4Z4VA

Crystal structure of gii.10 p domain in complex with 19mm fucose
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
315
structure length
311
Chain Sequence
b'SKPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title The sweet quartet: Binding of fucose to the norovirus capsid.
pubmed doi rcsb
source organism Norovirus gii.10
molecule tags Viral protein
total genus 71
structure length 311
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4z4vA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4z4vA01
4RDKA 3SKBA 4OP7A 4X06A 5KW9A 4WZLA 4WZEA 5J35A 3V7AA 4OPOA 3ONYA 3R6KA 4OOXA 3SLNA 5IYQA 3PUNA 4QUZA 4OPVA 5HZAA 2ZL5A 4X7EA 3LQ6A 3PUMA 4RPDA 4WZTA 3ASQA 4WZKA 5BSXA 3D26A 3PA2A 5F4OA 5IYWA 4QVJA 4P25A 4RDJA 2ZL7A 3Q38A 4P26A 4Z4RA 3ASRA 5E6TA 3Q39A 4X07A 4P12A 3ASTA 3SLDA 4Z4ZA 3BY2A 5BSYA 4X0CA 2OBTA 4RM0A 3BY1A 5F4JA 2ZL6A 3SEJA 4RLZA 3BQJA 4X7DA 4Z4TA 4Z4SA 4OPSA 3ONUA 2OBSA 4RPBA 5IYPA 3Q3AA 3ASPA 3Q6QA 5IYNA 3PA1A 4X05A 3SJPA 3PVDA 4P1VA 4QV2A 4X7FA 4Z4YA 5HZBA 5F4MA 4QVAA 4OOVA 4ROXA 4RDLA 3R6JA 4P2NA 5IYRA 2OBRA 3RY8A 4P3IA 1IHMA 4Z4VA 3ASSA 3Q6RA 4X7CA 3LQEA 4Z4UA 5J3OA 4Z4WA 4OOSA
chains in the Genus database with same CATH superfamily
3GIRA 1BX1A 2C4UA 2FVGA 4RD2A 3I55B 3ZUGA 3OFNA 1UD4A 1EFTA 3G4SB 2VBVA 1IJFA 3KL9A 4X06A 4XONA 5J35A 2VNKA 3KEWA 3NE5B 2HCJB 3OW7A 3T56B 4M4SA 1M90D 4IW3B 3SLNA 1E3ZA 3WY9A 3AVTA 4C43A 2QE7A 3E20A 1B2RA 1FRNA 1TVCA 3ZPNA 3JQQA 4B3GA 4B48A 4LBYA 2ZTNA 2B7BA 3BCDA 4DK1A 2V31A 1OGJA 4PABA 1KD1D 1EFUA 3W2IA 3QFSA 4P6VF 3OKXA 2RC6A 1YI2B 1ZM2A 1G7TA 3AVVA 1VQPB 2VYQA 1PJ6A 4G6IA 3CP8A 2I1LA 5A8AA 1T6YA 2V4DA 4XLEA 4RDJA 1EP1B 4P26A 4QHYA 1PKVA 4Z4RA 5L46A 3WQZA 5E6TA 1DARA 4B43A 3Q39A 2QTZA 2R6HA 1W9XA 2V7WA 1JNYA 2WYRA 2BV3A 3U6KA 3SLDA 3BY2A 5BSYA 4X0CA 1CNFA 2DYIA 2W6IA 4DQKA 3A1PA 4TMXA 5GV7A 2WR8A 3G05A 4XLAA 2XZPA 1YX2A 1VLOA 3VMFA 4CQJA 4FN5A 2ZL6A 1XFOA 1W2BB 3BH4A 2WZNA 1KK2A 2BM0A 2C78A 2ZZGA 1VQ6B 3JQRA 1E1QA 1UMKA 1KK0A 1FNBA 4E0FA 1Q81D 1G7RA 1M1KD 1KK3A 3PENA 1VQOB 3FKSA 3CXCB 1PJ7A 1V0EA 4QV2A 4G7XA 2ZZFA 3JQPA 1YJNB 5A88A 5A89A 3OEEA 