5BSXA

Crystal structure of gii.10 p domain in complex with disinfectant puregreen24
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
314
structure length
308
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Treatment of norovirus particles with citrate.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 66
structure length 308
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5bsxA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5bsxA01
4P25A 4OOSA 4OPOA 3D26A 5IYNA 5E6TA 3PVDA 3R6KA 4WZEA 4RM0A 3PA2A 3BQJA 4OPVA 5F4OA 4ROXA 3ASRA 3Q39A 4OOVA 4X05A 4WZTA 3Q3AA 4X7EA 4Z4RA 4Z4SA 4QUZA 4X7CA 4OPSA 3ONUA 3RY8A 1IHMA 3ASTA 3SKBA 4P26A 3Q38A 3ASPA 4P3IA 4X06A 2OBRA 4P12A 4QVAA 5IYRA 4Z4UA 4RDJA 4Z4TA 4X7FA 3ASQA 4OOXA 4QV2A 5KW9A 4RPDA 2ZL7A 4X0CA 3LQEA 3LQ6A 3V7AA 5F4MA 3BY1A 4Z4VA 5IYWA 3PUNA 5IYPA 4Z4WA 3Q6RA 4RPBA 3SLDA 5HZAA 5BSYA 2ZL5A 4P2NA 5J3OA 3PA1A 4X7DA 4RDLA 3SJPA 4QVJA 2ZL6A 5J35A 4Z4YA 2OBTA 3ONYA 3SEJA 3R6JA 4OP7A 4P1VA 4WZKA 3ASSA 3Q6QA 5IYQA 3BY2A 4RDKA 5HZBA 4X07A 4RLZA 5BSXA 3PUMA 2OBSA 4WZLA 5F4JA 4Z4ZA 3SLNA
chains in the Genus database with same CATH superfamily
2EFGA 2B7BA 1KZLA 3PENA 1CNFA 4Z1MA 2R6HA 2J7KA 2BF4A 5E6TA 1YI2B 3ZBTA 3WBKA 2V7WA 2X85A 4XLEA 2PIAA 3CMAB 4PC3A 1E64A 4LC0A 1E3ZA 3GVKA 3H9NA 1BMFA 2QDXA 1NDHA 2HDNB 3OZUA 1FNMA 3BNWA 3GSIA 3QFCA 1QFZA 3H94A 3CCLB 5F4OA 4ROXA 3OFNA 1SKYB 3OOCA 1OGJA 4WZTA 2VYQA 2GPJA 4YAWA 2NPFA 1UD3A 2LZJA 2CK3A 1VQ4B 3AVVA 2JJ1A 4P6VF 4N3NA 1DG1G 2V7UA 1MABA 2HMAA 3JQPA 4PABA 4TN1A 3CCMB 1QG0A 3ASTA 1QGZA 3VNUA 3CC7B 1W0JA 3Q38A 2XNDA 1BJKA 4G5GA 1VQNB 4X06A 2BPOA 1RQRA 2CF4A 4QVAA 5IYRA 2XNJA 1B23P 3U6KA 3FJOA 4B3FX 2QTLA 4LBWA 5LMZA 3ASQA 1N08A 3WNDA 3OAAA 2OK8A 2C5BA 3GIRA 1QUEA 2DOGA 2ZL7A 1KMHA 3G05A 1YJWB 2C77A 2HLDA 2ZXIA 1G7SA 3LQEA 4B48A 1HA3A 1TLLA 2C2WA 2VNIA 4Y7CA 3FPKA 2PLFA 3AVWA 2X6YA 4UZUA 3CCJB 1VQMB 1W2BB 5DSZA 2XGJA 4YAOA 3SLDA 5HZAA 4RJLA 1VQOB 2KVOA 4LBYA 4XNFA 2F43A 5TY0A 1FNBA 1Y0YA 2GREA 4GQNA 1QVGB 2DCUA 2V7TA 2ZZGA 2X0KA 2OK7A 4G1VA 5A8AA 4DK0A 4XD7A 1WTHD 4X7DA 1WSVA 1VQLB 4TSFA 3W2GA 3CCSB 