4Z4VA

Crystal structure of gii.10 p domain in complex with 19mm fucose
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
315
structure length
311
Chain Sequence
SKPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title The sweet quartet: Binding of fucose to the norovirus capsid.
pubmed doi rcsb
source organism Norovirus gii.10
molecule tags Viral protein
total genus 71
structure length 311
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4z4vA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4z4vA01
4RPBA 3R6KA 3ASSA 4P26A 3PUMA 4OPSA 3PA2A 3LQEA 4X7CA 4Z4SA 4RPDA 5HZBA 3ASTA 5BSXA 4OPVA 4P1VA 4QUZA 5IYQA 4RM0A 3BY2A 4X07A 5IYWA 3Q6RA 4QVJA 4RDJA 4X05A 4WZKA 5F4JA 3SEJA 2ZL5A 4X0CA 3ASQA 3SLDA 3ASRA 2OBTA 4Z4VA 4Z4RA 4Z4ZA 4P12A 2ZL7A 3ONUA 3PUNA 4ROXA 4OOSA 5HZAA 5IYRA 3RY8A 3Q38A 4OPOA 4P3IA 4RLZA 4X7EA 4RDLA 5IYPA 4WZLA 4WZTA 3PVDA 2OBRA 3Q39A 3ASPA 3LQ6A 5J35A 3BQJA 4OOVA 3SKBA 3SJPA 4X7DA 3V7AA 3ONYA 4Z4YA 4RDKA 4WZEA 2OBSA 3PA1A 5IYNA 4P25A 4X7FA 5BSYA 3Q6QA 4P2NA 3R6JA 4OOXA 2ZL6A 1IHMA 4QVAA 3SLNA 5F4MA 5KW9A 4Z4UA 4QV2A 4Z4TA 3BY1A 5F4OA 4X06A 3Q3AA 3D26A 5J3OA 5E6TA 4OP7A 4Z4WA
chains in the Genus database with same CATH superfamily
1Q86D 5AN9A 5HKKA 4XL9A 3P26A 1N06A 2HDNB 2P3MA 3LVBA 3PUMA 2EIXA 4M1KA 1BLIA 3I56B 4XQFA 3CB4A 1YJWB 2V7TA 1ELOA 4YAUA 2DEUA 1E62A 3B78A 2R9VA 3B82A 4ASUA 1BX0A 2PMDA 3GQBA 1J9ZA 1WDTA 2QGGA 1VHOA 4X7CA 3H94A 1Y0YA 2GJPA 4RPDA 4TMVA 3ASTA 3A8JA 1S72B 2NV4A 4NCNA 4OPVA 5IYQA 1QFZA 3I55B 4N3NA 4G6IA 5A88A 1QUEA 2CF4A 3JQPA 1EFCA 4PC2A 2J7KA 4WZKA 4RD1A 2VYQA 2RC5A 3SEJA 4B47A 4RCYA 3VMFA 5DS0A 2VNKA 3AGQA 2CW5A 4ZV4A 1CNFA 2QMUA 2GQFA 2F1MA 1H42A 3BH4A 2XEXA 3GVJA 2D3NA 2ZL7A 4XNFA 1PJ7A 3ONUA 2DIEA 4P22A 4Y7CA 2C78A 3ZZ0A 4OOSA 1EP2B 4NNJA 1WSVA 1IB0A 1T5EA 3Q38A 4OPOA 4RLZA 4KKSA 2WYRA 5CDFA 3W5VA 3ZC3A 1VQKB 4LBYA 3CCJB 2DY1A 1YJ9B 4C0SA 4R71A 1GJRA 1PKVA 4G7WA 3LQ6A 3BQJA 2WSSA 1YITB 4FXUA 1VQ6B 1XFOA 3OP1A 2PLFA 4HE6A 2BVNA 1QGZA 3U2QA 1VQNB 1RQRA 4Z4YA 3QE2A 3W2GA 4P25A 5B6IA 4YAOA 1EFRA 2Q6LA 2XZPA 1EP3B 4XLHA 2KVOA 2CNDA 2HCJB 3H9NA 1ZM9A 3CW2A 