5BSXA

Crystal structure of gii.10 p domain in complex with disinfectant puregreen24
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
314
structure length
308
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein
publication title Treatment of norovirus particles with citrate.
pubmed doi rcsb
source organism Norwalk virus
total genus 66
structure length 308
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5bsxA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5bsxA01
4RDKA 3Q39A 4QVAA 4OOVA 4RDJA 5J35A 3PA2A 3PVDA 5F4MA 3ASSA 4Z4TA 3SLDA 4OOSA 2ZL6A 2OBRA 2OBSA 2ZL7A 3PA1A 3Q38A 3BQJA 5HZBA 3R6KA 4Z4YA 4QUZA 3LQEA 4RLZA 4X7DA 4Z4VA 5J3OA 4Z4UA 1IHMA 5F4OA 4QV2A 3ASPA 5BSXA 5HZAA 4Z4RA 3ASRA 4X7FA 3LQ6A 3ONUA 4WZKA 4P12A 4Z4ZA 3Q6RA 4RDLA 5KW9A 4X7EA 4WZEA 4P1VA 4WZTA 3PUMA 4WZLA 5IYWA 4P3IA 4QVJA 4X7CA 3R6JA 4OPOA 5IYPA 3ASTA 4X07A 3ONYA 4P2NA 3SLNA 3PUNA 4OP7A 3Q3AA 4OPVA 4Z4WA 4ROXA 4P26A 5E6TA 5IYQA 4RPDA 3SKBA 4RPBA 3Q6QA 4RM0A 3SEJA 4P25A 5BSYA 2OBTA 4X06A 3RY8A 3BY1A 3ASQA 5F4JA 3V7AA 2ZL5A 4OOXA 4X05A 5IYRA 3BY2A 4X0CA 3SJPA 4OPSA 3D26A 4Z4SA 5IYNA
chains in the Genus database with same CATH superfamily
3FKSA 1KC8D 1NRKA 1BX0A 4DNTB 1HA3A 1ZM2A 4B43A 4M1KA 2E1BA 4XLEA 1MRZA 3ZBUA 2BM1A 3CB4A 1VLOA 4TMTA 5FL7A 1EFRA 3W2HA 4ZGNB 2F1LA 1Q82D 4B44A 3V76A 3VR6A 4XKWA 1E1RA 4TSFA 1VQMB 3SLDA 1TTTA 3CCVB 4XOPA 3CMEB 1S4MA 1PKVA 3CTAA 4G6IA 4RCZA 4P9SA 2ZL7A 2CC2A 1QGZA 2XZPA 1FNMA 4U9UA 3ES9A 3VO1A 5HZBA 3G05A 2OK8A 2GPJA 1WOSA 1UD4A 4QUZA 2YWEA 3G71B 1VQ8B 4X7DA 2B7BA 3BNWA 4Z4UA 2VJJA 2DY1A 3G4SB 1RQPA 1UD3A 4NBSA 5DN6A 3ZUGA 1W34A 3LO8A 2XNCA 1D2EA 1N05A 1ZM3A 2DYIA 1D8TA 4M53A 4AF7A 4G7XA 4Z4RA 4AVZA 1WPCA 3ASRA 3WBJA 1NB0A 3LQ6A 2DEUA 4PC6A 4C43A 4XMYA 4YAUA 1BPLA 1MABA 3CP2A 4XD7A 4ASUA 4Z4ZA 1N0VC 3GIRA 3A8IA 2BV3A 2XGJA 4II3A 5KW9A 3OFNA 4G1VA 4TN1A 4XR6A 1CQXA 3CCUB 1IB0A 1VQ7B 3CCMB 4P1VA 4QFMA 3A3GA 3PUMA 3A35A 1K8AD 1JB9A 3CMMA 2BVNA 3T56B 1FNDA 1FRNA 2ZZFA 4X7CA 4UZUA 1N07A 1ZM4A 1QFYA 3AVXA 3ZZTA 4MYUA 5AN9A 1DARA 1XFOA 3AVTA 3H9NA 4B3GA 2EIXA 1R5NA 4PAAA 4B47A 3WY9A 2DERA 