4DNTB

Crystal structure of the cusba heavy-metal efflux complex from escherichia coli, mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Cation efflux system protein CusB
total genus 58
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00529 HlyD HlyD membrane-fusion protein of T1SS
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4dntB02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dntB03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 4dntB01
1CI3M 1TU2B 4KI0A 1O7LA 2R6GA 3OW7A 3PUWA 3FPPA 3L7ZC 1Q12A 1ZKOA 1H9KA 4RCNA 3RLFA 2D5DA 3FMCA 2KCCA 1ONLA 3A8IE 2E74C 4LK1C 3PUXA 3MXUA 4JK1C 4DNRB 1GUSA 3VR4A 2EDGA 1Q1BA 2A68D 3CRLC 2L5TA 4IFDH 2DNEA 1GJXA 2AUJD 4DK1A 2A6HD 1TKWB 3WDNA 2PPBC 1K8OA 1K8MA 2V4DA 1Q90A 1OXXK 1VCIA 2A6EC 2KA7A 4IFDG 1H9RA 1VF5C 4KHZA 2A68C 4IQZA 2NN6I 3I73A 3U9SA 3SE0A 1GUGA 3A8JE 3BDOA 1H9SA 2DNCA 3A7LA 5BN5A 1OXSC 3M7NA 3IFTA 1OXUA 2A69C 1OXTA 2BA0A 1E2WA 2JE6I 1HPCA 3AB9A 1H9MA 2A6ED 2CW0C 1HTPA 1Q1EA 2NN6H 1B9MA 1E2ZA 1BDOA 3A7AB 3I72A 1B9NA 4DNTB 5KNCA 1IW7C 4KN7C 5KNBA 4G7OC 1GUTA 5K36H 4H13C 3OPOA 3IKJA 4OO1H 3PV0A 2DN8A 2JEAI 1T5EA 1IW7D 1Y8PB 2D2CC 1DXMA 2NN6G 4GZYC 3P20A 3PUZA 1O78A 3VR2A 4G7ZC 1EWHA 1Y8NB 2O5JC 4KKUA 3H94A 4BA2I 2EJFC 3QIAA 1IYUA 2EJMA 2PCFB 2D62A 3M4YA 1HCZA 1V43A 4XTCS 4KKTA 1ZYRC 4HR7B 4XIGS 3M85A 2K7VA 3D4RA 3PUYA 2F1MA 3MFYA 2E76C 1DD2A 1E2VA 2LMCB 3EQLC 2QF7A 1QJOA 1CTMA 4TKOB 5JEAG 1IYVA 3A8KE 4BA1I 4OO1G 5A35A 3QJYA 2Q8IB 2PNRC 3KLRA 2IT1A 2ZT9C 1I6VC 2AUKA 2B8GA 3T53B 1GUNA 3CRKC 1H9JA 3PUVA 2A6HC 4JBWA 1CFMA 3T56B 1LACA 4LJZC 5C0XH 3T51B 2BDOA 4PV1C 1PMRA 1SMYC 1VF7A 3DXJC 3LWUA 4KMUC 1VDZA 3N6RA 3SDZA 2K33A 2BA1A 4KKSA 1HQMC 4H44C 4KN4C 4TQUS 1Z6HA 2YYZA 2B8FA 5JEAH 3OOCA 2JXMB 4DK0A 1OXVA 3GQBA 3VR6A 1FR3A 3D31A 3HGBA 3ND9A 3LNNA 3TZUA 3VR3A 5BN3A 5BN4A 1Y8OB 3QG1A 4G7HC 2EVBA 1Y69U 2O5IC 1YNNC 1H9SB 1A6XA 2BE5C 3W3AA 5C0XG 1YNJC 2E75C 2K32A 4L8JA 2JEBI 1GHKA 3NE5B 2AWOA 1Z7TA 3GD7A 1DCZA 1G291 4H0LC 3VR5A 3I4LA 4I7ZC 2BE5D 1GHJA 3BG3A 2A69D 3ND8A 1V8QA 5K36G 1LABA 5KNDA 1GUOA 3VA7A 4OGQC 1FYCA 2EJGC
chains in the Genus database with same CATH superfamily
4NPSA 1T6YA 4BBSG 2K03A 2R6GA 1SJED 5FO0A 3NBIA 1PRTF 4JYAQ 4G5GA 4OXPA 2HT1A 3H3VC 1E7ZA 4X0CA 1HR0L 1QGZA 3ONUA 4KJNA 1QFYA 4RH6A 3J80i 5I4DA 2ZJQA 4WWVA 3PMFA 3E20A 4AF7A 2UXCQ 2EDGA 2L15A 2EYOA 3M3YB 3ERQA 1BBXC 3MC0B 2K75A 1GJXA 4LUVA 2OTLA 4DV5Q 2DGYA 4KTAA 3OAAA 5FJ8G 4GKJL 2NVYH 1AH9A 2KA7A 4IFDG 3W2EA 1NSNS 2E2JB 3ASTA 1LLRD 2QCPX 3U9SA 3R2IA 1E63A 2B7BA 3A7LA 1N32Q 3BYYB 5IT9L 4LF7Q 3STBD 4QV2A 2KVMA 4RD6A 2B63B 1NE3A 2F0NA 3TEHB 3I70A 1MJEA 4LC0A 2VB3X 4KD3A 1YJWA 4X65L 2XRSD 2F0KA 1ELOA 4YHHL 1STAA 5FLXL 1M90D 1R4PB 3EJIA 1ICWA 5C0XJ 4ACAA 2AWNA 4DUZQ 2EXDA 2BN4A 4HN7A 1EYGA 4UP7A 2HUGA 1ILQA 4X3TA 3BDLA 4NXNL 1EIHA 1A0IA 1JC7A 5M5YH 4DAVA 2F0PA 5IYBH 3A0JA 3G71A 1VQPB 5IK2A 3F2UA 1K83H 1XX8A 2JA8H 2I1LA 1QG0A 5M3FG 2D3LA 4O2DA 4HIOA 1GUWA 1CQXA 1GVHA 3H0GG 4A3FH 3S2DH 4L5RC 1XMQQ 4BBRG 4RGMA 3M3YH 1TT2A 3DWQA 3I56B 4LJZC 2OTJA 1A62A 3HKZG 4MZ9A 1NR4A 1YVCA 1SYGA 2HDLA 3OIPA 4BWGB 4LFBQ 4RAUC 4R71A 2CVRA 2PW5A 2NWGA 1T5XD 4LFBL 5FKAC 5FO9B 3K5NA 5IWAQ 5LMZA 2VUMB 4CKBA 1V1PB 3BDCA 3G4SA 3HGBA 2GJPA 4L5SA 2NZ1D 2H1EA 2J7ZA 3I3CA 1Y1WH 1HNZL 1WOCA 2XTIA 4JI1Q 3CCRA 4QB4A 5GV8A 4WRDA 1BVSA 1CT1D 2JA6B 2M5SA 1GAWA 1BQQT 1QVFB 1XNQQ 1WU8A 2AWOA 1FX0A 4KLKA 3BS1A 3VR5A 2CBXA 5A8AA 1FGUA 2QTZA 1LTGD 3ND8A 4BY1G 3LQEA 3HKSA 1IBKL 2A74C 5EPLA 1UEAB 1DYQA 4DK3C 1RF2D 3OSOA 4Z4ZA 1JMCA 4XL9A 1UD3A 5BSYA 3DHQA 4F88A 4ZYSA 3I55A 2W6JA 5DLQE 3FMCA 4UP9A 3GDEA 2PMDA 3WNDA 1HFNA 1D2BA 4NBSA 5JJLA 4RLZA 1MJCA 1JA1A 2AQ3B 3I2ZA 4DF7A 1LTAD 3VO1A 4JI4L 1BMFA 1VQ7A 4IFDH 4ACBA 2RCNA 3S1RB 1Y1VH 1SNMA 1B4OA 1EFID 1MSHA 1XPOA 4FXGC 5JPNC 3QFSA 2ALYB 1ZEQX 3SE0A 5FA6A 5E1FA 1UD2A 1KK2A 2M9VA 5BN5A 1S3OA 2X0KA 5ELBA 1D5MC 3CXCB 1H9MA 1X6OA 1W0KA 1Q1EA 3AU7A 4K6DA 5LHY1 1STNA 1FJGL 4DAYA 3PO2B 4DNTB 1I4HA 1UE7A 2WP8J 1KZLA 4HIKA 2WINB 2JA6H 1FJGQ 1N8RD 3K5MA 2SNSA 4FF1A 3RNUA 2WV6D 4P74A 1I5FA 4C3IH 1HHVA 5J3BA 1KC8C 1D7QA 1T5EA 4XQNA 3GTPB 3J81i 4NXNQ 1DXMA 3E3XA 5JEAJ 2XIWA 3I4MH 1I8DA 1VQPA 1VQNB 2NZHA 3JQPA 3S2HB 1HCZA 2ZL5A 2ZBVA 4HIZA 3GTMH 5JBQA 2B2VA 4DR6Q 2PZTA 5C6AA 1Q8IA 5KRUA 3QJYA 4OOXA 4RPBA 5IGFA 3KLRA 3G7LA 1I6VC 1IL8A 2A6HC 3SK4A 2NV4A 1LTBD 3CC4A 1TXYA 1I7PA 4J1MA 4KD4A 4DV7Q 3CC4B 1EY8A 1N33L 1FNDA 2V7WA 2F0MA 1OO9B 1N34Q 1SMYC 2CCZA 2PQAB 1UD4A 2K5QA 3VYUA 4P12A 2OEOA 1N34L 2YTXA 1VS0A 3NENA 3K6OA 1VQ4B 3HP3A 1CHQD 2ATWA 1V5VA 4X3UA 3BQJA 2VQFL 1OXVA 2XVSA 4TRDA 4HIMA 1IXRA 1KQSA 5BN3A 4G7HC 3UDIA 5A2QL 2R7ZG 2EFGA 4AQYQ 3G6EA 3LVBA 4C3HG 1WDTA 2GJRA 4R8IA 4LAAA 3CESA 3PUNA 1YI2A 2EPBA 5AN9A 1WYDA 1BLIA 1HZBA 2VZAA 2E75C 4DR6L 5TRDA 3GD7A 1SXTA 2R93B 1D1IA 1QWYA 1YNXA 2AQ1B 3CCVA 1VHOA 2R7DA 4JV5Q 1JJCB 5C3XA 2DERA 1SFOB 4RCZA 3AVWA 4OHJA 4DV2L 5FO1A 3DEOA 4IUPA 2JA6G 3MA2B 3K5OA 1N9WA 4DV2Q 3OW7A 4X7DA 1LT3D 1DOLA 1Y1WG 1XMOL 3Q6QA 1PXUA 3J7A5 2B2YC 2C4TA 1H9KA 1IBLL 1U0LA 3BY2A 4CHTB 5IGCA 4MTKA 4DA2A 3A8IE 4QUCA 2F0GA 2QW7A 1QE6A 4JI4Q 3KL9A 2EIFA 1B1ZA 4JI2L 3MCAA 4RM0A 1Y1VG 1WTXA 2KQ3A 2AUJD 3WDNA 2E2IB 3OZVA 1ZM3A 4TVAB 1SJHD 3I4NB 1Q90A 2F0HA 2Y0SB 1YITB 2QILA 3PF5A 2MQHA 1STBA 3MXPA 3F1ZA 3Q23A 2ZL7A 1VQKB 2FMCA 4U68A 1QNKA 5C5LA 4M4SA 4PABA 3CW2A 2ASBA 2K1BA 4RCOA 4A3IG 4LBVA 1E2ZA 2EQSA 2ZZGA 3E6ZX 2EYFA 2R3ZA 5FLMH 2F3WA 3O13A 1ZM4A 2R9VA 3PO3H 3VYTA 2KBNA 2B2WC 2O4XA 5JPMC 3CMAA 3CCUA 2B2TA 4QMGA 3ICEA 5EKLA 2KEDA 4R1JA 4GS3A 3PF4A 4OO1H 1U9RA 1EP2B 1K3RA 5IIFA 3NUCA 4XLCA 5DM63 5FIUA 3VR2A 4C56C 5E4WC 3KJOA 5I6WA 3X3MA 4B3XA 4K8IA 5M9OA 5G3LD 4X66L 2IX1A 1UD6A 2D62A 3S14B 5IGEA 3S1QB 2HQEA 5J3OA 2ZTCA 5DM73 4XLFA 1MRZA 2RDFA 1PA6A 2AHOB 2F0FA 4CDEC 1TWFB 2Q8IB 2QDBA 2IT1A 3PUVA 3FKIG 3FDTA 1IB0A 5ELOA 4JBWA 5C4ZA 1JOKA 3N52A 2QEJC 4DV3Q 1DARA 2OTJB 1R9TB 4II3A 3I4NH 1STYA 5C3WA 2PZWA 3LWUA 3C1EA 4NDXA 1EUJA 4QUFA 5IP7H 3NHHA 5DN6A 2IW3A 4KKSA 1VQHA 2XRQD 2OK8A 2B8FA 3K80C 1E3ZA 4A3JH 4UZEA 4B44A 2VNHA 1UD5A 3OZUA 4XDXA 5CR3A 4DV0L 1PH5A 1WFQA 1Z7TA 2ZTNA 1D2EA 1H8HA 4RA8A 3RMHA 3S1RH 3NP8A 3CC2A 2BV3A 4LW1A 2YWFA 1LABA 2R92G 3RZDB 1LT4D 3K8AA 3GTJB 3HOVH 4P6YA 3H0GH 1RHPA 3OMCA 2Q8TA 3PUWA 4POFA 1RD9D 1ZKOA 2L12A 1GVPA 1WCMH 2NPFA 1Q8KA 1F2LA 3GTGB 4R4CA 1VQ5A 3RY8A 2CFMA 5CORA 1Z9FA 4DR1Q 1VMCA 2NVXB 1VHEA 4B47A 1J6QA 3FRPB 1CZWA 2IL8A 2OK7A 3ZYYX 3CPWA 5E3FA 3OKXA 5KW9A 3E0EA 1EQVA 4DR7L 1X65A 5IGBA 1PH6A 5ELFA 4WJ3M 4JI5L 2BVNA 1JB7A 1EY7A 1F2YA 2F4VQ 4XR6A 4A75A 2JDIA 4E0FA 3NTIA 2ZZFA 3S2HH 4YCWA 3I90A 3HOVG 1H9SA 3W2GA 1KXLA 2R93G 1K0SA 4J8QA 1L0YB 4V190 5C4XB 5CV4A 3GTOB 2AQ2B 1B9MA 2GPJA 3W5VA 1BBUA 4FF4A 1UUPA 4X62L 4NMZA 3TZDA 2RHSB 4JBMA 4LBZA 4Z1MA 1HNXL 3Q3AA 1KHIA 1SYBA 2J4XA 4A3FG 4M1UB 4BY7H 5GV7A 1GKHA 4WQMA 1RIPA 4OELB 3CCQB 1GO3E 2A5HA 1M1KD 2DY1A 2B2UC 2MO1A 1LYLA 5M5YB 1EWHA 2K5VA 4EGVA 3QIAA 3GTJH 1G91A 1PZID 4K8JA 3RR5A 2NZOA 4A3EB 4YY3Q 4XIGS 4DV0Q 1FNBA 3QOJA 3MFYA 1DD2A 1E2VA 3PSIA 1KC8D 1PRTB 4HMJA 4QF4A 4DNIA 4ME3A 2Z8LA 2Q2UA 3CCEA 1E64A 3OYYA 4B3TQ 4AYBG 3R93A 2JQOA 2JA5G 4WZKA 3FPUB 2PE3A 3T53B 1YHAA 4AH6A 3J81c 2HCCA 2QEXA 3OMGA 4OWWB 1D5ZC 4FK8A 1SSOA 4FVMA 5H1SE 2GK6A 1PFMA 4GQNA 4LF4L 1TVXA 3DXJC 2PNHA 1C9OA 2R7FA 1CQFA 3V05A 1BJKA 1I4PA 4YELA 1IJEA 3TDQA 5I9PA 2OCEA 4X05A 3GQBA 4U673 1Y1WB 1FR3A 5BN4A 3LNNA 1SMXA 4OONA 3QG1A 3SJZA 2ES2A 3HOWG 3S15H 2BE5C 1SE3A 3NXWA 1C0AA 1SROA 2I5HA 3CCLA 3B8HA 5EAYA 1MKHA 1HZ9A 3RZOB 2EYPA 1S4MA 3D0FA 4C1NI 4RD1A 4XLHA 4WFN3 3AGPA 1UE1A 3K57A 1W9XA 1B53A 1F2ZA 4HSPA 4DUYL 4G7WA 3V76A 3UE0A 1IJFA 2CWAA 2N88A 4R4QA 2B39A 1M4VA 4F7XA 3C2QA 1RTNA 1U4PA 4GNXB 2ID0A 4LF9Q 1NJIC 2K5WA 3ONAB 4QJFA 4JBKA 4Z9CB 4QL5A 2WJVA 1KRTA 4P71A 3EVQA 1YJ9A 4DNRB 1PYBA 3G6JB 1Q81D 1BCPF 2CHBD 2F4VL 1SBBB 4WJWA 5L37A 1BX0A 1NB9A 3LX0A 1A8PA 1X32A 2DYIA 4JW0A 4B43A 2ZJPA 1VF5C 3JAML 2R93H 1XJVA 1KL9A 2PQEA 2A8VA 2DNCA 2HCIA 3LGJA 3ULJA 1E1QA 2Q6KA 1OXUA 1E1TA 1OXTA 4DUYQ 3ES9A 1WOOA 1HTPA 1RDPD 3I72A 3A7AB 2WZNA 2JN4A 3MFGA 2F0EA 1STHA 4A4IA 1HNXQ 1O7ZA 2B5OA 4HE5A 3M9BA 4ZGQB 3OEEA 2JN9A 4PAAA 5NUCA 1TWGH 2RHQB 3R3OA 4H13C 4L5QA 4C3JG 4P2CB 2DOGA 3CPFA 4YWLA 4B08A 5AJ3Q 1Q82C 2Q6LA 1JQYD 1SR3A 1Y8NB 1YBYA 1HZEA 2V7TA 2BMWA 1EY5A 1QB5D 4A3MH 3OJXA 2PCFB 1ENAA 2RC5A 2F0UA 2PYKA 1QUQA 1JJ2A 4KKTA 4GN5A 3U6BA 1AEXA 1Z47A 2WIIB 1IKLA 2CK3A 3CHBD 5J35A 1T6ZA 4XYOA 4DK6C 1UMKA 1WD0A 1PVOA 3GVJA 1JE5A 1F9PA 3C2PA 3HRZC 1KD1C 2L9HA 3TQYA 2WYRA 2AHOA 2GA4B 4HMIA 1LO5D 3F2CA 1KIXA 3DWAA 3OW2B 5AFWA 3ULLA 1W3SA 1VF7A 3J7YW 1KD1D 4X7EA 1YEZA 3MZ5A 1XB2A 4Z4TA 3SXHA 3VYSA 1L0WA 2MUYA 1QUFA 4N9PA 4TQUS 5CV7A 4XQQA 4DV5L 4A3MG 1BCPC 4FF3A 3PO3G 3FJOA 1P8LA 5JEAH 3A54A 1NCVA 5M3MH 4DK0A 4A3FB 1VQ6A 1E0BA 3H15A 4GLVB 3SEBA 1SMYD 3CF5A 3VR3A 3W2FA 3CCRB 4PQXA 1Q3LA 5GAGC 3K58A 4ASUA 3CMAB 3CCUB 1BO0A 3FHWA 1PRTC 1MSGA 4Z4WA 4NNJA 2G9DA 2RBMA 2Z1CA 4DV1Q 3MEFA 4XORA 3OWEB 2OBRA 3BG3A 3PUMA 1IZ6A 1NB0A 1V8QA 5K36G 1T9HA 1NY4A 3VA7A 4DGZA 1TU2B 1GR1A 1I3QB 5E6TA 1Y1VB 1EQTA 4A3GH 3ZC3A 3MTSA 1WSVA 1VQGA 3D6WA 2F0LA 1EQQA 2R7ZB 2D5DA 4PZ6A 1BCPB 1TY2A 2B63H 1BPLA 1K8AD 1KRSA 3A3BA 4ZKCB 4Z4SA 1QVGA 1G8ZD 2V7XA 3Q24A 1QCBD 2A68D 3PO2H 1JWSD 3A74A 1FGBD 1F9RA 3CPWB 1CA5A 2XZOA 4C3JB 2C4UA 1S5FD 1EWCA 5LL6X 3MAQA 1HNWL 2V4DA 3C1FA 1LT5D 5BR8L 4XLAA 4DR2L 3BZCA 4IQZA 1EOTA 2XZPA 2OTLB 4MIUA 2JA7H 3Q8DA 4Q7JB 1XMQL 1XTDA 3IFTA 1AIPA 4YCVA 2ZXHA 5C4XH 3QFTA 3KF8B 5J39A 1VQIA 2BOSA 1STEA 3CCMA 3W2DA 4FWTA 3EIVA 3M7GA 4OX9Q 4GKKL 3J81L 1EYDA 5C0XI 2KCTA 5C3EB 3NWTA 2ZTEA 2NVTB 1Y8PB 3JQQA 1ICFB 2K05A 4DXGA 2B63G 1UNSA 3GVLA 3FP9A 1ENFA 5FO7B 1IHMA 1PH2A 2HDNB 1CKNA 1S5ED 2IPKD 4X3SA 3ZUGA 1HR0W 1ZYRC 1EWIA 2ZTDA 4P2NA 4OWXB 4X7CA 3D4RA 3U9OA 5C4XG 4NCNA 2B7CA 3PIP3 3PVDA 2XWBB 3I55B 1CQVA 1B2RA 4K1XA 4B3SL 3G71B 4DAPA 4Q5VA 3W2IA 3IAYA 4YWMA 4JI3Q 2GN5A 2Q6IA 2KHSA 1GUNA 1WTHD 1SYDA 1E1OA 2L0CA 1K28D 3CB4A 3KF6A 5C44H 1E3XA 2WSSA 4Z4VA 4RHRA 1KLGD 1RKNA 3C3LA 5EGTA 3N6RA 3S1NH 1CUKA 3J80E 1KDCA 2V31A 4QVAA 3PENA 2YYZA 3TMEA 5IGGA 2KUMA 4X6AH 3ND9A 3NQIA 3J81E 2UUCQ 1X3GA 4IFDJ 4J0QA 5HXBA 4X8IA 3G4SB 1CKMA 2K14A 1FDRA 4TT3A 3V96A 2QDLA 1G51A 5DEHA 3PO3B 3PIOA 2JIZA 4UY8C 5EPKA 1D1KA 3CCMB 3I4MB 1CK1A 1WI5A 2OWOA 2DEUA 3J7AF 1E22A 1V1QA 3KEWA 1Q86D 4AYBE 3GVKA 