4Z4VA

Crystal structure of gii.10 p domain in complex with 19mm fucose
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
315
structure length
311
Chain Sequence
SKPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title The sweet quartet: Binding of fucose to the norovirus capsid.
pubmed doi rcsb
source organism Norovirus gii.10
molecule tags Viral protein
total genus 71
structure length 311
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4z4vA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4z4vA01
3ASSA 4P3IA 4OOSA 3LQ6A 2OBSA 3ASQA 2ZL7A 3PUNA 5IYPA 3Q6QA 4X0CA 5J3OA 3ONUA 1IHMA 5J35A 3BQJA 3Q3AA 4X7EA 4WZLA 3SKBA 4RDLA 4RM0A 5F4MA 3D26A 4Z4YA 3LQEA 3SLNA 3SJPA 5F4OA 3PVDA 4Z4ZA 4QVJA 2ZL5A 3SEJA 4P26A 4X7DA 3R6KA 3ASTA 3Q38A 2OBRA 4P1VA 4P12A 4RPBA 4Z4WA 4RDKA 4ROXA 4X06A 5KW9A 4OOXA 5IYWA 4WZKA 4WZTA 3V7AA 3ASRA 5F4JA 4QVAA 4QV2A 3Q39A 3R6JA 4OP7A 4RLZA 4OPVA 5HZAA 4X7CA 4P2NA 3BY1A 5HZBA 4P25A 5BSYA 3BY2A 3PA1A 4Z4RA 4Z4UA 4OPOA 4RDJA 5IYRA 4OOVA 5E6TA 2ZL6A 5BSXA 5IYNA 3PUMA 3RY8A 3SLDA 3ASPA 4X07A 4RPDA 5IYQA 3ONYA 3PA2A 4X05A 4X7FA 4Z4TA 4Z4SA 4QUZA 4OPSA 4Z4VA 3Q6RA 4WZEA 2OBTA
chains in the Genus database with same CATH superfamily
2QTLA 2V7VA 1QGAA 1OGIA 4GQNA 2BV3A 1KTVA 3ASQA 3LQ6A 3HAGA 4ASUA 5AN9A 4XLFA 3H9NA 1XFOA 1E62A 1YI2B 3U6BA 1T6YA 3Q6QA 5FO0A 1MABA 1H8HA 2V7XA 3FPPA 2M5SA 1IHMA 3CRZA 1Q9SA 2X85A 4P6VF 4UZFA 4DNRB 1CQXA 4E0FA 5A8AA 4X7EA 4WZLA 4XD7A 3CCMB 1NB9A 4KKSA 2VZLA 4L8JA 2XZPA 5GV7A 1BX1A 1Q81D 3A8IA 1D2EA 1WU8A 1BJKA 4QVJA 4XORA 4G1VA 5H59A 3BCDA 2NPFA 2V7WA 3OZWA 4YHBA 1NB0A 3LNNA 1XB2A 4MYTA 1VLOA 4HIZA 1W0JA 1JNYA 5KW9A 1QUEA 5KSWB 1QG0A 4CQJA 4OOXA 4PABA 4YAWA 5IYWA 1HVXA 2FX3A 1QGZA 3G4SB 1Q7YD 4RD3A 1Q86D 4TKOB 3Q39A 1KK3A 4JMQA 1KC8D 1W9XA 4XL9A 4HE5A 1M1KD 4KKTA 1NBMA 2JN9A 1VQMB 4OPVA 3CPXA 1SM4A 4TMXA 2VNKA 1KD1D 1JA0A 3AGPA 4RD4A 5FL7A 1J9ZA 1XE1A 3VO1A 5TY0A 4ZCLA 3QFRA 3I56B 1KK1A 1PJ7A 5H5JA 4P25A 2DERA 3ZC3A 4YAUA 3GVJA 2GK7A 1TLLA 4H9GA 1WPCA 4DK0A 2E1RA 2CRVA 3JQQA 4LC0A 2VYQA 1EFTA 1W35A 2DIEA 2V7UA 4Z4RA 2Q6LA 5GV8A 4OPOA 5IYRA 2BGIA 1DDGA 