3I56B 2QGGA 4QVJA 1T6ZA 4U9UA 3ONYA 1Q82D 1GJRA 1VLYA 2DYIA 3R6JA 4XN3A 4AC9A 4P1VA 1SM4A 4WZKA 2DY1A 1G7TA 1VQ7B 3AVTA 2VBSA 3E20A 4HIZA 2HCJB 5HZBA 4K1XA 3CESA 4XOTA 1QUFA 1EWYA 3ZZUA 1N05A 2BGJA 4MYUA 4HE6A 1AMOA 2PMDA 3A3GA 1COWA 5F4JA 4ZGNB 2V7QA 5DS0A 1JB9A 4XONA 4RD0A 1N8RD 2E1RA 3KL9A 2GK7A 2OTLB 3OJWA 4TMZA 1VHOA 4TT3A 4FN5A 4OOSA 3D26A 5FO1A 1MRZA 3WBJA 4XR6A 3QSYA 2V4DA 2ZXHA 4XL9A 1WOSA 3U2QA 1VLOA 2BVNA 2M5SA 1NRKA 3R6KA 5HKKA 4WZEA 4RM0A 1JNYA 1HZEA 3NE5B 1EFUA 5FA6A 1H42A 4ZCIA 1OGIA 2D3NA 2I1LA 2Q6LA 3OE7A 1S0UA 2WSSA 3CRZA 5FL7A 3W2EA 1J9ZA 2WZNA 4L8JA 1FNCA 3QFRA 1E1QA 1H8HA 3Q39A 1XFOA 3ZZTA 3G6EB 5TRDA 4X05A 1OB0A 4DK1A 1TTTA 1W35A 1E3XA 1BX0A 1XB2A 3B82A 4X7EA 1NB9A 3V76A 4KKUA 4DQKA 1VQPB 1JJ2B 4X7CA 1W87A 1XQBA 2P3MA 3CB4A 1YJNB 4YEJA 4OPSA 2OTJB 1Q86D 3QFSA 4LBVA 3E1YE 4AF6A 1E63A 4P26A 3WNCA 4RD3A 1ZM9A 2BSAA 4C0SA 2BMWA 4P3IA 2QE7A 3BH4A 1QFJA 2YWHA 3QE2A 1FNDA 4Z4UA 3JQRA 1KJZA 1VQ6B 1EFRA 1GAWA 4MYTA 1W0KA 3LNNA 2W6IA 4M2LA 4OOXA 3ZZ0A 4RPDA 4G1BA 4X0CA 2VBTA 4NNJA 2ZTNA 3BY1A 3MHPA 4Z4VA 5GV7A 2D3LA 1YHQB 1IJEA 2BGIA 3U6BA 4WWVA 5JBQA 3Q6RA 1HVXA 4RPBA 4WQMA 3W5HA 5BSYA 3OW2B 1S4MA 3SJZA 2ZL5A 1DDGA 3OEEA 5A88A 4P2NA 3W5UA 1G7CA 4ZCMA 5J3OA 1R5BA 1GO2A 1KK3A 1QGYA 4KKTA 3VO2A 4RCZA 4EH1A 3A1PA 1WPCA 1UD8A 5FIUA 4RD1A 4B4DA 4F7DA 1E79A 3SJPA 1EP1B 3BCDA 2GJRA 5J35A 1QH0A 4XKWA 3SEJA 2BM1A 1BQEA 1QX4A 3OW7A 1UD5A 1GR1A 3CW2A 2WYRA 1KQSB 2D74A 3WQZA 3Q6QA 4FWTA 5IYQA 3CTAA 1AIPA 1GAQA 2X53S 4FK8A 4XMYA 1EFTA 4PC2A 2GJKA 4II3A 4XOPA 4RLZA 2VJJA 1PKVA 5BSXA 5GV8A 3CPWB 2BN4A 2XZPA 4FXUA 2OBSA 4YXWA 3AGQA 2WZPP 1ZM2A 1XE1A 4H9GA 4LBZA 2VBVA 1KK0A 2VBUA 3MMPA 3W2HA 1YITB 4RD2A 2B7CA 1T5EA 1KK2A 5IK2A 1H85A 2XZLA 1QFYA 2BV3A 4OPOA 4BPRA 4ZV4A 1NBMA 1WOOA 1SKQA 1K73D 4ACBA 4YHBA 1PJ7A 1ELOA 2VZLA 4B44A 2CC2A 3QFTA 2QTZA 1EFCA 3BCFA 3J81k 1V0EA 4TKOB 2X6XA 4PAAA 3KEWA 2XEXA 4G7WA 1F20A 2RC6A 1H8EA 4XLFA 3CCVB 1YX2A 1D1NA 1IJFA 1VQ8B 1VF7A 3PA2A 4DNRB 4N3GA 2C5HA 3ZPNA 1Q81D 3ZIAA 2XZOA 5B6IA 4OPVA 1G7RA 3ASRA 2ZZQA 5TV2A 4TMVA 2RC5A 4OOVA 1S72B 4Z4RA 1FRNA 3WYAA 2JDIA 3A8JA 