3R6JA 4PGOA 4UZEA 3MMPA 3CPXA 1TVCA 4FK8A 4F7DA 1V5VA 1ZUNB 1N8RD 1UD4A 4XONA 3OE7A 4AC9A 2XNDA 4Z4UA 2X8KA 2ZXHA 5EMNA 2GK7A 1V0EA 5GV7A 3VR6A 1UD8A 5DN6A 3W2EA 3A3GA 3D26A 1NDHA 1WORA 3W2IA 1IJFA 5J3OA 3ZBTA 4RD3A 2XOKA 1E3XA 2Z6BD 4CQJA 3WYAA 1GVHA 3AVUA 1D2EA 4XM3A 3G6EB 3ASSA 3BCFA 1G7TA 3FPKA 2JJ1A 4P26A 1DDIA 2AHOA 5H59A 4OPSA 1VLYA 3OZVA 2X6YA 3QFCA 2X85A 3QFTA 2QTLA 3OJXA 3CXCB 2WJYA 4UZUA 5TR9A 3OW2B 3T56B 1E79A 4G7XA 4XLFA 2V7WA 5THXA 1HA3A 2GJKA 1PJ5A 5BSXA 2BMWA 4QUZA 4TKOB 3OAAA 1DG1G 2E1RA 5IYWA 3CMEB 1GAWA 1CNEA 1WU8A 4TMTA 4RDJA 2XNJA 4HE5A 4X05A 4B3FX 5IK2A 3A35A 1WOPA 1WOSA 2WZPP 3VNUA 5F4JA 3HAGA 2Q6KA 4B3GA 1R5BA 2ZL5A 3ASQA 4HIZA 4L8JA 3SLDA 3W5UA 3OEEA 4QHYA 3QSYA 1H8HA 1E63A 3WBJA 3KEWA 2CBXA 1YLOA 2JDIA 4XORA 2ZTGA 1QVGB 2DCUA 2C4UA 3PUNA 1E43A 4XLAA 1YI2B 3ZPNA 1I18A 3RY8A 3VO1A 2QE7A 1HVXA 1N0UA 1NB9A 4YAFA 2F43A 3CRZA 1KK3A 1MRZA 3CCSB 3GSIA 4WZTA 1N07A 5L46A 3CCEB 1JA0A 3AGPA 4DNTB 2BGJA 4NBSA 5KNLA 4TMZA 4XOPA 2R6HA 4TT3A 1KQSB 1NRKA 2M5SA 3FKSA 1KK2A 3SKBA 3V76A 2OTLB 1BX1A 1VLOA 3AVWA 3VNVA 4II2A 5HXBA 4JMQA 2B5OA 1EFTA 2ZZFA 3CCLB 1FNMA 3B8HA 4X7DA 3GVLA 4RD2A 3ZUGA 1VQ5B 4PABA 1IJEA 1ZM4A 3ONYA 4RDKA 4WZEA 5IYNA 2W6JA 2OK8A 4X7FA 4DQLA 5BSYA 1WPCA 3U6BA 2D9RA 1FNDA 2FVGA 4B48A 2XZOA 3ZIAA 3J81k 4AF7A 3OKXA 2VBUA 4DK1A 2VBTA 4RD4A 3AVVA 3WXMA 3ISXA 1KC8D 1KD1D 2ZL6A 4ZCIA 1VQ4B 3A8KA 2C77A 1KTVA 4Y9RA 3ZBUA 1FNBA 2VJIA 2XNCA 5F4MA 1QX4A 3AVTA 2QA4B 4QV2A 3DDYA 4Z4TA 3OZWA 1H8EA 1A8PA 2DOGA 3OW7A 4X06A 1VQLB 1QH0A 3LNNA 4LBVA 3Q3AA 4ACBA 5H5JA 3G71B 2NPFA 1W87A 3OOCA 1VQ9B 1T6ZA 1PJ6A 3A1PA 4KKTA 5E6TA 4B3XA 4OP7A 5FNZA 1HZEA 1G7CA 4RPBA 4XKVA 2B7BA 3BNWA 4RJLA 1FNCA 2QTZA 4PC1A 4XN3A 4ACAA 1N0VC 4G5GA 2V31A 4PC7A 4RD0A 1I7PA 1FDRA 3SJZA 4G1VA 2Q6OA 1YJNB 3WQZA 3CD6B 2V7XA 1BPLA 1EFUA 3AVXA 2OTJB 1N05A 3CC7B 1G7SA 4UZFA 2QN6A 4TSFA 1KJZA 1K8AD 2Q6IA 1CQXA 2C5HA 1Q7YD 1Q81D 4ZCLA 4XMYA 3QFSA 1OHHA 4P9SA 3ZZUA 5HZBA 3CCMB 1YHQB 5A89A 4UAJA 4J0QA 1WTHD 4P1VA 2OYNA 2GJRA 2VNIA 2I1LA 4TMXA 4RM0A 3BY2A 3CTAA 2YWEA 4Z1MA 2V7UA 1DDGA 1U2RA 3VO2A 4FWTA 3Q6RA 2D3LA 4QVJA 1JB9A 1VQ8B 