1FNCA 3SLNA 5CDFA 4OP7A 2C4TA 3Q3AA 2JJ1A 3T53B 3CC4B 4YXWA 3WNBA 5E6TA 3CCEB 5TV2A 4YEJA 3CW2A 1N08A 4XORA 4YELA 3SKBA 2ZZEA 4IW3B 3WXMA 3CMAB 2VBUA 1V0EA 2WJVA 2QN6A 2F1MA 2VBSA 4Y7CA 1FNBA 5FA6A 4YAOA 1R5OA 1W9XA 1VHEA 2Q6LA 4RD0A 2DETA 3BY1A 1XQBA 3V7AA 2ZL5A 2BM0A 4KKTA 3OZVA 1WORA 2VBVA 4X05A 1N8RD 5IYRA 4DQKA 1VQ6B 1YLOA 4X8IA 1UD2A 4X0CA 1V0FA 3D26A 1SKYB 4B4DA 4XQFA 2NPFA 4LBZA 1FRQA 2YWGA 1NBMA 4EH1A 2VNIA 2ZTGA 2X6YA 3AGPA 4ZV4A 1JJ2B 3VO2A 3SJZA 2OTLB 1KRHA 3VNUA 1NB9A 4Y9UA 4LBWA 2D9RA 1BLIA 4XN3A 4M0LA 2QDXA 3AVYA 5A88A 3A3BA 3I56B 4QHYA 1JA0A 3ASSA 4RD3A 2ZITA 4Z4TA 1KD1D 1COWA 4DQLA 4RJLA 2ZL6A 2Q6OA 2OBSA 1QFJA 2V7UA 3PA1A 4DK0A 3Q38A 2X3UA 1FX0A 1Q81D 3R6KA 1T6YA 3H94A 4RCYA 4LC0A 3LQEA 4PC7A 3OZWA 5J3OA 4Z4VA 3QSYA 4ZGQB 4ZCMA 3OAAA 1PJ5A 2D74A 2XZOA 3CCLB 3CRZA 1IHMA 1QVGB 2BMWA 4QV2A 3ASPA 1WTHD 3JU4A 1KQSB 3E1YE 4JMQA 1UD8A 4CQJA 4X7FA 3W5UA 2GREA 2PIAA 4WZKA 3W2GA 4XLAA 3AVVA 3Q6RA 1KMHA 1WOPA 3OP1A 2F43A 1D1NA 3AGQA 2JDIA 1QX4A 3CD6B 4RD6A 1VQ9B 1DDGA 1E79A 3OJXA 2R9VA 4P6YA 1EWYA 3OJWA 4XOTA 1E62A 2RC5A 3QFTA 1YIJB 4XKVA 1T6ZA 2JIZA 5IYPA 1G7TA 1GAWA 2WZPP 3P27A 4FWTA 3W5VA 2YWFA 4B48A 3CCQB 1P4MA 1HVXA 3ONYA 2B5OA 2V7WA 1QGAA 1YI2B 5JBQA 1W2BB 4DNRB 4WQMA 4K1XA 1EFCA 1G7RA 4XM3A 4TKOB 3GVKA 4ACAA 1EXMA 4XONA 1OGJA 2B7CA 4P26A 1PJ7A 5IYQA 3ISXA 1QVFB 4LBVA 3CCRB 2ZBVA 3CCJB 4Q7JB 3FPPA 4XL9A 1BQEA 1BX1A 4RPBA 3CCSB 4RM0A 3SEJA 1K28D 1ZM9A 2GJKA 4R71A 4HE6A 4N3NA 4TMWA 4X06A 1TUIA 5HKKA 3CC7B 3RY8A 1Q86D 4F7DA 4RD1A 2ZXIA 2D3NA 1PJ6A 3P26A 5TRDA 4G7WA 3G6EB 4KKUA 3FJOA 2M5SA 2PE3A 4PC2A 4Z4SA 1SKQA 4NNJA 1OHHA 1K73D 2X85A 1DDIA 1YHQB 4G1BA 1N06A 2EFGA 3AVWA 3E20A 3KEWA 2AHOA 2OTJB 2WZNA 1OB2A 2QMUA 1NJID 3WQZA 2VZLA 1KK3A 2V7XA 2NV4A 5F4MA 5A89A 2XEXA 2XNDA 3QFRA 4L8JA 2BSAA 4RD4A 2QGGA 1GJRA 1YJNB 1OB5A 1I18A 2WPDA 1UD5A 3W5HA 1BMFA 3OEEA 4WWVA 3CC2B 3VNVA 2WYRA 3B78A 3BQJA 3OW7A 3MHPA 1U2RA 2OK7A 4YAWA 2FVGA 4Z4YA 4GQNA 2HMAA 4TT3A 5GV8A 3VMFA 2D3LA 3B82A 4PGOA 2WJYA 3NE5B 1UD6A 5TR9A 3PENA 3ZBTA 2R6HA 1HZEA 3A8JA 2ZZGA 1YX2A 3ZC3A 1WU8A 5HZAA 3JQPA 3BH4A 2BGJA 3A8KA 3ONUA 