3CTAA

Crystal structure of riboflavin kinase from thermoplasma acidophilum
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
216
structure length
187
Chain Sequence
DQYYRAIKKIKEAAEASNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTVTKRGQILNITEKGLDVLYTEFADLSRILAIKNNVVITGTVTSQYIIQFQEKLGIIPYLNIKVDQASLPELRKIRGFRGIHIEGFKTRTFGSVKAFPAKIQNIPCFVIMPERTVYTDVIEIISDDRVSVEVYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Riboflavin kinase
publication title Crystal structure of riboflavin kinase from Thermoplasma acidophilum.
rcsb
source organism Thermoplasma acidophilum dsm 1728
molecule tags Transferase
total genus 56
structure length 187
sequence length 216
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ctaA01
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 3ctaA02
1H9GA 2RVCA 3WTZA 3LQRA 3FX3A 2DW4A 1O3RA 4O6JA 3CUOA 2JTVA 4M6XA 3Q9SA 4EJOA 3REOA 2YX7A 2L3DA 3NRVA 3M8EA 2FBHA 3BROA 4CICA 1O3QA 4ENNA 1XDUA 1TNTA 4RAZA 1TTYA 1O7LA 4HQMA 2K02A 2DQRA 1P2FA 5L3FA 1T39A 4FT8A 3EETA 2EFQA 3WTUC 5FD5A 1FLIA 4RB2C 4CYDA 3QPHA 2IA2A 2O0YA 4YG2F 4LMYA 3VODA 4HZFA 2MC3A 5D4RA 3I53A 3KZZA 1UCRA 1OPCA 3GFLA 4EJVA 4UNOA 1KYZA 5DV5A 1YYVA 4UZFA 4Q4ZF 1RIOH 1SMYF 1BI3A 4R79A 2ZJ2A 4KYWA 5DCMA 3IWZA 3QAHA 1LDDA 4ENMA 4PGGA 5BPDA 2L54A 1JXSA 3GO5A 3LFKA 3E6BA 4P96A 3VEPA 2QQAA 1RNLA 3FXUA 3MZHA 3ULQB 3C1DA 2QM3A 4DNCA 5CVRA 2UXXA 2O3FA 1LVAA 1N07A 1SD5A 1FYLA 5KVRA 1B4AA 2DU9A 3R0AA 5J6XA 2ZKZA 2NYXA 4KNYA 2VBXA 5FLXK 4U7DA 5A2QZ 4CGZA 3MZYA 1D5VA 2QENA 1I1SA 1LNWA 4U88A 4LGWA 4YIFA 1STZA 4I98B 2X4HA 3KP5A 4A0XA 5FB2A 3WGIA 5DYMA 1IF1A 2DPUA 5ICCA 4OU0A 5BQTA 5J8CA 2P4WA 5HDGA 3F8MA 2EFOA 4RGXA 2VBYA 2QZ8A 2RDPA 4GYGA 3E97A 2DLLA 2VC0A 4I0AA 2P3MA 4RB0A 1IXCA 1YFHA 3FM5A 4BH9A 2CYYA 3KP7A 2ZMEB 1L3LA 3DF8A 1GVJA 3EYYA 3ZP5A 3OV8A 4EQQA 3I5UA 4G94A 1R1TA 3V7CA 3F8FA 3IHUA 3M1EA 1XSVA 4YFXF 2LF7A 3FZVA 3ISPA 1D8JA 5LGTA 3ZN1A 4R1HA 4Q47A 5A88A 1LDJA 1YW7A 1Q1HA 3HIFA 1R5HA 1B59A 3IRQA 4ZZDA 4MEXF 1ZYRF 1QPMA 5D8KB 1IN8A 3V7SA 1UHWA 5HS8A 1R36A 1GXQA 5HLIA 1ULYA 4WF2A 1BJAA 1MJ9A 2BYVE 5ILVA 3CUQB 1P92A 3SQNA 3I58A 2XGXA 4MHGA 3ML6A 1U5TB 5H6QA 1LB2A 4AVPA 1T2KA 2DPDA 2DTRA 2R3SA 2PJPA 4P9UA 1SMTA 4QWQA 2JRTA 1ZARA 3E5QA 1LDKB 3PQKA 2RN7A 2XRNA 2HFHA 1I6XA 5FD6A 3AAFA 3BJAA 3FWEA 1KU7A 1HSJA 4RS8A 5LRRA 3L7WA 2YSRA 3I71A 3CDHA 4BHPA 1BN5A 1XCVA 2Z3YA 4IRIA 2CW0F 3PQJA 3ABTA 1S6LA 3TKYA 4G6QA 4L9NA 1HW5A 4LJZF 1GHCA 4UHTA 5JFRA 3ZMSA 5F6FA 4UVAA 2DQLA 5D6FA 3GFJA 3N4MA 3ZMZA 4JK1X 1T0FA 1S29A 1F4KA 5CVUA 4LB6B 4BYYA 4ESFA 2RC4A 1R22A 4A2UA 1OKRA 1P4XA 3F8CA 1KU2A 5DDGA 4XSXF 5L3DA 3T1BA 1FBUA 3CO6C 4M9ZA 2XUBA 3KEOA 1FBSA 1NB9A 3L00A 5D8LB 3T0YA 3SHFA 2Q0OA 2DI3A 4KA4A 3H92A 4Q5SF 4Y15A 2W84A 2P6SA 4KICA 4E70A 1FT9A 4ZYEA 3VOEA 1QGPA 4KMFA 1OYYA 4XRFA 3TDUC 3S2WA 2M45A 4L9JA 2XKOA 3TO7A 2A68F 4AIJA 1QQIA 5ICGA 3K9TA 1IRGA 3BOQA 1KQ9A 2Z9OA 1SD7A 1ZRFA 3WTTC 1P6RA 4HLXA 3P7NA 4N9HA 1BC7C 2XVCA 4CDGA 2EWNA 1USSA 3F21A 1WRJA 4HV5A 3LWFA 4RB3C 1MKMA 1S3JA 2PG4A 4I02A 1QNTA 2BBYA 1J59A 5FO5A 3ECHA 1HQCA 5E20A 1T6ZA 3NEUA 5K5OA 2CQKA 2CO5A 2F2EA 1Z7UA 2UXNA 2EV6A 3MEXA 1XDSA 4N0BA 3CTAA 5E18F 5LGNA 3E6DA 2FRHA 3MQ0A 1WKMA 1XSDA 2VBVA 1K79A 4XSZF 2P7VB 2FA5A 1IRFA 1KYWA 5A8AA 3BWGA 3P9IA 2K4JA 1DPRA 3GZ6A 1IUYA 3RKWA 3EDPA 1K7AA 4EM2A 3HOSA 5HVQC 2KJBA 3WTVC 2FNAA 5LGUA 2V1DA 5KK1A 4HQEA 3R61A 4KIFA 3T8TA 1ON2A 1L0OC 1SFXA 3F3XA 5CVVA 4WXHA 3QPTA 5HLHA 3GVAA 1TQPA 5LRSA 4AWXB 5JR3A 2RNJA 2V79A 4GO1A 2M30A 5HDKA 1I1GA 2W24A 3BPVA 4UVCA 2XAFA 1YTYA 2TDXA 1QZZA 4U0WA 2DAOA 1Z05A 4NHJA 4IJAA 5LHIA 2HWVA 1KU9A 3L09A 3ZUGA 3W6JB 2CWEA 1RUNA 1IAWA 1T6YA 4WX9A 5CYVA 1KQ0A 3BDDA 2K86A 1YS7A 1FNNA 2HTSA 1MD0A 2BE5F 1YW9A 5LEKA 3E6MA 4B09A 3RTRA 5JVTA 2VXZA 2VONA 3RYRA 3WG9A 3BP8A 5BS6A 2C6YA 4UZEA 1Z1DA 2P5KA 2E7XA 4WK8F 3GYHX 2XAQA 3TO9A 1IN7A 3U2RA 4EV0A 3R4KA 3FHZA 2W85A 3G73A 2G7UA 3K0LA 2EK5A 4BXUA 5IT3A 1FOKA 5E1ZB 1N06A 1FP2A 1Q9SA 2QVOA 5TRDA 3B73A 2Z99A 4A6EA 4MGRA 3J7AO 1G3YA 2F5EA 2JT1A 4PGHA 2NRAC 5L3CA 2L01A 1BI1A 1LEAA 2CSOA 1ZLJA 5AIPA 1ZG1A 2I1LA 2RV8A 1TQMA 1R1UA 1R58A 2FE3A 5BMZA 4ZZLA 5ICEA 1S4MA 2IJLA 2F5DA 3R6SA 2QQBA 4EJUA 5FLXZ 4A0ZA 5FO0A 1YIOA 2NAZA 2Q2EA 3RKYA 1J5YA 4A12A 4LLLA 4OOIA 2M1BA 3WE3A 2PN6A 2WV0A 1AWCA 4M73A 1KGSA 3QP5A 2GAUA 3U1DA 4CXFA 1FWZA 4CHUA 4ZYDA 4M9SA 1SD4A 2A3SA 3ABUA 2GZWA 5E1WA 2QBYA 3TGNA 2CGPA 3HYIA 1IN5A 3COAC 5CVIA 2OAZA 1FSEA 2EV0A 1Z6TA 2D1VA 4OINF 3F22A 3E5UA 3C18A 2EA4A 3FXQA 4Z2YA 3GWZA 3J81K 2YPRA 4PCQA 1YLFA 2WC2A 1ZRDA 1S7AA 4TV7A 1B6AA 3V8KA 4HX4A 1BM9A 2X0KA 3HTUA 3I59A 2Z5UA 5E1XA 2NS0A 2EFPA 4L5IA 5BOXA 2Y75A 3QOPA 4S04A 3K2ZA 1MGTA 3DXJF 4OMZA 1BI2A 4A5NA 5DEQA 2Q8KA 1YG2A 5E8IA 2ZO4A 1Z6RA 3IL2A 5ERIA 2IA1A 4M72A 1MRZA 3OP1A 1HSTA 3JTGA 2P6TA 2L02A 2HQNA 4ETSA 1FP1D 1J9IA 4L9VA 3FMSA 3DPTA 1T38A 2E7WA 2ZNZA 3GFMA 3PFIA 2WWYA 3KLOA 1J0RA 1FBQA 3KCCA 4U7BA 4YFNF 1XB4A 1PDNC 3JAMK 1Y0UA 3BPXA 1N08A 3IC7A 1WQ2A 1R1VA 2IA0A 3C7JA 5FNZA 5D6EA 3U9GA 5CLSA 5FFXA 2GA1A 4B8XA 4HX8A 4EM0B 3DKWA 1S8NA 3SZPA 3WTXC 2Z33A 2QUFA 4HV6A 