1QX4A

Structrue of s127p mutant of cytochrome b5 reductase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
270
structure length
264
Chain Sequence
HMITLENPDIKYPLRLIDKEILSHDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKEAGGKMPQYLENMNIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQSEKDILLRPELEELRNEHSSRFKLWYTVDKAPDAWDYSQGFVNEEMIRDHLPPPGEETLILMCGPPPMIQFACLPNLERVGHPKERCFTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-cytochrome b5 reductase
publication title The structure of the S127P mutant of cytochrome b5 reductase that causes methemoglobinemia shows the AMP moiety of the flavin occupying the substrate binding site
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 66
structure length 264
sequence length 270
chains with identical sequence B
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2003-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qx4A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qx4A02
1WDTA 2QMUA 3LO8A 3AVVA 1JA1A 4ZCLA 3OJXA 3CRZA 3MCAA 1AIPA 2DERA 3B8HA 3QFTA 1GO2A 3CC4B 1YJNB 3B82A 5AN9A 1G7RA 2BGIA 1SM4A 4M53A 2OK7A 4ACAA 2PIAA 2X3UA 3W2GA 1OGIA 2YWFA 4J0QA 1AMOA 1Q82D 2NPFA 2BVNA 2RC5A 3AGPA 1EP1B 1N0UA 3JQPA 1DDGA 4M4SA 1ELOA 4B48A 1KD1D 4LBVA 1ZUNB 4ZV4A 1QGZA 2XNCA 1FNDA 4TMXA 3VO1A 1KC8D 1EXMA 2BF4A 1FDRA 2B5OA 3CCMB 1G7TA 2C77A 4PC6A 1B2RA 1CQXA 4RD3A 4YAUA 4PC1A 2GQFA 4FK8A 1BX0A 1FRNA 3ZZ0A 1E63A 3W2FA 2E1RA 2QEXB 4N3GA 4IW3B 5H5JA 1YHQB 2YWEA 4M1KA 1G7SA 4HE5A 1F20A 1QGAA 4NCNA 3PENA 1VQMB 4UAJA 3LVBA 3P27A 1K73D 3G71B 1CNFA 4H9GA 3CCUB 1VQPB 2CRVA 4RD2A 3AVUA 3SJZA 3CB4A 4MYUA 3CCLB 2VNIA 4M0LA 3G6EB 4RJLA 3ES9A 1HA3A 3G4SB 3AVXA 4B4DA 3CPWB 1UMKA 4G1VA 1ZM2A 1TTTA 2DCUA 3P26A 4QHYA 4NBSA 3ZBUA 4PC3A 4FWTA 2EIXA 3QE2A 1K8AD 5FA6A 2GPJA 1VQ4B 3JQRA 3WNDA 1JJ2B 3LYUA 3LRXA 1D1NA 5GV8A 4R71A 1S0UA 2BM1A 1FNCA 2D74A 3CCSB 1IJEA 2YWHA 5GV7A 1YIJB 1W2BB 1QVFB 4N3NA 3W2HA 2QA4B 4YAOA 3VMFA 4AF7A 1XB2A 4PGOA 4G5GA 4P6VF 3CCJB 5H59A 4PC7A 3WNCA 1U2RA 3W2EA 1CNEA 1DARA 1EP3B 2OTJB 1Q7YD 4LBWA 2DETA 4FN5A 1B23P 3CC2B 4YALA 3CC7B 1IB0A 1Q81D 3U6KA 2OK8A 4G1BA 1W87A 3WY9A 2PMDA 2AHOA 1SKQA 4YAFA 3WBKA 3ZBTA 1EWYA 3WNBA 2RC6A 3B78A 1N0VC 3OW2B 4K1XA 3V76A 1FNBA 4PC2A 1EP2B 1KK1A 1TVCA 1BQEA 4AF6A 1ZM3A 2QDXA 5JBQA 1Q86D 1VQ6B 1M90D 3I1FA 2PLFA 1OB2A 1G7CA 3AVTA 1QX4A 1W35A 1H42A 2VNJA 2BPOA 2HCJB 1ZM4A 4BPRA 3CCVB 2OTLB 3FJOA 1EFCA 5DSZA 2FX3A 4TN1A 2VNKA 3ZZTA 1R5BA 1QGYA 3CCEB 1EFTA 2VYQA 1VQLB 1JNYA 1H85A 1GAWA 2R6HA 3CXCB 4B43A 3U6BA 1KQSB 2C78A 1R5OA 5TV2A 3I56B 3ZZUA 5KSWB 3MHPA 3QFRA 4YAWA 2CNDA 5EMNA 3AGQA 3QFSA 4QFMA 4P3YA 3CW2A 4LBYA 2BMWA 1E62A 1DG1G 5TR9A 4AC9A 1KJZA 1YJWB 1JB9A 4ZCMA 4ZCIA 1VQ9B 4MYTA 3CMAB 2QTLA 4EH1A 4YHBA 1QG0A 4B47A 1VQKB 4Q7JB 1TLLA 1XE1A 4HE6A 3W2IA 1KK2A 2XEXA 3A1FA 2HDNB 3U2QA 2BV3A 3QSYA 1F60A 3MMPA 4C0SA 3CCRB 4Y7CA 1VQ5B 3OZUA 4RD1A 3FPKA 4DQKA 1D8TA 1S72B 3WBJA 1KK0A 5HXBA 3ZC3A 4F7DA 2EFGA 1W34A 1A8PA 3CMEB 3VNVA 2BM0A 4Y9UA 4ZGQB 1VQOB 1QFZA 1KK3A 2QN6A 1OB5A 1TUIA 4LBZA 2XNJA 1KTVA 2DEUA 3VO2A 4TMZA 4ZGNB 3I55B 1VQ8B 3VNUA 3E1YE 1GJRA 1K9MD 1QVGB 3JQQA 1BX1A 1FNMA 1E64A 1M1KD 2VZLA 1DDIA 4RD6A 4TMVA 1VQNB 2B7CA 2QTZA 2HMAA 1QH0A 4ACBA 3AVYA 3W5UA 3W5HA 4TMTA 1NDHA 1GR1A 3WXMA 1QFJA 1YI2B 4LC0A 3WYAA 3OZWA 1OGJA 1D2EA 1GVHA 1N8RD 4U9UA 2YWGA 1KRHA 1FRQA 4RCZA 3W5VA 3CD6B 3E20A 3OJWA 4RCYA 1YITB 1I7PA 2BGJA 2BN4A 4B3XA 4C43A 1QFYA 2ZITA 1QUEA 4DQLA 4B44A 4WQMA 3AVWA 1YJ9B 3OZVA 1R5NA 4Y9RA 1BJKA 1GAQA 4RD4A 1J9ZA 4M2LA 5TY0A 1ZM9A 3J81k 2DY1A 2B7BA 1QUFA 1NJID 3QFCA 3CCQB 1EFUA 4TMWA 1JA0A 1IJFA 2J7KA 4RD0A 2VNHA 1VQ7B 5THXA 2BSAA
chains in the Genus database with same CATH superfamily
4KFTA 1TE2A 3SZOA 1BS9A 1JG7A 3TLJA 5K8TA 4LF7B 4EO4A 4YAJA 1F4VA 1ZGJA 1Q17A 4TGLA 3OQMA 3PEWA 1D6SA 2OP0A 3KR2A 4ZCLA 1O94D 4WADA 2E85A 2AE1A 3SEZA 8ATCA 2ZBRA 4LWPA 4C0AC 3U3XA 2EJWA 4JBNA 3RHSA 4BFZA 4WL0A 1JQAA 3CBQA 2Q21A 4GI7A 3D8RA 1E20A 3QUTA 4JVMA 4D46A 4EHNA 3C5WP 2PTHA 3DXFA 3NOXA 4P7GA 2RJ3A 4ZP1A 5IZCC 1W0KA 1DKOA 4FFLA 1EFHA 3UKOA 2B20A 1EYZA 4QKQA 1CUDA 3AEXA 4D2IA 3GBVA 4C30A 4RPHA 4EGSA 1A4UA 6LDHA 4UVIA 1VL5A 5IEBA 2W37A 2PIAA 2ZS7A 4RKWA 1NW4A 2R7NA 1I3LA 3EFOB 2DQZA 2XDYA 1EE9A 1UD6A 4RMHA 1EGHA 1XIVA 1EXNA 5AM2A 1YBMA 5L4NA 4HFRA 2DUNA 3OG9A 5JJKA 1KO8A 1AZTA 2HTFA 3IVXA 3AGPA 5GVRA 1YT5A 1SU6A 3UB3A 5IKXA 4QARA 2YV3A 1ZCZA 1T8UA 3GBPA 4BFWA 5JDIA 1UWCA 4RDJA 3JU4A 1MTZA 3NM5A 5H3CA 1JXAA 3WO0A 2ZPAA 1XTQA 4S35A 1FZQA 2Z83A 3MRXA 2QMQA 3HBFA 3PSAA 3EOZA 4FFNA 3CVWA 4A0GA 2Q3DA 4EJ6A 5JROA 4GMGA 2F2TA 2D8MA 3FCOA 2FG5A 4G0XA 4DLAA 2HBRA 4F46A 4CQJA 4G4JA 4Q00A 4NYJQ 3QU2A 4PS1A 3DE5X 1YNSA 2GEFA 2ZB2A 2ZUSA 4LF5B 3VO1A 3HWWA 1Y33E 4KITB 5JAPA 1CSEE 2YC4C 3WKCA 3I9KA 4H7EA 1D5WA 1VCOA 3G5LA 1PR1A 4XAQA 3RSHA 2AR9A 2VSFA 4IF4A 3AF0A 4EMSA 4U63A 4BLPA 5C37A 2BSXA 2D7DA 4A36A 5IAKA 3UHPA 4MQ4A 2FWJA 5JSZA 2O0HA 4AKGA 4FSDA 3UZUA 4KHPB 3ZDBA 2HJGA 1XWFA 2X8BA 1W88A 2CC2A 3DKIA 1DEAA 2CUZA 3R7SA 5JCOC 3WE7A 4BZPA 4C78A 5JD5A 2O48X 3FNEA 5KNLA 1BOFA 2D7JA 4RM3A 1VL8A 1YVEI 4YMWA 