2KVOA 2P3MA 3QFSA 3CXCB 2ZZQA 1GO2A 1YITB 2X6WA 2W6IA 3GVLA 2BGIA 4XNFA 4X7EA 3ZIAA 3QFCA 3GSIA 4UZFA 3I55B 2FX3A 3OEHA 3I1FA 5KNLA 2PMDA 2V31A 1T6XA 4WZLA 1GAQA 4PC1A 1VHOA 2JN9A 4P3IA 1KK1A 2Z6BD 2CW5A 3OW2B 3R6JA 1JNYA 4ZCIA 2OYNA 4XLFA 1VQPB 4OPOA 1WDTA 4NCNA 2PLFA 1UMKA 5B6IA 3ASTA 1KK2A 5IK2A 1B2RA 1KZLA 3OPOA 4E0FA 1ELOA 1K9MD 1TLLA 3FPKA 2WSSA 1KJZA 1W0KA 3BCDA 2ZTNA 4ACBA 1TVCA 4OPVA 4B3FX 1VQ4B 4HIZA 3BC9A 3W2EA 5L46A 3OKXA 2C5HA 1J9ZA 1YJWB 1E63A 1Y0RA 1QG0A 1T5EA 5BSYA 4P25A 2VNHA 1VF7A 2XNJA 1EP3B 2GJPA 2CK3A 1H8HA 1VJSA 1H85A 2I1LA 2CRVA 3ASQA 5F4JA 1WOOA 1WSVA 4OOXA 2DOGA 1CNEA 2BF4A 2X0KA 1QFZA 3QE2A 5A8AA 3U6BA 1GR1A 3LVBA 1OB0A 3WNDA 4OPSA 3MCAA 1GVHA 1VQKB 2HCJB 4RDKA 3CPWB 1G7SA 3Q39A 1B23P 4QVAA 4FXUA 5H5JA 2CBXA 4N3GA 3ZPNA 2V7TA 4OOVA 4FK8A 4RDJA 1E64A 2BN4A 1A8PA 3CPXA 4FN5A 2C5BA 3MMPA 4UZEA 4MYTA 4C0SA 2HLDA 2QA4B 1AIPA 2GQFA 1H8EA 5J35A 1Q9SA 3PA2A 4PABA 5FIUA 1YJ9B 3OE7A 2X6XA 1W35A 3PVDA 2GJRA 4XN0A 4YAFA 3U2QA 1E43A 4ZCLA 2E1RA 1DG1G 4OOSA 5TY0A 5KSWB 1FDRA 1N0UA 1OGIA 4HE5A 2OBRA 2VYQA 4TMXA 2VNKA 3W2IA 3WBKA 4M2LA 1S72B 1VLYA 2QTLA 3CP8A 3HAGA 1I7PA 4DK1A 1EFUA 1VQLB 1IJFA 4RLZA 1E3ZA 2ZXHA 2RC6A 1R5BA 1WSRA 1I8DA 4J0QA 4RD2A 1S0UA 2X8KA 4YALA 5HXBA 1V5VA 3GQBA 5F4OA 4Z1MA 3WYAA 5H59A 4AF6A 4B3XA 5BSXA 2W6JA 1IJEA 3OZUA 2F4NA 4KKSA 3OOCA 4P12A 2DIEA 2X53S 2VNJA 1SM4A 2J7KA 4TMVA 5FO1A 3WNCA 2GK6A 4UAJA 5FNZA 4RDLA 4AC9A 1QH0A 1E1QA 3GVJA 1H42A 3KL9A 3JQRA 5LMZA 2XZLA 5DSZA 2Q6IA 2BPOA 4M4SA 1E3XA 4WZEA 5DS0A 4P22A 4Y9RA 4WZTA 2QTZA 1XE1A 2DCUA 5IYWA 1RQRA 4QVJA 1AMOA 3AVUA 2C77A 1Y0YA 3BCFA 3DDYA 1BJKA 1EP1B 1G7CA 2WR8A 1VQNB 1M1KD 2V4DA 4H9GA 4YHBA 4BPRA 2GK7A 3U6KA 2C78A 4X07A 2XOKA 1KTVA 1EFTA 1NDHA 3T51B 1JA1A 4G5GA 1F60A 1WP6A 4P2NA 3CESA 2QE7A 2V7VA 2C2WA 3B8HA 3A1PA 3J81k 3PUNA 4Z4WA 2Q6KA 4ROXA 5FO0A 2VJIA 3ZZUA 1EP2B 3ZZ0A 1M90D 1CNFA 1QUFA 4RPDA 2QEXB 2ZBUA 3LNNA 5THXA 2HDNB 1ZUNB 5EMNA 4II2A 3Q6QA 1W0JA 4TMZA 2LZJA 2OBTA 4LBYA 1QUEA 4PC3A 3W2FA 1QGYA 4P3YA 2VBTA 4XLHA 4XLCA 2V7QA 1W87A 3JQQA 1XB2A 2YWHA 4P6VF 1VQ5B 1F20A 2C4UA 5GV7A 2CF4A 1VQOB 1Q7YD 3BY2A 1KK0A 3SJPA 2CNDA 2JJ2A 5IYNA
