5BSXA

Crystal structure of gii.10 p domain in complex with disinfectant puregreen24
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
314
structure length
308
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Treatment of norovirus particles with citrate.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 66
structure length 308
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5bsxA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5bsxA01
5E6TA 5IYWA 4OPOA 4WZLA 4OOXA 5F4JA 4Z4SA 3ASQA 4RDLA 3BY1A 3SEJA 4P26A 2OBTA 4QV2A 5IYNA 3PUNA 4RDKA 5BSYA 3ASSA 3ONYA 5IYPA 4ROXA 5IYQA 4WZEA 4Z4RA 5BSXA 2ZL5A 4WZTA 3BY2A 3R6JA 5J3OA 5J35A 3Q38A 3PA1A 4OP7A 4RLZA 3PUMA 5F4OA 4RPDA 3LQEA 3Q6RA 5KW9A 2ZL7A 4OOSA 3V7AA 5F4MA 4QVJA 4Z4WA 4Z4ZA 4X7EA 5HZBA 4X06A 4OOVA 3RY8A 4QVAA 3PVDA 2OBSA 3R6KA 4P12A 4RM0A 4X7DA 3Q39A 4Z4UA 3PA2A 4OPSA 3ASPA 2ZL6A 4P25A 5IYRA 4RPBA 4QUZA 5HZAA 4X7CA 3ONUA 3ASRA 4P1VA 4Z4VA 2OBRA 3LQ6A 1IHMA 4P3IA 4Z4TA 3SLNA 3BQJA 4X7FA 4X0CA 4P2NA 4WZKA 3SLDA 3Q3AA 3SKBA 3D26A 3ASTA 3SJPA 4X07A 4OPVA 4RDJA 4Z4YA 3Q6QA 4X05A
chains in the Genus database with same CATH superfamily
3W5VA 1XFOA 3OFNA 4XLFA 3A3BA 2HLDA 4OOXA 4ZCIA 5F4JA 2D74A 4Y9RA 4Z4SA 2BPOA 3SEJA 1UD8A 2BGIA 1B2RA 4XN0A 2QTZA 1T6ZA 2OK8A 3BC9A 3CESA 4P26A 4XOTA 4AC9A 4N3GA 5HXBA 1BPLA 5KNLA 4RDKA 4XLAA 1W0JA 3ZBTA 5BSYA 3CCMB 4QHYA 1EFRA 2ZZEA 5FNZA 2DOGA 4M2LA 4XLCA 4XNFA 4LBWA 4CQJA 1G7RA 5FIUA 3I55B 4WZTA 2LZJA 2BGJA 1CQXA 2GK6A 1H42A 3CCLB 2X3UA 5JBQA 3R6JA 3JQRA 4ZCLA 1QGYA 3PA1A 2J7KA 1MRZA 2V7WA 1AMOA 1QVFB 1V5VA 4RLZA 2QGGA 3CCRB 2DCUA 1YJWB 1SM4A 5F4OA 4RPDA 3OJXA 2X85A 3OZWA 3VNVA 1KTVA 1G7SA 3Q6RA 1DDIA 2PIAA 1E3ZA 3H94A 4KKUA 3V7AA 2ZBUA 1M1KD 3U2QA 1M90D 1FNDA 5CDFA 3OW7A 2GJPA 2VNHA 2GPJA 1VQOB 4NNJA 4X7EA 5A89A 2F1MA 3ZZUA 2WJYA 3GVJA 4RD0A 1KD1D 1UD3A 4ZCMA 3NE5B 1EFCA 2JDIA 3ISXA 4GQNA 3MHPA 2QN6A 1ZM2A 4TMVA 2CW5A 3OPOA 4HE5A 1EP2B 5H5JA 5DSZA 4M53A 1S72B 4RD1A 3CC7B 2V7UA 1QFJA 3Q39A 1FDRA 1JB9A 4Z4UA 2JIZA 3J81k 1VQ4B 1P4MA 4P3YA 3GQBA 1DG1G 3OE7A 1D1NA 3OEHA 2E1BA 2JJ1A 2OK7A 1E79A 1N06A 3ONUA 