3CTAA

Crystal structure of riboflavin kinase from thermoplasma acidophilum
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
216
structure length
187
Chain Sequence
DQYYRAIKKIKEAAEASNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTVTKRGQILNITEKGLDVLYTEFADLSRILAIKNNVVITGTVTSQYIIQFQEKLGIIPYLNIKVDQASLPELRKIRGFRGIHIEGFKTRTFGSVKAFPAKIQNIPCFVIMPERTVYTDVIEIISDDRVSVEVYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of riboflavin kinase from Thermoplasma acidophilum.
rcsb
source organism Thermoplasma acidophilum dsm 1728
molecule tags Transferase
molecule keywords Riboflavin kinase
total genus 56
structure length 187
sequence length 216
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ctaA01
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 3ctaA02
1LB2A 1YW8A 3TGNA 5AIPA 5D5XB 1S3JA 1PUEE 3HHHA 2D2WA 4Q5SF 5DD4A 2XGXA 4XSZF 2MD5A 3CO6C 5HLGA 3P7NA 1FBUA 5FO5A 2RVCA 3RTRA 3ZUGA 4G6QA 1ZRDA 2EV0A 1MZBA 2HTJA 5FD5A 3D5LA 1O57A 4RGXA 4MNUA 2QM3A 4MEYF 2YPRA 5LGUA 1D5VA 2OZUA 4M71A 4P9UA 5EEGA 3E3VA 2IW5A 3I58A 2CO5A 3SZPA 4XSXF 1ZARA 1JGSA 5E20A 3N97A 4RAZA 2LKPA 2KIMA 3DP7A 1BIBA 1LEAA 2EJRA 1S7AA 1ON2A 2ETHA 1XMAA 2FMLA 2HYFA 3Q9VA 4S05A 1F1ZA 1RUNA 5HS8A 1J59A 3LAPA 4N9IA 3BROA 1T6ZA 1RUOA 2UZKA 4H0EA 5DYMA 3E6CC 2EFNA 3T1BA 1PP7U 4UHTA 2O3FA 2MLGA 2JSCA 5H6QA 3F3XA 4ETSA 1I1SA 1OYIA 2ZFWA 4HF2A 1KU7A 1NB9A 1LNWA 4Y17A 1Y0UA 2QBYB 2L3DA 5DD8A 5AIQA 4N9HA 2K4JA 4HV5A 5E8GA 1BI2A 3I71A 3DFGA 2QQ9A 3HSFA 2RGVA 3V8JA 5LLQA 4BQAA 3QP6A 4RB0A 1R1TA 3BDDA 4PGHA 2GZWA 4UV8A 3ECOA 3GF2A 3SHFA 2IRFG 5LGNA 1REPC 3ISPA 3B02A 4HOBA 1ZG1A 3C18A 3G73A 2RC4A 2ZMEA 3GO5A 1WI9A 2FBIA 4KNYA 1LJ9A 1CF7B 1Z6TA 4CXFA 2X0KA 3RKWA 1ZG3A 1UHMA 2OD5A 2VE9A 3GFLA 5ILVA 4NB5A 4L5JA 3RYRA 2HS5A 1XGNA 3C7JA 2DLLA 4KYWA 1MJAA 4L9JA 4LJZF 4NQWA 3S2WA 5JI6A 3HRMA 1T6XA 2P6SA 3KZYA 3WTZA 3ZQ7A 5DCMB 4ZYEA 1HKQA 2GQQA 3T8TA 2STTA 3V7SA 1ODDA 1B59A 3J80Z 2VXZA 4ZYGA 1IN8A 1QBJA 1IAWA 1FYKA 1KA8A 2BEOA 2RNJA 3L9FA 1KGSA 4HF0A 2Y75A 4M9SA 1YS7A 1T39A 2OQRA 4HV6A 3QRFF 4U0YA 2XVCA 3CUQB 3WTYC 4FHTA 3GX4X 3MZHA 2J5PA 4BH9A 4EM2A 1ZREA 2RV8A 2LNBA 3V4GA 1JHFA 1D3YA 4A0YA 4EVIA 5BQTA 2DBBA 1N07A 2V6CA 5K5QA 2NS0A 1IUYA 5LHIA 2K27A 3F72A 4BAYA 4Y13A 3F21A 3Q9SA 5E8IA 1RNLA 2ISZA 2IT0A 2VC1A 3KCCA 2A3SA 3WGHA 5HVQC 2H09A 1B6AA 1XDSA 3RYPA 1XCBA 2I1LA 4P9FA 5D6EA 4KMUX 1R5GA 3RJPA 2WV0A 5BPDA 1QGPA 1R22A 3DV8A 1IF1A 1DPRA 1P92A 2H6BA 4L9NA 2Z9OA 1SFXA 3R0JA 4M73A 3IC7A 4LLNA 5D8LB 3ZPLA 4UNOA 2M5WA 2O61A 4R79A 1FZPB 5LBQA 4OOIA 2P5KA 2ZBKA 1GHCA 1T38A 3HRTA 3DXJF 2P5LC 2FMYA 4GCVA 1MRZA 1YW7A 2VBUA 3WTSC 4I09A 2IA2A 5ICEA 2R7DA 5E17F 2Q8KA 3R4KA 4XLPF 5L3DA 1FP1D 5IT9K 3KETA 3MFKA 2XASA 1SAXA 1EV7A 4WF2A 1TTYA 1BI3A 3BNWA 5A88A 2LSOA 4IRGA 3T8RA 3FZVA 3QU6A 3LAJA 4FX4A 3RDIA 4QLCU 1STZA 1ZYRF 3M1EA 3ZMDA 3VFZA 4YG2F 1H9GA 1BJAA 4QWQA 1DP7P 2FSWA 1TQIA 3DPTA 5BPIA 4KICA 5LEJA 2C6YA 4LD5A 3REOA 3J7AO 2GWRA 1Z6RA 5F1RA 1KU2A 2L01A 4EJOA 1HBXG 1MKMA 5LEKA 3CLOA 3W6JB 3L09A 2BGCA 1A04A 2K7LA 2CW0F 1S6LA 1D8KA 2V79A 1ZAOA 2CGPA 2DTRA 3EYIA 4BHBA 2O8XA 4HDUA 1S7OA 3SXYA 4MTDA 4YFKF 2QYOA 4JQFA 2EA4A 3ERED 5E1XA 1TQMA 1KYWA 4HAMA 1IXRC 5HDGA 3IL2A 4HBLA 1K78B 4I2OA 3EYYA 2G7UA 4HZFA 3RI4A 2EFQA 1KQ9A 4R1HA 3LA7A 4WK8F 3CUOA 2VT2A 1FP2A 3D0SA 5L3EA 4MTEA 3GUDA 3E5XA 3FWEA 1Q9SA 2EWNA 3WE3A 1TW3A 2KRFA 2XKPA 2OYNA 2JPCA 3I54A 4O6JA 1DDNA 5BOXA 3BJAA 3BOQA 5H20A 2LF8A 3CTAA 3H92A 4AD9A 2KJCA 1P4WA 2XAFA 2WTEA 1XMKA 3E5QA 3Q5FA 3WGIA 1J9IA 3QPTA 2DPDA 2HEOA 3IKTA 4BYYA 1R1UA 1GXQA 2UXNA 4Y15A 4OIRF 3KP2A 2DFIA 1E2XA 4MEXF 1BC8C 4BNCA 4ZYDA 4I7HA 1P6RA 4G7HF 1Q1HA 2VOOA 4XLNF 4FT8A 2OA4A 5J8FA 2PG4A 4M6XA 4U0VA 5KVRA 2UXXA 2FOKA 3HHGA 2GA2A 1EH7A 4G8XA 1R7JA 1U2WA 4HX8A 1W7PA 2XUBA 1FX7A 4R8HA 1G4DA 1ZG5A 2HQNA 3TQNA 4P5OA 1LQ1A 3I64A 4G7OF 3TDUC 2MC3A 1ZH5A 2VN2A 1RIOH 1SD4A 1D8JA 3V7RA 2EB7A 4HQMA 4EV0A 4IPAA 1U78A 3TO9A 2GXBA 1R23A 4GO1A 2VBWA 5ERIA 4HLYA 1AOYA 2FNPA 3FM3A 5D5VB 4KIBA 1MDMB 2VODA 2O0YA 4BHCA 4D0PA 1XSVA 4ENNA 3ZN1A 2QQAA 3ELKA 1F5TA 3WODF 1KYZA 1OMIA 3H3ZA 5L3CA 4CICA 2W24A 1SMTA 4EJVA 3L00A 4KMFA 2RKHA 2KKOA 1USSA 3P9IA 4AWXB 1J5YA 4LG0B 3PQKA 4IXAA 2QLZA 1S29A 1K78A 5LRRA 5CVIA 5CVUA 1NHAA 1PP8F 1SD6A 3C3WA 1F9NA 1U3EM 2Z99A 4G9YA 2R3SA 4S04A 4RAYA 1OPCA 2K86A 4KN7X 2DU9A 1K79A 2M1BA 4B09A 1ULYA 5F6FA 3PFIA 5L3BA 2TDXA 5DDGA 1C0WA 4OMYA 4M9ZA 4OIPF 5DV5A 4AVPA 1TQPA 5K5OA 1JXSA 3KP7A 4XBFA 5DEQA 1JE8A 4BXUA 1FSHA 5HLIA 1P4XA 2J5OA 1HSJA 4L0YB 2WWYA 3E5UA 3JTHA 3E6BA 1FWZA 3QAHA 1G3TA 2VBYA 2W85A 3ECHA 5IT3A 2XAGA 2L02A 2CYYA 3CJNA 4P96A 5D8KB 2CQKA 1TNTA 1RI7A 4CZZA 3EQLF 3JSPA 1QNTA 3M7GA 2HR3A 2GXGA 3QP5A 5HOOA 1USTA 4JBAA 2XROA 3V8LA 1R5HA 3FMQA 4IHSA 2O03A 5JHUA 3IRQA 1XSXA 2P4WA 3ABUA 2E7XA 4IF4A 1IXCA 3K9TA 2GAUA 5E1WA 2ESHA 4UVAA 4N0BA 2RDPA 4WWCA 2M30A 3LSTA 4WXHA 2D1VA 1I6XA 3DF8A 1QZYA 2XRNA 4OU0A 2EFPA 2VBXA 2HDCA 1BM9A 1HW5A 1U8RA 2LF7A 4ZYHA 1JHHA 4YFXF 5BS6A 1BI0A 4M9XA 1YTYA 3BJ6A 4GGGA 4OINF 4B8XA 3ULQB 1TW2A 5ICFA 4EJUA 3HSEA 5DCMA 4MGRA 2LDUA 1KQ0A 2QENA 2HQRA 