1QX4A

Structrue of s127p mutant of cytochrome b5 reductase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
270
structure length
264
Chain Sequence
HMITLENPDIKYPLRLIDKEILSHDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKEAGGKMPQYLENMNIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQSEKDILLRPELEELRNEHSSRFKLWYTVDKAPDAWDYSQGFVNEEMIRDHLPPPGEETLILMCGPPPMIQFACLPNLERVGHPKERCFTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH-cytochrome b5 reductase
publication title The structure of the S127P mutant of cytochrome b5 reductase that causes methemoglobinemia shows the AMP moiety of the flavin occupying the substrate binding site
pubmed doi rcsb
source organism Rattus norvegicus
total genus 66
structure length 264
sequence length 270
chains with identical sequence B
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2003-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qx4A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qx4A02
4WQMA 1EFUA 3MMPA 2BN4A 1S72B 2QN6A 4LBYA 1H85A 3LVBA 4HE5A 3OZUA 1XE1A 1VQKB 1KD1D 1CNFA 4TMVA 3VO1A 1IJFA 3W2IA 3CMAB 2VNHA 2BGJA 1TLLA 4AC9A 4R71A 1AIPA 1KC8D 2QTLA 3MHPA 2QEXB 1G7RA 4M4SA 4ZCLA 1QGYA 4NBSA 2GPJA 3G6EB 4RD3A 1QG0A 1J9ZA 5GV7A 2NPFA 3JQQA 1IJEA 1G7SA 4LBWA 3WXMA 1SKQA 2E1RA 2J7KA 4B44A 4FK8A 1I7PA 3I56B 4RD1A 1R5BA 3W2HA 1FNBA 2YWFA 3W2EA 3E1YE 1FNCA 4ZV4A 2DY1A 4HE6A 3VMFA 5THXA 3AVVA 3FPKA 3OJWA 1K73D 1OGJA 3I55B 1NJID 3P26A 4YAWA 4B48A 1QFZA 1VQ9B 1YJWB 4BPRA 1WDTA 1VQOB 1K9MD 2B5OA 4YAFA 1GVHA 1UMKA 4B3XA 2BSAA 2D74A 4FN5A 4FWTA 3QFTA 3CC2B 1FRNA 4ZCMA 1DG1G 4YHBA 4TMWA 3OZVA 4LC0A 3G4SB 4B47A 1B23P 1DDGA 3CCEB 4B43A 2BV3A 1G7CA 1K8AD 2QDXA 3CCJB 2YWHA 1N8RD 5TV2A 1YI2B 5H59A 2DERA 3CMEB 1VQNB 3ZBTA 1KK2A 5H5JA 4F7DA 1ZM4A 3CPWB 1VQ8B 1EP1B 2PMDA 4TMZA 4M2LA 3A1FA 3J81k 3ZC3A 2OK7A 1VQPB 3CCLB 4H9GA 1QVGB 2VNJA 1F60A 4C0SA 1FNDA 1QFJA 3WNDA 1YIJB 4ACAA 3AGQA 3CXCB 1NDHA 4YAUA 1E63A 3CC4B 1OB5A 3CRZA 1VQ7B 3JQPA 1BJKA 3AVYA 4TMXA 3VNVA 1G7TA 3W2FA 2YWGA 4TMTA 3CCVB 1QFYA 3WY9A 3CW2A 3MCAA 4RD2A 1JJ2B 1S0UA 1W2BB 1KK0A 5JBQA 2VYQA 2CNDA 3B78A 3SJZA 1H42A 1EP2B 4G1VA 3U2QA 2OK8A 4TN1A 2HMAA 4RCZA 1GAWA 3CCSB 2HDNB 1VQLB 3B8HA 3ZBUA 3E20A 1EFTA 5HXBA 1KQSB 3LRXA 1KTVA 3OJXA 1ZM3A 4RCYA 3VO2A 1D1NA 4G5GA 3QFCA 1W35A 3AVTA 1GR1A 1KRHA 1Q81D 1CNEA 1ZM9A 1M90D 2BM0A 4P3YA 4UAJA 3QFRA 4MYUA 2BM1A 3VNUA 4K1XA 4N3GA 4RD0A 2VZLA 4YAOA 2R6HA 4PC3A 4ZGNB 4LBZA 1Q82D 2AHOA 2BMWA 1EFCA 3QE2A 5EMNA 1YHQB 4AF7A 1ZM2A 1QGAA 4M1KA 1FDRA 3W5UA 4DQLA 4U9UA 4P6VF 4Q7JB 1R5OA 4Y9UA 3WNCA 1E62A 1QX4A 4N3NA 1TVCA 1ZUNB 2PIAA 2FX3A 4RD6A 4RJLA 1QVFB 5TR9A 1QUEA 1EXMA 4MYTA 3P27A 4ACBA 1YITB 4C43A 3FJOA 3CCQB 4J0QA 2CRVA 3CCMB 2DETA 2BVNA 1Q7YD 4IW3B 2QA4B 4PC2A 1BX1A 3WYAA 3U6KA 3JQRA 5KSWB 2B7BA 1BX0A 1GJRA 1QH0A 3LO8A 2EFGA 4PC6A 3ES9A 3W2GA 4NCNA 3CD6B 3CB4A 3ZZ0A 2C78A 1TTTA 1AMOA 1TUIA 4PGOA 1BQEA 2OTLB 2GQFA 3AGPA 5TY0A 1KK3A 2VNIA 1VQ4B 4QHYA 3ZZUA 3CCRB 1A8PA 4DQKA 4PC7A 3W5HA 4QFMA 1EP3B 1DARA 2VNKA 1ELOA 5GV8A 5AN9A 5FA6A 1GO2A 4B4DA 3ZZTA 2QTZA 2BPOA 2HCJB 1Q86D 1N0UA 1IB0A 2YWEA 1OB2A 1U2RA 2RC6A 2XEXA 1QGZA 2X3UA 4Y9RA 1DDIA 3PENA 3LYUA 3QFSA 1B2RA 4LBVA 4YALA 1W34A 2B7CA 2XNCA 2DEUA 4ZGQB 2QMUA 3V76A 4M53A 1YJ9B 1FRQA 1OGIA 3I1FA 2BF4A 1N0VC 4RD4A 1F20A 1CQXA 3QSYA 3AVUA 1D2EA 3AVXA 3G71B 3CC7B 2PLFA 1EWYA 1D8TA 1R5NA 4G1BA 1QUFA 2ZITA 3U6BA 1YJNB 2EIXA 1KJZA 1SM4A 1VQ6B 1JB9A 3OZWA 2OTJB 3W5VA 4EH1A 4ZCIA 3WNBA 4PC1A 3AVWA 1VQMB 1FNMA 4AF6A 1E64A 1M1KD 5DSZA 2RC5A 4M0LA 1JA1A 1HA3A 1JA0A 1KK1A 1GAQA 2XNJA 2DCUA 3WBKA 2BGIA 4Y7CA 1W87A 2C77A 1JNYA 3OW2B 3WBJA 3CCUB 1XB2A 1VQ5B 3B82A
chains in the Genus database with same CATH superfamily
