4Z4VA

Crystal structure of gii.10 p domain in complex with 19mm fucose
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
315
structure length
311
Chain Sequence
SKPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein
publication title The sweet quartet: Binding of fucose to the norovirus capsid.
pubmed doi rcsb
source organism Norovirus gii.10
total genus 71
structure length 311
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4z4vA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4z4vA01
4X06A 4Z4UA 3Q3AA 4RDKA 4Z4TA 4QV2A 4RDJA 3PVDA 4WZKA 5HZBA 4X07A 5F4MA 4Z4VA 2OBTA 3ONYA 2OBRA 4X0CA 4OPVA 3LQEA 3SJPA 4P2NA 5IYQA 5E6TA 4RPDA 4Z4SA 3SEJA 3BY2A 4RLZA 2ZL7A 3ONUA 3LQ6A 5IYWA 5HZAA 3ASTA 4X7CA 3PUMA 3ASQA 4X05A 4ROXA 2ZL5A 4P12A 4X7FA 3ASRA 3ASSA 4OOXA 4QVJA 4RPBA 3BQJA 5KW9A 3Q6QA 3R6JA 4WZLA 5BSYA 4Z4RA 4X7DA 5BSXA 3D26A 5IYRA 4OP7A 5J3OA 5F4JA 4P1VA 3Q39A 3PA1A 4RM0A 3V7AA 1IHMA 4OPOA 4OOVA 5IYNA 3Q38A 4WZEA 3SKBA 3ASPA 4QUZA 4QVAA 3BY1A 2ZL6A 4P26A 4RDLA 3RY8A 3Q6RA 4Z4ZA 5J35A 3R6KA 3SLNA 3PA2A 5IYPA 5F4OA 4OPSA 4X7EA 4P25A 4OOSA 4P3IA 3SLDA 4Z4YA 4WZTA 4Z4WA 3PUNA 2OBSA
chains in the Genus database with same CATH superfamily
3CMEB 4P9SA 2ZBUA 4AF6A 2XEXA 4IW3B 4RDKA 2XZLA 1WOPA 3I1FA 1K73D 2V31A 4ZGQB 1T6XA 1Q86D 1W87A 2YWFA 1CQXA 3PENA 2QTLA 2XGJA 2ZXIA 1Q82D 4XMYA 2YWEA 5F4MA 2OTLB 2QEXB 1R5NA 3GVLA 4XLHA 3W5UA 1UMKA 1YX2A 1R5OA 2OBRA 2DYIA 4E0FA 1E43A 5EMNA 4R71A 1VLYA 4N3GA 3OFNA 3CCUB 4M0LA 3CP2A 1QFZA 1FNCA 1G7RA 1E64A 4TMVA 1VQ7B 3G05A 4RCYA 2ZXHA 1WSVA 5GV8A 2ZZGA 1VQNB 4KKTA 3OAAA 4XLAA 3ZBTA 2GJPA 4C0SA 1WU8A 3BY2A 1Q81D 2CK3A 3E1YE 1N07A 1KK1A 2C5BA 2XZPA 4PC6A 3ONUA 4DK0A 1HZEA 1TVCA 1TUIA 1H85A 1B2RA 4ASUA 1VQOB 4RD3A 2Z6BD 1HVXA 2C2WA 2HMAA 1U2RA 4OOXA 2OTJB 1EFTA 1EXMA 1W0JA 1XB2A 3Q6QA 1QGAA 2BVNA 3R6JA 2C77A 3MHPA 4B43A 5BSYA 3CMAB 4X7DA 1S72B 1BQEA 2HDNB 5BSXA 3VO2A 1K28D 1FNDA 4HE6A 2R9VA 2YWHA 3OEEA 2PE3A 4XKVA 2B7BA 2ZTGA 1SM4A 2VBVA 4WQMA 2D9RA 2W6JA 4M53A 1E1RA 1GVHA 5HKKA 3HAGA 1H8EA 3FJOA 2X0KA 2JJ1A 3ASPA 1BX1A 4NNJA 3WBKA 2BSAA 1WPCA 1YJ9B 3LVBA 3OJWA 