2W57A 5LHHA 4RGUA 1U5TB 1YFHA 2CSOA 2BV6A 1I1GA 2M87A 1HSTA 3F8BA 5IT9Z 2OU2A 2F5DA 4ZZDA 4YIIA 1HXDA 3ZMTA 3K69A 1W7PB 2A61A 1YW9A 2XAHA 2P7CB 3MEXA 5ILUA 4UZFA 2A68F 1S8NA 3V7CA 1HW1A 1CF7A 2BYVE 1XCVA 1IRFA 3F8CA 2PMHA 1ZLJA 5CLSA 1CGPA 1PDNC 4HDVA 3N4MA 2F2EA 1TBXA 1BC7C 2P3MA 3FHZA 3KP3A 1Z91A 2BE5F 3M8EA 2KJBA 3K1MA 3O3KA 2IPQX 2HGCA 3K1PA 2XAJA 3ZMUA 4KDPA 3P9CA 3CUQC 3H3UA 4ZH4F 1UB9A 1DPUA 2DQRA 2CFXA 2M45A 3VEPA 1E17A 3MZYA 3KZZA 4L9VA 5ICCA 4I0BA 1SFUA 3K1NA 3KP6A 2VONA 1W4MA 4EGZA 4WXDA 4O5VA 2VBSA 3TKYA 1FPQA 1XB4A 5FFXA 1XSDA 4PDKA 4ENKA 3HIFA 2NRAC 4RB2C 1YLFA 2HOEA 3V8KA 5HDKA 1FSEA 3L7WA 4EJTA 3HOTA 1ONVA 1H0MA 5FO0A 4RB1A 1V3FA 3COAC 2PJPA 4EM1A 2JT1A 5A89A 3F8FA 2EK5A 2M8EA 2FBKA 3KLOA 3E6MA 4ESBA 2K4BA 3QU3A 1FLIA 1LVAA 4MHGA 4U88A 3WU0A 1ZGJA 2YSRA 4UV9A 2KIFA 1YQAA 4HYEA 4MQ9F 2HKOA 2NYXA 2HKXA 4UXNA 2DT5A 2Z3YA 3NQOA 2FNAA 2H6CA 3FX3A 3MCZA 2F5FA 2E7WA 2D1HA 1MJ9A 3I59B 4LK0F 1O7FA 1U5TC 2G9WA 1T6SA 2AS5F 3BP8A 2Z33A 5L3GA 3BJOA 1B1BA 1QQIA 4NHJA 2HYGD 4M6YA 4IJAA 5K5RA 2MH9A 3RPUA 4ENMA 4KN4X 5D6FA 2IVMA 3NEUA 4EGYA 2VOPA 6PAXA 3T5XA 3GYHX 1NB0A 4GXOA 5AONA 1K7AA 4CO8A 1ON1A 1SD5A 1R36A 5L3FA 2WC2A 2VE8A 3O6BB 3MWMA 3E6DA 1O3SA 1B9NA 4LFUA 4UZEA 3KP4A 2PMUA 2V9VA 1LDJA 1ZLKA 2VC0A 1QZZA 1N08A 2EV6A 4PCQA 3J81Z 4L0ZB 2PN6A 3J80K 1RZ4A 3OP1A 3HRUA 2X0LA 3WTUC 5E1ZB 3FMRA 2NNNA 2V1DA 1ZN2A 1SFEA 5JVTA 1QO0D 2PFBA 2W25A 1XD7A 3JAMK 1X3UA 1FOKA 2EA2A 2DK8A 2YU3A 3GFMA 5DUIA 1FYLA 1WWXA 2A69F 4KT5C 2QVOA 4ZZLA 3HTSB 3IWFA 1H9TA 5KK1A 3TDZC 5J6XA 1P4AA 5FO1A 1FBSA 4A0ZA 3PQJA 4LB6B 4AIJA 2JTVA 1AWCA 1BIAA 2Q2EA 3FXUA 1KQ8A 4HW0A 5D5UB 1V4RA 4CHUA 1LEBA 4YFNF 2GA1A 3U9GA 5LGTA 1HKSA 3DQVC 3JAMZ 3F22A 4PZJA 5A2QZ 3EETA 3WTTC 2X4HA 2OBPA 1OYWA 3R61A 2COMA 1KU3A 5BMZA 5HS7A 4UVBA 3ZP5A 2GIVA 1XDUA 3WG9A 4I02A 4G94A 1I5ZA 3SZTA 3SQNA 2Y0MA 1QPMA 2H94A 5LRSA 1OKRA 1IN7A 4M72A 3GXOA 2R7FA 1L0OC 5TJJA 2DO7A 1T98A 4IVNA 5CVVA 4HX4A 4DNCA 1N06A 2BBYA 1P4MA 2O6GE 2FA5A 2MBFA 3KLNA 4A6DA 4A0XA 4L9TA 1FC3A 1OR7A 2W84A 3JW4A 1Z9CA 2DAOA 4IHTA 5CVRA 3OOPA 5JR3A 1YG2A 4OMZA 4KIFA 5ED4A 1ZHFA 4RS8A 4K2EA 1G3YA 3LA3A 2G7HA 4L18B 3WTWC 3EUHA 1G3SA 1Z05A 3R60A 2P5VA 3DEUA 1MGTA 2YR2A 5JFRA 1IN5A 5H6RA 2D45A 2A6EF 3DPLC 2ISYA 1B4AA 4LK1F 4HA8A 2HZTA 2FXAA 1G3WA 3KEQA 3FF5A 5FNZA 1N05A 1Z7UA 3E97A 1GVJA 4Q47A 3GFJA 2XV4S 1EH8A 3VOEA 3EDPA 5CVJA 1L3LA 5HLHA 1WQ2A 2PEXA 1BI1A 5D4RA 4OIOF 1ZGAA 3CUQA 3GZ5A 1MJBA 4I0AA 4RB3C 3IRRA 4HF1A 1IN4A 2RQPA 2YX4A 4EMSA 1F4KA 4LMYA 5ILSA 2ACJA 1R00A 2UWMA 2FU4A 1Z1DA 1OYYA 4JK1X 4ON0A 3F6VA 5FB2A 3GLXA 2HFHA 3HSRA 2L54A 1UCRA 3O2PE 2F5EA 2FF4A 2HTSA 3F23A 1J0RA 2ZNZA 4O3MA 2Q0OA 3M9AA 5FLXZ 4FX0A 1UFMA 2ZNYA 3U2RA 3LQQA 1K6OA 5FGMA 1MDMA 3QPHA 5E18F 3BWGA 2STWA 3HYIA 4HX7A 5FFZA 4LLGF 2ZMEB 2XAQA 1T2KA 3JSOA 1P2FA 3QOPA 2PI0A 3CDHA 4Z2YA 1FYMA 1G6NA 4IRIA 1R1VA 3HUGA 1R58A 3I5UA 4I98B 1FBQA 1DUXC 3HTUA 3GW2A 4GYIA 1YO5C 1IRGA 3TO7A 2A6HF 1LDKB 1B9MA 3GWZA 2P6TA 1KU9A 1VTNC 3F8MA 2ESNA 3SFZA 3P9KA 4P55A 3ABTA 2A5YB 1LDDA 3R6SA 4ESFA 3OV8A 3LA2A 4U7BA 2P7VB 1YIOA 5LHGA 3C1DA 1TNSA 5CJ9A 2H27A 4Q48A 3FMSA 3U1DA 5ICGA 2CG4A 4CYDA 4KA4A 1UHWA 2QQBA 2PQ8A 2QWWA 3ZMVA 5CYVA 4EQQA 4A5MA 2EFOA 3NRVA 4LGWA 4WX9A 5TRDA 2DI3A 4U0WA 4YIFA 5DUKA 2NAZA 2F5CA 1BOAA 1T6YA 3GEZA 2VBTA 4KFCA 3BPXA 3CO7C 1W5TA 1IW7F 1EH6A 2IA1A 4MQVA 4Q4ZF 4L5IA 2QBYA 4EM0B 4BHPA 4A6EA 3TO6A 1XGMA 3WE2A 2ZKZA 1O7LA 1T0FA 3WTXC 2E1NA 5D4SA 3KP5A 3KE2A 3IHUA 1O3RA 1GXPA 1XGOA 2VBVA 4I01A 3F6OA 3KEOA 1S4MA 1MD0A 2DQLA 2DPUA 2FBHA 3GZ6A 2HWVA 2PLYA 2RN7A 4LLLA 2L4MA 2OQGA 4ESJA 5K1YA 1IN6A 1FNNA 3VB2A 4PGGA 2FEZA 3IWZA 3LFKA 2EV5A 3RIRA 3ZN0A 1J2XA 3W6KB 5HDNA 2JPBA 5D5WB 2ELHA 3G3ZA 2NNYA 3AAFA 2FE3A 2IP2A 3MQ0A 2Z5UA 5FD6A 2A07F 4GYGA 3ML6A 2FRHA 4LG0A 4AIHA 4A5NA 2E1CA 1I27A 3FM5A 3DKWA 1SD7A 2VBZA 1FY7A 2ZCWA 1U5TA 4G7ZF 3RPQA 2DK5A 1U6GA 4KUMA 3J81K 4TV7A 2B0LA 2KIUA 5A2QK 5EEHA 4LB5A 3LWFA 1WSUA 3MAJA 3RKXA 1BBYA 1ZRCA 1O3QA 3M8FA 2XIGA 2OAZA 2IJLA 1W7PD 1J75A 3KFWX 3B73A 2ZJ2A 2XKOA 1W5SA 3LQRA 3WTVC 3GVAA 3I0TA 4XRFA 1IXSB 2YX7A 2V1XA 2ZXJA 1WRJA 2OZ6A 2V1UA 2Y48A 4OIQF 3FXQA 2IA0A 1HW2A 4CDGA 2K02A 4UVCA 2MLKA 2QZ8A 3HRSA 4EJWA 3RKYA 3TOAA 1TLHB 3F8NA 2CWEA 5DCFA 4U7DA 4WCGA 3GFIA 4ENJA 1HKTA 3T0YA 2ADUA 3L2CA 4F7ZA 5FLXK 1ZRFA 3JTGA 3I4PA 3FXRA 5A8AA 4A2UA 2PBIA 3K0LA 1IZ1A 3BY6A 3WGGA 3ZMZA 4HQEA 2JZYA 2MH2A 3HOSA 2L4AA 2ZO4A 4KIGA 3BPVA 4M74A 1O3TA 4ASNA 2AXLA 4UUVA 3R0AA 2DW4A 2QUFA 1FT9A 1SMYF 3IKVA 3I53A 4HLXA 3VODA 4G6DA 3WU1B 4A12A 4CGZA 5J8CA 1XGSA 1YS6A 2FQ3A 2P8TA 2XHKA 4RGSA 1HQCA 1WKMA 4RGRA 5HS9A 4DQ2A 1BN5A 2MA3A 4WXCA 3ROUA 3K2ZA 4IRHA 4E70A 3I59A 2EFWA 1J7KA 3BZ6A 1YYVA 2JRTA 5F64A 3TOBA 1XN7A 3ZMSA 4AIKA 2VT3A
chains in the Genus database with same CATH superfamily