4Z4SA 4QUZA 2QN6A 1WOPA 2GJPA 3ONUA 4X8IA 2V7XA 3JU4A 3RY8A 3B8HA 2X8KA 1N06A 2WJYA 2JN9A 4XLCA 1I7PA 2C78A 3VMFA 2QA4B 4C43A 2NV4A 3OEHA 4P12A 1PJ6A 4RDJA 1WSRA 2CW5A 4M0LA 1FX0A 3CCRB 4RD4A 1FDRA 2B5OA 1YJ9B 3G4SB 1T6YA 1IB0A 4UZEA 1D8TA 4QV2A 4KKSA 5KW9A 3ZBUA 3CC4B 4Q7JB 4B3XA 4P9SA 3AVXA 4JMQA 1N07A 4R71A 1OB2A 3AVUA 4Y9RA 3T56B 3CCEB 2BM0A 4RD6A 4UZFA 4Z4WA 1P4MA 4J0QA 3AVYA 1RQPA 2D9RA 2X6WA 5THXA 4RCYA 2V7VA 2Q6OA 2WPDA 3OJXA 1BLIA 1E1RA 3VNVA 2WR8A 1QVFB 1K8AD 3PA1A 1WDTA 2C4UA 4XLHA 3LO8A 4YELA 4ZGQB 1Q7YD 4RDLA 5CDFA 4XLAA 2JIZA 2DERA 2ZL6A 1TUIA 2OBTA 3FKSA 3GVLA 1PJ5A 4XORA 5KSWB 2CNDA 2VNJA 1UD2A 4YAUA 1VQKB 3JQQA 4PC7A 4X07A 2VNKA 2QMUA 2DEUA 1BX1A 1F60A 4XKVA 3T51B 3ZUGA 5HXBA 4NBSA 1D2EA 4ASUA 4Z4ZA 3SLNA 1W9XA 5TR9A 2YWFA 4P25A 2Q6IA 4PGOA 5IYNA 2ZBUA 3W2FA 2DIEA 2F1LA 3P26A 4ZCLA 1YIJB 4ACAA 2JJ2A 2ZBVA 3CMMA 1K9MD 4TMXA 1VQ5B 3PVDA 3I1FA 1E43A 1B2RA 1FRQA 2EIXA 3ZC3A 1NJID 1KC8D 1CNEA 4XM3A 1VQ9B 1UMKA 3A8IA 1OB5A 3GQBA 1WU8A 3CD6B 2E1BA 1EXMA 3CP2A 3AGPA 2ZZFA 1UD4A 3BQJA 3WY9A 4DNTB 5L46A 5AN9A 1R5OA 3OZVA 4TMWA 2XNCA 2CBXA 1EP2B 2FVGA 2X3UA 4P22A 2AHOA 2FX3A 1YLOA 1ZM4A 2VJIA 3ISXA 4P6YA 4QFMA 4AF7A 3CP8A 1Q9SA 3MCAA 2VNHA 2YWGA 3Q3AA 2F4NA 3HAGA 4TMTA 1T6XA 4HE5A 1N0UA 1UD6A 4G6IA 3OZWA 4PC1A 5KNLA 2GK6A 4G7XA 1IHMA 1I8DA 3A3BA 3SKBA 1BPLA 4UAJA 3ASPA 3A8KA 2ZITA 2OBRA 1QGAA 3LVBA 2F1MA 3GVJA 1WORA 3OPOA 5H59A 1I18A 3CCUB 4CQJA 3CMEB 4P3YA 1N0VC 1R5NA 3CCQB 1VHEA 2DETA 4Z4TA 4QHYA 1KK1A 1W34A 5DN6A 4IW3B 4B43A 3W2IA 3I55B 1GVHA 4X7FA 4YAFA 1KD1D 2ZTGA 4PC6A 1A8PA 5A89A 3VO1A 1WP6A 3LQ6A 3V7AA 1V5VA 5H5JA 5F4MA 1JA1A 5IYWA 3PUNA 4M1KA 4AVZA 4XQFA 1K28D 5IYPA 3FPPA 1VJSA 2W6JA 4M53A 5EMNA 3DDYA 3CC2B 1DARA 1EP3B 1DDIA 3W5VA 2PE3A 3T53B 2WJVA 2YWEA 5FO0A 3B78A 2Z6BD 3WNBA 1M1KD 4E0FA 2V31A 2ZZEA 2QEXB 1U2RA 1V0FA 1KRHA 2GQFA 4XN0A 3OP1A 3OKXA 4Z4YA 2C4TA 3VR6A 4II2A 1OHHA 1KTVA 4OP7A 1ZM3A 4B47A 1JA0A 4YALA 1Y0RA 3ASSA 3CXCB 1ZUNB 3WXMA 3BY2A 1CQXA 2R9VA 3BC9A 4RDKA 5FNZA 4DQLA 4B3GA 3ES9A 3CPXA 3PUMA 4NCNA 4WZLA 3G71B 2CRVA 2Q6KA 4M4SA 2OYNA 2XOKA 1M90D 3A35A 4Y9UA 3P27A 1TVCA 1NB0A 1E62A
