4DNTB

Crystal structure of the cusba heavy-metal efflux complex from escherichia coli, mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
322
structure length
322
Chain Sequence
b'ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein CusB
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 58
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00529 HlyD HlyD membrane-fusion protein of T1SS
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4dntB02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dntB03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 4dntB01
3QIAA 3GD7A 3QG1A 3GQBA 3PUWA 1PMRA 4KMUC 4G7OC 3A8KE 4I7ZC 5JEAH 1OXTA 5K36H 2E75C 4BA1I 4JBWA 4DK1A 2QF7A 3FPPA 3EQLC 1SMYC 2ZT9C 3I73A 1GUSA 3N6RA 5BN4A 5K36G 4IFDH 3L7ZC 1E2VA 4OGQC 1I6VC 5C0XH 1Q12A 1K8MA 3P20A 1GUNA 3VR6A 4G7HC 1GHJA 1IW7C 2A6EC 2F1MA 3T56B 3VR4A 4KHZA 1FYCA 1LABA 3BG3A 2JEAI 3PUVA 1G291 2EJGC 1VCIA 5BN3A 1YNJC 3OOCA 3M7NA 4XIGS 2A69D 4KKUA 2JEBI 3M4YA 3ND8A 4HR7B 1H9JA 2DN8A 4H0LC 1HQMC 2AWOA 4L8JA 1H9KA 4KKSA 1Z6HA 2B8FA 3D4RA 4XTCS 5A35A 4OO1H 1IYVA 3OW7A 1DXMA 1VF5C 1GUOA 3A7LA 4KN4C 3VR5A 1OXSC 2EVBA 1Q1BA 3H94A 2R6GA 2YYZA 1HCZA 1B9NA 4DNTB 1IYUA 2DNEA 3MXUA 5JEAG 1IW7D 2D5DA 2A68D 1HTPA 2KCCA 1GHKA 2V4DA 2A6HC 2E74C 1E2WA 2BE5D 1EWHA 1O78A 1Q90A 3D31A 3PUZA 3QJYA 4BA2I 1Y8PB 4TKOB 1H9SB 4JK1C 2O5JC 4IFDG 3DXJC 4KN7C 1YNNC 1B9MA 3RLFA 5C0XG 1Z7TA 1CFMA 1HPCA 4TQUS 3SDZA 1T5EA 4G7ZC 4RCNA 1VF7A 1H9SA 3PUXA 2BDOA 3TZUA 2E76C 2K33A 3SE0A 3VR2A 3AB9A 2BA0A 3MFYA 1ZKOA 3VR3A 3LWUA 2O5IC 2EJFC 2JE6I 2JXMB 1Y8NB 3I72A 2L5TA 1TKWB 1OXXK 1H9MA 4H13C 3U9SA 3WDNA 3LNNA 3HGBA 1V43A 2IT1A 4GZYC 3I4LA 1GUTA 1FR3A 2A6HD 3M85A 1GUGA 2AUJD 3W3AA 4OO1G 3KLRA 2D62A 1QJOA 2A6ED 2PPBC 1OXUA 5KNBA 1DCZA 2AUKA 1ZYRC 1TU2B 1Y69U 2NN6H 2NN6I 4H44C 3IKJA 2LMCB 1ONLA 1CTMA 1V8QA 3A8JE 2K32A 2Q8IB 3A7AB 1K8OA 4IQZA 2BA1A 1OXVA 1LACA 1DD2A 2KA7A 2K7VA 3ND9A 2A69C 2DNCA 1H9RA 3BDOA 3CRLC 3PUYA 2B8GA 4DNRB 1GJXA 3PV0A 4LK1C 3T53B 5KNCA 1VDZA 4KI0A 3IFTA 1O7LA 2PCFB 3CRKC 4LJZC 2EDGA 3FMCA 3A8IE 2A68C 1BDOA 1A6XA 3NE5B 1CI3M 3VA7A 2BE5C 1Q1EA 4KKTA 1Y8OB 1E2ZA 2CW0C 4PV1C 4DK0A 5BN5A 2EJMA 5KNDA 2PNRC 3T51B 2D2CC 2NN6G 3OPOA
chains in the Genus database with same CATH superfamily
1XNQQ 4B48A 1SYBA 4YAWA 1OB5A 2JA9A 4AYBG 1QX4A 4C3JB 3EIVA 2BM1A 2RBMA 2Q6OA 3AU7A 4GNXB 5M3MG 1TWCH 2B63H 2RQXA 3NWTA 2VJJA 4DR7L 2D9UA 4N9PA 1SR3A 2CWPA 4LFBL 2F1MA 2F3IA 4IZ8A 2IWHA 3S24A 1HFGA 1VQ8B 1VQOA 3OKXA 3WYAA 1IKMA 1ASZA 2F4NA 5BSXA 3PO3H 3Q6RA 3WNCA 2F0EA 4OPVA 3H0GB 3M4YA 4GOPB 5ELBA 2VQFL 5GV8A 1PRTD 1XMQQ 2K52A 2K5VA 1Z9FA 1KD1C 5FK9C 1IYVA 4JI5L 2RSOA 4LFCQ 1Y0YA 3GO5A 4ZRZA 3J7AV 1NJID 1Z47A 2BGJA 3GTQB 1NY4A 3W1BA 5J3OA 4J6HA 1N36Q 5IIFA 1EWHA 4KY7A 2SOBA 3QFRA 2JDIA 2BMWA 4RG1A 1SM4A 3SXHA 2K50A 2Z1CA 3NQTA 1EP2B 3SDZA 2ZJRA 4R4TA 2E76C 4WRDA 4TMXA 5FIUA 2DERA 3W2DA 5FOBB 5FKAC 3SK5A 4N9TA 1K73D 2JIZA 2FMCA 1BX1A 4ZGQB 4ZCLA 4OWXB 1TXYA 5JPMC 3CPWA 1XQBA 3U2QA 1FVIA 4OOSA 1VQPA 1DGSA 2M2LA 1EZ8A 2KVOA 4JPBW 4LF4Q 2CWAA 4JI7Q 4HN7A 4LMQD 2E2HB 1QGZA 1YNJD 1U0LA 2OBSA 2LZJA 1EFUA 4HIOA 2FVGA 3FKIB 3HZXA 4DNIA 4GKJQ 2XNJA 3MC0B 4UZFA 4FDBA 2UU9Q 1NE3A 1WSVA 2UXDQ 5C4XB 1JCKB 3WOEA 4RKBA 4A93B 3EN2A 3CCVA 1Q81C 3SLNA 3K57A 4HIMA 3W2FA 4A3BG 1ESRA 5GAEC 4X65L 1TY2A 3F2BA 1Q82C 2CCZA 1DONA 1TWFB 3I90A 3GTGH 5F2DA 1JOQA 1PH9A 3S16H 4H9GA 5E1FA 1WJJA 3SEBA 5C3EH 1A8PA 3NPPA 1STYA 4LW1A 3RZOB 1FNWA 2M5SA 2LXKA 4TT3A 5GQOA 1JJ2A 4GNXC 5LMUQ 5IGEA 4WORA 1VQNA 4JBMA 3MHPA 2GREA 3QG1A 4JCVE 4L63B 3S1NH 2VY3A 3RN5A 2O2LD 4X06A 4G7OC 4YWMA 5JEAH 1E3XA 4RKLA 2E75C 1TLLA 4MZ9A 4IFDJ 4UZUA 1EEFD 3PSIA 3EQLC 1VQ9A 4LF6Q 4BWGB 5I4DA 4XN0A 3ASPA 5BN4A 4V190 1CQFA 2E1BA 4GOPC 4GLXA 3I4NB 1BPLA 3J81L 2C5BA 2ZTEA 3TEHB 2XN9C 4DR5Q 4UDUC 3A54A 1VHOA 1XPUA 4X7CA 5COYA 3PUVA 2EJGC 3CCQB 4RD3A 3I2ZA 4AQYL 5K5PA 3SHLA 2PW5A 1LTGD 5D14A 1YJWA 1YJNA 3P1HA 2B63B 1CNFA 4OONA 3ZBUA 1HNXQ 2MQHA 4BBRB 1O80A 3BZCA 5I6WA 1XWEA 2E2DC 1VQKA 2L1BA 3GTOH 2CC2A 4XLEA 1C48A 3FPUB 1TWGB 5F4MA 2IX1A 2YYZA 1HCZA 3PO3B 1BQQT 5FLMH 4M0LA 1EP1B 1COWA 4P72A 4RGMA 4TN1A 2WIIB 2KCTA 3J7YW 3HOVG 2I5LX 3EJIA 1GAWA 4QVAA 4K0KQ 3E3XA 3MXGA 5M5YB 4XLCA 1UUPA 4JW0A 1L2FA 1S4ZA 1R4QB 2JSOA 3CQZH 2F0DA 1JJGA 1Y1VB 2XNDA 1MJCA 1HA6A 5IP9G 3NQIA 2D0OA 4IW3B 1YI2B 3P7JA 2A6HD 2F0WA 2QGQA 3K5OA 1SMXA 2YTVA 2F4VL 4B3RL 2VJIA 2Q2IA 1PLFA 5EBDA 3K58A 4K8IA 1VQAA 2F43A 2Q2UA 4QV2A 4FF3A 3OAAA 4IPDA 3ICEA 1SFOB 5C3WA 3P26A 1SNCA 2F0TA 1N34L 1WTXA 1Y14B 4LBZA 2Y0SG 4B3MQ 1VQ9B 4R4CA 5M3MH 5HURA 2VB3X 1GJRA 1ZXTA 4QGUA 3NBHB 4Y7NH 2YU9B 2MPMA 1Q3LA 2EY5A 1I8DA 2GK6A 4NXNL 4LJZC 1TWHB 3S17H 1UE6A 2Z4HA 1CKMA 1XPOA 1HVXA 3GP7A 2WZPP 2Q6LA 1Q1EA 2WAQG 3CC7A 1YJWB 4C43A 4PV1C 2F3WA 2YTXA 4OIKA 1F2ZA 1ZM9A 4JI2L 5BN5A 1VQ5A 3PGZA 3HOWG 4G7ZC 2NN6G 3OPOA 5A8AA 3QIAA 4DV6Q 4XOPA 4F7DA 5M3FB 4MN3A 2JA7G 4PG3A 2F0NA 4JV5L 4BA1I 1FJGQ 1IL2A 1EXMA 3KDFB 3G6EA 4A3FG 1I3QH 4EQNA 2JK8A 4UPAA 3STBD 3NP8A 2DY1A 1LT4D 1PVOA 4UHVA 2EIFA 2ZTCA 3CCMA 4UY8C 1HNZQ 3BJUA 3CCSA 2PIAA 3FEWX 3OWEB 5D3IB 4RD4A 5C6AA 4Z4SA 4F7XA 2D3NA 4A3CH 1SLJA 3LO8A 1WCMG 4QY7A 5HGQA 1PKVA 1A62A 3T1HL 1N32Q 3FRPB 1F2YA 1N33L 4QFMA 3OYYA 5FLXL 3D6CA 3K0YA 2DCUA 1BLIA 1OGJA 3ASQA 2XWBB 5DEHA 1W87A 4KN4C 4BS9A 3PO2B 2C2WA 1RD9D 1TVXA 4XDXA 1WTWA 3RR5A 1BO0A 4X0CA 1STAA 1I4XA 2MGSA 2OCEA 4ME5A 1TWAH 1EYAA 4PGOA 4UZEA 2WJYA 4AVZA 1QFJA 4DV1Q 4IFDG 4X7DA 1U4RA 3CF5A 1YIJB 2EFGA 4P9SA 2LS01 4R8IA 4JOIC 1VF7A 3GTOB 4C3JG 4A3BH 5IT9c 3AVXA 2MP1A 4XD7A 2YWGA 3U6BA 2MHVA 3DMUA 2ZL6A 1TKWB 1GAQA 2QA4B 5IP7G 4AC9A 4TVAB 3VYRA 3T4AC 5JJLA 3W5HA 4B9WA 3J80i 5CGKA 1T6XA 5T1IA 2EZVA 4G7WA 1ILPA 3KLRA 3UDGA 1SYDA 3IKJA 1L0WA 3H0GG 4QVJA 3S15B 2VNJA 4CJ0B 4DR3L 3IAYA 1V8QA 4R4OA 3CXCB 3CW2A 3ONAB 5E7NA 3U50C 1T6ZA 4IUPA 2K4KA 4DR7Q 4RA8A 1EIHA 1KHIA 3DHQA 4C2MH 1PH4A 4LFBQ 3CPFA 2V31A 1QVGA 1E63A 4N3NA 3VO2A 4C3IG 1KQSA 1UD3A 4DUYQ 4JI7L 1VQHA 4A3KB 1WD1A 2PI2E 5DNFA 2ZXIA 1QH0A 4GKKQ 3N52A 2VQFQ 3BCDA 3S2HH 2EDGA 5C0XI 5DS0A 1D8LA 2R7ZG 1VQ6B 3WOFA 2I0QA 4HJAA 2X6LA 1L0YB 3V7AA 4JI5Q 3B82A 2RC5A 3OEHA 3TS2A 1LTRD 2NVYB 1G8ZD 4LBVA 1KDAA 4IJHA 3A5UA 4X8IA 3BC9A 2VW9A 5FLXE 2ZBUA 4OEMB 4P26A 3MCAA 4Z1MA 4DV2L 1N36L 3G4SB 1X32A 4O0AA 4OHJA 4C1NK 1K83H 5JVG3 3FJOA 3JAML 1E2VA 4EVOA 3HOVH 4Q5VA 3ULPA 4L5RC 2YWHA 1J6QA 1GKHA 2PW7A 3C3LA 1LUZA 5TSSA 1B8AA 3FKIG 4DU9A 1T5XD 5CR3A 4PC3A 1G291 3QOLA 5IWAL 2B2TC 4A93G 3E5SA 1I3QB 2AQ3B 1PRTF 3ND8A 5IP9H 2DY8A 2R7FA 2B2WA 3D0FA 1H9JA 1V1OA 3A74A 2A74C 3M3YH 4RM0A 3C46A 2ZJQA 4KKSA 3D4RA 1Q7YC 5EKKA 4JI4L 1FDRA 4Y9UA 1DXMA 4XT1B 4NNJA 1YITB 2K5QA 4HEDA 3H94A 1IYUA 2QE7A 1I6HB 1VQMB 1IW7D 2A68D 2BDNA 3ZZ0A 2BSAA 2KECA 2OWOA 3M7GA 2CNDA 4DQLA 1PH2A 2O5JC 1Q8KA 4X65Q 2B2UC 2UXDL 3CAMA 1KQSB 1T6YA 4NDXA 1ZM2A 1YNXA 2EYPA 1H9SA 3K7UC 2MFIA 3TZUA 1U4LA 4LWCA 2P3MA 2BA0A 2XZLA 4FWTA 3D3RA 2WYRA 1ZUNB 4WFN3 2ZXOA 3OFNA 5KSWB 3Q23A 1DJRD 4M2LA 2L5TA 4TMVA 3I4NG 1TWAB 1RKNA 2FHTA 4PAAA 3HGBA 1STNA 4ILWA 2EY1A 1CSQA 1HRJA 1IHZA 3OZWA 1QJOA 1KLUD 3HOWH 3OMGA 2NN6H 1D5MC 5JBQA 1HNWL 4XKVA 1PZKD 1G91A 4G57A 1K8AC 2VYQA 2JA7H 1U2RA 4JVZA 1K8OA 1DDGA 4BBRG 3GTLB 2QN6A 5I9PA 2RC6A 1M8AA 4A3FH 3HAGA 4YY3L 3I4OA 4LF6L 3V05A 2CVRA 1TQOA 2ZZEA 1AEXA 1A3TA 1C0AA 3JAME 1F77A 1ET9A 1EY8A 1NR4A 5HY6A 3T1YL 3IFTA 4AQYQ 2Z9HA 2HIVA 1NBMA 4X62L 2SEBD 3DDYA 1AZQA 1K28D 1HFNA 3I3CA 1MSHA 4DAYB 3MHBA 1WCMH 4CGYB 2OK7A 2KOLA 3CMEB 3LGJA 4YIJA 1HNXL 2LFNA 2FX3A 4C56C 1BF4A 3CC2A 4JI6Q 5LMNW 1YJ9A 2BH8A 3SGIA 1Y1VG 2KBNA 2IX3A 1WP6A 1G2SA 4IUTA 3S2HB 2VBUA 1PMRA 2NYZD 3Q8DA 3MEFA 1W9XA 4FO2A 5ELDA 4KTAA 4QIWE 3BZDB 1PTOF 4XM3A 2QF7A 1PYWD 5KRUA 2CF4A 2B2YC 1SMYC 5ELFA 3N6RA 1HA5A 3A5ZB 2GQFA 3ZYYX 1SDFA 4IFDH 2HDLA 4RCZA 2IHEA 1IHMA 3VR6A 3WQZA 5FO1A 1FX0A 2Q8TA 1CKOA 4C3JH 3TQYA 1WD0A 2F0JA 3CC4A 3I7FA 1XPRA 1V1QA 2F4VQ 3OOCA 5IP7H 4HCEA 1B50A 1D1IA 2EPBA 1CA5A 4L5SA 1NNXA 1X54A 2WB1G 3HOVB 4QHYA 5IGCA 2B7CA 1SYFA 2KHSA 3Q6SA 3I91A 4OO1I 1EIYB 1A0IA 1VF5C 1LO5D 1EEID 2HHHL 3H0GH 3ERQA 4RGOS 1RL2A 1NCVA 2J7ZA 5DM73 3KF6B 3RMHA 3SK4A 1TTTA 2UUBL 3ZBTA 4K6DA 3J7ZC 3KJOA 2KCMA 2MUYA 3M9BA 5IYNA 3UDIA 2LSSA 4QCLA 1YNNC 4NXNQ 4IOAA 5M3FG 3CCLA 2VQEL 4C3IH 2XRQD 4AH6A 4ACBA 1SNPA 3GTQH 2BDOA 3HKZG 5IYQA 2ALYB 4KK7A 4ZUJA 1KD1D 1YHQA 2O5IC 2EJFC 2JE6I 4A3JB 2UUAL 1KAWA 2R7ZH 1EFID 1OXXK 3PA2A 1E0BA 4JI2Q 3RUZA 4RD1A 3TP6A 4IUVA 2CRVA 2GJRA 2Y0SB 3MMPA 1MHWC 1VQBA 3ZJYC 4K5WA 1KRHA 2NZHA 1K0SA 1GXDC 3M85A 5CBAE 2C77A 2EYFA 1SE3A 1OXUA 4JV5Q 5C4HA 3K5LA 2X6YA 2P5ZX 2QILA 3SJZA 2AHOB 1M1KC 1ZM3A 4EQOA 4HJ9A 4EH1A 2WSSA 2GJKA 2KA7A 2K7VA 1H9RA 2FINB 1WORA 4LF5L 2KVMA 3PO2G 4DNRB 4ZGNB 4ALPA 2B2WC 2E2HH 2OTJA 2NWGA 4RJLA 2WINB 4KI0A 4RPDA 1BBXC 4YAUA 3FKIH 4XLFA 3CRKC 1WU8A 1NB0A 2PQAA 1WTPA 1D6EC 1L0XB 4DN4M 1WOPA 1N33Q 1DM0B 1WOOA 4A93H 2VZAA 1A6XA 3NE5B 4LF9L 4R71A 2NUCA 4C3HB 4L5QA 2Z6BD 2CW0C 1VQ7B 1EFCA 4P6YA 1N32L 2BN4A 1TWFH 4F88A 4JBKA 1I18A 3BY1A 3WWVA 5HGTA 4IN3A 3TN2A 3DWAA 2B29A 3RZOH 4BXXG 4DAMA 4DV7L 1QZHA 4X3KA 3I1FA 1JR0D 3GDEA 3HRZC 1X6OA 2AQ2B 5EGTA 1D5ZC 2B3GA 1DARA 4DV1L 1E1TA 2EYMA 1M90C 1G7SA 4GLAC 1HH2P 4CKEA 1GUNA 2K01A 4G7HC 3G71B 3BY2A 3BS1A 1UD4A 2CH4A 2JYOA 4KHZA 4RGTA 3CCUB 5BR8L 2HLDA 2KUMA 3CP2A 5TY0A 1EYGA 3R2TA 2B2VC 2WZNA 3W5VA 4X3SA 3I4NH 1EWYA 2A69D 4A3KG 1CHQD 4KKUA 2JEBI 4JBJA 1QVFB 3BVMA 2TSSA 4X64L 5A89A 2DN8A 1VQGA 1EY9A 2OT2A 4LBYA 3NK9A 4DR3Q 2F0VA 1GUOA 1CKNA 1B23P 3V76A 1LT6D 1X3QA 4OPSA 1LLRD 4DXGA 3TREA 4YWKA 3G05A 4DQKA 4KY6A 3KEWA 5CV4A 3QJYA 4BBRH 1VQ4A 2NVXH 4CBVA 1CQVA 1IBKL 3S1MB 1OTCA 3T13A 4A3GG 2EOTA 5IYCG 1Z7TA 5IGDA 1TWGH 4DUYL 1HPCA 2NZ1D 1VQFA 2E2JH 3PUXA 1TY0A 1SAPA 5C44B 2F0FA 1NDHA 3GTKB 1ZKOA 4GKKL 3LWUA 1J8IA 2JP1A 5C5MA 4V0BA 1K3RA 3A0JA 4XYQA 3C2QA 1STHA 2D0PA 3LNNA 5EPLA 5M5YH 4C3IB 5FO8B 1LTSD 4B9XA 5J35A 3EVQA 3NEMA 4O42A 4DV2Q 5L37A 1Y1VH 4J0QA 1E1RA 2CFMA 1A3VA 3HFZB 1V5VA 2R7ZB 4WJWA 5A88A 1EY5A 4OIJA 4AF6A 1JQYD 4A3LG 4IQZA 2Q6KA 1I4RA 4AIMA 5D3DA 1L1OA 4KHVA 2R93G 1CQXA 3OW2B 3BDOA 4DV5L 3A56A 4XQJA 3PV0A 2CBXA 2ZM6L 1JORA 4LUZA 1OB0A 5JPNC 1E62A 5IWAQ 1SFOH 1UD2A 1F20A 4DUZL 1A3UA 4ZCKA 1GVHA 1YVCA 3RY8A 1BOSA 3Q24A 3VA5A 3G6JB 4JI4Q 5KYLA 1CI3M 1G51A 5HXBA 3GIRA 5JJZA 5IODA 2YU9H 2KEDA 3KUPA 1DYQA 2WFWA 1PRTB 3CMMA 5C5LA 3D4WA 4DK0A 3BVGA 3NTIA 