2X3UA 1FRNA 3UDFA 1YIJA 4MTNA 4JI6L 1VJSA 5EJWA 3Q38A 5IP9G 4JI5Q 3F8TA 1EFCA 4A3JB 3RLFA 1DGSA 1MHWC 3PIO3 4A3KG 4GNXA 2PMZB 2KENA 4X06A 1TWGB 2VUMG 1GUSA 2WAQB 3ZZUA 1LTLA 4X62Q 1TKWB 1K8OA 2YU9H 4RD0A 2Q2HA 1EFUA 4JVZA 1PJ5A 4DV7L 2BH2A 1COWA 4A3LH 2JA5B 1A63A 1STGA 4JI3L 2JYOA 3JAME 1OXSC 4BBSB 4IO9A 1DONA 2LXJA 3EFXD 2ZZEA 2FHTA 4O1NA 1IBMQ 3GTMB 4G1BA 2VNUD 2LKVA 1G7SA 3DEPA 4XT1B 5KNCA 1IW7C 1G7TA 4LBYA 4GN4B 1UD8A 1X3FA 1CNEA 3W1GA 3H3VH 4IUVA 3PIPA 4DR5L 4XN3A 2M00A 4K5WA 4HJ7A 1Q81C 3PQIA 2EYMA 1P4MA 2K5HA 4K5VA 5HGTA 2WB1B 4MN3A 4GZYC 3M4OH 4IUUA 4HTHA 4FNFA 4X3KA 1M90C 4BXXH 2O5JC 4KV6A 4S3SA 4J15A 1DJRD 4A3DG 1L1OB 1E62A 1HZCA 1YNND 2RA4A 4ZLTF 4ROXA 2F1MA 2WACA 3EQLC 5CBAE 3STBC 5M3MG 5D3IB 4DAMA 1CTMA 1XXGA 1QUEA 1IHZA 3AFQA 3PGZA 4BS9A 4WJ4A 3DM1A 2V7VA 3VYRA 2PNRC 3PA2A 3WWVA 1WD1A 3TSSA 1LACA 3HOYB 3TRZA 1QX4A 1WTPA 1AE2A 1LM0A 1VQOB 1MI2A 3QFCA 1C4QA 1VMPA 1G7CA 2OQ0A 5GAHC 1PTOD 1A3TA 1JICA 1A8VA 1CKOA 2K5NA 1KJZA 2R7ZH 2BGJA 4QVJA 2VS1A 4GLAC 3MEHA 2SOBA 1EFRA 3W3AA 2HIVA 3V7AA 5A2QE 1PTOC 1YJNB 4UDUC 2Z6BA 5DS0A 3T4AC 1QILA 5M5WB 3UI2A 2CH4A 4K14A 1HUMA 1W35A 4AC9A 4WZLA 1TWAH 4H0LC 1EEID 2MJ8A 2ZL6A 1BF4A 3W5HA 2PMZE 4QUZA 2YWGA 1QZGA 4EX5A 4PGOA 4YWKA 3LQ6A 4JOIC 3DM3A 1TWHB 3W5UA 1O7LA 1EXMA 4TSFA 2LS01 1GXDC 4RGOS 1HUNA 4L5TA 1J8IA 3GO5A 4QQBX 4L6TB 1BKBA 1JCKB 1ESFA 1BNZA 2PO4A 1TTTA 1C48A 3G05A 1L1OA 1HA6A 3BZKA 1SNCA 1VQMA 2NUCA 3CRLC 4M0LA 1HVXA 2KEEA 2K04A 1G6ZA 1M8AA 4X64L 1J9ZA 1SE4A 2WB1G 1MABA 1H9RA 5F4OA 4C2MH 2Z6BD 4X64Q 1NBMA 3OTOL 4DV3L 2EY2A 2HDMA 2FVGA 2C77A 1X54A 2GREA 1HPCA 1YITA 2WB1E 3K59A 4YALA 3TS0A 1B70B 4FF2A 2BSAA 2MGSA 3BJUA 3D3RA 1B9NA 3OP1A 3NTHA 3GIRA 4KN7C 4POGA 4JI8L 1B8AA 5HGQA 4FXKC 5A88A 3S1MB 3GP7A 1GUTA 4A3BH 3ISXA 1K0RA 3JU4A 4CJ0B 3CCQA 1CKNB 2BCOA 2NVTH 1AFPA 2DJGC 3RN5A 1N08A 1Q46A 1I4GA 2JK8A 3A5UA 1R9TH 2C5HA 2VNJA 2CQOA 1EZ6A 4ODGA 3JAMc 3KUPA 4LUOA 4BA2I 2EJFC 5IYNA 2EJMA 2RKSA 4F87A 3GV6A 2O2LD 3HKZB 3I91A 1PJ6A 3J80L 2K7VA 3PUYA 3BVGA 4PG3A 1ZM2A 2P3MA 1D8TA 3QE2A 4N3NA 2E76C 1PH3A 1UE5A 2QTLA 1O7YA 3MHPA 3CAMA 3QSYA 3W5OA 5JEAG 1HA5A 3TP7A 2HIXA 4RHSA 1H9JA 1X3EA 1ZUNB 2VBSA 4ZCLA 1CFMA 3HEJA 3IL8A 5C3EG 3HOUB 4A3DB 3HFZB 2L55A 1CSQA 2Q6OA 1CSPA 4R4OA 4QIWB 4M1KA 1SYFA 2N8NA 1VQ8B 4KMUC 3FVQA 1F77A 1O80A 2K33A 4XQFA 2OQKA 3ERSX 1DDGA 1SDFA 1H85A 1VQ4A 2EYHA 3BZDB 4X65Q 1PTOF 3VR6A 4A3JG 2D9RA 4A93H 1OHHA 2KHIA 4GNXC 4P72A 4RMFA 1T6XA 1AE3A 1QVFA 2FFKB 1N07A 4DR7Q 1XYIA 4Y9UA 2GJKA 2RQXA 4O42A 1DOKA 4UZUA 4C3IG 3H9NA 1ET9A 2K32A 1GHKA 1WOSA 2VZLA 4XYQA 3J80c 1N36Q 2LZJA 2DJFC 3W2HA 1RJTA 3E5SA 4IUTA 5G3LF 4JC0A 2PLFA 3PO2G 1I3QH 1QZHA 4ZV4A 1HQRD 1N05A 4XM3A 2JA5H 3SJPA 3ZJYC 2FJ2A 3L2PA 2F03A 3PA1A 3CD6A 4N8X1 4JI0L 1HRJA 4ZCIA 3P27A 4R4IA 3K7AB 3NPPA 2XGJA 4RPDA 4APVA 3S1NB 2UUBL 1PTOB 3WBKA 1NUCA 4KK7A 2IJ0A 1YX2A 1LUZA 1KTVA 2WJYA 2HLDA 5FK9C 4JI7Q 4HJAA 4CQJA 1LTRD 2X6XA 5IGDA 1R5NA 4OO1I 4XN0A 1R5OA 5IT9c 1TS4A 4OWTB 1FNCA 3Q6RA 4HJ5A 5IYDG 5FLMG 1F2MA 1K8AC 5CBEE 1QH0A 1JWUD 1EEFD 5CMDA 2JA7B 4M53A 1J9OA 1EL0A 1VQ8A 5EMNA 1FNVA 2TSSA 2D74A 2EOTA 5GADC 2E1RA 1IYJB 1VQCA 1OB2A 2DY8A 3SGIA 3CMMA 3SR1A 2TMPA 3I7FA 1BDOA 2UXBQ 3DWPA 1I94Q 2XNDA 3DLLA 2X6GA 1HR0Q 1EOVA 1SE8A 2QMUA 5KNBA 3WY9A 1TS2A 1WPCA 2N3SA 2WAQG 3OPOA 1PRTD 1ML0D 1RL2A 1XFOA 3R8BA 4B3GA 1VQAA 4LFCQ 4XOPA 2E2IH 3CD6B 1FD7D 3PUZA 4XKVA 1PJ7A 1KAWA 4G6IA 1E24A 4UHVA 1PYWD 1IKMA 1IYUA 3M4YA 5GROA 2X6LA 1FL0A 1K8GA 5JJIA 4HR7B 4EQ5A 1NTGA 2IHEA 1PTOH 4CKCA 4JI2Q 3ITPA 1S5DD 2G5DA 3ER0A 1PDQA 2CQAA 4BBSH 1XNQL 3OHXC 1H42A 2NB0A 2OXPA 2K6AA 1B23P 4A3CH 3AVYA 4O0AA 4FXUA 2B29A 4OIJA 1EYCA 4DQLA 4PV1C 1PMRA 3I4OA 1VQBA 2NTTA 4A3KB 3ASPA 1EY4A 4G1VA 3BCDA 2GK7A 4ID6A 4JV5L 2F0OA 4CDDC 2JXMB 2Z6KA 3CCLB 2LXKA 5HURA 4NXMQ 1Y69U 2KCNA 1G2TA 1P16A 5I9OA 3WOFA 1Q7YC 4YAOA 1GJRA 5HY6A 5C4HA 2YTYA 1U4LA 2JEBI 3HG9A 1PH8A 1UEBA 4RWSC 3TBIB 1U4MA 5IYWA 4DV4Q 4GLXA 1KRHA 3VNVA 4X66Q 3CMEA 4JI0Q 2X6YA 4OOSA 3OJWA 1O7IA 4FYDA 1E1RA 3KDFB 4CJ1B 1VQFA 1CI3M 4RG1A 2B2TC 4DN4M 4M2LA 5IYPA 2EY6A 2N49A 4H9GA 5LL6S 2I07B 3A5ZB 3JQRA 2Y0SG 5ELNA 4YY3L 1EWYA 1II3A 2F0IA 3NELA 3S1MH 4A3BB 1X3PA 1XE1A 1DG1G 1OGJA 5H59A 1VQMB 1TUIA 1N0VC 2A6HD 4RDLA 2UU9L 4A3IB 4HIDA 3P75A 4Z4UA 1VCIA 2VQFQ 3OW2A 2D0PA 2F43A 1TWAB 2WR8A 3ASSA 2NN6I 4IPHA 4B9XA 2Q2IA 1R5BA 3AYHB 5EKKA 1OGIA 2XSCA 3M4PA 1EY0A 5TR9A 1VQEA 4ZGNB 4DFAA 4JMQA 4K0KQ 2AKWB 4IJLA 3SK6A 1XPRA 1K73D 1XNRQ 3CC2B 4PC6A 2UXDQ 5D65A 3ASQA 2H5XA 2NYZD 3PV0A 3ULPA 4KHPQ 1WTOA 3B82A 3C46A 2JA8G 2MP1A 1U2RA 2NN6G 4LFAQ 1O78A 5JAVA 4WZEA 4BBRH 3J81k 4F7DA 2RSOA 1BUVT 2UU9Q 1WVLA 1I50H 4OPOA 1CM9A 4P75A 4F8MA 4XT3B 3M85A 1V9PA 2CKZB 1M1KC 3CQZH 3KJPA 4JG2A 2HMAA 2PI2A 4K2LA 4XNFA 2ICEC 4EVOA 4LF6Q 3GTKH 2Q2TA 4R4TA 2NVQH 1ZYRD 4RD3A 4Y7NH 3GTQB 4I7AA 2B8GA 5KNDA 4R9WA 4ZAIA 4TMVA 4HJ9A 1D6EC 1MGSA 3T51B 3RLNA 2DCUA 3U2QA 1EYAA 1IL2A 1D5XC 1WJJA 3ZZ0A 2UXDL 2BA1A 3I8ZA 4HE6A 1VQOA 4DQKA 2NTSA 4H44C 1PKVA 2K01A 5I2YA 4GKJQ 4KHPL 1VQ9B 3AFPA 1PFSA 3AGQA 4LFAL 2R92H 3D31A 1AP0A 3AVVA 1Y8OB 4BY1H 5LMUQ 4IUNA 1YNNC 5M3MB 2J7KA 4RD4A 2CRVA 1X56A 4IURA 2RCFA 1BQEA 4CDFC 3ONYA 1PYSB 2EY1A 2ZXRA 3DDYA 2WKCA 3CMEB 1KAAA 1LTID 1VQLB 4OPSA 1L1OC 5D14A 1DCZA 2UUAL 3EA6A 5KEEA 3G48A 4EQPA 1SYEA 3S17B 3NK9A 5IE8A 4P22A 1GAQA 4PNYA 4A3GG 1Q7YD 4OGQC 2CW5A 4BBRB 4HAEA 1SNDA 3KLSA 4HJ8A 4G4KA 3HZXA 2KVOA 3M4OB 2F52A 1D1NA 2SDFA 4IPGA 1E43A 3P7JA 3VA5A 1Q12A 3T1YQ 1Q9SA 1Y0RA 2I5LX 3CQZB 5M5XH 2D0OA 1ONLA 1B3AA 5IYBG 2YTVA 5ELDA 3BCFA 1Q86C 5IP7G 1AZQA 1N06A 1FVIA 2M2LA 3LO8A 5M3FH 4P3IA 4IJHA 1YHBA 2ENBA 1HA3A 5CV9A 3DMUA 5IP9H 3OZWA 3R6KA 2V7UA 2F4IA 3A8KA 3BDOA 4LWCA 1KQSB 2A69C 1ZXTA 4DV6Q 2BA0A 1E2WA 4XOTA 4K0KL 2CW0C 3M4QA 4BY1B 3KBGA 1VQDA 2ZZQA 4IZ8A 1IBLQ 3HOZB 2K28A 5JVG3 3K7AH 1WORA 2B2YA 5DSZA 1KK0A 4G7OC 2X85A 3IRBA 3CCVB 4JI1L 3CC7A 3W1BA 4ZUIA 1QFZA 4NW2A 5HKKA 4Z4RA 2W6IA 1VQLA 1HZAA 4A3KH 3KOJA 5C3EH 4P73A 3P20A 4JYAL 1YIJB 2JA9A 4DV1L 1C7YA 3HOYH 2VUMH 3RZDH 2PZUA 2OYNA 3MXNA 1EU3A 4RDKA 3HOVB 3J7AV 3S16H 1F9QA 1DM0B 1LT6D 4HCSA 4TSSA 3U58A 2UXCL 3A3GA 2IX3A 1K83B 5KYIA 5BSXA 5TY0A 3A8KE 3P1HA 5T1IA 1CZGA 1LTSD 2ZBUA 5B6IA 1I4QA 2ZT9C 1LTTD 2B2WA 5EBCA 5C0XH 1QGAA 2KECA 4P9SA 4GN3B 1CNFA 1N32L 3U50C 1E79A 2CF4A 5CDFA 4IN3A 2X6WA 2WZPP 1Z6HA 3OOCA 1BX1A 3KYHC 2K4KA 2EIXA 4YHHQ 1HFGA 2BDNA 4CGYB 4P6VF 4UPAA 3NBHA 1YNJC 3SLDA 3AVUA 1A2TA 4HEDA 4QCLA 2MHVA 4EQOA 4IW3B 4GOPB 4RD2A 1YJWB 3BYTB 3MXNB 4CKEA 1GHJA 3DUZA 5D3DA 2YU9B 3S9WA 4ME5A 1I4RA 1UWVA 2ZXOA 4DR4L 3QOLA 2FXQA 5FLXc 4ZCKA 1PV4A 2CWPA 1DOMA 1I6HB 2JP1A 1KNEA 2E1BA 2R6HA 1B3QA 5C5MA 4OL7A 4ULLA 2VNKA 3RN2A 1N0UA 2L4NA 3BY1A 3D4WA 4X7FA 3CCEB 1KDAA 1WTQA 5FOBB 2EE1A 2JJ1A 1RCVD 4PMWA 3WOEA 5IYCG 5C4JH 3CTAA 2LY7A 3IFDA 3OEHA 3VNUA 2A6EC 3TP8A 4LNQA 3AMUA 5DAUA 4NB3A 4KHZA 4YEJA 2A68C 1F20A 3D26A 1N33Q 5THXA 2EYLA 4KY5A 1AN8A 2F4NA 3NBHB 3AB9A 3FEWX 1VQ9A 2A6ED 3SK5A 1V1PA 1TY0A 2WFWA 2XN9C 1YLOA 4B3TL 5ELCA 3K7UC 5FLXE 1SRUA 4IALA 4DR5Q 4P1VA 3OE7A 4PC3A 4KHVA 2QE7A 4A3BG 3D4DA 2L1BA 2F0QA 1TS3A 4ZK9B 3GTLH 1W34A 2XOKA 3IKJA 1IBKQ 4IUQA 2DN8A 2N55A 2VY3A 4C3JH 5TV2A 3BU2A 2E5LL 4A3DH 1GO2A 4HSVA 3RUZA 5IT9E 2MO0A 4DUZL 2C35B 4TMXA 3U4VA 1WTVA 3K0YA 1U4RA 3U6KA 3I4NG 3Q22A 2LMCB 2Z6KC 2QF7A 2VQEQ 3T1HL 2A1AA 4RGTA 4BA1I 3MMPA 2C5CA 5A35A 4LF5L 2NVQB 5HZBA 3H09A 4Y7NB 3GTQH 3CRKC 2AUKA 3KK7A 2EYJA 3T56B 1WOPA 5L46A 1ASYA 3CW2C 4IFDI 1JJGA 1J5EQ 4C1NK 4LMQD 4IOCA 4M8AA 2QGQA 3A1PA 5A89A 2KHJA 4ZUJA 3F2DA 1HQMC 4KN4C 4DR3Q 1VLYA 4JI7L 5M5XB 2JJQA 4NKLA 2O5IC 2B2VC 2EVBA 5IY0A 1MIUA 2E2DC 2Y0SE 4GOPA 2E2HH 4OX9L 4YAUA 2FMMA 4WORA 4DU9A 2C78A 4YAWA 1D8LA 1NBWA 4RJLA 4TMZA 5FL7A 2X53S 3OTOQ 3QR8A 1VQJA 2F1LA 4YHBA 4XMYA 2K50A 2FX3A 1JE4A 3T1HQ 1K73C 3ZBTA 5FJ8H 3RLOA 4I7ZC 1SN8A 1ESRA 4RFBA 5C44B 2A69D 1KK3A 4B3RQ 1MBYA 3Q0AA 2IHFA 2I46A 1W0JA 2VBTA 4A3MB 1YNJD 3HOXG 1J5EL 4KI0A 4BXXG 4K5XA 3FPPA 3L7ZC 3WQZA 5FO8B 4XLEA 1EIFA 1I4XA 2IX0A 4EQNA 1R4QB 2KCCA 1BBWA 1JNYA 4LK1C 3L9AX 4PMCA 2F0TA 2BH8A 3HOUH 4XXEA 2R92B 3TP6A 5ISRA 1PFNA 2BM1A 3FPKA 1UE6A 3JAMi 1NRKA 1PHJA 1V0EA 4YAFA 2DNEA 4RKLA 3TREA 1K9MC 4OPVA 5IWAL 4FO2A 1YJ9B 2XZLA 2YWEA 1L2FA 1WTWA 5LMNL 4RDJA 1A3UA 5JJKA 3OFNA 2QA4A 1TWCH 3EROA 3KLSX 2OBTA 2X69A 2Z0SA 4H02A 5LMNQ 1VQKA 3CP0A 1GUGA 1KLUD 3S16B 1U5KA 2VBUA 3CCSB 4C2MB 1SNOA 1SKQA 5IODA 1N8RC 4Y9RA 3M7NA 4A3EG 4B3RL 1I94L 2LFNA 1NJID 2UUBQ 2DY7A 2DUDA 4X07A 3E0JA 1TLLA 3CXCA 3U4ZA 3FKIB 4LBWA 5K5PA 4XQJA 5K36H 1NAPA 1RQRA 4Y52H 4OP7A 2YWHA 3EBEA 4B48A 1X55A 2D2CC 3TP5A 1OTCA 3UDXA 4ILWA 4KKUA 4TMTA 1G7RA 2K52A 3MWYW 5E7NA 3CP8A 4XTCS 2WKDA 2I0QA 1BXTA 4R8NA 2BF4A 1NMGA 5EQ0A 1QNUA 5EKIA 1I18A 4A93B 3KLWA 3CCJA 1ILPA 1IYVA 2EY5A 2UXBL 2OT2A 3QO2A 4YCUA 1L0XB 2F3VA 2NVYB 1EY9A 2QEXB 2BDOA 2CC2A 4AF6A 2F0DA 2G9HD 1S4ZA 3HOWH 1NNXA 3R2TA 5AJ3L 3F2BA 4B9WA 5F2DA 2Z9HA 3T16A 3HOXB 1FNUA 1X9NA 5CGKA 3MVVA 2HHHL 3B6YA 4DAYB 3SVMA 3ZBUA 4PC7A 1G2SA 2CW0D 3L0OA 4G57A 1WSRA 3I1FA 3AQQA 5C0XG 1AZPA 1HNZQ 1SYCA 5M5WH 2DETA 1SFOH 1S72B 1PFBA 1PH9A 1PZKD 5F4JA 2KCMA 1GUOA 3WNCA 3WNBA 1JJ2B 1QUQB 1Y14B 2D9UA 2XEXA 4LUZA 5CV6A 2B3GA 1X3QA 2RDGA 5LMNW 1PZJD 2F0SA 4RCNA 2F0WA 1WCMB 5KGUA 2I5MX 2E74C 4DV6L 5EPJA 4GKKQ 4DKAC 1BOSA 3EN2A 3MXUA 4ABNA 3VR4A 1IBML 5IOCA 4II2A 1A15A 1Q1BA 2HHHQ 2L5TA 4WZTA 3NQTA 2PQAA 1ASZA 4UAJA 3E9IA 3ASRA 1ZM9A 1AW7A 1K8MA 1OXXK 3HOZG 1V0FA 3QFRA 4A3CG 2RC6A 3I73A 3NTKA 3A8JE 5J1ZA 4C3HH 2A19A 2WAQE 4RKBA 3HOYG 1UAPA 2JE6I 4BPRA 2SNMA 3GTOH 4E6IA 2VB2X 2GVAA 3CP2A 4K2KA 1NDHA 1EZ8A 1I6HH 4HCEA 3AVXA 4B3FX 3VO2A 4JOIA 5T1GA 3GTGH 4PMBA 2VL6A 2JEAI 4JI6Q 1QFJA 1IW7D 1MD2D 1YJNA 2SEBD 5C4JB 1XMOQ 1XQBA 4PC1A 1KDBA 2BM0A 3S14H 3KDFA 4FP5D 4CBVA 5BR8Q 1HNWQ 1SLJA 3H94A 2F0VA 4DV4L 2FINB 1YZ6A 2B2UA 2F0JA 3J7ZC 4RCYA 1F60A 1ET6A 4JCVE 3SHLA 1TWFH 3HOZH 3URYA 2UUAQ 2V7QA 4KY7A 5JOBA 4BY7G 3GV3A 1VQ5B 2Z4HA 1HTLD 4MHEA 4PZ8A 1F9SA 1SEBD 1JOQA 4EH1A 3L3OC 1LV9A 1WTRA 1WTHA 2XGTA 5C44G 3NEMA 5IYRA 3Q39A 1I50B 5M3FB 2XWJB 4YXWA 4NP5A 1DZ1A 3RD4A 1H95A 2MNAA 1W87A 1W2BA 2VYQA 3K0XA 3KF8A 1XTCD 4XD7A 3CU7A 4B4DA 1KMHA 2JSOA 4RGNA 1YI2B 1HH2P 4AQYL 2Z4IA 2HD3A 4AYBB 3SLNA 5GQOA 2QKIC 3HOUG 2E2JH 5CYUA 3HKZE 1XWEA 2ZM6L 1OB5A 3BH4A 3ZPNA 4A3IH 3TN2A 1TS5A 4Z4YA 3VDYA 1B2TA 3SKBA 3OWFA 4B3ML 4LFCL 4CDCC 3HAGA 2P5ZX 4MYTA 4A76A 