3CTAA

Crystal structure of riboflavin kinase from thermoplasma acidophilum
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
216
structure length
187
Chain Sequence
DQYYRAIKKIKEAAEASNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTVTKRGQILNITEKGLDVLYTEFADLSRILAIKNNVVITGTVTSQYIIQFQEKLGIIPYLNIKVDQASLPELRKIRGFRGIHIEGFKTRTFGSVKAFPAKIQNIPCFVIMPERTVYTDVIEIISDDRVSVEVYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Riboflavin kinase
publication title Crystal structure of riboflavin kinase from Thermoplasma acidophilum.
rcsb
source organism Thermoplasma acidophilum dsm 1728
total genus 56
structure length 187
sequence length 216
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ctaA01
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 3ctaA02
1T98A 4HW0A 4OIRF 3CUOA 5E17F 4R1HA 1NB9A 1ODDA 2RNJA 3I71A 3WTZA 4AIHA 2XRNA 1YO5C 4KDPA 1KQ8A 2DW4A 5BS6A 3CDHA 4I02A 1ZRDA 1H9GA 4EGZA 1KA8A 2RQPA 3F8CA 4MNUA 4HV5A 2Z33A 4CHUA 3LA2A 3V8JA 4O5VA 3KCCA 2A07F 5D6FA 3JTGA 1IRGA 3SZTA 3WG9A 2VC1A 4JK1X 4HV6A 4HF2A 3KP4A 4HF1A 1F9NA 2M8EA 2JT1A 4ZYDA 2ZMEB 2KIMA 1F4KA 3HUGA 3PQKA 2FU4A 3V7SA 1STZA 2M1BA 4L0YB 2B0LA 2DO7A 3S2WA 2VXZA 4B8XA 2L3DA 3LA3A 5JHUA 1FP1D 1I27A 2QQ9A 3SFZA 2P3MA 3GO5A 3GFLA 2O8XA 2Q2EA 1KU7A 2QBYB 4BHBA 3J81K 1YLFA 1J2XA 2R7FA 2BEOA 2EK5A 3V7RA 2ZBKA 3KEQA 4WCGA 1BI3A 3T5XA 2X0KA 1V3FA 4M6XA 4KIFA 2LSOA 2ESHA 1YYVA 2OZUA 4EVIA 4KMUX 5BPIA 3V8KA 1YTYA 2V79A 1W7PD 2PBIA 4O6JA 4KIBA 4RAZA 5J6XA 1MJBA 3BPXA 4ZYGA 1IF1A 3V4GA 3E5UA 2GXGA 1T38A 1H0MA 5FGMA 1FLIA 2EV5A 3KP6A 3DEUA 3GZ5A 3P7NA 1YW8A 4EMSA 3ELKA 1ULYA 1B9NA 5AIQA 3BP8A 2UXNA 3RYPA 2KRFA 3RPQA 2NYXA 1B59A 3ZP5A 1OR7A 3ZMTA 5L3FA 3LA7A 3V7CA 3O3KA 4RAYA 1VTNC 2EFOA 3GYHX 2RN7A 1UFMA 2A69F 1U2WA 1B9MA 1HW2A 2EV6A 3O6BB 5DCMA 3BNWA 2EV0A 4RGUA 4G7ZF 5FNZA 1JE8A 2W24A 3H92A 4I7HA 5F6FA 5ERIA 3CUQC 5L3GA 1BC7C 1Z7UA 3JAMK 2UWMA 4FHTA 2FQ3A 2H27A 2OA4A 2Y75A 3TO6A 2EFNA 1TQPA 4HQMA 2O3FA 4FX0A 3E6DA 5LBQA 1E17A 4QLCU 4KIGA 2X0LA 2STWA 3F21A 1I1GA 4EM2A 3RPUA 1FSHA 4ON0A 1U5TC 5E20A 2YX4A 3KETA 3EYIA 4OMZA 5IT9K 3JTHA 3JW4A 4ESBA 2ISZA 2HKOA 2J5OA 2ZKZA 4EJUA 2MH2A 2IW5A 3GVAA 5DCFA 1J75A 1MD0A 2EFPA 1ON2A 5F1RA 4L5IA 5D5XB 5BOXA 4A0XA 1BI0A 2OD5A 2RV8A 1R1TA 2A6EF 1YW9A 2Q0OA 1J5YA 3I64A 1OYWA 4L18B 1HKQA 1SMTA 4A12A 2A68F 4LLLA 2DU9A 2EA2A 1FPQA 3ABTA 3W6JB 1WWXA 1BIAA 1DPRA 1MJAA 3OOPA 4AIKA 2OZ6A 3ISPA 4A5NA 3WGHA 5HOOA 1K78B 1WRJA 2DT5A 3GLXA 1K79A 1EH6A 1LVAA 1BJAA 3BJ6A 1KYWA 4IF4A 2VODA 3GXOA 1Z05A 2WWYA 5HDNA 3RKXA 3H3ZA 1YIOA 1XSDA 2OQRA 1F1ZA 1Z9CA 5HLHA 4A0ZA 3I53A 1U5TA 5ICGA 3GX4X 1EV7A 2Q8KA 1R5HA 2BBYA 1LDJA 1LDDA 3N97A 5HDGA 5LGNA 1R36A 4FX4A 1OMIA 1HSJA 3FMQA 1TQMA 1NB0A 2Z9OA 3HOTA 4LG0B 1BI1A 2EB7A 1S7OA 2XKPA 1IAWA 5HLGA 1SD6A 2EFQA 2W85A 1W7PA 1XMAA 5H20A 2LKPA 3TDUC 3HRMA 4YFXF 3QRFF 4TV7A 2GQQA 3AAFA 3G73A 3VOEA 1XN7A 4YG2F 4EQQA 3P9KA 2JPCA 5ICEA 4I0AA 3U2RA 3RTRA 4U7BA 1U3EM 2QWWA 1LDKB 2FSWA 2KKOA 1ZARA 3BWGA 3BJOA 1XDUA 5FFXA 2OAZA 3ZMSA 1USTA 5D6EA 4AD9A 1R5GA 1MKMA 1WKMA 2D1HA 4EGYA 3ZN0A 3NRVA 1IW7F 4UHTA 1DP7P 4P9FA 2L54A 4OIQF 3I58A 2IRFG 3NQOA 2FEZA 3HRUA 5HS8A 1XCBA 1XB4A 5HLIA 3DPLC 4GGGA 1B4AA 2HTSA 2OQGA 2ADUA 2Y48A 1MRZA 5TJJA 1O7FA 1S4MA 3RKWA 2FMYA 3GZ6A 5FO5A 2W57A 2BE5F 3KLNA 1GHCA 2H6BA 2CG4A 1FNNA 2EJRA 5LHIA 5LLQA 4A5MA 3GFJA 5LRSA 2GZWA 2DBBA 4KT5C 3IKTA 4LMYA 2HYFA 3T8RA 5DUIA 3JSOA 4UVBA 4HYEA 2PI0A 3R60A 2P7CB 4JBAA 1JHHA 2HEOA 3IKVA 4MQVA 1O57A 1BC8C 3M8EA 3K1MA 3R61A 4U0YA 2XASA 1XGSA 1Z6RA 3HSEA 4EM1A 3Q9SA 1RNLA 2I1LA 2DAOA 5L3DA 4OOIA 3HOSA 4ZZLA 5E8GA 4A6EA 3EYYA 3F72A 5BMZA 5H6QA 1FX7A 4MGRA 1CF7B 2VOPA 1A04A 3HTSB 1I6XA 2V1UA 3OV8A 1ZAOA 3L9FA 5D5UB 4NHJA 4U0VA 4M6YA 3MCZA 2CO5A 1JXSA 3C18A 2QLZA 1MJ9A 4K2EA 3I59A 4GYGA 2VT2A 1R22A 2ZNYA 4UZEA 2E1NA 3LSTA 4ESFA 1N07A 1G3YA 2E1CA 1ZG3A 3HTUA 4ZYHA 4PGGA 4PCQA 5FD6A 3ZMZA 1LQ1A 2AXLA 1R1VA 1K6OA 1H9TA 4HX8A 3F3XA 3F23A 4WWCA 4UVAA 2HTJA 4WXCA 3CUQB 3HYIA 5FO1A 1G4DA 4F7ZA 2ACJA 4MEYF 2F5DA 4JQFA 2DPUA 1GXPA 1BBYA 1PUEE 5HDKA 1KU9A 1KYZA 2VBWA 2X4HA 2R3SA 2YPRA 3QPTA 3CLOA 2L02A 1D8JA 1S7AA 3Q9VA 2VE8A 4KYWA 4PGHA 2XV4S 3VB2A 1USSA 5ICFA 3U1DA 3ABUA 4KN4X 5CVJA 4U0WA 1SFEA 4L9TA 2P5LC 1TW3A 3DQVC 1YS7A 3IRRA 2VN2A 2O0YA 5HS7A 1Q1HA 6PAXA 3D0SA 1QZYA 3I5UA 4RB2C 2GAUA 5ILVA 1YW7A 4XSZF 2YSRA 1JGSA 4HDUA 1IUYA 1MZBA 2ESNA 5A89A 3DV8A 1FWZA 1QPMA 1W7PB 2XAGA 2IA1A 1J59A 2J5PA 2XAFA 4HAMA 3WU1B 4L0ZB 1P6RA 1QQIA 3I4PA 4CO8A 2LNBA 1SMYF 1RI7A 4MQ9F 2FNAA 4OINF 3WGIA 4P55A 4Y13A 4HF0A 3J80Z 1EH7A 1HKSA 1FSEA 2WC2A 2G7HA 1D8KA 4BYYA 3FM3A 4CZZA 5FLXK 4HA8A 1IN7A 5K1YA 2BGCA 1FC3A 1UHMA 3FWEA 2XIGA 5LEKA 3GEZA 3ECHA 4Q4ZF 3B02A 3HHGA 5CYVA 4ETSA 1TNSA 4KUMA 5JR3A 4G6DA 2HFHA 2G9WA 2M30A 4HLXA 2L01A 4XRFA 1FYKA 3EETA 1SD4A 4GXOA 3W6KB 2PEXA 3KZZA 3RKYA 1IZ1A 1W4MA 2P5VA 1ZREA 3FF5A 2C6YA 4GCVA 1BIBA 3GW2A 4M9XA 3MQ0A 4EJWA 3K0LA 1WQ2A 1L0OC 2TDXA 3WGGA 2Z99A 1SD7A 2PG4A 3ZPLA 3ML6A 2A3SA 4IRGA 3DPTA 1CGPA 3ZUGA 4I0BA 2H6CA 4R8HA 1YS6A 4P9UA 3L09A 3R0AA 3R6SA 2VBUA 3MFKA 1QNTA 2QQAA 1J0RA 4U7DA 