3CTAA

Crystal structure of riboflavin kinase from thermoplasma acidophilum
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
216
structure length
187
Chain Sequence
DQYYRAIKKIKEAAEASNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTVTKRGQILNITEKGLDVLYTEFADLSRILAIKNNVVITGTVTSQYIIQFQEKLGIIPYLNIKVDQASLPELRKIRGFRGIHIEGFKTRTFGSVKAFPAKIQNIPCFVIMPERTVYTDVIEIISDDRVSVEVYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of riboflavin kinase from Thermoplasma acidophilum.
rcsb
source organism Thermoplasma acidophilum dsm 1728
molecule tags Transferase
molecule keywords Riboflavin kinase
total genus 56
structure length 187
sequence length 216
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ctaA01
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 3ctaA02
2NRAC 1QBJA 3IRQA 4IRIA 1HKQA 2XGXA 4HLYA 3ML6A 2K4BA 2L4MA 4HDUA 4Q47A 3BOQA 4KFCA 1E17A 2ESHA 2PJPA 1YQAA 1HKTA 4I02A 2VODA 2IPQX 1BC8C 2A07F 3DV8A 4YFNF 1XGMA 2A3SA 3HOTA 4XBFA 4AWXB 2VONA 4M6YA 4U0WA 1RZ4A 2HYFA 2DTRA 2R3SA 4ZZDA 2BV6A 1FY7A 2K86A 2IT0A 4B8XA 4ETSA 3C18A 5ERIA 5LRRA 5H6QA 2M30A 2CFXA 2J5OA 4LLNA 1TW3A 1XD7A 3ZMSA 1SFEA 3HHGA 5HLIA 4UZEA 2VC0A 4DQ2A 4GXOA 2ZFWA 2VT3A 2X0KA 2HGCA 4IF4A 1T98A 2V1DA 2HKXA 1BIAA 4YIIA 1OPCA 4A6DA 2ADUA 5DDGA 4CXFA 5CVJA 3F6OA 5D5VB 3D0SA 5DUIA 2P5LC 3ZMUA 1K79A 1SAXA 2ISZA 4I01A 5A8AA 2PFBA 1EH6A 1IUYA 1OR7A 5E18F 4UUVA 1FBUA 1T39A 4EJWA 2FOKA 3FXUA 2B0LA 5FFXA 1TQPA 4P9FA 2RDPA 4CHUA 1FYKA 4BHBA 2VBVA 2IA0A 1WQ2A 3B02A 1LEBA 2MBFA 3I58A 1RUNA 2W25A 5D5XB 1RIOH 4EJVA 1IW7F 1R1TA 4EV0A 3W6JB 3CTAA 1AWCA 1MRZA 2D45A 2DU9A 3BJOA 2HDCA 2YU3A 3T0YA 3WU0A 3FMRA 1W5SA 4BNCA 3DPTA 1R7JA 1IN7A 3O3KA 4KYWA 4NB5A 4G6DA 4RGRA 4AIJA 4IPAA 2K7LA 2Q2EA 4O5VA 1P4MA 1ON2A 2BBYA 1LEAA 3J80Z 4QWQA 3U1DA 1F4KA 1N06A 2JPBA 4PCQA 1PUEE 1TQMA 3HRTA 1IAWA 2A5YB 5CLSA 4CDGA 2HEOA 1LDKB 4Q48A 2H94A 3ABUA 5K5RA 5D6EA 2PG4A 2EFQA 5IT9Z 1R23A 4OMYA 4ZYEA 3VODA 1O57A 4MQVA 1MJAA 4CICA 1R1VA 3MAJA 1Z1DA 4UVCA 3ZMVA 2PLYA 2CG4A 1BC7C 3H3UA 2RQPA 4IXAA 1SFXA 3F8NA 4IVNA 2DK8A 3WGIA 2FF4A 5L3FA 4Q4ZF 2V1XA 1U5TC 4HOBA 1U6GA 2W24A 3P9KA 4M9SA 3RPQA 1VTNC 4Q5SF 1MD0A 2I1LA 5LHIA 5AONA 1FBQA 3KEQA 1J75A 4WXCA 5LHGA 1FSEA 3BWGA 1C0WA 2O0YA 3CLOA 2EJRA 1U8RA 4A2UA 1H9GA 3KCCA 3MFKA 2V1UA 3CUOA 2IVMA 2QENA 4OMZA 4BHCA 4DNCA 1G3TA 5FB2A 4RS8A 3O2PE 4O6JA 1BM9A 3DFGA 3V4GA 3QRFF 1B9MA 5J8CA 3EYYA 5H6RA 2PMHA 1MDMA 4OOIA 2F5FA 5KVRA 2IW5A 3WTYC 1XB4A 2OAZA 3IWFA 3ERED 4S04A 3I59A 3D5LA 3TOAA 1XSVA 1KQ9A 3GO5A 5L3GA 2KKOA 3NQOA 3RTRA 1DPRA 3M8EA 5LRSA 1JHFA 5FLXZ 1TW2A 2DW4A 2HQRA 2XROA 3WGGA 3BP8A 4ZYDA 5ILSA 3TDZC 4XRFA 1V3FA 5K5QA 1ZGAA 3V8LA 4Z2YA 1N05A 1XGOA 1YW8A 3FXQA 3BY6A 5TRDA 5BS6A 2WWYA 1FP1D 3KP6A 2QVOA 5DYMA 3WG9A 1XMKA 4CZZA 4PGHA 3GX4X 1TNTA 3C1DA 4U7DA 4A0ZA 5L3CA 2FSWA 3BJ6A 2VT2A 4HV6A 3GZ5A 2GAUA 3U2RA 4HLXA 4HZFA 1IZ1A 2ZMEA 3G73A 4LJZF 1FWZA 1RI7A 4JBAA 2H27A 5ICCA 3E3VA 3LWFA 2VXZA 3KZZA 5E1ZB 2F5DA 5FGMA 4KIBA 3RIRA 3FHZA 1OYYA 3COAC 1AOYA 1S6LA 3C7JA 5HLHA 3OOPA 4M9ZA 2MLKA 2C6YA 2X4HA 2JTVA 1G4DA 1KGSA 1MGTA 4HBLA 3HUGA 2EFWA 2O6GE 4MNUA 2LKPA 2QBYB 2ZJ2A 2NNNA 3LAJA 3P9CA 1LDJA 5DEQA 1PP7U 4UVBA 5JHUA 3K0LA 1HW5A 4G8XA 5HS9A 4GCVA 3EUHA 3FF5A 5A2QK 1B59A 1O3RA 3F8CA 2CWEA 4OIPF 3L7WA 4OIQF 3K9TA 3K69A 1QO0D 3WTZA 1U5TA 3BJAA 3KEOA 4ENMA 3I54A 1NHAA 1FX7A 3F21A 4WF2A 2NNYA 4OINF 3SHFA 4A0XA 5BOXA 4EGZA 1G3YA 3IHUA 3N97A 3F72A 4WCGA 2XAGA 1YW7A 4EM0B 3F8FA 2ZNZA 2EFOA 1T2KA 1ZGJA 3IKVA 3ZMTA 1BIBA 3HIFA 1YIOA 5ICGA 1T6ZA 2GQQA 1WSUA 3VFZA 3HTSB 2LDUA 1BN5A 5HDKA 1O3QA 5CVVA 2BE5F 3BDDA 2QQAA 4LLGF 1D3YA 2AS5F 4KA4A 2IRFG 4HV5A 2ZBKA 3L9FA 2PMUA 5AIQA 2E1CA 1Q9SA 4L0YB 2FNPA 1J59A 3MQ0A 1S4MA 1QQIA 5FNZA 3KP7A 1FP2A 5IT9K 1YG2A 2STWA 3WGHA 1H0MA 2PQ8A 4MTDA 1Z05A 2PEXA 1IXCA 3FX3A 4WXHA 3KE2A 1SMYF 3ELKA 3QU6A 3VOEA 3QPTA 2LF8A 3KP4A 4EJOA 3RKXA 2JT1A 4UVAA 4UV9A 1YTYA 1R58A 3IRRA 1I5ZA 4XSZF 4S05A 3EDPA 4FT8A 3SXYA 3E6DA 3R0JA 3E97A 5A2QZ 4WX9A 3JW4A 1BBYA 4XLPF 3E6BA 2RN7A 4CO8A 1R5GA 3W6KB 2FA5A 2CW0F 1ODDA 4HF1A 2V6CA 3HHHA 2ZMEB 1P4XA 4I98B 2CO5A 2G7UA 5FFZA 4MQ9F 4M72A 5JR3A 2P7CB 2VOOA 2H6CA 1DPUA 5E1WA 2O3FA 1GXPA 2NYXA 1DP7P 2RC4A 5FO0A 2QZ8A 1GXQA 4RB0A 2A68F 4AIKA 3KP3A 3JTGA 4LLLA 3P7NA 3FMSA 3GVAA 2UZKA 4ESBA 2DPDA 4EMSA 5FLXK 5D8KB 5E8GA 1KU7A 3F8BA 2QLZA 2G9WA 3S2WA 3TKYA 1ZYRF 4L9JA 3P9IA 2RKHA 1SD7A 4P9UA 5ILUA 2O03A 1R00A 3M7GA 1HW2A 2JSCA 2Z5UA 2YX7A 2E1NA 4LK1F 3IKTA 1KYWA 5AIPA 3KP5A 4LB6B 2KRFA 3I71A 3IC7A 4I09A 2GWRA 3I64A 1XCBA 1IN6A 2RGVA 1MDMB 1ZG3A 1MJ9A 5LEKA 1P92A 3TGNA 3HYIA 3HSEA 2HTSA 2VBYA 3B73A 5J6XA 2VBWA 1STZA 4JK1X 2OQRA 4H0EA 2FQ3A 4HX8A 1Z7UA 4ENKA 2HQNA 4CYDA 2OQGA 2YPRA 4R8HA 5FO1A 1S8NA 2GXBA 4N9IA 4EQQA 4TV7A 4HX4A 3K1NA 1I1GA 2QBYA 1OKRA 3BPXA 1J5YA 1OYWA 1TLHB 3DF8A 1N08A 5LGUA 3F6VA 4HF2A 2DPUA 2E7WA 3GUDA 1S7OA 1S3JA 2H09A 1YYVA 2CYYA 3GXOA 3E6CC 5EEGA 1KQ0A 1S7AA 1HKSA 3RKYA 4G7ZF 1BOAA 4G9YA 4B09A 4RGXA 3I0TA 4A5MA 2EB7A 5E1XA 4KIGA 3T5XA 5A89A 1FC3A 4KN4X 1W7PB 2EK5A 2HS5A 1HSJA 2PN6A 4L5JA 2HWVA 3WODF 3SQNA 3OP1A 2F5CA 