chains in the Genus database with same CATH topology
4RDKA 3Q39A 4QVAA 4OOVA 4RDJA 5J35A 3PA2A 3PVDA 5F4MA 3ASSA 4Z4TA 3SLDA 4OOSA 2ZL6A 2OBRA 2OBSA 2ZL7A 3PA1A 3Q38A 3BQJA 5HZBA 3R6KA 4Z4YA 4QUZA 3LQEA 4RLZA 4X7DA 4Z4VA 5J3OA 4Z4UA 1IHMA 5F4OA 4QV2A 3ASPA 5BSXA 5HZAA 4Z4RA 3ASRA 4X7FA 3LQ6A 3ONUA 4WZKA 4P12A 4Z4ZA 3Q6RA 4RDLA 5KW9A 4X7EA 4WZEA 4P1VA 4WZTA 3PUMA 4WZLA 5IYWA 4P3IA 4QVJA 4X7CA 3R6JA 4OPOA 5IYPA 3ASTA 4X07A 3ONYA 4P2NA 3SLNA 3PUNA 4OP7A 3Q3AA 4OPVA 4Z4WA 4ROXA 4P26A 5E6TA 5IYQA 4RPDA 3SKBA 4RPBA 3Q6QA 4RM0A 3SEJA 4P25A 5BSYA 2OBTA 4X06A 3RY8A 3BY1A 3ASQA 5F4JA 3V7AA 2ZL5A 4OOXA 4X05A 5IYRA 3BY2A 4X0CA 3SJPA 4OPSA 3D26A 4Z4SA 5IYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RDK A;  3Q39 A;  4QVA A;  4OOV A;  4RDJ A;  5J35 A;  3PA2 A;  3PVD A;  5F4M A;  3ASS A;  4Z4T A;  3SLD A;  4OOS A;  2ZL6 A;  2OBR A;  2OBS A;  2ZL7 A;  3PA1 A;  3Q38 A;  3BQJ A;  5HZB A;  3R6K A;  4Z4Y A;  4QUZ A;  3LQE A;  4RLZ A;  4X7D A;  4Z4V A;  5J3O A;  4Z4U A;  1IHM A;  5F4O A;  4QV2 A;  3ASP A;  5BSX A;  5HZA A;  4Z4R A;  3ASR A;  4X7F A;  3LQ6 A;  3ONU A;  4WZK A;  4P12 A;  4Z4Z A;  3Q6R A;  4RDL A;  5KW9 A;  4X7E A;  4WZE A;  4P1V A;  4WZT A;  3PUM A;  4WZL A;  5IYW A;  4P3I A;  4QVJ A;  4X7C A;  3R6J A;  4OPO A;  5IYP A;  3AST A;  4X07 A;  3ONY A;  4P2N A;  3SLN A;  3PUN A;  4OP7 A;  3Q3A A;  4OPV A;  4Z4W A;  4ROX A;  4P26 A;  5E6T A;  5IYQ A;  4RPD A;  3SKB A;  4RPB A;  3Q6Q A;  4RM0 A;  3SEJ A;  4P25 A;  5BSY A;  2OBT A;  4X06 A;  3RY8 A;  3BY1 A;  3ASQ A;  5F4J A;  3V7A A;  2ZL5 A;  4OOX A;  4X05 A;  5IYR A;  3BY2 A;  4X0C A;  3SJP A;  4OPS A;  3D26 A;  4Z4S A;  5IYN A; 
#chains in the Genus database with same CATH topology
 3FKS A;  1KC8 D;  1NRK A;  1BX0 A;  4DNT B;  1HA3 A;  1ZM2 A;  4B43 A;  4M1K A;  2E1B A;  4XLE A;  1MRZ A;  3ZBU A;  2BM1 A;  3CB4 A;  1VLO A;  4TMT A;  5FL7 A;  1EFR A;  3W2H A;  4ZGN B;  2F1L A;  1Q82 D;  4B44 A;  3V76 A;  3VR6 A;  4XKW A;  1E1R A;  4TSF A;  1VQM B;  3SLD A;  1TTT A;  3CCV B;  4XOP A;  3CME B;  1S4M A;  1PKV A;  3CTA A;  4G6I A;  