4Z4VA

Crystal structure of gii.10 p domain in complex with 19mm fucose
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
315
structure length
311
Chain Sequence
SKPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The sweet quartet: Binding of fucose to the norovirus capsid.
pubmed doi rcsb
source organism Norovirus gii.10
molecule tags Viral protein
molecule keywords Capsid protein
total genus 71
structure length 311
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4z4vA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4z4vA01
4RDJA 5E6TA 5F4OA 4OOXA 5BSXA 4WZLA 4X7FA 4X05A 5IYRA 3R6JA 4Z4WA 4Z4VA 4ROXA 3RY8A 3ASTA 4Z4SA 4RPBA 4X07A 4P25A 5IYNA 4QVAA 5HZAA 4Z4UA 3Q3AA 3LQ6A 3BQJA 3ASQA 3ONYA 2OBSA 3SKBA 5HZBA 2ZL5A 3PA1A 5BSYA 5F4MA 5J35A 3Q39A 3LQEA 4RDLA 4RM0A 3PUNA 4X06A 3V7AA 3BY2A 3SLNA 4P2NA 3SEJA 3R6KA 4X0CA 4Z4YA 4Z4TA 4P3IA 3PVDA 3Q6RA 4Z4ZA 5IYQA 3ASSA 4OPSA 3PA2A 4X7DA 4WZTA 4Z4RA 4WZEA 2ZL6A 3SLDA 3ONUA 3SJPA 4OPVA 3PUMA 3Q38A 3ASPA 4OPOA 3Q6QA 4OP7A 5IYPA 3BY1A 5IYWA 4RLZA 4OOSA 2OBTA 4RDKA 3D26A 4X7CA 4P12A 4WZKA 4OOVA 5J3OA 4QV2A 2OBRA 5KW9A 1IHMA 4QUZA 2ZL7A 4P1VA 3ASRA 5F4JA 4X7EA 4P26A 4RPDA 4QVJA
chains in the Genus database with same CATH superfamily
4QFMA 4MYUA 3QE2A 4P9SA 1NB9A 2X3UA 4RD4A 4OOXA 1VQ6B 1QFJA 4YALA 2QTLA 3VO2A 4X05A 2V7WA 5IYRA 1KK1A 4ZGQB 4Z4WA 1JB9A 5FL7A 2JJ2A 4TSFA 2F43A 1VQMB 3V76A 4Z4SA 1NRKA 4RPBA 3I55B 3KL9A 4AF6A 4PGOA 1KTVA 1QGAA 3W2HA 2GJPA 1YLOA 3B82A 2GQFA 1RQPA 3Q3AA 3BQJA 4M1KA 1VLYA 1W0KA 5DN6A 1S4MA 4M4SA 4XOTA 2BV3A 5HZBA 3ZUGA 3VNUA 4LBZA 3T51B 4IW3B 2PMDA 2V31A 1BQEA 1UD2A 2F1LA 1UD5A 3CCSB 1GVHA 5J35A 1Q86D 1HA3A 1Y0RA 2C4UA 1GO2A 4AVZA 1UMKA 5THXA 4RM0A 4TMTA 5H59A 5KNLA 3QSYA 3MCAA 1V0FA 4UZEA 2C4TA 4WWVA 1XFOA 4G5GA 3SLNA 4P2NA 3SEJA 1EFRA 2V7UA 4XLEA 2I1LA 1VQ8B 2V7VA 2X85A 4Z4TA 1UD6A 3PVDA 5A89A 5IYQA 1VQ4B 2VNIA 4RD6A 1E43A 4X7DA 3CMAB 4YELA 1T6XA 1COWA 1G7CA 2R9VA 1GAWA 3OZWA 5GV8A 1VQLB 3QFTA 3GVKA 1TUIA 3SJPA 2WYRA 1EFUA 3OEHA 3AVUA 2XGJA 1KK2A 1VF7A 3Q38A 1ELOA 2EIXA 3AVXA 3Q6QA 1NB0A 2Z6BD 3ZBUA 2X6YA 4OP7A 4B3GA 1Q82D 1QUEA 