1IXSB 4RB1A 2IA0A 4B09A 4IRHA 4ENMA 4G94A 5FLXZ 2NRAC 3F6VA 1XSXA 1XSVA 4XLNF 5A88A 2BYVE 4BAYA 4BHPA 2XGXA 5KVRA 2ZNZA 3G3ZA 4HOBA 2STTA 1MDMB 3GUDA 4M71A 1R7JA 5K5OA 5TRDA 1U6GA 2MLKA 1B1BA 3WTVC 2OYNA 2MBFA 2CFXA 1ZGAA 4WK8F 4ENNA 3DXJF 3KLOA 2KJBA 4L5JA 3SZPA 3V8LA 1G6NA 1ZLKA 1BM9A 2XAHA 5CVUA 2G7UA 3CJNA 1LB2A 3E3VA 3KP7A 1HSTA 3P9IA 2ZMEA 3TOAA 3TQNA 2W84A 2PQ8A 4AIJA 2VE9A 1ON1A 2YU3A 4IRIA 3BROA 4MHGA 5IT3A 1FBSA 4D0PA 3E6BA 3QPHA 4P96A 2FA5A 4DNCA 5A2QK 2BV6A 1XD7A 4ENKA 2FF4A 5LGUA 2JZYA 5E1WA 2QBYA 1O3QA 2IA2A 1XDSA 2ZXJA 4WF2A 3REOA 2RVCA 1T0FA 2HQRA 5HVQC 3MZYA 4N9HA 4ZZDA 2UXXA 3KE2A 3WODF 3F22A 5CVRA 1FYLA 1HW1A 2ZCWA 2LF7A 2L4AA 4LK1F 1QZZA 3GFMA 2JTVA 4M73A 1UHWA 2VBSA 1T6XA 1P4XA 1IN5A 4NB5A 4LK0F 1WSUA 1KU2A 2MC3A 1P4AA 1TBXA 1P4WA 4HZFA 2HKXA 5FB2A 4KN7X 1BOAA 1RZ4A 3CTAA 4LB6B 4UNOA 4MEXF 3KZYA 1IXRC 5DDGA 2H09A 4RGSA 2HGCA 3E97A 5A2QZ 4LJZF 5E1ZB 1E2XA 4ZH4F 5D4RA 3T8TA 1KU3A 2ZJ2A 2XUBA 2HYGD 4A0YA 1D3YA 1LNWA 2HZTA 3QU6A 3KP5A 5EEGA 4BHCA 5BPDA 3OP1A 2FOKA 1R23A 2QZ8A 1QGPA 4G9YA 3TOBA 2JPBA 2VOOA 2RGVA 2K02A 1K7AA 3K1PA 1Y0UA 2VONA 2FMLA 1G3WA 4IVNA 3FMRA 4A2UA 3F8MA 3RYRA 1KGSA 2OU2A 3J7AO 5JI6A 3F8BA 3DFGA 2KJCA 2XHKA 1Q9SA 2P6TA 3I54A 2D45A 4UXNA 5AIPA 2HS5A 2PLYA 4HX7A 5DD8A 2COMA 3COAC 1IN6A 4PDKA 2M87A 3FM5A 1C0WA 5E18F 2QYOA 4UZFA 3K1NA 3KP2A 1N06A 2YR2A 3QOPA 3K2ZA 1OKRA 3DP7A 3KP3A 2R7DA 3M9AA 3F6OA 4ESJA 4BH9A 3C3WA 4Q48A 3WE2A 1OYYA 5CVIA 5DD4A 3FX3A 4ENJA 3SXYA 1IN4A 3B73A 3F8NA 4CXFA 1ZRFA 1OYIA 2F5CA 1S3JA 4AVPA 2DK5A 2K86A 3N4MA 3MZHA 4RB0A 4EJTA 1S8NA 1UCRA 4E70A 5DCMB 3TGNA 2HOEA 2HDCA 3LAJA 1T6SA 5ILUA 1UB9A 4I09A 4UV9A 3IHUA 5AONA 4G7OF 1SFXA 2DTRA 1Z91A 4UV8A 3P9CA 1XMKA 2XAJA 2V1DA 4L9VA 5BQTA 1T39A 2PJPA 4L9JA 3QP6A 1TLHB 3ROUA 3MWMA 2MA3A 2WTEA 2PFBA 1LEBA 3HIFA 1F5TA 4HQEA 4IHTA 2ETHA 3IWZA 2HQNA 4G6QA 4YFKF 2JRTA 4L9NA 3WTUC 3FHZA 3WTYC 4IPAA 2RDPA 5F64A 2CWEA 3GWZA 3M8FA 1ZHFA 3ZQ7A 1K78A 1XGOA 2O03A 4WXDA 2V9VA 1QBJA 2EWNA 4RGXA 4NQWA 5LEJA 4KA4A 1AWCA 4HBLA 2IPQX 2IJLA 3C1DA 4Z2YA 4LFUA 3BZ6A 3LQRA 3EUHA 2FBHA 3HRSA 4I98B 2DPDA 3T1BA 1T6YA 1DPUA 3TO7A 1V4RA 2PMUA 1T6ZA 2GA1A 2RKHA 3HSRA 4LG0A 3PQJA 3ULQB 1P4MA 2HWVA 2PMHA 3SQNA 1X3UA 3MAJA 3WTTC 4MTDA 1LEAA 3BOQA 2VBVA 5D8KB 2P4WA 3J80K 2P6SA 1SAXA 4PZJA 2O6GE 1FBUA 2NS0A 1TQIA 3BPVA 1QO0D 2MLGA 5KK1A 5FO0A 3R4KA 2OBPA 4Y17A 4EJVA 4LLGF 4OIOF 1HKTA 1U5TB 1L3LA 3ECOA 1ZN2A 4MTEA 2ZFWA 1XCVA 1IXCA 1HXDA 3GFIA 4XSXF 2F5FA 1FBQA 2IP2A 3O2PE 2DK8A 1PP8F 5ED4A 3ZMVA 4IXAA 4OMYA 2NAZA 4EJOA 3WE3A 1PP7U 3VODA 3D5LA 3I0TA 2K4JA 4OU0A 4AWXB 2XAQA 1JHFA 4Q5SF 4LB5A 1AOYA 4KNYA 2P7VB 2JSCA 4IJAA 3QU3A 5DV5A 2FE3A 1KQ0A 4RB3C 2A5YB 1TTYA 1SD5A 2ELHA 3K69A 3F8FA 5DEQA 2QENA 1W5SA 1J7KA 3J81Z 3QAHA 2K7LA 4WX9A 1PDNC 3BDDA 1XGNA 4XBFA 4FT8A 3M7GA 5D5WB 4M72A 1W5TA 5L3EA 3IRQA 1EH8A 3IC7A 1XGMA 1FP2A 2VBZA 2YX7A 3VEPA 3HRTA 3R0JA 5CJ9A 1ZYRF 2V6CA 4M9SA 1R1UA 2V1XA 2W25A 3KFWX 4RS8A 3CO7C 2NNYA 4XLPF 4I01A 3Q5FA 4ASNA 1I5ZA 1R00A 2DQLA 1REPC 1RUOA 2IT0A 2LDUA 1Z6TA 2ZO4A 4UVCA 5J8FA 1P92A 2FXAA 2WV0A 2CQKA 1B6AA 2K27A 2KIUA 3TDZC 5J8CA 2VT3A 1R58A 4LD5A 1CF7A 3JSPA 2VBYA 3QP5A 3VFZA 1RUNA 4HLYA 2XROA 3FMSA 2UZKA 2CYYA 2NNNA 5LRRA 2RC4A 4OIPF 1O3TA 5HS9A 4ZYEA 4M9ZA 5DUKA 3TO9A 4KICA 3DKWA 2ISYA 1ONVA 2Z3YA 4YIFA 2P5KA 5FD5A 4RGRA 1I1SA 2CSOA 3EDPA 2XKOA 1FT9A 4N0BA 4I2OA 2QVOA 4EM0B 4CYDA 1BI2A 3U9GA 3RDIA 3TKYA 2E7XA 1GVJA 5K5RA 1G3SA 1GXQA 4WXHA 3JAMZ 5JVTA 1WI9A 1BN5A 2FRHA 4G8XA 4GYIA 2CGPA 5LHHA 4IHSA 3CUQA 4KFCA 2QQBA 3WTWC 2D2WA 5H6RA 4CGZA 4GO1A 1S29A 2EA4A 2GIVA 2AS5F 2M45A 1SFUA 1IN8A 3I59B 1ZH5A 2QM3A 1RIOH 3SHFA 3E5XA 1HBXG 5IT9Z 4BNCA 5L3CA 3CO6C 1ZG5A 3HHHA 3LFKA 2GXBA 2DLLA 3LQQA 4HDVA 2FNPA 4R79A 3L00A 2A6HF 1FY7A 2A61A 3FXRA 1N08A 2DQRA 3GF2A 4BQAA 3BJAA 5JFRA 2MH9A 4N9IA 3C7JA 1O3RA 5D4SA 1ZG1A 2L4MA 3IL2A 1MGTA 3K9TA 1U8RA 3EQLF 5K5QA 4Q47A 5A8AA 3E6CC 2E7WA 1ZRCA 1FOKA 5D5VB 5DYMA 3NEUA 4EV0A 4H0EA 3IWFA 3MEXA 5LHGA 2DFIA 2HR3A 5E1XA 4CDGA 3WTXC 3DF8A 1S6LA 1OPCA 2XVCA 1DDNA 2FBIA 1YQAA 2F2EA 1O7LA 4A6DA 2LF8A 1G3TA 2FBKA 2DI3A 3HSFA 1YFHA 4YFNF 2GA2A 3H3UA 5LGTA 3WTSC 3L2CA 1Z1DA 5CVVA 2CW0F 3E6MA 2GWRA 1HQCA 5E8IA 4DQ2A 3WU0A 1YG2A 3ZMDA 2F5EA 5D8LB 3M1EA 4CICA 1J9IA 2MD5A 3KEOA 4LGWA 4G7HF 1HW5A 1KQ9A 5L3BA 3L7WA 4LLNA 3E5QA 4O3MA 2D1VA 1NHAA 4YIIA 5ILSA 1N05A 1ZGJA 3FXQA 3RJPA 4HX4A 2K4BA 1P2FA 5CLSA 3ZMUA 2O61A 3ERED 2P8TA 2QUFA 1TNTA 5ICCA 3LWFA 4UUVA 2Z5UA 4P5OA 3T0YA 4BXUA 1U78A 2VBTA 3RI4A 2IVMA 2KIFA 4U88A 3ZN1A 1DUXC 5FFZA 1TW2A 4KMFA 2PN6A 2H94A 1MDMA 2VC0A 1IRFA 1LJ9A 3RIRA 1T2KA 1FYMA 3PFIA 1FZPB 1D5VA 3FXUA 2EFWA 3FZVA 1O3SA 2Y0MA 4M74A 4S05A 4S04A 1ZLJA 3BY6A 4Y15A 5EEHA 3LAPA 2M5WA 2VBXA 4QWQA
chains in the Genus database with same CATH superfamily
