5BSXA

Crystal structure of gii.10 p domain in complex with disinfectant puregreen24
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
314
structure length
308
Chain Sequence
b'KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
molecule tags Viral protein
source organism Norwalk virus
publication title Treatment of norovirus particles with citrate.
pubmed doi rcsb
total genus 66
structure length 308
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5bsxA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5bsxA01
3Q38A 3SEJA 3ASRA 3ASTA 3ASQA 3Q39A 3PUNA 5BSYA 3ASPA 4P12A 4QVJA 5J3OA 2OBRA 2ZL5A 4X7DA 4OPOA 4OPVA 4Z4UA 4WZKA 3LQEA 5E6TA 3PVDA 4X05A 3BY2A 3BY1A 3BQJA 5IYPA 4QVAA 3PA2A 4Z4SA 3SJPA 4Z4WA 4RM0A 5HZBA 4ROXA 4QV2A 3SLNA 2OBSA 4Z4RA 4OP7A 3SLDA 3Q3AA 4OOSA 5HZAA 4Z4VA 3Q6RA 4X7CA 4RDKA 2OBTA 5F4JA 5IYQA 3ONUA 4WZEA 4OOVA 3ASSA 4P25A 4P26A 4OPSA 5IYRA 4X06A 4RDJA 5KW9A 3LQ6A 3PA1A 4WZTA 3RY8A 4P1VA 4RPBA 4RDLA 4QUZA 5BSXA 4RPDA 3ONYA 5F4MA 4Z4TA 2ZL7A 4X7EA 4X7FA 4X07A 5IYWA 4Z4YA 5F4OA 5IYNA 4P2NA 3R6JA 3V7AA 4Z4ZA 3PUMA 4WZLA 1IHMA 4RLZA 4X0CA 2ZL6A 3R6KA 3SKBA 5J35A 3Q6QA 4OOXA 4P3IA 3D26A
chains in the Genus database with same CATH superfamily
2W6IA 1T6ZA 4TT3A 1VQOB 3B82A 4LBVA 4M4SA 3KEWA 1XB2A 3H9NA 4G7XA 4YAUA 1SKYB 4II3A 4AVZA 1H8EA 4B43A 1VQKB 1KK0A 2XNCA 3QSYA 1H42A 1T6XA 1V5VA 5BSYA 3E1YE 1F60A 2R9VA 3FKSA 1VQ8B 3P27A 1WOSA 1R5BA 5FIUA 3OAAA 2VJJA 3NE5B 1VQ5B 1CNFA 4OPOA 1IJFA 3QFSA 1YJWB 1WPCA 4OPVA 4TMWA 4WZKA 2KVOA 1W9XA 5TRDA 4RD1A 3BY2A 4RD3A 4XOTA 4TSFA 4Z4SA 3VO2A 3A35A 2WZPP 1WP6A 5FA6A 4Z4WA 1M1KD 2CBXA 1MRZA 3DDYA 4RM0A 2OYNA 1KRHA 4U9UA 3ZPNA 3W5VA 5IK2A 4ROXA 1FRNA 2B5OA 1Y0RA 4XM3A 2OBSA 2RC5A 2DOGA 2DETA 4RD6A 4RCYA 1NB9A 2JIZA 1VQ4B 3JQQA 1UD5A 1H8HA 1UD4A 4Z4VA 2PIAA 1HVXA 2CK3A 2E1BA 1QFYA 2XZOA 3A8IA 1TTTA 2PE3A 1FDRA 1N0UA 3ONUA 4WZEA 4AF7A 2LZJA 3BCFA 2DEUA 4OOVA 4PC2A 1BLIA 1VQMB 1VQLB 2V7QA 2C5BA 4QHYA 4TMXA 4DNTB 2OK7A 5KW9A 1PJ5A 3GVJA 1BMFA 3RY8A 3ZZ0A 3U6KA 1FNDA 2ZXIA 1WOPA 4XONA 2GPJA 2YWEA 3BC9A 2BGIA 3LO8A 1E79A 4DQLA 2D9RA 1UD3A 3JU4A 1VQ6B 3T53B 