5LMZA 2BMWA 4G1BA 4N3GA 3OOCA 4XKVA 3A3GA 3CW2A 4OOSA 4XL9A 1E1QA 2HMAA 4G1VA 2ZTNA 4BPRA 3CESA 3MMPA 4XLCA 1H8HA 4XLFA 3FPPA 4PC7A 1ZM3A 2Q6KA 4DNTB 1SM4A 1W35A 2EFGA 1VQKB 1QGYA 1E63A 2OBRA 1E62A 2OK8A 2CW5A 4ZCIA 1EFCA 3VNVA 3CCEB 1DDIA 1FNCA 1YJ9B 2OYNA 2RC5A 4TMXA 4TT3A 1FRQA 4XLHA 1NJID 1D2EA 4P26A 2WR8A 1W34A 5BSYA 1I18A 5E6TA 1XB2A 4UZUA 3JQPA 1CQXA 1AIPA 1R5OA 2WZNA 2ZBUA 1I7PA 4G7WA 1QGZA 2J7KA 3JQQA 1KD1D 1M1KD 1KRHA 4X7FA 3BNWA 3CP2A 2B7BA 1M90D 1TVCA 3R6JA 1H85A 4TMWA 2WJVA 2X6XA 3T56B 2ZTGA 1HZEA 1VQNB 2CK3A 4ROXA 2JDIA 1DARA 2BGJA 4RCYA 1WPCA 1K9MD 1YI2B 5FIUA 5HZAA 3AGQA 4J0QA 4XN0A 3FJOA 1WOOA 3GQBA 2CRVA 1BPLA 4LC0A 4PC3A 2OBSA 4DK1A 2B5OA 3WNBA 2VNKA 3A8KA 1VQ5B 1FNMA 1FNBA 1QVFB 5F4MA 1VQ9B 4RDLA 1BLIA 1PJ5A 2YWEA 3WY9A 1YIJB 4P6VF 4L8JA 1VQPB 3HAGA 4M2LA 4FK8A 4Y7CA 3ZZUA 2YWFA 2PE3A 4X06A 1W0JA 2XZOA 3V7AA 3CCJB 2NV4A 1WDTA 2C77A 2DIEA 3VMFA 2GJKA 2LZJA 4PABA 4M0LA 4DK0A 4X0CA 3G71B 3GVJA 3OZVA 2X0KA 2QGGA 4Z4YA 2QMUA 4P3IA 2XNDA 1UD4A 2VJJA 1K73D 3ASSA 1PJ6A 1VQ7B 2GPJA 4XLAA 2DOGA 1I8DA 4C0SA 3WBKA 5CDFA 3CC2B 5DSZA 3CCUB 2V7QA 4WZEA 4K1XA 5EMNA 1OHHA 3LO8A 3I56B 2RC6A 1AMOA 1JJ2B 2PLFA 1T5EA 2BPOA 1S72B 3I1FA 3OEEA 4RD1A 2ZITA 2ZBVA 3ASPA 1T6ZA 4RCZA 3BC9A 2CC2A 3CPWB 2XEXA 5L46A 1JA1A 1JNYA 1KMHA 3AVVA 3CD6B 1KQSB 3LNNA 4XN3A 3ZIAA 3OJWA 3H94A 2OBTA 5TRDA 1S0UA 2WJYA 4RDKA 1W9XA 1N06A 2VBVA 3QFCA 1VHEA 1ZM4A 5GV7A 2VBUA 4P12A 4WZKA 4OOVA 3BCFA 1Q7YD 5J3OA 1WP6A 4NCNA 5A8AA 3CTAA 3G4SB 3H9NA 1W87A 2D3LA 4HE6A 4YAFA 2F1MA 3OE7A 1PKVA 1YITB 3JQRA 5HXBA 3A8JA 5HKKA 2ZL7A 4P1VA 3ASRA 4YEJA 5IK2A 1TTTA 5F4JA 1NDHA 1WTHD 2HCJB 4DNRB 3GVLA 5FNZA 4PAAA 1RQRA 3LVBA 2ZXHA 3A8IA 1KK3A 2WSSA 2JJ1A 2QN6A 2GREA 2E1RA 1E1RA 5F4OA 5FA6A 4TMZA 2C5HA 2ZZEA 5BSXA 2D74A 4WZLA 2DYIA 4ACAA 1F20A 2E1BA 4U9UA 2M5SA 3CPXA 1QFZA 4P22A 4F7DA 4LBWA 5AN9A 1OB5A 4NBSA 1ZUNB 1EP1B 4Z4VA 3W5HA 3B78A 4X8IA 5H5JA 1TLLA 4X07A 1D8TA 2W6JA 4QVAA 2W6IA 4FWTA 4RD2A 5TY0A 1EFTA 4PC2A 1JA0A 3W2FA 3ASQA 1YHQB 2VNHA 3JU4A 1KC8D 3SKBA 4NNJA 3WNCA 3CMMA 4CQJA 4ZV4A 4TN1A 3U6KA 1H8EA 1UD3A 1XE1A 1PJ7A 2R6HA 1VLOA 3A3BA 2ZL5A 