1W36C 1LB2A 5E3NA 1WPCA 4P9SA 3HAGA 3OW2B 1JTXA 1YW8A 5EG0B 3BH4A 1E43A 3S17J 2WADA 3TGNA 4LBVA 4RAGA 3FHNA 4RM3A 5AIPA 5D5XB 1GVDA 1S3JA 1PUEE 3HHHA 2VLAA 1UMQA 2D2WA 1ZGWA 1YIJI 3S1MJ 4Q5SF 5DD4A 3EUHC 3QWLA 1FIAA 2DA2A 2XGXA 1OB0A 4PABA 2WAQN 4XSZF 2E35A 2MD5A 1ZR4A 3CO6C 2QGGA 5HLGA 4Y7CA 3P7NA 3M8JA 5CQEA 2R9VA 1FBUA 3DU5A 5FO5A 2RVCA 2CV0A 3RTRA 4YAOA 3ZUGA 4G6QA 1ZRDA 2EV0A 1Z67A 1MZBA 4HNTA 2HTJA 1MBKA 3CC7B 4XKBA 5FD5A 2K9NA 3D5LA 1O57A 5FRNA 4RGXA 3CCUB 4Q7JB 4MNUA 2QM3A 4MEYF 2YPRA 4B43A 4X7DA 3A0BC 2XF7A 5LGUA 1D5VA 2OTLI 2OZUA 1UJ8A 1BLIA 4X8IA 4M71A 4C2MJ 4P9UA 3Q6QA 1YHQB 5EEGA 1K83J 2OK8A 3E3VA 2IW5A 3I58A 2L9RA 2ME0A 1NRKA 2CO5A 3SZPA 4XSXF 3C2GA 1ZARA 1OHHA 4XIDA 1AIPA 1JGSA 3SJMA 2HXIA 4BY1J 5E20A 4M3BA 3N97A 1TWCJ 4RAZA 1EFTA 1R4NB 1EF4A 3A3GA 3CC7I 2OBSA 4ZGQB 5KSWB 2LKPA 2KIMA 3DP7A 3BTJA 3OYNA 1U9NA 2VIXA 1BIBA 1LEAA 1EFCA 3WU2C 2C5HA 2PLFA 4AU7A 2EJRA 1S7AA 1ON2A 2ETHA 3ZPNA 1XMAA 2FMLA 3S3OA 5EF6A 2HYFA 4RJLA 3Q9VA 1OCOH 3OYBA 4S05A 2YWEA 1F1ZA 5KCMA 1RUNA 5HS8A 4Z1MA 1J59A 1G7RA 4Y52J 1QRYA 1XTAA 3TL4X 3LAPA 4C2UA 4ZV4A 1A35A 4N9IA 3BROA 1T6ZA 1RUOA 2W48A 3OMYA 3KYCB 4G1BA 2CMPA 2UZKA 4H0EA 2JA7J 3AL0C 3S15J 2X53S 2DN0A 5DYMA 5F08A 4S0HB 4BEHA 1ZKGA 3E6CC 3UR3C 3PNVA 2EFNA 3T1BA 3IV5A 1PP7U 4UHTA 2O3FA 2MLGA 2DXIA 1WJFA 1LFBA 4P12A 2JSCA 5H6QA 2A5WA 4B3AA 2GQFA 3Q3AA 4C3HJ 3QYEA 4FWTA 5C3EJ 1JI8A 1LVKA 3HB9A 2CRVA 1UELB 2QKLB 4A3EJ 3F3XA 4ETSA 1I1SA 3BR3A 1OYIA 2ZFWA 4HF2A 3PSIA 3LQ6A 1KU7A 1NB9A 4IZZA 2K40A 4IOAF 1LNWA 4Y17A 3ZGKA 1Y0UA 4DZPA 2QBYB 4BPRA 2L3DA 5DD8A 5AIQA 1BA5A 4IKFA 2KRCA 4N9HA 3Q0VA 3M3YJ 3ERMA 2CK3A 3PNYA 2H1KA 2BW3A 2K4JA 3N05A 3LSRA 2ZTGA 4HV5A 3H36A 2OV7A 4X0CA 5E8GA 5J3OA 5C4XJ 1BI2A 1X1PA 2E2IJ 3BT9A 3I71A 3DFGA 2QQ9A 2CUZA 2RGVA 3HSFA 3V8JA 5LLQA 1IC8A 4BQAA 3JQPA 3QP6A 2DEUA 1PJRA 3MMPA 4RB0A 1R1TA 1W36D 4IOCF 3BDDA 4PGHA 4XMYA 1KTVA 1FJLA 2GZWA 5F04A 1PUFA 4UV8A 3ES9A 4XKWA 3ECOA 3GF2A 4GDFA 3SHFA 4A3DJ 4TMZA 1AMOA 2YWHA 2IRFG 5IYWA 5LGNA 4G6IA 1REPC 3ISPA 3B02A 3GCMA 3BQZA 4YAWA 4YELA 4YALA 3LMMA 4HOBA 1ZG1A 3C18A 3G73A 1GLNA 2RC4A 3M4OJ 1K8AD 1TUIA 2ZMEA 3GO5A 3H0DA 2DYIA 1QFJA 1WI9A 2FBIA 4KNYA 3WHCA 4N3GA 5J4YA 5EZGA 5FROA 1WSRA 1LJ9A 4KKUA 3K4CA 5H59A 1CF7B 1Z6TA 4KT6A 1CNEA 2KP6A 2F5VA 3MD2A 2QSGX 5GTHC 1Q81D 4CXFA 2X0KA 3RKWA 3S93A 1T95A 4IX7A 5BSXA 1ZG3A 1UHMA 1EP1B 2OD5A 2VE9A 3GFLA 5ILVA 4NB5A 4L5JA 3OL3A 3RYRA 1U2RA 4ACBA 2HS5A 1U9OA 1XGNA 3C7JA 4NNJA 2DLLA 3JRAA 5HKKA 1IRZA 5IPAA 4KYWA 2V9PA 1MJAA 4L9JA 3CCYA 4LJZF 4NQWA 1K4SA 3S2WA 5JI6A 3HRMA 1E3OC 4RDKA 2PMDA 1T6XA 1V5VA 2RNGA 5FA6A 2L7ZA 2R93J 2P6SA 3KZYA 4RDUA 4A3FJ 2E2JJ 3GQBA 2W6JA 3KPHA 3WTZA 3LSJA 1G7SA 3TW7A 3ZQ7A 1OQYA 1ZTRA 5DCMB 1HKQA 3T8TA 2GQQA 3V7SA 4ZYEA 2STTA 1ODDA 1B59A 3J80Z 2OJED 2VXZA 2O7OA 4ZYGA 2XZPA 5J40A 1IN8A 4X7EA 1QBJA 3VR6A 1IAWA 1W1WE 3OIQA 2X1DA 1VZ0A 3OSFA 1RKTA 1FYKA 2AHOA 2EH3A 3ASOH 4E4HA 1N78A 1WU8A 4XR6A 1KA8A 2RNJA 2BEOA 4JP0A 1LUJB 3JR9A 3SEJA 3CCRB 3W2WA 3H94A 3L9FA 1ACIA 1KGSA 4HF0A 4ZTFA 1FOYA 2Y75A 3LNNA 3W2EA 2GM4A 1QFZA 4M9SA 2ELKA 2FX0A 2DFEA 1YS7A 1T39A 2OQRA 2QCOA 4HV6A 3QRFF 4XORA 4U0YA 2XVCA 3CUQB 4M3DA 3TMOA 4FHTA 3WTYC 2BZTA 3GX4X 3MZHA 4ACAA 2J5PA 4BH9A 2WR8A 3V42A 4EM2A 1ZREA 3FXLA 1OGIA 2WB1N 1DGWY 1TWGJ 2LLKA 2RV8A 2RC5A 1Z21A 4RBOA 1ZM9A 2VNIA 4M4SA 2LNBA 3V4GA 4BXFA 4LBWA 1WJCA 2HLDA 5K7FA 1JHFA 2VQHA 1D3YA 4A0YA 1WFXA 4G7XA 4EVIA 3W5VA 5BQTA 2DBBA 2W4SA 1N07A 1HZEA 1QGZA 4GQNA 2V6CA 3FXKA 3S3NA 1H85A 3QOEA 4EATA 2IGMA 5K5QA 2CBXA 2NS0A 2DERA 3OZUA 2TRTA 1IUYA 2E71A 5LHIA 2B63J 2K27A 2M3AA 1ZM3A 1JA1A 3F72A 4BAYA 4Y13A 2G0EA 2OTJI 1FNCA 1ETKA 2DYRH 4RD4A 5IYDJ 3MKZA 3OPOA 2V7TA 3F21A 3VSKA 5B1BH 4B48A 1XS9A 1R6RA 3ABLH 3Q9SA 9ANTA 5J1YA 2M7AA 4A69C 5E8IA 1RNLA 2ISZA 2IT0A 4LBZA 4Z4YA 4YIRX 2VC1A 4GFBA 3FK7A 1D2EA 1X19A 3CC2I 1JJ2B 1AKHB 3HDDA 3KCCA 2A3SA 1VHOA 4X0GA 2VJIA 3WGHA 5HVQC 3A01B 2H09A 3PSFA 1QVTA 2EZIA 1TZLA 1B6AA 1U8BA 2XNJA 3D5RC 3HKZA 3CB4A 1SKQA 3TP0A 1XDSA 3RYPA 4L5EA 3BR0A 5C44J 3U2QA 3CCLB 3BR6A 2YS9A 1XCBA 4KJZA 1H88C 3AVVA 2K9LA 2IS4A 2I1LA 4P9FA 5D6EA 2BY0A 4KMUX 3PA2A 1R5GA 4M3GA 3P26A 1HDPA 3RJPA 2WV0A 5BPDA 3S1NJ 3HJEA 3OYGA 4WZEA 1ZUNB 1QGPA 1R22A 3DV8A 1E64A 5KHDA 3HOVJ 4F92B 1IF1A 4ANJA 1DPRA 2LK2A 2GLOA 1P92A 5K7HA 3A35A 4BJ6C 3OEHA 2FQ4A 2H6BA 1A8PA 3E0JB 4L9NA 1DARA 1QUFA 2Z9OA 1SFXA 3R0JA 4M73A 3IC7A 2CS3A 3ESWB 4GRIA 3TP3A 4XRSG 4LLNA 3W2GA 1QZEA 5D8LB 3CCLI 1COWA 3ZC3A 3ZPLA 4UNOA 2ZXHA 2M5WA 3SFIA 4F3QA 2E36A 2O61A 4R79A 2LBFB 1FZPB 3W5UA 2JK3A 5LBQA 4OOIA 3E20A 4RD2A 2BV3A 3VMFA 2C4UA 2P5KA 4OPVA 3AVYA 2ZBKA 1GHCA 1T38A 3HRTA 3DXJF 2P5LC 1FNDA 2QQ8A 4XN0A 4YEJA 2FMYA 2NV4A 4GCVA 2IGNA 3EUKL 1MRZA 1YW7A 4XRMA 3WTSC 2VBUA 1HVXA 4TT3A 4I09A 4X1EA 2IA2A 2NOJB 3PUFA 1NH3A 3FKSA 5ICEA 2R7DA 5IOZA 5E17F 5LMZA 4M3FA 1BJZA 2IS1A 2Q8KA 1HA8A 3R4KA 2CQXA 2HZDA 2WAEA 4XLPF 5L3DA 1FP1D 5IT9K 1EWYA 3A4CA 3SZGA 3KETA 3MFKA 4F52A 4MYTA 1SVMA 2XASA 1IUFA 1SAXA 1EV7A 4WF2A 5KAIC 1W0UA 1TTYA 1KZHA 2Z6BD 1BI3A 1RETA 3BNWA 3AVXA 4LG3A 3K10A 2R0QC 4BL0B 3CF2A 3M07A 3PO2J 1OCRH 4BUPA 2WAFA 1IJFA 5A88A 3HL2A 1D8TA 1Q1VA 2LSOA 4IRGA 3T8RA 3VYTB 1E3XA 1I8DA 3AGQA 3CCQI 3FZVA 1YJNI 1SVOA 3QU6A 4CUGA 4YHBA 1N75A 1VQ8I 1RC9A 2LKSA 4PK4A 3Q0WA 3ZXSA 3LAJA 2PE3A 3PFYA 2QF7A 1Y56A 3JRBA 4RLQA 5JLXA 4FX4A 3F9KA 4BY7J 2VPLA 4ZYAA 3RDIA 4QLCU 3I56I 1STZA 1ZYRF 3M1EA 