2QN6A 3W5UA 2ZL6A 5BSXA 3CCUB 5HKKA 2Q6KA 3GQBA 4HE6A 4IW3B 3CD6B 4NNJA 1W2BB 1E64A 3ZZUA 3NE5B 1WDTA 3A1PA 4TMZA 2GJKA 2XGJA 1EFRA 1ZM4A 2D3LA 3OOCA 4RPDA 1CNFA 5EMNA 4AVZA 2F43A 5IYQA 4ZCMA 1YLOA 4G7XA 4TMWA 2OK8A 2DOGA 4X7FA 2CF4A 4Y9UA 2X6YA 4Z4TA 5TRDA 1I18A 2X0KA 5JBQA 3CPWB 3W5VA 2VJJA 4B44A 2ZITA 5B6IA 1SKYB 1H8EA 4QUZA 2DYIA 4FN5A 1VHEA 4TT3A 2ZZQA 2WZPP 3Q6RA 5LMZA 3KL9A 1N07A 3A3BA 3ZUGA 4WZEA 3OFNA 2QEXB 3FJOA 4AC9A 3ASSA 3KEWA 3CTAA 3QFCA 1VHOA 3LVBA 2DEUA 3B8HA 1YJNB 2F4NA 1FX0A 2ZZGA 1W87A 3OEEA 3A8KA 2KVOA 1GR1A 3OJXA 1WOOA 5FO1A 3WXMA 5IYPA 3CMAB 4B43A 3ISXA 1GAWA 4M4SA 2B7CA 5J3OA 3AVUA 2EIXA 4DQKA 3LO8A 2QDXA 2BM0A 3BQJA 3Q3AA 4NBSA 4XONA 4G1BA 3G71B 1H42A 2GQFA 1B23P 2V7TA 4PGOA 1QVGB 1XQBA 1E3XA 4UZEA 3VNVA 4XN0A 2C4TA 3BH4A 3SLNA 4QHYA 2F1LA 1Q82D 1T6ZA 1N0UA 2WR8A 2ZZFA 3CP2A 3SEJA 1V0EA 1V5VA 4P26A 4P9SA 2QGGA 3CESA 1BLIA 4X7DA 3R6KA 4YALA 3ASTA 1OHHA 1QH0A 3AVXA 4XLAA 3U6KA 4P12A 1EFUA 3BCFA 3OZUA 1VQ8B 1ZM3A 2VBVA 4P6YA 4ZCIA 1SKQA 1QFYA 2C4UA 1FNCA 1IB0A 1KQSB 3ASRA 5F4JA 4PC6A 4FK8A 1PJ5A 1KK0A 1G7CA 1W0KA 2OTLB 3CCVB 4YXWA 1E3ZA 2J7KA 3I1FA 4G5GA 4II3A 3QFSA 3QSYA 4XR6A 4P2NA 1DDIA 5DN6A 4DNTB 1PJ6A 1VJSA 1WSRA 3OW7A 2WJYA 1EP1B 1BQEA 2Q6OA 4R71A 4II2A 1UD3A 4ACAA 1VQ5B 4RD0A 4B4DA 3W5HA 1VQPB 1DARA 4UAJA 3SJZA 3BC9A 4Z4UA 4B47A 5TR9A 2PMDA 5E6TA 2XNJA 3GVKA 3RY8A 3ZPNA 3SLDA 3ZBTA 3CC2B 3OZVA 4TSFA 1WSVA 3ONYA 3VNUA 3VR6A 3CXCB 3A35A 4N3NA 1NRKA 2V7QA 3ES9A 2JJ2A 2X8KA 4MYUA 1F20A 1IJEA 3CW2A 4NCNA 2C5HA 4LBVA 1FNBA 4TN1A 3MMPA 3H94A 3T53B 4DK1A 1JB9A 2V31A 4Z4VA 3OE7A 4P3YA 2BMWA 4XOPA 3G05A 3E1YE 4M53A 2GJRA 2CC2A 4YEJA 2OK7A 4Y9RA 2OBTA 2D9RA 1EWYA 1B2RA 3U2QA 4N3GA 2YWEA 2BF4A 1FNDA 2I1LA 2PLFA 2OBSA 5HXBA 4RD2A 1OB5A 2ZL7A 2BN4A 1UD5A 1NJID 1WORA 1FRQA 1TTTA 4YELA 2C78A 4X0CA 1UD2A 1T5EA 2JIZA 2VNHA 4XM3A 5J35A 3AGQA 1FRNA 4X8IA 2GJPA 3OPOA 1N06A 4M1KA 1V0FA 1UD6A 3VO2A 2ZXIA 2VBUA 4TMTA 5A88A 2HDNB 1WOPA 4RCYA 4RM0A 5F4MA 3D26A 2JJ1A 5IK2A 3LQEA 2Q6IA 3CP8A 3SJPA 2OTJB 1UD8A 4LBWA 5F4OA 3PVDA 4Z4ZA 4DQLA 3WY9A 2RC6A 1QX4A 2ZL5A 1FDRA 3E20A 3V76A 4LBZA 1VQKB 3W2FA 1IJFA 