5FTKA 1H0HA 3OJFA 3M9LA 3NQ41 1VMKA 4NCBA 4K2HA 3UNXA 3T61A 4E22A 4AZVA 5KQMA 2QTVA 5A71A 3RWOA 2IXTA 2EERA 2OXRA 3CLSD 4RM2A 621PA 5JJCA 3B1WA 4JJZA 1VRCA 3AEKA 1LEHA 2YJ5A 3C4VA 1UXJA 4FOLA 1P39A 4IKOA 2YRWA 3FVTA 3CH4B 3G9QA 5I47A 2BAGA 4RK5A 2IU0A 3R76A 1LWNA 4AYWA 1Z08A 3CX6A 3H4IA 3LT1A 1F5SA 2CNBA 2VC2B 3SBDA 4M7WA 3CCUB 3A4NA 4BKOA 5I7UA 3FMGA 1J2UA 1XTSA 2YX1A 1G8JA 4TPKA 3TTVA 4BXOA 1ENYA 2CRVA 1Q1QA 1RXSA 2JZNA 2E4ZA 3OM9A 5BNTA 4UMFA 2FQ1A 2ZE8A 3GO4A 2PX2A 1J90A 3UT5B 4UTRA 3SJZA 5HGXA 1LDMA 5HMMA 1WCIA 1L7DA 3IEMA 1U04A 4OFWA 3KV3O 4QNRA 3ES9A 3EYAA 1V5VA 1X7HA 3PFHA 1BXZA 1DKMA 1YOVA 2Y76A 2ZWMA 3DCJA 2DCUA 5JAMA 2QYSA 2Z1NA 2C8KA 1BGWA 1H23A 1XHEA 3SSAA 2NT4A 1C9EA 3D8TA 4NBSA 4F12A 3F46A 4INPA 1C50A 4RKFA 4B6PA 5KS2A 3OQPA 4LIPD 3SSMA 1UEXC 3W3AH 4G1MB 4LN1A 1MV5A 2C7PA 2QNIA 3ZJVA 3VU3A 2NU8B 1JEEA 3V2UA 5FA6A 1HE3A 4QECA 1BVRA 4RUKA 1ZK4A 1VQ4B 1WQ4A 1JMYA 4LPSA 1A5ZA 2JH3A 5H9VA 1XFOA 2C8JA 3KQVA 2OZVA 4QQ8A 5KVSA 4GKJB 3AOEC 1RMYA 4D9NA 1JDTA 4I5FA 1QE3A 2DVMA 4HDCA 5HK8A 1GSHA 1MCZA 2PRZA 1HEIA 2UZIR 3AEUA 2JL1A 4WZTA 2AVDA 2BFOA 3D6TB 3C6ZA 4I5DA 3LIIA 4QULA 1WUKS 1EX9A 5CEEA 1JF8A 4Z4SA 5JXIA 4AKHA 3TIFA 1TMYA 3ELDA 2DTEA 5L7TA 4OEHA 1G6KA 4G85A 2H52A 2P3OA 2A4KA 1IPHA 3RYIB 4C3VA 1RAFA 2ZJ0A 4ZOQI 1S8OA 2QRLA 3KEWA 4HLQB 1Z5WA 1QIKA 1L4FA 1G6HA 4L15A 3S2EA 4AFNA 2YWRA 2ANBA 4CDNA 4EHDA 4ZJUA 2ZL7A 2DE0X 3AXTA 3OOJA 5EIEA 2QVGA 3Q3IA 1PFQA 2AG6A 2QG6A 3OLVA 4PLYA 1YVUA 4BEJA 1DOZA 1WV0A 4G0VA 3W5BA 3HB0A 4P36A 1IUPA 2DBZA 4ED9A 3HXQA 5TQJA 4B3GA 1UCFA 2AQIA 3HRKA 3MCTA 3P2JA 3LQQA 1X80A 3KB8A 3DHEA 2BJVA 3AWDA 5T4BA 5FV4A 4KMMA 1B42A 3Q6RA 3M33A 2Q3LA 1HNNA 2X2FA 4LW8A 1V8DA 2UU9B 1KI8A 1MUUA 4LTNA 5LB2A 3KR1A 1RXUA 4CL3A 4DGQA 1L5KA 5LZ9A 1ZVQA 2OFPA 1O97C 4M49A 1A77A 4DBVO 5AOCA 4IDDA 4CL0A 3EK2A 2PMDA 1RP1A 1T91A 2L82A 4EF4A 4WESA 1IY2A 4EMTA 3ONFA 2WPDD 3RUAA 4PXYA 5AW5A 4LWOA 1YIAA 2K2QB 3IFSA 4MRMB 3RC2A 4CQLA 3G8CA 1E9RA 1RJDA 4YV2A 3WOHA 3PNLA 3HKEB 1PG2A 5BOSA 4F5EA 1G3MA 4AY6A 3LBFA 4CM1A 1W76A 1NV9A 2B4TO 3NHWA 4JSYA 2KLBA 3BY2A 1FQOA 1FX1A 3RVSA 3SY8A 5GOTA 4DXAA 2H59A 4UTXA 3EUWA 1PR0A 3KKLA 1NXSA 4J07A 2YXDA 4LMAA 5EHQA 5IUNC 2HJVA 3G8BA 2FZWA 4HGOA 4N1AA 2QTAA 3IVGA 2ZCVA 3TFWA 5A7HA 2QRUA 2WF7A 2G1UA 4R8KA 4CKBA 1E3MA 1MMFB 3K6JA 2G1PA 3EG9A 1P80A 2R2GA 4KCGA 4A27A 2EWVA 3CG4A 1YBVA 4WAUA 2WA2A 3H11A 3TLXA 1MZPA 2GFQA 3VR5H 3VR2D 4COOA 1PJ2A 3EOAI 4S0ZA 1Z6QA 1WXHA 2J48A 3TE7A 1NMQA 3OZTA 1USUA 2DTXA 1JFFB 4R54A 5B1YA 1BEZA 1EFTA 5AKXA 1MIOA 3NNSA 3ABOB 3H7AA 4ZALA 5H4GA 1JNYA 3V1NA 1MAUA 4YRPA 4KGVA 2Z30A 2W11A 4QT0A 4CQMD 1N8KA 2H57A 2YY7A 2Z56A 2FMUA 5DEOA 4KV9A 4O08A 1L6IA 1TK9A 5DK4A 3OPMA 1CF2O 1SUAA 3D2LA 3SOZA 2I87A 3I2HA 5CIWA 4YASA 4BGVA 1H3EA 3KJEA 1AGNA 1N75A 2XYHA 2H2GA 1WUIS 2CXTA 4JR0A 3MUNA 1RKQA 1B26A 4QIHA 3SSOA 5A9SB 2LZJA 3GJ0A 1WQ3A 3W8NA 3GVIA 1XTBA 2GZ3A 3RLIA 4UAVA 2MU1A 3HA2A 4PLFA 1VBKA 3HLYA 5F2OA 1O6CA 2MSKA 3HC7A 2GZMA 4AI6A 4J43A 1QH1B 3U7QA 4B80A 1CNMA 1QLWA 4LF9B 3F2VA 1DINA 1HDCA 3BK2A 4B34A 4BNNA 4IGAA 2GETA 4V0LA 2YNMC 2GKSA 1TCAA 2ZANA 4PAQA 3SC3A 1QM5A 4IRMA 4KKVA 2NVBA 4EIWA 3NUQA 2CFTA 3AEZA 1JAZA 1UZMA 4NENA 3NCTA 4Y9TA 4Z3OA 1EK2A 3DLTA 3EMBA 2R44A 5J4YA 4R2WA 4UULA 1ORVA 1Z82A 2CMGA 5JVDA 1JB9A 4TKOB 3PD1A 1IBRA 1M72A 4WCDA 1EMDA 1F17A 1ZOOA 3IODA 4QXPA 5DO9A 3AUUA 5LP6C 3D6NB 3GGPA 1T24A 4EH1A 3GP8A 2P3SA 5FUXA 2OR3A 2VBIA 3CTAA 1VQKB 1C3JA 1NKTA 3VDNB 2WSYB 3H4TA 3SLKA 4KYIB 1TLLA 4YDRA 4B3DA 2DKFA 3HUFA 4E46A 3GLUA 4R68A 1R8XA 4GLFA 3HWRA 3TQIA 4PGHA 3OIVA 2E1BA 3CA8A 1HEYA 3GLKA 5BN5B 2BOVA 3LQKA 1IQRA 1MTOA 1OHHD 5CLLA 4M7OA 2JLWA 1YZFA 3QSYA 5AI0A 1XLTA 2VO1A 4FC6A 4I2VA 2V0CA 2IJGX 3THWA 2I78A 1YL6A 1G21A 3HGQA 4J2TA 1M6VB 4G2NA 1HBJA 2X6WA 1BKYA 1LPNA 2BR3A 4JODA 1J56A 4BO2A 1RQLA 2LV8A 3TSWA 4HPXB 4L6IA 3FPKA 2X2OA 1PV1A 2RMKA 4Z8XA 2EC5A 4GD3Q 2P4EA 2JLRA 3KLOA 2EJTA 4KXFB 7REQA 3DT8A 2G25A 5HZGA 1NUQA 5E9QA 1AHHA 2ZIZA 1W34A 2XCRB 4BLTA 4O1HA 5AW8A 1UJNA 3CRW1 2C59A 1A50B 1NWCA 3RANA 3PJGA 3HR8A 2W6ID 4EHFA 2ZTMA 1RRVA 5AWFC 2WDZA 3H3JA 3SQNA 3TRJA 2EWMA 3DVQX 3L6BA 3RABA 5L6MB 4MDFA 2QJWA 1T2VA 2PL5A 3BJIC 3OEHD 1VJGA 5D3MB 5C1PA 4F4JA 2COUA 1P0QA 1QHXA 4I46A 3NBUA 2IS6A 2DWUA 1RHJA 2WD9A 3L01A 1DCTA 1NLYA 4YFVA 1RI3A 2IH5A 2Q5CA 2O1SA 1S5PA 3LDHA 2Q4DA 5DGHA 5EKUA 2Z4SA 3BA1A 3KZKA 1UP4A 3LUJA 4DWWA 1CHNA 2GAJA 4ZGNB 3D43A 2G1JA 2IIQA 2YWXA 5CA1A 1KDPA 3Q12A 4YP6A 1K9MD 1NBHA 1EDBA 1Z75A 2GPYA 1W48A 2VUIB 3AF3A 5FUYA 3I05A 3V7FA 3AR9A 2UXDB 2XDQA 4UE3S 1K2WA 3UT0A 1IAQA 2JKYA 1C4KA 4N5DA 4F4CA 5LP6B 5F73A 4IMIB 4YNBA 1H5UA 5JAIA 2B7CA 1RLIA 4QEKA 4MW2A 1G8SA 1T4GA 2PS1A 4JJ4A 3EE6A 1JSCA 2FPOA 4L4UA 3TSYA 2R5WA 4EUSA 1ZIDA 3L1KA 5FX2A 5JFTA 1A9TA 3LTEA 4ZVLA 2VHCA 2A0KA 3F96A 1FS4A 1N2XA 1S2NA 4N65A 4WV3A 5JALA 1IUNA 3G05A 1KY2A 2X2EA 3K4HA 5ENDA 1AZSC 3IYLW 3QU5A 1FK8A 4OFBA 1P74A 1WKBA 4M21A 5ALHA 2FCAA 2LVBA 1NSFA 1DRVA 1M2KA 4O3FA 4M54A 3EHDA 4HN9A 3WSWA 3CPXA 4N5IX 2QGZA 5J2TF 4KOAA 3T5AA 2H29A 1OGJA 1U8ZA 3DHVA 4GR4A 3FOZA 2VJPA 1NTRA 2YY6A 4MCAA 3NC1C 4H31A 4I2NA 4Q4JA 