chains in the Genus database with same CATH topology
4P25A 4OOSA 4OPOA 3D26A 5IYNA 5E6TA 3PVDA 3R6KA 4WZEA 4RM0A 3PA2A 3BQJA 4OPVA 5F4OA 4ROXA 3ASRA 3Q39A 4OOVA 4X05A 4WZTA 3Q3AA 4X7EA 4Z4RA 4Z4SA 4QUZA 4X7CA 4OPSA 3ONUA 3RY8A 1IHMA 3ASTA 3SKBA 4P26A 3Q38A 3ASPA 4P3IA 4X06A 2OBRA 4P12A 4QVAA 5IYRA 4Z4UA 4RDJA 4Z4TA 4X7FA 3ASQA 4OOXA 4QV2A 5KW9A 4RPDA 2ZL7A 4X0CA 3LQEA 3LQ6A 3V7AA 5F4MA 3BY1A 4Z4VA 5IYWA 3PUNA 5IYPA 4Z4WA 3Q6RA 4RPBA 3SLDA 5HZAA 5BSYA 2ZL5A 4P2NA 5J3OA 3PA1A 4X7DA 4RDLA 3SJPA 4QVJA 2ZL6A 5J35A 4Z4YA 2OBTA 3ONYA 3SEJA 3R6JA 4OP7A 4P1VA 4WZKA 3ASSA 3Q6QA 5IYQA 3BY2A 4RDKA 5HZBA 4X07A 4RLZA 5BSXA 3PUMA 2OBSA 4WZLA 5F4JA 4Z4ZA 3SLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P25 A;  4OOS A;  4OPO A;  3D26 A;  5IYN A;  5E6T A;  3PVD A;  3R6K A;  4WZE A;  4RM0 A;  3PA2 A;  3BQJ A;  4OPV A;  5F4O A;  4ROX A;  3ASR A;  3Q39 A;  4OOV A;  4X05 A;  4WZT A;  3Q3A A;  4X7E A;  4Z4R A;  4Z4S A;  4QUZ A;  4X7C A;  4OPS A;  3ONU A;  3RY8 A;  1IHM A;  3AST A;  3SKB A;  4P26 A;  3Q38 A;  3ASP A;  4P3I A;  4X06 A;  2OBR A;  4P12 A;  4QVA A;  5IYR A;  4Z4U A;  4RDJ A;  4Z4T A;  4X7F A;  3ASQ A;  4OOX A;  4QV2 A;  5KW9 A;  4RPD A;  2ZL7 A;  4X0C A;  3LQE A;  3LQ6 A;  3V7A A;  5F4M A;  3BY1 A;  4Z4V A;  5IYW A;  3PUN A;  5IYP A;  4Z4W A;  3Q6R A;  4RPB A;  3SLD A;  5HZA A;  5BSY A;  2ZL5 A;  4P2N A;  5J3O A;  3PA1 A;  4X7D A;  4RDL A;  3SJP A;  4QVJ A;  2ZL6 A;  5J35 A;  4Z4Y A;  2OBT A;  3ONY A;  3SEJ A;  3R6J A;  4OP7 A;  4P1V A;  4WZK A;  3ASS A;  3Q6Q A;  5IYQ A;  3BY2 A;  4RDK A;  5HZB A;  4X07 A;  4RLZ A;  5BSX A;  3PUM A;  2OBS A;  4WZL A;  5F4J A;  4Z4Z A;  3SLN A; 
#chains in the Genus database with same CATH topology
 2EFG A;  2B7B A;  1KZL A;  3PEN A;  1CNF A;  4Z1M A;  2R6H A;  2J7K A;  2BF4 A;  5E6T A;  1YI2 B;  3ZBT A;  3WBK A;  2V7W A;  2X85 A;  4XLE A;  2PIA A;  3CMA B;  4PC3 A;  1E64 A;  4LC0 A;  1E3Z A;  3GVK A;  3H9N A;  1BMF A;  2QDX A;  1NDH A;  2HDN B;  3OZU A;  1FNM A;  3BNW A;  3GSI A;  3QFC A;  1QFZ A;  3H94 A;  3CCL B;  5F4O A;  4ROX A;  3OFN A;  1SKY B;  3OOC