3CTAA

Crystal structure of riboflavin kinase from thermoplasma acidophilum
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
216
structure length
187
Chain Sequence
b'DQYYRAIKKIKEAAEASNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTVTKRGQILNITEKGLDVLYTEFADLSRILAIKNNVVITGTVTSQYIIQFQEKLGIIPYLNIKVDQASLPELRKIRGFRGIHIEGFKTRTFGSVKAFPAKIQNIPCFVIMPERTVYTDVIEIISDDRVSVEVYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Riboflavin kinase
publication title Crystal structure of riboflavin kinase from Thermoplasma acidophilum.
rcsb
source organism Thermoplasma acidophilum dsm 1728
molecule tags Transferase
total genus 56
structure length 187
sequence length 216
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ctaA01
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 3ctaA02
3EETA 3U2RA 2COMA 5H20A 3I5UA 3E5XA 4GCVA 4OOIA 5K5QA 2MA3A 1XN7A 4HF0A 2VE9A 2BEOA 4XLPF 4MGRA 4BH9A 5ICGA 1P6RA 4P9UA 5DEQA 1MKMA 1XD7A 2G7UA 4IJAA 4MEYF 3J81K 1VTNC 1YW7A 3O2PE 1MDMA 1ODDA 3CDHA 1YS6A 3QRFF 2I1LA 5HDKA 4KNYA 2ZJ2A 2VXZA 2K27A 2NYXA 3HTSB 1BBYA 4CHUA 3BNWA 1ZLJA 1OPCA 1XB4A 2KIFA 2IP2A 5IT3A 2YX4A 4ZZDA 1LDDA 2FE3A 2ZKZA 2A61A 3M7GA 2ZNYA 4WCGA 5F6FA 5L3BA 4JBAA 1OKRA 1BJAA 5TRDA 5D5XB 4LLNA 3LA3A 3RKYA 1SD7A 1R5HA 3D5LA 2VC0A 2ACJA 4U0YA 3FXQA 4CXFA 5K5OA 1FC3A 3ZPLA 1T6YA 3KCCA 4CO8A 1B6AA 2V1DA 1FNNA 4KN7X 5FD5A 4WX9A 4FX4A 4HYEA 1O57A 2BGCA 1FPQA 1MZBA 4M9XA 5KVRA 3J7AO 3FX3A 1ON2A 2OBPA 5AONA 5E1WA 2GWRA 2PFBA 1MGTA 1GXQA 2KIMA 1IAWA 5CVJA 3DKWA 4XSXF 3RIRA 1H0MA 4GO1A 2FBHA 3K0LA 1J5YA 5L3FA 2XAGA 3TO9A 2EV0A 1REPC 3I4PA 3V7SA 4L9NA 2MLGA 2XAQA 1WWXA 3OV8A 1KU9A 3KP7A 3EYYA 2R7DA 5DCMB 2A68F 2HKXA 3CO6C 1PP8F 1I6XA 4A0YA 1F1ZA 2CG4A 2FEZA 2H6BA 4OU0A 3M8FA 2NS0A 3MZYA 2RKHA 1YYVA 4IRGA 1R00A 1N08A 2GXGA 5E1ZB 4N9HA 1P4WA 2ISYA 4P9FA 1BOAA 4GYIA 1D8KA 3DV8A 5D6FA 1S4MA 2EV6A 3P9IA 4BAYA 2M87A 2RVCA 2K4BA 3JW4A 4NHJA 2RV8A 2Y0MA 1KU3A 3BDDA 4PGHA 3CUOA 3PQJA 2HTSA 4ZYGA 2PQ8A 3E6BA 3HYIA 3QOPA 5FLXZ 1JXSA 1YW9A 2K7LA 2VBZA 1XDSA 5HLIA 5E8IA 5CVIA 4EV0A 4RB0A 3SXYA 2M1BA 5TJJA 4EGZA 5E20A 4ENKA 5LRRA 2RGVA 4UZEA 3ELKA 3T8TA 2EV5A 3O6BB 3F6VA 2W24A 4I0BA 3SZTA 3TOAA 4HBLA 4G7HF 2XVCA 2VBYA 1ZRFA 5DD8A 4KICA 2ADUA 4EM2A 1H9GA 4P55A 2PJPA 1IRGA 5J6XA 1S6LA 5D5WB 1I1SA 3HIFA 5LGTA 1ZG5A 4RGUA 1W5SA 4L0YB 3KP4A 2HOEA 4EVIA 2V1UA 4KMUX 2DW4A 1FX7A 2C6YA 1U3EM 2STTA 3VB2A 2IJLA 2ZCWA 2RC4A 2ZMEB 4CICA 1IUYA 2XROA 1HSJA 4HDUA 1IRFA 1XGSA 4TV7A 3IKTA 2XKPA 5CJ9A 3SFZA 1XGNA 3LWFA 1XGMA 1Z7UA 5BS6A 4G6DA 5CLSA 2L01A 3KE2A 2OU2A 2W25A 3VOEA 1BI0A 4M71A 2JTVA 5FNZA 4KIFA 2QQ9A 2DAOA 1KA8A 1L3LA 3D0SA 1K78A 4LB6B 2FBKA 3V4GA 3QU6A 3HSFA 1CGPA 2EFQA 4BNCA 5ERIA 1YFHA 3WTSC 3DPLC 3HHGA 2QVOA 1G4DA 2A69F 3RI4A 3FXUA 3I59A 2QWWA 2W84A 3BOQA 3WTXC 5EEGA 3WU0A 4I2OA 2MLKA 1Q1HA 5FO5A 2WTEA 2KKOA 1W4MA 1RUNA 1W7PB 3M9AA 2XAHA 4O5VA 3DXJF 4OIQF 4ASNA 3DQVC 3WE2A 2D45A 1IN7A 1DPRA 3SZPA 2ETHA 1OR7A 2B0LA 5HVQC 1KYWA 3HHHA 1N06A 5LLQA 3EQLF 1B4AA 1KQ8A 2QQBA 1K6OA 2DQRA 2HDCA 4WXDA 1SAXA 4HF1A 2E1NA 4KIGA 1R36A 1RI7A 4UHTA 4ZYDA 3S2WA 1QZYA 3W6JB 4N0BA 3V8LA 4HV6A 5D4SA 3TGNA 2O61A 5A2QZ 1DUXC 3B73A 2DI3A 3E3VA 4WXCA 1NB9A 5H6QA 2XAJA 2YR2A 4PDKA 3ECHA 3HRTA 1ZAOA 2ZXJA 3IWZA 6PAXA 4I0AA 3TO7A 3T5XA 1U8RA 5LHGA 4G9YA 5ILVA 2WV0A 2MH2A 4M6YA 5LGNA 1LJ9A 2PI0A 4HX4A 1HBXG 2VBSA 3EDPA 3F8MA 3FMRA 3P7NA 3K1PA 4P5OA 3MQ0A 1XMAA 2OZ6A 4A0ZA 4Q47A 3LA7A 5BOXA 3GFMA 4BXUA 4CDGA 2L4AA 1ZG3A 4EJTA 1T2KA 4I01A 4Q48A 1HKQA 4I09A 2Z5UA 2EFPA 2O8XA 2RQPA 4D0PA 2D1HA 5DCMA 5LEKA 4WF2A 1K79A 1J59A 2P7VB 2DPDA 2Z99A 4EMSA 4HAMA 1HW2A 3E97A 2VT2A 2HZTA 2K02A 1B1BA 2WWYA 1C0WA 3DFGA 4LD5A 2TDXA 2CQKA 1TBXA 1NHAA 1WI9A 3RYPA 4A5NA 3VEPA 5A8AA 1T6ZA 1IXRC 5D4RA 3ZN0A 4KFCA 3L00A 3GF2A 4GYGA 4ZYHA 4M74A 2OAZA 3RDIA 2O0YA 2VBWA 4EM1A 3LA2A 3TKYA 3ZN1A 1K78B 4G7ZF 3MZHA 3GX4X 2R3SA 4YFKF 1AOYA 1H9TA 2RN7A 1ZGJA 2QLZA 2MD5A 2IT0A 1TW2A 2H6CA 4RAZA 3F21A 3I59B 2PG4A 2XASA 5FGMA 4ETSA 1FWZA 2FQ3A 3V8JA 2XGXA 4AWXB 3KLNA 4QWQA 3F8NA 2FRHA 3GO5A 4BHPA 2O6GE 3F3XA 5BMZA 5E18F 2ESHA 1BM9A 1PP7U 2VOOA 4G6QA 1UCRA 2VODA 1MJBA 5AIPA 3QP5A 5HDGA 4CZZA 1AWCA 3GLXA 4EGYA 2A6EF 2ISZA 1SFEA 1ZYRF 4HX7A 2NRAC 4P96A 3I64A 2W85A 2V9VA 1KU2A 2XIGA 2M5WA 2ZMEA 2P5KA 3SQNA 3T1BA 4MHGA 3I58A 4IRHA 4Y15A 5ICFA 3WGIA 4HW0A 1OYYA 1LDKB 3BP8A 2VE8A 5LHHA 1S7AA 4RB2C 2GA1A 2HYGD 3IC7A 2KJCA 1UHWA 3LAJA 2OA4A 4GXOA 2NAZA 3V7CA 4ON0A 2GQQA 2GAUA 3KZZA 3FF5A 4U88A 2CW0F 1GHCA 4YIIA 1LDJA 3ZMZA 2CO5A 3FMSA 3M8EA 3L2CA 3F22A 4ENMA 1J0RA 2K4JA 1J7KA 5ED4A 1QQIA 3BJOA 3J81Z 3E5QA 1IN6A 2YSRA 4R79A 2VBVA 4U0WA 4ESJA 3ECOA 4LK0F 4Z2YA 2OD5A 1P4XA 2JZYA 2X0LA 4BHCA 2F5FA 3BWGA 2CFXA 1WQ2A 1T6SA 1W7PA 3F6OA 5HOOA 1TW3A 3ZMUA 3BJ6A 4NQWA 3FZVA 2PMUA 1XGOA 2FXAA 3FMQA 3JAMK 1FBSA 2LF7A 1P92A 5HDNA 3QU3A 2QYOA 2XAFA 3LQRA 2HYFA 3DP7A 4AIJA 1F9NA 3Q5FA 3CUQB 3KP5A 3ROUA 1G3YA 4AVPA 5DD4A 2EB7A 3K1NA 4YFNF 3SHFA 3ZUGA 2M8EA 5BPDA 1JGSA 1QGPA 1ZN2A 2LDUA 3B02A 1FBQA 4HF2A 1FSHA 3CJNA 5FD6A 3HRUA 5LEJA 4RGSA 4YG2F 4DQ2A 4F7ZA 2XV4S 4KUMA 4E70A 5FB2A 