4UZEA 4ZV4A 4KKSA 1QH0A 5LMZA 1W34A 4HE5A 2VYQA 2VNJA 3LO8A 5DN6A 1FRNA 4ACAA 5AN9A 4P22A 4XLCA 1VQ5B 4L8JA 3WBJA 5J35A 3CRZA 2GPJA 1EWYA 3WNDA 1SKYB 2NPFA 3FPPA 3OEHA 4P6YA 3QFCA 4RD6A 4YAFA 5KSWB 4OOSA 2JJ2A 1S4MA 3B82A 4XNFA 1MABA 1PKVA 1DG1G 1WOOA 1H42A 1BJKA 3W2IA 4G5GA 2CF4A 2V7TA 2OBSA 1TLLA 2F4NA 2XNDA 3U2QA 3JQQA 3A8JA 3AVUA 4X06A 1N05A 2DERA 1E62A 2C4TA 3Q3AA 2BGIA 2QN6A 4KKUA 4Z4TA 4YALA 2ZZEA 4ZCMA 2D74A 3QFTA 3ZZUA 3OKXA 3CB4A 2DY1A 4TMXA 1VQPB 3WXMA 3CCRB 1T6ZA 5DSZA 3I56B 3ONYA 4RD4A 3A1PA 4X0CA 1E79A 1OB0A 1UD3A 2WPDA 4G7XA 3ZZTA 4OPVA 4TN1A 4YHBA 1SKQA 2XNJA 4J0QA 3JU4A 1V0EA 1I18A 3SJPA 5HXBA 1YI2B 4UZUA 1WDTA 1KK3A 4H9GA 5IYQA 3CPXA 2C5HA 1N0UA 1KK0A 5TV2A 4HIZA 1DARA 1Q9SA 1KRHA 2XNCA 1BX0A 2BGJA 5KNLA 3W2EA 3SEJA 1ZM9A 2VNHA 1KMHA 1YLOA 5FO0A 2C4UA 4XN3A 1W2BB 3A3GA 1YHQB 2WJVA 1OGJA 1WTHD 5DS0A 3CC2B 2PLFA 3OOCA 2ZZFA 3VMFA 1QUFA 1D2EA 4X7CA 4ROXA 1QFYA 2DOGA 4TMWA 1S0UA 1V5VA 3W2HA 4AC9A 1KQSB 3ASSA 1QVFB 5FL7A 3CCVB 3ZIAA 1W0KA 4B48A 3CCEB 4Z4RA 3VO1A 1D8TA 1G7CA 3BNWA 3D26A 4TKOB 1VQ4B 3QSYA 5H5JA 2F1MA 2NV4A 1YITB 4TT3A 2F1LA 5F4JA 1NB0A 5FNZA 3WNCA 4JMQA 4XLEA 1GAWA 2Q6IA 2YWGA 4BPRA 1G7TA 2GQFA 5IYNA 1T6YA 3Q38A 4WZEA 3SKBA 1WP6A 1AMOA 1FNMA 1T5EA 3CTAA 4QVAA 1FDRA 3JQPA 1HA3A 3CESA 3A35A 4F7DA 2WSSA 3BY1A 2ZL6A 2X53S 1FRQA 3W2FA 1W9XA 1MRZA 4PC1A 2VJJA 4ZGNB 2E1RA 1JJ2B 3Q6RA 1A8PA 3R6KA 3FPKA 1Y0YA 3A3BA 4MYUA 2V4DA 2V7VA 4OPSA 2X3UA 4X7EA 1DDIA 3AVXA 4P25A 2F43A 4Y9UA 3BC9A 5GV7A 1TTTA 4LC0A 4UAJA 2GREA 1IJEA 4LBWA 2JN9A 2X85A 1IB0A 4WZTA 4XOPA 2QE7A 4G1VA 3ZC3A 3DDYA 4M1KA 1PJ5A 4G6IA 2BM0A 1K9MD 3CCQB 1JB9A 2OYNA 2WJYA 1YJWB 5B6IA 4Z4UA 2M5SA 3JQRA 3WQZA 3U6KA 1GJRA 4PC3A 2CBXA 3CCMB 3OZVA 2C78A 2VBTA 4QV2A 1OB5A 3AGQA 4YELA 3AVTA 4XQFA 1E63A 4XN0A 4YAWA 3QFSA 4WZKA 2CC2A 2OK8A 2VZLA 2OBTA 1KD1D 4NBSA 1NB9A 3CP8A 1E3ZA 1ELOA 3G4SB 2HLDA 4XORA 3LQEA 4B44A 4PC2A 4NCNA 4P2NA 3OJXA 4XR6A 3P27A 4DNTB 3GVJA 1WORA 4RPDA 1N08A 4EH1A 2QMUA 3GSIA 4PAAA 4RLZA 4GQNA 4PC7A 4XKWA 2RC5A 4Y9RA 5TR9A 1GAQA 3FKSA 3VR6A 1NRKA 1VF7A 2E1BA 2P3MA 3H94A 5IYWA 3CC4B 4FWTA 5HZAA 1R5BA 2J7KA 1CNFA 