4QFMA 2OBRA 4P1VA 4RPBA 4Z4WA 3AVVA 2C2WA 2XOKA 4XMYA 4AF7A 2ZZEA 3ZBUA 1EP2B 3V7AA 3W2HA 3CCLB 2VBTA 5FIUA 4BPRA 4QVAA 2XNCA 2R9VA 2PE3A 4OP7A 3FPKA 1GJRA 2GPJA 2YWHA 1AIPA 1OGJA 1QFJA 3MCAA 3OAAA 5KNLA 4RD6A 4RJLA 2XNDA 4B48A 3WNDA 2X6WA 3OEHA 1N08A 5L46A 1FNMA 5HZBA 1ELOA 2VBSA 4Z1MA 5BSYA 1QGYA 3A8JA 3CC7B 4B3XA 1VQLB 2B7BA 1VQNB 1M90D 3CCSB 3JU4A 1RQPA 3WQZA 1CNEA 1E63A 2JDIA 2ZTGA 3G6EB 2EFGA 2P3MA 1K73D 1K28D 4M2LA 3PUMA 1VQ7B 3CC4B 4LBYA 2BVNA 3ASPA 3FKSA 3T51B 4B3FX 3GIRA 1D8TA 3B78A 2BGJA 2RC5A 4YAFA 1G7RA 1BPLA 3PA2A 4XN3A 4X05A 1E43A 2CNDA 1QVFB 4PC7A 1ZUNB 1I8DA 4PAAA 2W6JA 2AHOA 1N05A 5FNZA 3WBKA 4ACBA 4C43A 1JJ2B 3MHPA 4J0QA 4Z4SA 1BX0A 1KZLA 1Y0RA 4PC2A 4XKVA 1JA1A 1WP6A 4PC3A 5A89A 3J81k 1YJWB 4Q7JB 1YHQB 3WNCA 3JQPA 3AVTA 1I7PA 2Z6BD 2ZBVA 1GO2A 1R5OA 2OYNA 4WWVA 1K8AD 1GAQA 4U9UA 2D3NA 2XZOA 1YX2A 1F60A 4G6IA 3ZIAA 1VQ9B 2HCJB 2XEXA 1PKVA 1EFCA 4FXUA 2HLDA 1KMHA 4P3IA 4XKWA 4TMVA 4OOSA 1OB2A 1HA3A 3AVYA 4XLEA 3WBJA 3PUNA 3AVWA 3ZZTA 1H85A 2QE7A 3GSIA 2XZLA 2YWGA 1VLYA 3ONUA 4KKUA 3T56B 2QMUA 3CB4A 2BM1A 3CMEB 3P26A 4EH1A 3SKBA 4PC1A 3CCRB 1S72B 2LZJA 4B3GA 1GVHA 4RDLA 1E79A 1TVCA 3GVLA 4Z4YA 2NV4A 1P4MA 3CCJB 4UZUA 2D74A 1Y0YA 4P22A 2X3UA 1A8PA 2FVGA 5THXA 1W34A 2HMAA 1VQ4B 2F1MA 1MRZA 2C77A 2CK3A 3I55B 1NDHA 3Q38A 1UMKA 3OKXA 2BPOA 1YJ9B 1U2RA 1AMOA 4RDKA 1WOSA 1E1RA 4ROXA 4X06A 4ZGNB 1VQ6B 1DG1G 4FWTA 1QUFA 4WZKA 4WZTA 4C0SA 4ZV4A 2VJIA 4XNFA 2E1BA 4QV2A 2ZXHA 3OP1A 4RD1A 2C5BA 3R6JA 5CDFA 3VMFA 3WYAA 2WJVA 4RLZA 4XOTA 2CW5A 5HZAA 4XLCA 1BMFA 2YWFA 4X7CA 1D1NA 2X53S 2V4DA 3B82A 5FA6A 1KRHA 2WPDA 3BY1A 2W6IA 1EP3B 3BNWA 2WZNA 5TV2A 1VF7A 3CMMA 5DS0A 2VNJA 3DDYA 4YAOA 4XQFA 1WTHD 4G7WA 3CCEB 1YITB 2QTZA 1EXMA 3QFTA 3BY2A 3PA1A 1ZM2A 1ZM9A 2X6XA 3OW2B 1G7TA 2ZBUA 1YIJB 1TUIA 2PIAA 3QE2A 1E1QA 4AF6A 3P27A 2DCUA 4RDJA 3W2IA 1KK2A 4OOVA 3ZZ0A 1QFZA 3A3GA 5IYNA 2DETA 4F7DA 1N8RD 1S0UA 4X07A 2DY1A 1G7SA 4M0LA 2GK6A 2WYRA 3JQRA 2WSSA 5DSZA 1COWA 1RQRA 2GREA 1HZEA 2B5OA 1UD4A 2QA4B 4Y7CA 1OB0A 2BSAA 4ZGQB 4RCZA 1S4MA 2CBXA 4WQMA 3W2EA 3WNBA 1VQOB 3CCQB 4OPSA 1N0VC 3W2GA 2R6HA 1K9MD 2VNIA 2ZTNA 4XLHA 3PENA 1KJZA 1T6XA 1R5NA 4K1XA 1R5BA 3OJWA
