5BSXA

Crystal structure of gii.10 p domain in complex with disinfectant puregreen24
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
314
structure length
308
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Treatment of norovirus particles with citrate.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
molecule keywords Capsid protein
total genus 66
structure length 308
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5bsxA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5bsxA01
2ZL7A 3ASRA 3PA2A 2OBRA 5F4JA 3LQEA 4X07A 4P12A 3V7AA 4WZTA 4P2NA 4Z4VA 3Q3AA 4RPDA 5IYWA 3ONYA 4RDKA 3ASSA 2OBSA 2ZL5A 4P26A 2ZL6A 3SKBA 3LQ6A 4Z4SA 4RPBA 4OOXA 3R6KA 3ASTA 3Q6QA 4QV2A 4RLZA 5HZAA 4RM0A 3PVDA 4X06A 4OPOA 4RDJA 3SEJA 3SLDA 1IHMA 3R6JA 4OPVA 4Z4UA 3ASPA 5E6TA 5F4OA 4ROXA 3PUNA 5KW9A 4QVAA 4X7DA 3ONUA 4X7FA 2OBTA 5IYRA 4WZEA 5IYNA 5IYPA 5BSYA 4QVJA 4WZLA 4P25A 4P1VA 4Z4YA 4P3IA 4X7CA 4QUZA 3Q39A 3BY1A 5BSXA 3BQJA 3Q6RA 5F4MA 4OPSA 4WZKA 3D26A 3SLNA 4RDLA 5HZBA 5IYQA 4OOVA 3PA1A 5J3OA 3ASQA 3RY8A 4Z4ZA 3PUMA 4Z4TA 4OP7A 5J35A 3BY2A 4X05A 3Q38A 4Z4WA 4OOSA 3SJPA 4X7EA 4Z4RA 4X0CA
chains in the Genus database with same CATH superfamily
2C77A 4RD2A 2ZL7A 2X3UA 3GQBA 1T6XA 2GK7A 5F4JA 1YX2A 4P6YA 4P12A 1QX4A 3W2EA 1VQ8B 1GAQA 1G7TA 1N07A 2DY1A 2V7UA 2JIZA 3BC9A 2BN4A 2ZZQA 1QFZA 3OJXA 4LBWA 4LBYA 4P2NA 4Z4VA 3CCRB 3T56B 3ONYA 4RDKA 2DIEA 1Q86D 2VYQA 1HA3A 4II3A 1FNBA 3OW7A 1G7CA 1ZM9A 3DDYA 3ES9A 3OEEA 4YEJA 1EFTA 2CK3A 1YLOA 4PAAA 4TT3A 3W5VA 2D3LA 3WNCA 4XLAA 1YJ9B 4P9SA 2C2WA 2X85A 4Y9UA 4TMWA 1OGIA 1TLLA 1UD8A 3ZPNA 2ZBVA 2VBUA 2VJJA 4RM0A 1JB9A 1WORA 1K8AD 1PKVA 4ACBA 1WOOA 2BPOA 2OYNA 4RCYA 1VQ6B 3KEWA 3GVJA 3P27A 3SEJA 4M1KA 3SLDA 3ZBTA 3ZIAA 1KZLA 1Q7YD 1E62A 1ZM3A 4OPVA 5FNZA 1S4MA 4LC0A 2E1RA 2BV3A 5F4OA 1KK0A 2Q6LA 1KK3A 2B5OA 4HE5A 4X7DA 2DCUA 3ONUA 4X7FA 2BF4A 2ZBUA 4B48A 1G7SA 3BCDA 2LZJA 1UD2A 2DEUA 5BSYA 1W34A 4UZEA 1KK2A 1E1RA 4XORA 1V5VA 2PMDA 2WZPP 1EP1B 1WDTA 4PC1A 1VQ4B 2DYIA 4P1VA 3T51B 3OJWA 4Z4YA 1WP6A 4XM3A 1N0UA 4X7CA 2ZZFA 3CW2A 4FWTA 4DQKA 2R6HA 2VNIA 5HKKA 4BPRA 1RQPA 