2NBFA 3CRZA 2R61A 5I2XA 1XPUA 4C43A 1SNPA 3QB3A 3ZZTA 3PUXA 4JK1C 3SEJA 4N9TA 2QGGA 4MNOA 4ZQ3A 2WPDA 1H8EA 1QVGB 1NMFA 2AMCB 4DK1A 1A3VA 4JPBW 2VJIA 2HQLA 1WCMG 1B44D 4UZFA 4C0SA 4CJ2C 1JB3A 4Q0FA 1W6KA 1ENCA 2CH4W 3S24A 2ZM6Q 1JORA 2E5LQ 3B78A 1G6PA 3PCOB 3S2DB 2GVBA 1JB9A 1W6JA 2NN6H 2V1CC 1XNRL 1JWMD 1W2BB 3BVZA 1SKYB 2X8KA 2KOLA 2ZTGA 1V1OA 1EP3B 1SM4A 1Q82D 5TSSA 3H91A 5J22A 4NXML 2PIAA 2UUCL 3FKIH 4ALPA 5JVH3 3AVTA 4K6LA 1S72A 1SE2A 1EIYB 1TQOA 3V2TA 2XNJA 1FRQA 2YV5A 3A55A 3KBXA 2PW7A 2C2WA 3K81C 4QGUA 1VQNA 4FN5A 2ZXIA 3CCJB 2GQFA 2LSSA 2K5DA 5IYQA 1TWCB 1CA6A 4LF6L 1EFTA 4AIMA 2VBVA 2ZITA 5KNLA 1HJPA 1KTKA 1C8CA 2JA8B 3I56A 4TKOB 1QGYA 3A35A 1RTOA 2E8GA 3GTKB 4GOPC 2QA4B 3UDGA 2MFIA 2VXWA 2NVXH 4B3MQ 4DR4Q 3ZIAA 1HXYD 2ZXPA 1S5BD 3CKIB 4KJOA 4TN1A 3WXMA 4QHYA 1SAPA 3D6CA 3H6MA 3T1YL 1JA0A 3HOWB 3S1QH 4UP8A 1N36L 1VDZA 4J6HA 3SDZA 1GD7A 1PH1A 2VNIA 3KFUA 4YIJA 1PH4A 4DR2Q 1RODA 4B3SQ 2ZJRA 1PLFA 3WYAA 4PZ7A 3CPXA 1A2UA 1A6XA 4QIWE 2JA7G 5CV8A 3G6EB 2OBSA 3RZOH 4U9UA 4Y7CA 4L8JA 3CC7B 3R6JA 3AEVA 4AVZA 1S40A 3E9HA 2RDHA 4I65A 5CV5A 2D3NA 2VW9A 3P26A 1K3BC 1KK1A 3I4LA 4QY7A 1JOOA 3A56A 2VJJA 1YHQB 3TS2A 4BY7B 2H4OA 3GSIA 1E3PA 1EY6A 2EXZA 1FYCA 2J0TD 2PI2E 3HS0C 2BPOA 2XNCA 1AMOA 1QG7A 4L63B 2RF4A 2E2HB 3I4MG 1QVCA 4OIKA 3SK8A 3S15B 1FNMA 4N8FA 4A3EH 4MYUA 4JI8Q 4DXFA 5E4XA 2QN6A 4LF9L 4TMWA 4C3IB 1B50A 3T13A 1RQPA 4P26A 3MXGA 1VQ7B 2RVLA 4DR1L 3E1YE 1CHPD 4ZRZA 2DIEA 1TR5A 2CNDA 3BVMA 2EZVA 2PPBC 1EU4A 3H3VI 4H7BA 4A3LG 4A93G 5KIXA 3J81j 2L11A 1EP1B 3KF6B 4XKWA 1GM5A 4LF5Q 1BCPD 3NSWA 3Q6SA 1VQ6B 1QOHA 5H5JA 3MHBA 5HZAA 3VMFA 1TIID 4IOAA 4A3GB 4FDBA 1WP6A 4IPCA 2BGIA 4ZKBB 1B7YB 5LMUL 1EQRA 2Q8RE 2IWHA 3QWNA 3A8IA 2A73B 5DNFA 4DR3L 4LF4Q 4UAIA 1JR0D 4ZCMA 1TVCA 3H0GB 3JC66 4G7ZC 3UE1A 4P3YA 4IPDA 1DDIA 1TWHH 5GAEC 1V43A 1JT8A 1YHQA 1PH7A 4XONA 1FNWA 1VLOA 4OEMB 4PC2A 4G7XA 1QJOA 4C3HB 5IYDH 2OF1A 4OO1G 2XNAC 1S5CD 4JBJA 1S0UA 3BNWA 3X3NA 1EFWA 5KSWB 3NWSA 3WBJA 3GTPH 3OIQA 4DPGA 5IYCH 4QFMA 5JJZA 4OOVA 1KABA 2JJ2A 1GOZA 2QDXA 2C9OA 1OB0A 1NR2A 5KYLA 5CC4A 1EIGA 2ICIA 5ELEA 1K28A 4FXDA 5EBDA 4P25A 3TZUA 2N78A 3BC9A 2F3IA 3K5LA 4LF8Q 3CCSA 2RSNA 3D8GA 1H9SB 1BR9A 3GTLB 1SNQA 2VQEL 5FNZA 4KY6A 5F4MA 4LF8L 2IY5B 3FKSA 1K9MD 2C5BA 1Y0YA 3NE5B 2KJXA 3LWEA 4V0BA 1G291 3A8JA 3S17H 2BE5D 5COYA 5I6YA 4LF7L 2HCJB 4N3GA 2MPMA 2EJGC 3HOXH 1KNAA
chains in the Genus database with same CATH topology
2K03A 2R6GA 1SJED 3NBIA 1PRTF 3H3VC 4KJNA 4RH6A 5I4DA 3PMFA 2EDGA 3M3YB 2EYOA 3ERQA 1BBXC 3MC0B 1GJXA 4KTAA 3OAAA 2KA7A 4IFDG 1NSNS 2E2JB 1LLRD 2QCPX 3U9SA 3R2IA 3A7LA 3BYYB 5IT9L 2KVMA 2B63B 2F0NA 3I70A 2VB3X 4KD3A 2XRSD 2F0KA 1STAA 5FLXL 1R4PB 3EJIA 1ICWA 5C0XJ 2AWNA 4HN7A 2HUGA 1ILQA 4X3TA 3BDLA 1EIHA 1JC7A 4DAVA 2F0PA 5IK2A 3F2UA 1XX8A 2D3LA 1GUWA 4RGMA 1TT2A 3DWQA 4LJZC 1NR4A 1SYGA 2HDLA 3OIPA 4BWGB 4RAUC 2CVRA 2PW5A 2NWGA 1T5XD 5FKAC 5FO9B 3K5NA 2VUMB 4CKBA 1V1PB 3BDCA 3HGBA 2GJPA 2NZ1D 2H1EA 2J7ZA 3I3CA 4QB4A 4WRDA 1CT1D 2JA6B 2M5SA 1BQQT 2AWOA 1FX0A 3BS1A 3VR5A 1LTGD 3ND8A 2A74C 5EPLA 1UEAB 1DYQA 1RF2D 3OSOA 4XL9A 1UD3A 3DHQA 4F88A 4ZYSA 2W6JA 3FMCA 1HFNA 1D2BA 2AQ3B 4DF7A 1LTAD 4IFDH 1BMFA 3S1RB 1SNMA 1B4OA 1EFID 1MSHA 4FXGC 5JPNC 1ZEQX 3SE0A 5E1FA 1UD2A 2M9VA 5BN5A 5ELBA 1D5MC 1H9MA 1W0KA 1Q1EA 3AU7A 4K6DA 5LHY1 1STNA 4DAYA 3PO2B 4DNTB 1I4HA 2WP8J 1KZLA 2WINB 3K5MA 2SNSA 4FF1A 2WV6D 1HHVA 1T5EA 4XQNA 3GTPB 1DXMA 5JEAJ 2XIWA 1I8DA 3S2HB 1HCZA 4HIZA 2B2VA 2PZTA 5C6AA 1Q8IA 5KRUA 3QJYA 5IGFA 3KLRA 3G7LA 1I6VC 1IL8A 2A6HC 3SK4A 1LTBD 4J1MA 4KD4A 1EY8A 2F0MA 1OO9B 1SMYC 1UD4A 2K5QA 3VYUA 2OEOA 3K6OA 3HP3A 1CHQD 4X3UA 1OXVA 2XVSA 4TRDA 5BN3A 4G7HC 5A2QL 4C3HG 2GJRA 4R8IA 4LAAA 3CESA 2EPBA 1BLIA 2E75C 3GD7A 1SXTA 2R93B 1D1IA 1QWYA 2AQ1B 5C3XA 1SFOB 4OHJA 3DEOA 4IUPA 3MA2B 3K5OA 3OW7A 1LT3D 1DOLA 1PXUA 2B2YC 1H9KA 4CHTB 5IGCA 4DA2A 3A8IE 4QUCA 2F0GA 1QE6A 1B1ZA 1WTXA 2KQ3A 2AUJD 3WDNA 2E2IB 1SJHD 3I4NB 1Q90A 2F0HA 2Y0SB 2QILA 1STBA 3MXPA 3Q23A 2FMCA 4U68A 1QNKA 5C5LA 2K1BA 4RCOA 1E2ZA 2ZZGA 3E6ZX 2EYFA 2R3ZA 2F3WA 3O13A 2R9VA 3VYTA 2O4XA 2B2WC 5JPMC 2B2TA 4QMGA 5EKLA 2KEDA 4OO1H 1U9RA 5IIFA 3NUCA 4XLCA 5DM63 3VR2A 4C56C 5E4WC 5I6WA 3X3MA 4K8IA 5M9OA 5G3LD 2IX1A 1UD6A 2D62A 3S14B 5IGEA 3S1QB 2HQEA 5DM73 4XLFA 2RDFA 2F0FA 1TWFB 2Q8IB 2QDBA 2IT1A 3PUVA 3FDTA 4JBWA 5C4ZA 1JOKA 3N52A 2QEJC 1R9TB 4II3A 1STYA 5C3WA 2PZWA 3LWUA 3C1EA 4NDXA 4QUFA 3NHHA 5DN6A 2IW3A 4KKSA 2XRQD 2B8FA 1E3ZA 1UD5A 4XDXA 5CR3A 2ZTNA 1Z7TA 1H8HA 4RA8A 3RMHA 3NP8A 1LABA 3RZDB 1LT4D 3GTJB 1RHPA 3OMCA 2Q8TA 3PUWA 1RD9D 1ZKOA 2L12A 3GTGB 1F2LA 5CORA 1VMCA 2NVXB 3FRPB 1CZWA 2IL8A 3ZYYX 5E3FA 1EQVA 5IGBA 5ELFA 1EY7A 1F2YA 4XR6A 2JDIA 4E0FA 3NTIA 2ZZFA 3I90A 1H9SA 4J8QA 1L0YB 4V190 5C4XB 5CV4A 3GTOB 2AQ2B 1B9MA 4FF4A 1UUPA 4NMZA 3TZDA 4Z1MA 1SYBA 2J4XA 4M1UB 2A5HA 2B2UC 5M5YB 1EWHA 4EGVA 3QIAA 1G91A 1PZID 4K8JA 4A3EB 4XIGS 3QOJA 3MFYA 1DD2A 1E2VA 1PRTB 4HMJA 4QF4A 2Z8LA 3R93A 3FPUB 3T53B 2HCCA 3OMGA 1D5ZC 1SSOA 4FVMA 2GK6A 1PFMA 4GQNA 1TVXA 3DXJC 1CQFA 3V05A 1I4PA 4YELA 3TDQA 5I9PA 4U673 1Y1WB 3GQBA 1FR3A 5BN4A 3LNNA 3QG1A 2BE5C 1SE3A 3NXWA 3RZOB 2EYPA 4C1NI 4XLHA 4WFN3 3K57A 1W9XA 1B53A 1F2ZA 4HSPA 4G7WA 2N88A 2B39A 1M4VA 4F7XA 1RTNA 1U4PA 2ID0A 2K5WA 3ONAB 4Z9CB 2WJVA 3EVQA 4DNRB 3G6JB 1BCPF 2CHBD 1SBBB 4WJWA 3LX0A 1X32A 1VF5C 3JAML 2PQEA 2DNCA 2HCIA 1E1QA 1OXUA 1OXTA 1HTPA 1RDPD 3I72A 3A7AB 3MFGA 2F0EA 1STHA 1O7ZA 3OEEA 5NUCA 3R3OA 4H13C 4C3JG 4P2CB 4B08A 1JQYD 1Y8NB 1HZEA 1EY5A 1QB5D 2PCFB 1ENAA 2F0UA 2PYKA 4KKTA 1AEXA 1Z47A 2WIIB 1IKLA 2CK3A 3CHBD 4XYOA 1WD0A 3GVJA 1F9PA 3C2PA 3HRZC 2L9HA 2GA4B 4HMIA 1LO5D 3DWAA 5AFWA 1VF7A 3J7YW 3MZ5A 3SXHA 3VYSA 2MUYA 4XQQA 4N9PA 4TQUS 5CV7A 4FF3A 1BCPC 5JEAH 3A54A 1NCVA 4DK0A 4A3FB 1E0BA 3SEBA 1SMYD 3VR3A 4PQXA 1Q3LA 3K58A 4ASUA 1BO0A 1PRTC 1MSGA 4NNJA 2G9DA 2RBMA 2Z1CA 4XORA 3OWEB 3BG3A 1V8QA 5K36G 3VA7A 4DGZA 1TU2B 1I3QB 1Y1VB 1EQTA 3MTSA 3D6WA 2F0LA 2R7ZB 2D5DA 1BCPB 1TY2A 1BPLA 3A3BA 4ZKCB 1G8ZD 3Q24A 1QCBD 2A68D 1JWSD 1FGBD 1F9RA 1CA5A 2XZOA 4C3JB 1S5FD 1EWCA 5LL6X 3MAQA 2V4DA 3C1FA 1LT5D 4XLAA 4IQZA 1EOTA 2XZPA 4MIUA 3IFTA 2ZXHA 5J39A 2BOSA 1STEA 3W2DA 3M7GA 3J81L 1EYDA 5C0XI 5C3EB 3NWTA 2NVTB 1Y8PB 2K05A 4DXGA 1UNSA 3GVLA 5FO7B 1ENFA 1S5ED 2IPKD 4X3SA 1ZYRC 3D4RA 3U9OA 3PIP3 2XWBB 1CQVA 4DAPA 4Q5VA 3IAYA 2KHSA 1GUNA 1WTHD 1SYDA 2L0CA 1K28D 1E3XA 2WSSA 4RHRA 3C3LA 1KLGD 1RKNA 5EGTA 3N6RA 3J80E 1KDCA 2V31A 2YYZA 3TMEA 5IGGA 2KUMA 3ND9A 3NQIA 3J81E 4IFDJ 4TT3A 3V96A 5DEHA 3PO3B 2JIZA 5EPKA 1D1KA 3I4MB 1CK1A 3J7AF 3KEWA 3GVKA 1VJSA 5EJWA 4A3JB 3RLFA 3PIO3 2PMZB 1TWGB 1GUSA 2WAQB 1TKWB 1K8OA 1COWA 2JA5B 1STGA 2JYOA 3JAME 1OXSC 4BBSB 1DONA 3EFXD 2ZZEA 2FHTA 4O1NA 3GTMB 2VNUD 2LKVA 3DEPA 4XT1B 5KNCA 1IW7C 1UD8A 4IUVA 4XN3A 2M00A 4K5WA 2EYMA 4K5VA 5HGTA 2WB1B 4MN3A 4GZYC 4IUUA 4HTHA 4FNFA 4X3KA 2O5JC 4KV6A 4S3SA 1DJRD 2RA4A 1YNND 4ZLTF 2F1MA 2WACA 3EQLC 5CBAE 5D3IB 1CTMA 1XXGA 1IHZA 4BS9A 3DM1A 3VYRA 2PNRC 1WD1A 3TSSA 1LACA 3HOYB 1WTPA 1MI2A 1C4QA 1VMPA 1PTOD 1A3TA 1JICA 3MEHA 2SOBA 1EFRA 3W3AA 5A2QE 1PTOC 4UDUC 5M5WB 3T4AC 1QILA 3UI2A 4K14A 1HUMA 4H0LC 1EEID 2MJ8A 1BF4A 1TWHB 1O7LA 2LS01 4TSFA 1GXDC 4RGOS 1HUNA 1J8IA 3GO5A 4L6TB 1JCKB 1ESFA 1BNZA 2PO4A 1C48A 3G05A 1HA6A 1SNCA 2NUCA 3CRLC 1HVXA 2KEEA 2K04A 1G6ZA 1M8AA 1SE4A 1MABA 1H9RA 2Z6BD 1NBMA 2EY2A 2HDMA 1HPCA 3K59A 4FF2A 2MGSA 3D3RA 1B9NA 3NTHA 4KN7C 3S1MB 4FXKC 3GP7A 1GUTA 3JU4A 4CJ0B 2BCOA 1AFPA 1I4GA 1EZ6A 4ODGA 3KUPA 4BA2I 2EJFC 2EJMA 2RKSA 4F87A 3GV6A 2O2LD 3HKZB 3I91A 3J80L 2K7VA 3PUYA 3BVGA 2E76C 1O7YA 5JEAG 1HA5A 3TP7A 4RHSA 1H9JA 3HOUB 1CFMA 3IL8A 3HEJA 4A3DB 2L55A 4QIWB 1SYFA 4KMUC 3FVQA 1F77A 1O80A 2K33A 4XQFA 1SDFA 2EYHA 3BZDB 1PTOF 3VR6A 1OHHA 2FFKB 1XYIA 4O42A 2GJKA 2RQXA 1DOKA 4UZUA 4C3IG 1ET9A 2K32A 1GHKA 4XYQA 2LZJA 1RJTA 3E5SA 4IUTA 5G3LF 1HQRD 4XM3A 2FJ2A 2F03A 1HRJA 3K7AB 3NPPA 2XGJA 3S1NB 1PTOB 1NUCA 4KK7A 2IJ0A 2WJYA 2HLDA 5FK9C 1LTRD 2X6XA 5IGDA 4OO1I 4XN0A 1TS4A 1F2MA 5CBEE 1JWUD 1EEFD 5CMDA 2JA7B 1J9OA 1EL0A 1FNVA 2TSSA 2EOTA 2DY8A 3CMMA 3SR1A 2TMPA 1BDOA 3DWPA 2XNDA 2X6GA 5KNBA 1TS2A 1WPCA 3OPOA 1PRTD 1ML0D 3R8BA 4B3GA 4XOPA 1FD7D 3PUZA 4XKVA 4G6IA 1IKMA 1PYWD 1IYUA 3M4YA 2X6LA 4HR7B 1PTOH 4CKCA 3ITPA 1S5DD 1PDQA 2CQAA 3OHXC 2NB0A 2OXPA 2K6AA 4FXUA 4OIJA 1EYCA 4PV1C 1PMRA 2NTTA 4A3KB 1EY4A 3BCDA 2GK7A 4ID6A 2F0OA 2JXMB 5HURA 1Y69U 2KCNA 1G2TA 5I9OA 3WOFA 5C4HA 1U4LA 2JEBI 3HG9A 4RWSC 3TBIB 1U4MA 2X6YA 4FYDA 1E1RA 4CJ1B 1CI3M 4DN4M 2B2TC 2EY6A 5LL6S 2I07B 1II3A 2F0IA 4A3BB 1X3PA 2A6HD 4A3IB 3P75A 1VCIA 2F43A 1TWAB 4B9XA 2NN6I 5EKKA 2XSCA 1EY0A 4DFAA 4JMQA 3SK6A 5D65A 2NYZD 3PV0A 1WTOA 3C46A 2MP1A 2NN6G 1O78A 5JAVA 2RSOA 1BUVT 1WVLA 1CM9A 4F8MA 4XT3B 3M85A 4K2LA 4XNFA 2ICEC 4EVOA 1ZYRD 3GTQB 2B8GA 5KNDA 4R9WA 4ZAIA 1D6EC 1MGSA 3T51B 1EYAA 1D5XC 2BA1A 3I8ZA 2NTSA 5I2YA 4H44C 1PKVA 2K01A 3D31A 1AP0A 1Y8OB 4IUNA 1YNNC 5M3MB 4IURA 2EY1A 2ZXRA 3DDYA 2WKCA 1KAAA 1LTID 5D14A 1DCZA 3EA6A 5KEEA 4EQPA 1SYEA 3S17B 3NK9A 4P22A 4PNYA 4OGQC 4BBRB 4HAEA 1SNDA 3KLSA 4G4KA 3HZXA 2KVOA 3M4OB 2SDFA 3VA5A 1E43A 3P7JA 1Q12A 3CQZB 1ONLA 1B3AA 5ELDA 3BCFA 1AZQA 2M2LA 2ENBA 5CV9A 3DMUA 3BDOA 2F4IA 2A69C 1ZXTA 2BA0A 1E2WA 4XOTA 2CW0C 4BY1B 3KBGA 4IZ8A 2ZZQA 3HOZB 2K28A 5JVG3 2B2YA 4G7OC 2X85A 4ZUIA 4NW2A 5HKKA 2W6IA 3P20A 2PZUA 3MXNA 1EU3A 3HOVB 3J7AV 1F9QA 1DM0B 1LT6D 4HCSA 4TSSA 3A3GA 2IX3A 1K83B 5KYIA 3A8KE 3P1HA 5T1IA 1CZGA 1LTSD 1I4QA 2ZT9C 1LTTD 2B2WA 5EBCA 5C0XH 2KECA 1E79A 5CDFA 4IN3A 2X6WA 2WZPP 1Z6HA 3OOCA 1HFGA 2BDNA 4CGYB 3NBHA 1YNJC 1A2TA 4HEDA 4QCLA 2MHVA 4EQOA 3BYTB 4CKEA 1GHJA 3DUZA 5D3DA 2YU9B 3S9WA 4ME5A 1I4RA 2ZXOA 3QOLA 1DOMA 1I6HB 2JP1A 1KNEA 2E1BA 5C5MA 4OL7A 4ULLA 2L4NA 3D4WA 1KDAA 1WTQA 5FOBB 2EE1A 4PMWA 3WOEA 2JJ1A 1RCVD 2LY7A 3IFDA 3OEHA 2A6EC 3TP8A 3AMUA 5DAUA 4KHZA 4YEJA 2A68C 2EYLA 4KY5A 1AN8A 3AB9A 3FEWX 2A6ED 3SK5A 1V1PA 1TY0A 2XN9C 5ELCA 5FLXE 4IALA 3OE7A 4KHVA 2QE7A 3D4DA 2L1BA 2F0QA 1TS3A 4ZK9B 2XOKA 3IKJA 4IUQA 2DN8A 2N55A 4HSVA 3RUZA 5IT9E 1WTVA 3K0YA 1U4RA 3Q22A 2LMCB 2QF7A 4RGTA 4BA1I 2C5CA 5A35A 2NVQB 3H09A 4Y7NB 3CRKC 2AUKA 3KK7A 2EYJA 3T56B 4IFDI 4C1NK 4LMQD 4M8AA 4ZUJA 1HQMC 4KN4C 1VLYA 5M5XB 4NKLA 2O5IC 2B2VC 2EVBA 2E2DC 2FMMA 4WORA 4DU9A 5FL7A 2X53S 4XMYA 1JE4A 4I7ZC 4RFBA 1ESRA 5C44B 2A69D 1MBYA 3Q0AA 2I46A 1W0JA 4A3MB 1YNJD 4KI0A 4K5XA 3FPPA 