3CCUB 3AVVA 3ONYA 5F4MA 4ZCLA 1QH0A 2XNJA 1JA1A 4TMTA 1W87A 4XL9A 3VR6A 3OPOA 4LBWA 4YAFA 2BM1A 2ZTGA 4B48A 1K8AD 1N06A 3E20A 5B6IA 1KTVA 1EFCA 1UD2A 4FWTA 2WSSA 5AN9A 1TVCA 1OB0A 1SKQA 3WXMA 1VLOA 4XN3A 3CCRB 2WYRA 1I18A 2VBUA 3W5UA 2X6YA 4XKVA 4WZLA 1GVHA 2P3MA 4B47A 4ZV4A 2QA4B 1VF7A 2VZLA 2OTJB 2BGJA 2X0KA 1W0KA 4P3YA 3G4SB 2ZL6A 3OZUA 4BPRA 5HKKA 4F7DA 3SKBA 4OOXA 4HE6A 3JQPA 4FXUA 2B7BA 1H85A 5A8AA 2R6HA 3QFCA 3Q38A 3QFRA 3SEJA 5H5JA 3CCVB 1EP2B 5A88A 3ASTA 1M90D 3A3GA 2DYIA 3H94A 3ZUGA 2FX3A 1Q81D 3CP2A 3Q39A 4ASUA 2V7VA 4MYUA 4P6VF 5GV8A 1EFTA 4K1XA 1KJZA 3VNVA 2BV3A 2QE7A 1HA3A 3BCDA 1D1NA 4G5GA 1E64A 2X3UA 3ZBUA 3A3BA 3CCJB 1DDGA 4ZCMA 3PVDA 2VBSA 4YXWA 4NBSA 1GJRA 3GQBA 3JQRA 4P9SA 2I1LA 2JDIA 3BQJA 3BY1A 4RD2A 2JJ1A 4XR6A 4XORA 1YJNB 1ZM3A 3SJPA 4NNJA 1E43A 1A8PA 1I8DA 1WOOA 1NRKA 1WU8A 1N0VC 1QVFB 1NDHA 5HZBA 3FPPA 1ZUNB 2X6WA 3SLNA 1OB2A 4Z4RA 1V0FA 2RC6A 4TKOB 4AC9A 4ZGNB 1EFUA 3SLDA 1E3XA 3MCAA 4XLAA 2QN6A 3WQZA 5HZAA 4XMYA 3MHPA 3Q6RA 3OW2B 4PGOA 2WZNA 1D8TA 5H59A 5DSZA 4X7CA 2OBTA 2BMWA 4G1VA 5F4JA 5A89A 3OW7A 1WSRA 4X8IA 1VQ9B 1B2RA 3PENA 5TR9A 4YAOA 1E1RA 2VYQA 1KK2A 4OPSA 4RCZA 5IYRA 1Q82D 4N3GA 1E3ZA 1XE1A 1N08A 1JA0A 1VJSA 1GR1A 3LQ6A 3ZZUA 1Q7YD 1EP1B 3PA1A 2VNHA 4WZTA 2XZPA 3U6BA 2QEXB 4Q7JB 3I1FA 4P22A 1ZM2A 3WNBA 2XOKA 4Z1MA 4YAWA 2YWGA 3VMFA 2QTZA 3VNUA 3GVKA 1YI2B 2M5SA 1W0JA 1WSVA 1QVGB 2ZL7A 4Z4TA 1K73D 3G05A 2XEXA 1NB0A 2J7KA 4PC1A 4X7FA 4XQFA 1CNEA 5TV2A 4Z4YA 3W2IA 4LBYA 4M1KA 4P6YA 1S4MA 3OEEA 4XLFA 2GK7A 3CPWB 5EMNA 4AF6A 3CXCB 5HXBA 3R6JA 3V7AA 4Z4ZA 3PUMA 4NCNA 2ZZEA 3KL9A 3I56B 2C2WA 1VHOA 3OJXA 1IHMA 4RLZA 2GREA 1I7PA 2JJ2A 4X0CA 4RD4A 4KKUA 1FRQA 1T6YA 1VQPB 1XQBA 3R6KA 1R5NA 2BM0A 1KK3A 2Q6KA 4XLHA 2Q6LA 2D3LA 2CC2A 4B44A 4ACAA 2X8KA 2Q6OA 3W2EA 1P4MA 3V76A 3ASQA 2XZLA 4WQMA 4P3IA 3AVUA 4E0FA 1YJ9B 2BVNA 3U2QA 3A8JA 2OTLB 2C4UA 4JMQA 4FK8A 4Y7CA 2ZZGA 4QVJA 3VO1A 5J3OA 2GJPA 4G1BA 3B78A 1UD8A 2B7CA 2NV4A 1G7CA 1UD6A 4XD7A 3W2GA 3FJOA 3ES9A 2HCJB 5DN6A 4Z4UA 2QGGA 2ZZFA 2C5HA 4PC6A 5KSWB 3LQEA 3GVLA 4YELA 5E6TA 4X05A 4YEJA 1WTHD 2BPOA 2Z6BD 4DNRB 3CMEB 3CW2A 3PA2A 