5EMNA 4ZCMA 2CK3A 2VNHA 3WNCA 1P4MA 5JBQA 2W6JA 4OOVA 3VR6A 4KKSA 2X85A 1KRHA 3R6JA 5CDFA 1KK1A 3ES9A 3OAAA 4TMZA 1EP3B 5FO0A 3ZBTA 4JMQA 3GQBA 1JA1A 3CCQB 4YAWA 1N05A 1VQ8B 3Q6RA 3LQEA 1OB0A 5J3OA 2QTLA 3FPKA 3AVYA 1WOSA 3CCMB 2JN9A 4Z4WA 4XOTA 3OE7A 4LBVA 2DIEA 3OZVA 1QVGB 3OPOA 1S0UA 2YWHA 1TUIA 4Z1MA 4HE5A 4UZEA 1QGAA 2BVNA 2GJRA 3I1FA 1Q7YD 2XEXA 2NV4A 4XKVA 2OTLB 1DDIA 4ZV4A 4WZLA 2V7VA 4WZEA 1QGYA 2VZLA 4G5GA 3G71B 1QG0A 2F4NA 2F43A 3OOCA 4DNTB 1FNDA 2GPJA 4XN3A 1WSRA 2YWFA 3PUNA 1D2EA 2VNIA 5HZAA 2GK7A 4F7DA 4J0QA 3J81k 1OB2A 1YITB 1VHOA 4PAAA 3A3BA 4YHBA 4NNJA 4TKOB 2ZZQA 1YJ9B 2XGJA 1PJ5A 5GV8A 1TLLA 2BGJA 2VJIA 1N07A 2WJYA 3H94A 4FK8A 4RCYA 3VO2A 5LMZA 3MMPA 3P27A 3ASQA 3FPPA 3ZZUA 1QUFA 1F60A 4TN1A 1GVHA 3CCSB 2GK6A 4U9UA 3CCEB 1NBMA 5BSXA 3D26A 3MCAA 5F4OA 3W5VA 1N06A 5IYWA 4P25A 1NRKA 1FRQA 1DDGA 1B23P 1VQ4B 4YAOA 3CCRB 1YJWB 1YIJB 2R9VA 4Z4ZA 1VQ5B 4XM3A 4RM0A 1W87A 1QX4A 1BQEA 4KKUA 4ASUA 2BF4A 1IB0A 3ZZ0A 3VNVA 1HVXA 3A8IA 1ELOA 1FNCA 2GJPA 3AGQA 1XB2A 4RD6A 1E3XA 4XMYA 2LZJA 4RLZA 3ZC3A 3BQJA 3WNDA 2VJJA 4Z4SA 4OPSA 4RD1A 5IYPA 1FX0A 3ASPA 3I56B 5TRDA 1N08A 2C5BA 4WQMA 3CMEB 4X05A 3B78A 3CPXA 3OZWA 1VQMB 3SJPA 1YHQB 3PVDA 2BMWA 3WBKA 4ZGQB 1QUEA 4P1VA 4XLHA 3VO1A 1GR1A 5HZBA 1FDRA 1G7CA 2DERA 1QVFB 1T6XA 2HMAA 3V76A 4DK0A 5FL7A 1BLIA 5DSZA 2HLDA 2BGIA 4P3YA 1QFJA 1VHEA 4X8IA 4P2NA 5B6IA 1E64A 4XQFA 4AC9A 2X6WA 2OBRA 3RY8A 4LBWA 4LC0A 3ZBUA 1N0UA 1WPCA 4P3IA 1W35A 2WSSA 2Q6LA 2X3UA 2EIXA 2X6YA 2Q6OA 3P26A 2VBTA 2NPFA 4PC3A 4B3XA 1WOPA 1JJ2B 3B82A 2ZZEA 1EWYA 2Q6KA 2CC2A 2ZTGA 2WJVA 2PLFA 3AGPA 2ZITA 4B47A 2BM1A 2OK8A 1COWA 1QFZA 4RDKA 3SKBA 2F1LA 4LBZA 3SJZA 1R5NA 4TSFA 4EH1A 1RQRA 1OB5A 4OP7A 4B3FX 3U6BA 2QA4B 4G7WA 2J7KA 3V7AA 5DN6A 5FNZA 3BCFA 4OPOA 1K28D 3ONYA 1J9ZA 4AF7A 4K1XA 3CCVB 1UD3A 3H9NA 2VBUA 2E1RA 2RC5A 1NJID 1ZM9A 1H8HA 4YXWA 1QH0A 2HDNB 3AVUA 4TMVA 2D3NA 1UD8A 2DY1A 4PGOA 4PC6A 4X7EA 1K73D 1ZM3A 1EFRA 1Y0RA 2DOGA 3A8JA 5H59A 1H85A 4RPDA 2V7QA 4TMTA 1N0VC 4WZTA 4DQLA 1YLOA 2P3MA 4YALA 2GJKA 1MABA 4WZKA 3CC2B 1QGZA 1UD6A 2JIZA 1KQSB 3CW2A 3WNBA 1VLYA 3ISXA 2CRVA 3CRZA 2XOKA 