5FL7A 5DTDA 2HMAA 3ZMDA 2COBA 2AHQA 3VFZA 3W2AA 3G4SI 1VJSA 2EZLA 2WZNA 2WB1A 4TSFA 4YG2F 1H9GA 1BJAA 4QWQA 1DP7P 2FSWA 4EEFG 4QVAA 2HDDA 1TQIA 4B3XA 3DPTA 4F55A 4KICA 5LEJA 5BPIA 3CJTB 4MO7A 2C6YA 4LD5A 3REOA 3J7AO 5J1RA 1VQ6I 3CMEB 1QGAA 2GWRA 3BLYA 3CCEB 1Z6RA 5F1RA 1KU2A 2L01A 1FOWA 5IOYA 4Z4WA 3OKXA 2DODA 2F6CA 4EJOA 1HBXG 1MKMA 4Y3OA 3RZDJ 5LEKA 3CLOA 2TCTA 4XLEA 3W6JB 1SM4A 3VO2A 3HBLA 3L09A 2BGCA 1A04A 2K7LA 2CW0F 1S6LA 3FIWA 3SJZA 4B4DA 1D8KA 2V79A 1ZAOA 5EJCA 2CGPA 1MABA 2DTRA 2NS7A 3EYIA 1IGNA 4BHBA 1KONA 2O8XA 4HDUA 1S7OA 1RRJA 4X07A 3SXYA 1X2NA 4MTDA 4YFKF 1VQKI 4E7JA 2QYOA 1MBJA 1QHHD 5IYPA 4JQFA 2EA4A 2GIZA 3ERED 3CCSI 1M1KD 5F4OA 4BQNA 3ZRGA 3BTIA 1VQPB 3ASRA 1MBGA 5LD2C 5E1XA 3SLDA 3WXMA 1IJEA 1TQMA 4RMNA 1KYWA 4HAMA 1W0TA 1TWHJ 1X2MA 4QSHA 1WOPA 4J0QA 1QVGB 2NVQJ 2XDVA 4PC2A 1IXRC 3ZBUA 3ZQLA 1V55H 1LKXA 3CQZJ 1M1EB 3FDYA 3LSIA 4HBLA 5HDGA 3IL2A 1K78B 4I2OA 3EYYA 3H1CA 2WPDA 2G7UA 1YHQI 3MKLA 3CCJB 4HZFA 3RI4A 2EFQA 3ZBTA 3I56B 2BSAA 1KQ9A 4R1HA 4UB8C 3LA7A 5B6IA 2OUMA 4AVZA 3S16J 1JKRC 3WYAA 4WK8F 3CUOA 2VT2A 2P81A 1FP2A 4BE1A 3D0SA 5L3EA 4MTEA 4IEJA 3GUDA 3K4MA 3PIPF 4E7IA 2N8GA 5GV8A 3E5XA 3FWEA 4H4KC 1KK3A 1Q9SA 2KHMA 2V4JC 2HVRA 2J7KA 5E6TA 3BC9A 2IXSA 4RPBA 2MABA 2DA6A 2EWNA 4ZC3A 3OYMA 3WE3A 1TW3A 2KRFA 3LFUA 2XKPA 1BMFA 3HXLA 2OYNA 2ZZQA 4M1KA 2QTLA 4F93B 1VQOB 2DA7A 1Y0YA 3MVPA 2E34A 3U21A 1BL0A 2BF4A 2JPCA 3VYSB 3I54A 4O6JA 1DDNA 2V26A 4XONA 2DA4A 1SVLA 3BJAA 3BOQA 5IP6A 5H20A 4YRVA 2LF8A 2HXOA 5FJ8J 2CNDA 4PC6A 3CTAA 3K4KA 3H92A 4AD9A 1WJ5A 2KJCA 1IV6A 3JRFA 1P4WA 2XAFA 1TT0A 2WTEA 1XMKA 2CF4A 3E5QA 2W7NA 3WGIA 3UKGA 3QPTA 3Q5FA 1JJ8C 1J9IA 3ONYA 5GV7A 2DPDA 1VQOI 3IKTA 2HEOA 1HDDC 3LL7A 3K7AJ 1H8HA 4BYYA 2WBMA 1R1UA 1GXQA 5H5JA 5EZHA 2UXNA 1KC8D 5BNGA 4M0LA 1XMXA 4PSWA 2V1NA 1JB9A 2AO9A 3BC8A 1POGA 4Y15A 5E79C 2L7KA 2XRLA 2DFIA 2RREA 3KP2A 3MN2A 3ABKH 4OIRF 2GOMA 1E2XA 4MEXF 1BC8C 4BNCA 4ZYDA 1A31A 4I7HA 1P6RA 5M3MJ 4G7HF 1Q1HA 2VOOA 1MMAA 2D74A 2AXTC 4XLNF 4FT8A 2OA4A 5EMNA 5J8FA 2PG4A 4M6XA 5E3MA 1X1AA 3OYKA 4FK8A 2QSHX 4PJLA 1H89C 1E1QA 1GJRA 4U0VA 1FIPA 1E79A 5KVRA 2EIJH 2UXXA 1T0FC 4FISA 3RQ4A 4XQFA 2HOSA 3O8HA 2L9VA 2FOKA 3HHGA 2GA2A 1EH7A 4G8XA 1R7JA 1U2WA 4HX8A 2ZBUA 3CCMB 2F4IA 1W7PA 1GV2A 2VZLA 2XUBA 1FX7A 3ZCOA 4R8HA 3A8KA 1G4DA 1ZG5A 2BY3A 2BM0A 3CF5F 2IGKA 2LG4A 3J7ZI 1GDTA 2QEXB 5DM7F 2HQNA 3TQNA 1EFUA 4RD3A 4P5OA 1LQ1A 4WZLA 3I64A 4A3BJ 4G7OF 3TDUC 2V7VA 1LPQA 2MC3A 1ZH5A 2VN2A 1RIOH 1SD4A 5IYBJ 2HQ5A 3GTKJ 3V7RA 3GTOJ 2M4GA 1D8JA 3PUNA 1IDYA 2K85A 1YX3A 2EB7A 2JWTA 4HQMA 4EV0A 3OYIA 3E1YE 3CJRB 1WJEA 4IPAA 1U78A 3TO9A 2MGQA 4DNRB 2L0KA 5KAFC 2E1BA 4DK0A 4V2FA 2H1LA 4XOPA 2Z2SB 3P5JA 2GXBA 3JRIA 1R23A 1ZQ3P 2X6YA 4WZKA 5EGOB 2RC6A 1BQEA 4RCYA 2GBYA 4GO1A 3W6VA 1MBFA 2VBWA 1HC8A 5ERIA 2DTZA 5IK2A 4HLYA 3S8PA 2XF5A 3HGYA 4BDYA 3FK6A 1T5EA 1AOYA 1FDRA 2FNPA 3FM3A 5D5VB 4X06A 1MIJA 3FXJA 4KIBA 4PJJA 1MDMB 4PAAA 2VODA 4QV2A 2O0YA 2EINH 3CDLA 1G59A 3VYRB 3BR5A 4BHCA 1XSVA 3CLQA 3VSLA 4D0PA 5B1AH 4Y7NJ 1HLVA 4ENNA 2BVLA 3RKQA 2XB5A 1W5CC 3ZN1A 2QQAA 2JA5J 1CQXA 5DS0A 3ELKA 4IW3B 3J81k 1F5TA 2C4TA 2E19A 3WODF 1KYZA 2JN9A 4DBQA 1OMIA 3AVUA 2D5VA 3H3ZA 5GAEJ 1D5YA 4DOZA 4MLOA 5TGTA 5L3CA 3S2DJ 1R5NA 4CICA 2DETA 2W24A 1UD4A 4FCYA 1ETVA 1SMTA 4EJVA 3L00A 1G8XA 4KMFA 3MZ8A 4AUXA 1HOMA 2RKHA 2HOTA 3R6KA 2KKOA 1USSA 5M5XJ 2E1RA 1A6IA 3PL8A 1QHGA 3P9IA 4AWXB 1J5YA 3ZQGA 4IL6C 4LG0B 2LMDA 3PQKA 3KEYA 1UAAA 4IXAA 4F91B 3BY1A 2QLZA 2VNHA 1S29A 4AYBA 3K4NA 1K78A 3OWTA 5LRRA 5CVIA 5CVUA 1NHAA 1PP8F 1R5ID 1SD6A 3I3LA 2L9NA 2M7BA 2YUSA 2I8DA 3BQYA 1ZK8A 3KEWA 3C3WA 2R7OA 1H8EA 1F9NA 2PIAA 1U3EM 2Z99A 4G9YA 4M2LA 4PJNA 1W0JA 3A8JA 2R3SA 4S04A 4XLCA 2KVOA 3NWSA 4RAYA 1OPCA 4HRIA 2O5RA 4X7CA 2K86A 1I39A 1WDTA 1MNEA 2VNKA 2R7VA 4KN7X 2DU9A 2M8GX 2M1BA 1K79A 2WJYA 5THXA 4B09A 1ULYA 5F6FA 3PFIA 5HXBA 3KZIC 1D0YA 5L3BA 4YAFA 2CQ7A 2NXNB 2TDXA 5DDGA 1C0WA 4OMYA 4M9ZA 4OIPF 1WOOA 5DV5A 3AKZA 4AVPA 5E3OA 1TQPA 1OB5A 1FNMA 2ZL5A 5F0CA 5K5OA 1JXSA 1YI2B 5CDFA 1EFRA 4BE0A 3KP7A 4XBFA 2B7BA 2XPUA 5DEQA 1JE8A 4BXUA 4PC3A 1FSHA 3CP2A 5HLIA 2F4OB 1P4XA 2J5OA 1HSJA 2CQQA 3ASNH 4A93J 4L0YB 3WQZA 2HVQA 4PC7A 2VL8A 3E5UA 2WWYA 1QUEA 3AVWA 2PX9A 4MYUA 2VASA 2K3PA 3E6BA 3JTHA 1UD8A 2ELJA 1FWZA 3PO3J 3QAHA 2F1MA 1Z0XA 3BG7A 1G3TA 1JNYA 2Y69H 2VBYA 2DCUA 1XX5A 4ABZA 2Z16A 3CC2B 4ASUA 1X1DA 2LY2A 2W85A 3HKZN 5JBQA 3ECHA 4QPQA 1W2BB 3ASTA 1SAUA 2BY2A 2XAGA 5IT3A 1YOVB 3QQAA 3JQQA 1B8IB 2L02A 3H0GJ 5CKTA 1WJAA 2GPJA 2CYYA 3CJNA 4XKVA 4P96A 2ME6A 1APLC 1BW6A 2GK6A 4J01A 5D8KB 1TNTA 2CQKA 1BR1A 1V5GA 1RI7A 4CZZA 2D3LA 3EQLF 5GP9A 3JSPA 1UD6A 1QNTA 2HQAA 3M7GA 2HR3A 1UD3A 1VQ5I 1VFCA 2GXGA 3QP5A 1MH3A 5HOOA 4NQWB 3S2HJ 5IYNA 1USTA 4JBAA 3E1SA 3OFNA 2XROA 1SFOJ 2DJIA 1WHUA 3V8LA 1R5HA 3FMQA 2XPWA 2DOAA 3BTCA 4IHSA 3FKIJ 4OPSA 2O03A 1VQLB 5JHUA 4XD7A 4JMQA 1Z3XA 5TISC 5GPCA 1XSXA 3IRQA 3G71B 2P4WA 3BR1A 1E3HA 3ABUA 2E7XA 3NAUA 4IF4A 2B5OA 1KRHA 1IXCA 1FTTA 2EIKH 1MW7A 3K9TA 2GAUA 1Y8QB 1ETQA 2Y0SN 5E1WA 2ESHA 4DQLA 1NJID 1I50J 2XSJC 4UVAA 3CESA 4ZDPA 1WSVA 4HE6A 4N0BA 2RDPA 