chains in the Genus database with same CATH topology
3ASSA 4P3IA 4OOSA 3LQ6A 2OBSA 3ASQA 2ZL7A 3PUNA 5IYPA 3Q6QA 4X0CA 5J3OA 3ONUA 1IHMA 5J35A 3BQJA 3Q3AA 4X7EA 4WZLA 3SKBA 4RDLA 4RM0A 5F4MA 3D26A 4Z4YA 3LQEA 3SLNA 3SJPA 5F4OA 3PVDA 4Z4ZA 4QVJA 2ZL5A 3SEJA 4P26A 4X7DA 3R6KA 3ASTA 3Q38A 2OBRA 4P1VA 4P12A 4RPBA 4Z4WA 4RDKA 4ROXA 4X06A 5KW9A 4OOXA 5IYWA 4WZKA 4WZTA 3V7AA 3ASRA 5F4JA 4QVAA 4QV2A 3Q39A 3R6JA 4OP7A 4RLZA 4OPVA 5HZAA 4X7CA 4P2NA 3BY1A 5HZBA 4P25A 5BSYA 3BY2A 3PA1A 4Z4RA 4Z4UA 4OPOA 4RDJA 5IYRA 4OOVA 5E6TA 2ZL6A 5BSXA 5IYNA 3PUMA 3RY8A 3SLDA 3ASPA 4X07A 4RPDA 5IYQA 3ONYA 3PA2A 4X05A 4X7FA 4Z4TA 4Z4SA 4QUZA 4OPSA 4Z4VA 3Q6RA 4WZEA 2OBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASS A;  4P3I A;  4OOS A;  3LQ6 A;  2OBS A;  3ASQ A;  2ZL7 A;  3PUN A;  5IYP A;  3Q6Q A;  4X0C A;  5J3O A;  3ONU A;  1IHM A;  5J35 A;  3BQJ A;  3Q3A A;  4X7E A;  4WZL A;  3SKB A;  4RDL A;  4RM0 A;  5F4M A;  3D26 A;  4Z4Y A;  3LQE A;  3SLN A;  3SJP A;  5F4O A;  3PVD A;  4Z4Z A;  4QVJ A;  2ZL5 A;  3SEJ A;  4P26 A;  4X7D A;  3R6K A;  3AST A;  3Q38 A;  2OBR A;  4P1V A;  4P12 A;  4RPB A;  4Z4W A;  4RDK A;  4ROX A;  4X06 A;  5KW9 A;  4OOX A;  5IYW A;  4WZK A;  4WZT A;  3V7A A;  3ASR A;  5F4J A;  4QVA A;  4QV2 A;  3Q39 A;  3R6J A;  4OP7 A;  4RLZ A;  4OPV A;  5HZA A;  4X7C A;  4P2N A;  3BY1 A;  5HZB A;  4P25 A;  5BSY A;  3BY2 A;  3PA1 A;  4Z4R A;  4Z4U A;  4OPO A;  4RDJ A;  5IYR A;  4OOV A;  5E6T A;  2ZL6 A;  5BSX A;  5IYN A;  3PUM A;  3RY8 A;  3SLD A;  3ASP A;  4X07 A;  4RPD A;  5IYQ A;  3ONY A;  3PA2 A;  4X05 A;  4X7F A;  4Z4T A;  4Z4S A;  4QUZ A;  4OPS A;  4Z4V A;  3Q6R A;  4WZE A;  2OBT A; 
#chains in the Genus database with same CATH topology
 2QTL A;  2V7V A;  1QGA A;  1OGI A;  4GQN A;  2BV3 A;  1KTV A;  3ASQ A;  3LQ6 A;  3HAG A;  4ASU A;  5AN9 A;  4XLF A;  3H9N A;  1XFO A;  1E62 A;  1YI2 B;  3U6B A;  1T6Y A;  3Q6Q A;  5FO0 A;  1MAB A;  1H8H A;  2V7X A;  3FPP A;  2M5S A;  1IHM A;  3CRZ A;  1Q9S A;  2X85 A;  4P6V F;  4UZF A;  4DNR B;  1CQX A;  4E0F A;  5A8A A;  4X7E A;  