1TWHH 4QMGA 1O7ZA 2PNRC 1JA1A 1ZM4A 2R92B 2OYNA 3PUWA 1WOSA 1SYEA 3JQRA 2ZL7A 5IYRA 1CNEA 1V1PA 1OXTA 4LUOA 1A8VA 2RF4A 4DAVA 3CKIB 2HIXA 4RD2A 1QG0A 4DR2L 1G6PA 3IFDA 5LMNL 5M3FH 3PIPA 3HOYG 1VQOB 1EP3B 2ZTNA 2JJ2A 3BCFA 4P6VF 4Y52H 4FK8A 3CCRA 4DXFA 2ATWA 1EFWA 5KEEA 3J80L 1WI5A 3BG3A 1EQTA 5BN3A 3JU4A 2NPFA 1W2BA 3M4OB 4G5GA 1HNWQ 2EXDA 3SK6A 3PIO3 1ELOA 1G2TA 2RA4A 1ENFA 3HOUG 1Z6HA 2QGGA 1IYJB 3R6JA 4PNYA 4CKCA 3OHXC 2D9RA 3H3VC 1X3GA 4ZKCB 4JI8Q 4YY3Q 4FXDA 1DOMA 2D5DA 1JE5A 4N8FA 2A19A 2VS1A 4P71A 1Q90A 1YX2A 3ZZTA 5E4XA 3T1YQ 1HXYD 2KENA 1X55A 2K5WA 1QGAA 1B9MA 3V2TA 4X62Q 3PO2H 3NELA 3OE7A 1XE1A 5EBCA 1ILQA 5EQ0A 1LTLA 4PMWA 3AB9A 3OJXA 1I94L 2X53S 3CPWB 2A8VA 3TZDA 1BNZA 3Q22A 3RN2A 3UI2A 2UUCL 2NVXB 3ZPNA 3HKSA 4TMTA 1VQPB 4WZLA 5IGFA 1DOKA 4YXWA 3TP7A 1GUGA 1P16A 2Z4IA 1WTQA 4JI6L 4NXML 2E2JB 5E4WC 1V9PA 2PZTA 1E3PA 1A2UA 1F2LA 5CV6A 1JJCB 5ELNA 3R93A 1KTVA 3ZZUA 1BR9A 4BXXH 3A3BA 3A8JE 1V1PB 3RD4A 2D3LA 3CCVB 5EJWA 2KHJA 4HTHA 1PTOB 4ZK9B 5CMDA 2IY5B 2LY7A 3CD6A 3S15H 2MJ8A 2ZBVA 1PRTC 1SSOA 2WR8A 4A3DG 1PH5A 3C1EA 4FN5A 3TMEA 3QFTA 1CM9A 4P12A 3GVJA 2O4XA 1UWVA 1NJIC 3CCJA 4I65A 1JJ2B 1VQNB 4B47A 4A3KH 2DETA 1OHHA 2M00A 2EYLA 4P2CB 1ZEQX 1CHPD 3PENA 4YAOA 2Z6KA 3QO2A 5H1SE 2HHHQ 4A3EB 4A3JG 3BNWA 4IURA 4B3SL 1JNYA 2JA6B 2H1EA 3C2PA 1I4HA 2UUBQ 1MABA 3R6KA 1B4OA 1DG1G 5C4JB 1EY4A 2XGTA 1Q46A 4DA2A 2VBTA 4I7ZC 2NVYH 4XQNA 3DWPA 5TV2A 2VQEQ 3ZC3A 5A2QL 1XMOQ 1IJEA 4LBWA 2FFKB 1FNVA 4JBWA 4CDCC 2J4XA 1IZ6A 3J81E 1K73C 1J5EQ 1BCPF 4P75A 3ASRA 3SVMA 2C5CA 2PI2A 1W0KA 2WB1B 5EKLA 4XNFA 4A3GH 1HTLD 4UP9A 1I6VC 5IYCH 1Q12A 2UUAQ 1K8MA 3HOZB 2E1RA 3P20A 2G5DA 4ULLA 2JJ1A 1QNKA 1VMCA 3VR4A 2SDFA 3A55A 2KJXA 2ZZGA 2VXWA 1YJNB 2XTIA 4A3MB 1JB7A 3ER0A 1BXTA 1YNJC 2RVLA 2DYIA 1VQKB 2JQOA 3I4MB 3GSIA 3L3OC 3H6MA 2JA5B 4H0LC 1X65A 1H42A 4L8JA 1V0EA 2B8FA 4G4KA 1F2MA 4YHHL 2QMUA 3HKZB 1CSPA 3QE2A 3E6ZX 3S2DH 5CBEE 2WACA 1PZID 4IUQA 1WFQA 4C3HG 4LF5Q 4L6TB 1JICA 2R6HA 3W2HA 4A3LH 4RH6A 4CDDC 4HIDA 1EY7A 1VS0A 2GVAA 3OZUA 4JK1C 1LTAD 4PZ8A 1SEBD 4KN7C 2RHQB 3MEHA 1J9ZA 1I6HH 1K3BC 1Q86D 3VR3A 3ERSX 4P3YA 2EE1A 1Q7YD 3K7AB 4LF9Q 3GTPB 2JXMB 1Y8NB 4K5VA 1VQDA 3U9SA 3CMAA 2VUMG 1RTOA 3E1YE 1SN8A 1V43A 2IT1A 1RHPA 2XIWA 2C78A 3W1GA 1C9OA 4R4IA 1PTOC 4ZCMA 1QFYA 1WTHD 4DV7Q 3AVUA 4QB4A 1DCZA 2AUKA 5I9OA 4OWWB 3P27A 4WQMA 1PDQA 1K9MC 5TRDA 3PVDA 2C4UA 1ONLA 2OTLA 3T16A 1R4PB 1EU3A 1JMCA 1E1OA 1DDIA 4B3FX 4NMZA 3TBIB 1G7RA 1GUWA 3BZKA 5F4JA 1S72A 3JC66 1R9TB 2DNCA 4XONA 4ROXA 3E0JA 5BR8Q 2PE3A 1YHAA 3H09A 3TP5A 2Z8LA 1AH9A 1B7YB 1BJKA 1LV9A 3DUZA 4LF7L 3GTLH 1YBYA 3CU7A 4X64Q 1HQRD 1XTCD 3CC7B 1VQLA 3FVQA 1W35A 2MO1A 5I6YA 3U58A 1X3FA 1LT3D 1VQ5B 2XSCA 1EIFA 1KTKA 2Q8RE 4RAUC 5C44G 4RPBA 3OTOQ 3R8BA 1PJ7A 2D2CC 3CRZA 4EQPA 1YZ6A 4EX5A 3MAQA 2NB0A 1IBKQ 1KMHA 4II2A 3G6EB 1YHBA 3HS0C 2MO0A 2F0MA 3A8KE 4PC1A 2F4IA 1KL9A 4DK1A 1EWIA 3RLNA 4YALA 3CCMB 2ZZQA 5CV8A 3TSSA 5K36G 1PJ5A 5D65A 3FPKA 4OGQC 5M5XB 2PMZB 3CCSB 1ZYRD 3NUCA 2VL6A 4HCSA 3K6OA 3W2IA 4S3SA 3NENA 4QUCA 3MWYW 5HKKA 1HR0W 1WDTA 4ZQ3A 2I5HA 3HG9A 3FP9A 4NBSA 3M7NA 4XIGS 2K03A 1LM0A 3TP8A 2F0SA 1B2RA 4A3GB 3EBEA 2ZXRA 4JG2A 4CJ1B 2C35B 3RZDB 2PYKA 3LQ6A 1B70B 4X3TA 1EYDA 2F0OA 2QEXA 2QEJC 3OIQA 2OTLB 4KV6A 4DAPA 4DV5Q 5JJIA 2EQSA 1STBA 4PQXA 5EKIA 4K14A 2ZM6Q 4HIKA 2Q2TA 1TS4A 2E74C 4PMBA 1II3A 3DM3A 1EUJA 2JA8G 4IPGA 2R92G 1WTRA 3W5UA 3L0OA 1I7PA 4IPCA 2V7XA 4DUZQ 4CJ2C 4WJ4A 2Z6KC 3M4PA 4A3DH 2L11A 1VLYA 3S2DB 2YWFA 5E6TA 5T1GA 4X3UA 1SKQA 4WZEA 4YCWA 3UE1A 1UMKA 4HMJA 4OXPA 2R93B 2ICEC 3NXWA 1QG7A 4FXKC 2PQEA 3UDFA 1IXRA 4U9UA 2RDGA 4B3TL 3U4VA 4OO1G 4A3JH 4MYUA 2BM0A 2X6GA 2A6ED 4AYBE 1Y69U 1P8LA 4ZAIA 3PA1A 2LMCB 4Z9CB 4TMWA 1SBBB 4FNFA 1SROA 2WPDA 2FJ2A 1QWYA 4DR2Q 1QVGB 3KFUA 5LMNQ 2BVNA 4ACAA 3I55A 4JI0L 2BPOA 3AQQA 3W5OA 4FF1A 1QGYA 2F0KA 3ND9A 4OL7A 4R8NA 5FJ8G 4RHRA 1N05A 5AN9A 3WBKA 3QSYA 1VQCA 2VNIA 4QF4A 1B53A 4XQFA 1Q8IA 4EGVA 4C1NI 3D26A 2CH4W 3D6WA 3BH4A 2L15A 1VHEA 2L9HA 2RCNA 1N8RC 1S40A 1CK1A 4TSFA 1K28A 2N8NA 4WJ3M 1ET6A 4U68A 1PH1A 1F9QA 4LFAL 1TS5A 2OBTA 1QUQA 3SEJA 2HCCA 3M4QA 3HOYB 4BBSG 5ELCA 2VNUD 3H9NA 4PC7A 4XR6A 1UE1A 1ASYA 3GD7A 2HDMA 4JI8L 2XWJB 3ONYA 4HAEA 4C3HH 4IJLA 5IT9L 3B78A 3I56A 3U9OA 1UD8A 1GUSA 2XGJA 3JQPA 1I94Q 2CQOA 3HOUB 3KF8A 3CESA 4Q0FA 1I4PA 1A2TA 2UUCQ 2CW0D 3AVWA 1GR1A 2Q6IA 2A1AA 4ZKBB 2J7KA 1A63A 3SK8A 2EXZA 4NXMQ 1PFNA 2A73B 2VUMH 5LL6X 4HSPA 3TRZA 2DJGC 3MFGA 3VYTA 3ITPA 3DEOA 1E7ZA 1WPCA 2F0GA 1PXUA 4XTCS 5A35A 4DR4L 4OPOA 2IW3A 4BY7G 1QFZA 1FD7D 2PMDA 2KCCA 1N06A 3PQIA 2F0UA 4A3EG 2ZJPA 2BE5D 1E2WA 2JA6G 1O78A 2L0CA 4TKOB 4XMYA 1H9SB 3WNBA 2IPKD 5IK2A 1EL0A 4RDLA 4LUVA 2K5NA 3BQJA 5DN6A 1D7QA 1IBML 2K6AA 3MFYA 3CW2C 4P73A 4IALA 1YLOA 4XLHA 3S1MH 4G1BA 5DSZA 4H7BA 5BSYA 1H9MA 1HUNA 5LMZA 4GS3A 1P4MA 2N88A 4DK3C 4B3SQ 3HOZG 3KBXA 3H3VH 1F9SA 1GUTA 3ASSA 2AMCB 1FR3A 2RSNA 5C44H 3GTKH 5KYIA 1BUVT 5H5JA 1XX8A 4R9WA 4A3DB 2R9VA 4A3MG 1I50B 2BH2A 4K2LA 1MJEA 5IE8A 2EY2A 1KJZA 3I4MG 3HOXB 1XMOL 2JA5G 5M5WH 2BA1A 1J5EL 3MXNA 2UXBL 1BCPB 5J1ZA 1GJXA 4DR1L 2GVBA 3SLDA 1AN8A 1BBWA 1T9HA 3KF8B 5AJ3L 5THXA 2V1CC 2OEOA 4KJOA 3EROA 2AQ1B 1GO3E 1JOKA 2H4OA 4RLZA 1PH8A 3AFPA 2A68C 4YHHQ 3SJPA 3CC2B 2OQKA 4XT3B 1YJ9B 2Z6BA 4IUNA 3ULLA 1LTID 1E24A 3PIOA 1KLGD 4DFAA 3Q39A 4ZV4A 3K81C 3Q3AA 4FVMA 3KJPA 2ES2A 3WXMA 3GTMB 5NUCA 4JC0A 2JA8H 2CQAA 2R92H 3L7ZC 3E9HA 1HA3A 3U4ZA 3B8HA 4RD6A 3S14H 3CC4B 1RCVD 1GHJA 1KK2A 1KZLA 2A5HA 2IX0A 2V7WA 2X8KA 2JEAI 3AGPA 2AKWB 3JAMi 4HMIA 1Y1WG 3KLWA 1NMGA 1SNQA 1HZAA 1Q81D 4TMZA 1A15A 1OO9B 1HQMC 1H9KA 5B6IA 2GPJA 4OO1H 4ASUA 4GOPA 1Q82D 1S5DD 1UD6A 1CUKA 2V7TA 4GLVB 1OXSC 1UEBA 1VQEA 3OSOA 4FP5D 1HR0L 3M4OH 1D1KA 1B9NA 2Y0SE 4ABNA 3K80C 4UP8A 5EAYA 5JJKA 3KL9A 3CCLB 2VUMB 3BU2A 4JI3Q 1HUMA 3QB3A 1EY0A 2OK8A 1EOVA 1Y8PB 1SJED 5FNZA 4B3GA 1EWCA 3D8GA 3TDQA 5FJ8H 4GQNA 4LF7Q 3QWNA 4J1MA 1YHQB 1KK1A 1B1ZA 4OP7A 3FKSA 1AZPA 1WOCA 3VO1A 1Y0RA 4DKAC 5KW9A 3K5MA 1SE8A 3PUMA 2OBRA 2WAQE 4NPSA 1S5FD 5EPKA 3J81c 1N9WA 3SR1A 1FL0A 2R61A 3LQEA 1NB9A 2GK7A 3I4LA 3OTOL 4I7AA 1PYBA 4BBSH 1BCPC 4M1KA 2F1LA 2IHFA 1IL8A 4RGNA 2F0HA 1AMOA 1Q9SA 2EYHA 1R5BA 1SNDA 1H95A 3A7AB 1BKBA 2UXCL 2OTJB 4IUUA 4RWSC 3PUYA 3LWEA 1E22A 3BDCA 4LK1C 4H02A 2PQAB 3OIPA 2C5HA 1PV4A 4R1JA 4M4SA 1AFPA 3CHBD 5M5WB 1PTOH 1F9PA 2DEUA 4KY5A 1S0UA 1DOLA 3BDLA 4B4DA 1QUFA 2CHBD 1JB9A 1C4QA 2KQ3A 3A3GA 1V0FA 2NVQB 3A35A 4Z4RA 1DZ1A 3T51B 3A8JA 2NVTB 5HZBA 1NUCA 3JQQA 1GVPA 1X3PA 5C3XA 4BY7H 1SNOA 1E64A 2HDNB 1MRZA 4A3EH 2WV6D 3K5NA 2CW5A 3CB4A 3W2EA 3H15A 5C0XJ 2JA6H 4XL9A 3AEVA 4IPHA 1PHJA 4ID6A 2K05A 5C4JH 1RIPA 2N55A 4K2KA 2XNCA 1CA6A 3AVVA 5CV7A 5FO9B 4KHPQ 4HJ8A 1H85A 1B3AA 3CTAA 1KRSA 4LAAA 2PO4A 2RDFA 4B3TQ 5CORA 1JWSD 2VB2X 3HOZH 4HR7B 3HP3A 2JA8B 1EQVA 1CKNB 1BX0A 1AP0A 3CCQA 2HCIA 3S14B 4A3CG 4X07A 1X56A 2E5LQ 4A3MH 4JYAL 4JI0Q 4DR6Q 5DM63 1VQ4B 5FL7A 1F60A 1RQRA 2DNEA 2PZUA 2WKCA 3MXUA 5I2YA 4BY1B 5IYWA 3I4MH 3AGQA 2L55A 4MTKA 1RDPD 2JA5H 4BA2I 2W6JA 5ELOA 5FA6A 4ZYSA 3DXJC 1VQJA 2CKZB 3CP0A 3PF5A 4CDFC 4MIUA 4LFAQ 4DV4L 1KC8C 5HZAA 1B3QA 4N3GA 4B08A 4BPRA 4H13C 3D4DA 4YEJA 1FGBD 1STGA 1WYDA 1XNRL 1HJPA 3MXPA 3URYA 1SKYB 1QZGA 3GTPH 3K7AH 3KK7A 1I4GA 4DV3L 2D62A 1JWMD 4GN5A 1XFOA 1TU2B 3MTSA 4FF2A 2VNKA 1YI2A 4JOIA 1MBYA 1L1OB 3NSWA 4OELB 4EQ5A 1XB2A 1VJSA 1LACA 2L12A 5FLXc 1R5OA 2FMMA 4B44A 2A69C 3PF4A 1NMFA 4KLKA 4BBSB 2JN4A 3E9IA 5FO7B 4FXGC 5GAGC 4K1XA 2C9OA 2SNSA 2ZL5A 1PTOD 4QUZA 4P1VA 4B3XA 3NBHA 1R9TH 2X69A 3A8IA 1TIID 1LYLA 4IO9A 3Q38A 1K9MD 4P2NA 3S1QH 3UDXA 3U6KA 4DR4Q 1Y1WH 3MVVA 3DLLA 4YAFA 1MI2A 1ML0D 1XXGA 3H91A 3NTKA 4E0FA 4MTNA 2DGYA 3ISXA 1BBUA 4Z4YA 4RDKA 5L46A 1TWCB 2B39A 4RHSA 2PZWA 4PMCA 4UAIA 4A3IG 1KNAA 1QOHA 2ZT9C 3PMFA 1C7YA 3OZVA 3CCRB 4DF7A 1IBMQ 1TVCA 2GJPA 1KXLA 4X66L 1QB5D 3KDFA 4Z4TA 3J80E 3HOXG 1EFTA 4E6IA 4BY7B 4WWVA 2VZLA 1W2BB 3VMFA 4QQBX 1O7IA 1FYCA 1RQPA 2BV3A 1KDCA 4QJFA 1D2EA 4NB3A 3BYYB 5M5XH 3ZUGA 4PABA 1ENAA 3SKBA 5C4ZA 1K0RA 3CP8A 1YEZA 4HSVA 5J39A 1IB0A 3A8KA 1S5ED 4Z4VA 3VR5A 2WP8J 2HUGA 3MA2B 2UXBQ 1HTPA 3LX0A 2YTYA 3B6YA 4DR1Q 1GHKA 3ASTA 2V4DA 3QFCA 1SXTA 1HHVA 2I07B 4K5XA 2XOKA 1G7CA 1PZJD 3RZDH 5AJ3Q 5TR9A 2B2TA 1X9NA 5KIXA 1STEA 3RNUA 2DJFC 2YV5A 5C0XG 2HD3A 2KEEA 1KK0A 4ME3A 1JE4A 4OWTB 2NBFA 4A76A 4NKLA 3VR2A 4TSSA 1EIGA 2OQ0A 2DOGA 2OF1A 2JN9A 1U4PA 1U5KA 1YIJA 4X7FA 2RKSA 2V7VA 2BGIA 4XN3A 1KDBA 1L1OC 4UP7A 4L5TA 3JAMc 1FGUA 5ELEA 1CZGA 4LC0A 5IOCA 1X3EA 4K8JA 2FXQA 1MSGA 1MKHA 5G3LD 2QA4A 4OX9L 2D74A 1WTHA 2K75A 4PZ6A 3S1RH 1OGIA 2B2UA 2R93H 1CTMA 1JT8A 2VNHA 4LF8Q 1JB3A 3CD6B 1FNMA 2XVSA 3OMCA 2GA4B 3GTGB 1D8TA 3NBIA 3S16B 3CXCA 3CRLC 5I2XA 5C3EB 4GN3B 1SNMA 3J7A5 1FNDA 2W6IA 3CCJB 4O2DA 1MD2D 1W34A 2K28A 1S5CD 2QKIC 4F87A 3A8IE 1SYGA 4G7XA 2F52A 1KAAA 2WB1E 3K0XA 4JI1Q 5IGGA 4FYDA 3S1NB 1E3ZA 2R7DA 1VQ6A 1HR0Q 4KKTA 1WTVA 1HZBA 2I46A 1E43A 1QNUA 2I1LA 1N0UA 1KNEA 1RF2D 1W6JA 2V7QA 5LL6S 5A2QE 1EQQA 4KMUC 2F0IA 2HMAA 1D2BA 3GTJH 2C4TA 1E79A 1UEAB 1UD5A 4PC6A 3S1QB 3E0EA 5M9OA 4JI3L 1N8RD 1Y1WB 3HOYH 3MZ5A 4F8MA 3I73A 4IOCA 5JVH3 1FNBA 2K14A 3HKZE 4K6LA 1XJVA 4DV0Q 3F2CA 3G4SA 1UAPA 5DAUA 2ASBA 4XORA 3VYSA 3PIP3 3Q6QA 4WZTA 1K8AD 1FNUA 1LABA 1QE6A 4AF7A 1OB2A 4PC2A 3HOUH 2R3ZA 2E2IH 2ID0A 1AE3A 2ZITA 3FHWA 1IBLL 1SYCA 1NAPA 2NTSA 1TUIA 5JOBA 2B2YA 3DM1A 4Z4UA 2N3SA 2JJQA 2E8GA 3A7LA 2UXCQ 1TT2A 2EVBA 3I8ZA 1JA0A 4YELA 5EPJA 5IY0A 4XQQA 3AVTA 1JC7A 3EFXD 4FF4A 1UE5A 1XNQL 3L2PA 2A6HC 3D31A 2EYJA 1YITA 1BVSA 1SJHD 4TRDA 3VNUA 2RHSB 3CQZB 1VQMA 1HZEA 4DGZA 4HIZA 1B44D 2NV4A 1KABA 1RJTA 1F9RA 1S5BD 3WY9A 1BMFA 4X7EA 2K33A 3SE0A 4M53A 3CMAB 4NW2A 5GAHC 3J81i 2EIXA 4Z4ZA 2ZXPA 3GVLA 3I72A 3NHHA 1SMYD 4GZYC 4AYBB 1FRNA 1D5XC 3FDTA 2AUJD 3W3AA 2PLFA 4P3IA 4NP5A 2NN6I 3F2UA 5M3MB 4MHEA 1S72B 5J3BA 2BCOA 1QUEA 1XMQL 1HZCA 1KK3A 1UNSA 1NBWA 4Y7NB 4A3IH 2Q8IB 3S9WA 4OOVA 3W2GA 1CT1D 4LFCL 2F0QA 3S17B 3GVKA 2QDBA 1I50H 2X0KA 5H59A 3IRBA 2B8GA 3S1RB 2ZTGA 4Y9RA 1VQLB 4BY1G 5KNCA 3HOXH 3OEEA 1FRQA 1EQRA 3P75A 3Q0AA 4KHPL 5IYBG 5KGUA 4XKWA 3WNDA 3ONUA 1G6ZA 4P22A 1I4QA 4CKBA 3PCOB 1MGSA 1ICWA 3STBC 4RMFA 2PMZE 5CYUA 1TS2A 4JYAQ 3VA7A 2G9DA 1QCBD 1XTDA 1YNND 1Y8OB 1GM5A 3L9AX 5J22A 5C4XG 3F1ZA 3VDYA 4DAYA 2E5LL 5F4OA 3CMEA 5LHY1 5JEAJ 4DR6L 3LVBA 1JOOA 3KBGA 1Q86C 2B5OA 1U4MA 4DK6C 1EYCA 5IYDG 4LF4L 5KNLA 1KRTA 3FPPA 4Q7JB 2L4NA 1N07A 