1UMKA 4QVAA 1GAWA 2JN9A 4HE5A 2X85A 2GJRA 4PABA 2VBVA 2C77A 2CNDA 3OKXA 4OP7A 3CCQB 4EH1A 1TLLA 2WJVA 1EFRA 3AGPA 2GQFA 3P26A 2X53S 3WYAA 1AIPA 1KQSB 4YALA 2EFGA 2C78A 1HZEA 4RDKA 5IYQA 4C0SA 4M0LA 1QGAA 2F1MA 3B8HA 2V7WA 3ASSA 3WBKA 4UZEA 2VNJA 3QFTA 3ZZTA 4P25A 4WWVA 2V31A 3WBJA 3HAGA 4GQNA 1NJID 1J9ZA 4TN1A 4XOPA 3WNDA 2VNKA 4DK1A 4X06A 1QX4A 1VLYA 4DK0A 2QDXA 2NPFA 2AHOA 3ZBTA 2BSAA 4KKTA 1R5OA 4P1VA 4TMVA 3SJZA 1EXMA 4XLEA 1RQRA 3OP1A 3CCLB 4RPBA 1F20A 2QTLA 4RDLA 1QFJA 1PJ7A 4UZFA 5BSXA 3FPKA 2V7UA 3AVWA 1OB5A 3CPXA 1COWA 1WDTA 2D74A 3T56B 3D26A 2DERA 2C4TA 5IYWA 3CC7B 4YHBA 3ZC3A 5F4OA 1JB9A 4XKWA 5TY0A 2WPDA 1ZM9A 1NBMA 4PC3A 4B4DA 1GO2A 1FNMA 4KKSA 2ZITA 2YWHA 3AGQA 5FNZA 1JJ2B 1K9MD 3CP8A 4CQJA 1QUEA 1KC8D 1KMHA 1B23P 3OZWA 4PAAA 1YX2A 2BN4A 3MMPA 3CESA 2ZXHA 4TMZA 3A1PA 3CCMB 4XN0A 4FN5A 1JNYA 1MABA 2E1RA 4ZCIA 1N8RD 3Q6QA 5J35A 4G6IA 3OEHA 4R71A 3CCEB 3CCSB 2GK6A 1K28D 1AMOA 5FO1A 2XNDA 1BX0A 1BJKA 3ASRA 4UZUA 1OHHA 2ZTNA 2ZBVA 4J0QA 5LMZA 2QMUA 1OGIA 2F1LA 3J81k 1KZLA 2F43A 3WY9A 3W2HA 1CQXA 1BPLA 2PMDA 2F4NA 3PUNA 3LNNA 1YHQB 2V7XA 1S0UA 5DS0A 1E63A 1KK1A 2Q6IA 3ASPA 1BX1A 2W6JA 4LBZA 4P12A 5KNLA 2HLDA 2OBRA 2ZL5A 2HMAA 1G7TA 3GSIA 4X7DA 1W2BB 1Q86D 3CD6B 1TUIA 3CB4A 1VQNB 2X6XA 3AVXA 1G7RA 1D2EA 1ELOA 1VQ7B 3AVYA 3BNWA 4G7WA 1QUFA 5IYPA 1W35A 3CC4B 2D3NA 5FL7A 1E1QA 3ISXA 1G7SA 4C43A 1E62A 4QV2A 4IW3B 4L8JA 4PC7A 5JBQA 4M2LA 1DDIA 3CC2B 3CMAB 3Q3AA 1KD1D 4OOSA 5GV7A 2DY1A 1FNBA 2DIEA 3I55B 1RQPA 4M53A 3QE2A 1V0EA 3AVTA 3OE7A 1QGYA 1YIJB 2DCUA 2CRVA 3OJWA 2V7TA 1PJ6A 4XLCA 3GIRA 4UAJA 3OFNA 2WJYA 4HIZA 5L46A 1BQEA 4P26A 4RJLA 1EP3B 4B3GA 2EIXA 5THXA 1W34A 2HDNB 1SM4A 4MYTA 1OGJA 4RDJA 3A8KA 4B3FX 3G71B 2CW5A 1QG0A 1T5EA 1WORA 2GJKA 2VBTA 1U2RA 4II2A 3G6EB 3OZVA 2BF4A 1QGZA 2ZZQA 1ZM4A 3BH4A 4QUZA 1PKVA 4RPDA 4ZGQB 3T51B 4B3XA 1N07A 4LC0A 4X7EA 4Y9RA 4X07A 1QFZA 2OK8A 1DG1G 3W2FA 5CDFA 1YITB 3CTAA 4QFMA 4RD0A 3W5HA 1DARA 2FVGA 5FO0A 1FX0A 3LVBA 1IJEA 5IYNA 4N3NA 2WR8A 4P2NA 1XFOA 2V4DA 4H9GA 1YLOA 2VNIA 3CRZA 1N05A 3ZIAA 4XNFA 1IB0A 1FNCA 3WNCA 3OOCA 1Q9SA 2XGJA 2PLFA 1EWYA 2CF4A 4Y9UA 1GAQA 1Y0YA 2ZBUA 1S72B 3CMMA 1VHEA 4DQKA 4ACBA 2VJIA 2YWFA