1QFYA 5B6IA 5TV2A 3ZZ0A 2QEXB 5JBQA 1IB0A 2HLDA 3Q39A 3ZPNA 1N0UA 1VQOB 1G7TA 4G6IA 1SKQA 4FXUA 1CNFA 2VBSA 3OFNA 4UAJA 2OK7A 1F60A 3A1PA 1MRZA 2V7XA 3OJXA 2KVOA 2JIZA 4XQFA 2D9RA 4HIZA 3W5VA 3CCRB 4AF7A 3BY2A 3R6KA 3CCVB 4LBYA 1VHOA 1QH0A 2GK7A 3OP1A 1OB0A 2QA4B 2QDXA 3Q6RA 4ACBA 3QFSA 2VYQA 1E3ZA 4OPSA 3PA2A 5FO0A 4Z4ZA 2Q6IA 3PENA 4WZTA 4Y9UA 1K8AD 3B8HA 3ES9A 4II2A 3ISXA 1A8PA 3OZUA 4B44A 2CF4A 4LBVA 4XD7A 4OPVA 4B47A 4M53A 3CC4B 3PUMA 1R5BA 4HE5A 4YXWA 5KSWB 1WORA 2DCUA 2BF4A 3AGPA 1IJEA 1G7SA 3QFRA 4ZGNB 5IYWA 2PIAA 1UD8A 1BJKA 2X6WA 4KKSA 2BSAA 1G7RA 2OTLB 3G6EB 4B48A 2XZLA 2BM0A 2BM1A 1WOPA 4C43A 1E64A 4UZFA 2VBTA 3CC7B 4YAUA 4DQLA 4QHYA 1N05A 1Y0YA 4JMQA 4XR6A 4B3FX 3MHPA 1W2BB 3CMEB 5KW9A 4XM3A 1KZLA 1CNEA 4QUZA 2CBXA 3P27A 4YHBA 1P4MA 3CCLB 1B2RA 3AVTA 3P26A 4X7EA 4RPDA 1E79A 2FVGA 3CCQB 3J81k 2QTZA 4RDJA 5A88A 1OGIA 2DEUA 3ZZTA 2QE7A 1VJSA 2GK6A 4RD3A 2CNDA 1GAQA 1WSRA 4WQMA 3G05A 4TKOB 4DQKA 2X8KA 2XNJA 1D1NA 4B43A 3OKXA 3VR6A 3AVYA 1FNDA 2C5BA 3NE5B 3CRZA 4KKTA 1BMFA 4N3NA 5TR9A 3RY8A 4MYTA 3WBJA 3ASTA 4XORA 3WQZA 4P25A 2F4NA 5IYNA 3WYAA 1J9ZA 3VO1A 4RJLA 1E3XA 1T6YA 3W2IA 1N08A 4P3YA 3W2EA 4Z4UA 1ZM2A 4YAOA 3LQ6A 4AC9A 3ONYA 1XQBA 1FRNA 4GQNA 1R5NA 3KEWA 3FKSA 3CXCB 3AVWA 4XONA 1EWYA 1V0EA 1NBMA 3WXMA 3ZC3A 4EH1A 4P6YA 3PA1A 1EP3B 4Z1MA 3LQEA 1N8RD 1Q81D 1BX1A 2OTJB 1GR1A 4B4DA 1K28D 2ZZGA 1WSVA 2WZPP 3PUNA 1EXMA 2VJIA 2V7TA 3SJZA 3W2GA 2C2WA 2V4DA 2VNJA 3BH4A 4XMYA 2XNCA 3OPOA 2NPFA 1YX2A 1DDGA 4ZCMA 1H42A 3E1YE 3U6BA 2Q6LA 2XZPA 3A35A 4E0FA 1QVGB 5DS0A 3DDYA 3FPKA 2VZLA 1V5VA 1N07A 3T53B 1KJZA 2DETA 2Q6OA 1N0VC 3E20A 3CP8A 1GJRA 2ZZFA 2YWHA 4ASUA 4II3A 4Z4RA 2WPDA 3GSIA 2ZL6A 4G7XA 3SLDA 3ONUA 1KK0A 2ZXIA 1YJNB 2DERA 4FN5A 1BX0A 2D3NA 2BN4A 1EP2B 3BCDA 1DG1G 2YWGA 2ZZQA 4OPOA 4PC1A 2FX3A 1ZM9A 3WNDA 1QUFA 1SKYB 1WU8A 5IYPA 3BY1A 2GJRA 2XOKA 1IJFA 2P3MA 1U2RA 4B3XA 3GIRA 3U2QA 4RLZA 2HDNB 1HVXA 1Q9SA 1WOSA 1QG0A 3OW2B 1OGJA 4XNFA 1QX4A 3OAAA 1FDRA 4RD0A 4KKUA 3D26A 2C78A 4X7CA 4XKWA 2JN9A 2B7CA 2BVNA 4H9GA 4YAWA 1FX0A 5FO1A 3W5UA 4QV2A 2DY1A 4R71A 4TMVA 2AHOA 1OB2A 4ZCLA 2X53S 1B23P 1IHMA 3OW7A 3ZBTA 1YJWB 4PC6A 4Y9RA 4XOPA 1MABA 3CB4A 4Q7JB 2BGIA 3CCMB 4QVJA