A;  1OGJ A;  4WZT A;  2VYQ A;  2GPJ A;  4YAW A;  2NPF A;  1UD3 A;  2LZJ A;  2CK3 A;  1VQ4 B;  3AVV A;  2JJ1 A;  4P6V F;  4N3N A;  1DG1 G;  2V7U A;  1MAB A;  2HMA A;  3JQP A;  4PAB A;  4TN1 A;  3CCM B;  1QG0 A;  3AST A;  1QGZ A;  3VNU A;  3CC7 B;  1W0J A;  3Q38 A;  2XND A;  1BJK A;  4G5G A;  1VQN B;  4X06 A;  2BPO A;  1RQR A;  2CF4 A;  4QVA A;  5IYR A;  2XNJ A;  1B23 P;  3U6K A;  3FJO A;  4B3F X;  2QTL A;  4LBW A;  5LMZ A;  3ASQ A;  1N08 A;  3WND A;  3OAA A;  2OK8 A;  2C5B A;  3GIR A;  1QUE A;  2DOG A;  2ZL7 A;  1KMH A;  3G05 A;  1YJW B;  2C77 A;  2HLD A;  2ZXI A;  1G7S A;  3LQE A;  4B48 A;  1HA3 A;  1TLL A;  2C2W A;  2VNI A;  4Y7C A;  3FPK A;  2PLF A;  3AVW A;  2X6Y A;  4UZU A;  3CCJ B;  1VQM B;  1W2B B;  5DSZ A;  2XGJ A;  4YAO A;  3SLD A;  5HZA A;  4RJL A;  1VQO B;  2KVO A;  4LBY A;  4XNF A;  2F43 A;  5TY0 A;  1FNB A;  1Y0Y A;  2GRE A;  4GQN A;  1QVG B;  2DCU A;  2V7T A;  2ZZG A;  2X0K A;  2OK7 A;  4G1V A;  5A8A A;  4DK0 A;  4XD7 A;  1WTH D;  4X7D A;  1WSV A;  1VQL B;  4TSF A;  3W2G A;  3CCS B;  3I56 B;  2QGG A;  4QVJ A;  1T6Z A;  4U9U A;  3ONY A;  1Q82 D;  1GJR A;  1VLY A;  2DYI A;  3R6J A;  4XN3 A;  4AC9 A;  4P1V A;  1SM4 A;  4WZK A;  2DY1 A;  1G7T A;  1VQ7 B;  3AVT A;  2VBS A;  3E20 A;  4HIZ A;  2HCJ B;  5HZB A;  4K1X A;  3CES A;  4XOT A;  1QUF A;  1EWY A;  3ZZU A;  1N05 A;  2BGJ A;  4MYU A;  4HE6 A;  1AMO A;  2PMD A;  3A3G A;  1COW A;  5F4J A;  4ZGN B;  2V7Q A;  5DS0 A;  1JB9 A;  4XON A;  4RD0 A;  1N8R D;  2E1R A;  3KL9 A;  2GK7 A;  2OTL B;  3OJW A;  4TMZ A;  1VHO A;  4TT3 A;  4FN5 A;  4OOS A;  3D26 A;  5FO1 A;  1MRZ A;  3WBJ A;  4XR6 A;  3QSY A;  2V4D A;  2ZXH A;  4XL9 A;  1WOS A;  3U2Q A;  1VLO A;  2BVN A;  2M5S A;  1NRK A;  3R6K A;  5HKK A;  4WZE A;  4RM0 A;  1JNY A;  1HZE A;  3NE5 B;  1EFU A;  5FA6 A;  1H42 A;  4ZCI A;  1OGI A;  2D3N A;  2I1L A;  2Q6L A;  3OE7 A;  1S0U A;  2WSS A;  3CRZ A;  5FL7 A;  3W2E A;  1J9Z A;  2WZN A;  4L8J A;  1FNC A;  3QFR A;  1E1Q A;  1H8H A;  3Q39 A;  1XFO A;  3ZZT A;  3G6E B;  5TRD A;  4X05 A;  1OB0 A;  4DK1 A;  1TTT A;  1W35 A;  1E3X A;  1BX0 A;  1XB2 A;  