4RCZ A;  4P9S A;  2ZL7 A;  2CC2 A;  1QGZ A;  2XZP A;  1FNM A;  4U9U A;  3ES9 A;  3VO1 A;  5HZB A;  3G05 A;  2OK8 A;  2GPJ A;  1WOS A;  1UD4 A;  4QUZ A;  2YWE A;  3G71 B;  1VQ8 B;  4X7D A;  2B7B A;  3BNW A;  4Z4U A;  2VJJ A;  2DY1 A;  3G4S B;  1RQP A;  1UD3 A;  4NBS A;  5DN6 A;  3ZUG A;  1W34 A;  3LO8 A;  2XNC A;  1D2E A;  1N05 A;  1ZM3 A;  2DYI A;  1D8T A;  4M53 A;  4AF7 A;  4G7X A;  4Z4R A;  4AVZ A;  1WPC A;  3ASR A;  3WBJ A;  1NB0 A;  3LQ6 A;  2DEU A;  4PC6 A;  4C43 A;  4XMY A;  4YAU A;  1BPL A;  1MAB A;  3CP2 A;  4XD7 A;  4ASU A;  4Z4Z A;  1N0V C;  3GIR A;  3A8I A;  2BV3 A;  2XGJ A;  4II3 A;  5KW9 A;  3OFN A;  4G1V A;  4TN1 A;  4XR6 A;  1CQX A;  3CCU B;  1IB0 A;  1VQ7 B;  3CCM B;  4P1V A;  4QFM A;  3A3G A;  3PUM A;  3A35 A;  1K8A D;  1JB9 A;  3CMM A;  2BVN A;  3T56 B;  1FND A;  1FRN A;  2ZZF A;  4X7C A;  4UZU A;  1N07 A;  1ZM4 A;  1QFY A;  3AVX A;  3ZZT A;  4MYU A;  5AN9 A;  1DAR A;  1XFO A;  3AVT A;  3H9N A;  4B3G A;  2EIX A;  1R5N A;  4PAA A;  4B47 A;  3WY9 A;  2DER A;  1FNC A;  3SLN A;  5CDF A;  4OP7 A;  2C4T A;  3Q3A A;  2JJ1 A;  3T53 B;  3CC4 B;  4YXW A;  3WNB A;  5E6T A;  3CCE B;  5TV2 A;  4YEJ A;  3CW2 A;  1N08 A;  4XOR A;  4YEL A;  3SKB A;  2ZZE A;  4IW3 B;  3WXM A;  3CMA B;  2VBU A;  1V0E A;  2WJV A;  2QN6 A;  2F1M A;  2VBS A;  4Y7C A;  1FNB A;  5FA6 A;  4YAO A;  1R5O A;  1W9X A;  1VHE A;  2Q6L A;  4RD0 A;  2DET A;  3BY1 A;  1XQB A;  3V7A A;  2ZL5 A;  2BM0 A;  4KKT A;  3OZV A;  1WOR A;  2VBV A;  4X05 A;  1N8R D;  5IYR A;  4DQK A;  1VQ6 B;  1YLO A;  4X8I A;  1UD2 A;  4X0C A;  1V0F A;  3D26 A;  1SKY B;  4B4D A;  4XQF A;  2NPF A;  4LBZ A;  1FRQ A;  2YWG A;  1NBM A;  4EH1 A;  2VNI A;  2ZTG A;  2X6Y A;  3AGP A;  4ZV4 A;  1JJ2 B;  3VO2 A;  3SJZ A;  2OTL B;  1KRH A;  3VNU A;  1NB9 A;  4Y9U A;  4LBW A;  2D9R A;  1BLI A;  4XN3 A;  4M0L A;  2QDX A;  3AVY A;  5A88 A;  3A3B A;  3I56 B;  4QHY A;  1JA0 A;  3ASS A;  4RD3 A;  2ZIT A;  4Z4T A;  1KD1 D;  1COW A;  4DQL A;  4RJL A;  2ZL6 A;  2Q6O A;  2OBS A;  1QFJ A;  2V7U A;  3PA1 A;  4DK0 A;  3Q38 A;  2X3U A;  1FX0 A;  1Q81 D;  3R6K A;  1T6Y A;  3H94 A;  