1IN6A 2A07F 1ONVA 1T6SA 3IWFA 2MH9A 3HOTA 5A89A 4WWCA 1T6XA 2MA3A 5K1YA 1V4RA 1FX7A 5HDNA 1EH6A 2LDUA 2JSCA 2AXLA 1SFUA 4WCGA 3HSEA 3LA2A 1B9NA 4IHSA 1ON1A 5DUIA 2KIMA 3E3VA 2A61A 2FMLA 3TOAA 2R7FA 4UXNA 2MLGA 1ZREA 4WXDA 2BV6A 2LSOA 2OQRA 2H09A 3HSRA 2P5LC 3GFIA 4KT5C 1FY7A 2IRFG 2STTA 5K5RA 5F1RA 2MH2A 3KFWX 4BNCA 1ZHFA 2OZ6A 1XMAA 2VBZA 3GW2A 1IXSB 2IPQX 1I5ZA 3WTSC 1TQIA 1PUEE 5EEGA 4S05A 4L18B 2RGVA 4P55A 5DD8A 2IW5A 4GGGA 3FM3A 4Q48A 2XAHA 3HRSA 3O3KA 2GA2A 2L4MA 4I2OA 3QU3A 5D5VB 4GCVA 1W7PA 5H6RA 3M7GA 2VBSA 3F6OA 4IXAA 3LAJA 1RZ4A 3GLXA 2G9WA 1RUOA 4D0PA 1QZYA 1H9TA 2FXAA 2D2WA 4MTEA 5D5UB 3KP3A 1FYMA 5D4SA 2H27A 1JHHA 2A6HF 1O57A 3CUQC 4G6DA 3ROUA 2QQ9A 1U5TC 1DDNA 2H6BA 4XBFA 2ESNA 3QRFF 2LF8A 2FBIA 1YO5C 3CO7C 3ZN0A 4NQWA 4YIIA 3HHGA 1ZN2A 2NNYA 1ZH5A 2DK8A 2JZYA 4G7ZF 2O61A 4RGUA 3KZYA 3GXOA 5EEHA 6PAXA 1DUXC 4HF1A 1WSUA 4OMYA 3BNWA 2R7DA 1G3TA 2IVMA 3LA7A 4U0YA 1P4AA 2ISYA 3GX4X 5F64A 4Y13A 3RDIA 5J8FA 2OBPA 2UWMA 2OA4A 5LEJA 3I64A 2CFXA 2E1NA 3FF5A 1XMKA 4EMSA 1AOYA 3TDZC 3VB2A 3WU0A 2W57A 4I09A 3P9KA 2KIFA 4KUMA 3SZTA 1OR7A 1VTNC 3R0JA 4XLPF 5IT9K 1D3YA 3WGGA 2H94A 3HSFA 2VN2A 2HKOA 4ENKA 1F1ZA 4KN4X 2VBUA 4M74A 2JPCA 4L0ZB 3EYIA 3C3WA 5JI6A 3K69A 2PEXA 3HUGA 4P9FA 3F8BA 1DPUA 4LK0F 4RGSA 3E5XA 3HRTA 3IKTA 2PMHA 5HS9A 2ESHA 3MWMA 2QBYB 3F6VA 4I7HA 3WGHA 1KQ8A 2AS5F 3ERED 3LA3A 1G4DA 4BHCA 4CO8A 2K27A 1XCBA 2IT0A 4KFCA 4OIPF 1UFMA 2RQPA 2KKOA 4O5VA 5CVJA 3IRRA 1A04A 2V9VA 5ED4A 2K7LA 1BIBA 4M71A 4N9IA 1U8RA 1J7KA 1U78A 2VC1A 1SAXA 1S7OA 4G8XA 3MCZA 3I59B 4XLNF 1WI9A 1O7FA 4HLYA 4G7HF 2VE9A 4ZYHA 1YW8A 1WWXA 4HAMA 1Z91A 2DT5A 3V4GA 4GXOA 3WODF 5LHHA 1N05A 4HYEA 3Q5FA 1MDMA 3T8RA 2HGCA 3WTWC 4HW0A 1RI7A 1U6GA 2HZTA 2DO7A 3FXRA 1CF7B 4LLGF 1ODDA 3KP4A 1R00A 3F8NA 3WU1B 2M8EA 4OIQF 2STWA 4FX0A 3GEZA 1LQ1A 2COMA 2F5CA 4RAYA 2PMUA 2ISZA 5FFZA 2VBWA 2A69F 3CJNA 3KLNA 1EH8A 2QYOA 4MNUA 4QLCU 4A5MA 1HKTA 5ILUA 4OIOF 2XROA 1P4MA 1KA8A 1HXDA 3HRMA 2XIGA 4BQAA 2OQGA 4JQFA 3HHHA 2FOKA 1XN7A 2PLYA 2ACJA 2L4AA 4ESBA 1OYIA 1LJ9A 1TW3A 4EGYA 3M9AA 2GIVA 3G3ZA 1MJAA 3BJ6A 2XASA 2UZKA 2B0LA 3D0SA 3J81Z 5ICFA 1TBXA 4L9TA 2HEOA 1LEBA 2FU4A 1BIAA 1K6OA 1K78A 4MTDA 4MQ9F 2VODA 1EV7A 3WTYC 2KIUA 2JPBA 1X3UA 2NNNA 3SFZA 2XHKA 1W5TA 4IVNA 2HYFA 5L3GA 2HS5A 5FO1A 4IF4A 4GYIA 2PI0A 3QU6A 4ZYGA 4LG0A 1YQAA 1Z9CA 1QO0D 4IRGA 3EUHA 1IZ1A 4L5JA 1ZRCA 2MBFA 2X0LA 2PFBA 1IN4A 1SD6A 3DQVC 3I0TA 2V1UA 1XSXA 1E17A 3RKXA 2EV5A 1JE8A 2YR2A 2HYGD 2BGCA 1J2XA 3GF2A 3LAPA 5A2QK 2FNPA 2P8TA 3E6CC 2YU3A 3N97A 3KE2A 2XV4S 3IKVA 2PQ8A 1QBJA 1G3SA 3HRUA 4M9XA 1DP7P 4UV8A 2W25A 4HX7A 3ZMTA 5HS7A 3ZPLA 5ILSA 3J80Z 1W7PB 5JHUA 4MEYF 2V1XA 5D5WB 3MAJA 3V7RA 4ESJA 2G7HA 3JAMZ 3KEQA 1O3TA 1CF7A 5LLQA 3KETA 4PDKA 2HR3A 3I54A 4ASNA 1NB0A 2QWWA 4KIGA 5HOOA 4L0YB 4EM1A 2EFWA 1FZPB 4UV9A 2LNBA 3J80K 4EVIA 2M5WA 4EGZA 3K1PA 2EFNA 1BOAA 1W4MA 4A0YA 3R60A 5AIQA 3K1NA 4WXCA 1PP8F 4LLNA 1OMIA 1B9MA 4KDPA 5H20A 4CZZA 1TLHB 2E1CA 2ZBKA 3TO6A 1F9NA 5LBQA 1NHAA 3L9FA 1XGMA 2HKXA 1R7JA 2V6CA 2ZFWA 3JW4A 3NQOA 5E8GA 2O6GE 2ADUA 4FHTA 2PBIA 2KRFA 2YX4A 3P9CA 1UB9A 3H3UA 2IP2A 1SFEA 1HBXG 1O3SA 2HTJA 2GQQA 4IRHA 3ZQ7A 2DFIA 1R5GA 4BHBA 3RJPA 3HTSB 2GXGA 2FSWA 2VT2A 4RGRA 2A6EF 2P5VA 4ON0A 2H6CA 3FMQA 2Y0MA 2MLKA 2GXBA 4IPAA 1HW1A 3BJOA 1XGSA 1BI0A 1W7PD 4EJTA 3F23A 2K4BA 3KP6A 1I27A 2VE8A 3RPQA 1P4WA 1FPQA 1G3WA 3L2CA 3T5XA 4P5OA 3K1MA 4UVBA 2VOOA 2BEOA 2QLZA 3MFKA 2OZUA 2M87A 3M8FA 3OOPA 2O03A 3DP7A 2ZMEA 2DK5A 4IHTA 1ZLKA 5LHGA 1XD7A 1FC3A 3CLOA 1C0WA 4AIKA 3EQLF 2LKPA 3I4PA 4JBAA 1HKSA 3DPLC 1GXPA 1IXRC 2HOEA 1KU3A 1B1BA 2D1HA 3BZ6A 3ZMVA 2D45A 4UUVA 3TOBA 4H0EA 1TW2A 3JSPA 3DFGA 4RB1A 2OU2A 1MZBA 4LD5A 2KJCA 1UHMA 1JHFA 5TJJA 1BBYA 4U0VA 2OYNA 3WE2A 1E2XA 2EJRA 3DEUA 3FMRA 2GWRA 2Y48A 1MDMB 4I0BA 4HDVA 4AIHA 3RYPA 4KMUX 2FMYA 1HKQA 5CJ9A 1XGNA 1W5SA 4Y17A 2FF4A 4HOBA 1REPC 3QP6A 3BY6A 5K5QA 3DV8A 1ZGJA 3CUQA 2F5FA 4F7ZA 3D5LA 5DCFA 2XKPA 2VT3A 5IT9Z 3B02A 2VOPA 2EA2A 1V3FA 3ZMDA 2J5OA 1U5TA 3RIRA 2A5YB 1EH7A 1OYWA 1T98A 3RI4A 2ELHA 4DQ2A 1FSHA 4K2EA 4O3MA 3Q9VA 2OD5A 2J5PA 1ZG5A 3ZMUA 1ZAOA 1F5TA 5DCMB 4HF2A 1TNSA 1U3EM 4KN7X 4A6DA 2XAGA 3RPUA 1PP7U 3LQQA 3ECOA 4PZJA 2O8XA 5DUKA 4FX4A 2ETHA 1J75A 4R8HA 1ZG3A 5BPIA 1G6NA 5HLGA 3V8JA 3KP2A 1H0MA 3JSOA 1D8KA 4MQVA 5FGMA 4EJWA 2WTEA 3ELKA 3GUDA 3V8LA 1JGSA 1XGOA 2ZNYA 1FYKA 2HQRA 4LK1F 4M6YA 1K78B 4HBLA 4HF0A 5D5XB 4OIRF 1ZGAA 5L3BA 2HDCA 4KIBA 3O6BB 2FBKA 1R23A 4HDUA 1IW7F 4ZH4F 3GZ5A 4BAYA 4LFUA 2VBTA 2MD5A 3LSTA 3JTHA 4NB5A 2EB7A 2XAJA 2RKHA 4G9YA 4LG0B 5AONA 1HW2A 4LB5A 4AD9A 1U2WA 3VFZA 1USTA 5DD4A 4I01A 3SXYA 1YS6A 1CGPA 2DBBA 4ENJA 2CG4A 2ZXJA 3F72A 1MJBA 4YFKF 1BC8C 3H3ZA 3O2PE 2P7CB 5L3EA 4G7OF 2FEZA 5E17F 2FQ3A 4HA8A 3W6KB 2ZCWA 3TQNA
chains in the Genus database with same CATH superfamily