4G6IA 4IFDI 4M8AA 1H8EA 5C0XH 4DV4Q 1EOTA 1ICFB 2OXPA 2X3UA 3ZIAA 2QTZA 4GKJL 2SNMA 3T56B 2H5XA 3BYTB 2UU9L 3GTMH 1M1KD 1LTBD 3GTJB 1XNRQ 4MYTA 1UE7A 3AFQA 2N78A 4DV3Q 4HJ7A 4II3A 2F0PA 4QUFA 4HE6A 2J0TD 4QIWB 2QTLA 1R5NA 2QEXB 3OP1A 1WSRA 1WTOA 5IGBA 3X3MA 3H3VI 4UAJA 1Q1BA 1GD7A 4DNTB 2Z0SA 5LMUL 2TMPA 4X05A 2E2IB 2F0LA 4A3BB 2IJ0A 2VBVA 4ZCIA 2DIEA 3PUZA 2B2VA 2XEXA 4HE5A 2B63G 3KF6A 4CHTB 3QOJA 1PFBA 3ES9A 2K1BA 2DY7A 1T5EA 4RCNA 3AMUA 3NTHA 2KHIA 1NR2A 4JMQA 3OWFA 4ZUIA 5ISRA 3PO3G 1EZ6A 1ESFA 2F03A 4R4QA 2K5HA 3WDNA 4XXEA 2WJVA 3AYHB 3G48A 4DR5L 2XZOA 1IKLA 1M90D 2K5DA 1ENCA 4RFBA 3F8TA 1EY6A 3A1PA 2QW7A 4C2MB 4O1NA 5KNBA 1ZYRC 2N49A 4H44C 3I55B 3CCEA 3KOJA 4A4IA 4KJNA 4X66Q 1GO2A 2VBSA 1OXVA 2AWNA 1DD2A 4POGA 1NSNS 2HCJB 2AHOA 2HT1A 2PNHA 3OJWA 5GV7A 1AIPA 1VDZA 2G9HD 4P25A 4RD0A 1SE2A 4CDEC 1BCPD 4RDJA 3FMCA 4A3IB 2BF4A 1QUQB 3HEJA 4K0KL 1FNCA 3EA6A 1LT5D 1PYSB 2ZZFA 4GN4B 2DUDA 2X6WA 1CZWA 4QL5A 5JAVA 5EMNA 1KIXA 4ODGA 3DWQA 5CV5A 1AE2A 4B3RQ 2HQLA 1K83B 2NZOA 1G7TA 3WBJA 1NTGA 3PUNA 2RCFA 3GQBA 4B43A 5IT9E 1VQ7A 5CV9A 3CPXA 4C0SA 1PFMA 3I56B 1VMPA 2QDLA 5K36H 1EFRA 2NVQH 3RLOA 4KD3A 3J81k 1N34Q 1RODA 2EYOA 1K8GA 3KLSA 3KLSX 1E1QA 2QDXA 2NVTH 4CQJA 4APVA 4KD4A 3R2IA 4RCYA 3R3OA 1IW7C 4B3ML 2A6EC 3M3YB 1D1NA 4OOXA 2IL8A 4N8X1 1W0JA 2M9VA 1LTTD 4OX9Q 1XYIA 3G71A 1VCIA 4ZLTF 3K59A 2XNAC 1RTNA 5C3EG 1IJFA 4FXUA 1PFSA 3GV6A 1N08A 3O13A 1QILA 2EY6A 3CCUA 2MNAA 3X3NA 1AW7A 3KYHC 3RLFA 2AWOA 1I5FA 1VQIA 3OW7A 3K8AA 4P74A 4YCUA 1QVFA 2XZPA 3TS0A 4NCNA 3VYUA 2R6GA 4PZ7A 2BOSA 5JEAG 3CCEB 4RCOA 4LF8L 4DV6L 1TR5A 4U673 1WVLA 4GNXA 4YCVA 3AVYA 1C8CA 3E20A 5IYPA 1CFMA 1HZ9A 3DEPA 4MNOA 1FJGL 4TQUS 4BY1H 5GADC 2WKDA 3F2DA 2WAQB 5FO0A 1W3SA 3VNVA 1H8HA 1U9RA 2NTTA 1PH3A 5IYBH 4G1VA 1VQ8A 1PA6A 1N0VC 2QCPX 2ICIA 3HOWB 4JI1L 4Z4WA 1HNZL 2X6XA 5G3LF 1PH7A 1SE4A 1JWUD 2JA7B 3C1FA 1B2TA 3T1HQ 4Y7CA 3BVZA 5C4XH 3J80c 2PPBC 4A3FB 1M4VA 2XRSD 3ULJA 1NRKA 5DLQE 2B7BA 4M1UB 4J15A 2HQEA 1O7YA 1J9OA 4YWLA 1PH6A 3GV3A 3MXNB 2K32A 4XLAA 5CDFA 5FLMG 4LNQA 1EU4A 2GN5A 5IYDH 2V7UA 1KC8D 3J81j 2CK3A 2F3VA 4POFA 4DPGA 2Q2HA 2KCNA 3QR8A 4DV0L 2K04A 5E3FA 3T53B 2ZTDA 1WCMB 2LXJA 3NWSA 3OW2A 1VLOA 4J8QA 4XYOA 5CC4A 1O7LA 1S3OA 1TS3A 1IBLQ 2PCFB 2ENBA 2X85A 3I70A 1GOZA 4X6AH 1PJ6A 2I5MX 1BDOA 1MIUA 3G7LA 3QFSA 3UE0A 5AFWA 3V96A 1QVCA 4A75A 4WZKA 2BE5C 5GROA 3IL8A 1W6KA 1SRUA 3J7AF 1E2ZA 2RDHA 1S4MA 4YHBA 2EJMA 4HJ5A 5KNDA 2YWEA 4XOTA 2ZXHA 1BQEA 2LKVA
chains in the Genus database with same CATH topology
1SYBA 4C3JB 2RBMA 3AU7A 2RQXA 3NWTA 2VJJA 2D9UA 4N9PA 2F1MA 4IZ8A 2IWHA 1HFGA 1IKMA 2F0EA 3H0GB 3M4YA 5ELBA 1PRTD 5FK9C 1IYVA 2RSOA 3GO5A 4ZRZA 3J7AV 1Z47A 3GTQB 4J6HA 5IIFA 1EWHA 4KY7A 2SOBA 2JDIA 3SXHA 2Z1CA 3NQTA 3SDZA 2E76C 4WRDA 3W2DA 5FOBB 5FKAC 3SK5A 4N9TA 2JIZA 2FMCA 5JPMC 2M2LA 1EZ8A 2KVOA 4HN7A 4LMQD 2E2HB 1YNJD 2LZJA 3FKIB 3HZXA 3MC0B 5C4XB 1JCKB 3WOEA 4RKBA 4A93B 3K57A 1ESRA 1TY2A 1DONA 1TWFB 3I90A 5F2DA 1JOQA 5E1FA 3SEBA 3RZOB 3NPPA 1STYA 1FNWA 2M5SA 4TT3A 5IGEA 4WORA 3QG1A 4L63B 2O2LD 4G7OC 5JEAH 1E3XA 4RKLA 2E75C 4IFDJ 4UZUA 1EEFD 3EQLC 4BWGB 5I4DA 4XN0A 5BN4A 4V190 1CQFA 2E1BA 3I4NB 1BPLA 3J81L 2XN9C 4UDUC 3A54A 5COYA 3PUVA 2EJGC 5K5PA 3SHLA 2PW5A 1LTGD 5D14A 3P1HA 2B63B 4BBRB 1O80A 5I6WA 1XWEA 2E2DC 2L1BA 4XLEA 1C48A 3FPUB 1TWGB 2IX1A 2YYZA 1HCZA 3PO3B 1BQQT 1COWA 4RGMA 2WIIB 3J7YW 3EJIA 5M5YB 3MXGA 4XLCA 1UUPA 1S4ZA 1R4QB 2JSOA 2F0DA 1Y1VB 2XNDA 1HA6A 3NQIA 3P7JA 2A6HD 2F0WA 3K5OA 2VJIA 1PLFA 5EBDA 3K58A 4K8IA 2F43A 4FF3A 3OAAA 1SFOB 5C3WA 1SNCA 2F0TA 1WTXA 5HURA 2VB3X 1ZXTA 2YU9B 2MPMA 1Q3LA 2EY5A 1I8DA 2GK6A 4LJZC 1TWHB 2Z4HA 1HVXA 3GP7A 2WZPP 1Q1EA 4PV1C 2F3WA 4OIKA 1F2ZA 5BN5A 4G7ZC 2NN6G 3OPOA 3QIAA 4XOPA 5M3FB 4MN3A 2F0NA 4BA1I 4EQNA 3NP8A 1LT4D 3FEWX 3OWEB 5D3IB 5C6AA 4F7XA 2D3NA 1PKVA 3FRPB 1F2YA 5FLXL 3D6CA 3K0YA 1BLIA 2XWBB 5DEHA 4BS9A 4KN4C 3PO2B 1RD9D 1TVXA 4XDXA 1WTWA 1BO0A 1STAA 1I4XA 2MGSA 4ME5A 1EYAA 2WJYA 4AVZA 4IFDG 1U4RA 2LS01 4R8IA 1VF7A 3GTOB 4C3JG 2MP1A 4XD7A 2MHVA 3DMUA 1TKWB 3VYRA 3T4AC 4B9WA 5CGKA 5T1IA 2EZVA 4G7WA 1ILPA 3KLRA 1SYDA 3IKJA 3S15B 4CJ0B 3IAYA 1V8QA 3ONAB 4IUPA 4RA8A 1EIHA 3DHQA 2V31A 4C3IG 1UD3A 4A3KB 1WD1A 5DNFA 2ZXIA 3N52A 3BCDA 2EDGA 5C0XI 3WOFA 2X6LA 1L0YB 3OEHA 1LTRD 2NVYB 1G8ZD 1KDAA 3BC9A 5FLXE 4Z1MA 1X32A 4OHJA 4C1NK 5JVG3 3JAML 1E2VA 4EVOA 4Q5VA 2PW7A 3C3LA 5TSSA 4DU9A 1T5XD 5CR3A 1G291 3QOLA 2B2TC 3E5SA 1I3QB 2AQ3B 1PRTF 3ND8A 2DY8A 2B2WA 1H9JA 1V1OA 2A74C 3C46A 4KKSA 3D4RA 5EKKA 1DXMA 4XT1B 4NNJA 2K5QA 4HEDA 3H94A 1IYUA 2QE7A 1I6HB 1IW7D 2A68D 2BDNA 2KECA 3M7GA 2O5JC 2B2UC 4NDXA 2EYPA 1H9SA 3TZUA 1U4LA 2BA0A 2XZLA 3D3RA 4WFN3 2ZXOA 3OFNA 3Q23A 1DJRD 2L5TA 1TWAB 1RKNA 2FHTA 3HGBA 1STNA 4ILWA 2EY1A 1HRJA 1IHZA 1QJOA 1KLUD 3OMGA 2NN6H 1D5MC 4XKVA 1PZKD 1G91A 4G57A 1K8OA 3GTLB 5I9PA 1M8AA 3HAGA 3V05A 2CVRA 1TQOA 2ZZEA 1AEXA 1A3TA 3JAME 1F77A 1ET9A 1EY8A 1NR4A 3IFTA 1NBMA 2SEBD 3DDYA 1AZQA 1K28D 1HFNA 3I3CA 1MSHA 3MHBA 4CGYB 2KOLA 4YIJA 2LFNA 4C56C 1BF4A 2IX3A 1WP6A 1G2SA 4IUTA 3S2HB 1PMRA 2NYZD 1W9XA 4FO2A 5ELDA 4KTAA 3BZDB 1PTOF 4XM3A 2QF7A 1PYWD 5KRUA 2B2YC 1SMYC 5ELFA 3N6RA 1HA5A 3ZYYX 4IFDH 1SDFA 2HDLA 3VR6A 3WQZA 1FX0A 2Q8TA 1WD0A 2F0JA 3OOCA 4HCEA 1B50A 1D1IA 2EPBA 1CA5A 3HOVB 5IGCA 1SYFA 2KHSA 3Q6SA 3I91A 4OO1I 1VF5C 1LO5D 1EEID 3ERQA 4RGOS 2J7ZA 1NCVA 5DM73 3RMHA 3SK4A 4K6DA 2MUYA 4QCLA 1YNNC 2XRQD 1SNPA 2BDOA 4KK7A 4ZUJA 2O5IC 2EJFC 2JE6I 4A3JB 1EFID 1OXXK 1E0BA 3RUZA 3TP6A 4IUVA 2GJRA 2Y0SB 4K5WA 1GXDC 3M85A 5CBAE 2EYFA 1SE3A 1OXUA 5C4HA 3K5LA 2X6YA 2QILA 4EQOA 2WSSA 2GJKA 2KA7A 2K7VA 1H9RA 2FINB 2KVMA 4DNRB 2B2WC 2NWGA 2WINB 4KI0A 1BBXC 4XLFA 3CRKC 1WTPA 1D6EC 1L0XB 4DN4M 1DM0B 1A6XA 3NE5B 2NUCA 4C3HB 2Z6BD 2CW0C 4F88A 1I18A 5HGTA 4IN3A 3TN2A 3DWAA 4X3KA 1JR0D 3HRZC 2AQ2B 5EGTA 1D5ZC 2EYMA 4CKEA 1GUNA 2K01A 4G7HC 3BS1A 1UD4A 2JYOA 4KHZA 4RGTA 2HLDA 2KUMA 3CP2A 3R2TA 2B2VC 4X3SA 2A69D 1CHQD 4KKUA 2JEBI 3BVMA 2TSSA 2DN8A 1EY9A 2OT2A 3NK9A 2F0VA 1GUOA 1LT6D 1X3QA 1LLRD 4DXGA 3G05A 4KY6A 3KEWA 5CV4A 3QJYA 4CBVA 1CQVA 3S1MB 3T13A 2EOTA 1Z7TA 5IGDA 1HPCA 2NZ1D 3PUXA 1TY0A 1SAPA 5C44B 2F0FA 3GTKB 1ZKOA 3LWUA 1J8IA 2JP1A 5C5MA 4V0BA 4XYQA 1STHA 3LNNA 5EPLA 4C3IB 5FO8B 1LTSD 4B9XA 3EVQA 4O42A 1E1RA 1A3VA 2R7ZB 4WJWA 1EY5A 4OIJA 1JQYD 4IQZA 1I4RA 5D3DA 4KHVA 3BDOA 3A56A 4XQJA 3PV0A 1JORA 1OB0A 5JPNC 1UD2A 1A3UA 1BOSA 3Q24A 3VA5A 3G6JB 5KYLA 1CI3M 5JJZA 5IODA 2KEDA 3KUPA 1DYQA 1PRTB 3CMMA 5C5LA 3D4WA 4DK0A 3BVGA 3NTIA 4QMGA 1O7ZA 2PNRC 2R92B 3PUWA 1SYEA 1V1PA 1OXTA 4DAVA 3CKIB 3IFDA 3BCFA 2ZTNA 2JJ2A 4DXFA 5KEEA 3J80L 3BG3A 1EQTA 5BN3A 3JU4A 3M4OB 3SK6A 3PIO3 1G2TA 2RA4A 1ENFA 1Z6HA 4PNYA 4CKCA 3OHXC 3H3VC 4ZKCB 4FXDA 1DOMA 2D5DA 1Q90A 5E4XA 1HXYD 2K5WA 1B9MA 3V2TA 3OE7A 5EBCA 1ILQA 5EQ0A 4PMWA 3AB9A 2X53S 3TZDA 1BNZA 3Q22A 3UI2A 2NVXB 3ZPNA 5IGFA 1DOKA 4YXWA 3TP7A 1GUGA 2Z4IA 1WTQA 2E2JB 5E4WC 2PZTA 1A2UA 1F2LA 5CV6A 3R93A 1BR9A 3A3BA 3A8JE 1V1PB 3RD4A 2D3LA 5EJWA 4ZK9B 4HTHA 1PTOB 5CMDA 2LY7A 2MJ8A 1PRTC 1SSOA 3C1EA 3TMEA 1CM9A 3GVJA 2O4XA 4I65A 4P2CB 2M00A 1OHHA 2EYLA 1ZEQX 1CHPD 3QO2A 4A3EB 4IURA 2JA6B 2H1EA 3C2PA 1I4HA 1MABA 1B4OA 5C4JB 1EY4A 4DA2A 4I7ZC 4XQNA 3DWPA 5A2QL 4JBWA 2FFKB 1FNVA 2J4XA 3J81E 1BCPF 3SVMA 2C5CA 1W0KA 2WB1B 5EKLA 4XNFA 1HTLD 1I6VC 1Q12A 1K8MA 3HOZB 3P20A 4ULLA 2JJ1A 1QNKA 1VMCA 3VR4A 2SDFA 3A55A 2KJXA 2ZZGA 2VXWA 4A3MB 1BXTA 1YNJC 2RVLA 3I4MB 3L3OC 3H6MA 2JA5B 4H0LC 2B8FA 4L8JA 4G4KA 1V0EA 1F2MA 3HKZB 3E6ZX 5CBEE 2WACA 1PZID 4IUQA 4C3HG 4L6TB 1JICA 4RH6A 1EY7A 4JK1C 1LTAD 1SEBD 4KN7C 3MEHA 3VR3A 3GTPB 2EE1A 3K7AB 2JXMB 1Y8NB 4K5VA 3U9SA 1RTOA 1V43A 2IT1A 1RHPA 2XIWA 1PTOC 1WTHD 4QB4A 1DCZA 2AUKA 5I9OA 1PDQA 1ONLA 3T16A 1R4PB 1EU3A 3TBIB 4B3FX 4NMZA 1GUWA 1R9TB 2DNCA 4XONA 3E0JA 3H09A 3TP5A 2Z8LA 1LV9A 3DUZA 3CU7A 1HQRD 1XTCD 3FVQA 5I6YA 1LT3D 2XSCA 1KTKA 2Q8RE 4RAUC 3R8BA 2D2CC 4EQPA 3MAQA 2NB0A 1KMHA 4II2A 3HS0C 2F0MA 3A8KE 2F4IA 4DK1A 5CV8A 2ZZQA 3TSSA 5K36G 5D65A 4OGQC 5M5XB 2PMZB 3NUCA 1ZYRD 4HCSA 3K6OA 4S3SA 4QUCA 3MWYW 5HKKA 4ZQ3A 3HG9A 3M7NA 4XIGS 2K03A 3TP8A 2F0SA 4A3GB 2ZXRA 4CJ1B 3RZDB 2PYKA 4X3TA 1EYDA 2F0OA 2QEJC 3OIQA 4KV6A 4DAPA 1STBA 4PQXA 5EKIA 4K14A 1TS4A 2E74C 4PMBA 1II3A 1WTRA 4CJ2C 2L11A 1VLYA 3S2DB 5T1GA 4X3UA 4HMJA 2R93B 2ICEC 3NXWA 1QG7A 4FXKC 2PQEA 2RDGA 4OO1G 2X6GA 2A6ED 1Y69U 4ZAIA 4Z9CB 2LMCB 1SBBB 4FNFA 2WPDA 2FJ2A 1QWYA 4FF1A 2F0KA 3ND9A 4OL7A 4R8NA 4RHRA 4QF4A 1B53A 4XQFA 1Q8IA 4EGVA 4C1NI 3D6WA 3BH4A 2L9HA 1CK1A 4TSFA 1ET6A 4U68A 1F9QA 1TS5A 2HCCA 3HOYB 5ELCA 2VNUD 4XR6A 3GD7A 2HDMA 2XWJB 4HAEA 5IT9L 3U9OA 1UD8A 1GUSA 2XGJA 3HOUB 3KF8A 3CESA 4Q0FA 1I4PA 1A2TA 2CW0D 4ZKBB 3SK8A 2EXZA 1PFNA 2A73B 5LL6X 4HSPA 3MFGA 3VYTA 3ITPA 3DEOA 1WPCA 2F0GA 1PXUA 4XTCS 5A35A 2IW3A 1FD7D 2KCCA 2F0UA 2BE5D 1E2WA 1O78A 2L0CA 4TKOB 4XMYA 1H9SB 2IPKD 5IK2A 1EL0A 5DN6A 2K6AA 3MFYA 4IALA 4XLHA 4H7BA 1H9MA 1HUNA 2N88A 3KBXA 1F9SA 1GUTA 2RSNA 1FR3A 5KYIA 1BUVT 1XX8A 4R9WA 4A3DB 2R9VA 1I50B 4K2LA 2EY2A 3HOXB 2BA1A 3MXNA 1GJXA 1BCPB 5J1ZA 1AN8A 2OEOA 4KJOA 3EROA 2AQ1B 1JOKA 2H4OA 2A68C 4XT3B 4IUNA 1LTID 1KLGD 4DFAA 4FVMA 3GTMB 5NUCA 2CQAA 3L7ZC 1RCVD 1GHJA 1KZLA 2A5HA 2IX0A 2X8KA 2JEAI 4HMIA 1SNQA 1A15A 1HQMC 1OO9B 1H9KA 4OO1H 4ASUA 1S5DD 1UD6A 1OXSC 3OSOA 4FP5D 1D1KA 1B9NA 4ABNA 2VUMB 1HUMA 3QB3A 1EY0A 1Y8PB 3D8GA 1SJED 3TDQA 4B3GA 1EWCA 4GQNA 3QWNA 4J1MA 1B1ZA 3FKSA 1AZPA 3K5MA 1S5FD 5EPKA 3SR1A 2R61A 2GK7A 3I4LA 1BCPC 1IL8A 4RGNA 2F0HA 2EYHA 1SNDA 3A7AB 4IUUA 4RWSC 3PUYA 3LWEA 3BDCA 4LK1C 3OIPA 1AFPA 3CHBD 5M5WB 1PTOH 1F9PA 4KY5A 1DOLA 3BDLA 2CHBD 1C4QA 2KQ3A 3A3GA 1V0FA 2NVQB 3A35A 1DZ1A 3T51B 2NVTB 1NUCA 1X3PA 5C3XA 1SNOA 2WV6D 3K5NA 5C0XJ 4XL9A 4ID6A 2K05A 2N55A 4K2KA 1CA6A 5CV7A 5FO9B 1B3AA 4LAAA 2PO4A 2RDFA 5CORA 1JWSD 2VB2X 4HR7B 3HP3A 2JA8B 1EQVA 1AP0A 2HCIA 3S14B 5DM63 5FL7A 2DNEA 2PZUA 2WKCA 3MXUA 5I2YA 4BY1B 2L55A 1RDPD 4BA2I 2W6JA 4ZYSA 3DXJC 4MIUA 4B08A 4H13C 3D4DA 4YEJA 1FGBD 1STGA 3URYA 3MXPA 1SKYB 3KK7A 1I4GA 2D62A 1JWMD 1TU2B 3MTSA 4FF2A 1MBYA 3NSWA 1VJSA 1LACA 2L12A 2FMMA 2A69C 4BBSB 5FO7B 4FXGC 2C9OA 2SNSA 1PTOD 3NBHA 2X69A 1TIID 3MVVA 1MI2A 1ML0D 1XXGA 3H91A 3NTKA 4E0FA 1TWCB 2B39A 4RHSA 2PZWA 4PMCA 4UAIA 1KNAA 1QOHA 2ZT9C 3PMFA 4DF7A 2GJPA 1QB5D 3J80E 4E6IA 4BY7B 1FYCA 1KDCA 3BYYB 1ENAA 5C4ZA 3CP8A 4HSVA 5J39A 1S5ED 3VR5A 2WP8J 2HUGA 3MA2B 1HTPA 3LX0A 1GHKA 