4WWCA 2AQEA 4RPDA 2M30A 3LSTA 4WXHA 5HNHA 2D1VA 1IDZA 3OIPA 1I6XA 4TMWA 2UUZA 3DF8A 3FPKA 2JJ7A 1Y0RA 1QZYA 2XRNA 4OU0A 1V54H 3T53B 2CV1A 2Y0SA 2EFPA 2E60A 2VBXA 4CCKA 4WWVA 2HDCA 1BM9A 1HW5A 1U8RA 2LF7A 4ZYHA 3BTLA 1E63A 1JHHA 2ID6A 3HOWJ 4YFXF 2KDZA 3OE7A 2XNDA 5BS6A 3CCVB 4B44A 1BI0A 3VNUA 4M9XA 3PIOF 3ISXA 3RZOJ 2MSYA 1F36A 1DP3A 1YTYA 3BJ6A 1WJDA 2BPOA 2OTLB 2QA4I 3LQEA 1I3AA 4GGGA 4OINF 1F60A 2V7UA 4B8XA 2R7WA 2BMWA 2R7TA 3ULQB 1TW2A 3Q38A 5J35A 5J3LA 4PUSA 3ZZTA 4DK1A 3EUAA 2ID3A 2XC7A 1CQTA 4QVJA 5ICFA 2B9SA 2XZLA 4EJUA 4E7ZA 3HSEA 1KK0A 5DCMA 3HG9A 4MGRA 2LDUA 3DKXA 1X3WB 2F4MB 1KQ0A 1IHMA 2QENA 3L2VA 2HQRA 2W57A 5LHHA 4RGUA 1U5TB 4RM2A 1YFHA 2XOKA 2ZITA 5TV2A 4FXUA 2ZFUA 1Z3YA 2CSOA 2BV6A 1I1GA 2M87A 4NUBA 1HSTA 2ZSIB 3F8BA 2LZJA 1NK2P 2R4GA 2OU2A 2R7ZJ 5IT9Z 2F5DA 1Y39A 3GVKA 4ZZDA 3DPUA 4BU2A 2Q1ZB 4YIIA 1HA3A 1HXDA 1VQ9B 2RQQA 3ZMTA 3FPPA 2JN6A 2JQ7A 2JRMA 3K69A 1W7PB 2A61A 1YW9A 2XAHA 4XK4A 2DIEA 2P7CB 4BGDA 4ZDOA 4QUZA 3PA1A 4PSXA 3MEXA 5ILUA 4UZFA 3CXCB 1QVFB 4XICA 2A68F 1S8NA 3V7CA 1JUSA 1HW1A 1MNMC 4CCJA 4ITVA 4BS9A 1R71A 1CF7A 3ZZ0A 1ORKA 2WA0A 2BYVE 1XCVA 1IRFA 3F8CA 2PMHA 1ZLJA 3W2VA 1S7EA 5JLWA 5CLSA 1CGPA 1PDNC 3OYAA 3F0CA 5B3SH 1IV8A 3K4LA 2JA2A 2BHZA 4HDVA 3N4MA 3OS1A 3JCUC 1NDHA 2F2EA 1TBXA 1FMVA 1BC7C 3DWLE 2P3MA 3G05A 3FHZA 3KP3A 3W2FA 2XEXA 1Z91A 1A36A 2R6HA 2BE5F 3M8EA 1I6HJ 1S72I 2KJBA 3K1MA 3O3KA 3V7AA 4JX5A 1SEUA 2IPQX 1SC7A 2HGCA 3K1PA 2XAJA 3ZMUA 4KDPA 3P9CA 3OSGA 3OYEA 4CA0A 1KD1D 2MFZA 3CUQC 3H3UA 5IYCJ 4N4NB 2R7RA 2O9LA 3NE5B 4ZH4F 1UB9A 4P1VA 2JA6J 1DPUA 2DQRA 1QX4A 4V2GA 2VPRA 2FJ1A 2CFXA 2M45A 2X1EA 4Z4UA 1VQNB 3VEPA 1E17A 3H9NA 3MZYA 3KZZA 4L9VA 5ICCA 2XB0X 4I0BA 4NBSA 3OYDA 1SFUA 3K1NA 3KP6A 1OLTA 2VONA 1W4MA 4EGZA 1N8RD 4WXDA 2LC2A 4O5VA 2VBSA 3H5NA 2D3NA 5GPAA 3TKYA 5J4VA 1FPQA 4BQOA 1VQNI 3PVDA 1XB4A 5M5YJ 2M34A 5FFXA 5C4JJ 1XSDA 2OBRA 1ITYA 1V5EA 4PDKA 1R5BA 2NPFA 3IAS2 3MKYB 4Y9RA 4L8JA 2C2WA 3RSNA 4ENKA 3HIFA 2NRAC 1GT0C 5M5WJ 3VDXA 2WJVA 4RB2C 1W9XA 1YLFA 2BY1A 4UY8I 2HOEA 3IH2A 1GO2A 2ZC2A 3V8KA 5HDKA 4RAFA 1EKEA 1FSEA 3L7WA 4EJTA 3HOTA 2VJJA 2DA3A 4HSTA 1D1NA 1ONVA 1H0MA 5FO0A 2E1OA 4RB1A 4C30A 1V3FA 2K9QA 3HPGA 2W00A 3COAC 1UD2A 4AF6A 2R7UA 2GJRA 2PJPA 4EM1A 4CH7A 3G2BA 4BE2A 3HOUJ 2JT1A 4R71A 3F8FA 5A89A 2EK5A 2M8EA 2ZZFA 3D1NI 3OY9A 2W6IA 1AA7A 1RKWA 1K28D 2FBKA 2EIXA 4LC0A 1VQMI 4C2TA 3KLOA 3E6MA 4ESBA 3L2WA 2K4BA 3QU3A 1FLIA 1LVAA 1MMNA 4MHGA 1X58A 4CQJA 4U88A 1W34A 3ZZUA 5J47A 2JMWA 3HZJA 2W1OA 3ZOBA 1B72A 1R9TJ 1FOXA 1GAQA 3NARA 3WU0A 1ZGJA 1WJBA 2YSRA 3BG6A 4OWRB 4UV9A 2KIFA 1YQAA 2JDIA 4ZJZA 1PUFB 4HYEA 4MQ9F 3DBHB 4DQKA 2HKOA 3CCUI 4IHWA 1KK2A 3GSIA 2L2OA 2D9RA 4PFPA 2NYXA 1UD5A 4B47A 1VQPI 2V4DA 3GVJA 2HKXA 1QU3A 1JUPA 4UXNA 3OS2A 1NTCA 2DT5A 2Z3YA 2X6WA 3CCMI 2BVNA 5FKLA 4G7WA 5IYRA 3NQOA 4Y4RA 2FNAA 1R49A 3DTIA 2H6CA 3QFTA 3GIRA 3FX3A 3MCZA 2F5FA 2R5ZB 5TY0A 3OZWA 3WBJA 2E7WA 5E3LA 2D1HA 1MJ9A 3I59B 4RDLA 1S9HA 4RD1A 1Y0NA 1O7FA 4LK0F 1U5TC 1K61A 2G9WA 4DNTB 3MCAA 5F27A 4U87A 2LKXA 4P6VF 2KISA 1T6SA 5KNLA 1G7CA 3W5HA 4FASD 2AS5F 3L2RA 2NVYJ 4P3YA 1P9QC 1OCPA 3BP8A 2ZJRF 1AKHA 1QA6A 1CNFA 2Z33A 2MG4A 5L3GA 3KYDB 2BGIA 3LSMA 2LOOA 1FEXA 1WTHD 4A3JJ 3ASSA 3BJOA 4BQQA 4LOCA 3A0HC 3WG7H 1B1BA 1QQIA 4E7LA 2ZJPF 4NHJA 2HYGD 2L7MP 3BZKA 1VQ7I 1XQBA 4M6YA 3QFSA 1FRNA 4IJAA 1Y1VJ 3L1PA 1P7JA 3RPUD 1N77A 4N3NA 5K5RA 3S32A 2MH9A 3RPUA 4HNVA 3DBRB 4ENMA 3BCFA 2KQRA 2NOGA 4KN4X 2DDAA 4NC7A 2IVMA 2ECBA 5D6FA 1GUUA 3NEUA 4EGYA 2CH0A 2VOPA 2R5YB 6PAXA 3T5XA 3IAM2 3GYHX 3OYHA 1NB0A 3OOCA 4PJ0C 2ZL6A 4GXOA 3T51B 4AC9A 1JGGA 5AONA 4NCNA 1DU6A 1K7AA 4Z4VA 4CCNA 4CO8A 1ON1A 1SD5A 1R36A 5L3FA 2CRGA 2WC2A 4JX4A 4TKOB 1VQ8B 2C78A 3BCAA 3A03A 2VE8A 3O6BB 3MWMA 3QODA 3E6DA 2V7WA 2F48A 1J09A 4AIDA 4A3MJ 1MMDA 1O3SA 3UNGC 1B9NA 4RDJA 5BSYA 2K9SA 4YAUA 1VQLI 4LFUA 2A6TA 4BJ5C 4UZEA 2DMPA 2XGJA 2XPVA 3KP4A 2PMUA 2V9VA 1LDJA 1ZLKA 2VC0A 3AGPA 1QZZA 3K4JA 5IYQA 2AQFA 2BHYA 1N08A 2EV6A 2JJ2A 1ERDA 4UZUA 2EZHA 4PCQA 4PFOA 3J81Z 3A1YA 4L0ZB 2PN6A 2IS2A 4LBYA 3B82A 4TMVA 3J80K 1RZ4A 5DM6F 3OP1A 2Q6OA 3VWBA 3HRUA 4TN1A 2X0LA 3WTUC 1DGRM 2FD5A 5E1ZB 3FMRA 2VKDA 2NNNA 2LFBA 2V1DA 1ZN2A 1SFEA 4DYQA 5JVTA 4OPOA 1QO0D 2PFBA 1AU7A 2W25A 1XD7A 3JAMK 1X3UA 5F0FA 4IQ4A 3PUBA 1FOKA 2EA2A 2DK8A 2DFHA 2EQRA 2YU3A 3AG2H 2H8RA 1FTZA 1E1RA 1GV5A 1NK3P 2LREA 1VF9A 1RR7A 1T8IA 4UB6C 1E0EA 3GFMA 5DUIA 1IG7A 3GTPJ 4LIVA 2V7QA 4CYCA 1FYLA 4Z6YA 1XFOA 4B3FX 1WWXA 2HNHA 2BM1A 4E0FA 1NG7A 2A69F 4V19K 3RY8A 2GJPA 4KT5C 2CUJA 2QVOA 4ZZLA 1OJLA 3HTSB 4DIQA 3IWFA 1H9TA 2QA4B 2X6OA 5F1JA 3JU4A 5KK1A 1B2RA 1OFCX 3TDZC 5J6XA 1P4AA 5FO1A 1FBSA 3CCVI 4AC0A 4A0ZA 1O4XA 1MMGA 4A3CJ 4ZGNB 3PQJA 4LB6B 1QVUA 1VF7A 4QFMA 4RA2A 2VXDA 5JHFA 4AIJA 2LBFA 2QKMB 4FTHA 2JTVA 2KLOA 2X48A 1AWCA 1BIAA 2Q2EA 4RD0A 4E6KG 1PJ6A 1RQRA 2CC2A 3FXUA 1YJWB 3W3CA 5DN6A 3K4BA 4HW0A 1KQ8A 5D5UB 1A6QA 1V4RA 4CHUA 1YJ9I 1MMSA 1JA0A 3GBGA 3H9JA 2GK7A 2YU9J 2VI6A 3WBKA 3OIOA 2OBTA 3L2QA 3DLAA 4HNUA 1LEBA 2GOXB 1OGJA 1QPIA 5TR9A 4YFNF 3SKBA 1X1CA 2GA1A 1RR8C 2BGJA 2ZL7A 1VQMB 3U9GA 4NDLA 1D0XA 