1Z91A 4CGZA 3FHZA 4A2UA 4HLXA 4RGRA 1GXPA 4R1HA 2P3MA 1N05A 4ZZLA 1BC7C 3GUDA 3K69A 3I53A 4RS8A 1I5ZA 2KIUA 1O7LA 4M9ZA 3E5UA 4HOBA 4L0ZB 1G3SA 3K9TA 2ZNZA 4YFXF 4OINF 1F4KA 1HQCA 1Z05A 2STWA 1V3FA 3GYHX 2IA0A 4PGGA 5HS8A 5E1XA 2LF8A 4ZYEA 3KETA 2EFNA 2DU9A 4KA4A 3ABUA 2G9WA 3GFJA 2VOPA 2JSCA 3ABTA 3TDZC 3DEUA 4A0XA 1KU7A 2A3SA 3I71A 2VC1A 3L7WA 2Q8KA 4KYWA 2DTRA 1T38A 2IA2A 5H6RA 1OYIA 1RZ4A 4XLNF 1YIOA 1HSTA 2EWNA 3WTYC 1LEBA 2FBIA 1IZ1A 1X3UA 4A5MA 1ZREA 1SFXA 1XSVA 4EM0B 1ZLKA 1YO5C 1YG2A 4LMYA 1BC8C 2O03A 2L3DA 1BI2A 4GGGA 1DP7P 3MWMA 1XSDA 1TQMA 3CTAA 4A6DA 1S3JA 1ZRDA 4G94A 1E17A 4M73A 4LJZF 2A07F 3NRVA 1YS7A 3Q9SA 2MH9A 4QLCU 3HRMA 5HLGA 1TTYA 4ESFA 3K1MA 1U5TB 3MEXA 1R5GA 2ESNA 5L3EA 1UB9A 4KT5C 2F5DA 3KEOA 4ENNA 2HEOA 5A88A 1P4MA 3KP6A 4HQEA 4WK8F 2V79A 2M45A 4XBFA 2PLYA 4NB5A 2EA4A 1R58A 3LQQA 2UXXA 1QBJA 1NB0A 5LBQA 1S7OA 2EFOA 2X4HA 3IRQA 4XSZF 3ZMVA 1Q9SA 2VT3A 3WGGA 1RNLA 1LB2A 5F64A 3T8RA 5IT9K 1QZZA 4BHBA 3P9KA 3HOSA 1DDNA 1BI3A 5E8GA 3GZ5A 4LLGF 3BJAA 4ENJA 4JQFA 1LEAA 3RPUA 4EJUA 4IXAA 1ZG1A 4A6EA 1T39A 2J5OA 5HS7A 2DT5A 3GWZA 4IHTA 1T0FA 2HKOA 1XCVA 1FSEA 4PZJA 2EFWA 2OYNA 4MTEA 5FFXA 1JHHA 3W6KB 5DUKA 4OIPF 3ZMSA 3WU1B 2HTJA 5D8KB 1MJAA 1G3TA 2EA2A 2Q2EA 4EJOA 1OYWA 4JK1X 5FFZA 3VFZA 2CGPA 1QNTA 1Z6TA 2RDPA 1U2WA 5K1YA 1O7FA 4WXHA 2KJBA 1ZARA 2EK5A 1Z9CA 2QENA 1O3QA 1IW7F 2JPCA 4LG0A 2FOKA 3WTUC 1U6GA 4L9JA 4HQMA 4OIOF 4AIHA 3I54A 3PQKA 4I98B 2RNJA 2IRFG 4IVNA 3CUQA 4H0EA 4G7OF 2XUBA 4IF4A 3ZMDA 1S8NA 2A6HF 3U9GA 1CF7B 1PDNC 2YU3A 3J80K 3TOBA 5L3GA 1HW5A 4L18B 3JSPA 3RKXA 2X0KA 3KP3A 1V4RA 1FY7A 2PN6A 3WODF 1BI1A 1XSXA 4M72A 2EJRA 3QP6A 1D3YA 3FM3A 5DUIA 5ILUA 3COAC 3E6MA 1BIBA 3CUQC 1L0OC 3WGHA 3F72A 4A12A 1EH7A 3PFIA 3ZQ7A 2ZO4A 1IN8A 3G73A 2QQAA 3C18A 2HR3A 2VBTA 5DDGA 4IPAA 4MQ9F 5DV5A 2E7XA 3JTHA 2BYVE 3HUGA 4OIRF 2GZWA 1B59A 1R1UA 3F8FA 4Q4ZF 3MAJA 3FXRA 3M1EA 4HZFA 2W57A 2DK8A 4M9SA 2F5CA 4YIFA 4FHTA 4RAYA 4MTDA 1KQ9A 3E6CC 3REOA 3RKWA 3ZP5A 2P5VA 1FYLA 3O3KA 3GW2A 2PBIA 1FYMA 3CLOA 1FOKA 3J80Z 1W5TA 4UVAA 2VONA 2OQGA 2A5YB 2V1XA 4MEXF 5K5RA 3C3WA 4LFUA 3K2ZA 1T98A 3KP2A 2O3FA 2HFHA 4KN4X 5DYMA 4B09A 5JFRA 1GVJA 5BPIA 5FO1A 2E7WA 2XHKA 4O6JA 2VN2A 3F8BA 4EQQA 1JE8A 1R1VA 4Y17A 2FMYA 4XRFA 1B9NA 3RTRA 3G3ZA 1FYKA 3RYRA 1FBUA 3MCZA 4KMFA 3TQNA 3BPXA 4FX0A 2JPBA 5CYVA 4LLLA 1SFUA 1ON1A 5FLXK 2Q0OA 4KIBA 4UVCA 1U5TA 1ZRCA 3F23A 2JRTA 2IVMA 4KDPA 2L4MA 1BIAA 2DPUA 2LKPA 2CWEA 5FO0A 3GFLA 4EJVA 4M6XA 5AIQA 1HKSA 3WG9A 3BZ6A 3EUHA 2FMLA 4AD9A 5D8LB 1N07A 2MC3A 2ZFWA 4UV9A 4LG0B 3ISPA 2FU4A 5ICEA 4HX8A 3IL2A 1W7PD 2PMHA 5JHUA 1IN4A 3N97A 2OQRA 3QPTA 1ZH5A 2HQNA 3C7JA 2AS5F 1I1GA 3I0TA 4G8XA 4DNCA 2FSWA 3H92A 3OP1A 3HSEA 1U5TC 5J8FA 3L9FA 4I7HA 1HKTA 1WSUA 3R0AA 1SMTA 4BQAA 2VBUA 2QBYB 3GFIA 2GXBA 4IHSA 2UZKA 1XDUA 2P7CB 3QPHA 1BN5A 1WRJA 1J2XA 2Z9OA 1FT9A 2Y75A 1KQ0A 1KYZA 4WWCA 4HLYA 2K86A 1YLFA 3GEZA 3Q9VA 4MNUA 4L9TA 3IRRA 3R61A 5BQTA 1SD5A 3U1DA 3EYIA 2VBXA 3L09A 4BYYA 4L5IA 4S04A 2IW5A 1R7JA 2G7HA 1R23A 1HXDA 3RPQA 1SD4A 2J5PA 2HGCA 5LHIA 4OMYA 1ONVA 2V6CA 3R4KA 3ML6A 1ZGAA 2DBBA 2JT1A 2DO7A 3AAFA 2P5LC 1TLHB 2E1CA 2FNPA 5E17F 3ERED 1IXSB 1P4AA 3NQOA 5ILSA 1MDMB 4Q5SF 1Z1DA 3KZYA 3HTUA 3GZ6A 5HS9A 3JAMZ 5HLHA 2M30A 4LGWA 2FF4A 1QO0D 3QAHA 5L3CA 5L3DA 2KRFA 1UFMA 1LQ1A 4K2EA 3E6DA 1TQIA 5F1RA 4UZFA 2H09A 3RJPA 4U7BA 3H3UA 1LVAA 2BE5F 5J8CA 4LK1F 4PCQA 1CF7A 5CVRA 4S05A 4B8XA 2P6SA 2LNBA 1MJ9A 3WTTC 5KK1A 1SD6A 1IF1A 2DQLA 1U78A 3WE3A 2Z3YA 4MQVA 1YQAA 1HW1A 1G3WA 1TNSA 4RB3C 3V8KA 5D6EA 1O3SA 2DK5A 2L54A 1FP1D 1QPMA 1Y0UA 1E2XA 2L02A 1EH8A 4Y13A 1YTYA 4EJWA 2P8TA 4L5JA 3IKVA 1Z6RA 4UV8A 2XKOA 1EV7A 1P2FA 3MFKA 1JHFA 5JVTA 5CVVA 3GXOA 2H27A 5A2QK 2ELHA 4HDVA 1FP2A 4HV5A 1O3TA 1UHMA 3FM5A 3LFKA 2D2WA 1WKMA 1ULYA 4ESBA 1SMYF 2GA2A 4FT8A 2Z33A 1J75A 4I02A 1OMIA 1EH6A 4R8HA 4UXNA 3R0JA 3HOTA 2UXNA 1MRZA 2BV6A 3GVAA 3JTGA 2FA5A 2F5EA 3WTVC 2IPQX 2OZUA 2ZBKA 3JSOA 5LRSA 2F2EA 2FNAA 4L9VA 4U7DA 3ULQB 1MD0A 3DPTA 5LGUA 2IA1A 5D5UB 1TNTA 1IXCA 2NNNA 5CVUA 2D1VA 4UNOA 4O3MA 3N4MA 2QZ8A 2NNYA 1STZA 1DPUA 3BPVA 4LB5A 1YW8A 3V7RA 1K7AA 1A04A 3IWFA 1PUEE 3KEQA 3LAPA 3FWEA 2DFIA 3TDUC 5JI6A 3KLOA 3VODA 1B9MA 2PEXA 4HA8A 2QUFA 2MBFA 4N9IA 1D8JA 3TO6A 2Y48A 1I27A 3BROA 3HRSA 3IHUA 4ZH4F 2QM3A 2CYYA 1FLIA 2UWMA 5D5VB 2DLLA 5JR3A 3HSRA 2YX7A 1KGSA 3KFWX 1D5VA 3LSTA 2HS5A 2YPRA 3NEUA 2BBYA 2CSOA 5A89A 2P6TA 1ZHFA 2LSOA 2H94A 5EEHA 1XCBA 2GIVA 1O3RA 1T6XA 2AXLA 2HQRA 1J9IA 1IN5A 3R6SA 5IT9Z 1G6NA 3WTZA 3T0YA 1FZPB 4AIKA 4IRIA 1LNWA 3WTWC 3H3ZA 3R60A 4UVBA 3OOPA 2XRNA 4RGXA 3F8CA 2QBYA 1RIOH 3P9CA 2WC2A 3CO7C 2R7FA 4UUVA 1RUOA 2P4WA 1TQPA 1XMKA 1USSA 1USTA 3C1DA 3ZMTA 4OMZA 5DCFA 1S29A 5ICCA 1R22A 2HWVA 3DF8A 1F5TA 1R1TA 3BY6A 4CYDA 4U0VA 4RB1A
chains in the Genus database with same CATH superfamily