4WZL A;  4XD7 A;  3CCM B;  1NB9 A;  4KKS A;  2VZL A;  4L8J A;  2XZP A;  5GV7 A;  1BX1 A;  1Q81 D;  3A8I A;  1D2E A;  1WU8 A;  1BJK A;  4QVJ A;  4XOR A;  4G1V A;  5H59 A;  3BCD A;  2NPF A;  2V7W A;  3OZW A;  4YHB A;  1NB0 A;  3LNN A;  1XB2 A;  4MYT A;  1VLO A;  4HIZ A;  1W0J A;  1JNY A;  5KW9 A;  1QUE A;  5KSW B;  1QG0 A;  4CQJ A;  4OOX A;  4PAB A;  4YAW A;  5IYW A;  1HVX A;  2FX3 A;  1QGZ A;  3G4S B;  1Q7Y D;  4RD3 A;  1Q86 D;  4TKO B;  3Q39 A;  1KK3 A;  4JMQ A;  1KC8 D;  1W9X A;  4XL9 A;  4HE5 A;  1M1K D;  4KKT A;  1NBM A;  2JN9 A;  1VQM B;  4OPV A;  3CPX A;  1SM4 A;  4TMX A;  2VNK A;  1KD1 D;  1JA0 A;  3AGP A;  4RD4 A;  5FL7 A;  1J9Z A;  1XE1 A;  3VO1 A;  5TY0 A;  4ZCL A;  3QFR A;  3I56 B;  1KK1 A;  1PJ7 A;  5H5J A;  4P25 A;  2DER A;  3ZC3 A;  4YAU A;  3GVJ A;  2GK7 A;  1TLL A;  4H9G A;  1WPC A;  4DK0 A;  2E1R A;  2CRV A;  3JQQ A;  4LC0 A;  2VYQ A;  1EFT A;  1W35 A;  2DIE A;  2V7U A;  4Z4R A;  2Q6L A;  5GV8 A;  4OPO A;  5IYR A;  2BGI A;  1DDG A;  2QN6 A;  3W5U A;  2ZL6 A;  5BSX A;  3CCU B;  5HKK A;  2Q6K A;  3GQB A;  4HE6 A;  4IW3 B;  3CD6 B;  4NNJ A;  1W2B B;  1E64 A;  3ZZU A;  3NE5 B;  1WDT A;  3A1P A;  4TMZ A;  2GJK A;  2XGJ A;  1EFR A;  1ZM4 A;  2D3L A;  3OOC A;  4RPD A;  1CNF A;  5EMN A;  4AVZ A;  2F43 A;  5IYQ A;  4ZCM A;  1YLO A;  4G7X A;  4TMW A;  2OK8 A;  2DOG A;  4X7F A;  2CF4 A;  4Y9U A;  2X6Y A;  4Z4T A;  5TRD A;  1I18 A;  2X0K A;  5JBQ A;  3CPW B;  3W5V A;  2VJJ A;  4B44 A;  2ZIT A;  5B6I A;  1SKY B;  1H8E A;  4QUZ A;  2DYI A;  4FN5 A;  1VHE A;  4TT3 A;  2ZZQ A;  2WZP P;  3Q6R A;  5LMZ A;  3KL9 A;  1N07 A;  3A3B A;  3ZUG A;  4WZE A;  3OFN A;  2QEX B;  3FJO A;  4AC9 A;  3ASS A;  3KEW A;  3CTA A;  3QFC A;  1VHO A;  3LVB A;  2DEU A;  3B8H A;  1YJN B;  2F4N A;  1FX0 A;  2ZZG A;  1W87 A;  3OEE A;  3A8K A;  2KVO A;  1GR1 A;  3OJX A;  1WOO A;  5FO1 A;  3WXM A;  5IYP A;  3CMA B;  4B43 A;  3ISX A;  1GAW A;  4M4S A;  2B7C A;  5J3O A;  3AVU A;  2EIX A;  4DQK A;  3LO8 A;  2QDX A;  2BM0 A;  3BQJ A;  3Q3A A;  4NBS A;  4XON A;  4G1B A;  3G71 B;  1H42 A;  2GQF A;  1B23 P;  2V7T A;  4PGO A;  1QVG B;  1XQB