2X48A 3GVKA 1T98A 5F0CA 4HW0A 2N8GA 4J19A 1ETYA 1V5GA 4CYCB 1QX4A 1RPWA 2W48A 4OIRF 3CUOA 5E17F 2LR8A 1M1KD 4R1HA 2A5WA 5B66C 3HL2A 1NB9A 1ODDA 1HC8A 2RNJA 4AC0A 4DK1A 3JRFA 2Y9YA 3HDDA 3I71A 4FASD 2BXYA 3WTZA 4AIHA 2XRNA 1YO5C 3RPUD 4NC7A 3A3BA 3Q0UA 4YELA 3L2VA 4KDPA 1F60A 1VQ5I 1KQ8A 4XLFA 2DW4A 1ORKA 2MG4A 2QMUA 5BS6A 2BM0A 4Z4YA 1UZCA 3CDHA 4I02A 1ZRDA 1H9GA 2K5CA 4BY7J 1KD1D 4EGZA 3ISXA 3G1OA 1KA8A 3PO2J 3CC4B 3PO3J 2RQPA 3LVBA 3F8CA 1X4PA 3CZ6A 3CDLA 1W2BB 2W00A 4N3GA 4MNUA 2LOOA 3KEYA 3AL0C 1D8TA 4HV5A 3PFYA 2Z33A 3H5RA 3P26A 4CHUA 4LBVA 2WA0A 2ZXIA 4II3A 4BQOA 3M4OJ 1EFRA 3W2EA 2DA3A 3LA2A 3S93A 3V8JA 2LYCA 4O5VA 3KCCA 4A69C 5IOYA 2A07F 1YE9A 5L46A 5D6FA 1B72B 2HCJB 2FX3A 2UV1A 5DM7F 3LNQA 3JTGA 2WR8A 4PGOA 2TRTA 3U2QA 3ESWB 1NK3P 1IRGA 3JQRA 3SZTA 3WG9A 4X7CA 2VC1A 3K10A 4JK1X 3CJQB 4HV6A 4HF2A 4CA0A 3KP4A 2L7MP 2NV4A 4HF1A 1DP3A 2DT7B 3OZUA 1F9NA 2M8EA 3BLYA 2DOAA 2WB1N 4BE2A 1QH0A 1UD4A 4GDFA 2FOWA 2VNHA 2CK3A 2H1KA 2F48A 4XMYA 2JT1A 4HE5A 4ZYDA 2KL4A 2ZMEB 2CFOA 2KIMA 2V7WA 3JR9A 4B1RA 1F4KA 1Y0RA 1W0UA 3HUGA 3IH2A 3PQKA 4E7IA 5CQGA 5DS0A 4RPDA 2FU4A 3V7SA 3EUAA 1W9XA 3IAM2 1STZA 2M1BA 2EFGA 4TN1A 4L0YB 1Q7YD 1KONA 2B0LA 2DO7A 3S2WA 3D5RC 2E60A 2VXZA 4B8XA 2FD5A 2L3DA 4XQFA 3ERMA 3K2AA 3LA3A 3I1FA 5JHUA 3ASPA 1FP1D 1I27A 4B43A 2QQ9A 2CV2A 3RQ4A 2PJRA 4BU2A 1WZ2A 3KZIC 3SFZA 4ZDOA 3GO5A 3GFLA 2P3MA 1Y56A 1BX0A 2O8XA 1WORA 2AQFA 2QA4B 1OR7C 2Q2EA 5FKKA 3P5JA 1P7JA 3W5HA 1KU7A 1WVRA 4UB8C 5FIUA 2GM4A 2R7UA 1BMFA 1N8RD 2QBYB 4BHBA 3J81K 1YLFA 1J2XA 5KCMA 4A3EJ 2A05A 2R7FA 2BEOA 3GTOJ 2EIKH 2EK5A 3KIOA 3W2VA 3H3VK 3V7RA 2ZBKA 1R5ID 1DARA 3KEQA 4WCGA 3KX2A 4ACBA 1BI3A 1Z7LA 3T5XA 2PIAA 1G2HA 2X0KA 2D5VA 1V3FA 4M6XA 1QHHD 4DQLA 4KIFA 1ENHA 2ICWG 2LH9A 4RM3A 1JA0A 2LSOA 2ESHA 3BR2A 4A3DJ 1YYVA 2OZUA 3ASOH 4EVIA 4C3IJ 4KMUX 5BPIA 3G71B 1J09A 3V8KA 1LE8B 1WHUA 1G59A 1LUJB 1YTYA 2V79A 1W7PD 1D1NA 2DXIA 1YX3A 2PBIA 1E3XA 1MABA 3OYKA 4EH1A 4W97A 4O6JA 2HDDA 4QV2A 4IQ4A 1X1AA 1BLIA 1N78A 4KIBA 2DOGA 3WHBA 3H9GA 4RAZA 4AU7A 5J6XA 2R7RA 2KZGA 1MJBA 3U6BA 1TT0A 1E3PA 3BPXA 1ACIA 4ZYGA 1TWAJ 3J81k 1IF1A 4WZEA 3V4GA 2KFDA 3LL7A 3E5UA 1BR4A 2LP0A 2GXGA 3CCUB 1D5YA 1T38A 3HC7A 1H0MA 2VZLA 5FGMA 1HOMA 5LD2C 1FLIA 1YOVB 2EV5A 1T5EA 3KP6A 3DEUA 5J4YA 1AMOA 2DYIA 3GZ5A 3P7NA 4PJNA 4DIQA 1YW8A 4EMSA 2R7SA 3ELKA 2PE3A 1BJKA 1ULYA 2QSFX 3JRAA 1B9NA 5AIQA 1BPLA 1Y6IA 3BP8A 2UXNA 4RM2A 3RYPA 1RR8C 2CJJA 3AGQA 4Z4TA 2KRFA 2AO9A 3RPQA 3A35A 2NYXA 1B59A 2W6JA 2C78A 2NVXJ 1ITYA 3A8KA 1EFTA 2XZLA 3OYDA 1R5NA 3ZP5A 1OR7A 2R5YA 2MD0A 3GTKJ 3ZMTA 5L3FA 3LA7A 3V7CA 1G7TA 1VLYA 4DK0A 4EEFG 4IOAF 3W2HA 3E7LA 1W5CC 1SKYB 2JK3A 2WAEA 4TMZA 5GAGJ 1R4NB 3A3GA 2CUEA 3O3KA 4RAYA 3OFNA 3QFTA 2DEUA 2YWFA 1VQOB 1PJ5A 1VTNC 2EFOA 2RN7A 3GYHX 5EEAA 1DU0A 1UFMA 2A69F 3G1LA 1U2WA 1B9MA 4RM0A 3W2AA 1HW2A 3FISA 4ROXA 1IDZA 2EV6A 2JA8J 3O6BB 2DIEA 5DCMA 5FRMA 3BNWA 2K9SA 4A3GJ 2VKDA 3NAUA 1JKOC 4Z6YA 2EV0A 4RGUA 3JRGA 4G7ZF 4A3IJ 1G7RA 5FNZA 1JE8A 1Z0XA 3CQZJ 2W24A 1QUFA 3CESA 1KJZA 3VPRA 4WWVA 1Q1VA 4GQNA 3G6EB 3H92A 2VQLA 3ASTA 4ZV4A 4ZGNB 3ZXSA 3CP8A 3BR1A 1AKHA 4I7HA 4F93B 2V7QA 3ZBTA 4FE4A 2HPMA 3QODA 1R5OA 2ZTNA 5F6FA 2WV1A 3CCMB 1FRQA 3CMMA 2HI3A 5ERIA 4Y3OA 5B6IA 2EH3A 3ZZTA 2XB0X 1GDTA 2C5BA 3CUQC 4IOCF 1VQ8I 4AIDA 5L3GA 1BC7C 1S72B 1Z7UA 4OAZA 3JAMK 1ETWA 2UWMA 4FHTA 2J7KA 3ZGKA 3CDIA 3ZBUA 3ZZ0A 2FQ3A 2R7VA 1VFCA 2V9KA 2H27A 2HLDA 4L5EA 2OA4A 2Y75A 3TO6A 1QFJA 2CNDA 4YAUA 2EFNA 3OS0A 1TQPA 3BR3A 1N0VC 4HQMA 4AYBA 2O3FA 4L8JA 4FX0A 3ZQFA 1NJID 4CSWA 2VNKA 2O8KA 2OTJI 3E6DA 5LBQA 3OS2A 1E17A 5CQEA 3PJRA 2XDVA 1MNMC 2V31A 1EKEA 4DQKA 2C5HA 1ETQA 2CBXA 4QLCU 3ZC3A 3CMEB 4KIGA 1T33A 4BPRA 2X0LA 2STWA 3F21A 1I1GA 4EM2A 1IGNA 2XNCA 2ID3A 4RLZA 4ZC3A 2M7AA 2LBFB 3RPUA 1EJ9A 1FSHA 4ON0A 1U5TC 2EZKA 3DLAA 3BG7A 3CCYA 5E20A 2YX4A 2GOXB 3KETA 1IV6A 4DZPA 3EYIA 1OHHA 3W2WA 4OMZA 1KQSB 4XRMA 2E35A 3ABMH 5JLWA 3JTHA 3JW4A 4ESBA 5IT9K 2BPOA 2ISZA 1GT0C 4G1VA 4ZGQB 2XF6A 2HKOA 2DFFA 2J5OA 4W1UA 2VQHA 2ZKZA 4ITVA 2Q1ZB 3S3OA 4EJUA 1FOXA 3LFUA 3KYCB 2KDOA 2MH2A 3O8GA 2IW5A 3GVAA 1QVFB 3WYAA 3W3CA 2F4OB 3O8HA 2DJIA 2EINH 5DCFA 5E3LA 4CH7A 1J75A 1MD0A 1FIAA 2EFPA 1ON2A 2KP6A 1DG1G 1YHQI 3LNNA 1K8AD 5F1RA 4L5IA 2HDWA 4XOPA 2HQ5A 5D5XB 5BOXA 4A0XA 4V2GA 1BI0A 2OD5A 1R1TA 3ES9A 2A6EF 3OOCA 1M90D 3SDBA 2JRMA 1YW9A 4P3IA 2Q0OA 3AVTA 1J5YA 3I64A 1OYWA 4L18B 1HKQA 1JA1A 2BN4A 1VQ7B 1APLC 1SMTA 4KJZA 2DCUA 2M0CA 4A12A 2A68F 4TMVA 1XQBA 3BZCA 5FRNA 4LLLA 3TP3A 2DU9A 2AHOA 2XGDA 3QFCA 2EA2A 1FPQA 4X6AJ 1WPCA 1WCMJ 2DA5A 1YI2I 1ZM4A 3ABTA 1VI0A 3W6JB 3S1MJ 2R7TA 2PMDA 1WWXA 2MW8A 1BIAA 2WB1A 1DPRA 1MJAA 3OOPA 4AIKA 3CPWB 3Q38A 2OZ6A 3ISPA 3CP2A 2MSYA 4A5NA 3ZQQA 3WGHA 3I55B 5IYDJ 1W36D 5HOOA 2YU9J 1K78B 5KAFC 1WRJA 2DT5A 3GLXA 2WAQN 1K79A 4XLAA 4IHYA 1EH6A 1LVAA 3IV5A 1BJAA 3WY9A 4B3FX 2BGJA 3BJ6A 2LY1A 2WZNA 1FNDA 4NCNA 1KYWA 2L5QA 4NQWB 1NH3A 4IF4A 1A35A 2VODA 3GXOA 3WBKA 1Z05A 2WWYA 5HDNA 1XTAA 3RKXA 1WGXA 3H3ZA 2P81A 3GTQJ 1VHEA 3PUBA 1YIOA 1XSDA 2OQRA 4XN3A 3M3YJ 4RD4A 4BJTA 1F1ZA 4E0FA 1Z9CA 5HLHA 4A3KJ 4A0ZA 3I53A 1U5TA 5TGTA 5ICGA 5F08A 3GX4X 3GCMA 2M0MA 1VF7A 1EV7A 1MNDA 2X53S 2Q8KA 1VQLB 1R5HA 3BH4A 2KMUA 4X8IA 1K4SA 1HA3A 2DODA 2BBYA 3HOWJ 4E6KG 2V6EA 3CC4I 1LDJA 4IEJA 5E6TA 2L9VA 4B3GA 3GBGA 1LDDA 3N97A 3BCFA 5HDGA 5LGNA 3H5AA 1W0JA 1D2EA 1R36A 4FX4A 2VKHA 1B8IA 2DETA 4WZKA 4BUPA 1OMIA 1HSJA 3FMQA 