4DYCA 1QGAA 3L1PA 3EETA 1S9HA 5TV2A 5THXA 2HOTA 4NC6A 1XS9A 4PJ0C 5B3SH 3U2RA 2COMA 2OUMA 1GV2A 3K10A 5H20A 1PJ7A 3I5UA 3E5XA 4GCVA 4OOIA 2IBDA 4ZDLA 5K5QA 2MA3A 3I56B 2XZLA 5IYNA 1XN7A 3HBLA 1SVOA 4V2FA 1UD3A 2DERA 4HF0A 2VE9A 2BEOA 2VYQA 3R6JA 3H5AA 4XLPF 1YHQB 4MGRA 4BH9A 5ICGA 1P6RA 4P9UA 5DEQA 1MKMA 3ZR8X 4Z4WA 1XD7A 2G7UA 3GMEA 4IJAA 1HDPA 2E1BA 3S1QJ 2XPWA 2R93J 3CCLI 2VASA 1WOPA 4MEYF 3J81K 1MBHA 2BF4A 1MBGA 4AC9A 1VTNC 1YW7A 2IGKA 1TUIA 4X8IA 3KEYA 5J3LA 3BR6A 3O2PE 1WJ5A 1MDMA 1ODDA 1D2EA 3CDHA 4MYUA 1YS6A 3QRFF 3LMMA 5HDKA 2I1LA 3JR9A 4KKSA 5C4XJ 3OYCA 1B2RA 3BTIA 1U8BA 4TMVA 1V5GA 1YRNB 3K4BA 3I3LA 2WADA 5FKKA 3VYSB 4KNYA 2XGEA 3WHCA 2ZJ2A 2VXZA 2K27A 1BOBA 3D5SC 1K73D 1YIJB 2NYXA 4RBOA 3HTSB 1BBYA 4CHUA 4YIRX 3BNWA 1MBJA 3JRDA 1ZLJA 1OPCA 4PJLA 2ELKA 5IOZA 1QFZA 4XORA 1XB4A 2KIFA 4D7MA 2QTZA 1GV5A 1UZCA 2VJJA 2IP2A 2XSDC 1VQMI 5IT3A 3BZCA 1W34A 2FD5A 2YX4A 4ZZDA 1LDDA 1QGZA 1KZLA 4XL9A 2ZBVA 1TVCA 2FE3A 2Z2SB 2ZKZA 3QODA 4NCNA 3AL0C 4KKUA 2LBFA 4E6KG 2A61A 3JCUC 4LC0A 3S2HJ 4AYBA 2CRGA 2Y2ZA 1WJEA 3M7GA 2BZTA 1WJBA 2ZNYA 2R7UA 4WCGA 5F6FA 3QOEA 2CW8A 4WWVA 1G8XA 4F91B 5L3BA 4JBAA 2F4MB 3PNTA 4LG3A 1OKRA 1BJAA 4DJAA 5TRDA 1SEUA 1I7PA 5GP9A 2XGCA 5TY0A 5GPAA 5D5XB 1DGWY 4PJMA 2E2IJ 2IS2A 1FRNA 4CCJA 5E79C 4LLNA 3DTIA 4XMYA 1MBKA 3LA3A 3SYTA 3RKYA 5H59A 3WBJA 1BR1A 1SD7A 1R5HA 3D5LA 3NE5B 4G7XA 2VC0A 1TWCJ 2ACJA 4U0YA 3GVKA 2KDZA 1Y0NA 3RZDJ 3FXQA 2EQRA 4CXFA 3D5RC 3M8JA 5K5OA 1FC3A 2ME6A 3OYGA 2BSAA 4ACAA 3ZPLA 2VPRA 1T6YA 3ISXA 3KCCA 4CO8A 3CCVI 4HIZA 2HVSA 1S0UA 3SEJA 3BR3A 1BR2A 1B6AA 2V1DA 2VKVA 2B7BA 5FL7A 1FNNA 4KN7X 5FD5A 3LNQA 3OJXA 4WX9A 2VJIA 4ZCLA 4II2A 4FX4A 1VF7A 4HYEA 1O57A 2BGCA 1VQPI 1FPQA 2X8KA 1M90D 2VNHA 4MO7A 2BVLA 3ZQHA 4D7NA 2DMNA 2M7AA 4RJLA 2IS1A 1V0EA 3GTLJ 3SLNA 1D1AA 2C5BA 1MZBA 2AO9A 1UELB 4G12A 2L7KA 4M9XA 5KVRA 3J7AO 3FX3A 4M3DA 4PC7A 5FKOA 2OBTA 1ON2A 2M8GX 2OBPA 3FIWA 5AONA 3PUMA 4OP7A 5E1WA 4IX7A 3U2QA 4C0SA 2GWRA 1VZ0A 2PFBA 1MGTA 3TMOA 4RCYA 1GXQA 2KIMA 1IAWA 5CVJA 4IQ4A 3HOWJ 3DKWA 4XSXF 3RIRA 1H0MA 4GO1A 2FBHA 3DU6A 2A6TA 3K0LA 1J5YA 1ZGWA 5L3FA 2XAGA 5EG0B 3TO9A 2EV0A 1REPC 3I4PA 5GTHC 3V7SA 4RD3A 2HXIA 3HC7A 4A93J 1DU6A 1IJFA 3A3BA 3Q6QA 5J1YA 2KISA 4WZLA 4L9NA 2MLGA 5E3MA 1MMSA 2XAQA 3MD2A 3SFIA 4UB8C 1WWXA 3FXOA 4OWRB 4A3FJ 3OV8A 1KU9A 3KP7A 3ZZUA 3EYYA 3GBGA 2L2OA 3G71B 2R7DA 2Q1ZB 4CCNA 3BQZA 5DCMB 2R5ZA 2BVMA 1Y56A 2A68F 2HKXA 3CO6C 1PP8F 3CCQI 4P1VA 2Y0SA 2ZJPF 1I6XA 4A0YA 1F1ZA 4PC2A 1JTYA 2CG4A 2X85A 5DS9A 1IJEA 2FEZA 2H6BA 1UD8A 1XMXA 2ME0A 3D1NI 4OU0A 3M8FA 1E3OC 2OK8A 2LFBA 3OJWA 3ONUA 2NS0A 3MZYA 4JX5A 5C3EJ 5FRMA 2RKHA 1YYVA 4IRGA 1R00A 2LK2A 4BKXA 5J1RA 2DXIA 2JA8J 1N08A 3K70D 3W5UA 2GXGA 5FRNA 5E1ZB 4N9HA 4XD7A 1P4WA 3L2VA 3H0DA 2AXTC 1ZTRA 2ISYA 2VB6A 3O8GA 4BY1J 1YI2B 2JA6J 4P9FA 3ZZ0A 1VQLI 1LKXA 5C44J 1BOAA 3Q0WA 4GYIA 2JA7J 4M1KA 1D8KA 3DV8A 3MVPA 2IGOA 5D6FA 3I1FA 3ZIAA 1S4MA 2EV6A 4OAZA 5F4JA 3P9IA 3A01B 5M5YJ 4BAYA 2M87A 2RVCA 2K4BA 3PUBA 3JW4A 4NHJA 2RV8A 3QFTA 3IAM2 5K7HA 2R7TA 2BV3A 4M3BA 3DEWA 2Y0MA 3S3NA 1W2BB 1KU3A 1TWAJ 3BDDA 1PJRA 1ZK8A 3CUOA 2ELJA 2HTSA 3PQJA 2PQ8A 3E6BA 3HYIA 3QOPA 4PGHA 4D5CA 4ZYGA 4IHYA 3OFNA 3HJEA 1YJNI 5FLXZ 1JXSA 1YW9A 3QE2A 1OISA 1OLTA 2K7LA 3OYJA 2C2WA 3GTGJ 2VBZA 2R7OA 1XDSA 5HLIA 4BDZA 5E8IA 3SJZA 2I5UA 5CVIA 4EV0A 3CD6I 3PFYA 3ASPA 2VNIA 4BUPA 4RB0A 3SXYA 2CW5A 2QCOA 2M1BA 5TJJA 4EGZA 2C78A 3BTJA 5J4YA 2NS8A 1X1PA 5E20A 4ENKA 2VNJA 3H94A 1N25A 3FBIB 5LRRA 2RGVA 2VL8A 3ELKA 2QGGA 4UZEA 1S7EA 2DMQA 3CCSI 3H3VK 4QUZA 2WA0A 3G6EI 4YELA 3T8TA 2EV5A 4AM3A 3U6KA 3O6BB 2CJJA 2L5QA 3Q38A 5H5JA 3F6VA 1HC8A 2W24A 1WSVA 4P1WA 2XPUA 1X4OA 3OIOA 1HCRA 4I0BA 3SZTA 3TOAA 3OYLA 4HBLA 4G7HF 2XVCA 2VBYA 2Q6LA 5F08A 2BXZA 1ZRFA 1VQOB 2CQQA 5DD8A 1B72B 1R5NA 4CCKA 4M53A 2R4GA 4KICA 1XE1A 1GAWA 2ADUA 2ZL7A 4FN5A 4EM2A 2DOAA 1H9GA 4E7JA 4A3GJ 4X7FA 3RZOJ 4P55A 2PJPA 1LUJB 2E36A 3SZGA 3W2AA 1IRGA 5J6XA 3OPOA 1S6LA 4WZEA 5D5WB 1POGA 3G05A 1I1SA 2VI6A 4F92B 3A2KA 3HIFA 1T08B 1WPKA 5HZAA 5LGTA 3VYUB 1EJ9A 1ZG5A 3OIPA 4RGUA 2WAQN 2M0CA 1NK2P 2BHYA 4RLQA 1LE8B 1W5SA 4L0YB 2LBFB 1VQ6B 3KP4A 3OZWA 3FHNA 2HOEA 3AGQA 4EVIA 2V1UA 1VF9A 4KMUX 1QVTA 1OB2A 3ONYA 2DW4A 2XF7A 1FX7A 1TZLA 2C6YA 3U21A 2VIXA 2QMUA 3ZQLA 1U3EM 4TKOB 2STTA 4XLFA 2KL4A 3VB2A 2IJLA 2ZCWA 2RC4A 2ZMEB 2HDNB 4CICA 1GAQA 3S1RJ 2XRLA 1IUYA 1OHHA 1E64A 2XROA 1HSJA 3DWLE 2NXNB 4P2NA 4HDUA 3X2QH 1IRFA 1XGSA 4TV7A 1YOVB 3IKTA 2XKPA 3PJRA 2QGUA 5CJ9A 3SFZA 1ACIA 1XGNA 4A3CJ 3LWFA 3V76A 3UR3C 1XGMA 1Z7UA 4IHWA 1SFOJ 5BS6A 1A31A 2H8WA 3KYCB 4G6DA 5CLSA 1OCTC 2CBXA 2L01A 3KE2A 4LIVA 2OU2A 2LG4A 2W25A 3OS2A 2VKDA 3VOEA 4XQFA 2V1NA 1BI0A 1NTCA 5M5WJ 2ZL5A 4M71A 1A35A 2ICWG 3EPZA 2QA4I 2JTVA 3S15J 5IYDJ 2MC4A 5FNZA 4KIFA 3BZKA 1T8IA 3PL8A 3TL4X 4QIWN 2QQ9A 5IPAA 3E0JB 2DAOA 1KA8A 1L3LA 4IKFA 5E3NA 1WGXA 2JK3A 3D0SA 1K78A 4LB6B 2RC5A 2FBKA 3V4GA 2MD0A 3FXLA 3QU6A 3HSFA 5DS0A 1WJAA 2CV0A 1NG6A 1N78A 1CGPA 2EFQA 2EZHA 4BNCA 3ZCOA 1P7IA 5ERIA 1YFHA 3WTSC 1EFRA 2LRDA 3DPLC 1YX5A 3HHGA 5JLXA 4BL0B 3CC4I 2QVOA 3SDBA 2VQCA 1G4DA 4Y9UA 2A69F 3RI4A 2N8GA 2VQLA 3FXUA 2EPFA 4A3LJ 3I59A 1E1RA 2QWWA 2FOWA 1ETYA 3ABMH 2W84A 3Q0UA 3BOQA 3P5JA 3LOCA 3WTXC 5EEGA 3WU0A 1RPWA 1IG7A 3S1NJ 1ERDA 3WYAA 4BQQA 2KLOA 4P12A 4ZDPA 3VDXA 4I2OA 2JN6A 1VQ7B 4JX4A 5AN9A 2MLKA 2D3NA 2CH0A 1V5EA 2GOXB 4C9YA 5JBQA 2M7BA 2KVOA 2PMDA 