2V4DA 1SXTA 1HHVA 2I07B 4K5XA 2XOKA 1PZJD 2B2TA 5KIXA 1STEA 5C0XG 2KEEA 1JE4A 2NBFA 4NKLA 3VR2A 4TSSA 1EIGA 2OF1A 1U4PA 2RKSA 4XN3A 1KDBA 5ELEA 1CZGA 5IOCA 4K8JA 1MSGA 5G3LD 2B2UA 1CTMA 1JB3A 3OMCA 2XVSA 2GA4B 3GTGB 3NBIA 3S16B 3CRLC 5I2XA 5C3EB 1SNMA 2W6IA 1MD2D 2K28A 1S5CD 2QKIC 4F87A 3A8IE 1SYGA 4G7XA 4FYDA 1KAAA 5IGGA 3S1NB 1E3ZA 4KKTA 1WTVA 2I46A 1E43A 1QNUA 1RF2D 1KNEA 1W6JA 2V7QA 5LL6S 5A2QE 4KMUC 2F0IA 1D2BA 1E79A 1UEAB 1UD5A 3S1QB 5M9OA 1Y1WB 3MZ5A 4F8MA 3I73A 5JVH3 4K6LA 1UAPA 5DAUA 4XORA 3VYSA 3PIP3 1FNUA 1LABA 1QE6A 2R3ZA 2ID0A 1SYCA 1NAPA 2NTSA 5JOBA 2B2YA 3DM1A 3A7LA 1TT2A 2EVBA 3I8ZA 4YELA 5EPJA 4XQQA 1JC7A 3EFXD 4FF4A 2A6HC 3D31A 2EYJA 1SJHD 4TRDA 3CQZB 1HZEA 4DGZA 4HIZA 1B44D 1KABA 1RJTA 1F9RA 1S5BD 1BMFA 2K33A 3SE0A 4NW2A 2ZXPA 3GVLA 3I72A 3NHHA 1SMYD 4GZYC 4AYBB 1D5XC 3FDTA 2AUJD 3W3AA 4NP5A 2NN6I 3F2UA 5M3MB 4MHEA 2BCOA 1UNSA 4Y7NB 2Q8IB 3S9WA 1CT1D 2F0QA 3S17B 3GVKA 2QDBA 2B8GA 3S1RB 2ZTGA 5KNCA 3OEEA 3Q0AA 3P75A 5KGUA 4XKWA 1G6ZA 4P22A 1I4QA 4CKBA 1MGSA 1ICWA 5CYUA 1TS2A 3VA7A 2G9DA 1QCBD 1YNND 1Y8OB 3L9AX 5J22A 4DAYA 5LHY1 5JEAJ 1JOOA 3KBGA 1U4MA 1EYCA 5KNLA 3FPPA 2L4NA 4G6IA 4IFDI 4M8AA 1H8EA 5C0XH 1EOTA 2OXPA 3ZIAA 2SNMA 3T56B 3BYTB 1LTBD 3GTJB 4II3A 2F0PA 4QUFA 2J0TD 4QIWB 1WTOA 5IGBA 3X3MA 1Q1BA 4DNTB 2TMPA 2E2IB 2F0LA 4A3BB 2IJ0A 2DIEA 3PUZA 2B2VA 4CHTB 3QOJA 1PFBA 2K1BA 2DY7A 1T5EA 4RCNA 3AMUA 3NTHA 1NR2A 4JMQA 3OWFA 4ZUIA 5ISRA 1EZ6A 1ESFA 2F03A 3WDNA 4XXEA 2WJVA 2XZOA 1IKLA 2K5DA 1ENCA 4RFBA 1EY6A 4C2MB 4O1NA 5KNBA 1ZYRC 4H44C 4KJNA 1OXVA 2AWNA 1DD2A 1NSNS 1VDZA 2G9HD 1SE2A 1BCPD 3FMCA 4A3IB 3HEJA 3EA6A 1LT5D 2ZZFA 2X6WA 1CZWA 5JAVA 4ODGA 3DWQA 5CV5A 1K83B 3GQBA 5IT9E 5CV9A 1VMPA 1PFMA 5K36H 1EFRA 4KD3A 1RODA 2EYOA 3KLSA 3KLSX 1E1QA 4KD4A 3R2IA 3R3OA 1IW7C 2A6EC 3M3YB 2IL8A 1W0JA 2M9VA 1LTTD 1XYIA 1VCIA 4ZLTF 3K59A 2XNAC 1RTNA 4FXUA 3GV6A 3O13A 1QILA 2EY6A 3X3NA 1AW7A 3RLFA 2AWOA 3OW7A 2XZPA 3VYUA 2R6GA 2BOSA 5JEAG 4RCOA 1TR5A 4U673 1WVLA 1C8CA 3DEPA 1CFMA 4TQUS 2WKDA 2WAQB 1H8HA 1U9RA 2NTTA 2QCPX 2ICIA 3HOWB 2X6XA 5G3LF 1SE4A 1JWUD 2JA7B 3C1FA 1B2TA 3BVZA 2PPBC 4A3FB 1M4VA 2XRSD 1NRKA 4M1UB 2HQEA 1O7YA 1J9OA 3GV3A 2K32A 4XLAA 5CDFA 1EU4A 2CK3A 2F3VA 2KCNA 2K04A 5E3FA 3T53B 1WCMB 3NWSA 4J8QA 4XYOA 5CC4A 1O7LA 1TS3A 2PCFB 2ENBA 2X85A 3I70A 1GOZA 1BDOA 3G7LA 5AFWA 3V96A 2BE5C 3IL8A 1W6KA 3J7AF 1E2ZA 2RDHA 2EJMA 5KNDA 4XOTA 2ZXHA 2LKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QIA A;  3GD7 A;  3QG1 A;  3GQB A;  3PUW A;  1PMR A;  4KMU C;  4G7O C;  3A8K E;  4I7Z C;  5JEA H;  1OXT A;  5K36 H;  2E75 C;  4BA1 I;  4JBW A;  4DK1 A;  2QF7 A;  3FPP A;  3EQL C;  1SMY C;  2ZT9 C;  3I73 A;  1GUS A;  3N6R A;  5BN4 A;  5K36 G;  4IFD H;  3L7Z C;  1E2V A;  4OGQ C;  1I6V C;  5C0X H;  1Q12 A;  1K8M A;  3P20 A;  1GUN A;  3VR6 A;  4G7H C;  1GHJ A;  1IW7 C;  2A6E C;  2F1M A;  3T56 B;  3VR4 A;  4KHZ A;  1FYC A;  1LAB A;  3BG3 A;  2JEA I;  3PUV A;  1G29 1;  2EJG C;  1VCI A;  5BN3 A;  1YNJ C;  3OOC A;  3M7N A;  4XIG S;  2A69 D;  4KKU A;  2JEB I;  3M4Y A;  3ND8 A;  4HR7 B;  1H9J A;  2DN8 A;  4H0L C;  1HQM C;  2AWO A;  4L8J A;  1H9K A;  4KKS A;  1Z6H A;  2B8F A;  3D4R A;  4XTC S;  5A35 A;  4OO1 H;  1IYV A;  3OW7 A;  1DXM A;  1VF5 C;  1GUO A;  3A7L A;  4KN4 C;  3VR5 A;  1OXS C;  2EVB A;  1Q1B A;  3H94 A;  2R6G A;  2YYZ A;  1HCZ A;  1B9N A;  4DNT B;  1IYU A;  2DNE A;  3MXU A;  5JEA G;  1IW7 D;  2D5D A;  2A68 D;  1HTP A;  2KCC A;  1GHK A;  2V4D A;  2A6H C;  2E74 C;  1E2W A;  2BE5 D;  1EWH A;  1O78 A;  1Q90 A;  3D31 A;  3PUZ A;  3QJY A;  4BA2 I;  1Y8P B;  4TKO B;  1H9S B;  4JK1 C;  2O5J C;  4IFD G;  3DXJ C;  4KN7 C;  1YNN C;  1B9M A;  3RLF A;  5C0X G;  1Z7T A;  1CFM A;  1HPC A;  4TQU S;  3SDZ A;  1T5E A;  4G7Z C;  4RCN A;  1VF7 A;  1H9S A;  3PUX A;  2BDO A;  3TZU A;  2E76 C;  2K33 A;  3SE0 A;  3VR2 A;  3AB9 A;  2BA0 A;  3MFY A;  1ZKO A;  3VR3 A;  3LWU A;  2O5I C;  2EJF C;  2JE6 I;  2JXM B;  1Y8N B;  3I72 A;  2L5T A;  1TKW B;  1OXX K;  1H9M A;  4H13 C;  3U9S A;  3WDN A;  3LNN A;  3HGB A;  1V43 A;  2IT1 A;  4GZY C;  3I4L A;  1GUT A;  1FR3 A;  2A6H D;  3M85 A;  1GUG A;  2AUJ D;  3W3A A;  4OO1 G;  3KLR A;  2D62 A;  1QJO A;  2A6E D;  2PPB C;  1OXU A;  5KNB A;  1DCZ A;  2AUK A;  1ZYR C;  1TU2 B;  1Y69 U;  2NN6 H;  2NN6 I;  4H44 C;  3IKJ A;  2LMC B;  1ONL A;  1CTM A;  1V8Q A;  3A8J E;  2K32 A;  2Q8I B;  3A7A B;  1K8O A;  4IQZ A;  2BA1 A;  1OXV A;  1LAC A;  1DD2 A;  2KA7 A;  2K7V A;  3ND9 A;  2A69 C;  2DNC A;  1H9R A;  3BDO A;  3CRL C;  3PUY A;  2B8G A;  4DNR B;  1GJX A;  3PV0 A;  4LK1 C;  3T53 B;  5KNC A;  1VDZ A;  4KI0 A;  3IFT A;  1O7L A;  2PCF B;  3CRK C;  4LJZ C;  2EDG A;  3FMC A;  3A8I E;  2A68 C;  1BDO A;  1A6X A;  3NE5 B;  1CI3 M;  3VA7 A;  2BE5 C;  1Q1E A;  4KKT A;  1Y8O B;  1E2Z A;  2CW0 C;  4PV1 C;  4DK0 A;  5BN5 A;  2EJM A;  5KND A;  2PNR C;  3T51 B;  2D2C C;  2NN6 G;  3OPO A; 
#chains in the Genus database with same CATH topology
 1XNQ Q;  4B48 A;  1SYB A;  4YAW A;  1OB5 A;  2JA9 A;  4AYB G;  1QX4 A;  4C3J B;  3EIV A;  2BM1 A;  2RBM A;  2Q6O A;  3AU7 A;  4GNX B;  5M3M G;  1TWC H;  2B63 H;  2RQX A;  3NWT A;  2VJJ A;  4DR7 L;  2D9U A;  4N9P A;  1SR3 A;  2CWP A;  4LFB L;  2F1M A;  2F3I A;  4IZ8 A;  2IWH A;  3S24 A;  1HFG A;  1VQ8 B;  1VQO A;  3OKX A;  3WYA A;  1IKM A;  1ASZ A;  2F4N A;  5BSX A;  3PO3 H;  3Q6R A;  3WNC A;  2F0E A;  4OPV A;  3H0G B;  3M4Y A;  4GOP B;  5ELB A;  2VQF L;  5GV8 A;  1PRT D;  1XMQ Q;  2K52 A;  2K5V A;  1Z9F A;  1KD1 C;  5FK9 C;  1IYV A;  4JI5 L;  2RSO A;  4LFC Q;  1Y0Y A;  3GO5 A;  4ZRZ A;  3J7A V;  1NJI D;  1Z47 A;  2BGJ A;  3GTQ B;  1NY4 A;  3W1B A;  5J3O A;  4J6H A;  1N36 Q;  5IIF A;  1EWH A;  4KY7 A;  2SOB A;  3QFR A;  2JDI A;  2BMW A;  4RG1 A;  1SM4 A;  3SXH A;  2K50 A;  2Z1C A;  3NQT A;  1EP2 B;  3SDZ A;  2ZJR A;  4R4T A;  2E76 C;  4WRD A;  4TMX A;  5FIU A;  2DER A;  3W2D A;  5FOB B;  5FKA C;  3SK5 A;  4N9T A;  1K73 D;  2JIZ A;  2FMC A;  1BX1 A;  4ZGQ B;  4ZCL A;  4OWX B;  1TXY A;  5JPM C;  3CPW A;  1XQB A;  3U2Q A;  1FVI A;  4OOS A;  1VQP A;  1DGS A;  2M2L A;  1EZ8 A;  2KVO A;  4JPB W;  4LF4 Q;  2CWA A;  4JI7 Q;  4HN7 A;  4LMQ D;  2E2H B;  1QGZ A;  1YNJ D;  1U0L A;  2OBS A;  2LZJ A;  1EFU A;  4HIO A;  2FVG A;  3FKI B;  3HZX A;  4DNI A;  4GKJ Q;  2XNJ A;  3MC0 B;  4UZF A;  4FDB A;  2UU9 Q;  1NE3 A;  1WSV A;  2UXD Q;  5C4X B;  1JCK B;  3WOE A;  4RKB A;  4A93 B;  3EN2 A;  3CCV A;  1Q81 C;  3SLN A;  3K57 A;  4HIM A;  3W2F A;  4A3B G;  1ESR A;  5GAE C;  4X65 L;  1TY2 A;  3F2B A;  1Q82 C;  2CCZ A;  1DON A;  1TWF B;  3I90 A;  3GTG H;  5F2D A;  1JOQ A;  1PH9 A;  3S16 H;  4H9G A;  5E1F A;  1WJJ A;  3SEB A;  5C3E H;  1A8P A;  3NPP A;  1STY A;  4LW1 A;  3RZO B;  1FNW A;  2M5S A;  2LXK A;  4TT3 A;  5GQO A;  1JJ2 A;  4GNX C;  5LMU Q;  5IGE A;  4WOR A;  1VQN A;  4JBM A;  3MHP A;  2GRE A;  3QG1 A;  4JCV E;  4L63 B;  3S1N H;  2VY3 A;  3RN5 A;  2O2L D;  4X06 A;  4G7O C;  4YWM A;  5JEA H;  1E3X A;  4RKL A;  2E75 C;  1TLL A;  4MZ9 A;  4IFD J;  4UZU A;  1EEF D;  3PSI A;  3EQL C;  1VQ9 A;  4LF6 Q;  4BWG B;  5I4D A;  4XN0 A;  3ASP A;  5BN4 A;  4V19 0;  1CQF A;  2E1B A;  4GOP C;  4GLX A;  3I4N B;  1BPL A;  3J81 L;  2C5B A;  2ZTE A;  3TEH B;  2XN9 C;  4DR5 Q;  4UDU C;  3A54 A;  1VHO A;  1XPU A;  4X7C A;  5COY A;  3PUV A;  2EJG C;  3CCQ B;  4RD3 A;  3I2Z A;  4AQY L;  5K5P A;  3SHL A;  2PW5 A;  1LTG D;  5D14 A;  1YJW A;  1YJN A;  3P1H A;  2B63 B;  1CNF A;  4OON A;  3ZBU A;  1HNX Q;  2MQH A;  4BBR B;  1O80 A;  3BZC A;  5I6W A;  1XWE A;  2E2D C;  1VQK A;  2L1B A;  3GTO H;  2CC2 A;  4XLE A;  1C48 A;  3FPU B;  1TWG B;  5F4M A;  2IX1 A;  2YYZ A;  1HCZ A;  3PO3 B;  1BQQ T;  5FLM H;  4M0L A;  1EP1 B;  1COW A;  4P72 A;  4RGM A;  4TN1 A;  2WII B;  2KCT A;  3J7Y W;  3HOV G;  2I5L X;  3EJI A;  1GAW A;  4QVA A;  4K0K Q;  3E3X A;  3MXG A;  5M5Y B;  4XLC A;  1UUP A;  4JW0 A;  1L2F A;  1S4Z A;  1R4Q B;  2JSO A;  3CQZ H;  2F0D A;  1JJG A;  1Y1V B;  2XND A;  1MJC A;  1HA6 A;  5IP9 G;  3NQI A;  2D0O A;  4IW3 B;  1YI2 B;  3P7J A;  2A6H D;  2F0W A;  2QGQ A;  3K5O A;  1SMX A;  2YTV A;  2F4V L;  4B3R L;  2VJI A;  2Q2I A;  1PLF A;  5EBD A;  3K58 A;  4K8I A;  1VQA A;  2F43 A;  2Q2U A;  4QV2 A;  4FF3 A;  3OAA A;  4IPD A;  3ICE A;  1SFO B;  5C3W A;  3P26 A;  1SNC A;  2F0T A;  1N34 L;  1WTX A;  1Y14 B;  4LBZ A;  2Y0S G;  4B3M Q;  1VQ9 B;  4R4C A;  5M3M H;  5HUR A;  2VB3 X;  1GJR A;  1ZXT A;  4QGU A;  3NBH B;  4Y7N H;  2YU9 B;  2MPM A;  1Q3L A;  2EY5 A;  1I8D A;  2GK6 A;  4NXN L;  4LJZ C;  1TWH B;  3S17 H;  1UE6 A;  2Z4H A;  1CKM A;  1XPO A;  1HVX A;  3GP7 A;  2WZP P;  2Q6L A;  1Q1E A;  2WAQ G;  3CC7 A;  1YJW B;  4C43 A;  4PV1 C;  2F3W A;  2YTX A;  4OIK A;  1F2Z A;  1ZM9 A;  4JI2 L;  5BN5 A;  1VQ5 A;  3PGZ A;  3HOW G;  4G7Z C;  2NN6 G;  3OPO A;  5A8A A;  3QIA A;  4DV6 Q;  4XOP A;  4F7D A;  5M3F B;  4MN3 A;  2JA7 G;  4PG3 A;  2F0N A;  4JV5 L;  4BA1 I;  1FJG Q;  1IL2 A;  1EXM A;  3KDF B;  3G6E A;  4A3F G;  1I3Q H;  4EQN A;  2JK8 A;  4UPA A;  3STB D;  3NP8 A;  2DY1 A;  1LT4 D;  1PVO A;  4UHV A;  2EIF A;  2ZTC A;  3CCM A;  4UY8 C;  1HNZ Q;  3BJU A;  3CCS A;  2PIA A;  3FEW X;  3OWE B;  5D3I B;  4RD4 A;  5C6A A;  4Z4S A;  4F7X A;  2D3N A;  4A3C H;  1SLJ A;  3LO8 A;  1WCM G;  4QY7 A;  5HGQ A;  1PKV A;  1A62 A;  3T1H L;  1N32 Q;  3FRP B;  1F2Y A;  1N33 L;  4QFM A;  3OYY A;  5FLX L;  3D6C A;  3K0Y A;  2DCU A;  1BLI A;  1OGJ A;  3ASQ A;  2XWB B;  5DEH A;  1W87 A;  4KN4 C;  4BS9 A;  3PO2 B;  2C2W A;  1RD9 D;  1TVX A;  4XDX A;  1WTW A;  3RR5 A;  1BO0 A;  4X0C A;  1STA A;  1I4X A;  2MGS A;  2OCE A;  4ME5 A;  1TWA H;  1EYA A;  4PGO A;  4UZE A;  2WJY A;  4AVZ A;  1QFJ A;  4DV1 Q;  4IFD G;  4X7D A;  1U4R A;  3CF5 A;  1YIJ B;  2EFG A;  4P9S A;  2LS0 1;  4R8I A;  4JOI C;  1VF7 A;  3GTO B;  4C3J G;  4A3B H;  5IT9 c;  3AVX A;  2MP1 A;  4XD7 A;  2YWG A;  3U6B A;  2MHV A;  3DMU A;  2ZL6 A;  1TKW B;  1GAQ A;  2QA4 B;  5IP7 G;  4AC9 A;  4TVA B;  3VYR A;  3T4A C;  5JJL A;  3W5H A;  4B9W A;  3J80 i;  5CGK A;  1T6X A;  5T1I A;  2EZV A;  4G7W A;  1ILP A;  3KLR A;  3UDG A;  1SYD A;  3IKJ A;  1L0W A;  3H0G G;  4QVJ A;  3S15 B;  2VNJ A;  4CJ0 B;  4DR3 L;  3IAY A;  1V8Q A;  4R4O A;  3CXC B;  3CW2 A;  3ONA B;  5E7N A;  3U50 C;  1T6Z A;  4IUP A;  2K4K A;  4DR7 Q;  4RA8 A;  1EIH A;  1KHI A;  3DHQ A;  