4RD3A 2PMDA 2DETA 3CP2A 3PA2A 4XL9A 3AVWA 1E79A 1H42A 4QVJA 1E43A 3ZZTA 2BPOA 4H9GA 1S72B 3A8KA 1E62A 1AMOA 3Q38A 5AN9A 3WBJA 1BPLA 2JJ1A 1VJSA 4X07A 2QN6A 3ASTA 2OYNA 2OBTA 4HE6A 1KMHA 1T6ZA 1VQKB 1XE1A 3CCJB 1ZM4A 4RCZA 1K8AD 2PE3A 1R5BA 1WOOA 4L8JA 5F4JA 2V7XA 3SEJA 3VNUA 2DEUA 4NCNA 4XNFA 4X7DA 5FO1A 3QSYA 1NDHA 3ONUA 4RPBA 2YWEA 4P22A 4G1BA 3CMAB 3OP1A 5HXBA 1WSVA 3LNNA 1VQ9B 1WU8A 1OGIA 2XZOA 4PC2A 1R5OA 2VNJA 2QEXB 1W0KA 4X7FA 1IJEA 4Y9RA 4Z4YA 1E1RA 5F4MA 2Z6BD 4XKWA 2B5OA 1D8TA 5TR9A 3OW2B 3BNWA 1Q86D 4RDLA 3QFRA 3GVJA 4MYUA 4YAFA 2D74A 2XNJA 3BC9A 3B8HA 5IYRA 2AHOA 4Y7CA 2XNDA 3W2HA 4BPRA 3ASSA 2X53S 4RJLA 4XLFA 1OHHA 1I18A 2BN4A 4Z4UA 2ZBVA 4YEJA 5DS0A 1SKYB 4ZGNB 4N3NA 1Q82D 2GQFA 3QE2A 1WTHD 4TT3A 3CC7B 2JJ2A 4Q7JB 4M53A 3QFCA 4FXUA 2Q6IA 1Q9SA 1JA0A 2XNCA 2CF4A 3T51B 3E1YE 1UD2A 3OJWA 4M1KA 2OTJB 1V0FA 4AF6A 1BMFA 1DG1G 1GO2A 4XR6A 5KSWB 1NB0A 1MRZA 2VBSA 5KW9A 1QFYA 4PC7A 4Y9UA 1KTVA 3U2QA 1I8DA 3CD6B 4XD7A 3W2GA 4II3A 1K9MD 3FJOA 3MHPA 3A3GA 2ZXHA 1WORA 3R6KA 3W2FA 3AVXA 1KJZA 4OOXA 4B4DA 2C77A 5IYQA 1T5EA 1VQLB 2D3LA 1UD5A 4QUZA 1HA3A 3LVBA 3JU4A 4OPVA 1GAQA 2XZLA 2M5SA 2C2WA 2WZPP 2ZL5A 2X8KA 4ACAA 3LQ6A 3PUMA 1HZEA 3A35A 3W5UA 4TMWA 1VQNB 1H8EA 1CNEA 1WP6A 1V5VA 2EFGA 2ZXIA 4RD0A 4ZCIA 1ZUNB 2CNDA 1GAWA 1SKQA 1VF7A 4P6YA 2JDIA 1G7SA 3CB4A 1XQBA 1D1NA 4UAJA 1F20A 1S4MA 2X6XA 4UZUA 3WXMA 5KNLA 2ZL7A 2PIAA 3QFTA 3ASRA 4KKTA 1FNMA 3OZUA 2ZBUA 4QFMA 5THXA 3G6EB 3ZIAA 3OJXA 4P12A 4MYTA 5IK2A 1EP2B 4AVZA 2CBXA 1EXMA 1CQXA 3WYAA 4DNRB 1JB9A 3BY1A 5H5JA 4XN0A 4ACBA 1W34A 1NB9A 1TTTA 4P9SA 2F1MA 4RD4A 4ZCLA 3DDYA 2CW5A 2WPDA 1W0JA 4WWVA 1RQPA 3HAGA 4Z4TA 3W5HA 2D9RA 2GREA 2X0KA 2OBSA 4C0SA 4YAUA 4M0LA 4HIZA 3CCLB 4M2LA 1AIPA 3Q3AA 1KC8D 3Q6QA 1Y0YA 1BX0A 3LO8A 5IYNA 1I7PA 3PA1A 4YELA 4II2A 2V7TA 1U2RA 5FA6A 4R71A 1N8RD 4FWTA 2C5HA 2QGGA 1EFCA 3CPWB 2QDXA 1BJKA 1A8PA 5HKKA 1E63A 3CESA 1WDTA 3GVLA 2DCUA 2YWGA 1VQ7B 4QVAA 4G1VA 4ROXA 4NBSA 4GQNA 2V7UA 3W2EA 3CMMA 4XORA 5TY0A 1IHMA 4Z4VA 3CTAA 2C4TA 2OK7A 4N3GA 4X7CA 4XLCA 3GVKA 5TV2A 2KVOA 4XOPA 1KZLA 3GSIA 3T53B 4PC1A 3OEHA 1SM4A 2BSAA 3CC4B 2E1BA 2B7CA 5FIUA 4B44A 2QMUA 1GJRA 3CCUB 4UZFA 4OOSA 2FX3A