1Z6RA 4R1HA 2FMYA 2MH2A 1YW9A 3ECOA 1W4MA 2A69F 3ZMDA 5HOOA 2CGPA 1W5TA 5FO5A 5JVTA 1E2XA 4G7OF 2MLGA 1D8KA 2PI0A 4U7BA 3BROA 1ZH5A 1JE8A 4KT5C 3DPLC 5J8FA 3J81Z 2UXNA 2P8TA 3T8RA 3REOA 1IN4A 2E7XA 4LMYA 5L3BA 4NQWA 2HR3A 4N0BA 1ZN2A 4KDPA 1G3SA 2XAQA 1GVJA 3K1PA 5CVIA 2ZXJA 1H9TA 3TO6A 2KIUA 1LQ1A 3I59B 3TOBA 3RYRA 2DFIA 2VE9A 2D1HA 3SZPA 4O3MA 3PQKA 4HQMA 5DD4A 2GA2A 3I4PA 1FZPB 4ESJA 1Y0UA 4YFKF 3CUQC 2CSOA 4UHTA 3LSTA 2WV0A 3GFIA 2EV0A 2EV6A 5ICFA 2DK5A 3RPUA 5BPDA 5TJJA 5LGNA 3TO7A 4AVPA 3KP2A 4LD5A 4JQFA 3MWMA 4BAYA 1HXDA 3KLOA 2OZUA 4OIRF 2A6EF 1ZRCA 1K78B 3GZ6A 3U9GA 1EH8A 3CUQA 1SFUA 5E17F 3V7RA 2A61A 3GFMA 2STTA 1LB2A 2BEOA 1XN7A 1T0FA 3EQLF 4P96A 4EM1A 1T6SA 4IRGA 2XASA 2EWNA 2MH9A 1MKMA 5LHHA 1G3WA 3TQNA 4EVIA 1ZHFA 5FD6A 3RI4A 1P6RA 2QYOA 3BPVA 1U78A 4MGRA 5ICEA 2NS0A 3CUQB 3L00A 1L3LA 1XGNA 2COMA 1J2XA 1K78A 2RVCA 3I5UA 2VOPA 3BZ6A 2DQRA 4PZJA 1QZYA 2MD5A 5BPIA 2PBIA 5H20A 1FPQA 3WTUC 1HBXG 1BJAA 4MHGA 3VEPA 4Y13A 1KU2A 2XUBA 3WU1B 1QGPA 4GYGA 1Z91A 3CDHA 2OYNA 2RNJA 3G3ZA 1B9NA 5E20A 4EGYA 2FRHA 1UCRA 4M74A 2P4WA 4KNYA 4RGUA 4OIOF 1Z9CA 3FXRA 2ACJA 3ZQ7A 2BGCA 4IJAA 2HTJA 1Q1HA 1R36A 3ULQB 3CO6C 4UZFA 2R7FA 3KZYA 4HQEA 1FLIA 4PGGA 2IA2A 4I0AA 3CO7C 2OU2A 4G94A 4HDVA 1IRGA 2HZTA 4LB5A 2VE8A 3C3WA 5BQTA 4L18B 4LG0A 1ZG1A 3T8TA 5CVUA 1X3UA 2CQKA 1LNWA 1CGPA 4M71A 1QPMA 4RAYA 1DUXC 4EM2A 3DP7A 5ILVA 5DUKA 1ONVA 5HS7A 1D8JA 3HSFA 4RB3C 2DLLA 2O61A 2V9VA 1W7PA 3LQQA 1FYLA 4NHJA 6PAXA 2L4AA 3R6SA 1YS6A 2Z9OA 3RDIA 1ON1A 3SFZA 1YFHA 2AXLA 5JFRA 2DT5A 4YFXF 2M87A 1XSXA 3EETA 2F5EA 2Q8KA 1K6OA 2XAHA 4UXNA 3O6BB 1P2FA 1RNLA 2YX4A 2P6TA 5D4RA 2OBPA 3MCZA 3HRUA 2DI3A 2M5WA 4U0YA 2DO7A 2LF7A 4ENNA 4KICA 4RB2C 1FOKA 2M45A 1WKMA 4U0VA 1BI0A 4ZYGA 2L01A 3PFIA 4P5OA 4RGSA 1IF1A 4L9TA 3V8KA 4BQAA 4KIFA 1USTA 3GF2A 1ZRFA 1ZREA 3WTSC 3GFLA 4OU0A 4CGZA 2IJLA 1F1ZA 1SD4A 5CYVA 1ZLKA 4HAMA 3T1BA 3ZN1A 4IRHA 3Q9SA 3ZPLA 4ZYHA 4ZZLA 5D4SA 1V4RA 2XKOA 3JAMZ 1JXSA 3R4KA 4YG2F 1GHCA 1F5TA 3MEXA 2P3MA 1K7AA 3LQRA 2OA4A 1OMIA 3JSPA 2Z3YA 3J81K 5K1YA 4MEXF 3HOSA 3ZP5A 2FU4A 1I27A 3N4MA 3GW2A 4EJTA 5F6FA 1Z6TA 2RV8A 4M6XA 1XGSA 4A12A 3LFKA 3GLXA 4RAZA 2OD5A 3GWZA 1PDNC 1BI3A 2FXAA 1HQCA 1MZBA 3WTXC 4HYEA 2EA4A 2DAOA 3QU3A 3Q5FA 1R1UA 1SD6A 2GZWA 1SMTA 3ABTA 3QP6A 2LNBA 2VBTA 2KJCA 1J0RA 2XKPA 2BYVE 4HF0A 2Z99A 5DCMA 4PDKA 5D5UB 5LLQA 1QZZA 3M8FA 2UWMA 1O3SA 5DCMB 4I2OA 2XIGA 2ETHA 4ZH4F 5CVRA 3K1MA 3V7SA 4GYIA 2D2WA 5DCFA 1RUOA 2VBZA 2WC2A 2DBBA 2XAJA 4ASNA 1MJBA 4BH9A 3TO9A 3LA7A 3QOPA 3QP5A 2YSRA 2W85A 4M73A 2K27A 1ZAOA 1IN8A 2LSOA 1I6XA 1TQIA 1DDNA 3E5UA 2GIVA 3FM3A 3OV8A 2DQLA 2L54A 3DXJF 2XAFA 3CJNA 3FWEA 2ISYA 1W7PD 4BHPA 2Z33A 1KA8A 3DEUA 4EJUA 1YS7A 3R0AA 4HX7A 3EYIA 1ZRDA 2ZNYA 4D0PA 2WTEA 2QQ9A 1WWXA 1TNSA 4WK8F 4GO1A 5LBQA 3M9AA 2KJBA 2UXXA 3ZMZA 4A0YA 1T6YA 5DV5A 2EFNA 1OYIA 3F3XA 3DKWA 4MTEA 4Y15A 4E70A 3L09A 1L0OC 2QM3A 4LK0F 1J7KA 2Q0OA 1FT9A 4LGWA 3GFJA 4L9VA 3E6MA 3J80K 1BI2A 2OZ6A 1FYMA 4QLCU 1NB9A 3ECHA 2H6BA 3ZN0A 2HFHA 2L3DA 2P5VA 3MZYA 5HLGA 1NB0A 1WI9A 2XV4S 5HVQC 2K02A 1YLFA 2VBXA 2YR2A 2EV5A 3FMQA 2P6SA 2VC1A 3MZHA 5CJ9A 2ZKZA 4G7HF 3K2ZA 4KUMA 4WXDA 1R22A 3V8JA 1XMAA 4F7ZA 3IL2A 1CF7A 5D8LB 3I53A 4A5NA 1ZARA 1XDUA 3H92A 2JZYA 1UB9A 2P7VB 4HA8A 4MEYF 2HKOA 4P55A 4ON0A 1BI1A 2GA1A 4L0ZB 3WE3A 4I0BA 5KK1A 2IA1A 4U88A 1XCVA 2G7HA 5EEHA 2X0LA 5DD8A 3R61A 2FMLA 2VBUA 1HSTA 2FNAA 1N07A 1U3EM 3WE2A 3KFWX 2P5KA 2Y48A 3JSOA 4YIFA 4LFUA 4KMFA 1UHMA 2ELHA 2F2EA 1B4AA 1XDSA 4M9XA 2EFPA 1HW1A 1YO5C 1FSHA 3KETA 1B1BA 1D5VA 2K4JA 2R7DA 5ED4A 1QNTA 1A04A 4ESFA 3J7AO 2XVCA 1CF7B 3E5XA 4L5IA 3NEUA 3L2CA 4IHTA 1R5HA 2HOEA 3NRVA 1PP8F 1P4AA 5IT3A 5F64A 3IWZA 2QUFA 5D5WB 1KU9A 5D6FA 1IRFA 2ZCWA 1IXRC 3V7CA 1KU3A 2J5PA 2MA3A 5BMZA 3R60A 1ULYA 5FD5A 2Y75A 4K2EA 1TBXA 3RKWA 2W57A 4AD9A 2VN2A 4FX0A 3WTWC 2Y0MA 3QAHA 3QPHA 3F22A 3GEZA 5HS8A 3LA2A 4A6EA 3GYHX 2A6HF 1IXSB 2NAZA 1JHHA 3F8MA 2M1BA 3HSRA 4IHSA 2QQBA 1B6AA 1U5TB 4RB1A 3BNWA 1UHWA 3HRMA 5JI6A 5LEJA 1LDDA 2JRTA 1FBSA 4KN7X 3LA3A 3SZTA 1O7LA 1SD5A 1UFMA 5A88A 2ZO4A 5HDGA 3ZUGA 3FZVA 1J9IA 3LAPA 2M8EA 1KYZA 4BXUA 4XLNF 3TDUC 1WRJA 2HYGD 3RYPA 2EA2A 1LJ9A 3AAFA 1F9NA 2FE3A 1EV7A 2L02A 1ZG5A 2GXGA 2V79A 4KMUX 4Y17A 5LGTA 4ENJA 1T6XA 3FM5A 2KIFA 4XSXF 1TTYA 1IN5A 1P4WA 3PQJA 2XHKA 4WWCA 5K5OA 2FBKA 4I7HA 3WTTC 1FNNA 4FX4A 4GGGA 2JPCA 5L3DA 2ESNA 1O3TA 2VBSA 3JAMK 1LVAA 1REPC 3M1EA 1EH7A 2W84A 2FBIA 3WTVC 1U2WA 3KLNA 1S29A 2QWWA 5HDNA 3F23A 4G6QA 3H3ZA 1KQ8A 2FBHA 2KIMA 1USSA 2D1VA 5E8IA 1G6NA 4L9NA 3E5QA 2IP2A 4UNOA 1T38A 2TDXA 5L3EA 1I1SA 2MC3A 1ZLJA 3HRSA 1JGSA 5F1RA 3JTHA 4N9HA 4LG0B 4UV8A 1XSDA 4AIHA 3VB2A 2O8XA 4FHTA 3HTUA 3Q9VA 2XRNA 4BYYA 3DQVC 3ISPA 4R79A 4HW0A 1O7FA 2FEZA 3ROUA 3RJPA
chains in the Genus database with same CATH superfamily