3L7ZC 3WQZA 5FO8B 4XLEA 1I4XA 2IX0A 4EQNA 1R4QB 2KCCA 4LK1C 3L9AX 4PMCA 2F0TA 2R92B 4XXEA 3TP6A 5ISRA 1PFNA 1NRKA 1V0EA 2DNEA 4RKLA 4FO2A 2XZLA 1WTWA 1A3UA 3OFNA 3EROA 3KLSX 2X69A 1GUGA 1KLUD 3S16B 4C2MB 1SNOA 5IODA 3M7NA 2LFNA 2DY7A 3E0JA 3FKIB 5K5PA 4XQJA 5K36H 1NAPA 2D2CC 3TP5A 4ILWA 4KKUA 3MWYW 3CP8A 4XTCS 2WKDA 1BXTA 4R8NA 5EQ0A 1QNUA 5EKIA 1I18A 4A93B 1ILPA 1IYVA 2EY5A 2OT2A 3QO2A 1L0XB 2F3VA 2NVYB 1EY9A 2BDOA 2F0DA 2G9HD 1S4ZA 3R2TA 4B9WA 5F2DA 3T16A 3HOXB 1FNUA 5CGKA 3MVVA 3SVMA 1G2SA 2CW0D 4G57A 5C0XG 1AZPA 1SYCA 1PFBA 1PZKD 1GUOA 2D9UA 5CV6A 1X3QA 2RDGA 1PZJD 2F0SA 4RCNA 2F0WA 1WCMB 5KGUA 2E74C 5EPJA 1BOSA 3MXUA 4ABNA 3VR4A 5IOCA 4II2A 1A15A 1Q1BA 2L5TA 3NQTA 1K8MA 1AW7A 1OXXK 1V0FA 3I73A 3NTKA 3A8JE 5J1ZA 4RKBA 1UAPA 2JE6I 2SNMA 4E6IA 2VB2X 3CP2A 4K2KA 1EZ8A 4HCEA 4B3FX 5T1GA 4PMBA 2JEAI 1IW7D 1MD2D 2SEBD 5C4JB 1KDBA 4FP5D 4CBVA 3H94A 2F0VA 2FINB 2B2UA 2F0JA 1ET6A 3SHLA 3URYA 2V7QA 4KY7A 5JOBA 3GV3A 2Z4HA 1HTLD 4MHEA 1F9SA 1SEBD 1JOQA 3L3OC 1LV9A 1WTRA 1I50B 5M3FB 2XWJB 4YXWA 4NP5A 1DZ1A 3RD4A 3KF8A 1XTCD 4XD7A 3CU7A 1KMHA 2JSOA 4RGNA 2Z4IA 4AYBB 2QKIC 5CYUA 1XWEA 3BH4A 3ZPNA 3TN2A 1TS5A 1B2TA 3OWFA 3HAGA 2NBFA 2R61A 5I2XA 1SNPA 3QB3A 3PUXA 4JK1C 4N9TA 4ZQ3A 2WPDA 1H8EA 4DK1A 1A3VA 2VJIA 1B44D 4CJ2C 1JB3A 4Q0FA 1W6KA 1ENCA 1JORA 3S2DB 1W6JA 2NN6H 1JWMD 3BVZA 1SKYB 2X8KA 2KOLA 2ZTGA 1V1OA 5TSSA 3H91A 5J22A 5JVH3 4K6LA 1SE2A 1TQOA 3V2TA 3A55A 3KBXA 2PW7A 2ZXIA 2K5DA 1TWCB 1CA6A 5KNLA 1KTKA 1C8CA 2JA8B 4TKOB 3A35A 1RTOA 3GTKB 2VXWA 3ZIAA 1HXYD 2ZXPA 1S5BD 3CKIB 4KJOA 1SAPA 3D6CA 3H6MA 3HOWB 1VDZA 4J6HA 3SDZA 4YIJA 1RODA 1PLFA 1A2UA 1A6XA 5CV8A 4L8JA 4AVZA 2RDHA 4I65A 5CV5A 2D3NA 3I4LA 1JOOA 3A56A 2VJJA 4BY7B 2H4OA 2EXZA 1EY6A 1FYCA 2J0TD 3HS0C 1QG7A 4L63B 2E2HB 4OIKA 3SK8A 3S15B 4DXFA 5E4XA 4C3IB 1B50A 3T13A 3MXGA 2RVLA 1CHPD 4ZRZA 2DIEA 1TR5A 3BVMA 2EZVA 2PPBC 1EU4A 4H7BA 5KIXA 2L11A 4XKWA 1BCPD 3NSWA 3Q6SA 1QOHA 3MHBA 1TIID 4A3GB 1WP6A 4ZKBB 2Q8RE 2IWHA 3QWNA 2A73B 5DNFA 4UAIA 1JR0D 3H0GB 4G7ZC 1V43A 4XONA 1FNWA 4G7XA 1QJOA 4C3HB 2OF1A 4OO1G 2XNAC 1S5CD 3X3NA 3NWSA 3OIQA 5JJZA 1KABA 2JJ2A 1GOZA 2C9OA 5KYLA 1OB0A 1NR2A 5CC4A 1EIGA 2ICIA 5ELEA 4FXDA 5EBDA 3TZUA 3BC9A 3K5LA 2RSNA 3D8GA 1H9SB 1BR9A 3GTLB 1SNQA 4KY6A 3FKSA 3NE5B 2KJXA 3LWEA 4V0BA 1G291 2BE5D 5COYA 5I6YA 2MPMA 2EJGC 1KNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CI3 M;  1TU2 B;  4KI0 A;  1O7L A;  2R6G A;  3OW7 A;  3PUW A;  3FPP A;  3L7Z C;  1Q12 A;  1ZKO A;  1H9K A;  4RCN A;  3RLF A;  2D5D A;  3FMC A;  2KCC A;  1ONL A;  3A8I E;  2E74 C;  4LK1 C;  3PUX A;  3MXU A;  4JK1 C;  4DNR B;  1GUS A;  3VR4 A;  2EDG A;  1Q1B A;  2A68 D;  3CRL C;  2L5T A;  4IFD H;  2DNE A;  1GJX A;  2AUJ D;  4DK1 A;  2A6H D;  1TKW B;  3WDN A;  2PPB C;  1K8O A;  1K8M A;  2V4D A;  1Q90 A;  1OXX K;  1VCI A;  2A6E C;  2KA7 A;  4IFD G;  1H9R A;  1VF5 C;  4KHZ A;  2A68 C;  4IQZ A;  2NN6 I;  3I73 A;  3U9S A;  3SE0 A;  1GUG A;  3A8J E;  3BDO A;  1H9S A;  2DNC A;  3A7L A;  5BN5 A;  1OXS C;  3M7N A;  3IFT A;  1OXU A;  2A69 C;  1OXT A;  2BA0 A;  1E2W A;  2JE6 I;  1HPC A;  3AB9 A;  1H9M A;  2A6E D;  2CW0 C;  1HTP A;  1Q1E A;  2NN6 H;  1B9M A;  1E2Z A;  1BDO A;  3A7A B;  3I72 A;  1B9N A;  4DNT B;  5KNC A;  1IW7 C;  4KN7 C;  5KNB A;  4G7O C;  1GUT A;  5K36 H;  4H13 C;  3OPO A;  3IKJ A;  4OO1 H;  3PV0 A;  2DN8 A;  2JEA I;  1T5E A;  1IW7 D;  1Y8P B;  2D2C C;  1DXM A;  2NN6 G;  4GZY C;  3P20 A;  3PUZ A;  1O78 A;  3VR2 A;  4G7Z C;  1EWH A;  1Y8N B;  2O5J C;  4KKU A;  3H94 A;  4BA2 I;  2EJF C;  3QIA A;  1IYU A;  2EJM A;  2PCF B;  2D62 A;  3M4Y A;  1HCZ A;  1V43 A;  4XTC S;  4KKT A;  1ZYR C;  4HR7 B;  4XIG S;  3M85 A;  2K7V A;  3D4R A;  3PUY A;  2F1M A;  3MFY A;  2E76 C;  1DD2 A;  1E2V A;  2LMC B;  3EQL C;  2QF7 A;  1QJO A;  1CTM A;  4TKO B;  5JEA G;  1IYV A;  3A8K E;  4BA1 I;  4OO1 G;  5A35 A;  3QJY A;  2Q8I B;  2PNR C;  3KLR A;  2IT1 A;  2ZT9 C;  1I6V C;  2AUK A;  2B8G A;  3T53 B;  1GUN A;  3CRK C;  1H9J A;  3PUV A;  2A6H C;  4JBW A;  1CFM A;  3T56 B;  1LAC A;  4LJZ C;  5C0X H;  3T51 B;  2BDO A;  4PV1 C;  1PMR A;  1SMY C;  1VF7 A;  3DXJ C;  3LWU A;  4KMU C;  1VDZ A;  3N6R A;  3SDZ A;  2K33 A;  2BA1 A;  4KKS A;  1HQM C;  4H44 C;  4KN4 C;  4TQU S;  1Z6H A;  2YYZ A;  2B8F A;  5JEA H;  3OOC A;  2JXM B;  4DK0 A;  1OXV A;  3GQB A;  3VR6 A;  1FR3 A;  3D31 A;  3HGB A;  3ND9 A;  3LNN A;  3TZU A;  3VR3 A;  5BN3 A;  5BN4 A;  1Y8O B;  3QG1 A;  4G7H C;  2EVB A;  1Y69 U;  2O5I C;  1YNN C;  1H9S B;  1A6X A;  2BE5 C;  3W3A A;  5C0X G;  1YNJ C;  2E75 C;  2K32 A;  4L8J A;  2JEB I;  1GHK A;  3NE5 B;  2AWO A;  1Z7T A;  3GD7 A;  1DCZ A;  1G29 1;  4H0L C;  3VR5 A;  3I4L A;  4I7Z C;  2BE5 D;  1GHJ A;  3BG3 A;  2A69 D;  3ND8 A;  1V8Q A;  5K36 G;  1LAB A;  5KND A;  1GUO A;  3VA7 A;  4OGQ C;  1FYC A;  2EJG C; 
#chains in the Genus database with same CATH topology
 4NPS A;  1T6Y A;  4BBS G;  2K03 A;  2R6G A;  1SJE D;  5FO0 A;  3NBI A;  1PRT F;  4JYA Q;  4G5G A;  4OXP A;  2HT1 A;  3H3V C;  1E7Z A;  4X0C A;  1HR0 L;  1QGZ A;  3ONU A;  4KJN A;  1QFY A;  4RH6 A;  3J80 i;  5I4D A;  2ZJQ A;  4WWV A;  3PMF A;  3E20 A;  4AF7 A;  2UXC Q;  2EDG A;  2L15 A;  2EYO A;  3M3Y B;  3ERQ A;  1BBX C;  3MC0 B;  2K75 A;  1GJX A;  4LUV A;  2OTL A;  4DV5 Q;  2DGY A;  4KTA A;  3OAA A;  5FJ8 G;  4GKJ L;  2NVY H;  1AH9 A;  2KA7 A;  4IFD G;  3W2E A;  1NSN S;  2E2J B;  3AST A;  1LLR D;  2QCP X;  3U9S A;  3R2I A;  1E63 A;  2B7B A;  3A7L A;  1N32 Q;  3BYY B;  5IT9 L;  4LF7 Q;  3STB D;  4QV2 A;  2KVM A;  4RD6 A;  2B63 B;  1NE3 A;  2F0N A;  3TEH B;  3I70 A;  1MJE A;  4LC0 A;  2VB3 X;  4KD3 A;  1YJW A;  4X65 L;  2XRS D;  2F0K A;  1ELO A;  4YHH L;  1STA A;  5FLX L;  1M90 D;  1R4P B;  3EJI A;  1ICW A;  5C0X J;  4ACA A;  2AWN A;  4DUZ Q;  2EXD A;  2BN4 A;  4HN7 A;  1EYG A;  4UP7 A;  2HUG A;  1ILQ A;  4X3T A;  3BDL A;  4NXN L;  1EIH A;  1A0I A;  1JC7 A;  5M5Y H;  4DAV A;  2F0P A;  5IYB H;  3A0J A;  3G71 A;  1VQP B;  5IK2 A;  3F2U A;  1K83 H;  1XX8 A;  2JA8 H;  2I1L A;  1QG0 A;  5M3F G;  2D3L A;  4O2D A;  4HIO A;  1GUW A;  1CQX A;  1GVH A;  3H0G G;  4A3F H;  3S2D H;  4L5R C;  1XMQ Q;  4BBR G;  4RGM A;  3M3Y H;  1TT2 A;  3DWQ A;  3I56 B;  4LJZ C;  2OTJ A;  1A62 A;  3HKZ G;  4MZ9 A;  1NR4 A;  1YVC A;  1SYG A;  2HDL A;  3OIP A;  4BWG B;  4LFB Q;  4RAU C;  4R71 A;  2CVR A;  2PW5 A;  2NWG A;  1T5X D;  4LFB L;  5FKA C;  5FO9 B;  3K5N A;  5IWA Q;  5LMZ A;  2VUM B;  4CKB A;  1V1P B;  3BDC A;  3G4S A;  3HGB A;  2GJP A;  4L5S A;  2NZ1 D;  2H1E A;  2J7Z A;  3I3C A;  1Y1W H;  1HNZ L;  1WOC A;  2XTI A;  4JI1 Q;  3CCR A;  4QB4 A;  5GV8 A;  4WRD A;  1BVS A;  1CT1 D;  2JA6 B;  2M5S A;  1GAW A;  1BQQ T;  1QVF B;  1XNQ Q;  1WU8 A;  2AWO A;  1FX0 A;  4KLK A;  3BS1 A;  3VR5 A;  2CBX A;  5A8A A;  1FGU A;  2QTZ A;  1LTG D;  3ND8 A;  4BY1 G;  3LQE A;  3HKS A;  1IBK L;  2A74 C;  5EPL A;  1UEA B;  1DYQ A;  4DK3 C;  1RF2 D;  3OSO A;  4Z4Z A;  1JMC A;  4XL9 A;  1UD3 A;  5BSY A;  3DHQ A;  4F88 A;  4ZYS A;  3I55 A;  2W6J A;  5DLQ E;  3FMC A;  4UP9 A;  3GDE A;  2PMD A;  3WND A;  1HFN A;  1D2B A;  4NBS A;  5JJL A;  4RLZ A;  1MJC A;  1JA1 A;  2AQ3 B;  3I2Z A;  4DF7 A;  1LTA D;  3VO1 A;  4JI4 L;  1BMF A;  1VQ7 A;  4IFD H;  4ACB A;  2RCN A;  3S1R B;  1Y1V H;  1SNM A;  1B4O A;  1EFI D;  1MSH A;  1XPO A;  4FXG C;  5JPN C;  3QFS A;  2ALY B;  1ZEQ X;  3SE0 A;  5FA6 A;  5E1F A;  1UD2 A;  1KK2 A;  2M9V A;  5BN5 A;  1S3O A;  2X0K A;  5ELB A;  1D5M C;  3CXC B;  1H9M A;  1X6O A;  1W0K A;  1Q1E A;  3AU7 A;  4K6D A;  5LHY 1;  1STN A;  1FJG L;  4DAY A;  3PO2 B;  4DNT B;  1I4H A;  1UE7 A;  2WP8 J;  1KZL A;  4HIK A;  2WIN B;  2JA6 H;  1FJG Q;  1N8R D;  3K5M A;  2SNS A;  4FF1 A;  3RNU A;  2WV6 D;  4P74 A;  1I5F A;  4C3I H;  1HHV A;  5J3B A;  1KC8 C;  1D7Q A;  1T5E A;  4XQN A;  3GTP B;  3J81 i;  4NXN Q;  1DXM A;  3E3X A;  5JEA J;  2XIW A;  3I4M H;  1I8D A;  1VQP A;  1VQN B;  2NZH A;  3JQP A;  3S2H B;  1HCZ A;  2ZL5 A;  2ZBV A;  4HIZ A;  3GTM H;  5JBQ A;  2B2V A;  4DR6 Q;  2PZT A;  5C6A A;  1Q8I A;  5KRU A;  3QJY A;  4OOX A;  4RPB A;  5IGF A;  3KLR A;  3G7L A;  1I6V C;  1IL8 A;  2A6H C;  3SK4 A;  2NV4 A;  1LTB D;  3CC4 A;  1TXY A;  1I7P A;  4J1M A;  4KD4 A;  4DV7 Q;  3CC4 B;  1EY8 A;  1N33 L;  1FND A;  2V7W A;  2F0M A;  1OO9 B;  1N34 Q;  1SMY C;  2CCZ A;  2PQA B;  1UD4 A;  2K5Q A;  3VYU A;  4P12 A;  2OEO A;  1N34 L;  2YTX A;  1VS0 A;  3NEN A;  3K6O A;  1VQ4 B;  3HP3 A;  1CHQ D;  2ATW A;  1V5V A;  4X3U A;  3BQJ A;  2VQF L;  1OXV A;  2XVS A;  4TRD A;  4HIM A;  1IXR A;  1KQS A;  5BN3 A;  4G7H C;  3UDI A;  5A2Q L;  2R7Z G;  2EFG A;  4AQY Q;  3G6E A;  3LVB A;  4C3H G;  1WDT A;  2GJR A;  4R8I A;  4LAA A;  3CES A;  3PUN A;  1YI2 A;  2EPB A;  5AN9 A;  1WYD A;  1BLI A;  1HZB A;  2VZA A;  2E75 C;  4DR6 L;  5TRD A;  3GD7 A;  1SXT A;  2R93 B;  1D1I A;  1QWY A;  1YNX A;  2AQ1 B;  3CCV A;  1VHO A;  2R7D A;  4JV5 Q;  1JJC B;  5C3X A;  2DER A;  1SFO B;  4RCZ A;  3AVW A;  4OHJ A;  4DV2 L;  5FO1 A;  3DEO A;  4IUP A;  2JA6 G;  3MA2 B;  3K5O A;  1N9W A;  4DV2 Q;  3OW7 A;  4X7D A;  1LT3 D;  1DOL A;  1Y1W G;  1XMO L;  3Q6Q A;  1PXU A;  3J7A 5;  2B2Y C;  2C4T A;  1H9K A;  1IBL L;  1U0L A;  3BY2 A;  4CHT B;  5IGC A;  4MTK A;  4DA2 A;  3A8I E;  4QUC A;  2F0G A;  2QW7 A;  1QE6 A;  4JI4 Q;  3KL9 A;  2EIF A;  1B1Z A;  4JI2 L;  3MCA A;  4RM0 A;  1Y1V G;  1WTX A;  2KQ3 A;  2AUJ D;  3WDN A;  2E2I B;  3OZV A;  1ZM3 A;  4TVA B;  1SJH D;  3I4N B;  1Q90 A;  2F0H A;  2Y0S B;  1YIT B;  2QIL A;  3PF5 A;  2MQH A;  1STB A;  3MXP A;  3F1Z A;  3Q23 A;  2ZL7 A;  1VQK B;  2FMC A;  4U68 A;  1QNK A;  5C5L A;  4M4S A;  4PAB A;  3CW2 A;  2ASB A;  2K1B A;  4RCO A;  4A3I G;  4LBV A;  1E2Z A;  2EQS A;  2ZZG A;  3E6Z X;  2EYF A;  2R3Z A;  5FLM H;  2F3W A;  3O13 A;  1ZM4 A;  2R9V A;  3PO3 H;  3VYT A;  2KBN A;  2B2W C;  2O4X A;  5JPM C;  3CMA A;  3CCU A;  2B2T A;  4QMG A;  3ICE A;  5EKL A;  2KED A;  4R1J A;  4GS3 A;  3PF4 A;  4OO1 H;  1U9R A;  1EP2 B;  1K3R A;  5IIF A;  3NUC A;  4XLC A;  5DM6 3;  5FIU A;  3VR2 A;  4C56 C;  5E4W C;  3KJO A;  5I6W A;  3X3M A;  4B3X A;  4K8I A;  5M9O A;  5G3L D;  4X66 L;  2IX1 A;  1UD6 A;  2D62 A;  3S14 B;  5IGE A;  3S1Q B;  2HQE A;  5J3O A;  2ZTC A;  5DM7 3;  4XLF A;  1MRZ A;  2RDF A;  1PA6 A;  2AHO B;  2F0F A;  4CDE C;  1TWF B;  2Q8I B;  