1E64A 4TMWA 2CRVA 2W6IA 2X6XA 1T6YA 2RC6A 4X0CA 2ZBVA 1E3ZA 3LO8A 4E0FA 1B23P 1SKYB 3KL9A 5FO1A 2OBTA 3ZZTA 4Z4VA 3T53B 4LBWA 4AF6A 4Y9UA 2DYIA 1COWA 1M90D 3MCAA 1VQ7B 2VNHA 4PAAA 5FO0A 1DARA 1XE1A 2LZJA 4ROXA 2F1LA 1QGYA 1W0KA 1RQPA 2VZLA 1K73D 1UD5A 4X7EA 3GIRA 4C43A 4XR6A 4WZLA 3U6KA 4XLCA 1R5OA 2OBRA 5TY0A 2B7CA 4G1BA 4OOVA 2V7VA 1QFYA 4B43A 5A8AA 4YHBA 1W9XA 4P6VF 4RD6A 2QEXB 2DERA 2JJ2A 2GK6A 3NE5B 1NJID 5JBQA 3CP2A 2ZZQA 1GR1A 2YWFA 2ZBUA 2BSAA 1KZLA 1Y0RA 1F60A 1WSRA 4XKWA 3OEHA 2VNJA 1S0UA 2F4NA 5TRDA 1ZM2A 5DSZA 4YELA 4P2NA 3W5HA 1EXMA 2ZZEA 2BM0A 3WNDA 4B44A 1E1RA 3WY9A 4B4DA 3W2HA 4OOXA 1OB2A 1D1NA 4M53A 3JQRA 1QGAA 4KKUA 1FRNA 2YWGA 4QVAA 1OGIA 2VBSA 2X3UA 3SLNA 1E1QA 2WZNA 4PC3A 1JNYA 1K28D 2WR8A 2C5BA 1W0JA 4P6YA 3OPOA 5FL7A 4XOTA 5KSWB 3G05A 4QFMA 5TV2A 4GQNA 1UD6A 4Z4WA 3CPWB 5FIUA 3R6KA 1AIPA 1TUIA 1WP6A 1VHEA 2VBVA 1SM4A 1XB2A 2QDXA 5LMZA 1KK1A 4WWVA 2HLDA 3FPPA 3OZUA 1OB5A 1M1KD 3CC4B 2XZLA 2GPJA 1XQBA 2DETA 2C2WA 1UD2A 4N3GA 1F20A 4K1XA 2BN4A 3PA2A 3QFRA 1Q9SA 1VF7A 2BPOA 3LQEA 4ZCMA 2ZTNA 1QFJA 1QUFA 3E1YE 4Z4SA 1FX0A 2WPDA 4YALA 4DNRB 4ZGNB 1WOOA 2EFGA 1ZM3A 1EWYA 1NB0A 4X07A 2V7QA 3GVKA 2JIZA 1D8TA 2CK3A 2X6WA 4IW3B 2PIAA 2ZITA 3CCVB 3WNCA 1K9MD 1N08A 3A3BA 4M4SA 3ASRA 1S4MA 2BV3A 2XGJA 4YAWA 3MHPA 2BGIA 3P27A 4DQKA 4Z4RA 2FX3A 3A8IA 4Z4ZA 3G4SB 1QVFB 2ZZGA 4P12A 2D74A 3CCQB 1W35A 3AVYA 1NBMA 1T6XA 3WBKA 2YWHA 3W2FA 3CCUB 1P4MA 1BQEA 1I8DA 3CCRB 3E20A 5HZAA 5IYRA 4FN5A 3OFNA 1G7RA 3OJWA 4TN1A 1TTTA 4P3IA 4EH1A 4RDLA 1R5NA 4LC0A 4U9UA 3JU4A 5IYPA 2JN9A 3JQQA 3CMAB 1B2RA 3PVDA 3Q39A 2X0KA 1KMHA 4XN0A 3ES9A 1OGJA 3ASPA 3BC9A 5J35A 2V4DA 1VQMB 2BM1A 2PE3A 1Q82D 4RCZA 3SJPA 1W34A 1H85A 2C4TA 1W2BB 1BJKA 1KK0A 2X53S 1YIJB 1UD3A 4Q7JB 1V0FA 4MYTA 3V7AA 2WJVA 4YEJA 3CC2B 1FRQA 4ZGQB 4YXWA 2OBSA 3PA1A 4BPRA 1SKQA 1EP1B 1BMFA 1QG0A 1MABA 2HMAA 1VJSA 1GO2A 1YX2A 2BF4A 1KRHA 3Q6QA 3CP8A 5GV8A 3WNBA 1JJ2B 4P3YA 1VQOB 4XD7A 3CESA 4X8IA 1TLLA 3PENA 2CC2A 4XLEA 4MYUA 4M0LA 1IHMA 4AVZA 4H9GA 4DK0A 1UMKA 1VQPB 5KW9A 2E1BA 3BCDA 3T51B 3BY1A 2ZXIA 5F4OA 4LBZA 3CMMA 4II3A 4PC6A 4WQMA 5FA6A 3FJOA 2VJJA 3I1FA 2GREA 4M2LA 2OK7A 1GAQA 1JA1A 1OB0A 1AMOA