3LOCA 2PMZN 3WNDA 5LGTA 2DOGA 3CZ6A 1HKSA 1X3ZB 3DQVC 1EP2B 3O8GA 3QYFA 4B1RA 3JAMZ 3CMYA 2ZB9A 3F22A 3PENA 1YITB 1EA3A 4PZJA 2YWGA 4LIUA 5A2QZ 3EETA 2VJ4A 3WTTC 2X4HA 2OBPA 2ZJQF 1K6YA 1OYWA 3R61A 1Q82D 3U6KA 4CZCA 5LFAA 4KKTA 3J7YJ 3G1LA 3WNBA 3SDBA 3GTGJ 2COMA 1KU3A 2E1MC 2IGOA 5BMZA 5HS7A 4UVBA 2PJRB 3ZP5A 1U0JA 2GIVA 4C3IJ 4W97A 4RD6A 1S5LC 3DU6A 1H8AC 1ZM2A 1VHEA 3CRZA 1IO2A 1XDUA 3WG9A 2XSDC 4I02A 4G94A 2ZTNA 3Q39A 2NVUB 2V9KA 1YJ9B 2X6XA 1I5ZA 3SZTA 2DMTA 3SQNA 3ASPA 2Y0MA 2EBIA 1QPMA 2HI3A 4E7KA 4WQMA 2H94A 5LRSA 1OKRA 3A2KA 1IN7A 3JQRA 3OZVA 1OB2A 5M3FJ 4M72A 3GXOA 3CP8A 4Z4RA 4ZCMA 2R7FA 4OAYA 1L0OC 2CFOA 3H35A 2CW7A 4TMXA 5TJJA 2DO7A 5HODA 1T98A 1KZLA 4IVNA 4M3EA 5CVVA 2E5ZA 1AHDP 4HX4A 2KFDA 3S1RJ 4DW6A 2O8KA 2DT6A 4DNCA 1N06A 2BBYA 4XM3A 1P4MA 4JX6A 2O6GE 1VLYA 2FA5A 2MBFA 3KLNA 1A5JA 5B66C 4A6DA 3OYJA 4A0XA 4Y33A 4L9TA 3ZR8X 1FC3A 4FE4A 1GR1A 1OR7A 1DG1G 2NVTJ 2W84A 3JW4A 1Z9CA 3DDYA 3LVBA 3ZQIA 2DAOA 2XGCA 2PMZA 4IHTA 4Z4ZA 3DEWA 5L46A 2WY8Q 2HPMA 2ZZGA 5CVRA 3OOPA 2NS8A 5JR3A 1YG2A 2VKHA 1YRNB 2R5YA 4OMZA 4KIFA 2F4NA 5ED4A 4ZCIA 1ZHFA 4RS8A 2BXZA 4MIMA 4K2EA 1G3YA 4DZJA 2F1LA 3HEFA 3KIOA 3LA3A 2RAEA 3GVLA 2M2EA 2G7HA 2LD5A 2OC6A 1ELOA 4L18B 3WTWC 2PJRA 3HOYJ 4D1QA 2L7FP 2CJJA 1SFKA 2VYQA 2EZKA 3OL4A 4A3KJ 2DFFA 3EUHA 4XLHA 1JT6A 1TC3C 3B6AA 2HVSA 4IHXA 1G3SA 3U6BA 1Z05A 1T56A 3R60A 2LVSA 2P5VA 3MMYB 3DEUA 5FRMA 1MGTA 2YR2A 5JFRA 4AM3A 1IN5A 3JRDA 3M1CA 2KZGA 5H6RA 2D45A 1YX5A 2M5SA 2A6EF 3DPLC 2ISYA 1B4AA 4LK1F 3H5RA 4HA8A 2HZTA 4XN3A 4IO9F 3JRCA 2FXAA 3A1PA 5EYRA 1G3WA 3CCJI 3KEQA 3FF5A 1UZCA 1EP3B 1ETWA 1GAWA 5FNZA 1N05A 3FKJA 1Z7UA 3QPLA 1ENHA 2E5NA 2WYRA 2DT7B 3WHBA 4BDZA 2LRDA 3GTMJ 4Z4TA 4XOTA 3E97A 1GVJA 1NBMA 4Q47A 4NC6A 1QGYA 2CW8A 3GFJA 2XV4S 1MBEA 1EH8A 3VOEA 1K4TA 1YE9A 1JKPC 3I1FA 3EDPA 3ZQFA 5CVJA 1L3LA 5HLHA 1EXMA 4XKCA 5J1UA 1R4MB 1JTYA 1WQ2A 2MYSA 2PEXA 3BZCA 1EJ9A 2Z1DA 1BI1A 5D4RA 4OIOF 1ZGAA 3D5SC 3FXOA 1LFPA 1ZELA 1YLOA 3CUQA 3GZ5A 4IHVA 2YWFA 3G6EB 3BG5A 1WGXA 1MJBA 4I0AA 4RB3C 3IRRA 4HF1A 4QTRA 3NWTA 1IN4A 2RQPA 2YX4A 4EMSA 3JREA 1F4KA 2GXAA 1WPKA 5GAGJ 4RLZA 4LMYA 5ILSA 3G71I 2ACJA 2VQLA 3FBNB 1R00A 2UWMA 4CCMA 3I4NJ 1DU0A 2EIMH 2FU4A 1Z1DA 4HG2A 1OYYA 4JK1X 4ON0A 3F6VA 4MFEA 3CCEI 5FB2A 3GLXA 4X6AJ 2HFHA 3HSRA 2L54A 2XGEA 4DYRA 2HYJA 3GZNB 4AF7A 1UCRA 3O2PE 2F5EA 2FF4A 5FLMJ 2OF7A 3DTKA 3VYUB 2HTSA 5B5EC 3F23A 4XL9A 1J0RA 3G4SB 1UMKA 2ZNZA 4OAZA 3ZQQA 2DJNA 3HUGB 2VKEA 1N0VC 4XNFA 2QSFX 2CU7A 2X85A 4F7DA 4EH1A 4O3MA 1D1BA 1UG2A 1BOBA 3VPRA 4G5GA 4C0SA 5EGOA 2Q0OA 3QFRA 3SJPA 3M9AA 5FLXZ 4LITA 4D7MA 2KT0A 4FX0A 4XLFA 1UFMA 4QHYA 2ZNYA 3U2RA 3A02A 2KZVA 1JUMA 3BY2A 3CMAB 2HOAA 3LQQA 4KKSA 1K6OA 5FGMA 1PYVA 2ZSHB 1MDMA 1K73D 3CMMA 1D1AA 1KQSB 3KX2A 4FE7A 3QPHA 5E18F 3BWGA 1RQPA 1OCCH 2STWA 1KJZA 3HYIA 2R7QA 1WH5A 3OOUA 3CMEI 1VQ5B 1VQ6B 2BXYA 4HX7A 5FFZA 4LLGF 2DMNA 3B6CA 2XGDA 2B7CA 2ZMEB 3OJXA 4QPOA 2E1MB 2WAQA 2WV1A 2XAQA 2ZZEA 3SLNA 1MNDA 1T2KA 3JSOA 1P2FA 3C2BA 3AL0B 3QOPA 2PI0A 2OK7A 3CDHA 4Z2YA 1FYMA 2DDBA 3DCFA 5FIUA 1G6NA 3BR2A 2EPFA 4IRIA 5DSZA 1R1VA 1IRXA 3HUGA 2LH9A 1R58A 2JVHA 1JKQC 3I5UA 4I98B 4P2NA 4I99C 1FBQA 5GTIC 3T56B 3PJRA 1DUXC 3LNQA 3FISA 3HOZJ 3HTUA 1VQ4B 1XC5A 3GW2A 4GYIA 2H8WA 2QN6A 2X8KA 1YO5C 1IRGA 4OOSA 3TO7A 3X2QH 3B78A 2A6HF 2OCEA 4P26A 1VLOA 1LDKB 1B9MA 3D26A 3CPWB 3GWZA 4PC1A 1XE1A 3LSPA 2P6TA 2M4KA 1KU9A 1VTNC 2EILH 4P3IA 3F8MA 2FVGA 3HM5A 4Z4SA 2KL4A 2ESNA 3SFZA 3P9KA 4P55A 3ABTA 5HZAA 2A5YB 3Q0UA 1LDDA 4DJAA 3QYBA 4ZCLA 3GTLJ 3QSYA 5EG0A 3R6SA 4ESFA 3OV8A 4C43A 3LA2A 4U7BA 2P7VB 1WZ2A 1YIOA 3A8IA 5LHGA 2V6EA 1I18A 2Y9ZA 4NC8A 1WORA 3C1DA 1TNSA 5CJ9A 2H27A 4Q48A 3JRGA 5GAHJ 3FMSA 1WOSA 4Y9UA 3U1DA 1K9MD 5ICGA 2CG4A 2JVGA 4D5CA 4CYDA 4KA4A 2KIQA 1N25A 4QIWN 3B8HA 1UHWA 2QQBA 5F0HA 2IEKA 2PQ8A 2M9HA 2R7XA 1VQ7B 2QWWA 2VQGA 3ZMVA 2LY1A 5CYVA 3SEQA 2Y2ZA 4EQQA 4A5MA 2EFOA 3NRVA 3ZIAA 4LGWA 4ROXA 4WX9A 1BPLA 3C2HA 2CUEA 5TRDA 2W82A 2DI3A 4PJMA 4U0WA 4YIFA 2R7SA 5DUKA 2NAZA 1VQ9I 2Q2EB 2F5CA 1BOAA 3BG9A 1T6YA 3GEZA 2V7XA 3KL9A 3OEEA 3G6EI 4CYCB 3G1OA 4KFCA 2JUCA 5BOXA 2VBTA 2QE7A 1KMHA 3BPXA 4HPQA 2CUFA 1P7IA 5HNFA 2K5CA 2LR8A 4W1UA 3DTEA 3CO7C 1W5TA 1IW7F 2HPIA 1S0UA 3MHPA 1EH6A 2IA1A 2OPTA 3OYLA 5AN9A 4B4CA 4MQVA 4YXWA 4Q4ZF 1IB0A 4L5IA 3QE2A 2QBYA 2DA5A 3H9QA 4EM0B 1YITI 4BHPA 3RQIA 3PNTA 4A6EA 2I10A 3JRHA 2CW5A 1UG0A 3TO6A 2DY1A 1I7PA 1XGMA 1X1BA 1E62A 5HLTA 3OAAA 5F4MA 3WE2A 1JJ6C 2ZKZA 3I55B 2DMQA 1O7LA 2F43A 1HCRA 5H2FC 4P22A 3W2HA 1T0FA 1TWFJ 3WTXC 2E1NA 2QGUA 1ZM4A 1I3QJ 1LE8A 5JVGF 5D4SA 2ECCA 3KP5A 3KE2A 2XZOA 1J9ZA 3FBIB 3IHUA 3ABMH 1O3RA 1GXPA 4DGWB 1XGOA 2V7FA 2KPMA 4I01A 1TL8A 2HCJB 2VBVA 4WZTA 3F6OA 3KEOA 1S4MA 1MD0A 2DQLA 2DPUA 3OR1C 2L5QA 2MC4A 4UAJA 3EPZA 4OOXA 2FBHA 3GZ6A 4X7FA 2HWVA 4XLAA 2PLYA 2RN7A 4LLLA 4IQJA 3J7AY 1ETOA 2L4MA 4KITB 2OQGA 2DOFA 4AYBN 3PM1A 1E3PA 4ESJA 3IH4A 2Q6KA 3LSHA 5K1YA 3S1QJ 5GADJ 1DDGA 2BOLA 1B8IA 3I9V2 4A3LJ 1IN6A 4TMTA 5EEAA 1FNNA 1X4PA 2OCCH 1V0FA 3CC4I 3CD6B 3VB2A 2VQCA 4U9UA 4H9GA 2L9SA 4PGGA 2C77A 3DBLB 3S3MA 4NBQA 2FEZA 3VNVA 3LSGA 2HDWA 3IWZA 