3PUMA 4XD7A 1ZM4A 2BF4A 4II3A 4B3GA 1VLOA 3WNBA 1YIJB 4X7FA 3GQBA 2ZBVA 4QVJA 4RPBA 3W5VA 3ES9A 2GJRA 1QGYA 2QTZA 4WZLA 3QE2A 4YXWA 5TRDA 1N06A 2WYRA 1FX0A 2Q6OA 4PGOA 3ZUGA 4P6VF 1Q7YD 1QFJA 1QX4A 4P1VA 2BN4A 3OE7A 3OZUA 3QFRA 1XFOA 3PA1A 4UZFA 5THXA 1VQ8B 4RM0A 4DQKA 1YJNB 1JNYA 3BCDA 3V7AA 3ZBUA 2D3NA 4II2A 1IHMA 4OPOA 3OZWA 3AVYA 4K1XA 5A89A 4DK1A 3KEWA 2B5OA 1BMFA 2VBUA 2X8KA 3W5HA 1QUEA 2B7CA 4B47A 3B8HA 3LNNA 1W35A 1Y0RA 2DEUA 4RJLA 4P3YA 5A8AA 2BV3A 1VHEA 1EFUA 1RQPA 4Z1MA 4P26A 1F20A 3VNVA 2EFGA 4RDLA 1VJSA 1J9ZA 1UD5A 4QFMA 2AHOA 3RY8A 3CD6B 4LBZA 3G6EB 2V7UA 5TY0A 1WOSA 4Z4ZA 4XL9A 2VNKA 2VJIA 4ACBA 3CPWB 2R6HA 4XOTA 3U6BA 3CW2A 1CNEA 1OB2A 4G1BA 1V0FA 4WWVA 2DETA 5FA6A 4N3NA 3H9NA 1UD4A 3GVKA 2PMDA 1EP3B 4P3IA 4YEJA 3G71B 3BCFA 3NE5B 3KL9A 3P26A 1QG0A 4Z4YA 4TMTA 2BPOA 2EIXA 3ZZ0A 3OP1A 1KTVA 1WSRA 4X8IA 1G7SA 1NDHA 3CMMA 3SJZA 3MCAA 4XLFA 5L46A 1JA0A 4RDJA 2GK7A 3PVDA 1H8HA 1M90D 2RC6A 5HZBA 4M4SA 4M2LA 2CRVA 4X07A 4MYTA 4Z4VA 3OPOA 3AVVA 3GIRA 1UD6A 1QVGB 3VNUA 1QGZA 3WY9A 1N8RD 1OGIA 2FX3A 1E1QA 2W6IA 1FNBA 1VQ9B 4QHYA 2XOKA 5CDFA 1N0VC 5E6TA 2DCUA 2X6WA 2Q6KA 3MMPA 1OHHA 4Z4SA 4TMZA 4YAOA 1GR1A 2V7QA 2Q6LA 2CNDA 2X6XA 2ZL7A 2ZTNA 1IJFA 1K8AD 3LQ6A 1PJ6A 1NJID 3T56B 3B78A 3ASTA 2FVGA 1ZUNB 1KZLA 3ISXA 1XQBA 2D3LA 3ASQA 5FIUA 4X05A 1ZM2A 4B3XA 2ZL5A 4RD1A 4P12A 3W2GA 3A8KA 2OK7A 2QDXA 3ZPNA 3ASRA 3BQJA 2V7XA 5KW9A 1UD2A 4FXUA 1M1KD 3T53B 5IYRA 4OP7A 2BMWA 4DQLA 4G7WA 1EFRA 1BPLA 1COWA 1GO2A 1UD8A 4XONA 5J3OA 3CXCB 3V76A 1XE1A 2JDIA 3Q39A 3CCJB 3A8IA 2GJKA 3E20A 1VQKB 1EP1B 1EFCA 1BLIA 4XM3A 4B4DA 1ZM3A 4B3FX 4YAUA 2JIZA 1VQMB 2ZZQA 2KVOA 4OOVA 5A88A 1NBMA 1DDGA 4TSFA 2CW5A 2WZPP 4QUZA 2PIAA 2VBSA 4CQJA 4RD2A 4FK8A 2GK6A 2V7WA 1P4MA 3CC7B 1RQRA 4FN5A 1I7PA 3BH4A 3J81k 2QGGA 2I1LA 3T51B 2HCJB 3OW2B 4Q7JB 5H59A 4Y7CA 4RD0A 1KK2A 4C43A 2VNIA 2DIEA 5JBQA 4PABA 4RCZA 1VQLB 3I55B 1VQ6B 3SLNA 5IK2A 5FO1A 1E3XA 3CCSB 1D1NA 2LZJA 3PA2A 5IYPA 5F4OA 3AGPA 2X6YA 1JA1A 2WZNA 3CCLB 4AVZA 2XZOA 2BM1A 4ZCLA 3WYAA 4AF7A 4U9UA 2ZITA 1AIPA 1EP2B 1PJ7A 1KC8D 1I8DA 3SLDA 1F60A 4LBYA 3AVWA 3OW7A 1VHOA 2WR8A 2QA4B 1B23P 4Z4WA 3PUNA 1KJZA 4ZCIA 4LBVA 4DNRB