chains in the Genus database with same CATH topology
4RPBA 3R6KA 3ASSA 4P26A 3PUMA 4OPSA 3PA2A 3LQEA 4X7CA 4Z4SA 4RPDA 5HZBA 3ASTA 5BSXA 4OPVA 4P1VA 4QUZA 5IYQA 4RM0A 3BY2A 4X07A 5IYWA 3Q6RA 4QVJA 4RDJA 4X05A 4WZKA 5F4JA 3SEJA 2ZL5A 4X0CA 3ASQA 3SLDA 3ASRA 2OBTA 4Z4VA 4Z4RA 4Z4ZA 4P12A 2ZL7A 3ONUA 3PUNA 4ROXA 4OOSA 5HZAA 5IYRA 3RY8A 3Q38A 4OPOA 4P3IA 4RLZA 4X7EA 4RDLA 5IYPA 4WZLA 4WZTA 3PVDA 2OBRA 3Q39A 3ASPA 3LQ6A 5J35A 3BQJA 4OOVA 3SKBA 3SJPA 4X7DA 3V7AA 3ONYA 4Z4YA 4RDKA 4WZEA 2OBSA 3PA1A 5IYNA 4P25A 4X7FA 5BSYA 3Q6QA 4P2NA 3R6JA 4OOXA 2ZL6A 1IHMA 4QVAA 3SLNA 5F4MA 5KW9A 4Z4UA 4QV2A 4Z4TA 3BY1A 5F4OA 4X06A 3Q3AA 3D26A 5J3OA 5E6TA 4OP7A 4Z4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RPB A;  3R6K A;  3ASS A;  4P26 A;  3PUM A;  4OPS A;  3PA2 A;  3LQE A;  4X7C A;  4Z4S A;  4RPD A;  5HZB A;  3AST A;  5BSX A;  4OPV A;  4P1V A;  4QUZ A;  5IYQ A;  4RM0 A;  3BY2 A;  4X07 A;  5IYW A;  3Q6R A;  4QVJ A;  4RDJ A;  4X05 A;  4WZK A;  5F4J A;  3SEJ A;  2ZL5 A;  4X0C A;  3ASQ A;  3SLD A;  3ASR A;  2OBT A;  4Z4V A;  4Z4R A;  4Z4Z A;  4P12 A;  2ZL7 A;  3ONU A;  3PUN A;  4ROX A;  4OOS A;  5HZA A;  5IYR A;  3RY8 A;  3Q38 A;  4OPO A;  4P3I A;  4RLZ A;  4X7E A;  4RDL A;  5IYP A;  4WZL A;  4WZT A;  3PVD A;  2OBR A;  3Q39 A;  3ASP A;  3LQ6 A;  5J35 A;  3BQJ A;  4OOV A;  3SKB A;  3SJP A;  4X7D A;  3V7A A;  3ONY A;  4Z4Y A;  4RDK A;  4WZE A;  2OBS A;  3PA1 A;  5IYN A;  4P25 A;  4X7F A;  5BSY A;  3Q6Q A;  4P2N A;  3R6J A;  4OOX A;  2ZL6 A;  1IHM A;  4QVA A;  3SLN A;  5F4M A;  5KW9 A;  4Z4U A;  4QV2 A;  4Z4T A;  3BY1 A;  5F4O A;  4X06 A;  3Q3A A;  3D26 A;  5J3O A;  5E6T A;  4OP7 A;  4Z4W A; 
#chains in the Genus database with same CATH topology
 1Q86 D;  5AN9 A;  5HKK A;  4XL9 A;  3P26 A;  1N06 A;  2HDN B;  2P3M A;  3LVB A;  3PUM A;  2EIX A;  4M1K A;  1BLI A;  3I56 B;  4XQF A;  3CB4 A;  1YJW B;  2V7T A;  1ELO A;  4YAU A;  2DEU A;  1E62 A;  3B78 A;  2R9V A;  3B82 A;  4ASU A;  1BX0 A;  2PMD A;  3GQB A;  1J9Z A;  1WDT A;  2QGG A;  1VHO A;  4X7C A;  3H94 A;  1Y0Y A;  2GJP A;  