chains in the Genus database with same CATH topology
3Q38A 3SEJA 3ASRA 3ASTA 3ASQA 3Q39A 3PUNA 5BSYA 3ASPA 4P12A 4QVJA 5J3OA 2OBRA 2ZL5A 4X7DA 4OPOA 4OPVA 4Z4UA 4WZKA 3LQEA 5E6TA 3PVDA 4X05A 3BY2A 3BY1A 3BQJA 5IYPA 4QVAA 3PA2A 4Z4SA 3SJPA 4Z4WA 4RM0A 5HZBA 4ROXA 4QV2A 3SLNA 2OBSA 4Z4RA 4OP7A 3SLDA 3Q3AA 4OOSA 5HZAA 4Z4VA 3Q6RA 4X7CA 4RDKA 2OBTA 5F4JA 5IYQA 3ONUA 4WZEA 4OOVA 3ASSA 4P25A 4P26A 4OPSA 5IYRA 4X06A 4RDJA 5KW9A 3LQ6A 3PA1A 4WZTA 3RY8A 4P1VA 4RPBA 4RDLA 4QUZA 5BSXA 4RPDA 3ONYA 5F4MA 4Z4TA 2ZL7A 4X7EA 4X7FA 4X07A 5IYWA 4Z4YA 5F4OA 5IYNA 4P2NA 3R6JA 3V7AA 4Z4ZA 3PUMA 4WZLA 1IHMA 4RLZA 4X0CA 2ZL6A 3R6KA 3SKBA 5J35A 3Q6QA 4OOXA 4P3IA 3D26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q38 A;  3SEJ A;  3ASR A;  3AST A;  3ASQ A;  3Q39 A;  3PUN A;  5BSY A;  3ASP A;  4P12 A;  4QVJ A;  5J3O A;  2OBR A;  2ZL5 A;  4X7D A;  4OPO A;  4OPV A;  4Z4U A;  4WZK A;  3LQE A;  5E6T A;  3PVD A;  4X05 A;  3BY2 A;  3BY1 A;  3BQJ A;  5IYP A;  4QVA A;  3PA2 A;  4Z4S A;  3SJP A;  4Z4W A;  4RM0 A;  5HZB A;  4ROX A;  4QV2 A;  3SLN A;  2OBS A;  4Z4R A;  4OP7 A;  3SLD A;  3Q3A A;  4OOS A;  5HZA A;  4Z4V A;  3Q6R A;  4X7C A;  4RDK A;  2OBT A;  5F4J A;  5IYQ A;  3ONU A;  4WZE A;  4OOV A;  3ASS A;  4P25 A;  4P26 A;  4OPS A;  5IYR A;  4X06 A;  4RDJ A;  5KW9 A;  3LQ6 A;  3PA1 A;  4WZT A;  3RY8 A;  4P1V A;  4RPB A;  4RDL A;  4QUZ A;  5BSX A;  4RPD A;  3ONY A;  5F4M A;  4Z4T A;  2ZL7 A;  4X7E A;  4X7F A;  4X07 A;  5IYW A;  4Z4Y A;  5F4O A;  5IYN A;  4P2N A;  3R6J A;  3V7A A;  4Z4Z A;  3PUM A;  4WZL A;  1IHM A;  4RLZ A;  4X0C A;  2ZL6 A;  3R6K A;  3SKB A;  5J35 A;  3Q6Q A;  4OOX A;  4P3I A;  3D26 A; 
#chains in the Genus database with same CATH topology
 2W6I A;  1T6Z A;  4TT3 A;  1VQO B;  3B82 A;  4LBV A;  4M4S A;  3KEW A;  1XB2 A;  3H9N A;  4G7X A;  4YAU A;  1SKY B;  4II3 A;  4AVZ A;  1H8E A;  4B43 A;  1VQK B;  1KK0 A;  2XNC A;  3QSY A;  1H42 A;  1T6X A;  1V5V A;  5BSY A;  3E1Y E;  1F60 A;  2R9V A;  3FKS A;  1VQ8 B;  3P27 A;  1WOS A;  1R5B A;  5FIU A;  3OAA A;  2VJJ A;  3NE5 