2X0RA 2OCLA 4XD2A 4WUVA 5D5PA 3V8VA 4EG1A 1ZSYA 3LP5A 4B74A 5FA8A 4U9UA 4AP6A 3C48A 3JARA 2I7DA 4MKFA 2YWGA 4IINA 3MJHA 4O33A 1ZNXA 5EPUA 3PGJA 3SIPA 1Y1PA 3SR0A 4BVHA 1T5HX 2NZVG 2A84A 1D2HA 4R40A 3D81A 1SZCA 4ML3A 4NATA 1EJBA 3WGYA 1YC2A 4BE9A 1DIAA 3A6FA 3WKDA 2XD4A 3EXG1 2DH5A 5EJ2A 4TZ6A 2Q6OA 2FWBA 3FCUB 3HVIA 4GOJA 3RJ9A 1ZC4A 4J2OA 1HK7A 2YOFA 3H5VA 3IIEA 3PQEA 4M22A 1EUQA 3LFUA 3E4DA 1LB1B 3B9RA 1NBWB 2AB0A 2NSDA 4MLPA 2REBA 2GN2A 1N9GB 2A1UA 2ZZKA 4WZAE 4EY3A 4XQGA 2D9RA 4UTPA 4GX2A 4JJ8A 1KSGA 4LV6A 3SEJA 3ORSA 3V32A 3K0KA 3PP8A 5LA6F 1IY9A 5CB4F 3GT7A 5IN4A 4JQOA 2K7ZA 4R8MA 3D3JA 3UHJA 1UK6A 3LW7A 1JPJA 2AZTA 4L28A 2GLXA 2PRKA 1YTLA 3GZJA 2J41A 4EGJA 5JAZA 1U5CA 3QA3E 5K20A 5JSZB 4RPBA 3CYFA 2J8ZA 4YXWA 1K8QA 5EE5B 4DMUB 4ABYA 1YMQA 4LKRA 4DTIA 1RI2A 2ZREA 1M34E 4MYRA 5DM70 3GIRA 4DM3A 3TZBA 1K08A 3GRVA 2EEZA 4H6WA 3UYKA 4YX9A 3IKTA 3ENWA 2JLVA 1SOAA 3QVJA 3IBCA 1Q44A 2IW3A 4WN9A 3FVQA 3VH3A 2QTVB 1BMFA 3CZPA 3S1AA 3OOSA 2FQQA 5JTTA 2QRVB 2ZQYA 2QVCA 3RASA 2RCYA 2C07A 1Q7RA 3QNMA 3GV0A 4UVGA 4L6AA 4B7ZA 1FW6A 1K6MA 4RHEA 3RVLA 4EG3A 3A8TA 5DNDA 5EHIA 4CFYA 3MSCA 4RK0A 2F3TA 1Z0FA 4CI9A 4H3KB 2ZIXA 2XRFA 1LF5A 1SHLA 2BKUA 4J6FA 1VHLA 3FGNA 1VC2A 3UK7A 4NK5A 1CS0B 5HQTA 1KWKA 2F8SA 2G7ZA 1YI1A 4GICA 2ILTA 3KCNA 4JJAA 1KU0A 2Z9DA 3CRZA 1O96B 1UJ5A 2Q3JA 2CYBA 1WCIB 4FX5A 3SR4A 4D9BA 5BV8A 2XMZA 2OFFA 1VPTA 4TZKA 2JIDA 1QAOA 2CZCA 4N40A 1NB9A 3B8HA 3AKZA 1VA4A 3PPIA 4ROXA 1L8AA 3OHSX 4W9NA 5FQNA 3I01A 3ZXYA 2IZ1A 4BVJA 5HTKA 5A2QA 5JPCA 2VYCA 4HDMB 2BGIA 4LJLA 4X65B 3U61B 3PV0A 2ZBQA 4JMQA 3SWWA 4GC9A 2PEYA 4NOLA 1JSLA 5IF9A 2AK3A 1DB3A 1OLXA 2PHZA 3EGOA 3O4RA 4X20A 1Z7YA 3ZVMA 1CPYA 4C0BA 1DE0A 3ZGXA 2I2FA 1JEJA 3EW9A 4E7PA 1W2HA 3G8DA 1QGED 4FYMA 3FMIA 4KXVA 5E7QA 2OHIA 4EG4A 4DB4A 5BORA 1FU8A 3VTKA 3VSCA 1CZUA 4GWLA 5LLDA 4E09A 2BFMA 2QN7A 5IF3A 4MQLA 4ZN6A 5FWXB 1UH5A 2FUCA 5B2FA 2VPYA 1LI4A 4L5JA 3OZDA 4EGAA 3ABQB 1KD1D 1XP5A 2CVOA 4K9RA 1G59A 4PM4A 3MOIA 3JTEA 3ZTTA 3RV3A 4ZV4A 2FP3A 3W4KA 5HJEA 1B43A 2O2DA 2BGTA 3TBFA 4KHZA 4IDEA 2J3JA 5JNWA 3DWIA 5AVSA 2AE2A 1EVLA 1OX4A 1YQUA 4X5OA 2NYVA 1I4EB 3GQVA 5CYOA 5DNYB 3GIDA 5IAAA 3EQ9A 3L7BA 3BJEA 1O95A 2C77A 2LDXA 5JS6A 1J2EA 3U0VA 4FGJA 3TLGA 1TA4A 2AH5A 1MQAA 4Q9JA 3U40A 2HT1A 3SE0A 2W4QA 1UODA 3HCBA 2PK3A 5DYNA 1D4ZA 3CONA 3BHJA 3CLKA 1EAYA 2OY0A 3MS2A 1ZH0A 2IP2A 2AJBA 3UH0A 1JQ3A 4XW2A 2VJMB 5GJBA 1R9GA 2WJGA 4XPIB 4N5LA 3W6OA 4KSCA 4R2KA 5BR1A 2JAQA 1ZI8A 4XXHA 3S8YA 4EHKA 2NUPA 1NUUA 1M9NA 2XJ4A 3FR8A 2W2MA 2H4FA 4KRFA 4QYTA 2WKSA 1OI3A 1O8CA 2GZSA 2SKDA 3IJPA 2D3TA 3VR3D 4EKNB 4RIEA 4E2WA 1BYUA 4OUDA 3CJQA 5LUBA 4EFKA 4INAA 5CDFA 3U7GA 1CJBA 4FHGA 2IUEA 2XODA 5TMDA 3I73A 4GZ5A 4MARA 3W05A 4BFTA 5CCBA 2Y77A 2O5CA 2QBYB 1N7HA 2C2GA 1RVV1 2FTKE 3NYIA 3M5CA 1YJBA 3H9QA 3KXDA 1PGJA 1GGHA 4I1OA 4J0IA 4H9GA 4Q4HB 4DK1A 3FIJA 3A36A 1NVDA 3QUBA 5EQTA 3O2SB 4JI1B 3TOSA 3X1JA 1QLHA 1US8A 1Z5NA 1TZJA 2CHUA 1A7UA 4CCYA 2ZCUA 3FPHA 4I5GA 3RGGA 1VYHA 4CM6A 4Q7EA 3CO0S 2QLTA 5DXFA 3WNQA 2WSMA 5KC9A 3MAJA 2VAVA 1UMKA 4G1VA 4XJSA 5L3RA 4JP2A 3RS5A 4EK9A 2DXIA 4O4LF 4F5ZA 1M0EA 2IOFK 1ZHHA 3FMVA 4H7PA 3H5LA 4US2R 3EG9B 2ZP1A 1ZUWA 5FBRB 3KPUA 3IEXA 2YFQA 4FE4A 4L8LA 4PPFA 2EW2A 1BCSA 1KRWA 1OSNA 4L3WA 1D4AA 1XLTC 5E6TA 2G1AA 4NE7A 2JLAA 3ZD7A 3M6LA 4JROA 1J0XO 4IO0A 3MBIA 3W34A 1XSEA 2J3HA 4M1SA 3ROGA 2PD4A 4CMKA 1DKPA 1O77A 3WLEA 3IGFA 2WOOA 4BN0A 3HXMA 3FUCA 4L8GA 1MIOB 2GCGA 3NB0A 5DASA 4BYMA 2PV0A 4LV8B 5IYQA 3U4HA 1Z5PA 1F9EA 2XGSA 3MBKA 3UKDA 2BCJQ 3WGKA 1ZK0A 3EIXA 1Q1AA 3G17A 4AUNA 1PG5A 2H4WA 3O2JA 5G3ZA 3TTYA 9GPBA 1CZRA 4M1TA 3K30A 2V58A 4KG7A 4C1BA 3G68A 1WMBA 1ZH4A 4NXMB 2I2CA 5DHAA 3ESZA 2I5PO 4MUHA 5KEIA 3FVWA 4DGSA 4EF5A 4AJ9A 2GWHA 4J1NA 4MGEA 1E1RD 4IVRA 4G5FA 3S68A 1H22A 2O59A 2PPLA 4BRZA 3VMFA 2J3MA 5H4HA 2FPKA 1NY6A 1QBKC 4OQYA 4B8WA 3H2SA 3M1IA 2YZKA 4YBZA 1L4LA 1E4OA 1XI2A 1E2BA 4R0MA 1GRNA 1KI9A 2C5FA 3LC0A 1NRIA 3DDSA 4GPAA 4I9GA 4N7RA 5IUKC 4PC7A 3E7DA 5IYRA 3ZLTA 5DWQA 2IYSA 1IWPB 2Q4BA 3GCDA 3X1KA 3ACBA 1H2BA 1CTQA 2XQVA 3H6GA 4X8HA 1E3EA 1Y3HA 3KT6A 4XOUA 5JVDB 2VRCD 1NW7A 3OQIA 3QUSA 5B3JA 5LYJB 1CDOA 1SUCA 3GFTA 3R3VA 3KSBC 1MC5A 2IUTA 5IARA 4C87A 2EWWA 3G6WA 4HQ6A 4QHSA 1AGRA 4U2DA 1I5EA 3L7DA 3KWFA 2V54A 2GTPA 3EF0A 5IAGA 3W9BA 4ZYZA 2GM5A 5F3DA 2O5VA 3A1CA 1P4SA 4G1BA 3GDOA 1RU3A 2DT5A 3AERB 3EPRA 1P0IA 4X6XA 2O4CA 2DT8A 1PR9A 2W7TA 4Q3DA 5G53C 2WA1A 1Q0ZA 3A6LA 3KLMX 3UGTA 2FOXA 3NWPA 3N6VA 4GYYA 2E4VA 3B6JA 4MVJP 2RC6A 2G70A 4C7KA 4ESVA 2FZ4A 4GL2A 4XM3A 3BMNA 4W5NA 4GPTA 3OIFA 4MWSA 2QUIA 2RGCA 1XL0A 1Z63A 3E8XA 2ZAMA 2IPAB 3DZ8A 1E3SA 4RH0A 4NZPA 3UV6A 3VYSB 5F9HA 4UBLA 3VKFA 3KZVA 4JYMA 4AY5A 1KDRA 1W2GA 2OV4A 1RHQA 1DADA 1PVOA 1Q91A 2LUOA 3CF4G 1VQ6B 4ZOLF 3OU6A 4N49A 1XQ9A 4TWZA 2IYUA 1RC1A 3TB6A 3VH4A 1N1GA 3QTTA 3GJSA 1SK8A 2C3PA 3PNVA 4AMYA 1D6NA 2JLQA 4LC9A 4C76A 5AVZA 3M3HA 1RFLA 5ICFA 1X19A 2ERYA 4XEUA 1SKYB 2JN9A 3DE6X 4UHHA 2HXGA 2XT9A 4A91A 3FJOA 3BCUA 4Q3AA 1HX7A 1ZD5A 3STUA 3WGMA 2ACKA 5CFQA 4L7VA 1LQTA 3GLIE 4MUJA 1EA7A 2C5LA 4LHXA 2RHBA 2ZUEA 2B4RO 4XLCA 5CVEA 5KQPA 3LBIA 