chains in the Genus database with same CATH topology
4X06A 4Z4UA 3Q3AA 4RDKA 4Z4TA 4QV2A 4RDJA 3PVDA 4WZKA 5HZBA 4X07A 5F4MA 4Z4VA 2OBTA 3ONYA 2OBRA 4X0CA 4OPVA 3LQEA 3SJPA 4P2NA 5IYQA 5E6TA 4RPDA 4Z4SA 3SEJA 3BY2A 4RLZA 2ZL7A 3ONUA 3LQ6A 5IYWA 5HZAA 3ASTA 4X7CA 3PUMA 3ASQA 4X05A 4ROXA 2ZL5A 4P12A 4X7FA 3ASRA 3ASSA 4OOXA 4QVJA 4RPBA 3BQJA 5KW9A 3Q6QA 3R6JA 4WZLA 5BSYA 4Z4RA 4X7DA 5BSXA 3D26A 5IYRA 4OP7A 5J3OA 5F4JA 4P1VA 3Q39A 3PA1A 4RM0A 3V7AA 1IHMA 4OPOA 4OOVA 5IYNA 3Q38A 4WZEA 3SKBA 3ASPA 4QUZA 4QVAA 3BY1A 2ZL6A 4P26A 4RDLA 3RY8A 3Q6RA 4Z4ZA 5J35A 3R6KA 3SLNA 3PA2A 5IYPA 5F4OA 4OPSA 4X7EA 4P25A 4OOSA 4P3IA 3SLDA 4Z4YA 4WZTA 4Z4WA 3PUNA 2OBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X06 A;  4Z4U A;  3Q3A A;  4RDK A;  4Z4T A;  4QV2 A;  4RDJ A;  3PVD A;  4WZK A;  5HZB A;  4X07 A;  5F4M A;  4Z4V A;  2OBT A;  3ONY A;  2OBR A;  4X0C A;  4OPV A;  3LQE A;  3SJP A;  4P2N A;  5IYQ A;  5E6T A;  4RPD A;  4Z4S A;  3SEJ A;  3BY2 A;  4RLZ A;  2ZL7 A;  3ONU A;  3LQ6 A;  5IYW A;  5HZA A;  3AST A;  4X7C A;  3PUM A;  3ASQ A;  4X05 A;  4ROX A;  2ZL5 A;  4P12 A;  4X7F A;  3ASR A;  3ASS A;  4OOX A;  4QVJ A;  4RPB A;  3BQJ A;  5KW9 A;  3Q6Q A;  3R6J A;  4WZL A;  5BSY A;  4Z4R A;  4X7D A;  5BSX A;  3D26 A;  5IYR A;  4OP7 A;  5J3O A;  5F4J A;  4P1V A;  3Q39 A;  3PA1 A;  4RM0 A;  3V7A A;  1IHM A;  4OPO A;  4OOV A;  5IYN A;  3Q38 A;  4WZE A;  3SKB A;  3ASP A;  4QUZ A;  4QVA A;  3BY1 A;  2ZL6 A;  4P26 A;  4RDL A;  3RY8 A;  3Q6R A;  4Z4Z A;  5J35 A;  3R6K A;  3SLN A;  3PA2 A;  5IYP A;  5F4O A;  4OPS A;  4X7E A;  4P25 A;  4OOS A;  4P3I A;  3SLD A;  4Z4Y A;  4WZT A;  4Z4W A;  3PUN A;  2OBS A; 
#chains in the Genus database with same CATH topology
 3CME B;  4P9S A;  2ZBU A;  4AF6 A;  2XEX A;  4IW3 B;  4RDK A;  2XZL A;  1WOP A;  3I1F A;  1K73 D;  2V31 A;  4ZGQ B;  1T6X A;  1Q86 D;  1W87 A;  2YWF A;  1CQX A;  3PEN A;  2QTL A;  2XGJ A;  2ZXI A;  1Q82 D;  4XMY A;  2YWE A;  5F4M A;  2OTL B;  2QEX B;  1R5N A;  3GVL A;  4XLH A;  3W5U A;  1UMK A;  1YX2 A;  1R5O A;  2OBR A;  2DYI A;  4E0F