2NRAC 4CA0A 1QBJA 3IRQA 5B6IA 4IRIA 3S2DJ 2ZL7A 1HKQA 2XGXA 4HLYA 3ML6A 2LK2A 3CCJI 3QODA 1KJZA 2K4BA 3BTCA 2E1MC 5IOZA 5M3MJ 2L4MA 2YU9J 4HDUA 1E0EA 3CC2B 4Q47A 3BOQA 3K70D 3WNDA 3IH2A 4KFCA 5EDNA 1E17A 2ESHA 2PJPA 1Y6IA 3H35A 1YQAA 1HKTA 4I02A 2VODA 2IPQX 1BC8C 2A07F 3DV8A 1QVFB 4YFNF 2E2JJ 1XGMA 1W36D 2A3SA 2R7WA 3SJMA 3HOTA 2H1KA 3S14J 4XBFA 3FKSA 4AWXB 5B1BH 4E7ZA 5BNGA 1SVMA 5J4YA 1YE9A 2VONA 5CDFA 1QX4A 4M6YA 4U0WA 4ZDLA 1RZ4A 2HYFA 2DTRA 2R3SA 4J0QA 2IBDA 1LE8A 1YX3A 4ZZDA 2ZTNA 2BV6A 4X7EA 1FY7A 2VASA 5FKMA 1IV6A 2D9RA 2K86A 2QTZA 1KRHA 2M4KA 1OCCH 2JJ1A 2IT0A 3IAM2 3E7LA 3K7AJ 2ZXHA 4B8XA 3OEHA 4ETSA 5DM6F 4Z4YA 1GT0C 1GUUA 3J7AY 3C18A 1IG7A 5ERIA 5LRRA 5H6QA 2V7VA 2M30A 2CFXA 1OGIA 4P3YA 2Z1DA 2J5OA 1YJNB 1IUFA 2R93J 4LLNA 1TW3A 3CD6B 1XD7A 4RLZA 2QGUA 3AG1H 3FXKA 2WA0A 3BTLA 3PUFA 3ZMSA 1SFEA 3HHGA 3L2WA 5HLIA 5EEAA 2W6IA 2BF4A 1ETVA 1H89C 2A05A 2CQNA 4UZEA 2VC0A 1AKHB 4WZTA 4CQJA 4IW3B 4DQ2A 5E6TA 1FIPA 4GXOA 2ZFWA 2M2EA 1KTVA 2VT3A 4PK4A 4HSRA 2BY3A 2X0KA 2HGCA 4IF4A 2V7WA 1WOPA 3CPWB 1T98A 1R5ID 2V1DA 4XLHA 3LNQA 3BG7A 5JVGF 5GV7A 2F4OB 2HKXA 2MFZA 4E0FA 1BIAA 2Y69H 1OPCA 4YIIA 4AIDA 2L9RA 1TWHJ 4HG2A 3LSPA 1ZR2A 2CV0A 4A6DA 4Z4RA 2ADUA 4PJJA 2VQCA 1YHQI 2LMDA 1MMNA 5DDGA 4CXFA 4BQQA 5CVJA 3F6OA 5D5VB 4ZTFA 3D0SA 5DUIA 2P5LC 3ZMUA 1Z67A 2DYSH 3OW7A 1TLLA 1K79A 1SAXA 5IYCJ 1I50J 4B3GA 1G7CA 4QVJA 2A6TA 2ISZA 2XDVA 4YAUA 3P26A 4WWVA 1WDTA 3MKZA 4I01A 5A8AA 2PFBA 1VQ8B 4G6TB 1EH6A 2WBMA 3LOCA 4XN3A 4IHYA 1OR7A 3OOUA 1IUYA 1HOMA 1WPCA 2GK7A 1OFCX 1QGZA 5E18F 3CCRI 2EZLA 5EYRA 2JA7J 1MBEA 1U2RA 5CQGA 1VNDA 5F1JA 3TEDA 4UUVA 1J9ZA 2B7EA 4PJLA 1FBUA 1WI3A 1T39A 1FNMA 4EJWA 3ABKH 2FOKA 2OV7A 5FKLA 3FXUA 2QTLA 2B0LA 2VI6A 5FFXA 1ZKGA 1MMSA 1TQPA 4P9FA 1APLC 2TCTA 3W5HA 2RDPA 3V7AA 3BR6A 5KW9A 1DGWY 1I8DA 1UAAA 5IYQA 4CHUA 1QZEA 1FYKA 3A3GA 2CUEA 3VNVA 4BHBA 4B4CA 3HOYJ 1BPLA 1OCPA 2VBVA 2IA0A 1WQ2A 3B02A 1LEBA 4DGWB 1VF7A 2MBFA 2HPMA 4XNFA 2CS3A 3I58A 1RUNA 1YJWB 2W25A 5D5XB 4IQ4A 4Y3OA 5J1RA 1RIOH 3FXLA 4EJVA 1IW7F 1ITYA 3BTIA 1RESA 3CCUB 4OPSA 2DCUA 1OHHA 1TP4A 1WJEA 2XEXA 1R1TA 4EV0A 3W6JB 3QFRA 2F1LA 3P27A 3CTAA 1FMVA 5J47A 1V5VA 2CRVA 1GVDA 3DTKA 1WJ5A 1AWCA 3S1QJ 1MRZA 4OOXA 1R4NB 2D45A 2DU9A 2F48A 3BJOA 4J19A 2HDCA 1D8TA 2XOKA 3D26A 1E3OC 2EILH 1E1RA 2YU3A 3T0YA 3WU0A 2IS1A 2XGDA 2VYQA 1VQPI 1N25A 4X05A 4Z4TA 3FMRA 5FA6A 1MMDA 4GDFA 2DDAA 2IGOA 2K5CA 1W5SA 4BNCA 4FK8A 3DPTA 4P22A 1JJ8C 4GRIA 1R7JA 2K85A 5GADJ 1IN7A 3O3KA 4KYWA 3OY9A 3CMYA 2QMUA 5CPRB 2LBFB 1ZQ3P 4NB5A 2HMAA 4BEHB 3WBKA 5M5WJ 2C5HA 4G6DA 3I56I 4RGRA 4A3IJ 1ZGWA 1UD5A 2QE7A 2NXNB 4AIJA 4IPAA 4NQWB 2K7LA 2Q2EA 2X48A 4A3DJ 1TZLA 4O5VA 1P4MA 1ON2A 2LP0A 2BBYA 4QTRA 3D1NI 1D1CA 1LEAA 2DTZA 4AYBN 3J80Z 1BQEA 2D3LA 2XNJA 1KK1A 4QWQA 4L5EA 1U9OA 4M6VA 3U1DA 3SLDA 4NNJA 5IY5H 3SJPA 1F4KA 1N06A 2JPBA 3BG6A 4MO7A 4PCQA 1PUEE 1TQMA 2M7AA 3HRTA 2JN9A 3GBGA 3P5JA 2OK8A 3A1PA 2HLDA 1BR4A 2QSFX 2R92J 3CCVB 1MBJA 5F0CA 3DTIA 1MIJA 4K1XA 3PJRA 4XMYA 3BG5A 4Y33A 2W82A 1IAWA 2CRGA 3W2VA 2ZBVA 2A5YB 1T95A 5CLSA 4PSXA 1BL0A 1WSVA 4CDGA 2KQRA 2X8KA 2HEOA 1LDKB 4Q48A 3ZQQA 2H94A 3ABUA 5K5RA 5D6EA 1OCRH 2PG4A 5FL7A 2EFQA 5IT9Z 1K28D 2WAQA 1EFRA 4WZLA 1R23A 4OMYA 4ZYEA 2XZOA 3VODA 1O57A 4MQVA 1MJAA 2XSJC 4CICA 3JQRA 1R1VA 3MAJA 4BDYA 4RDLA 4W1UA 1Z1DA 4UVCA 3ZMVA 2PLYA 4KKTA 1Y0YA 3LSGA 4F91B 2CG4A 1ZTRA 2RC6A 4YHBA 1AHDP 4KISA 1BC7C 4OPOA 3H3UA 4FE7A 2CFOA 4TMVA 2RQPA 4IXAA 2X85A 4PC2A 3I55B 2OJED 1SFXA 2RC5A 3SFIA 3JR9A 1I6HJ 4P26A 3W2WA 4JX5A 3AG2H 3F8NA 4DNRB 2DA1A 2ECBA 4IVNA 1IB0A 1NRKA 1D0ZA 4YRVA 4PJ0C 2DK8A 4W97A 3WGIA 2FF4A 2HDWA 5L3FA 2P81A 4Q4ZF 3HOVJ 2V1XA 1NJID 1U5TC 2ZJQF 4QPOA 2X6XA 4HOBA 1WOOA 3PO2J 1PUFA 3CCVI 1U6GA 1V55H 4NUBA 2NPFA 2W24A 5M3FJ 3IAS2 5J4VA 2K9QA 3P9KA 4M9SA 2ZTGA 3ZQCA 1S72I 3A1YA 3WNBA 4E6KG 2I8DA 4HRIA 2JQ7A 3RPQA 4DYQA 1VTNC 1ZK8A 3CCQI 1G59A 1TT5B 4Q5SF 1MD0A 1KK2A 3OYDA 4C3IJ 2I1LA 2Y2ZA 3ZQLA 3SDGA 3UNGC 5M5YJ 5IYPA 5LHIA 4E7KA 5AONA 5HKKA 1FBQA 2DFFA 2L9SA 3KEQA 1J75A 4WXCA 5LHGA 1FSEA 3BWGA 1C0WA 3VO1A 2O0YA 2BXZA 2TRTA 1R71A 3CLOA 3KEWA 1BW5A 3ZGKA 2EJRA 3RQ4A 4B47A 4WQMA 2M3AA 4DZJA 4IHXA 1U8RA 1QFYA 2C5BA 2E1BA 2X6WA 1HC8A 2DA2A 1K61A 3PIPF 4A2UA 1UD2A 1XE1A 1H9GA 3KCCA 2W48A 3MFKA 2X1DA 2V1UA 3CUOA 2IVMA 2QENA 1I3AA 4OMZA 4BHCA 4CCNA 4DNCA 1RQPA 3JU4A 1G3TA 4WZEA 4TMTA 5FB2A 3OYBA 4RS8A 3O2PE 4O6JA 3RZDJ 1BM9A 1Z7LA 2ZC2A 3DFGA 1PJ7A 1UELB 3V4GA 2X51A 3QRFF 2ZXIA 1TVCA 2M8GX 1B9MA 2LH9A 2X6YA 1FNBA 5J8CA 3S3OA 3HGGA 3RQIA 5GTHC 3HOZJ 1FNDA 2XPWA 3EYYA 5H6RA 4DJAA 2PMHA 5C3EJ 4B3FX 1W0UA 2KZVA 1M1EB 1MDMA 3MHPA 4OOIA 2F5FA 3VDXA 3AVYA 1WORA 5KVRA 2IW5A 3VSKA 4BJ6C 4BGDA 3WTYC 2ZITA 3H36A 1XB4A 2BOLA 1FDRA 4RDKA 2OAZA 2F4NA 3IWFA 4BE0A 3BQJA 2QA4B 3ERED 2FJ1A 1NK3P 4S04A 4HEA2 1MW7A 3HZJA 3D5LA 3I59A 3TOAA 2R5ZB 3CMEB 1XSVA 1KQ9A 2Q6LA 3HJEA 1PJ5A 4M1KA 3OSFA 2PJRA 5B66C 3FJOA 2XSDC 3GO5A 5L3GA 2KKOA 2VPRA 2WAEA 4D5FA 4UUSA 2C77A 3NQOA 3RTRA 1DPRA 3M8EA 1B8IB 5LRSA 1DDGA 1VF9A 1JHFA 5F27A 5C4JJ 5FLXZ 1BJZA 1TW2A 2DW4A 2HQRA 2XROA 2HZDA 3WGGA 1WJCA 3DKYA 3FIWA 3H0GJ 1MBFA 3BP8A 3OJXA 2DFEA 4ZYDA 3BCBA 2Z2SB 3H3VK 2DA6A 3TW6A 4P6VF 5ILSA 1P7JA 4HSTA 4RD3A 2WADA 1Q82D 3TDZC 4XRFA 1V3FA 2ZZGA 3KX2A 1WVRA 5K5QA 2W6JA 3ESWB 5C44J 3G4SI 2BVNA 3CCMB 1ZGAA 3V8LA 4Z2YA 1N05A 1XGOA 1JTYA 3NARA 1YW8A 1ZELA 3FXQA 3BY6A 2KMUA 5TRDA 5BS6A 2WWYA 3MMYB 1FP1D 