chains in the Genus database with same CATH topology
4RDKA 3SKBA 4OP7A 4X06A 5KW9A 4WZLA 4WZEA 5J35A 3V7AA 4OPOA 3ONYA 3R6KA 4OOXA 3SLNA 5IYQA 3PUNA 4QUZA 4OPVA 5HZAA 2ZL5A 4X7EA 3LQ6A 3PUMA 4RPDA 4WZTA 3ASQA 4WZKA 5BSXA 3D26A 3PA2A 5F4OA 5IYWA 4QVJA 4P25A 4RDJA 2ZL7A 3Q38A 4P26A 4Z4RA 3ASRA 5E6TA 3Q39A 4X07A 4P12A 3ASTA 3SLDA 4Z4ZA 3BY2A 5BSYA 4X0CA 2OBTA 4RM0A 3BY1A 5F4JA 2ZL6A 3SEJA 4RLZA 3BQJA 4X7DA 4Z4TA 4Z4SA 4OPSA 3ONUA 2OBSA 4RPBA 5IYPA 3Q3AA 3ASPA 3Q6QA 5IYNA 3PA1A 4X05A 3SJPA 3PVDA 4P1VA 4QV2A 4X7FA 4Z4YA 5HZBA 5F4MA 4QVAA 4OOVA 4ROXA 4RDLA 3R6JA 4P2NA 5IYRA 2OBRA 3RY8A 4P3IA 1IHMA 4Z4VA 3ASSA 3Q6RA 4X7CA 3LQEA 4Z4UA 5J3OA 4Z4WA 4OOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RDK A;  3SKB A;  4OP7 A;  4X06 A;  5KW9 A;  4WZL A;  4WZE A;  5J35 A;  3V7A A;  4OPO A;  3ONY A;  3R6K A;  4OOX A;  3SLN A;  5IYQ A;  3PUN A;  4QUZ A;  4OPV A;  5HZA A;  2ZL5 A;  4X7E A;  3LQ6 A;  3PUM A;  4RPD A;  4WZT A;  3ASQ A;  4WZK A;  5BSX A;  3D26 A;  3PA2 A;  5F4O A;  5IYW A;  4QVJ A;  4P25 A;  4RDJ A;  2ZL7 A;  3Q38 A;  4P26 A;  4Z4R A;  3ASR A;  5E6T A;  3Q39 A;  4X07 A;  4P12 A;  3AST A;  3SLD A;  4Z4Z A;  3BY2 A;  5BSY A;  4X0C A;  2OBT A;  4RM0 A;  3BY1 A;  5F4J A;  2ZL6 A;  3SEJ A;  4RLZ A;  3BQJ A;  4X7D A;  4Z4T A;  4Z4S A;  4OPS A;  3ONU A;  2OBS A;  4RPB A;  5IYP A;  3Q3A A;  3ASP A;  3Q6Q A;  5IYN A;  3PA1 A;  4X05 A;  3SJP A;  3PVD A;  4P1V A;  4QV2 A;  4X7F A;  4Z4Y A;  5HZB A;  5F4M A;  4QVA A;  4OOV A;  4ROX A;  4RDL A;  3R6J A;  4P2N A;  5IYR A;  2OBR A;  3RY8 A;  4P3I A;  1IHM A;  4Z4V A;  3ASS A;  3Q6R A;  4X7C A;  3LQE A;  4Z4U A;  5J3O A;  4Z4W A;  4OOS A; 
#chains in the Genus database with same CATH topology
 3GIR A;  1BX1 A;  2C4U A;  2FVG A;  4RD2 A;  3I55 B;  3ZUG A;  3OFN A;  1UD4 A;  1EFT A;  3G4S B;  2VBV A;  1IJF A;  3KL9 A;  4X06 A;  4XON A;  5J35 A;  2VNK A;  3KEW A;  3NE5 B;  2HCJ B;  3OW7 A;  3T56 B;  4M4S A;  1M90 D;  4IW3 B;  3SLN A;  1E3Z A;  3WY9 A;  3AVT A;  4C43 A;  2QE7 A;  3E20 A;  1B2R A;  1FRN A;  1TVC A;  3ZPN A;  