A;  1E3X A;  4UZE A;  3VNV A;  4XN0 A;  2C4T A;  3BH4 A;  3SLN A;  4QHY A;  2F1L A;  1Q82 D;  1T6Z A;  1N0U A;  2WR8 A;  2ZZF A;  3CP2 A;  3SEJ A;  1V0E A;  1V5V A;  4P26 A;  4P9S A;  2QGG A;  3CES A;  1BLI A;  4X7D A;  3R6K A;  4YAL A;  3AST A;  1OHH A;  1QH0 A;  3AVX A;  4XLA A;  3U6K A;  4P12 A;  1EFU A;  3BCF A;  3OZU A;  1VQ8 B;  1ZM3 A;  2VBV A;  4P6Y A;  4ZCI A;  1SKQ A;  1QFY A;  2C4U A;  1FNC A;  1IB0 A;  1KQS B;  3ASR A;  5F4J A;  4PC6 A;  4FK8 A;  1PJ5 A;  1KK0 A;  1G7C A;  1W0K A;  2OTL B;  3CCV B;  4YXW A;  1E3Z A;  2J7K A;  3I1F A;  4G5G A;  4II3 A;  3QFS A;  3QSY A;  4XR6 A;  4P2N A;  1DDI A;  5DN6 A;  4DNT B;  1PJ6 A;  1VJS A;  1WSR A;  3OW7 A;  2WJY A;  1EP1 B;  1BQE A;  2Q6O A;  4R71 A;  4II2 A;  1UD3 A;  4ACA A;  1VQ5 B;  4RD0 A;  4B4D A;  3W5H A;  1VQP B;  1DAR A;  4UAJ A;  3SJZ A;  3BC9 A;  4Z4U A;  4B47 A;  5TR9 A;  2PMD A;  5E6T A;  2XNJ A;  3GVK A;  3RY8 A;  3ZPN A;  3SLD A;  3ZBT A;  3CC2 B;  3OZV A;  4TSF A;  1WSV A;  3ONY A;  3VNU A;  3VR6 A;  3CXC B;  3A35 A;  4N3N A;  1NRK A;  2V7Q A;  3ES9 A;  2JJ2 A;  2X8K A;  4MYU A;  1F20 A;  1IJE A;  3CW2 A;  4NCN A;  2C5H A;  4LBV A;  1FNB A;  4TN1 A;  3MMP A;  3H94 A;  3T53 B;  4DK1 A;  1JB9 A;  2V31 A;  4Z4V A;  3OE7 A;  4P3Y A;  2BMW A;  4XOP A;  3G05 A;  3E1Y E;  4M53 A;  2GJR A;  2CC2 A;  4YEJ A;  2OK7 A;  4Y9R A;  2OBT A;  2D9R A;  1EWY A;  1B2R A;  3U2Q A;  4N3G A;  2YWE A;  2BF4 A;  1FND A;  2I1L A;  2PLF A;  2OBS A;  5HXB A;  4RD2 A;  1OB5 A;  2ZL7 A;  2BN4 A;  1UD5 A;  1NJI D;  1WOR A;  1FRQ A;  1TTT A;  4YEL A;  2C78 A;  4X0C A;  1UD2 A;  1T5E A;  2JIZ A;  2VNH A;  4XM3 A;  5J35 A;  3AGQ A;  1FRN A;  4X8I A;  2GJP A;  3OPO A;  1N06 A;  4M1K A;  1V0F A;  1UD6 A;  3VO2 A;  2ZXI A;  2VBU A;  4TMT A;  5A88 A;  2HDN B;  1WOP A;  4RCY A;  4RM0 A;  5F4M A;  3D26 A;  2JJ1 A;  5IK2 A;  3LQE A;  2Q6I A;  3CP8 A;  3SJP A;  2OTJ B;  1UD8 A;  4LBW A;  5F4O A;  3PVD A;  4Z4Z A;  4DQL A;  3WY9 A;  2RC6 A;  1QX4 A;  2ZL5 A;  1FDR A;  3E20 A;  3V76 A;  4LBZ A;  1VQK B;  3W2F A;  1IJF A;  4QFM A;  2OBR A;  4P1V A;  4RPB A;  4Z4W A;  3AVV A;  2C2W