4DNTB

Crystal structure of the cusba heavy-metal efflux complex from escherichia coli, mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Cation efflux system protein CusB
total genus 58
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00529 HlyD HlyD membrane-fusion protein of T1SS
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4dntB02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dntB03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 4dntB01
3VR6A 1G291 1I6VC 3BDOA 4KN4C 1DCZA 3CRKC 2PPBC 2NN6I 3MFYA 5JEAH 3AB9A 1E2VA 5KNDA 2EJGC 1ONLA 1IW7C 1H9KA 4LK1C 1LACA 1OXVA 2PNRC 4LJZC 1PMRA 3PUXA 5JEAG 1H9SA 4JBWA 2O5IC 4OGQC 1FYCA 3WDNA 1IYUA 1VDZA 3GQBA 3QG1A 4GZYC 1O78A 1CTMA 2AWOA 5K36G 4PV1C 1Q90A 2BE5C 2A69C 1EWHA 2A6HD 2ZT9C 1VF7A 2JEBI 1TU2B 2KA7A 4TKOB 3I73A 4IQZA 1Y69U 2A69D 3I72A 4JK1C 2K33A 2A68D 2D62A 1QJOA 2EJFC 3OPOA 2A6HC 2BA0A 1K8MA 1Q1BA 3VR2A 2AUJD 1VCIA 4KKTA 3SDZA 2B8GA 4DK1A 2KCCA 1Y8OB 3T51B 1GJXA 1H9SB 3LWUA 2AUKA 4HR7B 4XIGS 2NN6G 1HQMC 5KNBA 3NE5B 2LMCB 2Q8IB 1IW7D 3W3AA 3VA7A 5C0XH 5A35A 3PUZA 3PUVA 1FR3A 3DXJC 4BA2I 2NN6H 2V4DA 4KI0A 3M7NA 1H9RA 1ZKOA 3RLFA 4KHZA 4BA1I 2A68C 3ND9A 4H44C 1Q1EA 3PUYA 1YNNC 1GHKA 1Q12A 1ZYRC 1OXXK 1TKWB 2EVBA 2BE5D 4H13C 4KKSA 4RCNA 1VF5C 3M85A 2DNEA 4G7OC 1DD2A 3L7ZC 4IFDH 4OO1G 2DN8A 3PUWA 4H0LC 1A6XA 1H9JA 4KKUA 4DNTB 1HPCA 5BN3A 1DXMA 2BDOA 3PV0A 5K36H 3MXUA 4IFDG 4OO1H 3IFTA 4G7ZC 1V43A 1Z7TA 1B9NA 2B8FA 3VR5A 1GUOA 2PCFB 3LNNA 3D4RA 1O7LA 1HTPA 2A6ED 1GHJA 2K32A 3GD7A 4DK0A 3A8JE 3EQLC 3VR4A 5C0XG 4I7ZC 4DNRB 1E2WA 4KN7C 3VR3A 5KNCA 1E2ZA 3A8KE 1Z6HA 3TZUA 2JEAI 3FPPA 3OOCA 1SMYC 3A7AB 2K7VA 3HGBA 3KLRA 3H94A 1K8OA 3IKJA 1YNJC 2JXMB 3BG3A 4TQUS 4G7HC 4L8JA 2E76C 1T5EA 1B9MA 3QIAA 3P20A 2YYZA 1GUTA 1GUSA 2CW0C 2R6GA 2F1MA 3QJYA 1OXSC 3SE0A 5BN5A 1V8QA 2O5JC 2QF7A 1H9MA 2A6EC 1CFMA 1OXTA 1IYVA 5BN4A 3D31A 1GUNA 2D2CC 2E74C 3I4LA 3N6RA 3T56B 2D5DA 1BDOA 2EJMA 1Y8NB 3A8IE 1Y8PB 2E75C 2L5TA 4XTCS 3U9SA 3A7LA 2JE6I 2IT1A 1HCZA 3CRLC 3ND8A 1LABA 1GUGA 3FMCA 2BA1A 3OW7A 2DNCA 2EDGA 1OXUA 3M4YA 4KMUC 3T53B 1CI3M
chains in the Genus database with same CATH superfamily
5FJ8H 1N32Q 2W6JA 2PQEA 1GJRA 3BDOA 3GVLA 1N34L 3CHBD 2EJGC 3KDFB 4NXNL 2K04A 3B8HA 2Y0SG 4LJZC 1G6PA 1F77A 1S5CD 1VQFA 1U4MA 2F1LA 4QIWB 2B63B 1QZHA 3CC2A 1UE1A 3GQBA 4GZYC 2JN4A 5F4MA 4HIMA 2BE5C 1XNQQ 3TDQA 4DV3Q 4YWMA 3M4OB 4N3NA 4KK7A 2F0JA 1PH3A 4L5RC 4CBVA 4RDJA 1XX8A 1OHHA 1TS4A 1M8AA 2UUAL 4JI3L 3SHLA 2KENA 2A6HC 1MJCA 5FLXL 4IJLA 1S3OA 2EY2A 3VMFA 3T1YL 3HFZB 1OTCA 2F0FA 3NWTA 3URYA 2WB1G 4DAYA 2AUKA 2GVBA 3VDYA 4Z4UA 4C1NI 1M90C 4B3RL 4B08A 4RHRA 1VQ9A 3FKIG 4XD7A 3J7YW 1KMHA 1YITA 4KI0A 2PMZE 5M3MG 1JWUD 1QOHA 1QUQA 1RQPA 1G2SA 1Q1EA 3PUYA 2B2YC 4JI4L 2RDFA 4IPCA 3R2TA 3QFCA 4H13C 2JA5B 2J7ZA 3R6KA 4DUYQ 4YXWA 3MA2B 2WAQB 3S2DB 4LFAQ 3MXGA 4X06A 3PUWA 4H0LC 3CC4A 4JV5Q 3IFDA 4QUFA 3M4OH 1BO0A 4K8JA 2XWJB 4RAUC 1HPCA 3F1ZA 5C44H 5M3FH 1NTGA 1WI5A 2MHVA 2WAQE 1K73C 1I7PA 2AQ2B 4TT3A 2ENBA 1YBYA 4GNXA 3K59A 1X9NA 1YIJA 4OPVA 3CP2A 1EWCA 4IJHA 3NHHA 3H9NA 1PFNA 3HOUB 2WV6D 1D5XC 1HA3A 2B2VA 2E2HB 4C3HB 3L9AX 1CQVA 1YNXA 3UDGA 4RD0A 1MIUA 1NE3A 1VHOA 2FVGA 4R4TA 2K5VA 1UWVA 2DOGA 3NBHA 2F1MA 1EXMA 2XNJA 1V8QA 3F2DA 1O7IA 2B29A 4UY8C 3UE1A 2LZJA 2X6XA 5FOBB 2QE7A 1W35A 4AC9A 3S2HH 1Q7YD 2OBSA 1VQLA 5GAGC 1Q9SA 2E75C 1A8VA 1PDQA 5EPLA 2N8NA 2FJ2A 1HCZA 2ZXRA 1LABA 1JA0A 1HNXL 2EDGA 1I6HB 1HHVA 2LXKA 3BH4A 3GVKA 2PLFA 3PO3H 1CHPD 2HDMA 5IYDH 2CH4W 3BZCA 1M90D 4HCEA 1H9KA 1SXTA 4H7BA 1PH5A 2UXCL 1SYFA 5IYDG 1N05A 1Q86D 3BJUA 2LS01 4JI7Q 1V1OA 5CBEE 1GOZA 5IGCA 2Y0SE 4WZKA 1RF2D 1NAPA 4X7EA 2C35B 1HZ9A 2YWFA 4P75A 4P3YA 2XZLA 4M1KA 1XMQL 2ZZFA 4BY1H 3CD6A 3GTGH 2RCNA 4ZQ3A 4L63B 3A35A 2TMPA 1HZBA 2EJFC 2G9HD 3GTJB 2YWHA 1Q3LA 4X07A 2BA0A 4X3KA 1F2LA 3CCUA 1JT8A 2QEXA 4A3JG 2V31A 4G57A 1LUZA 1UD8A 3HOZB 1EP1B 1NMGA 4P6VF 1I4RA 2CH4A 4YWLA 4XN0A 1QGZA 1VQAA 2F0SA 3ZJYC 1HUNA 4IUNA 3KBXA 4BA2I 1JC7A 4R4IA 1E22A 2YWEA 4TSSA 2GPJA 4YHHL 3VNUA 1CHQD 2K5QA 3E9HA 1YJ9B 4R4CA 3MTSA 1ZYRC 1E1TA 5C0XJ 1K3RA 4AQYQ 3GTPH 4A3MH 4G7OC 3OEHA 3L7ZC 1MJEA 5ELOA 1CSPA 4DR7L 1NNXA 1A6XA 2ZITA 1BX1A 1N32L 1QUFA 4Z4ZA 4FO2A 2AHOA 3P27A 2ASBA 5C5LA 2FX3A 3G48A 4KY6A 2I5HA 2FXQA 3SEBA 3PUNA 1WTRA 2EXDA 4F88A 2ZTEA 4LBZA 1E2ZA 4RH6A 2D9UA 2L1BA 2QA4B 4X64Q 1SMYC 2CW5A 1D5MC 2F0EA 1N9WA 1VQKB 3A8JA 1K8OA 5C5MA 4TQUS 2NZHA 1B9MA 3QIAA 1C9OA 2PZWA 3FJOA 4C43A 2X53S 2L9HA 3BDLA 4ZUIA 1SM4A 1F2ZA 4BBSG 1IYVA 4KHPQ 3OKXA 4UZUA 1XXGA 5KEEA 3CCJA 1YJWA 4PC6A 1SDFA 2K1BA 2JA8G 3SK5A 3AVUA 3GP7A 3J81c 1EFID 4J15A 1B50A 4JI1L 1LTGD 1I94Q 3S14H 5IWAL 4DR5Q 4DK6C 1Y8PB 4B3MQ 4A3BB 3CPWB 1IZ6A 2A19A 3KF6A 4OP7A 3J80E 4Y7NH 3LVBA 4TSFA 3ND8A 1Y1WG 3M3YH 5D3IB 4LUOA 4KMUC 4RKLA 1TQOA 2ZBVA 4JYAQ 1FRNA 2E1RA 1QG0A 1XE1A 1W3SA 3AB9A 3GTQH 1G91A 1QVFB 1EU3A 1IW7C 2CKZB 1VQMA 1OXVA 2DGYA 1IKLA 1CQXA 3MHPA 3E0JA 4HJ9A 1E43A 3HOZH 5EBCA 5CV7A 1QFYA 5CYUA 4RLZA 1SE2A 4NDXA 1HZEA 1CZWA 1I4XA 1VQNA 1VDZA 4JOIA 2BN4A 3KF8B 4KY7A 4EX5A 4BY1B 2RHQB 2K6AA 2X6LA 4RGNA 2YU9H 1BX0A 1E1OA 4NXMQ 2A6HD 3I73A 3JC66 4WJ4A 1UEBA 3GTMH 1JOKA 3DLLA 1A8PA 5LMUL 2XNCA 3GTPB 1U2RA 3G6EA 3PA2A 1XYIA 1EFTA 4C3JB 4OXPA 3A0JA 5FO7B 1VQ6B 4RGTA 1JWSD 2QDBA 1D2BA 1YHQA 2I1LA 3BVZA 3U9OA 2RSOA 1TWHB 1VQ4A 3S15B 1D2EA 1I6HH 2KECA 5FJ8G 4PQXA 1PLFA 3B78A 5E4WC 2F43A 2Z6KC 3UDIA 1GAWA 3AFPA 3H3VH 3RD4A 4BXXG 5I2XA 3H09A 3PIO3 5HURA 2NZOA 2ATWA 1K8AC 2D3LA 2XSCA 1DXMA 4ULLA 4DR4Q 2EE1A 1AMOA 2B8FA 1YX2A 4JI6Q 1DZ1A 1JOQA 2NTSA 4EH1A 5CV5A 4G1VA 1PKVA 1D6EC 1S5ED 2F0TA 4XYQA 5C0XG 5JVG3 4JI7L 1VQHA 3FRPB 2F0OA 4PMCA 4N8X1 3CD6B 1Z6HA 4LW1A 3ONUA 1RIPA 4YY3L 1UD2A 1Y0RA 2SNMA 4WFN3 1WOPA 1BUVT 3IAYA 1JOOA 4L8JA 1SFOH 4LF5L 1VLOA 1G2TA 1YNND 1H8EA 3P20A 1EIHA 1SYGA 4Z4RA 5DAUA 4PC1A 1E62A 4FF3A 5BN5A 5M5YB 3D3RA 2QF7A 3MEFA 1QGAA 3K7AH 1C4QA 2E5LL 1WTPA 5IGDA 1KC8D 3RLOA 5HGQA 1FD7D 1X55A 4X65Q 4DU9A 1CKMA 2XWBB 4K2KA 2R9VA 4KY5A 3LX0A 4PC3A 1UD3A 1J9OA 1NR4A 1O80A 3HP3A 1X3FA 4HSVA 4IALA 1ASZA 3VNVA 4G7ZC 4IPGA 1BQEA 4FDBA 3QFSA 5J35A 1Y0YA 4XT1B 5KNLA 4Y7CA 4OWWB 5JJKA 5FLXc 5GQOA 1XTDA 5C3EH 2YTYA 5JPNC 4MTKA 2BDNA 1EY8A 1PTOC 2J0TD 1RQRA 3JQRA 4ZLTF 1B23P 2SEBD 3S24A 1Q90A 1I4GA 1NUCA 4DAYB 3OIPA 1VF7A 3ONAB 3OIQA 2E2JH 2XGTA 2AHOB 1AEXA 2K4KA 2SOBA 1TS3A 2BV3A 2I5LX 4X3SA 3HZXA 3AGQA 2BSAA 2VBVA 1VQNB 3RZOB 3GDEA 4BS9A 1Q86C 3SDZA 4DK1A 2VB2X 3EJIA 2CWAA 3ICEA 5KNBA 1H8HA 3FKIB 1YJ9A 1DGSA 2DIEA 2DYIA 1KHIA 3PIOA 2LFNA 1YJNA 3PO2G 2V1CC 2JK8A 5C4JH 1PH6A 3PO3G 3MFGA 1ASYA 2D3NA 2QKIC 3HKZG 4A3FH 3CMMA 3KJPA 4XOTA 3W2FA 2O4XA 3KBGA 2Q2TA 3I4MH 4BBSB 4XQFA 2WKCA 2WSSA 3AMUA 4A3FG 1DD2A 4JBMA 2VZLA 4ID6A 4K5VA 1EIFA 2WAQG 3J81k 5JJLA 1S5BD 1T6YA 5COYA 1PZJD 3H0GB 3Q39A 3C1EA 4PG3A 5J3BA 3SJZA 1WJJA 4HTHA 4BY1G 4DUZL 2F4VQ 1KD1C 4QFMA 3M7GA 3CMEA 3CXCA 1K8GA 3I56B 1E7ZA 3PF4A 3WXMA 3KUPA 4C3HG 4EQPA 3A7AB 3QO2A 3HGBA 1KABA 1VQDA 1L1OC 4NBSA 3OTOL 1SNMA 4WRDA 1RCVD 2HMAA 2OQ0A 2RQXA 1GUSA 4EQ5A 1PFSA 2EYOA 3SE0A 4XLAA 2R93B 2EQSA 1SE8A 4Z4SA 1JJGA 2NYZD 4B3ML 4MZ9A 3SK6A 2Q2UA 3T16A 5D65A 2I0QA 1MABA 3I4NH 2IL8A 2CK3A 3EVQA 4OWTB 1N33L 2WFWA 3QOLA 1IKMA 2B2TA 3WBKA 1B1ZA 1STYA 4DV2Q 1BR9A 1HA5A 2ES2A 1CI3M 4X05A 3I8ZA 1KRSA 3GTOH 1E1RA 3MFYA 1L1OB 1WSRA 4RD1A 1JJCB 5KYIA 3TP5A 1D5ZC 1NSNS 4R4OA 1X56A 3PUXA 4DFAA 3BVMA 1CZGA 2AWNA 2O5IC 5KSWB 2R7DA 1BLIA 2WYRA 1VQ4B 1IYUA 2UXBQ 1FX0A 2P3MA 4HEDA 2KVMA 3ZZ0A 2ZL7A 1SJED 3OYYA 4Q5VA 4K0KQ 1O7YA 3CTAA 1EY0A 1GO3E 2A69D 3I3CA 4X66Q 1PFMA 2D62A 4TMZA 3CF5A 2B63H 2JA8H 4N8FA 3CAMA 5CGKA 1CKNB 1I4QA 3PCOB 1MKHA 5C4XH 1LTBD 4PC7A 4DV5L 1G7RA 4GS3A 5I6WA 5AJ3Q 1L2FA 1WSVA 3E9IA 3J80i 2KCNA 1Y1WH 4P72A 4A3CG 4UP9A 1U9RA 4KHPL 1JNYA 1ZKOA 1J5EL 2Q6IA 1SJHD 2MO0A 1ILPA 2R7ZB 1SNPA 2VBUA 2Z9HA 4RCYA 4OX9L 3HOZG 2IHEA 2KEDA 2BE5D 2KBNA 1XPRA 2LY7A 3ONYA 3NQIA 4G6IA 1CKNA 2XTIA 3TBIB 4C1NK 4HSPA 5CV6A 2BM0A 1KRHA 1Y1VH 1EQVA 3R93A 1KLUD 3A5ZB 5ELCA 3D4RA 1RHPA 1SBBB 2FMCA 1V0EA 1GHJA 3FPKA 1PA6A 1WPCA 4JI6L 5J1ZA 2JA7H 1XQBA 4R1JA 1R4QB 4IW3B 1SSOA 1WVLA 3T13A 2Z6KA 3ASPA 4XM3A 4FXUA 4O0AA 4TVAB 2HD3A 2GA4B 4X6AH 1ZM9A 1G51A 1WTOA 4PAAA 2HHHQ 5DN6A 1BCPF 5EBDA 2EY5A 4PZ8A 1OXSC 4JYAL 1CT1D 1WTHA 2NVYB 4YCWA 3J81E 3GTLH 3N6RA 1QFJA 1I4PA 1DG1G 2BVNA 4FWTA 2WJVA 1EFCA 4B3RQ 4LBWA 1CQFA 1I18A 3GTOB 1GUGA 1STBA 1X6OA 4JMQA 3CPWA 4TN1A 2PCFB 1QUQB 2XVSA 1GM5A 4A3EB 2IY5B 5DSZA 5M3FB 5JJIA 1Q82D 3CU7A 4LF9L 4X3TA 4O1NA 3VYUA 5F4OA 1KDCA 1VQ5A 4C3JH 2SDFA 3A3GA 4DQKA 4JBWA 2K5WA 1FYCA 3WDNA 2GQFA 4B3GA 4ACAA 1UE7A 3I56A 4A3FB 2E1BA 3W5UA 5K36G 1JB3A 3K58A 4IPDA 3W5VA 1M1KD 1LYLA 3HG9A 2HQLA 4JI8L 3ERSX 1PH1A 1QE6A 2KOLA 3ZBUA 1IYJB 3CW2A 3FKIH 2K03A 3LGJA 1LTID 2VBTA 4P25A 2E8GA 5CV4A 3A3BA 1K8MA 1Q1BA 1LM0A 1AP0A 1B44D 5FNZA 4DR2Q 4JI0L 2HDNB 4XT3B 4A3GH 3OAAA 1Y8OB 4EQOA 4HR7B 1HFGA 5M5WH 2Q8IB 5A35A 3PUZA 3PUVA 3WNBA 3LWEA 4B48A 4CDFC 1S4MA 4FF1A 1SMYD 3RLFA 4UDUC 1SEBD 2QDXA 3RZOH 1X3GA 5A8AA 2VXWA 1TWFH 1IBLQ 1X3QA 2UUBQ 4CDDC 1YHQB 4HE6A 1XWEA 5IT9E 2R93G 1H42A 3DUZA 3NK9A 1AE2A 4MIUA 2R3ZA 4IFDH 1CNFA 1BBXC 1VQ7A 2D9RA 4UZFA 4JCVE 4B9XA 3HOWH 2F0IA 1E1QA 4Z4VA 1H9JA 4R8IA 2BDOA 3W2EA 4JG2A 1EP3B 1Q8KA 3C46A 1WOSA 4IFDG 1TY2A 3BCFA 1PZID 3B6YA 2VYQA 1P16A 2DY7A 4RKBA 3G7LA 4QIWE 3RR5A 1V1PA 4DK0A 3A8JE 2EFGA 1NRKA 3NBIA 1MRZA 4BBRH 3HOVG 3WYAA 4XKWA 3S1QH 5F4JA 4XNFA 2XN9C 3OOCA 1KTVA 2K7VA 4DR6Q 2WACA 3LQ6A 2HQEA 5BSYA 1XFOA 1QNKA 3S1RB 2J4XA 1EWIA 3K7AB 1C8CA 5TRDA 4A3LH 1XPOA 1KIXA 4A3DB 3WOEA 3J81j 4Z4WA 2F0MA 1GUTA 3AYHB 1BCPB 3QWNA 2VNKA 3CRZA 3MHBA 1E3XA 4XKVA 3E0EA 4JI2Q 1XMOQ 1SFOB 3HOXG 1EY6A 2BOSA 4Y9RA 4GN4B 2N78A 5L46A 1EQRA 3AVTA 2ZM6Q 2PE3A 5E7NA 2R7ZG 4RFBA 4DK3C 3ZIAA 2KCMA 4XTCS 2PNHA 3D4DA 2Q8TA 4WORA 3ASTA 4RDKA 3W2DA 2UXDL 2ZXIA 1N0VC 4LF7L 3L2PA 4QHYA 1P8LA 2BH8A 5IGFA 4R4QA 2A73B 4JI5L 1VQJA 2JDIA 3E5SA 1KTKA 3A5UA 4N3GA 1EFUA 1DONA 1JMCA 1WCMH 1BMFA 2UUAQ 1H9SA 1BCPC 1TWCH 4LFBL 4XYOA 4XQQA 1FJGL 2F3WA 1PTOH 4A3KH 1A63A 4QF4A 2L15A 3V7AA 2JIZA 5ELEA 3J7A5 4RCZA 3G6EB 2AQ3B 3P7JA 2F0HA 1LTLA 4TKOB 1WFQA 4IQZA 1KK2A 3PGZA 2BGJA 5F2DA 3W1GA 1K28A 3H6MA 3CCUB 3VYSA 2ZTCA 4YAOA 3D0FA 3J7ZC 1JA1A 2VNJA 1PYBA 4EVOA 2MGSA 2DY8A 3WWVA 2OCEA 4YAUA 1B3AA 2KCCA 1YVCA 4K14A 4IN3A 5FL7A 4UP7A 1AIPA 2WIIB 1WYDA 3S1NB 3BZDB 1HTLD 3W3AA 