1NRKA 3OKXA 4Z4VA 2VNKA 1AIPA 4YAUA 5B6IA 3JQQA 4L8JA 3KEWA 1UD4A 3BQJA 2Q6KA 2YWFA 2OTJB 3CP2A 5A8AA 3VR6A 2VBUA 4XLHA 2XZLA 3ZZ0A 3ASTA 1XQBA 2R6HA 2VNJA 3A3GA 2GREA 4OPVA 1E43A 3B8HA 4RDJA 1QG0A 4JMQA 4B3FX 5HKKA 1WDTA 2DYIA 3MCAA 1IJEA 4TMTA 1UD2A 3WNBA 5LMZA 4U9UA 2DIEA 4X05A 1UMKA 2C2WA 1VQNB 2CRVA 4ZGNB 4UZFA 5IYWA 1YX2A 4WZLA 2B7CA 2ZZQA 4RCYA 4KKSA 1N8RD 2EFGA 1E64A 1QFYA 4M0LA 3W5UA 3WNCA 3ASQA 4DNTB 1TTTA 2Z6BD 2C4UA 1NDHA 1W87A 2OBTA 4QV2A 4ZGQB 4P6YA 1GAWA 1NB9A 5H59A 2RC6A 5A88A 1KK1A 1VHOA 4KKTA 2GK7A 1G7CA 4J0QA 3CCSB 1SKQA 1GAQA 3CCEB 1H8HA 3ASSA 3FKSA 2YWGA 5IYQA 4WZEA 3BH4A 4YELA 2DERA 2V7QA 4TMWA 4AVZA 1VLYA 2VJJA 3OJWA 5J35A 2AHOA 5FO1A 2C4TA 1T6XA 4PABA 2ZTNA 4P9SA 1A8PA 3LQEA 1YI2B 4RCZA 2F1LA 2C78A 1OB0A 3JQPA 3ZIAA 2DETA 2VJIA 2X6WA 1BQEA 4N3NA 4XR6A 5F4MA 4Z1MA 1WSVA 4QVJA 2XZOA 1YITB 5DN6A 3HAGA 1EWYA 3CRZA 1TUIA 1ZUNB 2BM1A 4OOVA 4XONA 4YHBA 4C43A 1W35A 4AF6A 3RY8A 4XL9A 1W2BB 1IB0A 1E62A 2ZTGA 1XE1A 2OBSA 2E1RA 1VLOA 4ACBA 3CP8A 4B47A 1QUEA 1QX4A 1COWA 4X7DA 4G7WA 1MABA 2V31A 3PA2A 4TKOB 2C77A 5TRDA 4II2A 2ZZGA 3ASPA 5IYRA 2Q6OA 1VQMB 1S0UA 1HVXA 3VO2A 4YALA 3LO8A 2X6YA 3GSIA 2NPFA 1G7TA 1IHMA 4DK1A 1ELOA 2PLFA 4C0SA 4X7FA 2QDXA 4P2NA 4AF7A 4Q7JB 2GJKA 1QFZA 2W6JA 3VNUA 1GJRA 1TLLA 1Y0YA 2V7TA 2QTLA 5GV8A 1FRNA 1TVCA 2F43A 3OP1A 4PAAA 1GR1A 1RQPA 2Q6IA 1HA3A 1PJ5A 2ZZFA 1KK2A 3SJPA 4BPRA 1QGAA 3U6KA 1WORA 2HMAA 3OZVA 4FK8A 4Y9UA 1KRHA 3OW2B 2OTLB 3ZC3A 3Q6QA 5FL7A 3AGQA 3A1PA 4Z4WA 1RQRA 2WZNA 3CMMA 4F7DA 1N07A 4P6VF 2WZPP 2DY1A 3V76A 5E6TA 2FX3A 3FPPA 4OPOA 3T56B 5GV7A 4UAJA 3OOCA 2VBSA 4G1BA 4DK0A 4RD4A 4LBYA 1WP6A 3E20A 2BSAA 4X8IA 4RDLA 5IK2A 1GVHA 1KMHA 2XNJA 4XKWA 4XMYA 1I7PA 3G71B 1JNYA 4PC7A 4B43A 5IYNA 5THXA 3PUNA 4UZEA 1K8AD 3G6EB 4ACAA 1CNEA 1KK0A 1H8EA 1D8TA 3CMEB 3AVWA 4RD3A 1ZM3A 3BCDA 4DQKA 3ES9A 2GQFA 3CD6B 1NB0A 3A35A 1BMFA 2HDNB 1ZM9A 4XKVA 1I8DA 1GO2A 2XEXA 1VQ5B 1EP1B 2D3LA 1WOSA 3BY2A 5J3OA 4DNRB 2OYNA 5L46A 4G7XA 4OP7A 1UD6A 3LVBA 3PUMA 4XD7A 3A8KA 4UZUA 4XQFA 1VQ9B 4ZV4A 4YXWA 1WPCA 3OEEA 2X8KA 1PJ7A 5KW9A 2ZL7A 3U6BA 2CC2A 2X6XA 4OOSA 1VQLB 