3JR7A 3OKXA 2DQYA 4UTRA 2AN3A 3Q8XB 2YNMA 4HWPA 1EFUA 5CK5A 3JZDA 3ROEA 2W9XA 3LNNA 1WABA 1H85A 2MU1A 4QWMA 4ER6A 5JRJA 2QV7A 4KK4A 5I3CA 1LJUA 4OL9A 2XUPA 4DLSA 1SD1A 4N82A 4XJSA 2A4MA 2HRBA 3QXXA 2KS6A 4FKMA 2A7QA 3I0ZA 1XEXB 1XNJA 3KWFA 5M04A 4NDAA 1IJFA 4INOA 1YVUA 5EJMA 4N41A 2IVZA 5G0WA 4N5MA 5HPYB 1L5MA 1RCTE 4ZT7A 4ZYXA 3G7SA 3U39A 1ZUNA 4KDCA 3FFWA 3QBDA 3V8VA 1A69A 1DX4A 2W93A 3QXSA 4WASA 1X7YA 4JB8A 1P45A 1E3MA 5IBPA 4LDAA 1Q3HA 2G1AA 3W9BA 3WOVA 2GZ2A 3GUYA 3HBAA 5D84A 3B1FA 4L4XA 1QHHB 5BSTA 3TSZA 1GU7A 2OILA 5CA0A 4ESVA 2IFTA 4JEIA 4E1AA 4DSZA 1JIXA 3CPJB 2MYUA 4KAFA 1Z7BA 3PT5A 4Q9NA 5FLXA 3H0KA 3SU8A 1CE8A 2XRYA 2YHAA 1YRHA 5CFRA 2GWRA 1OFUX 2H4HA 3IAM6 1QCYA 5GY7A 3OEHA 2V96A 3AHHA 3KL9A 3W5BA 5C7OO 4ZZ2A 3B1JA 1YDWA 4EAQA 4V0NA 3I56B 1SZDA 2OXRA 1BKSB 1PUIA 1YB5A 4FMDF 2WAOA 4XMYA 1FNNA 2ZZQA 1FNBA 5IVHA 5HCNA 1TCVA 1USUA 3QF4B 1ISSA 1FNCA 1DRVA 1R0SA 2ZUCA 1KO8A 3ANYB 5E95A 1S1CA 4DZTA 4KNYA 4B85A 5FWAA 3CPHA 4TT8A 4BNGA 3OIGA 1SB9A 4QOHA 5J4YA 3A1DA 3KBBA 1C0LA 2BC9A 3N0TA 1HTWA 2O2ZA 2RIRA 2FVXA 1RE1A 1ZLYA 1UKCA 3P26A 1ICEA 1XZ8A 2DT8A 2RHTA 4I81A 4MIEA 1AO0A 2XVAA 3L7JA 1DEHA 3CFYA 4K0KB 4HDNB 4DJTA 2P79A 2QRMA 5TT1A 3ZZ1A 1YDMA 3OZSA 4B83A 1HQKA 1IVYA 1U1CA 4DDUA 5EN4A 4R8KA 3P0EA 3PZRA 4MDYA 1GPBA 2WJHA 3SSOA 121PA 1SXJE 2J33A 3E3LA 4MIOA 1QPZA 1QOZA 4KKVA 5FI0B 3HG7A 3HRHA 3NUGA 3RVNA 1DG1G 5CT8A 4CEIA 5AICA 1L7AA 4X54A 3ZIDA 4D44A 2ATXA 1TCBA 3WZLA 1AKUA 1NJ8A 3U4GA 3KKNA 1J9GA 3OESA 5F4JA 4JLAA 1LZLA 4NPAA 3NHKA 4QHSA 5ALNA 3CSDA 1X15A 4E03A 3QK7A 1WR8A 1MVOA 1C9MA 3A9RA 3A32A 2G71A 3VNQA 4WVFA 4LOKA 1RYMA 5HSGA 4GLOA 4MYCA 2QSYA 3RBZA 1UMBB 5SICE 4ZQIA 4PANA 2WTXA 1WHSA 4NEQA 4Z7QB 2KI5A 3OURA 1ODKA 4IMJB 3PLRA 3WGQA 4UTPA 5AJHA 1JI0A 2O19A 2RDMA 2CK3A 1C7IA 1A5AB 4PTLA 1HZZA 1OWMA 2RCYA 2VOJA 3RFTA 5EIXA 3CZQA 4FYVA 3B2NA 3HM2A 3O73A 4UQPA 4P84A 5IM5A 1XMOB 1AGYA 4S05A 3CO5A 1VBKA 1IMOA 4NJEB 4KR0A 2NYVA 4YELA 2D1YA 2H2GA 1I4WA 1QFXA 3MRXA 1CY7A 1XVLA 3U4IA 3DAGA 4ML3A 1S3FA 2HQSA 3ICVA 1PGJA 1AVTA 1I36A 1N5OX 3TR0A 1ZVVA 4ANFA 4RESA 3RJZA 5KU7A 1VLYA 2AFHE 4DUZB 2QXYA 3TW6A 4IEFB 1KMIY 5JBIA 5JS8A 2VHVA 3MEQA 3QNMA 3R20A 4LCBA 4GE3A 4XZ3A 5GONA 2ALJA 5CX4A 2AFRA 1LF0A 1UD2A 2EJBA 2J09A 2IHUA 1OMOA 1CFZA 2FZEA 2JGEA 1UL1X 3QKRB 3T41A 3VNAA 2GVZC 1RXCA 1U1EA 3IDFA 4GMFA 1P4JA 1F5SA 2C4TA 2GHIA 2C3PA 1VCMA 2W2LD 4JUDX 3T15A 1J0BA 4XUDA 1PWZA 3U4DA 4E33A 3M3HA 1PL8A 3H75A 4BNDA 1DX6A 1T35A 3IE0A 4Z0PA 3ZNOA 1S2MA 4C89A 1N2IA 2CUTA 3A6HA 3IRVA 4RV5A 4X0CA 4YRPA 3UC9A 2CSXA 2GPYA 2ZWVA 3LRTA 4TRJA 3WY9A 3MCAA 3DEIA 1KR5A 3CH5A 4H4DA 4DKJA 3ADPA 5KYUA 1Z45A 1V26A 2ZYUX 3UHJA 3OZGA 1VLOA 5EVJA 1ZD3A 4MP6A 2IS4A 3D5EA 4O2RA 1I4LD 2QJTA 3DXZA 3OLCX 1M34A 1NGSA 3ACDA 3QVGA 4RBNA 2X9GA 5G3YA 1H42A 4KH0A 2XB8A 4QUIA 5DX8A 1T2FA 2HJWA 1FU4A 3FTNA 3MYRA 2OK8A 1U7TA 1C3VA 1YBHA 3KXDA 4FLEA 1GG5A 2H52A 2G0AA 4IDHA 3UMSA 1FXWA 3ABIA 1L7PA 1CEQA 5LM3A 5ALYA 5KPDA 3GDWA 3ZBUA 4X1IA 2GCNA 3QVVA 4NCJA 2VR1A 5HXBA 2HYIC 2GN4A 3RAGA 3CRRA 4DB2A 5H8WA 2YFHA 1V1JA 5FTNA 1N05A 1R6VA 3E23A 3NDBB 4V1CI 1I8DA 3VO2A 5EZSA 1T9BA 3TF5A 1PJZA 2CJXA 3KNZA 3WX0A 1K92A 2O2CA 1Q2UA 2EX4A 3BC1A 3CLUC 1Z12A 2W0SA 1V5IA 3NFYA 1I6MA 1T4CA 4IYRA 1J42A 4QUKA 2X5NA 5J63A 2NTJA 1FOEB 2QN8A 2NSJA 2DY0A 5B3JC 1M90D 3UM9A 4H0CA 2UXCB 2JJYA 4QC2A 4GW3A 2OHFA 4RS4A 5IEJA 1OXVA 1QDEA 1VM6A 4QGBA 4BN0A 5C4IA 2I33A 3ZYZA 4BO7A 4F9FA 2RK6A 3HVKA 1JAIA 2EHDA 4IRXA 3DSRA 4P7GA 5EKSA 1KXZA 5KSYA 2VP5A 1PWEA 4RXUA 1W36B 3HKEA 4Z0NA 1AY0A 2C20A 4IH1A 1S4QA 3HHEA 3OOHA 3IJPA 4HTFB 2EKDA 1NKTA 4GBMA 2EERA 3QITA 4LBZA 1P62B 1RNLA 3FM9A 3HSSA 4KBFA 1WSBA 3OAAD 4QNRA 3Q9LA 4US0R 1DKOA 4IH4A 4BY9E 3F67A 4AO8A 2YL2A 2TMYA 3VDMA 3L93A 3V4VB 2ZZMA 2GXUA 2XBLA 3AR3A 1N36B 1EUYA 2HSGA 3R0VA 2X4IA 3M9LA 3CEMA 1L4FA 3GEDA 1WMBA 1OHHA 1U8FO 4RH0A 4RVHA 3OHSX 4M1KA 4E30A 4NBNA 3BGOS 2EJVA 5FAKA 1KAHA 3PFIA 4CIVA 1BXZA 3CZRA 4GVXA 3SNKA 1XKXA 1JWLA 2H7VA 2XBUA 3ZDBA 2FN9A 3R9XA 3SZ3A 2FSGA 2X6YA 1W4ZA 3H1EA 2A0UA 5L3QB 1BOFA 3BH6A 4KVAA 4MPDA 3H5AA 5JSZA 1RLUA 1I9GA 3DWIA 