1JGGA 1QVTA 3KP6A 2QVOA 4C30A 5DYMA 3ZQFA 3WG9A 1XMKA 1ZM9A 4CZZA 4PGHA 1VQ7B 4B43A 3HPGA 2VKEA 3FKJA 5EGOB 3GX4X 1TNTA 1B23P 3M4OJ 3K4LA 3C1DA 2LBFA 4U7DA 2JA6J 2E2HJ 2M0MA 4A0ZA 5L3CA 2FSWA 2QA4I 3G6EB 3BJ6A 3JCUC 2VT2A 4HV6A 2WB1A 4XIDA 1HF0A 3GZ5A 2GAUA 3U2RA 2Y9YA 4HLXA 4HZFA 3ONUA 1IZ1A 2ZMEA 3HC7A 3G73A 2DN0A 4LJZF 1FWZA 1X1CA 1CQTA 1RI7A 1OCOH 2V4DA 4JBAA 4GQNA 2H27A 1E62A 4N3GA 4BY1J 4NDLA 3OYHA 2BW3A 3BCFA 3QFCA 5ICCA 1K4SA 3E3VA 2KP6A 3QYFA 1T56A 3LWFA 2VXZA 3KZZA 4RD1A 1KZHA 3H0DA 5E1ZB 1A35A 2F5DA 3AKZA 2ZFUA 1K4TA 1JUSA 1IJEA 3GTPJ 3HOWJ 3A8JA 5FGMA 1WHUA 1X1DA 3CB4A 4RPDA 1U9NA 2KIQA 3OYMA 1O4XA 1VQ4I 4KIBA 3RIRA 3FHZA 1OYYA 3COAC 4M4SA 3MKLA 4DNTB 4YELA 1AOYA 4B1RA 3WYAA 3FBIB 3EUAA 1S6LA 2MSYA 2WAFA 3C7JA 5HLHA 3OOPA 5HXBA 4M9ZA 4ZCIA 2EZHA 2MLKA 2W4SA 2C6YA 3WXMA 2X4HA 3TW7A 2JTVA 4XL9A 1G4DA 3K4NA 1KGSA 4FASD 2OK7A 4GFBA 2XZPA 1MGTA 4HBLA 3TP0A 3HUGA 2EFWA 5L46A 2O6GE 1GLNA 4RA2A 4MNUA 4F52A 2LKPA 3IV5A 2ZJ2A 2E5ZA 1OISA 2NNNA 3DBRB 3LAJA 2QBYB 3P9CA 2NV4A 1P7IA 4BJ5C 2E1MB 1LDJA 2JVHA 5DEQA 4RBOA 1PP7U 2KVOA 1QRYA 3ISXA 2WAQN 4NCNA 1Y56A 1VQOB 4UVBA 4XORA 3K0LA 5JHUA 1HW5A 3FXJA 4G8XA 1JT0A 2BM1A 2C4TA 3L2QA 5HS9A 4RD6A 4GCVA 3GTOJ 2D3NA 5DS9A 4G7XA 1OGJA 3EUHA 3FF5A 2WJVA 3BR5A 1CNFA 1RKTA 5A2QK 1B59A 1O3RA 2R5YB 5F4JA 3F8CA 5J1YA 2CWEA 4B3XA 1A6IA 2HXIA 3CD6I 4OIPF 1R6RA 1UMQA 3L7WA 4KKUA 4OIQF 3K9TA 3K69A 5IK2A 2H8WA 1ENHA 4XKBA 2V1NA 1QO0D 3RCOA 5FKOA 3WTZA 1ETOA 1U5TA 2KRHA 3BJAA 3CCEI 3CCYA 3KEOA 4F55A 4ENMA 1SVLA 3I54A 1GJRA 1EFUA 2L2OA 1NHAA 3C2HA 2Y9ZA 2RAEA 1VQLI 1FX7A 3SLNA 3S93A 3CMEI 1XPXA 3F21A 1WZ2A 5GV8A 2MG4A 1Y8QB 1VHEA 1SKQA 4PFPA 4WF2A 2NNYA 3AG4H 2XGCA 3W2FA 4OINF 4G5GA 2VNHA 2RNGA 3CJRB 3SHFA 2ZZQA 4A0XA 3BC8A 1UG2A 2LYCA 4EGZA 1G3YA 3IHUA 3N97A 5BOXA 4PJMA 3T51B 3F72A 2BY0A 1BJKA 1YJWI 2FX0A 3CC7B 4WCGA 2GXAA 2XAGA 2R7SA 4N3NA 1N8RD 1YW7A 2V26A 2JWTA 4EM0B 3F8FA 4AC0A 5H2FC 2ZNZA 2EFOA 1H42A 1T2KA 1QFZA 1ZGJA 1VJSA 3IKVA 4QHYA 1A8PA 4DQLA 4P3IA 3ZMTA 1BIBA 3HIFA 1YIOA 5ICGA 3I9V2 2X1EA 4ITVA 4Z1MA 3GTLJ 3W2IA 1LE8B 2YWGA 1FOXA 1T6ZA 2GQQA 1WSUA 3VFZA 4X8IA 3H9QA 3HTSB 2LDUA 4IHVA 1HVXA 4Z4WA 1V0FA 4QFMA 2CJJA 3JQPA 1BN5A 3HG9A 5HDKA 1O3QA 2E36A 5CVVA 4X07A 1GO2A 2BE5F 4ASUA 2ZSIB 2JVGA 3D5SC 1OQYA 4Z4VA 4FCYA 3BDDA 5F0FA 2QQAA 4LLGF 2V31A 4E7SA 1D3YA 2AS5F 2ME6A 4KA4A 3H94A 2IRFG 4HV5A 1PUFB 2V6EA 2ZBKA 3L9FA 5FLMJ 2BSAA 2PMUA 3LQEA 5AIQA 1RC9A 2E1CA 1Q9SA 4ROXA 4L0YB 2MGQA 2FNPA 3L2UA 2LC2A 2LY1A 1J59A 3Q0VA 3MQ0A 1S4MA 3S3NA 4F7DA 1QQIA 2F5VA 3Q3SA 3KP7A 1FP2A 5FNZA 2OTJB 3WNCA 2VJ4A 4YIRX 2BZTA 2XF7A 4KKSA 5IT9K 1YG2A 2STWA 3WGHA 1H0MA 1IO2A 2PQ8A 4MTDA 3KL9A 5B5EC 4BY7J 1Z05A 2PEXA 1IXCA 3W2GA 3FX3A 2DODA 4WXHA 2DA5A 1EA3A 3KE2A 1SMYF 1ETXA 2LOOA 3ELKA 3QU6A 3VOEA 3B6AA 3QPTA 2LF8A 3KP4A 3RKXA 4EJOA 2JT1A 4UVAA 4UV9A 4D9JA 3OYAA 1YTYA 1X19A 1R58A 1YRNA 4IX7A 3GTKJ 2OBRA 3IRRA 1TWFJ 3DDYA 1I5ZA 4XSZF 3TP3A 1MSEC 4S05A 3EDPA 4FT8A 3KEYA 2ELJA 3SXYA 1GAQA 3E6DA 3ASRA 4Z4SA 4F3QA 3R0JA 1QGAA 2K9LA 3M07A 4UB6C 3E97A 1KK0A 5A2QZ 4WX9A 4Y52J 4AVZA 3JW4A 1BBYA 2FD5A 4XLPF 3G1LA 3E6BA 2RN7A 4CO8A 1WJDA 1R5GA 3W6KB 3HOXJ 2B9SA 1SEUA 2FA5A 2CW0F 1CQXA 1QH0A 1ODDA 5IP9J 5EJCA 3LO8A 3OPOA 3BH4A 3DBHB 3F9KA 4HF1A 1WJBA 2V6CA 4Y9RA 2WZPP 5H59A 5TV2A 1X1AA 2ZMEB 3HHHA 1RR7A 4XR6A 1P4XA 1QGYA 3QYBA 5IYNA 1W0JA 4DZPA 2M4GA 4I98B 2CO5A 2G7UA 5FFZA 4MQ9F 4M72A 5JR3A 2P7CB 3NE5B 2VOOA 2H6CA 3MKWB 1DPUA 1N0VC 1S0UA 5EG0A 3A01A 1W87A 1I7PA 2JA8J 5E1WA 3BR1A 3GVJA 2O3FA 1GXPA 3RZOJ 3PSIA 2NYXA 1YITB 5EGOA 2V7TA 3PUBA 2DA4A 1DP7P 2RC4A 3JREA 3QPSA 1H8AC 5FO0A 2QZ8A 1MNMC 2KFDA 1GXQA 3MMPA 3CCRB 3A03A 3JRGA 4RB0A 3W6VA 2A68F 1VQ4B 4AIKA 1XTAA 3KP3A 1FJLA 3JTGA 4LLLA 1QPIA 3VYSB 3P7NA 5FIUA 4BJTA 4IZZA 3FMSA 3GVAA 2UZKA 4BXXJ 4ESBA 2CV1A 1JB9A 2GK6A 2VKDA 2DPDA 4EMSA 5FLXK 2HQAA 2R7XA 5D8KB 4LG3A 3IH4A 4NC7A 3RPUD 4DBQA 3OS0A 2JDIA 1EFTA 1YJ9B 5E8GA 3F8BA 1KU7A 1FTTA 2QLZA 2G9WA 3S2WA 1QA6A 2HVRA 3TKYA 1YX2A 4M3GA 3AL0B 1ZYRF 1MSFC 2JUGA 2WV1A 4C2TA 3H9JA 1NK2P 4L9JA 4QVAA 3SEZA 2IS6A 4RDJA 2BMWA 3HPHA 2EIJH 1X4PA 2ME0A 3AFHA 3U21A 1UD8A 2Q6OA 3P9IA 2BGJA 2RKHA 2NVXJ 1SD7A 4P9UA 3DU5A 1XX5A 5ILUA 2O03A 1WTHD 2WYRA 1R00A 1VQNI 3M7GA 1HW2A 2JSCA 2Z5UA 3I1FA 2YX7A 1JUMA 4C2MJ 1WH7A 2E1NA 4LK1F 1UZCA 4XLEA 3IKTA 1KYWA 4KITB 2R6HA 4TMZA 1VQNB 5AIPA 3BCDA 2DT6A 3ASNH 3KP5A 4LB6B 1EP1B 2KRFA 3MZ8A 2QGGA 2CQXA 3FBNB 2HVQA 2XPVA 3I71A 3IC7A 3PO3J 1WCMJ 4I09A 1JI8A 2GWRA 1F20A 2ECCA 3I64A 2DY1A 1XCBA 1Z0XA 2I5UA 1IN6A 3KYCB 2RGVA 1MDMB 1ZG3A 4UB8C 4RCZA 1MJ9A 1A36A 1KQSB 1DQUA 2P0WA 5LEKA 1P92A 3TGNA 1BLIA 3SKBA 2M34A 3HYIA 3HSEA 2HTSA 2X1CA 2VPLA 2VBYA 3B73A 5J6XA 2MC4A 1BR2A 2LREA 3ES9A 1YIJI 2VBWA 2OBTA 2JUCA 1STZA 3TBIA 4JK1X 2OQRA 2EIKH 4A3LJ 4M3DA 3E1SA 3GVLA 1IJFA 1OR7C 5TISC 4H0EA 4HIZA 5E3NA 2FQ3A 4HX8A 3FK7A 3OL3A 1Z7UA 4ENKA 1F60A 1IHMA 1D1NA 4CCMA 2F43A 2HQNA 3V76A 4CYDA 2OQGA 1KC8D 3SZGA 4XOPA 1LKXA 2NS7A 1IDYA 2YPRA 4M3EA 4R8HA 4CSWA 1ACIA 5FO1A 1OCZH 2LR8A 1S8NA 2GXBA 4II3A 2KZGA 1WPKA 4N9IA 4EQQA 2VJIA 3KYDB 3Q6RA 4TV7A 1W35A 1QUFA 4HX4A 