3JQQ A;  4B3G A;  4B48 A;  4LBY A;  2ZTN A;  2B7B A;  3BCD A;  4DK1 A;  2V31 A;  1OGJ A;  4PAB A;  1KD1 D;  1EFU A;  3W2I A;  3QFS A;  4P6V F;  3OKX A;  2RC6 A;  1YI2 B;  1ZM2 A;  1G7T A;  3AVV A;  1VQP B;  2VYQ A;  1PJ6 A;  4G6I A;  3CP8 A;  2I1L A;  5A8A A;  1T6Y A;  2V4D A;  4XLE A;  4RDJ A;  1EP1 B;  4P26 A;  4QHY A;  1PKV A;  4Z4R A;  5L46 A;  3WQZ A;  5E6T A;  1DAR A;  4B43 A;  3Q39 A;  2QTZ A;  2R6H A;  1W9X A;  2V7W A;  1JNY A;  2WYR A;  2BV3 A;  3U6K A;  3SLD A;  3BY2 A;  5BSY A;  4X0C A;  1CNF A;  2DYI A;  2W6I A;  4DQK A;  3A1P A;  4TMX A;  5GV7 A;  2WR8 A;  3G05 A;  4XLA A;  2XZP A;  1YX2 A;  1VLO A;  3VMF A;  4CQJ A;  4FN5 A;  2ZL6 A;  1XFO A;  1W2B B;  3BH4 A;  2WZN A;  1KK2 A;  2BM0 A;  2C78 A;  2ZZG A;  1VQ6 B;  3JQR A;  1E1Q A;  1UMK A;  1KK0 A;  1FNB A;  4E0F A;  1Q81 D;  1G7R A;  1M1K D;  1KK3 A;  3PEN A;  1VQO B;  3FKS A;  3CXC B;  1PJ7 A;  1V0E A;  4QV2 A;  4G7X A;  2ZZF A;  3JQP A;  1YJN B;  5A88 A;  5A89 A;  3OEE A;  5EMN A;  4ZCM A;  2CK3 A;  2VNH A;  3WNC A;  1P4M A;  5JBQ A;  2W6J A;  4OOV A;  3VR6 A;  4KKS A;  2X85 A;  1KRH A;  3R6J A;  5CDF A;  1KK1 A;  3ES9 A;  3OAA A;  4TMZ A;  1EP3 B;  5FO0 A;  3ZBT A;  4JMQ A;  3GQB A;  1JA1 A;  3CCQ B;  4YAW A;  1N05 A;  1VQ8 B;  3Q6R A;  3LQE A;  1OB0 A;  5J3O A;  2QTL A;  3FPK A;  3AVY A;  1WOS A;  3CCM B;  2JN9 A;  4Z4W A;  4XOT A;  3OE7 A;  4LBV A;  2DIE A;  3OZV A;  1QVG B;  3OPO A;  1S0U A;  2YWH A;  1TUI A;  4Z1M A;  4HE5 A;  4UZE A;  1QGA A;  2BVN A;  2GJR A;  3I1F A;  1Q7Y D;  2XEX A;  2NV4 A;  4XKV A;  2OTL B;  1DDI A;  4ZV4 A;  4WZL A;  2V7V A;  4WZE A;  1QGY A;  2VZL A;  4G5G A;  3G71 B;  1QG0 A;  2F4N A;  2F43 A;  3OOC A;  4DNT B;  1FND A;  2GPJ A;  4XN3 A;  1WSR A;  2YWF A;  3PUN A;  1D2E A;  2VNI A;  5HZA A;  2GK7 A;  4F7D A;  4J0Q A;  3J81 k;  1OB2 A;  1YIT B;  1VHO A;  4PAA A;  3A3B A;  4YHB A;  4NNJ A;  4TKO B;  2ZZQ A;  1YJ9 B;  2XGJ A;  1PJ5 A;  5GV8 A;  1TLL A;  2BGJ A;  2VJI A;  1N07 A;  2WJY A;  3H94 A;  4FK8 A;  4RCY A;  3VO2 A;  5LMZ A;  3MMP A;  3P27 A;  3ASQ A;  3FPP A;  3ZZU A;  1QUF A;  1F60 A;  4TN1 A;  1GVH