9X A;  4IFD J;  2XNJ A;  2A1A A;  2NYZ D;  3I90 A;  2ZL5 A;  2VL6 A;  4HCS A;  1QUQ A;  2HCC A;  3DMU A;  2Q6K A;  1AEX A;  3PV0 A;  1K28 A;  2HCJ B;  5FK9 C;  4QVA A;  1A8V A;  1XNQ Q;  1NUC A;  3G7L A;  2A8V A;  4H44 C;  4DUZ L;  4IFD I;  2NB0 A;  4LFB L;  3SXH A;  3V05 A;  1QOH A;  3F2B A;  1ENC A;  3NWT A;  2MHV A;  1OB2 A;  4WRD A;  1R9T H;  3MXN A;  1EYC A;  4RPD A;  1GAQ A;  3MHP A;  3LGJ A;  4X65 Q;  2DER A;  3S17 H;  4JVZ A;  1NBM A;  3CME A;  2BGI A;  1CNE A;  4CKE A;  4EQO A;  3M4Q A;  2Z0S A;  2AQ1 B;  4YWM A;  2KCN A;  4C3J G;  3CPW B;  5IYD G;  4G4K A;  5E6T A;  4C3H G;  3OIQ A;  2R92 G;  3OZW A;  3HOZ G;  2QN6 A;  1KRT A;  3WWV A;  2ZJP A;  2B63 G;  3L7Z C;  4DF7 A;  2X6X A;  4K5V A;  1GUT A;  2LS0 1;  4AYB E;  1YNX A;  4DV1 L;  1JR0 D;  3PGZ A;  4KY5 A;  1PTO C;  3BQJ A;  4R9W A;  2F0P A;  4XMY A;  4PMC A;  1HHV A;  4P2N A;  3VYT A;  5DAU A;  3J7Z C;  3JAM i;  2EQS A;  1WTH A;  4LK1 C;  3RUZ A;  2ZZG A;  3VR5 A;  3MAQ A;  1E7Z A;  2F0J A;  3NE5 B;  4MHE A;  4ODG A;  1HNW Q;  2NPF A;  4H0L C;  4H7B A;  3OMC A;  3G71 A;  4QV2 A;  1HNZ Q;  1G7T A;  1VQH A;  2B2Y A;  2WAQ B;  5FNZ A;  3M7G A;  1WJJ A;  4PZ8 A;  4GLV B;  1E3X A;  2ZBV A;  3CW2 C;  1LUZ A;  2HQE A;  3CPX A;  2A6H D;  5EBC A;  1GO3 E;  1ILP A;  3NHH A;  1KIX A;  4CQJ A;  2JJQ A;  2RQX A;  1M1K C;  5G3L D;  3RLN A;  2PIA A;  4EGV A;  1DYQ A;  1BX0 A;  4KMU C;  5EBD A;  3R3O A;  4MTK A;  3U9O A;  1IXR A;  5TV2 A;  2OTL A;  4IPG A;  3M3Y B;  5EPL A;  4B9W A;  2WR8 A;  1H9K A;  1W9X A;  2I1L A;  1EU3 A;  1G91 A;  2BGJ A;  2PI2 E;  2QEX B;  5CDF A;  1NY4 A;  1XTC D;  3PO3 H;  3CC7 A;  3K7A H;  2Z6B A;  4YAU A;  3I7F A;  4FP5 D;  3Q23 A;  3J81 E;  2UUC L;  3QFR A;  1DOL A;  5DEH A;  3A35 A;  3SJP A;  5C0X G;  4RD0 A;  1QNU A;  4DXF A;  1NAP A;  4G7X A;  3U6K A;  3T13 A;  3KJP A;  2PPB C;  5M5Y B;  5C4X G;  2ZM6 Q;  1HTL D;  2AUJ D;  2Q2I A;  3J80 c;  3E0J A;  5IT9 E;  1Q46 A;  4A3C G;  1FNC A;  1JE5 A;  1PYS B;  3KF8 B;  4ILW A;  3VR6 A;  1SE2 A;  2VZL A;  2VYQ A;  3S14 B;  3RR5 A;  2XGJ A;  3LNN A;  1UD2 A;  3EJI A;  3H3V C;  2B2V A;  2BDO A;  2EZV A;  4XQF A;  2CVR A;  1N36 L;  2JA7 H;  1YNN D;  5COR A;  3PMF A;  5ELB A;  1F2Z A;  2D0P A;  1W6J A;  2CH4 A;  3JQQ A;  5C44 G;  2PNH A;  3KEW A;  2L9H A;  3U2Q A;  2JN9 A;  2DNC A;  1R9T B;  2YU9 H;  1LLR D;  3PIO A;  4DR1 L;  2IHF A;  3LO8 A;  1U9R A;  4PNY A;  4EQP A;  5C3E B;  3RZD B;  3CME B;  1SNC A;  2QDB A;  4RKB A;  3WOE A;  1BUV T;  3T51 B;  1V1P B;  4DNI A;  3NSW A;  4DAV A;  4RD6 A;  5J35 A;  2UU9 L;  4HIZ A;  2LSS A;  5C3W A;  3C1F A;  2FHT A;  3SK8 A;  3H3V I;  2F3W A;  2EIF A;  3R2I A;  2F4N A;  2B2W C;  1IL2 A;  1H8H A;  1PRT D;  2E76 C;  4MYT A;  2RC5 A;  4X7D A;  4BY1 H;  3AVW A;  4AQY L;  1YNN C;  4A3M B;  2GK7 A;  1VQ7 A;  2R6H A;  2XZP A;  3NK9 A;  2KEC A;  4R8N A;  1QZG A;  4XLH A;  4C3I B;  2F0U A;  3NBI A;  1D2B A;  4XQJ A;  1MKH A;  1EY6 A;  2KCC A;  1VQI A;  3ZZU A;  4HID A;  4DNR B;  5C4J H;  2ZTG A;  5CV7 A;  4BBS B;  4DR5 L;  3WY9 A;  5KGU A;  4PAA A;  2H5X A;  2SDF A;  1UD3 A;  4OIK A;  1CKO A;  3CW2 A;  1HXY D;  2Z8L A;  2W6I A;  4IUR A;  1HZE A;  3GVL A;  1CKN A;  3I70 A;  3J81 L;  4LF9 L;  3CRZ A;  3CCJ A;  2NVQ B;  4UPA A;  3DXJ C;  4WWV A;  3H09 A;  5CV6 A;  4JBK A;  4C2M H;  