1Y1WJ 3A8IA 3PL8A 2DT7B 3K1NA 1I1GA 3H1CA 2QBYA 1YLOA 3ZOBA 2OBSA 1OKRA 4X6AJ 3BPXA 1J5YA 1ELOA 1OYWA 1TLHB 3DF8A 3K4MA 5J1UA 1N08A 4G6IA 2ZXWH 4DIQA 3HKZN 1Q81D 1K9MD 3GTQJ 4BUPA 4S0HB 4FWTA 5FROA 5LGUA 1WSRA 1IV8A 1ZM3A 3F6VA 4HF2A 1W36C 1RQRA 1ZM4A 3G2BA 1MBHA 2DJNA 2DPUA 3VYRB 1KONA 2F6CA 2E7WA 3KZIC 3GUDA 5EF6A 1E43A 1WH5A 1S7OA 3LSRA 2NVQJ 1S3JA 2H09A 3OAAA 1X4OA 1YYVA 2IGMA 1X3ZB 2ZZEA 2CYYA 2AQEA 3GXOA 5DSZA 1JJ6C 3E6CC 5EEGA 1KQ0A 1S7AA 5GAHJ 1DP3A 3PA2A 4QPQA 4QUZA 4P9SA 1FNCA 1HKSA 3RKYA 5EG0B 4G7ZF 1BOAA 3CCUI 4G9YA 4AF7A 4B09A 4A3GJ 3F0CA 4RGXA 3I0TA 4A5MA 2EB7A 5E1XA 4KIGA 3T5XA 4E7IA 1Z77A 5A89A 1SKYB 2XNDA 3JRFA 1FC3A 3LSIA 4KN4X 3PIOF 4BDZA 3VYTB 1W7PB 2EK5A 1BMFA 2KDOA 2HS5A 1HSJA 4D7NA 2ZSHB 2PN6A 3I3LA 4L5JA 1DU6A 1I3QJ 2GBYA 4CH7A 2HWVA 2IGKA 3WODF 3SQNA 3MCAA 2F5CA 3OP1A 1Z6RA 2EH3A 2HOSA 4R1HA 1VQ7I 2PIAA 3ZCOA 2FMYA 5C4XJ 2MH2A 1VQMB 1YW9A 1PJ6A 1TWAJ 1D0XA 2DOFA 3ECOA 4RD2A 1W4MA 2A69F 3ZMDA 2VUMJ 3S1NJ 4AM3A 5HOOA 2CGPA 1W5TA 5FO5A 3C2GA 5JVTA 5KHDA 1E2XA 1ETQA 5FRNA 1YRNB 4G7OF 2M0CA 2K9SA 1BOBA 1GV2A 3A3BA 2MLGA 1D8KA 4NC8A 4XONA 2PI0A 4U7BA 3EPZA 3L2VA 3BROA 1ZH5A 3WQZA 1JE8A 5J3OA 2E5NA 3CCLI 3OIPA 2YWHA 4KT5C 1EXMA 3DPLC 4ZC3A 2DOEA 3LMMA 5J8FA 3J81Z 2UXNA 2P8TA 3T8RA 3CC2I 1V5EA 2DETA 3REOA 1IN4A 2E7XA 4LMYA 5L3BA 2FOWA 4NQWA 4E4HA 2HR3A 1ETYA 4N0BA 1ZN2A 4KDPA 2JN6A 4D1QA 1EFCA 1G3SA 2XAQA 1GVJA 3K1PA 5CVIA 4PFOA 1Z3XA 2ZXJA 2IS2A 1H9TA 1T5EA 2VL8A 3TO6A 4BXFA 2KIUA 1WJFA 3T56B 4EH1A 2L7KA 3RSNA 1LQ1A 3I59B 3CMAI 2K3PA 5THXA 3CCSB 3TOBA 3RYRA 3GTJJ 3ERMA 1E3PA 2HNHA 2DFIA 3ASOH 2VE9A 3L1PA 3OZUA 2D1HA 3ASQA 4P25A 3SZPA 4FISA 4O3MA 3PQKA 4HQMA 5DD4A 1DDIA 4JMQA 5BSYA 1LPQA 3OIQA 4V2FA 1RR8C 2GA2A 4UAJA 3I4PA 1LVKA 1FZPB 3ZZ0A 4ESJA 1Y0UA 4G12A 5CKTA 1V0EA 1TL8A 1YHQB 1IC8A 4YFKF 3CUQC 2CSOA 4UHTA 2QDXA 2KT0A 2L0KA 3CJTB 3LSTA 2WV0A 3GFIA 2EV0A 5IYWA 2PMDA 2EV6A 5ICFA 3FKIJ 3CC7I 3GLLA 2ZL5A 3A4CA 3CCLB 2DK5A 2VQHA 4J01A 3RPUA 3HOUJ 3JQQA 2D74A 5BPDA 1MABA 5TJJA 1JNYA 3OYNA 3OEEA 4M2LA 5LGNA 1M90D 3TO7A 4AVPA 2L9VA 4ZYAA 3GTGJ 3KP2A 4LD5A 3DLLF 3MD2A 1PKVA 3AVVA 4JQFA 2R9VA 3MWMA 1X58A 3J7ZI 4BAYA 1A5JA 2OTLB 1HXDA 3KLOA 2OZUA 4YEJA 1N75A 4BQNA 1TTTA 4OIRF 2A6EF 2JK3A 5JLXA 1ZRCA 1K78B 3GZ6A 5DM7F 3U9GA 3A0BC 1RKWA 1G2HA 3IP4B 2BM0A 1EH8A 4MYUA 3CUQA 1SFUA 2GIZA 1QVGB 2BXYA 5E17F 3R6JA 3V7RA 2A61A 3GFMA 3LSJA 2CF4A 4HE5A 1I18A 4JYKA 3TMOA 4I6ZA 2STTA 3BTJA 3EUHC 1LB2A 1FRQA 2BEOA 2LG4A 4BBRJ 1XN7A 5FRMA 1T0FA 2R4GA 3EQLF 4P96A 4EM1A 1VQ6B 4ACAA 1T6SA 4IRGA 2R5YA 1FX0A 4OOSA 2A5WA 3OWTA 5CQEA 5E3OA 2XASA 2EWNA 3BQYA 2MH9A 1MKMA 5LHHA 1VFCA 3W5VA 1G3WA 3TQNA 4EVIA 2YS9A 1ZHFA 5FD6A 3GTMJ 3J7YJ 2JIZA 3QQAA 3RI4A 1P6RA 4B3AA 3OYIA 2QYOA 3Q0WA 4V2GA 3BPVA 2F4MB 1GV5A 4Q7JB 3CCMI 1LUJB 1U78A 1B2RA 4B4DA 1JKOC 1VQKB 3IH3A 4MGRA 5FJ8J 3L2RA 2NOGA 5ICEA 2NS0A 3CUQB 3L00A 1L3LA 1XGNA 2COMA 1WJAA 1AIPA 2VIXA 1J2XA 1AKHA 2AHOA 1K78A 4XOTA 4UY8I 1KK3A 2RVCA 2EBIA 3HUGB 1VQ5B 2BVLA 3CF2A 1W2BB 3I5UA 2LKSA 2VOPA 4LBWA 3BZ6A 2DQRA 2QCOA 3HM5A 1QZYA 4PZJA 1H8EA 1KD1D 2MD5A 2CUJA 3PNTA 2QSGX 5BPIA 2PBIA 4NBSA 1R5OA 1MNEA 5H20A 1POGA 1YI2I 3HAGA 3U6KA 3G6EI 2QKMB 3OYEA 3I56B 2E1OA 1FPQA 3Q0UA 3WTUC 2LD5A 3FPKA 3ZC3A 2XGJA 4DYRA 3QSYA 3M1CA 2HXOA 1HBXG 2QF7A 1BJAA 4LOCA 1T8IA 5E3MA 4MHGA 3ZXSA 3VEPA 4Y13A 4X0GA 2UUZA 4TKOB 1KU2A 2XUBA 3WU1B 3OL4A 4XKVA 1QGPA 4GYGA 2GJKA 1KMHA 2XF5A 2XPUA 1Z91A 3Q3AA 3HKZA 2B7CA 2R7TA 3CW2A 3PUNA 3CDHA 2EQRA 2K40A 2OYNA 4IOAF 1HLVA 2RNJA 3G3ZA 4BBSJ 2Z16A 3CP2A 3UR3C 1B9NA 5E20A 4EGYA 2FRHA 4HE6A 4CCLA 1UCRA 3OZVA 4M74A 2YUSA 1AU7A 3DPUA 2P4WA 1SAUA 3DTEA 4KNYA 2AXTC 4RGUA 2ZJRF 4OIOF 1Z9CA 3S16J 1N0UA 3GVKA 4PC1A 1ZM2A 4H9GA 3S1MJ 3VR6A 2IS4A 5J40A 2Z6BD 3OKXA 3FXRA 2CQQA 1K83J 4BQOA 2ACJA 1N77A 4OAYA 5TR9A 3ZQ7A 2BGCA 4IJAA 2J7KA 2HTJA 2Q1ZB 2Q2EB 3RKQA 1Q1HA 3H5NA 4ZGQB 3OS2A 1R36A 1NG7A 3BT9A 3ULQB 1XFOA 2N8GA 2FUG2 2RQQA 2HI3A 4G1BA 4ZJZA 3CO6C 1UD4A 4UZFA 2R7FA 3CCEB 1HDPA 3KZYA 1AA7A 4HQEA 1A31A 3I4MJ 3R6KA 1W9XA 1FLIA 1GVHA 1F36A 1NH3A 2CU7A 1X1PA 4PGGA 2IA2A 4I0AA 2BHZA 3CO7C 2OU2A 2R7RA 1IDZA 4M0LA 4YALA 4G94A 1NG6A 3G1MA 1J09A 4LITA 2XNCA 4HDVA 3LNNA 4I76A 2OUMA 1IRGA 4EATA 2OTJI 4FETA 5B3SH 4IQJA 2HZTA 3HDDA 4LB5A 2NVTJ 2VE8A 3C3WA 5BQTA 3VWBA 4RPBA 4L18B 1H8HA 4LG0A 1OLTA 3LQ6A 2EIXA 1S9HA 3DBLB 1ZG1A 3T8TA 5CVUA 3QYEA 1X3UA 2CQKA 1Q1VA 1U8BA 2AHQA 1DU0A 2KPMA 1LNWA 1JKPC 1CGPA 4M71A 1QPMA 4RAYA 2C78A 1DUXC 4EM2A 3HGYA 1WP6A 1QHGA 4PC6A 4JX4A 2LY9A 2HOTA 2LZJA 2BGIA 2R5ZA 2PX9A 3B78A 3DP7A 4PC7A 5F4OA 4ZGNB 5B1AH 5ILVA 5DUKA 1ONVA 5IYBJ 2JJ2A 5HS7A 1D8JA 4CZCA 3HSFA 2Y30A 4RB3C 2DLLA 4RLFA 4E7HA 3S3MA 1VQLB 2O61A 2V9VA 1W7PA 1VQ9I 3SEJA 3LQQA 1FYLA 4BKXA 2MD0A 4NHJA 3KIOA 1D2EA 2RREA 6PAXA 2L4AA 3ZRGA 1DARA 3R6SA 4D5CA 3CC4B 3OE7A 1YS6A 2LY2A 3RDIA 1ON1A 1VI0A 2Z9OA 1X3WB 3SFZA 2WY8Q 3OYCA 4F92B 1YFHA 1MBKA 4UUTA 4ZTJA 4V19K 2AXLA 3AVUA 5JFRA 2XB0X 1YIJB 1QU3A 2DT5A 4BE2A 4PC3A 4YFXF 1Y39A 3WHCA 3GQBA 2F1MA 1ETWA 2JA2A 2M87A 1XSXA 1V5FA 1EP3B 1VQ8I 3EETA 4PSWA 2F5EA 2Q8KA 1W1WE 2XAHA 5K7HA 1K6OA 2E34A 