A;  1E43 A;  5EMN A;  4R71 A;  1VLY A;  4N3G A;  3OFN A;  3CCU B;  4M0L A;  3CP2 A;  1QFZ A;  1FNC A;  1G7R A;  1E64 A;  4TMV A;  1VQ7 B;  3G05 A;  4RCY A;  2ZXH A;  1WSV A;  5GV8 A;  2ZZG A;  1VQN B;  4KKT A;  3OAA A;  4XLA A;  3ZBT A;  2GJP A;  4C0S A;  1WU8 A;  3BY2 A;  1Q81 D;  2CK3 A;  3E1Y E;  1N07 A;  1KK1 A;  2C5B A;  2XZP A;  4PC6 A;  3ONU A;  4DK0 A;  1HZE A;  1TVC A;  1TUI A;  1H85 A;  1B2R A;  4ASU A;  1VQO B;  4RD3 A;  2Z6B D;  1HVX A;  2C2W A;  2HMA A;  1U2R A;  4OOX A;  2OTJ B;  1EFT A;  1EXM A;  1W0J A;  1XB2 A;  3Q6Q A;  1QGA A;  2BVN A;  3R6J A;  2C77 A;  3MHP A;  4B43 A;  5BSY A;  3CMA B;  4X7D A;  1S72 B;  1BQE A;  2HDN B;  5BSX A;  3VO2 A;  1K28 D;  1FND A;  4HE6 A;  2R9V A;  2YWH A;  3OEE A;  2PE3 A;  4XKV A;  2B7B A;  2ZTG A;  1SM4 A;  2VBV A;  4WQM A;  2D9R A;  2W6J A;  4M53 A;  1E1R A;  1GVH A;  5HKK A;  3HAG A;  1H8E A;  3FJO A;  2X0K A;  2JJ1 A;  3ASP A;  1BX1 A;  4NNJ A;  3WBK A;  2BSA A;  1WPC A;  1YJ9 B;  3LVB A;  3OJW A;  4UZE A;  4ZV4 A;  4KKS A;  1QH0 A;  5LMZ A;  1W34 A;  4HE5 A;  2VYQ A;  2VNJ A;  3LO8 A;  5DN6 A;  1FRN A;  4ACA A;  5AN9 A;  4P22 A;  4XLC A;  1VQ5 B;  4L8J A;  3WBJ A;  5J35 A;  3CRZ A;  2GPJ A;  1EWY A;  3WND A;  1SKY B;  2NPF A;  3FPP A;  3OEH A;  4P6Y A;  3QFC A;  4RD6 A;  4YAF A;  5KSW B;  4OOS A;  2JJ2 A;  1S4M A;  3B82 A;  4XNF A;  1MAB A;  1PKV A;  1DG1 G;  1WOO A;  1H42 A;  1BJK A;  3W2I A;  4G5G A;  2CF4 A;  2V7T A;  2OBS A;  1TLL A;  2F4N A;  2XND A;  3U2Q A;  3JQQ A;  3A8J A;  3AVU A;  4X06 A;  1N05 A;  2DER A;  1E62 A;  2C4T A;  3Q3A A;  2BGI A;  2QN6 A;  4KKU A;  4Z4T A;  4YAL A;  2ZZE A;  4ZCM A;  2D74 A;  3QFT A;  3ZZU A;  3OKX A;  3CB4 A;  2DY1 A;  4TMX A;  1VQP B;  3WXM A;  3CCR B;  1T6Z A;  5DSZ A;  3I56 B;  3ONY A;  4RD4 A;  3A1P A;  4X0C A;  1E79 A;  1OB0 A;  1UD3 A;  2WPD A;  4G7X A;  3ZZT A;  4OPV A;  4TN1 A;  4YHB A;  1SKQ A;  2XNJ A;  4J0Q A;  3JU4 A;  1V0E A;  1I18 A;  3SJP A;  5HXB A;  1YI2 B;  4UZU A;  1WDT A;  1KK3 A;  4H9G A;  5IYQ A;  3CPX A;  2C5H A;  1N0U A;  1KK0 A;  5TV2 A;  4HIZ A;  1DAR A;  1Q9S A;  1KRH A;  2XNC A;  