1EFRA 1HVXA 1MABA 1S0UA 4FN5A 2JJ1A 2F4NA 2X0KA 3WXMA 5BSXA 1MRZA 1F60A 4UAJA 5F4MA 2OTJB 4OPSA 1YIJB 1Q82D 1FX0A 2BVNA 2YWHA 1FRNA 3OPOA 4Q7JB 3OW2B 1B2RA 3A8JA 3H9NA 2D3NA 4B3FX 5HZBA 2OTLB 1Y0YA 2Q6OA 1Y0RA 1IJEA 1H85A 2OK7A 1FNMA 4UZFA 4C0SA 5IYQA 1GAWA 4YAWA 3QFCA 3RY8A 1G7RA 1SKQA 4N3NA 4TN1A 1BX1A 4OP7A 3CCEB 4U9UA 3FPPA 1FNCA 1KRHA 2QGGA 4ZCLA 1BQEA 1VQOB 4J0QA 1YI2B 2WJVA 3VO2A 1KD1D 2VBSA 3GSIA 2C5BA 1S72B 4RD4A 5DSZA 3CPWB 3I55B 1AMOA 4B43A 1VQKB 1NDHA 5TV2A 2QEXB 2C4TA 1K73D 1P4MA 5IK2A 2V7XA 1QFJA 1EP2B 4GQNA 3V7AA 5DN6A 3W5UA 4WZTA 2BM1A 2XZLA 4KKTA 1ZM2A 4PC2A 4YXWA 4YELA 1I7PA 3A1PA 3Q3AA 4RPDA 3VNVA 1E63A 1W2BB 2VNHA 2GPJA 2P3MA 2OBSA 2ZL5A 4H9GA 5FO0A 1YJWB 4X8IA 2XZOA 5LMZA 1QH0A 4G7XA 1EP3B 4Z4SA 3SJZA 4N3GA 2YWGA 4B3GA 3VNUA 2QN6A 2PLFA 4HIZA 4PGOA 3AVYA 1JNYA 1QGAA 1W35A 5HZAA 2BGJA 3CXCB 1K28D 2DETA 3CCJB 3MCAA 4EH1A 4M53A 1KC8D 2BMWA 3OZUA 4AVZA 1UD4A 2B7BA 4KKUA 1TUIA 1PJ6A 2W6IA 2J7KA 1N08A 4Y9RA 2WYRA 2RC5A 3R6JA 1R5OA 3OZWA 5FA6A 1SM4A 2VZLA 3ZC3A 1ELOA 4G1BA 4G6IA 1I8DA 4XONA 1KK1A 2WJYA 2X6XA 1QVGB 4M4SA 1OB0A 3QFTA 2X8KA 4WZEA 3QFRA 4QVJA 1VQ7B 1SKYB 4RD3A 3G71B 1JA0A 2QMUA 4P25A 4F7DA 3G05A 4UZUA 4XLCA 3CCMB 1BX0A 5GV8A 4TKOB 3CMMA 1VQPB 4ACAA 1TTTA 4XLHA 3B82A 1E3XA 5TY0A 1VHEA 1W0JA 1XB2A 3OKXA 3Q39A 4DK0A 4TSFA 4NCNA 4Z1MA 1A8PA 2VJIA 1H42A 1VF7A 3A3BA 3BQJA 4K1XA 4ZGNB 3CCUB 2B7CA 2ZITA 4WZKA 1N05A 4ASUA 1ZM4A 3D26A 4PC7A 4QHYA 2JDIA 2VNKA 1CQXA 2BSAA 1AIPA 4RDLA 1JA1A 3V76A 2ZZEA 3CRZA 1QG0A 2CC2A 2X53S 4XLEA 1UD3A 3WNDA 2QE7A 1OHHA 4OOVA 2JN9A 3WBJA 3J81k 3PA1A 4XR6A 4RCZA 5J3OA 2AHOA 4Z4ZA 1F20A 2VBTA 4Z4TA 4WQMA 1VJSA 2CNDA 3WY9A 2DOGA 5AN9A 1H8EA 3E1YE 4XKVA 3BY2A 3W2GA 3JQRA 1KTVA 3QSYA 1KQSB 4X05A 2QTZA 1VQMB 5FO1A 3Q38A 1WOSA 3I56B 4DNTB 1DDGA 4RD6A 1E79A 3CP2A 3E20A 3W2IA 4YHBA 2QA4B 4G5GA 2YWEA 2JJ2A 5A88A 3OZVA 4II2A 4ZCMA 4XN3A 1FNDA 3NE5B 4JMQA 2D74A 5TRDA 2OBRA 3ZUGA 3LQEA 1N0VC 1QGYA 2I1LA 4XOTA 3CC2B 1E64A 5JBQA 1VQLB 2V7QA 4C43A 2NPFA 1QUEA 1H8HA 1UD6A 5IYWA 3U6KA 3ASSA 3WNBA 1B23P 4XN0A 1DG1G 3HAGA 2QTLA 1FDRA 3VO1A 1V0EA 2NV4A 2ZL6A 3OAAA 5TR9A 1KJZA 