4C2M H;  1PH4 A;  4LFB Q;  3CPF A;  2V31 A;  1QVG A;  1E63 A;  4N3N A;  3VO2 A;  4C3I G;  1KQS A;  1UD3 A;  4DUY Q;  4JI7 L;  1VQH A;  4A3K B;  1WD1 A;  2PI2 E;  5DNF A;  2ZXI A;  1QH0 A;  4GKK Q;  3N52 A;  2VQF Q;  3BCD A;  3S2H H;  2EDG A;  5C0X I;  5DS0 A;  1D8L A;  2R7Z G;  1VQ6 B;  3WOF A;  2I0Q A;  4HJA A;  2X6L A;  1L0Y B;  3V7A A;  4JI5 Q;  3B82 A;  2RC5 A;  3OEH A;  3TS2 A;  1LTR D;  2NVY B;  1G8Z D;  4LBV A;  1KDA A;  4IJH A;  3A5U A;  4X8I A;  3BC9 A;  2VW9 A;  5FLX E;  2ZBU A;  4OEM B;  4P26 A;  3MCA A;  4Z1M A;  4DV2 L;  1N36 L;  3G4S B;  1X32 A;  4O0A A;  4OHJ A;  4C1N K;  1K83 H;  5JVG 3;  3FJO A;  3JAM L;  1E2V A;  4EVO A;  3HOV H;  4Q5V A;  3ULP A;  4L5R C;  2YWH A;  1J6Q A;  1GKH A;  2PW7 A;  3C3L A;  1LUZ A;  5TSS A;  1B8A A;  3FKI G;  4DU9 A;  1T5X D;  5CR3 A;  4PC3 A;  1G29 1;  3QOL A;  5IWA L;  2B2T C;  4A93 G;  3E5S A;  1I3Q B;  2AQ3 B;  1PRT F;  3ND8 A;  5IP9 H;  2DY8 A;  2R7F A;  2B2W A;  3D0F A;  1H9J A;  1V1O A;  3A74 A;  2A74 C;  3M3Y H;  4RM0 A;  3C46 A;  2ZJQ A;  4KKS A;  3D4R A;  1Q7Y C;  5EKK A;  4JI4 L;  1FDR A;  4Y9U A;  1DXM A;  4XT1 B;  4NNJ A;  1YIT B;  2K5Q A;  4HED A;  3H94 A;  1IYU A;  2QE7 A;  1I6H B;  1VQM B;  1IW7 D;  2A68 D;  2BDN A;  3ZZ0 A;  2BSA A;  2KEC A;  2OWO A;  3M7G A;  2CND A;  4DQL A;  1PH2 A;  2O5J C;  1Q8K A;  4X65 Q;  2B2U C;  2UXD L;  3CAM A;  1KQS B;  1T6Y A;  4NDX A;  1ZM2 A;  1YNX A;  2EYP A;  1H9S A;  3K7U C;  2MFI A;  3TZU A;  1U4L A;  4LWC A;  2P3M A;  2BA0 A;  2XZL A;  4FWT A;  3D3R A;  2WYR A;  1ZUN B;  4WFN 3;  2ZXO A;  3OFN A;  5KSW B;  3Q23 A;  1DJR D;  4M2L A;  2L5T A;  4TMV A;  3I4N G;  1TWA B;  1RKN A;  2FHT A;  4PAA A;  3HGB A;  1STN A;  4ILW A;  2EY1 A;  1CSQ A;  1HRJ A;  1IHZ A;  3OZW A;  1QJO A;  1KLU D;  3HOW H;  3OMG A;  2NN6 H;  1D5M C;  5JBQ A;  1HNW L;  4XKV A;  1PZK D;  1G91 A;  4G57 A;  1K8A C;  2VYQ A;  2JA7 H;  1U2R A;  4JVZ A;  1K8O A;  1DDG A;  4BBR G;  3GTL B;  2QN6 A;  5I9P A;  2RC6 A;  1M8A A;  4A3F H;  3HAG A;  4YY3 L;  3I4O A;  4LF6 L;  3V05 A;  2CVR A;  1TQO A;  2ZZE A;  1AEX A;  1A3T A;  1C0A A;  3JAM E;  1F77 A;  1ET9 A;  1EY8 A;  1NR4 A;  5HY6 A;  3T1Y L;  3IFT A;  4AQY Q;  2Z9H A;  2HIV A;  1NBM A;  4X62 L;  2SEB D;  3DDY A;  1AZQ A;  1K28 D;  1HFN A;  3I3C A;  1MSH A;  4DAY B;  3MHB A;  1WCM H;  4CGY B;  2OK7 A;  2KOL A;  3CME B;  3LGJ A;  4YIJ A;  1HNX L;  2LFN A;  2FX3 A;  4C56 C;  1BF4 A;  3CC2 A;  4JI6 Q;  5LMN W;  1YJ9 A;  2BH8 A;  3SGI A;  1Y1V G;  2KBN A;  2IX3 A;  1WP6 A;  1G2S A;  4IUT A;  3S2H B;  2VBU A;  1PMR A;  2NYZ D;  3Q8D A;  3MEF A;  1W9X A;  4FO2 A;  5ELD A;  4KTA A;  4QIW E;  3BZD B;  1PTO F;  4XM3 A;  2QF7 A;  1PYW D;  5KRU A;  2CF4 A;  2B2Y C;  1SMY C;  5ELF A;  3N6R A;  1HA5 A;  3A5Z B;  2GQF A;  3ZYY X;  1SDF A;  4IFD H;  2HDL A;  4RCZ A;  2IHE A;  1IHM A;  3VR6 A;  3WQZ A;  5FO1 A;  1FX0 A;  2Q8T A;  1CKO A;  4C3J H;  3TQY A;  1WD0 A;  2F0J A;  3CC4 A;  3I7F A;  1XPR A;  1V1Q A;  2F4V Q;  3OOC A;  5IP7 H;  4HCE A;  1B50 A;  1D1I A;  2EPB A;  1CA5 A;  4L5S A;  1NNX A;  1X54 A;  2WB1 G;  3HOV B;  4QHY A;  5IGC A;  2B7C A;  1SYF A;  2KHS A;  3Q6S A;  3I91 A;  4OO1 I;  1EIY B;  1A0I A;  1VF5 C;  1LO5 D;  1EEI D;  2HHH L;  3H0G H;  3ERQ A;  4RGO S;  1RL2 A;  1NCV A;  2J7Z A;  5DM7 3;  3KF6 B;  3RMH A;  3SK4 A;  1TTT A;  2UUB L;  3ZBT A;  4K6D A;  3J7Z C;  3KJO A;  2KCM A;  2MUY A;  3M9B A;  5IYN A;  3UDI A;  2LSS A;  4QCL A;  1YNN C;  4NXN Q;  4IOA A;  5M3F G;  3CCL A;  2VQE L;  4C3I H;  2XRQ D;  4AH6 A;  4ACB A;  1SNP A;  3GTQ H;  2BDO A;  3HKZ G;  5IYQ A;  2ALY B;  4KK7 A;  4ZUJ A;  1KD1 D;  1YHQ A;  2O5I C;  2EJF C;  2JE6 I;  4A3J B;  2UUA L;  1KAW A;  2R7Z H;  1EFI D;  1OXX K;  3PA2 A;  1E0B A;  4JI2 Q;  3RUZ A;  4RD1 A;  3TP6 A;  4IUV A;  2CRV A;  2GJR A;  2Y0S B;  3MMP A;  1MHW C;  1VQB A;  3ZJY C;  4K5W A;  1KRH A;  2NZH A;  1K0S A;  1GXD C;  3M85 A;  5CBA E;  2C77 A;  2EYF A;  1SE3 A;  1OXU A;  4JV5 Q;  5C4H A;  3K5L A;  2X6Y A;  2P5Z X;  2QIL A;  3SJZ A;  2AHO B;  1M1K C;  1ZM3 A;  4EQO A;  4HJ9 A;  4EH1 A;  2WSS A;  2GJK A;  2KA7 A;  2K7V A;  1H9R A;  2FIN B;  1WOR A;  4LF5 L;  2KVM A;  3PO2 G;  4DNR B;  4ZGN B;  4ALP A;  2B2W C;  2E2H H;  2OTJ A;  2NWG A;  4RJL A;  2WIN B;  4KI0 A;  4RPD A;  1BBX C;  4YAU A;  3FKI H;  4XLF A;  3CRK C;  1WU8 A;  1NB0 A;  2PQA A;  1WTP A;  1D6E C;  1L0X B;  4DN4 M;  1WOP A;  1N33 Q;  1DM0 B;  1WOO A;  4A93 H;  2VZA A;  1A6X A;  3NE5 B;  4LF9 L;  4R71 A;  2NUC A;  4C3H B;  4L5Q A;  2Z6B D;  2CW0 C;  1VQ7 B;  1EFC A;  4P6Y A;  1N32 L;  2BN4 A;  1TWF H;  4F88 A;  4JBK A;  1I18 A;  3BY1 A;  3WWV A;  5HGT A;  4IN3 A;  3TN2 A;  3DWA A;  2B29 A;  3RZO H;  4BXX G;  4DAM A;  4DV7 L;  1QZH A;  4X3K A;  3I1F A;  1JR0 D;  3GDE A;  3HRZ C;  1X6O A;  2AQ2 B;  5EGT A;  1D5Z C;  2B3G A;  1DAR A;  4DV1 L;  1E1T A;  2EYM A;  1M90 C;  1G7S A;  4GLA C;  1HH2 P;  4CKE A;  1GUN A;  2K01 A;  4G7H C;  3G71 B;  3BY2 A;  3BS1 A;  1UD4 A;  2CH4 A;  2JYO A;  4KHZ A;  4RGT A;  3CCU B;  5BR8 L;  2HLD A;  2KUM A;  3CP2 A;  5TY0 A;  1EYG A;  3R2T A;  2B2V C;  2WZN A;  3W5V A;  4X3S A;  3I4N H;  1EWY A;  2A69 D;  4A3K G;  1CHQ D;  4KKU A;  2JEB I;  4JBJ A;  1QVF B;  3BVM A;  2TSS A;  4X64 L;  5A89 A;  2DN8 A;  1VQG A;  1EY9 A;  2OT2 A;  4LBY A;  3NK9 A;  4DR3 Q;  2F0V A;  1GUO A;  1CKN A;  1B23 P;  3V76 A;  1LT6 D;  1X3Q A;  4OPS A;  1LLR D;  4DXG A;  3TRE A;  4YWK A;  3G05 A;  4DQK A;  4KY6 A;  3KEW A;  5CV4 A;  3QJY A;  4BBR H;  1VQ4 A;  2NVX H;  4CBV A;  1CQV A;  1IBK L;  3S1M B;  1OTC A;  3T13 A;  4A3G G;  2EOT A;  5IYC G;  1Z7T A;  5IGD A;  1TWG H;  4DUY L;  1HPC A;  2NZ1 D;  1VQF A;  2E2J H;  3PUX A;  1TY0 A;  1SAP A;  5C44 B;  2F0F A;  1NDH A;  3GTK B;  1ZKO A;  4GKK L;  3LWU A;  1J8I A;  2JP1 A;  5C5M A;  4V0B A;  1K3R A;  3A0J A;  4XYQ A;  3C2Q A;  1STH A;  2D0P A;  3LNN A;  5EPL A;  5M5Y H;  4C3I B;  5FO8 B;  1LTS D;  4B9X A;  5J35 A;  3EVQ A;  3NEM A;  4O42 A;  4DV2 Q;  5L37 A;  1Y1V H;  4J0Q A;  1E1R A;  2CFM A;  1A3V A;  3HFZ B;  1V5V A;  2R7Z B;  4WJW A;  5A88 A;  1EY5 A;  4OIJ A;  4AF6 A;  1JQY D;  4A3L G;  4IQZ A;  2Q6K A;  1I4R A;  4AIM A;  5D3D A;  1L1O A;  4KHV A;  2R93 G;  1CQX A;  3OW2 B;  3BDO A;  4DV5 L;  3A56 A;  4XQJ A;  3PV0 A;  2CBX A;  2ZM6 L;  1JOR A;  4LUZ A;  1OB0 A;  5JPN C;  1E62 A;  5IWA Q;  1SFO H;  1UD2 A;  1F20 A;  4DUZ L;  1A3U A;  4ZCK A;  1GVH A;  1YVC A;  3RY8 A;  1BOS A;  3Q24 A;  3VA5 A;  3G6J B;  4JI4 Q;  5KYL A;  1CI3 M;  1G51 A;  5HXB A;  3GIR A;  5JJZ A;  5IOD A;  2YU9 H;  2KED A;  3KUP A;  1DYQ A;  2WFW A;  1PRT B;  3CMM A;  5C5L A;  3D4W A;  4DK0 A;  3BVG A;  3NTI A;  1TWH H;  4QMG A;  1O7Z A;  2PNR C;  1JA1 A;  1ZM4 A;  2R92 B;  2OYN A;  3PUW A;  1WOS A;  1SYE A;  3JQR A;  2ZL7 A;  5IYR A;  1CNE A;  1V1P A;  1OXT A;  4LUO A;  1A8V A;  2RF4 A;  4DAV A;  3CKI B;  2HIX A;  4RD2 A;  1QG0 A;  4DR2 L;  1G6P A;  3IFD A;  5LMN L;  5M3F H;  3PIP A;  3HOY G;  1VQO B;  1EP3 B;  2ZTN A;  2JJ2 A;  3BCF A;  4P6V F;  4Y52 H;  4FK8 A;  3CCR A;  4DXF A;  2ATW A;  1EFW A;  5KEE A;  3J80 L;  1WI5 A;  3BG3 A;  1EQT A;  5BN3 A;  3JU4 A;  2NPF A;  1W2B A;  3M4O B;  4G5G A;  1HNW Q;  2EXD A;  3SK6 A;  3PIO 3;  1ELO A;  1G2T A;  2RA4 A;  1ENF A;  3HOU G;  1Z6H A;  2QGG A;  1IYJ B;  3R6J A;  4PNY A;  4CKC A;  3OHX C;  2D9R A;  3H3V C;  1X3G A;  4ZKC B;  4JI8 Q;  4YY3 Q;  4FXD A;  1DOM A;  2D5D A;  1JE5 A;  4N8F A;  2A19 A;  2VS1 A;  4P71 A;  1Q90 A;  1YX2 A;  3ZZT A;  5E4X A;  3T1Y Q;  1HXY D;  2KEN A;  1X55 A;  2K5W A;  1QGA A;  1B9M A;  3V2T A;  4X62 Q;  3PO2 H;  3NEL A;  3OE7 A;  1XE1 A;  5EBC A;  1ILQ A;  5EQ0 A;  1LTL A;  4PMW A;  3AB9 A;  3OJX A;  1I94 L;  2X53 S;  3CPW B;  2A8V A;  3TZD A;  1BNZ A;  3Q22 A;  3RN2 A;  3UI2 A;  2UUC L;  2NVX B;  3ZPN A;  3HKS A;  4TMT A;  1VQP B;  4WZL A;  5IGF A;  1DOK A;  4YXW A;  3TP7 A;  1GUG A;  1P16 A;  2Z4I A;  1WTQ A;  4JI6 L;  4NXM L;  2E2J B;  5E4W C;  1V9P A;  2PZT A;  1E3P A;  1A2U A;  1F2L A;  5CV6 A;  1JJC B;  5ELN A;  3R93 A;  1KTV A;  3ZZU A;  1BR9 A;  4BXX H;  3A3B A;  3A8J E;  1V1P B;  3RD4 A;  2D3L A;  3CCV B;  5EJW A;  2KHJ A;  4HTH A;  1PTO B;  4ZK9 B;  5CMD A;  2IY5 B;  2LY7 A;  3CD6 A;  3S15 H;  2MJ8 A;  2ZBV A;  1PRT C;  1SSO A;  2WR8 A;  4A3D G;  1PH5 A;  3C1E A;  4FN5 A;  3TME A;  3QFT A;  1CM9 A;  4P12 A;  3GVJ A;  2O4X A;  1UWV A;  1NJI C;  3CCJ A;  4I65 A;  1JJ2 B;  1VQN B;  4B47 A;  4A3K H;  2DET A;  1OHH A;  2M00 A;  2EYL A;  4P2C B;  1ZEQ X;  1CHP D;  3PEN A;  4YAO A;  2Z6K A;  3QO2 A;  5H1S E;  2HHH Q;  4A3E B;  4A3J G;  3BNW A;  4IUR A;  4B3S L;  1JNY A;  2JA6 B;  2H1E A;  3C2P A;  1I4H A;  2UUB Q;  1MAB A;  3R6K A;  1B4O A;  1DG1 G;  5C4J B;  1EY4 A;  2XGT A;  1Q46 A;  4DA2 A;  2VBT A;  4I7Z C;  2NVY H;  4XQN A;  3DWP A;  5TV2 A;  2VQE Q;  3ZC3 A;  5A2Q L;  1XMO Q;  1IJE A;  4LBW A;  2FFK B;  1FNV A;  4JBW A;  4CDC C;  2J4X A;  1IZ6 A;  3J81 E;  1K73 C;  1J5E Q;  1BCP F;  4P75 A;  3ASR A;  3SVM A;  2C5C A;  2PI2 A;  1W0K A;  2WB1 B;  5EKL A;  4XNF A;  4A3G H;  1HTL D;  4UP9 A;  1I6V C;  5IYC H;  1Q12 A;  2UUA Q;  1K8M A;  3HOZ B;  2E1R A;  3P20 A;  2G5D A;  4ULL A;  2JJ1 A;  1QNK A;  1VMC A;  3VR4 A;  2SDF A;  3A55 A;  2KJX A;  2ZZG A;  2VXW A;  1YJN B;  2XTI A;  4A3M B;  1JB7 A;  3ER0 A;  1BXT A;  1YNJ C;  2RVL A;  2DYI A;  1VQK B;  2JQO A;  3I4M B;  3GSI A;  3L3O C;  3H6M A;  2JA5 B;  4H0L C;  1X65 A;  1H42 A;  4L8J A;  1V0E A;  2B8F A;  4G4K A;  1F2M A;  4YHH L;  2QMU A;  3HKZ B;  1CSP A;  3QE2 A;  3E6Z X;  3S2D H;  5CBE E;  2WAC A;  1PZI D;  4IUQ A;  1WFQ A;  4C3H G;  4LF5 Q;  4L6T B;  1JIC A;  2R6H A;  3W2H A;  4A3L H;  4RH6 A;  4CDD C;  4HID A;  1EY7 A;  1VS0 A;  2GVA A;  3OZU A;  4JK1 C;  1LTA D;  4PZ8 A;  1SEB D;  4KN7 C;  2RHQ B;  3MEH A;  1J9Z A;  1I6H H;  1K3B C;  1Q86 D;  3VR3 A;  3ERS X;  4P3Y A;  2EE1 A;  1Q7Y D;  3K7A B;  4LF9 Q;  3GTP B;  2JXM B;  1Y8N B;  4K5V A;  1VQD A;  3U9S A;  3CMA A;  2VUM G;  1RTO A;  3E1Y E;  1SN8 A;  1V43 A;  2IT1 A;  1RHP A;  2XIW A;  2C78 A;  3W1G A;  1C9O A;  4R4I A;  1PTO C;  4ZCM A;  1QFY A;  1WTH D;  4DV7 Q;  3AVU A;  4QB4 A;  1DCZ A;  2AUK A;  5I9O A;  4OWW B;  3P27 A;  4WQM A;  1PDQ A;  1K9M C;  5TRD A;  3PVD A;  2C4U A;  1ONL A;  2OTL A;  3T16 A;  1R4P B;  1EU3 A;  1JMC A;  