3B82 A;  4X7E A;  1NB9 A;  3V76 A;  4KKU A;  4DQK A;  1VQP B;  1JJ2 B;  4X7C A;  1W87 A;  1XQB A;  2P3M A;  3CB4 A;  1YJN B;  4YEJ A;  4OPS A;  2OTJ B;  1Q86 D;  3QFS A;  4LBV A;  3E1Y E;  4AF6 A;  1E63 A;  4P26 A;  3WNC A;  4RD3 A;  1ZM9 A;  2BSA A;  4C0S A;  2BMW A;  4P3I A;  2QE7 A;  3BH4 A;  1QFJ A;  2YWH A;  3QE2 A;  1FND A;  4Z4U A;  3JQR A;  1KJZ A;  1VQ6 B;  1EFR A;  1GAW A;  4MYT A;  1W0K A;  3LNN A;  2W6I A;  4M2L A;  4OOX A;  3ZZ0 A;  4RPD A;  4G1B A;  4X0C A;  2VBT A;  4NNJ A;  2ZTN A;  3BY1 A;  3MHP A;  4Z4V A;  5GV7 A;  2D3L A;  1YHQ B;  1IJE A;  2BGI A;  3U6B A;  4WWV A;  5JBQ A;  3Q6R A;  1HVX A;  4RPB A;  4WQM A;  3W5H A;  5BSY A;  3OW2 B;  1S4M A;  3SJZ A;  2ZL5 A;  1DDG A;  3OEE A;  5A88 A;  4P2N A;  3W5U A;  1G7C A;  4ZCM A;  5J3O A;  1R5B A;  1GO2 A;  1KK3 A;  1QGY A;  4KKT A;  3VO2 A;  4RCZ A;  4EH1 A;  3A1P A;  1WPC A;  1UD8 A;  5FIU A;  4RD1 A;  4B4D A;  4F7D A;  1E79 A;  3SJP A;  1EP1 B;  3BCD A;  2GJR A;  5J35 A;  1QH0 A;  4XKW A;  3SEJ A;  2BM1 A;  1BQE A;  1QX4 A;  3OW7 A;  1UD5 A;  1GR1 A;  3CW2 A;  2WYR A;  1KQS B;  2D74 A;  3WQZ A;  3Q6Q A;  4FWT A;  5IYQ A;  3CTA A;  1AIP A;  1GAQ A;  2X53 S;  4FK8 A;  4XMY A;  1EFT A;  4PC2 A;  2GJK A;  4II3 A;  4XOP A;  4RLZ A;  2VJJ A;  1PKV A;  5BSX A;  5GV8 A;  3CPW B;  2BN4 A;  2XZP A;  4FXU A;  2OBS A;  4YXW A;  3AGQ A;  2WZP P;  1ZM2 A;  1XE1 A;  4H9G A;  4LBZ A;  2VBV A;  1KK0 A;  2VBU A;  3MMP A;  3W2H A;  1YIT B;  4RD2 A;  2B7C A;  1T5E A;  1KK2 A;  5IK2 A;  1H85 A;  2XZL A;  1QFY A;  2BV3 A;  4OPO A;  4BPR A;  4ZV4 A;  1NBM A;  1WOO A;  1SKQ A;  1K73 D;  4ACB A;  4YHB A;  1PJ7 A;  1ELO A;  2VZL A;  4B44 A;  2CC2 A;  3QFT A;  2QTZ A;  1EFC A;  3BCF A;  3J81 k;  1V0E A;  4TKO B;  2X6X A;  4PAA A;  3KEW A;  2XEX A;  4G7W A;  1F20 A;  2RC6 A;  1H8E A;  4XLF A;  3CCV B;  1YX2 A;  1D1N A;  1IJF A;  1VQ8 B;  1VF7 A;  3PA2 A;  4DNR B;  4N3G A;  2C5H A;  3ZPN A;  1Q81 D;  3ZIA A;  2XZO A;  5B6I A;  4OPV A;  1G7R A;  3ASR A;  2ZZQ A;  5TV2 A;  4TMV A;  2RC5 A;  4OOV A;  1S72 B;  4Z4R A;  1FRN A;  3WYA A;  2JDI A;  3A8J A;  4Z4S A;  