5BSKA 1S3SA 1A8UA 3IUNA 3KPVA 4BO0A 4KKTA 2IDZA 2UVQA 5AJZA 2JB9A 2PZAA 3PFNA 4P5PA 4EI7A 5JIBA 5KNDA 3JQ7B 4UFNA 2JS7A 1QHEA 5JLJA 3GLSA 2WZPP 4HSGA 1JIUA 2SCUA 1FNSA 3DEJA 4RFSB 1FYWA 3S1SA 3HR4A 5B7QA 3C16C 2OQIA 4XDHA 3W2TA 2GJSA 3ZJ5A 4IMJB 4BWVA 2JLXA 1G0OA 1VMEA 2XOKD 3KVVA 3OUTA 3P9CA 3DONA 2XUJA 4RPGA 3TQOA 4YO8A 3K0AB 3RBVA 1JHUA 4V0ME 5ALFA 1KEKA 3HJRA 1LRLA 2Z2KA 2R6AA 1KQNA 3DZKA 2PX6A 1ZQ9A 3A6KA 2GARA 1VKZA 1IN7A 4J4TA 2HMUA 1BMQA 4HDNA 1PLKA 1SU4A 3HB9A 1EFPA 2FPSA 1UPXA 3H5NA 1BN7A 2ZATA 2ATVA 4IIEA 3KUXA 1E4EA 4NH4A 5B58T 2GPTA 3RADC 4DKJA 4ZHQB 1DG1G 3QBJA 5ALWA 1Q1GA 1D6MA 4P82A 1HT3A 3HUDA 3GT3A 4MRVA 3RNOA 2GYVA 3CXUA 4AVYA 3D8UA 3HDYA 3PVSA 3LSYA 1E1QA 2D0IA 2FGJA 3NHBA 4J91A 2GN0A 3QPUA 4JGIA 3UUWA 2OXTA 5IMSA 5JAOA 3O83A 2WQ6A 4PN3A 2F8MA 3DAFA 3VUFA 4AY2A 1R6VA 3LA8A 4DLZA 2IZ0A 2D2XA 1DRKA 4I1IA 4D8WA 5BRAA 1DJQA 5EERA 5LNK6 2PX4A 2H18A 3E5MA 1XE1A 4FVTA 3U37A 4IX9A 3OZCA 4OMCA 4RM0A 1PK8A 2EIHA 2H4JA 1YJQA 2X41A 3KYIB 5DM60 2VP2A 3KHKA 1WBDA 3G59A 3SYTA 3MMPA 2D3WA 3GAFA 3OU2A 4OQLA 4W9NC 1MC8A 5TPZD 4AN4A 1SXJD 2XXBA 1JFTA 2JHAA 2Q6LA 2ZI5A 2A1UB 4RZUA 4EJMA 1WEKA 3D31A 4WXMA 2X5KO 4XB2A 4XCVA 2UZ3A 5EZYB 3HDGA 3I8SA 3VISA 2XUOA 4OAOA 3CJRA 2ZYDA 1S72B 4KQIA 5BWCA 4DUPA 3ABSB 3EGVA 1NNI1 2GO1A 4LY3A 2DBRA 2C8VA 2PFGA 4NZMA 4RVCA 3DL7A 3FSGD 2RIPA 1J8QA 1AUXA 3IUSA 1AKNA 1ATZA 2G0NA 2M32A 5JU6A 4OHCA 3ZIAD 5B55A 3RGWS 3VA7A 2FR0A 3BC9A 1LW6E 2C8LA 1OH8A 4BQRA 1EBUA 1W4BA 3TQCA 4BKPA 1C9KA 4YRDA 2P0YA 4DQ0A 1YKFA 3A8JA 1BS1A 2PX0A 4K87A 3GAAA 2JGIA 3LBAA 3ZCUA 3C1AA 1LTQA 3GP3A 4DS3A 1H8HA 1LK7A 4NHOA 2HJ9A 1PVDA 3KT3A 1JR3D 1S01A 2A35A 3UAWA 1GPAA 4ZICA 1KJQA 4GXQA 5EJ9A 1VCNA 3I55B 2UXBB 2QL5A 3Q8MA 2XECA 4FDLA 1KJ9A 5CYPA 2IHNA 3BMCA 4FINA 4EUFA 3TRDA 3ZCRA 2HUNA 3ZY2A 3IOCA 1R8QA 4PXAA 1WNTA 4B3FX 1YR9A 2D06A 2P9FA 3B20A 5B2ZA 5H83A 2Y9PB 4EMUA 1M1KD 3I61A 1A71A 4RTRA 4XR6A 4DFDA 3AIMA 3SJCA 1H2AS 3ZNNA 5JY1A 3PJRA 4O4JA 4WVLA 2OHFA 1AUPA 3K5HA 3VR5D 1E2UA 5EJ6A 4F45A 1K9VF 1F8FA 2IV3A 2QRGA 2GILA 3MMNA 2FR1A 4B6QA 1NX6A 3DP7A 1CE8A 5E4TA 1CXZA 1B76A 4W6ZA 2X76A 4OHVA 3EH1A 2H1IA 1I3MA 1R4AA 2TECE 3QI7A 2J7PD 5LDDC 1A96A 4N7BA 3UV7A 2NWQA 2WUEA 3RF6A 4D92A 1K27A 1NT4A 1XZEA 1RC8A 2H2AA 1GL6A 2VJNA 3QG5A 1B0ZA 4I9NA 4NBUA 2ZIEA 3OWOA 3O4GA 4UAGA 2G6BA 4QGHA 4CKCA 4ZVSA 5KYKA 1OLXB 1XZNA 1Q6YA 1SO8A 1EM8B 1XF1A 3CUUA 4YLGA 4F6LA 1PWYE 1XQXA 1GTSA 4MB0A 1KRHA 1XROA 2ZR9A 5IYZA 3RYCB 5C5CA 3PF8A 1Z4LA 3C6KA 3DZFA 2PL3A 3ICWA 3L5OA 1VIVA 1U2DA 2I2XB 3D2AA 5ITZA 4X8LA 6YASA 2XMBA 3ILYA 2P2DA 3M2PA 1U7PA 2E89A 1KEVA 4NEGA 3AY3A 4EYSA 1BE8A 5M04A 1VGQA 5E3IA 3IDQA 5CFNA 2BGJA 3GVJA 2BLNA 4TYWA 3BSSA 1LPOA 2QLMA 3STHA 4P4UA 3PUZA 4OSEA 2FG6C 3GRCA 3G7NA 1REQA 5DBFA 5H8WA 3N6RA 3G9ZA 1U2TA 1PUXA 1OX4B 5T3YA 4B9AA 4R2MA 4XYMA 1QG2A 4LXUA 4YJFA 5HA5A 4C43A 4K8OA 4KAFA 2VH5R 4C21A 2QPOA 4KO2S 3PHIA 1R0BA 4I55A 4XX0A 2NP6A 2E55A 5I8PA 2ONJA 2PBRA 1J4AA 3GLRA 4UBJA 1E2JA 3RVKA 5JNLA 1RXVA 1AD2A 1KAQA 3ZHBA 4NMXB 1JPVA 4P12A 5JOQA 1DPGA 2GXAA 3LWZA 1KDTA 4DCOA 4RNCA 4DA4A 1PKVA 4FEYA 4HATA 2J3EA 4JJIA 5EIAA 1QGDA 1VCMA 1M2EA 4LJSA 2EF0A 2HWWA 1Z0JA 5K3AA 2F1OA 3IQFA 2LWIA 1UFOA 2ONCA 3IBGA 4C08A 3E82A 1XAHA 1FXUA 1ORWA 3C7DB 1N2OA 2NUPB 3OCZA 1IM2A 1GR0A 3JS5A 4OJKA 4NJMB 4QXAA 2XE7A 4YH1A 3W9UA 1WOPA 5BY2A 1T8YA 3VDQA 3VH2A 2OCXA 4AKTA 2BGUA 1CYEA 3EGWA 1DFHA 3T4EA 1HFEL 1N8TA 2SICE 3IDZA 1Q15A 2LGJA 4CT0A 5EWMB 2EJBA 3BH0A 2LKCA 3HZZA 3N1UA 4FMCB 4JL8A 5AKHA 1X1DA 4FR5A 3S28A 4B09A 2VNHA 3O1LA 2Y4NA 5FEUA 2MR6A 3WYDA 2W2NA 4I3HA 1JLSA 2JGMA 2YVUA 1TJ3A 2XMRA 1NJ8A 2JGJA 3PUKA 5FYDA 2Q4OA 2WTXA 5KVCA 3IQEA 5DX0A 2FPWA 1U8FO 2OE2A 4FDTA 2JATA 5B3JC 1BDBA 1F0YA 1TGVA 1M1UA 3L6RA 3NPMA 2E9SA 4QQNA 3WHIA 3TYXA 4CMGA 3NW9A 2GAIA 3QV1A 3UW3A 3KDSE 3DWFA 2BKXA 4QVJA 3UN1A 4KR6A 1U31A 2H2HA 5ALJA 3SQDA 3OURA 4CIYA 2VEOA 1YJNB 3ZU5A 1N08A 1LV7A 3L2OB 3RIXA 1N2HA 2JFBA 3BBLA 3ONWA 3UJ6A 3WMEA 2V1UA 1ZGHA 4YRTA 5BVGA 2LRHA 1UKZA 5ULLA 2OBBA 3A35A 2X6QA 3W2GA 4D8XA 3A10A 2XGJA 1NE2A 3OIGA 4DAEA 1Q7EA 3LUGA 1U0GA 4AJPA 5JPDA 4P0QB 2J0EA 1DC3A 5JC8A 3C3PA 3TJRA 1W85A 2PEZA 2IBSA 2OPHA 4X05A 4F91B 1GDHA 2EGUA 2FEWB 1Y80A 1YBAA 2G7MC 3CJTA 3A04A 4G56A 1UINA 3C3EA 4MS1B 1MOQA 3QKIA 5CVUA 1DDGA 1CQIA 1NQVA 2FX2A 3EQ2A 3OZIA 5CITA 1JA9A 4O2BA 3FCYA 4L50A 1YRAA 4REQA 3E9NA 3GLGA 1UBCA 5EVJA 1G41A 5CVVA 1L7RA 2ZDQA 3LPNA 1KFJB 4JYZA 3R6WA 5KHAA 1WA5A 3QBEA 1NAIA 1YI8A 1RFGE 2C29D 4BNIA 2XDWA 3WYEA 3O90A 1C8BA 2ZJ8A 4JDUA 3OE7D 4U6SA 3R7FA 3BF7A 3G89A 4LUCA 4UPDA 4ZT2A 4YP1A 3CT4A 3PUWA 4WKOA 1UD4A 3TOCA 3R41A 3I5YA 3IEPA 3ZG6A 4L51A 4NCHA 3W0LB 4PYRA 3RKSA 4JU8A 4KGZA 1ZAYA 5BSUA 3O8RA 2C7BA 1WUYA 2CNKA 5JZOA 1DRJA 2ID7A 1AVTA 1FYVA 2CLDX 5AXDA 2BUBA 2EBHX 1HNWB 3FWNA 1XA0A 3OQIB 1AURA 4IDCA 3FMFA 1FXWA 2PV7A 3VZQA 3YASA 4BUJA 3NDIA 5BQ5A 3HYLA 3QVMA 3GGSA 1SBQA 2QEXB 2OL4A 4II2A 3L8MA 3UCFA 1BLIA 4C0LA 4XFKA 1YHQB 1FSPA 3LY8A 4P4LA 1LW7A 1P6XA 1S1CA 3VPXA 3H3FA 2YN0A 3UPTA 2JNWA 3LQRA 2IYLD 4L7QA 4XQ0A 2A0UA 1OFTA 5BYBA 3OVMA 4OLBA 1QGAA 4BNJA 4D4HA 1PEDA 1I2BA 1OROA 2CL7X 