1TQMA 1NB0A 2Z9OA 3M8JA 2MFZA 3HOTA 4M3FA 4LG0B 1BI1A 1JB9A 4C43A 3W2IA 1D1CA 2EB7A 2XKPA 1S7OA 1ZM3A 3VYSB 5C4XJ 4Y9RA 1IAWA 4XR6A 1P7IA 3SZGA 5HLGA 3JRBA 4FN5A 1SD6A 2X51A 2EFQA 2PMZN 1MMDA 2W85A 3CCSB 1W7PA 1M1EB 2KHMA 4E7KA 3J7AY 1XMAA 4BJ6C 5H20A 1JJ6C 3G05A 2LKPA 3TDUC 5F0FA 3HRMA 3HUGB 4HIZA 4YFXF 3QRFF 3IP4B 2KRCA 4TV7A 2GQQA 1RR7A 4BKXA 3AAFA 3G73A 4TSFA 3VOEA 1XN7A 2OUMA 4RLFA 4XKBA 3HOZJ 2EILH 1JKRC 4YG2F 2XAUA 2K40A 3BR0A 2EZIA 5IK2A 4EQQA 1WJ5A 3P9KA 2JPCA 2PJRB 4F52A 3B8HA 5ICEA 4I0AA 3U2RA 3RTRA 1VZ0A 2BY1A 4U7BA 3OS1A 2WJYA 1YRNA 2KIQA 1U3EM 2QWWA 1IRZA 1LDKB 3MKLA 2WSSA 2FSWA 2KKOA 2HVQA 1ZARA 1I50J 3BJOA 3BWGA 1X2NA 1K6YA 1XDUA 2DA2A 3BQYA 5FFXA 2R93J 2OAZA 3ZMSA 1USTA 5D6EA 4AD9A 3H1CA 1R5GA 1RQPA 1MKMA 1WKMA 3S8PA 4MYUA 2D1HA 4QFMA 1D0XA 2KZVA 2Y2ZA 1S0UA 4DYCA 1X2MA 2QA4I 4U9UA 4EGYA 1I6HJ 3ZN0A 5HODA 3NRVA 1ZM9A 1IW7F 2F4NA 3U6KA 4MLOA 1PKVA 2DYRH 3AL0B 3DDYA 1I3QJ 4UHTA 1DP7P 2EBIA 3AG1H 1UMKA 1A5JA 4P9FA 2L54A 4OIQF 1V5VA 1E0EA 1VQKB 3WNCA 3I58A 4BBSJ 2IRFG 2O5RA 3NQOA 1EP3B 4HRIA 2XB5A 4JX4A 2FEZA 1UD6A 3MCAA 3HRUA 5HS8A 1XCBA 3ZOBA 1XB4A 2M2EA 5J40A 5HLIA 4IW3B 3DPLC 4GGGA 5C3EJ 3JREA 1EXMA 3I56B 1SAUA 1B4AA 2HTSA 2OQGA 2ADUA 2CRVA 2Y48A 3BR6A 4NBQA 3CW2A 3OE7A 3OYGA 2X1CA 1MRZA 2Z16A 1Z3YA 4DZJA 5TJJA 2DTZA 1O7FA 1S4MA 3RKWA 4Y52J 1MBHA 3OIPA 2JMWA 3G71I 2KPMA 2FMYA 3GZ6A 1D0ZA 5FO5A 2W57A 1PYVA 2BE5F 5TY0A 1A6IA 3P27A 4Y7CA 2QKMB 1ZR2A 3HG9A 2ZBVA 3KLNA 1DU6A 5GV8A 1GHCA 1JJ2B 3QYEA 3WHCA 1N25A 4KKTA 4UAJA 2H6BA 4PSXA 2CW7A 4CZCA 2CG4A 2BW3A 5M5WJ 1FNNA 2L7ZA 2R4GA 3TMOA 2EJRA 2VASA 5LHIA 1TWGJ 3PIPF 5LLQA 4XRSG 3ONUA 3U21A 2E34A 3GFJA 4A5MA 5LRSA 2GZWA 3D1NI 4AC9A 4D1QA 3B78A 4B4DA 1KK1A 1JTXA 1LKXA 2QGGA 2XSJC 2DBBA 4YRVA 3OYLA 2JVHA 3CCUI 4KT5C 4XKCA 3IKTA 4LMYA 2HYFA 4D5FA 1UJ8A 2Q6OA 4TMWA 1TVCA 2R5YB 2K9MA 2HYJA 4HPQA 1QUEA 3T8RA 3HAGA 3KEWA 2HZDA 2C4TA 2B7BA 4OOVA 5DUIA 3JSOA 3FDYA 4UVBA 4XIDA 4HYEA 3M1CA 2PI0A 1WOOA 3R60A 2P7CB 4JBAA 1VQMB 1JHHA 3RZOJ 2HEOA 2ZXWH 3IKVA 1MBKA 2VPRA 3OSGA 4PUSA 3FXKA 4MFEA 3FXOA 5LMZA 4MQVA 1ZM2A 3EPZA 1RQRA 1O57A 5E3NA 1G7CA 4BS9A 1MSFC 5CPRB 1JKQC 2VUMJ 4X0GA 1YIJB 4RAGA 2ID6A 1BC8C 2E36A 1WJAA 3M8EA 3K1MA 3R61A 2OF7A 1WOPA 4U0YA 2M9HA 1GO2A 3CCLB 3S2HJ 3CCVB 2XASA 1XGSA 1W0KA 1Z6RA 3HSEA 4EM1A 3OJWA 3JRHA 3Q9SA 2B9SA 1RNLA 3VMFA 3UKGA 1HF0A 1VQNB 2I1LA 2DAOA 5L3DA 2P0WA 2VI6A 3BQZA 4IX7A 1XS9A 1DDGA 4RDKA 1H88C 1Y8QB 4OOIA 1Q82D 5HNHA 3HOSA 5IOZA 5GAHJ 3OYHA 4F55A 1BW5A 3T51B 1NK2P 4ZZLA 4HNVA 3PSFA 2F4MB 3G6EI 3A0BC 1ZKGA 2ZZFA 2PX9A 5E8GA 5KHDA 4A6EA 3EYYA 3F72A 4P6VF 1TP4A 3JQQA 2OC6A 2DA4A 1S9HA 1KTVA 3GTLJ 5BMZA 5H6QA 3BCDA 4AUXA 3CCMI 3FKJA 1PJRA 2CW8A 1FX7A 3CF5F 1U9NA 3H9NA 4MGRA 4P25A 2EZLA 1CF7B 1NG6A 1I39A 2JUCA 2VOPA 1A04A 3HTSB 1YX5A 1I6XA 3JRDA 2OV7A 2V1UA 5FKMA 3RSNA 1S72I 2KRHA 3GQBA 3LSKA 3OV8A 1ZAOA 2HU9A 3L9FA 3CCEB 5D5UB 4NHJA 4U0VA 2MC4A 4M6YA 3GTGJ 2WPDA 3B6AA 2CO5A 3MCZA 2CV0A 4ZYAA 2C77A 2DMPA 5M3MJ 3FXJA 1JXSA 5HZAA 4HE6A 5H59A 2CUJA 3C18A 2EZHA 2QLZA 1MJ9A 4K2EA 5F04A 3VR6A 3IUOA 3LSMA 3I9V2 3I59A 4GYGA 5K7HA 4YEJA 2QEXB 2VT2A 1R22A 3CMEI 2ZNYA 2IXSA 2O9LA 1FNMA 5M3FJ 1PVEA 1FOWA 1UELB 5J4VA 5IYRA 1Y0NA 2E1NA 2WAQA 4UZEA 2HPIA 3LSTA 3A2KA 3AVUA 2HXOA 4ESFA 1N07A 1G3YA 2E1CA 2Y0SN 3DKYA 3ZR8X 1ZG3A 3HTUA 4ZYHA 1MIJA 4PCQA 4PGGA 3DBLB 3DU5A 3HOVJ 3A1PA 5FD6A 3ZMZA 4N4NB 1LQ1A 2AXLA 2DMUA 1R1VA 1K6OA 1H9TA 2AXTC 4HX8A 3F3XA 5CKTA 5J1RA 2VJ5A 3OIOA 3F23A 1RETA 4WWCA 2VNJA 2ZL6A 4QUZA 4UVAA 1OFCX 1OCRH 2XZPA 2Y30A 3GZNB 4WQMA 3C2HA 4RD6A 5GV7A 2Y9ZA 2HTJA 4WXCA 4M2LA 3CUQB 1GAWA 3ZRGA 3HYIA 2KVOA 5FO1A 2JUGA 2XOKA 1G4DA 1AU7A 2DFEA 2OK7A 2JA2A 4F7ZA 2Q6LA 1XX5A 2ACJA 4MEYF 2F5DA 2VKEA 3PA1A 4F3QA 4JQFA 2CC2A 2DPUA 2JA7J 4I6ZA 2PMZA 1GXPA 1VQ7I 2L0KA 1BBYA 1Y1WJ 1PUEE 5HDKA 1KU9A 4FISA 1KYZA 2V7TA 2VBWA 2X4HA 2YPRA 2R3SA 3IH3A 3QPTA 3PNYA 3CLOA 2L02A 1KK3A 1N77A 1D8JA 5KSWB 1S7AA 3Q9VA 5JHFA 4Q7JB 1T56A 2VE8A 4KYWA 4PGHA 1JJ8C 2F6CA 2XV4S 3VB2A 1USSA 2HMAA 3PVDA 3CCJB 5ICFA 3U1DA 4PC6A 3ABUA 1TWCJ 2GIZA 3HM5A 4KN4X 5CVJA 1IHMA 4M0LA 4S0HB 4Z4WA 4CCMA 2F4IA 4U0WA 1QVGB 3I55I 1SEUA 1SFEA 4L9TA 2P5LC 1TW3A 3DQVC 1YS7A 3PUNA 1F20A 3FJOA 4X7EA 3IRRA 4QPQA 2VN2A 2VJIA 2O0YA 5HS7A 4D5CA 3OAAA 2QSGX 1Q1HA 1E3OC 6PAXA 3D0SA 1QU3A 1QZYA 3I5UA 4RB2C 4RJLA 2GAUA 3SLNA 3VNVA 4CCLA 2HOTA 5ILVA 1PJ7A 4RMNA 1YW7A 4XSZF 4X06A 2MABA 2YSRA 1QFZA 4RD2A 4ZCLA 1JGSA 1BJZA 2VJ4A 1VQLI 3VYUB 4HDUA 1MZBA 4NC6A 3BT9A 3K4MA 2ESNA 1MH4A 2KDZA 4A3JJ 1IUYA 4K1XA 5A89A 2O7OA 3DV8A 2M3AA 1FWZA 1QPMA 1W7PB 2LG4A 3TBIA 4Z4UA 2IGOA 3BC9A 1OB5A 2DA1A 2XAGA 1MSEC 2RREA 1XMXA 2IA1A 1J59A 2J5PA 4G6IA 3BTIA 4BEHB 2XAFA 2LFBA 4JP0A 1G8XA 2OBSA 2JJ7A 3CD6B 3MKYB 1SVMA 2OBRA 1A36A 4HAMA 3WU1B 4L0ZB 1P6RA 2R5ZB 1QQIA 3I4PA 2LNBA 1SMYF 4CO8A 1RI7A 4MQ9F 2FNAA 4OINF 1TTTA 2GJKA 3WGIA 3CCSI 2LLKA 4B3XA 4P55A 3IAS2 4OPSA 2GLOA 4Y13A 4HF0A 3J80Z 2QTLA 4WZTA 1EH7A 1FIPA 1FSEA 1HKSA 1WFXA 2WC2A 4E7LA 1MMSA 3OKXA 3BR5A 2G7HA 5IYCJ 1D8KA 4BYYA 3DU6A 3LQEA 3FM3A 4CCOA 4OP7A 4CZZA 2BY0A 2LK2A 2X6WA 3OZVA 3G4SB 4WZLA 4DYQA 