1BX0 A;  2BGJ A;  5KNL A;  3W2E A;  3SEJ A;  1ZM9 A;  2VNH A;  1KMH A;  1YLO A;  5FO0 A;  2C4U A;  4XN3 A;  1W2B B;  3A3G A;  1YHQ B;  2WJV A;  1OGJ A;  1WTH D;  5DS0 A;  3CC2 B;  2PLF A;  3OOC A;  2ZZF A;  3VMF A;  1QUF A;  1D2E A;  4X7C A;  4ROX A;  1QFY A;  2DOG A;  4TMW A;  1S0U A;  1V5V A;  3W2H A;  4AC9 A;  1KQS B;  3ASS A;  1QVF B;  5FL7 A;  3CCV B;  3ZIA A;  1W0K A;  4B48 A;  3CCE B;  4Z4R A;  3VO1 A;  1D8T A;  1G7C A;  3BNW A;  3D26 A;  4TKO B;  1VQ4 B;  3QSY A;  5H5J A;  2F1M A;  2NV4 A;  1YIT B;  4TT3 A;  2F1L A;  5F4J A;  1NB0 A;  5FNZ A;  3WNC A;  4JMQ A;  4XLE A;  1GAW A;  2Q6I A;  2YWG A;  4BPR A;  1G7T A;  2GQF A;  5IYN A;  1T6Y A;  3Q38 A;  4WZE A;  3SKB A;  1WP6 A;  1AMO A;  1FNM A;  1T5E A;  3CTA A;  4QVA A;  1FDR A;  3JQP A;  1HA3 A;  3CES A;  3A35 A;  4F7D A;  2WSS A;  3BY1 A;  2ZL6 A;  2X53 S;  1FRQ A;  3W2F A;  1W9X A;  1MRZ A;  4PC1 A;  2VJJ A;  4ZGN B;  2E1R A;  1JJ2 B;  3Q6R A;  1A8P A;  3R6K A;  3FPK A;  1Y0Y A;  3A3B A;  4MYU A;  2V4D A;  2V7V A;  4OPS A;  2X3U A;  4X7E A;  1DDI A;  3AVX A;  4P25 A;  2F43 A;  4Y9U A;  3BC9 A;  5GV7 A;  1TTT A;  4LC0 A;  4UAJ A;  2GRE A;  1IJE A;  4LBW A;  2JN9 A;  2X85 A;  1IB0 A;  4WZT A;  4XOP A;  2QE7 A;  4G1V A;  3ZC3 A;  3DDY A;  4M1K A;  1PJ5 A;  4G6I A;  2BM0 A;  1K9M D;  3CCQ B;  1JB9 A;  2OYN A;  2WJY A;  1YJW B;  5B6I A;  4Z4U A;  2M5S A;  3JQR A;  3WQZ A;  3U6K A;  1GJR A;  4PC3 A;  2CBX A;  3CCM B;  3OZV A;  2C78 A;  2VBT A;  4QV2 A;  1OB5 A;  3AGQ A;  4YEL A;  3AVT A;  4XQF A;  1E63 A;  4XN0 A;  4YAW A;  3QFS A;  4WZK A;  2CC2 A;  2OK8 A;  2VZL A;  2OBT A;  1KD1 D;  4NBS A;  1NB9 A;  3CP8 A;  1E3Z A;  1ELO A;  3G4S B;  2HLD A;  4XOR A;  3LQE A;  4B44 A;  4PC2 A;  4NCN A;  4P2N A;  3OJX A;  4XR6 A;  3P27 A;  4DNT B;  3GVJ A;  1WOR A;  4RPD A;  1N08 A;  4EH1 A;  2QMU A;  3GSI A;  4PAA A;  4RLZ A;  4GQN A;  4PC7 A;  4XKW A;  2RC5 A;  4Y9R A;  5TR9 A;  1GAQ A;  3FKS A;  3VR6 A;  1NRK A;  1VF7 A;  2E1B A;  2P3M A;  3H94 A;  5IYW A;  3CC4 B;  4FWT A;  5HZA A;  1R5B A;  2J7K A;  1CNF A;  3PUM A;  4XD7 A;  1ZM4 A;  2BF4 A;  4II3 A;  4B3G