2V31A 4HNVA 1Q1HA 5FO5A 1YRNA 2JQ7A 2WTEA 4PSWA 1D0XA 1W4MA 2KKOA 5GV7A 3I9V2 2EIJH 4X1EA 2G0EA 2CK3A 3LL7A 1N0VC 1RUNA 2LYCA 1W7PB 1Y0YA 3M9AA 4D9JA 2XAHA 4O5VA 2OBSA 3DXJF 4OIQF 3QYFA 4I6ZA 2DIEA 2V7QA 4ASNA 3JQRA 4Z6YA 3DQVC 4ZV4A 3WE2A 2V26A 2D45A 1IN7A 4M2LA 3K7AJ 2ZXWH 1DPRA 3NARA 4MFEA 1KZHA 4NQWB 1WH7A 3JQQA 2NOGA 4YAOA 3SZPA 2ETHA 4XN0A 1OR7A 4HEA2 1OCZH 2B0LA 5HVQC 1KYWA 3RY8A 5KNLA 3Q3AA 3BG6A 3VO1A 2LY1A 1X3WB 3HHHA 1N06A 3BCBA 4QSHA 3S32A 5IYBJ 3EQLF 1B4AA 5LLQA 1HA8A 1N77A 1XQBA 3CC2B 3RPUD 5FLMJ 3AVVA 1KQ8A 2QQBA 4EATA 4P6VF 1RKTA 2GPJA 1TP4A 4P26A 1K6OA 4ACBA 2DQRA 2HDCA 4WXDA 1SAXA 4HF1A 2DA6A 3DEEA 1NBMA 2GJPA 2E1NA 4KIGA 1R36A 2ZSIB 3BT9A 4IO9F 2R92J 2BPOA 1RI7A 1ZM9A 4B3AA 9ANTA 2UUZA 4UHTA 4ZYDA 3S2WA 1QZYA 1F20A 3CCUI 2BVNA 3CCEB 3DBRB 2DA2A 5EDNA 1K9MD 1MMNA 2KMUA 4N0BA 3W6JB 3V8LA 2CUJA 4HV6A 2C77A 5D4SA 3J7YJ 1MBEA 2Z16A 3BCAA 1TT5B 3CQZJ 2YS9A 1JUSA 3TGNA 3GVLA 1VLYA 1TWFJ 2O61A 5A2QZ 3K4KA 2E5NA 3B73A 1DUXC 3GTOJ 4PC1A 2DI3A 3E3VA 3N05A 3ABLH 4WXCA 1HA3A 1NB9A 4QVAA 5H6QA 1F36A 2XAJA 1JJ6C 2YR2A 5JLWA 4PDKA 3JQPA 2CW7A 3ECHA 3HRTA 1ZAOA 2ZXJA 1WJCA 3C2GA 2ZBUA 3IWZA 1T56A 6PAXA 4I0AA 3TO7A 3T5XA 1U8RA 5LHGA 4G9YA 5ILVA 2WV0A 1Y6IA 2OF7A 1VQ5I 2MH2A 3HZJA 1T95A 4M6YA 2VUMJ 4Z4VA 5LGNA 4QHYA 1VQ4B 1LJ9A 3CZ6A 3TP3A 2PI0A 2GJKA 4DNRB 1MBFA 1OJLA 4HX4A 3CMAI 1QU3A 1HBXG 2VBSA 3Q3SA 2X1CA 2Y9ZA 2E34A 4CCLA 1B8IA 2K9SA 3EDPA 4Z1MA 5EF6A 3F8MA 4XLCA 3FMRA 2E1RA 2VPLA 3P7NA 3K1PA 1PUFB 1QA6A 4P5OA 3MQ0A 1XMAA 2OZ6A 4A0ZA 4RD2A 4G1BA 2HXOA 4Q47A 2OK7A 4N4OB 3LA7A 2F5VA 5BOXA 3GFMA 4TMXA 4JMQA 2XB0X 2EZLA 1X3ZB 2R5YB 4BXUA 4CDGA 2L4AA 1ZG3A 4N3NA 4EJTA 2O5RA 1T2KA 1D8TA 4I01A 4Q48A 1HKQA 4JP0A 2QN6A 3A4CA 3GZNB 3I4NJ 1A5JA 4I09A 2CUFA 2EFPA 2Z5UA 4OOSA 2O8XA 2DA3A 3VYRB 2RQPA 1VQKI 4D0PA 1ITYA 1QG0A 4G6IA 2D1HA 5DCMA 5LEKA 4RAFA 3WQZA 4WF2A 1K79A 5B1AH 3CDIA 1J59A 4GRIA 5IYPA 1NRKA 2RNGA 1YITI 2P7VB 3Q39A 2DPDA 3S93A 4WZTA 1JKPC 1IGNA 2Z99A 4EMSA 4HAMA 1HW2A 3E97A 2C4UA 2VT2A 5TR9A 2HZTA 2K02A 1B1BA 3QFCA 2WWYA 1C0WA 2YU9J 3DFGA 2OPTA 3MKZA 4LD5A 2TDXA 3JRIA 2BY3A 1GVDA 3I56I 2CQKA 1TBXA 4UUTA 4X0GA 2CQXA 4RPDA 1NHAA 1WI9A 2ID6A 2FX0A 1GUUA 3RYPA 4A5NA 3VEPA 1YHQI 1W36C 3CXCB 4C3HJ 5A8AA 3C2HA 3LSHA 1T6ZA 1IXRC 2HPIA 5CKTA 3LFUA 3I55I 5D4RA 3ZN0A 1E79A 2QDXA 5J35A 1KK0A 4KFCA 1DP3A 3L00A 3VSLA 2RQQA 3UNGC 3GF2A 1BJKA 1R4NB 4GYGA 2AQFA 2YWFA 4KITB 1PYVA 1FMWA 1O4XA 4ZYHA 5TISC 4M74A 5B66C 3AFHA 4F55A 3ASOH 4RDJA 2OAZA 3WNDA 3OEHA 4OAYA 4I99C 3RDIA 2O0YA 4NBSA 2VBWA 3LA2A 3TKYA 4EM1A 3ZN1A 5HKKA 3CCMB 3OL3A 3H1CA 1K78B 4PC6A 4G7ZF 1DG1G 3IV5A 3MZHA 1K6YA 2VQHA 2L9RA 4XKVA 1MNEA 3GX4X 3JU4A 2R3SA 4YFKF 3BG7A 1JI8A 1WI3A 1YIJI 1AOYA 1H9TA 4PFPA 2KZGA 4UUSB 3J7ZI 2RN7A 1N8RD 4LIUA 1ZGJA 2QLZA 2YWGA 2MD5A 3OYNA 4E7ZA 4CCMA 2X1EA 1K28D 4DBRA 3W3CA 3VR6A 3F0CA 2IT0A 1QUFA 1TW2A 4P3YA 2H6CA 2Q6KA 4RAZA 3F21A 1WDTA 3I59B 2PG4A 2F4IA 2DDAA 2XASA 5E6TA 2C5HA 5FGMA 4ETSA 1FWZA 2FQ3A 3H9QA 2XGXA 3V8JA 1WFXA 2BHZA 4AWXB 2LTPA 2KP6A 3KLNA 3ASSA 4QWQA 1B72A 3PUNA 3F8NA 4C2UA 2FRHA 2L7FP 3GO5A 3A8JA 3CCJB 3IH4A 4BHPA 2O6GE 3F3XA 4BS9A 5BMZA 5E18F 3L2QA 2ESHA 1BM9A 2X53S 1BX1A 1PP7U 2VOOA 2V4DA 3SJPA 4G6QA 1UCRA 2KIQA 4ITVA 4XNFA 5JVGF 1MJBA 2VODA 5AIPA 2CNDA 5CQGA 1DQUA 1RRJA 4UZUA 3LSRA 4ZGQB 1KC8D 4X6AJ 1AKHB 3QP5A 5HDGA 4CZZA 1AWCA 3GLXA 1ENHA 4DZPA 1EFCA 3J81k 4EGYA 5B1BH 4HE5A 1S72B 2KFDA 4QPOA 2A6EF 3K6GA 3MCAA 2ISZA 1AMOA 3B8HA 4DQLA 1D5YA 1SFEA 1ZYRF 4HX7A 1T33A 2W4SA 2NRAC 4P96A 1YLOA 1LE8A 3I64A 2W85A 4YAWA 1ETKA 2MFZA 2V9VA 1EA3A 1KU2A 3S17J 2X1DA 2E35A 2A05A 2M5WA 2XIGA 1UG2A 3BR0A 3HOXJ 2DFFA 3OIQA 3OYAA 4RMNA 1APLC 3A35A 4Y33A 2ZMEA 2P5KA 3SQNA 3HB9A 2F4NA 3CB4A 1H8HA 2ZZQA 3T1BA 5FIUA 5F27A 2B7EA 3JRFA 5EJCA 3I58A 4IRHA 4MHGA 4AU7A 4BE0A 4Y15A 5ICFA 2M2EA 2ZTGA 2CC2A 3ZQQA 1G7SA 1QGYA 3WGIA 2WPDA 4HW0A 2KRCA 2HLDA 1OYYA 1LDKB 3AG3H 4YXWA 3RQ4A 3BP8A 4Z4YA 2VE8A 4J19A 2K3FA 1DGRM 5LHHA 1S7AA 2GA1A 2HYGD 4RB2C 3IC7A 3GQBA 1VQ9B 4CUGA 2KJCA 1UHWA 3FPPA 4RD6A 4YHBA 3JRBA 3LAJA 3W2EA 4A3BJ 3A1PA 2O9LA 4J0QA 2OA4A 3ZGKA 5F04A 4GXOA 4HPQA 2PJRA 2NAZA 3V7CA 4DW6A 1CQXA 1GR1A 1IHMA 4Z4RA 1VQNB 1BL0A 3HKZA 2W00A 4ON0A 2ZTNA 5EGOA 1YJWB 2GQQA 2K9LA 4E7HA 2HCJB 1QRYA 2GAUA 2OJED 3KZZA 3FF5A 2ZMEC 4XK4A 3KYDB 2CW0F 4U88A 1NH3A 1GHCA 1D1NA 4CCOA 4XLHA 3QFSA 4B43A 5IY5H 4YIIA 3AVXA 1LDJA 1GJRA 2LH9A 2CO5A 4RA2A 2NVUB 3ZMZA 4D1QA 2Q2EB 1W5CC 3FMSA 3LSMA 3M8EA 4ZJZA 2LVSA 4B44A 2Y9YA 3L2CA 3F22A 3WG7H 3ASNH 4ENMA 1R9TJ 1J0RA 2K4JA 1J7KA 2OCEA 5M3FJ 1PJ5A 2PMZN 1QX4A 3ZBTA 5DTDA 1QQIA 3NAUA 5ED4A 4XLAA 3L2RA 4Y7NJ 1ETWA 3G71I 3BJOA 4AC0A 3E5QA 3J81Z 3AVUA 1ETXA 1N75A 5KAIC 1Z67A 3CF2A 2LKXA 4M0LA 3DLAA 2OC6A 1FTZA 1B8IB 3QPLA 1WJDA 1IN6A 1E3ZA 2YSRA 4R79A 3CW2A 2VBVA 1QHHD 4U0WA 1W0TA 1QFYA 4ESJA 3ECOA 1NDHA 2B7CA 4LK0F 3JREA 2E5ZA 1V55H 1Y1VJ 3DTEA 2OD5A 4Z2YA 1P4XA 2JZYA 1KK3A 2X0LA 3ZXSA 2DCEA 4BHCA 2DT7B 2F5FA 2DYSH 1YI2I 3BWGA 1WH5A 2CFXA 1WQ2A 3A0HC 1T6SA 1W7PA 4RPBA 1ZR2A 4XN3A 4Y3OA 2LOOA 2BW3B 3F6OA 5HOOA 1TW3A 1RR8C 2MABA 1FNBA 2NVTJ 3HGGA 3ZMUA 3BJ6A 