3HUEA 4BB6A 4L0QA 5ADHA 1O87A 3H4IA 2O2DA 2QM0A 1NB0A 1Q11A 3KPJA 3KOUA 4KXFB 4NMHA 2GUGA 2SICE 2Y1GA 4TXLA 1B2LA 1K27A 1F8YA 2F43B 3M81A 4HVAA 1UPBA 2O9JA 2SKEA 2HSJA 4QDUA 5KWEA 5A0VA 1M1YE 1M0WA 1Q20A 2QX9A 3OSUA 3M4ZA 4KEAA 4B31A 4FIDA 1IHDA 3WK8A 1OD6A 2QXTA 4I50B 3CCQB 1MW8X 3E1GA 1HLFA 1SC9A 1DTWB 5BWCA 1JBEA 3AH8A 3BIWA 4B4WA 5HVNA 1C7QA 1HWYA 1XRNA 1QIHA 1LBEA 1NMSA 2Y0PA 3GMIA 4JR2A 5F35A 3SN6A 1S9DA 4AJKA 4H7EA 1T1JA 5AK3A 2ZRCA 3ETGA 2CRVA 3KXLA 1YS9A 3CS3A 3KOXA 2BMEA 4TV9A 2FP4B 5DIZA 2PQMA 1D9XA 5KNLA 2E2WA 1SA0A 2FEAA 2RAVA 4LE0A 3ZHQA 3OY7A 4QVIA 3GVHA 4QUZA 4F97A 1JU9A 1G8MA 1I3CA 1VMAA 4L4ZA 4XARA 3UT5B 1W36D 4URZR 1W1WA 1W47A 2VJLA 4KV9A 5CHEA 4BQNA 3H99A 2A14A 3GO4A 4MYRA 3Q3VA 3G17A 5IJAA 4HH1A 3KFXA 2Q2WA 3SYKA 3AIIA 1WY5A 1EAMA 1JHRA 1QH0A 2VOEA 4XDYA 4CODB 3PGXA 2FOLA 2YOFA 4B17A 4HS4A 4BV2A 2BTEA 5A6VA 4GQIA 2BGLA 5F5XA 5JJCA 2EF0A 2J8ZA 2YJTD 1E3IA 3R5TA 4L5JA 4L74A 4AJ9A 1GCGA 1N3YA 1T5LA 4G0YA 3ZHSA 5JD4A 4HGQA 3DB1A 1GP2A 5E4YA 1ZJZA 3S44A 1NVDA 2NVOA 4G37A 1CETA 1WF6A 1XNGA 1QS0B 1SIOA 2HJ9A 1W94A 2O1EA 3IBFA 4RGYA 2V6IA 3CTAA 4PABA 2EWVA 2PZJA 3AZOA 4IUCS 2GKGA 4L16A 4QUHA 4R0NA 5TY0A 5CMLA 3C6XA 4AURA 5KTNA 4RLZA 2WZDA 4R81A 5DI9A 5ALQA 4B32A 5CHYA 4MWDA 1E6KA 2QYTA 3IVXA 2VNIA 2VT2A 3U44A 2OV2A 3F47A 2ZKIA 4NAHA 1MV8A 3T3NA 1WZEA 2YYZA 1JXQA 4ZEVA 3CCRB 1SCUA 3Q88A 1S2OA 2LNDA 3VC7A 1Y3IA 1QSGA 1W0JD 4WADA 1QYXA 2Q0SA 1QOPB 1ZL0A 2QSUA 1H2WA 1QHFA 5CUQA 4Y2SA 5DOVA 5B1EA 1T3HA 1W88B 4JP8A 3X0DA 4HC4A 5GVRA 3PIDA 4D0NA 1RW4A 4UASA 3NKFA 5FA6A 3TNJA 3T3EA 1DIOB 1EHCA 1TFRA 4ZTBA 3OW7A 3CUUA 2DUMA 1I14A 2O0MA 4R9UC 4K46A 5DV9A 1B16A 5FUVA 3ZCXA 3ZWCA 4XQFA 1GSHA 2FW9A 5E6SB 3USZA 5AVUA 1N0UA 4N5IX 4JGBA 3SZLA 1Z36A 1FVOA 5BV7A 1ZY2A 1NLZA 1PFQA 4WT7A 1CJTC 2XIQA 4MP3A 3WGTA 4C6TA 5INTA 4JI7B 3VHQA 5D51S 3WJ7A 3EY4A 1U2RA 4NZMA 2GBIA 3MGGA 2VQSA 2PU5A 5KYYB 1AKEA 2HAEA 3I6ZA 5C2JB 1NLUA 2PKCA 1H2YA 4KDFA 1R8SA 4DNFA 4JI8B 4BECA 2ZKLA 1GCOA 3NJ8A 5JEEA 4MAFA 3DULA 4UMFA 3SF8B 5KU1A 4JQOA 4KYVA 2X9VA 4PYKA 2CL6X 4N5HX 4QO8A 3WA6A 4Y9RA 1Y4ZA 2DM6A 4GOXA 4B9EA 2C3UA 4PTYA 3KSAC 2VHZA 1CUEA 1IHPA 4J91A 3D2CA 1V16A 1GQFA 1Q0RA 3CF4G 2XNDA 4K9NA 4MJLA 4B7AA 1DAHA 3Q7TA 2C7GA 3VX3A 3PK0A 3FYCA 1TUBA 3NGLA 1E5DA 2QMUA 1T3GA 2WHYA 3IV7A 2J4CA 5BWLA 5TPWB 2BONA 1SXPA 4OHPA 3CR7A 5DHSA 5AOAA 3WDLA 3QV1A 3GG9A 3UBTA 5EIWA 3R3XA 1GRQA 3EE6A 3ISTA 2LE0A 1CUAA 4MUFA 3Q5DA 4D9MA 3RAEC 1ESDA 4TS4A 1KU0A 2D4AA 4HRYA 1GGKA 1YFJA 2V45A 5FBQB 3ZU4A 2CN1A 5JI2E 1B41A 2G9VA 4KNWA 4G1BA 1E9EA 1HDCA 3K94A 3EIQA 2ZITA 3L7KA 1H4VB 1P17A 1BDBA 2WKSA 4I1VA 4KFUA 3ZCVA 1TEVA 1OXTA 1RQPA 3D31A 3EDOA 3H2HA 2P1RA 1I01A 4FGKA 1Y9AA 1GZUA 2Q3LA 1VJDA 4JLNA 1RTTA 2W83A 3AHJA 2GAFA 5AVOA 3UGQA 2RAUA 3QLVA 1JF8A 4UFNA 1H8HA 2FWRA 3DVRX 4X20B 5EOVA 1M5RA 3BSYA 2D54A 1DAPA 4IZIA 3RYFA 3D6VA 3SJPA 4QD3A 4PE5B 1H5QA 1F7VA 3JZFA 3T1OA 3RUAA 3R5SA 2HU5A 1XL1A 1JDUA 1K6IA 1Q22A 3JQAB 3P9QA 3VI4B 1GTG1 5D1HA 1ZXXA 3M6FA 2GCPA 5HIMA 3GJ5A 1ULAA 1E0SA 2YXPX 2ZW9A 4J2TA 1DUVG 4F2WA 3PGLA 3UMYA 1TZBA 3HADA 1AJEA 4EZBA 4ER7A 5JY6A 1M2VB 4K40A 5UKDA 1QV7A 2ASEA 1NATA 1Z29A 2ZRFA 1VLMA 3ORFA 3WGJA 1IXYA 2KB0A 2WSBA 3RI3A 2YZNA 2HMUA 5ES4B 1RP1A 1SKUA 1JHUA 2CVOA 3I28A 2C77A 4JP5A 1DAGA 3A4LA 4A2QA 2WEKA 4OSPA 2CHFA 1N4AA 3BGIA 4B71A 2L2QA 3M6UA 1EFPB 2Y67A 3BRSA 2AE2A 4ZQCB 5DN6D 1NVVR 4W5HA 1NLYA 3T0FA 2P9JA 2PS9A 2XHEA 3BQMB 1YRLA 1WULS 4LHSA 4JLWA 4OK5A 1XMVA 5HIAA 4LRSB 3D3QA 3HN2A 4ND7A 4P5EA 1OYWA 1JAXA 5AM0A 4UBKA 4ZZ1A 5CLLA 4HE5A 2ZR0A 2Z57A 1NYRA 4J0JA 4MUIA 5CTAA 2ATEA 1M1NB 5IK2A 3H16A 1IEVA 3NBMA 2XDQA 3NO4A 1NFRA 3GFTA 4UBOA 1OH6A 5EIEA 2DYKA 3E48A 3MWDB 1KH2A 4URFA 4WFJA 4Q12A 5EIFA 3KJEA 2Q9UA 2QRJA 4TMVA 3LK6A 5D3KA 3EC7A 4U7PB 5AM5A 3W2IA 3MJEA 3WLLA 1QIIA 3I39X 3E3AA 4ID3A 4X1KB 1JXMA 3QKSB 4L6CA 5DW3A 1OJLA 2W6JD 3C1UA 1ZDMA 4KMRA 3AF1A 1JT2A 3V8QA 5B6JA 2FMTA 1O94A 