1KAWA 5CBAE 3SEJA 4HJ7A 3GTMB 2OK7A 3Q24A 2QDLA 5M5WB 5A89A 2QEJC 3BY2A 3JAMc 4F8MA 4DV0L 2L11A 4UHVA 3FDTA 3ULLA 4JI1Q 5IP7H 4A3KB 1Q12A 4RGOS 3HKZB 2ZTGA 3TZDA 5C3EB 3JQPA 4RCNA 1W6KA 1MSGA 3DM1A 1HNXQ 1O7ZA 4RCOA 5IK2A 1D1IA 2NUCA 3ZPNA 5E3FA 2G5DA 2V7VA 3K5NA 2ZJPA 1HZAA 2DCUA 5IYBG 1E24A 3NELA 4DV6Q 3ULJA 5DEHA 2KHIA 4DF7A 3RN5A 2HT1A 1COWA 1HTPA 4DR6L 4DV3L 2EIXA 1MD2D 1PH9A 4GKKL 3HOUH 5KNCA 5LHY1 4X8IA 1F60A 1G8ZD 2EYFA 5B6IA 2ICEC 3O13A 1N07A 4TRDA 4YIJA 2CHBD 1K28D 2RA4A 1HFNA 3MXPA 3GIRA 1BVSA 3RUZA 5C4XG 1F9RA 1SMXA 2GREA 3H0GG 3UDXA 5CR3A 3BYYB 2KQ3A 4YEJA 4C2MH 2X6YA 3G71A 1RJTA 3TS0A 2C2WA 4MYTA 1C7YA 1F9QA 3K0XA 1PJ7A 1NR2A 4XOPA 1SNOA 4JI3Q 1PTOF 2X6GA 2NVXB 4A93B 2OEOA 4YCUA 1GKHA 3GTLB 2CQOA 3RNUA 1BDOA 2F0QA 1U4RA 4Z4TA 4HJAA 1B4OA 2MNAA 2PW7A 3I55B 3KF6B 2EYPA 4GOPB 1L0WA 2R92H 3CB4A 3MCAA 4FNFA 3DWPA 1JB7A 1W0JA 3QB3A 3AVYA 3RLNA 4CHTB 4WWVA 4CKCA 2V7TA 2NWGA 4JPBW 1UUPA 5IIFA 4E6IA 2N3SA 2CW0D 3GSIA 4IUQA 3SVMA 5IE8A 4DV4L 4YELA 3K81C 3ISXA 4JI8Q 3LO8A 1A15A 2Z1CA 4GKJQ 1O78A 2WR8A 2C5CA 2HDLA 2KA7A 4A3IH 4UAJA 5A2QE 4XLFA 4A3MB 1IJFA 2M00A 3CPXA 2UXCQ 4OONA 2JA5H 4K8IA 2PMDA 3OPOA 1TWFB 4I7AA 2KEEA 1BCPD 1X32A 2B2UA 3U58A 2DJFC 1E64A 3HOVB 4KV6A 1U5KA 4ZUJA 2BPOA 2JA5G 4DV0Q 1GR1A 2KVOA 2AKWB 3VA7A 1XNRL 5HZAA 1FR3A 3ZC3A 2V4DA 1FNWA 4OEMB 4ABNA 2H1EA 4ALPA 5CDFA 2VJIA 3MZ5A 4P12A 4WJ3M 1GO2A 5LL6X 2RKSA 3S2HB 1MI2A 4NXNQ 5FA6A 5E6TA 2VBSA 4KHVA 4OO1G 1IBLL 2QGGA 1PRTD 5K36H 4DNTB 4GLXA 4OO1H 1JJ2A 5I6YA 1KK3A 1VQ6A 1B2RA 2MQHA 1KJZA 1XTCD 4Y9UA 1O7LA 3NBHB 2A6ED 2E2HH 1K0SA 3GD7A 4J1MA 3MXNA 1EY4A 4P22A 3TS2A 2Z4HA 3TZUA 2NPFA 2X85A 2JJQA 3WOFA 1DOLA 1S0UA 3OE7A 2OBTA 3A8KA 4GLAC 1WP6A 1YNJC 2JXMB 2Z4IA 3BG3A 3J7AF 4L5SA 1PVOA 4FP5D 5EPKA 1A3UA 4YAFA 5IT9c 1PV4A 4QVJA 4XDXA 1OB0A 4Q7JB 2UUCL 1H9MA 4P9SA 4OIKA 1CFMA 4PZ6A 1S5FD 2XGJA 2OTLB 3MEHA 3I4LA 2A8VA 5FKAC 3D26A 2R61A 1SRUA 2D5DA 4IFDI 2UXDQ 4KTAA 2VQEL 3DWQA 2JA7B 3NUCA 2H5XA 1WTVA 1A62A 3HOWG 3FPUB 3U9SA 4POFA 4DV1L 5C4ZA 3PO3B 5C3EG 2HCCA 3CPFA 2BA1A 2XIWA 3R6JA 1ENFA 5K5PA 1R5BA 5DLQE 4EGVA 3P75A 4MYUA 2JA6H 4ZCIA 1KD1D 1BNZA 2F0GA 3PENA 3BCDA 1VQ9B 1JQYD 1ONLA 1EY5A 4BBRG 1PHJA 3HOVH 5KRUA 1FNVA 1PMRA 4B43A 1TWGH 2K05A 4DR3Q 4LF4L 2F0WA 2XRSD 4P74A 1ESRA 1EZ6A 1K83H 5I4DA 3W2IA 1K3BC 4A3JB 1EL0A 4A3IB 4A76A 5C3XA 4N9PA 4PV1C 4DAVA 2W6IA 1GVHA 1PRTF 3QR8A 3UE0A 1CSQA 2GJKA 1UNSA 2G9DA 1Y69U 3FVQA 3QFTA 1A2UA 4AYBB 5IYNA 2QCPX 2ICIA 2HCIA 1RD9D 4CJ1B 3OZWA 3NP8A 4ZYSA 2EZVA 2CF4A 2R7ZH 2UUBL 4P73A 4NP5A 3T51B 1H9SB 3CCQB 2NTTA 2PZUA 3ER0A 2XZOA 3SGIA 4NXML 2QN6A 3NSWA 4OL7A 1TT2A 1XMOL 1ML0D 1GD7A 2X69A 2PMZB 2OYNA 5IYRA 2Q8RE 1VQIA 1OXXK 2EVBA 4ZK9B 3CKIB 1WTWA 1QVFA 4WJWA 4S3SA 2ZZEA 2I07B 3EFXD 4KLKA 3V05A 3M85A 3L0OA 1VQCA 3G4SB 2V7WA 2NVXH 1BPLA 1ZM3A 1I3QB 1MHWC 3PV0A 2F52A 4Y52H 1HZCA 3NTHA 1EQTA 5EGTA 4QGUA 2I5MX 2QEXB 1R5OA 1RODA 4IURA 1OB2A 1M4VA 1OGIA 3S9WA 2L4NA 1KNEA 1D8LA 4KD3A 3A8KE 3JU4A 2JP1A 1S72A 3FPPA 1Y14B 4GKJL 3NEMA 1PXUA 3KLRA 3K0YA 3OP1A 4A3DG 1FNDA 2CWPA 5I9PA 3ULPA 4DV7L 3QOJA 3W5HA 3GTKB 2ZBUA 4IUVA 4LUZA 1V1PB 5FIUA 5ELBA 1J8IA 1Q7YC 4ZGNB 3L3OC 2ZTDA 1VMCA 3KLSX 3HOXB 1X3EA 3A8IA 2O5JC 1OXTA 3UDFA 3U2QA 3EIVA 1GXDC 1FNBA 1PRTC 2A1AA 2MP1A 2WB1E 3ITPA 3CQZH 4DV1Q 4LFCQ 2QTLA 1LTSD 2VZAA 3CW2C 3K8AA 1NB9A 2QMUA 1NMFA 2Z6BD 1FGUA 1Q46A 4M4SA 1Z9FA 5C4JB 1E63A 3CCJB 3OZVA 4B3XA 1LTAD 3PVDA 5C0XI 2F4NA 2EY6A 2TSSA 4LC0A 2K28A 4RMFA 4C56C 4OX9Q 4OWXB 1ET9A 5JEAH 3CCMB 5EAYA 4DUYL 4H9GA 1LACA 3HOUG 4XLCA 1PFBA 5JEAG 5T1IA 2OTJB 4HCSA 4M1UB 5LMZA 3I4MB 4PNYA 3Q23A 4BBSH 4IUUA 3PSIA 5TV2A 1WOOA 5EQ0A 2XNAC 3SK8A 2AWOA 2E2JB 3W2HA 1ZM2A 1PRTB 1R4PB 4NPSA 3BY1A 2OWOA 1QUEA 4RJLA 1U4PA 2ZT9C 2ZJRA 4X7FA 1B70B 1IHZA 4B3TL 4JK1C 1IBML 1KZLA 3AVWA 4ZGQB 4B3FX 2NB0A 3CMEB 2B2TC 4QY7A 5C44G 3CMAA 1DDGA 3OFNA 5BR8Q 1QX4A 1WCMB 2V7XA 1WTHD 2Z8LA 4NKLA 1U0LA 2VS1A 2K5NA 2KJXA 3LWUA 4Z1MA 3MC0B 5HGTA 1XNQL 4X65L 1FNCA 3KLSA 5H59A 5JVH3 3IL8A 1BBWA 3DHQA 4X62L 1RKNA 2E5LQ 4QCLA 4IZ8A 2A68C 1KRTA 1LT5D 3RZDB 1Q82C 3OMGA 1VJSA 1ZM4A 2HCJB 5GADC 1GHKA 4AH6A 5ISRA 4CQJA 3Q6RA 3K7UC 1IBKQ 3OJWA 2XRQD 2GVAA 2WB1B 3ZYYX 1AFPA 2GJPA 2ID0A 3F2UA 4DV2L 3SKBA 1L0YB 3GV6A 2DN8A 3KK7A 2VUMB 2NVTB 1HH2P 1OGJA 1B53A 1YJNB 4XXEA 2JA7G 3OTOQ 1CKOA 3WNCA 3BNWA 1NJIC 4FF2A 4II2A 4WZEA 3CC7A 4WZTA 1Y1WB 3AGPA 3R2IA 4QB4A 4A3IG 4QUZA 5BSXA 1EWYA 1CK1A 1D1KA 3I70A 3ASRA 5C4XB 1TLLA 2R6HA 3VR3A 4DGZA 4AYBG 2WZPP 4RG1A 4P26A 4BWGB 1A0IA 4BBRB 1QILA 1S40A 3HAGA 1JE4A 4GN3B 3G71B 2F3VA 1FGBD 1K9MC 3PQIA 3HS0C 5HKKA 1STEA 5EPJA 4HMJA 1RTOA 1LT4D 4L6TB 2VQEQ 3TRZA 5NUCA 4B4DA 4B3SQ 2JN9A 3ZZUA 4BPRA 2F0PA 2JA9A 1TWGB 2H4OA 4AIMA 2PO4A 2XOKA 1VQLB 2UUCQ 4FF4A 4QVAA 4ZCKA 3HEJA 4C3JG 3WY9A 1ICWA 2F0DA 3OWFA 4ZKBB 5J22A 1LTTD 5FK9C 4JOIC 3DMUA 1V1QA 3RN2A 2X6WA 1T6XA 2RHSB 3TEHB 3VR6A 3CC4B 2VNUD 1TR5A 4WZLA 4KN4C 3S16H 3CRKC 2X0KA 2NN6I 2FHTA 4K0KL 4Z9CB 3F2BA 4AVZA 4AQYL 1SKQA 3FP9A 5FLXE 1EYCA 4CJ2C 1SE3A 4P2NA 5D3DA 2VNIA 2MPMA 4P2CB 2D0OA 2E2IB 2QA4A 3E1YE 4TMWA 1FL0A 5J3OA 4IUTA 4OIJA 3KEWA 5AJ3L 3CCSA 2OQKA 1LV9A 3I7FA 2YU9B 4A3MG 1OB5A 2JEBI 2K75A 5FLMG 2PIAA 1DOKA 2CVRA 2KHSA 2GJRA 4R8NA 3DEPA 5IYQA 4IOAA 4C3IG 2F0NA 3SXHA 3T1HL 1NJID 2RF4A 1QZGA 2RBMA 3I1FA 1ENAA 1PZKD 4DAPA 4QUCA 4GOPC 1VCIA 3SR1A 4FXKC 1VLYA 2UU9L 3GTQB 3M9BA 5LL6S 1AZPA 2JJ2A 1Q81D 3K5MA 4JI2L 1L1OA 4MTNA 4K2LA 2JA6G 5TR9A 1EY9A 2VL6A 1I8DA 1IXRA 4MHEA 3PIPA 2M9VA 3GTJH 1EUJA 5ELDA 1LT6D 4N9TA 2DNEA 2NVYH 1SROA 2ZZQA 1KC8C 1SYBA 4K6DA 1Q81C 1HRJA 1HQRD 3NXWA 1TWHH 1EU4A 3E6ZX 3IFTA 5ELFA 3S15H 1CNEA 3S16B 4P71A 2Z0SA 3LNNA 2C77A 1B3QA 1VQEA 4U9UA 4Z4YA 4UPAA 4KN7C 3VYTA 4UP8A 1FJGQ 1VQOB 3V76A 4ASUA 2JQOA 4X3UA 1VQKA 1EYAA 4MN3A 1VQBA 3BVGA 1VQOA 4I65A 3KDFA 1J6QA 1EEFD 2GK6A 1WU8A 1EYDA 4DV5Q 2YYZA 3I4MG 2Q6OA 4HJ5A 2D74A 2A6EC 3VYRA 1DOMA 4RWSC 3DWAA 3S2DH 3NWSA 2E2IH 2M5SA 3CCMA 1K8AD 3V96A 3CQZB 2C4UA 1J5EQ 2Q2IA 4BY7B 1AN8A 2Z6BA 5C6AA 3EROA 1IL2A 1VMPA 4HMIA 4A4IA 3K6OA 5DM63 4FN5A 1PJ5A 2BCOA 5IYCH 4JBKA 1WCMG 1UMKA 3CRLC 1IL8A 3AEVA 1TUIA 3FHWA 3OMCA 1JB9A 1WD1A 3ZZTA 1N36L 4ACBA 5HXBA 2PW5A 4A3KG 3PUMA 4C3HH 3KFUA 3EN2A 4M8AA 2C4TA 1S5DD 1E2VA 4CDCC 2GN5A 4LK1C 3I90A 4X66L 1D7QA 4XN3A 3HOWB 1W6JA 4LF8L 3J81L 4IFDJ 1SKYB 2KHJA 4L5TA 1PH8A 3OWEB 4IOCA 4HIKA 4APVA 1YIJB 3J80c 3D4WA 2HUGA 4DQLA 2PYKA 3DM3A 5JOBA 2IX3A 2QW7A 1SNDA 3CCQA 4NNJA 3W2GA 4BXXH 1DARA 4C2MB 1YI2B 1QCBD 1QB5D 2K33A 1ELOA 2DETA 4QMGA 2O2LD 1VQ8B 4ROXA 5FO9B 4LF6L 3Q0AA 2AUJD 4PMWA 4ZCLA 2AQ1B 4LF5Q 4HIOA 4U68A 3X3MA 1YEZA 2K01A 4X7DA 3SLNA 5HZBA 1ZEQX 1F9PA 4QL5A 5C0XH 1IW7D 1KK0A 4RM0A 1KAAA 2L0CA 3KLWA 3H15A 5LMUQ 4B9WA 2VQFL 4ILWA 1X54A 1V9PA 4G7WA 4BA1I 5HY6A 1NCVA 5IYBH 1T9HA 3WNDA 1YNNC 1AW7A 3C3LA 1AZQA 3GV3A 4GNXC 4CDEC 1IJEA 1STGA 5GAHC 2B2WC 1V5VA 1Z47A 1KQSA 3RY8A 1R5NA 3A74A 1MSHA 2IW3A 1BKBA 2RDGA 2MO1A 2VB3X 3MAQA 1V43A 4DN4M 4GLVB 2UXBL 1B9NA 1U4LA 3VO1A 3BQJA 4YHBA 2IJ0A 4R71A 2B3GA 1T5XD 3MWYW 3EQLC 1VQ8A 3VR4A 5CMDA 4HN7A 4I7ZC 1E2WA 1HNWL 4QV2A 2BGIA 1K9MD 3A56A 4C3IB 2L55A 3J80L 1L0XB 1M1KC 3CCSB 1F2YA 3P1HA 1BJKA 3AU7A 4G7HC 2RSNA 3F8TA 1IBMQ 1I50B 4ZRZA 1Y1VB 3D6WA 2EY1A 4RD3A 4V190 1STHA 4RD2A 2D0PA 2LXJA 1F2MA 5J39A 5LMNQ 1LT3D 4KJNA 1SAPA 4TMXA 4DXFA 3KL9A 4TMVA 4FK8A 1EOVA 1TWCB 3MXNB 3T56B 3C2PA 2KCTA 3A8IE 2EYHA 2EPBA 1SYEA 1FDRA 1ILQA 1XNRQ 4DXGA 2BF4A 1CUKA 3GTKH 2ZXOA 1OO9B 3BU2A 4LAAA 2CC2A 3M3YB 1E3PA 2PPBC 4OPSA 4ZCMA 1HA6A 1YITB 5AN9A 3HKSA 2B39A 2PZTA 4B3TQ 2NVQB 1XJVA 3S14B 2V7QA 4G1BA 3PO2H 4O42A 3RMHA 5TY0A 2B7CA 2BMWA 1BQQT 1PYWD 1CA5A 2BH2A 1T6ZA 3H3VI 3QG1A 2GK7A 2AMCB 4PMBA 1CTMA 3VA5A 3I2ZA 4X64L 2A69C 1W2BB 4LF6Q 5JPMC 4X62Q 2VW9A 1WTXA 4RPBA 3E3XA 4LBVA 3U50C 1UE6A 5IYPA 2PI2A 3C2QA 3S1MH 3ASQA 4JW0A 3U6KA 3J7AV 3CC7B 4B44A 3M4PA 4KKTA 3U4ZA 1S4ZA 1F20A 2VQFQ 4BY7G 4X7CA 2NN6G 1VHEA 2DJGC 1TXYA 2DUDA 3AQQA 3P26A 5I2YA 1G7CA 2I46A 2EIFA 5CORA 4B3SL 4OOXA 2NN6H 4HE5A 3MVVA 5C44B 1GAQA 1UE5A 1LLRD 2F0LA 2ZM6L 5GV8A 4H44C 4A3JH 4IUPA 5KW9A 5G3LD 3W1BA 3CCLA 4AF7A 2K50A 1TKWB 2HIXA 4IO9A 5EKIA 2LSSA 1HR0L 3KYHC 4RDLA 3NPPA 1CA6A 4M0LA 4JI5Q 4HIZA 3PO2B 4PZ7A 3RZDH 4NB3A 1TVXA 4KKUA 3OEEA 3I55A 3A55A 1Z7TA 1PH2A 2QTZA 3EBEA 4K6LA 3I4NG 3OZUA 4E0FA 3EA6A 1W2BA 5FLMH 4A3GG 4XONA 3X3NA 2CCZA 2EOTA 5IY0A 1ZYRD 4C3IH 4F7DA 3G05A 3ERQA 2VUMG 3PF5A 2ZTNA 2NVQH 1DM0B 1STAA 2ZL5A 3TP6A 1E0BA 1VQ5B 3T4AC 2R92B 5EMNA 1WD0A 4NCNA 1ESFA 2B2YA 3HRZC 3H91A 4MNOA 2R93H 1KXLA 3A54A 3K5LA 1SR3A 4RD4A 4P3IA 3BYTB 4TMTA 4QQBX 1YZ6A 1YHAA 1MGSA 5IT9L 1WDTA 4XQNA 1D8TA 1TWAH 3PA1A 2XZPA 3D8GA 3I4OA 3Q22A 1BOSA 1XB2A 2EJMA 1Y8NB 1YHBA 4OOVA 2EXZA 4U673 3HOYB 3A1PA 3I91A 2YV5A 2B63G 2IHFA 2JSOA 2NZ1D 3OW7A 1H85A 2DNCA 1TIID 1UEAB 2MUYA 2K5HA 1I6VC 4K5XA 3WBJA 4DR4L 1TS5A 2M2LA 1VQGA 2ZL6A 1I3QH 5KNDA 1EFWA 3VO2A 4A3LG 4A3CH 3TSSA 3BDCA 5G3LF 1BXTA 5I9OA 3TREA 2DEUA 1KDBA 2OK8A 4GKKQ 2XEXA 5TSSA 4K1XA 4LF8Q 2PQAB 3STBC 4YY3Q 1W0KA 4DUZQ 1WORA 2YTXA 1EQQA 2F4VL 4POGA 1EWHA 2RDHA 1KDAA 1X65A 4OO1I 2MJ8A 3JAME 1TU2B 5C4HA 1AE3A 1GVPA 4H02A 2RC6A 1A3TA 1Y1VG 2EYMA 3QFRA 3CP8A 1JWMD 4AF6A 4FYDA 3VR2A 3DEOA 4IPHA 4FVMA 4DV7Q 2LKVA 1GJXA 2VY3A 2JA8B 4Q0FA 1HNZL 4A3EG 5FO1A 3CESA 4PABA 3E20A 2LMCB 4ME5A 3SK4A 3TP7A 5IWAQ 4DR5L 4LBYA 1II3A 1VQMB 1WOCA 3G4SA 1RL2A 4ZAIA 3DXJC 2B2VC 1NY4A 1H9RA 2R7FA 5KGUA 1E79A 3ND9A 5IYWA 5A2QL 1IB0A 3BS1A 3CCLB 1ENCA 1SE4A 5C3WA 4FXGC 3G6JB 3R8BA 4HJ8A 1K83B 2IPKD 4G7XA 2ZXHA 4KKSA 4DNIA 2OF1A 3D6CA 4II3A 1EOTA 1GUWA 4GQNA 1A3VA 2MFIA 4CJ0B 1UAPA 4CKBA 2CRVA 5M5YH 3H3VC 4O2DA 1EIGA 2JA6B 4A3DH 1UD4A 5ELNA 3KJOA 4RA8A 5CV8A 4JI4Q 1HNWQ 4LMQD 1FNMA 3CMAB 2K32A 1DDIA 3OJXA 1YLOA 5GROA 3S1QB 2WZNA 2JEAI 4JV5L 2B2WA 3ASSA 1QNUA 3OW2A 3M4QA 1HR0W 1R9TB 3H94A 4DAMA 5GV7A 4UAIA 4G5GA 2NBFA 3Q6QA 1N8RC 3HKZE 4LNQA 5IGBA 4Y7NB 1HJPA 5GAEC 4DR1Q 3NTIA 1SNQA 2CW0C 1N36Q 3GO5A 4GOPA 4ZV4A 1S72B 4QJFA 2F03A 5DM73 1K0RA 3QSYA 5LMNL 5M5XB 4CKEA 2WJYA 1QWYA 2L5TA 1XPUA 2RVLA 1FVIA 2IT1A 4PC2A 1TTTA 2OT2A 3DDYA 3M4YA 1C0AA 1HQMC 2ZXPA 4LFAL 3SJPA 3ZUGA 2XNDA 1VQPA 5E4XA 1G291 5M3MH 3B82A 3H0GH 2HIVA 4OELB 2J7KA 1YJWB 3STBD 3I4NB 1E3ZA 2VJJA 4GN5A 1ZXTA 3CCRA 5DS0A 1DJRD 1NBMA 3KOJA 5AFWA 4OGQC 1QVGA 3ES9A 1PJ6A 2F3IA 1B7YB 1EFRA 5IGEA 3TMEA 4J0QA 5M3FG 1EYGA 1JR0D 1HUMA 2IX0A 3LQEA 2RC5A 2DY1A 1EY7A 