4A3EJ 1UJ8A 4NQWA 3FZVA 2PMUA 1XGOA 1R5OA 2L7ZA 2FXAA 3FMQA 3JAMK 1FBSA 2HVQA 2LF7A 4CQJA 2V7FA 4YAFA 2BM1A 1P92A 5HDNA 3QU3A 3ABKH 2QYOA 2XAFA 3LQRA 2HYFA 4XRSG 3DP7A 4AIJA 1F9NA 2M4KA 2WAQA 3Q5FA 3DDYA 4TT3A 3CUQB 1EP1B 1TT0A 2R6HA 4RD0A 3KP5A 3ROUA 2E71A 3E20A 5F4OA 3ZBUA 1G3YA 2ZFUA 3OYEA 1MMDA 3H36A 4AVPA 2D74A 1D1CA 3A8KA 5DD4A 2E60A 3CJTB 3HPGA 2EB7A 3K1NA 1Q82D 5BSYA 4QPQA 2B5OA 2QSFX 3WXMA 4W97A 3SHFA 4YFNF 3ZUGA 4HRIA 2M8EA 4FISA 5BPDA 1JGSA 3OOUA 4A69C 4BXFA 1QGPA 4DZJA 1E3HA 4J01A 1ZN2A 3A0BC 2EZIA 4XIDA 2LDUA 3B02A 1FBQA 3GLLA 1JKRC 2QSHX 4HF2A 1FSHA 3CJNA 5FD6A 5GAHJ 2E2JJ 1JA0A 4X7EA 4CSWA 3HRUA 2J7KA 1EXMA 2WJVA 5LEJA 2XGJA 2WZPP 4Z4SA 4RGSA 2EIXA 4YG2F 3GTQJ 2DA4A 4DQ2A 4F7ZA 3W2IA 3ONQA 4MIMA 2X9DA 2XV4S 4KUMA 4E70A 5FB2A 2PE3A 3H9NA 5IOYA 2XOKA 4AF7A 1Z91A 4CGZA 4P6YA 1E62A 1OB0A 2H8RA 4DQKA 3CMEI 3LSKA 3LQ6A 2XNDA 3ES9A 2TCTA 4A2UA 4HLXA 1SANA 3FHZA 3PO2J 4IQJA 4RGRA 2K85A 1E0EA 1GXPA 4R1HA 1Z21A 3AG1H 1N05A 1ORKA 2Z1DA 2P3MA 4HSTA 4ZZLA 3K70C 5FJ8J 2LMDA 1BC7C 3GUDA 3K69A 4XKCA 2BGJA 3I53A 3VWBA 4RS8A 1I5ZA 2KIUA 1JKQC 1O7LA 2V4JC 4M9ZA 3E5UA 4HOBA 4L0ZB 4PK4A 1G3SA 3K9TA 1TWHJ 2ZNZA 4YFXF 1E43A 2A5WA 3FK7A 4JOMA 4OINF 1F4KA 1WSRA 1HQCA 1COWA 3BCDA 1Z05A 3OZUA 3ASRA 1SC7A 1PUFA 2DCUA 1B23P 2BOLA 1V3FA 2DA5A 5GAGJ 3GYHX 2IA0A 2STWA 3QFRA 4PGGA 5HS8A 1VQ8B 5E1XA 2CUEA 2LF8A 2MW8A 4ZYEA 3KETA 1G59A 2EFNA 1GVHA 3RKQA 1W0UA 3G1OA 3BY1A 4LOCA 2DU9A 2R5YA 4QVJA 1JJ8C 3R6KA 1R5BA 4KA4A 2BXYA 3ABUA 3KL9A 5FROA 2G9WA 1MW7A 5C4JJ 4BDYA 4OOXA 3GFJA 4NDLA 2VOPA 2JSCA 3ABTA 3TDZC 3VYTB 5TGTA 1UMQA 3DEUA 4A0XA 3MHPA 1KU7A 1NJID 2RC6A 5BNGA 2A3SA 1VFCA 1GLNA 2GOMA 1FJLA 2FVGA 3KEWA 5J1UA 3I71A 2VC1A 4DGWB 1IUFA 1XG1A 1YJ9B 2OBRA 1EWYA 1AA7A 3LSPA 4PC3A 3L7WA 4Z4TA 1R4MB 2Q8KA 2DTRA 1T38A 4KYWA 2CMPA 1QH0A 2DMUA 1KMHA 2JJ2A 2IA2A 1WOOA 5H6RA 3B6CA 3CCRB 1OYIA 1RZ4A 4XLNF 4KT6A 3LSIA 1YIOA 2QTLA 1VHOA 2WZNA 1HSTA 2EBIA 2EWNA 3WTYC 1LEBA 2FBIA 1IZ1A 2WB1N 1X3UA 4TMZA 2W6JA 2JIZA 4A5MA 3S3OA 1ZREA 1SFXA 2VNKA 2YWEA 5K7ZA 3CC7B 1XSVA 2LY9A 4NC7A 1PJ6A 2JDIA 3HM5A 4EM0B 1ZLKA 3GTMJ 1YO5C 2F4OB 1YG2A 3C2BA 3S8PA 4LMYA 2Y31A 1KD1D 2PJRB 1BC8C 2O03A 2VLAA 1RETA 2L3DA 1BI2A 1MABA 4GGGA 1DP7P 2ZB9A 3MWMA 3GCMA 5EGOB 2OCCH 4C30A 1VQ7I 2YWHA 1WORA 1JKOC 1XSDA 3OYFA 1TQMA 4F3QA 1MMAA 5IYCJ 4X07A 3CTAA 4A6DA 1S3JA 4ZTJA 5J47A 1ZRDA 4G94A 1E17A 1DDIA 4M73A 4DK1A 4LJZF 4PFOA 2A07F 1GO2A 2GBYA 3NRVA 1MH3A 1K61A 2I10A 2DJNA 4UUSA 1YS7A 3Q9SA 2MH9A 4QLCU 3HRMA 5HLGA 3OS0A 3U6BA 3LSGA 1NG7A 1UMKA 1TTYA 1HOMA 4P3IA 4ESFA 3K1MA 3DTKA 4EEFG 4G1VA 1U5TB 3CPWB 3MEXA 1R5GA 4ZCMA 2ESNA 2KRHA 5L3EA 3WBKA 2VJ5A 1UB9A 1VNDA 1U2RA 3LNNA 2DY1A 4KT5C 1WPCA 1SVLA 2F5DA 3KEOA 4ENNA 3PSFA 1DU0A 2AHOA 1JJ2B 4IHXA 2HEOA 1EF4A 5A88A 3FXJA 1P4MA 3CC2I 4Y7CA 3KP6A 3CMYA 4HQEA 4FCYA 1IV8A 2ZZFA 3BLYA 4FE4A 4WK8F 1HF0A 2V79A 4ZDOA 2HNHA 2M45A 4XBFA 2PLYA 2IEKA 4NB5A 4BPRA 1X58A 2EA4A 1V0FA 1R58A 3LQQA 2UXXA 3Q0VA 2ID3A 1AKHA 1QBJA 1NB0A 1Y0RA 5LBQA 1S7OA 4KISA 2EFOA 5LFAA 2X4HA 3CCEI 3IRQA 2NVQJ 3PNVA 3WY9A 5F0CA 4X7DA 4XSZF 4B3FX 1BPLA 3IP4B 3ZMVA 4XM3A 1IB0A 1Q9SA 3V42A 2VT3A 2WYRA 4WZKA 3WGGA 1RNLA 1LB2A 4ZGNB 1HVXA 4M3FA 1WU8A 4BBRJ 2K40A 3FPKA 5F64A 3T8RA 5IT9K 3VNVA 1QZZA 1RESA 4BHBA 3P9KA 1K4TA 3HOSA 3W6VA 1DDNA 1BI3A 5E8GA 3F9KA 3BCFA 1TC3C 1TLLA 3GZ5A 4LLGF 3BG9A 3OOCA 4QFMA 3BJAA 4ENJA 3CDLA 3CESA 4JQFA 1LEAA 3RPUA 2XEXA 4EJUA 4IXAA 4H4KC 4A6EA 4S0HB 2J5OA 1ZG1A 4HG2A 5HS7A 1T39A 4XONA 2P0WA 2DT5A 3GWZA 2LKSA 3VO2A 1G7CA 2W48A 3H9GA 4IHTA 1VQ4I 3T56B 1T0FA 1JA1A 2QE7A 2WAEA 3FK6A 3HDDA 2HKOA 5JHFA 1XCVA 3W2WA 1FSEA 4XOPA 4E7KA 2HMAA 4PZJA 2EFWA 2OYNA 1OR7C 3LQEA 5HNHA 1JB9A 1QUEA 3TW7A 4MTEA 4OPOA 2LR8A 4YAUA 5FFXA 3SKBA 1JHHA 3W6KB 3ESWB 2M0MA 3PNYA 5DUKA 4OIPF 4RD4A 3ZMSA 3HOYJ 3WU1B 1X2NA 5GV8A 2HTJA 2BY0A 4ROXA 1LPQA 3CPXA 2FJ1A 5D8KB 1MJAA 1FOXA 4DK0A 2V7TA 5IP7J 4EH1A 2FUG2 1G3TA 3AGPA 3FKIJ 1MNDA 2EA2A 2Q2EA 1VLOA 4EJOA 1LFUP 4ZC3A 2B63J 1MNMC 2X6WA 3H5RA 1M1KD 1OYWA 4JK1X 1JGGA 4BBSJ 1F60A 5FFZA 1J09A 3K4MA 4X7CA 4IW3B 2DYRH 5KW9A 1Y8QB 1Z7LA 3VFZA 3VPRA 2QSGX 2WR8A 2CGPA 1QNTA 1Z6TA 2QKLB 5FKNA 1W0JA 3OMYA 1I39A 2RDPA 1Z3YA 1WCMJ 1U2WA 5K1YA 4L8JA 2XZPA 1X2MA 2HYJA 2F1MA 1O7FA 4WXHA 2HDDA 2XB5A 2OTJB 1HZEA 2KJBA 4ABZA 1ZARA 1G7TA 1M1EB 4K1XA 2EK5A 1Z9CA 3LSJA 2K9MA 3W2FA 4DOZA 2QENA 4RLFA 1O3QA 1RKWA 1IW7F 1WP6A 4NBQA 2X48A 4ANJA 2BW3A 1W36D 2JPCA 1RR7A 4ZTFA 2EINH 4LG0A 4PSXA 2FOKA 2XDVA 3WTUC 2GQFA 1U6GA 4L9JA 1A8PA 1FX0A 5DSZA 4HQMA 4OIOF 2CU7A 3QPSA 4AIHA 3I54A 2XNCA 1OCPA 1FDRA 1P7JA 3JRHA 2OTLB 5J3OA 2HI3A 3PQKA 1R49A 3OYHA 4I98B 3GTPJ 3T51B 2K3PA 1FRQA 2RNJA 2IRFG 2NV4A 3DCFA 4IVNA 3OYDA 1YX2A 3CUQA 3DBHB 1U9NA 2Q6IA 3PA2A 4P22A 4H0EA 4V2GA 4G7OF 3CCMI 2XUBA 2IGMA 4IF4A 4BE2A 3ZMDA 4A3MJ 1I3QJ 1S8NA 2A6HF 3CP8A 3CMAB 3IAS2 3U9GA 2E1MB 1CF7B 1PDNC 1MIJA 2YU3A 2R7SA 3J80K 3TOBA 5L3GA 4BE1A 1BA5A 1HW5A 1UD5A 4L18B 3JSPA 1K4SA 3RKXA 1E63A 2W7NA 2GK6A 4TN1A 2X0KA 3HOVJ 1G7RA 3KP3A 1V4RA 4YEJA 1H42A 2ZC2A 4M6VA 1FY7A 4PABA 1RQPA 2PN6A 3WODF 1BI1A 1XSXA 4M72A 3HGYA 2EJRA 1WTHD 4YALA 