chains in the Genus database with same CATH topology
4RDJA 5E6TA 5F4OA 4OOXA 5BSXA 4WZLA 4X7FA 4X05A 5IYRA 3R6JA 4Z4WA 4Z4VA 4ROXA 3RY8A 3ASTA 4Z4SA 4RPBA 4X07A 4P25A 5IYNA 4QVAA 5HZAA 4Z4UA 3Q3AA 3LQ6A 3BQJA 3ASQA 3ONYA 2OBSA 3SKBA 5HZBA 2ZL5A 3PA1A 5BSYA 5F4MA 5J35A 3Q39A 3LQEA 4RDLA 4RM0A 3PUNA 4X06A 3V7AA 3BY2A 3SLNA 4P2NA 3SEJA 3R6KA 4X0CA 4Z4YA 4Z4TA 4P3IA 3PVDA 3Q6RA 4Z4ZA 5IYQA 3ASSA 4OPSA 3PA2A 4X7DA 4WZTA 4Z4RA 4WZEA 2ZL6A 3SLDA 3ONUA 3SJPA 4OPVA 3PUMA 3Q38A 3ASPA 4OPOA 3Q6QA 4OP7A 5IYPA 3BY1A 5IYWA 4RLZA 4OOSA 2OBTA 4RDKA 3D26A 4X7CA 4P12A 4WZKA 4OOVA 5J3OA 4QV2A 2OBRA 5KW9A 1IHMA 4QUZA 2ZL7A 4P1VA 3ASRA 5F4JA 4X7EA 4P26A 4RPDA 4QVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RDJ A;  5E6T A;  5F4O A;  4OOX A;  5BSX A;  4WZL A;  4X7F A;  4X05 A;  5IYR A;  3R6J A;  4Z4W A;  4Z4V A;  4ROX A;  3RY8 A;  3AST A;  4Z4S A;  4RPB A;  4X07 A;  4P25 A;  5IYN A;  4QVA A;  5HZA A;  4Z4U A;  3Q3A A;  3LQ6 A;  3BQJ A;  3ASQ A;  3ONY A;  2OBS A;  3SKB A;  5HZB A;  2ZL5 A;  3PA1 A;  5BSY A;  5F4M A;  5J35 A;  3Q39 A;  3LQE A;  4RDL A;  4RM0 A;  3PUN A;  4X06 A;  3V7A A;  3BY2 A;  3SLN A;  4P2N A;  3SEJ A;  3R6K A;  4X0C A;  4Z4Y A;  4Z4T A;  4P3I A;  3PVD A;  3Q6R A;  4Z4Z A;  5IYQ A;  3ASS A;  4OPS A;  3PA2 A;  4X7D A;  4WZT A;  4Z4R A;  4WZE A;  2ZL6 A;  3SLD A;  3ONU A;  3SJP A;  4OPV A;  3PUM A;  3Q38 A;  3ASP A;  4OPO A;  3Q6Q A;  4OP7 A;  5IYP A;  3BY1 A;  5IYW A;  4RLZ A;  4OOS A;  2OBT A;  4RDK A;  3D26 A;  4X7C A;  4P12 A;  4WZK A;  4OOV A;  5J3O A;  4QV2 A;  2OBR A;  5KW9 A;  1IHM A;  4QUZ A;  2ZL7 A;  4P1V A;  3ASR A;  5F4J A;  4X7E A;  4P26 A;  4RPD A;  4QVJ A; 
#chains in the Genus database with same CATH topology
 4QFM A;  4MYU A;  3QE2 A;  4P9S A;  1NB9 A;  2X3U A;  4RD4 A;  4OOX A;  1VQ6 B;  1QFJ A;  4YAL A;  2QTL A;  3VO2 A;  4X05 A;  2V7W A;  5IYR A;  1KK1 A;  4ZGQ B;  4Z4W A;  1JB9 A;  5FL7 A;  2JJ2 A;  4TSF A;  2F43 A;  1VQM B;  3V76 A;  4Z4S A;  1NRK A;  4RPB A;  3I55 B;  3KL9 A;  4AF6 A;  4PGO A;  1KTV A;  1QGA A;  3W2H