3I3C A;  3C2Q A;  3RLO A;  2OYN A;  2NVT H;  1PRT C;  1Q3L A;  1LTG D;  3ERQ A;  4P2C B;  2MFI A;  4FXK C;  5JEA H;  2OK7 A;  2N49 A;  5I6Y A;  3QOJ A;  4P74 A;  3K57 A;  5EKK A;  3PUY A;  2RKS A;  1EY8 A;  3ND9 A;  3MMP A;  4DPG A;  1G2S A;  3KFU A;  2LMC B;  2EYP A;  1KAW A;  3MWY W;  2ASB A;  1QNK A;  1Q8K A;  1SBB B;  3AVV A;  1SR3 A;  1VQM B;  3CHB D;  2IY5 B;  1V1Q A;  3PO3 B;  2OTJ B;  4QB4 A;  1STE A;  1E2W A;  4FXU A;  1E3P A;  2R7D A;  2WYR A;  4ZYS A;  4A3K G;  4A3L H;  3CCS B;  1CSP A;  2C9O A;  2F0I A;  1HJP A;  5KND A;  4HJ5 A;  2BH2 A;  1CQX A;  4WZK A;  2J0T D;  3EFX D;  4ABN A;  1OTC A;  4L5Q A;  2F03 A;  1WP6 A;  3PVD A;  4JI4 Q;  3A8J A;  1VQM A;  1EP3 B;  2NBF A;  3TBI B;  3V96 A;  1J5E L;  2O4X A;  4AYB G;  1NBW A;  4ZCM A;  1VF5 C;  1V8Q A;  4DV6 Q;  2KEN A;  1AP0 A;  2HDM A;  3E0E A;  2JA5 H;  1TY2 A;  1XXG A;  1Y69 U;  1H8E A;  1G7S A;  1XWE A;  4JI8 L;  1LT4 D;  2XZL A;  5J39 A;  3GTJ H;  2A69 D;  2G5D A;  4C0S A;  4PQX A;  1CZW A;  2JYO A;  4JI2 L;  1OGJ A;  3A74 A;  3GV6 A;  4JW0 A;  1QVF B;  1QWY A;  1DCZ A;  3CCU A;  4OIJ A;  4UY8 C;  3WNC A;  5JJI A;  1ENA A;  4B3F X;  1I94 Q;  4RA8 A;  4C3H H;  2X8K A;  1ELO A;  1V0F A;  2OEO A;  4Q0F A;  2R92 H;  2BCO A;  1IKM A;  2X0K A;  3BG3 A;  2B2U C;  2GVB A;  1VMP A;  3SK5 A;  2QCP X;  4JYA Q;  2D9U A;  4RD2 A;  1E2V A;  4UAI A;  5C0X H;  2R7F A;  1YNJ D;  3T53 B;  1WTV A;  3OW7 A;  4ZKC B;  3PUW A;  3Q8D A;  2KHI A;  1K8M A;  1T9H A;  1DD2 A;  1FR3 A;  1XX8 A;  4CBV A;  1STB A;  5C4X H;  3G4S A;  1H9R A;  2EJF C;  4ID6 A;  4F7D A;  2F0H A;  4O42 A;  1AMO A;  2K6A A;  4A3M H;  5ELC A;  4IZ8 A;  2E2I H;  4NXN L;  1OXS C;  5JJK A;  1VQ8 B;  3ZYY X;  1YHQ B;  3BCF A;  1XNR L;  1EUJ A;  2PMZ E;  3FMC A;  1UEA B;  4C3J B;  4ZKB B;  1GXD C;  1PV4 A;  1NTG A;  2E1R A;  1N34 Q;  3HOZ B;  4JI0 L;  4DUY Q;  4BA1 I;  1HNZ L;  3GQB A;  1VF7 A;  4K0K L;  3RZD H;  1PXU A;  2BM0 A;  1BXT A;  1D5X C;  4TSS A;  4CJ0 B;  4GNX C;  4GKJ Q;  1PH7 A;  3GTO B;  4L63 B;  3HOW H;  2J7K A;  1JA0 A;  1TLL A;  4YAW A;  4GKJ L;  1HA6 A;  4XIG S;  3D8G A;  2BM1 A;  3T16 A;  2ATW A;  3VDY A;  1F9S A;  1RD9 D;  1L1O C;  4A3J G;  3OW2 B;  3A1P A;  3HOX G;  3B78 A;  1BCP C;  1EFI D;  3K7U C;  3ONA B;  4Z4U A;  1F2M A;  2F0L A;  4AIM A;  2DJF C;  4XQN A;  1EL0 A;  4C43 A;  1CA5 A;  3ZBT A;  1YHB A;  3CKI B;  3K5N A;  3KL9 A;  4X64 Q;  4XOP A;  2F1M A;  2CRV A;  1AIP A;  3WNB A;  1U5K A;  3K0Y A;  4K6L A;  4LAA A;  1N32 L;  3CU7 A;  5IK2 A;  4QGU A;  3WND A;  1RQP A;  2DCU A;  1VQK B;  1SYE A;  4KY6 A;  3S9W A;  1IBL L;  2J7Z A;  4IUP A;  4S3S A;  4XL9 A;  5EMN A;  4AC9 A;  3KOJ A;  5KNB A;  4UHV A;  4DK1 A;  2IT1 A;  1WVL A;  2MP1 A;  4KV6 A;  2NVQ H;  1FVI A;  4FK8 A;  1A62 A;  2R6G A;  4UDU C;  4A3D H;  3W2I A;  1WPC A;  2B2T A;  1JJ2 A;  3IAY A;  3A3G A;  3FDT A;  1AZQ A;  4HJ8 A;  3PO2 H;  4C2M B;  1A3U A;  1O78 A;  3NTI A;  5I6W A;  1MGS A;  3I4M H;  2L0C A;  1Y1V B;  3CCM A;  3CCU B;  1L1O B;  3J7Y W;  4M0L A;  4JI5 Q;  3W5U A;  1K3R A;  4RH6 A;  1HVX A;  3OPO A;  4N3G A;  5DNF A;  4LWC A;  3DEP A;  5KYL A;  2V7V A;  1JE4 A;  5IOD A;  3F2C A;  4G7O C;  2VXW A;  3GTP H;  2D3N A;  1I18 A;  2MPM A;  4FDB A;  1EIH A;  4OX9 L;  3UDI A;  4B44 A;  2YYZ A;  5BR8 L;  1YI2 A;  3KLS A;  3I56 B;  