3QP6A 4NUBA 1OCCH 4FWTA 3W5HA 4XOTA 1W0KA 1QZEA 1D3YA 3FM3A 3ZC3A 2CQ7A 2R7WA 5DUIA 4XRSA 4F52A 5ILUA 3COAC 2V7WA 3A8IA 3CCJI 2DEUA 3E6MA 1BIBA 3CUQC 1L0OC 3WGHA 3AKZA 3F72A 4A12A 4L5EA 1EH7A 1BW6A 4BY7J 1BX0A 1ETOA 3PFIA 3ZQ7A 3KIOA 4X05A 2D3LA 2ZO4A 2HOAA 1BQEA 1IN8A 1I3AA 3G73A 4N4NB 3FISA 2QQAA 3C18A 1D0YA 4AUXA 1TTTA 1X1CA 2HR3A 2VBTA 1UD4A 3WNCA 1S72I 4Y4RA 4E4HA 5DDGA 4IPAA 4MQ9F 4B3GA 2E7XA 3JTHA 5DV5A 4BEHB 3BR2A 2BYVE 2HDWA 3HUGA 3BY2A 5GAEJ 1ZKGA 1JTXA 2PMZA 3W5VA 4OIRF 2DOEA 2GZWA 3BR1A 3QSYA 2CRVA 1ZUNB 3PO3J 3OSGA 1SFKA 1RQRA 4CZCA 3I55B 1B59A 2DFEA 2QEXB 1R1UA 3BTCA 3F8FA 1QFJA 4Q4ZF 4A3DJ 2GLOA 3MAJA 3FXRA 3M1EA 4HZFA 1DDGA 4U87A 2XNJA 2W57A 4C3IJ 1BMFA 3G4SB 3ZRGA 5LMZA 2DK8A 2JA2A 2MGQA 2ZXHA 2F5CA 4M9SA 4YIFA 4GDFA 2M5SA 1T5EA 4FHTA 4RAYA 3CJRB 1EFUA 1SVMA 3S1MJ 1WOSA 2RREA 2HVRA 4RM2A 3SEQA 4X0CA 2LC2A 1VQ9I 4GFBA 2VKHA 4RM0A 4MTDA 3RCOA 1KQ9A 1BLIA 3E6CC 1KRHA 2F43A 2COBA 2JN9A 3REOA 3RKWA 1Y39A 1VQNI 3BQYA 1R5ID 3M4OJ 2ZSHB 2XF5A 3ZP5A 2H1KA 2P5VA 3K4NA 2P81A 1FYLA 2QQ8A 3OY9A 2VXDA 3K2AA 1OCRH 3O3KA 3GW2A 1YJWI 2PBIA 1FYMA 4UB6C 3CLOA 1TWGJ 3CCLB 1FOKA 4OOVA 3J80Z 5LD2C 1UD6A 1W5TA 5EZHA 2LY2A 4UVAA 3LO8A 2VONA 4BU2A 5HZBA 3FKJA 3NWTA 2OQGA 2A5YB 2V1XA 4MEXF 1W9XA 5K5RA 4E7LA 3C3WA 4YRVA 2NS7A 4MFDA 1OGJA 5CDFA 2EFGA 4LFUA 3K2ZA 3BQJA 1T98A 1XX5A 1ETQA 3KP2A 2TRTA 1ZM3A 3MN2A 3L2UA 2O3FA 2HFHA 4KN4X 5DYMA 1R71A 4B09A 5JFRA 4FE7A 3KZIC 1WZ2A 1N0UA 1GVJA 5GPCA 5BPIA 4AIDA 5FO1A 4RLZA 2IS4A 2E7WA 2K9QA 2LLKA 2XHKA 2ECCA 3CJQB 3A02A 2VN2A 3E1SA 2X51A 4O6JA 3F8BA 1KK1A 1I50J 1IDZA 4EQQA 1JE8A 4FASD 3G1MA 2X6XA 3MKLA 1V54H 1R1VA 1FMVA 4OPSA 1VQMB 5HODA 3HAGA 3QYBA 1KONA 4Y17A 2FMYA 2M3AA 4XRFA 1BW5A 5EMNA 5B5EC 1B9NA 1ELOA 3BC9A 1KQSB 3RTRA 3J7AY 3G3ZA 2MYSA 1IC8A 4IOCF 1FYKA 2HOSA 3D26A 1BJZA 2MG4A 4U9UA 3RYRA 1FBUA 3MCZA 4KMFA 1AHDP 2HQ5A 3DPUA 3TQNA 4QTRA 3BPXA 3HOZJ 4FX0A 2JPBA 5CYVA 4Q7JB 4FK8A 4LLLA 4TMTA 5KAFC 1SFUA 1ON1A 5FLXK 2JRMA 2VJ4A 3HXLA 2XC7A 2Q0OA 4KIBA 3M1CA 4UY8I 3I4MJ 3PVDA 3O8HA 3K4JA 4G7WA 4UAJA 4A3KJ 2ZXIA 3SJMA 4UVCA 1U5TA 1ZRCA 1EP3B 3F23A 2JRTA 2IVMA 4KDPA 4AF6A 2F48A 3ZPNA 2L4MA 2UV1A 2GK7A 4HNTA 4MYTA 4ASUA 4BJ5C 1BIAA 2DPUA 4P25A 2LKPA 2JA5J 2CWEA 4II3A 3OL4A 5FO0A 3GFLA 3QYEA 4G6TB 3W2VA 4EJVA 1ZQ3P 4G5GA 1LVKA 2VKEA 2LZJA 5EEAA 4M6XA 5AIQA 3PENA 1HKSA 2EZKA 2LP0A 3WG9A 3PUFA 2R9VA 3BZ6A 1UHSA 4PAAA 3EUHA 2FMLA 2XGDA 4AD9A 3MMYB 5D8LB 1QPIA 1N07A 3OW7A 3CCVB 2MC3A 3GVJA 4A3IJ 2ZFWA 5HNFA 1WJFA 3EUKL 3ISPA 4UV9A 2FU4A 4LG0B 5ICEA 1Z77A 4HX8A 3OYBA 3IL2A 1W7PD 2PMHA 5JHUA 1MSEC 1E3XA 1IN4A 3KX2A 4CYCB 2DT6A 3N97A 1VHEA 2OQRA 5GADJ 3ZQIA 3QPTA 1ZH5A 1VQPB 2HQNA 3FBNB 3C7JA 1JT6A 1I1GA 1HLVA 2AS5F 3I0TA 2V7UA 3SEZA 4G8XA 4DNCA 5FA6A 2FSWA 3H92A 3OP1A 5L46A 3HSEA 1U5TC 2LD5A 5J8FA 2IGNA 3L9FA 4I7HA 1HKTA 1WSUA 4AYBN 3R0AA 1IRZA 1XTAA 3JRAA 2WY8Q 2QF7A 1SMTA 3A03A 3BG5A 3JRGA 4BQAA 4C2MJ 3CLQA 1ZELA 2VBUA 2QBYB 3OYKA 3GFIA 4IHSA 2GXBA 2UZKA 3E1YE 2NPFA 1XDUA 1U9OA 4R71A 2ZJRF 2JMWA 3SDGA 1QVUA 2P7CB 3QPHA 4RD1A 1E3PA 1BN5A 1WRJA 1YE9A 3EUHC 1HDDC 3T53B 2EH3A 1J2XA 4BQOA 2Z9OA 2DODA 2V6EA 4W1UA 2DFHA 2L9SA 4ZYAA 3RQIA 1FT9A 1TL8A 2X3UA 2Y75A 5IYQA 1KQ0A 1KYZA 2WB1A 3CF5F 2CV1A 3MMPA 4IL6C 4TMWA 1OCOH 4WWCA 3HL2A 4XKBA 4HLYA 2WV1A 2K86A 1VQOI 1A6QA 3DKYA 4B4DA 1X19A 1YLFA 3GEZA 3Q9VA 4Y9RA 4MNUA 3FDYA 5F0FA 4L9TA 3PM1A 4E7SA 2HQAA 5HLTA 3IRRA 2KZVA 3R61A 3HKZN 5BQTA 1VQ8I 1SD5A 3U1DA 3S16J 1PVEA 3CCQB 3M07A 3EYIA 1JUPA 2L9VA 4OPVA 2CS3A 4CH7A 2VBXA 1MSFC 4RCZA 3L09A 4BYYA 2DTZA 4L5IA 4S04A 4LITA 3AVWA 4H9GA 1FNDA 4E0FA 2IW5A 1R7JA 2IS6A 4DYQA 2G7HA 1R23A 1HXDA 3RPQA 4RAGA 3V7AA 3ZQFA 1SD4A 5EZGA 2J5PA 5J4VA 3BC8A 3EUAA 5F4MA 2HGCA 1UG0A 5LHIA 4PJNA 4OMYA 3HUGB 1VQ6I 3VNUA 1VQLB 3ZQGA 1ZR4A 1ZM4A 3PSIA 1ONVA 1GT0C 1LFPA 2V6CA 3OR1C 3R4KA 1YJ9I 3MKWB 3ML6A 1ZGAA 2DBBA 2ZJQF 2JT1A 4XR6A 3WNBA 3NWSA 1Q1VA 2DO7A 3AAFA 2P5LC 2WSSA 4TSFA 1OQYA 4LBVA 1W35A 5DN6A 3AL0B 1TLHB 2E1CA 2FNPA 3CCRI 2E2HJ 4X06A 3H35A 5E17F 3ERED 1IXSB 1H8EA 4BQNA 4LBWA 2L9NA 1P4AA 3NQOA 4CA0A 1H89C 2GXAA 1I18A 4NNJA 5ILSA 1YX3A 3BTLA 3DU5A 1YJNB 1FIPA 1MDMB 2CUZA 4Q5SF 2BM0A 1Z1DA 3KZYA 3CC7I 2D9RA 2BN4A 3HTUA 2R7XA 2OV7A 1VJSA 3GZ6A 3GSIA 3CD6B 5HS9A 3MZ8A 2BY2A 3JAMZ 4HNUA 2IXSA 5HLHA 1W1WE 2M30A 4LGWA 2HPMA 2DYIA 1R6RA 2X6YA 3ZZTA 2FF4A 1JNYA 1QO0D 2LREA 3QAHA 2AQEA 1FOYA 3CMEB 5L3CA 2E19A 5L3DA 3OWTA 2KRFA 1UFMA 5KCMA 1LQ1A 2M34A 2Y0SN 4K2EA 3BH4A 3E6DA 3CCSB 3G6EB 1TQIA 5J40A 3G2BA 1D0ZA 4B3XA 5F1RA 1XFOA 4UZFA 1G2HA 2H09A 2XPVA 2EIMH 3RJPA 2GIZA 4U7BA 3H3UA 1SKYB 1LVAA 2BE5F 5J8CA 1FIAA 1KJZA 4LK1F 2JVGA 4DBQA 4PCQA 1CF7A 4GQNA 5CVRA 4S05A 3ZQCA 4B8XA 2P6SA 4PUSA 2R7ZJ 3BR5A 4FQGA 2LNBA 4WQMA 1MJ9A 2QKMB 3WTTC 1V5VA 1A36A 3P27A 4DYRA 3AVYA 1Y1WJ 5KK1A 1SD6A 1IF1A 2KQRA 2DQLA 2R7RA 1U78A 3OE7A 4LBYA 1MH4A 5FKLA 3WE3A 4KKTA 2ECBA 1AIPA 4N3GA 2Z3YA 4MQVA 1YQAA 2DA7A 1LFBA 4IEJA 3RSNA 1HW1A 1G3WA 1TNSA 2JJ7A 3V8KA 4RB3C 1NK3P 5D6EA 1O3SA 1ZM2A 2MSYA 2ZITA 2DK5A 3GTJJ 2L54A 1XPXA 1FP1D 2JSPA 1ETVA 2XZOA 5IYWA 1QPMA 1Y0UA 1E2XA 4Z4UA 2KDOA 2DN0A 2L02A 2X6OA 