1IB0A 1NRKA 4YALA 3GVLA 4RPBA 3FKSA 2F1LA 2C5HA 4OOXA 3W5HA 3R6KA 3QE2A 3AVVA 3ASTA 2GJRA 5KSWB 3CESA 2Q6KA 4G7WA 4KKSA 3PVDA 3CMAB 3H94A 4RJLA 2V7VA 4M0LA 4B44A 2CBXA 2HDNB 2WPDA 4Y7CA 1IHMA 3LNNA 1T6ZA 2GJPA 5A89A 2DERA 2X6YA 3GIRA 1W9XA 4YAFA 2XOKA 1K9MD 5KW9A 2ZXIA 1D2EA 3CMEB 3BH4A 1M90D 2OBTA 1XFOA 2HLDA 5IYRA 4XL9A 2C78A 1PJ5A 5IYNA 5IYPA 1GJRA 2KVOA 1JJ2B 1T6YA 2VNJA 4QFMA 1UD5A 4P3IA 2Q6IA 1GR1A 1WU8A 2RC6A 5B6IA 3A35A 2QDXA 3GVKA 3P26A 2BGIA 2HCJB 3OE7A 3BY1A 1YJNB 2XNDA 4TMZA 3FJOA 2R9VA 3WQZA 1YITB 2XGJA 4YAUA 3SLNA 1I18A 1D8TA 1FRQA 1COWA 2XZPA 1KMHA 1WTHD 3CCVB 3CPXA 3ZZUA 4R71A 3ZBUA 2BM0A 3T53B 4XOPA 2PIAA 3ASQA 2ZTGA 1ZUNB 3PUMA 1Q9SA 2CRVA 3A8KA 3OEHA 1T5EA 4LBVA 1WSVA 1NJID 2CW5A 4XQFA 1WSRA 1BLIA 5HXBA 1VLYA 1QVFB 3BNWA 1VLOA 2V7WA 5KNLA 4Z4WA 3I1FA 4L8JA 5CDFA 3CCQB 2W6JA 3SJPA 1HZEA 3CP8A 1VQ5B 4HE6A 4B4DA 1GO2A 4TMTA 2E1BA 4X7EA 4Z4RA 4ZCIA 3B78A 1N8RD 4LBZA 1NB9A 1GVHA 1E43A 1WPCA 4B3XA 3AVWA 3ASRA 1EXMA 4PC6A 4DNRB 3PA2A 4X07A 4ZGQB 1D1NA 5GV7A 2WSSA 3A3GA 5THXA 1M1KD 3QFSA 3VR6A 1VQ9B 3JU4A 2V31A 5L46A 2EFGA 4RD1A 3CCLB 1VQNB 4P6VF 4PABA 1J9ZA 1QUFA 2FX3A 4B47A 5FIUA 2F1MA 3W2HA 4E0FA 1V0FA 4P26A 2PE3A 2F43A 1NB0A 2D9RA 3SKBA 1OB2A 3LQ6A 1N06A 4NNJA 3AGQA 2ZZGA 2WZNA 1XQBA 4XKWA 2ZTNA 3Q6QA 4QV2A 3ZZTA 4RLZA 1U2RA 3VMFA 4NBSA 2HMAA 1NBMA 2CF4A 2X6WA 4ZV4A 4RD0A 5H5JA 4WWVA 3PENA 5H59A 4X06A 2FVGA 4OPOA 4RDJA 3U6BA 4AF6A 3ZZ0A 2XNCA 2GJKA 3LO8A 4Z4UA 3ASPA 5E6TA 1E1QA 4ROXA 4DQLA 1BJKA 1XE1A 2GQFA 3PUNA 3G6EB 4QVAA 1WOPA 3G4SB 1BMFA 1RQRA 2XEXA 3U2QA 2V7TA 3AGPA 4CQJA 3OOCA 4FK8A 1R5BA 4XNFA 4YAOA 2YWFA 1YHQB 4WZLA 4P3YA 1QFYA 3WYAA 5EMNA 4TMVA 4M2LA 3AVTA 3JQPA 1PJ7A 4QUZA 4AF7A 3OP1A 1TVCA 4P22A 1OB5A 1VHOA 3KL9A 1Q81D 3AVUA 3Q6RA 4PC3A 3JQQA 1EWYA 3FPKA 1CNEA 1EFCA 2V4DA 5DS0A 2GK6A 1BPLA 1EFUA 3LVBA 1W0KA 3B8HA 4AC9A 3CCSB 4MYUA 4XD7A 2Z6BD 1OGJA 5FL7A 3CD6B 2GREA 1DDIA 3AVXA 3ISXA 3W2FA 3CB4A 2VBVA 3MHPA 2ZXHA 5J35A 3CC4B 1UMKA 4TMXA 1CNFA 4G1VA 4FXUA 1W87A 3A8IA 2XNJA 4DK1A 3MMPA 3CC7B 2OK8A 4IW3B 2EIXA 2M5SA 3CTAA 3BCFA 4OOSA 2WR8A 1R5NA 2C4UA 1QGZA 1IJFA 3OFNA 1DARA 3WBKA 4XLFA 1E3ZA 4XMYA 5A8AA 4X0CA 4MYTA