A;  1VLO A;  3WNB A;  1YIJ B;  4X7F A;  3GQB A;  2ZBV A;  4QVJ A;  4RPB A;  3W5V A;  3ES9 A;  2GJR A;  1QGY A;  2QTZ A;  4WZL A;  3QE2 A;  4YXW A;  5TRD A;  1N06 A;  2WYR A;  1FX0 A;  2Q6O A;  4PGO A;  3ZUG A;  4P6V F;  1Q7Y D;  1QFJ A;  1QX4 A;  4P1V A;  2BN4 A;  3OE7 A;  3OZU A;  3QFR A;  1XFO A;  3PA1 A;  4UZF A;  5THX A;  1VQ8 B;  4RM0 A;  4DQK A;  1YJN B;  1JNY A;  3BCD A;  3V7A A;  3ZBU A;  2D3N A;  4II2 A;  1IHM A;  4OPO A;  3OZW A;  3AVY A;  4K1X A;  5A89 A;  4DK1 A;  3KEW A;  2B5O A;  1BMF A;  2VBU A;  2X8K A;  3W5H A;  1QUE A;  2B7C A;  4B47 A;  3B8H A;  3LNN A;  1W35 A;  1Y0R A;  2DEU A;  4RJL A;  4P3Y A;  5A8A A;  2BV3 A;  1VHE A;  1EFU A;  1RQP A;  4Z1M A;  4P26 A;  1F20 A;  3VNV A;  2EFG A;  4RDL A;  1VJS A;  1J9Z A;  1UD5 A;  4QFM A;  2AHO A;  3RY8 A;  3CD6 B;  4LBZ A;  3G6E B;  2V7U A;  5TY0 A;  1WOS A;  4Z4Z A;  4XL9 A;  2VNK A;  2VJI A;  4ACB A;  3CPW B;  2R6H A;  4XOT A;  3U6B A;  3CW2 A;  1CNE A;  1OB2 A;  4G1B A;  1V0F A;  4WWV A;  2DET A;  5FA6 A;  4N3N A;  3H9N A;  1UD4 A;  3GVK A;  2PMD A;  1EP3 B;  4P3I A;  4YEJ A;  3G71 B;  3BCF A;  3NE5 B;  3KL9 A;  3P26 A;  1QG0 A;  4Z4Y A;  4TMT A;  2BPO A;  2EIX A;  3ZZ0 A;  3OP1 A;  1KTV A;  1WSR A;  4X8I A;  1G7S A;  1NDH A;  3CMM A;  3SJZ A;  3MCA A;  4XLF A;  5L46 A;  1JA0 A;  4RDJ A;  2GK7 A;  3PVD A;  1H8H A;  1M90 D;  2RC6 A;  5HZB A;  4M4S A;  4M2L A;  2CRV A;  4X07 A;  4MYT A;  4Z4V A;  3OPO A;  3AVV A;  3GIR A;  1UD6 A;  1QVG B;  3VNU A;  1QGZ A;  3WY9 A;  1N8R D;  1OGI A;  2FX3 A;  1E1Q A;  2W6I A;  1FNB A;  1VQ9 B;  4QHY A;  2XOK A;  5CDF A;  1N0V C;  5E6T A;  2DCU A;  2X6W A;  2Q6K A;  3MMP A;  1OHH A;  4Z4S A;  4TMZ A;  4YAO A;  1GR1 A;  2V7Q A;  2Q6L A;  2CND A;  2X6X A;  2ZL7 A;  2ZTN A;  1IJF A;  1K8A D;  3LQ6 A;  1PJ6 A;  1NJI D;  3T56 B;  3B78 A;  3AST A;  2FVG A;  1ZUN B;  1KZL A;  3ISX A;  1XQB A;  2D3L A;  3ASQ A;  5FIU A;  4X05 A;  1ZM2 A;  4B3X A;  2ZL5 A;  4RD1 A;  4P12 A;  3W2G A;  3A8K A;  2OK7 A;  2QDX A;  3ZPN A;  3ASR A;  3BQJ A;  2V7X A;  5KW9 A;  1UD2 A;  4FXU A;  1M1K D;  3T53 B;  5IYR A;  4OP7 A;  2BMW A;  