2VBTA 1QVGB 1FX0A 1Q7YD 4YAOA 1F60A 2QEXB 1E63A 3VO1A 1DARA 4Z4ZA 1BLIA 5HZBA 1Q82D 4II3A 4TN1A 4MYUA 1OB5A 1E3XA 1OHHA 2W6IA 3W2HA 1YHQB 4B48A 4QVAA 2BF4A 3AGPA 1V0EA 3ZZTA 3PVDA 3AVUA 2P3MA 3R6KA 3CPXA 1KJZA 3I56B 1YJ9B 3B78A 4HE6A 3SJZA 1KQSB 1BJKA 2WYRA 1QGZA 4RM0A 2XOKA 2PMDA 1EXMA 4OPSA 3QSYA 4FN5A 3W2GA 1YIJB 4LBVA 2ZL6A 3GIRA 4P25A 4G6IA 3W2FA 3ZUGA 4RPBA 4NCNA 3CTAA 5HZAA 1S4MA 4XN3A 1N05A 5TY0A 2Q6LA 3ASRA 3T53B 2OBRA 1K28D 2CBXA 2BM0A 3AVTA 4P3IA 4Z4TA 2M5SA 4PC2A 2R9VA 3LNNA 2VBVA 4X0CA 1CNFA 1F20A 4G5GA 3G4SB 2B5OA 2EIXA 3WQZA 3Q3AA 2BVNA 2HCJB 3QFRA 1R5BA 1WU8A 3WBKA 2CF4A 1T6YA 3D26A 4TSFA 1WSRA 1J9ZA 4RD2A 3WNDA 1U2RA 2ZXHA 1VQPB 4FXUA 3CMAB 3CC2B 3W5HA 2VYQA 3CXCB 1I18A 2B7BA 3ZPNA 4B44A 1EFUA 3GVKA 3PENA 2CK3A 1QH0A 4YAFA 1OGIA 2F4NA 3WY9A 1VJSA 2D9RA 2FVGA 4YAWA 3A8IA 3WXMA 4HIZA 4TMZA 2VNIA 5TR9A 3CB4A 1NBMA 4DQLA 3VMFA 3BY1A 2QMUA 5TV2A 4MYTA 2X53S 3WBJA 2QE7A 3QFCA 4E0FA 4FWTA 1K73D 3P27A 4QFMA 1V0FA 3CCUB 2ZITA 4RJLA 4XM3A 3P26A 1VQKB 1R5OA 2XZPA 1Q81D 2RC5A 1BX1A 3ZBUA 3AVYA 1ZM4A 2WR8A 2GJRA 2JJ2A 3ONYA 5IYPA 1N0UA 4ROXA 3WYAA 2JN9A 4Z4RA 3W2EA 2BV3A 3GVLA 2WJVA 4PGOA 1T5EA 5BSXA 2ZL5A 1WOOA 2PE3A 2I1LA 2KVOA 1FNMA 4LC0A 4LBZA 1N0VC 2ZBVA 3BNWA 1JA1A 2WPDA 1WOPA 3Q38A 5EMNA 3OAAA 1KC8D 1VHEA 2D3NA 4ASUA 3E1YE 4IW3B 3T51B 3MMPA 3AVVA 1K9MD 1WTHD 4R71A 1E1RA 1HZEA 1OB2A 3G05A 4XLEA 4RD6A 4XOPA 4M4SA 2XNCA 3CCVB 4M1KA 2X0KA 4PC3A 5FA6A 1Q9SA 3QFSA 3BCFA 1VQ8B 1EFTA 1E1QA 4X06A 3H9NA 1PKVA 1YLOA 4B3GA 3OZUA 3A8JA 1KK3A 3QFTA 3CC4B 1D2EA 1KZLA 1IJFA 1Q86D 1R5NA 1W34A 3I1FA 2V7VA 4TT3A 4P12A 5DS0A 1NJID 1B23P 4YEJA 1UD5A 4Y7CA 4WQMA 3CPWB 2WSSA 1QUFA 1EP3B 2VZLA 3DDYA 2ZXIA 3FPKA 1FNCA 4XORA 4QUZA 1N08A 2C5HA 3CW2A 4G1VA 1BX0A 4H9GA 4X7CA 3W2IA 1Y0RA 5KSWB 4P1VA 2YWEA 1OGJA 1VF7A 1H85A 2V4DA 1YJNB 2CNDA 3LQ6A 3SLNA 5FO0A 2V7XA 4B4DA 1JJ2B 3B82A 3KL9A 4WZKA 3SLDA 1SKYB 2XNDA 2BMWA 2XGJA 3CCQB 5AN9A 1PJ6A 3AVXA 2C5BA 1XB2A 4PC1A 3SKBA 1FNBA 1VQ7B 4NBSA 3CCJB 1DDGA 4TMXA 4X07A 2NV4A 1FRQA 4PC6A 1W0KA 4B3XA 3QE2A 1VQ6B 4WWVA 1JA0A 4K1XA 2YWHA 4EH1A 3JU4A 2DEUA 4Z4YA 2BN4A 3FJOA 1W9XA 4P22A 2QA4B