chains in the Genus database with same CATH topology
2ZL7A 3ASRA 3PA2A 2OBRA 5F4JA 3LQEA 4X07A 4P12A 3V7AA 4WZTA 4P2NA 4Z4VA 3Q3AA 4RPDA 5IYWA 3ONYA 4RDKA 3ASSA 2OBSA 2ZL5A 4P26A 2ZL6A 3SKBA 3LQ6A 4Z4SA 4RPBA 4OOXA 3R6KA 3ASTA 3Q6QA 4QV2A 4RLZA 5HZAA 4RM0A 3PVDA 4X06A 4OPOA 4RDJA 3SEJA 3SLDA 1IHMA 3R6JA 4OPVA 4Z4UA 3ASPA 5E6TA 5F4OA 4ROXA 3PUNA 5KW9A 4QVAA 4X7DA 3ONUA 4X7FA 2OBTA 5IYRA 4WZEA 5IYNA 5IYPA 5BSYA 4QVJA 4WZLA 4P25A 4P1VA 4Z4YA 4P3IA 4X7CA 4QUZA 3Q39A 3BY1A 5BSXA 3BQJA 3Q6RA 5F4MA 4OPSA 4WZKA 3D26A 3SLNA 4RDLA 5HZBA 5IYQA 4OOVA 3PA1A 5J3OA 3ASQA 3RY8A 4Z4ZA 3PUMA 4Z4TA 4OP7A 5J35A 3BY2A 4X05A 3Q38A 4Z4WA 4OOSA 3SJPA 4X7EA 4Z4RA 4X0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZL7 A;  3ASR A;  3PA2 A;  2OBR A;  5F4J A;  3LQE A;  4X07 A;  4P12 A;  3V7A A;  4WZT A;  4P2N A;  4Z4V A;  3Q3A A;  4RPD A;  5IYW A;  3ONY A;  4RDK A;  3ASS A;  2OBS A;  2ZL5 A;  4P26 A;  2ZL6 A;  3SKB A;  3LQ6 A;  4Z4S A;  4RPB A;  4OOX A;  3R6K A;  3AST A;  3Q6Q A;  4QV2 A;  4RLZ A;  5HZA A;  4RM0 A;  3PVD A;  4X06 A;  4OPO A;  4RDJ A;  3SEJ A;  3SLD A;  1IHM A;  3R6J A;  4OPV A;  4Z4U A;  3ASP A;  5E6T A;  5F4O A;  4ROX A;  3PUN A;  5KW9 A;  4QVA A;  4X7D A;  3ONU A;  4X7F A;  2OBT A;  5IYR A;  4WZE A;  5IYN A;  5IYP A;  5BSY A;  4QVJ A;  4WZL A;  4P25 A;  4P1V A;  4Z4Y A;  4P3I A;  4X7C A;  4QUZ A;  3Q39 A;  3BY1 A;  5BSX A;  3BQJ A;  3Q6R A;  5F4M A;  4OPS A;  4WZK A;  3D26 A;  3SLN A;  4RDL A;  5HZB A;  5IYQ A;  4OOV A;  3PA1 A;  5J3O A;  3ASQ A;  3RY8 A;  4Z4Z A;  3PUM A;  4Z4T A;  4OP7 A;  5J35 A;  3BY2 A;  4X05 A;  3Q38 A;  4Z4W A;  4OOS A;  3SJP A;  4X7E A;  4Z4R A;  4X0C A; 
#chains in the Genus database with same CATH topology
 2C77 A;  4RD2 A;  2ZL7 A;  2X3U A;  3GQB A;  1T6X A;  2GK7 A;  5F4J A;  1YX2 A;  4P6Y A;  4P12 A;  1QX4 A;  3W2E A;  1VQ8 B;  1GAQ A;  1G7T A;  1N07 A;  2DY1 A;  2V7U A;  2JIZ A;  3BC9 A;  2BN4 A;  2ZZQ A;  1QFZ A;  3OJX A;  4LBW A;  4LBY A;  4P2N A;  4Z4V A;  3CCR B;  3T56 B;  3ONY A;  4RDK A;  2DIE A;  1Q86 D;  2VYQ A;  1HA3 A;  4II3 A;  