4QUZ A;  2QN6 A;  1WOP A;  2GJP A;  3ONU A;  4X8I A;  2V7X A;  3JU4 A;  3RY8 A;  3B8H A;  2X8K A;  1N06 A;  2WJY A;  2JN9 A;  4XLC A;  1I7P A;  2C78 A;  3VMF A;  2QA4 B;  4C43 A;  2NV4 A;  3OEH A;  4P12 A;  1PJ6 A;  4RDJ A;  1WSR A;  2CW5 A;  4M0L A;  1FX0 A;  3CCR B;  4RD4 A;  1FDR A;  2B5O A;  1YJ9 B;  3G4S B;  1T6Y A;  1IB0 A;  4UZE A;  1D8T A;  4QV2 A;  4KKS A;  5KW9 A;  3ZBU A;  3CC4 B;  4Q7J B;  4B3X A;  4P9S A;  3AVX A;  4JMQ A;  1N07 A;  4R71 A;  1OB2 A;  3AVU A;  4Y9R A;  3T56 B;  3CCE B;  2BM0 A;  4RD6 A;  4UZF A;  4Z4W A;  1P4M A;  4J0Q A;  3AVY A;  1RQP A;  2D9R A;  2X6W A;  5THX A;  4RCY A;  2V7V A;  2Q6O A;  2WPD A;  3OJX A;  1BLI A;  1E1R A;  3VNV A;  2WR8 A;  1QVF B;  1K8A D;  3PA1 A;  1WDT A;  2C4U A;  4XLH A;  3LO8 A;  4YEL A;  4ZGQ B;  1Q7Y D;  4RDL A;  5CDF A;  4XLA A;  2JIZ A;  2DER A;  2ZL6 A;  1TUI A;  2OBT A;  3FKS A;  3GVL A;  1PJ5 A;  4XOR A;  5KSW B;  2CND A;  2VNJ A;  1UD2 A;  4YAU A;  1VQK B;  3JQQ A;  4PC7 A;  4X07 A;  2VNK A;  2QMU A;  2DEU A;  1BX1 A;  1F60 A;  4XKV A;  3T51 B;  3ZUG A;  5HXB A;  4NBS A;  1D2E A;  4ASU A;  4Z4Z A;  3SLN A;  1W9X A;  5TR9 A;  2YWF A;  4P25 A;  2Q6I A;  4PGO A;  5IYN A;  2ZBU A;  3W2F A;  2DIE A;  2F1L A;  3P26 A;  4ZCL A;  1YIJ B;  4ACA A;  2JJ2 A;  2ZBV A;  3CMM A;  1K9M D;  4TMX A;  1VQ5 B;  3PVD A;  3I1F A;  1E43 A;  1B2R A;  1FRQ A;  2EIX A;  3ZC3 A;  1NJI D;  1KC8 D;  1CNE A;  4XM3 A;  1VQ9 B;  1UMK A;  3A8I A;  1OB5 A;  3GQB A;  1WU8 A;  3CD6 B;  2E1B A;  1EXM A;  3CP2 A;  3AGP A;  2ZZF A;  1UD4 A;  3BQJ A;  3WY9 A;  4DNT B;  5L46 A;  5AN9 A;  1R5O A;  3OZV A;  4TMW A;  2XNC A;  2CBX A;  1EP2 B;  2FVG A;  2X3U A;  4P22 A;  2AHO A;  2FX3 A;  1YLO A;  1ZM4 A;  2VJI A;  3ISX A;  4P6Y A;  4QFM A;  4AF7 A;  3CP8 A;  1Q9S A;  3MCA A;  2VNH A;  2YWG A;  3Q3A A;  2F4N A;  3HAG A;  4TMT A;  1T6X A;  4HE5 A;  1N0U A;  1UD6 A;  4G6I A;  3OZW A;  4PC1 A;  5KNL A;  2GK6 A;  4G7X A;  1IHM A;  1I8D A;  3A3B A;  3SKB A;  1BPL A;  4UAJ A;  3ASP A;  3A8K A;  2ZIT A;  2OBR A;  1QGA A;  3LVB A;  2F1M A;  3GVJ A;  1WOR A;  3OPO A;  5H59 A;  1I18 A;  