3OAAA 2VXDA 1H9GA 1EFUA 1YJ9B 2RVCA 1QGZA 4S0HB 4E7HA 3WTZA 3LQRA 3FX3A 2DW4A 1APLC 1O3RA 1S5LC 3QODA 2BVLA 2DA5A 3A01B 4O6JA 2CUFA 3CUOA 1JKRC 1YIJI 1PKVA 3CDIA 2XGJA 3WYAA 2JTVA 4A69C 5GPAA 4M6XA 4OAZA 3Q9SA 2GQFA 4EJOA 2OTLB 5THXA 1VQLI 3REOA 4BJTA 2YX7A 1RQPA 2J7KA 2L3DA 2F4MB 3M8EA 3NRVA 1K4SA 4C2MJ 2ZBUA 5GV7A 3AVXA 1Y8RB 3MKYB 5EZGA 2FBHA 1P9QC 3BROA 4CICA 4HNTA 1BOBA 1O3QA 1V0FA 4ENNA 1XDUA 1TNTA 4RAZA 4RD3A 1TTYA 1O7LA 4HQMA 2K02A 2DQRA 4BKXA 2NOJB 1P2FA 2OCEA 5L3FA 4FT8A 1T39A 3EETA 1TUIA 2EFQA 3CMAB 1E0EA 3WTUC 4LBYA 5FD5A 4RM0A 4Y7CA 1FLIA 2DDBA 3A02A 3CESA 4RB2C 1IUFA 1KTVA 3NWSA 4FCYA 3ABMH 5GP9A 4CYDA 3QPHA 2OV7A 2EILH 1I6HJ 2Y31A 2WADA 1Z77A 2IA2A 4D7MA 4UB6C 2O0YA 4YG2F 4LMYA 1ETYA 1D1CA 1GUUA 4HZFA 3VODA 1YRNB 2MC3A 1AIPA 5D4RA 1YE9A 2FD5A 3I53A 2XZPA 3W2VA 3QYEA 4G12A 2M34A 4PJJA 2JN6A 3OL3A 1UD8A 1K4TA 3KZZA 4A3FJ 2E5NA 1UCRA 3OYMA 1OPCA 3GFLA 4EJVA 4UNOA 1KYZA 5DV5A 1YYVA 1Z0XA 4UZFA 2D3LA 4Q4ZF 1RIOH 1R9TJ 1SMYF 2RNGA 1BI3A 2LH9A 4R79A 4PC3A 4D5FA 3RKQA 2ZJ2A 3EUKL 4KYWA 2X3UA 3ZXSA 3GTPJ 3KL9A 2DYSH 5DCMA 4IQ4A 4FQGA 3IWZA 1BA5A 2DEUA 1YI2I 3QAHA 1LDDA 3PJRA 2CK3A 4ENMA 4PGGA 3RQ4A 5BPDA 1VQ5I 3S1NJ 3OYGA 2L54A 2EZHA 4NBQA 1RR8C 2ZTGA 1JXSA 4Y3OA 1KQSB 2LP0A 1N8RD 1OCZH 3GO5A 4A3KJ 3LFKA 1ITYA 3SDBA 4BDYA 4YHBA 1X1CA 1O4XA 3E6BA 4P96A 3M3YJ 3VEPA 2QQAA 1RNLA 4XICA 2QGGA 4Y4RA 2VKVA 2QCOA 5BSYA 2BW3B 3FXUA 2ZJRF 4WWVA 3H9JA 3K4LA 3MZHA 1E3XA 3ULQB 4MFDA 1VQKI 5LMZA 2XAUA 3C1DA 4PC7A 2X85A 2QM3A 4IEJA 1RC9A 2WAFA 3LNNA 2WJVA 3OS0A 5B1AH 4DNCA 1G7TA 3ASNH 2HZDA 2VJIA 5CVRA 2UXXA 2XB0X 4LG3A 1YJNI 1N77A 2O3FA 2F1LA 3JRGA 3L2WA 2V7XA 1LVAA 3ERMA 3S15J 3WBJA 1N07A 2LG4A 3DLLF 4AYBN 3JRCA 1SD5A 1FYLA 5KVRA 1B4AA 2DU9A 1RRJA 2R7RA 1QX4A 4KKUA 1X4PA 1QVUA 2L0KA 3R0AA 2VPRA 4RDJA 1HDPA 3FXOA 2AXTC 2CFOA 4TT3A 4D7NA 2DFFA 4Y7NJ 5J6XA 5GPCA 3Q6QA 2ZKZA 2JWTA 3OMYA 2NYXA 2KQRA 4DBQA 2JRMA 2I5UA 3G6EI 3K4MA 1B8IA 4KNYA 1SANA 2EIMH 2HPMA 2VBXA 3AFHA 5FLXK 4U7DA 5A2QZ 3HC7A 3WU2C 2BY0A 1YHQB 1Q7YD 2ICWG 3D5SC 3HEFA 5J1RA 4CGZA 3MZYA 3OS2A 1NJID 1D5VA 2QENA 3K10A 4WZLA 2ID3A 2XNJA 1I1SA 1LNWA 4U88A 4LGWA 4YIFA 1STZA 1SVMA 4I98B 2X4HA 3CP8A 1VQ7B 3KP5A 4A0XA 4ZJZA 1ZGWA 5FB2A 3WGIA 4GRIA 1UD2A 1SFKA 3JQRA 5DYMA 1IF1A 2DPUA 1X2NA 5ICCA 1JUSA 4OU0A 1ZM2A 2L7FP 1V55H 2KHMA 4WZKA 5BQTA 5J8CA 4DJAA 4A3EJ 2VB6A 3ZR8X 2HOSA 3S17J 2E35A 1BJKA 2P4WA 1I3AA 3GTOJ 5HDGA 2L9NA 1UAAA 3F8MA 2EFOA 3ASPA 4RGXA 5E6TA 2VBYA 2QZ8A 4ZV4A 3AGQA 2AQEA 2RDPA 2DCUA 4X05A 3T53B 3CCVI 4GYGA 3E97A 2DLLA 2VC0A 4I0AA 2P3MA 4XLFA 5DTDA 1EFTA 4RB0A 1XC5A 1IXCA 1YFHA 1R5OA 3I56B 1DU0A 3FM5A 4BH9A 2CYYA 3KP7A 3MMPA 2ZMEB 3LVBA 1L3LA 1K73D 4M3DA 4BJ6C 2E71A 3DF8A 1GVJA 3CCRI 3EYYA 1VQNB 3ZP5A 1WJCA 3OV8A 4Z4TA 2XB5A 1GJRA 2R7SA 3LOCA 4EQQA 1MNMC 3I5UA 4G94A 2CV2A 2PIAA 3W2WA 4RD4A 3W5VA 1MMGA 3CF5F 1R1TA 2XNDA 1POGA 2MG4A 3V7CA 3F8FA 2ZL6A 4X1EA 5IK2A 3IHUA 3M1EA 1XSVA 3JRBA 4YFXF 2R4GA 2FOWA 3CC7I 1N75A 1QVFB 2I8DA 2LF7A 3FZVA 5E3OA 1K6YA 3OYNA 4F7DA 1A5JA 3ISPA 1D8JA 5LGTA 3ZN1A 3W2IA 4II2A 3K4KA 4HRIA 1LPQA 3T56B 2IS2A 4NC6A 1F60A 2XZOA 4IX7A 3H5RA 4R1HA 2HOAA 1VQ8I 4Q47A 5A88A 1LDJA 1YW7A 1A31A 1Q1HA 5BNGA 3HIFA 1R5HA 3NARA 1YRNA 5FKLA 5JLXA 2DA7A 1B59A 3IRQA 1KK0A 4Z4ZA 5M5WJ 1UD6A 1UG2A 3BTJA 4C43A 4NC8A 4ZZDA 4UY8I 2DDAA 4MEXF 1ZYRF 3U2QA 1MBGA 1QPMA 1UELB 5D8KB 3PUNA 1Q86D 1IN8A 3GCMA 3V7SA 4C9YA 1X4OA 2JA6J 1UHWA 5HS8A 5F4JA 1R36A 2K9QA 1R4MB 2K9SA 3FHNA 1GXQA 5HLIA 1OGIA 4PFPA 2V7QA 2E2IJ 1IDYA 1S7EA 1ULYA 2HMAA 2ZZFA 4ITVA 4WF2A 1BJAA 5B3SH 1EFCA 2VLAA 1MJ9A 2BYVE 5ILVA 3OZUA 2CUZA 1IO2A 3DWLE 5GAGJ 1T8IA 3CUQB 1P92A 3A0BC 4DYRA 2ZTNA 2PMZN 3SQNA 1WHUA 4C2TA 3I58A 2XGXA 3HOWJ 4XLAA 2M5SA 1GO2A 4MHGA 3PIPF 4UUSB 4X7DA 3FXLA 4EH1A 3ML6A 2CQQA 1U5TB 3Q6RA 1GLNA 3CJQB 5H6QA 1LB2A 4AVPA 3OYEA 1WPCA 1T2KA 3HBLA 2LLKA 2DPDA 2DTRA 2R3SA 4YALA 2PJPA 4P9UA 2L9VA 2QSFX 2EIXA 2GM4A 1SMTA 4V2FA 3ZQFA 2XF6A 3BZKA 4QWQA 2JRTA 3BQYA 1ZARA 1NTCA 2GJRA 2R7WA 3E5QA 1XG1A 1LDKB 4PFOA 5IOYA 1MSFC 1HOMA 3PQKA 4Z4WA 3VNVA 1JUMA 3HAGA 4E7SA 5HODA 3UR3C 2ZC2A 2RN7A 1F36A 2XRNA 2HFHA 3H94A 1I6XA 3Q3AA 5FD6A 3AAFA 3BJAA 3FWEA 1KU7A 1BQEA 2IBDA 3A4CA 1HSJA 4CQJA 4AM3A 3CW2A 2K3FA 2GOXB 4RS8A 5LRRA 1IV6A 3L7WA 2L2OA 2YSRA 5IY5H 3ES9A 4RCZA 3I71A 1QFJA 1VLOA 1HLVA 4RA2A 1ENHA 3CDHA 4AU7A 5J47A 3JU4A 4BHPA 1RETA 4C3JJ 1BN5A 1XCVA 2Z3YA 3AG3H 4IRIA 2CW0F 3PQJA 2DN0A 4CCKA 2WZPP 1U0JA 3ABTA 1S6LA 3H35A 4B1RA 3OS1A 3BZCA 3KYDB 1IDZA 3TKYA 3TEDA 3JRFA 3RZOJ 2GK6A 4G6QA 1FRQA 4L9NA 4P1VA 1HW5A 4LJZF 3JRHA 3MKWB 1GVHA 1CQXA 1GHCA 4UHTA 1D0YA 5JFRA 2KDZA 2JIZA 2E2JJ 3ZMSA 4YAFA 5F6FA 3LO8A 3R6JA 1P7JA 2X8KA 1FX0A 5IYQA 4UVAA 2DQLA 5D6FA 3GFJA 5FA6A 3QSYA 3W3CA 1VZ0A 2ZJPF 3N4MA 2JJ1A 3ZMZA 3DEEA 1GAWA 2DA6A 4JK1X 1Y0YA 3GQBA 1WORA 1T0FA 2OTJB 3Q38A 1S29A 3MMYB 1F4KA 5CVUA 4RDLA 4LB6B 5HZBA 4BYYA 4ESFA 2RC4A 3SEQA 3P26A 1R22A 1Z67A 4A2UA 3CMEI 4UAJA 1R5BA 1VQ9B 2JUGA 1OKRA 1P4XA 2F4OB 3F8CA 1KU2A 3NWTA 1Y8QB 5DDGA 3KEWA 4XSXF 5L3DA 3T1BA 1FBUA 3WG7H 1FNDA 3CO6C 4M9ZA 2XUBA 3KEOA 1FBSA 1NB9A 1OJLA 3L00A 3V42A 5D8LB 3OJWA 2O8KA 3T0YA 3SHFA 2Q0OA 1TWCJ 1NH3A 1W1WE 2PX9A 1QUFA 3OKXA 3OEHA 2DI3A 3WXMA 2CRGA 4KA4A 4CCLA 3H92A 3BR0A 3DEWA 1WPKA 3DBLB 2DETA 4Q5SF 4M0LA 3CCUI 5B5EC 4Y15A 2W84A 2P6SA 2C77A 4DQLA 5HNHA 4KICA 4D9JA 4XN0A 2VASA 4E70A 3K4JA 1FT9A 3KEYA 4ZYEA 3GSIA 3VOEA 3GLLA 1QGPA 