3LVBA 2OMKA 4AICA 1C30B 3KKQA 4QTYA 5JZVA 3R3YA 3RJ5A 3G71B 3VUEA 1ESEA 1X1AA 1MOZA 2P35A 2A5FA 1BDHA 3FG9A 1ZWKA 3WWEA 5L6LB 3S3TA 4E3ZA 4H7DA 2GKGA 5IM4A 4OH1A 4GKKB 1WHSB 4LJ5A 1JZSA 1W0KD 5AM4A 3BZUA 5JC1A 1V1MA 3E58A 4N18A 4QPZA 3RYTC 3PWTA 3HEMA 5C32A 4GMXA 5A0VA 2VNIA 3G6EB 3D0OA 5EIBC 4IFTA 3FOFC 5DP2A 1R4MA 1ZVVA 4FBLA 3NDBB 3UPUA 4UVDA 5ESXA 3TLBA 1PQYA 3TKLA 1O6ZA 2PS0A 4H18A 4YGYA 1V3TA 1I5OA 4KQHA 1Y1LA 3LW8A 3RBZA 1EWRA 3TSOA 5HRAA 4DBLC 1HVXA 5EIHA 3WLPA 5HRUA 3S4YA 3QU7A 1UM9A 4BWYA 2B3DA 1U80A 2B6HA 3CVYA 3D6AA 3THYB 2RGXA 2D5IA 1V7QA 1C1DB 4Q93A 4HXFB 1MA0A 2AFIB 2DOGA 2WTNA 4C4PA 5K99A 1QDLB 2Y6VA 2X0IA 1XXHE 5D3ZA 2NXJA 2YJGA 4MQUA 3OCYA 3OETA 2Z4RA 5A1TA 5BN4A 3E03A 2PMBA 5IDXA 1SKAA 3ZIDA 5FPKA 3F7TA 2HSDA 4DZZA 2DKOA 3U80A 4ZMRA 4UM5A 3U9LA 1RWWA 4BVKA 3B89A 2II6A 5G0SA 2FZKA 1IJEA 2OEPA 4B73A 5H02A 4C2BA 1Z2CA 1EP9A 3AFIA 3NE5B 2VKQA 1NUHA 4UCWA 4NFYA 1G0NA 1J00A 1M1YE 4NCJA 5AOBA 3T5CA 1GN8A 1LSOA 4EY8A 3L04A 2DAPA 4BLQA 3HWX1 4HB4A 1XZ8A 2CF6A 5CXXA 4XWWA 4R7GA 3OX2A 2DP4E 1YJAA 1XB2A 2H1FA 5IDYA 1Z26A 2VHQA 1Z0KA 4D44A 4XFJA 3CESA 1VB5A 1E66A 3RRBA 3LXUX 1ZD9A 1G3RA 3CLRC 5FA5A 2NO5A 3STWA 4D4IA 4DCTA 4F60A 4IWNA 4A03A 1DARA 1PJ5A 4OSPA 2YMQA 2A0XA 2R8YA 2ZRPA 3I6IA 2HNKA 2P67A 3QLUA 3G9TA 1TCCA 5ALXA 5CT9A 1EK6A 1PSDA 3RFXA 5LP6F 3CC2B 3E22B 3PXEA 1UXOA 2H17A 2ZIWB 3MOSA 1EFVB 3CZQA 2R2AA 3HCFA 3N2KA 2V3CC 4PLWA 1FLNA 1MEEA 5A8AA 2NZ2A 3KSMA 1KYWA 3NHKA 5ALEA 1ABBA 3H1EA 2FPLA 1LSSA 2BEKA 3VAZA 4CR6A 1SXPA 4D43A 2R97A 4DYDA 1SELA 1K98A 3ILSA 1UWLA 2IELA 1AQIA 2NV6A 5C52B 1LPPA 3CMMA 2XB2A 3DCNA 1Z83A 2WWGA 2HPVA 2XH8A 1FX0B 2YC2C 4L0MA 3IC5A 2HQRA 4ZCSA 5JYEA 1M5RA 1W36B 3IAXA 4F6RA 5F7ZA 3RUIA 3DBVO 5KNDH 4TUYA 5K3FA 2SECE 1HH4A 3DC2A 1EXVA 3IT0A 1YRWA 3GU3A 4ENUA 3KTDA 4H15A 5J40A 3TINA 1SUBA 5KUTA 4D9CA 4OA8A 1B15A 1FQJA 4OMUA 3TDKA 4RSGA 4DNPA 4JZKA 1BQ3A 3CEPB 3GLHE 3HGTA 1CR6A 1E2MA 2D1YA 2JLYA 2PZFA 3H1PA 5J3JA 1H42A 1QC5B 1U2DC 4AX8A 4E30A 2B4QA 4Z4QA 4WWHA 3WI7A 2FFJA 2JFUA 2O7RA 5IYNA 2JBHA 1EFAA 3CCVB 1O5TA 5HJ5A 3NTXA 4EGCB 5FHRA 5GIOE 3ZNQA 1KQFA 1JJBA 4DIBA 3V42A 1V5FA 3HN2A 3K8YA 4JNCA 1WU8A 3OZRA 3Q9LA 3NV7A 3EVNA 2PKXA 1C80A 2VNKA 2ZSKA 4DMRA 3T0GA 3BKWA 4LTDA 3CPJB 3SM9A 4IKEA 3CR8A 3U3JA 4HUTA 1DBRA 4LOHA 3HKCB 4QUKA 3U44B 3AIKA 3Q5EA 1C4WA 2DYKA 3BMCB 5MHTA 1EI9A 3SR3A 2JI7A 4F72A 3EVBA 3GJ6A 2G1KA 4L74A 2A67A 5JS1A 5B6IA 2XUIA 3H8WA 1OASA 3BUSA 1L4NA 2A9PA 1PT9A 1U7HA 1VLZA 2M9MA 4H0FA 4N8EA 4WSOA 1JH8A 2P4SA 1RR6A 2PSEA 4LMPA 1W6UA 4WVFA 3W90A 4V1CB 1V43A 1PD0A 1WL8A 2A1IA 3EISA 2GNAA 2NU6A 1YI0A 3NANA 3RJMA 1NF2A 3NDRA 5E6SB 2ZTNA 3TZ6A 3A1VA 2CGEA 1WXXA 1Y1SA 2E49A 5JBNA 2RHDA 4NPHA 2J07A 2BDEA 1CETA 2QZ9A 4QFMA 2W8ZA 4BMOB 1KPHA 3HACA 4ROTA 1IHUA 3TG2A 2BH2A 3QEMB 2JKZA 3IHWA 4C89A 3NV9A 4IZOA 1PRYA 2O2XA 3TVYA 1WHTB 2G5PA 3B3GA 1KJZA 2X0FA 1I32A 3QPAA 2AD5A 3CX4A 2WI8A 4BC1A 1XTPA 1VL6A 5CAEB 2Q1SA 3FUVA 4P3OA 4JI8B 1XVIA 4HDOB 1DQZA 1E9CA 1OAKA 2MSNA 3V8MA 4B47A 4YQYA 5EIOA 5E9AA 3V6MA 2E4UA 4PRYA 5IYZB 5T4HA 3C3AA 3MJTA 2BMAA 1K5PA 1PJSA 2QSJA 3D7RA 4GSLA 4LECA 3K2QA 1N6OA 5F4BA 1FDIA 4ALIA 4EFLA 1ADJA 3H0KA 2I4TA 5HILA 5ITZB 1FVHA 2ZJ7A 4PX5A 4YRBA 1LBQA 2OLEA 2PCLA 4OJMX 1SXIA 4HBZA 1N78A 4M1ZA 4DCGA 3EVTA 4XWGA 1HG0A 2G5TA 4G4GA 3BYZA 4XYGA 1WLSA 1N77A 2WU0A 4U2KA 1I7QB 3R3UA 3IAUA 4J03A 4JJEA 4URWR 2HREA 4PHHA 4RD1A 2HSJA 1NVVQ 2MTBA 2AIRA 4DLNA 4X7BA 3LCUA 1Z2EA 1IN4A 4HH0A 4Z9AA 2W6JA 3NC0C 4P4SA 3PC2A 4R9NA 1E6MA 2IHTA 2YVQA 4AQYB 1L5LA 1DRUA 5JRDS 1C3LA 4LF8B 2QQ5A 3N86A 3HJBA 1R0YA 3GJQA 3CIOA 5HSGA 3MD0A 4ER5A 1RWPA 3O74A 4EUEA 3IBFA 4WZEA 3FDIA 1Z29A 3V1LA 3CNEA 4WBXC 4A8HA 4E13A 2V7XA 1K75A 5E0OA 1E7WA 1T2UA 1JAYA 1E3LA 1T1SA 1P0FA 3A28A 2W42A 4KK3A 3KSUA 1MFPA 4BE4A 4Q1AA 3AFGA 1E3QA 5FQOA 5KQGA 3ZDCA 5E9WA 5GPBA 4O5AA 4B7UA 5DTJA 1HXHA 5EI5A 1K4YA 3A3OA 3IQXA 4OIFA 1WY5A 3VNUA 1CY0A 4ZREA 2YUTA 4AWBA 2WTAA 3GMDA 2QRKA 3S1LA 2ACVA 3H3XA 3QKWA 2NUAB 3TCKA 3FPLA 2XWPA 5FKJA 3IX7A 3OC6A 1E7SA 2V55B 4PPGA 4C4TA 4UHEA 1WMAA 5A3QA 3JD0A 3H9NA 2BFDA 3E9EA 3VNSA 3QSGA 4EVSA 3RRMA 3K0FB 3PQDA 4NVRA 3RIEA 1QFSA 1QVAA 1X86B 2Z8YA 3K32A 2REXB 3IEIA 4O8ZA 1ETHA 1B00A 4GVPA 1FP7A 5LU9A 1TZCA 1JWAB 3JQ8B 3FUUA 1FEZA 2IFTA 3GFPA 3SZRA 4C7MA 4TMTA 1P2GA 3D7MA 3I6BA 1I1OA 1BW9B 1RI1A 4UU7A 3MT9A 4FTWA 3CE9A 1ZNZA 1ADBA 4LC0A 1VMIA 1ZMTA 5DGTA 3GAZA 1UBMS 4OJTA 5BVGB 3IVAA 5K8JB 2H8KA 2JW5A 1X3SA 4KVZA 2P9HA 3RQIA 3SDSA 2VZ9A 1SC6A 4U2FA 3UQZA 2JI4A 4DXDA 4Q7QA 3K4PA 3HY6A 4OJNA 3SS9X 4HR7A 5DWVA 3B1VA 4QU8A 2YMLA 4JR1A 4MVJF 2HWYA 3C14C 3S2ZA 3VI3B 4D74A 1E79A 1OI2A 4C4XA 1D5CA 1GYQA 1YE5A 4QBIA 1YCFA 4YJGB 1T5BA 3DVLA 3EASA 3I3OA 4ERNA 5JCXA 2WZQA 2P0AA 1Y8ZA 2K87A 3K73O 3CLUC 1CQIB 1EHIA 5E6RB 3ZPXA 2P6UA 3FOEC 1Z28A 2NSHA 3OJWA 3A58B 4MAMA 4WXRA 2VT7A 4FGKA 3LVRE 4O2BB 5DGCA 1PW7A 2O5RA 3GLGB 3AP2A 4GL4A 4ZMBA 1QR2A 5SICE 1KO1A 3M8KA 4ND3A 3QFHA 2FWPA 4R8RA 4AZ3A 4K86A 4P3NA 4WK2B 1NG9A 2O8CA 5E4YA 2CL6X 3PQ6A 5TQ2A 4B5LA 4DKXA 3DDNA 1QFYA 2ZITA 3TOVA 2ZI7A 1T29A 4YDSA 3AR7A 2B35A 1P1CA 2UVDA 3C3XA 5K09A 1NLMA 5K9ZA 2GGSA 