2W1OA 3H5NA 1EH8A 4AVZA 4HSRA 2AHQA 4Y13A 1YTYA 4EJWA 2P8TA 3FXKA 4L5JA 3W2GA 3IKVA 3OW2B 1X1DA 4XKWA 1Z6RA 2NVYJ 3KYLA 3CP2A 4M3EA 4UV8A 2XKOA 3Q6RA 1EV7A 1P2FA 3GTKJ 3MFKA 1XB2A 1JHFA 1I8DA 2E1MC 5JVTA 1E1QA 1GDTA 1W87A 5E3LA 5CVVA 3MKYB 3GXOA 2H27A 5A2QK 2ELHA 5IK2A 2M9HA 4HDVA 1JT0A 5FLVA 4BJTA 1FP2A 3B6AA 4HV5A 4C3JJ 2WAFA 1O3TA 1F43A 2JJ1A 2W6IA 1Q7YD 4PGOA 2GREA 4BEHA 1UHMA 3FM5A 3LFKA 2D2WA 4XICA 1S5LC 2RAEA 2JUGA 2VQGA 5K7FA 1QVGB 1WKMA 3M3YJ 1ULYA 3GIRA 4ESBA 1SMYF 2GA2A 4NC8A 4FT8A 2F6CA 2Z33A 1J75A 4I02A 2K9NA 2PLFA 1OMIA 1EH6A 3AG2H 4R8HA 1AU7A 1KTVA 4UXNA 5M3MJ 1FTTA 1FNCA 2Q6OA 3R0JA 2UXNA 3PIOF 3HOTA 1MRZA 1SKQA 2BV6A 3GVAA 3JTGA 3OZVA 2FA5A 4C43A 2F5EA 2B9SA 3WTVC 1CNEA 4KJZA 2QA4B 2WBMA 2JUCA 2IPQX 1X1BA 1IRXA 1A6IA 2ZBKA 2HU9A 2OZUA 1WHUA 1X1AA 3QWLA 3JSOA 5LRSA 3DLLF 1FEXA 2F2EA 2FNAA 2PIAA 2E1OA 4L9VA 4U7DA 3ULQB 1JUMA 1MD0A 3DPTA 2XAUA 5LGUA 4A3JJ 2IA1A 1H8AC 5D5UB 1TNTA 3W2HA 1OGIA 2D5VA 1IXCA 3A1YA 2XSJC 2NNNA 5CVUA 1OB5A 2D1VA 4UNOA 2R7VA 1WVRA 4HE6A 5BSXA 2V7VA 3CC4B 4O3MA 2R5ZB 1MMGA 5DM7F 3N4MA 4I76A 2DJIA 2QZ8A 2NNYA 1SM4A 3P26A 1STZA 1DPUA 1X4PA 3BPVA 3WU2C 2W82A 5M5XJ 4LB5A 1PKVA 1YW8A 3V7RA 1K7AA 4XLEA 1A04A 3U1KA 3IWFA 2BGIA 1Q81D 1PUEE 3FJOA 3KEQA 1K8AD 3DBLB 3LAPA 2NOJB 3HEFA 4LBZA 3OS1A 4RDUA 3FWEA 2DFIA 4E7IA 4V19K 3TDUC 3FXMA 5JI6A 3AG4H 2Y69H 1OFCX 3KLOA 1EP2B 1EFTA 3B78A 4QV2A 2IAIA 3VODA 2ZZGA 1B9MA 4IHVA 2PEXA 4HA8A 3PIPF 1FOWA 2QUFA 2H1LA 2MBFA 5KSWB 4D5FA 1IO2A 2KT0A 2OTJI 4N9IA 1D8JA 2DOGA 3IUOA 3ASTA 2VZLA 3TO6A 2Y48A 3WHBA 1I27A 3BROA 3HRSA 3IHUA 4B1RA 4DNTB 4ZH4F 2DA1A 2QM3A 2CYYA 3OSFA 2GM4A 1FLIA 1SAUA 2JVHA 3A3GA 3OEEA 2WY7Q 5D5VB 2UWMA 4FXUA 2M4GA 2DLLA 5JR3A 3HSRA 4J00A 5IYRA 2YX7A 3BG3A 1I6HJ 2JWTA 5KHDA 3ERMA 3OKXA 4BXXJ 4IZZA 1T0FC 3HOUJ 1VI0A 2PX9A 1KGSA 2DETA 3KFWX 2CF4A 5B6IA 3OYIA 1D5VA 2L7MP 4DIQA 2ZL6A 4RDLA 3LSTA 2DOFA 2OTLI 4F7DA 2HS5A 2YPRA 3CCYA 3NEUA 3K4LA 1QHGA 4ZCIA 3S3MA 2BBYA 2CSOA 1K83J 2P6TA 1ZHFA 5A89A 3CCUB 2EILH 2LSOA 2H94A 3TBIA 3LVBA 3TEDA 4Y52J 5EEHA 3OR2C 1RC9A 1P9QC 5FKMA 2V9KA 3L2WA 2C4TA 4M4SA 3OAAA 3CRZA 2L0KA 2O8KA 1DARA 2NVXJ 1XCBA 5F1JA 2KHMA 3KPHA 2GIVA 3HPHA 1O3RA 1T6XA 2GJRA 1Q86D 4C2TA 4M3GA 5F0HA 3B82A 2AXLA 1J9ZA 1FNMA 1Y8RB 2HQRA 4CYCA 1CQTA 1D1BA 5EG0A 5IP6A 5EYRA 4BACA 1J9IA 1IN5A 4BGDA 3H0GJ 3TW6A 2HZDA 3R6SA 3IH3A 2WJYA 4RM3A 4BJ6C 5DM6F 3ZOBA 5IT9Z 1H85A 1VQ5B 1G6NA 2DMTA 3T0YA 3WTZA 1FZPB 4B4CA 4AIKA 1EKEA 4IRIA 4FTHA 1LNWA 2KPMA 3WTWC 4IOAF 3H3ZA 2BY1A 3R60A 3QQAA 1CNFA 3OYMA 4UVBA 3OOPA 2XRNA 5GTIC 1Z3XA 4RGXA 3F8CA 3UKGA 2QBYA 1RIOH 4B47A 1U0JA 1IDYA 3P9CA 2WC2A 5CPRB 2R0QC 3IH2A 2CFOA 2V7XA 1QVFB 2FQ4A 3JRCA 4B48A 2FX3A 5CQEA 3CO7C 5IP9J 3CMMA 2R7FA 3FKSA 4UUVA 2EIKH 1RUOA 2P4WA 1TQPA 2O7OA 1XMKA 2YUSA 3DKXA 3VSKA 3TP0A 1USSA 2Z6BD 4JX6A 1USTA 1UD2A 3C1DA 4P9SA 4F93B 2XF6A 3K4CA 1KK2A 3ZMTA 5H2FC 1IV6A 4OMZA 5DCFA 3H9JA 1S29A 2R7QA 5ICCA 5HXBA 2CQNA 1H88C 3S2DJ 3VMFA 1R22A 2HWVA 4JYKA 3PA1A 3DF8A 1XC5A 2K5CA 3SLDA 4MLOA 2ZZEA 3AVTA 4FETA 2F1LA 2I8DA 3A01A 3S14J 2DMPA 4PJJA 1VQKB 2Y30A 3E7LA 4RDKA 1F5TA 2QEXI 1R1TA 1IJWC 1V5FA 3BY6A 2CV2A 4Z4ZA 3HG9A 3G1LA 1YITB 3G4SI 1Z0XA 2V9PA 5E3OA 4XRMA 2BMWA 3ASQA 4CYDA 1BR4A 4U0VA 4RB1A 2DDBA 1UAAA
chains in the Genus database with same CATH topology
3EETA 3U2RA 2COMA 5H20A 3I5UA 3E5XA 4GCVA 4OOIA 5K5QA 2MA3A 1XN7A 4HF0A 2VE9A 2BEOA 4XLPF 4MGRA 4BH9A 5ICGA 1P6RA 4P9UA 5DEQA 1MKMA 1XD7A 2G7UA 4IJAA 4MEYF 3J81K 1VTNC 1YW7A 3O2PE 1MDMA 1ODDA 3CDHA 1YS6A 3QRFF 2I1LA 5HDKA 4KNYA 2ZJ2A 2VXZA 2K27A 2NYXA 3HTSB 1BBYA 4CHUA 3BNWA 1ZLJA 1OPCA 1XB4A 2KIFA 2IP2A 5IT3A 2YX4A 4ZZDA 1LDDA 2FE3A 2ZKZA 2A61A 3M7GA 2ZNYA 4WCGA 5F6FA 5L3BA 4JBAA 1OKRA 1BJAA 5TRDA 5D5XB 4LLNA 3LA3A 3RKYA 1SD7A 1R5HA 3D5LA 2VC0A 2ACJA 4U0YA 3FXQA 4CXFA 5K5OA 1FC3A 3ZPLA 1T6YA 3KCCA 4CO8A 1B6AA 2V1DA 1FNNA 4KN7X 5FD5A 4WX9A 4FX4A 4HYEA 1O57A 2BGCA 1FPQA 1MZBA 4M9XA 5KVRA 3J7AO 3FX3A 1ON2A 2OBPA 5AONA 5E1WA 2GWRA 2PFBA 1MGTA 1GXQA 2KIMA 1IAWA 5CVJA 3DKWA 4XSXF 3RIRA 1H0MA 4GO1A 2FBHA 3K0LA 1J5YA 5L3FA 2XAGA 3TO9A 2EV0A 1REPC 3I4PA 3V7SA 4L9NA 2MLGA 2XAQA 1WWXA 3OV8A 1KU9A 3KP7A 3EYYA 2R7DA 5DCMB 2A68F 2HKXA 3CO6C 1PP8F 1I6XA 4A0YA 1F1ZA 2CG4A 2FEZA 2H6BA 4OU0A 3M8FA 2NS0A 3MZYA 2RKHA 1YYVA 4IRGA 1R00A 1N08A 2GXGA 5E1ZB 4N9HA 1P4WA 2ISYA 4P9FA 1BOAA 4GYIA 1D8KA 3DV8A 5D6FA 1S4MA 2EV6A 3P9IA 4BAYA 2M87A 2RVCA 2K4BA 3JW4A 4NHJA 2RV8A 2Y0MA 1KU3A 3BDDA 4PGHA 3CUOA 3PQJA 2HTSA 4ZYGA 2PQ8A 3E6BA 3HYIA 3QOPA 5FLXZ 1JXSA 1YW9A 2K7LA 2VBZA 1XDSA 5HLIA 5E8IA 5CVIA 4EV0A 4RB0A 3SXYA 2M1BA 5TJJA 4EGZA 5E20A 4ENKA 5LRRA 2RGVA 4UZEA 3ELKA 3T8TA 2EV5A 3O6BB 3F6VA 2W24A 4I0BA 3SZTA 3TOAA 4HBLA 4G7HF 2XVCA 2VBYA 1ZRFA 5DD8A 4KICA 2ADUA 4EM2A 1H9GA 4P55A 2PJPA 1IRGA 5J6XA 1S6LA 5D5WB 1I1SA 3HIFA 5LGTA 1ZG5A 4RGUA 1W5SA 4L0YB 3KP4A 2HOEA 4EVIA 2V1UA 4KMUX 2DW4A 1FX7A 2C6YA 1U3EM 2STTA 3VB2A 2IJLA 2ZCWA 2RC4A 2ZMEB 4CICA 1IUYA 2XROA 1HSJA 4HDUA 1IRFA 1XGSA 4TV7A 3IKTA 2XKPA 5CJ9A 3SFZA 1XGNA 3LWFA 1XGMA 1Z7UA 5BS6A 4G6DA 5CLSA 2L01A 3KE2A 2OU2A 2W25A 3VOEA 1BI0A 4M71A 2JTVA 5FNZA 