4UXNA 3O6BB 2BVMA 1P2FA 1RNLA 2CUZA 2YX4A 3S8PA 3ASPA 2P6TA 4XD7A 5D4RA 2OBPA 3MCZA 2BY2A 3HRUA 2DI3A 4TN1A 2M5WA 1Q86D 1UD6A 2GREA 4U0YA 2DO7A 2DIEA 1FTZA 2CW7A 2LF7A 2NS8A 2X6OA 1M1KD 3W2AA 4ENNA 4KICA 4RB2C 3OSGA 1EJ9A 1FOKA 3BZCA 2M45A 2MYSA 3CMMA 2Y31A 1WKMA 3AL0C 5FKKA 2CW5A 2DJIA 2R7UA 4U0VA 3U6BA 2JSPA 5TY0A 2XGEA 4QSHA 1BI0A 3B82A 2D5VA 2QQ8A 4ZYGA 2L01A 5E3LA 1JKRC 3S32A 3PFIA 4P5OA 3AVXA 2FX3A 1MMGA 4ACBA 5DS0A 4RGSA 2KDZA 2LVSA 1IF1A 2R7VA 1DGRM 2V9PA 4BE1A 1JA1A 1FRNA 4L9TA 3V8KA 4BQAA 4A93J 3AGQA 3OIOA 4KIFA 4BS9A 1SM4A 1USTA 3GF2A 1ZRFA 1TT0A 3WTSC 1ZREA 3GFLA 4FE4A 4OU0A 2EIMH 2IJLA 1F1ZA 2IGNA 2O8KA 4CGZA 4MFDA 5KAIC 1W34A 1SD4A 5IPAA 5CYVA 3OW2B 1ZLKA 4AC9A 4HAMA 3S1RJ 1FEXA 1UHSA 4P1VA 3T1BA 3ZN1A 4EEFG 4OWRB 2I10A 5TGTA 2C4UA 3CZ6A 4J00A 4Z6YA 3CCJB 3QPLA 4IRHA 2GJRA 3O8HA 3BCAA 4Y7NJ 3C2BA 3Q9SA 1U0JA 4OAZA 3ZPLA 4ABZA 1E63A 3VPRA 4NBQA 1BX0A 5M5XJ 4ZYHA 4ZZLA 5GAGJ 4RCYA 2KLOA 3G4SB 1HA8A 3WU2C 5D4SA 2VNKA 1V4RA 1UJ8A 2XKOA 2CUFA 3JAMZ 1R49A 4DK0A 1SFKA 3S17J 1JXSA 1E3HA 3R4KA 4OP7A 1D5YA 4YG2F 4ZDOA 1W5CC 1GHCA 1F5TA 3MEXA 2P3MA 4QIWN 4XN0A 2DDBA 4Y7CA 4ZDPA 1K7AA 4AF6A 3LQRA 2OA4A 3J81k 1OMIA 3JSPA 4XKWA 3W2HA 2X53S 2Z3YA 2G0EA 3J81K 4RJLA 1T0FC 5GPAA 3FISA 3AG3H 5GPCA 5KSWB 3A0HC 2GJPA 5K1YA 1WGXA 3OYLA 3QOEA 3SYTA 4MEXF 3HOSA 3ZP5A 1TWCJ 2ELKA 4KT6A 2DEUA 2FU4A 3G71B 1QHHD 1I27A 4IKFA 1MH3A 2OPTA 3N4MA 4MIMA 3FHNA 5IP7J 4PUSA 3GW2A 4RDUA 2WJYA 4FN5A 4EJTA 3ZQIA 2GQFA 4P1WA 2WR8A 3K4JA 2PMZA 5LFAA 1EF4A 4N4OB 1YJNI 2OF7A 5F6FA 2VQGA 1Z6TA 2RV8A 4A3MJ 4M6XA 2F4IA 2R7ZJ 2JJ7A 3GSIA 1XGSA 5K7FA 1IRXA 1GR1A 3A8KA 3FXOA 4A12A 3LFKA 1ZUNB 5F04A 3GLXA 4RM3A 2EFGA 4RAZA 2OD5A 1JKQC 3GMEA 1B72B 3GWZA 4CCJA 1VLYA 2Q6KA 3QFTA 4ZCLA 1PDNC 3PA1A 5JLWA 1BI3A 1XB2A 2DERA 2FXAA 1HQCA 1MZBA 5KNLA 3WTXC 2CNDA 5GP9A 2E1RA 4HYEA 1VQMI 2EA4A 1MBGA 2DAOA 3QU3A 1QUEA 5LD2C 2GPJA 2QEXI 3Q5FA 1R1UA 3A02A 3IUOA 3X2QH 4BEHA 1SD6A 2GZWA 3NWTA 4YAFA 1X1BA 1Y0RA 4IEJA 4YAWA 1SMTA 3ABTA 3G1OA 1XS9A 2R7OA 3DEWA 4M3BA 4AU7A 3QP6A 5HZAA 2LNBA 2VBTA 1FOWA 4BPRA 2KJCA 1J0RA 1BX1A 1E1QA 2XKPA 2BYVE 4HF0A 2Z99A 2EINH 5DCMA 4A3BJ 4PDKA 2CBXA 5D5UB 3DEEA 5LLQA 5EZGA 1QZZA 3M8FA 4XICA 2UWMA 1O3SA 3W2EA 5H5JA 5DCMB 1UG0A 3K4CA 1RPWA 4I2OA 4ZV4A 3OYKA 5HZBA 2XIGA 2ETHA 4ZH4F 5CVRA 4Y9UA 3K1MA 1XG1A 3V7SA 1LFPA 3NWSA 2FQ4A 2L5QA 2D2WA 4GYIA 3OFNA 2XB5A 5DCFA 5HNFA 5LMZA 3PNYA 1RUOA 3ABLH 3BC9A 2R7QA 2VBZA 3PVDA 2WC2A 2LFBA 2DBBA 3H5AA 1HDDC 2XAJA 4ASNA 1MJBA 4BH9A 3TO9A 3BLYA 3LA7A 2E35A 3D5RC 3QOPA 3QP5A 1YITI 1NDHA 2DMNA 3K10A 4Z4ZA 1PJRA 2WY7Q 2JRMA 2YSRA 4NC6A 1MH4A 2W85A 4M73A 2EZIA 1ZAOA 2K27A 1WFXA 2DMUA 2OTLI 1IN8A 2LSOA 1I6XA 2ZB9A 1TQIA 1RRJA 1DDNA 2QN6A 2GOXB 3E5UA 2GIVA 4C9YA 1COWA 3FM3A 3QWLA 4RD4A 3LSHA 3OV8A 2DQLA 2CMPA 2L54A 1R9TJ 3DXJF 1E3ZA 3PNVA 2QEXB 2PLFA 2V4JC 2XAFA 3N05A 5DN6A 3CJNA 1DG1G 2KHMA 3JRDA 3VNUA 3FWEA 2X3UA 2ISYA 4JP0A 1YOVB 3OS1A 1VQ9B 1W7PD 4BHPA 2BY1A 3E1YE 5K7ZA 2Z33A 1KA8A 2KL4A 4AUXA 4B48A 3K4BA 4U9UA 5J35A 5IP6A 2C2WA 3DEUA 1Z21A 4EJUA 1PVEA 2W1OA 1YS7A 3VSLA 3OR1C 2HDDA 3ASTA 3T53B 1B8IA 3CESA 3R0AA 4HX7A 2QKLB 4UUSB 3B6CA 3EYIA 1ZRDA 2ZNYA 3CJQB 4TT3A 3PSFA 3ZZUA 3PM1A 2X9DA 2MABA 4D0PA 3S15J 4C2UA 3B8HA 3HBLA 2V7FA 1HZEA 3A35A 3DCFA 4Y4RA 2WTEA 4E7LA 2QQ9A 1WWXA 1E64A 3VMFA 1TNSA 2HYJA 4WK8F 4GO1A 1VQKI 1CNEA 4PABA 2L7ZA 5LBQA 1AMOA 4X0CA 2GLOA 3M9AA 2KJBA 3EUKL 2UXXA 3WG7H 3ZMZA 4A0YA 1T6YA 5DV5A 5F4MA 2EFNA 3WHBA 2GOMA 3ZQHA 3M8JA 1NTCA 2DMPA 2ID6A 2XRLA 4FQGA 3H5RA 1S7EA 1FIAA 2DFHA 5EZHA 1OYIA 3G05A 3F3XA 3UKGA 3U1KA 1BW6A 2WB1N 3DKWA 4PJNA 1PYVA 2BHYA 2DA3A 3DU6A 4MTEA 4Y15A 4E70A 4IOCF 4DK1A 3L09A 1L0OC 2QM3A 4LK0F 1IGNA 3BY1A 2E19A 1JA0A 1R5NA 1OB5A 3I55I 1J7KA 3E20A 2Q0OA 3SDBA 5HODA 1FT9A 1Y8RB 3ZR8X 3JRIA 2DYIA 2CQ7A 4XRMA 4LGWA 2K9MA 3HEFA 3GFJA 4L9VA 1E79A 3E6MA 3J80K 3OYFA 4U87A 1BI2A 2OZ6A 1FOYA 4QLCU 1FYMA 1V5GA 1Q7YD 4HNTA 4E7JA 1NB9A 3LL7A 1T33A 3ECHA 2H6BA 5IYDJ 3OMYA 4XLAA 1LFBA 3ZN0A 2HFHA 1ZR4A 2L3DA 4A3KJ 4OOVA 2P5VA 5FKNA 3WY9A 3OJWA 4I99C 1VQ5I 2VZLA 4HNUA 5EMNA 3MZYA 2K9NA 2E2IJ 4L8JA 2AO9A 5HLGA 3KPHA 1NB0A 1WI9A 3ONYA 1ORKA 4BL0B 5GAEJ 1P9QC 1VHOA 2XV4S 3FDYA 5HVQC 4TSFA 1EKEA 4TMWA 2K02A 1IRZA 1YLFA 2VBXA 2YR2A 1JJ2B 2EV5A 3FMQA 4H4KC 2FVGA 2Q6IA 2OCCH 2P6SA 4KJZA 2VC1A 4CCKA 2O7OA 2XC7A 3MN2A 4A3JJ 3MZHA 2ZMEC 5CJ9A 3ZIAA 3I4NJ 2GM4A 4PGOA 3LVBA 4CCOA 2H1LA 3HL2A 4Z4UA 3MKYB 1D0YA 2ZKZA 4MFEA 4G7HF 3K2ZA 4KUMA 2CW8A 4WXDA 2DMTA 3NAUA 1R22A 3TL4X 3V8JA 3GCMA 1XMAA 4X7FA 4F7ZA 3IL2A 4FXUA 1CF7A 5D8LB 3I53A 4A5NA 3AGPA 1X2NA 1ZARA 2LLKA 3K4KA 1XDUA 1WU8A 4A3EJ 1S72B 2CH0A 3H92A 4DQKA 2JZYA 1UB9A 2P7VB 4HA8A 4MEYF 2HKOA 4P55A 4ON0A 2V7XA 4P6YA 5E79C 1BI1A 1D1AA 2GA1A 2KISA 3BG3A 5IOYA 4L0ZB 1SVOA 3JRCA 1OCTC 3WE3A 2M7BA 4I0BA 1VLOA 5KK1A 2IA1A 4DOZA 4U88A 2CK3A 1W0KA 1XCVA 2G7HA 3BQZA 5J3LA 5EEHA 5KCMA 3VYUB 2X0LA 1BA5A 1HA3A 3OYGA 3LFUA 3ZPNA 5DD8A 3R61A 3V42A 4FTHA 1HCRA 4XM3A 2HVSA 2FMLA 5JHFA 1HSTA 2VBUA 3CCSI 2FNAA 1N07A 2XZLA 3FXMA 2ZL6A 4AYBA 1U3EM 1OB0A 4LC0A 2MW8A 2VKVA 3A2KA 3WE2A 2NVYJ 1QG0A 3KFWX 2P5KA 