4RPD A;  4TMV A;  3AST A;  3A8J A;  1S72 B;  2NV4 A;  4NCN A;  4OPV A;  5IYQ A;  1QFZ A;  3I55 B;  4N3N A;  4G6I A;  5A88 A;  1QUE A;  2CF4 A;  3JQP A;  1EFC A;  4PC2 A;  2J7K A;  4WZK A;  4RD1 A;  2VYQ A;  2RC5 A;  3SEJ A;  4B47 A;  4RCY A;  3VMF A;  5DS0 A;  2VNK A;  3AGQ A;  2CW5 A;  4ZV4 A;  1CNF A;  2QMU A;  2GQF A;  2F1M A;  1H42 A;  3BH4 A;  2XEX A;  3GVJ A;  2D3N A;  2ZL7 A;  4XNF A;  1PJ7 A;  3ONU A;  2DIE A;  4P22 A;  4Y7C A;  2C78 A;  3ZZ0 A;  4OOS A;  1EP2 B;  4NNJ A;  1WSV A;  1IB0 A;  1T5E A;  3Q38 A;  4OPO A;  4RLZ A;  4KKS A;  2WYR A;  5CDF A;  3W5V A;  3ZC3 A;  1VQK B;  4LBY A;  3CCJ B;  2DY1 A;  1YJ9 B;  4C0S A;  4R71 A;  1GJR A;  1PKV A;  4G7W A;  3LQ6 A;  3BQJ A;  2WSS A;  1YIT B;  4FXU A;  1VQ6 B;  1XFO A;  3OP1 A;  2PLF A;  4HE6 A;  2BVN A;  1QGZ A;  3U2Q A;  1VQN B;  1RQR A;  4Z4Y A;  3QE2 A;  3W2G A;  4P25 A;  5B6I A;  4YAO A;  1EFR A;  2Q6L A;  2XZP A;  1EP3 B;  4XLH A;  2KVO A;  2CND A;  2HCJ B;  3H9N A;  1ZM9 A;  3CW2 A;  3R6J A;  4PGO A;  4UZE A;  3MMP A;  3CPX A;  1TVC A;  4FK8 A;  4F7D A;  1V5V A;  1ZUN B;  1N8R D;  1UD4 A;  4XON A;  3OE7 A;  4AC9 A;  2XND A;  4Z4U A;  2X8K A;  2ZXH A;  5EMN A;  2GK7 A;  1V0E A;  5GV7 A;  3VR6 A;  1UD8 A;  5DN6 A;  3W2E A;  3A3G A;  3D26 A;  1NDH A;  1WOR A;  3W2I A;  1IJF A;  5J3O A;  3ZBT A;  4RD3 A;  2XOK A;  1E3X A;  2Z6B D;  4CQJ A;  3WYA A;  1GVH A;  3AVU A;  1D2E A;  4XM3 A;  3G6E B;  3ASS A;  3BCF A;  1G7T A;  3FPK A;  2JJ1 A;  4P26 A;  1DDI A;  2AHO A;  5H59 A;  4OPS A;  1VLY A;  3OZV A;  2X6Y A;  3QFC A;  2X85 A;  3QFT A;  2QTL A;  3OJX A;  3CXC B;  2WJY A;  4UZU A;  5TR9 A;  3OW2 B;  3T56 B;  1E79 A;  4G7X A;  4XLF A;  2V7W A;  5THX A;  1HA3 A;  2GJK A;  1PJ5 A;  5BSX A;  2BMW A;  4QUZ A;  4TKO B;  3OAA A;  1DG1 G;  2E1R A;  5IYW A;  3CME B;  1GAW A;  1CNE A;  1WU8 A;  4TMT A;  4RDJ A;  2XNJ A;  4HE5 A;  4X05 A;  4B3F X;  5IK2 A;  3A35 A;  1WOP A;  1WOS A;  2WZP P;  3VNU A;  5F4J A;  3HAG A;  2Q6K A;  4B3G A;  1R5B A;  2ZL5 A;  3ASQ A;  4HIZ A;  4L8J A;  3SLD A;  3W5U A;  3OEE A;  4QHY A;  3QSY A;  1H8H A;  1E63 A;  3WBJ A;  3KEW