A;  3CCS B;  2GK6 A;  4U9U A;  3CCE B;  1NBM A;  5BSX A;  3D26 A;  3MCA A;  5F4O A;  3W5V A;  1N06 A;  5IYW A;  4P25 A;  1NRK A;  1FRQ A;  1DDG A;  1B23 P;  1VQ4 B;  4YAO A;  3CCR B;  1YJW B;  1YIJ B;  2R9V A;  4Z4Z A;  1VQ5 B;  4XM3 A;  4RM0 A;  1W87 A;  1QX4 A;  1BQE A;  4KKU A;  4ASU A;  2BF4 A;  1IB0 A;  3ZZ0 A;  3VNV A;  1HVX A;  3A8I A;  1ELO A;  1FNC A;  2GJP A;  3AGQ A;  1XB2 A;  4RD6 A;  1E3X A;  4XMY A;  2LZJ A;  4RLZ A;  3ZC3 A;  3BQJ A;  3WND A;  2VJJ A;  4Z4S A;  4OPS A;  4RD1 A;  5IYP A;  1FX0 A;  3ASP A;  3I56 B;  5TRD A;  1N08 A;  2C5B A;  4WQM A;  3CME B;  4X05 A;  3B78 A;  3CPX A;  3OZW A;  1VQM B;  3SJP A;  1YHQ B;  3PVD A;  2BMW A;  3WBK A;  4ZGQ B;  1QUE A;  4P1V A;  4XLH A;  3VO1 A;  1GR1 A;  5HZB A;  1FDR A;  1G7C A;  2DER A;  1QVF B;  1T6X A;  2HMA A;  3V76 A;  4DK0 A;  5FL7 A;  1BLI A;  5DSZ A;  2HLD A;  2BGI A;  4P3Y A;  1QFJ A;  1VHE A;  4X8I A;  4P2N A;  5B6I A;  1E64 A;  4XQF A;  4AC9 A;  2X6W A;  2OBR A;  3RY8 A;  4LBW A;  4LC0 A;  3ZBU A;  1N0U A;  1WPC A;  4P3I A;  1W35 A;  2WSS A;  2Q6L A;  2X3U A;  2EIX A;  2X6Y A;  2Q6O A;  3P26 A;  2VBT A;  2NPF A;  4PC3 A;  4B3X A;  1WOP A;  1JJ2 B;  3B82 A;  2ZZE A;  1EWY A;  2Q6K A;  2CC2 A;  2ZTG A;  2WJV A;  2PLF A;  3AGP A;  2ZIT A;  4B47 A;  2BM1 A;  2OK8 A;  1COW A;  1QFZ A;  4RDK A;  3SKB A;  2F1L A;  4LBZ A;  3SJZ A;  1R5N A;  4TSF A;  4EH1 A;  1RQR A;  1OB5 A;  4OP7 A;  4B3F X;  3U6B A;  2QA4 B;  4G7W A;  2J7K A;  3V7A A;  5DN6 A;  5FNZ A;  3BCF A;  4OPO A;  1K28 D;  3ONY A;  1J9Z A;  4AF7 A;  4K1X A;  3CCV B;  1UD3 A;  3H9N A;  2VBU A;  2E1R A;  2RC5 A;  1NJI D;  1ZM9 A;  1H8H A;  4YXW A;  1QH0 A;  2HDN B;  3AVU A;  4TMV A;  2D3N A;  1UD8 A;  2DY1 A;  4PGO A;  4PC6 A;  4X7E A;  1K73 D;  1ZM3 A;  1EFR A;  1Y0R A;  2DOG A;  3A8J A;  5H59 A;  1H85 A;  4RPD A;  2V7Q A;  4TMT A;  1N0V C;  4WZT A;  4DQL A;  1YLO A;  2P3M A;  4YAL A;  2GJK A;  1MAB A;  4WZK A;  3CC2 B;  1QGZ A;  1UD6 A;  2JIZ A;  1KQS B;  3CW2 A;  3WNB A;  1VLY A;  3ISX A;  2CRV A;  3CRZ A;  2XOK A;  4RD3 A;  2PMD A;  2DET A;  3CP2 A;  3PA2 A;  4XL9 A;  3AVW A;  