2CQAA 3JAML 1PYSB 3S1NH 5JAVA 1QJOA 3TP8A 4XR6A 1HNZQ 3S17B 4C0SA 1SLJA 4RPDA 4XMYA 4J8QA 1QFZA 2OBRA 1TS2A 2B8GA 4OOSA 1STNA 2PI2E 2L12A 3CCVA 1W34A 2NV4A 4XIGS 3ZBTA 1VS0A 4YAWA 2JYOA 4JC0A 1EIYB 1WTQA 1B8AA 1N33Q 3WQZA 3HOYG 1ET6A 3W5OA 5CC4A 5IODA 3MMPA 3M7NA 4LFCL 1D1NA 3BC9A 3JAMi 5M9OA 2X3UA 4M2LA 3HOYH 2HLDA 5M5XH 4DR2L 4JI0Q 5JJZA 5IP9H 1W87A 1N34Q 3TQYA 1VF5C 1JCKB 5FO0A 1I5FA 2N49A 5IP9G 4M53A 2P5ZX 3HOXH 1UD6A 2F0UA 4KD4A 4XORA 3OHXC 2KUMA 3MXUA 3CCVB 4DA2A 2IWHA 1KL9A 1IHMA 3GVJA 2Y0SB 4ODGA 1GUOA 3CP0A 4FXDA 1SYDA 5IGGA 2WKDA 1RTNA 1TVCA 4DNRB 1SYCA 3UI2A 4HIDA 3U4VA 3NTKA 1MBYA 1A2TA 3IRBA 2OTJA 1HXYD 4DR1L 4BY7H 2Q2HA 5EKKA 2C5BA 1RDPD 1T5EA 3T1YQ 4A3BG 3CXCB 4YWKA 5IOCA 4GNXB 2R6GA 3QJYA 4RHSA 2F4IA 3T1HQ 2ZZGA 4A3BH 3AVVA 1UD5A 4L5QA 3S1RH 2VNHA 4F87A 4WQMA 1C48A 2D2CC 1TWAB 1BF4A 2EYJA 4YHHQ 4A75A 4HAEA 4DR3L 4LF4Q 1EEID 2K14A 4ZKCB 3PIP3 1CM9A 4YCVA 1N8RD 1N08A 4JBJA 1SN8A 3A7LA 4NW2A 2ZJQA 2JE6I 1FNUA 5M3MB 2E2DC 3TN2A 4DKAC 4DR7Q 3SLDA 1NDHA 2B7BA 3T53B 3FKSA 1W9XA 1DCZA 1ICFB 5JBQA 1IBKL 5LMNW 1NBWA 1SNCA 4EQNA 2OTLA 1JE5A 2PNRC 2YWGA 3AVXA 2QILA 4B47A 2NVTH 2VUMH 1KLGD 3S1MB 1G7SA 2C9OA 2Q6LA 1KNAA 4KJOA 2JJ1A 4A93H 2C5HA 2FMMA 4G4KA 5IP7G 3Q38A 1FRQA 5D14A 2CFMA 1JORA 5FO8B 3K57A 1PH7A 5JEAJ 4X0CA 4A93G 2WP8J 4LWCA 2IX1A 3CCEA 5DNFA 1TY0A 4LF9Q 2N88A 5THXA 4NMZA 5EJWA 3I72A 3Q6SA 1N06A 1EP2B 2A68D 2RCFA 1R9TH 2UU9Q 2B5OA 2HHHL 2PQAA 1K73D 1NB0A 3AFQA 3FEWX 2X8KA 1J9ZA 2FINB 3N52A 1XMQQ 5EKLA 3CC2B 1HR0Q 3S17H 1JJ2B 1DYQA 1I4HA 1QVCA 4UZEA 3Q8DA 4OHJA 1X3PA 3NE5B 5KYLA 1V0FA 1PH4A 3GTGB 2Q6KA 4RD6A 4PGOA 2FFKB 3JQQA 3U6BA 3NQTA 4KHZA 2OXPA 3Q3AA 4K5WA 1B2TA 2QGQA 1N0UA 2C78A 5L37A 3J81i 1AH9A 4J6HA 4YALA 3F2CA 4LUVA 3K5OA 3QE2A 5CV9A 4AYBE 4R9WA 4XL9A 4P1VA 4OPOA 5BN3A 2DERA 1HVXA 2A5HA 4ME3A 1LTRD 1YI2A 4F7XA 1QGYA 3VR5A 4XLEA 1G7TA 3CCEB 3PMFA 5KIXA 2WINB 4DPGA 5A88A 2A74C 4JVZA 3V2TA 1P4MA 3KF8A 4A3GB 4P6YA 4LFBQ 3K80C 3R3OA 5H5JA 1BBUA 2K5DA 2V7UA 1QVGB 4DV4Q 1QG7A 2CBXA 3C1FA 2CNDA 2R92G 3BZKA 4CGYB 3CCRB 1PTOD 3IKJA 2SNSA 3OSOA 1H95A 4A3EH 2E76C 4DV6L 2ALYB 5IYCG 1JICA 5H1SE 4V0BA 4LF7Q 5BR8L 1VQPB 2EYLA 3OW2B 1PTOB 1F9SA 1I94L 1KK1A 2WPDA 2K52A 5BN4A 1G6ZA 3D31A 1GUNA 2E74C 5T1GA 3NENA 4XLHA 2YTVA 4XQJA 2F0VA 1QH0A 1LO5D 1KQSB 1VQ7B 2B2UC 4RGMA 1ZUNB 1YNJD 5E1FA 2BM1A 2F0KA 1EZ8A 1I50H 3FMCA 1Q8IA 2N55A 1OXUA
chains in the Genus database with same CATH topology
2W6JA 2PQEA 3BDOA 3GVLA 3CHBD 2EJGC 2K04A 4LJZC 1F77A 1S5CD 1U4MA 4QIWB 2B63B 3GQBA 4GZYC 2BE5C 3TDQA 3M4OB 4KK7A 2F0JA 4CBVA 1XX8A 1OHHA 1TS4A 1M8AA 3SHLA 2A6HC 5FLXL 2EY2A 2F0FA 3NWTA 3URYA 4DAYA 2AUKA 4C1NI 4B08A 4RHRA 4XD7A 3J7YW 1KMHA 4KI0A 1JWUD 1QOHA 1Q1EA 1G2SA 3PUYA 2B2YC 2RDFA 3R2TA 4H13C 2JA5B 2J7ZA 4YXWA 3MA2B 2WAQB 3S2DB 3MXGA 3PUWA 4H0LC 3IFDA 4QUFA 1BO0A 4K8JA 2XWJB 4RAUC 1HPCA 2MHVA 2AQ2B 4TT3A 2ENBA 3K59A 3CP2A 1EWCA 3NHHA 1PFNA 3HOUB 2WV6D 1D5XC 2B2VA 2E2HB 4C3HB 3L9AX 1CQVA 3NBHA 2F1MA 1V8QA 2LZJA 2X6XA 5FOBB 2QE7A 2E75C 1PDQA 5EPLA 2FJ2A 1HCZA 2ZXRA 1LABA 2EDGA 1I6HB 1HHVA 3BH4A 3GVKA 1CHPD 2HDMA 4HCEA 1H9KA 1SXTA 4H7BA 1SYFA 2LS01 1V1OA 5CBEE 1GOZA 5IGCA 1RF2D 1NAPA 2XZLA 2ZZFA 4ZQ3A 4L63B 3A35A 2TMPA 2EJFC 2G9HD 3GTJB 1Q3LA 2BA0A 4X3KA 1F2LA 2V31A 4G57A 1UD8A 3HOZB 1I4RA 4XN0A 2F0SA 1HUNA 4IUNA 3KBXA 4BA2I 1JC7A 4TSSA 1CHQD 2K5QA 3MTSA 1ZYRC 5C0XJ 4G7OC 3OEHA 3L7ZC 1A6XA 4FO2A 5C5LA 4KY6A 3SEBA 1WTRA 4F88A 1E2ZA 4RH6A 2D9UA 2L1BA 1SMYC 1D5MC 2F0EA 1K8OA 5C5MA 4TQUS 1B9MA 3QIAA 2PZWA 2L9HA 2X53S 3BDLA 4ZUIA 1F2ZA 1IYVA 1XXGA 4UZUA 5KEEA 1SDFA 2K1BA 3SK5A 3GP7A 1EFID 1B50A 1LTGD 4A3BB 1Y8PB 3J80E 3ND8A 4TSFA 5D3IB 4KMUC 4RKLA 1TQOA 3AB9A 1G91A 1EU3A 1IW7C 1OXVA 3E0JA 1IKLA 1E43A 5EBCA 5CV7A 5CYUA 1SE2A 4NDXA 1HZEA 1CZWA 1I4XA 1VDZA 4BY1B 4KY7A 2K6AA 2X6LA 4RGNA 2A6HD 3I73A 1JOKA 3GTPB 1XYIA 4C3JB 5FO7B 4RGTA 1JWSD 2QDBA 1D2BA 3BVZA 3U9OA 2RSOA 1TWHB 3S15B 2KECA 4PQXA 1PLFA 5E4WC 2F43A 3RD4A 5I2XA 3H09A 3PIO3 5HURA 2D3LA 2XSCA 1DXMA 4ULLA 2EE1A 2B8FA 1DZ1A 1JOQA 2NTSA 5CV5A 4XYQA 1PKVA 1D6EC 1S5ED 2F0TA 5JVG3 5C0XG 3FRPB 2F0OA 4PMCA 1Z6HA 1UD2A 2SNMA 4WFN3 1BUVT 3IAYA 1JOOA 4L8JA 1G2TA 1YNND 1H8EA 3P20A 1EIHA 1SYGA 5DAUA 4FF3A 5BN5A 5M5YB 3D3RA 2QF7A 1C4QA 1WTPA 5IGDA 1FD7D 4DU9A 2XWBB 4K2KA 2R9VA 4KY5A 3LX0A 1UD3A 1J9OA 1NR4A 1O80A 3HP3A 4HSVA 4IALA 4G7ZC 4XT1B 5KNLA 5JPNC 2BDNA 1EY8A 1PTOC 2J0TD 4ZLTF 2SEBD 1Q90A 1I4GA 1NUCA 3OIPA 1VF7A 3ONAB 3OIQA 1AEXA 2SOBA 1TS3A 4X3SA 3HZXA 3RZOB 4BS9A 3SDZA 4DK1A 2VB2X 3EJIA 5KNBA 1H8HA 3FKIB 2DIEA 2LFNA 3MFGA 2D3NA 2QKIC 3CMMA 4XOTA 2O4XA 3KBGA 4BBSB 4XQFA 2WKCA 2WSSA 3AMUA 1DD2A 4ID6A 4K5VA 1S5BD 5COYA 1PZJD 3H0GB 3C1EA 4HTHA 3M7GA 3KUPA 4EQPA 4C3HG 3A7AB 3QO2A 3HGBA 1KABA 1SNMA 4WRDA 1RCVD 2RQXA 1GUSA 2EYOA 3SE0A 4XLAA 2R93B 2NYZD 3SK6A 3T16A 5D65A 1MABA 2IL8A 2CK3A 3EVQA 3QOLA 1IKMA 2B2TA 1B1ZA 1STYA 1BR9A 1HA5A 1CI3M 3I8ZA 1E1RA 3MFYA 5KYIA 3TP5A 1D5ZC 1NSNS 3PUXA 4DFAA 3BVMA 1CZGA 2AWNA 2O5IC 1BLIA 1IYUA 1FX0A 4HEDA 2KVMA 1SJED 4Q5VA 1O7YA 1EY0A 2A69D 3I3CA 1PFMA 2D62A 5CGKA 1I4QA 1LTBD 5I6WA 2KCNA 1U9RA 1ZKOA 1SJHD 1ILPA 2R7ZB 1SNPA 2KEDA 2BE5D 2LY7A 3NQIA 4G6IA 3TBIB 4C1NK 4HSPA 5CV6A 3R93A 1EQVA 1KLUD 5ELCA 3D4RA 1RHPA 1SBBB 2FMCA 1V0EA 1GHJA 1WPCA 5J1ZA 1R4QB 1SSOA 1WVLA 3T13A 4XM3A 4FXUA 2GA4B 1WTOA 5DN6A 1BCPF 5EBDA 2EY5A 1OXSC 1CT1D 2NVYB 3J81E 3N6RA 1I4PA 2WJVA 1CQFA 1I18A 3GTOB 1GUGA 1STBA 4JMQA 2PCFB 2XVSA 4A3EB 5M3FB 3CU7A 4X3TA 4O1NA 3VYUA 1KDCA 2SDFA 3A3GA 4JBWA 2K5WA 1FYCA 3WDNA 4B3GA 4A3FB 2E1BA 5K36G 1JB3A 3K58A 3HG9A 1QE6A 2KOLA 2K03A 1LTID 5CV4A 3A3BA 1K8MA 1Q1BA 1AP0A 1B44D 4XT3B 3OAAA 1Y8OB 4EQOA 4HR7B 1HFGA 2Q8IB 5A35A 3PUZA 3PUVA 3LWEA 4FF1A 1SMYD 3RLFA 4UDUC 1SEBD 2VXWA 1X3QA 1XWEA 3DUZA 3NK9A 4MIUA 2R3ZA 4IFDH 1BBXC 4B9XA 2F0IA 1E1QA 1H9JA 4R8IA 2BDOA 4IFDG 3C46A 1TY2A 3BCFA 1PZID 2DY7A 4RKBA 3G7LA 1V1PA 4DK0A 3A8JE 1NRKA 3NBIA 4XKWA 4XNFA 2XN9C 3OOCA 2K7VA 2WACA 2HQEA 1QNKA 3S1RB 2J4XA 3K7AB 1C8CA 4A3DB 3WOEA 2F0MA 1GUTA 1BCPB 3QWNA 3MHBA 1E3XA 4XKVA 1SFOB 1EY6A 2BOSA 4RFBA 3ZIAA 4XTCS 3D4DA 2Q8TA 4WORA 3W2DA 2ZXIA 5IGFA 2A73B 2JDIA 3E5SA 1KTKA 1DONA 1BMFA 1H9SA 1BCPC 4XYOA 4XQQA 2F3WA 1PTOH 4QF4A 2JIZA 5ELEA 2AQ3B 3P7JA 2F0HA 4TKOB 4IQZA 5F2DA 3H6MA 3VYSA 4EVOA 2MGSA 2DY8A 1B3AA 2KCCA 4K14A 4IN3A 5FL7A 2WIIB 3S1NB 3BZDB 1HTLD 3W3AA 5CBAE 3GTMB 3Q24A 5M5WB 2QEJC 4F8MA 2L11A 3FDTA 4A3KB 1Q12A 4RGOS 3HKZB 2ZTGA 3TZDA 5C3EB 4RCNA 1W6KA 1MSGA 3DM1A 1O7ZA 4RCOA 5IK2A 1D1IA 2NUCA 3ZPNA 5E3FA 3K5NA 5DEHA 4DF7A 1COWA 1HTPA 1MD2D 5KNCA 5LHY1 1G8ZD 2EYFA 3O13A 4TRDA 2ICEC 4YIJA 2CHBD 1K28D 2RA4A 1HFNA 3MXPA 3RUZA 1F9RA 5CR3A 3BYYB 2KQ3A 4YEJA 2X6YA 1RJTA 1F9QA 1NR2A 4XOPA 1SNOA 1PTOF 2X6GA 2NVXB 4A93B 2OEOA 3GTLB 1BDOA 2F0QA 1U4RA 1B4OA 2PW7A 2EYPA 4FNFA 3DWPA 1W0JA 3QB3A 4CHTB 4CKCA 2NWGA 1UUPA 5IIFA 4E6IA 2CW0D 4IUQA 3SVMA 4YELA 1A15A 2Z1CA 1O78A 2C5CA 2HDLA 2KA7A 5A2QE 4XLFA 4A3MB 2M00A 4K8IA 3OPOA 1TWFB 2KEEA 1BCPD 1X32A 2B2UA 3HOVB 4KV6A 4ZUJA 2KVOA 3VA7A 1FR3A 2V4DA 1FNWA 4ABNA 2H1EA 5CDFA 2VJIA 3MZ5A 5LL6X 2RKSA 3S2HB 1MI2A 4KHVA 4OO1G 1PRTD 5K36H 4DNTB 4OO1H 5I6YA 1XTCD 1O7LA 2A6ED 3GD7A 4J1MA 3MXNA 1EY4A 4P22A 2Z4HA 3TZUA 2X85A 3WOFA 1DOLA 3OE7A 1WP6A 1YNJC 2JXMB 2Z4IA 3BG3A 3J7AF 4FP5D 5EPKA 1A3UA 4XDXA 1OB0A 1H9MA 4OIKA 1CFMA 1S5FD 2XGJA 3MEHA 3I4LA 5FKAC 2R61A 2D5DA 4IFDI 4KTAA 2JA7B 3DWQA 3NUCA 1WTVA 3FPUB 3U9SA 5C4ZA 3PO3B 2HCCA 2BA1A 2XIWA 1ENFA 5K5PA 4EGVA 3P75A 1BNZA 2F0GA 3BCDA 1JQYD 1ONLA 1EY5A 5KRUA 1FNVA 1PMRA 2K05A 2F0WA 2XRSD 1ESRA 1EZ6A 5I4DA 4A3JB 1EL0A 4A3IB 5C3XA 4N9PA 4PV1C 4DAVA 2W6IA 1PRTF 1UNSA 2GJKA 2G9DA 1Y69U 3FVQA 1A2UA 4AYBB 2QCPX 2ICIA 2HCIA 1RD9D 4CJ1B 3NP8A 4ZYSA 2EZVA 4NP5A 3T51B 1H9SB 2NTTA 2PZUA 2XZOA 3NSWA 4OL7A 1TT2A 1ML0D 2X69A 2PMZB 2Q8RE 1OXXK 2EVBA 4ZK9B 3CKIB 1WTWA 4WJWA 4S3SA 2ZZEA 2I07B 3EFXD 3V05A 3M85A 1BPLA 1I3QB 3PV0A 3NTHA 1EQTA 5EGTA 4IURA 1RODA 1M4VA 3S9WA 2L4NA 1KNEA 4KD3A 3A8KE 3JU4A 2JP1A 3FPPA 1PXUA 3KLRA 3K0YA 5I9PA 3QOJA 3GTKB 4IUVA 1V1PB 5ELBA 1J8IA 3L3OC 1VMCA 3KLSX 3HOXB 2O5JC 1OXTA 1GXDC 1PRTC 2MP1A 3ITPA 1LTSD 2Z6BD 5C4JB 1LTAD 5C0XI 2EY6A 2TSSA 2K28A 4C56C 1ET9A 5JEAH 1LACA 4XLCA 1PFBA 5JEAG 5T1IA 4HCSA 4M1UB 3I4MB 4PNYA 3Q23A 4IUUA 3SK8A 5EQ0A 2XNAC 2AWOA 2E2JB 1R4PB 1PRTB 1U4PA 2ZT9C 1IHZA 4JK1C 1KZLA 4B3FX 2NB0A 2B2TC 3OFNA 1WCMB 1WTHD 2Z8LA 4NKLA 2KJXA 3LWUA 4Z1MA 3MC0B 5HGTA 3KLSA 5JVH3 3IL8A 3DHQA 1RKNA 4QCLA 4IZ8A 2A68C 1LT5D 3RZDB 3OMGA 1VJSA 1GHKA 5ISRA 2XRQD 2WB1B 3ZYYX 1AFPA 2GJPA 2ID0A 3F2UA 1L0YB 3GV6A 2DN8A 3KK7A 2VUMB 2NVTB 1B53A 4XXEA 4FF2A 4II2A 1Y1WB 3R2IA 4QB4A 1CK1A 1D1KA 3I70A 5C4XB 3VR3A 4DGZA 2WZPP 4BWGB 4BBRB 1QILA 3HAGA 1JE4A 2F3VA 1FGBD 3HS0C 5HKKA 1STEA 5EPJA 4HMJA 1RTOA 1LT4D 4L6TB 5NUCA 2F0PA 1TWGB 2H4OA 2PO4A 2XOKA 4FF4A 3HEJA 4C3JG 1ICWA 2F0DA 3OWFA 4ZKBB 5J22A 1LTTD 5FK9C 3DMUA 2X6WA 3VR6A 2VNUD 1TR5A 4KN4C 3CRKC 2NN6I 2FHTA 4Z9CB 4AVZA 5FLXE 1EYCA 4CJ2C 1SE3A 5D3DA 2MPMA 4P2CB 2E2IB 4IUTA 4OIJA 3KEWA 1LV9A 2YU9B 2JEBI 1DOKA 2CVRA 2KHSA 2GJRA 4R8NA 3DEPA 4C3IG 2F0NA 3SXHA 2RBMA 4DAPA 1ENAA 1PZKD 4QUCA 1VCIA 3SR1A 4FXKC 1VLYA 3GTQB 5LL6S 1AZPA 2JJ2A 3K5MA 4K2LA 1EY9A 1I8DA 4MHEA 2M9VA 5ELDA 1LT6D 4N9TA 2DNEA 2ZZQA 1SYBA 4K6DA 1HRJA 1HQRD 3NXWA 1EU4A 3E6ZX 3IFTA 5ELFA 3S16B 3LNNA 4KN7C 3VYTA 4ASUA 4X3UA 1EYAA 4MN3A 3BVGA 4I65A 1EEFD 2GK6A 1EYDA 2YYZA 2A6EC 3VYRA 1DOMA 4RWSC 3DWAA 3NWSA 2M5SA 4BY7B 3V96A 3CQZB 1AN8A 5C6AA 3EROA 1VMPA 4HMIA 3K6OA 5DM63 2BCOA 3CRLC 1IL8A 3OMCA 1WD1A 2PW5A 4M8AA 1S5DD 1E2VA 4LK1C 3I90A 4XN3A 3HOWB 1W6JA 4IFDJ 3J81L 1SKYB 3OWEB 3D4WA 2HUGA 5JOBA 2PYKA 2IX3A 1SNDA 4NNJA 4C2MB 1QCBD 1QB5D 2K33A 4QMGA 2O2LD 5FO9B 3Q0AA 2AUJD 4PMWA 2AQ1B 4U68A 3X3MA 2K01A 1ZEQX 1F9PA 5C0XH 1IW7D 1KAAA 2L0CA 4B9WA 4ILWA 4G7WA 4BA1I 1NCVA 1YNNC 1AW7A 3C3LA 1AZQA 3GV3A 1STGA 2B2WC 1Z47A 1MSHA 2IW3A 2RDGA 2VB3X 3MAQA 1V43A 4DN4M 1B9NA 1U4LA 2IJ0A 1T5XD 3MWYW 3EQLC 3VR4A 5CMDA 4HN7A 4I7ZC 1E2WA 3A56A 4C3IB 2L55A 3J80L 1L0XB 1F2YA 3P1HA 3AU7A 4G7HC 2RSNA 1I50B 4ZRZA 1Y1VB 3D6WA 2EY1A 4V190 1STHA 5IT9E 1F2MA 5J39A 1LT3D 4KJNA 1SAPA 4DXFA 1TWCB 3T56B 3C2PA 3A8IE 2EYHA 2EPBA 1SYEA 1ILQA 4DXGA 2ZXOA 1OO9B 4LAAA 3M3YB 2PPBC 1HA6A 2B39A 2PZTA 2NVQB 3S14B 2V7QA 4O42A 3RMHA 1BQQT 1PYWD 1CA5A 3QG1A 2GK7A 4PMBA 1CTMA 3VA5A 2A69C 5JPMC 1WTXA 3J7AV 4KKTA 1S4ZA 2NN6G 5I2YA 2I46A 