1E1O A;  1DDI A;  4B3F X;  4NMZ A;  3TBI B;  1G7R A;  1GUW A;  3BZK A;  5F4J A;  1S72 A;  3JC6 6;  1R9T B;  2DNC A;  4XON A;  4ROX A;  3E0J A;  5BR8 Q;  2PE3 A;  1YHA A;  3H09 A;  3TP5 A;  2Z8L A;  1AH9 A;  1B7Y B;  1BJK A;  1LV9 A;  3DUZ A;  4LF7 L;  3GTL H;  1YBY A;  3CU7 A;  4X64 Q;  1HQR D;  1XTC D;  3CC7 B;  1VQL A;  3FVQ A;  1W35 A;  2MO1 A;  5I6Y A;  3U58 A;  1X3F A;  1LT3 D;  1VQ5 B;  2XSC A;  1EIF A;  1KTK A;  2Q8R E;  4RAU C;  5C44 G;  4RPB A;  3OTO Q;  3R8B A;  1PJ7 A;  2D2C C;  3CRZ A;  4EQP A;  1YZ6 A;  4EX5 A;  3MAQ A;  2NB0 A;  1IBK Q;  1KMH A;  4II2 A;  3G6E B;  1YHB A;  3HS0 C;  2MO0 A;  2F0M A;  3A8K E;  4PC1 A;  2F4I A;  1KL9 A;  4DK1 A;  1EWI A;  3RLN A;  4YAL A;  3CCM B;  2ZZQ A;  5CV8 A;  3TSS A;  5K36 G;  1PJ5 A;  5D65 A;  3FPK A;  4OGQ C;  5M5X B;  2PMZ B;  3CCS B;  1ZYR D;  3NUC A;  2VL6 A;  4HCS A;  3K6O A;  3W2I A;  4S3S A;  3NEN A;  4QUC A;  3MWY W;  5HKK A;  1HR0 W;  1WDT A;  4ZQ3 A;  2I5H A;  3HG9 A;  3FP9 A;  4NBS A;  3M7N A;  4XIG S;  2K03 A;  1LM0 A;  3TP8 A;  2F0S A;  1B2R A;  4A3G B;  3EBE A;  2ZXR A;  4JG2 A;  4CJ1 B;  2C35 B;  3RZD B;  2PYK A;  3LQ6 A;  1B70 B;  4X3T A;  1EYD A;  2F0O A;  2QEX A;  2QEJ C;  3OIQ A;  2OTL B;  4KV6 A;  4DAP A;  4DV5 Q;  5JJI A;  2EQS A;  1STB A;  4PQX A;  5EKI A;  4K14 A;  2ZM6 Q;  4HIK A;  2Q2T A;  1TS4 A;  2E74 C;  4PMB A;  1II3 A;  3DM3 A;  1EUJ A;  2JA8 G;  4IPG A;  2R92 G;  1WTR A;  3W5U A;  3L0O A;  1I7P A;  4IPC A;  2V7X A;  4DUZ Q;  4CJ2 C;  4WJ4 A;  2Z6K C;  3M4P A;  4A3D H;  2L11 A;  1VLY A;  3S2D B;  2YWF A;  5E6T A;  5T1G A;  4X3U A;  1SKQ A;  4WZE A;  4YCW A;  3UE1 A;  1UMK A;  4HMJ A;  4OXP A;  2R93 B;  2ICE C;  3NXW A;  1QG7 A;  4FXK C;  2PQE A;  3UDF A;  1IXR A;  4U9U A;  2RDG A;  4B3T L;  3U4V A;  4OO1 G;  4A3J H;  4MYU A;  2BM0 A;  2X6G A;  2A6E D;  4AYB E;  1Y69 U;  1P8L A;  4ZAI A;  3PA1 A;  2LMC B;  4Z9C B;  4TMW A;  1SBB B;  4FNF A;  1SRO A;  2WPD A;  2FJ2 A;  1QWY A;  4DR2 Q;  1QVG B;  3KFU A;  5LMN Q;  2BVN A;  4ACA A;  3I55 A;  4JI0 L;  2BPO A;  3AQQ A;  3W5O A;  4FF1 A;  1QGY A;  2F0K A;  3ND9 A;  4OL7 A;  4R8N A;  5FJ8 G;  4RHR A;  1N05 A;  5AN9 A;  3WBK A;  3QSY A;  1VQC A;  2VNI A;  4QF4 A;  1B53 A;  4XQF A;  1Q8I A;  4EGV A;  4C1N I;  3D26 A;  2CH4 W;  3D6W A;  3BH4 A;  2L15 A;  1VHE A;  2L9H A;  2RCN A;  1N8R C;  1S40 A;  1CK1 A;  4TSF A;  1K28 A;  2N8N A;  4WJ3 M;  1ET6 A;  4U68 A;  1PH1 A;  1F9Q A;  4LFA L;  1TS5 A;  2OBT A;  1QUQ A;  3SEJ A;  2HCC A;  3M4Q A;  3HOY B;  4BBS G;  5ELC A;  2VNU D;  3H9N A;  4PC7 A;  4XR6 A;  1UE1 A;  1ASY A;  3GD7 A;  2HDM A;  4JI8 L;  2XWJ B;  3ONY A;  4HAE A;  4C3H H;  4IJL A;  5IT9 L;  3B78 A;  3I56 A;  3U9O A;  1UD8 A;  1GUS A;  2XGJ A;  3JQP A;  1I94 Q;  2CQO A;  3HOU B;  3KF8 A;  3CES A;  4Q0F A;  1I4P A;  1A2T A;  2UUC Q;  2CW0 D;  3AVW A;  1GR1 A;  2Q6I A;  2A1A A;  4ZKB B;  2J7K A;  1A63 A;  3SK8 A;  2EXZ A;  4NXM Q;  1PFN A;  2A73 B;  2VUM H;  5LL6 X;  4HSP A;  3TRZ A;  2DJG C;  3MFG A;  3VYT A;  3ITP A;  3DEO A;  1E7Z A;  1WPC A;  2F0G A;  1PXU A;  4XTC S;  5A35 A;  4DR4 L;  4OPO A;  2IW3 A;  4BY7 G;  1QFZ A;  1FD7 D;  2PMD A;  2KCC A;  1N06 A;  3PQI A;  2F0U A;  4A3E G;  2ZJP A;  2BE5 D;  1E2W A;  2JA6 G;  1O78 A;  2L0C A;  4TKO B;  4XMY A;  1H9S B;  3WNB A;  2IPK D;  5IK2 A;  1EL0 A;  4RDL A;  4LUV A;  2K5N A;  3BQJ A;  5DN6 A;  1D7Q A;  1IBM L;  2K6A A;  3MFY A;  3CW2 C;  4P73 A;  4IAL A;  1YLO A;  4XLH A;  3S1M H;  4G1B A;  5DSZ A;  4H7B A;  5BSY A;  1H9M A;  1HUN A;  5LMZ A;  4GS3 A;  1P4M A;  2N88 A;  4DK3 C;  4B3S Q;  3HOZ G;  3KBX A;  3H3V H;  1F9S A;  1GUT A;  3ASS A;  2AMC B;  1FR3 A;  2RSN A;  5C44 H;  3GTK H;  5KYI A;  1BUV T;  5H5J A;  1XX8 A;  4R9W A;  4A3D B;  2R9V A;  4A3M G;  1I50 B;  2BH2 A;  4K2L A;  1MJE A;  5IE8 A;  2EY2 A;  1KJZ A;  3I4M G;  3HOX B;  1XMO L;  2JA5 G;  5M5W H;  2BA1 A;  1J5E L;  3MXN A;  2UXB L;  1BCP B;  5J1Z A;  1GJX A;  4DR1 L;  2GVB A;  3SLD A;  1AN8 A;  1BBW A;  1T9H A;  3KF8 B;  5AJ3 L;  5THX A;  2V1C C;  2OEO A;  4KJO A;  3ERO A;  2AQ1 B;  1GO3 E;  1JOK A;  2H4O A;  4RLZ A;  1PH8 A;  3AFP A;  2A68 C;  4YHH Q;  3SJP A;  3CC2 B;  2OQK A;  4XT3 B;  1YJ9 B;  2Z6B A;  4IUN A;  3ULL A;  1LTI D;  1E24 A;  3PIO A;  1KLG D;  4DFA A;  3Q39 A;  4ZV4 A;  3K81 C;  3Q3A A;  4FVM A;  3KJP A;  2ES2 A;  3WXM A;  3GTM B;  5NUC A;  4JC0 A;  2JA8 H;  2CQA A;  2R92 H;  3L7Z C;  3E9H A;  1HA3 A;  3U4Z A;  3B8H A;  4RD6 A;  3S14 H;  3CC4 B;  1RCV D;  1GHJ A;  1KK2 A;  1KZL A;  2A5H A;  2IX0 A;  2V7W A;  2X8K A;  2JEA I;  3AGP A;  2AKW B;  3JAM i;  4HMI A;  1Y1W G;  3KLW A;  1NMG A;  1SNQ A;  1HZA A;  1Q81 D;  4TMZ A;  1A15 A;  1OO9 B;  1HQM C;  1H9K A;  5B6I A;  2GPJ A;  4OO1 H;  4ASU A;  4GOP A;  1Q82 D;  1S5D D;  1UD6 A;  1CUK A;  2V7T A;  4GLV B;  1OXS C;  1UEB A;  1VQE A;  3OSO A;  4FP5 D;  1HR0 L;  3M4O H;  1D1K A;  1B9N A;  2Y0S E;  4ABN A;  3K80 C;  4UP8 A;  5EAY A;  5JJK A;  3KL9 A;  3CCL B;  2VUM B;  3BU2 A;  4JI3 Q;  1HUM A;  3QB3 A;  1EY0 A;  2OK8 A;  1EOV A;  1Y8P B;  1SJE D;  5FNZ A;  4B3G A;  1EWC A;  3D8G A;  3TDQ A;  5FJ8 H;  4GQN A;  4LF7 Q;  3QWN A;  4J1M A;  1YHQ B;  1KK1 A;  1B1Z A;  4OP7 A;  3FKS A;  1AZP A;  1WOC A;  3VO1 A;  1Y0R A;  4DKA C;  5KW9 A;  3K5M A;  1SE8 A;  3PUM A;  2OBR A;  2WAQ E;  4NPS A;  1S5F D;  5EPK A;  3J81 c;  1N9W A;  3SR1 A;  1FL0 A;  2R61 A;  3LQE A;  1NB9 A;  2GK7 A;  3I4L A;  3OTO L;  4I7A A;  1PYB A;  4BBS H;  1BCP C;  4M1K A;  2F1L A;  2IHF A;  1IL8 A;  4RGN A;  2F0H A;  1AMO A;  1Q9S A;  2EYH A;  1R5B A;  1SND A;  1H95 A;  3A7A B;  1BKB A;  2UXC L;  2OTJ B;  4IUU A;  4RWS C;  3PUY A;  3LWE A;  1E22 A;  3BDC A;  4LK1 C;  4H02 A;  2PQA B;  3OIP A;  2C5H A;  1PV4 A;  4R1J A;  4M4S A;  1AFP A;  3CHB D;  5M5W B;  1PTO H;  1F9P A;  2DEU A;  4KY5 A;  1S0U A;  1DOL A;  3BDL A;  4B4D A;  1QUF A;  2CHB D;  1JB9 A;  1C4Q A;  2KQ3 A;  3A3G A;  1V0F A;  2NVQ B;  3A35 A;  4Z4R A;  1DZ1 A;  3T51 B;  3A8J A;  2NVT B;  5HZB A;  1NUC A;  3JQQ A;  1GVP A;  1X3P A;  5C3X A;  4BY7 H;  1SNO A;  1E64 A;  2HDN B;  1MRZ A;  4A3E H;  2WV6 D;  3K5N A;  2CW5 A;  3CB4 A;  3W2E A;  3H15 A;  5C0X J;  2JA6 H;  4XL9 A;  3AEV A;  4IPH A;  1PHJ A;  4ID6 A;  2K05 A;  5C4J H;  1RIP A;  2N55 A;  4K2K A;  2XNC A;  1CA6 A;  3AVV A;  5CV7 A;  5FO9 B;  4KHP Q;  4HJ8 A;  1H85 A;  1B3A A;  3CTA A;  1KRS A;  4LAA A;  2PO4 A;  2RDF A;  4B3T Q;  5COR A;  1JWS D;  2VB2 X;  3HOZ H;  4HR7 B;  3HP3 A;  2JA8 B;  1EQV A;  1CKN B;  1BX0 A;  1AP0 A;  3CCQ A;  2HCI A;  3S14 B;  4A3C G;  4X07 A;  1X56 A;  2E5L Q;  4A3M H;  4JYA L;  4JI0 Q;  4DR6 Q;  5DM6 3;  1VQ4 B;  5FL7 A;  1F60 A;  1RQR A;  2DNE A;  2PZU A;  2WKC A;  3MXU A;  5I2Y A;  4BY1 B;  5IYW A;  3I4M H;  3AGQ A;  2L55 A;  4MTK A;  1RDP D;  2JA5 H;  4BA2 I;  2W6J A;  5ELO A;  5FA6 A;  4ZYS A;  3DXJ C;  1VQJ A;  2CKZ B;  3CP0 A;  3PF5 A;  4CDF C;  4MIU A;  4LFA Q;  4DV4 L;  1KC8 C;  5HZA A;  1B3Q A;  4N3G A;  4B08 A;  4BPR A;  4H13 C;  3D4D A;  4YEJ A;  1FGB D;  1STG A;  1WYD A;  1XNR L;  1HJP A;  3MXP A;  3URY A;  1SKY B;  1QZG A;  3GTP H;  3K7A H;  3KK7 A;  1I4G A;  4DV3 L;  2D62 A;  1JWM D;  4GN5 A;  1XFO A;  1TU2 B;  3MTS A;  4FF2 A;  2VNK A;  1YI2 A;  4JOI A;  1MBY A;  1L1O B;  3NSW A;  4OEL B;  4EQ5 A;  1XB2 A;  1VJS A;  1LAC A;  2L12 A;  5FLX c;  1R5O A;  2FMM A;  4B44 A;  2A69 C;  3PF4 A;  1NMF A;  4KLK A;  4BBS B;  2JN4 A;  3E9I A;  5FO7 B;  4FXG C;  5GAG C;  4K1X A;  2C9O A;  2SNS A;  2ZL5 A;  1PTO D;  4QUZ A;  4P1V A;  4B3X A;  3NBH A;  1R9T H;  2X69 A;  3A8I A;  1TII D;  1LYL A;  4IO9 A;  3Q38 A;  1K9M D;  4P2N A;  3S1Q H;  3UDX A;  3U6K A;  4DR4 Q;  1Y1W H;  3MVV A;  3DLL A;  4YAF A;  1MI2 A;  1ML0 D;  1XXG A;  3H91 A;  3NTK A;  4E0F A;  4MTN A;  2DGY A;  3ISX A;  1BBU A;  4Z4Y A;  4RDK A;  5L46 A;  1TWC B;  2B39 A;  4RHS A;  2PZW A;  4PMC A;  4UAI A;  4A3I G;  1KNA A;  1QOH A;  2ZT9 C;  3PMF A;  1C7Y A;  3OZV A;  3CCR B;  4DF7 A;  1IBM Q;  1TVC A;  2GJP A;  1KXL A;  4X66 L;  1QB5 D;  3KDF A;  4Z4T A;  3J80 E;  3HOX G;  1EFT A;  4E6I A;  4BY7 B;  4WWV A;  2VZL A;  1W2B B;  3VMF A;  4QQB X;  1O7I A;  1FYC A;  1RQP A;  2BV3 A;  1KDC A;  4QJF A;  1D2E A;  4NB3 A;  3BYY B;  5M5X H;  3ZUG A;  4PAB A;  1ENA A;  3SKB A;  5C4Z A;  1K0R A;  3CP8 A;  1YEZ A;  4HSV A;  5J39 A;  1IB0 A;  3A8K A;  1S5E D;  4Z4V A;  3VR5 A;  2WP8 J;  2HUG A;  3MA2 B;  2UXB Q;  1HTP A;  3LX0 A;  2YTY A;  3B6Y A;  4DR1 Q;  1GHK A;  3AST A;  2V4D A;  3QFC A;  1SXT A;  1HHV A;  2I07 B;  4K5X A;  2XOK A;  1G7C A;  1PZJ D;  3RZD H;  5AJ3 Q;  5TR9 A;  2B2T A;  1X9N A;  5KIX A;  1STE A;  3RNU A;  2DJF C;  2YV5 A;  5C0X G;  2HD3 A;  2KEE A;  1KK0 A;  4ME3 A;  1JE4 A;  4OWT B;  2NBF A;  4A76 A;  4NKL A;  3VR2 A;  4TSS A;  1EIG A;  2OQ0 A;  2DOG A;  2OF1 A;  2JN9 A;  1U4P A;  1U5K A;  1YIJ A;  4X7F A;  2RKS A;  2V7V A;  2BGI A;  4XN3 A;  1KDB A;  1L1O C;  4UP7 A;  4L5T A;  3JAM c;  1FGU A;  5ELE A;  1CZG A;  4LC0 A;  5IOC A;  1X3E A;  4K8J A;  2FXQ A;  1MSG A;  1MKH A;  5G3L D;  2QA4 A;  4OX9 L;  2D74 A;  1WTH A;  2K75 A;  4PZ6 A;  3S1R H;  1OGI A;  2B2U A;  2R93 H;  1CTM A;  1JT8 A;  2VNH A;  4LF8 Q;  1JB3 A;  3CD6 B;  1FNM A;  2XVS A;  3OMC A;  2GA4 B;  3GTG B;  1D8T A;  3NBI A;  3S16 B;  3CXC A;  3CRL C;  5I2X A;  5C3E B;  4GN3 B;  1SNM A;  3J7A 5;  1FND A;  2W6I A;  3CCJ B;  4O2D A;  1MD2 D;  1W34 A;  2K28 A;  1S5C D;  2QKI C;  4F87 A;  3A8I E;  1SYG A;  4G7X A;  2F52 A;  1KAA A;  2WB1 E;  3K0X A;  4JI1 Q;  5IGG A;  4FYD A;  3S1N B;  1E3Z A;  2R7D A;  1VQ6 A;  1HR0 Q;  4KKT A;  1WTV A;  1HZB A;  2I46 A;  1E43 A;  1QNU A;  2I1L A;  1N0U A;  1KNE A;  1RF2 D;  1W6J A;  2V7Q A;  5LL6 S;  5A2Q E;  1EQQ A;  4KMU C;  2F0I A;  2HMA A;  1D2B A;  3GTJ H;  2C4T A;  1E79 A;  1UEA B;  1UD5 A;  4PC6 A;  3S1Q B;  3E0E A;  5M9O A;  4JI3 L;  1N8R D;  1Y1W B;  3HOY H;  3MZ5 A;  4F8M A;  3I73 A;  4IOC A;  5JVH 3;  1FNB A;  2K14 A;  3HKZ E;  4K6L A;  1XJV A;  4DV0 Q;  3F2C A;  3G4S A;  1UAP A;  5DAU A;  2ASB A;  4XOR A;  3VYS A;  3PIP 3;  3Q6Q A;  4WZT A;  1K8A D;  1FNU A;  1LAB A;  1QE6 A;  4AF7 A;  1OB2 A;  4PC2 A;  3HOU H;  2R3Z A;  2E2I H;  2ID0 A;  1AE3 A;  2ZIT A;  3FHW A;  1IBL L;  1SYC A;  1NAP A;  2NTS A;  1TUI A;  5JOB A;  2B2Y A;  3DM1 A;  4Z4U A;  2N3S A;  2JJQ A;  2E8G