1E79 A;  1H42 A;  4QVJ A;  1E43 A;  3ZZT A;  2BPO A;  4H9G A;  1S72 B;  3A8K A;  1E62 A;  1AMO A;  3Q38 A;  5AN9 A;  3WBJ A;  1BPL A;  2JJ1 A;  1VJS A;  4X07 A;  2QN6 A;  3AST A;  2OYN A;  2OBT A;  4HE6 A;  1KMH A;  1T6Z A;  1VQK B;  1XE1 A;  3CCJ B;  1ZM4 A;  4RCZ A;  1K8A D;  2PE3 A;  1R5B A;  1WOO A;  4L8J A;  5F4J A;  2V7X A;  3SEJ A;  3VNU A;  2DEU A;  4NCN A;  4XNF A;  4X7D A;  5FO1 A;  3QSY A;  1NDH A;  3ONU A;  4RPB A;  2YWE A;  4P22 A;  4G1B A;  3CMA B;  3OP1 A;  5HXB A;  1WSV A;  3LNN A;  1VQ9 B;  1WU8 A;  1OGI A;  2XZO A;  4PC2 A;  1R5O A;  2VNJ A;  2QEX B;  1W0K A;  4X7F A;  1IJE A;  4Y9R A;  4Z4Y A;  1E1R A;  5F4M A;  2Z6B D;  4XKW A;  2B5O A;  1D8T A;  5TR9 A;  3OW2 B;  3BNW A;  1Q86 D;  4RDL A;  3QFR A;  3GVJ A;  4MYU A;  4YAF A;  2D74 A;  2XNJ A;  3BC9 A;  3B8H A;  5IYR A;  2AHO A;  4Y7C A;  2XND A;  3W2H A;  4BPR A;  3ASS A;  2X53 S;  4RJL A;  4XLF A;  1OHH A;  1I18 A;  2BN4 A;  4Z4U A;  2ZBV A;  4YEJ A;  5DS0 A;  1SKY B;  4ZGN B;  4N3N A;  1Q82 D;  2GQF A;  3QE2 A;  1WTH D;  4TT3 A;  3CC7 B;  2JJ2 A;  4Q7J B;  4M53 A;  3QFC A;  4FXU A;  2Q6I A;  1Q9S A;  1JA0 A;  2XNC A;  2CF4 A;  3T51 B;  3E1Y E;  1UD2 A;  3OJW A;  4M1K A;  2OTJ B;  1V0F A;  4AF6 A;  1BMF A;  1DG1 G;  1GO2 A;  4XR6 A;  5KSW B;  1NB0 A;  1MRZ A;  2VBS A;  5KW9 A;  1QFY A;  4PC7 A;  4Y9U A;  1KTV A;  3U2Q A;  1I8D A;  3CD6 B;  4XD7 A;  3W2G A;  4II3 A;  1K9M D;  3FJO A;  3MHP A;  3A3G A;  2ZXH A;  1WOR A;  3R6K A;  3W2F A;  3AVX A;  1KJZ A;  4OOX A;  4B4D A;  2C77 A;  5IYQ A;  1T5E A;  1VQL B;  2D3L A;  1UD5 A;  4QUZ A;  1HA3 A;  3LVB A;  3JU4 A;  4OPV A;  1GAQ A;  2XZL A;  2M5S A;  2C2W A;  2WZP P;  2ZL5 A;  2X8K A;  4ACA A;  3LQ6 A;  3PUM A;  1HZE A;  3A35 A;  3W5U A;  4TMW A;  1VQN B;  1H8E A;  1CNE A;  1WP6 A;  1V5V A;  2EFG A;  2ZXI A;  4RD0 A;  4ZCI A;  1ZUN B;  2CND A;  1GAW A;  1SKQ A;  1VF7 A;  4P6Y A;  2JDI A;  1G7S A;  3CB4 A;  1XQB A;  1D1N A;  4UAJ A;  1F20 A;  1S4M A;  2X6X A;  4UZU A;  3WXM A;  5KNL A;  2ZL7 A;  2PIA A;  3QFT A;  3ASR A;  4KKT A;  1FNM A;  3OZU A;  2ZBU A;  4QFM A;  5THX A;  3G6E B;  3ZIA A;  