2F17A 3ZCSA 1KOLA 4CR8A 4M4SA 3QX9A 5CDSA 2YYYA 3FGNA 5JZBA 4MW9A 4NBSA 4FT2A 3TZLA 1RZVA 2Q99A 3ER6A 3OCXA 5DK6A 3ZV3A 5C4MA 1RHUA 1ISFA 1WP9A 2CHGA 5DE3A 3KVYA 4JNCA 3EQ7A 1II9A 3K1AB 3PQFA 5DOZA 5DO9A 3RM3A 3RTCA 4XLAA 3CUVA 1DIAA 3M6AA 3CEJA 2YRXA 4FW9A 4DNPA 1JW9B 3JQAD 4FHEA 2Z58A 3KEMA 4HDKB 1GNSA 4MK4A 2Y3IA 1ZVKA 5CRIA 2E5WA 1W25A 3GVLA 4J16A 5FV4A 2BGWA 4AMBA 4CVNA 3R6TA 5TQJA 3WMWA 3H9CA 1MV5A 2PG3A 2W2PA 3H6GA 3X1XA 1KYXA 4Q02A 2V98A 1XJQA 1XJCA 2DY1A 2D3WA 1DC4A 1DEAA 5B1DA 4V1CA 1S96A 1A77A 2I7VA 2VJMA 3A26A 4HP8A 2XYGA 3H9JA 4LMPA 1U7DA 4CM6A 1VPDA 3EEBA 4I5FA 4OX9B 1W0KD 1FX1A 2W2VA 1CDEA 2JLRA 1E3DA 1OGJA 5FBLB 5TE9A 3S28A 4YR9A 3JQBC 4QUEA 4KX3A 2ZBVA 5EERA 4AG5A 2QE7D 1UJ5A 4DUYB 1U6KA 3SKXA 2F48A 3CLTD 2YXEA 3D81A 4A8JA 4WBNA 1YL5A 5L7WA 3PFHA 2ZJAA 1JFVA 2PANA 3D0KA 1KZ1A 4OUDB 5TS2A 3RRFA 3T6KA 4YPOA 5TEVA 4R2HA 3SX4A 5I7WA 2PKXA 5F77A 1EM8B 4CHTA 4Q3OA 1K7CA 3IKLA 4LHYA 1YQUA 5CJPA 3ZDFA 1CP2A 1VBMA 4JSTA 4LJLA 1QAQA 1E20A 3EDCA 3NKLA 3VU3A 3AEKA 1YI8A 3LDAA 4H60A 3SFTA 2W2KA 3U37A 1N6NA 1O57A 2A0YA 2AFVA 4MV9A 3ELYA 3WISA 3RIYA 4LNHA 2BRUA 3MINA 3NXKA 3WS7A 5K3OA 3D6UA 3IJ5A 3V7WA 4LC0A 1WMDA 5DBGA 3LQFA 1E3JA 3K72B 2H4FA 2FAXA 2FR8C 3NVMB 2OYCA 3WGMA 5B5SA 2FN4A 2H16A 3F97A 3C5WP 3V5NA 1SK9A 2NUTB 4ZXFA 4WWVA 4X8HA 2P2YA 1VI5A 7GPBA 1JGTA 2BHNA 3CW8X 2JDIA 2OT3B 2IS6A 4MTCA 1N8RD 2PUTA 1XZIA 5LZ5A 2IA5A 1UXOA 1E61A 2JEOA 3NBKA 4MWEA 5TQ0B 3F49S 4WX2B 3FNIA 2UYYA 1JLKA 3ZBTA 2OO3A 3FTQA 1KK2A 4HD8A 4HSGA 1LU9A 2FQWA 3ZU5A 4YRNA 1N5RA 2H2FA 3W7BA 3B12A 1L0BA 3IL2A 1T8PA 5U4QA 3KVVA 3M33A 1ST3A 4ZV7A 3SD7A 1DAFA 4EZEA 3DVQX 4BEJA 5FAXA 4E5YA 1E1CA 1MPTA 3ZC3A 3VJRA 1IY2A 1XCLA 2PD3A 3BMNA 1H6DA 1XCJA 4Y2GA 4F7WA 5B2EA 821PA 4O5AA 4NNJA 1HG0A 2PGAA 5JFOA 1E89A 3CJTA 3OWXA 4S3MA 1E6WA 1KPIA 2YTZA 4QSHA 1WCIA 1TM7E 3A2MA 2HPZA 4C0SA 3O84A 3T8YA 1WW3A 3FVWA 2QMQA 1Z4PX 5FPPA 8AT1A 4RCVA 4ND2A 4TPKA 5JC1A 4DIBA 2XZPA 3PIIA 4UHBA 3SYNA 3LCMA 2XTNA 5ISMA 2H1VA 1NB9A 1V45E 4Y2UA 1PJBA 2QLMA 1SC4A 2LWIA 3ESRA 2I4MA 5KOHB 1RXVA 2B61A 2W0MA 1FP6A 1Z25A 2DP4E 4YP7A 1DJMA 1NC3A 1GZ6A 1N2GA 3TVTA 1DC5A 2AXEA 2I2DA 5CDHA 5FADA 1DKPA 1WZNA 1NP6A 4I4LA 3O4JA 4RABA 3DDSA 1A9ZA 1BXGB 1PT5A 1U0FA 1RQ2A 4Q3CA 5DNAA 5DSXA 4ZEWA 1X1BA 1C80A 3BC9A 2E82A 2H5JA 2QLLA 3GRZA 4Q4AB 1WHTB 4DCMA 4WZZA 4MI9A 2C4HA 3CE6A 1CB0A 5FQOA 2H06A 5SY6A 3A10A 2NSDA 4QKQA 4DC1A 3FJ1A 3QUAA 5D6NA 2QVCA 2X5OA 1A1VA 3NXSA 1U1FA 1H3NA 2XYPA 1NQXA 1N0WA 1OA1A 3EFBA 5DBFA 1KK0A 2CNWD 5ECDA 1KAGA 1O6GA 4Y0NA 5K3BA 4D2IA 1QP4A 3MT0A 1UKBA 4H0NA 1V5FA 3WZMA 2PUVA 1RP7A 3MWEB 4L5BA 2YIVX 4I6GA 4Q01A 3EVBA 5FPQA 4K9DA 1CJBA 4TUYB 5BSUA 2R84A 3ZHYA 1ZUIA 2ZS9A 3DVAA 4CDMA 4EPWA 2BUBA 4LJ6A 2B92A 1ZINA 1CF4A 2GXQA 1VZ2A 2A5LA 2Y05A 3VH4A 5IJ9B 5G0VA 3LBNA 4HCJA 4FU0A 3WLRA 1CUSA 4NCHA 4EHJA 5BOSB 3KEGA 3UH0A 2AI1A 3OM1A 3ZTWA 4BLTA 4CUKA 1P4MA 5H9WA 1GOTA 4QA9A 3C1OA 5PNTA 2O3UA 5EQDA 5BRJA 3KQKA 2B98A 4Y67A 2BMDA 4FS3A 1FK8A 1PNRA 3EG9A 4BE4A 3PWZA 3OY2A 4LNUB 1ZFNA 3PYLA 3RS3A 4YRRA 4CF5A 3ONNA 1PK7A 2CZQA 1UBSB 5E7JA 4TWIA 2P9QA 3NBAA 5IVPA 3A9CA 2QIOA 2Y1WA 4TN5A 2EFHB 3UKDA 2VDOB 1YQDA 2QG4A 2YVKA 1Q81D 3MRVA 2J6HA 3BIXA 3NUZA 3TLJA 1JR2A 4F06A 2F9FA 2UKDA 4ZGGA 1GPWB 1VYHA 2M9MA 2EZUA 4X95A 5T4FA 3UUWA 5CVTA 5I7VA 2V4MA 1JA9A 2PGOA 2DGDA 4H6VA 2WF7A 4HVTA 4DLWA 2WT8A 1AH2A 3W1WA 4N3GA 1WP6A 2XE8A 1LEHA 1GRNA 2OHJA 2NZ2A 1UM8A 4GGPA 3RRJA 1T2CA 1URPA 2ZS7A 5H81A 3SBEA 2MYPA 5L9AA 2ZRAA 1E9DA 1K6XA 2YDYA 3OO1A 4Q7MB 4RACA 1WXFA 2VXYA 2PO5A 4QTYA 3DMRA 1E2UA 3A8TA 4K5QA 4WKCA 3C14C 2XB2A 4WOKA 2EW1A 1CR1A 1EBFA 3FLEA 1JHXA 2Y9MB 1MZPA 2MSWA 3JQGA 2WE7A 1Q17A 3FPLA 4GC9A 2OOKA 4RJKA 1UBKS 5MN6A 1VLZA 4FDAA 4PQYA 4RF4A 4F3YA 3JQ8A 5KPJA 3ZTTA 4KXMA 1V8DA 1YJCA 1R4MB 1YASA 1VRWA 1R5OA 4XRRA 4GP6A 1LD3A 3F90A 1FQJA 1V1MB 5I9SA 1G5QA 1QO0A 3FHLA 2J30A 3LWNA 5J5AA 1GV1A 3RT1A 4XVUA 3BD8A 1VHJA 