B;  1VQ5 B;  1CNF A;  4OPO A;  1IJF A;  3QFS A;  1YJW B;  1WPC A;  4OPV A;  4TMW A;  4WZK A;  2KVO A;  1W9X A;  5TRD A;  4RD1 A;  3BY2 A;  4RD3 A;  4XOT A;  4TSF A;  4Z4S A;  3VO2 A;  3A35 A;  2WZP P;  1WP6 A;  5FA6 A;  4Z4W A;  1M1K D;  2CBX A;  1MRZ A;  3DDY A;  4RM0 A;  2OYN A;  1KRH A;  4U9U A;  3ZPN A;  3W5V A;  5IK2 A;  4ROX A;  1FRN A;  2B5O A;  1Y0R A;  4XM3 A;  2OBS A;  2RC5 A;  2DOG A;  2DET A;  4RD6 A;  4RCY A;  1NB9 A;  2JIZ A;  1VQ4 B;  3JQQ A;  1UD5 A;  1H8H A;  1UD4 A;  4Z4V A;  2PIA A;  1HVX A;  2CK3 A;  2E1B A;  1QFY A;  2XZO A;  3A8I A;  1TTT A;  2PE3 A;  1FDR A;  1N0U A;  3ONU A;  4WZE A;  4AF7 A;  2LZJ A;  3BCF A;  2DEU A;  4OOV A;  4PC2 A;  1BLI A;  1VQM B;  1VQL B;  2V7Q A;  2C5B A;  4QHY A;  4TMX A;  4DNT B;  2OK7 A;  5KW9 A;  1PJ5 A;  3GVJ A;  1BMF A;  3RY8 A;  3ZZ0 A;  3U6K A;  1FND A;  2ZXI A;  1WOP A;  4XON A;  2GPJ A;  2YWE A;  3BC9 A;  2BGI A;  3LO8 A;  1E79 A;  4DQL A;  2D9R A;  1UD3 A;  3JU4 A;  1VQ6 B;  3T53 B;  3CCU B;  3AVV A;  3ONY A;  5F4M A;  4ZCL A;  1QH0 A;  2XNJ A;  1JA1 A;  4TMT A;  1W87 A;  4XL9 A;  3VR6 A;  3OPO A;  4LBW A;  4YAF A;  2BM1 A;  2ZTG A;  4B48 A;  1K8A D;  1N06 A;  3E20 A;  5B6I A;  1KTV A;  1EFC A;  1UD2 A;  4FWT A;  2WSS A;  5AN9 A;  1TVC A;  1OB0 A;  1SKQ A;  3WXM A;  1VLO A;  4XN3 A;  3CCR B;  2WYR A;  1I18 A;  2VBU A;  3W5U A;  2X6Y A;  4XKV A;  4WZL A;  1GVH A;  2P3M A;  4B47 A;  4ZV4 A;  2QA4 B;  1VF7 A;  2VZL A;  2OTJ B;  2BGJ A;  2X0K A;  1W0K A;  4P3Y A;  3G4S B;  2ZL6 A;  3OZU A;  4BPR A;  5HKK A;  4F7D A;  3SKB A;  4OOX A;  4HE6 A;  3JQP A;  4FXU A;  2B7B A;  1H85 A;  5A8A A;  2R6H A;  3QFC A;  3Q38 A;  3QFR A;  3SEJ A;  5H5J A;  3CCV B;  1EP2 B;  5A88 A;  3AST A;  1M90 D;  3A3G A;  2DYI A;  3H94 A;  3ZUG A;  2FX3 A;  1Q81 D;  3CP2 A;  3Q39 A;  4ASU A;  2V7V A;  4MYU A;  4P6V F;  5GV8 A;  1EFT A;  4K1X A;  1KJZ A;  3VNV A;  2BV3 A;  2QE7 A;  1HA3 A;  3BCD A;  1D1N A;  4G5G A;  1E64 A;  2X3U A;  3ZBU A;  3A3B A;  3CCJ B;  1DDG A;  4ZCM A;  3PVD A;  2VBS A;  4YXW A;  4NBS A;  1GJR A;  3GQB A;  3JQR A;  4P9S A;  2I1L A;  2JDI A;  3BQJ A;  3BY1 