3CCU B;  4CQJ A;  3CME B;  4P3Y A;  1N0V C;  1R5N A;  3CCQ B;  1VHE A;  2DET A;  4Z4T A;  4QHY A;  1KK1 A;  1W34 A;  5DN6 A;  4IW3 B;  4B43 A;  3W2I A;  3I55 B;  1GVH A;  4X7F A;  4YAF A;  1KD1 D;  2ZTG A;  4PC6 A;  1A8P A;  5A89 A;  3VO1 A;  1WP6 A;  3LQ6 A;  3V7A A;  1V5V A;  5H5J A;  5F4M A;  1JA1 A;  5IYW A;  3PUN A;  4M1K A;  4AVZ A;  4XQF A;  1K28 D;  5IYP A;  3FPP A;  1VJS A;  2W6J A;  4M53 A;  5EMN A;  3DDY A;  3CC2 B;  1DAR A;  1EP3 B;  1DDI A;  3W5V A;  2PE3 A;  3T53 B;  2WJV A;  2YWE A;  5FO0 A;  3B78 A;  2Z6B D;  3WNB A;  1M1K D;  4E0F A;  2V31 A;  2ZZE A;  2QEX B;  1U2R A;  1V0F A;  1KRH A;  2GQF A;  4XN0 A;  3OP1 A;  3OKX A;  4Z4Y A;  2C4T A;  3VR6 A;  4II2 A;  1OHH A;  1KTV A;  4OP7 A;  1ZM3 A;  4B47 A;  1JA0 A;  4YAL A;  1Y0R A;  3ASS A;  3CXC B;  1ZUN B;  3WXM A;  3BY2 A;  1CQX A;  2R9V A;  3BC9 A;  4RDK A;  5FNZ A;  4DQL A;  4B3G A;  3ES9 A;  3CPX A;  3PUM A;  4NCN A;  4WZL A;  3G71 B;  2CRV A;  2Q6K A;  4M4S A;  2OYN A;  2XOK A;  1M90 D;  3A35 A;  4Y9U A;  3P27 A;  1TVC A;  1NB0 A;  1E62 A; 
#chains in the Genus database with same CATH homology
 4P25 A;  4OOS A;  4OPO A;  3D26 A;  5IYN A;  5E6T A;  3PVD A;  3R6K A;  4WZE A;  4RM0 A;  3PA2 A;  3BQJ A;  4OPV A;  5F4O A;  4ROX A;  3ASR A;  3Q39 A;  4OOV A;  4X05 A;  4WZT A;  3Q3A A;  4X7E A;  4Z4R A;  4Z4S A;  4QUZ A;  4X7C A;  4OPS A;  3ONU A;  3RY8 A;  1IHM A;  3AST A;  3SKB A;  4P26 A;  3Q38 A;  3ASP A;  4P3I A;  4X06 A;  2OBR A;  4P12 A;  4QVA A;  5IYR A;  4Z4U A;  4RDJ A;  4Z4T A;  4X7F A;  3ASQ A;  4OOX A;  4QV2 A;  5KW9 A;  4RPD A;  2ZL7 A;  4X0C A;  3LQE A;  3LQ6 A;  3V7A A;  5F4M A;  3BY1 A;  4Z4V A;  5IYW A;  3PUN A;  5IYP A;  4Z4W A;  3Q6R A;  4RPB A;  3SLD A;  5HZA A;  5BSY A;  2ZL5 A;  4P2N A;  5J3O A;  3PA1 A;  4X7D A;  4RDL A;  3SJP A;  4QVJ A;  2ZL6 A;  5J35 A;  4Z4Y A;  2OBT A;  3ONY A;  3SEJ A;  3R6J A;  4OP7 A;  4P1V A;  4WZK A;  3ASS A;  3Q6Q A;  5IYQ A;  3BY2 A;  4RDK A;  5HZB A;  4X07 A;  4RLZ A;  5BSX A;  3PUM A;  2OBS A;  4WZL A;  5F4J A;  4Z4Z A;  3SLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...