3ZBUA 1VQ4I 1AA7A 4KMFA 1OYYA 4GDFA 4BL0B 3U6BA 3RQIA 4WZEA 5JVGF 3BR6A 1XX5A 2M4KA 4RM2A 1LFBA 4XRFA 4H4KC 2C4TA 1WFXA 1VQOB 1MABA 3TDUC 1VHOA 3VMFA 3DDYA 3S2WA 2M45A 4L9JA 3FPPA 1VQ6I 1RR7A 1Y1WJ 5M5XJ 2XKOA 3TO7A 2A68F 2HCJB 4AIJA 1QQIA 4B4DA 5ICGA 3BG3A 1JTYA 3LL7A 3S32A 4QFMA 3K9TA 1IRGA 3BOQA 1KQ9A 2CMPA 2Z9OA 3CB4A 4Z4SA 2DA1A 3QYFA 2HDWA 1XQBA 1SD7A 2AHQA 4DK0A 1UMQA 2ZL5A 2DA4A 1ZRFA 3WTTC 3PNVA 1P6RA 1V54H 4HLXA 2KIQA 2MSYA 3P7NA 3W2EA 4ANJA 1SAUA 5M3MJ 3AG1H 2EH3A 2LYCA 5FKOA 2VJJA 2WAEA 4N9HA 1BC7C 1COWA 3N05A 3CC2I 2XVCA 2EWNA 4CDGA 4DOZA 1USSA 1PYVA 3F21A 2F1MA 2XNCA 3TP3A 2X53S 1JGGA 3I3LA 1WRJA 2X9DA 3BCBA 1DU6A 4HPQA 3LWFA 4HV5A 3WHCA 4RB3C 1MSEC 1MKMA 1S3JA 2IXSA 2PG4A 4I02A 5EDNA 2HDDA 1S72I 1Q81D 1OFCX 1QNTA 2BBYA 5HNFA 2QEXB 1J59A 1JUPA 1LFPA 5FO5A 3ECHA 1HQCA 5E20A 5JHFA 1T6ZA 3NEUA 2R7VA 2E1MB 3IAS2 3M1CA 5K5OA 2G0EA 1KC8D 1IJEA 4XLEA 3RZDJ 2CQKA 2LTPA 2CO5A 2PMDA 2F2EA 1Z7UA 2UXNA 2EV6A 3MEXA 5KNLA 2IGMA 1XDSA 4LIUA 4BQNA 3OW2B 4N0BA 3CTAA 1GV5A 4RD0A 2I10A 5E18F 5LGNA 3E6DA 2FRHA 3MQ0A 2WB1N 5TISC 3K4BA 1WKMA 1XSDA 1PJ7A 2VBVA 1K79A 1RQRA 4XSZF 1TLLA 1QGAA 1OR7C 2P7VB 1QPIA 2FA5A 2R6HA 1IRFA 1NDHA 2OUMA 1JT0A 3QFTA 3CCQB 4BBSJ 3W2FA 3GTMJ 1KYWA 4P26A 3ESWB 5IOZA 4XIDA 3BH4A 2P0WA 1UD3A 3A8IA 5A8AA 5IP6A 4BU2A 3IAM2 3BWGA 2QF7A 2IS6A 3P9IA 4IZZA 2YWFA 2K4JA 4RDKA 2Q2EB 2R9VA 1DPRA 3GZ6A 2DYRH 3W6VA 3P27A 1IUYA 3RKWA 1VF7A 3EDPA 3IV5A 1K7AA 1E3ZA 2LMDA 4EM2A 3HOSA 2F5VA 4JMQA 3SKBA 3E7LA 2KJBA 1TZLA 5HVQC 3WTVC 1JKOC 2FNAA 5LGUA 2V1DA 1HCRA 1M90D 4N4NB 2L9RA 2VI6A 1OB0A 3G4SB 5KK1A 4HQEA 3X2QH 3R61A 3SJMA 4KIFA 3T8TA 5K7ZA 2DXIA 2V31A 2VZLA 1ON2A 5EG0A 1QA6A 1XB2A 4RD6A 4L5EA 3ZIAA 2XGCA 4B47A 3SLDA 4NUBA 1IRXA 1L0OC 1QHHD 1SFXA 4X6AJ 2LY9A 1B8IB 1W0UA 2EZIA 3F3XA 5CVVA 4WXHA 3JRDA 1W87A 3CCLB 4CCOA 2R7ZJ 3QPTA 4XK4A 4X07A 4ACAA 2Y2ZA 3GVAA 5HLHA 5CPRB 1D0XA 4TMXA 1TQPA 5LRSA 3NAUA 4AWXB 5JR3A 2N8GA 2M7AA 3HB9A 2GJPA 2CBXA 4YIRX 3JQQA 4BE0A 2MYSA 4E4HA 2RNJA 3DCFA 1EP1B 2V79A 4GO1A 2M30A 5HDKA 2FVGA 3CCMI 1I1GA 2W24A 4ZC3A 3BPVA 1G7RA 1D2EA 2EBIA 4NDLA 4UVCA 4F3QA 5FLMJ 1HA3A 1MW7A 4ZCMA 2VNHA 2DCEA 2XAFA 4PJLA 2R0QC 4LIVA 1YTYA 2TDXA 3H3VK 1QZZA 3BC8A 4U0WA 5J3LA 2DAOA 5FRNA 2FX3A 1A8PA 2O7OA 1Z05A 2E36A 4C3HJ 4NHJA 4IJAA 3PSIA 4DNTB 4E0FA 1MNEA 5LHIA 1BLIA 3W2GA 2HWVA 1KU9A 2WJYA 4E7KA 4B3FX 5FRMA 3L09A 4EATA 3W6JB 3ZUGA 3WNCA 1IV8A 4XL9A 4C3IJ 1DDIA 3GVLA 3IH3A 5CDFA 3VYUB 1Q82D 1H85A 2CWEA 1RUNA 1DGRM 1IAWA 3Q3SA 1T6YA 5EJCA 4G5GA 4WX9A 5CYVA 1KQ0A 3BDDA 3CD6B 2DOGA 5EF6A 2Y0SN 4Z4RA 4TMVA 2YU9J 1JTXA 2K86A 1YS7A 1FNNA 2HTSA 4ZDPA 1MD0A 4MYUA 3BG7A 2BE5F 1YW9A 1GV2A 3CCEB 5LEKA 2F43A 2Q1ZB 3E6MA 4B09A 3EPZA 4JX5A 3KYCB 1ZR4A 1T33A 4AUXA 4FE7A 2LY1A 3RTRA 1OCTC 5LD2C 5JVTA 4LBWA 5HKKA 2X1CA 3Q0VA 3C2BA 2VXZA 1H42A 2NVTJ 2VONA 3RYRA 1SKQA 1MMNA 3K4NA 3WG9A 4PABA 2FJ1A 3BP8A 4PJNA 4PK4A 5BS6A 1JJ8C 2C6YA 4UZEA 2ELKA 3HM5A 1Z1DA 1TT5B 2P5KA 1EXMA 1YJWB 2E7XA 4WK8F 3GYHX 1ZUNB 2JA5J 2XAQA 1BR2A 3TO9A 4KISA 2HQ5A 1ZK8A 1IN7A 3Q0UA 3U2RA 3S93A 3FXMA 4EV0A 3R4KA 3SEZA 3S14J 3FHZA 1UMKA 2W85A 4GQNA 2NV4A 3G73A 1ZTRA 2ELJA 1MH3A 2G7UA 3K70C 3K0LA 5IPAA 2EK5A 4XNFA 4BXUA 5GAHJ 5IT3A 3L2RA 4C2UA 1FOKA 5E1ZB 3IP4B 1N06A 2VYQA 3SJZA 1FP2A 2H1KA 1Q9SA 2QVOA 5TRDA 2R7QA 3B73A 4G7XA 1X2MA 3CMMA 2E60A 2Z99A 4A6EA 1HA8A 3C2HA 2V7WA 4MGRA 2ZBVA 2Y30A 1EWYA 2L5QA 3J7AO 1G3YA 2RAEA 1GVDA 2F5EA 2JT1A 2L7MP 1RKWA 3WQZA 3TP0A 2VQCA 4LOCA 4JOMA 4PGHA 2EFGA 3H0GJ 2ECCA 2NRAC 4TMZA 3OL4A 5J4YA 3SLNA 3QE2A 1DG1G 3CDLA 2R7OA 2L01A 5L3CA 1BI1A 1LEAA 4RD1A 1WGXA 2CSOA 1ZLJA 3DPUA 5AIPA 4QPQA 2BVMA 1ZG1A 4IO9F 2VKEA 2I1LA 2KISA 2DIEA 2RV8A 1TQMA 2WAQA 3A1PA 1R1UA 3HGGA 1R58A 3CCJI 2FE3A 2B5OA 3DLAA 4RAFA 3M8JA 4EEFG 1WJEA 5BMZA 4RLZA 4ZZLA 5ICEA 3OSFA 1S4MA 2IJLA 3HKZN 4P9SA 2F5DA 3R6SA 2EQRA 2QQBA 3PO3J 4EJUA 2XSDC 5FLXZ 4J19A 2BSAA 3QOEA 4A0ZA 3JRIA 4NNJA 5FO0A 1YIOA 4M2LA 2NAZA 3GTKJ 1QFZA 2Q2EA 3RKYA 2DT7B 1J5YA 4A3DJ 1EP3B 3OZVA 4A12A 4XOPA 3G71B 4LLLA 4HSTA 4XKWA 3UNGC 4HNUA 2BHZA 4OOIA 2M1BA 4TMWA 3HOUJ 4I76A 4FTHA 1QHGA 3A2KA 1OISA 3WE3A 4QUZA 2ZSHB 2DMNA 2PN6A 2KRHA 1QZEA 3HGYA 2WV0A 1FDRA 3CJRB 3S3OA 3KPHA 4M3EA 4M73A 1AWCA 3V76A 1KGSA 2EZKA 2R7UA 1OCCH 3QP5A 1PVEA 5H59A 2GAUA 2TCTA 5IYCJ 5J35A 1YJ9I 3BY2A 5F0CA 3U1DA 3ZQQA 1V5FA 2W6JA 1D1NA 4CXFA 1FWZA 4CHUA 4ZYDA 4M9SA 1SD4A 4I6ZA 3BCAA 1HF0A 1Y0RA 4P12A 5EGOA 1U2RA 2A3SA 4Y9RA 3ABUA 2GZWA 3LMMA 5E1WA 1UG0A 1ZR2A 2OTLI 2QBYA 3TGNA 3BCDA 1Y1VJ 2LC2A 2M4GA 2HVQA 3EUHC 2CGPA 3HYIA 2CQ7A 5TR9A 1IN5A 2VJ5A 2OBTA 3MZ8A 1GDTA 3COAC 5CVIA 3EUAA 2V7VA 1X58A 3OJXA 1WJDA 3RCOA 3AL0C 2OAZA 4IHXA 1WI3A 4D5CA 1FSEA 2EV0A 2OPTA 2XRLA 1Z6TA 2D1VA 3CMAI 4PUSA 1Y39A 4BDZA 4OINF 3F22A 1R4NB 3FDYA 4XM3A 9ANTA 1WP6A 3E5UA 2A5WA 4RDUA 2CUEA 3C18A 2EA4A 3FXQA 4W1UA 3GWZA 4ZYAA 4Z2YA 2VUMJ 1KZLA 1TL8A 1W0KA 1JJ2B 3J81K 2YPRA 4PCQA 1YLFA 2F48A 1WTHD 2WC2A 3I55B 3BR2A 2V26A 2NVQJ 4DQKA 1ZRDA 3HG9A 1S7AA 4TV7A 1VLYA 2Y69H 1WJBA 2XEXA 2BGJA 3D26A 2B9SA 1DDGA 5FJ8J 3CP2A 2DOEA 1B6AA 4XR6A 3V8KA 3ZGKA 2IGNA 4HX4A 4XKVA 4XN3A 4XOTA 2DYIA 