A;  4RD2 A;  2JJ1 A;  4XR6 A;  4XOR A;  1YJN B;  1ZM3 A;  3SJP A;  4NNJ A;  1E43 A;  1A8P A;  1I8D A;  1WOO A;  1NRK A;  1WU8 A;  1N0V C;  1QVF B;  1NDH A;  5HZB A;  3FPP A;  1ZUN B;  2X6W A;  3SLN A;  1OB2 A;  4Z4R A;  1V0F A;  2RC6 A;  4TKO B;  4AC9 A;  4ZGN B;  1EFU A;  3SLD A;  1E3X A;  3MCA A;  4XLA A;  2QN6 A;  3WQZ A;  5HZA A;  4XMY A;  3MHP A;  3Q6R A;  3OW2 B;  4PGO A;  2WZN A;  1D8T A;  5H59 A;  5DSZ A;  4X7C A;  2OBT A;  2BMW A;  4G1V A;  5F4J A;  5A89 A;  3OW7 A;  1WSR A;  4X8I A;  1VQ9 B;  1B2R A;  3PEN A;  5TR9 A;  4YAO A;  1E1R A;  2VYQ A;  1KK2 A;  4OPS A;  4RCZ A;  5IYR A;  1Q82 D;  4N3G A;  1E3Z A;  1XE1 A;  1N08 A;  1JA0 A;  1VJS A;  1GR1 A;  3LQ6 A;  3ZZU A;  1Q7Y D;  1EP1 B;  3PA1 A;  2VNH A;  4WZT A;  2XZP A;  3U6B A;  2QEX B;  4Q7J B;  3I1F A;  4P22 A;  1ZM2 A;  3WNB A;  2XOK A;  4Z1M A;  4YAW A;  2YWG A;  3VMF A;  2QTZ A;  3VNU A;  3GVK A;  1YI2 B;  2M5S A;  1W0J A;  1WSV A;  1QVG B;  2ZL7 A;  4Z4T A;  1K73 D;  3G05 A;  2XEX A;  1NB0 A;  2J7K A;  4PC1 A;  4X7F A;  4XQF A;  1CNE A;  5TV2 A;  4Z4Y A;  3W2I A;  4LBY A;  4M1K A;  4P6Y A;  1S4M A;  3OEE A;  4XLF A;  2GK7 A;  3CPW B;  5EMN A;  4AF6 A;  3CXC B;  5HXB A;  3R6J A;  3V7A A;  4Z4Z A;  3PUM A;  4NCN A;  2ZZE A;  3KL9 A;  3I56 B;  2C2W A;  1VHO A;  3OJX A;  1IHM A;  4RLZ A;  2GRE A;  1I7P A;  2JJ2 A;  4X0C A;  4RD4 A;  4KKU A;  1FRQ A;  1T6Y A;  1VQP B;  1XQB A;  3R6K A;  1R5N A;  2BM0 A;  1KK3 A;  2Q6K A;  4XLH A;  2Q6L A;  2D3L A;  2CC2 A;  4B44 A;  4ACA A;  2X8K A;  2Q6O A;  3W2E A;  1P4M A;  3V76 A;  3ASQ A;  2XZL A;  4WQM A;  4P3I A;  3AVU A;  4E0F A;  1YJ9 B;  2BVN A;  3U2Q A;  3A8J A;  2OTL B;  2C4U A;  4JMQ A;  4FK8 A;  4Y7C A;  2ZZG A;  4QVJ A;  3VO1 A;  5J3O A;  2GJP A;  4G1B A;  3B78 A;  1UD8 A;  2B7C A;  2NV4 A;  1G7C A;  1UD6 A;  4XD7 A;  3W2G A;  3FJO A;  3ES9 A;  2HCJ B;  5DN6 A;  4Z4U A;  2QGG A;  2ZZF A;  2C5H A;  4PC6 A;  5KSW B;  3LQE A;  3GVL A;  4YEL A;  5E6T A;  4X05 A;  4YEJ A;  1WTH D;  2BPO A;  2Z6B D;  4DNR B;  3CME B;  3CW2 A;  3PA2 A;  1UMK A;  4QVA A;  1GAW A;  2JN9 A;  4HE5 A;  2X85 A;  2GJR A;  