1VMC A;  4KJN A;  1TWC H;  2BF4 A;  2XEX A;  5C44 H;  4LF9 Q;  1ET9 A;  1TXY A;  3RN5 A;  2N78 A;  1N8R C;  1KHI A;  4A3L G;  2LZJ A;  1D2E A;  1HA3 A;  3I4O A;  3K5L A;  2HDN B;  3OMG A;  4Z4V A;  5LL6 S;  2B2Y C;  1FNV A;  4DK3 C;  4JI8 Q;  1KNE A;  1EIF A;  3CCS A;  1I50 H;  1VQO A;  2DGY A;  2GK6 A;  1VLO A;  4UAJ A;  1B9N A;  3TDQ A;  2UUA Q;  3W5H A;  4RPB A;  1TWA H;  2OF1 A;  2DN8 A;  3EQL C;  4PC1 A;  1PZK D;  2JA6 G;  2E2H B;  3STB C;  3MTS A;  4DR4 Q;  2B3G A;  2F43 A;  3I4N H;  1E1R A;  4WZE A;  5IWA Q;  3NQI A;  4B3T Q;  1H95 A;  1RKN A;  1NR2 A;  4JYA L;  3TN2 A;  3SKB A;  1T5E A;  3BNW A;  1J6Q A;  3G48 A;  2EXZ A;  4XYO A;  3TP6 A;  4KHP L;  3A8I E;  1CFM A;  3A56 A;  2LY7 A;  1EWI A;  1SAP A;  1EYA A;  3GTL B;  4NB3 A;  1MJE A;  3HOU H;  4PC6 A;  2Z4I A;  1GVP A;  2R93 G;  1WTX A;  4DN4 M;  2F0S A;  3OP1 A;  3LQE A;  1P8L A;  2DET A;  2HUG A;  1BX1 A;  4CDF C;  2Z6K A;  5CMD A;  4LFB Q;  2H1E A;  3B82 A;  4PZ6 A;  3MZ5 A;  4RHS A;  1TS2 A;  2JP1 A;  4YHH L;  4BBS G;  5COY A;  4IN3 A;  5ELO A;  5J1Z A;  5KIX A;  3T1H Q;  2C5C A;  2L1B A;  3V76 A;  2XIW A;  1SND A;  5AJ3 L;  3I2Z A;  5IYN A;  2JEB I;  3HGB A;  1NDH A;  3S14 H;  4HR7 B;  3VYS A;  1NB9 A;  3CRL C;  3O13 A;  4YCV A;  1I6H B;  2UUB Q;  3CCQ A;  3TZD A;  2ZIT A;  1B44 D;  4DU9 A;  2NVY B;  3F2D A;  3TS0 A;  3PIO 3;  1EQR A;  1SKY B;  3M9B A;  4ZK9 B;  4RGN A;  2XVS A;  2ZXO A;  4LF6 Q;  1LTI D;  3GO5 A;  5ELF A;  1PFS A;  1Q82 C;  1VQF A;  1O7Z A;  1QFZ A;  2GJP A;  1DOM A;  3K6O A;  3QSY A;  5CV5 A;  4DGZ A;  5FO7 B;  2WAQ G;  4U67 3;  3SDZ A;  4EH1 A;  5M3M G;  5IOC A;  1NR4 A;  4ME5 A;  1Y1W H;  4FN5 A;  2DEU A;  3QWN A;  4XKV A;  3K0X A;  1WYD A;  4NW2 A;  1R5O A;  3QR8 A;  1QUQ B;  1F9R A;  4TRD A;  2XWB B;  1F2Y A;  2ES2 A;  2IJ0 A;  4DV4 Q;  5EKL A;  1Y14 B;  4OX9 Q;  2PW7 A;  5JEA J;  4R4C A;  1TWH H;  1IJF A;  2F0O A;  2KVM A;  3AVT A;  4TQU S;  4TSF A;  1HZ9 A;  2F4I A;  4R4O A;  2AUK A;  4B3S Q;  4U68 A;  3R6J A;  3HEJ A;  4C3I H;  5IGD A;  4LF8 Q;  5M3F H;  4B47 A;  4QUF A;  5C0X J;  4IJH A;  1E79 A;  3ZBU A;  3PCO B;  1ILQ A;  3OTO Q;  3F2U A;  3ERS X;  2NZO A;  3PF4 A;  3C2P A;  1BBW A;  2J4X A;  1ZUN B;  2R3Z A;  3MHB A;  4RWS C;  1KQS B;  4DV5 Q;  1Y1V H;  4L6T B;  1SYC A;  3BZC A;  4KHP Q;  3GIR A;  4LUO A;  3BH4 A;  1XMO L;  2CW0 C;  1B3Q A;  4XLE A;  1OXT A;  1A3V A;  4DAP A;  1ZYR C;  5HZA A;  2ZTN A;  1ICW A;  2L4N A;  1BVS A;  2WII B;  5CV4 A;  5HKK A;  3TRE A;  4A3E G;  4IJL A;  4UP9 A;  3ZUG A;  1SMY C;  2VS1 A;  4JI3 Q;  1WD1 A;  2K50 A;  1B9M A;  2NVT B;  3OEE A;  3HP3 A;  5IT9 L;  1ASZ A;  3CCL B;  4G7W A;  2K5N A;  3ASQ A;  1BR9 A;  2JN4 A;  1LM0 A;  2PMZ B;  5IYD H;  1D7Q A;  1PTO B;  1GUG A;  1N0U A;  2VBT A;  2GN5 A;  1JQY D;  4Q7J B;  4YIJ A;  1PVO A;  4XT1 B;  3U4Z A;  4NXM Q;  2AQ2 B;  1PZI D;  4C56 C;  4P1V A;  3HOX H;  2YTY A;  5B6I A;  1N07 A;  1DJR D;  1I4X A;  1IBK Q;  5C5L A;  3E6Z X;  4TMZ A;  2EOT A;  5ELE A;  2H4O A;  1VQP A;  1SYF A;  4G7H C;  1T6Z A;  1EEI D;  3DWP A;  4P6V F;  3UDX A;  3PUN A;  4TMV A;  1UE5 A;  1X3F A;  2MUY A;  1SMY D;  1WTW A;  4BXX G;  2E2H H;  4YCW A;  4JBM A;  1E64 A;  1XFO A;  2CWP A;  2QA4 A;  3FJO A;  2VUM G;  3J7A V;  4OHJ A;  1H9J A;  3M4O B;  1XPO A;  1VQO B;  4K2L A;  3Q22 A;  