chains in the Genus database with same CATH topology
5E6TA 5IYWA 4OPOA 4WZLA 4OOXA 5F4JA 4Z4SA 3ASQA 4RDLA 3BY1A 3SEJA 4P26A 2OBTA 4QV2A 5IYNA 3PUNA 4RDKA 5BSYA 3ASSA 3ONYA 5IYPA 4ROXA 5IYQA 4WZEA 4Z4RA 5BSXA 2ZL5A 4WZTA 3BY2A 3R6JA 5J3OA 5J35A 3Q38A 3PA1A 4OP7A 4RLZA 3PUMA 5F4OA 4RPDA 3LQEA 3Q6RA 5KW9A 2ZL7A 4OOSA 3V7AA 5F4MA 4QVJA 4Z4WA 4Z4ZA 4X7EA 5HZBA 4X06A 4OOVA 3RY8A 4QVAA 3PVDA 2OBSA 3R6KA 4P12A 4RM0A 4X7DA 3Q39A 4Z4UA 3PA2A 4OPSA 3ASPA 2ZL6A 4P25A 5IYRA 4RPBA 4QUZA 5HZAA 4X7CA 3ONUA 3ASRA 4P1VA 4Z4VA 2OBRA 3LQ6A 1IHMA 4P3IA 4Z4TA 3SLNA 3BQJA 4X7FA 4X0CA 4P2NA 4WZKA 3SLDA 3Q3AA 3SKBA 3D26A 3ASTA 3SJPA 4X07A 4OPVA 4RDJA 4Z4YA 3Q6QA 4X05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E6T A;  5IYW A;  4OPO A;  4WZL A;  4OOX A;  5F4J A;  4Z4S A;  3ASQ A;  4RDL A;  3BY1 A;  3SEJ A;  4P26 A;  2OBT A;  4QV2 A;  5IYN A;  3PUN A;  4RDK A;  5BSY A;  3ASS A;  3ONY A;  5IYP A;  4ROX A;  5IYQ A;  4WZE A;  4Z4R A;  5BSX A;  2ZL5 A;  4WZT A;  3BY2 A;  3R6J A;  5J3O A;  5J35 A;  3Q38 A;  3PA1 A;  4OP7 A;  4RLZ A;  3PUM A;  5F4O A;  4RPD A;  3LQE A;  3Q6R A;  5KW9 A;  2ZL7 A;  4OOS A;  3V7A A;  5F4M A;  4QVJ A;  4Z4W A;  4Z4Z A;  4X7E A;  5HZB A;  4X06 A;  4OOV A;  3RY8 A;  4QVA A;  3PVD A;  2OBS A;  3R6K A;  4P12 A;  4RM0 A;  4X7D A;  3Q39 A;  4Z4U A;  3PA2 A;  4OPS A;  3ASP A;  2ZL6 A;  4P25 A;  5IYR A;  4RPB A;  4QUZ A;  5HZA A;  4X7C A;  3ONU A;  3ASR A;  4P1V A;  4Z4V A;  2OBR A;  3LQ6 A;  1IHM A;  4P3I A;  4Z4T A;  3SLN A;  3BQJ A;  4X7F A;  4X0C A;  4P2N A;  4WZK A;  3SLD A;  3Q3A A;  3SKB A;  3D26 A;  3AST A;  3SJP A;  4X07 A;  4OPV A;  4RDJ A;  4Z4Y A;  3Q6Q A;  4X05 A; 
#chains in the Genus database with same CATH topology
 3W5V A;  1XFO A;  3OFN A;  4XLF A;  3A3B A;  2HLD A;  4OOX A;  4ZCI A;  5F4J A;  2D74 A;  4Y9R A;  4Z4S A;  2BPO A;  3SEJ A;  1UD8 A;  2BGI A;  1B2R A;  4XN0 A;  2QTZ A;  1T6Z A;  2OK8 A;  3BC9 A;  3CES A;  4P26 A;  4XOT A;  4AC9 A;  4N3G A;  5HXB A;  1BPL A;  5KNL A;  4RDK A;  4XLA A;  1W0J A;  3ZBT A;  5BSY A;  3CCM B;  4QHY A;  1EFR A;  2ZZE A;  5FNZ A;  2DOG