4DQL A;  4G7W A;  1EFR A;  1BPL A;  1COW A;  1GO2 A;  1UD8 A;  4XON A;  5J3O A;  3CXC B;  3V76 A;  1XE1 A;  2JDI A;  3Q39 A;  3CCJ B;  3A8I A;  2GJK A;  3E20 A;  1VQK B;  1EP1 B;  1EFC A;  1BLI A;  4XM3 A;  4B4D A;  1ZM3 A;  4B3F X;  4YAU A;  2JIZ A;  1VQM B;  2ZZQ A;  2KVO A;  4OOV A;  5A88 A;  1NBM A;  1DDG A;  4TSF A;  2CW5 A;  2WZP P;  4QUZ A;  2PIA A;  2VBS A;  4CQJ A;  4RD2 A;  4FK8 A;  2GK6 A;  2V7W A;  1P4M A;  3CC7 B;  1RQR A;  4FN5 A;  1I7P A;  3BH4 A;  3J81 k;  2QGG A;  2I1L A;  3T51 B;  2HCJ B;  3OW2 B;  4Q7J B;  5H59 A;  4Y7C A;  4RD0 A;  1KK2 A;  4C43 A;  2VNI A;  2DIE A;  5JBQ A;  4PAB A;  4RCZ A;  1VQL B;  3I55 B;  1VQ6 B;  3SLN A;  5IK2 A;  5FO1 A;  1E3X A;  3CCS B;  1D1N A;  2LZJ A;  3PA2 A;  5IYP A;  5F4O A;  3AGP A;  2X6Y A;  1JA1 A;  2WZN A;  3CCL B;  4AVZ A;  2XZO A;  2BM1 A;  4ZCL A;  3WYA A;  4AF7 A;  4U9U A;  2ZIT A;  1AIP A;  1EP2 B;  1PJ7 A;  1KC8 D;  1I8D A;  3SLD A;  1F60 A;  4LBY A;  3AVW A;  3OW7 A;  1VHO A;  2WR8 A;  2QA4 B;  1B23 P;  4Z4W A;  3PUN A;  1KJZ A;  4ZCI A;  4LBV A;  4DNR B; 
#chains in the Genus database with same CATH homology
 4X06 A;  4Z4U A;  3Q3A A;  4RDK A;  4Z4T A;  4QV2 A;  4RDJ A;  3PVD A;  4WZK A;  5HZB A;  4X07 A;  5F4M A;  4Z4V A;  2OBT A;  3ONY A;  2OBR A;  4X0C A;  4OPV A;  3LQE A;  3SJP A;  4P2N A;  5IYQ A;  5E6T A;  4RPD A;  4Z4S A;  3SEJ A;  3BY2 A;  4RLZ A;  2ZL7 A;  3ONU A;  3LQ6 A;  5IYW A;  5HZA A;  3AST A;  4X7C A;  3PUM A;  3ASQ A;  4X05 A;  4ROX A;  2ZL5 A;  4P12 A;  4X7F A;  3ASR A;  3ASS A;  4OOX A;  4QVJ A;  4RPB A;  3BQJ A;  5KW9 A;  3Q6Q A;  3R6J A;  4WZL A;  5BSY A;  4Z4R A;  4X7D A;  5BSX A;  3D26 A;  5IYR A;  4OP7 A;  5J3O A;  5F4J A;  4P1V A;  3Q39 A;  3PA1 A;  4RM0 A;  3V7A A;  1IHM A;  4OPO A;  4OOV A;  5IYN A;  3Q38 A;  4WZE A;  3SKB A;  3ASP A;  4QUZ A;  4QVA A;  3BY1 A;  2ZL6 A;  4P26 A;  4RDL A;  3RY8 A;  3Q6R A;  4Z4Z A;  5J35 A;  3R6K A;  3SLN A;  3PA2 A;  5IYP A;  5F4O A;  4OPS A;  4X7E A;  4P25 A;  4OOS A;  4P3I A;  3SLD A;  4Z4Y A;  4WZT A;  4Z4W A;  3PUN A;  2OBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...