5CORA 2NN6H 3MVVA 5C44B 1LLRD 2F0LA 4H44C 4IUPA 5G3LD 1TKWB 5EKIA 3NPPA 1CA6A 4HIZA 3PO2B 1TVXA 4KKUA 3OEEA 3A55A 1Z7TA 4K6LA 4E0FA 3EA6A 4XONA 3X3NA 2EOTA 1ZYRD 3G05A 3ERQA 2ZTNA 1DM0B 1STAA 3TP6A 1E0BA 3T4AC 2R92B 1WD0A 1ESFA 2B2YA 3HRZC 3H91A 3A54A 3K5LA 3BYTB 1MGSA 5IT9L 4XQNA 3Q22A 2XZPA 3D8GA 1BOSA 2EJMA 1Y8NB 2EXZA 4U673 3HOYB 3I91A 2JSOA 2NZ1D 3OW7A 2DNCA 1TIID 1UEAB 2MUYA 1I6VC 4K5XA 1TS5A 2M2LA 5KNDA 3TSSA 3BDCA 5G3LF 1BXTA 5I9OA 1KDBA 5TSSA 1W0KA 1EWHA 2RDHA 1KDAA 4OO1I 2MJ8A 3JAME 1TU2B 5C4HA 1A3TA 2EYMA 3CP8A 1JWMD 4FYDA 3VR2A 3DEOA 4FVMA 2LKVA 1GJXA 2JA8B 4Q0FA 3CESA 4ME5A 2LMCB 3TP7A 3SK4A 1II3A 4ZAIA 3DXJC 2B2VC 1H9RA 5KGUA 1E79A 3ND9A 5A2QL 3BS1A 1ENCA 1SE4A 5C3WA 4FXGC 3G6JB 3R8BA 1K83B 2IPKD 4G7XA 2ZXHA 4KKSA 2OF1A 3D6CA 4II3A 1EOTA 1GUWA 4GQNA 1A3VA 4CJ0B 1UAPA 4CKBA 3H3VC 1EIGA 2JA6B 1UD4A 4RA8A 5CV8A 4LMQD 2K32A 3S1QB 2JEAI 2B2WA 1QNUA 1R9TB 3H94A 4UAIA 2NBFA 5IGBA 4Y7NB 3NTIA 1SNQA 2CW0C 3GO5A 2F03A 5DM73 5M5XB 4CKEA 2WJYA 1QWYA 2L5TA 2RVLA 2IT1A 2OT2A 3DDYA 3M4YA 1HQMC 2ZXPA 2XNDA 5E4XA 1G291 3I4NB 1E3ZA 2VJJA 1ZXTA 1DJRD 1NBMA 5AFWA 4OGQC 1EFRA 5IGEA 3TMEA 1JR0D 1HUMA 2IX0A 1EY7A 2CQAA 3JAML 5JAVA 1QJOA 3TP8A 4XR6A 3S17B 4XMYA 4J8QA 2B8GA 1TS2A 1STNA 2L12A 4XIGS 2JYOA 1WTQA 3WQZA 1ET6A 5CC4A 5IODA 3M7NA 3BC9A 5M9OA 2HLDA 5JJZA 1VF5C 1JCKB 1UD6A 2F0UA 4KD4A 4XORA 3OHXC 2KUMA 3MXUA 4DA2A 2IWHA 3GVJA 2Y0SB 4ODGA 1GUOA 4FXDA 1SYDA 5IGGA 2WKDA 1RTNA 4DNRB 1SYCA 3UI2A 3NTKA 1MBYA 1A2TA 1HXYD 5EKKA 1RDPD 1T5EA 5IOCA 2R6GA 3QJYA 4RHSA 2F4IA 2ZZGA 1UD5A 4F87A 1C48A 2D2CC 1TWAB 1BF4A 2EYJA 4HAEA 1EEID 4ZKCB 3PIP3 1CM9A 4NW2A 3A7LA 2JE6I 1FNUA 5M3MB 2E2DC 3TN2A 3T53B 3FKSA 1W9XA 1DCZA 1SNCA 4EQNA 2PNRC 2QILA 1KLGD 3S1MB 2C9OA 1KNAA 4KJOA 2JJ1A 2FMMA 4G4KA 5D14A 1JORA 5FO8B 3K57A 5JEAJ 2WP8J 2IX1A 5DNFA 1TY0A 2N88A 4NMZA 5EJWA 3I72A 3Q6SA 2A68D 3FEWX 2X8KA 3N52A 2FINB 5EKLA 1DYQA 1I4HA 4OHJA 1X3PA 3NE5B 5KYLA 1V0FA 3GTGB 2FFKB 3NQTA 4KHZA 2OXPA 4K5WA 1B2TA 4J6HA 3K5OA 5CV9A 4R9WA 4XL9A 5BN3A 1HVXA 2A5HA 1LTRD 4F7XA 3VR5A 4XLEA 5KIXA 3PMFA 2WINB 3V2TA 2A74C 3KF8A 4A3GB 3R3OA 2K5DA 1QG7A 3C1FA 4CGYB 1PTOD 3IKJA 2SNSA 3OSOA 2E76C 1JICA 4V0BA 2EYLA 1PTOB 1F9SA 2WPDA 5BN4A 1G6ZA 3D31A 1GUNA 2E74C 5T1GA 4XLHA 4XQJA 2F0VA 1LO5D 2B2UC 4RGMA 1YNJD 5E1FA 2F0KA 1EZ8A 3FMCA 1Q8IA 2N55A 1OXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VR6 A;  1G29 1;  1I6V C;  3BDO A;  4KN4 C;  1DCZ A;  3CRK C;  2PPB C;  2NN6 I;  3MFY A;  5JEA H;  3AB9 A;  1E2V A;  5KND A;  2EJG C;  1ONL A;  1IW7 C;  1H9K A;  4LK1 C;  1LAC A;  1OXV A;  2PNR C;  4LJZ C;  1PMR A;  3PUX A;  5JEA G;  1H9S A;  4JBW A;  2O5I C;  4OGQ C;  1FYC A;  3WDN A;  1IYU A;  1VDZ A;  3GQB A;  3QG1 A;  4GZY C;  1O78 A;  1CTM A;  2AWO A;  5K36 G;  4PV1 C;  1Q90 A;  2BE5 C;  2A69 C;  1EWH A;  2A6H D;  2ZT9 C;  1VF7 A;  2JEB I;  1TU2 B;  2KA7 A;  4TKO B;  3I73 A;  4IQZ A;  1Y69 U;  2A69 D;  3I72 A;  4JK1 C;  2K33 A;  2A68 D;  2D62 A;  1QJO A;  2EJF C;  3OPO A;  2A6H C;  2BA0 A;  1K8M A;  1Q1B A;  3VR2 A;  2AUJ D;  1VCI A;  4KKT A;  3SDZ A;  2B8G A;  4DK1 A;  2KCC A;  1Y8O B;  3T51 B;  1GJX A;  1H9S B;  3LWU A;  2AUK A;  4HR7 B;  4XIG S;  2NN6 G;  1HQM C;  5KNB A;  3NE5 B;  2LMC B;  2Q8I B;  1IW7 D;  3W3A A;  3VA7 A;  5C0X H;  5A35 A;  3PUZ A;  3PUV A;  1FR3 A;  3DXJ C;  4BA2 I;  2NN6 H;  2V4D A;  4KI0 A;  3M7N A;  1H9R A;  1ZKO A;  3RLF A;  4KHZ A;  4BA1 I;  2A68 C;  3ND9 A;  4H44 C;  1Q1E A;  3PUY A;  1YNN C;  1GHK A;  1Q12 A;  1ZYR C;  1OXX K;  1TKW B;  2EVB A;  2BE5 D;  4H13 C;  4KKS A;  4RCN A;  1VF5 C;  3M85 A;  2DNE A;  4G7O C;  1DD2 A;  3L7Z C;  4IFD H;  4OO1 G;  2DN8 A;  3PUW A;  4H0L C;  1A6X A;  1H9J A;  4KKU A;  4DNT B;  1HPC A;  5BN3 A;  1DXM A;  2BDO A;  3PV0 A;  5K36 H;  3MXU A;  4IFD G;  4OO1 H;  3IFT A;  4G7Z C;  1V43 A;  1Z7T A;  1B9N A;  2B8F A;  3VR5 A;  1GUO A;  2PCF B;  3LNN A;  3D4R A;  1O7L A;  1HTP A;  2A6E D;  1GHJ A;  2K32 A;  3GD7 A;  4DK0 A;  3A8J E;  3EQL C;  3VR4 A;  5C0X G;  4I7Z C;  4DNR B;  1E2W A;  4KN7 C;  3VR3 A;  5KNC A;  1E2Z A;  3A8K E;  1Z6H A;  3TZU A;  2JEA I;  3FPP A;  3OOC A;  1SMY C;  3A7A B;  2K7V A;  3HGB A;  3KLR A;  3H94 A;  1K8O A;  3IKJ A;  1YNJ C;  2JXM B;  3BG3 A;  4TQU S;  4G7H C;  4L8J A;  2E76 C;  1T5E A;  1B9M A;  3QIA A;  3P20 A;  2YYZ A;  1GUT A;  1GUS A;  2CW0 C;  2R6G A;  2F1M A;  3QJY A;  1OXS C;  3SE0 A;  5BN5 A;  1V8Q A;  2O5J C;  2QF7 A;  1H9M A;  2A6E C;  1CFM A;  1OXT A;  1IYV A;  5BN4 A;  3D31 A;  1GUN A;  2D2C C;  2E74 C;  3I4L A;  3N6R A;  3T56 B;  2D5D A;  1BDO A;  2EJM A;  1Y8N B;  3A8I E;  1Y8P B;  2E75 C;  2L5T A;  4XTC S;  3U9S A;  3A7L A;  2JE6 I;  2IT1 A;  1HCZ A;  3CRL C;  3ND8 A;  1LAB A;  1GUG A;  3FMC A;  2BA1 A;  3OW7 A;  2DNC A;  2EDG A;  1OXU A;  3M4Y A;  4KMU C;  3T53 B;  1CI3 M; 
#chains in the Genus database with same CATH topology
 5FJ8 H;  1N32 Q;  2W6J A;  2PQE A;  1GJR A;  3BDO A;  3GVL A;  1N34 L;  3CHB D;  2EJG C;  3KDF B;  4NXN L;  2K04 A;  3B8H A;  2Y0S G;  4LJZ C;  1G6P A;  1F77 A;  1S5C D;  1VQF A;  1U4M A;  2F1L A;  4QIW B;  2B63 B;  1QZH A;  3CC2 A;  1UE1 A;  3GQB A;  4GZY C;  2JN4 A;  5F4M A;  4HIM A;  2BE5 C;  1XNQ Q;  3TDQ A;  4DV3 Q;  4YWM A;  3M4O B;  4N3N A;  4KK7 A;  2F0J A;  1PH3 A;  4L5R C;  4CBV A;  4RDJ A;  1XX8 A;  1OHH A;  1TS4 A;  1M8A A;  2UUA L;  4JI3 L;  3SHL A;  2KEN A;  2A6H C;  1MJC A;  5FLX L;  4IJL A;  1S3O A;  2EY2 A;  3VMF A;  3T1Y L;  3HFZ B;  1OTC A;  2F0F A;  3NWT A;  3URY A;  2WB1 G;  4DAY A;  2AUK A;  2GVB A;  3VDY A;  4Z4U A;  4C1N I;  1M90 C;  4B3R L;  4B08 A;  4RHR A;  1VQ9 A;  3FKI G;  4XD7 A;  3J7Y W;  1KMH A;  1YIT A;  4KI0 A;  2PMZ E;  5M3M G;  1JWU D;  1QOH A;  1QUQ A;  1RQP A;  1G2S A;  1Q1E A;  3PUY A;  2B2Y C;  4JI4 L;  2RDF A;  4IPC A;  3R2T A;  3QFC A;  4H13 C;  2JA5 B;  2J7Z A;  3R6K A;  4DUY Q;  4YXW A;  3MA2 B;  2WAQ B;  3S2D B;  4LFA Q;  3MXG A;  4X06 A;  3PUW A;  4H0L C;  3CC4 A;  4JV5 Q;  3IFD A;  4QUF A;  3M4O H;  1BO0 A;  4K8J A;  2XWJ B;  4RAU C;  1HPC A;  3F1Z A;  5C44 H;  5M3F H;  1NTG A;  1WI5 A;  2MHV A;  2WAQ E;  1K73 C;  1I7P A;  2AQ2 B;  4TT3 A;  2ENB A;  1YBY A;  4GNX A;  3K59 A;  1X9N A;  1YIJ A;  4OPV A;  3CP2 A;  1EWC A;  4IJH A;  3NHH A;  3H9N A;  1PFN A;  3HOU B;  2WV6 D;  1D5X C;  1HA3 A;  2B2V A;  2E2H B;  4C3H B;  3L9A X;  1CQV A;  1YNX A;  3UDG A;  4RD0 A;  1MIU A;  1NE3 A;  1VHO A;  2FVG A;  4R4T A;  2K5V A;  1UWV A;  2DOG A;  3NBH A;  2F1M A;  1EXM A;  2XNJ A;  1V8Q A;  3F2D A;  1O7I A;  2B29 A;  4UY8 C;  3UE1 A;  2LZJ A;  2X6X A;  5FOB B;  2QE7 A;  1W35 A;  4AC9 A;  3S2H H;  1Q7Y D;  2OBS A;  1VQL A;  5GAG C;  1Q9S A;  2E75 C;  1A8V A;  1PDQ A;  5EPL A;  2N8N A;  2FJ2 A;  1HCZ A;  2ZXR A;  1LAB A;  1JA0 A;  1HNX L;  2EDG A;  1I6H B;  1HHV A;  2LXK A;  3BH4 A;  3GVK A;  2PLF A;  3PO3 H;  1CHP D;  2HDM A;  5IYD H;  2CH4 W;  3BZC A;  1M90 D;  4HCE A;  1H9K A;  1SXT A;  4H7B A;  1PH5 A;  2UXC L;  1SYF A;  5IYD G;  1N05 A;  1Q86 D;  3BJU A;  2LS0 1;  4JI7 Q;  1V1O A;  5CBE E;  1GOZ A;  5IGC A;  2Y0S E;  4WZK A;  1RF2 D;  1NAP A;  4X7E A;  2C35 B;  1HZ9 A;  2YWF A;  4P75 A;  4P3Y A;  2XZL A;  4M1K A;  1XMQ L;  2ZZF A;  4BY1 H;  3CD6 A;  3GTG H;  2RCN A;  4ZQ3 A;  4L63 B;  3A35 A;  2TMP A;  1HZB A;  2EJF C;  2G9H D;  3GTJ B;  2YWH A;  1Q3L A;  4X07 A;  2BA0 A;  4X3K A;  1F2L A;  3CCU A;  1JT8 A;  2QEX A;  4A3J G;  2V31 A;  4G57 A;  1LUZ A;  1UD8 A;  3HOZ B;  1EP1 B;  1NMG A;  4P6V F;  1I4R A;  2CH4 A;  4YWL A;  4XN0 A;  1QGZ A;  1VQA A;  2F0S A;  3ZJY C;  1HUN A;  4IUN A;  3KBX A;  4BA2 I;  1JC7 A;  4R4I A;  1E22 A;  2YWE A;  4TSS A;  2GPJ A;  4YHH L;  3VNU A;  1CHQ D;  2K5Q A;  3E9H A;  1YJ9 B;  4R4C A;  3MTS A;  1ZYR C;  1E1T A;  5C0X J;  1K3R A;  4AQY Q;  3GTP H;  4A3M H;  4G7O C;  3OEH A;  3L7Z C;  1MJE A;  5ELO A;  1CSP A;  4DR7 L;  1NNX A;  1A6X A;  2ZIT A;  1BX1 A;  1N32 L;  1QUF A;  4Z4Z A;  4FO2 A;  2AHO A;  3P27 A;  2ASB A;  5C5L A;  2FX3 A;  3G48 A;  4KY6 A;  2I5H A;  2FXQ A;  3SEB A;  3PUN A;  1WTR A;  2EXD A;  4F88 A;  2ZTE A;  4LBZ A;  1E2Z A;  4RH6 A;  2D9U A;  2L1B A;  2QA4 B;  4X64 Q;  1SMY C;  2CW5 A;  1D5M C;  2F0E A;  1N9W A;  1VQK B;  3A8J A;  1K8O A;  5C5M A;  4TQU S;  2NZH A;  1B9M A;  3QIA A;  1C9O A;  2PZW A;  3FJO A;  4C43 A;  2X53 S;  2L9H A;  3BDL A;  4ZUI A;  1SM4 A;  1F2Z A;  4BBS G;  1IYV A;  4KHP Q;  3OKX A;  4UZU A;  1XXG A;  5KEE A;  3CCJ A;  1YJW A;  4PC6 A;  1SDF A;  2K1B A;  2JA8 G;  3SK5 A;  3AVU A;  3GP7 A;  3J81 c;  1EFI D;  4J15 A;  1B50 A;  4JI1 L;  1LTG D;  1I94 Q;  3S14 H;  5IWA L;  4DR5 Q;  4DK6 C;  1Y8P B;  4B3M Q;  4A3B B;  3CPW B;  1IZ6 A;  2A19 A;  3KF6 A;  4OP7 A;  3J80 E;  4Y7N H;  3LVB A;  4TSF A;  3ND8 A;  1Y1W G;  3M3Y H;  5D3I B;  4LUO A;  4KMU C;  4RKL A;  1TQO A;  2ZBV A;  4JYA Q;  1FRN A;  2E1R A;  1QG0 A;  1XE1 A;  1W3S A;  3AB9 A;  3GTQ H;  1G91 A;  1QVF B;  1EU3 A;  1IW7 C;  2CKZ B;  1VQM A;  1OXV A;  2DGY A;  1IKL A;  1CQX A;  3MHP A;  3E0J A;  4HJ9 A;  1E43 A;  3HOZ H;  5EBC A;  5CV7 A;  1QFY A;  5CYU A;  4RLZ A;  1SE2 A;  4NDX A;  1HZE A;  1CZW A;  1I4X A;  1VQN A;  1VDZ A;  4JOI A;  2BN4 A;  3KF8 B;  4KY7 A;  4EX5 A;  4BY1 B;  2RHQ B;  2K6A A;  2X6L A;  4RGN A;  2YU9 H;  1BX0 A;  1E1O A;  4NXM Q;  2A6H D;  3I73 A;  3JC6 6;  4WJ4 A;  1UEB A;  3GTM H;  1JOK A;  3DLL A;  1A8P A;  5LMU L;  2XNC A;  3GTP B;  1U2R A;  3G6E A;  3PA2 A;  1XYI A;  1EFT A;  4C3J B;  4OXP A;  3A0J A;  5FO7 B;  1VQ6 B;  4RGT A;  1JWS D;  2QDB A;  1D2B A;  1YHQ A;  2I1L A;  3BVZ A;  3U9O A;  2RSO A;  1TWH B;  1VQ4 A;  3S15 B;  1D2E A;  1I6H H;  2KEC A;  5FJ8 G;  4PQX A;  1PLF A;  3B78 A;  5E4W C;  2F43 A;  2Z6K C;  3UDI A;  1GAW A;  3AFP A;  3H3V H;  3RD4 A;  4BXX G;  5I2X A;  3H09 A;  3PIO 3;  5HUR A;  2NZO A;  2ATW A;  1K8A C;  2D3L A;  2XSC A;  1DXM A;  4ULL A;  4DR4 Q;  2EE1 A;  1AMO A;  2B8F A;  1YX2 A;  4JI6 Q;  1DZ1 A;  1JOQ A;  2NTS A;  4EH1 A;  5CV5 A;  4G1V A;  1PKV A;  1D6E C;  1S5E D;  2F0T A;  4XYQ A;  5C0X G;  5JVG 3;  4JI7 L;  1VQH A;  3FRP B;  2F0O A;  4PMC A;  4N8X 1;  3CD6 B;  1Z6H A;  4LW1 A;  3ONU A;  1RIP A;  4YY3 L;  1UD2 A;  1Y0R A;  2SNM A;  4WFN 3;  1WOP A;  1BUV T;  3IAY A;  1JOO A;  4L8J A;  1SFO H;  4LF5 L;  1VLO A;  1G2T A;  1YNN D;  1H8E A;  3P20 A;  1EIH A;  