A;  2GJP A;  1YLO A;  3B82 A;  2GQF A;  1RQP A;  3Q3A A;  3BQJ A;  4M1K A;  1VLY A;  1W0K A;  5DN6 A;  1S4M A;  4M4S A;  4XOT A;  2BV3 A;  5HZB A;  3ZUG A;  3VNU A;  4LBZ A;  3T51 B;  4IW3 B;  2PMD A;  2V31 A;  1BQE A;  1UD2 A;  2F1L A;  1UD5 A;  3CCS B;  1GVH A;  5J35 A;  1Q86 D;  1HA3 A;  1Y0R A;  2C4U A;  1GO2 A;  4AVZ A;  1UMK A;  5THX A;  4RM0 A;  4TMT A;  5H59 A;  5KNL A;  3QSY A;  3MCA A;  1V0F A;  4UZE A;  2C4T A;  4WWV A;  1XFO A;  4G5G A;  3SLN A;  4P2N A;  3SEJ A;  1EFR A;  2V7U A;  4XLE A;  2I1L A;  1VQ8 B;  2V7V A;  2X85 A;  4Z4T A;  1UD6 A;  3PVD A;  5A89 A;  5IYQ A;  1VQ4 B;  2VNI A;  4RD6 A;  1E43 A;  4X7D A;  3CMA B;  4YEL A;  1T6X A;  1COW A;  1G7C A;  2R9V A;  1GAW A;  3OZW A;  5GV8 A;  1VQL B;  3QFT A;  3GVK A;  1TUI A;  3SJP A;  2WYR A;  1EFU A;  3OEH A;  3AVU A;  2XGJ A;  1KK2 A;  1VF7 A;  3Q38 A;  1ELO A;  2EIX A;  3AVX A;  3Q6Q A;  1NB0 A;  2Z6B D;  3ZBU A;  2X6Y A;  4OP7 A;  4B3G A;  1Q82 D;  1QUE A;  5LMZ A;  2BMW A;  4G1B A;  4N3G A;  3OOC A;  4XKV A;  3A3G A;  3CW2 A;  4OOS A;  4XL9 A;  1E1Q A;  2HMA A;  4G1V A;  2ZTN A;  4BPR A;  3CES A;  3MMP A;  4XLC A;  1H8H A;  4XLF A;  3FPP A;  4PC7 A;  1ZM3 A;  2Q6K A;  4DNT B;  1SM4 A;  1W35 A;  2EFG A;  1VQK B;  1QGY A;  1E63 A;  2OBR A;  1E62 A;  2OK8 A;  2CW5 A;  4ZCI A;  1EFC A;  3VNV A;  3CCE B;  1DDI A;  1FNC A;  1YJ9 B;  2OYN A;  2RC5 A;  4TMX A;  4TT3 A;  1FRQ A;  4XLH A;  1NJI D;  1D2E A;  4P26 A;  2WR8 A;  1W34 A;  5BSY A;  1I18 A;  5E6T A;  1XB2 A;  4UZU A;  3JQP A;  1CQX A;  1AIP A;  1R5O A;  2WZN A;  2ZBU A;  1I7P A;  4G7W A;  1QGZ A;  2J7K A;  3JQQ A;  1KD1 D;  1M1K D;  1KRH A;  4X7F A;  3BNW A;  3CP2 A;  2B7B A;  1M90 D;  1TVC A;  3R6J A;  1H85 A;  4TMW A;  2WJV A;  2X6X A;  3T56 B;  2ZTG A;  1HZE A;  1VQN B;  2CK3 A;  4ROX A;  2JDI A;  1DAR A;  2BGJ A;  4RCY A;  1WPC A;  1K9M D;  1YI2 B;  5FIU A;  5HZA A;  3AGQ A;  4J0Q A;  4XN0 A;  3FJO A;  1WOO A;  3GQB A;  2CRV A;  1BPL A;  4LC0 A;  4PC3 A;  2OBS A;  4DK1 A;  2B5O A;  3WNB A;  2VNK A;  3A8K A;  1VQ5 B;  1FNM A;  1FNB A;  1QVF B;  5F4M A;  1VQ9 B;  4RDL A;  1BLI A;  1PJ5 