A;  2CBX A;  1YLO A;  2JDI A;  4XOR A;  2ZTG A;  1QVG B;  2DCU A;  2C4U A;  3PUN A;  1E43 A;  4XLA A;  1YI2 B;  3ZPN A;  1I18 A;  3RY8 A;  3VO1 A;  2QE7 A;  1HVX A;  1N0U A;  1NB9 A;  4YAF A;  2F43 A;  3CRZ A;  1KK3 A;  1MRZ A;  3CCS B;  3GSI A;  4WZT A;  1N07 A;  5L46 A;  3CCE B;  1JA0 A;  3AGP A;  4DNT B;  2BGJ A;  4NBS A;  5KNL A;  4TMZ A;  4XOP A;  2R6H A;  4TT3 A;  1KQS B;  1NRK A;  2M5S A;  3FKS A;  1KK2 A;  3SKB A;  3V76 A;  2OTL B;  1BX1 A;  1VLO A;  3AVW A;  3VNV A;  4II2 A;  5HXB A;  4JMQ A;  2B5O A;  1EFT A;  2ZZF A;  3CCL B;  1FNM A;  3B8H A;  4X7D A;  3GVL A;  4RD2 A;  3ZUG A;  1VQ5 B;  4PAB A;  1IJE A;  1ZM4 A;  3ONY A;  4RDK A;  4WZE A;  5IYN A;  2W6J A;  2OK8 A;  4X7F A;  4DQL A;  5BSY A;  1WPC A;  3U6B A;  2D9R A;  1FND A;  2FVG A;  4B48 A;  2XZO A;  3ZIA A;  3J81 k;  4AF7 A;  3OKX A;  2VBU A;  4DK1 A;  2VBT A;  4RD4 A;  3AVV A;  3WXM A;  3ISX A;  1KC8 D;  1KD1 D;  2ZL6 A;  4ZCI A;  1VQ4 B;  3A8K A;  2C77 A;  1KTV A;  4Y9R A;  3ZBU A;  1FNB A;  2VJI A;  2XNC A;  5F4M A;  1QX4 A;  3AVT A;  2QA4 B;  4QV2 A;  3DDY A;  4Z4T A;  3OZW A;  1H8E A;  1A8P A;  2DOG A;  3OW7 A;  4X06 A;  1VQL B;  1QH0 A;  3LNN A;  4LBV A;  3Q3A A;  4ACB A;  5H5J A;  3G71 B;  2NPF A;  1W87 A;  3OOC A;  1VQ9 B;  1T6Z A;  1PJ6 A;  3A1P A;  4KKT A;  5E6T A;  4B3X A;  4OP7 A;  5FNZ A;  1HZE A;  1G7C A;  4RPB A;  4XKV A;  2B7B A;  3BNW A;  4RJL A;  1FNC A;  2QTZ A;  4PC1 A;  4XN3 A;  4ACA A;  1N0V C;  4G5G A;  2V31 A;  4PC7 A;  4RD0 A;  1I7P A;  1FDR A;  3SJZ A;  4G1V A;  2Q6O A;  1YJN B;  3WQZ A;  3CD6 B;  2V7X A;  1BPL A;  1EFU A;  3AVX A;  2OTJ B;  1N05 A;  3CC7 B;  1G7S A;  4UZF A;  2QN6 A;  4TSF A;  1KJZ A;  1K8A D;  2Q6I A;  1CQX A;  2C5H A;  1Q7Y D;  1Q81 D;  4ZCL A;  4XMY A;  3QFS A;  1OHH A;  4P9S A;  3ZZU A;  5HZB A;  3CCM B;  1YHQ B;  5A89 A;  4UAJ A;  4J0Q A;  1WTH D;  4P1V A;  2OYN A;  2GJR A;  2VNI A;  2I1L A;  4TMX A;  4RM0 A;  3BY2 A;  3CTA A;  2YWE A;  4Z1M A;  2V7U A;  1DDG A;  1U2R A;  3VO2 A;  4FWT A;  3Q6R A;  2D3L A;  4QVJ A;  1JB9 A;  1VQ8 B;  1E64 A;  4TMW A;  2CRV A;  2W6I A;  2X6X A;  1T6Y A;  2RC6 