1TFRA 1ZD3A 2Z08A 5TGTA 1QRRA 2YTZA 3D7SA 4YDHB 3KWMA 4MRNA 5MN4A 4Q3LA 5A6VA 3SBEA 3V4VB 1H9BA 1J9ZA 4NZOA 5TY0A 4E6EA 1T1IA 2VEDA 2AJLI 2VG8A 2J6HA 3DFKA 3KB6A 4UHDA 2XD9A 4LRSB 4CF5A 4BNGA 4FGSA 2Q8PA 3Q0TA 3QNUA 3D5EA 4R0VA 5FJIA 5AVYA 4ITRC 1ULAA 1ZQ1A 1LPMA 1V3UA 1W5EA 5SZIA 4MGKR 1DZIA 1D2RA 4B76A 1IZYA 1NF9A 3KKZA 1Q1EA 1XTTA 3ONNA 4KTVE 4P80A 2JLBA 3GUVA 2E18A 1KQGA 4DIDA 2F8TA 3HYTA 3WK9A 1U0TA 3KJGA 3MINA 4IMRA 2XCIA 5AW0A 1CRWG 4GU5A 4N0MA 3VTZA 3FBGA 5A4IS 3LCVB 4KO3S 5AKYA 3ELUA 1LA2A 3B36A 3ZWXA 3OTWA 3T1VA 3DYBA 4JN6B 1I8DA 2WBLC 1IBCA 2OBMA 4ZI5A 2DBQA 4L8FA 4DLYA 2X4LA 5EKTA 2J9FB 1X7WA 1ONBA 3ZTYA 1Y8AA 4D9JA 2P8JA 16PKA 1V1MB 3LE8A 3QLUC 5JVDF 5LYJF 3ESQA 4MINA 2JHFA 4W6QA 3E5NA 5JMWA 4N0PA 4CL2A 3I3SR 2R8OA 1X87A 1GNVA 2EQ5A 1W4RA 1G63A 5BRJA 4LYAA 2A0WA 2XA9A 3D0QA 3F9IA 1XZJA 3B82A 2IVZA 2QVLA 3GZ4A 5DB4A 4C03A 1DC4A 1WD5A 4U5XA 5JLAA 3BWXA 3G5MA 1POWA 4KO8A 4KMSA 3QKUA 4REMA 3TOZA 4NOJA 4GXNA 1RIIA 2W4IA 3OFJA 4RPLA 2RGEA 3ET5A 3GQBA 4LE0A 4XIJA 3L93A 5BSVA 1V0EA 1KAEA 5BUQA 2JA2A 1UM9B 2VN8A 2VPIA 3ZDYB 4BO3A 4DUZB 3LPDA 4GI1A 3BFVA 1QQAA 1UIRA 1RLMA 3CINA 4G24A 3FLMA 1RRGA 2ZT5A 3TB4A 4E14A 3VAAA 3H9CA 4N5NA 2C1XA 2BGRA 1WPRA 2EP8A 1ZL0A 4EY5A 1FJXA 3BRSA 1B3RA 2ZB3A 3CR7A 3ZD8A 2HLHA 3DB2A 4J49A 1OXKB 2A7QA 5BN4B 1J9GA 4YXFA 3V1KA 1PGPA 5E38A 1M2VA 4URFA 5EJ8A 1UQUA 4GPZA 4OOXA 2K4MA 2OTCA 1JS1X 4MI3A 5AW3A 4NFSA 1KHHA 1X2EA 3WGJA 1M2HA 3CEMA 3W7BA 1Y3BE 5DNCA 4OOEA 2VP5A 4MDEA 4COKA 1CZKA 1FDRA 5AK4A 1IOZA 1NBMD 3NFYA 1BCRA 3DF7A 2C2WA 5DIZA 5K4GA 3A31A 3PZRA 3G5UA 4XLAA 3UYLA 5BXQC 3BL5A 3WYGA 5IMBA 2CB0A 4RTSA 3OLCX 2VIIA 3QEOA 2ACEA 3A3YA 4P2BA 1OI4A 5JSHA 1H66A 4ONEA 2HMYB 1E2FA 1NKSA 5CU7A 5TDHA 4GDFA 3E9CA 3RU3A 1YGYA 4OI2A 4I9HA 3I28A 1Q0LA 2HT6A 3I2KA 1DG3A 4LOAA 4R01A 3SS7X 4I50A 1UMCB 2M98A 2I4LA 5L8VA 4XQFA 1BMFD 4BQFA 3T9EA 2GPBA 2DR2A 1PV4A 2HQOA 2PUFA 1KZ6A 2D6FA 3T94A 2X2PA 1NE7A 4P2GA 1JTEA 4WK0B 5DRTA 4L57A 2O8EA 1EFKA 3OY7A 3AO0B 2JI6A 5KDDA 1LXCA 4W8GA 4JIMA 3Q8KA 4MMZB 1R0KA 1QBGA 2C0CA 2B8NA 1U7DA 2CYAA 2J46A 3PITA 4LY9A 3OWXA 1E6LA 2W93A 3F6BX 4X1IA 1RWQA 4WOJA 3RDPA 3MWLA 4JB2A 3V9AA 3VZPA 4PNEA 1PZEA 3DE3X 1R3DA 1JG6A 4WNYA 3CUTA 4GQBA 1DIGA 2AA3A 3VZBA 1FVFA 1TMGE 2GS9A 3B5EA 1GUAA 2WRZA 3MERA 3MA0A 5FI5A 5ILOA 3O1IC 4NXNB 1P7YA 2C9ZA 4MQ6A 2ENWA 3TGPA 1QYDA 1WSDA 5CVDA 5THKA 5TMEA 1GG8A 4Z5XA 2IE8A 3C3DA 3KJNA 1T8SA 3FVRA 1WSVA 5IKEA 4QUZA 1BH2A 3A4LA 3TW8B 3R0XA 5K3FB 1NWHA 3N2GA 4RTKA 4LI3X 4XKJA 4TSFA 4M0LA 1W5SA 1F4LA 2JCBA 2IYNA 5HQ3B 2UDPA 2P27A 4RDLA 2QPAA 1FSSA 2EZ8A 4MH0R 4FNOA 2B1IA 2P68A 4PFKA 4TTTS 4DPMA 1G4AE 1Q2UA 3TZQA 2X1HA 1TTTA 2OHJA 2XR1A 3I6MA 4HUQA 5EKXA 3SC2A 4DM7A 1R37A 2YY5A 3L8HA 2E0IA 3O75A 3ANNA 1U7ZA 4B6EA 5JMOA 2PY6A 1YMVA 2XWSA 5HFAA 2JCXA 3ELYA 2FJ0A 2IHBA 3WSTA 4RPKA 4K5QA 3Q8XB 2F4NA 2Q0QA 1RE0A 1NSTA 3PJDA 4B85A 1YR6A 4LF4B 2CXUA 3JQRA 1QZ3A 4L3VA 3LYUA 3RV4A 3EZNA 4B2PA 4OXXA 3T8YA 3OEED 4JBGA 3HK2A 4Y2XA 2HEGA 2ZPUA 4IBOA 4M1QA 1YRLA 2PO7A 4IV0A 1EX7A 1FNCA 5JISA 2C7QA 1NXWA 3CP8A 1HLGA 1LY1A 1V2GA 1X6VA 4PPNA 1UDAA 4FMDB 1CR4A 1MR3F 1O95D 3H4MA 1NVKA 4HAXA 4CUJA 1E9EA 2QM7A 1IG3A 4RCVA 3R5KA 4EFDA 2E87A 3OTGA 1RYZA 1UJMA 4NYJR 4IIVA 4PYNA 3V48A 1VJSA 1KMHB 1C1XB 4YAOA 1AN0A 2ZRHA 2GJ8A 3MGKA 2C2OA 4MYDA 4QSHA 5JO0A 4MR7A 5KKCA 4QJBA 1PZFA 2PWYA 4QO7A 3Q7QA 4YO7A 5C4GB 3ZCSA 5F51A 3HB5X 1Z47A 4P6VF 1XNJA 3BXEA 3R6JA 1NVXQ 4HNSA 4IOMA 4MCHA 4NTZA 3RF7A 3STVA 5KBYA 4XGIA 1QU2A 2HMSA 2PT6A 1ZI6A 4D8YA 1G8KA 1ZX1A 3ZWYA 3BXXA 3EEQA 2VUUA 3R9XB 4CDRA 1Z13A 1FDUA 3LWBA 5HRCA 1HZJA 1AUVA 1E89A 8LDHA 2GKOA 3EA0A 2YCBA 4FI3C 1W7AA 2EARA 2VFAA 3AHCA 3L41A 1WF3A 4MV3A 4OGFA 5COAA 1WZUA 5AJHA 2CLOB 1M2WA 2P2NA 2BFFA 4JBIA 2W6OA 3DFIA 2WG1A 3P9XA 3R3WA 1UFVA 4D0RA 2PWPA 1B0UA 1VPEA 1U8AA 3ESBA 4LISA 3ZBTA 1DUIA 1G291 3JY6A 4EW2A 3VNBA 3PQ5A 2NZYA 2P77A 4GKVA 3A9CA 3T5MA 4G01B 2Z2ZA 4G07A 1TZMA 1N0VC 3NTVA 5EL0A 5EWJA 3PE4A 1KP2A 2G88A 1FNBA 3AJEA 1SUEA 2GEBA 3LXRA 4HZGA 4Y1RB 1NVAA 1SUFA 5KPDA 4KN6A 2VJYA 2ZRBA 3B1YA 3BG5A 1GL9B 3MJDA 3MT8A 1HYEA 2BFNA 2NNLD 2OHVA 1G5RA 4GX5A 1X1BA 1TYEB 1YU6A 2AJ8A 4NMMA 5MN6A 4OIMA 5BSWA 4FU0A 5A05A 5JS7A 3T3OA 1NJ6A 1Y0BA 3LNNA 1BXRA 5JFGA 5JQWA 5F98A 4B3CA 4MV4A 5C8YB 1CUAA 1RZVA 3IHKA 5JEEA 3DO8A 1E3WA 2OILA 5T6MA 3RS3A 4JI2B 2ISSD 4YEJA 4L5AA 2O8DA 4R6XA 1ONNA 1M3SA 1XN1A 3OF2A 4L5CA 3TQFA 2I71A 3NTLA 1EK5A 3CLHA 4LZNA 3UTCA 1TKAA 2BH9A 2PX8A 3DULA 3QE3A 3QF7A 2VQEB 2FN7A 3O4JA 1NNUA 4KQKA 3VV3A 4QDZA 3ZI7A 4ZIRA 1RQ2A 5B37A 5HZAA 4V03A 3DLIA 5DSZA 2ZYWX 2FX3A 5EMKA 2J45A 4NNJA 1DX4A 2OESA 3JQAA 2I7CA 3FLAA 4IVPA 5F1PA 2V1XA 5FB3A 4P31A 4X9XA 1CX9B 1OTHA 2PZBA 1B8OA 4I0WB 1M1ZA 3E70C 5AI9A 2AF4C 3UMFA 3VZSA 4U1RA 4B81A 1JKXA 4K03A 4OBBA 4KODA 4UVHA 5L3VA 1XV5A 4UXIA 1U0OC 2EFCB 2FA9A 5ITVA 1T4CA 5ADWA 1Y3DE 3ETNA 3FPBA 4C05A 4LZOA 4MYHA 1BA3A 2LCQA 1VJDA 3P9RA 4DSOA 1W8IA 2BFDB 2EYUA 1WOOA 1DIRA 2O0JA 4BQIA 4EP1A 3ADDA 3B1XA 3LGSA 3AR5A 1H93A 2YVKA 3U81A 1R5JA 1XRNA 4HTFA 4OL9A 4GP9A 1Z6AA 3LT2A 4ENRA 1QPZA 3MFQA 1TM4E 1RM4A 3I56B 1V0FA 1R0XA 3HFJA 4I66A 