4RCY A;  4LC0 A;  3LQE A;  4PC7 A;  3OZW A;  5J3O A;  4Z4V A;  3QSY A;  4ZGQ B;  4ZCM A;  3OAA A;  1PJ5 A;  2D74 A;  2XZO A;  3CCL B;  3CRZ A;  1IHM A;  1QVG B;  2BMW A;  4QV2 A;  3ASP A;  1WTH D;  3JU4 A;  1KQS B;  3E1Y E;  4JMQ A;  1UD8 A;  4CQJ A;  4X7F A;  3W5U A;  2GRE A;  2PIA A;  4WZK A;  3W2G A;  4XLA A;  3AVV A;  3Q6R A;  1KMH A;  1WOP A;  3OP1 A;  2F43 A;  1D1N A;  3AGQ A;  2JDI A;  1QX4 A;  3CD6 B;  4RD6 A;  1VQ9 B;  1DDG A;  1E79 A;  3OJX A;  2R9V A;  4P6Y A;  1EWY A;  3OJW A;  4XOT A;  1E62 A;  2RC5 A;  3QFT A;  1YIJ B;  4XKV A;  1T6Z A;  2JIZ A;  5IYP A;  1G7T A;  1GAW A;  2WZP P;  3P27 A;  4FWT A;  3W5V A;  2YWF A;  4B48 A;  3CCQ B;  1P4M A;  1HVX A;  3ONY A;  2B5O A;  2V7W A;  1QGA A;  1YI2 B;  5JBQ A;  1W2B B;  4DNR B;  4WQM A;  4K1X A;  1EFC A;  1G7R A;  4XM3 A;  4TKO B;  3GVK A;  4ACA A;  1EXM A;  4XON A;  1OGJ A;  2B7C A;  4P26 A;  1PJ7 A;  5IYQ A;  3ISX A;  1QVF B;  4LBV A;  3CCR B;  2ZBV A;  3CCJ B;  4Q7J B;  3FPP A;  4XL9 A;  1BQE A;  1BX1 A;  4RPB A;  3CCS B;  4RM0 A;  3SEJ A;  1K28 D;  1ZM9 A;  2GJK A;  4R71 A;  4HE6 A;  4N3N A;  4TMW A;  4X06 A;  1TUI A;  5HKK A;  3CC7 B;  3RY8 A;  1Q86 D;  4F7D A;  4RD1 A;  2ZXI A;  2D3N A;  1PJ6 A;  3P26 A;  5TRD A;  4G7W A;  3G6E B;  4KKU A;  3FJO A;  2M5S A;  2PE3 A;  4PC2 A;  4Z4S A;  1SKQ A;  4NNJ A;  1OHH A;  1K73 D;  2X85 A;  1DDI A;  1YHQ B;  4G1B A;  1N06 A;  2EFG A;  3AVW A;  3E20 A;  3KEW A;  2AHO A;  2OTJ B;  2WZN A;  1OB2 A;  2QMU A;  1NJI D;  3WQZ A;  2VZL A;  1KK3 A;  2V7X A;  2NV4 A;  5F4M A;  5A89 A;  2XEX A;  2XND A;  3QFR A;  4L8J A;  2BSA A;  4RD4 A;  2QGG A;  1GJR A;  1YJN B;  1OB5 A;  1I18 A;  2WPD A;  1UD5 A;  3W5H A;  1BMF A;  3OEE A;  4WWV A;  3CC2 B;  3VNV A;  2WYR A;  3B78 A;  3BQJ A;  3OW7 A;  3MHP A;  1U2R A;  2OK7 A;  4YAW A;  2FVG A;  4Z4Y A;  4GQN A;  2HMA A;  4TT3 A;  5GV8 A;  3VMF A;  2D3L A;  3B82 A;  4PGO A;  2WJY A;  3NE5 B;  1UD6 A;  5TR9 A;  3PEN A;  3ZBT A;  2R6H A;  1HZE A;  3A8J A;  2ZZG A;  1YX2 A;  3ZC3 A;  1WU8 A;  5HZA A;  3JQP A;  3BH4 A;  2BGJ A;  3A8K A;  3ONU A;  2KVO A;  2P3M A;  3QFS A;  3CXC