1OCZH 3LFKA 5FKMA 2EV5A 3RIRA 3H3VK 1TWAJ 1J2XA 3ZN0A 1Z77A 1S72B 2QMUA 4J19A 3OS0A 3WY9A 1W0KA 2GJKA 3W2IA 3GLLA 2DOEA 3W6KB 2ICWG 3FXMA 3TBIA 5HDNA 4RM0A 1TVCA 2JPBA 2FOWA 3FJOA 1OISA 5D5WB 2ELHA 3G3ZA 3H9GA 3K70D 2NNYA 1FRQA 2MW8A 2X51A 3AAFA 2FE3A 1YJWI 2IP2A 3CCRI 2P0WA 3MQ0A 3ZQCA 1TTTA 2Z5UA 2EFGA 1M90D 1IJWC 2LY9A 2E2HJ 5FD6A 2XF6A 3PUMA 2JJ1A 2A07F 2Q6LA 4GYGA 4M6VA 1F43A 3ML6A 1NG6A 2NVXJ 2FRHA 4LG0A 5IP9J 4G12A 2XAUA 1RESA 2Y31A 3SDGA 3HOXJ 3QPSA 1JKOC 4AIHA 1DDIA 3CW2A 1G7TA 3AVTA 3R6JA 2UV1A 1R5OA 4A5NA 2XNCA 2E1CA 1I27A 3FM5A 5KW9A 3DKWA 1MH4A 5IY5H 1D1CA 4CCLA 3SEZA 4UUTA 1SD7A 2VBZA 3HC7A 1FY7A 3IH3A 2ZCWA 1T33A 2WSSA 4G6TB 4PGOA 1U5TA 4G7ZF 1VNDA 3RPQA 4BBSJ 2BVMA 3S14J 2DK5A 2QTZA 4HIZA 1E3ZA 4DYCA 1BX0A 3Q3SA 3CMAI 4JYKA 1MSEC 1U6GA 3IP4B 4OP7A 4IHYA 5FLVA 3SYTA 1WH7A 4C3JJ 1WCMJ 4KUMA 2JIZA 3BCDA 1V5FA 3IUOA 3G1MA 3J81K 2HU9A 1BR2A 2M0CA 3AG4H 2ZMEC 3Q6RA 4TV7A 4FETA 4UUSB 2B0LA 2KIUA 4BACA 5A2QK 2DMUA 5EEHA 2DA1A 3LWFA 4LB5A 2KRHA 1WSUA 3MAJA 3RKXA 2OTJB 2KDOA 1BBYA 1ZRCA 4BKXA 1HF0A 1BR4A 1O3QA 2R92J 4KISA 3M8FA 2XIGA 3I4MJ 3HGGA 2OAZA 2X3UA 2IJLA 1W7PD 1J75A 5FKKA 4FQGA 3KFWX 2Y30A 4JOMA 2IBDA 1N0UA 1FX0A 2DCEA 3B73A 1JT0A 3DKYA 2ZJ2A 2XKOA 1W5SA 1VI0A 3LQRA 5CQGA 1Q86D 3WTVC 2CQNA 2V31A 3GVAA 3I0TA 4XRFA 5FKOA 2BN4A 4OOVA 4G1VA 1IXSB 4BBRJ 1WI3A 2YX7A 2ZXWH 4D9JA 1KK1A 2A05A 3ASQA 1F20A 3GTJJ 2V1XA 2ZXJA 1G2HA 1WRJA 2M0MA 2LP0A 4RLFA 4B3GA 3GTQJ 1BW5A 2OZ6A 2V1UA 1T08B 1FNBA 2Y48A 3E7LA 2WZPP 4OIQF 1RPWA 3FXQA 3CD6I 3CC4B 1OR7C 2IA0A 4CDGA 4CSWA 1HW2A 1D0ZA 2K02A 4UVCA 2ZBVA 2MLKA 3ONQA 2QZ8A 1V0EA 1WP6A 3TEDA 3HRSA 3AG3H 3L2UA 3QFCA 4EJWA 1ETXA 3RKYA 2Y9YA 2WY7Q 3TOAA 3BQJA 1TLHB 3F8NA 4P1WA 2CWEA 5DCFA 4U7DA 1Y6IA 4WCGA 3GFIA 3K6GA 3ONUA 4ENJA 5K7ZA 1SANA 3K2AA 1HKTA 3CPXA 5F4JA 3OW7A 3CCSB 3T0YA 2ADUA 2LYCA 3L2CA 4F7ZA 3OJWA 4P6YA 2K9MA 1QG0A 2IS6A 5FLXK 1QH0A 3TW6A 2DYSH 4I76A 4K1XA 1VQKB 1H42A 1ZRFA 2HDNB 3JTGA 1QFYA 2QDXA 3A3BA 3I4PA 3FXRA 1B72B 2GREA 5A8AA 4A2UA 1UHSA 2KMUA 2I5UA 3I55I 3WNCA 2PBIA 3DEEA 4D7NA 1B23P 3K0LA 4RCZA 1IZ1A 1FMWA 3BY6A 2JUGA 3WGGA 1MBHA 1ETYA 3ZMZA 4HQEA 4M53A 2JSPA 3RCOA 4BEHB 2CV2A 3P27A 1DQUA 2JZYA 2FUG2 4II2A 2MH2A 2VB6A 4BJTA 2L4AA 3KYLA 3HOSA 1YX2A 1BX1A 5FKNA 2ZO4A 4KIGA 1Y1WJ 3BPVA 1Z7LA 4M74A 4E7HA 3U1KA 2FX3A 3LO8A 5EDNA 3DLLF 3HPHA 3OYCA 1WVRA 1O3TA 1W87A 1OCTC 5IP7J 4ASNA 1YI2I 2AXLA 4ZDLA 1BJKA 3MKWB 4UUVA 1LE8B 3K70C 1W35A 1TLLA 3R0AA 4P25A 2DW4A 2QUFA 1FT9A 1SMYF 3AG1H 4J00A 2C5BA 4X05A 2K3FA 3IKVA 1PJ5A 2QEXI 3I53A 1TT5B 4HLXA 3VODA 4G6DA 3WU1B 1TP4A 5DS9A 1PJ7A 1YRNA 1Q7YD 4A12A 4CGZA 5J8CA 1XGSA 1X4OA 1YS6A 3BCBA 3OR2C 1LFUP 3CCQB 1YJNB 4BXXJ 4HEA2 5HZBA 1GVHA 2JA8J 2FQ3A 4DBRA 2VJ5A 3H5AA 2P8TA 3VO1A 2XHKA 3BG3A 4A3IJ 4FN5A 4RGSA 2B7EA 2R5ZA 1PKVA 3CJQB 1SKYB 4CCOA 2BW3B 1XG1A 3OYFA 3V76A 1YIJB 2LTPA 1HQCA 1WKMA 4RGRA 4C9YA 5HS9A 3LSKA 4DQ2A 4XRSA 1XPXA 1BN5A 3A01A 2MA3A 3AFHA 2VUMJ 4E7SA 3ZQHA 4WXCA 1Y8RB 2Q6IA 5CPRB 1MSFC 1PVEA 2MD0A 4MFDA 2X9DA 4N4OB 3ROUA 3K2ZA 4IRHA 3CDIA 2ZXIA 4E70A 3I59A 2EFWA 1XB2A 1J7KA 2VKVA 3BZ6A 4UUSA 1YYVA 2JRTA 3GMEA 4HSRA 2IAIA 1VQ4I 4HE5A 4A3GJ 4I6ZA 4II3A 2VNJA 5F64A 4D5FA 2X1CA 3TOBA 1ZR2A 1XN7A 4ZTJA 3ZMSA 4AIKA 2VT3A
chains in the Genus database with same CATH topology
1LB2A 1YW8A 3TGNA 5AIPA 5D5XB 1S3JA 1PUEE 3HHHA 2D2WA 4Q5SF 5DD4A 2XGXA 4XSZF 2MD5A 3CO6C 5HLGA 3P7NA 1FBUA 5FO5A 2RVCA 3RTRA 3ZUGA 4G6QA 1ZRDA 2EV0A 1MZBA 2HTJA 5FD5A 3D5LA 1O57A 4RGXA 4MNUA 2QM3A 4MEYF 2YPRA 5LGUA 1D5VA 2OZUA 4M71A 4P9UA 5EEGA 3E3VA 2IW5A 3I58A 2CO5A 3SZPA 4XSXF 1ZARA 1JGSA 5E20A 3N97A 4RAZA 2LKPA 2KIMA 3DP7A 1BIBA 1LEAA 2EJRA 1S7AA 1ON2A 2ETHA 1XMAA 2FMLA 2HYFA 3Q9VA 4S05A 1F1ZA 1RUNA 5HS8A 1J59A 3LAPA 4N9IA 3BROA 1T6ZA 1RUOA 2UZKA 4H0EA 5DYMA 3E6CC 2EFNA 3T1BA 1PP7U 4UHTA 2O3FA 2MLGA 2JSCA 5H6QA 3F3XA 4ETSA 1I1SA 1OYIA 2ZFWA 4HF2A 1KU7A 1NB9A 1LNWA 4Y17A 1Y0UA 2QBYB 2L3DA 5DD8A 5AIQA 4N9HA 2K4JA 4HV5A 5E8GA 1BI2A 3I71A 3DFGA 2QQ9A 3HSFA 2RGVA 3V8JA 5LLQA 4BQAA 3QP6A 4RB0A 1R1TA 3BDDA 4PGHA 2GZWA 4UV8A 3ECOA 3GF2A 3SHFA 2IRFG 5LGNA 1REPC 3ISPA 3B02A 4HOBA 1ZG1A 3C18A 3G73A 2RC4A 2ZMEA 3GO5A 1WI9A 2FBIA 4KNYA 1LJ9A 1CF7B 1Z6TA 4CXFA 2X0KA 3RKWA 1ZG3A 1UHMA 2OD5A 2VE9A 3GFLA 5ILVA 4NB5A 4L5JA 3RYRA 2HS5A 1XGNA 3C7JA 2DLLA 4KYWA 1MJAA 4L9JA 4LJZF 4NQWA 3S2WA 5JI6A 3HRMA 1T6XA 2P6SA 3KZYA 3WTZA 3ZQ7A 5DCMB 4ZYEA 1HKQA 2GQQA 3T8TA 2STTA 3V7SA 1ODDA 1B59A 3J80Z 2VXZA 4ZYGA 1IN8A 1QBJA 1IAWA 1FYKA 1KA8A 2BEOA 2RNJA 3L9FA 1KGSA 4HF0A 2Y75A 4M9SA 1YS7A 1T39A 2OQRA 4HV6A 3QRFF 4U0YA 2XVCA 3CUQB 3WTYC 4FHTA 3GX4X 3MZHA 2J5PA 4BH9A 4EM2A 1ZREA 2RV8A 2LNBA 3V4GA 1JHFA 1D3YA 4A0YA 4EVIA 5BQTA 2DBBA 1N07A 2V6CA 5K5QA 2NS0A 1IUYA 5LHIA 2K27A 3F72A 4BAYA 4Y13A 3F21A 3Q9SA 5E8IA 1RNLA 2ISZA 2IT0A 2VC1A 3KCCA 2A3SA 3WGHA 5HVQC 2H09A 1B6AA 1XDSA 3RYPA 1XCBA 2I1LA 4P9FA 5D6EA 4KMUX 1R5GA 3RJPA 2WV0A 5BPDA 1QGPA 1R22A 3DV8A 1IF1A 1DPRA 1P92A 2H6BA 4L9NA 2Z9OA 1SFXA 3R0JA 4M73A 3IC7A 4LLNA 5D8LB 3ZPLA 4UNOA 2M5WA 2O61A 4R79A 1FZPB 5LBQA 4OOIA 2P5KA 2ZBKA 1GHCA 1T38A 3HRTA 3DXJF 2P5LC 