A;  2YWE A;  3WY9 A;  1YIJ B;  4P6V F;  4L8J A;  1VQP B;  3HAG A;  4M2L A;  4FK8 A;  4Y7C A;  3ZZU A;  2YWF A;  2PE3 A;  4X06 A;  1W0J A;  2XZO A;  3V7A A;  3CCJ B;  2NV4 A;  1WDT A;  2C77 A;  2DIE A;  3VMF A;  2GJK A;  2LZJ A;  4PAB A;  4M0L A;  4DK0 A;  4X0C A;  3G71 B;  3GVJ A;  3OZV A;  2X0K A;  2QGG A;  4Z4Y A;  2QMU A;  4P3I A;  2XND A;  1UD4 A;  2VJJ A;  1K73 D;  3ASS A;  1PJ6 A;  1VQ7 B;  2GPJ A;  4XLA A;  2DOG A;  1I8D A;  4C0S A;  3WBK A;  5CDF A;  3CC2 B;  5DSZ A;  3CCU B;  2V7Q A;  4WZE A;  4K1X A;  5EMN A;  1OHH A;  3LO8 A;  3I56 B;  2RC6 A;  1AMO A;  1JJ2 B;  2PLF A;  1T5E A;  2BPO A;  1S72 B;  3I1F A;  3OEE A;  4RD1 A;  2ZIT A;  2ZBV A;  3ASP A;  1T6Z A;  4RCZ A;  3BC9 A;  2CC2 A;  3CPW B;  2XEX A;  5L46 A;  1JA1 A;  1JNY A;  1KMH A;  3AVV A;  3CD6 B;  1KQS B;  3LNN A;  4XN3 A;  3ZIA A;  3OJW A;  3H94 A;  2OBT A;  5TRD A;  1S0U A;  2WJY A;  4RDK A;  1W9X A;  1N06 A;  2VBV A;  3QFC A;  1VHE A;  1ZM4 A;  5GV7 A;  2VBU A;  4P12 A;  4WZK A;  4OOV A;  3BCF A;  1Q7Y D;  5J3O A;  1WP6 A;  4NCN A;  5A8A A;  3CTA A;  3G4S B;  3H9N A;  1W87 A;  2D3L A;  4HE6 A;  4YAF A;  2F1M A;  3OE7 A;  1PKV A;  1YIT B;  3JQR A;  5HXB A;  3A8J A;  5HKK A;  2ZL7 A;  4P1V A;  3ASR A;  4YEJ A;  5IK2 A;  1TTT A;  5F4J A;  1NDH A;  1WTH D;  2HCJ B;  4DNR B;  3GVL A;  5FNZ A;  4PAA A;  1RQR A;  3LVB A;  2ZXH A;  3A8I A;  1KK3 A;  2WSS A;  2JJ1 A;  2QN6 A;  2GRE A;  2E1R A;  1E1R A;  5F4O A;  5FA6 A;  4TMZ A;  2C5H A;  2ZZE A;  5BSX A;  2D74 A;  4WZL A;  2DYI A;  4ACA A;  1F20 A;  2E1B A;  4U9U A;  2M5S A;  3CPX A;  1QFZ A;  4P22 A;  4F7D A;  4LBW A;  5AN9 A;  1OB5 A;  4NBS A;  1ZUN B;  1EP1 B;  4Z4V A;  3W5H A;  3B78 A;  4X8I A;  5H5J A;  1TLL A;  4X07 A;  1D8T A;  2W6J A;  4QVA A;  2W6I A;  4FWT A;  4RD2 A;  5TY0 A;  1EFT A;  4PC2 A;  1JA0 A;  3W2F A;  3ASQ A;  1YHQ B;  2VNH A;  3JU4 A;  1KC8 D;  3SKB A;  4NNJ A;  3WNC A;  3CMM A;  4CQJ A;  4ZV4 A;  4TN1 A;  3U6K A;  1H8E A;  1UD3 A;  1XE1 A;  1PJ7 A;  2R6H A;  1VLO A;  3A3B A;  2ZL5 A;  1QFY A;  5B6I A;  5TV2 A;  3ZZ0 A;  2QEX B;  5JBQ A;  1IB0 A;  2HLD A;  3Q39 A;  3ZPN