4CCMA 1MBHA 1BM9A 5H2FC 1MH4A 3OE7A 2OBRA 3OYHA 2X0KA 2DJIA 3HTUA 3I59A 1QH0A 2Z5UA 5E3NA 5E1XA 1WH5A 3ZQHA 4AYBA 2NS0A 4R71A 2YUSA 2EFPA 4W97A 3U21A 4PJ0C 4L5IA 5BOXA 2Y75A 1J9ZA 4IHYA 4PSXA 3QOPA 1EJ9A 1BR1A 4S04A 1F20A 2VQLA 1TT0A 4BS9A 4D1QA 3H1CA 3K2ZA 1MGTA 3MVPA 3DXJF 4OMZA 3FJOA 3HJEA 5FLVA 4B3AA 2EIJH 1BI2A 2NVUB 4CYCA 3JREA 4E7IA 4A5NA 4G1BA 1U8BA 3I4NJ 5DEQA 2Q8KA 3HZJA 2XPVA 1ZELA 1WH7A 1WSVA 1YG2A 2ZO4A 3OOUA 3TW6A 1Z6RA 3FKJA 5E8IA 5ERIA 3IL2A 2IA1A 1X1DA 4M72A 3JR9A 1JI8A 1MRZA 1HSTA 4M3GA 4CH7A 3OP1A 1MMAA 1KZHA 1R5ID 1AU7A 1OCOH 3JTGA 1UZCA 2P6TA 2ZZGA 2L02A 2HQNA 2F4NA 4ETSA 1TTTA 4HG2A 1FP1D 3H0DA 4FASD 2OF7A 1J9IA 4L9VA 3FMSA 5JLWA 3PA2A 2DMQA 3DPTA 4P6VF 5B6IA 1T38A 2CC2A 2E7WA 2ZNZA 2Q6IA 3GFMA 5F08A 3LSIA 3PFIA 1IHMA 2WWYA 1KONA 3KLOA 1G59A 1J0RA 1FBQA 3KCCA 2LKXA 4Y33A 4U7BA 2QMUA 4YFNF 4X0GA 3LQ6A 1XB4A 2QGUA 3HPHA 1YHQI 5IP7J 3C2GA 1PDNC 3PNTA 3CC4B 4B3XA 4HE5A 3JAMK 2R93J 3W5HA 3TMOA 4XQFA 1Y0UA 2LZJA 2XGEA 3BPXA 4NQWB 4J01A 1FOWA 1M1EB 1VQ7I 2TRTA 1I7PA 2ZZEA 4PAAA 2DMPA 2LVSA 1E43A 3IC7A 4RMNA 1N08A 1WOSA 1WQ2A 2IA0A 3C7JA 1R1VA 4RBOA 2D9RA 4YAWA 4QPOA 5DSZA 5FNZA 5D6EA 2WV1A 3U9GA 1GAQA 5CLSA 5FFXA 2GA1A 4N4OB 3VYTB 1W35A 4B8XA 4HX8A 4EM0B 2M2EA 4RLQA 3DKWA 1S8NA 5F1JA 3SZPA 3WTXC 2Z33A 2QUFA 2Z16A 4HV6A 2V7UA 3SFIA 1IN6A 2A07F 3B8HA 1ONVA 1T6SA 1KJZA 3IWFA 2YS9A 1YITB 1V0EA 1OCPA 2LFBA 2MH9A 4UB8C 3S3NA 3HOTA 1R71A 5F0FA 3H9QA 4WWCA 5A89A 1T6XA 3I56I 2MA3A 4PSWA 5K1YA 1V4RA 2PJRA 1FX7A 5HDNA 1EH6A 4AF7A 2X6OA 2R5YA 4OOSA 2VKDA 2LDUA 2JSCA 3JQPA 1IGNA 2AXLA 3MKLA 4RLFA 4ROXA 3OSGA 2K5CA 3VYSB 1SFUA 3K2AA 5HXBA 3OYKA 4WCGA 1VQNI 3HSEA 3LA2A 1GT0C 4P3YA 4QV2A 3A35A 1B9NA 4DW6A 2RQQA 4M53A 4YXWA 3A3BA 3H9NA 5IYNA 3P5JA 4IHSA 1ON1A 5DUIA 2OK8A 2KIMA 3J7AY 3E3VA 1W9XA 4TKOB 5EG0B 1U9NA 1ZKGA 4OP7A 2A61A 2FMLA 3TOAA 2R7FA 2XF7A 4UXNA 2K9MA 1IG7A 2MLGA 1ZREA 2IAIA 4WXDA 2ME0A 5F04A 2BV6A 1Z21A 2LSOA 3F0CA 1Z3YA 2OQRA 2H09A 3HUGB 5M5YJ 3HSRA 2P5LC 2BF4A 5IYDJ 2PMZA 3S3MA 3GFIA 4KT5C 1FY7A 2IRFG 2STTA 2W6IA 4ZDLA 3LSJA 2IEKA 5K5RA 5F1RA 3PA1A 4YAOA 3BQZA 2DFEA 1VQMB 2DERA 1LFUP 3ONQA 2OBSA 2MH2A 3L2UA 3KFWX 3I1FA 4BNCA 1VQPB 1T08B 1ZHFA 1EKEA 2OZ6A 2GBYA 1XMAA 3CQZJ 3R6KA 2VBZA 2V4DA 2NVYJ 2ZMEC 3GW2A 5FL7A 2K9NA 1IXSB 2NXNB 3FK6A 2CV1A 2IPQX 1I5ZA 4WZTA 3WTSC 1TQIA 3CJTB 4M1KA 1PUEE 2ECBA 5EEGA 3AGPA 4S05A 4L18B 3GTQJ 2RGVA 4P55A 5DD8A 3VO1A 5HLTA 1WZ2A 3AVTA 2IW5A 2F4IA 4GGGA 1CNEA 3OYIA 3FM3A 1VFCA 1DP3A 2XOKA 1KK2A 1E3PA 3E1YE 3SZGA 3ZZUA 4C30A 4Q48A 1RKTA 2XAHA 3S16J 2UV1A 3HDDA 1WJAA 3HRSA 3O3KA 4XRSG 1QRYA 1KRHA 2KZVA 2DA2A 2GA2A 2L4MA 2V9KA 2K85A 4I2OA 1ORKA 3QU3A 4M3BA 2JVHA 5D5VB 2H8RA 3S2HJ 4GCVA 4QVJA 1QU3A 4ZCIA 1W7PA 4Q7JB 2M8GX 4B4CA 5H6RA 4IW3B 5E3LA 5TV2A 1YX3A 3KZIC 2DODA 3M7GA 1DGWY 4RM3A 2VBSA 3F6OA 1X19A 3A1YA 3O8GA 4IXAA 3LAJA 3B82A 1RZ4A 5E79C 2C5HA 2DY1A 1I3QJ 3GLXA 2G9WA 2E34A 4D0PA 3S1RJ 2MGQA 1RUOA 1OQYA 3CCSB 2WR8A 1QZYA 1H9TA 2WBMA 4P3IA 4H9GA 2FXAA 4XONA 2D2WA 4MTEA 5D5UB 3KP3A 1X3WB 2QA4B 1FYMA 1FTZA 3WY9A 1JNYA 2GK7A 5D4SA 3PUFA 2H27A 2HI3A 3BTCA 5J1UA 1JHHA 4BXXJ 2A6HF 1O57A 4CSWA 1Y6IA 3CUQC 1MBKA 3J7YJ 4G6DA 3G1OA 3H5NA 3ROUA 1OB5A 3OIPA 4FWTA 3PUMA 5IYRA 5TGTA 5FKMA 2NVXJ 4BACA 2QQ9A 5JBQA 4BY7J 2OC6A 2XPUA 1U5TC 1JJ6C 5CKTA 1DDNA 3FKIJ 5J4VA 2H6BA 4XBFA 5KW9A 4QVAA 2OJED 2ESNA 1BPLA 1PJ5A 3QRFF 2LF8A 2FBIA 4XMYA 1YO5C 1D1BA 3CO7C 3TW7A 3ZN0A 4NQWA 4YIIA 2MW8A 3ZQCA 1VHEA 4P25A 3HHGA 1W0JA 3WHBA 1ZN2A 2E1RA 1QVTA 3W2HA 1FEXA 2NNYA 1ZH5A 2DK8A 2JZYA 1J09A 4BBRJ 1BX1A 4G7ZF 3DTEA 3CCYA 4RGUA 2O61A 3AVYA 3KZYA 2H8WA 2Y9YA 5TY0A 1SVOA 3BC9A 1R5NA 1V5EA 3GXOA 5EEHA 1QFYA 2O9LA 6PAXA 4QHYA 3ZZ0A 2MD0A 2RC6A 1YIJB 3BQJA 1DUXC 4HF1A 1WSUA 4OMYA 1W2BB 3LSKA 3BNWA 4Z4YA 2XPWA 3LSMA 2OTJI 2R7DA 1G3TA 2IVMA 3LA7A 4U0YA 3HPGA 4ZDOA 1PJRA 4MFEA 1P4AA 2ISYA 3ZOBA 3GX4X 3ASTA 3WNDA 1VQLB 2NS7A 1LKXA 1VQ9I 3ASOH 3LNQA 2BHYA 5F64A 4Y13A 1HDDC 3RDIA 5J8FA 2OBPA 2JA7J 4A3LJ 1JA1A 2UWMA 3WNBA 2OA4A 2ZXIA 2DA3A 5F4OA 1MMDA 2UUZA 5LEJA 3I64A 1NK3P 2CFXA 2E1NA 3FF5A 1XMKA 4G1VA 4EMSA 1AOYA 3I9V2 3TDZC 3VB2A 3WU0A 2W57A 4CCNA 4RJLA 2X51A 4I09A 3P9KA 4FK8A 2KIFA 4KUMA 2JVGA 3SZTA 1OR7A 1VTNC 3R0JA 4XLPF 4KKTA 1SM4A 5IT9K 4XLCA 2BMWA 4AC9A 1D3YA 2DMTA 2H94A 4IL6C 4U87A 3WGGA 3HSFA 5K7FA 4E7LA 2X48A 3OOCA 2VN2A 1ELOA 2HKOA 4OPVA 4ENKA 1F1ZA 4E7JA 4P6YA 1KD1D 2ZXWH 4KN4X 3G2BA 4ASUA 4X7FA 2GLOA 1ZM9A 1XFOA 2VBUA 4M74A 3NE5B 2JPCA 4L0ZB 3OFNA 4F52A 3EYIA 1SVLA 1W0TA 2A6TA 2ZZQA 3C3WA 5JI6A 4BQQA 3K69A 3BG5A 3OIQA 1X1AA 2ZITA 2PEXA 3HUGA 3QFRA 3QPLA 4Y52J 4P9FA 3A03A 4JX6A 1TWHJ 3F8BA 1DPUA 4LK0F 4RGSA 2QKLB 2V1NA 1AMOA 3DTIA 3E5XA 3HRTA 1VQOI 1WJFA 5EGOB 3OIOA 2V9PA 4A3IJ 2HPIA 2BY3A 2KLOA 2PMHA 3IKTA 5HS9A 3OZWA 2ESHA 4G6TB 3SEJA 3MWMA 2QBYB 3B6AA 3LSHA 3F6VA 4KT6A 4ZGNB 1YI2B 4B48A 1BL0A 1VQ5B 2C2WA 4IOAF 4I7HA 3ASRA 1YX5A 3FKSA 1W36D 3WGHA 2M7BA 1KQ8A 2BY2A 2AS5F 3ERED 1FIAA 2CQXA 1G2HA 2WSSA 1BR4A 3LA3A 1G4DA 4BHCA 4CO8A 5H5JA 2JA8J 2CF4A 3PM1A 4Z4UA 4Z6YA 2K27A 1XCBA 2DTZA 1H8EA 1V5GA 1UD4A 2EINH 2IT0A 3BTLA 4PC1A 2OCCH 4KFCA 