4KIFA 2QQ9A 2DAOA 1KA8A 1L3LA 3D0SA 1K78A 4LB6B 2FBKA 3V4GA 3QU6A 3HSFA 1CGPA 2EFQA 4BNCA 5ERIA 1YFHA 3WTSC 3DPLC 3HHGA 2QVOA 1G4DA 2A69F 3RI4A 3FXUA 3I59A 2QWWA 2W84A 3BOQA 3WTXC 5EEGA 3WU0A 4I2OA 2MLKA 1Q1HA 5FO5A 2WTEA 2KKOA 1W4MA 1RUNA 1W7PB 3M9AA 2XAHA 4O5VA 3DXJF 4OIQF 4ASNA 3DQVC 3WE2A 2D45A 1IN7A 1DPRA 3SZPA 2ETHA 1OR7A 2B0LA 5HVQC 1KYWA 3HHHA 1N06A 5LLQA 3EQLF 1B4AA 1KQ8A 2QQBA 1K6OA 2DQRA 2HDCA 4WXDA 1SAXA 4HF1A 2E1NA 4KIGA 1R36A 1RI7A 4UHTA 4ZYDA 3S2WA 1QZYA 3W6JB 4N0BA 3V8LA 4HV6A 5D4SA 3TGNA 2O61A 5A2QZ 1DUXC 3B73A 2DI3A 3E3VA 4WXCA 1NB9A 5H6QA 2XAJA 2YR2A 4PDKA 3ECHA 3HRTA 1ZAOA 2ZXJA 3IWZA 6PAXA 4I0AA 3TO7A 3T5XA 1U8RA 5LHGA 4G9YA 5ILVA 2WV0A 2MH2A 4M6YA 5LGNA 1LJ9A 2PI0A 4HX4A 1HBXG 2VBSA 3EDPA 3F8MA 3FMRA 3P7NA 3K1PA 4P5OA 3MQ0A 1XMAA 2OZ6A 4A0ZA 4Q47A 3LA7A 5BOXA 3GFMA 4BXUA 4CDGA 2L4AA 1ZG3A 4EJTA 1T2KA 4I01A 4Q48A 1HKQA 4I09A 2Z5UA 2EFPA 2O8XA 2RQPA 4D0PA 2D1HA 5DCMA 5LEKA 4WF2A 1K79A 1J59A 2P7VB 2DPDA 2Z99A 4EMSA 4HAMA 1HW2A 3E97A 2VT2A 2HZTA 2K02A 1B1BA 2WWYA 1C0WA 3DFGA 4LD5A 2TDXA 2CQKA 1TBXA 1NHAA 1WI9A 3RYPA 4A5NA 3VEPA 5A8AA 1T6ZA 1IXRC 5D4RA 3ZN0A 4KFCA 3L00A 3GF2A 4GYGA 4ZYHA 4M74A 2OAZA 3RDIA 2O0YA 2VBWA 4EM1A 3LA2A 3TKYA 3ZN1A 1K78B 4G7ZF 3MZHA 3GX4X 2R3SA 4YFKF 1AOYA 1H9TA 2RN7A 1ZGJA 2QLZA 2MD5A 2IT0A 1TW2A 2H6CA 4RAZA 3F21A 3I59B 2PG4A 2XASA 5FGMA 4ETSA 1FWZA 2FQ3A 3V8JA 2XGXA 4AWXB 3KLNA 4QWQA 3F8NA 2FRHA 3GO5A 4BHPA 2O6GE 3F3XA 5BMZA 5E18F 2ESHA 1BM9A 1PP7U 2VOOA 4G6QA 1UCRA 2VODA 1MJBA 5AIPA 3QP5A 5HDGA 4CZZA 1AWCA 3GLXA 4EGYA 2A6EF 2ISZA 1SFEA 1ZYRF 4HX7A 2NRAC 4P96A 3I64A 2W85A 2V9VA 1KU2A 2XIGA 2M5WA 2ZMEA 2P5KA 3SQNA 3T1BA 4MHGA 3I58A 4IRHA 4Y15A 5ICFA 3WGIA 4HW0A 1OYYA 1LDKB 3BP8A 2VE8A 5LHHA 1S7AA 4RB2C 2GA1A 2HYGD 3IC7A 2KJCA 1UHWA 3LAJA 2OA4A 4GXOA 2NAZA 3V7CA 4ON0A 2GQQA 2GAUA 3KZZA 3FF5A 4U88A 2CW0F 1GHCA 4YIIA 1LDJA 3ZMZA 2CO5A 3FMSA 3M8EA 3L2CA 3F22A 4ENMA 1J0RA 2K4JA 1J7KA 5ED4A 1QQIA 3BJOA 3J81Z 3E5QA 1IN6A 2YSRA 4R79A 2VBVA 4U0WA 4ESJA 3ECOA 4LK0F 4Z2YA 2OD5A 1P4XA 2JZYA 2X0LA 4BHCA 2F5FA 3BWGA 2CFXA 1WQ2A 1T6SA 1W7PA 3F6OA 5HOOA 1TW3A 3ZMUA 3BJ6A 4NQWA 3FZVA 2PMUA 1XGOA 2FXAA 3FMQA 3JAMK 1FBSA 2LF7A 1P92A 5HDNA 3QU3A 2QYOA 2XAFA 3LQRA 2HYFA 3DP7A 4AIJA 1F9NA 3Q5FA 3CUQB 3KP5A 3ROUA 1G3YA 4AVPA 5DD4A 2EB7A 3K1NA 4YFNF 3SHFA 3ZUGA 2M8EA 5BPDA 1JGSA 1QGPA 1ZN2A 2LDUA 3B02A 1FBQA 4HF2A 1FSHA 3CJNA 5FD6A 3HRUA 5LEJA 4RGSA 4YG2F 4DQ2A 4F7ZA 2XV4S 4KUMA 4E70A 5FB2A 1Z91A 4CGZA 3FHZA 4A2UA 4HLXA 4RGRA 1GXPA 4R1HA 2P3MA 1N05A 4ZZLA 1BC7C 3GUDA 3K69A 3I53A 4RS8A 1I5ZA 2KIUA 1O7LA 4M9ZA 3E5UA 4HOBA 4L0ZB 1G3SA 3K9TA 2ZNZA 4YFXF 4OINF 1F4KA 1HQCA 1Z05A 2STWA 1V3FA 3GYHX 2IA0A 4PGGA 5HS8A 5E1XA 2LF8A 4ZYEA 3KETA 2EFNA 2DU9A 4KA4A 3ABUA 2G9WA 3GFJA 2VOPA 2JSCA 3ABTA 3TDZC 3DEUA 4A0XA 1KU7A 2A3SA 3I71A 2VC1A 3L7WA 2Q8KA 4KYWA 2DTRA 1T38A 2IA2A 5H6RA 1OYIA 1RZ4A 4XLNF 1YIOA 1HSTA 2EWNA 3WTYC 1LEBA 2FBIA 1IZ1A 1X3UA 4A5MA 1ZREA 1SFXA 1XSVA 4EM0B 1ZLKA 1YO5C 1YG2A 4LMYA 1BC8C 2O03A 2L3DA 1BI2A 4GGGA 1DP7P 3MWMA 1XSDA 1TQMA 3CTAA 4A6DA 1S3JA 1ZRDA 4G94A 1E17A 4M73A 4LJZF 2A07F 3NRVA 1YS7A 3Q9SA 2MH9A 4QLCU 3HRMA 5HLGA 1TTYA 4ESFA 3K1MA 1U5TB 3MEXA 1R5GA 2ESNA 5L3EA 1UB9A 4KT5C 2F5DA 3KEOA 4ENNA 2HEOA 5A88A 1P4MA 3KP6A 4HQEA 4WK8F 2V79A 2M45A 4XBFA 2PLYA 4NB5A 2EA4A 1R58A 3LQQA 2UXXA 1QBJA 1NB0A 5LBQA 1S7OA 2EFOA 2X4HA 3IRQA 4XSZF 3ZMVA 1Q9SA 2VT3A 3WGGA 1RNLA 1LB2A 5F64A 3T8RA 5IT9K 1QZZA 4BHBA 3P9KA 3HOSA 1DDNA 1BI3A 5E8GA 3GZ5A 4LLGF 3BJAA 4ENJA 4JQFA 1LEAA 3RPUA 4EJUA 4IXAA 1ZG1A 4A6EA 1T39A 2J5OA 5HS7A 2DT5A 3GWZA 4IHTA 1T0FA 2HKOA 1XCVA 1FSEA 4PZJA 2EFWA 2OYNA 4MTEA 5FFXA 1JHHA 3W6KB 5DUKA 4OIPF 3ZMSA 3WU1B 2HTJA 5D8KB 1MJAA 1G3TA 2EA2A 2Q2EA 4EJOA 1OYWA 4JK1X 5FFZA 3VFZA 2CGPA 1QNTA 1Z6TA 2RDPA 1U2WA 5K1YA 1O7FA 4WXHA 2KJBA 1ZARA 2EK5A 1Z9CA 2QENA 1O3QA 1IW7F 2JPCA 4LG0A 2FOKA 3WTUC 1U6GA 4L9JA 4HQMA 4OIOF 4AIHA 3I54A 3PQKA 4I98B 2RNJA 2IRFG 4IVNA 3CUQA 4H0EA 4G7OF 2XUBA 4IF4A 3ZMDA 1S8NA 2A6HF 3U9GA 1CF7B 1PDNC 2YU3A 3J80K 3TOBA 5L3GA 1HW5A 4L18B 3JSPA 3RKXA 2X0KA 3KP3A 1V4RA 1FY7A 2PN6A 3WODF 1BI1A 1XSXA 4M72A 2EJRA 3QP6A 1D3YA 3FM3A 5DUIA 5ILUA 3COAC 3E6MA 1BIBA 3CUQC 1L0OC 3WGHA 3F72A 4A12A 1EH7A 3PFIA 3ZQ7A 2ZO4A 1IN8A 3G73A 2QQAA 3C18A 2HR3A 2VBTA 5DDGA 4IPAA 4MQ9F 5DV5A 2E7XA 3JTHA 2BYVE 3HUGA 4OIRF 2GZWA 1B59A 1R1UA 3F8FA 4Q4ZF 3MAJA 3FXRA 3M1EA 4HZFA 2W57A 2DK8A 4M9SA 2F5CA 4YIFA 4FHTA 4RAYA 4MTDA 1KQ9A 3E6CC 3REOA 3RKWA 3ZP5A 2P5VA 1FYLA 3O3KA 3GW2A 2PBIA 1FYMA 3CLOA 1FOKA 3J80Z 1W5TA 4UVAA 2VONA 2OQGA 2A5YB 2V1XA 4MEXF 5K5RA 3C3WA 4LFUA 3K2ZA 1T98A 3KP2A 2O3FA 2HFHA 4KN4X 5DYMA 4B09A 5JFRA 1GVJA 5BPIA 5FO1A 2E7WA 2XHKA 4O6JA 2VN2A 3F8BA 4EQQA 1JE8A 1R1VA 4Y17A 2FMYA 4XRFA 1B9NA 3RTRA 3G3ZA 1FYKA 3RYRA 1FBUA 3MCZA 4KMFA 3TQNA 3BPXA 4FX0A 2JPBA 5CYVA 4LLLA 1SFUA 1ON1A 5FLXK 2Q0OA 4KIBA 4UVCA 1U5TA 1ZRCA 3F23A 2JRTA 2IVMA 4KDPA 2L4MA 1BIAA 2DPUA 2LKPA 2CWEA 5FO0A 3GFLA 4EJVA 4M6XA 5AIQA 1HKSA 3WG9A 3BZ6A 3EUHA 2FMLA 4AD9A 5D8LB 1N07A 2MC3A 2ZFWA 4UV9A 4LG0B 3ISPA 2FU4A 5ICEA 4HX8A 3IL2A 1W7PD 2PMHA 5JHUA 1IN4A 3N97A