1FNB A;  3OW7 A;  1G7C A;  1ZM9 A;  3DDY A;  3ES9 A;  3OEE A;  4YEJ A;  1EFT A;  2CK3 A;  1YLO A;  4PAA A;  4TT3 A;  3W5V A;  2D3L A;  3WNC A;  4XLA A;  1YJ9 B;  4P9S A;  2C2W A;  2X85 A;  4Y9U A;  4TMW A;  1OGI A;  1TLL A;  1UD8 A;  3ZPN A;  2ZBV A;  2VBU A;  2VJJ A;  4RM0 A;  1JB9 A;  1WOR A;  1K8A D;  1PKV A;  4ACB A;  1WOO A;  2BPO A;  2OYN A;  4RCY A;  1VQ6 B;  3KEW A;  3GVJ A;  3P27 A;  3SEJ A;  4M1K A;  3SLD A;  3ZBT A;  3ZIA A;  1KZL A;  1Q7Y D;  1E62 A;  1ZM3 A;  4OPV A;  5FNZ A;  1S4M A;  4LC0 A;  2E1R A;  2BV3 A;  5F4O A;  1KK0 A;  2Q6L A;  1KK3 A;  2B5O A;  4HE5 A;  4X7D A;  2DCU A;  3ONU A;  4X7F A;  2BF4 A;  2ZBU A;  4B48 A;  1G7S A;  3BCD A;  2LZJ A;  1UD2 A;  2DEU A;  5BSY A;  1W34 A;  4UZE A;  1KK2 A;  1E1R A;  4XOR A;  1V5V A;  2PMD A;  2WZP P;  1EP1 B;  1WDT A;  4PC1 A;  1VQ4 B;  2DYI A;  4P1V A;  3T51 B;  3OJW A;  4Z4Y A;  1WP6 A;  4XM3 A;  1N0U A;  4X7C A;  2ZZF A;  3CW2 A;  4FWT A;  4DQK A;  2R6H A;  2VNI A;  5HKK A;  4BPR A;  1RQP A;  1EFR A;  1HVX A;  1MAB A;  1S0U A;  4FN5 A;  2JJ1 A;  2F4N A;  2X0K A;  3WXM A;  5BSX A;  1MRZ A;  1F60 A;  4UAJ A;  5F4M A;  2OTJ B;  4OPS A;  1YIJ B;  1Q82 D;  1FX0 A;  2BVN A;  2YWH A;  1FRN A;  3OPO A;  4Q7J B;  3OW2 B;  1B2R A;  3A8J A;  3H9N A;  2D3N A;  4B3F X;  5HZB A;  2OTL B;  1Y0Y A;  2Q6O A;  1Y0R A;  1IJE A;  1H85 A;  2OK7 A;  1FNM A;  4UZF A;  4C0S A;  5IYQ A;  1GAW A;  4YAW A;  3QFC A;  3RY8 A;  1G7R A;  1SKQ A;  4N3N A;  4TN1 A;  1BX1 A;  4OP7 A;  3CCE B;  4U9U A;  3FPP A;  1FNC A;  1KRH A;  2QGG A;  4ZCL A;  1BQE A;  1VQO B;  4J0Q A;  1YI2 B;  2WJV A;  3VO2 A;  1KD1 D;  2VBS A;  3GSI A;  2C5B A;  1S72 B;  4RD4 A;  5DSZ A;  3CPW B;  3I55 B;  1AMO A;  4B43 A;  1VQK B;  1NDH A;  5TV2 A;  2QEX B;  2C4T A;  1K73 D;  1P4M A;  5IK2 A;  2V7X A;  1QFJ A;  1EP2 B;  4GQN A;  3V7A A;  5DN6 A;  3W5U A;  4WZT A;  2BM1 A;  2XZL A;  4KKT A;  1ZM2 A;  4PC2 A;  4YXW A;  4YEL A;  1I7P A;  3A1P A;  3Q3A A;  4RPD A;  3VNV A;  1E63 A;  1W2B B;  2VNH A;  2GPJ A;  2P3M A;  2OBS A;  2ZL5 A;  4H9G A;  5FO0 A;  1YJW B;  4X8I A;  2XZO A;  5LMZ A;  1QH0 A;  4G7X