B;  2ZZQ A;  1GO2 A;  1YIT B;  2X6W A;  2W6I A;  3GVL A;  2BGI A;  4XNF A;  4X7E A;  3ZIA A;  3QFC A;  3GSI A;  4UZF A;  3I55 B;  2FX3 A;  3OEH A;  3I1F A;  5KNL A;  2PMD A;  2V31 A;  1T6X A;  4WZL A;  1GAQ A;  4PC1 A;  1VHO A;  2JN9 A;  4P3I A;  1KK1 A;  2Z6B D;  2CW5 A;  3OW2 B;  3R6J A;  1JNY A;  4ZCI A;  2OYN A;  4XLF A;  1VQP B;  4OPO A;  1WDT A;  4NCN A;  2PLF A;  1UMK A;  5B6I A;  3AST A;  1KK2 A;  5IK2 A;  1B2R A;  1KZL A;  3OPO A;  4E0F A;  1ELO A;  1K9M D;  1TLL A;  3FPK A;  2WSS A;  1KJZ A;  1W0K A;  3BCD A;  2ZTN A;  4ACB A;  1TVC A;  4OPV A;  4B3F X;  1VQ4 B;  4HIZ A;  3BC9 A;  3W2E A;  5L46 A;  3OKX A;  2C5H A;  1J9Z A;  1YJW B;  1E63 A;  1Y0R A;  1QG0 A;  1T5E A;  5BSY A;  4P25 A;  2VNH A;  1VF7 A;  2XNJ A;  1EP3 B;  2GJP A;  2CK3 A;  1H8H A;  1VJS A;  1H85 A;  2I1L A;  2CRV A;  3ASQ A;  5F4J A;  1WOO A;  1WSV A;  4OOX A;  2DOG A;  1CNE A;  2BF4 A;  2X0K A;  1QFZ A;  3QE2 A;  5A8A A;  3U6B A;  1GR1 A;  3LVB A;  1OB0 A;  3WND A;  4OPS A;  3MCA A;  1GVH A;  1VQK B;  2HCJ B;  4RDK A;  3CPW B;  1G7S A;  3Q39 A;  1B23 P;  4QVA A;  4FXU A;  5H5J A;  2CBX A;  4N3G A;  3ZPN A;  2V7T A;  4OOV A;  4FK8 A;  4RDJ A;  1E64 A;  2BN4 A;  1A8P A;  3CPX A;  4FN5 A;  2C5B A;  3MMP A;  4UZE A;  4MYT A;  4C0S A;  2HLD A;  2QA4 B;  1AIP A;  2GQF A;  1H8E A;  5J35 A;  1Q9S A;  3PA2 A;  4PAB A;  5FIU A;  1YJ9 B;  3OE7 A;  2X6X A;  1W35 A;  3PVD A;  2GJR A;  4XN0 A;  4YAF A;  3U2Q A;  1E43 A;  4ZCL A;  2E1R A;  1DG1 G;  4OOS A;  5TY0 A;  5KSW B;  1FDR A;  1N0U A;  1OGI A;  4HE5 A;  2OBR A;  2VYQ A;  4TMX A;  2VNK A;  3W2I A;  3WBK A;  4M2L A;  1S72 B;  1VLY A;  2QTL A;  3CP8 A;  3HAG A;  1I7P A;  4DK1 A;  1EFU A;  1VQL B;  1IJF A;  4RLZ A;  1E3Z A;  2ZXH A;  2RC6 A;  1R5B A;  1WSR A;  1I8D A;  4J0Q A;  4RD2 A;  1S0U A;  2X8K A;  4YAL A;  5HXB A;  1V5V A;  3GQB A;  5F4O A;  4Z1M A;  3WYA A;  5H59 A;  4AF6 A;  4B3X A;  5BSX A;  2W6J A;  1IJE A;  3OZU A;  2F4N A;  4KKS A;  3OOC A;  4P12 A;  2DIE A;  2X53 S;  2VNJ A;  1SM4 A;  2J7K A;  4TMV A;  5FO1 A;  3WNC A;  2GK6 A;  4UAJ A;  5FNZ A;  4RDL A;  4AC9 A;  1QH0 