A;  4X0C A;  2ZBV A;  1E3Z A;  3LO8 A;  4E0F A;  1B23 P;  1SKY B;  3KL9 A;  5FO1 A;  2OBT A;  3ZZT A;  4Z4V A;  3T53 B;  4LBW A;  4AF6 A;  4Y9U A;  2DYI A;  1COW A;  1M90 D;  3MCA A;  1VQ7 B;  2VNH A;  4PAA A;  5FO0 A;  1DAR A;  1XE1 A;  2LZJ A;  4ROX A;  2F1L A;  1QGY A;  1W0K A;  1RQP A;  2VZL A;  1K73 D;  1UD5 A;  4X7E A;  3GIR A;  4C43 A;  4XR6 A;  4WZL A;  3U6K A;  4XLC A;  1R5O A;  2OBR A;  5TY0 A;  2B7C A;  4G1B A;  4OOV A;  2V7V A;  1QFY A;  4B43 A;  5A8A A;  4YHB A;  1W9X A;  4P6V F;  4RD6 A;  2QEX B;  2DER A;  2JJ2 A;  2GK6 A;  3NE5 B;  1NJI D;  5JBQ A;  3CP2 A;  2ZZQ A;  1GR1 A;  2YWF A;  2ZBU A;  2BSA A;  1KZL A;  1Y0R A;  1F60 A;  1WSR A;  4XKW A;  3OEH A;  2VNJ A;  1S0U A;  2F4N A;  5TRD A;  1ZM2 A;  5DSZ A;  4YEL A;  4P2N A;  3W5H A;  1EXM A;  2ZZE A;  2BM0 A;  3WND A;  4B44 A;  1E1R A;  3WY9 A;  4B4D A;  3W2H A;  4OOX A;  1OB2 A;  1D1N A;  4M53 A;  3JQR A;  1QGA A;  4KKU A;  1FRN A;  2YWG A;  4QVA A;  1OGI A;  2VBS A;  2X3U A;  3SLN A;  1E1Q A;  2WZN A;  4PC3 A;  1JNY A;  1K28 D;  2WR8 A;  2C5B A;  1W0J A;  4P6Y A;  3OPO A;  5FL7 A;  4XOT A;  5KSW B;  3G05 A;  4QFM A;  5TV2 A;  4GQN A;  1UD6 A;  4Z4W A;  3CPW B;  5FIU A;  3R6K A;  1AIP A;  1TUI A;  1WP6 A;  1VHE A;  2VBV A;  1SM4 A;  1XB2 A;  2QDX A;  5LMZ A;  1KK1 A;  4WWV A;  2HLD A;  3FPP A;  3OZU A;  1OB5 A;  1M1K D;  3CC4 B;  2XZL A;  2GPJ A;  1XQB A;  2DET A;  2C2W A;  1UD2 A;  4N3G A;  1F20 A;  4K1X A;  2BN4 A;  3PA2 A;  3QFR A;  1Q9S A;  1VF7 A;  2BPO A;  3LQE A;  4ZCM A;  2ZTN A;  1QFJ A;  1QUF A;  3E1Y E;  4Z4S A;  1FX0 A;  2WPD A;  4YAL A;  4DNR B;  4ZGN B;  1WOO A;  2EFG A;  1ZM3 A;  1EWY A;  1NB0 A;  4X07 A;  2V7Q A;  3GVK A;  2JIZ A;  1D8T A;  2CK3 A;  2X6W A;  4IW3 B;  2PIA A;  2ZIT A;  3CCV B;  3WNC A;  1K9M D;  1N08 A;  3A3B A;  4M4S A;  3ASR A;  1S4M A;  2BV3 A;  2XGJ A;  4YAW A;  3MHP A;  2BGI A;  3P27 A;  4DQK A;  4Z4R A;  2FX3 A;  3A8I A;  4Z4Z A;  3G4S B;  1QVF B;  2ZZG A;  4P12 A;  2D74 A;  3CCQ B;  1W35 A;  3AVY A;  1NBM A;  1T6X A;  3WBK A;  2YWH A;  3W2F A;  3CCU B;  1P4M A;  1BQE A;  1I8D A;  3CCR B;  3E20 A;  