A;  2XOK A;  4XMY A;  4AF7 A;  2ZZE A;  3ZBU A;  1EP2 B;  3V7A A;  3W2H A;  3CCL B;  2VBT A;  5FIU A;  4BPR A;  4QVA A;  2XNC A;  2R9V A;  2PE3 A;  4OP7 A;  3FPK A;  1GJR A;  2GPJ A;  2YWH A;  1AIP A;  1OGJ A;  1QFJ A;  3MCA A;  3OAA A;  5KNL A;  4RD6 A;  4RJL A;  2XND A;  4B48 A;  3WND A;  2X6W A;  3OEH A;  1N08 A;  5L46 A;  1FNM A;  5HZB A;  1ELO A;  2VBS A;  4Z1M A;  5BSY A;  1QGY A;  3A8J A;  3CC7 B;  4B3X A;  1VQL B;  2B7B A;  1VQN B;  1M90 D;  3CCS B;  3JU4 A;  1RQP A;  3WQZ A;  1CNE A;  1E63 A;  2JDI A;  2ZTG A;  3G6E B;  2EFG A;  2P3M A;  1K73 D;  1K28 D;  4M2L A;  3PUM A;  1VQ7 B;  3CC4 B;  4LBY A;  2BVN A;  3ASP A;  3FKS A;  3T51 B;  4B3F X;  3GIR A;  1D8T A;  3B78 A;  2BGJ A;  2RC5 A;  4YAF A;  1G7R A;  1BPL A;  3PA2 A;  4XN3 A;  4X05 A;  1E43 A;  2CND A;  1QVF B;  4PC7 A;  1ZUN B;  1I8D A;  4PAA A;  2W6J A;  2AHO A;  1N05 A;  5FNZ A;  3WBK A;  4ACB A;  4C43 A;  1JJ2 B;  3MHP A;  4J0Q A;  4Z4S A;  1BX0 A;  1KZL A;  1Y0R A;  4PC2 A;  4XKV A;  1JA1 A;  1WP6 A;  4PC3 A;  5A89 A;  3J81 k;  1YJW B;  4Q7J B;  1YHQ B;  3WNC A;  3JQP A;  3AVT A;  1I7P A;  2Z6B D;  2ZBV A;  1GO2 A;  1R5O A;  2OYN A;  4WWV A;  1K8A D;  1GAQ A;  4U9U A;  2D3N A;  2XZO A;  1YX2 A;  1F60 A;  4G6I A;  3ZIA A;  1VQ9 B;  2HCJ B;  2XEX A;  1PKV A;  1EFC A;  4FXU A;  2HLD A;  1KMH A;  4P3I A;  4XKW A;  4TMV A;  4OOS A;  1OB2 A;  1HA3 A;  3AVY A;  4XLE A;  3WBJ A;  3PUN A;  3AVW A;  3ZZT A;  1H85 A;  2QE7 A;  3GSI A;  2XZL A;  2YWG A;  1VLY A;  3ONU A;  4KKU A;  3T56 B;  2QMU A;  3CB4 A;  2BM1 A;  3CME B;  3P26 A;  4EH1 A;  3SKB A;  4PC1 A;  3CCR B;  1S72 B;  2LZJ A;  4B3G A;  1GVH A;  4RDL A;  1E79 A;  1TVC A;  3GVL A;  4Z4Y A;  2NV4 A;  1P4M A;  3CCJ B;  4UZU A;  2D74 A;  1Y0Y A;  4P22 A;  2X3U A;  1A8P A;  2FVG A;  5THX A;  1W34 A;  2HMA A;  1VQ4 B;  2F1M A;  1MRZ A;  2C77 A;  2CK3 A;  3I55 B;  1NDH A;  3Q38 A;  1UMK A;  3OKX A;  2BPO A;  1YJ9 B;  1U2R A;  1AMO A;  4RDK A;  1WOS A;  1E1R A;  4ROX A;  4X06 A;  4ZGN B;  1VQ6 B;  1DG1 G;  4FWT A;  1QUF A;  4WZK A;  4WZT A;  4C0S A;  4ZV4 A;  2VJI A;  4XNF A;  2E1B A;  4QV2 A;  