A;  4M2L A;  4XLC A;  4XNF A;  4LBW A;  4CQJ A;  1G7R A;  5FIU A;  3I55 B;  4WZT A;  2LZJ A;  2BGJ A;  1CQX A;  2GK6 A;  1H42 A;  3CCL B;  2X3U A;  5JBQ A;  3R6J A;  3JQR A;  4ZCL A;  1QGY A;  3PA1 A;  2J7K A;  1MRZ A;  2V7W A;  1AMO A;  1QVF B;  1V5V A;  4RLZ A;  2QGG A;  3CCR B;  2DCU A;  1YJW B;  1SM4 A;  5F4O A;  4RPD A;  3OJX A;  2X85 A;  3OZW A;  3VNV A;  1KTV A;  1G7S A;  3Q6R A;  1DDI A;  2PIA A;  1E3Z A;  3H94 A;  4KKU A;  3V7A A;  2ZBU A;  1M1K D;  3U2Q A;  1M90 D;  1FND A;  5CDF A;  3OW7 A;  2GJP A;  2VNH A;  2GPJ A;  1VQO B;  4NNJ A;  4X7E A;  5A89 A;  2F1M A;  3ZZU A;  2WJY A;  3GVJ A;  4RD0 A;  1KD1 D;  1UD3 A;  4ZCM A;  3NE5 B;  1EFC A;  2JDI A;  3ISX A;  4GQN A;  3MHP A;  2QN6 A;  1ZM2 A;  4TMV A;  2CW5 A;  3OPO A;  4HE5 A;  1EP2 B;  5H5J A;  5DSZ A;  4M53 A;  1S72 B;  4RD1 A;  3CC7 B;  2V7U A;  1QFJ A;  3Q39 A;  1FDR A;  1JB9 A;  4Z4U A;  2JIZ A;  3J81 k;  1VQ4 B;  1P4M A;  4P3Y A;  3GQB A;  1DG1 G;  3OE7 A;  1D1N A;  3OEH A;  2E1B A;  2JJ1 A;  2OK7 A;  1E79 A;  1N06 A;  3ONU A;  1NRK A;  3OKX A;  4Z4V A;  2VNK A;  1AIP A;  4YAU A;  5B6I A;  3JQQ A;  4L8J A;  3KEW A;  1UD4 A;  3BQJ A;  2Q6K A;  2YWF A;  2OTJ B;  3CP2 A;  5A8A A;  3VR6 A;  2VBU A;  4XLH A;  2XZL A;  3ZZ0 A;  3AST A;  1XQB A;  2R6H A;  2VNJ A;  3A3G A;  2GRE A;  4OPV A;  1E43 A;  3B8H A;  4RDJ A;  1QG0 A;  4JMQ A;  4B3F X;  5HKK A;  1WDT A;  2DYI A;  3MCA A;  1IJE A;  4TMT A;  1UD2 A;  3WNB A;  5LMZ A;  4U9U A;  2DIE A;  4X05 A;  1UMK A;  2C2W A;  1VQN B;  2CRV A;  4ZGN B;  4UZF A;  5IYW A;  1YX2 A;  4WZL A;  2B7C A;  2ZZQ A;  4RCY A;  4KKS A;  1N8R D;  2EFG A;  1E64 A;  1QFY A;  4M0L A;  3W5U A;  3WNC A;  3ASQ A;  4DNT B;  1TTT A;  2Z6B D;  2C4U A;  1NDH A;  1W87 A;  2OBT A;  4QV2 A;  4ZGQ B;  4P6Y A;  1GAW A;  1NB9 A;  5H59 A;  2RC6 A;  5A88 A;  1KK1 A;  1VHO A;  4KKT A;  2GK7 A;  1G7C A;  4J0Q A;  3CCS B;  1SKQ A;  1GAQ A;  3CCE B;  1H8H A;  3ASS A;  3FKS A;  2YWG A;  5IYQ A;  4WZE A;  3BH4 A;  4YEL A;  2DER A;  2V7Q A;  4TMW A;  4AVZ A;  1VLY A;  2VJJ A;  3OJW A;  5J35 A;  2AHO A;  5FO1 A;  2C4T A;  1T6X A;  