A;  1E1Q A;  3GVJ A;  1H42 A;  3KL9 A;  3JQR A;  5LMZ A;  2XZL A;  5DSZ A;  2Q6I A;  2BPO A;  4M4S A;  1E3X A;  4WZE A;  5DS0 A;  4P22 A;  4Y9R A;  4WZT A;  2QTZ A;  1XE1 A;  2DCU A;  5IYW A;  1RQR A;  4QVJ A;  1AMO A;  3AVU A;  2C77 A;  1Y0Y A;  3BCF A;  3DDY A;  1BJK A;  1EP1 B;  1G7C A;  2WR8 A;  1VQN B;  1M1K D;  2V4D A;  4H9G A;  4YHB A;  4BPR A;  2GK7 A;  3U6K A;  2C78 A;  4X07 A;  2XOK A;  1KTV A;  1EFT A;  1NDH A;  3T51 B;  1JA1 A;  4G5G A;  1F60 A;  1WP6 A;  4P2N A;  3CES A;  2QE7 A;  2V7V A;  2C2W A;  3B8H A;  3A1P A;  3J81 k;  3PUN A;  4Z4W A;  2Q6K A;  4ROX A;  5FO0 A;  2VJI A;  3ZZU A;  1EP2 B;  3ZZ0 A;  1M90 D;  1CNF A;  1QUF A;  4RPD A;  2QEX B;  2ZBU A;  3LNN A;  5THX A;  2HDN B;  1ZUN B;  5EMN A;  4II2 A;  3Q6Q A;  1W0J A;  4TMZ A;  2LZJ A;  2OBT A;  4LBY A;  1QUE A;  4PC3 A;  3W2F A;  1QGY A;  4P3Y A;  2VBT A;  4XLH A;  4XLC A;  2V7Q A;  1W87 A;  3JQQ A;  1XB2 A;  2YWH A;  4P6V F;  1VQ5 B;  1F20 A;  2C4U A;  5GV7 A;  2CF4 A;  1VQO B;  1Q7Y D;  3BY2 A;  1KK0 A;  3SJP A;  2CND A;  2JJ2 A;  5IYN A; 
#chains in the Genus database with same CATH homology
 4RDK A;  3Q39 A;  4QVA A;  4OOV A;  4RDJ A;  5J35 A;  3PA2 A;  3PVD A;  5F4M A;  3ASS A;  4Z4T A;  3SLD A;  4OOS A;  2ZL6 A;  2OBR A;  2OBS A;  2ZL7 A;  3PA1 A;  3Q38 A;  3BQJ A;  5HZB A;  3R6K A;  4Z4Y A;  4QUZ A;  3LQE A;  4RLZ A;  4X7D A;  4Z4V A;  5J3O A;  4Z4U A;  1IHM A;  5F4O A;  4QV2 A;  3ASP A;  5BSX A;  5HZA A;  4Z4R A;  3ASR A;  4X7F A;  3LQ6 A;  3ONU A;  4WZK A;  4P12 A;  4Z4Z A;  3Q6R A;  4RDL A;  5KW9 A;  4X7E A;  4WZE A;  4P1V A;  4WZT A;  3PUM A;  4WZL A;  5IYW A;  4P3I A;  4QVJ A;  4X7C A;  3R6J A;  4OPO A;  5IYP A;  3AST A;  4X07 A;  3ONY A;  4P2N A;  3SLN A;  3PUN A;  4OP7 A;  3Q3A A;  4OPV A;  4Z4W A;  4ROX A;  4P26 A;  5E6T A;  5IYQ A;  4RPD A;  3SKB A;  4RPB A;  3Q6Q A;  4RM0 A;  3SEJ A;  4P25 A;  5BSY A;  2OBT A;  4X06 A;  3RY8 A;  3BY1 A;  3ASQ A;  5F4J A;  3V7A A;  2ZL5 A;  4OOX A;  4X05 A;  5IYR A;  3BY2 A;  4X0C A;  3SJP A;  4OPS A;  3D26 A;  4Z4S A;  5IYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...