5FLXK 4HA8A 1IN7A 5K1YA 1LVKA 1FC3A 2BGCA 3LSGA 5IP9J 1UHMA 2EPFA 3FWEA 1XFOA 2XIGA 5LEKA 1XPXA 3GEZA 4C9YA 3ECHA 4Q4ZF 4MYTA 3B02A 3HHGA 2Z6BD 3OW7A 1FEXA 1OCZH 5CYVA 5H5JA 4DNRB 4ETSA 1TNSA 4KUMA 3OYNA 4RD1A 5JR3A 2BVMA 1PUFA 3GVJA 1JUPA 3DTKA 2HFHA 2G9WA 2M30A 2V26A 4G6DA 4HLXA 5HKKA 2L01A 4XRFA 2DFHA 4PSWA 1FYKA 3EETA 2D9RA 5F4OA 4NNJA 2CQ7A 3ASRA 1SFKA 1SD4A 4GXOA 3W6KB 4HNUA 2R0QC 1EF4A 2PEXA 3KZZA 3ABLH 3RKYA 1SC7A 1IZ1A 2BOLA 2V4JC 3OYIA 1W4MA 2P5VA 1GV2A 4I99C 1ZREA 4PK4A 1DGRM 3FF5A 4QWQA 2C6YA 4GCVA 2QN6A 1BIBA 1KK0A 3ZPNA 1Z77A 2L9RA 4XOTA 1GV5A 3GW2A 4M9XA 1NRKA 1Y39A 3MQ0A 4P2NA 2HXIA 1HCRA 3IH4A 3MKZA 3HGYA 1OQYA 2ZMEC 4EJWA 1VLOA 1WSVA 3DBRB 3K0LA 5M5XJ 3L2UA 1WQ2A 1L0OC 2TDXA 3WGGA 2CUZA 2Z99A 1SD7A 1HLVA 4P26A 2PG4A 5FJ8J 3ZPLA 1MBGA 4J0QA 4X1EA 1H8AC 3ML6A 4JX6A 1VQKI 2JN9A 2A3SA 4XORA 4C2UA 4IRGA 2X1DA 3H94A 3DPTA 4IHWA 1CGPA 5HNFA 3ZUGA 4I0BA 2H6CA 4MIMA 4R8HA 1W35A 1YS6A 5IP6A 3I56I 4P9UA 2DT6A 4CYCA 1WU8A 1VF9A 1QVUA 3HPHA 3L09A 3R0AA 3R6SA 2VBUA 2M7BA 3MFKA 2F5VA 1QNTA 2QQAA 1J0RA 5J1UA 4U7DA 1IXSB 4QPOA 4RB1A 2IA0A 5IYPA 4B09A 3QSYA 3S3MA 4IRHA 3A01B 4ENMA 2IS2A 4G94A 5FLXZ 1ETKA 2QCOA 2ZXHA 1X58A 3B6CA 1T0FC 2X6OA 2DA7A 4OAYA 1E3ZA 2NRAC 3OJXA 2LMDA 3OPOA 3W5UA 3F6VA 4TMTA 1XSXA 1XSVA 2NOGA 4XLNF 3S3NA 2F1LA 4LBWA 5A88A 2H8WA 2BYVE 2XNJA 5DTDA 2R7XA 4BAYA 2GOMA 4BHPA 3GTJJ 3TW7A 2XGXA 5KVRA 2ZNZA 3G3ZA 4HOBA 4LIVA 3OZWA 4Z4VA 2STTA 1MDMB 3GUDA 4M71A 1R7JA 5K5OA 4F91B 5TRDA 1U6GA 2MLKA 3JRCA 2JDIA 3OR2C 1B1BA 3WTVC 3CCRI 2OYNA 3ZQHA 2MBFA 2QSHX 2F43A 4C3HJ 4C0SA 2CFXA 3F9KA 1ZGAA 4IQJA 4WK8F 4E7ZA 2ZC2A 1RESA 4ENNA 3SJMA 3DXJF 5CDFA 4QSHA 2GREA 3WBJA 2OTLB 3KLOA 2DDBA 2KJBA 3HPGA 4L5JA 4M3EA 3SZPA 3V8LA 1VQMI 2RQQA 1G6NA 3OR1C 3FBNB 1ZUNB 2DERA 3VNUA 4P22A 3VYRB 1FRNA 1ZLKA 1BM9A 1ZGWA 1H42A 2XAHA 2IEKA 5CVUA 4B48A 4M4SA 4KKSA 5FKLA 2G7UA 3CJNA 1LB2A 3E3VA 3KP7A 2E2HJ 3CF2A 1HSTA 1QZEA 1YIJI 4BXFA 2IGNA 2FX0A 2ZMEA 3P9IA 3TOAA 3TQNA 3K4LA 2VPLA 2W84A 4LG3A 3BQJA 2PQ8A 4AIJA 2VE9A 2LD5A 3CCLI 4ASUA 2L9SA 3CCVI 3HOXJ 4XICA 1ON1A 2YU3A 4IRIA 3BROA 1J9ZA 4MHGA 2UUZA 2Y0SA 2E71A 4B4CA 2Z2SB 5J1YA 4OWRB 1VQNI 4ZCMA 3E0JB 3OIQA 5IT3A 1R6RA 1FBSA 2K3PA 4D0PA 1JNYA 3E6BA 3QPHA 4P96A 2FA5A 1GAQA 4DNCA 5A2QK 2BV6A 1XD7A 3SLDA 2BVNA 4M6VA 2PLFA 4ENKA 2FF4A 5LGUA 3V42A 2JZYA 3SFIA 4YAOA 2XF5A 5E1WA 4ZDLA 2QBYA 1O3QA 4X7DA 2L9NA 1JUSA 2IA2A 3BG5A 2BZTA 3Q3SA 1XDSA 2WBMA 2ZXJA 4WF2A 3REOA 5GTIC 2RVCA 2X1EA 1T0FA 2HQRA 5HVQC 3MZYA 3CMAB 4N9HA 2X6XA 2R7WA 4ZZDA 1LFUP 2UXXA 3KE2A 3A1YA 4P6YA 4EATA 3WODF 3DWLE 4BJ5C 2ZFUA 2NVYJ 3F22A 3WG7H 1AIPA 5CVRA 1FYLA 1HW1A 2ZCWA 1POGA 2BXZA 2LF7A 3CCEI 2L4AA 2CQNA 2LVSA 4LK1F 1ETOA 1IV8A 1QZZA 3GFMA 1DDIA 2DMQA 2ZITA 2JTVA 4M73A 1UHWA 2VBSA 1T6XA 1P4XA 1IN5A 1ZQ3P 1KRHA 4B47A 2QKLB 2XEXA 2X3UA 3OEEA 4U87A 4NB5A 1EFCA 4LK0F 2ZJRF 1WSUA 3R6JA 1KU2A 2MC3A 3WU2C 2QF7A 1JT6A 1P4AA 2FVGA 3MD2A 3QFSA 3VWBA 1TBXA 1V54H 2M5SA 2QEXI 1P4WA 4HZFA 3OYFA 1XG1A 2HKXA 1MNEA 5EG0A 5FB2A 4KN7X 4LBZA 1BOAA 2H1LA 2ME0A 1AHDP 2B63J 1RZ4A 3CTAA 1YX2A 2NS7A 1NG7A 3H9QA 4LB6B 1OB0A 4UNOA 1IG7A 2BMWA 1QGYA 4PJJA 4MEXF 3BCBA 2F1MA 2ECBA 3KZYA 1ERDA 3J7ZI 4KITB 2ZJPF 1VQ9B 1IXRC 3HKZN 1TUIA 2BV3A 5DDGA 2H09A 2LKSA 4HG2A 4RGSA 3OYAA 2Q2EB 2HGCA 3E97A 4XKVA 4N3NA 5A2QZ 2LY2A 3KYLA 4LJZF 1H85A 3L1PA 2X85A 3LSJA 1WH7A 5E1ZB 1E2XA 2Z1DA 4PC7A 1MW7A 2W6IA 3JQPA 4ZH4F 3H5NA 5D4RA 4P12A 1AA7A 1LFBA 1KU3A 3T8TA 2ZJ2A 2XUBA 2HYGD 4A0YA 4ABZA 3I4MJ 4BBRJ 1XB2A 3AFHA 4XD7A 1SFOJ 1D3YA 1VQ4I 1LNWA 2HZTA 3QFRA 1KC8D 3CRZA 3QU6A 3QYBA 3DLLF 3EUKL 3KP5A 1HA8A 1GVHA 5EEGA 1FTZA 2KLOA 4BHCA 1Q86D 4M3GA 5BPDA 1HVXA 3OP1A 3M07A 2FOKA 1R23A 1T08B 2QZ8A 4RBOA 2DA6A 1QGPA 2DDAA 2IAIA 3PL8A 4G9YA 3TOBA 5B1AH 5JVGF 2WZPP 1UMQA 2JPBA 1ZELA 3FXLA 2Q6IA 2VOOA 1X1DA 2RGVA 2K02A 1K7AA 3K1PA 1WP6A 1IRXA 3AGPA 2BY2A 5HXBA 1BX1A 1FNCA 3HGGA 4BY1J 3CXCB 1A6QA 1Y0UA 1CQXA 4AM3A 1JT0A 1WI3A 2LY9A 4RAFA 5EZHA 3K4JA 2VONA 1K28D 2FMLA 1G3WA 4IVNA 5DS9A 3FMRA 4A2UA 1P9QC 5JLXA 3F8MA 3RYRA 3ZQGA 3CCJI 1KGSA 2OU2A 5FLMJ 1Z67A 2BVLA 3V76A 2XPWA 3J7AO 4C2TA 4IZZA 3AG4H 3F8BA 5JI6A 2DMTA 2E1RA 3DFGA 2KJCA 2XHKA 3BTLA 4XM3A 1Q9SA 1YJWB 4IL6C 1RC9A 1SVOA 2P6TA 3I54A 2D45A 3U1KA 3RKQA 2LZJA 4UUSA 4UXNA 5AIPA 1FJLA 2VLAA 4CCNA 4A3CJ 2HS5A 1K83J 2W1OA 2PLYA 2B7EA 2Y31A 5M5YJ 4HX7A 5DD8A 3AVWA 2COMA 2FQ4A 3H0DA 2XC7A 3COAC 1IN6A 4PDKA 2M87A 3FM5A 1C0WA 5IYBJ 4RCYA 4PFOA 5E18F 1HDDC 3OW2B 3G1MA 1N75A 2DYSH 2QYOA 3ASQA 1KK2A 4UZFA 1E79A 1CNEA 2QGUA 4BQNA 1WJEA 3K1NA 4RD0A 3Q3AA 1MMNA 3KP2A 1N06A 3JCUC 2YR2A 3QOPA 2R7ZJ 4M3BA 3K2ZA 1OKRA 3DP7A 4DW6A 3KP3A 2R7DA 4Y7NJ 3CCRB 2XNDA 2LREA 2RAEA 3M9AA 3F6OA 4ESJA 1W36C 4BH9A 3C3WA 5FKNA 1YITB 4Q48A 3WE2A 2COBA 3NARA 1OYYA 4XLHA 5CVIA 2NPFA 1VNDA 5DD4A 2ZZGA 3FX3A 5JBQA 4ENJA 3SXYA 4LIUA 2M34A 4Z4ZA 3CD6I 3HOUJ 1BA5A 4BGDA 1IN4A 1Y1VJ 2H8RA 3B73A 3F8NA 4CXFA 1ZRFA 1PJ6A 4P3YA 5FA6A 2XGJA 2MYSA 5TR9A 1I8DA 2VNIA 1OYIA 4XK4A 3S17J 2F5CA 1WJCA 3QE2A 4PAAA 1Q81D 2JSPA 5GAEJ 1RRJA 2GJPA 1IO2A 3OY9A 1S3JA 3UNGC 4AVPA 2DK5A 2K86A 3N4MA 3W6VA 3MZHA 1T8IA 