1SYG A;  4Z4R A;  5DAU A;  4PC1 A;  1E62 A;  4FF3 A;  5BN5 A;  5M5Y B;  3D3R A;  2QF7 A;  3MEF A;  1QGA A;  3K7A H;  1C4Q A;  2E5L L;  1WTP A;  5IGD A;  1KC8 D;  3RLO A;  5HGQ A;  1FD7 D;  1X55 A;  4X65 Q;  4DU9 A;  1CKM A;  2XWB B;  4K2K A;  2R9V A;  4KY5 A;  3LX0 A;  4PC3 A;  1UD3 A;  1J9O A;  1NR4 A;  1O80 A;  3HP3 A;  1X3F A;  4HSV A;  4IAL A;  1ASZ A;  3VNV A;  4G7Z C;  4IPG A;  1BQE A;  4FDB A;  3QFS A;  5J35 A;  1Y0Y A;  4XT1 B;  5KNL A;  4Y7C A;  4OWW B;  5JJK A;  5FLX c;  5GQO A;  1XTD A;  5C3E H;  2YTY A;  5JPN C;  4MTK A;  2BDN A;  1EY8 A;  1PTO C;  2J0T D;  1RQR A;  3JQR A;  4ZLT F;  1B23 P;  2SEB D;  3S24 A;  1Q90 A;  1I4G A;  1NUC A;  4DAY B;  3OIP A;  1VF7 A;  3ONA B;  3OIQ A;  2E2J H;  2XGT A;  2AHO B;  1AEX A;  2K4K A;  2SOB A;  1TS3 A;  2BV3 A;  2I5L X;  4X3S A;  3HZX A;  3AGQ A;  2BSA A;  2VBV A;  1VQN B;  3RZO B;  3GDE A;  4BS9 A;  1Q86 C;  3SDZ A;  4DK1 A;  2VB2 X;  3EJI A;  2CWA A;  3ICE A;  5KNB A;  1H8H A;  3FKI B;  1YJ9 A;  1DGS A;  2DIE A;  2DYI A;  1KHI A;  3PIO A;  2LFN A;  1YJN A;  3PO2 G;  2V1C C;  2JK8 A;  5C4J H;  1PH6 A;  3PO3 G;  3MFG A;  1ASY A;  2D3N A;  2QKI C;  3HKZ G;  4A3F H;  3CMM A;  3KJP A;  4XOT A;  3W2F A;  2O4X A;  3KBG A;  2Q2T A;  3I4M H;  4BBS B;  4XQF A;  2WKC A;  2WSS A;  3AMU A;  4A3F G;  1DD2 A;  4JBM A;  2VZL A;  4ID6 A;  4K5V A;  1EIF A;  2WAQ G;  3J81 k;  5JJL A;  1S5B D;  1T6Y A;  5COY A;  1PZJ D;  3H0G B;  3Q39 A;  3C1E A;  4PG3 A;  5J3B A;  3SJZ A;  1WJJ A;  4HTH A;  4BY1 G;  4DUZ L;  2F4V Q;  1KD1 C;  4QFM A;  3M7G A;  3CME A;  3CXC A;  1K8G A;  3I56 B;  1E7Z A;  3PF4 A;  3WXM A;  3KUP A;  4C3H G;  4EQP A;  3A7A B;  3QO2 A;  3HGB A;  1KAB A;  1VQD A;  1L1O C;  4NBS A;  3OTO L;  1SNM A;  4WRD A;  1RCV D;  2HMA A;  2OQ0 A;  2RQX A;  1GUS A;  4EQ5 A;  1PFS A;  2EYO A;  3SE0 A;  4XLA A;  2R93 B;  2EQS A;  1SE8 A;  4Z4S A;  1JJG A;  2NYZ D;  4B3M L;  4MZ9 A;  3SK6 A;  2Q2U A;  3T16 A;  5D65 A;  2I0Q A;  1MAB A;  3I4N H;  2IL8 A;  2CK3 A;  3EVQ A;  4OWT B;  1N33 L;  2WFW A;  3QOL A;  1IKM A;  2B2T A;  3WBK A;  1B1Z A;  1STY A;  4DV2 Q;  1BR9 A;  1HA5 A;  2ES2 A;  1CI3 M;  4X05 A;  3I8Z A;  1KRS A;  3GTO H;  1E1R A;  3MFY A;  1L1O B;  1WSR A;  4RD1 A;  1JJC B;  5KYI A;  3TP5 A;  1D5Z C;  1NSN S;  4R4O A;  1X56 A;  3PUX A;  4DFA A;  3BVM A;  1CZG A;  2AWN A;  2O5I C;  5KSW B;  2R7D A;  1BLI A;  2WYR A;  1VQ4 B;  1IYU A;  2UXB Q;  1FX0 A;  2P3M A;  4HED A;  2KVM A;  3ZZ0 A;  2ZL7 A;  1SJE D;  3OYY A;  4Q5V A;  4K0K Q;  1O7Y A;  3CTA A;  1EY0 A;  1GO3 E;  2A69 D;  3I3C A;  4X66 Q;  1PFM A;  2D62 A;  4TMZ A;  3CF5 A;  2B63 H;  2JA8 H;  4N8F A;  3CAM A;  5CGK A;  1CKN B;  1I4Q A;  3PCO B;  1MKH A;  5C4X H;  1LTB D;  4PC7 A;  4DV5 L;  1G7R A;  4GS3 A;  5I6W A;  5AJ3 Q;  1L2F A;  1WSV A;  3E9I A;  3J80 i;  2KCN A;  1Y1W H;  4P72 A;  4A3C G;  4UP9 A;  1U9R A;  4KHP L;  1JNY A;  1ZKO A;  1J5E L;  2Q6I A;  1SJH D;  2MO0 A;  1ILP A;  2R7Z B;  1SNP A;  2VBU A;  2Z9H A;  4RCY A;  4OX9 L;  3HOZ G;  2IHE A;  2KED A;  2BE5 D;  2KBN A;  1XPR A;  2LY7 A;  3ONY A;  3NQI A;  4G6I A;  1CKN A;  2XTI A;  3TBI B;  4C1N K;  4HSP A;  5CV6 A;  2BM0 A;  1KRH A;  1Y1V H;  1EQV A;  3R93 A;  1KLU D;  3A5Z B;  5ELC A;  3D4R A;  1RHP A;  1SBB B;  2FMC A;  1V0E A;  1GHJ A;  3FPK A;  1PA6 A;  1WPC A;  4JI6 L;  5J1Z A;  2JA7 H;  1XQB A;  4R1J A;  1R4Q B;  4IW3 B;  1SSO A;  1WVL A;  3T13 A;  2Z6K A;  3ASP A;  4XM3 A;  4FXU A;  4O0A A;  4TVA B;  2HD3 A;  2GA4 B;  4X6A H;  1ZM9 A;  1G51 A;  1WTO A;  4PAA A;  2HHH Q;  5DN6 A;  1BCP F;  5EBD A;  2EY5 A;  4PZ8 A;  1OXS C;  4JYA L;  1CT1 D;  1WTH A;  2NVY B;  4YCW A;  3J81 E;  3GTL H;  3N6R A;  1QFJ A;  1I4P A;  1DG1 G;  2BVN A;  4FWT A;  2WJV A;  1EFC A;  4B3R Q;  4LBW A;  1CQF A;  1I18 A;  3GTO B;  1GUG A;  1STB A;  1X6O A;  4JMQ A;  3CPW A;  4TN1 A;  2PCF B;  1QUQ B;  2XVS A;  1GM5 A;  4A3E B;  2IY5 B;  5DSZ A;  5M3F B;  5JJI A;  1Q82 D;  3CU7 A;  4LF9 L;  4X3T A;  4O1N A;  3VYU A;  5F4O A;  1KDC A;  1VQ5 A;  4C3J H;  2SDF A;  3A3G A;  4DQK A;  4JBW A;  2K5W A;  1FYC A;  3WDN A;  2GQF A;  4B3G A;  4ACA A;  1UE7 A;  3I56 A;  4A3F B;  2E1B A;  3W5U A;  5K36 G;  1JB3 A;  3K58 A;  4IPD A;  3W5V A;  1M1K D;  1LYL A;  3HG9 A;  2HQL A;  4JI8 L;  3ERS X;  1PH1 A;  1QE6 A;  2KOL A;  3ZBU A;  1IYJ B;  3CW2 A;  3FKI H;  2K03 A;  3LGJ A;  1LTI D;  2VBT A;  4P25 A;  2E8G A;  5CV4 A;  3A3B A;  1K8M A;  1Q1B A;  1LM0 A;  1AP0 A;  1B44 D;  5FNZ A;  4DR2 Q;  4JI0 L;  2HDN B;  4XT3 B;  4A3G H;  3OAA A;  1Y8O B;  4EQO A;  4HR7 B;  1HFG A;  5M5W H;  2Q8I B;  5A35 A;  3PUZ A;  3PUV A;  3WNB A;  3LWE A;  4B48 A;  4CDF C;  1S4M A;  4FF1 A;  1SMY D;  3RLF A;  4UDU C;  1SEB D;  2QDX A;  3RZO H;  1X3G A;  5A8A A;  2VXW A;  1TWF H;  1IBL Q;  1X3Q A;  2UUB Q;  4CDD C;  1YHQ B;  4HE6 A;  1XWE A;  5IT9 E;  2R93 G;  1H42 A;  3DUZ A;  3NK9 A;  1AE2 A;  4MIU A;  2R3Z A;  4IFD H;  1CNF A;  1BBX C;  1VQ7 A;  2D9R A;  4UZF A;  4JCV E;  4B9X A;  3HOW H;  2F0I A;  1E1Q A;  4Z4V A;  1H9J A;  4R8I A;  2BDO A;  3W2E A;  4JG2 A;  1EP3 B;  1Q8K A;  3C46 A;  1WOS A;  4IFD G;  1TY2 A;  3BCF A;  1PZI D;  3B6Y A;  2VYQ A;  1P16 A;  2DY7 A;  4RKB A;  3G7L A;  4QIW E;  3RR5 A;  1V1P A;  4DK0 A;  3A8J E;  2EFG A;  1NRK A;  3NBI A;  1MRZ A;  4BBR H;  3HOV G;  3WYA A;  4XKW A;  3S1Q H;  5F4J A;  4XNF A;  2XN9 C;  3OOC A;  1KTV A;  2K7V A;  4DR6 Q;  2WAC A;  3LQ6 A;  2HQE A;  5BSY A;  1XFO A;  1QNK A;  3S1R B;  2J4X A;  1EWI A;  3K7A B;  1C8C A;  5TRD A;  4A3L H;  1XPO A;  1KIX A;  4A3D B;  3WOE A;  3J81 j;  4Z4W A;  2F0M A;  1GUT A;  3AYH B;  1BCP B;  3QWN A;  2VNK A;  3CRZ A;  3MHB A;  1E3X A;  4XKV A;  3E0E A;  4JI2 Q;  1XMO Q;  1SFO B;  3HOX G;  1EY6 A;  2BOS A;  4Y9R A;  4GN4 B;  2N78 A;  5L46 A;  1EQR A;  3AVT A;  2ZM6 Q;  2PE3 A;  5E7N A;  2R7Z G;  4RFB A;  4DK3 C;  3ZIA A;  2KCM A;  4XTC S;  2PNH A;  3D4D A;  2Q8T A;  4WOR A;  3AST A;  4RDK A;  3W2D A;  2UXD L;  2ZXI A;  1N0V C;  4LF7 L;  3L2P A;  4QHY A;  1P8L A;  2BH8 A;  5IGF A;  4R4Q A;  2A73 B;  4JI5 L;  1VQJ A;  2JDI A;  3E5S A;  1KTK A;  3A5U A;  4N3G A;  1EFU A;  1DON A;  1JMC A;  1WCM H;  1BMF A;  2UUA Q;  1H9S A;  1BCP C;  1TWC H;  4LFB L;  4XYO A;  4XQQ A;  1FJG L;  2F3W A;  1PTO H;  4A3K H;  1A63 A;  4QF4 A;  2L15 A;  3V7A A;  2JIZ A;  5ELE A;  3J7A 5;  4RCZ A;  3G6E B;  2AQ3 B;  3P7J A;  2F0H A;  1LTL A;  4TKO B;  1WFQ A;  4IQZ A;  1KK2 A;  3PGZ A;  2BGJ A;  5F2D A;  3W1G A;  1K28 A;  3H6M A;  3CCU B;  3VYS A;  2ZTC A;  4YAO A;  3D0F A;  3J7Z C;  1JA1 A;  2VNJ A;  1PYB A;  4EVO A;  2MGS A;  2DY8 A;  3WWV A;  2OCE A;  4YAU A;  1B3A A;  2KCC A;  1YVC A;  4K14 A;  4IN3 A;  5FL7 A;  4UP7 A;  1AIP A;  2WII B;  1WYD A;  3S1N B;  3BZD B;  1HTL D;  3W3A A;  1KAW A;  5CBA E;  3SEJ A;  4HJ7 A;  3GTM B;  2OK7 A;  3Q24 A;  2QDL A;  5M5W B;  5A89 A;  2QEJ C;  3BY2 A;  3JAM c;  4F8M A;  4DV0 L;  2L11 A;  4UHV A;  3FDT A;  3ULL A;  4JI1 Q;  5IP7 H;  4A3K B;  1Q12 A;  4RGO S;  3HKZ B;  2ZTG A;  3TZD A;  5C3E B;  3JQP A;  4RCN A;  1W6K A;  1MSG A;  3DM1 A;  1HNX Q;  1O7Z A;  4RCO A;  5IK2 A;  1D1I A;  2NUC A;  3ZPN A;  5E3F A;  2G5D A;  2V7V A;  3K5N A;  2ZJP A;  1HZA A;  2DCU A;  5IYB G;  1E24 A;  3NEL A;  4DV6 Q;  3ULJ A;  5DEH A;  2KHI A;  4DF7 A;  3RN5 A;  2HT1 A;  1COW A;  1HTP A;  4DR6 L;  4DV3 L;  2EIX A;  1MD2 D;  1PH9 A;  4GKK L;  3HOU H;  5KNC A;  5LHY 1;  4X8I A;  1F60 A;  1G8Z D;  2EYF A;  5B6I A;  2ICE C;  3O13 A;  1N07 A;  4TRD A;  4YIJ A;  2CHB D;  1K28 D;  2RA4 A;  1HFN A;  3MXP A;  3GIR A;  1BVS A;  3RUZ A;  5C4X G;  1F9R A;  1SMX A;  2GRE A;  3H0G G;  3UDX A;  5CR3 A;  3BYY B;  2KQ3 A;  4YEJ A;  4C2M H;  2X6Y A;  3G71 A;  1RJT A;  3TS0 A;  2C2W A;  4MYT A;  1C7Y A;  1F9Q A;  3K0X A;  1PJ7 A;  1NR2 A;  4XOP A;  1SNO A;  4JI3 Q;  1PTO F;  2X6G A;  2NVX B;  4A93 B;  2OEO A;  4YCU A;  1GKH A;  3GTL B;  2CQO A;  3RNU A;  1BDO A;  2F0Q A;  1U4R A;  4Z4T A;  4HJA A;  1B4O A;  2MNA A;  2PW7 A;  3I55 B;  3KF6 B;  2EYP A;  4GOP B;  1L0W A;  2R92 H;  3CB4 A;  3MCA A;  4FNF A;  3DWP A;  1JB7 A;  1W0J A;  3QB3 A;  3AVY A;  3RLN A;  4CHT B;  4WWV A;  4CKC A;  2V7T A;  2NWG A;  4JPB W;  1UUP A;  5IIF A;  4E6I A;  2N3S A;  2CW0 D;  3GSI A;  4IUQ A;  3SVM A;  5IE8 A;  4DV4 L;  4YEL A;  3K81 C;  3ISX A;  4JI8 Q;  3LO8 A;  1A15 A;  2Z1C A;  4GKJ Q;  1O78 A;  2WR8 A;  2C5C A;  2HDL A;  2KA7 A;  4A3I H;  4UAJ A;  5A2Q E;  4XLF A;  4A3M B;  1IJF A;  2M00 A;  3CPX A;  2UXC Q;  4OON A;  2JA5 H;  4K8I A;  2PMD A;  3OPO A;  1TWF B;  4I7A A;  2KEE A;  1BCP D;  1X32 A;  2B2U A;  3U58 A;  2DJF C;  1E64 A;  3HOV B;  4KV6 A;  1U5K A;  4ZUJ A;  2BPO A;  2JA5 G;  4DV0 Q;  1GR1 A;  2KVO A;  2AKW B;  3VA7 A;  1XNR L;  5HZA A;  1FR3 A;  3ZC3 A;  2V4D A;  1FNW A;  4OEM B;  4ABN A;  2H1E A;  4ALP A;  5CDF A;  2VJI A;  3MZ5 A;  4P12 A;  4WJ3 M;  1GO2 A;  5LL6 X;  2RKS A;  3S2H B;  1MI2 A;  4NXN Q;  5FA6 A;  5E6T A;  2VBS A;  4KHV A;  4OO1 G;  1IBL L;  2QGG A;  1PRT D;  5K36 H;  4DNT B;  4GLX A;  4OO1 H;  1JJ2 A;  5I6Y A;  1KK3 A;  1VQ6 A;  1B2R A;  2MQH A;  1KJZ A;  1XTC D;  4Y9U A;  1O7L A;  3NBH B;  2A6E D;  2E2H H;  1K0S A;  3GD7 A;  4J1M A;  3MXN A;  1EY4 A;  4P22 A;  3TS2 A;  2Z4H A;  3TZU A;  2NPF A;  2X85 A;  2JJQ A;  3WOF A;  1DOL A;  1S0U A;  3OE7 A;  2OBT A;  3A8K A;  4GLA C;  1WP6 A;  1YNJ C;  2JXM B;  2Z4I A;  3BG3 A;  3J7A F;  4L5S A;  1PVO A;  4FP5 D;  5EPK A;  1A3U A;  4YAF A;  5IT9 c;  1PV4 A;  4QVJ A;  4XDX A;  1OB0 A;  4Q7J B;  2UUC L;  1H9M A;  4P9S A;  4OIK A;  1CFM A;  4PZ6 A;  1S5F D;  2XGJ A;  2OTL B;  3MEH A;  3I4L A;  2A8V A;  5FKA C;  3D26 A;  2R61 A;  1SRU A;  2D5D A;  4IFD I;  2UXD Q;  4KTA A;  2VQE L;  3DWQ A;  2JA7 B;  3NUC A;  2H5X A;  1WTV A;  1A62 A;  3HOW G;  3FPU B;  3U9S A;  4POF A;  4DV1 L;  5C4Z A;  3PO3 B;  5C3E G;  2HCC A;  3CPF A;  2BA1 A;  2XIW A;  3R6J A;  1ENF A;  5K5P A;  1R5B A;  5DLQ E;  4EGV A;  3P75 A;  4MYU A;  2JA6 H;  4ZCI A;  1KD1 D;  1BNZ A;  2F0G A;  3PEN A;  3BCD A;  1VQ9 B;  1JQY D;  1ONL A;  1EY5 A;  4BBR G;  1PHJ A;  3HOV H;  5KRU A;  1FNV A;  1PMR A;  4B43 A;  1TWG H;  2K05 A;  4DR3 Q;  4LF4 L;  2F0W A;  2XRS D;  4P74 A;  1ESR A;  1EZ6 A;  1K83 H;  5I4D A;  3W2I A;  1K3B C;  4A3J B;  1EL0 A;  4A3I B;  4A76 A;  5C3X A;  4N9P A;  4PV1 C;  