A;  1EP3 B;  4Z4S A;  3SJZ A;  4N3G A;  2YWG A;  4B3G A;  3VNU A;  2QN6 A;  2PLF A;  4HIZ A;  4PGO A;  3AVY A;  1JNY A;  1QGA A;  1W35 A;  5HZA A;  2BGJ A;  3CXC B;  1K28 D;  2DET A;  3CCJ B;  3MCA A;  4EH1 A;  4M53 A;  1KC8 D;  2BMW A;  3OZU A;  4AVZ A;  1UD4 A;  2B7B A;  4KKU A;  1TUI A;  1PJ6 A;  2W6I A;  2J7K A;  1N08 A;  4Y9R A;  2WYR A;  2RC5 A;  3R6J A;  1R5O A;  3OZW A;  5FA6 A;  1SM4 A;  2VZL A;  3ZC3 A;  1ELO A;  4G1B A;  4G6I A;  1I8D A;  4XON A;  1KK1 A;  2WJY A;  2X6X A;  1QVG B;  4M4S A;  1OB0 A;  3QFT A;  2X8K A;  4WZE A;  3QFR A;  4QVJ A;  1VQ7 B;  1SKY B;  4RD3 A;  3G71 B;  1JA0 A;  2QMU A;  4P25 A;  4F7D A;  3G05 A;  4UZU A;  4XLC A;  3CCM B;  1BX0 A;  5GV8 A;  4TKO B;  3CMM A;  1VQP B;  4ACA A;  1TTT A;  4XLH A;  3B82 A;  1E3X A;  5TY0 A;  1VHE A;  1W0J A;  1XB2 A;  3OKX A;  3Q39 A;  4DK0 A;  4TSF A;  4NCN A;  4Z1M A;  1A8P A;  2VJI A;  1H42 A;  1VF7 A;  3A3B A;  3BQJ A;  4K1X A;  4ZGN B;  3CCU B;  2B7C A;  2ZIT A;  4WZK A;  1N05 A;  4ASU A;  1ZM4 A;  3D26 A;  4PC7 A;  4QHY A;  2JDI A;  2VNK A;  1CQX A;  2BSA A;  1AIP A;  4RDL A;  1JA1 A;  3V76 A;  2ZZE A;  3CRZ A;  1QG0 A;  2CC2 A;  2X53 S;  4XLE A;  1UD3 A;  3WND A;  2QE7 A;  1OHH A;  4OOV A;  2JN9 A;  3WBJ A;  3J81 k;  3PA1 A;  4XR6 A;  4RCZ A;  5J3O A;  2AHO A;  4Z4Z A;  1F20 A;  2VBT A;  4Z4T A;  4WQM A;  1VJS A;  2CND A;  3WY9 A;  2DOG A;  5AN9 A;  1H8E A;  3E1Y E;  4XKV A;  3BY2 A;  3W2G A;  3JQR A;  1KTV A;  3QSY A;  1KQS B;  4X05 A;  2QTZ A;  1VQM B;  5FO1 A;  3Q38 A;  1WOS A;  3I56 B;  4DNT B;  1DDG A;  4RD6 A;  1E79 A;  3CP2 A;  3E20 A;  3W2I A;  4YHB A;  2QA4 B;  4G5G A;  2YWE A;  2JJ2 A;  5A88 A;  3OZV A;  4II2 A;  4ZCM A;  4XN3 A;  1FND A;  3NE5 B;  4JMQ A;  2D74 A;  5TRD A;  2OBR A;  3ZUG A;  3LQE A;  1N0V C;  1QGY A;  2I1L A;  4XOT A;  3CC2 B;  1E64 A;  5JBQ A;  1VQL B;  2V7Q A;  4C43 A;  2NPF A;  1QUE A;  1H8H A;  1UD6 A;  5IYW A;  3U6K A;  3ASS A;  3WNB A;  1B23 P;  4XN0 A;  1DG1 G;  3HAG A;  2QTL A;  1FDR A;  3VO1 A;  1V0E A;  2NV4 A;  2ZL6 A;  3OAA A;  5TR9 A;  1KJZ A;  1IB0 A;  1NRK A;  4YAL A;  3GVL A;  4RPB A;  