2ZXH A;  3OP1 A;  4RD1 A;  2C5B A;  3R6J A;  5CDF A;  3VMF A;  3WYA A;  2WJV A;  4RLZ A;  4XOT A;  2CW5 A;  5HZA A;  4XLC A;  1BMF A;  2YWF A;  4X7C A;  1D1N A;  2X53 S;  2V4D A;  3B82 A;  5FA6 A;  1KRH A;  2WPD A;  3BY1 A;  2W6I A;  1EP3 B;  3BNW A;  2WZN A;  5TV2 A;  1VF7 A;  3CMM A;  5DS0 A;  2VNJ A;  3DDY A;  4YAO A;  4XQF A;  1WTH D;  4G7W A;  3CCE B;  1YIT B;  2QTZ A;  1EXM A;  3QFT A;  3BY2 A;  3PA1 A;  1ZM2 A;  1ZM9 A;  2X6X A;  3OW2 B;  1G7T A;  2ZBU A;  1YIJ B;  1TUI A;  2PIA A;  3QE2 A;  1E1Q A;  4AF6 A;  3P27 A;  2DCU A;  4RDJ A;  3W2I A;  1KK2 A;  4OOV A;  3ZZ0 A;  1QFZ A;  3A3G A;  5IYN A;  2DET A;  4F7D A;  1N8R D;  1S0U A;  4X07 A;  2DY1 A;  1G7S A;  4M0L A;  2GK6 A;  2WYR A;  3JQR A;  2WSS A;  5DSZ A;  1COW A;  1RQR A;  2GRE A;  1HZE A;  2B5O A;  1UD4 A;  2QA4 B;  4Y7C A;  1OB0 A;  2BSA A;  4ZGQ B;  4RCZ A;  1S4M A;  2CBX A;  4WQM A;  3W2E A;  3WNB A;  1VQO B;  3CCQ B;  4OPS A;  1N0V C;  3W2G A;  2R6H A;  1K9M D;  2VNI A;  2ZTN A;  4XLH A;  3PEN A;  1KJZ A;  1T6X A;  1R5N A;  4K1X A;  1R5B A;  3OJW A; 
#chains in the Genus database with same CATH homology
 3ASS A;  4P3I A;  4OOS A;  3LQ6 A;  2OBS A;  3ASQ A;  2ZL7 A;  3PUN A;  5IYP A;  3Q6Q A;  4X0C A;  5J3O A;  3ONU A;  1IHM A;  5J35 A;  3BQJ A;  3Q3A A;  4X7E A;  4WZL A;  3SKB A;  4RDL A;  4RM0 A;  5F4M A;  3D26 A;  4Z4Y A;  3LQE A;  3SLN A;  3SJP A;  5F4O A;  3PVD A;  4Z4Z A;  4QVJ A;  2ZL5 A;  3SEJ A;  4P26 A;  4X7D A;  3R6K A;  3AST A;  3Q38 A;  2OBR A;  4P1V A;  4P12 A;  4RPB A;  4Z4W A;  4RDK A;  4ROX A;  4X06 A;  5KW9 A;  4OOX A;  5IYW A;  4WZK A;  4WZT A;  3V7A A;  3ASR A;  5F4J A;  4QVA A;  4QV2 A;  3Q39 A;  3R6J A;  4OP7 A;  4RLZ A;  4OPV A;  5HZA A;  4X7C A;  4P2N A;  3BY1 A;  5HZB A;  4P25 A;  5BSY A;  3BY2 A;  3PA1 A;  4Z4R A;  4Z4U A;  4OPO A;  4RDJ A;  5IYR A;  4OOV A;  5E6T A;  2ZL6 A;  5BSX A;  5IYN A;  3PUM A;  3RY8 A;  3SLD A;  3ASP A;  4X07 A;  4RPD A;  5IYQ A;  3ONY A;  3PA2 A;  4X05 A;  4X7F A;  4Z4T A;  4Z4S A;  4QUZ A;  4OPS A;  4Z4V A;  3Q6R A;  4WZE A;  2OBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...