5HZA A;  5IYR A;  4FN5 A;  3OFN A;  1G7R A;  3OJW A;  4TN1 A;  1TTT A;  4P3I A;  4EH1 A;  4RDL A;  1R5N A;  4LC0 A;  4U9U A;  3JU4 A;  5IYP A;  2JN9 A;  3JQQ A;  3CMA B;  1B2R A;  3PVD A;  3Q39 A;  2X0K A;  1KMH A;  4XN0 A;  3ES9 A;  1OGJ A;  3ASP A;  3BC9 A;  5J35 A;  2V4D A;  1VQM B;  2BM1 A;  2PE3 A;  1Q82 D;  4RCZ A;  3SJP A;  1W34 A;  1H85 A;  2C4T A;  1W2B B;  1BJK A;  1KK0 A;  2X53 S;  1YIJ B;  1UD3 A;  4Q7J B;  1V0F A;  4MYT A;  3V7A A;  2WJV A;  4YEJ A;  3CC2 B;  1FRQ A;  4ZGQ B;  4YXW A;  2OBS A;  3PA1 A;  4BPR A;  1SKQ A;  1EP1 B;  1BMF A;  1QG0 A;  1MAB A;  2HMA A;  1VJS A;  1GO2 A;  1YX2 A;  2BF4 A;  1KRH A;  3Q6Q A;  3CP8 A;  5GV8 A;  3WNB A;  1JJ2 B;  4P3Y A;  1VQO B;  4XD7 A;  3CES A;  4X8I A;  1TLL A;  3PEN A;  2CC2 A;  4XLE A;  4MYU A;  4M0L A;  1IHM A;  4AVZ A;  4H9G A;  4DK0 A;  1UMK A;  1VQP B;  5KW9 A;  2E1B A;  3BCD A;  3T51 B;  3BY1 A;  2ZXI A;  5F4O A;  4LBZ A;  3CMM A;  4II3 A;  4PC6 A;  4WQM A;  5FA6 A;  3FJO A;  2VJJ A;  3I1F A;  2GRE A;  4M2L A;  2OK7 A;  1GAQ A;  1JA1 A;  1OB0 A;  1AMO A; 
#chains in the Genus database with same CATH homology
 4RPB A;  3R6K A;  3ASS A;  4P26 A;  3PUM A;  4OPS A;  3PA2 A;  3LQE A;  4X7C A;  4Z4S A;  4RPD A;  5HZB A;  3AST A;  5BSX A;  4OPV A;  4P1V A;  4QUZ A;  5IYQ A;  4RM0 A;  3BY2 A;  4X07 A;  5IYW A;  3Q6R A;  4QVJ A;  4RDJ A;  4X05 A;  4WZK A;  5F4J A;  3SEJ A;  2ZL5 A;  4X0C A;  3ASQ A;  3SLD A;  3ASR A;  2OBT A;  4Z4V A;  4Z4R A;  4Z4Z A;  4P12 A;  2ZL7 A;  3ONU A;  3PUN A;  4ROX A;  4OOS A;  5HZA A;  5IYR A;  3RY8 A;  3Q38 A;  4OPO A;  4P3I A;  4RLZ A;  4X7E A;  4RDL A;  5IYP A;  4WZL A;  4WZT A;  3PVD A;  2OBR A;  3Q39 A;  3ASP A;  3LQ6 A;  5J35 A;  3BQJ A;  4OOV A;  3SKB A;  3SJP A;  4X7D A;  3V7A A;  3ONY A;  4Z4Y A;  4RDK A;  4WZE A;  2OBS A;  3PA1 A;  5IYN A;  4P25 A;  4X7F A;  5BSY A;  3Q6Q A;  4P2N A;  3R6J A;  4OOX A;  2ZL6 A;  1IHM A;  4QVA A;  3SLN A;  5F4M A;  5KW9 A;  4Z4U A;  4QV2 A;  4Z4T A;  3BY1 A;  5F4O A;  4X06 A;  3Q3A A;  3D26 A;  5J3O A;  5E6T A;  4OP7 A;  4Z4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...