4DAV A;  2W6I A;  1GVH A;  1PRT F;  3QR8 A;  3UE0 A;  1CSQ A;  2GJK A;  1UNS A;  2G9D A;  1Y69 U;  3FVQ A;  3QFT A;  1A2U A;  4AYB B;  5IYN A;  2QCP X;  2ICI A;  2HCI A;  1RD9 D;  4CJ1 B;  3OZW A;  3NP8 A;  4ZYS A;  2EZV A;  2CF4 A;  2R7Z H;  2UUB L;  4P73 A;  4NP5 A;  3T51 B;  1H9S B;  3CCQ B;  2NTT A;  2PZU A;  3ER0 A;  2XZO A;  3SGI A;  4NXM L;  2QN6 A;  3NSW A;  4OL7 A;  1TT2 A;  1XMO L;  1ML0 D;  1GD7 A;  2X69 A;  2PMZ B;  2OYN A;  5IYR A;  2Q8R E;  1VQI A;  1OXX K;  2EVB A;  4ZK9 B;  3CKI B;  1WTW A;  1QVF A;  4WJW A;  4S3S A;  2ZZE A;  2I07 B;  3EFX D;  4KLK A;  3V05 A;  3M85 A;  3L0O A;  1VQC A;  3G4S B;  2V7W A;  2NVX H;  1BPL A;  1ZM3 A;  1I3Q B;  1MHW C;  3PV0 A;  2F52 A;  4Y52 H;  1HZC A;  3NTH A;  1EQT A;  5EGT A;  4QGU A;  2I5M X;  2QEX B;  1R5O A;  1ROD A;  4IUR A;  1OB2 A;  1M4V A;  1OGI A;  3S9W A;  2L4N A;  1KNE A;  1D8L A;  4KD3 A;  3A8K E;  3JU4 A;  2JP1 A;  1S72 A;  3FPP A;  1Y14 B;  4GKJ L;  3NEM A;  1PXU A;  3KLR A;  3K0Y A;  3OP1 A;  4A3D G;  1FND A;  2CWP A;  5I9P A;  3ULP A;  4DV7 L;  3QOJ A;  3W5H A;  3GTK B;  2ZBU A;  4IUV A;  4LUZ A;  1V1P B;  5FIU A;  5ELB A;  1J8I A;  1Q7Y C;  4ZGN B;  3L3O C;  2ZTD A;  1VMC A;  3KLS X;  3HOX B;  1X3E A;  3A8I A;  2O5J C;  1OXT A;  3UDF A;  3U2Q A;  3EIV A;  1GXD C;  1FNB A;  1PRT C;  2A1A A;  2MP1 A;  2WB1 E;  3ITP A;  3CQZ H;  4DV1 Q;  4LFC Q;  2QTL A;  1LTS D;  2VZA A;  3CW2 C;  3K8A A;  1NB9 A;  2QMU A;  1NMF A;  2Z6B D;  1FGU A;  1Q46 A;  4M4S A;  1Z9F A;  5C4J B;  1E63 A;  3CCJ B;  3OZV A;  4B3X A;  1LTA D;  3PVD A;  5C0X I;  2F4N A;  2EY6 A;  2TSS A;  4LC0 A;  2K28 A;  4RMF A;  4C56 C;  4OX9 Q;  4OWX B;  1ET9 A;  5JEA H;  3CCM B;  5EAY A;  4DUY L;  4H9G A;  1LAC A;  3HOU G;  4XLC A;  1PFB A;  5JEA G;  5T1I A;  2OTJ B;  4HCS A;  4M1U B;  5LMZ A;  3I4M B;  4PNY A;  3Q23 A;  4BBS H;  4IUU A;  3PSI A;  5TV2 A;  1WOO A;  5EQ0 A;  2XNA C;  3SK8 A;  2AWO A;  2E2J B;  3W2H A;  1ZM2 A;  1PRT B;  1R4P B;  4NPS A;  3BY1 A;  2OWO A;  1QUE A;  4RJL A;  1U4P A;  2ZT9 C;  2ZJR A;  4X7F A;  1B70 B;  1IHZ A;  4B3T L;  4JK1 C;  1IBM L;  1KZL A;  3AVW A;  4ZGQ B;  4B3F X;  2NB0 A;  3CME B;  2B2T C;  4QY7 A;  5C44 G;  3CMA A;  1DDG A;  3OFN A;  5BR8 Q;  1QX4 A;  1WCM B;  2V7X A;  1WTH D;  2Z8L A;  4NKL A;  1U0L A;  2VS1 A;  2K5N A;  2KJX A;  3LWU A;  4Z1M A;  3MC0 B;  5HGT A;  1XNQ L;  4X65 L;  1FNC A;  3KLS A;  5H59 A;  5JVH 3;  3IL8 A;  1BBW A;  3DHQ A;  4X62 L;  1RKN A;  2E5L Q;  4QCL A;  4IZ8 A;  2A68 C;  1KRT A;  1LT5 D;  3RZD B;  1Q82 C;  3OMG A;  1VJS A;  1ZM4 A;  2HCJ B;  5GAD C;  1GHK A;  4AH6 A;  5ISR A;  4CQJ A;  3Q6R A;  3K7U C;  1IBK Q;  3OJW A;  2XRQ D;  2GVA A;  2WB1 B;  3ZYY X;  1AFP A;  2GJP A;  2ID0 A;  3F2U A;  4DV2 L;  3SKB A;  1L0Y B;  3GV6 A;  2DN8 A;  3KK7 A;  2VUM B;  2NVT B;  1HH2 P;  1OGJ A;  1B53 A;  1YJN B;  4XXE A;  2JA7 G;  3OTO Q;  1CKO A;  3WNC A;  3BNW A;  1NJI C;  4FF2 A;  4II2 A;  4WZE A;  3CC7 A;  4WZT A;  1Y1W B;  3AGP A;  3R2I A;  4QB4 A;  4A3I G;  4QUZ A;  5BSX A;  1EWY A;  1CK1 A;  1D1K A;  3I70 A;  3ASR A;  5C4X B;  1TLL A;  2R6H A;  3VR3 A;  4DGZ A;  4AYB G;  2WZP P;  4RG1 A;  4P26 A;  4BWG B;  1A0I A;  4BBR B;  1QIL A;  1S40 A;  3HAG A;  1JE4 A;  4GN3 B;  3G71 B;  2F3V A;  1FGB D;  1K9M C;  3PQI A;  3HS0 C;  5HKK A;  1STE A;  5EPJ A;  4HMJ A;  1RTO A;  1LT4 D;  4L6T B;  2VQE Q;  3TRZ A;  5NUC A;  4B4D A;  4B3S Q;  2JN9 A;  3ZZU A;  4BPR A;  2F0P A;  2JA9 A;  1TWG B;  2H4O A;  4AIM A;  2PO4 A;  2XOK A;  1VQL B;  2UUC Q;  4FF4 A;  4QVA A;  4ZCK A;  3HEJ A;  4C3J G;  3WY9 A;  1ICW A;  2F0D A;  3OWF A;  4ZKB B;  5J22 A;  1LTT D;  5FK9 C;  4JOI C;  3DMU A;  1V1Q A;  3RN2 A;  2X6W A;  1T6X A;  2RHS B;  3TEH B;  3VR6 A;  3CC4 B;  2VNU D;  1TR5 A;  4WZL A;  4KN4 C;  3S16 H;  3CRK C;  2X0K A;  2NN6 I;  2FHT A;  4K0K L;  4Z9C B;  3F2B A;  4AVZ A;  4AQY L;  1SKQ A;  3FP9 A;  5FLX E;  1EYC A;  4CJ2 C;  1SE3 A;  4P2N A;  5D3D A;  2VNI A;  2MPM A;  4P2C B;  2D0O A;  2E2I B;  2QA4 A;  3E1Y E;  4TMW A;  1FL0 A;  5J3O A;  4IUT A;  4OIJ A;  3KEW A;  5AJ3 L;  3CCS A;  2OQK A;  1LV9 A;  3I7F A;  2YU9 B;  4A3M G;  1OB5 A;  2JEB I;  2K75 A;  5FLM G;  2PIA A;  1DOK A;  2CVR A;  2KHS A;  2GJR A;  4R8N A;  3DEP A;  5IYQ A;  4IOA A;  4C3I G;  2F0N A;  3SXH A;  3T1H L;  1NJI D;  2RF4 A;  1QZG A;  2RBM A;  3I1F A;  1ENA A;  1PZK D;  4DAP A;  4QUC A;  4GOP C;  1VCI A;  3SR1 A;  4FXK C;  1VLY A;  2UU9 L;  3GTQ B;  3M9B A;  5LL6 S;  1AZP A;  2JJ2 A;  1Q81 D;  3K5M A;  4JI2 L;  1L1O A;  4MTN A;  4K2L A;  2JA6 G;  5TR9 A;  1EY9 A;  2VL6 A;  1I8D A;  1IXR A;  4MHE A;  3PIP A;  2M9V A;  3GTJ H;  1EUJ A;  5ELD A;  1LT6 D;  4N9T A;  2DNE A;  2NVY H;  1SRO A;  2ZZQ A;  1KC8 C;  1SYB A;  4K6D A;  1Q81 C;  1HRJ A;  1HQR D;  3NXW A;  1TWH H;  1EU4 A;  3E6Z X;  3IFT A;  5ELF A;  3S15 H;  1CNE A;  3S16 B;  4P71 A;  2Z0S A;  3LNN A;  2C77 A;  1B3Q A;  1VQE A;  4U9U A;  4Z4Y A;  4UPA A;  4KN7 C;  3VYT A;  4UP8 A;  1FJG Q;  1VQO B;  3V76 A;  4ASU A;  2JQO A;  4X3U A;  1VQK A;  1EYA A;  4MN3 A;  1VQB A;  3BVG A;  1VQO A;  4I65 A;  3KDF A;  1J6Q A;  1EEF D;  2GK6 A;  1WU8 A;  1EYD A;  4DV5 Q;  2YYZ A;  3I4M G;  2Q6O A;  4HJ5 A;  2D74 A;  2A6E C;  3VYR A;  1DOM A;  4RWS C;  3DWA A;  3S2D H;  3NWS A;  2E2I H;  2M5S A;  3CCM A;  1K8A D;  3V96 A;  3CQZ B;  2C4U A;  1J5E Q;  2Q2I A;  4BY7 B;  1AN8 A;  2Z6B A;  5C6A A;  3ERO A;  1IL2 A;  1VMP A;  4HMI A;  4A4I A;  3K6O A;  5DM6 3;  4FN5 A;  1PJ5 A;  2BCO A;  5IYC H;  4JBK A;  1WCM G;  1UMK A;  3CRL C;  1IL8 A;  3AEV A;  1TUI A;  3FHW A;  3OMC A;  1JB9 A;  1WD1 A;  3ZZT A;  1N36 L;  4ACB A;  5HXB A;  2PW5 A;  4A3K G;  3PUM A;  4C3H H;  3KFU A;  3EN2 A;  4M8A A;  2C4T A;  1S5D D;  1E2V A;  4CDC C;  2GN5 A;  4LK1 C;  3I90 A;  4X66 L;  1D7Q A;  4XN3 A;  3HOW B;  1W6J A;  4LF8 L;  3J81 L;  4IFD J;  1SKY B;  2KHJ A;  4L5T A;  1PH8 A;  3OWE B;  4IOC A;  4HIK A;  4APV A;  1YIJ B;  3J80 c;  3D4W A;  2HUG A;  4DQL A;  2PYK A;  3DM3 A;  5JOB A;  2IX3 A;  2QW7 A;  1SND A;  3CCQ A;  4NNJ A;  3W2G A;  4BXX H;  1DAR A;  4C2M B;  1YI2 B;  1QCB D;  1QB5 D;  2K33 A;  1ELO A;  2DET A;  4QMG A;  2O2L D;  1VQ8 B;  4ROX A;  5FO9 B;  4LF6 L;  3Q0A A;  2AUJ D;  4PMW A;  4ZCL A;  2AQ1 B;  4LF5 Q;  4HIO A;  4U68 A;  3X3M A;  1YEZ A;  2K01 A;  4X7D A;  3SLN A;  5HZB A;  1ZEQ X;  1F9P A;  4QL5 A;  5C0X H;  1IW7 D;  1KK0 A;  4RM0 A;  1KAA A;  2L0C A;  3KLW A;  3H15 A;  5LMU Q;  4B9W A;  2VQF L;  4ILW A;  1X54 A;  1V9P A;  4G7W A;  4BA1 I;  5HY6 A;  1NCV A;  5IYB H;  1T9H A;  3WND A;  1YNN C;  1AW7 A;  3C3L A;  1AZQ A;  3GV3 A;  4GNX C;  4CDE C;  1IJE A;  1STG A;  5GAH C;  2B2W C;  1V5V A;  1Z47 A;  1KQS A;  3RY8 A;  1R5N A;  3A74 A;  1MSH A;  2IW3 A;  1BKB A;  2RDG A;  2MO1 A;  2VB3 X;  3MAQ A;  1V43 A;  4DN4 M;  4GLV B;  2UXB L;  1B9N A;  1U4L A;  3VO1 A;  3BQJ A;  4YHB A;  2IJ0 A;  4R71 A;  2B3G A;  1T5X D;  3MWY W;  3EQL C;  1VQ8 A;  3VR4 A;  5CMD A;  4HN7 A;  4I7Z C;  1E2W A;  1HNW L;  4QV2 A;  2BGI A;  1K9M D;  3A56 A;  4C3I B;  2L55 A;  3J80 L;  1L0X B;  1M1K C;  3CCS B;  1F2Y A;  3P1H A;  1BJK A;  3AU7 A;  4G7H C;  2RSN A;  3F8T A;  1IBM Q;  1I50 B;  4ZRZ A;  1Y1V B;  3D6W A;  2EY1 A;  4RD3 A;  4V19 0;  1STH A;  4RD2 A;  2D0P A;  2LXJ A;  1F2M A;  5J39 A;  5LMN Q;  1LT3 D;  4KJN A;  1SAP A;  4TMX A;  4DXF A;  3KL9 A;  4TMV A;  4FK8 A;  1EOV A;  1TWC B;  3MXN B;  3T56 B;  3C2P A;  2KCT A;  3A8I E;  2EYH A;  2EPB A;  1SYE A;  1FDR A;  1ILQ A;  1XNR Q;  4DXG A;  2BF4 A;  1CUK A;  3GTK H;  2ZXO A;  1OO9 B;  3BU2 A;  4LAA A;  2CC2 A;  3M3Y B;  1E3P A;  2PPB C;  4OPS A;  4ZCM A;  1HA6 A;  1YIT B;  5AN9 A;  3HKS A;  2B39 A;  2PZT A;  4B3T Q;  2NVQ B;  1XJV A;  3S14 B;  2V7Q A;  4G1B A;  3PO2 H;  4O42 A;  3RMH A;  5TY0 A;  2B7C A;  2BMW A;  1BQQ T;  1PYW D;  1CA5 A;  2BH2 A;  1T6Z A;  3H3V I;  3QG1 A;  2GK7 A;  2AMC B;  4PMB A;  1CTM A;  3VA5 A;  3I2Z A;  4X64 L;  2A69 C;  1W2B B;  4LF6 Q;  5JPM C;  4X62 Q;  2VW9 A;  1WTX A;  4RPB A;  3E3X A;  4LBV A;  3U50 C;  1UE6 A;  5IYP A;  2PI2 A;  3C2Q A;  3S1M H;  3ASQ A;  4JW0 A;  3U6K A;  3J7A V;  3CC7 B;  4B44 A;  3M4P A;  4KKT A;  3U4Z A;  1S4Z A;  1F20 A;  2VQF Q;  4BY7 G;  4X7C A;  2NN6 G;  1VHE A;  2DJG C;  1TXY A;  2DUD A;  3AQQ A;  3P26 A;  5I2Y A;  1G7C A;  2I46 A;  2EIF A;  5COR A;  4B3S L;  4OOX A;  2NN6 H;  4HE5 A;  3MVV A;  5C44 B;  1GAQ A;  1UE5 A;  1LLR D;  2F0L A;  2ZM6 L;  5GV8 A;  4H44 C;  4A3J H;  4IUP A;  5KW9 A;  5G3L D;  3W1B A;  3CCL A;  4AF7 A;  2K50 A;  1TKW B;  2HIX A;  4IO9 A;  5EKI A;  2LSS A;  1HR0 L;  3KYH C;  4RDL A;  3NPP A;  1CA6 A;  4M0L A;  4JI5 Q;  4HIZ A;  3PO2 B;  4PZ7 A;  3RZD H;  4NB3 A;  1TVX A;  4KKU A;  3OEE A;  3I55 A;  3A55 A;  1Z7T A;  1PH2 A;  2QTZ A;  3EBE A;  4K6L A;  3I4N G;  3OZU A;  4E0F A;  3EA6 A;  1W2B A;  5FLM H;  4A3G G;  4XON A;  3X3N A;  2CCZ A;  2EOT A;  5IY0 A;  1ZYR D;  4C3I H;  4F7D A;  3G05 A;  3ERQ A;  2VUM G;  3PF5 A;  2ZTN A;  2NVQ H;  1DM0 B;  1STA A;  2ZL5 A;  3TP6 A;  1E0B A;  1VQ5 B;  3T4A C;  2R92 B;  5EMN A;  1WD0 A;  4NCN A;  1ESF A;  2B2Y A;  3HRZ C;  3H91 A;  4MNO A;  2R93 H;  1KXL A;  3A54 A;  3K5L A;  1SR3 A;  4RD4 A;  4P3I A;  3BYT B;  4TMT A;  4QQB X;  1YZ6 A;  1YHA A;  1MGS A;  5IT9 L;  1WDT A;  4XQN A;  1D8T A;  1TWA H;  3PA1 A;  2XZP A;  3D8G A;  3I4O A;  3Q22 A;  1BOS A;  1XB2 A;  2EJM A;  1Y8N B;  1YHB A;  4OOV A;  2EXZ A;  4U67 3;  3HOY B;  3A1P A;  3I91 A;  2YV5 A;  2B63 G;  2IHF A;  2JSO A;  2NZ1 D;  3OW7 A;  1H85 A;  2DNC A;  1TII D;  1UEA B;  2MUY A;  2K5H A;  1I6V C;  4K5X A;  3WBJ A;  4DR4 L;  1TS5 A;  2M2L A;  1VQG A;  2ZL6 A;  1I3Q H;  5KND A;  1EFW A;  3VO2 A;  4A3L G;  4A3C H;  3TSS A;  3BDC A;  5G3L F;  1BXT A;  5I9O A;  3TRE A;  2DEU A;  1KDB A;  2OK8 A;  4GKK Q;  2XEX A;  5TSS A;  4K1X A;  4LF8 Q;  2PQA B;  3STB C;  4YY3 Q;  1W0K A;  4DUZ Q;  1WOR A;  2YTX A;  1EQQ A;  2F4V L;  4POG A;  1EWH A;  2RDH A;  1KDA A;  1X65 A;  4OO1 I;  2MJ8 A;  3JAM E;  1TU2 B;  5C4H A;  1AE3 A;  1GVP A;  4H02 A;  2RC6 A;  1A3T A;  1Y1V G;  2EYM A;  3QFR A;  3CP8 A;  1JWM D;  4AF6 A;  4FYD A;  3VR2 A;  3DEO A;  4IPH A;  4FVM A;  4DV7 Q;  2LKV A;  1GJX A;  2VY3 A;  2JA8 B;  4Q0F A;  1HNZ L;  4A3E G;  5FO1 A;  3CES A;  4PAB A;  3E20 A;  2LMC B;  4ME5 A;  3SK4 