4PAB A;  2VBV A;  2C77 A;  2CND A;  3OKX A;  4OP7 A;  3CCQ B;  4EH1 A;  1TLL A;  2WJV A;  1EFR A;  3AGP A;  2GQF A;  3P26 A;  2X53 S;  3WYA A;  1AIP A;  1KQS B;  4YAL A;  2EFG A;  2C78 A;  1HZE A;  4RDK A;  5IYQ A;  4C0S A;  4M0L A;  1QGA A;  2F1M A;  3B8H A;  2V7W A;  3ASS A;  3WBK A;  4UZE A;  2VNJ A;  3QFT A;  3ZZT A;  4P25 A;  4WWV A;  2V31 A;  3WBJ A;  3HAG A;  4GQN A;  1NJI D;  1J9Z A;  4TN1 A;  4XOP A;  3WND A;  2VNK A;  4DK1 A;  4X06 A;  1QX4 A;  1VLY A;  4DK0 A;  2QDX A;  2NPF A;  2AHO A;  3ZBT A;  2BSA A;  4KKT A;  1R5O A;  4P1V A;  4TMV A;  3SJZ A;  1EXM A;  4XLE A;  1RQR A;  3OP1 A;  3CCL B;  4RPB A;  1F20 A;  2QTL A;  4RDL A;  1QFJ A;  1PJ7 A;  4UZF A;  5BSX A;  3FPK A;  2V7U A;  3AVW A;  1OB5 A;  3CPX A;  1COW A;  1WDT A;  2D74 A;  3T56 B;  3D26 A;  2DER A;  2C4T A;  5IYW A;  3CC7 B;  4YHB A;  3ZC3 A;  5F4O A;  1JB9 A;  4XKW A;  5TY0 A;  2WPD A;  1ZM9 A;  1NBM A;  4PC3 A;  4B4D A;  1GO2 A;  1FNM A;  4KKS A;  2ZIT A;  2YWH A;  3AGQ A;  5FNZ A;  1JJ2 B;  1K9M D;  3CP8 A;  4CQJ A;  1QUE A;  1KC8 D;  1KMH A;  1B23 P;  3OZW A;  4PAA A;  1YX2 A;  2BN4 A;  3MMP A;  3CES A;  2ZXH A;  4TMZ A;  3A1P A;  3CCM B;  4XN0 A;  4FN5 A;  1JNY A;  1MAB A;  2E1R A;  4ZCI A;  1N8R D;  3Q6Q A;  5J35 A;  4G6I A;  3OEH A;  4R71 A;  3CCE B;  3CCS B;  2GK6 A;  1K28 D;  1AMO A;  5FO1 A;  2XND A;  1BX0 A;  1BJK A;  3ASR A;  4UZU A;  1OHH A;  2ZTN A;  2ZBV A;  4J0Q A;  5LMZ A;  2QMU A;  1OGI A;  2F1L A;  3J81 k;  1KZL A;  2F43 A;  3WY9 A;  3W2H A;  1CQX A;  1BPL A;  2PMD A;  2F4N A;  3PUN A;  3LNN A;  1YHQ B;  2V7X A;  1S0U A;  5DS0 A;  1E63 A;  1KK1 A;  2Q6I A;  3ASP A;  1BX1 A;  2W6J A;  4LBZ A;  4P12 A;  5KNL A;  2HLD A;  2OBR A;  2ZL5 A;  2HMA A;  1G7T A;  3GSI A;  4X7D A;  1W2B B;  1Q86 D;  3CD6 B;  1TUI A;  3CB4 A;  1VQN B;  2X6X A;  3AVX A;  1G7R A;  1D2E A;  1ELO A;  1VQ7 B;  3AVY A;  3BNW A;  4G7W A;  1QUF A;  5IYP A;  1W35 A;  3CC4 B;  2D3N A;  5FL7 A;  1E1Q A;  3ISX A;  1G7S A;  4C43 A;  1E62 A;  4QV2 A;  4IW3 B;  4L8J A;  4PC7 A;  5JBQ A;  4M2L A;  1DDI A;  3CC2 B;  3CMA B;  3Q3A A;  1KD1 D;  4OOS A;  5GV7 A;  