A;  3A7L A;  2UXC Q;  1TT2 A;  2EVB A;  3I8Z A;  1JA0 A;  4YEL A;  5EPJ A;  5IY0 A;  4XQQ A;  3AVT A;  1JC7 A;  3EFX D;  4FF4 A;  1UE5 A;  1XNQ L;  3L2P A;  2A6H C;  3D31 A;  2EYJ A;  1YIT A;  1BVS A;  1SJH D;  4TRD A;  3VNU A;  2RHS B;  3CQZ B;  1VQM A;  1HZE A;  4DGZ A;  4HIZ A;  1B44 D;  2NV4 A;  1KAB A;  1RJT A;  1F9R A;  1S5B D;  3WY9 A;  1BMF A;  4X7E A;  2K33 A;  3SE0 A;  4M53 A;  3CMA B;  4NW2 A;  5GAH C;  3J81 i;  2EIX A;  4Z4Z A;  2ZXP A;  3GVL A;  3I72 A;  3NHH A;  1SMY D;  4GZY C;  4AYB B;  1FRN A;  1D5X C;  3FDT A;  2AUJ D;  3W3A A;  2PLF A;  4P3I A;  4NP5 A;  2NN6 I;  3F2U A;  5M3M B;  4MHE A;  1S72 B;  5J3B A;  2BCO A;  1QUE A;  1XMQ L;  1HZC A;  1KK3 A;  1UNS A;  1NBW A;  4Y7N B;  4A3I H;  2Q8I B;  3S9W A;  4OOV A;  3W2G A;  1CT1 D;  4LFC L;  2F0Q A;  3S17 B;  3GVK A;  2QDB A;  1I50 H;  2X0K A;  5H59 A;  3IRB A;  2B8G A;  3S1R B;  2ZTG A;  4Y9R A;  1VQL B;  4BY1 G;  5KNC A;  3HOX H;  3OEE A;  1FRQ A;  1EQR A;  3P75 A;  3Q0A A;  4KHP L;  5IYB G;  5KGU A;  4XKW A;  3WND A;  3ONU A;  1G6Z A;  4P22 A;  1I4Q A;  4CKB A;  3PCO B;  1MGS A;  1ICW A;  3STB C;  4RMF A;  2PMZ E;  5CYU A;  1TS2 A;  4JYA Q;  3VA7 A;  2G9D A;  1QCB D;  1XTD A;  1YNN D;  1Y8O B;  1GM5 A;  3L9A X;  5J22 A;  5C4X G;  3F1Z A;  3VDY A;  4DAY A;  2E5L L;  5F4O A;  3CME A;  5LHY 1;  5JEA J;  4DR6 L;  3LVB A;  1JOO A;  3KBG A;  1Q86 C;  2B5O A;  1U4M A;  4DK6 C;  1EYC A;  5IYD G;  4LF4 L;  5KNL A;  1KRT A;  3FPP A;  4Q7J B;  2L4N A;  1N07 A;  4G6I A;  4IFD I;  4M8A A;  1H8E A;  5C0X H;  4DV4 Q;  1EOT A;  1ICF B;  2OXP A;  2X3U A;  3ZIA A;  2QTZ A;  4GKJ L;  2SNM A;  3T56 B;  2H5X A;  3BYT B;  2UU9 L;  3GTM H;  1M1K D;  1LTB D;  3GTJ B;  1XNR Q;  4MYT A;  1UE7 A;  3AFQ A;  2N78 A;  4DV3 Q;  4HJ7 A;  4II3 A;  2F0P A;  4QUF A;  4HE6 A;  2J0T D;  4QIW B;  2QTL A;  1R5N A;  2QEX B;  3OP1 A;  1WSR A;  1WTO A;  5IGB A;  3X3M A;  3H3V I;  4UAJ A;  1Q1B A;  1GD7 A;  4DNT B;  2Z0S A;  5LMU L;  2TMP A;  4X05 A;  2E2I B;  2F0L A;  4A3B B;  2IJ0 A;  2VBV A;  4ZCI A;  2DIE A;  3PUZ A;  2B2V A;  2XEX A;  4HE5 A;  2B63 G;  3KF6 A;  4CHT B;  3QOJ A;  1PFB A;  3ES9 A;  2K1B A;  2DY7 A;  1T5E A;  4RCN A;  3AMU A;  3NTH A;  2KHI A;  1NR2 A;  4JMQ A;  3OWF A;  4ZUI A;  5ISR A;  3PO3 G;  1EZ6 A;  1ESF A;  2F03 A;  4R4Q A;  2K5H A;  3WDN A;  4XXE A;  2WJV A;  3AYH B;  3G48 A;  4DR5 L;  2XZO A;  1IKL A;  1M90 D;  2K5D A;  1ENC A;  4RFB A;  3F8T A;  1EY6 A;  3A1P A;  2QW7 A;  4C2M B;  4O1N A;  5KNB A;  1ZYR C;  2N49 A;  4H44 C;  3I55 B;  3CCE A;  3KOJ A;  4A4I A;  4KJN A;  4X66 Q;  1GO2 A;  2VBS A;  1OXV A;  2AWN A;  1DD2 A;  4POG A;  1NSN S;  2HCJ B;  2AHO A;  2HT1 A;  2PNH A;  3OJW A;  5GV7 A;  1AIP A;  1VDZ A;  2G9H D;  4P25 A;  4RD0 A;  1SE2 A;  4CDE C;  1BCP D;  4RDJ A;  3FMC A;  4A3I B;  2BF4 A;  1QUQ B;  3HEJ A;  4K0K L;  1FNC A;  3EA6 A;  1LT5 D;  1PYS B;  2ZZF A;  4GN4 B;  2DUD A;  2X6W A;  1CZW A;  4QL5 A;  5JAV A;  5EMN A;  1KIX A;  4ODG A;  3DWQ A;  5CV5 A;  1AE2 A;  4B3R Q;  2HQL A;  1K83 B;  2NZO A;  1G7T A;  3WBJ A;  1NTG A;  3PUN A;  2RCF A;  3GQB A;  4B43 A;  5IT9 E;  1VQ7 A;  5CV9 A;  3CPX A;  4C0S A;  1PFM A;  3I56 B;  1VMP A;  2QDL A;  5K36 H;  1EFR A;  2NVQ H;  3RLO A;  4KD3 A;  3J81 k;  1N34 Q;  1ROD A;  2EYO A;  1K8G A;  3KLS A;  3KLS X;  1E1Q A;  2QDX A;  2NVT H;  4CQJ A;  4APV A;  4KD4 A;  3R2I A;  4RCY A;  3R3O A;  1IW7 C;  4B3M L;  2A6E C;  3M3Y B;  1D1N A;  4OOX A;  2IL8 A;  4N8X 1;  1W0J A;  2M9V A;  1LTT D;  4OX9 Q;  1XYI A;  3G71 A;  1VCI A;  4ZLT F;  3K59 A;  2XNA C;  1RTN A;  5C3E G;  1IJF A;  4FXU A;  1PFS A;  3GV6 A;  1N08 A;  3O13 A;  1QIL A;  2EY6 A;  3CCU A;  2MNA A;  3X3N A;  1AW7 A;  3KYH C;  3RLF A;  2AWO A;  1I5F A;  1VQI A;  3OW7 A;  3K8A A;  4P74 A;  4YCU A;  1QVF A;  2XZP A;  3TS0 A;  4NCN A;  3VYU A;  2R6G A;  4PZ7 A;  2BOS A;  5JEA G;  3CCE B;  4RCO A;  4LF8 L;  4DV6 L;  1TR5 A;  4U67 3;  1WVL A;  4GNX A;  4YCV A;  3AVY A;  1C8C A;  3E20 A;  5IYP A;  1CFM A;  1HZ9 A;  3DEP A;  4MNO A;  1FJG L;  4TQU S;  4BY1 H;  5GAD C;  2WKD A;  3F2D A;  2WAQ B;  5FO0 A;  1W3S A;  3VNV A;  1H8H A;  1U9R A;  2NTT A;  1PH3 A;  5IYB H;  4G1V A;  1VQ8 A;  1PA6 A;  1N0V C;  2QCP X;  2ICI A;  3HOW B;  4JI1 L;  4Z4W A;  1HNZ L;  2X6X A;  5G3L F;  1PH7 A;  1SE4 A;  1JWU D;  2JA7 B;  3C1F A;  1B2T A;  3T1H Q;  4Y7C A;  3BVZ A;  5C4X H;  3J80 c;  2PPB C;  4A3F B;  1M4V A;  2XRS D;  3ULJ A;  1NRK A;  5DLQ E;  2B7B A;  4M1U B;  4J15 A;  2HQE A;  1O7Y A;  1J9O A;  4YWL A;  1PH6 A;  3GV3 A;  3MXN B;  2K32 A;  4XLA A;  5CDF A;  5FLM G;  4LNQ A;  1EU4 A;  2GN5 A;  5IYD H;  2V7U A;  1KC8 D;  3J81 j;  2CK3 A;  2F3V A;  4POF A;  4DPG A;  2Q2H A;  2KCN A;  3QR8 A;  4DV0 L;  2K04 A;  5E3F A;  3T53 B;  2ZTD A;  1WCM B;  2LXJ A;  3NWS A;  3OW2 A;  1VLO A;  4J8Q A;  4XYO A;  5CC4 A;  1O7L A;  1S3O A;  1TS3 A;  1IBL Q;  2PCF B;  2ENB A;  2X85 A;  3I70 A;  1GOZ A;  4X6A H;  1PJ6 A;  2I5M X;  1BDO A;  1MIU A;  3G7L A;  3QFS A;  3UE0 A;  5AFW A;  3V96 A;  1QVC A;  4A75 A;  4WZK A;  2BE5 C;  5GRO A;  3IL8 A;  1W6K A;  1SRU A;  3J7A F;  1E2Z A;  2RDH A;  1S4M A;  4YHB A;  2EJM A;  4HJ5 A;  5KND A;  2YWE A;  4XOT A;  2ZXH A;  1BQE A;  2LKV A; 
#chains in the Genus database with same CATH homology
 1SYB A;  4C3J B;  2RBM A;  3AU7 A;  2RQX A;  3NWT A;  2VJJ A;  2D9U A;  4N9P A;  2F1M A;  4IZ8 A;  2IWH A;  1HFG A;  1IKM A;  2F0E A;  3H0G B;  3M4Y A;  5ELB A;  1PRT D;  5FK9 C;  1IYV A;  2RSO A;  3GO5 A;  4ZRZ A;  3J7A V;  1Z47 A;  3GTQ B;  4J6H A;  5IIF A;  1EWH A;  4KY7 A;  2SOB A;  2JDI A;  3SXH A;  2Z1C A;  3NQT A;  3SDZ A;  2E76 C;  4WRD A;  3W2D A;  5FOB B;  5FKA C;  3SK5 A;  4N9T A;  2JIZ A;  2FMC A;  5JPM C;  2M2L A;  1EZ8 A;  2KVO A;  4HN7 A;  4LMQ D;  2E2H B;  1YNJ D;  2LZJ A;  3FKI B;  3HZX A;  3MC0 B;  5C4X B;  1JCK B;  3WOE A;  4RKB A;  4A93 B;  3K57 A;  1ESR A;  1TY2 A;  1DON A;  1TWF B;  3I90 A;  5F2D A;  1JOQ A;  5E1F A;  3SEB A;  3RZO B;  3NPP A;  1STY A;  1FNW A;  2M5S A;  4TT3 A;  5IGE A;  4WOR A;  3QG1 A;  4L63 B;  2O2L D;  4G7O C;  5JEA H;  1E3X A;  4RKL A;  2E75 C;  4IFD J;  4UZU A;  1EEF D;  3EQL C;  4BWG B;  5I4D A;  4XN0 A;  5BN4 A;  4V19 0;  1CQF A;  2E1B A;  3I4N B;  1BPL A;  3J81 L;  2XN9 C;  4UDU C;  3A54 A;  5COY A;  3PUV A;  2EJG C;  5K5P A;  3SHL A;  2PW5 A;  1LTG D;  5D14 A;  3P1H A;  2B63 B;  4BBR B;  1O80 A;  5I6W A;  1XWE A;  2E2D C;  2L1B A;  4XLE A;  1C48 A;  3FPU B;  1TWG B;  2IX1 A;  2YYZ A;  1HCZ A;  3PO3 B;  1BQQ T;  1COW A;  4RGM A;  2WII B;  3J7Y W;  3EJI A;  5M5Y B;  3MXG A;  4XLC A;  1UUP A;  1S4Z A;  1R4Q B;  2JSO A;  2F0D A;  1Y1V B;  2XND A;  1HA6 A;  3NQI A;  3P7J A;  2A6H D;  2F0W A;  3K5O A;  2VJI A;  1PLF A;  5EBD A;  3K58 A;  4K8I A;  2F43 A;  4FF3 A;  3OAA A;  1SFO B;  5C3W A;  1SNC A;  2F0T A;  1WTX A;  5HUR A;  2VB3 X;  1ZXT A;  2YU9 B;  2MPM A;  1Q3L A;  2EY5 A;  1I8D A;  2GK6 A;  4LJZ C;  1TWH B;  2Z4H A;  1HVX A;  3GP7 A;  2WZP P;  1Q1E A;  4PV1 C;  2F3W A;  4OIK A;  1F2Z A;  5BN5 A;  4G7Z C;  2NN6 G;  3OPO A;  3QIA A;  4XOP A;  5M3F B;  4MN3 A;  2F0N A;  4BA1 I;  4EQN A;  3NP8 A;  1LT4 D;  3FEW X;  3OWE B;  5D3I B;  5C6A A;  4F7X A;  2D3N A;  1PKV A;  3FRP B;  1F2Y A;  5FLX L;  3D6C A;  3K0Y A;  1BLI A;  2XWB B;  5DEH A;  4BS9 A;  4KN4 C;  3PO2 B;  1RD9 D;  1TVX A;  4XDX A;  1WTW A;  1BO0 A;  1STA A;  1I4X A;  2MGS A;  4ME5 A;  1EYA A;  2WJY A;  4AVZ A;  4IFD G;  1U4R A;  2LS0 1;  4R8I A;  1VF7 A;  3GTO B;  4C3J G;  2MP1 A;  4XD7 A;  2MHV A;  3DMU A;  1TKW B;  3VYR A;  3T4A C;  4B9W A;  5CGK A;  5T1I A;  2EZV A;  4G7W A;  1ILP A;  3KLR A;  1SYD A;  3IKJ A;  3S15 B;  4CJ0 B;  3IAY A;  1V8Q A;  3ONA B;  4IUP A;  4RA8 A;  1EIH A;  3DHQ A;  2V31 A;  4C3I G;  1UD3 A;  4A3K B;  1WD1 A;  5DNF A;  2ZXI A;  3N52 A;  3BCD A;  2EDG A;  5C0X I;  3WOF A;  2X6L A;  1L0Y B;  3OEH A;  1LTR D;  2NVY B;  1G8Z D;  1KDA A;  3BC9 A;  5FLX E;  4Z1M A;  1X32 A;  4OHJ A;  4C1N K;  5JVG 3;  3JAM L;  1E2V A;  4EVO A;  4Q5V A;  2PW7 A;  3C3L A;  5TSS A;  4DU9 A;  1T5X D;  5CR3 A;  1G29 1;  3QOL A;  2B2T C;  3E5S A;  1I3Q B;  2AQ3 B;  1PRT F;  3ND8 A;  2DY8 A;  2B2W A;  1H9J A;  1V1O A;  2A74 C;  3C46 A;  4KKS A;  3D4R A;  5EKK A;  1DXM A;  4XT1 B;  4NNJ A;  2K5Q A;  4HED A;  3H94 A;  1IYU A;  2QE7 A;  1I6H B;  1IW7 D;  2A68 D;  2BDN A;  2KEC A;  3M7G A;  2O5J C;  2B2U C;  4NDX A;  2EYP A;  1H9S A;  3TZU A;  1U4L A;  2BA0 A;  2XZL A;  3D3R A;  4WFN 3;  2ZXO A;  3OFN A;  3Q23 A;  1DJR D;  2L5T A;  1TWA B;  1RKN A;  2FHT A;  3HGB A;  1STN A;  4ILW A;  2EY1 A;  1HRJ A;  1IHZ A;  1QJO A;  1KLU D;  3OMG A;  2NN6 H;  1D5M C;  4XKV A;  1PZK D;  1G91 A;  4G57 A;  1K8O A;  3GTL B;  5I9P A;  1M8A A;  3HAG A;  3V05 A;  2CVR A;  1TQO A;  2ZZE A;  1AEX A;  1A3T A;  3JAM E;  1F77 A;  1ET9 A;  1EY8 A;  1NR4 A;  3IFT A;  1NBM A;  2SEB D;  3DDY A;  1AZQ A;  1K28 D;  1HFN A;  3I3C A;  1MSH A;  3MHB A;  4CGY B;  2KOL A;  4YIJ A;  2LFN A;  4C56 C;  1BF4 A;  2IX3 A;  1WP6 A;  1G2S A;  4IUT A;  3S2H B;  1PMR A;  2NYZ D;  1W9X A;  4FO2 A;  5ELD A;  4KTA A;  3BZD B;  1PTO F;  4XM3 A;  2QF7 A;  1PYW D;  5KRU A;  2B2Y C;  1SMY C;  5ELF A;  3N6R A;  1HA5 A;  3ZYY X;  4IFD H;  1SDF A;  2HDL A;  3VR6 A;  3WQZ A;  1FX0 A;  2Q8T A;  1WD0 A;  2F0J A;  3OOC A;  4HCE A;  1B50 A;  1D1I A;  2EPB A;  1CA5 A;  3HOV B;  5IGC A;  1SYF A;  2KHS A;  3Q6S A;  3I91 A;  4OO1 I;  1VF5 C;  1LO5 D;  1EEI D;  3ERQ A;  4RGO S;  2J7Z A;  1NCV A;  5DM7 3;  3RMH A;  3SK4 A;  4K6D A;  2MUY A;  4QCL A;  1YNN C;  2XRQ D;  1SNP A;  2BDO A;  4KK7 A;  4ZUJ A;  2O5I C;  2EJF C;  2JE6 I;  4A3J B;  1EFI D;  1OXX K;  1E0B A;  3RUZ A;  3TP6 A;  4IUV A;  2GJR A;  2Y0S B;  4K5W A;  1GXD C;  3M85 A;  5CBA E;  2EYF A;  1SE3 A;  1OXU A;  5C4H A;  3K5L A;  2X6Y A;  2QIL A;  4EQO A;  2WSS A;  2GJK A;  2KA7 A;  2K7V A;  1H9R A;  2FIN B;  2KVM A;  4DNR B;  2B2W C;  2NWG A;  2WIN B;  4KI0 A;  1BBX C;  4XLF A;  3CRK C;  1WTP A;  1D6E C;  1L0X B;  4DN4 M;  1DM0 B;  1A6X A;  3NE5 B;  2NUC A;  4C3H B;  2Z6B D;  2CW0 C;  4F88 A;  1I18 A;  5HGT A;  4IN3 A;  3TN2 A;  3DWA A;  4X3K A;  1JR0 D;  3HRZ C;  2AQ2 B;  5EGT A;  1D5Z C;  2EYM A;  4CKE A;  1GUN A;  2K01 A;  4G7H C;  3BS1 A;  1UD4 A;  2JYO A;  4KHZ A;  4RGT A;  2HLD A;  2KUM A;  3CP2 A;  3R2T