1RESA 3PIOF 4OIPF 2WB1A 1VQKB 3FIWA 1UFMA 2XF5A 2RQPA 3L1PA 2KKOA 4O5VA 4P1WA 1N0VC 3ZQGA 2P81A 5CVJA 3TL4X 1YJNB 3IRRA 1A04A 2WYRA 2VL8A 2CQNA 3AL0B 1S0UA 2V9VA 5ED4A 2QEXI 3ZZTA 5L46A 2K7LA 1BIBA 2CH0A 3W5UA 5AN9A 3FPKA 2C4UA 2IGOA 2MABA 1FOYA 4JP0A 1R49A 2R7TA 1B72A 4RPDA 1ETWA 4GFBA 4M71A 4N9IA 1E3HA 1CQTA 1U8RA 1J7KA 2BXZA 4II3A 3PUBA 3GIRA 1FMWA 1U78A 2VC1A 1SAXA 1S7OA 2BPOA 3G6EB 3K70D 4G8XA 1E79A 3MCZA 3I59B 4XLNF 1WI9A 2KFDA 1B2RA 1DQUA 1O7FA 3OR1C 3L2VA 4ZCLA 2BZTA 4TN1A 4HLYA 4G7HF 4K1XA 3GMEA 2VE9A 3D1NI 1JT6A 3CLQA 3MKZA 4KITB 4ZYHA 3VO2A 2GJKA 1YW8A 4LC0A 1WWXA 3CCQI 3HOYJ 2QTZA 4HAMA 1Z91A 1TVCA 2DT5A 2YWEA 4FETA 3V4GA 4GXOA 3VWBA 4KKSA 2JUCA 2LBFA 3WODF 3MCAA 5LHHA 1N05A 4FISA 1YX2A 4HYEA 3Q5FA 1MDMA 3QFCA 4RCYA 3T8RA 4X7EA 2HGCA 4CYCB 1FNCA 4V2GA 3WTWC 1VF9A 5F4MA 4HW0A 1SFOJ 4MIMA 5IYBJ 1RI7A 1U6GA 2E1MC 1YOVB 2DO7A 2HZTA 3A0HC 3FXRA 5IP9J 4LLGF 1CF7B 1ODDA 3KP4A 3AKZA 3J7ZI 1M1KD 1R00A 3F8NA 1B23P 5M3FJ 2KPMA 3WU1B 3CCVB 2M8EA 3G4SI 3LQEA 3BTIA 4DYQA 2CUJA 1FJLA 2WA0A 2STWA 4OIQF 1FOXA 1NG6A 4FX0A 5DM6F 2B7CA 3GEZA 4FE4A 1LQ1A 5C44J 5E3MA 4NBSA 2COMA 2F5CA 3PO2J 3J81k 4RAYA 2PMUA 2ISZA 3CCLI 5FFZA 2C5BA 3CCRB 4I99C 2E5ZA 4A3MJ 2VBWA 2GIZA 2A69F 1WSRA 3ZQIA 3DBHB 3CJNA 3Q0WA 1E63A 1E64A 4PC2A 2W1OA 3OYLA 3KLNA 1EH8A 2QYOA 4MNUA 2VQHA 4QLCU 1IJWC 3KYLA 1OLTA 2Y0SA 3K4CA 1OB2A 4A5MA 2Y9ZA 2Q6LA 4F55A 3S1MJ 1HKTA 5ILUA 4OIOF 4F91B 2K40A 2CU7A 2XROA 1E3OC 1P4MA 3CC7B 3AVUA 1KA8A 1HXDA 2KMUA 2KP6A 3HRMA 3BY1A 2XIGA 2BGIA 1UJ8A 3FXJA 2KVOA 2CW7A 4BQAA 2OQGA 4JQFA 5F0HA 3HHHA 4BE1A 5DS9A 2FOKA 1XN7A 5FIUA 3U6KA 2PLYA 4F92B 2ACJA 2R5ZA 2F6CA 3E1SA 1VQ8B 2L4AA 2HU9A 4C0SA 4ESBA 1OYIA 2QDXA 2V4JC 5J40A 1LJ9A 1MMSA 2AHOA 1TW3A 4EGYA 4UUTA 3M9AA 3MD2A 3CF2A 2GIVA 3G3ZA 2XGDA 3ISXA 1MJAA 3BJ6A 2PJRB 4FN5A 2QSHX 3CD6I 1K28D 2XASA 3CXCB 2UZKA 2H1LA 2R5YB 2B0LA 2R92J 3D0SA 3K6GA 3J81Z 3E0JB 3LSGA 4XLHA 2IS4A 1NBMA 3BG6A 5ICFA 3W2AA 2O5RA 2QQ8A 1TBXA 3ABKH 4L9TA 4QSHA 3CCEI 2FUG2 2HEOA 1LEBA 5DM7F 1LE8B 5BSXA 2BXYA 2FU4A 2MC4A 3I4MJ 1BIAA 3TBIA 1K6OA 4MTDA 1K78A 1NRKA 4MQ9F 5CQGA 2NS8A 1XE1A 2VODA 1EV7A 3WTYC 2KIUA 2JPBA 1X3UA 4NCNA 1TWAJ 4PGOA 2NNNA 4BEHA 3SFZA 1AKHB 1WJ5A 3AG4H 3GVJA 2XHKA 1W5TA 2EPFA 2VJ4A 4IVNA 1YJWI 1SKYB 2HYFA 3LSPA 4JYKA 3QFSA 3HOXJ 1JB9A 5L3GA 1K9MD 3DKYA 4YELA 1PJ6A 1X1PA 2HS5A 5FO1A 4IF4A 4E6KG 2B63J 1CNFA 4GYIA 2PI0A 4HNVA 5K7HA 2X6YA 3QU6A 4ZYGA 4LG0A 1EP2B 2Q6OA 1YQAA 1JKPC 1Z9CA 3S1QJ 3GBGA 1PUFB 1QO0D 4IRGA 3EUHA 2CW5A 4AIDA 4X06A 1IZ1A 2A05A 5FKNA 2YWHA 2NPFA 3PNYA 1MBFA 5C3EJ 4L5JA 1ZRCA 1G7SA 2MBFA 2CJJA 2X0LA 1JA0A 1ETVA 2DOFA 2PFBA 3HKZA 1IN4A 4DZJA 3HL2A 1SD6A 3V7AA 3DQVC 3I0TA 1XTAA 3RSNA 1ETOA 1XSXA 3G1LA 2V1UA 1E17A 1EFRA 3RKXA 4XORA 2ZXHA 2EV5A 2ID6A 5EZHA 1JE8A 2EIKH 4IHVA 5KSWB 2ZB9A 2YR2A 1FNBA 1ZM4A 4JX4A 2BVNA 2HYGD 2BGCA 4PC6A 1J2XA 3GF2A 3VYRB 3LAPA 5KAIC 2L7ZA 2FNPA 3VDXA 5A2QK 2GPJA 2P8TA 4N3GA 3E6CC 2X1EA 2YU3A 3N97A 3KE2A 4BE2A 2E2HJ 2XV4S 3IKVA 2KL4A 2PE3A 4QIWN 2D74A 2PQ8A 4X8IA 2KDOA 1QBJA 1G3SA 1X1BA 2VPLA 1FNMA 3HRUA 1YLOA 1ZM3A 2ZSIB 3A01A 2QSGX 2KT0A 4M9XA 4UV8A 1MIJA 1DP7P 2BN4A 2HLDA 1TWFJ 2W25A 3CPXA 4HX7A 3ZMTA 3K7AJ 3KX2A 3BLYA 5HS7A 3ZPLA 5ILSA 3B78A 3J80Z 1W7PB 4AC0A 5JHUA 4OOXA 4MEYF 1FTTA 2VNIA 5DN6A 3L2QA 2V1XA 4ZGQB 5D5WB 3MAJA 1Q1VA 3V7RA 1A36A 4U9UA 2LOOA 4ESJA 2G7HA 1QG0A 4UZUA 5C4JJ 3JAMZ 1D5YA 2HXIA 3KEQA 1G7CA 3G71I 1O3TA 4HSRA 2HXOA 1K8AD 2HVRA 1UHSA 3BR3A 3M4OJ 1CF7A 5LLQA 3KETA 4PDKA 3VSLA 2CRVA 3IH2A 4OOVA 4V19K 4DK1A 5IYWA 2HR3A 3I54A 4ASNA 4QTRA 4N3NA 1WDTA 2BY1A 5LFAA 1NB0A 1QGYA 1UD5A 3QQAA 2QWWA 3CMEB 4IHWA 1BW5A 4KIGA 3ZCOA 5HOOA 3ZQLA 4L0YB 4YEJA 4EM1A 2EFWA 1FZPB 2XDVA 4NC7A 1ACIA 3RY8A 4UV9A 2LNBA 4LBZA 3ZBTA 2VIXA 3J80K 2HQAA 4EVIA 1IRZA 2M5WA 4EGZA 1HC8A 5EMNA 3K1PA 2EFNA 1BOAA 1JKQC 5DS0A 1W4MA 4A0YA 4PJMA 3R60A 5AIQA 3K1NA 2JSPA 4WXCA 4XRSA 1PP8F 4BUPA 4LLNA 2CNDA 1OMIA 3KIOA 3A8KA 1B9MA 5KCMA 4KDPA 2COBA 3CCUB 4HEA2 5H20A 4DNRB 2E1BA 4CZZA 3SDGA 1TLHB 4J00A 3GZNB 1AHDP 2E1CA 3FISA 5J3OA 5F27A 2ZBKA 3TO6A 1IJFA 1D8TA 2JQ7A 1F9NA 2JMWA 2HDNB 4Y9UA 3ZC3A 1I39A 5LBQA 1VQ4B 1NHAA 2OK7A 3L9FA 4OPSA 2XZLA 1XGMA 4BPRA 2HKXA 2B7BA 1R7JA 2V6CA 3M07A 2L9SA 4AF6A 2ZFWA 3JW4A 3NQOA 5GV8A 5E8GA 4A3GJ 2O6GE 4YAUA 2CW8A 2W82A 3ONUA 3IH4A 1N0UA 2ADUA 2LD5A 5EYRA 4FHTA 4A3BJ 4ZTFA 2BW3A 3A3GA 1VQ6B 2LY2A 2C78A 2PBIA 4TSFA 2KRFA 3SJPA 2YX4A 3DTKA 1UB9A 3P9CA 1RPWA 4BQOA 1HVXA 3OPOA 3H3UA 2LRDA 1KK1A 3U1KA 2IP2A 1SFEA 1K61A 1HBXG 4DIQA 5J1YA 3I55I 1O3SA 3F9KA 2W48A 1IB0A 3ABLH 2HTJA 4M4SA 2GQQA 2MFZA 1E1RA 1E1QA 4IRHA 1BJZA 2Z1DA 2DOAA 2DFIA 3ZQ7A 1FIPA 4IOCF 2IS1A 1VJSA 1R5GA 1NG7A 3FBNB 2CS3A 4BHBA 2NOGA 3RJPA 1LE8A 3CC2B 3UKGA 3HTSB 2JJ7A 1BX0A 1A6QA 1WOOA 3VSKA 2AQFA 4BY1J 1R6RA 3OYDA 1ETQA 2GXGA 2VKHA 2FSWA 5KAFC 3PVDA 1AKHA 2VT2A 2M0MA 3H36A 3OYCA 2D5VA 1ERDA 4RAGA 4RGRA 1S72B 1H88C 1V5VA 2ZJQF 3T51B 4Z4VA 1T5EA 4DZPA 2A6EF 2AO9A 2M9HA 2P5VA 4ON0A 2HVSA 1QVGB 1WCMJ 2H6CA 1T0FC 3JRAA 2D3NA 4P2NA 3FMQA 3G1MA 2Y0MA 2MLKA 1HZEA 2GOMA 2HOTA 2GXBA 3G05A 3BT9A 4IQJA 4IPAA 1HW1A 3BJOA 3GTJJ 