A;  1N0U A;  1VQO B;  1G7T A;  4G6I A;  1SKQ A;  4FXU A;  1CNF A;  2VBS A;  3OFN A;  4UAJ A;  2OK7 A;  1F60 A;  3A1P A;  1MRZ A;  2V7X A;  3OJX A;  2KVO A;  2JIZ A;  4XQF A;  2D9R A;  4HIZ A;  3W5V A;  3CCR B;  4AF7 A;  3BY2 A;  3R6K A;  3CCV B;  4LBY A;  1VHO A;  1QH0 A;  2GK7 A;  3OP1 A;  1OB0 A;  2QA4 B;  2QDX A;  3Q6R A;  4ACB A;  3QFS A;  2VYQ A;  1E3Z A;  4OPS A;  3PA2 A;  5FO0 A;  4Z4Z A;  2Q6I A;  3PEN A;  4WZT A;  4Y9U A;  1K8A D;  3B8H A;  3ES9 A;  4II2 A;  3ISX A;  1A8P A;  3OZU A;  4B44 A;  2CF4 A;  4LBV A;  4XD7 A;  4OPV A;  4B47 A;  4M53 A;  3CC4 B;  3PUM A;  1R5B A;  4HE5 A;  4YXW A;  5KSW B;  1WOR A;  2DCU A;  2BF4 A;  3AGP A;  1IJE A;  1G7S A;  3QFR A;  4ZGN B;  5IYW A;  2PIA A;  1UD8 A;  1BJK A;  2X6W A;  4KKS A;  2BSA A;  1G7R A;  2OTL B;  3G6E B;  4B48 A;  2XZL A;  2BM0 A;  2BM1 A;  1WOP A;  4C43 A;  1E64 A;  4UZF A;  2VBT A;  3CC7 B;  4YAU A;  4DQL A;  4QHY A;  1N05 A;  1Y0Y A;  4JMQ A;  4XR6 A;  4B3F X;  3MHP A;  1W2B B;  3CME B;  5KW9 A;  4XM3 A;  1KZL A;  1CNE A;  4QUZ A;  2CBX A;  3P27 A;  4YHB A;  1P4M A;  3CCL B;  1B2R A;  3AVT A;  3P26 A;  4X7E A;  4RPD A;  1E79 A;  2FVG A;  3CCQ B;  3J81 k;  2QTZ A;  4RDJ A;  5A88 A;  1OGI A;  2DEU A;  3ZZT A;  2QE7 A;  1VJS A;  2GK6 A;  4RD3 A;  2CND A;  1GAQ A;  1WSR A;  4WQM A;  3G05 A;  4TKO B;  4DQK A;  2X8K A;  2XNJ A;  1D1N A;  4B43 A;  3OKX A;  3VR6 A;  3AVY A;  1FND A;  2C5B A;  3NE5 B;  3CRZ A;  4KKT A;  1BMF A;  4N3N A;  5TR9 A;  3RY8 A;  4MYT A;  3WBJ A;  3AST A;  4XOR A;  3WQZ A;  4P25 A;  2F4N A;  5IYN A;  3WYA A;  1J9Z A;  3VO1 A;  4RJL A;  1E3X A;  1T6Y A;  3W2I A;  1N08 A;  4P3Y A;  3W2E A;  4Z4U A;  1ZM2 A;  4YAO A;  3LQ6 A;  4AC9 A;  3ONY A;  1XQB A;  1FRN A;  4GQN A;  1R5N A;  3KEW A;  3FKS A;  3CXC B;  3AVW A;  4XON A;  1EWY A;  1V0E A;  1NBM A;  3WXM A;  3ZC3 A;  4EH1 A;  4P6Y A;  3PA1 A;  1EP3 B;  4Z1M A;  3LQE A;  1N8R D;  1Q81 D;  1BX1 A;  2OTJ B;  1GR1 A;  4B4D A;  1K28 D;  2ZZG A;  1WSV A;  2WZP P;  3PUN A;  1EXM A;  2VJI A;  2V7T A;  3SJZ A;  3W2G A;  2C2W A;  2V4D A;  2VNJ A;  3BH4 A;  4XMY A;  2XNC A;  3OPO A;  2NPF