2VNJ A;  3EN2 A;  4L8J A;  5BN4 A;  1I6H H;  3TME A;  4RCY A;  5H5J A;  4ASU A;  1T6Y A;  3MEF A;  1QGZ A;  5KEE A;  3I4N G;  3CCV A;  4QUC A;  2F0Q A;  4RG1 A;  4B3M L;  4M8A A;  5D3D A;  3HOV G;  4DQL A;  1FRQ A;  4FF4 A;  3I4M G;  3J81 j;  1PA6 A;  1ASY A;  1W2B B;  2PQA B;  2WPD A;  5EPK A;  5IT9 c;  3ONU A;  1JA1 A;  5EGT A;  5I2X A;  1U4R A;  3P1H A;  4A3G B;  1LAC A;  1X3E A;  5A35 A;  2QEX A;  4A75 A;  2X3U A;  2K7V A;  2BA1 A;  4LF7 L;  4N8X 1;  1Y0R A;  4LFA Q;  4WQM A;  3S15 H;  1VQL B;  3W2F A;  2C5H A;  2BE5 C;  3E9H A;  1KZL A;  4IO9 A;  5IYB H;  1VHO A;  1SNQ A;  1EIG A;  2MJ8 A;  2VBV A;  3K59 A;  4B48 A;  1WD0 A;  1KK3 A;  2CF4 A;  4ZGN B;  3BU2 A;  2AHO B;  2NVY H;  3CCM B;  2Z4H A;  2B7B A;  1WU8 A;  3W2E A;  2OTJ A;  2ZTD A;  4YY3 L;  3QO2 A;  2KEE A;  4XXE A;  4OGQ C;  3ER0 A;  5DM7 3;  1NNX A;  1A2U A;  4NNJ A;  4OWX B;  1JOQ A;  1BMF A;  2HIV A;  1N0V C;  4N9T A;  1C0A A;  3HOZ H;  3CF5 A;  5F2D A;  5E7N A;  1O7I A;  3HOY B;  3CES A;  4HED A;  2DIE A;  4F8M A;  5BN3 A;  3TP5 A;  3CCR B;  2EY6 A;  2F52 A;  3OZU A;  4RHR A;  2B2W A;  3GTO H;  3S2D B;  3D6C A;  1QZH A;  4IFD G;  1I3Q H;  3H6M A;  1QH0 A;  3CC2 A;  3K8A A;  2YTX A;  1JWS D;  5A8A A;  1EYG A;  1D5Z C;  4B3R L;  1MBY A;  3B6Y A;  3OJX A; 
#chains in the Genus database with same CATH homology
 4XT3 B;  1K8O A;  2PCF B;  3Q6S A;  3TSS A;  1IW7 C;  1KDB A;  3MXU A;  3HRZ C;  4RGT A;  1OHH A;  1TVX A;  3N6R A;  1S4Z A;  1TS4 A;  2XSC A;  3C46 A;  1ROD A;  1KAB A;  2RDF A;  1V43 A;  2MGS A;  4J6H A;  2B8F A;  3D6W A;  2K01 A;  1MD2 D;  2DY8 A;  2WKC A;  1HFN A;  1PDQ A;  2PZU A;  1PRT B;  2RBM A;  2HLD A;  3OWF A;  2JE6 I;  3A8J E;  2SNM A;  1IKL A;  4KN7 C;  4ZRZ A;  3NWS A;  1HCZ A;  2AQ3 B;  1JWU D;  1UUP A;  1J9O A;  2NTT A;  2Z1C A;  3I4L A;  3GTP B;  4TKO B;  2R9V A;  2XRS D;  3NP8 A;  4MN3 A;  1UD5 A;  2D62 A;  4NMZ A;  1KLU D;  3GVJ A;  2VNU D;  3BYY B;  4OO1 H;  3CP2 A;  1KDC A;  1EFR A;  4MIU A;  1GUW A;  1GHJ A;  4RKL A;  3QIA A;  3SE0 A;  4A3B B;  1T5X D;  3H91 A;  3IL8 A;  1VJS A;  1OXV A;  1JOK A;  1I4G A;  2ZZQ A;  1V1O A;  1PZJ D;  2EE1 A;  2Z6B D;  4XDX A;  1ENF A;  3TP8 A;  3FPP A;  3D31 A;  2RVL A;  1Y8N B;  5G3L F;  1JC7 A;  2FFK B;  1OXX K;  2ICE C;  1R4Q B;  3DWA A;  5HUR A;  5M9O A;  3QG1 A;  1QIL A;  1SYB A;  1BNZ A;  1LAB A;  2X69 A;  3IKJ A;  1C8C A;  1VDZ A;  3FKS A;  4HSV A;  1JWM D;  2WV6 D;  1IW7 D;  5E3F A;  3X3N A;  2WAC A;  4P22 A;  4HMJ A;  3FRP B;  5KYI A;  3ERO A;  1CA6 A;  4AVZ A;  4KI0 A;  4FF1 A;  2PQE A;  2GJR A;  1EZ6 A;  4Z1M A;  4FVM A;  4K14 A;  3GV3 A;  1DZ1 A;  3RMH A;  5EPJ A;  1SJH D;  1UD4 A;  2A74 C;  4A3E B;  4FF2 A;  4TT3 A;  1U4M A;  4DNT B;  1RHP A;  2ZT9 C;  2JA6 B;  4XM3 A;  3AU7 A;  1TWG B;  1TWH B;  2XZO A;  5FLX L;  2R7Z B;  2M00 A;  3MVV A;  1BF4 A;  3VA7 A;  1I50 B;  1HQM C;  5LL6 X;  3A54 A;  3PUZ A;  4O1N A;  1WTO A;  3P7J A;  2PYK A;  3UI2 A;  2L5T A;  1FD7 D;  5EKI A;  2KUM A;  2K5W A;  1STH A;  4YEL A;  1JB3 A;  1PFB A;  2NTS A;  2GJK A;  1NRK A;  1BPL A;  4RCN A;  4F87 A;  4NDX A;  4DAY A;  5KNC A;  4XR6 A;  2B63 B;  1ONL A;  5T1I A;  3JU4 A;  2ZXI A;  2NN6 G;  3NTK A;  4K8I A;  1IYU A;  3TZU A;  1SNM A;  2K04 A;  2JA5 B;  4IUU A;  1BCP D;  1E43 A;  4PMB A;  4WJW A;  3H94 A;  2EJG C;  