3PDWA 1KEWA 3MCVA 3TLYA 4EECA 1RYMA 3O4FA 5L53A 4TM8A 4RTNA 4XL9A 3I2YX 2QJRA 4EABA 4LBYA 4HQ0A 3LCRA 1H1DA 3R0QA 4MP8A 3PLNA 3R7AA 3UJ9A 3T3GA 5TR9A 4TKLA 1U63A 4TV9A 2O3JA 3KUUA 4EO7A 4WDQA 4Z9YA 4FMCF 1IDOA 2OVFA 4Z0NA 3UMCA 5JXHA 3LSTA 1QFMA 1QHNA 5DYTA 5JD4A 1DQNA 1G64A 2XUGA 1HURA 1JEYA 3BIJA 4DJTA 3BNWA 3PCXA 5LLSA 2PUWA 2AXNA 1AOXA 2EFYA 2C9MA 1GXSB 1JHOA 4KXMA 1OGYA 1ZUNA 4Q9DA 4DV3B 3HCWA 3HE3A 1LLFA 3EGCA 4LKOA 4CMEA 4MR9A 5IU6A 1XZKA 3SQWA 2R11A 1XZAA 3T1OA 2KBFA 4IPTA 1R2QA 1QJ4A 3CCRB 1AJEA 5K2MA 2H5EA 4AYXA 2GN8A 1ZRHA 2CJYA 2JD1A 2P1ZA 4AZ3B 3K4QA 4P4GA 3U31A 3HMQA 5AKKA 3FE2A 3F2IA 4P22A 2P4HX 2CVHA 1NJGA 5LUAA 2WSSD 5EY5B 4M36A 4FUTA 1BZYA 1AQ6A 3Q8WA 2FZGA 2R00A 4TT3A 1D04A 1QCYA 2I9PA 3OC0A 3DEIA 5LQDA 1HG1A 3SQXA 3KUCA 1BROA 3NHUA 1TO6A 3MLAA 3A3BA 2OCAA 1WY7A 2TMDA 3KAJA 3M5WA 2AJTA 1N2CB 1P9OA 3VI4B 3OKCA 4AWXA 1GGEA 3SQMA 3X0DA 1U0BB 3CM0A 4TZ0A 1ZU4A 3H2ZA 1Y4DE 5HDQA 3NWBA 3N8GA 2VP9A 5KNDD 2QD3A 4Q82A 3S27A 1UD5A 3KP1A 4ENSA 5I9NA 4FPXA 2QP4A 3MWKA 3ZDFA 2ZXIA 3IP9A 1XK7A 1RLJA 2ORYA 4GNRA 4INZA 4OA5A 5P8WA 3S5UA 4ND6A 3SM3A 1UDWA 3UWKA 5HUQA 3GPLA 1Q22A 3D64A 3B5JA 5HJ7A 2HU5A 3NJRA 5ENVA 4ARCA 3UEOA 1U0FA 4JOBA 5KYNA 1H2HA 3BBPA 3VGPA 1BX1A 4C22A 4IGFA 1K4MA 2PJDA 4A92A 4FT2A 4UTZA 4RH3A 1AKUA 3C0KA 2GF9A 2H1RA 2WJ6A 1NFFA 4QELA 1UBTS 2GN4A 1T36A 3NRBA 2BKEA 4ZYUA 1GL3A 1T0JB 2I55A 1VZ3A 1QH0A 2DBYA 1ZJ5A 1OBHA 3Q15C 1HTWA 3H04A 5CD9A 7AT1A 4BKUA 4X6UA 4UTVA 4IJVA 3G7UA 3ZHYA 4EZIA 2O0MA 3EEBA 3TNLA 1RQXA 1TOAA 3TZLA 2GLUA 1R6AA 2QVBA 8ADHA 2JCGA 5TRTA 1Q0HA 4DA7A 3RHTA 1GV0A 4HY3A 4NBVA 5FT9A 1MU0A 4J4BA 1CT9A 1R4ZA 4J1QA 1L4UA 2CJFA 3MTAA 5EIBD 1MNQA 2X8LA 1G20E 2VDRB 3LQ2A 3PUXA 4I6JA 3K8ZA 1HQDA 1MDBA 1NG1A 1LV8A 3ITEA 3DTVA 4OGGA 2V6JA 1MH1A 1FZTA 4R3NA 3L4EA 3TPFA 1MQSA 1T8RA 1LSJA 1T3TA 3BRWD 4HDKA 1F14A 4PN7A 1A8IA 2OFWA 1OYWA 1QHIA 3HP4A 4J1TA 3V1TC 4AB1A 3HM2A 3UMBA 4GPEA 4MGIR 1V16B 3GP5A 2HCBA 4QYSA 1ESZA 2M2IA 3ZEIA 3SKYA 1GNRA 1ZK2A 2I3AA 3DBRA 2QE7A 3W5VA 1XCBA 4DARA 2XA1A 4FZ3A 1T0HB 3FH0A 1OWNA 2WF6A 3KD3A 4L5IA 5IASA 3PXAA 3H2GA 3GVCA 4HQOA 1DUSA 2ORIA 2QVXX 1GLVA 1ZK1A 3QVXA 5TJ9A 3WR5A 3CRNA 4RK6A 4E51A 1GCOA 4D8UA 5HS4A 1I7NA 1NUSA 1GTRA 1BCRB 1P7CA 1Z33A 2G4LA 2ODPA 3ESCA 1SKBA 1UDBA 1BFUA 1AM4D 4H16A 5ECWA 4EAAA 2B30A 1KDYA 2UYHA 4X66B 1H0RA 2IC5A 4MQFA 3X3HA 3C39A 3KFVA 1UJBA 1A9ZA 4IRXA 1C7JA 1SRRA 2PAAA 3EJ6A 3HEBA 3BRCA 2J0QA 2ZSHA 4L4XA 4M2LA 4YREA 1OV6A 2B78A 4F3KA 3DV0B 3WWYA 1BFKA 1C3VA 3PGLA 4UCXA 1XJ0A 2NIPA 3CLRD 1H65A 1RPTA 4UVEA 5F1KA 4UMDA 1DAOA 2ZQ5A 5A4FS 4TXHA 4DRXA 2O8EB 5SY9A 2BFCA 1CEXA 1YRYE 4O1IA 3MUOA 4UM9D 5I5GA 1EFRA 5IJ0A 1UPTA 1FFCA 2QUAA 3CCQB 1X14A 4TL7A 5CPBA 4V0SA 3GFRA 2B7LA 1GFIA 3ASTA 4X1IB 3QMVA 3SX2A 4ATNA 1YDHA 3R3JA 5K0ZA 1MC4A 1LLCA 1E1NA 3PJEA 3RBAA 2WJIA 3RUPA 3FY4A 3QVTA 3RC9A 1IJFA 1I6LA 1RT9A 1VJ1A 3EGDA 4DR6B 3LKZA 4QU0A 5L3QA 1Z2DA 3C3CA 2Q0XA 3M49A 1T2DA 4HMOA 5JS2A 1WDTA 2NADA 5I7OA 5J2UA 3EUEA 3NM6B 1AE1A 1QV7A 3UV3A 4QDOA 3FOWA 3ZJYA 2WFLA 2X8AA 4UZSA 3DBHB 3KQNA 1T34A 2DGDA 3C3MA 3O9ZA 1T9HA 3TVDA 3T1TA 3C3BA 1Q0QA 1SVNA 1VG1A 2A0FA 4X41A 4U6NA 5BQOA 1OZFA 3UJAA 2B1RA 2I6TA 3TW0A 1LWOA 1Y37A 2YIDA 4RA9A 2I4IA 4AD8A 5AKGA 3JYHA 2FWMX 2AMFA 1Y8CA 1L7MA 3PEEA 3SC2B 4I6GA 1JDPA 2AOTA 3H5OA 1B0AA 3KKEA 4WLOA 3L1UA 3H84A 3I5XA 3L8CA 2YWFA 5JZSA 3WVNA 3MJ4A 3K6RA 2OCBA 1XPUA 2CFIA 2Y0CA 1XMIA 2BVNA 2ZUCA 3VU1A 3PDIA 4B45A 1ETUA 1K28D 4GQIA 2FI1A 3HKBB 2WM3A 3RUCA 4HNRA 3NFRA 3T9AA 2YYYA 2GFIA 2PRJA 4CI0B 3WIVA 5C5EA 3FVVA 3QXJA 2PL1A 4F2HA 5TC4A 2EKPA 4B7XA 1AQLA 3M6MD 5L40A 4PZEA 1ZMRA 1I80A 1THZA 2Y27A 3ETGA 4MV6A 5T4FA 1ANKA 1IY1A 2ATCA 3MJRA 2FRVA 1PR2A 5BYAA 4II7A 9ABPA 1QVVA 3NHPA 3V33A 1QO7A 3OFKA 4C06A 2G17A 2HBQA 3U39A 1NC1A 1HDIA 2YR0A 3HCEA 1QH8B 4OHXA 1MAAA 2IZZA 4TMXA 1IJBA 1SOMA 4GGOA 1GPWB 5MFPA 5D2CA 1L5HA 1U28A 2QJTA 3C7TA 3TLCA 3UPDA 4S24A 1IONA 1G7TA 1TM2A 2C82A 4O8CA 4Z1OA 1GLGA 3E7FA 1J8VA 1KFEB 2QWXA 2VDOB 3EXAA 1B2RA 3Q2IA 3VPSA 4EFNA 2V9PA 2PYZA 3GLTA 5EJMA 1RYYA 1QGOA 3REQB 3QJYA 5DMXA 1KPIA 2GJ9A 3CC8A 3Q1LA 3SE7A 4ARZA 4C3ZA 4EPYA 1VP9A 2PJRA 2RAFA 2GRAA 3OQOA 1T3GA 1BU8A 3BQJA 1C3OB 2OLKA 3JQGA 3ODPA 5KCMA 3R44A 1C4XA 4NESA 4HNTA 1EIWA 3BTSA 3KB1A 3E27A 5A04A 1ZW6A 3W2FA 1J0AA 2D2IA 2WIDA 4HVLA 4HH4A 1APBA 2WUDA 1NRJB 3AJRA 4LTMA 2D1QA 2B3TA 2CKDA 1UP7A 1WMSA 3SBXA 3WLHA 3A3NA 4MXDA 3EN0A 4Q3EA 3WGNA 1MD9A 3TDNA 2JBWA 2A86A 4YQEA 2K2WA 2HK7A 3WKEA 2IW1A 5TRDA 4JOSA 1ZCJA 2RAUA 3W1VA 1F20A 1UJ4A 1Y9ZA 3Q2OA 4ER3A 2PKEA 4J0GA 1ZK3A 2REQB 4M87A 3H2HA 3EXHA 1JFSA 1RLOA 1G8HA 3O84A 2OQRA 1FUYB 4AXBA 2QUJA 4MVCA 4X64B 2ZWVA 4CZ2A 3FCCA 5CG1A 2Q49A 3JVUA 4TS9A 4YCJA 1PJ3A 1JP7A 3PNQA 4ZVUA 5CFZA 3EF3A 3OY2A 4L08A 4R6WA 1XCGB 3B53X 2ZSDA 3SFVA 1I14A 1KEUA 3ZH2A 3MD9A 1WMDA 4G5QA 5SYAA 1WXFA 1A82A 2RH8A 3EZFA 1TAHA 1XTUA 2H63A 1QKKA 5ELLA 2RE8A 2OYNA 1BXRB 2Y0DA 4AW9A 5IYZF 1B16A 1ZOIA 1E3WB 3PI6A 1ARZA 2PZJA 1EWTA 3QX8A 4WZBA 2NTEA 4B0PA 4Q21A 3L6DA 2O8VA 1VLMA 5DSTA 3JASA 3QX7A 4FNMA 2R1VB 4IDQA 4CMEC 4JA0A 1NJSA 4J7XA 1Z68A 2V59A 2R4QA 3MWEA 4RAOA 2Z09A 