5B5EC 2YWHA 4RB0A 2XGCA 4EJTA 1MH3A 1S8NA 3I4NJ 2OBTA 3SJPA 1UCRA 2XF7A 4E70A 3S1QJ 5DCMB 3S32A 2HOEA 3TGNA 1A31A 3LAJA 2HDCA 1T6SA 5E3MA 3G4SI 5ILUA 1UB9A 3K7AJ 4I09A 2CW5A 2XZOA 3WQZA 3FBIB 4UV9A 3IHUA 3LSIA 5AONA 4P9SA 4MO7A 2DOFA 3DBHB 4G7OF 2CUFA 1MBEA 2E1MC 3BY1A 4CCJA 5F27A 1AKHB 1SFXA 2DTRA 3CC7B 1Z91A 4UV8A 3SEZA 3P9CA 1XMKA 2XAJA 2X6YA 2V1DA 1Y0YA 4ACAA 3V7AA 1OGIA 4L9VA 5BQTA 1T39A 4A93J 2PJPA 4LC0A 4L9JA 4RDJA 4G1BA 1VQ6B 4Z4SA 3QP6A 4PJLA 4E7HA 1UAAA 1TLHB 3QOEA 2VKVA 4GRIA 3ROUA 1VQOI 3VO2A 3MWMA 5GPAA 3FPKA 2NVTJ 2MA3A 2WTEA 1OCTC 3AG3H 2NXNB 3OL4A 2PFBA 5GTHC 1LEBA 2AQEA 3HIFA 1F5TA 1TC3C 2M8GX 2ZSHB 4HQEA 3G2BA 3CCQB 2ZSIB 9ANTA 4IHTA 2KISA 3OYMA 2HNHA 5FROA 1ZTRA 3OMYA 5EGOA 2NS8A 2ETHA 2HQNA 3IWZA 3PSIA 2JRTA 4G6QA 3VSKA 4L9NA 4YFKF 2JJ2A 2V7UA 3WTUC 3S14J 3FK6A 5BSYA 3FHZA 1ELOA 3WTYC 3A03A 5F4JA 4IPAA 2RDPA 3CMYA 5F64A 1ETXA 4XL9A 2CWEA 2YUSA 2R92J 2IS1A 4FK8A 3GWZA 3M8FA 4FQGA 3HOYJ 1ZHFA 1FNBA 3ZQ7A 1K78A 1XGOA 2R7OA 1GVDA 1V5EA 2IGKA 2LTPA 4Y9UA 2O03A 4WXDA 2V9VA 2KQRA 1QBJA 5B3SH 1RKWA 2EWNA 4RGXA 4NQWA 2EIXA 5LEJA 3PNTA 4KA4A 1UG0A 1AWCA 5BSXA 4HBLA 2IPQX 3E20A 4B44A 2IJLA 4M1KA 3C1DA 4G7XA 2KT0A 4Z2YA 3FIWA 3BTJA 4LFUA 2WY7Q 2OCEA 3BZ6A 1JTYA 3LQRA 2QE7A 3BZKA 1TLLA 3QPSA 3EUHA 2FBHA 3HRSA 3RY8A 4I98B 3K6GA 2DPDA 4HSTA 3T1BA 2FUG2 3D26A 5LFAA 1QA6A 4B3AA 2DN0A 4YAWA 1IUFA 5J47A 1T6YA 4OOSA 1DPUA 5DN6A 3N05A 5C4JJ 3TO7A 4P1WA 2CU7A 5HLTA 2NVQJ 4RDUA 4F7DA 2LRDA 4BXXJ 3S1RJ 1V4RA 2I5UA 2PMUA 1T6ZA 2GA1A 2RKHA 3HSRA 3HXLA 4LG0A 1JKPC 1FOYA 3PQJA 3ULQB 1V0EA 1P4MA 2HWVA 1FMVA 4YAFA 3PIOF 2PMHA 3WNDA 3SQNA 2EIMH 1X3UA 1U9OA 3MAJA 3OYEA 3B82A 4RLQA 3WTTC 1VQ4B 2OTLI 3HZJA 3ZQCA 2ZB9A 1LEAA 4MTDA 2VB6A 2LKXA 3BOQA 2GXAA 1G7SA 2VBVA 1R4MB 5D8KB 1IJWC 3FKIJ 4ZDPA 2VJJA 4DBRA 2P4WA 1R9TJ 1MBJA 3DTIA 2K9NA 3OOUA 3PNVA 3J80K 1QG0A 2P6SA 1SAXA 4FE7A 4PZJA 3SEQA 3UR3C 4XRSA 4X7FA 2O6GE 4G6TB 2OCCH 1BOBA 3MN2A 1VQPB 1FBUA 2TCTA 3PUFA 5B1BH 1GLNA 2NS0A 1TQIA 5J3LA 3PENA 2L7KA 1WH5A 1YJNB 3BPVA 1QO0D 2MLGA 5KK1A 5FO0A 2R7QA 3R4KA 2OBPA 3Q6QA 4Y17A 4EJVA 5AN9A 4LLGF 1WJBA 1X4OA 4OIOF 1HKTA 1N0UA 4X07A 4JYKA 3SKBA 3HKZA 5FKOA 2OJED 1U5TB 3DEEA 4XLCA 1L3LA 1H8HA 1UD3A 4X05A 1ZR4A 3R6KA 3ECOA 1DGWY 1TT5B 4YIRX 4H9GA 1ZN2A 4MTEA 2ZFWA 1XCVA 1EP2B 2V4DA 3K4KA 1IXCA 4QIWN 1HXDA 3GFIA 4XSXF 1X1PA 3BC8A 4TKOB 2F5FA 1FBQA 3FPPA 1YJ9B 2IP2A 3O2PE 4UB6C 2JWTA 1B8IB 2DK8A 1PP8F 5ED4A 1BL0A 3ZMVA 1WDTA 4IXAA 4KISA 2ZL5A 1EP1B 3X2QH 2ZBUA 2MGQA 4OMYA 3CMAI 1H8EA 3BG9A 2NAZA 3CC2B 2W4SA 4AF6A 3SDGA 4DJAA 4EJOA 1X3ZB 2WYRA 3AKZA 3VO1A 3WE3A 4J00A 3GMEA 1PP7U 3VODA 1WTHD 1JI8A 3NE5B 5TV2A 3D5LA 3H35A 3I0TA 2K4JA 2C2WA 2VYQA 3S1NJ 3AVYA 5EG0B 1R49A 4OU0A 5KNLA 3FHNA 4AWXB 2X8KA 2WADA 4A3MJ 2XAQA 5BNGA 1JHFA 2FJ1A 3BG6A 4Q5SF 4RDLA 2JA6J 3SJZA 3GIRA 5C44J 4LB5A 4BE0A 1AOYA 5IYNA 4KNYA 2P7VB 2JSCA 4IJAA 2JA5J 3QU3A 1U2RA 2K3FA 1IDYA 3OWTA 4NDLA 4IKFA 5DV5A 2FE3A 3QPLA 1KQ0A 1R71A 1YRNB 1IJEA 2V1NA 2E5ZA 2ELJA 4ZTFA 1I7PA 2CF4A 4E4HA 3S15J 4RB3C 5F0HA 4HNTA 2A5YB 2B5OA 4RCZA 1V55H 4FCYA 3S2DJ 1TTYA 2ZZQA 1SD5A 2CH0A 1OCOH 2ELHA 3K69A 4XN0A 3F8FA 3K70D 3Q0WA 1IB0A 5DEQA 2QENA 1W5SA 1J7KA 3ZIAA 1FMWA 2E19A 3J81Z 3QAHA 1X1CA 1VQ9I 2K7LA 3FK7A 4WX9A 1PDNC 1B2RA 1GR1A 2C4UA 3BDDA 2EQRA 1XGNA 4Y4RA 2IS6A 4XBFA 1UD2A 4FT8A 3JU4A 3A0HC 3M7GA 5H2FC 5D5WB 5EF6A 2RC5A 4M72A 1W5TA 5GPCA 4UZUA 1K9MD 5L3EA 3A02A 1MBFA 3ZCOA 4A3LJ 3IRQA 1EH8A 3IC7A 1XGMA 4XKWA 2DMNA 2VXDA 3MHPA 2NVUB 2JJ1A 4Z4RA 1FP2A 2VBZA 3DKXA 2YX7A 3VEPA 2HVRA 1SANA 3HRTA 4YALA 2AHQA 3LSHA 3R0JA 5CJ9A 3ASSA 4XLEA 5EZGA 3L2RA 2XSDC 1ZYRF 4RA2A 2V6CA 4M9SA 2E1OA 1R1UA 2V1XA 1E3HA 3ONQA 1KZLA 2V7XA 2ZL7A 2W25A 3KFWX 4CQJA 4JOMA 3LO8A 1SVLA 4ZTJA 2HOAA 4RS8A 5EJCA 3CO7C 2NNYA 4BDYA 5KW9A 2K9LA 4XLPF 4I01A 4BDZA 4UUSB 3GTMJ 3Q5FA 2BSAA 4ASNA 2QQ8A 3QYFA 2DOEA 1I5ZA 3HB9A 1R00A 1D1BA 3K4NA 3CB4A 1VQ5B 2XGEA 3AVXA 2DQLA 1REPC 3FKSA 1RUOA 2RNGA 2IT0A 2LDUA 1OCCH 1Z6TA 2ZO4A 4M3DA 4UVCA 3SYTA 3TL4X 2BW3B 5J8FA 1P92A 3MMYB 2FXAA 2WV0A 1E1QA 2V9PA 2CQKA 1WJDA 1YJWI 1B6AA 4KT6A 5EDNA 2K27A 3H0GJ 2KIUA 3TDZC 1UG2A 4PJMA 4I76A 5J8CA 2BY3A 4RPBA 1D1AA 1LFPA 2VT3A 1R58A 2G0EA 1NBMA 4IHXA 1SM4A 4E7SA 1ETVA 3RCOA 4N4OB 3W5VA 4LD5A 1TL8A 3JSPA 1CF7A 1NDHA 2VBYA 3QP5A 3S16J 3VFZA 1RUNA 4PC2A 5E79C 2W7NA 1OISA 2M4GA 4FETA 4HLYA 2GK6A 2XROA 3FMSA 2GPJA 3DCFA 5EYRA 2NOJB 4FTHA 1WOSA 1QRYA 2UZKA 1K73D 2CYYA 2NNNA 3T53B 4ZJZA 5LRRA 4DBQA 3L2WA 4JX5A 4DGWB 2RC4A 4OIPF 1O3TA 1YITI 1OGJA 1GUUA 5HS9A 4ZYEA 4M9ZA 3CLQA 2ZJQF 5THXA 5DUKA 4H4KC 3W2FA 2D3LA 3TW6A 1B72A 4J01A 2GQFA 3TO9A 4KICA 1XE1A 3DKWA 4PC3A 2ISYA 1EA3A 1ONVA 1EWYA 3JRIA 1QGAA 2Z3YA 4YIFA 2P5KA 4JMQA 5FD5A 4BACA 1COWA 3KL9A 2L2OA 2Y69H 4RGRA 2HOSA 4XNFA 2CSOA 1I1SA 1B23P 3EDPA 2Q6KA 3PM1A 2XKOA 2GBYA 1FT9A 3F0CA 4CUGA 5GADJ 3J7YJ 2IS4A 4OOXA 2E1BA 4N0BA 2CV1A 4I2OA 2QVOA 1YLOA 4EM0B 1U0JA 4ZCIA 4CYDA 1F36A 1BI2A 3U9GA 3RDIA 3TKYA 4UY8I 1W1WE 2E2JJ 2E7XA 3NWSA 2YWGA 3L2QA 2QTZA 1GVJA 5K5RA 1G3SA 4GFBA 1GXQA 1SKQA 3CC7I 2K85A 4WXHA 3JAMZ 1X1BA 5JVTA 1WI9A 5DM6F 2B7CA 1A8PA 1BN5A 