2FMYA 4GCVA 1MRZA 1YW7A 2VBUA 3WTSC 4I09A 2IA2A 5ICEA 2R7DA 5E17F 2Q8KA 3R4KA 4XLPF 5L3DA 1FP1D 5IT9K 3KETA 3MFKA 2XASA 1SAXA 1EV7A 4WF2A 1TTYA 1BI3A 3BNWA 5A88A 2LSOA 4IRGA 3T8RA 3FZVA 3QU6A 3LAJA 4FX4A 3RDIA 4QLCU 1STZA 1ZYRF 3M1EA 3ZMDA 3VFZA 4YG2F 1H9GA 1BJAA 4QWQA 1DP7P 2FSWA 1TQIA 3DPTA 5BPIA 4KICA 5LEJA 2C6YA 4LD5A 3REOA 3J7AO 2GWRA 1Z6RA 5F1RA 1KU2A 2L01A 4EJOA 1HBXG 1MKMA 5LEKA 3CLOA 3W6JB 3L09A 2BGCA 1A04A 2K7LA 2CW0F 1S6LA 1D8KA 2V79A 1ZAOA 2CGPA 2DTRA 3EYIA 4BHBA 2O8XA 4HDUA 1S7OA 3SXYA 4MTDA 4YFKF 2QYOA 4JQFA 2EA4A 3ERED 5E1XA 1TQMA 1KYWA 4HAMA 1IXRC 5HDGA 3IL2A 4HBLA 1K78B 4I2OA 3EYYA 2G7UA 4HZFA 3RI4A 2EFQA 1KQ9A 4R1HA 3LA7A 4WK8F 3CUOA 2VT2A 1FP2A 3D0SA 5L3EA 4MTEA 3GUDA 3E5XA 3FWEA 1Q9SA 2EWNA 3WE3A 1TW3A 2KRFA 2XKPA 2OYNA 2JPCA 3I54A 4O6JA 1DDNA 5BOXA 3BJAA 3BOQA 5H20A 2LF8A 3CTAA 3H92A 4AD9A 2KJCA 1P4WA 2XAFA 2WTEA 1XMKA 3E5QA 3Q5FA 3WGIA 1J9IA 3QPTA 2DPDA 2HEOA 3IKTA 4BYYA 1R1UA 1GXQA 2UXNA 4Y15A 4OIRF 3KP2A 2DFIA 1E2XA 4MEXF 1BC8C 4BNCA 4ZYDA 4I7HA 1P6RA 4G7HF 1Q1HA 2VOOA 4XLNF 4FT8A 2OA4A 5J8FA 2PG4A 4M6XA 4U0VA 5KVRA 2UXXA 2FOKA 3HHGA 2GA2A 1EH7A 4G8XA 1R7JA 1U2WA 4HX8A 1W7PA 2XUBA 1FX7A 4R8HA 1G4DA 1ZG5A 2HQNA 3TQNA 4P5OA 1LQ1A 3I64A 4G7OF 3TDUC 2MC3A 1ZH5A 2VN2A 1RIOH 1SD4A 1D8JA 3V7RA 2EB7A 4HQMA 4EV0A 4IPAA 1U78A 3TO9A 2GXBA 1R23A 4GO1A 2VBWA 5ERIA 4HLYA 1AOYA 2FNPA 3FM3A 5D5VB 4KIBA 1MDMB 2VODA 2O0YA 4BHCA 4D0PA 1XSVA 4ENNA 3ZN1A 2QQAA 3ELKA 1F5TA 3WODF 1KYZA 1OMIA 3H3ZA 5L3CA 4CICA 2W24A 1SMTA 4EJVA 3L00A 4KMFA 2RKHA 2KKOA 1USSA 3P9IA 4AWXB 1J5YA 4LG0B 3PQKA 4IXAA 2QLZA 1S29A 1K78A 5LRRA 5CVIA 5CVUA 1NHAA 1PP8F 1SD6A 3C3WA 1F9NA 1U3EM 2Z99A 4G9YA 2R3SA 4S04A 4RAYA 1OPCA 2K86A 4KN7X 2DU9A 1K79A 2M1BA 4B09A 1ULYA 5F6FA 3PFIA 5L3BA 2TDXA 5DDGA 1C0WA 4OMYA 4M9ZA 4OIPF 5DV5A 4AVPA 1TQPA 5K5OA 1JXSA 3KP7A 4XBFA 5DEQA 1JE8A 4BXUA 1FSHA 5HLIA 1P4XA 2J5OA 1HSJA 4L0YB 2WWYA 3E5UA 3JTHA 3E6BA 1FWZA 3QAHA 1G3TA 2VBYA 2W85A 3ECHA 5IT3A 2XAGA 2L02A 2CYYA 3CJNA 4P96A 5D8KB 2CQKA 1TNTA 1RI7A 4CZZA 3EQLF 3JSPA 1QNTA 3M7GA 2HR3A 2GXGA 3QP5A 5HOOA 1USTA 4JBAA 2XROA 3V8LA 1R5HA 3FMQA 4IHSA 2O03A 5JHUA 3IRQA 1XSXA 2P4WA 3ABUA 2E7XA 4IF4A 1IXCA 3K9TA 2GAUA 5E1WA 2ESHA 4UVAA 4N0BA 2RDPA 4WWCA 2M30A 3LSTA 4WXHA 2D1VA 1I6XA 3DF8A 1QZYA 2XRNA 4OU0A 2EFPA 2VBXA 2HDCA 1BM9A 1HW5A 1U8RA 2LF7A 4ZYHA 1JHHA 4YFXF 5BS6A 1BI0A 4M9XA 1YTYA 3BJ6A 4GGGA 4OINF 4B8XA 3ULQB 1TW2A 5ICFA 4EJUA 3HSEA 5DCMA 4MGRA 2LDUA 1KQ0A 2QENA 2HQRA 2W57A 5LHHA 4RGUA 1U5TB 1YFHA 2CSOA 2BV6A 1I1GA 2M87A 1HSTA 3F8BA 5IT9Z 2OU2A 2F5DA 4ZZDA 4YIIA 1HXDA 3ZMTA 3K69A 1W7PB 2A61A 1YW9A 2XAHA 2P7CB 3MEXA 5ILUA 4UZFA 2A68F 1S8NA 3V7CA 1HW1A 1CF7A 2BYVE 1XCVA 1IRFA 3F8CA 2PMHA 1ZLJA 5CLSA 1CGPA 1PDNC 4HDVA 3N4MA 2F2EA 1TBXA 1BC7C 2P3MA 3FHZA 3KP3A 1Z91A 2BE5F 3M8EA 2KJBA 3K1MA 3O3KA 2IPQX 2HGCA 3K1PA 2XAJA 3ZMUA 4KDPA 3P9CA 3CUQC 3H3UA 4ZH4F 1UB9A 1DPUA 2DQRA 2CFXA 2M45A 3VEPA 1E17A 3MZYA 3KZZA 4L9VA 5ICCA 4I0BA 1SFUA 3K1NA 3KP6A 2VONA 1W4MA 4EGZA 4WXDA 4O5VA 2VBSA 3TKYA 1FPQA 1XB4A 5FFXA 1XSDA 4PDKA 4ENKA 3HIFA 2NRAC 4RB2C 1YLFA 2HOEA 3V8KA 5HDKA 1FSEA 3L7WA 4EJTA 3HOTA 1ONVA 1H0MA 5FO0A 4RB1A 1V3FA 3COAC 2PJPA 4EM1A 2JT1A 5A89A 3F8FA 2EK5A 2M8EA 2FBKA 3KLOA 3E6MA 4ESBA 2K4BA 3QU3A 1FLIA 1LVAA 4MHGA 4U88A 3WU0A 1ZGJA 2YSRA 4UV9A 2KIFA 1YQAA 4HYEA 4MQ9F 2HKOA 2NYXA 2HKXA 4UXNA 2DT5A 2Z3YA 3NQOA 2FNAA 2H6CA 3FX3A 3MCZA 2F5FA 2E7WA 2D1HA 1MJ9A 3I59B 4LK0F 1O7FA 1U5TC 2G9WA 1T6SA 2AS5F 3BP8A 2Z33A 5L3GA 3BJOA 1B1BA 1QQIA 4NHJA 2HYGD 4M6YA 4IJAA 5K5RA 2MH9A 3RPUA 4ENMA 4KN4X 5D6FA 2IVMA 3NEUA 4EGYA 2VOPA 6PAXA 3T5XA 3GYHX 1NB0A 4GXOA 5AONA 1K7AA 4CO8A 1ON1A 1SD5A 1R36A 5L3FA 2WC2A 2VE8A 3O6BB 3MWMA 3E6DA 1O3SA 1B9NA 4LFUA 4UZEA 3KP4A 2PMUA 2V9VA 1LDJA 1ZLKA 2VC0A 1QZZA 1N08A 2EV6A 4PCQA 3J81Z 4L0ZB 2PN6A 3J80K 1RZ4A 3OP1A 3HRUA 2X0LA 3WTUC 5E1ZB 3FMRA 2NNNA 2V1DA 1ZN2A 1SFEA 5JVTA 1QO0D 2PFBA 2W25A 1XD7A 3JAMK 1X3UA 1FOKA 2EA2A 2DK8A 2YU3A 3GFMA 5DUIA 1FYLA 1WWXA 2A69F 4KT5C 2QVOA 4ZZLA 3HTSB 3IWFA 1H9TA 5KK1A 3TDZC 5J6XA 1P4AA 5FO1A 1FBSA 4A0ZA 3PQJA 4LB6B 4AIJA 2JTVA 1AWCA 1BIAA 2Q2EA 3FXUA 1KQ8A 4HW0A 5D5UB 1V4RA 4CHUA 1LEBA 4YFNF 2GA1A 3U9GA 5LGTA 1HKSA 3DQVC 3JAMZ 3F22A 4PZJA 5A2QZ 3EETA 3WTTC 2X4HA 2OBPA 1OYWA 3R61A 2COMA 1KU3A 5BMZA 5HS7A 4UVBA 3ZP5A 2GIVA 1XDUA 3WG9A 4I02A 4G94A 1I5ZA 3SZTA 3SQNA 2Y0MA 1QPMA 2H94A 5LRSA 1OKRA 1IN7A 4M72A 3GXOA 2R7FA 1L0OC 5TJJA 2DO7A 1T98A 4IVNA 5CVVA 4HX4A 4DNCA 1N06A 2BBYA 1P4MA 2O6GE 2FA5A 2MBFA 3KLNA 4A6DA 4A0XA 4L9TA 1FC3A 1OR7A 2W84A 3JW4A 1Z9CA 2DAOA 4IHTA 5CVRA 3OOPA 5JR3A 1YG2A 4OMZA 4KIFA 5ED4A 1ZHFA 4RS8A 4K2EA 1G3YA 3LA3A 2G7HA 4L18B 3WTWC 3EUHA 1G3SA 1Z05A 3R60A 2P5VA 3DEUA 1MGTA 2YR2A 5JFRA 1IN5A 5H6RA 2D45A 2A6EF 3DPLC 2ISYA 1B4AA 4LK1F 4HA8A 2HZTA 2FXAA 1G3WA 3KEQA 3FF5A 5FNZA 1N05A 1Z7UA 3E97A 1GVJA 4Q47A 3GFJA 2XV4S 1EH8A 3VOEA 3EDPA 5CVJA 1L3LA 5HLHA 1WQ2A 2PEXA 1BI1A 5D4RA 4OIOF 1ZGAA 3CUQA 3GZ5A 1MJBA 4I0AA 4RB3C 3IRRA 4HF1A 1IN4A 2RQPA 2YX4A 4EMSA 1F4KA 4LMYA 5ILSA 2ACJA 1R00A 2UWMA 2FU4A 1Z1DA 1OYYA 4JK1X 4ON0A 3F6VA 5FB2A 3GLXA 2HFHA 3HSR