A;  3TP7 A;  5IWA Q;  4DR5 L;  4LBY A;  1II3 A;  1VQM B;  1WOC A;  3G4S A;  1RL2 A;  4ZAI A;  3DXJ C;  2B2V C;  1NY4 A;  1H9R A;  2R7F A;  5KGU A;  1E79 A;  3ND9 A;  5IYW A;  5A2Q L;  1IB0 A;  3BS1 A;  3CCL B;  1ENC A;  1SE4 A;  5C3W A;  4FXG C;  3G6J B;  3R8B A;  4HJ8 A;  1K83 B;  2IPK D;  4G7X A;  2ZXH A;  4KKS A;  4DNI A;  2OF1 A;  3D6C A;  4II3 A;  1EOT A;  1GUW A;  4GQN A;  1A3V A;  2MFI A;  4CJ0 B;  1UAP A;  4CKB A;  2CRV A;  5M5Y H;  3H3V C;  4O2D A;  1EIG A;  2JA6 B;  4A3D H;  1UD4 A;  5ELN A;  3KJO A;  4RA8 A;  5CV8 A;  4JI4 Q;  1HNW Q;  4LMQ D;  1FNM A;  3CMA B;  2K32 A;  1DDI A;  3OJX A;  1YLO A;  5GRO A;  3S1Q B;  2WZN A;  2JEA I;  4JV5 L;  2B2W A;  3ASS A;  1QNU A;  3OW2 A;  3M4Q A;  1HR0 W;  1R9T B;  3H94 A;  4DAM A;  5GV7 A;  4UAI A;  4G5G A;  2NBF A;  3Q6Q A;  1N8R C;  3HKZ E;  4LNQ A;  5IGB A;  4Y7N B;  1HJP A;  5GAE C;  4DR1 Q;  3NTI A;  1SNQ A;  2CW0 C;  1N36 Q;  3GO5 A;  4GOP A;  4ZV4 A;  1S72 B;  4QJF A;  2F03 A;  5DM7 3;  1K0R A;  3QSY A;  5LMN L;  5M5X B;  4CKE A;  2WJY A;  1QWY A;  2L5T A;  1XPU A;  2RVL A;  1FVI A;  2IT1 A;  4PC2 A;  1TTT A;  2OT2 A;  3DDY A;  3M4Y A;  1C0A A;  1HQM C;  2ZXP A;  4LFA L;  3SJP A;  3ZUG A;  2XND A;  1VQP A;  5E4X A;  1G29 1;  5M3M H;  3B82 A;  3H0G H;  2HIV A;  4OEL B;  2J7K A;  1YJW B;  3STB D;  3I4N B;  1E3Z A;  2VJJ A;  4GN5 A;  1ZXT A;  3CCR A;  5DS0 A;  1DJR D;  1NBM A;  3KOJ A;  5AFW A;  4OGQ C;  1QVG A;  3ES9 A;  1PJ6 A;  2F3I A;  1B7Y B;  1EFR A;  5IGE A;  3TME A;  4J0Q A;  5M3F G;  1EYG A;  1JR0 D;  1HUM A;  2IX0 A;  3LQE A;  2RC5 A;  2DY1 A;  1EY7 A;  2CQA A;  3JAM L;  1PYS B;  3S1N H;  5JAV A;  1QJO A;  3TP8 A;  4XR6 A;  1HNZ Q;  3S17 B;  4C0S A;  1SLJ A;  4RPD A;  4XMY A;  4J8Q A;  1QFZ A;  2OBR A;  1TS2 A;  2B8G A;  4OOS A;  1STN A;  2PI2 E;  2L12 A;  3CCV A;  1W34 A;  2NV4 A;  4XIG S;  3ZBT A;  1VS0 A;  4YAW A;  2JYO A;  4JC0 A;  1EIY B;  1WTQ A;  1B8A A;  1N33 Q;  3WQZ A;  3HOY G;  1ET6 A;  3W5O A;  5CC4 A;  5IOD A;  3MMP A;  3M7N A;  4LFC L;  1D1N A;  3BC9 A;  3JAM i;  5M9O A;  2X3U A;  4M2L A;  3HOY H;  2HLD A;  5M5X H;  4DR2 L;  4JI0 Q;  5JJZ A;  5IP9 H;  1W87 A;  1N34 Q;  3TQY A;  1VF5 C;  1JCK B;  5FO0 A;  1I5F A;  2N49 A;  5IP9 G;  4M53 A;  2P5Z X;  3HOX H;  1UD6 A;  2F0U A;  4KD4 A;  4XOR A;  3OHX C;  2KUM A;  3MXU A;  3CCV B;  4DA2 A;  2IWH A;  1KL9 A;  1IHM A;  3GVJ A;  2Y0S B;  4ODG A;  1GUO A;  3CP0 A;  4FXD A;  1SYD A;  5IGG A;  2WKD A;  1RTN A;  1TVC A;  4DNR B;  1SYC A;  3UI2 A;  4HID A;  3U4V A;  3NTK A;  1MBY A;  1A2T A;  3IRB A;  2OTJ A;  1HXY D;  4DR1 L;  4BY7 H;  2Q2H A;  5EKK A;  2C5B A;  1RDP D;  1T5E A;  3T1Y Q;  4A3B G;  3CXC B;  4YWK A;  5IOC A;  4GNX B;  2R6G A;  3QJY A;  4RHS A;  2F4I A;  3T1H Q;  2ZZG A;  4A3B H;  3AVV A;  1UD5 A;  4L5Q A;  3S1R H;  2VNH A;  4F87 A;  4WQM A;  1C48 A;  2D2C C;  1TWA B;  1BF4 A;  2EYJ A;  4YHH Q;  4A75 A;  4HAE A;  4DR3 L;  4LF4 Q;  1EEI D;  2K14 A;  4ZKC B;  3PIP 3;  1CM9 A;  4YCV A;  1N8R D;  1N08 A;  4JBJ A;  1SN8 A;  3A7L A;  4NW2 A;  2ZJQ A;  2JE6 I;  1FNU A;  5M3M B;  2E2D C;  3TN2 A;  4DKA C;  4DR7 Q;  3SLD A;  1NDH A;  2B7B A;  3T53 B;  3FKS A;  1W9X A;  1DCZ A;  1ICF B;  5JBQ A;  1IBK L;  5LMN W;  1NBW A;  1SNC A;  4EQN A;  2OTL A;  1JE5 A;  2PNR C;  2YWG A;  3AVX A;  2QIL A;  4B47 A;  2NVT H;  2VUM H;  1KLG D;  3S1M B;  1G7S A;  2C9O A;  2Q6L A;  1KNA A;  4KJO A;  2JJ1 A;  4A93 H;  2C5H A;  2FMM A;  4G4K A;  5IP7 G;  3Q38 A;  1FRQ A;  5D14 A;  2CFM A;  1JOR A;  5FO8 B;  3K57 A;  1PH7 A;  5JEA J;  4X0C A;  4A93 G;  2WP8 J;  4LWC A;  2IX1 A;  3CCE A;  5DNF A;  1TY0 A;  4LF9 Q;  2N88 A;  5THX A;  4NMZ A;  5EJW A;  3I72 A;  3Q6S A;  1N06 A;  1EP2 B;  2A68 D;  2RCF A;  1R9T H;  2UU9 Q;  2B5O A;  2HHH L;  2PQA A;  1K73 D;  1NB0 A;  3AFQ A;  3FEW X;  2X8K A;  1J9Z A;  2FIN B;  3N52 A;  1XMQ Q;  5EKL A;  3CC2 B;  1HR0 Q;  3S17 H;  1JJ2 B;  1DYQ A;  1I4H A;  1QVC A;  4UZE A;  3Q8D A;  4OHJ A;  1X3P A;  3NE5 B;  5KYL A;  1V0F A;  1PH4 A;  3GTG B;  2Q6K A;  4RD6 A;  4PGO A;  2FFK B;  3JQQ A;  3U6B A;  3NQT A;  4KHZ A;  2OXP A;  3Q3A A;  4K5W A;  1B2T A;  2QGQ A;  1N0U A;  2C78 A;  5L37 A;  3J81 i;  1AH9 A;  4J6H A;  4YAL A;  3F2C A;  4LUV A;  3K5O A;  3QE2 A;  5CV9 A;  4AYB E;  4R9W A;  4XL9 A;  4P1V A;  4OPO A;  5BN3 A;  2DER A;  1HVX A;  2A5H A;  4ME3 A;  1LTR D;  1YI2 A;  4F7X A;  1QGY A;  3VR5 A;  4XLE A;  1G7T A;  3CCE B;  3PMF A;  5KIX A;  2WIN B;  4DPG A;  5A88 A;  2A74 C;  4JVZ A;  3V2T A;  1P4M A;  3KF8 A;  4A3G B;  4P6Y A;  4LFB Q;  3K80 C;  3R3O A;  5H5J A;  1BBU A;  2K5D A;  2V7U A;  1QVG B;  4DV4 Q;  1QG7 A;  2CBX A;  3C1F A;  2CND A;  2R92 G;  3BZK A;  4CGY B;  3CCR B;  1PTO D;  3IKJ A;  2SNS A;  3OSO A;  1H95 A;  4A3E H;  2E76 C;  4DV6 L;  2ALY B;  5IYC G;  1JIC A;  5H1S E;  4V0B A;  4LF7 Q;  5BR8 L;  1VQP B;  2EYL A;  3OW2 B;  1PTO B;  1F9S A;  1I94 L;  1KK1 A;  2WPD A;  2K52 A;  5BN4 A;  1G6Z A;  3D31 A;  1GUN A;  2E74 C;  5T1G A;  3NEN A;  4XLH A;  2YTV A;  4XQJ A;  2F0V A;  1QH0 A;  1LO5 D;  1KQS B;  1VQ7 B;  2B2U C;  4RGM A;  1ZUN B;  1YNJ D;  5E1F A;  2BM1 A;  2F0K A;  1EZ8 A;  1I50 H;  3FMC A;  1Q8I A;  2N55 A;  1OXU A; 
#chains in the Genus database with same CATH homology
 2W6J A;  2PQE A;  3BDO A;  3GVL A;  3CHB D;  2EJG C;  2K04 A;  4LJZ C;  1F77 A;  1S5C D;  1U4M A;  4QIW B;  2B63 B;  3GQB A;  4GZY C;  2BE5 C;  3TDQ A;  3M4O B;  4KK7 A;  2F0J A;  4CBV A;  1XX8 A;  1OHH A;  1TS4 A;  1M8A A;  3SHL A;  2A6H C;  5FLX L;  2EY2 A;  2F0F A;  3NWT A;  3URY A;  4DAY A;  2AUK A;  4C1N I;  4B08 A;  4RHR A;  4XD7 A;  3J7Y W;  1KMH A;  4KI0 A;  1JWU D;  1QOH A;  1Q1E A;  1G2S A;  3PUY A;  2B2Y C;  2RDF A;  3R2T A;  4H13 C;  2JA5 B;  2J7Z A;  4YXW A;  3MA2 B;  2WAQ B;  3S2D B;  3MXG A;  3PUW A;  4H0L C;  3IFD A;  4QUF A;  1BO0 A;  4K8J A;  2XWJ B;  4RAU C;  1HPC A;  2MHV A;  2AQ2 B;  4TT3 A;  2ENB A;  3K59 A;  3CP2 A;  1EWC A;  3NHH A;  1PFN A;  3HOU B;  2WV6 D;  1D5X C;  2B2V A;  2E2H B;  4C3H B;  3L9A X;  1CQV A;  3NBH A;  2F1M A;  1V8Q A;  2LZJ A;  2X6X A;  5FOB B;  2QE7 A;  2E75 C;  1PDQ A;  5EPL A;  2FJ2 A;  1HCZ A;  2ZXR A;  1LAB A;  2EDG A;  1I6H B;  1HHV A;  3BH4 A;  3GVK A;  1CHP D;  2HDM A;  4HCE A;  1H9K A;  1SXT A;  4H7B A;  1SYF A;  2LS0 1;  1V1O A;  5CBE E;  1GOZ A;  5IGC A;  1RF2 D;  1NAP A;  2XZL A;  2ZZF A;  4ZQ3 A;  4L63 B;  3A35 A;  2TMP A;  2EJF C;  2G9H D;  3GTJ B;  1Q3L A;  2BA0 A;  4X3K A;  1F2L A;  2V31 A;  4G57 A;  1UD8 A;  3HOZ B;  1I4R A;  4XN0 A;  2F0S A;  1HUN A;  4IUN A;  3KBX A;  4BA2 I;  1JC7 A;  4TSS A;  1CHQ D;  2K5Q A;  3MTS A;  1ZYR C;  5C0X J;  4G7O C;  3OEH A;  3L7Z C;  1A6X A;  4FO2 A;  5C5L A;  4KY6 A;  3SEB A;  1WTR A;  4F88 A;  1E2Z A;  4RH6 A;  2D9U A;  2L1B A;  1SMY C;  1D5M C;  2F0E A;  1K8O A;  5C5M A;  4TQU S;  1B9M A;  3QIA A;  2PZW A;  2L9H A;  2X53 S;  3BDL A;  4ZUI A;  1F2Z A;  1IYV A;  1XXG A;  4UZU A;  5KEE A;  1SDF A;  2K1B A;  3SK5 A;  3GP7 A;  1EFI D;  1B50 A;  1LTG D;  4A3B B;  1Y8P B;  3J80 E;  3ND8 A;  4TSF A;  5D3I B;  4KMU C;  4RKL A;  1TQO A;  3AB9 A;  1G91 A;  1EU3 A;  1IW7 C;  1OXV A;  3E0J A;  1IKL A;  1E43 A;  5EBC A;  5CV7 A;  5CYU A;  1SE2 A;  4NDX A;  1HZE A;  1CZW A;  1I4X A;  1VDZ A;  4BY1 B;  4KY7 A;  2K6A A;  2X6L A;  4RGN A;  2A6H D;  3I73 A;  1JOK A;  3GTP B;  1XYI A;  4C3J B;  5FO7 B;  4RGT A;  1JWS D;  2QDB A;  1D2B A;  3BVZ A;  3U9O A;  2RSO A;  1TWH B;  3S15 B;  2KEC A;  4PQX A;  1PLF A;  5E4W C;  2F43 A;  3RD4 A;  5I2X A;  3H09 A;  3PIO 3;  5HUR A;  2D3L A;  2XSC A;  1DXM A;  4ULL A;  2EE1 A;  2B8F A;  1DZ1 A;  1JOQ A;  2NTS A;  5CV5 A;  4XYQ A;  1PKV A;  1D6E C;  1S5E D;  2F0T A;  5JVG 3;  5C0X G;  3FRP B;  2F0O A;  4PMC A;  1Z6H A;  1UD2 A;  2SNM A;  4WFN 3;  1BUV T;  3IAY A;  1JOO A;  4L8J A;  1G2T A;  1YNN D;  1H8E A;  3P20 A;  1EIH A;  1SYG A;  5DAU A;  4FF3 A;  5BN5 A;  5M5Y B;  3D3R A;  2QF7 A;  1C4Q A;  1WTP A;  5IGD A;  1FD7 D;  4DU9 A;  2XWB B;  4K2K A;  2R9V A;  4KY5 A;  3LX0 A;  1UD3 A;  1J9O A;  1NR4 A;  1O80 A;  3HP3 A;  4HSV A;  4IAL A;  4G7Z C;  4XT1 B;  5KNL A;  5JPN C;  2BDN A;  1EY8 A;  1PTO C;  2J0T D;  4ZLT F;  2SEB D;  1Q90 A;  1I4G A;  1NUC A;  3OIP A;  1VF7 A;  3ONA B;  3OIQ A;  1AEX A;  2SOB A;  1TS3 A;  4X3S A;  3HZX A;  3RZO B;  4BS9 A;  3SDZ A;  4DK1 A;  2VB2 X;  3EJI A;  5KNB A;  1H8H A;  3FKI B;  2DIE A;  2LFN A;  3MFG A;  2D3N A;  2QKI C;  3CMM A;  4XOT A;  2O4X A;  3KBG A;  4BBS B;  4XQF A;  2WKC A;  2WSS A;  3AMU A;  1DD2 A;  4ID6 A;  4K5V A;  1S5B D;  5COY A;  1PZJ D;  3H0G B;  3C1E A;  4HTH A;  3M7G A;  3KUP A;  4EQP A;  4C3H G;  3A7A B;  3QO2 A;  3HGB A;  1KAB A;  1SNM A;  4WRD A;  1RCV D;  2RQX A;  1GUS A;  2EYO A;  3SE0 A;  4XLA A;  2R93 B;  2NYZ D;  3SK6 A;  3T16 A;  5D65 A;  1MAB A;  2IL8 A;  2CK3 A;  3EVQ A;  3QOL A;  1IKM A;  2B2T A;  1B1Z A;  1STY A;  1BR9 A;  1HA5 A;  1CI3 M;  3I8Z A;  1E1R A;  3MFY A;  5KYI A;  3TP5 A;  1D5Z C;  1NSN S;  3PUX A;  4DFA A;  3BVM A;  1CZG A;  2AWN A;  2O5I C;  1BLI A;  1IYU A;  1FX0 A;  4HED A;  2KVM A;  1SJE D;  4Q5V A;  1O7Y A;  1EY0 A;  2A69 D;  3I3C A;  1PFM A;  2D62 A;  5CGK A;  1I4Q A;  1LTB D;  5I6W A;  2KCN A;  1U9R A;  1ZKO A;  1SJH D;  1ILP A;  2R7Z B;  1SNP A;  2KED A;  2BE5 D;  2LY7 A;  3NQI A;  4G6I A;  3TBI B;  4C1N K;  4HSP A;  5CV6 A;  3R93 A;  1EQV A;  1KLU D;  5ELC A;  3D4R A;  1RHP A;  1SBB B;  2FMC A;  1V0E A;  1GHJ A;  1WPC A;  5J1Z A;  1R4Q B;  1SSO A;  1WVL A;  3T13 A;  4XM3 A;  4FXU A;  2GA4 B;  1WTO A;  5DN6 A;  1BCP F;  5EBD A;  2EY5 A;  1OXS C;  1CT1 D;  2NVY B;  3J81 E;  3N6R A;  1I4P A;  2WJV A;  1CQF A;  1I18 A;  3GTO B;  1GUG A;  1STB A;  4JMQ A;  2PCF B;  2XVS A;  4A3E B;  5M3F B;  3CU7 A;  4X3T A;  4O1N A;  3VYU A;  1KDC A;  2SDF A;  3A3G A;  4JBW A;  2K5W A;  1FYC A;  3WDN A;  4B3G A;  4A3F B;  2E1B A;  5K36 G;  1JB3 A;  3K58 A;  3HG9 A;  1QE6 A;  2KOL A;  2K03 A;  1LTI D;  5CV4 A;  3A3B A;  1K8M A;  1Q1B A;  1AP0 A;  1B44 D;  4XT3 B;  3OAA A;  1Y8O B;  4EQO A;  4HR7 B;  1HFG A;  2Q8I B;  5A35 A;  3PUZ A;  3PUV A;  3LWE A;  4FF1 A;  1SMY D;  3RLF A;  4UDU C;  1SEB D;  2VXW A;  1X3Q A;  1XWE A;  3DUZ A;  3NK9 A;  4MIU A;  2R3Z A;  4IFD H;  1BBX C;  4B9X A;  2F0I A;  1E1Q A;  1H9J A;  4R8I A;  2BDO A;  4IFD G;  