2QDB A;  2IT1 A;  3PUV A;  3FKI G;  3FDT A;  1IB0 A;  5ELO A;  4JBW A;  5C4Z A;  1JOK A;  3N52 A;  2QEJ C;  4DV3 Q;  1DAR A;  2OTJ B;  1R9T B;  4II3 A;  3I4N H;  1STY A;  5C3W A;  2PZW A;  3LWU A;  3C1E A;  4NDX A;  1EUJ A;  4QUF A;  5IP7 H;  3NHH A;  5DN6 A;  2IW3 A;  4KKS A;  1VQH A;  2XRQ D;  2OK8 A;  2B8F A;  3K80 C;  1E3Z A;  4A3J H;  4UZE A;  4B44 A;  2VNH A;  1UD5 A;  3OZU A;  4XDX A;  5CR3 A;  4DV0 L;  1PH5 A;  1WFQ A;  1Z7T A;  2ZTN A;  1D2E A;  1H8H A;  4RA8 A;  3RMH A;  3S1R H;  3NP8 A;  3CC2 A;  2BV3 A;  4LW1 A;  2YWF A;  1LAB A;  2R92 G;  3RZD B;  1LT4 D;  3K8A A;  3GTJ B;  3HOV H;  4P6Y A;  3H0G H;  1RHP A;  3OMC A;  2Q8T A;  3PUW A;  4POF A;  1RD9 D;  1ZKO A;  2L12 A;  1GVP A;  1WCM H;  2NPF A;  1Q8K A;  1F2L A;  3GTG B;  4R4C A;  1VQ5 A;  3RY8 A;  2CFM A;  5COR A;  1Z9F A;  4DR1 Q;  1VMC A;  2NVX B;  1VHE A;  4B47 A;  1J6Q A;  3FRP B;  1CZW A;  2IL8 A;  2OK7 A;  3ZYY X;  3CPW A;  5E3F A;  3OKX A;  5KW9 A;  3E0E A;  1EQV A;  4DR7 L;  1X65 A;  5IGB A;  1PH6 A;  5ELF A;  4WJ3 M;  4JI5 L;  2BVN A;  1JB7 A;  1EY7 A;  1F2Y A;  2F4V Q;  4XR6 A;  4A75 A;  2JDI A;  4E0F A;  3NTI A;  2ZZF A;  3S2H H;  4YCW A;  3I90 A;  3HOV G;  1H9S A;  3W2G A;  1KXL A;  2R93 G;  1K0S A;  4J8Q A;  1L0Y B;  4V19 0;  5C4X B;  5CV4 A;  3GTO B;  2AQ2 B;  1B9M A;  2GPJ A;  3W5V A;  1BBU A;  4FF4 A;  1UUP A;  4X62 L;  4NMZ A;  3TZD A;  2RHS B;  4JBM A;  4LBZ A;  4Z1M A;  1HNX L;  3Q3A A;  1KHI A;  1SYB A;  2J4X A;  4A3F G;  4M1U B;  4BY7 H;  5GV7 A;  1GKH A;  4WQM A;  1RIP A;  4OEL B;  3CCQ B;  1GO3 E;  2A5H A;  1M1K D;  2DY1 A;  2B2U C;  2MO1 A;  1LYL A;  5M5Y B;  1EWH A;  2K5V A;  4EGV A;  3QIA A;  3GTJ H;  1G91 A;  1PZI D;  4K8J A;  3RR5 A;  2NZO A;  4A3E B;  4YY3 Q;  4XIG S;  4DV0 Q;  1FNB A;  3QOJ A;  3MFY A;  1DD2 A;  1E2V A;  3PSI A;  1KC8 D;  1PRT B;  4HMJ A;  4QF4 A;  4DNI A;  4ME3 A;  2Z8L A;  2Q2U A;  3CCE A;  1E64 A;  3OYY A;  4B3T Q;  4AYB G;  3R93 A;  2JQO A;  2JA5 G;  4WZK A;  3FPU B;  2PE3 A;  3T53 B;  1YHA A;  4AH6 A;  3J81 c;  2HCC A;  2QEX A;  3OMG A;  4OWW B;  1D5Z C;  4FK8 A;  1SSO A;  4FVM A;  5H1S E;  2GK6 A;  1PFM A;  4GQN A;  4LF4 L;  1TVX A;  3DXJ C;  2PNH A;  1C9O A;  2R7F A;  1CQF A;  3V05 A;  1BJK A;  1I4P A;  4YEL A;  1IJE A;  3TDQ A;  5I9P A;  2OCE A;  4X05 A;  3GQB A;  4U67 3;  1Y1W B;  1FR3 A;  5BN4 A;  3LNN A;  1SMX A;  4OON A;  3QG1 A;  3SJZ A;  2ES2 A;  3HOW G;  3S15 H;  2BE5 C;  1SE3 A;  3NXW A;  1C0A A;  1SRO A;  2I5H A;  3CCL A;  3B8H A;  5EAY A;  1MKH A;  1HZ9 A;  3RZO B;  2EYP A;  1S4M A;  3D0F A;  4C1N I;  4RD1 A;  4XLH A;  4WFN 3;  3AGP A;  1UE1 A;  3K57 A;  1W9X A;  1B53 A;  1F2Z A;  4HSP A;  4DUY L;  4G7W A;  3V76 A;  3UE0 A;  1IJF A;  2CWA A;  2N88 A;  4R4Q A;  2B39 A;  1M4V A;  4F7X A;  3C2Q A;  1RTN A;  1U4P A;  4GNX B;  2ID0 A;  4LF9 Q;  1NJI C;  2K5W A;  3ONA B;  4QJF A;  4JBK A;  4Z9C B;  4QL5 A;  2WJV A;  1KRT A;  4P71 A;  3EVQ A;  1YJ9 A;  4DNR B;  1PYB A;  3G6J B;  1Q81 D;  1BCP F;  2CHB D;  2F4V L;  1SBB B;  4WJW A;  5L37 A;  1BX0 A;  1NB9 A;  3LX0 A;  1A8P A;  1X32 A;  2DYI A;  4JW0 A;  4B43 A;  2ZJP A;  1VF5 C;  3JAM L;  2R93 H;  1XJV A;  1KL9 A;  2PQE A;  2A8V A;  2DNC A;  2HCI A;  3LGJ A;  3ULJ A;  1E1Q A;  2Q6K A;  1OXU A;  1E1T A;  1OXT A;  4DUY Q;  3ES9 A;  1WOO A;  1HTP A;  1RDP D;  3I72 A;  3A7A B;  2WZN A;  2JN4 A;  3MFG A;  2F0E A;  1STH A;  4A4I A;  1HNX Q;  1O7Z A;  2B5O A;  4HE5 A;  3M9B A;  4ZGQ B;  3OEE A;  2JN9 A;  4PAA A;  5NUC A;  1TWG H;  2RHQ B;  3R3O A;  4H13 C;  4L5Q A;  4C3J G;  4P2C B;  2DOG A;  3CPF A;  4YWL A;  4B08 A;  5AJ3 Q;  1Q82 C;  2Q6L A;  1JQY D;  1SR3 A;  1Y8N B;  1YBY A;  1HZE A;  2V7T A;  2BMW A;  1EY5 A;  1QB5 D;  4A3M H;  3OJX A;  2PCF B;  1ENA A;  2RC5 A;  2F0U A;  2PYK A;  1QUQ A;  1JJ2 A;  4KKT A;  4GN5 A;  3U6B A;  1AEX A;  1Z47 A;  2WII B;  1IKL A;  2CK3 A;  3CHB D;  5J35 A;  1T6Z A;  4XYO A;  4DK6 C;  1UMK A;  1WD0 A;  1PVO A;  3GVJ A;  1JE5 A;  1F9P A;  3C2P A;  3HRZ C;  1KD1 C;  2L9H A;  3TQY A;  2WYR A;  2AHO A;  2GA4 B;  4HMI A;  1LO5 D;  3F2C A;  1KIX A;  3DWA A;  3OW2 B;  5AFW A;  3ULL A;  1W3S A;  1VF7 A;  3J7Y W;  1KD1 D;  4X7E A;  1YEZ A;  3MZ5 A;  1XB2 A;  4Z4T A;  3SXH A;  3VYS A;  1L0W A;  2MUY A;  1QUF A;  4N9P A;  4TQU S;  5CV7 A;  4XQQ A;  4DV5 L;  4A3M G;  1BCP C;  4FF3 A;  3PO3 G;  3FJO A;  1P8L A;  5JEA H;  3A54 A;  1NCV A;  5M3M H;  4DK0 A;  4A3F B;  1VQ6 A;  1E0B A;  3H15 A;  4GLV B;  3SEB A;  1SMY D;  3CF5 A;  3VR3 A;  3W2F A;  3CCR B;  4PQX A;  1Q3L A;  5GAG C;  3K58 A;  4ASU A;  3CMA B;  3CCU B;  1BO0 A;  3FHW A;  1PRT C;  1MSG A;  4Z4W A;  4NNJ A;  2G9D A;  2RBM A;  2Z1C A;  4DV1 Q;  3MEF A;  4XOR A;  3OWE B;  2OBR A;  3BG3 A;  3PUM A;  1IZ6 A;  1NB0 A;  1V8Q A;  5K36 G;  1T9H A;  1NY4 A;  3VA7 A;  4DGZ A;  1TU2 B;  1GR1 A;  1I3Q B;  5E6T A;  1Y1V B;  1EQT A;  4A3G H;  3ZC3 A;  3MTS A;  1WSV A;  1VQG A;  3D6W A;  2F0L A;  1EQQ A;  2R7Z B;  2D5D A;  4PZ6 A;  1BCP B;  1TY2 A;  2B63 H;  1BPL A;  1K8A D;  1KRS A;  3A3B A;  4ZKC B;  4Z4S A;  1QVG A;  1G8Z D;  2V7X A;  3Q24 A;  1QCB D;  2A68 D;  3PO2 H;  1JWS D;  3A74 A;  1FGB D;  1F9R A;  3CPW B;  1CA5 A;  2XZO A;  4C3J B;  2C4U A;  1S5F D;  1EWC A;  5LL6 X;  3MAQ A;  1HNW L;  2V4D A;  3C1F A;  1LT5 D;  5BR8 L;  4XLA A;  4DR2 L;  3BZC A;  4IQZ A;  1EOT A;  2XZP A;  2OTL B;  4MIU A;  2JA7 H;  3Q8D A;  4Q7J B;  1XMQ L;  1XTD A;  3IFT A;  1AIP A;  4YCV A;  2ZXH A;  5C4X H;  3QFT A;  3KF8 B;  5J39 A;  1VQI A;  2BOS A;  1STE A;  3CCM A;  3W2D A;  4FWT A;  3EIV A;  3M7G A;  4OX9 Q;  4GKK L;  3J81 L;  1EYD A;  5C0X I;  2KCT A;  5C3E B;  3NWT A;  2ZTE A;  2NVT B;  1Y8P B;  3JQQ A;  1ICF B;  2K05 A;  4DXG A;  2B63 G;  1UNS A;  3GVL A;  3FP9 A;  1ENF A;  5FO7 B;  1IHM A;  1PH2 A;  2HDN B;  1CKN A;  1S5E D;  2IPK D;  4X3S A;  3ZUG A;  1HR0 W;  1ZYR C;  1EWI A;  2ZTD A;  4P2N A;  4OWX B;  4X7C A;  3D4R A;  3U9O A;  5C4X G;  4NCN A;  2B7C A;  3PIP 3;  3PVD A;  2XWB B;  3I55 B;  1CQV A;  1B2R A;  4K1X A;  4B3S L;  3G71 B;  4DAP A;  4Q5V A;  3W2I A;  3IAY A;  4YWM A;  4JI3 Q;  2GN5 A;  2Q6I A;  2KHS A;  1GUN A;  1WTH D;  1SYD A;  1E1O A;  2L0C A;  1K28 D;  3CB4 A;  3KF6 A;  5C44 H;  1E3X A;  2WSS A;  4Z4V A;  4RHR A;  1KLG D;  1RKN A;  3C3L A;  5EGT A;  3N6R A;  3S1N H;  1CUK A;  3J80 E;  1KDC A;  2V31 A;  4QVA A;  3PEN A;  2YYZ A;  3TME A;  5IGG A;  2KUM A;  4X6A H;  3ND9 A;  3NQI A;  3J81 E;  2UUC Q;  1X3G A;  4IFD J;  4J0Q A;  5HXB A;  4X8I A;  3G4S B;  1CKM A;  2K14 A;  1FDR A;  4TT3 A;  3V96 A;  2QDL A;  1G51 A;  5DEH A;  3PO3 B;  3PIO A;  2JIZ A;  4UY8 C;  5EPK A;  1D1K A;  3CCM B;  3I4M B;  1CK1 A;  1WI5 A;  2OWO A;  2DEU A;  3J7A F;  1E22 A;  1V1Q A;  3KEW A;  1Q86 D;  4AYB E;  3GVK A;  2X3U A;  1FRN A;  3UDF A;  1YIJ A;  4MTN A;  4JI6 L;  1VJS A;  5EJW A;  3Q38 A;  5IP9 G;  4JI5 Q;  3F8T A;  1EFC A;  4A3J B;  3RLF A;  1DGS A;  1MHW C;  3PIO 3;  4A3K G;  4GNX A;  2PMZ B;  2KEN A;  4X06 A;  1TWG B;  2VUM G;  1GUS A;  2WAQ B;  3ZZU A;  1LTL A;  4X62 Q;  1TKW B;  1K8O A;  2YU9 H;  4RD0 A;  2Q2H A;  1EFU A;  4JVZ A;  1PJ5 A;  4DV7 L;  2BH2 A;  1COW A;  4A3L H;  2JA5 B;  1A63 A;  1STG A;  4JI3 L;  2JYO A;  3JAM E;  1OXS C;  4BBS B;  4IO9 A;  1DON A;  2LXJ A;  3EFX D;  2ZZE A;  2FHT A;  4O1N A;  1IBM Q;  3GTM B;  4G1B A;  2VNU D;  2LKV A;  1G7S A;  3DEP A;  4XT1 B;  5KNC A;  1IW7 C;  1G7T A;  4LBY A;  4GN4 B;  1UD8 A;  1X3F A;  1CNE A;  3W1G A;  3H3V H;  4IUV A;  3PIP A;  4DR5 L;  4XN3 A;  2M00 A;  4K5W A;  4HJ7 A;  1Q81 C;  3PQI A;  2EYM A;  1P4M A;  2K5H A;  4K5V A;  5HGT A;  2WB1 B;  4MN3 A;  4GZY C;  3M4O H;  4IUU A;  4HTH A;  4FNF A;  4X3K A;  1M90 C;  4BXX H;  2O5J C;  4KV6 A;  4S3S A;  4J15 A;  1DJR D;  4A3D G;  1L1O B;  1E62 A;  1HZC A;  1YNN D;  2RA4 A;  4ZLT F;  4ROX A;  2F1M A;  2WAC A;  3EQL C;  5CBA E;  3STB C;  5M3M G;  5D3I B;  4DAM A;  1CTM A;  1XXG A;  1QUE A;  1IHZ A;  3AFQ A;  3PGZ A;  4BS9 A;  4WJ4 A;  3DM1 A;  2V7V A;  3VYR A;  2PNR C;  3PA2 A;  3WWV A;  1WD1 A;  3TSS A;  1LAC A;  3HOY B;  3TRZ A;  1QX4 A;  1WTP A;  1AE2 A;  1LM0 A;  1VQO B;  1MI2 A;  3QFC A;  1C4Q A;  1VMP A;  1G7C A;  2OQ0 A;  5GAH C;  1PTO D;  1A3T A;  1JIC A;  1A8V A;  1CKO A;  2K5N A;  1KJZ A;  2R7Z H;  2BGJ A;  4QVJ A;  2VS1 A;  4GLA C;  3MEH A;  2SOB A;  1EFR A;  3W3A A;  2HIV A;  3V7A A;  5A2Q E;  1PTO C;  1YJN B;  4UDU C;  2Z6B A;  5DS0 A;  3T4A C;  1QIL A;  5M5W B;  3UI2 A;  2CH4 A;  4K14 A;  1HUM A;  1W35 A;  4AC9 A;  4WZL A;  1TWA H;  4H0L C;  1EEI D;  2MJ8 A;  2ZL6 A;  1BF4 A;  3W5H A;  2PMZ E;  4QUZ A;  2YWG A;  1QZG A;  4EX5 A;  4PGO A;  4YWK A;  3LQ6 A;  4JOI C;  3DM3 A;  1TWH B;  3W5U A;  1O7L A;  1EXM A;  4TSF A;  2LS0 1;  1GXD C;  4RGO S;  1HUN A;  4L5T A;  1J8I A;  3GO5 A;  4QQB X;  4L6T B;  1BKB A;  1JCK B;  1ESF A;  1BNZ A;  2PO4 A;  1TTT A;  1C48 A;  3G05 A;  1L1O A;  1HA6 A;  3BZK A;  1SNC A;  1VQM A;  2NUC A;  3CRL C;  4M0L A;  1HVX A;  2KEE A;  2K04 A;  1G6Z A;  1M8A A;  4X64 L;  1J9Z A;  1SE4 A;  2WB1 G;  1MAB A;  1H9R A;  5F4O A;  4C2M H;  2Z6B D;  4X64 Q;  1NBM A;  3OTO L;  4DV3 L;  2EY2 A;  2HDM A;  2FVG A;  2C77 A;  1X54 A;  2GRE A;  1HPC A;  1YIT A;  2WB1 E;  3K59 A;  4YAL A;  3TS0 A;  1B70 B;  4FF2 A;  2BSA A;  2MGS A;  3BJU A;  3D3R A;  1B9N A;  3OP1 A;  3NTH A;  3GIR A;  4KN7 C;  4POG A;  4JI8 L;  1B8A A;  5HGQ A;  4FXK C;  5A88 A;  3S1M B;  3GP7 A;  1GUT A;  4A3B H;  3ISX A;  1K0R A;  3JU4 A;  4CJ0 B;  3CCQ A;  1CKN B;  2BCO A;  2NVT H;  1AFP A;  2DJG C;  3RN5 A;  1N08 A;  1Q46 A;  1I4G A;  2JK8 A;  3A5U A;  1R9T H;  2C5H A;  2VNJ A;  2CQO A;  1EZ6 A;  4ODG A;  3JAM c;  3KUP A;  4LUO A;  4BA2 I;  2EJF C;  5IYN A;  2EJM A;  2RKS A;  4F87 A;  3GV6 A;  2O2L D;  3HKZ B;  3I91 A;  1PJ6 A;  3J80 L;  2K7V A;  3PUY A;  3BVG A;  4PG3 A;  1ZM2 A;  2P3M A;  1D8T A;  3QE2 A;  4N3N A;  2E76 C;  1PH3 A;  1UE5 A;  2QTL A;  1O7Y A;  3MHP A;  3CAM A;  3QSY A;  3W5O A;  5JEA G;  1HA5 A;  3TP7 A;  2HIX A;  4RHS A;  1H9J A;  1X3E A;  1ZUN B;  2VBS A;  4ZCL A;  1CFM A;  3HEJ A;  3IL8 A;  5C3E G;  3HOU B;  4A3D B;  3HFZ B;  2L55 A;  1CSQ A;  2Q6O A;  1CSP A;  4R4O A;  4QIW B;  4M1K A;  1SYF A;  2N8N A;  1VQ8 B;  4KMU C;  3FVQ A;  1F77 A;  1O80 A;  2K33 A;  4XQF A;  2OQK A;  3ERS X;  1DDG A;  1SDF A;  