3OJX A;  4P12 A;  4MYT A;  5IK2 A;  1EP2 B;  4AVZ A;  2CBX A;  1EXM A;  1CQX A;  3WYA A;  4DNR B;  1JB9 A;  3BY1 A;  5H5J A;  4XN0 A;  4ACB A;  1W34 A;  1NB9 A;  1TTT A;  4P9S A;  2F1M A;  4RD4 A;  4ZCL A;  3DDY A;  2CW5 A;  2WPD A;  1W0J A;  4WWV A;  1RQP A;  3HAG A;  4Z4T A;  3W5H A;  2D9R A;  2GRE A;  2X0K A;  2OBS A;  4C0S A;  4YAU A;  4M0L A;  4HIZ A;  3CCL B;  4M2L A;  1AIP A;  3Q3A A;  1KC8 D;  3Q6Q A;  1Y0Y A;  1BX0 A;  3LO8 A;  5IYN A;  1I7P A;  3PA1 A;  4YEL A;  4II2 A;  2V7T A;  1U2R A;  5FA6 A;  4R71 A;  1N8R D;  4FWT A;  2C5H A;  2QGG A;  1EFC A;  3CPW B;  2QDX A;  1BJK A;  1A8P A;  5HKK A;  1E63 A;  3CES A;  1WDT A;  3GVL A;  2DCU A;  2YWG A;  1VQ7 B;  4QVA A;  4G1V A;  4ROX A;  4NBS A;  4GQN A;  2V7U A;  3W2E A;  3CMM A;  4XOR A;  5TY0 A;  1IHM A;  4Z4V A;  3CTA A;  2C4T A;  2OK7 A;  4N3G A;  4X7C A;  4XLC A;  3GVK A;  5TV2 A;  2KVO A;  4XOP A;  1KZL A;  3GSI A;  3T53 B;  4PC1 A;  3OEH A;  1SM4 A;  2BSA A;  3CC4 B;  2E1B A;  2B7C A;  5FIU A;  4B44 A;  2QMU A;  1GJR A;  3CCU B;  4UZF A;  4OOS A;  2FX3 A; 
#chains in the Genus database with same CATH homology
 4RDK A;  3SKB A;  4OP7 A;  4X06 A;  5KW9 A;  4WZL A;  4WZE A;  5J35 A;  3V7A A;  4OPO A;  3ONY A;  3R6K A;  4OOX A;  3SLN A;  5IYQ A;  3PUN A;  4QUZ A;  4OPV A;  5HZA A;  2ZL5 A;  4X7E A;  3LQ6 A;  3PUM A;  4RPD A;  4WZT A;  3ASQ A;  4WZK A;  5BSX A;  3D26 A;  3PA2 A;  5F4O A;  5IYW A;  4QVJ A;  4P25 A;  4RDJ A;  2ZL7 A;  3Q38 A;  4P26 A;  4Z4R A;  3ASR A;  5E6T A;  3Q39 A;  4X07 A;  4P12 A;  3AST A;  3SLD A;  4Z4Z A;  3BY2 A;  5BSY A;  4X0C A;  2OBT A;  4RM0 A;  3BY1 A;  5F4J A;  2ZL6 A;  3SEJ A;  4RLZ A;  3BQJ A;  4X7D A;  4Z4T A;  4Z4S A;  4OPS A;  3ONU A;  2OBS A;  4RPB A;  5IYP A;  3Q3A A;  3ASP A;  3Q6Q A;  5IYN A;  3PA1 A;  4X05 A;  3SJP A;  3PVD A;  4P1V A;  4QV2 A;  4X7F A;  4Z4Y A;  5HZB A;  5F4M A;  4QVA A;  4OOV A;  4ROX A;  4RDL A;  3R6J A;  4P2N A;  5IYR A;  2OBR A;  3RY8 A;  4P3I A;  1IHM A;  4Z4V A;  3ASS A;  3Q6R A;  4X7C A;  3LQE A;  4Z4U A;  5J3O A;  4Z4W A;  4OOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...