3GTJ B;  3P20 A;  2E2J B;  4CKB A;  5K36 G;  5D3I B;  2NN6 I;  2F0N A;  2DNE A;  3S17 B;  5I9P A;  3I72 A;  4E0F A;  1EZ8 A;  3GTG B;  1BCP B;  1STN A;  3U9S A;  1KLG D;  1PLF A;  5A2Q E;  1E1Q A;  4IUV A;  2ZXP A;  3SEB A;  5KRU A;  4F7X A;  5IGC A;  3BDO A;  4A3I B;  2QEJ C;  4KN4 C;  1KMH A;  2O5J C;  4V0B A;  2O5I C;  4X3T A;  4A3K B;  4CJ2 C;  4ZAI A;  1EQV A;  2FIN B;  3I73 A;  2R61 A;  2OXP A;  3ZIA A;  2BA0 A;  5J22 A;  3HOW B;  4J8Q A;  1CI3 M;  3R2T A;  2EVB A;  2ZZF A;  4KJO A;  4YXW A;  1EY0 A;  1X32 A;  1PTO H;  2R92 B;  1HQR D;  5CBE E;  4JBW A;  3OWE B;  4HCE A;  1D1I A;  2VUM B;  3M7N A;  2M9V A;  4JMQ A;  3KBX A;  2L11 A;  2E75 C;  3E5S A;  3VR3 A;  5C44 B;  3W3A A;  3S1R B;  3D4R A;  3I4M B;  2JIZ A;  3FPU B;  4NKL A;  4PV1 C;  2K5Q A;  4R8I A;  2BE5 D;  3S2H B;  5AFW A;  2K33 A;  2QKI C;  5CGK A;  3I91 A;  3QOL A;  4XKW A;  1TWA B;  4J1M A;  5IGE A;  4UZU A;  2GA4 B;  4XOR A;  3MXP A;  3WDN A;  3OE7 A;  4NP5 A;  3H0G B;  2E2D C;  4CGY B;  2SNS A;  4C3I G;  3LWE A;  3NPP A;  1KAA A;  1Y8O B;  4QCL A;  1ET6 A;  3K5M A;  5C4Z A;  5DN6 A;  5C0X I;  3OSO A;  1NCV A;  4BY1 B;  4X3K A;  4I7Z C;  2L55 A;  2SOB A;  2HCI A;  5ISR A;  1U4P A;  4RGM A;  4IUQ A;  4ZUJ A;  5C4J B;  3BVG A;  3W2D A;  2EY1 A;  1LO5 D;  4FXD A;  1S5B D;  5EQ0 A;  1KNA A;  2KOL A;  3ZPN A;  1C48 A;  1I8D A;  1EWC A;  1AN8 A;  1A6X A;  1B4O A;  2Q8R E;  3BZD B;  1EQT A;  3PIP 3;  4JK1 C;  4K5W A;  1F2L A;  1WTH D;  1Y1W B;  2O2L D;  1DXM A;  3S1Q B;  2ENB A;  4IUT A;  1PYW D;  4IUN A;  3C1E A;  2WB1 B;  3Q24 A;  1EU4 A;  2K1B A;  2D5D A;  1PMR A;  5I4D A;  4FO2 A;  4CKC A;  2XND A;  1LT3 D;  2NUC A;  2K32 A;  2ID0 A;  4II2 A;  4RAU C;  2KED A;  3M85 A;  3BDC A;  5E1F A;  1GJX A;  4XLA A;  4B08 A;  4HSP A;  3N52 A;  2JA8 B;  2CW0 D;  1SSO A;  1O7Y A;  4B3G A;  1STY A;  5FLX E;  1TS5 A;  3I8Z A;  4XN0 A;  5FO9 B;  1I4Q A;  3TP7 A;  2EYL A;  5JPM C;  1E3Z A;  1Q1E A;  5TSS A;  1F9P A;  2D2C C;  2X53 S;  3RD4 A;  3GTM B;  2E74 C;  2R93 B;  1G8Z D;  1SEB D;  2NZ1 D;  4EQN A;  1M8A A;  4A3J B;  4BWG B;  3HG9 A;  1AFP A;  1M4V A;  1V0E A;  1ESR A;  5T1G A;  1AZP A;  3S1N B;  2X6W A;  2KQ3 A;  2K03 A;  1TR5 A;  1ZEQ X;  5A2Q L;  1LTT D;  1LT6 D;  1V1P A;  4X3S A;  1ZXT A;  1I4P A;  4XON A;  3CRK C;  3GVK A;  4XLF A;  1W0K A;  2EYF A;  1EY4 A;  4XNF A;  1EYD A;  3A3B A;  2Q8T A;  3LWU A;  1L0X B;  5FL7 A;  1HTP A;  1XYI A;  2VJI A;  2PZW A;  1RTN A;  4OL7 A;  1KDA A;  1H9S B;  5CV8 A;  4CHT B;  3BYT B;  5FOB B;  3RLF A;  2ICI A;  3X3M A;  1LTR D;  1PTO F;  2PZT A;  3BDL A;  1Q12 A;  1TWF B;  2EY2 A;  2JXM B;  2F0E A;  1DOK A;  3R8B A;  1MSH A;  3BVM A;  3KUP A;  1CTM A;  4RCO A;  5D14 A;  4FXG C;  1W0J A;  1Z7T A;  4Z9C B;  4BBR B;  1E2Z A;  2IX1 A;  4XTC S;  3A7A B;  4E6I A;  2EJM A;  4K8J A;  4G7Z C;  3OHX C;  2WJV A;  1O80 A;  1TS3 A;  4X3U A;  2M2L A;  1BQQ T;  4CJ1 B;  2XN9 C;  1EWH A;  1IHZ A;  3L9A X;  2WZP P;  2ZZE A;  1UAP A;  1STG A;  1WCM B;  4KK7 A;  4QMG A;  4M1U B;  1ESF A;  1YNJ C;  2JSO A;  3KF8 A;  1SDF A;  1A15 A;  2RDH A;  1RJT A;  4XYQ A;  1G29 1;  1WTR A;  1MAB A;  1LT5 D;  2AWO A;  1I3Q B;  2F0T A;  1SE3 A;  1PRT F;  2ZXR A;  1SJE D;  1TKW B;  1VCI A;  1Y8P B;  2G9H D;  1MI2 A;  2IW3 A;  1BOS A;  1LV9 A;  1CZG A;  3G05 A;  4OO1 