1H85 A;  1VQ4 A;  2EYH A;  3BZD B;  4X65 Q;  1PTO F;  3VR6 A;  4A3J G;  2D9R A;  4A93 H;  1OHH A;  2KHI A;  4GNX C;  4P72 A;  4RMF A;  1T6X A;  1AE3 A;  1QVF A;  2FFK B;  1N07 A;  4DR7 Q;  1XYI A;  4Y9U A;  2GJK A;  2RQX A;  4O42 A;  1DOK A;  4UZU A;  4C3I G;  3H9N A;  1ET9 A;  2K32 A;  1GHK A;  1WOS A;  2VZL A;  4XYQ A;  3J80 c;  1N36 Q;  2LZJ A;  2DJF C;  3W2H A;  1RJT A;  3E5S A;  4IUT A;  5G3L F;  4JC0 A;  2PLF A;  3PO2 G;  1I3Q H;  1QZH A;  4ZV4 A;  1HQR D;  1N05 A;  4XM3 A;  2JA5 H;  3SJP A;  3ZJY C;  2FJ2 A;  3L2P A;  2F03 A;  3PA1 A;  3CD6 A;  4N8X 1;  4JI0 L;  1HRJ A;  4ZCI A;  3P27 A;  4R4I A;  3K7A B;  3NPP A;  2XGJ A;  4RPD A;  4APV A;  3S1N B;  2UUB L;  1PTO B;  3WBK A;  1NUC A;  4KK7 A;  2IJ0 A;  1YX2 A;  1LUZ A;  1KTV A;  2WJY A;  2HLD A;  5FK9 C;  4JI7 Q;  4HJA A;  4CQJ A;  1LTR D;  2X6X A;  5IGD A;  1R5N A;  4OO1 I;  4XN0 A;  1R5O A;  5IT9 c;  1TS4 A;  4OWT B;  1FNC A;  3Q6R A;  4HJ5 A;  5IYD G;  5FLM G;  1F2M A;  1K8A C;  5CBE E;  1QH0 A;  1JWU D;  1EEF D;  5CMD A;  2JA7 B;  4M53 A;  1J9O A;  1EL0 A;  1VQ8 A;  5EMN A;  1FNV A;  2TSS A;  2D74 A;  2EOT A;  5GAD C;  2E1R A;  1IYJ B;  1VQC A;  1OB2 A;  2DY8 A;  3SGI A;  3CMM A;  3SR1 A;  2TMP A;  3I7F A;  1BDO A;  2UXB Q;  3DWP A;  1I94 Q;  2XND A;  3DLL A;  2X6G A;  1HR0 Q;  1EOV A;  1SE8 A;  2QMU A;  5KNB A;  3WY9 A;  1TS2 A;  1WPC A;  2N3S A;  2WAQ G;  3OPO A;  1PRT D;  1ML0 D;  1RL2 A;  1XFO A;  3R8B A;  4B3G A;  1VQA A;  4LFC Q;  4XOP A;  2E2I H;  3CD6 B;  1FD7 D;  3PUZ A;  4XKV A;  1PJ7 A;  1KAW A;  4G6I A;  1E24 A;  4UHV A;  1PYW D;  1IKM A;  1IYU A;  3M4Y A;  5GRO A;  2X6L A;  1FL0 A;  1K8G A;  5JJI A;  4HR7 B;  4EQ5 A;  1NTG A;  2IHE A;  1PTO H;  4CKC A;  4JI2 Q;  3ITP A;  1S5D D;  2G5D A;  3ER0 A;  1PDQ A;  2CQA A;  4BBS H;  1XNQ L;  3OHX C;  1H42 A;  2NB0 A;  2OXP A;  2K6A A;  1B23 P;  4A3C H;  3AVY A;  4O0A A;  4FXU A;  2B29 A;  4OIJ A;  1EYC A;  4DQL A;  4PV1 C;  1PMR A;  3I4O A;  1VQB A;  2NTT A;  4A3K B;  3ASP A;  1EY4 A;  4G1V A;  3BCD A;  2GK7 A;  4ID6 A;  4JV5 L;  2F0O A;  4CDD C;  2JXM B;  2Z6K A;  3CCL B;  2LXK A;  5HUR A;  4NXM Q;  1Y69 U;  2KCN A;  1G2T A;  1P16 A;  5I9O A;  3WOF A;  1Q7Y C;  4YAO A;  1GJR A;  5HY6 A;  5C4H A;  2YTY A;  1U4L A;  2JEB I;  3HG9 A;  1PH8 A;  1UEB A;  4RWS C;  3TBI B;  1U4M A;  5IYW A;  4DV4 Q;  4GLX A;  1KRH A;  3VNV A;  4X66 Q;  3CME A;  4JI0 Q;  2X6Y A;  4OOS A;  3OJW A;  1O7I A;  4FYD A;  1E1R A;  3KDF B;  4CJ1 B;  1VQF A;  1CI3 M;  4RG1 A;  2B2T C;  4DN4 M;  4M2L A;  5IYP A;  2EY6 A;  2N49 A;  4H9G A;  5LL6 S;  2I07 B;  3A5Z B;  3JQR A;  2Y0S G;  5ELN A;  4YY3 L;  1EWY A;  1II3 A;  2F0I A;  3NEL A;  3S1M H;  4A3B B;  1X3P A;  1XE1 A;  1DG1 G;  1OGJ A;  5H59 A;  1VQM B;  1TUI A;  1N0V C;  2A6H D;  4RDL A;  2UU9 L;  4A3I B;  4HID A;  3P75 A;  4Z4U A;  1VCI A;  2VQF Q;  3OW2 A;  2D0P A;  2F43 A;  1TWA B;  2WR8 A;  3ASS A;  2NN6 I;  4IPH A;  4B9X A;  2Q2I A;  1R5B A;  3AYH B;  5EKK A;  1OGI A;  2XSC A;  3M4P A;  1EY0 A;  5TR9 A;  1VQE A;  4ZGN B;  4DFA A;  4JMQ A;  4K0K Q;  2AKW B;  4IJL A;  3SK6 A;  1XPR A;  1K73 D;  1XNR Q;  3CC2 B;  4PC6 A;  2UXD Q;  5D65 A;  3ASQ A;  2H5X A;  2NYZ D;  3PV0 A;  3ULP A;  4KHP Q;  1WTO A;  3B82 A;  3C46 A;  2JA8 G;  2MP1 A;  1U2R A;  2NN6 G;  4LFA Q;  1O78 A;  5JAV A;  4WZE A;  4BBR H;  3J81 k;  4F7D A;  2RSO A;  1BUV T;  2UU9 Q;  1WVL A;  1I50 H;  4OPO A;  1CM9 A;  4P75 A;  4F8M A;  4XT3 B;  3M85 A;  1V9P A;  2CKZ B;  1M1K C;  3CQZ H;  3KJP A;  4JG2 A;  2HMA A;  2PI2 A;  4K2L A;  4XNF A;  2ICE C;  4EVO A;  4LF6 Q;  3GTK H;  2Q2T A;  4R4T A;  2NVQ H;  1ZYR D;  4RD3 A;  4Y7N H;  3GTQ B;  4I7A A;  2B8G A;  5KND A;  4R9W A;  4ZAI A;  4TMV A;  4HJ9 A;  1D6E C;  1MGS A;  3T51 B;  3RLN A;  2DCU A;  3U2Q A;  1EYA A;  1IL2 A;  1D5X C;  1WJJ A;  3ZZ0 A;  2UXD L;  2BA1 A;  3I8Z A;  4HE6 A;  1VQO A;  4DQK A;  2NTS A;  4H44 C;  1PKV A;  2K01 A;  5I2Y A;  4GKJ Q;  4KHP L;  1VQ9 B;  3AFP A;  1PFS A;  3AGQ A;  4LFA L;  2R92 H;  3D31 A;  1AP0 A;  3AVV A;  1Y8O B;  4BY1 H;  5LMU Q;  4IUN A;  1YNN C;  5M3M B;  2J7K A;  4RD4 A;  2CRV A;  1X56 A;  4IUR A;  2RCF A;  1BQE A;  4CDF C;  3ONY A;  1PYS B;  2EY1 A;  2ZXR A;  3DDY A;  2WKC A;  3CME B;  1KAA A;  1LTI D;  1VQL B;  4OPS A;  1L1O C;  5D14 A;  1DCZ A;  2UUA L;  3EA6 A;  5KEE A;  3G48 A;  4EQP A;  1SYE A;  3S17 B;  3NK9 A;  5IE8 A;  4P22 A;  1GAQ A;  4PNY A;  4A3G G;  1Q7Y D;  4OGQ C;  2CW5 A;  4BBR B;  4HAE A;  1SND A;  3KLS A;  4HJ8 A;  4G4K A;  3HZX A;  2KVO A;  3M4O B;  2F52 A;  1D1N A;  2SDF A;  4IPG A;  1E43 A;  3P7J A;  3VA5 A;  1Q12 A;  3T1Y Q;  1Q9S A;  1Y0R A;  2I5L X;  3CQZ B;  5M5X H;  2D0O A;  1ONL A;  1B3A A;  5IYB G;  2YTV A;  5ELD A;  3BCF A;  1Q86 C;  5IP7 G;  1AZQ A;  1N06 A;  1FVI A;  2M2L A;  3LO8 A;  5M3F H;  4P3I A;  4IJH A;  1YHB A;  2ENB A;  1HA3 A;  5CV9 A;  3DMU A;  5IP9 H;  3OZW A;  3R6K A;  2V7U A;  2F4I A;  3A8K A;  3BDO A;  4LWC A;  1KQS B;  2A69 C;  1ZXT A;  4DV6 Q;  2BA0 A;  1E2W A;  4XOT A;  4K0K L;  2CW0 C;  3M4Q A;  4BY1 B;  3KBG A;  1VQD A;  2ZZQ A;  4IZ8 A;  1IBL Q;  3HOZ B;  2K28 A;  5JVG 3;  3K7A H;  1WOR A;  2B2Y A;  5DSZ A;  1KK0 A;  4G7O C;  2X85 A;  3IRB A;  3CCV B;  4JI1 L;  3CC7 A;  3W1B A;  4ZUI A;  1QFZ A;  4NW2 A;  5HKK A;  4Z4R A;  2W6I A;  1VQL A;  1HZA A;  4A3K H;  3KOJ A;  5C3E H;  4P73 A;  3P20 A;  4JYA L;  1YIJ B;  2JA9 A;  4DV1 L;  1C7Y A;  3HOY H;  2VUM H;  3RZD H;  2PZU A;  2OYN A;  3MXN A;  1EU3 A;  4RDK A;  3HOV B;  3J7A V;  3S16 H;  1F9Q A;  1DM0 B;  1LT6 D;  4HCS A;  4TSS A;  3U58 A;  2UXC L;  3A3G A;  2IX3 A;  1K83 B;  5KYI A;  5BSX A;  5TY0 A;  3A8K E;  3P1H A;  5T1I A;  1CZG A;  1LTS D;  2ZBU A;  5B6I A;  1I4Q A;  2ZT9 C;  1LTT D;  2B2W A;  5EBC A;  5C0X H;  1QGA A;  2KEC A;  4P9S A;  4GN3 B;  1CNF A;  1N32 L;  3U50 C;  1E79 A;  2CF4 A;  5CDF A;  4IN3 A;  2X6W A;  2WZP P;  1Z6H A;  3OOC A;  1BX1 A;  3KYH C;  2K4K A;  2EIX A;  4YHH Q;  1HFG A;  2BDN A;  4CGY B;  4P6V F;  4UPA A;  3NBH A;  1YNJ C;  3SLD A;  3AVU A;  1A2T A;  4HED A;  4QCL A;  2MHV A;  4EQO A;  4IW3 B;  4GOP B;  4RD2 A;  1YJW B;  3BYT B;  3MXN B;  4CKE A;  1GHJ A;  3DUZ A;  5D3D A;  2YU9 B;  3S9W A;  4ME5 A;  1I4R A;  1UWV A;  2ZXO A;  4DR4 L;  3QOL A;  2FXQ A;  5FLX c;  4ZCK A;  1PV4 A;  2CWP A;  1DOM A;  1I6H B;  2JP1 A;  1KNE A;  2E1B A;  2R6H A;  1B3Q A;  5C5M A;  4OL7 A;  4ULL A;  2VNK A;  3RN2 A;  1N0U A;  2L4N A;  3BY1 A;  3D4W A;  4X7F A;  3CCE B;  1KDA A;  1WTQ A;  5FOB B;  2EE1 A;  2JJ1 A;  1RCV D;  4PMW A;  3WOE A;  5IYC G;  5C4J H;  3CTA A;  2LY7 A;  3IFD A;  3OEH A;  3VNU A;  2A6E C;  3TP8 A;  4LNQ A;  3AMU A;  5DAU A;  4NB3 A;  4KHZ A;  4YEJ A;  2A68 C;  1F20 A;  3D26 A;  1N33 Q;  5THX A;  2EYL A;  4KY5 A;  1AN8 A;  2F4N A;  3NBH B;  3AB9 A;  3FEW X;  1VQ9 A;  2A6E D;  3SK5 A;  1V1P A;  1TY0 A;  2WFW A;  2XN9 C;  1YLO A;  4B3T L;  5ELC A;  3K7U C;  5FLX E;  1SRU A;  4IAL A;  4DR5 Q;  4P1V A;  3OE7 A;  4PC3 A;  4KHV A;  2QE7 A;  4A3B G;  3D4D A;  2L1B A;  2F0Q A;  1TS3 A;  4ZK9 B;  3GTL H;  1W34 A;  2XOK A;  3IKJ A;  1IBK Q;  4IUQ A;  2DN8 A;  2N55 A;  2VY3 A;  4C3J H;  5TV2 A;  3BU2 A;  2E5L L;  4A3D H;  1GO2 A;  4HSV A;  3RUZ A;  5IT9 E;  2MO0 A;  4DUZ L;  2C35 B;  4TMX A;  3U4V A;  1WTV A;  3K0Y A;  1U4R A;  3U6K A;  3I4N G;  3Q22 A;  2LMC B;  2Z6K C;  2QF7 A;  2VQE Q;  3T1H L;  2A1A A;  4RGT A;  4BA1 I;  3MMP A;  2C5C A;  5A35 A;  4LF5 L;  2NVQ B;  5HZB A;  3H09 A;  4Y7N B;  3GTQ H;  3CRK C;  2AUK A;  3KK7 A;  2EYJ A;  3T56 B;  1WOP A;  5L46 A;  1ASY A;  3CW2 C;  4IFD I;  1JJG A;  1J5E Q;  4C1N K;  4LMQ D;  4IOC A;  4M8A A;  2QGQ A;  3A1P A;  5A89 A;  2KHJ A;  4ZUJ A;  3F2D A;  1HQM C;  4KN4 C;  4DR3 Q;  1VLY A;  4JI7 L;  5M5X B;  2JJQ A;  4NKL A;  2O5I C;  2B2V C;  2EVB A;  5IY0 A;  1MIU A;  2E2D C;  2Y0S E;  4GOP A;  2E2H H;  4OX9 L;  4YAU A;  2FMM A;  4WOR A;  4DU9 A;  2C78 A;  4YAW A;  1D8L A;  1NBW A;  4RJL A;  4TMZ A;  5FL7 A;  2X53 S;  3OTO Q;  3QR8 A;  1VQJ A;  2F1L A;  4YHB A;  4XMY A;  2K50 A;  2FX3 A;  1JE4 A;  3T1H Q;  1K73 C;  3ZBT A;  5FJ8 H;  3RLO A;  4I7Z C;  1SN8 A;  1ESR A;  4RFB A;  5C44 B;  2A69 D;  1KK3 A;  4B3R Q;  1MBY A;  3Q0A A;  2IHF A;  2I46 A;  1W0J A;  2VBT A;  4A3M B;  1YNJ D;  3HOX G;  1J5E L;  4KI0 A;  4BXX G;  4K5X A;  3FPP A;  3L7Z C;  3WQZ A;  5FO8 B;  4XLE A;  1EIF A;  1I4X A;  2IX0 A;  4EQN A;  1R4Q B;  2KCC A;  1BBW A;  1JNY A;  4LK1 C;  3L9A X;  4PMC A;  2F0T A;  2BH8 A;  3HOU H;  4XXE A;  2R92 B;  3TP6 A;  5ISR A;  1PFN A;  2BM1 A;  3FPK A;  1UE6 A;  3JAM i;  1NRK A;  1PHJ A;  1V0E A;  4YAF A;  2DNE A;  4RKL A;  3TRE A;  1K9M C;  4OPV A;  5IWA L;  4FO2 A;  1YJ9 B;  2XZL A;  2YWE A;  1L2F A;  1WTW A;  5LMN L;  4RDJ A;  1A3U A;  5JJK A;  3OFN A;  2QA4 A;  1TWC H;  3ERO A;  3KLS X;  2OBT A;  2X69 A;  2Z0S A;  4H02 A;  5LMN Q;  1VQK A;  3CP0 A;  1GUG A;  1KLU D;  3S16 B;  1U5K A;  2VBU A;  3CCS B;  4C2M B;  1SNO A;  1SKQ A;  5IOD A;  1N8R C;  4Y9R A;  3M7N A;  4A3E G;  4B3R L;  1I94 L;  2LFN A;  1NJI D;  2UUB Q;  2DY7 A;  2DUD A;  4X07 A;  3E0J A;  1TLL A;  3CXC A;  3U4Z A;  3FKI B;  4LBW A;  5K5P A;  4XQJ A;  5K36 H;  1NAP A;  1RQR A;  4Y52 H;  4OP7 A;  2YWH A;  3EBE A;  4B48 A;  1X55 A;  2D2C C;  3TP5 A;  1OTC A;  3UDX A;  4ILW A;  4KKU A;  4TMT A;  1G7R A;  2K52 A;  3MWY W;  5E7N A;  3CP8 A;  4XTC S;  2WKD A;  2I0Q A;  1BXT A;  4R8N A;  2BF4 A;  1NMG A;  5EQ0 A;  1QNU A;  5EKI A;  1I18 A;  4A93 B;  3KLW A;  3CCJ A;  1ILP A;  1IYV A;  2EY5 A;  2UXB L;  2OT2 A;  3QO2 A;  4YCU A;  1L0X B;  2F3V A;  2NVY B;  1EY9 A;  2QEX B;  2BDO A;  2CC2 A;  4AF6 A;  2F0D A;  2G9H D;  1S4Z A;  3HOW H;  1NNX A;  3R2T A;  5AJ3 L;  3F2B A;  4B9W A;  5F2D A;  2Z9H A;  3T16 A;  3HOX B;  1FNU A;  1X9N A;  5CGK A;  3MVV A;  2HHH L;  3B6Y A;  4DAY B;  3SVM A;  3ZBU A;  4PC7 A;  1G2S A;  2CW0 D;  3L0O A;  4G57 A;  1WSR A;  3I1F A;  3AQQ A;  5C0X G;  1AZP A;  1HNZ Q;  1SYC A;  5M5W H;  2DET A;  1SFO H;  1S72 B;  1PFB A;  1PH9 A;  1PZK D;  5F4J A;  2KCM A;  1GUO A;  3WNC A;  3WNB A;  1JJ2 B;  1QUQ B;  1Y14 B;  2D9U A;  2XEX A;  4LUZ A;  5CV6 A;  2B3G A;  1X3Q A;  2RDG A;  5LMN W;  1PZJ D;  2F0S A;  4RCN A;  2F0W A;  1WCM B;  5KGU A;  2I5M X;  2E74 C;  4DV6 L;  5EPJ A;  4GKK Q;  4DKA C;  1BOS A;  3EN2 