4PAB A;  2ZTN A;  4P9S A;  1A8P A;  3LQE A;  1YI2 B;  4RCZ A;  2F1L A;  2C78 A;  1OB0 A;  3JQP A;  3ZIA A;  2DET A;  2VJI A;  2X6W A;  1BQE A;  4N3N A;  4XR6 A;  5F4M A;  4Z1M A;  1WSV A;  4QVJ A;  2XZO A;  1YIT B;  5DN6 A;  3HAG A;  1EWY A;  3CRZ A;  1TUI A;  1ZUN B;  2BM1 A;  4OOV A;  4XON A;  4YHB A;  4C43 A;  1W35 A;  4AF6 A;  3RY8 A;  4XL9 A;  1W2B B;  1IB0 A;  1E62 A;  2ZTG A;  1XE1 A;  2OBS A;  2E1R A;  1VLO A;  4ACB A;  3CP8 A;  4B47 A;  1QUE A;  1QX4 A;  1COW A;  4X7D A;  4G7W A;  1MAB A;  2V31 A;  3PA2 A;  4TKO B;  2C77 A;  5TRD A;  4II2 A;  2ZZG A;  3ASP A;  5IYR A;  2Q6O A;  1VQM B;  1S0U A;  1HVX A;  3VO2 A;  4YAL A;  3LO8 A;  2X6Y A;  3GSI A;  2NPF A;  1G7T A;  1IHM A;  4DK1 A;  1ELO A;  2PLF A;  4C0S A;  4X7F A;  2QDX A;  4P2N A;  4AF7 A;  4Q7J B;  2GJK A;  1QFZ A;  2W6J A;  3VNU A;  1GJR A;  1TLL A;  1Y0Y A;  2V7T A;  2QTL A;  5GV8 A;  1FRN A;  1TVC A;  2F43 A;  3OP1 A;  4PAA A;  1GR1 A;  1RQP A;  2Q6I A;  1HA3 A;  1PJ5 A;  2ZZF A;  1KK2 A;  3SJP A;  4BPR A;  1QGA A;  3U6K A;  1WOR A;  2HMA A;  3OZV A;  4FK8 A;  4Y9U A;  1KRH A;  3OW2 B;  2OTL B;  3ZC3 A;  3Q6Q A;  5FL7 A;  3AGQ A;  3A1P A;  4Z4W A;  1RQR A;  2WZN A;  3CMM A;  4F7D A;  1N07 A;  4P6V F;  2WZP P;  2DY1 A;  3V76 A;  5E6T A;  2FX3 A;  3FPP A;  4OPO A;  3T56 B;  5GV7 A;  4UAJ A;  3OOC A;  2VBS A;  4G1B A;  4DK0 A;  4RD4 A;  4LBY A;  1WP6 A;  3E20 A;  2BSA A;  4X8I A;  4RDL A;  5IK2 A;  1GVH A;  1KMH A;  2XNJ A;  4XKW A;  4XMY A;  1I7P A;  3G71 B;  1JNY A;  4PC7 A;  4B43 A;  5IYN A;  5THX A;  3PUN A;  4UZE A;  1K8A D;  3G6E B;  4ACA A;  1CNE A;  1KK0 A;  1H8E A;  1D8T A;  3CME B;  3AVW A;  4RD3 A;  1ZM3 A;  3BCD A;  4DQK A;  3ES9 A;  2GQF A;  3CD6 B;  1NB0 A;  3A35 A;  1BMF A;  2HDN B;  1ZM9 A;  4XKV A;  1I8D A;  1GO2 A;  2XEX A;  1VQ5 B;  1EP1 B;  2D3L A;  1WOS A;  3BY2 A;  5J3O A;  4DNR B;  2OYN A;  5L46 A;  4G7X A;  4OP7 A;  1UD6 A;  3LVB A;  3PUM A;  4XD7 A;  3A8K A;  4UZU A;  4XQF A;  1VQ9 B;  4ZV4 A;  4YXW A;  1WPC A;  3OEE A;  2X8K A;  1PJ7 A;  5KW9 A;  2ZL7 A;  3U6B A;  2CC2 A;  2X6X A;  4OOS A;  1VQL B;  2VBT A;  