3E1SA 1K4TA 2GK7A 2FRHA 4G8XA 5HZBA 4DOZA 4GYIA 3BCAA 4V2FA 2CGPA 5LHHA 4IHSA 4G7WA 3W2GA 2JVGA 1BQEA 1VQ6I 3CUQA 3BY2A 2ME6A 4KFCA 4D9JA 3C2BA 5EGOB 2QQBA 3KYDB 3WTWC 2D2WA 3GTPJ 3ABKH 5H6RA 2R9VA 4CGZA 4PC1A 4GO1A 1VHOA 5IYQA 2ZTGA 4RD3A 1S29A 4DYRA 2EA4A 2GIVA 3Q6RA 3K70C 4A3FJ 2GJRA 3TEDA 1JGGA 3ZQIA 2AS5F 2JQ7A 2RC6A 4CCKA 2M45A 3CCQI 1BR1A 5K7ZA 3HEFA 1FDRA 1SFUA 4BE1A 5FLVA 1OB2A 1I18A 1IN8A 4R71A 3I59B 4C3JJ 1E43A 4D7NA 1ZH5A 5DSZA 2QM3A 2E2IJ 4C30A 4A3BJ 1RIOH 1MMAA 3QWLA 3SHFA 3E5XA 1F43A 1HBXG 5IT9Z 2WY8Q 4BNCA 5IPAA 4IO9F 2ELKA 4IHVA 2R6HA 4P1VA 1U8BA 3MVPA 5L3CA 3CO6C 2ECCA 1ZG5A 4PABA 3HHHA 3K4BA 1LE8A 1HZEA 2CRGA 3LFKA 4NC8A 2DJNA 3OL3A 4MFDA 2GXBA 2BF4A 4II2A 5KAIC 2DLLA 1I3AA 3HJEA 3LQQA 4AVZA 3VSLA 3MKWB 4HDVA 1NTCA 1TZLA 2FNPA 3ONYA 4R79A 2JN6A 3L00A 3CPXA 4HSRA 2A6HF 1FY7A 2A61A 2CMPA 1W87A 3PA2A 4NBSA 4XONA 3FXRA 1N08A 2E1MB 2IGMA 4QTRA 2DQRA 3GF2A 4BQAA 1E62A 3I3LA 4HEA2 5J35A 3BJAA 5JFRA 1X19A 2MH9A 3ZQLA 1V0FA 4Z1MA 3TP0A 3T56B 3CJRB 4N9IA 3C7JA 1O3RA 5D4SA 1ZG1A 1QGZA 1X3WB 1W34A 2L4MA 3IL2A 1MGTA 2OPTA 3K9TA 1U8RA 4BEHA 1GJRA 3DEWA 3EQLF 1Y8RB 5K5QA 4Q47A 4YXWA 5A8AA 3E6CC 4QVAA 1UD8A 1JUMA 2E7WA 1QVTA 2R5ZA 1ZRCA 3RZDJ 1FOKA 5D5VB 5DYMA 1CQTA 2M4KA 2D3NA 4QVJA 3WXMA 1BW6A 2X9DA 1OCPA 3NEUA 4EV0A 4H0EA 3PUMA 1KMHA 2VQCA 3IWFA 3MEXA 3OYBA 4OPOA 3GLLA 1ZK8A 5LHGA 2DFIA 2HR3A 2ZZEA 3FXMA 5E1XA 2XPUA 3LQ6A 1W0TA 4CDGA 3WTXC 2BHZA 1WJFA 1Z21A 3DF8A 1S6LA 2HQAA 1EFUA 1OPCA 3VDXA 2XVCA 1DDNA 2FBIA 1YQAA 2VQGA 4DNTB 2F2EA 1O7LA 4A6DA 2BHYA 2LF8A 1G3TA 2FBKA 2DI3A 2I8DA 3HSFA 3A4CA 1YFHA 1H89C 4X0CA 3DTEA 4C2MJ 2W82A 3Q0VA 1UHSA 4YFNF 2GA2A 4BQQA 5F4MA 1VQPI 4LOCA 4PFPA 3H3UA 4M53A 3VYTB 5LGTA 4YHBA 3WTSC 3L2CA 1Z1DA 2VL8A 2CQXA 4QHYA 4UUTA 1YJNI 5K7FA 1FTTA 2VIXA 1QHGA 5J3OA 5CVVA 2CW0F 3E6MA 1VQ8B 2GWRA 1HQCA 1TWHJ 5F1JA 1D0YA 3C2GA 3BG3A 3Q39A 5E8IA 4G5GA 3ZZUA 5EMNA 3SEJA 4DQ2A 3WU0A 3MMPA 4TMXA 3D5SC 3AVVA 1YG2A 3LSPA 3ZMDA 2YWEA 2CS3A 2F5EA 3WNBA 5D8LB 1HDPA 3M1EA 4CICA 1J9IA 3OEHA 2MD5A 3KEOA 4LBYA 2V7VA 1XC5A 4LGWA 4G7HF 1HW5A 1KQ9A 3RQIA 3L7WA 5L3BA 3E5QA 4LLNA 4O3MA 1DQUA 2D1VA 2OTJB 1YJ9I 4FWTA 3OYCA 1R5BA 3HBLA 1VJSA 2WJVA 2L7FP 1NHAA 4YIIA 4NUBA 1V5FA 5ILSA 1FX0A 3K4CA 3LSRA 1N05A 5IYWA 3AG2H 5IP7J 1ZGJA 3FXQA 1QFYA 3RJPA 4HX4A 1Z3XA 3MZ8A 2K4BA 1P2FA 5CLSA 2BGIA 3CC2I 4E7JA 2EIJH 3ZMUA 4FXUA 2O61A 2DY1A 3H9JA 4Y33A 1CNFA 3DPUA 3E1YE 3ERED 2P8TA 4G12A 2QUFA 1E64A 1TNTA 5ICCA 3LWFA 3NWTA 4BL0B 3KPHA 5E3OA 1WPKA 3LOCA 4UUVA 2Z5UA 4P5OA 3T0YA 3OSFA 1E63A 4AF7A 2D74A 4ANJA 1OLTA 4BXUA 3A01A 1WSRA 1U78A 2JIZA 2OK8A 2WAFA 2LBFA 3OYJA 2VBTA 3EUHC 2V7FA 3RI4A 2IVMA 1MMGA 2KIFA 4U88A 2XPVA 3ZN1A 1TWFJ 1KZHA 1OJLA 1DUXC 4V19K 3A8JA 1YHQB 1PUFB 1K61A 5FFZA 1TW2A 2I10A 4KMFA 2HVSA 2LC2A 2PN6A 2H94A 2XRLA 4LITA 4TT3A 1MDMA 1S5LC 2K9QA 1IRFA 1RKTA 2VC0A 5TISC 1LJ9A 3RIRA 1T2KA 1QPIA 2DCEA 1FYMA 2HDNB 2YS9A 3PFIA 4D7MA 5IY5H 1FZPB 1D5VA 1O4XA 3FXUA 3ASNH 2CQQA 2IBDA 3BTCA 1BR2A 2A6TA 4F92B 3QQAA 2EFWA 3FZVA 3GSIA 2BM1A 1UD5A 1O3SA 2Y0MA 5GP9A 3GVLA 3CJTB 4M74A 4AYBN 4S05A 3LMMA 1E1RA 2QDXA 1S7EA 4S04A 4KKUA 1ZLJA 1LPQA 3BY6A 1IJFA 1IC8A 3A8IA 1YI2B 5FL7A 1T95A 4Y15A 5EEHA 3LAPA 4OPVA 2E5NA 2M5WA 3H36A 2VBXA 2RV8A 4PJ0C
chains in the Genus database with same CATH topology
1T98A 4HW0A 4OIRF 3CUOA 5E17F 4R1HA 1NB9A 1ODDA 2RNJA 3I71A 3WTZA 4AIHA 2XRNA 1YO5C 4KDPA 1KQ8A 2DW4A 5BS6A 3CDHA 4I02A 1ZRDA 1H9GA 4EGZA 1KA8A 2RQPA 3F8CA 4MNUA 4HV5A 2Z33A 4CHUA 3LA2A 3V8JA 4O5VA 3KCCA 2A07F 5D6FA 3JTGA 1IRGA 3SZTA 3WG9A 2VC1A 4JK1X 4HV6A 4HF2A 3KP4A 4HF1A 1F9NA 2M8EA 2JT1A 4ZYDA 2ZMEB 2KIMA 1F4KA 3HUGA 3PQKA 2FU4A 3V7SA 1STZA 2M1BA 4L0YB 2B0LA 2DO7A 3S2WA 2VXZA 4B8XA 2L3DA 3LA3A 5JHUA 1FP1D 1I27A 2QQ9A 3SFZA 2P3MA 3GO5A 3GFLA 2O8XA 2Q2EA 1KU7A 2QBYB 4BHBA 3J81K 1YLFA 1J2XA 2R7FA 2BEOA 2EK5A 3V7RA 2ZBKA 3KEQA 4WCGA 1BI3A 3T5XA 2X0KA 1V3FA 4M6XA 4KIFA 2LSOA 2ESHA 1YYVA 2OZUA 4EVIA 4KMUX 5BPIA 3V8KA 1YTYA 2V79A 1W7PD 2PBIA 4O6JA 4KIBA 4RAZA 5J6XA 1MJBA 3BPXA 4ZYGA 1IF1A 3V4GA 3E5UA 2GXGA 1T38A 1H0MA 5FGMA 1FLIA 2EV5A 3KP6A 3DEUA 3GZ5A 3P7NA 1YW8A 4EMSA 3ELKA 1ULYA 1B9NA 5AIQA 3BP8A 2UXNA 3RYPA 2KRFA 3RPQA 2NYXA 1B59A 3ZP5A 1OR7A 3ZMTA 5L3FA 3LA7A 3V7CA 3O3KA 4RAYA 1VTNC 2EFOA 3GYHX 2RN7A 1UFMA 2A69F 1U2WA 1B9MA 1HW2A 2EV6A 3O6BB 5DCMA 3BNWA 2EV0A 4RGUA 4G7ZF 5FNZA 1JE8A 2W24A 3H92A 4I7HA 5F6FA 5ERIA 3CUQC 5L3GA 1BC7C 1Z7UA 3JAMK 2UWMA 4FHTA 2FQ3A 2H27A 2OA4A 2Y75A 3TO6A 2EFNA 1TQPA 4HQMA 2O3FA 4FX0A 3E6DA 5LBQA 1E17A 4QLCU 4KIGA 2X0LA 2STWA 3F21A 1I1GA 4EM2A 3RPUA 1FSHA 4ON0A 1U5TC 5E20A 2YX4A 3KETA 3EYIA 4OMZA 5IT9K 3JTHA 3JW4A 4ESBA 2ISZA 2HKOA 2J5OA 2ZKZA 4EJUA 2MH2A 2IW5A 3GVAA 5DCFA 1J75A 1MD0A 2EFPA 1ON2A 5F1RA 4L5IA 5D5XB 5BOXA 4A0XA 1BI0A 2OD5A 2RV8A 1R1TA 2A6EF 1YW9A 2Q0OA 1J5YA 3I64A 1OYWA 4L18B 1HKQA 1SMTA 4A12A 2A68F 4LLLA 2DU9A 2EA2A 1FPQA 3ABTA 3W6JB 1WWXA 1BIAA 1DPRA 1MJAA 3OOPA 4AIKA 2OZ6A 3ISPA 4A5NA 3WGHA 5HOOA 1K78B 1WRJA 2DT5A 3GLXA 1K79A 1EH6A 1LVAA 1BJAA 3BJ6A 1KYWA 4IF4A 2VODA 3GXOA 1Z05A 2WWYA 5HDNA 3RKXA 3H3ZA 1YIOA 1XSDA 2OQRA 1F1ZA 1Z9CA 