A;  1YX2 A;  1DDG A;  4ZCM A;  1H42 A;  3E1Y E;  3U6B A;  2Q6L A;  2XZP A;  3A35 A;  4E0F A;  1QVG B;  5DS0 A;  3DDY A;  3FPK A;  2VZL A;  1V5V A;  1N07 A;  3T53 B;  1KJZ A;  2DET A;  2Q6O A;  1N0V C;  3E20 A;  3CP8 A;  1GJR A;  2ZZF A;  2YWH A;  4ASU A;  4II3 A;  4Z4R A;  2WPD A;  3GSI A;  2ZL6 A;  4G7X A;  3SLD A;  3ONU A;  1KK0 A;  2ZXI A;  1YJN B;  2DER A;  4FN5 A;  1BX0 A;  2D3N A;  2BN4 A;  1EP2 B;  3BCD A;  1DG1 G;  2YWG A;  2ZZQ A;  4OPO A;  4PC1 A;  2FX3 A;  1ZM9 A;  3WND A;  1QUF A;  1SKY B;  1WU8 A;  5IYP A;  3BY1 A;  2GJR A;  2XOK A;  1IJF A;  2P3M A;  1U2R A;  4B3X A;  3GIR A;  3U2Q A;  4RLZ A;  2HDN B;  1HVX A;  1Q9S A;  1WOS A;  1QG0 A;  3OW2 B;  1OGJ A;  4XNF A;  1QX4 A;  3OAA A;  1FDR A;  4RD0 A;  4KKU A;  3D26 A;  2C78 A;  4X7C A;  4XKW A;  2JN9 A;  2B7C A;  2BVN A;  4H9G A;  4YAW A;  1FX0 A;  5FO1 A;  3W5U A;  4QV2 A;  2DY1 A;  4R71 A;  4TMV A;  2AHO A;  1OB2 A;  4ZCL A;  2X53 S;  1B23 P;  1IHM A;  3OW7 A;  3ZBT A;  1YJW B;  4PC6 A;  4Y9R A;  4XOP A;  1MAB A;  3CB4 A;  4Q7J B;  2BGI A;  3CCM B;  4QVJ A; 
#chains in the Genus database with same CATH homology
 4RDJ A;  5E6T A;  5F4O A;  4OOX A;  5BSX A;  4WZL A;  4X7F A;  4X05 A;  5IYR A;  3R6J A;  4Z4W A;  4Z4V A;  4ROX A;  3RY8 A;  3AST A;  4Z4S A;  4RPB A;  4X07 A;  4P25 A;  5IYN A;  4QVA A;  5HZA A;  4Z4U A;  3Q3A A;  3LQ6 A;  3BQJ A;  3ASQ A;  3ONY A;  2OBS A;  3SKB A;  5HZB A;  2ZL5 A;  3PA1 A;  5BSY A;  5F4M A;  5J35 A;  3Q39 A;  3LQE A;  4RDL A;  4RM0 A;  3PUN A;  4X06 A;  3V7A A;  3BY2 A;  3SLN A;  4P2N A;  3SEJ A;  3R6K A;  4X0C A;  4Z4Y A;  4Z4T A;  4P3I A;  3PVD A;  3Q6R A;  4Z4Z A;  5IYQ A;  3ASS A;  4OPS A;  3PA2 A;  4X7D A;  4WZT A;  4Z4R A;  4WZE A;  2ZL6 A;  3SLD A;  3ONU A;  3SJP A;  4OPV A;  3PUM A;  3Q38 A;  3ASP A;  4OPO A;  3Q6Q A;  4OP7 A;  5IYP A;  3BY1 A;  5IYW A;  4RLZ A;  4OOS A;  2OBT A;  4RDK A;  3D26 A;  4X7C A;  4P12 A;  4WZK A;  4OOV A;  5J3O A;  4QV2 A;  2OBR A;  5KW9 A;  1IHM A;  4QUZ A;  2ZL7 A;  4P1V A;  3ASR A;  5F4J A;  4X7E A;  4P26 A;  4RPD A;  4QVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...