1QVG B;  1FX0 A;  1Q7Y D;  4YAO A;  1F60 A;  2QEX B;  1E63 A;  3VO1 A;  1DAR A;  4Z4Z A;  1BLI A;  5HZB A;  1Q82 D;  4II3 A;  4TN1 A;  4MYU A;  1OB5 A;  1E3X A;  1OHH A;  2W6I A;  3W2H A;  1YHQ B;  4B48 A;  4QVA A;  2BF4 A;  3AGP A;  1V0E A;  3ZZT A;  3PVD A;  3AVU A;  2P3M A;  3R6K A;  3CPX A;  1KJZ A;  3I56 B;  1YJ9 B;  3B78 A;  4HE6 A;  3SJZ A;  1KQS B;  1BJK A;  2WYR A;  1QGZ A;  4RM0 A;  2XOK A;  2PMD A;  1EXM A;  4OPS A;  3QSY A;  4FN5 A;  3W2G A;  1YIJ B;  4LBV A;  2ZL6 A;  3GIR A;  4P25 A;  4G6I A;  3W2F A;  3ZUG A;  4RPB A;  4NCN A;  3CTA A;  5HZA A;  1S4M A;  4XN3 A;  1N05 A;  5TY0 A;  2Q6L A;  3ASR A;  3T53 B;  2OBR A;  1K28 D;  2CBX A;  2BM0 A;  3AVT A;  4P3I A;  4Z4T A;  2M5S A;  4PC2 A;  2R9V A;  3LNN A;  2VBV A;  4X0C A;  1CNF A;  1F20 A;  4G5G A;  3G4S B;  2B5O A;  2EIX A;  3WQZ A;  3Q3A A;  2BVN A;  2HCJ B;  3QFR A;  1R5B A;  1WU8 A;  3WBK A;  2CF4 A;  1T6Y A;  3D26 A;  4TSF A;  1WSR A;  1J9Z A;  4RD2 A;  3WND A;  1U2R A;  2ZXH A;  1VQP B;  4FXU A;  3CMA B;  3CC2 B;  3W5H A;  2VYQ A;  3CXC B;  1I18 A;  2B7B A;  3ZPN A;  4B44 A;  1EFU A;  3GVK A;  3PEN A;  2CK3 A;  1QH0 A;  4YAF A;  1OGI A;  2F4N A;  3WY9 A;  1VJS A;  2D9R A;  2FVG A;  4YAW A;  3A8I A;  3WXM A;  4HIZ A;  4TMZ A;  2VNI A;  5TR9 A;  3CB4 A;  1NBM A;  4DQL A;  3VMF A;  3BY1 A;  2QMU A;  5TV2 A;  4MYT A;  2X53 S;  3WBJ A;  2QE7 A;  3QFC A;  4E0F A;  4FWT A;  1K73 D;  3P27 A;  4QFM A;  1V0F A;  3CCU B;  2ZIT A;  4RJL A;  4XM3 A;  3P26 A;  1VQK B;  1R5O A;  2XZP A;  1Q81 D;  2RC5 A;  1BX1 A;  3ZBU A;  3AVY A;  1ZM4 A;  2WR8 A;  2GJR A;  2JJ2 A;  3ONY A;  5IYP A;  1N0U A;  4ROX A;  3WYA A;  2JN9 A;  4Z4R A;  3W2E A;  2BV3 A;  3GVL A;  2WJV A;  4PGO A;  1T5E A;  5BSX A;  2ZL5 A;  1WOO A;  2PE3 A;  2I1L A;  2KVO A;  1FNM A;  4LC0 A;  4LBZ A;  1N0V C;  2ZBV A;  3BNW A;  1JA1 A;  2WPD A;  1WOP A;  3Q38 A;  5EMN A;  3OAA A;  1KC8 D;  1VHE A;  2D3N A;  4ASU A;  3E1Y E;  4IW3 B;  3T51 B;  3MMP A;  3AVV A;  1K9M D;  1WTH D;  4R71 A;  1E1R A;  1HZE A;  1OB2 A;  3G05 A;  4XLE A;  4RD6 A;  4XOP A;  4M4S A;  2XNC A;  3CCV B;  4M1K A;  