5HLHA 4A0ZA 3I53A 1U5TA 5ICGA 3GX4X 1EV7A 2Q8KA 1R5HA 2BBYA 1LDJA 1LDDA 3N97A 5HDGA 5LGNA 1R36A 4FX4A 1OMIA 1HSJA 3FMQA 1TQMA 1NB0A 2Z9OA 3HOTA 4LG0B 1BI1A 2EB7A 1S7OA 2XKPA 1IAWA 5HLGA 1SD6A 2EFQA 2W85A 1W7PA 1XMAA 5H20A 2LKPA 3TDUC 3HRMA 4YFXF 3QRFF 4TV7A 2GQQA 3AAFA 3G73A 3VOEA 1XN7A 4YG2F 4EQQA 3P9KA 2JPCA 5ICEA 4I0AA 3U2RA 3RTRA 4U7BA 1U3EM 2QWWA 1LDKB 2FSWA 2KKOA 1ZARA 3BWGA 3BJOA 1XDUA 5FFXA 2OAZA 3ZMSA 1USTA 5D6EA 4AD9A 1R5GA 1MKMA 1WKMA 2D1HA 4EGYA 3ZN0A 3NRVA 1IW7F 4UHTA 1DP7P 4P9FA 2L54A 4OIQF 3I58A 2IRFG 3NQOA 2FEZA 3HRUA 5HS8A 1XCBA 1XB4A 5HLIA 3DPLC 4GGGA 1B4AA 2HTSA 2OQGA 2ADUA 2Y48A 1MRZA 5TJJA 1O7FA 1S4MA 3RKWA 2FMYA 3GZ6A 5FO5A 2W57A 2BE5F 3KLNA 1GHCA 2H6BA 2CG4A 1FNNA 2EJRA 5LHIA 5LLQA 4A5MA 3GFJA 5LRSA 2GZWA 2DBBA 4KT5C 3IKTA 4LMYA 2HYFA 3T8RA 5DUIA 3JSOA 4UVBA 4HYEA 2PI0A 3R60A 2P7CB 4JBAA 1JHHA 2HEOA 3IKVA 4MQVA 1O57A 1BC8C 3M8EA 3K1MA 3R61A 4U0YA 2XASA 1XGSA 1Z6RA 3HSEA 4EM1A 3Q9SA 1RNLA 2I1LA 2DAOA 5L3DA 4OOIA 3HOSA 4ZZLA 5E8GA 4A6EA 3EYYA 3F72A 5BMZA 5H6QA 1FX7A 4MGRA 1CF7B 2VOPA 1A04A 3HTSB 1I6XA 2V1UA 3OV8A 1ZAOA 3L9FA 5D5UB 4NHJA 4U0VA 4M6YA 3MCZA 2CO5A 1JXSA 3C18A 2QLZA 1MJ9A 4K2EA 3I59A 4GYGA 2VT2A 1R22A 2ZNYA 4UZEA 2E1NA 3LSTA 4ESFA 1N07A 1G3YA 2E1CA 1ZG3A 3HTUA 4ZYHA 4PGGA 4PCQA 5FD6A 3ZMZA 1LQ1A 2AXLA 1R1VA 1K6OA 1H9TA 4HX8A 3F3XA 3F23A 4WWCA 4UVAA 2HTJA 4WXCA 3CUQB 3HYIA 5FO1A 1G4DA 4F7ZA 2ACJA 4MEYF 2F5DA 4JQFA 2DPUA 1GXPA 1BBYA 1PUEE 5HDKA 1KU9A 1KYZA 2VBWA 2X4HA 2R3SA 2YPRA 3QPTA 3CLOA 2L02A 1D8JA 1S7AA 3Q9VA 2VE8A 4KYWA 4PGHA 2XV4S 3VB2A 1USSA 5ICFA 3U1DA 3ABUA 4KN4X 5CVJA 4U0WA 1SFEA 4L9TA 2P5LC 1TW3A 3DQVC 1YS7A 3IRRA 2VN2A 2O0YA 5HS7A 1Q1HA 6PAXA 3D0SA 1QZYA 3I5UA 4RB2C 2GAUA 5ILVA 1YW7A 4XSZF 2YSRA 1JGSA 4HDUA 1IUYA 1MZBA 2ESNA 5A89A 3DV8A 1FWZA 1QPMA 1W7PB 2XAGA 2IA1A 1J59A 2J5PA 2XAFA 4HAMA 3WU1B 4L0ZB 1P6RA 1QQIA 3I4PA 4CO8A 2LNBA 1SMYF 1RI7A 4MQ9F 2FNAA 4OINF 3WGIA 4P55A 4Y13A 4HF0A 3J80Z 1EH7A 1HKSA 1FSEA 2WC2A 2G7HA 1D8KA 4BYYA 3FM3A 4CZZA 5FLXK 4HA8A 1IN7A 5K1YA 2BGCA 1FC3A 1UHMA 3FWEA 2XIGA 5LEKA 3GEZA 3ECHA 4Q4ZF 3B02A 3HHGA 5CYVA 4ETSA 1TNSA 4KUMA 5JR3A 4G6DA 2HFHA 2G9WA 2M30A 4HLXA 2L01A 4XRFA 1FYKA 3EETA 1SD4A 4GXOA 3W6KB 2PEXA 3KZZA 3RKYA 1IZ1A 1W4MA 2P5VA 1ZREA 3FF5A 2C6YA 4GCVA 1BIBA 3GW2A 4M9XA 3MQ0A 4EJWA 3K0LA 1WQ2A 1L0OC 2TDXA 3WGGA 2Z99A 1SD7A 2PG4A 3ZPLA 3ML6A 2A3SA 4IRGA 3DPTA 1CGPA 3ZUGA 4I0BA 2H6CA 4R8HA 1YS6A 4P9UA 3L09A 3R0AA 3R6SA 2VBUA 3MFKA 1QNTA 2QQAA 1J0RA 4U7DA 1IXSB 4RB1A 2IA0A 4B09A 4IRHA 4ENMA 4G94A 5FLXZ 2NRAC 3F6VA 1XSXA 1XSVA 4XLNF 5A88A 2BYVE 4BAYA 4BHPA 2XGXA 5KVRA 2ZNZA 3G3ZA 4HOBA 2STTA 1MDMB 3GUDA 4M71A 1R7JA 5K5OA 5TRDA 1U6GA 2MLKA 1B1BA 3WTVC 2OYNA 2MBFA 2CFXA 1ZGAA 4WK8F 4ENNA 3DXJF 3KLOA 2KJBA 4L5JA 3SZPA 3V8LA 1G6NA 1ZLKA 1BM9A 2XAHA 5CVUA 2G7UA 3CJNA 1LB2A 3E3VA 3KP7A 1HSTA 3P9IA 2ZMEA 3TOAA 3TQNA 2W84A 2PQ8A 4AIJA 2VE9A 1ON1A 2YU3A 4IRIA 3BROA 4MHGA 5IT3A 1FBSA 4D0PA 3E6BA 3QPHA 4P96A 2FA5A 4DNCA 5A2QK 2BV6A 1XD7A 4ENKA 2FF4A 5LGUA 2JZYA 5E1WA 2QBYA 1O3QA 2IA2A 1XDSA 2ZXJA 4WF2A 3REOA 2RVCA 1T0FA 2HQRA 5HVQC 3MZYA 4N9HA 4ZZDA 2UXXA 3KE2A 3WODF 3F22A 5CVRA 1FYLA 1HW1A 2ZCWA 2LF7A 2L4AA 4LK1F 1QZZA 3GFMA 2JTVA 4M73A 1UHWA 2VBSA 1T6XA 1P4XA 1IN5A 4NB5A 4LK0F 1WSUA 1KU2A 2MC3A 1P4AA 1TBXA 1P4WA 4HZFA 2HKXA 5FB2A 4KN7X 1BOAA 1RZ4A 3CTAA 4LB6B 4UNOA 4MEXF 3KZYA 1IXRC 5DDGA 2H09A 4RGSA 2HGCA 3E97A 5A2QZ 4LJZF 5E1ZB 1E2XA 4ZH4F 5D4RA 3T8TA 1KU3A 2ZJ2A 2XUBA 2HYGD 4A0YA 1D3YA 1LNWA 2HZTA 3QU6A 3KP5A 5EEGA 4BHCA 5BPDA 3OP1A 2FOKA 1R23A 2QZ8A 1QGPA 4G9YA 3TOBA 2JPBA 2VOOA 2RGVA 2K02A 1K7AA 3K1PA 1Y0UA 2VONA 2FMLA 1G3WA 4IVNA 3FMRA 4A2UA 3F8MA 3RYRA 1KGSA 2OU2A 3J7AO 5JI6A 3F8BA 3DFGA 2KJCA 2XHKA 1Q9SA 2P6TA 3I54A 2D45A 4UXNA 5AIPA 2HS5A 2PLYA 4HX7A 5DD8A 2COMA 3COAC 1IN6A 4PDKA 2M87A 3FM5A 1C0WA 5E18F 2QYOA 4UZFA 3K1NA 3KP2A 1N06A 2YR2A 3QOPA 3K2ZA 1OKRA 3DP7A 3KP3A 2R7DA 3M9AA 3F6OA 4ESJA 4BH9A 3C3WA 4Q48A 3WE2A 1OYYA 5CVIA 5DD4A 3FX3A 4ENJA 3SXYA 1IN4A 3B73A 3F8NA 4CXFA 1ZRFA 1OYIA 2F5CA 1S3JA 4AVPA 2DK5A 2K86A 3N4MA 3MZHA 4RB0A 4EJTA 1S8NA 1UCRA 4E70A 5DCMB 3TGNA 2HOEA 2HDCA 3LAJA 1T6SA 5ILUA 1UB9A 4I09A 4UV9A 3IHUA 5AONA 4G7OF 1SFXA 2DTRA 1Z91A 4UV8A 3P9CA 1XMKA 2XAJA 2V1DA 4L9VA 5BQTA 1T39A 2PJPA 4L9JA 3QP6A 1TLHB 3ROUA 3MWMA 2MA3A 2WTEA 2PFBA 1LEBA 3HIFA 1F5TA 4HQEA 4IHTA 2ETHA 3IWZA 2HQNA 4G6QA 4YFKF 2JRTA 4L9NA 3WTUC 3FHZA 3WTYC 4IPAA 2RDPA 5F64A 2CWEA 3GWZA 3M8FA 1ZHFA 3ZQ7A 1K78A 1XGOA 2O03A 4WXDA 2V9VA 1QBJA 2EWNA 4RGXA 4NQWA 5LEJA 4KA4A 1AWCA 4HBLA 2IPQX 2IJLA 3C1DA 4Z2YA 4LFUA 3BZ6A 3LQRA 3EUHA 2FBHA 3HRSA 4I98B 2DPDA 3T1BA 1T6YA 1DPUA 3TO7A 1V4RA 2PMUA 1T6ZA 2GA1A 2RKHA 3HSRA 4LG0A 3PQJA 3ULQB 1P4MA 2HWVA 2PMHA 3SQNA 1X3UA 3MAJA 3WTTC 4MTDA 1LEAA 3BOQA 2VBVA 5D8KB 2P4WA 3J80K 2P6SA 1SAXA 4PZJA 2O6GE 1FBUA 2NS0A 1TQIA 3BPVA 1QO0D 2MLGA 5KK1A 5FO0A 3R4KA 2OBPA 4Y17A 4EJVA 4LLGF 4OIOF 1HKTA 1U5TB 1L3LA 3ECOA 1ZN2A 4MTEA 2ZFWA 1XCVA 1IXCA 1HXDA 3GFIA 4XSXF 2F5FA 1FBQA 2IP2A 3O2PE 2DK8A 1PP8F 5ED4A 3ZMVA 4IXAA 4OMYA 2NAZA 4EJOA 3WE3A 1PP7U 3VODA 3D5LA 3I0TA 2K4JA 4OU0A