3C46 A;  1TY2 A;  3BCF A;  1PZI D;  2DY7 A;  4RKB A;  3G7L A;  1V1P A;  4DK0 A;  3A8J E;  1NRK A;  3NBI A;  4XKW A;  4XNF A;  2XN9 C;  3OOC A;  2K7V A;  2WAC A;  2HQE A;  1QNK A;  3S1R B;  2J4X A;  3K7A B;  1C8C A;  4A3D B;  3WOE A;  2F0M A;  1GUT A;  1BCP B;  3QWN A;  3MHB A;  1E3X A;  4XKV A;  1SFO B;  1EY6 A;  2BOS A;  4RFB A;  3ZIA A;  4XTC S;  3D4D A;  2Q8T A;  4WOR A;  3W2D A;  2ZXI A;  5IGF A;  2A73 B;  2JDI A;  3E5S A;  1KTK A;  1DON A;  1BMF A;  1H9S A;  1BCP C;  4XYO A;  4XQQ A;  2F3W A;  1PTO H;  4QF4 A;  2JIZ A;  5ELE A;  2AQ3 B;  3P7J A;  2F0H A;  4TKO B;  4IQZ A;  5F2D A;  3H6M A;  3VYS A;  4EVO A;  2MGS A;  2DY8 A;  1B3A A;  2KCC A;  4K14 A;  4IN3 A;  5FL7 A;  2WII B;  3S1N B;  3BZD B;  1HTL D;  3W3A A;  5CBA E;  3GTM B;  3Q24 A;  5M5W B;  2QEJ C;  4F8M A;  2L11 A;  3FDT A;  4A3K B;  1Q12 A;  4RGO S;  3HKZ B;  2ZTG A;  3TZD A;  5C3E B;  4RCN A;  1W6K A;  1MSG A;  3DM1 A;  1O7Z A;  4RCO A;  5IK2 A;  1D1I A;  2NUC A;  3ZPN A;  5E3F A;  3K5N A;  5DEH A;  4DF7 A;  1COW A;  1HTP A;  1MD2 D;  5KNC A;  5LHY 1;  1G8Z D;  2EYF A;  3O13 A;  4TRD A;  2ICE C;  4YIJ A;  2CHB D;  1K28 D;  2RA4 A;  1HFN A;  3MXP A;  3RUZ A;  1F9R A;  5CR3 A;  3BYY B;  2KQ3 A;  4YEJ A;  2X6Y A;  1RJT A;  1F9Q A;  1NR2 A;  4XOP A;  1SNO A;  1PTO F;  2X6G A;  2NVX B;  4A93 B;  2OEO A;  3GTL B;  1BDO A;  2F0Q A;  1U4R A;  1B4O A;  2PW7 A;  2EYP A;  4FNF A;  3DWP A;  1W0J A;  3QB3 A;  4CHT B;  4CKC A;  2NWG A;  1UUP A;  5IIF A;  4E6I A;  2CW0 D;  4IUQ A;  3SVM A;  4YEL A;  1A15 A;  2Z1C A;  1O78 A;  2C5C A;  2HDL A;  2KA7 A;  5A2Q E;  4XLF A;  4A3M B;  2M00 A;  4K8I A;  3OPO A;  1TWF B;  2KEE A;  1BCP D;  1X32 A;  2B2U A;  3HOV B;  4KV6 A;  4ZUJ A;  2KVO A;  3VA7 A;  1FR3 A;  2V4D A;  1FNW A;  4ABN A;  2H1E A;  5CDF A;  2VJI A;  3MZ5 A;  5LL6 X;  2RKS A;  3S2H B;  1MI2 A;  4KHV A;  4OO1 G;  1PRT D;  5K36 H;  4DNT B;  4OO1 H;  5I6Y A;  1XTC D;  1O7L A;  2A6E D;  3GD7 A;  4J1M A;  3MXN A;  1EY4 A;  4P22 A;  2Z4H A;  3TZU A;  2X85 A;  3WOF A;  1DOL A;  3OE7 A;  1WP6 A;  1YNJ C;  2JXM B;  2Z4I A;  3BG3 A;  3J7A F;  4FP5 D;  5EPK A;  1A3U A;  4XDX A;  1OB0 A;  1H9M A;  4OIK A;  1CFM A;  1S5F D;  2XGJ A;  3MEH A;  3I4L A;  5FKA C;  2R61 A;  2D5D A;  4IFD I;  4KTA A;  2JA7 B;  3DWQ A;  3NUC A;  1WTV A;  3FPU B;  3U9S A;  5C4Z A;  3PO3 B;  2HCC A;  2BA1 A;  2XIW A;  1ENF A;  5K5P A;  4EGV A;  3P75 A;  1BNZ A;  2F0G A;  3BCD A;  1JQY D;  1ONL A;  1EY5 A;  5KRU A;  1FNV A;  1PMR A;  2K05 A;  2F0W A;  2XRS D;  1ESR A;  1EZ6 A;  5I4D A;  4A3J B;  1EL0 A;  4A3I B;  5C3X A;  4N9P A;  4PV1 C;  4DAV A;  2W6I A;  1PRT F;  1UNS A;  2GJK A;  2G9D A;  1Y69 U;  3FVQ A;  1A2U A;  4AYB B;  2QCP X;  2ICI A;  2HCI A;  1RD9 D;  4CJ1 B;  3NP8 A;  4ZYS A;  2EZV A;  4NP5 A;  3T51 B;  1H9S B;  2NTT A;  2PZU A;  2XZO A;  3NSW A;  4OL7 A;  1TT2 A;  1ML0 D;  2X69 A;  2PMZ B;  2Q8R E;  1OXX K;  2EVB A;  4ZK9 B;  3CKI B;  1WTW A;  4WJW A;  4S3S A;  2ZZE A;  2I07 B;  3EFX D;  3V05 A;  3M85 A;  1BPL A;  1I3Q B;  3PV0 A;  3NTH A;  1EQT A;  5EGT A;  4IUR A;  1ROD A;  1M4V A;  3S9W A;  2L4N A;  1KNE A;  4KD3 A;  3A8K E;  3JU4 A;  2JP1 A;  3FPP A;  1PXU A;  3KLR A;  3K0Y A;  5I9P A;  3QOJ A;  3GTK B;  4IUV A;  1V1P B;  5ELB A;  1J8I A;  3L3O C;  1VMC A;  3KLS X;  3HOX B;  2O5J C;  1OXT A;  1GXD C;  1PRT C;  2MP1 A;  3ITP A;  1LTS D;  2Z6B D;  5C4J B;  1LTA D;  5C0X I;  2EY6 A;  2TSS A;  2K28 A;  4C56 C;  1ET9 A;  5JEA H;  1LAC A;  4XLC A;  1PFB A;  5JEA G;  5T1I A;  4HCS A;  4M1U B;  3I4M B;  4PNY A;  3Q23 A;  4IUU A;  3SK8 A;  5EQ0 A;  2XNA C;  2AWO A;  2E2J B;  1R4P B;  1PRT B;  1U4P A;  2ZT9 C;  1IHZ A;  4JK1 C;  1KZL A;  4B3F X;  2NB0 A;  2B2T C;  3OFN A;  1WCM B;  1WTH D;  2Z8L A;  4NKL A;  2KJX A;  3LWU A;  4Z1M A;  3MC0 B;  5HGT A;  3KLS A;  5JVH 3;  3IL8 A;  3DHQ A;  1RKN A;  4QCL A;  4IZ8 A;  2A68 C;  1LT5 D;  3RZD B;  3OMG A;  1VJS A;  1GHK A;  5ISR A;  2XRQ D;  2WB1 B;  3ZYY X;  1AFP A;  2GJP A;  2ID0 A;  3F2U A;  1L0Y B;  3GV6 A;  2DN8 A;  3KK7 A;  2VUM B;  2NVT B;  1B53 A;  4XXE A;  4FF2 A;  4II2 A;  1Y1W B;  3R2I A;  4QB4 A;  1CK1 A;  1D1K A;  3I70 A;  5C4X B;  3VR3 A;  4DGZ A;  2WZP P;  4BWG B;  4BBR B;  1QIL A;  3HAG A;  1JE4 A;  2F3V A;  1FGB D;  3HS0 C;  5HKK A;  1STE A;  5EPJ A;  4HMJ A;  1RTO A;  1LT4 D;  4L6T B;  5NUC A;  2F0P A;  1TWG B;  2H4O A;  2PO4 A;  2XOK A;  4FF4 A;  3HEJ A;  4C3J G;  1ICW A;  2F0D A;  3OWF A;  4ZKB B;  5J22 A;  1LTT D;  5FK9 C;  3DMU A;  2X6W A;  3VR6 A;  2VNU D;  1TR5 A;  4KN4 C;  3CRK C;  2NN6 I;  2FHT A;  4Z9C B;  4AVZ A;  5FLX E;  1EYC A;  4CJ2 C;  1SE3 A;  5D3D A;  2MPM A;  4P2C B;  2E2I B;  4IUT A;  4OIJ A;  3KEW A;  1LV9 A;  2YU9 B;  2JEB I;  1DOK A;  2CVR A;  2KHS A;  2GJR A;  4R8N A;  3DEP A;  4C3I G;  2F0N A;  3SXH A;  2RBM A;  4DAP A;  1ENA A;  1PZK D;  4QUC A;  1VCI A;  3SR1 A;  4FXK C;  1VLY A;  3GTQ B;  5LL6 S;  1AZP A;  2JJ2 A;  3K5M A;  4K2L A;  1EY9 A;  1I8D A;  4MHE A;  2M9V A;  5ELD A;  1LT6 D;  4N9T A;  2DNE A;  2ZZQ A;  1SYB A;  4K6D A;  1HRJ A;  1HQR D;  3NXW A;  1EU4 A;  3E6Z X;  3IFT A;  5ELF A;  3S16 B;  3LNN A;  4KN7 C;  3VYT A;  4ASU A;  4X3U A;  1EYA A;  4MN3 A;  3BVG A;  4I65 A;  1EEF D;  2GK6 A;  1EYD A;  2YYZ A;  2A6E C;  3VYR A;  1DOM A;  4RWS C;  3DWA A;  3NWS A;  2M5S A;  4BY7 B;  3V96 A;  3CQZ B;  1AN8 A;  5C6A A;  3ERO A;  1VMP A;  4HMI A;  3K6O A;  5DM6 3;  2BCO A;  3CRL C;  1IL8 A;  3OMC A;  1WD1 A;  2PW5 A;  4M8A A;  1S5D D;  1E2V A;  4LK1 C;  3I90 A;  4XN3 A;  3HOW B;  1W6J A;  4IFD J;  3J81 L;  1SKY B;  3OWE B;  3D4W A;  2HUG A;  5JOB A;  2PYK A;  2IX3 A;  1SND A;  4NNJ A;  4C2M B;  1QCB D;  1QB5 D;  2K33 A;  4QMG A;  2O2L D;  5FO9 B;  3Q0A A;  2AUJ D;  4PMW A;  2AQ1 B;  4U68 A;  3X3M A;  2K01 A;  1ZEQ X;  1F9P A;  5C0X H;  1IW7 D;  1KAA A;  2L0C A;  4B9W A;  4ILW A;  4G7W A;  4BA1 I;  1NCV A;  1YNN C;  1AW7 A;  3C3L A;  1AZQ A;  3GV3 A;  1STG A;  2B2W C;  1Z47 A;  1MSH A;  2IW3 A;  2RDG A;  2VB3 X;  3MAQ A;  1V43 A;  4DN4 M;  1B9N A;  1U4L A;  2IJ0 A;  1T5X D;  3MWY W;  3EQL C;  3VR4 A;  5CMD A;  4HN7 A;  4I7Z C;  1E2W A;  3A56 A;  4C3I B;  2L55 A;  3J80 L;  1L0X B;  1F2Y A;  3P1H A;  3AU7 A;  4G7H C;  2RSN A;  1I50 B;  4ZRZ A;  1Y1V B;  3D6W A;  2EY1 A;  4V19 0;  1STH A;  5IT9 E;  1F2M A;  5J39 A;  1LT3 D;  4KJN A;  1SAP A;  4DXF A;  1TWC B;  3T56 B;  3C2P A;  3A8I E;  2EYH A;  2EPB A;  1SYE A;  1ILQ A;  4DXG A;  2ZXO A;  1OO9 B;  4LAA A;  3M3Y B;  2PPB C;  1HA6 A;  2B39 A;  2PZT A;  2NVQ B;  3S14 B;  2V7Q A;  4O42 A;  3RMH A;  1BQQ T;  1PYW D;  1CA5 A;  3QG1 A;  2GK7 A;  4PMB A;  1CTM A;  3VA5 A;  2A69 C;  5JPM C;  1WTX A;  3J7A V;  4KKT A;  1S4Z A;  2NN6 G;  5I2Y A;  2I46 A;  5COR A;  2NN6 H;  3MVV A;  5C44 B;  1LLR D;  2F0L A;  4H44 C;  4IUP A;  5G3L D;  1TKW B;  5EKI A;  3NPP A;  1CA6 A;  4HIZ A;  3PO2 B;  1TVX A;  4KKU A;  3OEE A;  3A55 A;  1Z7T A;  4K6L A;  4E0F A;  3EA6 A;  4XON A;  3X3N A;  2EOT A;  1ZYR D;  3G05 A;  3ERQ A;  2ZTN A;  1DM0 B;  1STA A;  3TP6 A;  1E0B A;  3T4A C;  2R92 B;  1WD0 A;  1ESF A;  2B2Y A;  3HRZ C;  3H91 A;  3A54 A;  3K5L A;  3BYT B;  1MGS A;  5IT9 L;  4XQN A;  3Q22 A;  2XZP A;  3D8G A;  1BOS A;  2EJM A;  1Y8N B;  2EXZ A;  4U67 3;  3HOY B;  3I91 A;  2JSO A;  2NZ1 D;  3OW7 A;  2DNC A;  1TII D;  1UEA B;  2MUY A;  1I6V C;  4K5X A;  1TS5 A;  2M2L A;  5KND A;  3TSS A;  3BDC A;  5G3L F;  1BXT A;  5I9O A;  1KDB A;  5TSS A;  1W0K A;  1EWH A;  2RDH A;  1KDA A;  4OO1 I;  2MJ8 A;  3JAM E;  1TU2 B;  5C4H A;  1A3T A;  2EYM A;  3CP8 A;  1JWM D;  4FYD A;  3VR2 A;  3DEO A;  4FVM A;  2LKV A;  1GJX A;  2JA8 B;  4Q0F A;  3CES A;  4ME5 A;  2LMC B;  3TP7 A;  3SK4 A;  1II3 A;  4ZAI A;  3DXJ C;  2B2V C;  1H9R A;  5KGU A;  1E79 A;  3ND9 A;  5A2Q L;  3BS1 A;  1ENC A;  1SE4 A;  5C3W A;  4FXG C;  3G6J B;  3R8B A;  1K83 B;  2IPK D;  4G7X A;  2ZXH A;  4KKS A;  2OF1 A;  3D6C A;  4II3 A;  1EOT A;  1GUW A;  4GQN A;  1A3V A;  4CJ0 B;  1UAP A;  4CKB A;  3H3V C;  1EIG A;  2JA6 B;  1UD4 A;  4RA8 A;  5CV8 A;  4LMQ D;  2K32 A;  3S1Q B;  2JEA I;  2B2W A;  1QNU A;  1R9T B;  3H94 A;  4UAI A;  2NBF A;  5IGB A;  4Y7N B;  3NTI A;  1SNQ A;  2CW0 C;  3GO5 A;  2F03 A;  5DM7 3;  5M5X B;  4CKE A;  2WJY A;  1QWY A;  2L5T A;  2RVL A;  2IT1 A;  2OT2 A;  3DDY A;  3M4Y A;  1HQM C;  2ZXP A;  2XND A;  5E4X A;  1G29 1;  3I4N B;  1E3Z A;  2VJJ A;  1ZXT A;  1DJR D;  1NBM A;  5AFW A;  4OGQ C;  1EFR A;  5IGE A;  3TME A;  1JR0 D;  1HUM A;  2IX0 A;  1EY7 A;  2CQA A;  3JAM L;  5JAV A;  1QJO A;  3TP8 A;  4XR6 A;  3S17 B;  4XMY A;  4J8Q A;  2B8G A;  1TS2 A;  1STN A;  2L12 A;  4XIG S;  2JYO A;  1WTQ A;  3WQZ A;  1ET6 A;  5CC4 A;  5IOD A;  3M7N A;  3BC9 A;  5M9O A;  2HLD A;  5JJZ A;  1VF5 C;  1JCK B;  1UD6 A;  2F0U A;  4KD4 A;  4XOR A;  3OHX C;  2KUM A;  3MXU A;  4DA2 A;  2IWH A;  3GVJ A;  2Y0S B;  4ODG A;  1GUO A;  4FXD A;  1SYD A;  5IGG A;  2WKD A;  1RTN A;  4DNR B;  1SYC A;  3UI2 A;  3NTK A;  1MBY A;  1A2T A;  1HXY D;  5EKK A;  1RDP D;  1T5E A;  5IOC A;  2R6G A;  3QJY A;  4RHS A;  2F4I A;  2ZZG A;  1UD5 A;  4F87 A;  1C48 A;  2D2C C;  1TWA B;  1BF4 A;  2EYJ A;  4HAE A;  1EEI D;  4ZKC B;  3PIP 3;  1CM9 A;  4NW2 A;  3A7L A;  2JE6 I;  1FNU A;  5M3M B;  2E2D C;  3TN2 A;  3T53 B;  3FKS A;  1W9X A;  1DCZ A;  1SNC A;  4EQN A;  2PNR C;  2QIL A;  1KLG D;  3S1M B;  2C9O A;  1KNA A;  4KJO A;  2JJ1 A;  2FMM A;  4G4K A;  5D14 A;  1JOR A;  5FO8 B;  3K57 A;  5JEA J;  2WP8 J;  2IX1 A;  5DNF A;  1TY0 A;  2N88 A;  4NMZ A;  5EJW A;  3I72 A;  3Q6S A;  2A68 D;  3FEW X;  2X8K A;  3N52 A;  2FIN B;  5EKL A;  1DYQ A;  1I4H A;  4OHJ A;  1X3P A;  3NE5 B;  5KYL A;  1V0F A;  3GTG B;  2FFK B;  3NQT A;  4KHZ A;  2OXP A;  4K5W A;  1B2T A;  4J6H A;  3K5O A;  5CV9 A;  4R9W A;  4XL9 A;  5BN3 A;  1HVX A;  2A5H A;  1LTR D;  4F7X A;  3VR5 A;  4XLE A;  5KIX A;  3PMF A;  2WIN B;  3V2T A;  2A74 C;  3KF8 A;  4A3G B;  3R3O A;  2K5D A;  1QG7 A;  3C1F A;  4CGY B;  1PTO D;  3IKJ A;  2SNS A;  3OSO A;  2E76 C;  1JIC A;  4V0B A;  2EYL A;  1PTO B;  1F9S A;  2WPD A;  5BN4 A;  1G6Z A;  3D31 A;  1GUN A;  2E74 C;  5T1G A;  4XLH A;  4XQJ A;  2F0V A;  1LO5 D;  2B2U C;  4RGM A;  1YNJ D;  5E1F A;  2F0K A;  1EZ8 A;  3FMC A;  1Q8I A;  2N55 A;  1OXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...