2ZT8A 1TQHA 2VK1A 3OJCA 4PG7A 2GPJA 4V3CA 1H1LA 4ND1A 2WFZA 1YGPA 2PBZA 2B0CA 2O2CA 2I7VA 3O03A 3UY4A 1N6IA 5MGNA 5CK5A 2JD0A 5CX1A 2HA2A 3VAYA 1GP2A 4UU1A 1WDWB 1AH2A 1X13A 3A4MA 3FMPB 4BY9E 1T4CB 4A23A 2ID4A 4I55F 3C3KA 5T8KA 5C81A 2NUTB 3WHKA 1PGOA 2B94A 4H1UA 1MQ8B 1O54A 5GV7A 4G8JA 1XMVA 4ZRDA 4WBNB 1X9HA 3T7TA 1I4LD 1ZXLA 3DKVA 1I3OA 2QXUA 2YRFA 3ZV5A 1H2WA 1P2BA 1WD7A 2QA4B 2P9QA 3GH1A 3D4IA 3V3KA 4MVJE 1AXGA 2TSYB 1Y0YA 3X43A 1SVIA 3VX4A 4D4KA 5FBWB 2O0KA 4CEJA 4C6RA 4ZQGA 5ALTA 5LQUA 3OLZA 3UIEA 4G5GA 1X1RA 4L2IA 1VHQA 2FR8A 3EH2A 3KELA 3OMXA 4ZEWA 2DBVO 3FHOA 1J1UA 3BXPA 4AN0A 4EW3A 4ZZ0A 2G9VA 2EZ9A 5JS8A 2A2ZA 2GCEA 4IXNA 1SZJG 4C0XA 1SZDA 2GESA 2Q1XA 1XNGA 2OBNA 2R87A 4FN5A 4FOTA 5K6RA 1KFKB 3MB5A 3T3MB 4DLLA 4G41A 5BT9A 3T3PB 1RTKA 2HPAA 2G67A 1HDXA 5CA0A 2Q45A 2XYGA 3HH8A 4KPEC 1R64A 1XLVA 1JSXA 2JDIA 1EXWA 4L9WA 1J39A 2WUVA 3I9V6 5DIFA 2OBSA 1XRQA 9LDBA 2BP7A 5U9CA 3HYNA 1ICIA 3PL1A 1U8XX 4RFVA 2GCOA 3WNBA 3FNGA 1K5HA 3ASZA 1V4BA 1BD3A 3JYLA 3HDHA 5DK6A 5FPPA 3EGXB 3FZGA 3WIDA 4FDVA 4DXHA 4WZAB 3INNA 2HIAA 3NHYA 3I6QA 1J9EA 1HE2A 3CLUD 4MUFA 3UO8B 2C3UA 3PL5A 1C0LA 3INGA 5AI8A 3TRIA 1P5FA 5KNCA 3GFQA 1EXDA 3ZV7A 2P1RA 1BHSA 1NQTA 2H9YA 2YHUA 3KBOA 3N3BC 4UJ3A 3S44A 4CF3A 2A5YB 5C51B 2UUCB 3H0EA 5AW1A 2Q27A 1CJVC 2DUJA 1NR1A 1KAGA 2Q6TA 2QLBA 4MRAA 5ILQA 2VHVA 3AR4A 3E8MA 4CCSA 4EY7A 3UJHA 3ANYB 4XJXA 2AX4A 3NJ4A 4F7WA 4OPSA 3L1HA 1W35A 3NTQA 4NAHA 1SHKA 3QLJA 2ZXFA 4PZPA 1JIIA 5JJBA 4ITUA 1A4XA 1O94A 3T1HB 1DKUA 3QW2A 3V8EA 2H2FA 1M34B 1N2SA 1ZVMA 2O6LA 3F6EX 3FN4A 4G26A 4M99A 2D5AA 2PYIA 1K89A 3NHRA 4HPJB 4O2BF 5B1DA 4DCPA 5L4SA 3G6KA 1BPLA 1GUYA 2HK9A 4YWJA 4JU9A 4EHHA 2P8SA 4ARSA 3ZZTA 4MDYA 3Q7PA 3V7UA 3CCEB 1SBIA 1J5XA 5KWIA 2VYQA 1VQLB 2JK0A 1F6WA 4XWOA 5EINA 5HIJA 5LOVB 3L6UA 5BSMA 3ROTA 3I34X 1AMNA 4DNTB 2QSUA 4KPGA 1TK2A 4D0NA 1ODLA 1WTCA 3MGAA 4KLCA 4RXUA 4YMVA 4Y2PA 4B4OA 1VL1A 1YUMA 3EC2A 5CR9A 4E70A 4LDJA 5JH7B 4HAZA 3GJRA 3OMWA 3SYKA 2WVJA 4QWMA 3GJ5A 4BNZA 1KQSB 2RH5A 2C20A 5KYUB 2PNJA 2J3QA 3MGBA 1Z73A 3SGLA 3WDMA 4KEAA 3ADCA 3S8MA 1OVMA 4OQDA 2ATXA 1TT5A 3URMA 3VOTA 1GZVA 1MPXA 3HXPA 2QVYX 4U4AA 3AK4A 3D1JA 5K3DA 3RUFA 3ND5A 2JJ8A 1FXWF 1G21E 1Z06A 2XTMA 2XZTA 4MHTA 1U3GA 4AP5A 3AGQA 4PZLA 2CL5A 3KHUA 1XYYA 3TR5A 1K7EB 4DV2B 4P3YA 3CW2A 3AI7A 4JBXA 4L95C 4HIZA 1FTQA 1RKXA 4WOKA 1C0PA 1O6GA 2VTKA 4CCAA 1NMEA 4AC9A 1IHYA 1JXOA 1QCZA 2IF0A 3NUGA 4QOIA 1JE1A 4ESOA 3OWHA 5AXAA 3RC3A 1DL5A 1HQCA 4BZXA 4MWEA 3SYLA 5KJCA 1E32A 3QU4A 4IXMA 1J07A 4XFDA 4ZQIA 5IVKA 1U1GA 4WEQA 4N41A 1F3OA 4MICA 2BFAA 1E2KA 5EJ5A 5J3OA 4Z49A 1X2BA 4POAA 1QYVA 4HDKB 1HKUA 2XYRA 3LC7O 4JLJA 1QG0A 1SKYE 1BWSA 3WRWA 1ULHA 2P65A 2UKDA 5LWHA 5IM4F 2Q9BA 1U11A 4KAAA 3UTDA 2GA9A 1MAWA 1D1QA 3RNLA 4IJWA 2FFHA 1SG0A 4UNPA 3DBRB 1ULTA 4BJ3A 4CG2A 2WYVA 2HDNB 3U2QA 2P9TA 1QQ6A 4L8VA 3OOHA 5BWOA 1ZGBA 2GX6A 2YMPA 5AW4A 5LDGA 4I7EA 3REGA 3I6ZA 3ZLUA 5JUWA 1T0BA 3DYIA 4M38A 1T3HA 4G4SO 1E7RA 1VG0B 1YVDA 3CZ9A 2NU9B 2RHMA 5ALKA 2PE3A 3ITNA 1ODSA 4DEVA 1ZD1A 1M1NA 3KJFA 3R7WB 2F43B 3EAQA 4MW4A 3ONUA 1SCUA 3C6YA 2BWJA 4IDBA 3WRXA 2DWCA 1MGOA 2WJWA 1K7CA 3QHQA 1XWWA 2V5AA 3CX7A 5K0JA 2DPXA 4LGVA 5HG0A 4MQFB 3GMIA 3GJXC 1IN1A 3LUDA 1S2MA 1VE7A 3CW8X 3UOGA 2FCRA 2EBFX 3ABRB 3NBMA 1DEOA 2C1ZA 3EWSA 3HBMA 1FFDA 1XCLA 2Z5VA 2VJOA 5FLYA 1I2CA 4X92A 1DKQA 2QEQA 3M3DA 2H00A 4X61A 1UDRA 2FPMA 1KK3A 1EJ0A 3DEYX 3E2PA 4C4AA 2DX7A 3P2OA 3UUEA 3WWOA 3IUPA 3MT0A 5A9TA 2BFCB 4LHEA 2G8NA 4FFSA 1U28C 4MX8A 1SY7A 1ODIA 2QU8A 2Y0PA 4NBWA 3A8IA 4IEEA 4XYBA 1FYFA 3UH1A 3E1YE 3IKLA 2X22A 3KOXA 4RDIA 4DNQA 4BKMA 4F92B 4PHTA 2HJSA 2O05A 1ESNA 1GG2A 1L5VA 2PXHA 1EVEA 5AICA 1Q74A 3LVQE 3LXMA 5H70A 4ARVA 3EGDB 3WJ7A 1CFZA 1F2TA 3C3WA 1TF7A 2BEUA 2VZLA 1X74A 3PCRB 4WY5A 4KMOA 1PHPA 5L3QB 3H5TA 3K0HA 4UM7A 2PFSA 3VYRB 5AI5A 3NOQA 5CCXA 1W36C 5J2UB 1GGKA 1KP3A 5CYGA 1PS9A 4QYIA 4JSTA 1VRVA 3ETDA 4EJSB 1Q12A 3OM8A 2WFLB 1XMXA 2JFNA 1MLDA 3IR7A 5KZMB 2C04A 2NXWA 3HU3A 4GR5A 4FLEA 4RXTA 1TUBB 2SNIE 3U7RA 3ZQ6A 2XB9A 3TFOA 1RKBA 3FFWA 1JW9B 1PQ4A 2GYUA 4MUYA 4WXPA 5FPQA 1YVPA 3L9XA 3G49A 4FYJA 1SC4A 1OBFO 3GRUA 4B6FA 4BDSA 3WYAA 5CM2Z 4ZZIA 2R1ZA 4JUIA 4IIDA 3EZYA 1Z56C 2ZJZA 4FBGA 3PR2B 2AOTB 1JU9A 3GDHA 3SC6A 3IHLA 4CV3A 4BECA 1GZHB 1UJCA 5JWOA 1IZ8A 4RSRA 4QQRA 4V3BA 1YRHA 3EXHC 3WV4A 3P5SA 1DCMA 2I1VB 1ECCA 2N47A 4TROA 5ED4A 1SKUA 5T7BA 4Z4YA 3GUCA 4FYWA 1W30A 1Y98A 4I4CA 5JTUA 3LX5A 5L46A 4RQUA 2OHXA 4IF6A 4B5KA 4FDMA 3ZWQA 4ND8A 1AG9A 1Z4NA 3MWJA 4DTCA 2XZOA 1JLMA 2XB6A 1XRMA 5LWQA 4TLEA 3K9HA 3OPQA 4JFRA 2GPAA 4YYZA 2D0PB 2FVXA 3CN7A 3H1FA 4Q4AB 3F74A 2V74B 2O7SA 5F4ZA 2IZ6A 5TQVA 5IX8A 1GYRA 4FIZA 5NLLA 3OCUA 3N0WA 3F8SA 4K9NA 4XQCA 2Q50A 3D2BA 3HCDA 1YF3A 3KCQA 1W0JA 1TGYA 3MRTA 5FF9A 3MK31 4KPUA 2MSLA 5CTJA 4EUHA 1JAIA 1N2GA 3HU5A 4IJMA 1KGDA 3G2QA 3T3DA 4DQLA 3I9NA 3BCFA 2C4KA 3IE0A 2WPDA 3IJEB 3JAKA 3PE3A 4MI6A 1P4HA 5EQDA 4CMBA 3FTEA 2DFKB 1AHNA 2NSLA 1D7OA 2C88A 5EUQB 4HV4A 5KSZA 1GQSA 1ZR4A 1YJ9B 1VHDA 3GFSA 2I65A 4FXUA 4G86A 4QQFA 2Y1DA 1J99A 3M6XA 2X8JA 3IERA 4EB6B 1IN6A 3BGWA 2SKCA 4A0QA 1V5IA 3RFFA 3EC1A