A;  3MXU A;  4ABN A;  3VR4 A;  1IBM L;  5IOC A;  4II2 A;  1A15 A;  1Q1B A;  2HHH Q;  2L5T A;  4WZT A;  3NQT A;  2PQA A;  1ASZ A;  4UAJ A;  3E9I A;  3ASR A;  1ZM9 A;  1AW7 A;  1K8M A;  1OXX K;  3HOZ G;  1V0F A;  3QFR A;  4A3C G;  2RC6 A;  3I73 A;  3NTK A;  3A8J E;  5J1Z A;  4C3H H;  2A19 A;  2WAQ E;  4RKB A;  3HOY G;  1UAP A;  2JE6 I;  4BPR A;  2SNM A;  3GTO H;  4E6I A;  2VB2 X;  2GVA A;  3CP2 A;  4K2K A;  1NDH A;  1EZ8 A;  1I6H H;  4HCE A;  3AVX A;  4B3F X;  3VO2 A;  4JOI A;  5T1G A;  3GTG H;  4PMB A;  2VL6 A;  2JEA I;  4JI6 Q;  1QFJ A;  1IW7 D;  1MD2 D;  1YJN A;  2SEB D;  5C4J B;  1XMO Q;  1XQB A;  4PC1 A;  1KDB A;  2BM0 A;  3S14 H;  3KDF A;  4FP5 D;  4CBV A;  5BR8 Q;  1HNW Q;  1SLJ A;  3H94 A;  2F0V A;  4DV4 L;  2FIN B;  1YZ6 A;  2B2U A;  2F0J A;  3J7Z C;  4RCY A;  1F60 A;  1ET6 A;  4JCV E;  3SHL A;  1TWF H;  3HOZ H;  3URY A;  2UUA Q;  2V7Q A;  4KY7 A;  5JOB A;  4BY7 G;  3GV3 A;  1VQ5 B;  2Z4H A;  1HTL D;  4MHE A;  4PZ8 A;  1F9S A;  1SEB D;  1JOQ A;  4EH1 A;  3L3O C;  1LV9 A;  1WTR A;  1WTH A;  2XGT A;  5C44 G;  3NEM A;  5IYR A;  3Q39 A;  1I50 B;  5M3F B;  2XWJ B;  4YXW A;  4NP5 A;  1DZ1 A;  3RD4 A;  1H95 A;  2MNA A;  1W87 A;  1W2B A;  2VYQ A;  3K0X A;  3KF8 A;  1XTC D;  4XD7 A;  3CU7 A;  4B4D A;  1KMH A;  2JSO A;  4RGN A;  1YI2 B;  1HH2 P;  4AQY L;  2Z4I A;  2HD3 A;  4AYB B;  3SLN A;  5GQO A;  2QKI C;  3HOU G;  2E2J H;  5CYU A;  3HKZ E;  1XWE A;  2ZM6 L;  1OB5 A;  3BH4 A;  3ZPN A;  4A3I H;  3TN2 A;  1TS5 A;  4Z4Y A;  3VDY A;  1B2T A;  3SKB A;  3OWF A;  4B3M L;  4LFC L;  4CDC C;  3HAG A;  2P5Z X;  4MYT A;  4A76 A;  2NBF A;  3CRZ A;  2R61 A;  5I2X A;  1XPU A;  4C43 A;  1SNP A;  3QB3 A;  3ZZT A;  3PUX A;  4JK1 C;  3SEJ A;  4N9T A;  2QGG A;  4MNO A;  4ZQ3 A;  2WPD A;  1H8E A;  1QVG B;  1NMF A;  2AMC B;  4DK1 A;  1A3V A;  4JPB W;  2VJI A;  2HQL A;  1WCM G;  1B44 D;  4UZF A;  4C0S A;  4CJ2 C;  1JB3 A;  4Q0F A;  1W6K A;  1ENC A;  2CH4 W;  3S24 A;  2ZM6 Q;  1JOR A;  2E5L Q;  3B78 A;  1G6P A;  3PCO B;  3S2D B;  2GVB A;  1JB9 A;  1W6J A;  2NN6 H;  2V1C C;  1XNR L;  1JWM D;  1W2B B;  3BVZ A;  1SKY B;  2X8K A;  2KOL A;  2ZTG A;  1V1O A;  1EP3 B;  1SM4 A;  1Q82 D;  5TSS A;  3H91 A;  5J22 A;  4NXM L;  2PIA A;  2UUC L;  3FKI H;  4ALP A;  5JVH 3;  3AVT A;  4K6L A;  1S72 A;  1SE2 A;  1EIY B;  1TQO A;  3V2T A;  2XNJ A;  1FRQ A;  2YV5 A;  3A55 A;  3KBX A;  2PW7 A;  2C2W A;  3K81 C;  4QGU A;  1VQN A;  4FN5 A;  2ZXI A;  3CCJ B;  2GQF A;  2LSS A;  2K5D A;  5IYQ A;  1TWC B;  1CA6 A;  4LF6 L;  1EFT A;  4AIM A;  2VBV A;  2ZIT A;  5KNL A;  1HJP A;  1KTK A;  1C8C A;  2JA8 B;  3I56 A;  4TKO B;  1QGY A;  3A35 A;  1RTO A;  2E8G A;  3GTK B;  4GOP C;  2QA4 B;  3UDG A;  2MFI A;  2VXW A;  2NVX H;  4B3M Q;  4DR4 Q;  3ZIA A;  1HXY D;  2ZXP A;  1S5B D;  3CKI B;  4KJO A;  4TN1 A;  3WXM A;  4QHY A;  1SAP A;  3D6C A;  3H6M A;  3T1Y L;  1JA0 A;  3HOW B;  3S1Q H;  4UP8 A;  1N36 L;  1VDZ A;  4J6H A;  3SDZ A;  1GD7 A;  1PH1 A;  2VNI A;  3KFU A;  4YIJ A;  1PH4 A;  4DR2 Q;  1ROD A;  4B3S Q;  2ZJR A;  1PLF A;  3WYA A;  4PZ7 A;  3CPX A;  1A2U A;  1A6X A;  4QIW E;  2JA7 G;  5CV8 A;  3G6E B;  2OBS A;  3RZO H;  4U9U A;  4Y7C A;  4L8J A;  3CC7 B;  3R6J A;  3AEV A;  4AVZ A;  1S40 A;  3E9H A;  2RDH A;  4I65 A;  5CV5 A;  2D3N A;  2VW9 A;  3P26 A;  1K3B C;  1KK1 A;  3I4L A;  4QY7 A;  1JOO A;  3A56 A;  2VJJ A;  1YHQ B;  3TS2 A;  4BY7 B;  2H4O A;  3GSI A;  1E3P A;  1EY6 A;  2EXZ A;  1FYC A;  2J0T D;  2PI2 E;  3HS0 C;  2BPO A;  2XNC A;  1AMO A;  1QG7 A;  4L63 B;  2RF4 A;  2E2H B;  3I4M G;  1QVC A;  4OIK A;  3SK8 A;  3S15 B;  1FNM A;  4N8F A;  4A3E H;  4MYU A;  4JI8 Q;  4DXF A;  5E4X A;  2QN6 A;  4LF9 L;  4TMW A;  4C3I B;  1B50 A;  3T13 A;  1RQP A;  4P26 A;  3MXG A;  1VQ7 B;  2RVL A;  4DR1 L;  3E1Y E;  1CHP D;  4ZRZ A;  2DIE A;  1TR5 A;  2CND A;  3BVM A;  2EZV A;  2PPB C;  1EU4 A;  3H3V I;  4H7B A;  4A3L G;  4A93 G;  5KIX A;  3J81 j;  2L11 A;  1EP1 B;  3KF6 B;  4XKW A;  1GM5 A;  4LF5 Q;  1BCP D;  3NSW A;  3Q6S A;  1VQ6 B;  1QOH A;  5H5J A;  3MHB A;  5HZA A;  3VMF A;  1TII D;  4IOA A;  4A3G B;  4FDB A;  1WP6 A;  4IPC A;  2BGI A;  4ZKB B;  1B7Y B;  5LMU L;  1EQR A;  2Q8R E;  2IWH A;  3QWN A;  3A8I A;  2A73 B;  5DNF A;  4DR3 L;  4LF4 Q;  4UAI A;  1JR0 D;  4ZCM A;  1TVC A;  3H0G B;  3JC6 6;  4G7Z C;  3UE1 A;  4P3Y A;  4IPD A;  1DDI A;  1TWH H;  5GAE C;  1V43 A;  1JT8 A;  1YHQ A;  1PH7 A;  4XON A;  1FNW A;  1VLO A;  4OEM B;  4PC2 A;  4G7X A;  1QJO A;  4C3H B;  5IYD H;  2OF1 A;  4OO1 G;  2XNA C;  1S5C D;  4JBJ A;  1S0U A;  3BNW A;  3X3N A;  1EFW A;  5KSW B;  3NWS A;  3WBJ A;  3GTP H;  3OIQ A;  4DPG A;  5IYC H;  4QFM A;  5JJZ A;  4OOV A;  1KAB A;  2JJ2 A;  1GOZ A;  2QDX A;  2C9O A;  1OB0 A;  1NR2 A;  5KYL A;  5CC4 A;  1EIG A;  2ICI A;  5ELE A;  1K28 A;  4FXD A;  5EBD A;  4P25 A;  3TZU A;  2N78 A;  3BC9 A;  2F3I A;  3K5L A;  4LF8 Q;  3CCS A;  2RSN A;  3D8G A;  1H9S B;  1BR9 A;  3GTL B;  1SNQ A;  2VQE L;  5FNZ A;  4KY6 A;  5F4M A;  4LF8 L;  2IY5 B;  3FKS A;  1K9M D;  2C5B A;  1Y0Y A;  3NE5 B;  2KJX A;  3LWE A;  4V0B A;  1G29 1;  3A8J A;  3S17 H;  2BE5 D;  5COY A;  5I6Y A;  4LF7 L;  2HCJ B;  4N3G A;  2MPM A;  2EJG C;  3HOX H;  1KNA A; 
#chains in the Genus database with same CATH homology
 2K03 A;  2R6G A;  1SJE D;  3NBI A;  1PRT F;  3H3V C;  4KJN A;  4RH6 A;  5I4D A;  3PMF A;  2EDG A;  3M3Y B;  2EYO A;  3ERQ A;  1BBX C;  3MC0 B;  1GJX A;  4KTA A;  3OAA A;  2KA7 A;  4IFD G;  1NSN S;  2E2J B;  1LLR D;  2QCP X;  3U9S A;  3R2I A;  3A7L A;  3BYY B;  5IT9 L;  2KVM A;  2B63 B;  2F0N A;  3I70 A;  2VB3 X;  4KD3 A;  2XRS D;  2F0K A;  1STA A;  5FLX L;  1R4P B;  3EJI A;  1ICW A;  5C0X J;  2AWN A;  4HN7 A;  2HUG A;  1ILQ A;  4X3T A;  3BDL A;  1EIH A;  1JC7 A;  4DAV A;  2F0P A;  5IK2 A;  3F2U A;  1XX8 A;  2D3L A;  1GUW A;  4RGM A;  1TT2 A;  3DWQ A;  4LJZ C;  1NR4 A;  1SYG A;  2HDL A;  3OIP A;  4BWG B;  4RAU C;  2CVR A;  2PW5 A;  2NWG A;  1T5X D;  5FKA C;  5FO9 B;  3K5N A;  2VUM B;  4CKB A;  1V1P B;  3BDC A;  3HGB A;  2GJP A;  2NZ1 D;  2H1E A;  2J7Z A;  3I3C A;  4QB4 A;  4WRD A;  1CT1 D;  2JA6 B;  2M5S A;  1BQQ T;  2AWO A;  1FX0 A;  3BS1 A;  3VR5 A;  1LTG D;  3ND8 A;  2A74 C;  5EPL A;  1UEA B;  1DYQ A;  1RF2 D;  3OSO A;  4XL9 A;  1UD3 A;  3DHQ A;  4F88 A;  4ZYS A;  2W6J A;  3FMC A;  1HFN A;  1D2B A;  2AQ3 B;  4DF7 A;  1LTA D;  4IFD H;  1BMF A;  3S1R B;  1SNM A;  1B4O A;  1EFI D;  1MSH A;  4FXG C;  5JPN C;  1ZEQ X;  3SE0 A;  5E1F A;  1UD2 A;  2M9V A;  5BN5 A;  5ELB A;  1D5M C;  1H9M A;  1W0K A;  1Q1E A;  3AU7 A;  4K6D A;  5LHY 1;  1STN A;  4DAY A;  3PO2 B;  4DNT B;  1I4H A;  2WP8 J;  1KZL A;  2WIN B;  3K5M A;  2SNS A;  4FF1 A;  2WV6 D;  1HHV A;  1T5E A;  4XQN A;  3GTP B;  1DXM A;  5JEA J;  2XIW A;  1I8D A;  3S2H B;  1HCZ A;  4HIZ A;  2B2V A;  2PZT A;  5C6A A;  1Q8I A;  5KRU A;  3QJY A;  5IGF A;  3KLR A;  3G7L A;  1I6V C;  1IL8 A;  2A6H C;  3SK4 A;  1LTB D;  4J1M A;  4KD4 A;  1EY8 A;  2F0M A;  1OO9 B;  1SMY C;  1UD4 A;  2K5Q A;  3VYU A;  2OEO A;  3K6O A;  3HP3 A;  1CHQ D;  4X3U A;  1OXV A;  2XVS A;  4TRD A;  5BN3 A;  4G7H C;  5A2Q L;  4C3H G;  2GJR A;  4R8I A;  4LAA A;  3CES A;  2EPB A;  1BLI A;  2E75 C;  3GD7 A;  1SXT A;  2R93 B;  1D1I A;  1QWY A;  2AQ1 B;  5C3X A;  1SFO B;  4OHJ A;  3DEO A;  4IUP A;  3MA2 B;  3K5O A;  3OW7 A;  1LT3 D;  1DOL A;  1PXU A;  2B2Y C;  1H9K A;  4CHT B;  5IGC A;  4DA2 A;  3A8I E;  4QUC A;  2F0G A;  1QE6 A;  1B1Z A;  1WTX A;  2KQ3 A;  2AUJ D;  3WDN A;  2E2I B;  1SJH D;  3I4N B;  1Q90 A;  2F0H A;  2Y0S B;  2QIL A;  1STB A;  3MXP A;  3Q23 A;  2FMC A;  4U68 A;  1QNK A;  5C5L A;  2K1B A;  4RCO A;  1E2Z A;  2ZZG A;  3E6Z X;  2EYF A;  2R3Z A;  2F3W A;  3O13 A;  2R9V A;  3VYT A;  2O4X A;  2B2W C;  5JPM C;  2B2T A;  4QMG A;  5EKL A;  2KED A;  4OO1 H;  1U9R A;  5IIF A;  3NUC A;  4XLC A;  5DM6 3;  3VR2 A;  4C56 C;  5E4W C;  5I6W A;  3X3M A;  4K8I A;  5M9O A;  5G3L D;  2IX1 A;  1UD6 A;  2D62 A;  3S14 B;  5IGE A;  3S1Q B;  2HQE A;  5DM7 3;  4XLF A;  2RDF A;  2F0F A;  1TWF B;  2Q8I B;  2QDB A;  2IT1 A;  3PUV A;  3FDT A;  4JBW A;  5C4Z A;  1JOK A;  3N52 A;  2QEJ C;  1R9T B;  4II3 A;  1STY A;  5C3W A;  2PZW A;  3LWU A;  3C1E A;  4NDX A;  4QUF A;  3NHH A;  5DN6 A;  2IW3 A;  4KKS A;  2XRQ D;  2B8F A;  1E3Z A;  1UD5 A;  4XDX A;  5CR3 A;  2ZTN A;  1Z7T A;  1H8H A;  4RA8 A;  3RMH A;  3NP8 A;  1LAB A;  3RZD B;  1LT4 D;  3GTJ B;  1RHP A;  3OMC A;  2Q8T A;  3PUW A;  1RD9 D;  1ZKO A;  2L12 A;  3GTG B;  1F2L A;  5COR A;  1VMC A;  2NVX B;  3FRP B;  1CZW A;  2IL8 A;  3ZYY X;  5E3F A;  1EQV A;  5IGB A;  5ELF A;  1EY7 A;  1F2Y A;  4XR6 A;  2JDI A;  4E0F A;  3NTI A;  2ZZF A;  3I90 A;  1H9S A;  4J8Q A;  1L0Y B;  4V19 0;  5C4X B;  5CV4 A;  3GTO B;  2AQ2 B;  1B9M A;  4FF4 A;  1UUP A;  4NMZ A;  3TZD A;  4Z1M A;  1SYB A;  2J4X A;  4M1U B;  2A5H A;  2B2U C;  5M5Y B;  1EWH A;  4EGV A;  3QIA A;  1G91 A;  1PZI D;  4K8J A;  4A3E B;  4XIG S;  3QOJ A;  3MFY A;  1DD2 A;  1E2V A;  1PRT B;  4HMJ A;  4QF4 A;  2Z8L A;  3R93 A;  3FPU B;  3T53 B;  2HCC A;  3OMG A;  1D5Z C;  1SSO A;  4FVM A;  2GK6 A;  1PFM A;  4GQN A;  1TVX A;  3DXJ C;  1CQF A;  3V05 A;  1I4P A;  4YEL A;  3TDQ A;  5I9P A;  4U67 3;  1Y1W B;  3GQB A;  1FR3 A;  5BN4 A;  3LNN A;  3QG1 A;  2BE5 C;  1SE3 A;  3NXW A;  3RZO B;  2EYP A;  4C1N I;  4XLH A;  4WFN 3;  3K57 A;  1W9X A;  1B53 A;  1F2Z A;  4HSP A;  4G7W A;  2N88 A;  2B39 A;  1M4V A;  4F7X A;  1RTN A;  1U4P A;  2ID0 A;  2K5W A;  3ONA B;  4Z9C B;  2WJV A;  3EVQ A;  4DNR B;  3G6J B;  1BCP F;  2CHB D;  1SBB B;  4WJW A;  3LX0 A;  1X32 A;  1VF5 C;  3JAM L;  2PQE A;  2DNC A;  2HCI A;  1E1Q A;  1OXU A;  1OXT A;  1HTP A;  1RDP D;  3I72 A;  3A7A B;  3MFG A;  2F0E A;  1STH A;  1O7Z A;  3OEE A;  5NUC A;  3R3O A;  4H13 C;  4C3J G;  4P2C B;  4B08 A;  1JQY D;  1Y8N B;  1HZE A;  1EY5 A;  1QB5 D;  2PCF B;  1ENA A;  2F0U A;  2PYK A;  4KKT A;  1AEX A;  1Z47 A;  2WII B;  1IKL A;  2CK3 A;  3CHB D;  4XYO A;  1WD0 A;  3GVJ A;  1F9P A;  3C2P A;  3HRZ C;  2L9H A;  2GA4 B;  4HMI A;  1LO5 D;  3DWA A;  5AFW A;  1VF7 A;  3J7Y W;  3MZ5 A;  3SXH A;  3VYS A;  2MUY A;  4XQQ A;  4N9P A;  4TQU S;  5CV7 A;  4FF3 A;  1BCP C;  5JEA H;  3A54 A;  1NCV A;  4DK0 A;  4A3F B;  1E0B A;  3SEB A;  1SMY D;  3VR3 A;  4PQX A;  1Q3L A;  3K58 A;  4ASU A;  1BO0 A;  1PRT C;  