I;  5JOB A;  4XD7 A;  3I4N B;  4PMW A;  3S1M B;  1W6K A;  1WTP A;  4Y7N B;  2WJY A;  5FO8 B;  2XRQ D;  1S5C D;  2EYO A;  2TMP A;  1TQO A;  3SK6 A;  4HN7 A;  3S15 B;  1BCP F;  4KY7 A;  3URY A;  1LTA D;  2JA7 B;  1HUN A;  2A69 C;  3SHL A;  1Q90 A;  2F0M A;  3FKI B;  1QCB D;  3GTQ B;  1PFM A;  3A55 A;  2IWH A;  3NQT A;  1GUS A;  3J7A F;  2FJ2 A;  1FYC A;  3OEH A;  5K36 H;  1I4H A;  3ITP A;  5KNL A;  2EDG A;  2A68 C;  2G9D A;  3DM1 A;  2B2T C;  3JAM E;  2QIL A;  3KLR A;  1RF2 D;  1MSG A;  3QB3 A;  3J80 E;  2Q8I B;  1QB5 D;  1SYD A;  4ZUI A;  3EA6 A;  2B2U A;  2BOS A;  2JDI A;  2B2V C;  2EYM A;  3C3L A;  4QIW B;  3MFG A;  4DXG A;  5HGT A;  1EY9 A;  1H9S A;  3ND8 A;  1CHP D;  2VB3 X;  3CP8 A;  4KHV A;  1PKV A;  5C5M A;  1TY0 A;  2M5S A;  2X85 A;  2K05 A;  4FF3 A;  3WQZ A;  2NN6 H;  1UD8 A;  2K28 A;  2XWJ B;  4QF4 A;  5JAV A;  3Q0A A;  2E1B A;  2WSS A;  4KD4 A;  3M4Y A;  3SR1 A;  3OOC A;  4A93 B;  2CHB D;  3VA5 A;  5ELD A;  2X6Y A;  1TU2 B;  3S16 B;  2A73 B;  1Z6H A;  4GQN A;  5IGB A;  1L0Y B;  4KTA A;  1RDP D;  3K58 A;  5JVH 3;  3EVQ A;  1R4P B;  3VYR A;  1E0B A;  1DON A;  3SK4 A;  2WKD A;  3DUZ A;  2RSN A;  2AWN A;  5M3F B;  4C3H B;  2EY5 A;  4II3 A;  3MXG A;  2RA4 A;  5M3M B;  1BDO A;  3BC9 A;  3PO2 B;  2E2I B;  1B50 A;  2F0D A;  4DA2 A;  3HZX A;  3DDY A;  3SVM A;  4XN3 A;  5I2Y A;  3NTH A;  3CQZ B;  2L12 A;  1CQF A;  3LX0 A;  4G6I A;  3NBH A;  1ZYR D;  3GD7 A;  4FNF A;  4HTH A;  3VR4 A;  5C6A A;  3BCD A;  4BA2 I;  1LTB D;  3T56 B;  2V4D A;  2BDN A;  4ZQ3 A;  2A6E C;  2VB2 X;  2X6L A;  2LKV A;  1C4Q A;  1JOO A;  1JIC A;  3FVQ A;  1QG7 A;  2A5H A;  4H13 C;  3CMM A;  4V19 0;  2VJJ A;  5E4X A;  5CR3 A;  3G6J B;  4KD3 A;  1F77 A;  1CM9 A;  4RFB A;  4KKT A;  4A3D B;  3GTK B;  1S5E D;  4IFD H;  1VLY A;  4KKU A;  3AMU A;  1G6Z A;  2CQA A;  2OT2 A;  3HOU B;  5C3X A;  2PNR C;  1D1K A;  4G57 A;  1HUM A;  2A6E D;  1Q1B A;  3D3R A;  1J8I A;  4IAL A;  5D65 A;  1H9M A;  4WOR A;  1II3 A;  2A6H C;  4ULL A;  3J80 L;  1FX0 A;  4K2K A;  3HOV B;  1I4R A;  2IPK D;  4K5X A;  3JAM L;  2A68 D;  1EY7 A;  2DY7 A;  1Q8I A;  3VYU A;  3D4D A;  4FYD A;  4HMI A;  5K5P A;  1F9Q A;  2LFN A;  1SNP A;  1JOR A;  4RGO S;  1LTS D;  4C1N K;  4LJZ C;  1EY5 A;  4ZLT F;  1HA5 A;  4N9P A;  3DEO A;  1OXU A;  2RDG A;  1BO0 A;  1X3P A;  3RZO B;  2KVO A;  2I07 B;  2XNA C;  5IGG A;  1EEF D;  1QJO A;  1K83 B;  4EVO A;  3DHQ A;  1GUO A;  1BLI A;  1PTO D;  3DWQ A;  3NUC A;  1I6V C;  4BS9 A;  4LMQ D;  4F88 A;  4BY7 B;  1QE6 A;  2EPB A;  1IL8 A;  1TII D;  3K5O A;  5EJW A;  2PW5 A;  1RCV D;  5C4H A;  1B1Z A;  2FMC A;  2F0F A;  2NVX B;  3FEW X;  3HKZ B;  3A8K E;  3KK7 A;  2F0G A;  2EYH A;  1O7L A;  1AW7 A;  3VR2 A;  1DM0 B;  5LHY 1;  2I46 A;  4XOT A;  1UD6 A;  2ZXH A;  3MEH A;  1COW A;  1KTK A;  3R93 A;  2RSO A;  2IX3 A;  4OO1 G;  2IX0 A;  4HAE A;  1FGB D;  3KBG A;  4DK0 A;  2EYJ A;  1IYV A;  2N88 A;  2D3L A;  1WTQ A;  2JJ2 A;  2HDL A;  2B39 A;  4Q5V A;  1HPC A;  1STA A;  3QJY A;  1ZKO A;  1CT1 D;  2KJX A;  2WIN B;  5I9O A;  5IGF A;  3MC0 B;  1OB0 A;  2Y0S B;  1S5F D;  1G2T A;  4XQQ A;  4DFA A;  1BBX C;  4KHZ A;  1RTO A;  1GHK A;  4A3F B;  1A2T A;  3T4A C;  5BN5 A;  2V31 A;  1SE4 A;  2N55 A;  3KLS X;  3NXW A;  1A3T A;  3D4W A;  2X6G A;  3L3O C;  3HOX B;  3BS1 A;  2PO4 A;  5CV9 A;  2W6J