3FKS A;  2F1L A;  2C5H A;  4OOX A;  3W5H A;  3R6K A;  3QE2 A;  3AVV A;  3AST A;  2GJR A;  5KSW B;  3CES A;  2Q6K A;  4G7W A;  4KKS A;  3PVD A;  3CMA B;  3H94 A;  4RJL A;  2V7V A;  4M0L A;  4B44 A;  2CBX A;  2HDN B;  2WPD A;  4Y7C A;  1IHM A;  3LNN A;  1T6Z A;  2GJP A;  5A89 A;  2DER A;  2X6Y A;  3GIR A;  1W9X A;  4YAF A;  2XOK A;  1K9M D;  5KW9 A;  2ZXI A;  1D2E A;  3CME B;  3BH4 A;  1M90 D;  2OBT A;  1XFO A;  2HLD A;  5IYR A;  4XL9 A;  2C78 A;  1PJ5 A;  5IYN A;  5IYP A;  1GJR A;  2KVO A;  1JJ2 B;  1T6Y A;  2VNJ A;  4QFM A;  1UD5 A;  4P3I A;  2Q6I A;  1GR1 A;  1WU8 A;  2RC6 A;  5B6I A;  3A35 A;  2QDX A;  3GVK A;  3P26 A;  2BGI A;  2HCJ B;  3OE7 A;  3BY1 A;  1YJN B;  2XND A;  4TMZ A;  3FJO A;  2R9V A;  3WQZ A;  1YIT B;  2XGJ A;  4YAU A;  3SLN A;  1I18 A;  1D8T A;  1FRQ A;  1COW A;  2XZP A;  1KMH A;  1WTH D;  3CCV B;  3CPX A;  3ZZU A;  4R71 A;  3ZBU A;  2BM0 A;  3T53 B;  4XOP A;  2PIA A;  3ASQ A;  2ZTG A;  1ZUN B;  3PUM A;  1Q9S A;  2CRV A;  3A8K A;  3OEH A;  1T5E A;  4LBV A;  1WSV A;  1NJI D;  2CW5 A;  4XQF A;  1WSR A;  1BLI A;  5HXB A;  1VLY A;  1QVF B;  3BNW A;  1VLO A;  2V7W A;  5KNL A;  4Z4W A;  3I1F A;  4L8J A;  5CDF A;  3CCQ B;  2W6J A;  3SJP A;  1HZE A;  3CP8 A;  1VQ5 B;  4HE6 A;  4B4D A;  1GO2 A;  4TMT A;  2E1B A;  4X7E A;  4Z4R A;  4ZCI A;  3B78 A;  1N8R D;  4LBZ A;  1NB9 A;  1GVH A;  1E43 A;  1WPC A;  4B3X A;  3AVW A;  3ASR A;  1EXM A;  4PC6 A;  4DNR B;  3PA2 A;  4X07 A;  4ZGQ B;  1D1N A;  5GV7 A;  2WSS A;  3A3G A;  5THX A;  1M1K D;  3QFS A;  3VR6 A;  1VQ9 B;  3JU4 A;  2V31 A;  5L46 A;  2EFG A;  4RD1 A;  3CCL B;  1VQN B;  4P6V F;  4PAB A;  1J9Z A;  1QUF A;  2FX3 A;  4B47 A;  5FIU A;  2F1M A;  3W2H A;  4E0F A;  1V0F A;  4P26 A;  2PE3 A;  2F43 A;  1NB0 A;  2D9R A;  3SKB A;  1OB2 A;  3LQ6 A;  1N06 A;  4NNJ A;  3AGQ A;  2ZZG A;  2WZN A;  1XQB A;  4XKW A;  2ZTN A;  3Q6Q A;  4QV2 A;  3ZZT A;  4RLZ A;  1U2R A;  3VMF A;  4NBS A;  2HMA A;  1NBM A;  2CF4 A;  2X6W A;  4ZV4 A;  4RD0 A;  5H5J A;  4WWV A;  3PEN A;  5H59 A;  4X06 A;  2FVG A;  4OPO A;  4RDJ A;  3U6B A;  4AF6 A;  3ZZ0 A;  2XNC A;  2GJK A;  