3BZWA 5EKDA 2H3EA 2ZGVA 4DLBA 1XZPA 2MINB 1VXRA 3N7UA 1L8OA 2VDPB 3RH0A 3GYBA 4DTCA 1MIHA 2JIRA 4O2AA 5BYAA 2VQDA 1RRFA 3U4QA 3C48A 1O97D 1P9OA 2GPBA 4O1MA 4EWLA 1AS3A 4F96A 3FPCA 4YONB 4B0PA 1I6WA 1WOPA 3PC3A 2OO5A 2ZPAA 4UCWA 2XRMA 3T06B 3A4MA 3I64A 4F4HA 5HIJA 4DADA 4L8LA 2B34A 5JHHB 4HNQA 4JI4B 3TBKA 2AK2A 3RRNA 2JIZD 3GUVA 1U8TA 4Z4FA 5FWXA 1Y1SA 1QXSA 1V7CA 2BGNA 1Q84A 4YK7A 3KCNA 3KTDA 5HF8A 3IAEA 3RUEA 5JD6A 1LBQA 1F3OA 2HY7A 2QUIA 3O2SB 4EYGA 1H1TA 4EELA 2PMFA 3H1GA 2EGGA 2AJBA 1P5FA 2BDTA 2VPTA 4QEKA 3RJ9A 3CR3C 4BNFA 4LC1A 4GOMD 3HUUA 5SZIA 5LYYA 4DSNA 4IOLA 3L1KA 4Z99A 2HXSA 2Z1MA 2W4MA 3DBOB 3STYA 5JNLA 2XMDA 4XWYA 3RK1A 4TZTA 1WD5A 2VZ8A 4MYDA 2J6CA 3QVLA 2H59A 5B2FA 1P4SA 1CUXA 3EOZA 4CLHA 5LLDA 4MDFA 4WKGA 1L7MA 3CCCA 5ALGA 4E1VA 3FN4A 3PC6A 4Q9KA 3L5KA 3CE9A 4TYNA 1F1JA 1NDUA 2PUFA 4NCNA 2VYVD 4GBJA 3CD6B 4GQNA 2OQRA 4IAOA 3FUTA 1ABBA 5JJIA 3BCFA 3JVUA 3T95A 4R1TA 1E69A 1JI3A 1NFFA 1Z6GA 4KO3S 4QGAA 5A3VA 4G1EB 4UPVA 2DULA 4ND8A 4CMHA 1KZ4A 4AF8A 4JU9A 1K8RA 2C9BA 4EY7A 4AMUA 4O29A 3BZUA 2P90A 1NP7A 3A9UA 5E2IA 5LJLA 5BV8A 1TUGA 3KJQA 4UE6A 1EWKA 1X1QA 1E60A 4INJA 3I6QA 4H6PA 3G2PA 1AE1A 1PGPA 4K9LA 3TNLA 2F2TA 3C6BA 3ONDA 4QHYA 3PGKA 1MA3A 4BE9A 2WJ3A 3B7PA 1V5WA 3DLIA 3GCXA 1NQOA 3K3PA 4NCKA 1S7GA 3NJ4A 3IP7A 2H54A 5HS6A 3UT5A 1ECJA 3VUEA 4DR2B 5JJLA 2IPXA 4NYIQ 2FY8A 1A4IA 3VR6D 2OBLA 5AO9A 1A5TA 2Q8QA 4JHLA 1R4NA 1RWVA 3OJFA 4G8BA 3O31A 1PFVA 3ASTA 3JAKB 4AUEA 1BCRA 2PCLA 1EXNA 2ZSIA 3HMKA 2DBRA 2VN8A 1FUUA 3NASA 4Y8VA 3OPOA 2PN1A 4RPDA 5TF0A 3N76A 4DA9A 4ZVSA 2FWMX 1SG6A 4XQCA 5H4HA 4A2WA 4DOMA 5A5GA 4NCIA 1NXVA 4FKBA 2EYQA 4YFVA 3TTUA 4BMCA 5CCEA 1DBWA 4DLZA 3T1NA 4QPZA 3LLCA 1M6NA 2IXFA 5KOJA 4IG9A 1D1SA 3D3WB 2WWYA 3MIIA 1QYIA 1WVMA 3E15A 3N0XA 3GLGA 1N33B 1F51E 1Z0UA 3PDIB 4JGGA 4BIMA 2WIAA 2XMPA 4KQFA 2XEXA 1OKKA 1BOOA 1YMUA 4QUJA 1GT6A 1P2UA 1QNLA 2A9OA 3DS8A 3RUPA 5REQB 1KS2A 5JNWA 4LF5B 1O03A 4Z7JA 4CKBA 1WBJB 3DTYA 3MGCA 3E22A 1N8KA 2V5VA 4WJKB 4X94A 4U7HA 2LD4A 3ASPA 1NIPA 3UG6A 5FA5A 2CJWA 4BFXA 1QU3A 1FFDA 3RANA 1L7EA 2GVDC 4IDAA 3JWHA 1BA2A 1Q0UA 4OGKA 4X91A 5BVGB 4JVNA 2W37A 2WYUA 3F46A 2P9TA 1JSCA 1I1OA 1NBIA 1K2WA 1VLLA 2HQBA 3FMFA 4CCYB 5J40A 1G2PA 2HJSA 2HXGA 1KI2A 2NZVG 1C8LA 3ANLA 3BXFA 1HLPA 4MVJE 4O25A 3UYKA 4N5LA 4A0GA 1A2OA 1WETA 2QRKA 3MGAA 3NLLA 4XQGA 3I1FA 3LC1O 4JJZA 3UAYA 4H3VA 3GZTB 2NU7A 3QSYA 4H3KB 1YBMA 2J5QA 4WLEA 4ZVNA 1Z83A 2IXDA 4XOTA 1A3CA 3YASA 3IQFA 1YAJA 5AI0A 2EJTA 4Z8XA 2Q4RA 1R0XA 1FU7A 2IW1A 1B6RA 4C9BA 3WIBA 1K89A 2CEAA 1O8CA 2P9ZA 3WL4A 4F3KA 1WUIS 4FB4A 3DR5A 1AHNA 3D5QA 4K26A 4N7BA 1XLUA 3EMVA 2KLBA 4EEXA 3A8JA 3B6IA 2A3RA 1GZVA 2B94A 1N77A 3OE1A 4RHUA 1EVZA 3KG2A 1XPRA 3NTUA 4KVGA 5CDUA 5A5VA 3H4TA 5GJBA 3AUFA 3GU3A 2XYHA 2H1CA 3GJ6A 3LNTA 1W4AA 3G6WA 3L1IA 3SKYA 5KX5B 4RPBA 1WB9A 3C3PA 4CM9D 4KZKA 2D4HA 1KHHA 5CVCA 2ZUWA 2ZEJA 3RHSA 1DC3A 4ZEMA 1J00A 221PA 2ZE6A 1U7XA 1BFUA 1TXGA 2HWXA 1E64A 2EFYA 4Q15A 4EFKA 2L69A 2NM0A 5L4NA 1TQHA 2FSHA 2JN9A 4K6CA 2Q9CA 4M86A 3CLHA 1NIJA 5EIAA 3KPYA 4BNLA 1WZCA 4GKKB 4RELA 1Q1AA 1A2BA 5LP1A 2EVWX 3BERA 2RGRA 3FX2A 3VH2A 5JZMA 4OQPA 4MEAA 1ODSA 1PDOA 3CONA 4AO7A 4AMVA 3KZCA 4B6RA 4YYEA 4F85A 1MFZA 1Q9SA 1F4VA 4ID9A 1RI1A 3DV0A 4DLPA 1UJ4A 1DKRA 1AU9A 3KUCA 1PQYA 1P4HA 2G07A 1YZYA 2DRIA 4A03A 1VQ5B 1NQ5A 3IE1A 4KQ1A 4BMZA 3U7EB 5KDDA 3DD5A 4UBIA 3CH4B 4K3VA 3O1HB 1B42A 2Y8EA 1IHUA 3HL0A 2C0QA 1C9NA 2ID4A 2AOTA 4MITA 1YMQA 1FTQA 2VVTA 2ZROA 4X7DA 4KTVE 1AXGA 3GELA 1OWNA 2E4XA 2SECE 2ZL6A 6AT1A 5AVRA 8MHTA 1F0PA 2A35A 1CRWG 2CZCA 4ZXPA 2ZSAA 1UK9A 5AHXA 2CSUA 1IY1A 1XE1A 4MV1A 4GG1A 1E8NA 1E1NA 1UANA 1GFZA 3DEAA 1IYZA 3ET4A 3ASUA 3HUDA 1IZ7A 3KV3O 1XU4A 3HP1A 4G85A 4LJKA 4CQLA 2VNHA 2XUZA 2J85A 4PCLA 2DTXA 5EAIA 1JHQA 4MGEA 3DT9A 5EJEA 3EA0A 2H4WA 3LGAA 3R6JA 4H59A 4BWVA 3LQEA 4OI1A 5FTLA 4RPHA 2WSIA 2JFZA 5FRDA 2PCJA 1IBLB 1E6EA 4TT3A 1BCSB 1J07A 1C3XA 1KMMA 