2WPDA 1XGSA 3E20A 1BI0A 1PUFA 1W7PD 4X7CA 4EJTA 2HYJA 2FQ4A 2JK3A 1S9HA 3VNUA 3PENA 2RREA 1OGJA 3FBIB 3F23A 3A8JA 2K4BA 3KP6A 4HE6A 1I27A 2VE8A 2M0CA 3H5AA 3DKXA 3RPQA 1I8DA 4OAYA 2E19A 4LITA 2QE7A 3AVVA 1P4WA 4CUGA 4CCJA 1FPQA 1G3WA 3L2CA 3T5XA 4P5OA 1TC3C 2L7KA 2V7FA 3K1MA 4UVBA 2VOOA 2BEOA 4M3FA 2QLZA 1A6IA 3HOVJ 3MFKA 4DBRA 2OZUA 2ZFUA 3OW7A 2M87A 1D1AA 3M8FA 3OOPA 2O03A 2K9LA 3DP7A 1EF4A 1BMFA 4P22A 1MNDA 1SEUA 2ZMEA 3FXKA 2DK5A 4IHTA 4WQMA 1ZLKA 1EA3A 3PFYA 2K3PA 5LHGA 2JJ2A 2CV0A 4A3CJ 4M6VA 1XD7A 1FC3A 1G8XA 3CLOA 2X1DA 3FK7A 4F93B 1C0WA 5CQEA 1TWGJ 3CC4I 1KMHA 4IKFA 2Q6KA 4XRMA 4AIKA 1VNDA 3EQLF 1WOPA 2LKPA 3I4PA 4JBAA 5IYPA 1B72B 1HKSA 3DPLC 4ABZA 1GXPA 1IC8A 2BM1A 1FRNA 1IXRC 2HOEA 2LR8A 1N25A 1KU3A 1B1BA 2D1HA 3BZ6A 3ZMVA 3QPSA 2D45A 4UUVA 3PL8A 3TOBA 1DARA 2V6EA 4H0EA 3LFUA 3BCFA 1TW2A 3BG9A 3JSPA 3B6CA 3DFGA 1Y0NA 2OU2A 1MZBA 4LD5A 4RB1A 4HIZA 4MYTA 2KJCA 1UHMA 3PSFA 4XKBA 1SC7A 4DYCA 4ACBA 1JHFA 5FKKA 5TJJA 3AG2H 1GR1A 1YITI 3QWLA 2PLFA 1BBYA 3CCMB 4U0VA 2DFHA 4BGDA 2OYNA 3WE2A 1E2XA 2EJRA 2LBFB 5FROA 3DEUA 1H8HA 3FMRA 2GWRA 4Z1MA 4A3JJ 2W4SA 2KZGA 2Y48A 1MDMB 4I0BA 3ZPNA 4HDVA 4AIHA 5GADJ 1ZQ3P 2QKMB 3RYPA 4KMUX 2FMYA 3ASSA 3OWTA 1HKQA 4G7WA 2X6WA 4RD2A 5CJ9A 1XGNA 4E7ZA 2GXAA 1W5SA 4Y17A 3D5RC 1H8AC 2FF4A 4HOBA 1ETKA 1MBEA 4KJZA 1REPC 1LVKA 3QP6A 1QUEA 2RC5A 1FMVA 4TMTA 3BY6A 5KHDA 5K5QA 3OYBA 3RPUD 3CZ6A 3BR5A 4LBVA 3DV8A 2XSJC 1ZGJA 3CUQA 2F5FA 4F7ZA 2VNJA 2WZNA 3D5LA 4MO7A 5DCFA 3HXLA 2XKPA 1K83J 2VT3A 1I50J 4UUSA 3S2DJ 3B02A 5IT9Z 2VOPA 2EA2A 1V3FA 3ZMDA 2DT6A 2J5OA 1U5TA 2V7TA 3RIRA 2A5YB 1EH7A 2HNHA 1OYWA 1T98A 4CA0A 4FXUA 3RI4A 2ELHA 4DQ2A 4XD7A 3H9GA 1T56A 2BM0A 5EEAA 1FSHA 4K2EA 4DGWB 4A93J 2ZL7A 4O3MA 3Q9VA 2OD5A 2J5PA 1ZG5A 2XC7A 2QTLA 3ZMUA 3AVWA 1ZAOA 2YWGA 3BR1A 2KRCA 2W7NA 5B1BH 1VQMI 3OYAA 1F5TA 5DCMB 1WVRA 3OYJA 2Z2SB 1VQPI 4HF2A 1W34A 4L8JA 3ONYA 2LREA 1TNSA 1U3EM 4KN7X 4A6DA 2XAGA 1Z7LA 5GTHC 3RPUA 1PP7U 4ZTJA 3LQQA 3ECOA 3IUOA 2O8XA 4PZJA 5DUKA 4FX4A 3GVKA 1I18A 3DU5A 2ME6A 3ZRGA 2ETHA 1J75A 3HOZJ 1A35A 4R8HA 3VPRA 2JN9A 1ZG3A 5BPIA 4B43A 1G6NA 3JCUC 5HLGA 2R5ZB 3V8JA 3KP2A 1BW6A 1H0MA 3JSOA 4G6IA 2VNKA 4YRVA 1ETXA 1D8KA 4CZCA 3GTLJ 4MQVA 3WBKA 1X3ZB 4B3GA 1Z3XA 4MLOA 1Y56A 3OY9A 1W5CC 3LSRA 3SYTA 4OPOA 4XKCA 3OYFA 3CPWB 2JDIA 3MN2A 2R7XA 5FGMA 2BV3A 1OCRH 4EJWA 1LUJB 3MHPA 3CMYA 2WTEA 3ELKA 3GUDA 4B44A 1VI0A 3V8LA 1JGSA 4BJ5C 1XGOA 1WU8A 3O8HA 2ZNYA 1FYKA 2HQRA 4LK1F 4M6YA 1K78B 4HBLA 1E62A 3CRZA 4J0QA 4HF0A 2JA2A 5D5XB 4OIRF 1ZGAA 2LK2A 4AVZA 3OR2C 5L3BA 2HDCA 1XS9A 1XMXA 2FX0A 2WY7Q 3OEEA 4BEHB 4KIBA 3O6BB 2FBKA 3CCSI 1R23A 4HDUA 1IW7F 5GAEJ 2QN6A 3CCJB 4ZH4F 1D0ZA 2LKSA 2IGKA 2QA4I 2EZLA 3GZ5A 3S8PA 4BAYA 4LFUA 2VQGA 1N78A 2VBTA 5B66C 2MD5A 3LSTA 3JTHA 4NB5A 5C4XJ 2EB7A 2XAJA 2RKHA 4G9YA 4LG0B 5AONA 1HW2A 4LB5A 2Z6BD 1MBJA 1TP4A 1H89C 1F43A 4RPBA 4AD9A 1XPXA 1U2WA 3ASQA 3VFZA 1P7IA 1USTA 5DD4A 4I01A 3SXYA 1YS6A 3Q39A 2B7EA 2GREA 1CGPA 2E1OA 2DMUA 2DBBA 4ENJA 1T95A 2CG4A 2ZXJA 3GTGJ 3F72A 1MJBA 2M3AA 4YFKF 1U9OA 2DJNA 2W00A 3H3ZA 4BXFA 1BC8C 4OWRB 4X0CA 3O2PE 5GTIC 2WAQN 1KK3A 3DBRB 2P7CB 2X6XA 2WY8Q 5L3EA 2BOLA 2FEZA 4G7OF 5E17F 3VR6A 2FQ3A 3DU6A 1W36C 1OHHA 4HA8A 5HZAA 3W6KB 2ZCWA 3TQNA 3QYBA 1NK2P
chains in the Genus database with same CATH topology
1H9GA 2RVCA 3WTZA 3LQRA 3FX3A 2DW4A 1O3RA 4O6JA 3CUOA 2JTVA 4M6XA 3Q9SA 4EJOA 3REOA 2YX7A 2L3DA 3NRVA 3M8EA 2FBHA 3BROA 4CICA 1O3QA 4ENNA 1XDUA 1TNTA 4RAZA 1TTYA 1O7LA 4HQMA 2K02A 2DQRA 1P2FA 5L3FA 1T39A 4FT8A 3EETA 2EFQA 3WTUC 5FD5A 1FLIA 4RB2C 4CYDA 3QPHA 2IA2A 2O0YA 4YG2F 4LMYA 3VODA 4HZFA 2MC3A 5D4RA 3I53A 3KZZA 1UCRA 1OPCA 3GFLA 4EJVA 4UNOA 1KYZA 5DV5A 1YYVA 4UZFA 4Q4ZF 1RIOH 1SMYF 1BI3A 4R79A 2ZJ2A 4KYWA 5DCMA 3IWZA 3QAHA 1LDDA 4ENMA 4PGGA 5BPDA 2L54A 1JXSA 3GO5A 3LFKA 3E6BA 4P96A 3VEPA 2QQAA 1RNLA 3FXUA 3MZHA 3ULQB 3C1DA 2QM3A 4DNCA 5CVRA 2UXXA 2O3FA 1LVAA 1N07A 1SD5A 1FYLA 5KVRA 1B4AA 2DU9A 3R0AA 5J6XA 2ZKZA 2NYXA 4KNYA 2VBXA 5FLXK 4U7DA 5A2QZ 4CGZA 3MZYA 1D5VA 2QENA 1I1SA 1LNWA 4U88A 4LGWA 4YIFA 1STZA 4I98B 2X4HA 3KP5A 4A0XA 5FB2A 3WGIA 5DYMA 1IF1A 2DPUA 5ICCA 4OU0A 5BQTA 5J8CA 2P4WA 5HDGA 3F8MA 2EFOA 4RGXA 2VBYA 2QZ8A 2RDPA 4GYGA 3E97A 2DLLA 2VC0A 4I0AA 2P3MA 4RB0A 1IXCA 1YFHA 3FM5A 4BH9A 2CYYA 3KP7A 2ZMEB 1L3LA 3DF8A 1GVJA 3EYYA 3ZP5A 3OV8A 4EQQA 3I5UA 4G94A 1R1TA 3V7CA 3F8FA 3IHUA 3M1EA 1XSVA 4YFXF 2LF7A 3FZVA 3ISPA 1D8JA 5LGTA 3ZN1A 4R1HA 4Q47A 5A88A 1LDJA 1YW7A 1Q1HA 3HIFA 1R5HA 1B59A 3IRQA 4ZZDA 4MEXF 1ZYRF 1QPMA 5D8KB 1IN8A 3V7SA 1UHWA 5HS8A 1R36A 1GXQA 5HLIA 1ULYA 4WF2A 1BJAA 1MJ9A 2BYVE 5ILVA 3CUQB 1P92A 3SQNA 3I58A 2XGXA 4MHGA 3ML6A 1U5TB 5H6QA 1LB2A 4AVPA 1T2KA 2DPDA 2DTRA 2R3SA 2PJPA 4P9UA 1SMTA 4QWQA 2JRTA 1ZARA 3E5QA 1LDKB 3PQKA 2RN7A 2XRNA 2HFHA 1I6XA 5FD6A 3AAFA 3BJAA 3FWEA 1KU7A 1HSJA 4RS8A 5LRRA 3L7WA 2YSRA 3I71A 3CDHA 4BHPA 1BN5A 1XCVA 2Z3YA 4IRIA 2CW0F 3PQJA 3ABTA 1S6LA 3TKYA 4G6QA 4L9NA 1HW5A 4LJZF 1GHCA 4UHTA 5JFRA 3ZMSA 5F6FA 4UVAA 2DQLA 5D6FA 3GFJA 3N4MA 3ZMZA 4JK1X 1T0FA 1S29A 1F4KA 5CVUA 4LB6B 4BYYA 4ESFA 2RC4A 1R22A 4A2UA 1OKRA 1P4XA 3F8CA 