3LO8 A;  4Z4U A;  3ASP A;  5E6T A;  1E1Q A;  4ROX A;  4DQL A;  1BJK A;  1XE1 A;  2GQF A;  3PUN A;  3G6E B;  4QVA A;  1WOP A;  3G4S B;  1BMF A;  1RQR A;  2XEX A;  3U2Q A;  2V7T A;  3AGP A;  4CQJ A;  3OOC A;  4FK8 A;  1R5B A;  4XNF A;  4YAO A;  2YWF A;  1YHQ B;  4WZL A;  4P3Y A;  1QFY A;  3WYA A;  5EMN A;  4TMV A;  4M2L A;  3AVT A;  3JQP A;  1PJ7 A;  4QUZ A;  4AF7 A;  3OP1 A;  1TVC A;  4P22 A;  1OB5 A;  1VHO A;  3KL9 A;  1Q81 D;  3AVU A;  3Q6R A;  4PC3 A;  3JQQ A;  1EWY A;  3FPK A;  1CNE A;  1EFC A;  2V4D A;  5DS0 A;  2GK6 A;  1BPL A;  1EFU A;  3LVB A;  1W0K A;  3B8H A;  4AC9 A;  3CCS B;  4MYU A;  4XD7 A;  2Z6B D;  1OGJ A;  5FL7 A;  3CD6 B;  2GRE A;  1DDI A;  3AVX A;  3ISX A;  3W2F A;  3CB4 A;  2VBV A;  3MHP A;  2ZXH A;  5J35 A;  3CC4 B;  1UMK A;  4TMX A;  1CNF A;  4G1V A;  4FXU A;  1W87 A;  3A8I A;  2XNJ A;  4DK1 A;  3MMP A;  3CC7 B;  2OK8 A;  4IW3 B;  2EIX A;  2M5S A;  3CTA A;  3BCF A;  4OOS A;  2WR8 A;  1R5N A;  2C4U A;  1QGZ A;  1IJF A;  3OFN A;  1DAR A;  3WBK A;  4XLF A;  1E3Z A;  4XMY A;  5A8A A;  4X0C A;  4MYT A; 
#chains in the Genus database with same CATH homology
 2ZL7 A;  3ASR A;  3PA2 A;  2OBR A;  5F4J A;  3LQE A;  4X07 A;  4P12 A;  3V7A A;  4WZT A;  4P2N A;  4Z4V A;  3Q3A A;  4RPD A;  5IYW A;  3ONY A;  4RDK A;  3ASS A;  2OBS A;  2ZL5 A;  4P26 A;  2ZL6 A;  3SKB A;  3LQ6 A;  4Z4S A;  4RPB A;  4OOX A;  3R6K A;  3AST A;  3Q6Q A;  4QV2 A;  4RLZ A;  5HZA A;  4RM0 A;  3PVD A;  4X06 A;  4OPO A;  4RDJ A;  3SEJ A;  3SLD A;  1IHM A;  3R6J A;  4OPV A;  4Z4U A;  3ASP A;  5E6T A;  5F4O A;  4ROX A;  3PUN A;  5KW9 A;  4QVA A;  4X7D A;  3ONU A;  4X7F A;  2OBT A;  5IYR A;  4WZE A;  5IYN A;  5IYP A;  5BSY A;  4QVJ A;  4WZL A;  4P25 A;  4P1V A;  4Z4Y A;  4P3I A;  4X7C A;  4QUZ A;  3Q39 A;  3BY1 A;  5BSX A;  3BQJ A;  3Q6R A;  5F4M A;  4OPS A;  4WZK A;  3D26 A;  3SLN A;  4RDL A;  5HZB A;  5IYQ A;  4OOV A;  3PA1 A;  5J3O A;  3ASQ A;  3RY8 A;  4Z4Z A;  3PUM A;  4Z4T A;  4OP7 A;  5J35 A;  3BY2 A;  4X05 A;  3Q38 A;  4Z4W A;  4OOS A;  3SJP A;  4X7E A;  4Z4R A;  4X0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...