3G23A 4N5NA 4M99A 4HNAA 3KE8A 5AK5A 3IUPA 2F1JA 2X2PA 3SYRA 3UFXB 4CBVA 5JYCA 5AM1A 2V7BA 2HKIA 4Z9XA 3AY3A 1YQGA 4DMGA 1IH8A 3BOSA 4QIHA 5EKUA 2DPGA 3IEMA 3AXSA 3CJQA 3B48A 2JVJA 3RTAA 2J7KA 2VXBA 3I1YA 2Q4TA 3AR6A 3ZK7A 4LS3A 2ZM6B 1S2LA 3MBKA 2ZZFA 5AP9A 1I6LA 2VWHA 1IATA 2XYVA 4RD1A 3GDFA 1C41A 3LDGA 4ENRA 4IGEA 3RK4A 3KVOA 5A02A 4YCNA 1CX9B 1NJ1A 1JHMA 3DT6A 3IHWA 1I2MA 1X7XA 1LQUA 2FMHA 2HQ1A 3MLBA 3TFWA 4ZV4A 2EL9A 3GLKA 3S2GA 3BNWA 4RANA 1NN1A 1H2BA 3AY0A 4RV9A 5EHQA 4AO6A 4EB3A 5HKKD 3EQ8A 5IHPA 1H4SA 1NW9B 3LY5A 4LRUA 4O4LF 4ZK2A 1FJHA 3DDCA 2DSNA 2UVQA 1CUVA 1TO1E 2ZBDA 4Y30A 1ZH8A 3RPEA 3E7FA 3RHZA 2NTNA 3K0HA 4HB4A 2B4AA 1N7IA 3RVPA 4RF2A 5E4TA 2GVNA 2HLNA 3GMDA 2AOUA 2HLDA 2VPQA 2ZI7A 4J7XA 4Q7LA 5C8YF 3QJYA 5DK4A 3UUEA 2PUAA 1QO7A 2V55B 1PHPA 3WGZA 3J7AC 1UOPA 2G04A 1OLXB 1U02A 3PQEA 4L3WA 1M6YA 1BMFD 2Q1TA 1E5LA 3QVTA 4X0EA 4DXDA 2A94A 2FW6A 3O7WA 3UAOA 1N9GB 2C9ZA 3OQ1A 5A71A 4DCSA 4G41A 4BB5A 5EGNA 4BO4A 4WCFB 2R7NA 3U7JA 4K7JA 5FB3A 3LTEA 5LR6A 2PQ0A 1O95C 2FG7C 2PZLA 4FD2A 4PIVA 2GESA 5BYBA 2AN4A 1XV5A 3DYBA 3PDWA 5LQCA 3EGXB 4LSZA 1KS9A 1R18A 5JVDB 2AN9A 4KYUA 1IUNA 1CEXA 2IGBA 4M1ZA 5KTMA 1IXKA 1R16A 1CZNA 3JYQA 3UK6A 3FUCA 1KFBB 1Z08A 3H8WA 3KR2A 3KYDA 2XTZA 1RXWA 3IUYA 1UWLA 5CEFA 2F3RA 1KO1A 1UWCA 1WS6A 1TQ6A 3B3FA 2DFTA 1CLUA 3HCWA 2B1IA 4JP3A 3RTEA 5H59A 1AT1A 1Z0FA 4F5YA 2XF2A 1P1IA 2NXEA 4EUHA 4D96A 2FUEA 4PLFA 3AWDA 1VQ8B 2C9OA 2PMDA 2BGKA 4LJYA 4IHKA 1ZN7A 5IAOA 4RHCA 3A70A 3VNRA 1I7SB 5A3RA 1LPBB 3EBLA 5EY5B 2O3TA 1Z8HA 2I1LA 3CO0S 1RTKA 2QZZA 3EK2A 3R09A 4D4GA 4M2LA 3GVKA 2YW9A 3R6DA 2GN8A 3FD8A 5BSKA 2GAAA 2O1WA 3BRWA 3X1WA 4DPLA 4EUFA 1YA4A 4IDBA 1JDZA 3JX9A 1OLOA 2G9UA 3JWGA 1VFNA 3O8OA 4H9GA 4MJXA 3K0AB 1H9BA 4ZD6A 5KQMA 1G2QA 4R2WA 2JLSA 1RQRA 4O4IA 2NIPA 1SUPA 2FPXA 4AG6A 2BKUA 1PD0A 2YMPA 3GJZA 3RJ5A 4ESHA 4UHEA 5EZYA 1TAQA 2XKKA 5BN3A 3SZMA 3ZWYA 1MP0A 4AS2A 5JTTA 3I01A 4BNUA 1XD9A 4N7RA 4D9HA 2WB4A 1SU8A 3OPVA 3QOYA 4RK5A 4DC9A 2V4UA 1EUQA 1E4EB 1V0FA 1E1MA 2GO7A 1QVWA 5IU6A 2HJGA 4S1TA 2EFCB 4JLJA 5AVTA 2Q2QA 2ZJ0A 1PHRA 3M1IA 1SPXA 1WE2A 2X1HA 4QEDA 1ILEA 1KOGA 2Z0MA 2V7WA 4Z9FA 3FPGA 3W5DA 1ODIA 3LUJA 1Z38A 4Y6QA 1XZDA 5HDQA 2JHPA 3CR8A 4DBLC 3NOVA 5AM2A 4MV7A 1QPGA 2W6MA 3FPAA 3MWGA 4ZPXA 5TMDA 2VP3A 5JUWA 4BU1A 2X8AA 2YCLA 4ZQGA 1V2GA 3IIJA 5H16A 1YULA 1OJ7A 3FHTA 3O93A 1B74A 4WNIA 1U28A 2VUIB 4ZEXA 2VK2A 3CIOA 4GZ3A 1JWBB 1SOAA 4JENA 3AQIA 3C7CB 3GP8A 1NRWA 1BE8A 3DZ8A 3LQYA 4ARZA 1EX1A 2QR5A 1OX4A 3NWBA 4QRHA 5ENZA 5K6AA 2ZU6A 1S8OA 2CVPA 2P4EA 5J4VA 5LWHA 2QM3A 2J3EA 3C7DB 3KTOA 3M6VA 4JIGA 4EL0A 3H7IA 1JDPA 2GPAA 4YUAA 3BVPA 2HWUA 1XPUA 2P2NA 4JQZA 3K0FA 4RHEA 2A0FA 1MC8A 4LDPA 5CP8A 3MLAA 3KWMA 4MB2A 4MWOA 3CWCA 3TR6A 3TX6A 2GBFA 3A7EA 5JMTA 5DNVA 3ZHCA 5KSZA 2QQ5A 3DBRA 4IWXA 3H11B 1AGNA 4MJ7A 2GXSA 4P7FA 3X1JA 2RB4A 1SXJB 3E4DA 4KRXA 3A8IA 1LGYA 4XQEA 1WCWA 5CLIA 3WWCA 2H18A 5ALUA 1IVNA 2Q5JA 4TTTS 4RZ3A 4MS3A 3KBOA 1FTWA 4E32A 2BR4A 3EEFA 2PK3A 3UICA 1W49A 1U9CA 1EZ1A 2BLNA 2C1XA 4HPJB 4UU8A 2HA5A 1YQ9A 2IYYA 3HPQA 3OUZA 4JZYA 1SBNE 5LA6A 2JAUA 2QGZA 5GINE 3NW9A 3KKPA 2VRCD 1I2BA 2HIMA 1BGWA 2PWAA 2Z09A 2B4KA 1JIKA 5THKA 4QOEA 2BL4A 2VLIA 5K99A 3TQFA 4PC3A 2A33A 1O54A 1ZAKA 2X7JA 5EJ5A 1VJGA 1N7GA 2XQIA 4AROA 3UW1A 4ZI2A 4FCTA 1LCIA 1A72A 2A1UA 4XGNA 3SXUB 1GPDG 4XN3A 2Y0CA 4O08A 3A3YA 4TL7A 5EMNA 4F2HA 3EIUA 1VKZA 2I8CA 1KIFA 4PO9A 2ZTUA 4LHWA 4PGHA 3KUKA 2VF5X 1ABEA 1EXVA 1XYGA 1FDRA 4UEQA 4EJ6A 3HJUA 2Q3DA 1UZAA 3E9EA 1TECE 2E21A 3KS9A 4JLUA 4BEVA 3THWB 1G55A 2FFBA 1AK2A 2PH3A 1QORA 2BFFA 2VSXA 3U9SA 1UFKA 4DLNA 1QKKA 2PMEA 2DBZA 2QN7A 3H84A 3JU3A 3P9PA 4UD6A 5ICGA 4YJHA 4ZHQB 4G5OA 4V0QA 1GSIA 1AKTA 1A96A 2VK1A 4PU0A 5E1MA 2ZB2A 4LXHA 1NUPA 4GD3Q 1HQYE 1KEWA 3DHWC 1GXSA 3G5AA 3HLYA 1O1YA 4G84A 5DNWA 3UCEA 4IIVA 4HNSA 2OXEA 3TLXA 3FI0A 2ON6A 1E2GA 2SNIE 4WFKA 4BYGA 1GL9B 4TVOA 3SZUA 1XXHA 5F7ZA 3D6FA 