A;  3PUV A;  2CK3 A;  1B53 A;  3OFN A;  5FKA C;  2WP8 J;  1SYG A;  5DM6 3;  3OAA A;  1D5M C;  3HS0 C;  5E4W C;  1GUN A;  5IIF A;  3V2T A;  5M5W B;  4WFN 3;  3P75 A;  5JPN C;  2QF7 A;  1B2T A;  5CBA E;  1JCK B;  5JJZ A;  2KA7 A;  1SXT A;  4KKS A;  4GZY C;  3A7L A;  1EOT A;  2JEA I;  3AB9 A;  4XLC A;  1CQV A;  4YEJ A;  1X3Q A;  1PFN A;  5C4X B;  3OIP A;  4K6D A;  5JEA G;  3MA2 B;  1TWC B;  2XOK A;  2IL8 A;  5CYU A;  2JJ1 A;  5CC4 A;  2K5D A;  4C1N I;  1FNW A;  4I65 A;  1K28 D;  1Z47 A;  2NWG A;  1U4L A;  2B8G A;  3IFD A;  3MFY A;  1OO9 B;  2F0K A;  2F3V A;  3PUX A;  3GP7 A;  1S5D D;  2TSS A;  1SNO A;  2F0W A;  2V7Q A;  3BVZ A;  5JVG 3;  4AYB B;  1GOZ A;  1FNU A;  1NSN S;  2QE7 A;  1HFG A;  2SEB D;  2KHS A;  3K7A B;  3WOF A;  3IFT A;  2YU9 B;  2FMM A;  5NUC A;  1D6E C;  1ML0 D;  5M5X B;  1TT2 A;  2F0V A;  4IQZ A;  1HRJ A;  1B3A A;  3HAG A;  1SFO B;  1CK1 A;  1CHQ D;  4B9X A;  4IFD J;  2NYZ D;  3I90 A;  4HCS A;  2HCC A;  3DMU A;  1AEX A;  3PV0 A;  5FK9 C;  1NUC A;  3G7L A;  4H44 C;  4IFD I;  2NB0 A;  3SXH A;  3V05 A;  1QOH A;  1ENC A;  3NWT A;  2MHV A;  4WRD A;  3MXN A;  1EYC A;  1NBM A;  4CKE A;  4EQO A;  2AQ1 B;  2KCN A;  4C3J G;  4G4K A;  4C3H G;  3OIQ A;  3L7Z C;  4DF7 A;  2X6X A;  4K5V A;  1GUT A;  2LS0 1;  1JR0 D;  4KY5 A;  1PTO C;  4R9W A;  2F0P A;  4XMY A;  4PMC A;  1HHV A;  3VYT A;  5DAU A;  4LK1 C;  3RUZ A;  2ZZG A;  3VR5 A;  3MAQ A;  2F0J A;  3NE5 B;  4MHE A;  4ODG A;  4H0L C;  4H7B A;  3OMC A;  2B2Y A;  2WAQ B;  3M7G A;  1E3X A;  2HQE A;  2A6H D;  5EBC A;  1ILP A;  3NHH A;  2RQX A;  5G3L D;  4EGV A;  1DYQ A;  4KMU C;  5EBD A;  3R3O A;  3U9O A;  3M3Y B;  5EPL A;  4B9W A;  1H9K A;  1W9X A;  1EU3 A;  1G91 A;  5CDF A;  1XTC D;  4FP5 D;  3Q23 A;  3J81 E;  1DOL A;  5DEH A;  3A35 A;  5C0X G;  1QNU A;  4DXF A;  1NAP A;  4G7X A;  3T13 A;  2PPB C;  5M5Y B;  1HTL D;  2AUJ D;  3E0J A;  5IT9 E;  4ILW A;  3VR6 A;  1SE2 A;  3S14 B;  2XGJ A;  3LNN A;  1UD2 A;  3EJI A;  3H3V C;  2B2V A;  2BDO A;  2EZV A;  4XQF A;  2CVR A;  1YNN D;  5COR A;  3PMF A;  5ELB A;  1F2Z A;  1W6J A;  3KEW A;  2L9H A;  2DNC A;  1R9T B;  1LLR D;  1U9R A;  4PNY A;  4EQP A;  5C3E B;  3RZD B;  4RKB A;  1SNC A;  2QDB A;  3WOE A;  1BUV T;  3T51 B;  1V1P B;  3NSW A;  4DAV A;  4HIZ A;  5C3W A;  3C1F A;  2FHT A;  3SK8 A;  2F3W A;  3R2I A;  2B2W C;  1H8H A;  1PRT D;  2E76 C;  1YNN C;  4A3M B;  2GK7 A;  2XZP A;  3NK9 A;  2KEC A;  4R8N A;  1D2B A;  4C3I B;  4XLH A;  2F0U A;  3NBI A;  4XQJ A;  1EY6 A;  2KCC A;  4DNR B;  2ZTG A;  5CV7 A;  4BBS B;  5KGU A;  2SDF A;  1UD3 A;  4OIK A;  1HXY D;  2Z8L A;  2W6I A;  4IUR A;  1HZE A;  3GVL A;  3I70 A;  3J81 L;  2NVQ B;  3DXJ C;  3H09 A;  5CV6 A;  3I3C A;  1PRT C;  1Q3L A;  1LTG D;  3ERQ A;  4P2C B;  4FXK C;  5JEA H;  5I6Y A;  3QOJ A;  3K57 A;  5EKK A;  3PUY A;  2RKS A;  1EY8 A;  3ND9 A;  1G2S A;  2LMC B;  2EYP A;  3MWY W;  1QNK A;  1SBB B;  3CHB D;  3PO3 B;  4QB4 A;  1STE A;  1E2W A;  4FXU A;  4ZYS A;  2C9O A;  2F0I A;  5KND A;  2J0T D;  3EFX D;  4ABN A;  2F03 A;  1WP6 A;  2NBF A;  3TBI B;  3V96 A;  2O4X A;  1VF5 C;  1V8Q A;  1AP0 A;  2HDM A;  1TY2 A;  1XXG A;  1Y69 U;  1H8E A;  1XWE A;  1LT4 D;  2XZL A;  5J39 A;  2A69 D;  4PQX A;  1CZW A;  2JYO A;  3GV6 A;  1QWY A;  1DCZ A;  4OIJ A;  1ENA A;  4B3F X;  4RA8 A;  2X8K A;  1V0F A;  4Q0F