2X0K A;  4PC3 A;  5FA6 A;  1Q9S A;  3QFS A;  3BCF A;  1VQ8 B;  1EFT A;  1E1Q A;  4X06 A;  3H9N A;  1PKV A;  1YLO A;  4B3G A;  3OZU A;  3A8J A;  1KK3 A;  3QFT A;  3CC4 B;  1D2E A;  1KZL A;  1IJF A;  1Q86 D;  1R5N A;  1W34 A;  3I1F A;  2V7V A;  4TT3 A;  4P12 A;  5DS0 A;  1NJI D;  1B23 P;  4YEJ A;  1UD5 A;  4Y7C A;  4WQM A;  3CPW B;  2WSS A;  1QUF A;  1EP3 B;  2VZL A;  3DDY A;  2ZXI A;  3FPK A;  1FNC A;  4XOR A;  4QUZ A;  1N08 A;  2C5H A;  3CW2 A;  4G1V A;  1BX0 A;  4H9G A;  4X7C A;  3W2I A;  1Y0R A;  5KSW B;  4P1V A;  2YWE A;  1OGJ A;  1VF7 A;  1H85 A;  2V4D A;  1YJN B;  2CND A;  3LQ6 A;  3SLN A;  5FO0 A;  2V7X A;  4B4D A;  1JJ2 B;  3B82 A;  3KL9 A;  4WZK A;  3SLD A;  1SKY B;  2XND A;  2BMW A;  2XGJ A;  3CCQ B;  5AN9 A;  1PJ6 A;  3AVX A;  2C5B A;  1XB2 A;  4PC1 A;  3SKB A;  1FNB A;  1VQ7 B;  4NBS A;  3CCJ B;  1DDG A;  4TMX A;  4X07 A;  2NV4 A;  1FRQ A;  4PC6 A;  1W0K A;  4B3X A;  3QE2 A;  1VQ6 B;  4WWV A;  1JA0 A;  4K1X A;  2YWH A;  4EH1 A;  3JU4 A;  2DEU A;  4Z4Y A;  2BN4 A;  3FJO A;  1W9X A;  4P22 A;  2QA4 B; 
#chains in the Genus database with same CATH homology
 5E6T A;  5IYW A;  4OPO A;  4WZL A;  4OOX A;  5F4J A;  4Z4S A;  3ASQ A;  4RDL A;  3BY1 A;  3SEJ A;  4P26 A;  2OBT A;  4QV2 A;  5IYN A;  3PUN A;  4RDK A;  5BSY A;  3ASS A;  3ONY A;  5IYP A;  4ROX A;  5IYQ A;  4WZE A;  4Z4R A;  5BSX A;  2ZL5 A;  4WZT A;  3BY2 A;  3R6J A;  5J3O A;  5J35 A;  3Q38 A;  3PA1 A;  4OP7 A;  4RLZ A;  3PUM A;  5F4O A;  4RPD A;  3LQE A;  3Q6R A;  5KW9 A;  2ZL7 A;  4OOS A;  3V7A A;  5F4M A;  4QVJ A;  4Z4W A;  4Z4Z A;  4X7E A;  5HZB A;  4X06 A;  4OOV A;  3RY8 A;  4QVA A;  3PVD A;  2OBS A;  3R6K A;  4P12 A;  4RM0 A;  4X7D A;  3Q39 A;  4Z4U A;  3PA2 A;  4OPS A;  3ASP A;  2ZL6 A;  4P25 A;  5IYR A;  4RPB A;  4QUZ A;  5HZA A;  4X7C A;  3ONU A;  3ASR A;  4P1V A;  4Z4V A;  2OBR A;  3LQ6 A;  1IHM A;  4P3I A;  4Z4T A;  3SLN A;  3BQJ A;  4X7F A;  4X0C A;  4P2N A;  4WZK A;  3SLD A;  3Q3A A;  3SKB A;  3D26 A;  3AST A;  3SJP A;  4X07 A;  4OPV A;  4RDJ A;  4Z4Y A;  3Q6Q A;  4X05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...