1QUEA 3VU9B 4B4OA 3FKSA 1PR6A 2QD2A 4MYSA 4X90A 3H13A 3FYHA 4NK5A 4F46A 2X6XA 1NTRA 4UHHA 2BOVA 1PFGA 3FJOA 1SUSA 1R6UA 1XRMA 3CRMA 3ZYCA 3O8QA 1SXJD 2QZ4A 4PAWA 1G42A 4TQGA 3OZ7A 4BRZA 3HM9A 4HLUC 1OFVA 4DRXA 1ESZA 1P18A 4J43A 4EG1A 2NSLA 4ZQBA 4ZI7A 3JD2A 4O1IA 2AF3C 1ZHHA 2HF9A 2D0OB 4LISA 3IJRA 1XQ1A 5HKLA 1QYRA 3OZAA 2HWYA 5BUQA 3PFGA 4ITVA 2RGYA 5C1IA 3IA7A 1KDVA 5CXXA 4HYTA 4V0LA 3D7MA 3GJ4A 3WYAA 3JQFA 5IANA 4BDSA 2IDKA 1CYDA 3LYHA 2C5BA 2OG2A 3S4YA 3OCYA 3WSTA 4FBLA 2ZWOA 4EMSA 1CERA 5JW6A 4K28A 1D2HA 4R1NA 3FIUA 3ZV4A 2A5FA 3BFPA 4UXHA 4PYQA 1PJTA 3W2GA 2BKLA 2OLEA 4GM0A 2WNHA 5ILGA 1TT5A 4ENVA 5HJ5A 3DFZA 1YK1A 3DL7A 3EC2A 3H8SA 2MTBA 4Q1BA 3FPPA 4XRGA 5KX5F 1DJQA 3G13A 4MGHA 4C78A 3WKDA 5HJ7A 4C0JA 5KVSA 1UKZA 2ZSFA 3SHTA 3Q8MA 2AS0A 3GAMA 1M8JA 3ONUA 2A2ZA 4FBMA 5IWCA 2WVHA 1HDGO 2XF8A 4K88A 3V32A 3X1KA 2ZSJA 5K0EA 4I55B 4J0DA 3GRRA 5JHGB 3URMA 2PE5A 3B3GA 3N3AC 1MJGA 2QSZA 3PGA1 2JZOA 1JEYB 1RIFA 1YWGO 1WV1A 4RIGA 4QOIA 3PQ6A 2E4ZA 1PS0A 4G1CA 3T0IA 1MA0A 2Q4BA 3DYVA 2R6ZA 1F06A 5ALSA 3W5HA 1FEZA 5ITWA 4IV5A 2GF0A 3NM4A 3UAZA 2G76A 1T9KA 1IWOA 1REQB 3M3PA 1GPYA 1IQ0A 4HNRA 2JIBA 3DMHA 3I52A 3NYQA 1M2HA 2XCIA 3FZNA 2QTZA 1NVKA 3KCQA 2ZIZA 3SJAA 1UDXA 1TZ2A 1YJBA 3QYAA 4U7GA 2H63A 3LWDA 1Q86D 1MABA 2FFAA 4I3HA 2C4WA 3OICA 4R7TA 5KHAA 4O2BB 5JDIC 5CH3A 4R31A 1KEEA 1TU0A 3DPUA 2G72A 2JCVA 4LYHA 5K8CA 2YWEA 1CW2B 2WF8A 3AP1A 4YRQA 5I4IA 2WD7A 1VPEA 4GXTA 1KYWA 3T7KA 3HLKA 5FPKA 5G4LA 4TTSA 4OLBA 4RL4A 2I03A 3R9KA 2OFOA 3BULA 1CWUA 3F4BA 4PNZA 4ARIA 4IIGA 1UM9B 4FGUA 4XKVA 1TRKA 3EW9A 1W30A 5KJEA 5D8DA 2OKGA 5EQFA 1V5GA 4AY4A 4YH1A 1AKYA 5FEMA 1MVLA 3EZGA 1BDHA 2NWQA 1C0KA 4Y2VA 5T67A 1SFRA 2QPAA 4B84A 5BR4A 3OFKA 1R0KA 1ZK0A 2XH8A 4Y1GA 5LXTB 1D1QA 1PLLA 3KPWA 1LV8A 4L02A 3CW9A 3G88A 1J5PA 1XEXA 2FN8A 2B7CA 2C3YA 2EJWA 3GA7A 4M76B 4ECAA 1T1IA 2XXAA 1E5TA 1K4YA 2WIGA 1THMA 4M53A 1NKVA 1ETUA 1S1MA 1LWOA 2FV8A 3Q1LA 3A3GA 5I5GA 1TX4B 1USVA 3RHTA 2ZE7A 3SLKA 1M1YB 4X41A 2OSVA 2BFCB 1CT9A 1CQXA 2G8LA 1V9LA 4LWPA 3DOHA 4NLLA 1NUTA 3LX4A 3LG2A 2PT6A 1QHHA 1D8TA 3T54A 3V8EA 3WLFA 3WSWA 1X87A 3BQJA 5TMPA 2YASA 3HUTA 3STXA 3C6YA 3FSEA 2QTTA 3T3OA 2HX1A 3K2QA 2DBQA 4E7PA 4O4IF 3QY9A 3EVFA 5K0CA 3SHQA 5JV5A 1IAVA 4JU8A 3PCXA 1V7QA 4I4CA 3W8RA 3MJ4A 4B6QA 2FSUA 3LDHA 4OEHA 5KJ1A 3ZQJA 2J31A 5CEEA 5KIAA 2D59A 4JL8A 1MGPA 3QF4A 4L2IB 4GGMX 1V71A 1WPXA 5A03A 4L9SA 1B3BA 2O1SA 3MLEA 4F12A 2UYHA 3AFGA 4E4YA 1G3IA 2X85A 3EDMA 3L6EA 4GI3A 1WXIA 5DLDA 5F2KA 5FYDA 4I9GA 4BKQA 5BN3B 4YMLA 5LQKA 4RTSA 5LZ7A 3DPSA 3OBBA 3HO8A 4ROTA 3H05A 5GZ3A 5KWVA 1T6ZA 2AG5A 2RC5A 3E81A 3MRSA 2X22A 2CXTA 4G07A 2GMWA 4YCCA 1QU2A 3THSA 3L02A 2IPMA 2CC2A 3E9RA 3NP7A 3KJNA 1OOEA 5I7RA 1X2BA 4G4GA 3ROPA 1G18A 3D7NA 3BREA 4HDNA 2G6TA 2XNJA 2J4DA 4LGVA 5T8KA 3SS8A 2QM7A 3MSXA 4DG9A 2B8JA 2YBEA 3KTAB 3S1LA 1EFHA 4IMRA 2W2LA 3KSRA 4J07A 3N53A 3RUHA 3D0RA 4K9KA 4PQGA 5B1SA 1R8YA 3WBJA 2PV0A 5AIBA 2IDMA 3F8SA 2QF7A 3W9YA 5HUQA 3N1UA 2FMUA 3X1YA 2XNHA 1D6JA 1CZLA 2FRXA 3BFJA 1D5WA 3L7IA 2C8JA 2EFEB 4HDQB 4N54A 1OQAA 2N0SA 2Q5QA 2LCIA 3L43A 4I5DA 1W1UA 4DLKA 1E1QD 4BRUA 1AHHA 4X44A 4GWLA 1Q21A 1U1DA 3GUZA 3L0ZA 2V9CA 5LWQA 3NHWA 4YTEA 3K4QA 4W7IA 8ADHA 5LUBA 5L3QA 2JIOA 4MLCA 2Q2NA 2JGAA 4PONA 4N47A 3PFBA 1THZA 2HLHA 1UC4B 5EWLB 2CLHB 5HGXA 4JA2A 1Z16A 2PS0A 1GLNA 1NSYA 2J0VA 2WM3A 3I01M 4OATA 1UK6A 4WN9B 1A7KA 4WXHA 1RD4A 1UMBA 3NYRA 4N0DA 5HGJA 4M1QA 2HMSA 4Q66C 3TQCA 5CB8A 5T7BA 4AJIA 1VMEA 1Z47A 2IHYA 2QTLA 4RU1A 4J0CA 1TJ4A 5JNTA 3IOEA 4FFNA 1EE9A 1Q1ZA 3N5KA 4FR0A 1F8GA 3SEFA 3RSQA 2QK4A 4GXNA 1GTRA 2VWPA 3EJ6A 1RWNA 1UJNA 1PEDA 1FYWA 2UZ4A 2IE8A 2R8BA 2CMGA 2QPOA 3WKAA 3U4CA 4XGRA 1CSEE 2NPFA 1ZL2A 4K9QA 1I3MA 4NJEA 4ZMRA 3D43A 4DDKA 3EMDA 3GIRA 1SCKA 4J4HA 5A2GA 2QN1A 4E0FA 2GZ1A 2UVPB 1UD6A 3AL2A 4QVJA 4LOAA 4S0ZA 1QHSA 4BIIA 2P6RA 1P2VA 4EKGA 1LDBA 4PG6A 3BFKA 2LP4Y 2WWHA 1AKWA 2OY0A 3B1YA 3EWNA 