1MSG A;  4NNJ A;  2G9D A;  2RBM A;  2Z1C A;  4XOR A;  3OWE B;  3BG3 A;  1V8Q A;  5K36 G;  3VA7 A;  4DGZ A;  1TU2 B;  1I3Q B;  1Y1V B;  1EQT A;  3MTS A;  3D6W A;  2F0L A;  2R7Z B;  2D5D A;  1BCP B;  1TY2 A;  1BPL A;  3A3B A;  4ZKC B;  1G8Z D;  3Q24 A;  1QCB D;  2A68 D;  1JWS D;  1FGB D;  1F9R A;  1CA5 A;  2XZO A;  4C3J B;  1S5F D;  1EWC A;  5LL6 X;  3MAQ A;  2V4D A;  3C1F A;  1LT5 D;  4XLA A;  4IQZ A;  1EOT A;  2XZP A;  4MIU A;  3IFT A;  2ZXH A;  5J39 A;  2BOS A;  1STE A;  3W2D A;  3M7G A;  3J81 L;  1EYD A;  5C0X I;  5C3E B;  3NWT A;  2NVT B;  1Y8P B;  2K05 A;  4DXG A;  1UNS A;  3GVL A;  5FO7 B;  1ENF A;  1S5E D;  2IPK D;  4X3S A;  1ZYR C;  3D4R A;  3U9O A;  3PIP 3;  2XWB B;  1CQV A;  4DAP A;  4Q5V A;  3IAY A;  2KHS A;  1GUN A;  1WTH D;  1SYD A;  2L0C A;  1K28 D;  1E3X A;  2WSS A;  4RHR A;  3C3L A;  1KLG D;  1RKN A;  5EGT A;  3N6R A;  3J80 E;  1KDC A;  2V31 A;  2YYZ A;  3TME A;  5IGG A;  2KUM A;  3ND9 A;  3NQI A;  3J81 E;  4IFD J;  4TT3 A;  3V96 A;  5DEH A;  3PO3 B;  2JIZ A;  5EPK A;  1D1K A;  3I4M B;  1CK1 A;  3J7A F;  3KEW A;  3GVK A;  1VJS A;  5EJW A;  4A3J B;  3RLF A;  3PIO 3;  2PMZ B;  1TWG B;  1GUS A;  2WAQ B;  1TKW B;  1K8O A;  1COW A;  2JA5 B;  1STG A;  2JYO A;  3JAM E;  1OXS C;  4BBS B;  1DON A;  3EFX D;  2ZZE A;  2FHT A;  4O1N A;  3GTM B;  2VNU D;  2LKV A;  3DEP A;  4XT1 B;  5KNC A;  1IW7 C;  1UD8 A;  4IUV A;  4XN3 A;  2M00 A;  4K5W A;  2EYM A;  4K5V A;  5HGT A;  2WB1 B;  4MN3 A;  4GZY C;  4IUU A;  4HTH A;  4FNF A;  4X3K A;  2O5J C;  4KV6 A;  4S3S A;  1DJR D;  2RA4 A;  1YNN D;  4ZLT F;  2F1M A;  2WAC A;  3EQL C;  5CBA E;  5D3I B;  1CTM A;  1XXG A;  1IHZ A;  4BS9 A;  3DM1 A;  3VYR A;  2PNR C;  1WD1 A;  3TSS A;  1LAC A;  3HOY B;  1WTP A;  1MI2 A;  1C4Q A;  1VMP A;  1PTO D;  1A3T A;  1JIC A;  3MEH A;  2SOB A;  1EFR A;  3W3A A;  5A2Q E;  1PTO C;  4UDU C;  5M5W B;  3T4A C;  1QIL A;  3UI2 A;  4K14 A;  1HUM A;  4H0L C;  1EEI D;  2MJ8 A;  1BF4 A;  1TWH B;  1O7L A;  2LS0 1;  4TSF A;  1GXD C;  4RGO S;  1HUN A;  1J8I A;  3GO5 A;  4L6T B;  1JCK B;  1ESF A;  1BNZ A;  2PO4 A;  1C48 A;  3G05 A;  1HA6 A;  1SNC A;  2NUC A;  3CRL C;  1HVX A;  2KEE A;  2K04 A;  1G6Z A;  1M8A A;  1SE4 A;  1MAB A;  1H9R A;  2Z6B D;  1NBM A;  2EY2 A;  2HDM A;  1HPC A;  3K59 A;  4FF2 A;  2MGS A;  3D3R A;  1B9N A;  3NTH A;  4KN7 C;  3S1M B;  4FXK C;  3GP7 A;  1GUT A;  3JU4 A;  4CJ0 B;  2BCO A;  1AFP A;  1I4G A;  1EZ6 A;  4ODG A;  3KUP A;  4BA2 I;  2EJF C;  2EJM A;  2RKS A;  4F87 A;  3GV6 A;  2O2L D;  3HKZ B;  3I91 A;  3J80 L;  2K7V A;  3PUY A;  3BVG A;  2E76 C;  1O7Y A;  5JEA G;  1HA5 A;  3TP7 A;  4RHS A;  1H9J A;  3HOU B;  1CFM A;  3IL8 A;  3HEJ A;  4A3D B;  2L55 A;  4QIW B;  1SYF A;  4KMU C;  3FVQ A;  1F77 A;  1O80 A;  2K33 A;  4XQF A;  1SDF A;  2EYH A;  3BZD B;  1PTO F;  3VR6 A;  1OHH A;  2FFK B;  1XYI A;  4O42 A;  2GJK A;  2RQX A;  1DOK A;  4UZU A;  4C3I G;  1ET9 A;  2K32 A;  1GHK A;  4XYQ A;  2LZJ A;  1RJT A;  3E5S A;  4IUT A;  5G3L F;  1HQR D;  4XM3 A;  2FJ2 A;  2F03 A;  1HRJ A;  3K7A B;  3NPP A;  2XGJ A;  3S1N B;  1PTO B;  1NUC A;  4KK7 A;  2IJ0 A;  2WJY A;  2HLD A;  5FK9 C;  1LTR D;  2X6X A;  5IGD A;  4OO1 I;  4XN0 A;  1TS4 A;  1F2M A;  5CBE E;  1JWU D;  1EEF D;  5CMD A;  2JA7 B;  1J9O A;  1EL0 A;  1FNV A;  2TSS A;  2EOT A;  2DY8 A;  3CMM A;  3SR1 A;  2TMP A;  1BDO A;  3DWP A;  2XND A;  2X6G A;  5KNB A;  1TS2 A;  1WPC A;  3OPO A;  1PRT D;  1ML0 D;  3R8B A;  4B3G A;  4XOP A;  1FD7 D;  3PUZ A;  4XKV A;  4G6I A;  1IKM A;  1PYW D;  1IYU A;  3M4Y A;  2X6L A;  4HR7 B;  1PTO H;  4CKC A;  3ITP A;  1S5D D;  1PDQ A;  2CQA A;  3OHX C;  2NB0 A;  2OXP A;  2K6A A;  4FXU A;  4OIJ A;  1EYC A;  4PV1 C;  1PMR A;  2NTT A;  4A3K B;  1EY4 A;  3BCD A;  2GK7 A;  4ID6 A;  2F0O A;  2JXM B;  5HUR A;  1Y69 U;  2KCN A;  1G2T A;  5I9O A;  3WOF A;  5C4H A;  1U4L A;  2JEB I;  3HG9 A;  4RWS C;  3TBI B;  1U4M A;  2X6Y A;  4FYD A;  1E1R A;  4CJ1 B;  1CI3 M;  4DN4 M;  2B2T C;  2EY6 A;  5LL6 S;  2I07 B;  1II3 A;  2F0I A;  4A3B B;  1X3P A;  2A6H D;  4A3I B;  3P75 A;  1VCI A;  2F43 A;  1TWA B;  4B9X A;  2NN6 I;  5EKK A;  2XSC A;  1EY0 A;  4DFA A;  4JMQ A;  3SK6 A;  5D65 A;  2NYZ D;  3PV0 A;  1WTO A;  3C46 A;  2MP1 A;  2NN6 G;  1O78 A;  5JAV A;  2RSO A;  1BUV T;  1WVL A;  1CM9 A;  4F8M A;  4XT3 B;  3M85 A;  4K2L A;  4XNF A;  2ICE C;  4EVO A;  1ZYR D;  3GTQ B;  2B8G A;  5KND A;  4R9W A;  4ZAI A;  1D6E C;  1MGS A;  3T51 B;  1EYA A;  1D5X C;  2BA1 A;  3I8Z A;  2NTS A;  5I2Y A;  4H44 C;  1PKV A;  2K01 A;  3D31 A;  1AP0 A;  1Y8O B;  4IUN A;  1YNN C;  5M3M B;  4IUR A;  2EY1 A;  2ZXR A;  3DDY A;  2WKC A;  1KAA A;  1LTI D;  5D14 A;  1DCZ A;  3EA6 A;  5KEE A;  4EQP A;  1SYE A;  3S17 B;  3NK9 A;  4P22 A;  4PNY A;  4OGQ C;  4BBR B;  4HAE A;  1SND A;  3KLS A;  4G4K A;  3HZX A;  2KVO A;  3M4O B;  2SDF A;  3VA5 A;  1E43 A;  3P7J A;  1Q12 A;  3CQZ B;  1ONL A;  1B3A A;  5ELD A;  3BCF A;  1AZQ A;  2M2L A;  2ENB A;  5CV9 A;  3DMU A;  3BDO A;  2F4I A;  2A69 C;  1ZXT A;  2BA0 A;  1E2W A;  4XOT A;  2CW0 C;  4BY1 B;  3KBG A;  4IZ8 A;  2ZZQ A;  3HOZ B;  2K28 A;  5JVG 3;  2B2Y A;  4G7O C;  2X85 A;  4ZUI A;  4NW2 A;  5HKK A;  2W6I A;  3P20 A;  2PZU A;  3MXN A;  1EU3 A;  3HOV B;  3J7A V;  1F9Q A;  1DM0 B;  1LT6 D;  4HCS A;  4TSS A;  3A3G A;  2IX3 A;  1K83 B;  5KYI A;  3A8K E;  3P1H A;  5T1I A;  1CZG A;  1LTS D;  1I4Q A;  2ZT9 C;  1LTT D;  2B2W A;  5EBC A;  5C0X H;  2KEC A;  1E79 A;  5CDF A;  4IN3 A;  2X6W A;  2WZP P;  1Z6H A;  3OOC A;  1HFG A;  2BDN A;  4CGY B;  3NBH A;  1YNJ C;  1A2T A;  4HED A;  4QCL A;  2MHV A;  4EQO A;  3BYT B;  4CKE A;  1GHJ A;  3DUZ A;  5D3D A;  2YU9 B;  3S9W A;  4ME5 A;  1I4R A;  2ZXO A;  3QOL A;  1DOM A;  1I6H B;  2JP1 A;  1KNE A;  2E1B A;  5C5M A;  4OL7 A;  4ULL A;  2L4N A;  3D4W A;  1KDA A;  1WTQ A;  5FOB B;  2EE1 A;  4PMW A;  3WOE A;  2JJ1 A;  1RCV D;  2LY7 A;  3IFD A;  3OEH A;  2A6E C;  3TP8 A;  3AMU A;  5DAU A;  4KHZ A;  4YEJ A;  2A68 C;  2EYL A;  4KY5 A;  1AN8 A;  3AB9 A;  3FEW X;  2A6E D;  3SK5 A;  1V1P A;  1TY0 A;  2XN9 C;  5ELC A;  5FLX E;  4IAL A;  3OE7 A;  4KHV A;  2QE7 A;  3D4D A;  2L1B A;  2F0Q A;  1TS3 A;  4ZK9 B;  2XOK A;  3IKJ A;  4IUQ A;  2DN8 A;  2N55 A;  4HSV A;  3RUZ A;  5IT9 E;  1WTV A;  3K0Y A;  1U4R A;  3Q22 A;  2LMC B;  2QF7 A;  4RGT A;  4BA1 I;  2C5C A;  5A35 A;  2NVQ B;  3H09 A;  4Y7N B;  3CRK C;  2AUK A;  3KK7 A;  2EYJ A;  3T56 B;  4IFD I;  4C1N K;  4LMQ D;  4M8A A;  4ZUJ A;  1HQM C;  4KN4 C;  1VLY A;  5M5X B;  4NKL A;  2O5I C;  2B2V C;  2EVB A;  2E2D C;  2FMM A;  4WOR A;  4DU9 A;  5FL7 A;  2X53 S;  4XMY A;  1JE4 A;  4I7Z C;  4RFB A;  1ESR A;  5C44 B;  2A69 D;  1MBY A;  3Q0A A;  2I46 A;  1W0J A;  4A3M B;  1YNJ D;  4KI0 A;  4K5X A;  3FPP A;  3L7Z C;  3WQZ A;  5FO8 B;  4XLE A;  1I4X A;  2IX0 A;  4EQN A;  1R4Q B;  2KCC A;  4LK1 C;  3L9A X;  4PMC A;  2F0T A;  2R92 B;  4XXE A;  3TP6 A;  5ISR A;  1PFN A;  1NRK A;  1V0E A;  2DNE A;  4RKL A;  4FO2 A;  2XZL A;  1WTW A;  1A3U A;  3OFN A;  3ERO A;  3KLS X;  2X69 A;  1GUG A;  1KLU D;  3S16 B;  4C2M B;  1SNO A;  5IOD A;  3M7N A;  2LFN A;  2DY7 A;  3E0J A;  3FKI B;  5K5P A;  4XQJ A;  5K36 H;  1NAP A;  2D2C C;  3TP5 A;  4ILW A;  4KKU A;  3MWY W;  3CP8 A;  4XTC S;  2WKD A;  1BXT A;  4R8N A;  5EQ0 A;  1QNU A;  5EKI A;  1I18 A;  4A93 B;  1ILP A;  1IYV A;  2EY5 A;  2OT2 A;  3QO2 A;  1L0X B;  2F3V A;  2NVY B;  1EY9 A;  2BDO A;  2F0D A;  2G9H D;  1S4Z A;  3R2T A;  4B9W A;  5F2D A;  3T16 A;  3HOX B;  1FNU A;  5CGK A;  3MVV A;  3SVM A;  1G2S A;  2CW0 D;  4G57 A;  5C0X G;  1AZP A;  1SYC A;  1PFB A;  1PZK D;  1GUO A;  2D9U A;  5CV6 A;  1X3Q A;  2RDG A;  1PZJ D;  2F0S A;  4RCN A;  2F0W A;  1WCM B;  5KGU A;  2E74 C;  5EPJ A;  1BOS A;  3MXU A;  4ABN A;  3VR4 A;  5IOC A;  4II2 A;  1A15 A;  1Q1B A;  2L5T A;  3NQT A;  1K8M A;  1AW7 A;  1OXX K;  1V0F A;  3I73 A;  3NTK A;  3A8J E;  5J1Z A;  4RKB A;  1UAP A;  2JE6 I;  2SNM A;  4E6I A;  2VB2 X;  3CP2 A;  4K2K A;  1EZ8 A;  4HCE A;  4B3F X;  5T1G A;  4PMB A;  2JEA I;  1IW7 D;  1MD2 D;  2SEB D;  5C4J B;  1KDB A;  4FP5 D;  4CBV A;  3H94 A;  2F0V A;  2FIN B;  2B2U A;  2F0J A;  1ET6 A;  3SHL A;  3URY A;  2V7Q A;  4KY7 A;  5JOB A;  3GV3 A;  2Z4H A;  1HTL D;  4MHE A;  1F9S A;  1SEB D;  1JOQ A;  3L3O C;  1LV9 A;  1WTR A;  1I50 B;  5M3F B;  2XWJ B;  4YXW A;  4NP5 A;  1DZ1 A;  3RD4 A;  3KF8 A;  1XTC D;  4XD7 A;  3CU7 A;  1KMH A;  2JSO A;  4RGN A;  2Z4I A;  4AYB B;  2QKI C;  5CYU A;  1XWE A;  3BH4 A;  3ZPN A;  3TN2 A;  1TS5 A;  1B2T A;  3OWF A;  3HAG A;  2NBF A;  2R61 A;  5I2X A;  1SNP A;  3QB3 A;  3PUX A;  4JK1 C;  4N9T A;  4ZQ3 A;  2WPD A;  1H8E A;  4DK1 A;  1A3V A;  2VJI A;  1B44 D;  4CJ2 C;  1JB3 A;  4Q0F A;  1W6K A;  1ENC A;  1JOR A;  3S2D B;  1W6J A;  2NN6 H;  1JWM D;  3BVZ A;  1SKY B;  2X8K A;  2KOL A;  2ZTG A;  1V1O A;  5TSS A;  3H91 A;  5J22 A;  5JVH 3;  4K6L A;  1SE2 A;  1TQO A;  3V2T A;  3A55 A;  3KBX A;  2PW7 A;  2ZXI A;  2K5D A;  1TWC B;  1CA6 A;  5KNL A;  1KTK A;  1C8C A;  2JA8 B;  4TKO B;  3A35 A;  1RTO A;  3GTK B;  2VXW A;  3ZIA A;  1HXY D;  2ZXP A;  1S5B D;  3CKI B;  4KJO A;  1SAP A;  3D6C A;  3H6M A;  3HOW B;  1VDZ A;  4J6H A;  3SDZ A;  4YIJ A;  1ROD A;  1PLF A;  1A2U A;  1A6X A;  5CV8 A;  4L8J A;  4AVZ A;  2RDH A;  4I65 A;  5CV5 A;  2D3N A;  3I4L A;  1JOO A;  3A56 A;  2VJJ A;  4BY7 B;  2H4O A;  2EXZ A;  1EY6 A;  1FYC A;  2J0T D;  3HS0 C;  1QG7 A;  4L63 B;  2E2H B;  4OIK A;  3SK8 A;  3S15 B;  4DXF A;  5E4X A;  4C3I B;  1B50 A;  3T13 A;  3MXG A;  2RVL A;  1CHP D;  4ZRZ A;  2DIE A;  1TR5 A;  3BVM A;  2EZV A;  2PPB C;  1EU4 A;  4H7B A;  5KIX A;  2L11 A;  4XKW A;  1BCP D;  3NSW A;  3Q6S A;  1QOH A;  3MHB A;  1TII D;  4A3G B;  1WP6 A;  4ZKB B;  2Q8R E;  2IWH A;  3QWN A;  2A73 B;  5DNF A;  4UAI A;  1JR0 D;  3H0G B;  4G7Z C;  1V43 A;  4XON A;  1FNW A;  4G7X A;  1QJO A;  4C3H B;  2OF1 A;  4OO1 G;  2XNA C;  1S5C D;  3X3N A;  3NWS A;  3OIQ A;  5JJZ A;  1KAB A;  2JJ2 A;  1GOZ A;  2C9O A;  5KYL A;  1OB0 A;  1NR2 A;  5CC4 A;  1EIG A;  2ICI A;  5ELE A;  4FXD A;  5EBD A;  3TZU A;  3BC9 A;  3K5L A;  2RSN A;  3D8G A;  1H9S B;  1BR9 A;  3GTL B;  1SNQ A;  4KY6 A;  3FKS A;  3NE5 B;  2KJX A;  3LWE A;  4V0B A;  1G29 1;  2BE5 D;  5COY A;  5I6Y A;  2MPM A;  2EJG C;  1KNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...