2Y48A 3DKXA 4RM0A 4HPQA 3JSOA 3CF5F 2IEKA 1YI2B 4YIFA 2PMZN 4LFUA 1UHMA 4DW6A 4KMFA 2ELHA 4X1EA 2F2EA 1B4AA 1A6QA 1XDSA 4M9XA 5HNHA 2HCJB 5DTDA 1VQOI 1NBMA 2EFPA 1HW1A 3BR0A 1YO5C 3S2HJ 3KETA 1FSHA 2VNJA 2KRCA 1B1BA 3K70C 4A3FJ 1N78A 1D5VA 5GTIC 1KZLA 3M3YJ 2K4JA 2CC2A 2HOAA 3FPPA 2L7MP 2R7DA 4LIVA 1UD3A 1XQBA 5ED4A 2R0QC 1QNTA 1A04A 2DOAA 4ESFA 3J7AO 2VJJA 2ZZFA 1Y1VJ 4RMNA 3BR3A 4X7DA 2XVCA 1CF7B 3E5XA 4L5IA 3QFSA 1EWYA 3NEUA 2VJ5A 3L2CA 4IHTA 2CV2A 3SEQA 1R5HA 4CYCA 2HOEA 2Y0SA 3NRVA 1F43A 3CPXA 2VKHA 2V7QA 4OPVA 1PP8F 1FMWA 1P4AA 5IT3A 2BN4A 5F64A 3IWZA 2QUFA 2UV1A 2LKXA 1OJLA 3FK6A 3OYJA 2YWFA 5D5WB 1Y0NA 1G8XA 4RD0A 1KU9A 2E60A 3CMAB 4MLOA 4II2A 2W7NA 2B7BA 4JOMA 2M5SA 3H9NA 3Q39A 1TC3C 4TMXA 5D6FA 3AVTA 1IRFA 3CC4I 4XRSA 3BG9A 4M53A 2DCEA 4C43A 2ZCWA 3ZQGA 1IXRC 3K2AA 5F0HA 3V7CA 3ZBTA 4LBYA 3W5UA 1KU3A 1SANA 4PAAA 1VQ6I 2J5PA 2LTPA 2MA3A 2ICWG 4DYCA 4A3CJ 4ANJA 5BMZA 3R60A 3OOCA 3QE2A 2DXIA 1ULYA 2HU9A 3H9GA 3LSMA 3JRBA 1GAWA 1EP2B 5FD5A 2HDNB 2Y75A 3PFYA 4LIUA 2PJRB 3CQZJ 4K2EA 9ANTA 3AVWA 4JX6A 2W00A 1TBXA 3RKWA 2W57A 1VQPB 4AD9A 1X2MA 2VN2A 1MNDA 4UZUA 5KAFC 1UMKA 4FX0A 3WTWC 3VO2A 4C3JJ 2Y0MA 2WZNA 3QAHA 4BACA 3QPHA 3F22A 2JA5J 4HNVA 1YX5A 3GIRA 3GEZA 2XF6A 4WZKA 5HS8A 3LA2A 2VXDA 4A6EA 2V9KA 2PE3A 4RLQA 2L9NA 4RAGA 4XK4A 1G7RA 3GYHX 2NOJB 3KYLA 2A6HF 1IXSB 1G7SA 5IYRA 2NAZA 1JHHA 3MVPA 3F8MA 2M1BA 3HSRA 2AQFA 4IHSA 1R5BA 2QQBA 1U5TB 1B6AA 4RB1A 3ZBUA 3BNWA 2QSHX 1UHWA 2YWEA 3HRMA 2COBA 5JI6A 5LEJA 1LDDA 2JRTA 2Y0SN 2NVUB 1FBSA 4KN7X 3CDLA 3LA3A 5BSXA 2IXSA 3SZTA 2OC6A 1O7LA 4XLFA 2H8RA 1JTXA 4P12A 1SD5A 3K6GA 4D7MA 3O8GA 1UFMA 1ERDA 2ZO4A 4CUGA 5HDGA 5A88A 3LSKA 2OCEA 3ZUGA 3FZVA 4IHWA 1JUPA 3G71I 1J9IA 1ETKA 1R4MB 3LAPA 2M8EA 1KYZA 2DA7A 3OR2C 4BXUA 2BPOA 3PUMA 4YXWA 3ZZTA 4ZCMA 4XLNF 1QVUA 2M9HA 3TDUC 1D1BA 4C0SA 4R71A 1WRJA 4RAFA 3ABMH 2HYGD 1T08B 3RYPA 3CRZA 2EA2A 1LJ9A 4G7WA 3U2QA 2VLAA 3AAFA 1F9NA 2FE3A 4G1VA 3WBJA 5JBQA 3CCQB 1Z3YA 1EV7A 2L02A 1ZG5A 3Q38A 2GXGA 2V79A 1H88C 2DOGA 4P2NA 4QV2A 4KMUX 4IL6C 2XAUA 4Y17A 5LGTA 4ENJA 3CP8A 1T6XA 3BZKA 1QFJA 3FM5A 2KIFA 3CXCB 1MMAA 3PENA 4A69C 4XKCA 4B44A 4XSXF 4YAOA 1TTYA 1IN5A 5F08A 1P4WA 4XLCA 3PQJA 2XHKA 3CLQA 1VZ0A 2HQ5A 2BV3A 1OB2A 4LBVA 4WWCA 5K5OA 2FBKA 1TUIA 4I7HA 3BY2A 3GZNB 3WTTC 1H85A 2ID3A 3ONQA 1FNNA 4FX4A 1V54H 4GGGA 2JPCA 1RETA 2VNIA 4MYTA 5L3DA 2ESNA 1YJ9I 1O3TA 2LRDA 1LFUP 2VBSA 4CYCB 2B5OA 3JAMK 2L7FP 1LVAA 3A01B 3OZWA 1REPC 3M1EA 5FLVA 1EH7A 2DYRH 4X06A 2O5RA 2W84A 3ASSA 2FBIA 2BW3B 3SJZA 2WPDA 3HB9A 1TWGJ 2K3FA 3WTVC 1K6YA 1U2WA 3KLNA 1S5LC 1S29A 2QWWA 5HDNA 1I39A 1W0TA 3F23A 4G6QA 3H3ZA 1KQ8A 1WOSA 2FBHA 2KIMA 1USSA 2D1VA 1K8AD 5E8IA 1K73D 3JRHA 1G6NA 5AN9A 4L9NA 1G7TA 2E71A 3E5QA 3Q6QA 4XQFA 4LBZA 4N4NB 3DWLE 3W3CA 2IP2A 4UNOA 1T38A 4F93B 1GDTA 3DLAA 2TDXA 2O9LA 1XC5A 4C3HJ 5L3EA 2VQLA 4XRSG 1XMXA 1I1SA 2MC3A 1ZLJA 1E3XA 3HRSA 3RY8A 1JGSA 3JRAA 5F1RA 2WSSA 2ZBUA 3JTHA 4N9HA 3BR2A 4LG0B 2DMQA 4UV8A 2EPFA 1XSDA 2EZKA 3CDIA 4IO9F 4DBRA 2IAIA 1JT6A 1B72A 4AIHA 3VB2A 1SC7A 2B63J 4M3FA 2JMWA 2VB6A 2O8XA 4FHTA 3HTUA 1SFOJ 5HLTA 1IJWC 2V7UA 2ZJPF 3Q9VA 3E0JB 2XRNA 4RM2A 4BYYA 2HPIA 3DQVC 4X7CA 3ISPA 1BR1A 4R79A 4HW0A 1O7FA 2FEZA 4BU2A 3ROUA 3HXLA 3RJPA
chains in the Genus database with same CATH topology
2NRAC 1QBJA 3IRQA 4IRIA 1HKQA 2XGXA 4HLYA 3ML6A 2K4BA 2L4MA 4HDUA 4Q47A 3BOQA 4KFCA 1E17A 2ESHA 2PJPA 1YQAA 1HKTA 4I02A 2VODA 2IPQX 1BC8C 2A07F 3DV8A 4YFNF 1XGMA 2A3SA 3HOTA 4XBFA 4AWXB 2VONA 4M6YA 4U0WA 1RZ4A 2HYFA 2DTRA 2R3SA 4ZZDA 2BV6A 1FY7A 2K86A 2IT0A 4B8XA 4ETSA 3C18A 5ERIA 5LRRA 5H6QA 2M30A 2CFXA 2J5OA 4LLNA 1TW3A 1XD7A 3ZMSA 1SFEA 3HHGA 5HLIA 4UZEA 2VC0A 4DQ2A 4GXOA 2ZFWA 2VT3A 2X0KA 2HGCA 4IF4A 1T98A 2V1DA 2HKXA 1BIAA 4YIIA 1OPCA 4A6DA 2ADUA 5DDGA 4CXFA 5CVJA 3F6OA 5D5VB 3D0SA 5DUIA 2P5LC 3ZMUA 1K79A 1SAXA 2ISZA 4I01A 5A8AA 2PFBA 1EH6A 1IUYA 1OR7A 5E18F 4UUVA 1FBUA 1T39A 4EJWA 2FOKA 3FXUA 2B0LA 5FFXA 1TQPA 4P9FA 2RDPA 4CHUA 1FYKA 4BHBA 2VBVA 2IA0A 1WQ2A 3B02A 1LEBA 2MBFA 3I58A 1RUNA 2W25A 5D5XB 1RIOH 4EJVA 1IW7F 1R1TA 4EV0A 3W6JB 3CTAA 1AWCA 1MRZA 2D45A 2DU9A 3BJOA 2HDCA 2YU3A 3T0YA 3WU0A 3FMRA 1W5SA 4BNCA 3DPTA 1R7JA 1IN7A 3O3KA 4KYWA 4NB5A 4G6DA 4RGRA 4AIJA 4IPAA 2K7LA 2Q2EA 4O5VA 1P4MA 1ON2A 2BBYA 1LEAA 3J80Z 4QWQA 3U1DA 1F4KA 1N06A 2JPBA 4PCQA 1PUEE 1TQMA 3HRTA 1IAWA 2A5YB 5CLSA 4CDGA 2HEOA 1LDKB 4Q48A 2H94A 3ABUA 5K5RA 5D6EA 2PG4A 2EFQA 5IT9Z 1R23A 4OMYA 4ZYEA 3VODA 1O57A 4MQVA 1MJAA 4CICA 1R1VA 3MAJA 1Z1DA 4UVCA 3ZMVA 2PLYA 2CG4A 1BC7C 3H3UA 2RQPA 4IXAA 1SFXA 3F8NA 4IVNA 2DK8A 3WGIA 2FF4A 5L3FA 4Q4ZF 2V1XA 1U5TC 4HOBA 1U6GA 2W24A 3P9KA 4M9SA 3RPQA 1VTNC 4Q5SF 1MD0A 2I1LA 5LHIA 5AONA 1FBQA 3KEQA 1J75A 4WXCA 5LHGA 1FSEA 3BWGA 1C0WA 2O0YA 3CLOA 2EJRA 1U8RA 4A2UA 1H9GA 3KCCA 3MFKA 2V1UA 3CUOA 2IVMA 2QENA 4OMZA 4BHCA 4DNCA 1G3TA 5FB2A 4RS8A 3O2PE 4O6JA 1BM9A 3DFGA 3V4GA 3QRFF 1B9MA 5J8CA 3EYYA 5H6RA 2PMHA 1MDMA 4OOIA 2F5FA 5KVRA 2IW5A 3WTYC 1XB4A 2OAZA 3IWFA 3ERED 4S04A 3I59A 3D5LA 3TOAA 1XSVA 1KQ9A 3GO5A 5L3GA 2KKOA 3NQOA 3RTRA 1DPRA 3M8EA 5LRSA 1JHFA 5FLXZ 1TW2A 2DW4A 