A;  2B2V C;  4X3S A;  2A69 D;  1CHQ D;  4KKU A;  2JEB I;  3BVM A;  2TSS A;  2DN8 A;  1EY9 A;  2OT2 A;  3NK9 A;  2F0V A;  1GUO A;  1LT6 D;  1X3Q A;  1LLR D;  4DXG A;  3G05 A;  4KY6 A;  3KEW A;  5CV4 A;  3QJY A;  4CBV A;  1CQV A;  3S1M B;  3T13 A;  2EOT A;  1Z7T A;  5IGD A;  1HPC A;  2NZ1 D;  3PUX A;  1TY0 A;  1SAP A;  5C44 B;  2F0F A;  3GTK B;  1ZKO A;  3LWU A;  1J8I A;  2JP1 A;  5C5M A;  4V0B A;  4XYQ A;  1STH A;  3LNN A;  5EPL A;  4C3I B;  5FO8 B;  1LTS D;  4B9X A;  3EVQ A;  4O42 A;  1E1R A;  1A3V A;  2R7Z B;  4WJW A;  1EY5 A;  4OIJ A;  1JQY D;  4IQZ A;  1I4R A;  5D3D A;  4KHV A;  3BDO A;  3A56 A;  4XQJ A;  3PV0 A;  1JOR A;  1OB0 A;  5JPN C;  1UD2 A;  1A3U A;  1BOS A;  3Q24 A;  3VA5 A;  3G6J B;  5KYL A;  1CI3 M;  5JJZ A;  5IOD A;  2KED A;  3KUP A;  1DYQ A;  1PRT B;  3CMM A;  5C5L A;  3D4W A;  4DK0 A;  3BVG A;  3NTI A;  4QMG A;  1O7Z A;  2PNR C;  2R92 B;  3PUW A;  1SYE A;  1V1P A;  1OXT A;  4DAV A;  3CKI B;  3IFD A;  3BCF A;  2ZTN A;  2JJ2 A;  4DXF A;  5KEE A;  3J80 L;  3BG3 A;  1EQT A;  5BN3 A;  3JU4 A;  3M4O B;  3SK6 A;  3PIO 3;  1G2T A;  2RA4 A;  1ENF A;  1Z6H A;  4PNY A;  4CKC A;  3OHX C;  3H3V C;  4ZKC B;  4FXD A;  1DOM A;  2D5D A;  1Q90 A;  5E4X A;  1HXY D;  2K5W A;  1B9M A;  3V2T A;  3OE7 A;  5EBC A;  1ILQ A;  5EQ0 A;  4PMW A;  3AB9 A;  2X53 S;  3TZD A;  1BNZ A;  3Q22 A;  3UI2 A;  2NVX B;  3ZPN A;  5IGF A;  1DOK A;  4YXW A;  3TP7 A;  1GUG A;  2Z4I A;  1WTQ A;  2E2J B;  5E4W C;  2PZT A;  1A2U A;  1F2L A;  5CV6 A;  3R93 A;  1BR9 A;  3A3B A;  3A8J E;  1V1P B;  3RD4 A;  2D3L A;  5EJW A;  4ZK9 B;  4HTH A;  1PTO B;  5CMD A;  2LY7 A;  2MJ8 A;  1PRT C;  1SSO A;  3C1E A;  3TME A;  1CM9 A;  3GVJ A;  2O4X A;  4I65 A;  4P2C B;  2M00 A;  1OHH A;  2EYL A;  1ZEQ X;  1CHP D;  3QO2 A;  4A3E B;  4IUR A;  2JA6 B;  2H1E A;  3C2P A;  1I4H A;  1MAB A;  1B4O A;  5C4J B;  1EY4 A;  4DA2 A;  4I7Z C;  4XQN A;  3DWP A;  5A2Q L;  4JBW A;  2FFK B;  1FNV A;  2J4X A;  3J81 E;  1BCP F;  3SVM A;  2C5C A;  1W0K A;  2WB1 B;  5EKL A;  4XNF A;  1HTL D;  1I6V C;  1Q12 A;  1K8M A;  3HOZ B;  3P20 A;  4ULL A;  2JJ1 A;  1QNK A;  1VMC A;  3VR4 A;  2SDF A;  3A55 A;  2KJX A;  2ZZG A;  2VXW A;  4A3M B;  1BXT A;  1YNJ C;  2RVL A;  3I4M B;  3L3O C;  3H6M A;  2JA5 B;  4H0L C;  2B8F A;  4L8J A;  4G4K A;  1V0E A;  1F2M A;  3HKZ B;  3E6Z X;  5CBE E;  2WAC A;  1PZI D;  4IUQ A;  4C3H G;  4L6T B;  1JIC A;  4RH6 A;  1EY7 A;  4JK1 C;  1LTA D;  1SEB D;  4KN7 C;  3MEH A;  3VR3 A;  3GTP B;  2EE1 A;  3K7A B;  2JXM B;  1Y8N B;  4K5V A;  3U9S A;  1RTO A;  1V43 A;  2IT1 A;  1RHP A;  2XIW A;  1PTO C;  1WTH D;  4QB4 A;  1DCZ A;  2AUK A;  5I9O A;  1PDQ A;  1ONL A;  3T16 A;  1R4P B;  1EU3 A;  3TBI B;  4B3F X;  4NMZ A;  1GUW A;  1R9T B;  2DNC A;  4XON A;  3E0J A;  3H09 A;  3TP5 A;  2Z8L A;  1LV9 A;  3DUZ A;  3CU7 A;  1HQR D;  1XTC D;  3FVQ A;  5I6Y A;  1LT3 D;  2XSC A;  1KTK A;  2Q8R E;  4RAU C;  3R8B A;  2D2C C;  4EQP A;  3MAQ A;  2NB0 A;  1KMH A;  4II2 A;  3HS0 C;  2F0M A;  3A8K E;  2F4I A;  4DK1 A;  5CV8 A;  2ZZQ A;  3TSS A;  5K36 G;  5D65 A;  4OGQ C;  5M5X B;  2PMZ B;  3NUC A;  1ZYR D;  4HCS A;  3K6O A;  4S3S A;  4QUC A;  3MWY W;  5HKK A;  4ZQ3 A;  3HG9 A;  3M7N A;  4XIG S;  2K03 A;  3TP8 A;  2F0S A;  4A3G B;  2ZXR A;  4CJ1 B;  3RZD B;  2PYK A;  4X3T A;  1EYD A;  2F0O A;  2QEJ C;  3OIQ A;  4KV6 A;  4DAP A;  1STB A;  4PQX A;  5EKI A;  4K14 A;  1TS4 A;  2E74 C;  4PMB A;  1II3 A;  1WTR A;  4CJ2 C;  2L11 A;  1VLY A;  3S2D B;  5T1G A;  4X3U A;  4HMJ A;  2R93 B;  2ICE C;  3NXW A;  1QG7 A;  4FXK C;  2PQE A;  2RDG A;  4OO1 G;  2X6G A;  2A6E D;  1Y69 U;  4ZAI A;  4Z9C B;  2LMC B;  1SBB B;  4FNF A;  2WPD A;  2FJ2 A;  1QWY A;  4FF1 A;  2F0K A;  3ND9 A;  4OL7 A;  4R8N A;  4RHR A;  4QF4 A;  1B53 A;  4XQF A;  1Q8I A;  4EGV A;  4C1N I;  3D6W A;  3BH4 A;  2L9H A;  1CK1 A;  4TSF A;  1ET6 A;  4U68 A;  1F9Q A;  1TS5 A;  2HCC A;  3HOY B;  5ELC A;  2VNU D;  4XR6 A;  3GD7 A;  2HDM A;  2XWJ B;  4HAE A;  5IT9 L;  3U9O A;  1UD8 A;  1GUS A;  2XGJ A;  3HOU B;  3KF8 A;  3CES A;  4Q0F A;  1I4P A;  1A2T A;  2CW0 D;  4ZKB B;  3SK8 A;  2EXZ A;  1PFN A;  2A73 B;  5LL6 X;  4HSP A;  3MFG A;  3VYT A;  3ITP A;  3DEO A;  1WPC A;  2F0G A;  1PXU A;  4XTC S;  5A35 A;  2IW3 A;  1FD7 D;  2KCC A;  2F0U A;  2BE5 D;  1E2W A;  1O78 A;  2L0C A;  4TKO B;  4XMY A;  1H9S B;  2IPK D;  5IK2 A;  1EL0 A;  5DN6 A;  2K6A A;  3MFY A;  4IAL A;  4XLH A;  4H7B A;  1H9M A;  1HUN A;  2N88 A;  3KBX A;  1F9S A;  1GUT A;  2RSN A;  1FR3 A;  5KYI A;  1BUV T;  1XX8 A;  4R9W A;  4A3D B;  2R9V A;  1I50 B;  4K2L A;  2EY2 A;  3HOX B;  2BA1 A;  3MXN A;  1GJX A;  1BCP B;  5J1Z A;  1AN8 A;  2OEO A;  4KJO A;  3ERO A;  2AQ1 B;  1JOK A;  2H4O A;  2A68 C;  4XT3 B;  4IUN A;  1LTI D;  1KLG D;  4DFA A;  4FVM A;  3GTM B;  5NUC A;  2CQA A;  3L7Z C;  1RCV D;  1GHJ A;  1KZL A;  2A5H A;  2IX0 A;  2X8K A;  2JEA I;  4HMI A;  1SNQ A;  1A15 A;  1HQM C;  1OO9 B;  1H9K A;  4OO1 H;  4ASU A;  1S5D D;  1UD6 A;  1OXS C;  3OSO A;  4FP5 D;  1D1K A;  1B9N A;  4ABN A;  2VUM B;  1HUM A;  3QB3 A;  1EY0 A;  1Y8P B;  3D8G A;  1SJE D;  3TDQ A;  4B3G A;  1EWC A;  4GQN A;  3QWN A;  4J1M A;  1B1Z A;  3FKS A;  1AZP A;  3K5M A;  1S5F D;  5EPK A;  3SR1 A;  2R61 A;  2GK7 A;  3I4L A;  1BCP C;  1IL8 A;  4RGN A;  2F0H A;  2EYH A;  1SND A;  3A7A B;  4IUU A;  4RWS C;  3PUY A;  3LWE A;  3BDC A;  4LK1 C;  3OIP A;  1AFP A;  3CHB D;  5M5W B;  1PTO H;  1F9P A;  4KY5 A;  1DOL A;  3BDL A;  2CHB D;  1C4Q A;  2KQ3 A;  3A3G A;  1V0F A;  2NVQ B;  3A35 A;  1DZ1 A;  3T51 B;  2NVT B;  1NUC A;  1X3P A;  5C3X A;  1SNO A;  2WV6 D;  3K5N A;  5C0X J;  4XL9 A;  4ID6 A;  2K05 A;  2N55 A;  4K2K A;  1CA6 A;  5CV7 A;  5FO9 B;  1B3A A;  4LAA A;  2PO4 A;  2RDF A;  5COR A;  1JWS D;  2VB2 X;  4HR7 B;  3HP3 A;  2JA8 B;  1EQV A;  1AP0 A;  2HCI A;  3S14 B;  5DM6 3;  5FL7 A;  2DNE A;  2PZU A;  2WKC A;  3MXU A;  5I2Y A;  4BY1 B;  2L55 A;  1RDP D;  4BA2 I;  2W6J A;  4ZYS A;  3DXJ C;  4MIU A;  4B08 A;  4H13 C;  3D4D A;  4YEJ A;  1FGB D;  1STG A;  3URY A;  3MXP A;  1SKY B;  3KK7 A;  1I4G A;  2D62 A;  1JWM D;  1TU2 B;  3MTS A;  4FF2 A;  1MBY A;  3NSW A;  1VJS A;  1LAC A;  2L12 A;  2FMM A;  2A69 C;  4BBS B;  5FO7 B;  4FXG C;  2C9O A;  2SNS A;  1PTO D;  3NBH A;  2X69 A;  1TII D;  3MVV A;  1MI2 A;  1ML0 D;  1XXG A;  3H91 A;  3NTK A;  4E0F A;  1TWC B;  2B39 A;  4RHS A;  2PZW A;  4PMC A;  4UAI A;  1KNA A;  1QOH A;  2ZT9 C;  3PMF A;  4DF7 A;  2GJP A;  1QB5 D;  3J80 E;  4E6I A;  4BY7 B;  1FYC A;  1KDC A;  3BYY B;  1ENA A;  5C4Z A;  3CP8 A;  4HSV A;  5J39 A;  1S5E D;  3VR5 A;  2WP8 J;  2HUG A;  3MA2 B;  1HTP A;  3LX0 A;  1GHK A;  2V4D A;  1SXT A;  1HHV A;  2I07 B;  4K5X A;  2XOK A;  1PZJ D;  2B2T A;  5KIX A;  1STE A;  5C0X G;  2KEE A;  1JE4 A;  2NBF A;  4NKL A;  3VR2 A;  4TSS A;  1EIG A;  2OF1 A;  1U4P A;  2RKS A;  4XN3 A;  1KDB A;  5ELE A;  1CZG A;  5IOC A;  4K8J A;  1MSG A;  5G3L D;  2B2U A;  1CTM A;  1JB3 A;  3OMC A;  2XVS A;  2GA4 B;  3GTG B;  3NBI A;  3S16 B;  3CRL C;  5I2X A;  5C3E B;  1SNM A;  2W6I A;  1MD2 D;  2K28 A;  1S5C D;  2QKI C;  4F87 A;  3A8I E;  1SYG A;  4G7X A;  4FYD A;  1KAA A;  5IGG A;  3S1N B;  1E3Z A;  4KKT A;  1WTV A;  2I46 A;  1E43 A;  1QNU A;  1RF2 D;  1KNE A;  1W6J A;  2V7Q A;  5LL6 S;  5A2Q E;  4KMU C;  2F0I A;  1D2B A;  1E79 A;  1UEA B;  1UD5 A;  3S1Q B;  5M9O A;  1Y1W B;  3MZ5 A;  4F8M A;  3I73 A;  5JVH 3;  4K6L A;  1UAP A;  5DAU A;  4XOR A;  3VYS A;  3PIP 3;  1FNU A;  1LAB A;  1QE6 A;  2R3Z A;  2ID0 A;  1SYC A;  1NAP A;  2NTS A;  5JOB A;  2B2Y A;  3DM1 A;  3A7L A;  1TT2 A;  2EVB A;  3I8Z A;  4YEL A;  5EPJ A;  4XQQ A;  1JC7 A;  3EFX D;  4FF4 A;  2A6H C;  3D31 A;  2EYJ A;  1SJH D;  4TRD A;  3CQZ B;  1HZE A;  4DGZ A;  4HIZ A;  1B44 D;  1KAB A;  1RJT A;  1F9R A;  1S5B D;  1BMF A;  2K33 A;  3SE0 A;  4NW2 A;  2ZXP A;  3GVL A;  3I72 A;  3NHH A;  1SMY D;  4GZY C;  4AYB B;  1D5X C;  3FDT A;  2AUJ D;  3W3A A;  4NP5 A;  2NN6 I;  3F2U A;  5M3M B;  4MHE A;  2BCO A;  1UNS A;  4Y7N B;  2Q8I B;  3S9W A;  1CT1 D;  2F0Q A;  3S17 B;  3GVK A;  2QDB A;  2B8G A;  3S1R B;  2ZTG A;  5KNC A;  3OEE A;  3Q0A A;  3P75 A;  5KGU A;  4XKW A;  1G6Z A;  4P22 A;  1I4Q A;  4CKB A;  1MGS A;  1ICW A;  5CYU A;  1TS2 A;  3VA7 A;  2G9D A;  1QCB D;  1YNN D;  1Y8O B;  3L9A X;  5J22 A;  4DAY A;  5LHY 1;  5JEA J;  1JOO A;  3KBG A;  1U4M A;  1EYC A;  5KNL A;  3FPP A;  2L4N A;  4G6I A;  4IFD I;  4M8A A;  1H8E A;  5C0X H;  1EOT A;  2OXP A;  3ZIA A;  2SNM A;  3T56 B;  3BYT B;  1LTB D;  3GTJ B;  4II3 A;  2F0P A;  4QUF A;  2J0T D;  4QIW B;  1WTO A;  5IGB A;  3X3M A;  1Q1B A;  4DNT B;  2TMP A;  2E2I B;  2F0L A;  4A3B B;  2IJ0 A;  2DIE A;  3PUZ A;  2B2V A;  4CHT B;  3QOJ A;  1PFB A;  2K1B A;  2DY7 A;  1T5E A;  4RCN A;  3AMU A;  3NTH A;  1NR2 A;  4JMQ A;  3OWF A;  4ZUI A;  5ISR A;  1EZ6 A;  1ESF A;  2F03 A;  3WDN A;  4XXE A;  2WJV A;  2XZO A;  1IKL A;  2K5D A;  1ENC A;  4RFB A;  1EY6 A;  4C2M B;  4O1N A;  5KNB A;  1ZYR C;  4H44 C;  4KJN A;  1OXV A;  2AWN A;  1DD2 A;  1NSN S;  1VDZ A;  2G9H D;  1SE2 A;  1BCP D;  3FMC A;  4A3I B;  3HEJ A;  3EA6 A;  1LT5 D;  2ZZF A;  2X6W A;  1CZW A;  5JAV A;  4ODG A;  3DWQ A;  5CV5 A;  1K83 B;  3GQB A;  5IT9 E;  5CV9 A;  1VMP A;  1PFM A;  5K36 H;  1EFR A;  4KD3 A;  1ROD A;  2EYO A;  3KLS A;  3KLS X;  1E1Q A;  4KD4 A;  3R2I A;  3R3O A;  1IW7 C;  2A6E C;  3M3Y B;  2IL8 A;  1W0J A;  2M9V A;  1LTT D;  1XYI A;  1VCI A;  4ZLT F;  3K59 A;  2XNA C;  1RTN A;  4FXU A;  3GV6 A;  3O13 A;  1QIL A;  2EY6 A;  3X3N A;  1AW7 A;  3RLF A;  2AWO A;  3OW7 A;  2XZP A;  3VYU A;  2R6G A;  2BOS A;  5JEA G;  4RCO A;  1TR5 A;  4U67 3;  1WVL A;  1C8C A;  3DEP A;  1CFM A;  4TQU S;  2WKD A;  2WAQ B;  1H8H A;  1U9R A;  2NTT A;  2QCP X;  2ICI A;  3HOW B;  2X6X A;  5G3L F;  1SE4 A;  1JWU D;  2JA7 B;  3C1F A;  1B2T A;  3BVZ A;  2PPB C;  4A3F B;  1M4V A;  2XRS D;  1NRK A;  4M1U B;  2HQE A;  1O7Y A;  1J9O A;  3GV3 A;  2K32 A;  4XLA A;  5CDF A;  1EU4 A;  2CK3 A;  2F3V A;  2KCN A;  2K04 A;  5E3F A;  3T53 B;  1WCM B;  3NWS A;  4J8Q A;  4XYO A;  5CC4 A;  1O7L A;  1TS3 A;  2PCF B;  2ENB A;  2X85 A;  3I70 A;  1GOZ A;  1BDO A;  3G7L A;  5AFW A;  3V96 A;  2BE5 C;  3IL8 A;  1W6K A;  3J7A F;  1E2Z A;  2RDH A;  2EJM A;  5KND A;  4XOT A;  2ZXH A;  2LKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...