A;  2OEO A;  2BCO A;  1IKM A;  3BG3 A;  2B2U C;  1VMP A;  3SK5 A;  2QCP X;  2D9U A;  1E2V A;  4UAI A;  5C0X H;  1YNJ D;  3T53 B;  1WTV A;  3OW7 A;  4ZKC B;  3PUW A;  1K8M A;  1DD2 A;  1FR3 A;  1XX8 A;  4CBV A;  1STB A;  1H9R A;  2EJF C;  4ID6 A;  2F0H A;  4O42 A;  2K6A A;  5ELC A;  4IZ8 A;  1OXS C;  3ZYY X;  3BCF A;  3FMC A;  1UEA B;  4C3J B;  4ZKB B;  1GXD C;  3HOZ B;  4BA1 I;  3GQB A;  1VF7 A;  1PXU A;  1BXT A;  1D5X C;  4TSS A;  4CJ0 B;  3GTO B;  4L63 B;  1HA6 A;  4XIG S;  3D8G A;  3T16 A;  1F9S A;  1RD9 D;  1BCP C;  1EFI D;  3ONA B;  1F2M A;  2F0L A;  4XQN A;  1EL0 A;  1CA5 A;  3K5N A;  3CKI B;  4XOP A;  2F1M A;  3K0Y A;  4K6L A;  4LAA A;  3CU7 A;  5IK2 A;  4KY6 A;  1SYE A;  3S9W A;  2J7Z A;  4IUP A;  4S3S A;  4XL9 A;  5KNB A;  4DK1 A;  2IT1 A;  1WVL A;  2MP1 A;  4KV6 A;  2R6G A;  4UDU C;  1WPC A;  2B2T A;  3IAY A;  3A3G A;  3FDT A;  1AZQ A;  4C2M B;  1A3U A;  1O78 A;  3NTI A;  5I6W A;  1MGS A;  2L0C A;  1Y1V B;  3J7Y W;  4RH6 A;  1HVX A;  3OPO A;  5DNF A;  3DEP A;  5KYL A;  1JE4 A;  5IOD A;  4G7O C;  2VXW A;  2D3N A;  1I18 A;  2MPM A;  1EIH A;  2YYZ A;  3KLS A;  1VMC A;  4KJN A;  1ET9 A;  2LZJ A;  3K5L A;  3OMG A;  5LL6 S;  2B2Y C;  1FNV A;  1KNE A;  2GK6 A;  3TDQ A;  1B9N A;  2OF1 A;  2DN8 A;  3EQL C;  1PZK D;  2E2H B;  3MTS A;  2F43 A;  1E1R A;  3NQI A;  1RKN A;  1NR2 A;  3TN2 A;  1T5E A;  4XYO A;  2EXZ A;  3TP6 A;  3A8I E;  1CFM A;  3A56 A;  2LY7 A;  1SAP A;  1EYA A;  3GTL B;  2Z4I A;  1WTX A;  4DN4 M;  2F0S A;  2HUG A;  5CMD A;  2H1E A;  4RHS A;  3MZ5 A;  1TS2 A;  2JP1 A;  5COY A;  4IN3 A;  5KIX A;  5J1Z A;  2C5C A;  2L1B A;  2XIW A;  1SND A;  2JEB I;  3HGB A;  4HR7 B;  3VYS A;  3CRL C;  3O13 A;  1I6H B;  3TZD A;  1B44 D;  4DU9 A;  2NVY B;  3PIO 3;  1SKY B;  4ZK9 B;  4RGN A;  2XVS A;  2ZXO A;  1LTI D;  3GO5 A;  5ELF A;  1O7Z A;  2GJP A;  1DOM A;  3K6O A;  5CV5 A;  4DGZ A;  5FO7 B;  4U67 3;  3SDZ A;  5IOC A;  1NR4 A;  4ME5 A;  3QWN A;  4XKV A;  4NW2 A;  1F9R A;  4TRD A;  2XWB B;  1F2Y A;  2IJ0 A;  5EKL A;  2PW7 A;  5JEA J;  2F0O A;  2KVM A;  4TQU S;  4TSF A;  2F4I A;  2AUK A;  4U68 A;  3HEJ A;  5IGD A;  4QUF A;  5C0X J;  1E79 A;  1ILQ A;  3F2U A;  3C2P A;  2J4X A;  2R3Z A;  3MHB A;  4RWS C;  4L6T B;  1SYC A;  3BH4 A;  2CW0 C;  4XLE A;  1OXT A;  1A3V A;  4DAP A;  1ZYR C;  1ICW A;  2ZTN A;  2L4N A;  2WII B;  5CV4 A;  5HKK A;  1SMY C;  1WD1 A;  1B9M A;  2NVT B;  3OEE A;  3HP3 A;  5IT9 L;  4G7W A;  2PMZ B;  1BR9 A;  1PTO B;  1GUG A;  1JQY D;  4YIJ A;  4XT1 B;  2AQ2 B;  1PZI D;  4C56 C;  1DJR D;  1I4X A;  5C5L A;  3E6Z X;  2EOT A;  5ELE A;  2H4O A;  1SYF A;  4G7H C;  1EEI D;  3DWP A;  2MUY A;  1SMY D;  1WTW A;  3J7A V;  4OHJ A;  1H9J A;  3M4O B;  4K2L A;  3Q22 A;  4L8J A;  5BN4 A;  3TME A;  4ASU A;  5KEE A;  4QUC A;  2F0Q A;  4M8A A;  5D3D A;  4FF4 A;  2WPD A;  5EPK A;  5EGT A;  5I2X A;  1U4R A;  3P1H A;  4A3G B;  1LAC A;  5A35 A;  2K7V A;  2BA1 A;  2BE5 C;  1KZL A;  1SNQ A;  1EIG A;  2MJ8 A;  3K59 A;  1WD0 A;  2Z4H A;  3QO2 A;  4XXE A;  2KEE A;  4OGQ C;  5DM7 3;  1A2U A;  4NNJ A;  1JOQ A;  1BMF A;  4N9T A;  5F2D A;  3HOY B;  3CES A;  4HED A;  2DIE A;  4F8M A;  5BN3 A;  3TP5 A;  2EY6 A;  4RHR A;  2B2W A;  3S2D B;  3D6C A;  4IFD G;  3H6M A;  1JWS D;  1D5Z C;  1MBY A;  1UNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...