2HQRA 2XROA 3WGGA 3BP8A 4ZYDA 5ILSA 3TDZC 4XRFA 1V3FA 5K5QA 1ZGAA 3V8LA 4Z2YA 1N05A 1XGOA 1YW8A 3FXQA 3BY6A 5TRDA 5BS6A 2WWYA 1FP1D 3KP6A 2QVOA 5DYMA 3WG9A 1XMKA 4CZZA 4PGHA 3GX4X 1TNTA 3C1DA 4U7DA 4A0ZA 5L3CA 2FSWA 3BJ6A 2VT2A 4HV6A 3GZ5A 2GAUA 3U2RA 4HLXA 4HZFA 1IZ1A 2ZMEA 3G73A 4LJZF 1FWZA 1RI7A 4JBAA 2H27A 5ICCA 3E3VA 3LWFA 2VXZA 3KZZA 5E1ZB 2F5DA 5FGMA 4KIBA 3RIRA 3FHZA 1OYYA 3COAC 1AOYA 1S6LA 3C7JA 5HLHA 3OOPA 4M9ZA 2MLKA 2C6YA 2X4HA 2JTVA 1G4DA 1KGSA 1MGTA 4HBLA 3HUGA 2EFWA 2O6GE 4MNUA 2LKPA 2QBYB 2ZJ2A 2NNNA 3LAJA 3P9CA 1LDJA 5DEQA 1PP7U 4UVBA 5JHUA 3K0LA 1HW5A 4G8XA 5HS9A 4GCVA 3EUHA 3FF5A 5A2QK 1B59A 1O3RA 3F8CA 2CWEA 4OIPF 3L7WA 4OIQF 3K9TA 3K69A 1QO0D 3WTZA 1U5TA 3BJAA 3KEOA 4ENMA 3I54A 1NHAA 1FX7A 3F21A 4WF2A 2NNYA 4OINF 3SHFA 4A0XA 5BOXA 4EGZA 1G3YA 3IHUA 3N97A 3F72A 4WCGA 2XAGA 1YW7A 4EM0B 3F8FA 2ZNZA 2EFOA 1T2KA 1ZGJA 3IKVA 3ZMTA 1BIBA 3HIFA 1YIOA 5ICGA 1T6ZA 2GQQA 1WSUA 3VFZA 3HTSB 2LDUA 1BN5A 5HDKA 1O3QA 5CVVA 2BE5F 3BDDA 2QQAA 4LLGF 1D3YA 2AS5F 4KA4A 2IRFG 4HV5A 2ZBKA 3L9FA 2PMUA 5AIQA 2E1CA 1Q9SA 4L0YB 2FNPA 1J59A 3MQ0A 1S4MA 1QQIA 5FNZA 3KP7A 1FP2A 5IT9K 1YG2A 2STWA 3WGHA 1H0MA 2PQ8A 4MTDA 1Z05A 2PEXA 1IXCA 3FX3A 4WXHA 3KE2A 1SMYF 3ELKA 3QU6A 3VOEA 3QPTA 2LF8A 3KP4A 4EJOA 3RKXA 2JT1A 4UVAA 4UV9A 1YTYA 1R58A 3IRRA 1I5ZA 4XSZF 4S05A 3EDPA 4FT8A 3SXYA 3E6DA 3R0JA 3E97A 5A2QZ 4WX9A 3JW4A 1BBYA 4XLPF 3E6BA 2RN7A 4CO8A 1R5GA 3W6KB 2FA5A 2CW0F 1ODDA 4HF1A 2V6CA 3HHHA 2ZMEB 1P4XA 4I98B 2CO5A 2G7UA 5FFZA 4MQ9F 4M72A 5JR3A 2P7CB 2VOOA 2H6CA 1DPUA 5E1WA 2O3FA 1GXPA 2NYXA 1DP7P 2RC4A 5FO0A 2QZ8A 1GXQA 4RB0A 2A68F 4AIKA 3KP3A 3JTGA 4LLLA 3P7NA 3FMSA 3GVAA 2UZKA 4ESBA 2DPDA 4EMSA 5FLXK 5D8KB 5E8GA 1KU7A 3F8BA 2QLZA 2G9WA 3S2WA 3TKYA 1ZYRF 4L9JA 3P9IA 2RKHA 1SD7A 4P9UA 5ILUA 2O03A 1R00A 3M7GA 1HW2A 2JSCA 2Z5UA 2YX7A 2E1NA 4LK1F 3IKTA 1KYWA 5AIPA 3KP5A 4LB6B 2KRFA 3I71A 3IC7A 4I09A 2GWRA 3I64A 1XCBA 1IN6A 2RGVA 1MDMB 1ZG3A 1MJ9A 5LEKA 1P92A 3TGNA 3HYIA 3HSEA 2HTSA 2VBYA 3B73A 5J6XA 2VBWA 1STZA 4JK1X 2OQRA 4H0EA 2FQ3A 4HX8A 1Z7UA 4ENKA 2HQNA 4CYDA 2OQGA 2YPRA 4R8HA 5FO1A 1S8NA 2GXBA 4N9IA 4EQQA 4TV7A 4HX4A 3K1NA 1I1GA 2QBYA 1OKRA 3BPXA 1J5YA 1OYWA 1TLHB 3DF8A 1N08A 5LGUA 3F6VA 4HF2A 2DPUA 2E7WA 3GUDA 1S7OA 1S3JA 2H09A 1YYVA 2CYYA 3GXOA 3E6CC 5EEGA 1KQ0A 1S7AA 1HKSA 3RKYA 4G7ZF 1BOAA 4G9YA 4B09A 4RGXA 3I0TA 4A5MA 2EB7A 5E1XA 4KIGA 3T5XA 5A89A 1FC3A 4KN4X 1W7PB 2EK5A 2HS5A 1HSJA 2PN6A 4L5JA 2HWVA 3WODF 3SQNA 3OP1A 2F5CA 1Z6RA 4R1HA 2FMYA 2MH2A 1YW9A 3ECOA 1W4MA 2A69F 3ZMDA 5HOOA 2CGPA 1W5TA 5FO5A 5JVTA 1E2XA 4G7OF 2MLGA 1D8KA 2PI0A 4U7BA 3BROA 1ZH5A 1JE8A 4KT5C 3DPLC 5J8FA 3J81Z 2UXNA 2P8TA 3T8RA 3REOA 1IN4A 2E7XA 4LMYA 5L3BA 4NQWA 2HR3A 4N0BA 1ZN2A 4KDPA 1G3SA 2XAQA 1GVJA 3K1PA 5CVIA 2ZXJA 1H9TA 3TO6A 2KIUA 1LQ1A 3I59B 3TOBA 3RYRA 2DFIA 2VE9A 2D1HA 3SZPA 4O3MA 3PQKA 4HQMA 5DD4A 2GA2A 3I4PA 1FZPB 4ESJA 1Y0UA 4YFKF 3CUQC 2CSOA 4UHTA 3LSTA 2WV0A 3GFIA 2EV0A 2EV6A 5ICFA 2DK5A 3RPUA 5BPDA 5TJJA 5LGNA 3TO7A 4AVPA 3KP2A 4LD5A 4JQFA 3MWMA 4BAYA 1HXDA 3KLOA 2OZUA 4OIRF 2A6EF 1ZRCA 1K78B 3GZ6A 3U9GA 1EH8A 3CUQA 1SFUA 5E17F 3V7RA 2A61A 3GFMA 2STTA 1LB2A 2BEOA 1XN7A 1T0FA 3EQLF 4P96A 4EM1A 1T6SA 4IRGA 2XASA 2EWNA 2MH9A 1MKMA 5LHHA 1G3WA 3TQNA 4EVIA 1ZHFA 5FD6A 3RI4A 1P6RA 2QYOA 3BPVA 1U78A 4MGRA 5ICEA 2NS0A 3CUQB 3L00A 1L3LA 1XGNA 2COMA 1J2XA 1K78A 2RVCA 3I5UA 2VOPA 3BZ6A 2DQRA 4PZJA 1QZYA 2MD5A 5BPIA 2PBIA 5H20A 1FPQA 3WTUC 1HBXG 1BJAA 4MHGA 3VEPA 4Y13A 1KU2A 2XUBA 3WU1B 1QGPA 4GYGA 1Z91A 3CDHA 2OYNA 2RNJA 3G3ZA 1B9NA 5E20A 4EGYA 2FRHA 1UCRA 4M74A 2P4WA 4KNYA 4RGUA 4OIOF 1Z9CA 3FXRA 2ACJA 3ZQ7A 2BGCA 4IJAA 2HTJA 1Q1HA 1R36A 3ULQB 3CO6C 4UZFA 2R7FA 3KZYA 4HQEA 1FLIA 4PGGA 2IA2A 4I0AA 3CO7C 2OU2A 4G94A 4HDVA 1IRGA 2HZTA 4LB5A 2VE8A 3C3WA 5BQTA 4L18B 4LG0A 1ZG1A 3T8TA 5CVUA 1X3UA 2CQKA 1LNWA 1CGPA 4M71A 1QPMA 4RAYA 1DUXC 4EM2A 3DP7A 5ILVA 5DUKA 1ONVA 5HS7A 1D8JA 3HSFA 4RB3C 2DLLA 2O61A 2V9VA 1W7PA 3LQQA 1FYLA 4NHJA 6PAXA 2L4AA 3R6SA 1YS6A 2Z9OA 3RDIA 1ON1A 3SFZA 1YFHA 2AXLA 5JFRA 2DT5A 4YFXF 2M87A 1XSXA 3EETA 2F5EA 2Q8KA 1K6OA 2XAHA 4UXNA 3O6BB 1P2FA 1RNLA 2YX4A 2P6TA 5D4RA 2OBPA 3MCZA 3HRUA 2DI3A 2M5WA 4U0YA 2DO7A 2LF7A 4ENNA 4KICA 4RB2C 1FOKA 2M45A 1WKMA 4U0VA 1BI0A 4ZYGA 2L01A 3PFIA 4P5OA 4RGSA 1IF1A 4L9TA 3V8KA 4BQAA 4KIFA 1USTA 3GF2A 1ZRFA 1ZREA 3WTSC 3GFLA 4OU0A 4CGZA 2IJLA 1F1ZA 1SD4A 5CYVA 1ZLKA 4HAMA 3T1BA 3ZN1A 4IRHA 3Q9SA 3ZPLA 4ZYHA 4ZZLA 5D4SA 1V4RA 2XKOA 3JAMZ 1JXSA 3R4KA 4YG2F 1GHCA 1F5TA 3MEXA 2P3MA 1K7AA 3LQRA 2OA4A 1OMIA 3JSPA 2Z3YA 3J81K 5K1YA 4MEXF 3HOSA 3ZP5A 2FU4A 1I27A 3N4MA 3GW2A 4EJTA 5F6FA 1Z6TA 2RV8A 4M6XA 1XGSA 4A12A 3LFKA 3GLXA 4RAZA 2OD5A 3GWZA 1PDNC 1BI3A 2FXAA 1HQCA 1MZBA 3WTXC 4HYEA 2EA4A 2DAOA 3QU3A 3Q5FA 1R1UA 1SD6A 2GZWA 1SMTA 3ABTA 3QP6A 2LNBA 2VBTA 2KJCA 1J0RA 2XKPA 2BYVE 4HF0A 2Z99A 5DCMA 4PDKA 5D5UB 5LLQA 1QZZA 3M8FA 2UWMA 1O3SA 5DCMB 4I2OA 2XIGA 2ETHA 4ZH4F 5CVRA 3K1MA 3V7SA 4GYIA 2D2WA 5DCFA 1RUOA 2VBZA 2WC2A 2DBBA 2XAJA 4ASNA 1MJBA 4BH9A 3TO9A 3LA7A 3QOPA 3QP5A 2YSRA 2W85A 4M73A 2K27A 1ZAOA 1IN8A 2LSOA 1I6XA 1TQIA 1DDNA 3E5UA 2GIV