1KU2A 5DDGA 4XSXF 5L3DA 3T1BA 1FBUA 3CO6C 4M9ZA 2XUBA 3KEOA 1FBSA 1NB9A 3L00A 5D8LB 3T0YA 3SHFA 2Q0OA 2DI3A 4KA4A 3H92A 4Q5SF 4Y15A 2W84A 2P6SA 4KICA 4E70A 1FT9A 4ZYEA 3VOEA 1QGPA 4KMFA 1OYYA 4XRFA 3TDUC 3S2WA 2M45A 4L9JA 2XKOA 3TO7A 2A68F 4AIJA 1QQIA 5ICGA 3K9TA 1IRGA 3BOQA 1KQ9A 2Z9OA 1SD7A 1ZRFA 3WTTC 1P6RA 4HLXA 3P7NA 4N9HA 1BC7C 2XVCA 4CDGA 2EWNA 1USSA 3F21A 1WRJA 4HV5A 3LWFA 4RB3C 1MKMA 1S3JA 2PG4A 4I02A 1QNTA 2BBYA 1J59A 5FO5A 3ECHA 1HQCA 5E20A 1T6ZA 3NEUA 5K5OA 2CQKA 2CO5A 2F2EA 1Z7UA 2UXNA 2EV6A 3MEXA 1XDSA 4N0BA 3CTAA 5E18F 5LGNA 3E6DA 2FRHA 3MQ0A 1WKMA 1XSDA 2VBVA 1K79A 4XSZF 2P7VB 2FA5A 1IRFA 1KYWA 5A8AA 3BWGA 3P9IA 2K4JA 1DPRA 3GZ6A 1IUYA 3RKWA 3EDPA 1K7AA 4EM2A 3HOSA 5HVQC 2KJBA 3WTVC 2FNAA 5LGUA 2V1DA 5KK1A 4HQEA 3R61A 4KIFA 3T8TA 1ON2A 1L0OC 1SFXA 3F3XA 5CVVA 4WXHA 3QPTA 5HLHA 3GVAA 1TQPA 5LRSA 4AWXB 5JR3A 2RNJA 2V79A 4GO1A 2M30A 5HDKA 1I1GA 2W24A 3BPVA 4UVCA 2XAFA 1YTYA 2TDXA 1QZZA 4U0WA 2DAOA 1Z05A 4NHJA 4IJAA 5LHIA 2HWVA 1KU9A 3L09A 3ZUGA 3W6JB 2CWEA 1RUNA 1IAWA 1T6YA 4WX9A 5CYVA 1KQ0A 3BDDA 2K86A 1YS7A 1FNNA 2HTSA 1MD0A 2BE5F 1YW9A 5LEKA 3E6MA 4B09A 3RTRA 5JVTA 2VXZA 2VONA 3RYRA 3WG9A 3BP8A 5BS6A 2C6YA 4UZEA 1Z1DA 2P5KA 2E7XA 4WK8F 3GYHX 2XAQA 3TO9A 1IN7A 3U2RA 4EV0A 3R4KA 3FHZA 2W85A 3G73A 2G7UA 3K0LA 2EK5A 4BXUA 5IT3A 1FOKA 5E1ZB 1N06A 1FP2A 1Q9SA 2QVOA 5TRDA 3B73A 2Z99A 4A6EA 4MGRA 3J7AO 1G3YA 2F5EA 2JT1A 4PGHA 2NRAC 5L3CA 2L01A 1BI1A 1LEAA 2CSOA 1ZLJA 5AIPA 1ZG1A 2I1LA 2RV8A 1TQMA 1R1UA 1R58A 2FE3A 5BMZA 4ZZLA 5ICEA 1S4MA 2IJLA 2F5DA 3R6SA 2QQBA 4EJUA 5FLXZ 4A0ZA 5FO0A 1YIOA 2NAZA 2Q2EA 3RKYA 1J5YA 4A12A 4LLLA 4OOIA 2M1BA 3WE3A 2PN6A 2WV0A 1AWCA 4M73A 1KGSA 3QP5A 2GAUA 3U1DA 4CXFA 1FWZA 4CHUA 4ZYDA 4M9SA 1SD4A 2A3SA 3ABUA 2GZWA 5E1WA 2QBYA 3TGNA 2CGPA 3HYIA 1IN5A 3COAC 5CVIA 2OAZA 1FSEA 2EV0A 1Z6TA 2D1VA 4OINF 3F22A 3E5UA 3C18A 2EA4A 3FXQA 4Z2YA 3GWZA 3J81K 2YPRA 4PCQA 1YLFA 2WC2A 1ZRDA 1S7AA 4TV7A 1B6AA 3V8KA 4HX4A 1BM9A 2X0KA 3HTUA 3I59A 2Z5UA 5E1XA 2NS0A 2EFPA 4L5IA 5BOXA 2Y75A 3QOPA 4S04A 3K2ZA 1MGTA 3DXJF 4OMZA 1BI2A 4A5NA 5DEQA 2Q8KA 1YG2A 5E8IA 2ZO4A 1Z6RA 3IL2A 5ERIA 2IA1A 4M72A 1MRZA 3OP1A 1HSTA 3JTGA 2P6TA 2L02A 2HQNA 4ETSA 1FP1D 1J9IA 4L9VA 3FMSA 3DPTA 1T38A 2E7WA 2ZNZA 3GFMA 3PFIA 2WWYA 3KLOA 1J0RA 1FBQA 3KCCA 4U7BA 4YFNF 1XB4A 1PDNC 3JAMK 1Y0UA 3BPXA 1N08A 3IC7A 1WQ2A 1R1VA 2IA0A 3C7JA 5FNZA 5D6EA 3U9GA 5CLSA 5FFXA 2GA1A 4B8XA 4HX8A 4EM0B 3DKWA 1S8NA 3SZPA 3WTXC 2Z33A 2QUFA 4HV6A 1IN6A 2A07F 1ONVA 1T6SA 3IWFA 2MH9A 3HOTA 5A89A 4WWCA 1T6XA 2MA3A 5K1YA 1V4RA 1FX7A 5HDNA 1EH6A 2LDUA 2JSCA 2AXLA 1SFUA 4WCGA 3HSEA 3LA2A 1B9NA 4IHSA 1ON1A 5DUIA 2KIMA 3E3VA 2A61A 2FMLA 3TOAA 2R7FA 4UXNA 2MLGA 1ZREA 4WXDA 2BV6A 2LSOA 2OQRA 2H09A 3HSRA 2P5LC 3GFIA 4KT5C 1FY7A 2IRFG 2STTA 5K5RA 5F1RA 2MH2A 3KFWX 4BNCA 1ZHFA 2OZ6A 1XMAA 2VBZA 3GW2A 1IXSB 2IPQX 1I5ZA 3WTSC 1TQIA 1PUEE 5EEGA 4S05A 4L18B 2RGVA 4P55A 5DD8A 2IW5A 4GGGA 3FM3A 4Q48A 2XAHA 3HRSA 3O3KA 2GA2A 2L4MA 4I2OA 3QU3A 5D5VB 4GCVA 1W7PA 5H6RA 3M7GA 2VBSA 3F6OA 4IXAA 3LAJA 1RZ4A 3GLXA 2G9WA 1RUOA 4D0PA 1QZYA 1H9TA 2FXAA 2D2WA 4MTEA 5D5UB 3KP3A 1FYMA 5D4SA 2H27A 1JHHA 2A6HF 1O57A 3CUQC 4G6DA 3ROUA 2QQ9A 1U5TC 1DDNA 2H6BA 4XBFA 2ESNA 3QRFF 2LF8A 2FBIA 1YO5C 3CO7C 3ZN0A 4NQWA 4YIIA 3HHGA 1ZN2A 2NNYA 1ZH5A 2DK8A 2JZYA 4G7ZF 2O61A 4RGUA 3KZYA 3GXOA 5EEHA 6PAXA 1DUXC 4HF1A 1WSUA 4OMYA 3BNWA 2R7DA 1G3TA 2IVMA 3LA7A 4U0YA 1P4AA 2ISYA 3GX4X 5F64A 4Y13A 3RDIA 5J8FA 2OBPA 2UWMA 2OA4A 5LEJA 3I64A 2CFXA 2E1NA 3FF5A 1XMKA 4EMSA 1AOYA 3TDZC 3VB2A 3WU0A 2W57A 4I09A 3P9KA 2KIFA 4KUMA 3SZTA 1OR7A 1VTNC 3R0JA 4XLPF 5IT9K 1D3YA 3WGGA 2H94A 3HSFA 2VN2A 2HKOA 4ENKA 1F1ZA 4KN4X 2VBUA 4M74A 2JPCA 4L0ZB 3EYIA 3C3WA 5JI6A 3K69A 2PEXA 3HUGA 4P9FA 3F8BA 1DPUA 4LK0F 4RGSA 3E5XA 3HRTA 3IKTA 2PMHA 5HS9A 2ESHA 3MWMA 2QBYB 3F6VA 4I7HA 3WGHA 1KQ8A 2AS5F 3ERED 3LA3A 1G4DA 4BHCA 4CO8A 2K27A 1XCBA 2IT0A 4KFCA 4OIPF 1UFMA 2RQPA 2KKOA 4O5VA 5CVJA 3IRRA 1A04A 2V9VA 5ED4A 2K7LA 1BIBA 4M71A 4N9IA 1U8RA 1J7KA 1U78A 2VC1A 1SAXA 1S7OA 4G8XA 3MCZA 3I59B 4XLNF 1WI9A 1O7FA 4HLYA 4G7HF 2VE9A 4ZYHA 1YW8A 1WWXA 4HAMA 1Z91A 2DT5A 3V4GA 4GXOA 3WODF 5LHHA 1N05A 4HYEA 3Q5FA 1MDMA 3T8RA 2HGCA 3WTWC 4HW0A 1RI7A 1U6GA 2HZTA 2DO7A 3FXRA 1CF7B 4LLGF 1ODDA 3KP4A 1R00A 3F8NA 3WU1B 2M8EA 4OIQF 2STWA 4FX0A 3GEZA 1LQ1A 2COMA 2F5CA 4RAYA 2PMUA 2ISZA 5FFZA 2VBWA 2A69F 3CJNA 3KLNA 1EH8A 2QYOA 4MNUA 4QLCU 4A5MA 1HKTA 5ILUA 4OIOF 2XROA 1P4MA 1KA8A 1HXDA 3HRMA 2XIGA 4BQAA 2OQGA 4JQFA 3HHHA 2FOKA 1XN7A 2PLYA 2ACJA 2L4AA 4ESBA 1OYIA 1LJ9A 1TW3A 4EGYA 3M9AA 2GIVA 3G3ZA 1MJAA 3BJ6A 2XASA 2UZKA 2B0LA 3D0SA 3J81Z 5ICFA 1TBXA 4L9TA 2HEOA 1LEBA 2FU4A 1BIAA 1K6OA 1K78A 4MTDA 4MQ9F 2VODA 1EV7A 3WTYC 2KIUA 2JPBA 1X3UA 2NNNA 3SFZA 2XHKA 1W5TA 4IVNA 2HYFA 5L3GA 2HS5A 5FO1A 4IF4A 4GYIA 2PI0A 3QU6A 4ZYGA 4LG0A 1YQAA 1Z9CA 1QO0D 4IRGA 3EUHA 1IZ1A 4L5JA 1ZRCA 2MBFA 2X0LA 2PFBA 1IN4A 1SD6A 3DQVC 3I0TA 2V1UA 1XSXA 1E17A 3RKXA 2EV5A 1JE8A 2YR2A 2HYGD 2BGCA 1J2XA 3GF2A 3LAPA 5A2QK 2FNPA 2P8TA 3E6CC 2YU3A 3N97A 3KE2A 2XV4S 3IKVA 2PQ8A 1QBJA 1G3SA 3HRUA 4M9XA 1DP7P 4UV8A 2W25A 4HX7A