2DY1 A;  1FNB A;  2DIE A;  3I55 B;  1RQP A;  4M53 A;  3QE2 A;  1V0E A;  3AVT A;  3OE7 A;  1QGY A;  1YIJ B;  2DCU A;  2CRV A;  3OJW A;  2V7T A;  1PJ6 A;  4XLC A;  3GIR A;  4UAJ A;  3OFN A;  2WJY A;  4HIZ A;  5L46 A;  1BQE A;  4P26 A;  4RJL A;  1EP3 B;  4B3G A;  2EIX A;  5THX A;  1W34 A;  2HDN B;  1SM4 A;  4MYT A;  1OGJ A;  4RDJ A;  3A8K A;  4B3F X;  3G71 B;  2CW5 A;  1QG0 A;  1T5E A;  1WOR A;  2GJK A;  2VBT A;  1U2R A;  4II2 A;  3G6E B;  3OZV A;  2BF4 A;  1QGZ A;  2ZZQ A;  1ZM4 A;  3BH4 A;  4QUZ A;  1PKV A;  4RPD A;  4ZGQ B;  3T51 B;  4B3X A;  1N07 A;  4LC0 A;  4X7E A;  4Y9R A;  4X07 A;  1QFZ A;  2OK8 A;  1DG1 G;  3W2F A;  5CDF A;  1YIT B;  3CTA A;  4QFM A;  4RD0 A;  3W5H A;  1DAR A;  2FVG A;  5FO0 A;  1FX0 A;  3LVB A;  1IJE A;  5IYN A;  4N3N A;  2WR8 A;  4P2N A;  1XFO A;  2V4D A;  4H9G A;  1YLO A;  2VNI A;  3CRZ A;  1N05 A;  3ZIA A;  4XNF A;  1IB0 A;  1FNC A;  3WNC A;  3OOC A;  1Q9S A;  2XGJ A;  2PLF A;  1EWY A;  2CF4 A;  4Y9U A;  1GAQ A;  1Y0Y A;  2ZBU A;  1S72 B;  3CMM A;  1VHE A;  4DQK A;  4ACB A;  2VJI A;  2YWF A; 
#chains in the Genus database with same CATH homology
 3Q38 A;  3SEJ A;  3ASR A;  3AST A;  3ASQ A;  3Q39 A;  3PUN A;  5BSY A;  3ASP A;  4P12 A;  4QVJ A;  5J3O A;  2OBR A;  2ZL5 A;  4X7D A;  4OPO A;  4OPV A;  4Z4U A;  4WZK A;  3LQE A;  5E6T A;  3PVD A;  4X05 A;  3BY2 A;  3BY1 A;  3BQJ A;  5IYP A;  4QVA A;  3PA2 A;  4Z4S A;  3SJP A;  4Z4W A;  4RM0 A;  5HZB A;  4ROX A;  4QV2 A;  3SLN A;  2OBS A;  4Z4R A;  4OP7 A;  3SLD A;  3Q3A A;  4OOS A;  5HZA A;  4Z4V A;  3Q6R A;  4X7C A;  4RDK A;  2OBT A;  5F4J A;  5IYQ A;  3ONU A;  4WZE A;  4OOV A;  3ASS A;  4P25 A;  4P26 A;  4OPS A;  5IYR A;  4X06 A;  4RDJ A;  5KW9 A;  3LQ6 A;  3PA1 A;  4WZT A;  3RY8 A;  4P1V A;  4RPB A;  4RDL A;  4QUZ A;  5BSX A;  4RPD A;  3ONY A;  5F4M A;  4Z4T A;  2ZL7 A;  4X7E A;  4X7F A;  4X07 A;  5IYW A;  4Z4Y A;  5F4O A;  5IYN A;  4P2N A;  3R6J A;  3V7A A;  4Z4Z A;  3PUM A;  4WZL A;  1IHM A;  4RLZ A;  4X0C A;  2ZL6 A;  3R6K A;  3SKB A;  5J35 A;  3Q6Q A;  4OOX A;  4P3I A;  3D26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...