1ZWLA 2F67A 4TZKA 5J5VA 2RGXA 3QELB 2YWFA 3RAFC 4RZ2A 1N9KA 3ILXA 1AHIA 4C01A 1MNAA 2G36A 1ES9A 1I3KA 4RKQA 2AMJA 3T9CA 3KQHA 4MVJG 3QVSA 4PSCA 2VHEA 3C8MA 1QVZA 1VG0B 3VH3A 3VOTA 1T4MA 4ND5A 1G5FA 5KZMB 4ZREA 1FJXA 1B0AA 2CJPA 1OFHA 2HA2A 4MQEB 4AJ2A 1Z3CA 3DEJA 4HIZA 1XAHA 3G7NA 3A2NA 1C1DB 4OUKX 4X07A 3WHLA 4RTKA 1KY2A 2KBFA 1K8XB 3OAAA 1D0SA 4GH5A 3QE0A 1QQ6A 2I8AA 3ILVA 4PCUA 5HIIA 1PWHA 1RXIA 4D9NA 4D9GA 4ENPA 4ZQFA 5B7NA 1SOMA 3A1TA 3CXUA 3IP9A 4G2TA 4HAOA 1YB4A 3UCXA 5FP0A 4YRBA 1JKJB 3AF6A 1KQPA 3QXGA 3H1PA 1ZMOA 3N8IA 3AM5A 5K8TA 5CIYA 3UN1A 2B3TA 1FTNA 4KHPB 1ONSA 3DBIA 2ESRA 1UD5A 4JBLA 2FMFA 4HZGA 1L5FA 1CVLA 3LHKA 3Q6MA 3EGWA 3HCBA 2HUNA 2EW8A 4JI5B 3PRYA 3DJFA 4D46A 3R0XA 1FYFA 4B47A 2GX6A 4E70A 4Q82A 1G7CA 1P0CA 1A8QA 3W90A 4YMWA 2ZL7A 4LK3A 3ZJTA 4ICIA 3IAFA 1SK8A 4L0MA 4NYIR 1QQTA 4KI7A 1N07A 3HR7A 4AKHA 1MT3A 1ZHOA 4MGIR 1OBVA 2BMAA 3IUEA 4L5CA 4TS3A 5FFMA 3C3BA 4YB8A 2MWMA 3AEXA 3I5AA 4AUNA 1NBWB 3HY4A 2PVSA 1JR6A 1ML3A 2VJQA 3A1CA 3O2JA 4R8RA 1WDWB 2FPIB 2BBTA 3OIUA 1HVXA 2X0JA 4RUKA 4Z0TA 1LW7A 4J4BA 3S2IA 1DO2A 2PSHA 3BK2A 1KOJA 3NE5B 1FTYA 1GGFA 3BS4A 4DRYA 3A1FA 1XVAA 1DZIA 1FPQA 3WK5A 3C97A 5HA5A 2OK7A 1VQPB 1TU4A 1RHQA 1AXEA 2ZBUA 1KYZA 4MQ4A 5AHOA 3ZEIA 1VQ1A 2RIPA 4ZYZA 1H2FA 5IFLA 3V42A 2I91A 2AEEA 2SHKA 1QVGB 3U61B 4QRIA 1IU9A 1KBOA 2ENUA 1UD8A 3NHAA 3OM0A 5JIBA 2XMBA 5KW9A 4TKVB 2ZETA 4HTFA 1J0XO 1P0PA 2CNNA 3SQNA 1PCXA 2PFGA 2HCFA 1Z18A 2CYAA 4CYMA 4TZ0A 2DWCA 3S8EA 1Y63A 3MJCA 2HSWA 3WBFA 3GLUA 3IAXA 3Q72A 1DHRA 4O02B 4UNIA 1M6EX 3BIFA 3W05A 2WA2A 1YT5A 2C3MA 3WK6A 3T4EA 4BBAA 5JALA 3Q8WA 1G66A 1I51A 1CLEA 2XV1A 1T3TA 4UE2A 4B7CA 2OCYC 4BP9A 2Q1WA 1FDSA 3QLJA 2IDJA 2WTNA 2X2EA 1E8DA 2QN2A 1UPFA 1N6IA 2NV0A 2CMHA 4M55A 2VDKB 1CY6A 2QVGA 2X0EA 1DELA 2ZSKA 1OU4A 3LOQA 1I7QB 3PEEA 4V3CA 5IMSA 4YJ2B 2PKEA 4A16A 3NONA 1MRNA 2FDCA 2WUDA 1PAUA 4B46A 1TKRA 3ILHA 1E7QA 1YIDA 1W0JA 4P5DA 4U00A 2F43A 2IU6A 3B78A 3HGQA 5FF9A 3UVEA 3DDWA 5IM4F 1U99A 2M6RA 2EU8A 3OETA 3TEJA 1IN8A 2HHHB 1MENA 4DBLE 1UIRA 3TRIA 3ZG6A 5J2UF 2CB9A 4OBBA 2W2MA 2W6ZA 4I50A 4RVNA 2QVBA 3VAYA 4CIXA 1DTWA 2HDNB 1R00A 5LOVA 2FU5C 3V2GA 1L4GA 5T3YA 2BFMA 4X7MA 4LXUA 5E2BA 3U3OA 1AKRA 3N8HA 1CRZA 1RM0A 3C45A 2JK1A 1BJTA 1M7HA 4IJMA 4FFLA 4JC8A 1MLDA 1SIWA 1MJGM 2FP4A 1QKIA 4CCAA 1MDFA 2QJWA 2O8EB 3PQ3A 2Z5GA 3ONEA 4MWGA 4QXRA 1D1NA 4YPFA 4DHWA 1UBRS 4URVR 3B7GA 3C3XA 1Q7GA 1W35A 2B4YA 2ATIA 2YN0A 3NIWA 5CNIA 3A6PC 1K4MA 2GKSA 2A30A 3RY8A 5E7QA 2EW2A 3AF3A 2UZIR 3W3AD 5D3QA 3KQOA 5JANA 1PSDA 1ZX1A 3F78A 3EZFA 2VBTA 3GJYA 1PX2A 5JG7A 4TTPA 5HP4A 3FZEA 2FJUA 4M54A 2VRNA 2ZI4A 3BE4A 4RLFA 4PWYA 3V1NA 3M6IA 4CMEC 2GM3A 4G8JA 4I9UA 2EOAA 2G83A 2OAGA 2Q3FA 3R7LA 3SSAA 3AHGA 3SX0A 1I7NA 2C2KA 3WLJA 1ZNXA 1QS0A 2O0HA 4RM2A 2JASA 4L5YA 5IJ0B 1QIGA 4P33A 2JNWA 1C29B 4GNRA 1CUIA 4YMGA 3DEFA 2HU7A 4NXMB 1G5RA 1NZDA 3HY3A 2Z8XA 4WLUA 1I4TD 1XA4A 2ZWAA 3EA5A 4IIFA 4N76A 1QJCA 4RYDA 3GFQA 4RVSA 3ED1A 3THOA 4LPSA 4ND1A 4AF7A 3P2YA 2QA5A 3PC8A 4JBXA 4NS1A 4QVKA 3SYLA 3TOZA 5EQTA 4DQ0A 5B4UA 3F5DA 1QGAA 5IDWA 2QUAA 4LJ5A 4XLCA 3W5UA 2GM9A 4U9UA 3AKYA 3OP4A 2QW1A 4LEIA 3COZA 5EP1A 3FZQA 5T8KC 2PRSA 1LA2A 1ZD9A 2I78A 1LF5A 1XDDA 2OCPA 2DMRA 3L7LA 2RG7A 4R8MA 2V7QD 2RONA 2NUAA 3SX2A 3TZKA 4QU5A 3QJ5A 1L5WA 3OECA 1KVUA 1BLIA 3ITNA 4UQLA 5IT4A 1G0NA 1RJGA 4OKIA 4CMAA 5LYJB 2PA3A 5E6SA 3UJCA 2PPVA 1I1QB 1W46A 3HVUA 1QVFB 2ET6A 3ROXA 3ZDZB 4BKUA 4AKGA 1C9KA 1VIMA 1V6CA 1DC7A 2AW3A 1E92A 1YCGA 2GYUA 4S35A 2DUJA 1DINA 2WW8A 1J25A 3GDOA 1N8TA 1TKAA 4R51A 4UREA 2ZR9A 4U7FA 3DWEX 3OF2A 5K4GA 1QPBA 2PXXA 2ISSD 3GGOA 1GZ4A 1ZGHA 3C6MA 3FSJX 3AW9A 3HJCA 1MUUA 2D0PB 1U6IA 2C96A 3OZBA 4E4TA 2COEA 1XVIA 3SF8A 2VNSA 2P2SA 3L0BA 4DQVA 3UK2A 4BUCA 1H2AS 1KEPA 4GE0A 4XORA 5HRUA 1Z4KA 4WWHA 1GHTA 4R1PA 2HIHA 1IULA 4G1MB 4F4CA 3WDSA 1PTJC 5IBCA 4F60A 4RDLA 1XL0A 1WXQA 5K4HA 4X7CA 2XB6A 3QEAZ 2Q6OA 1M73E 2X6TA 2I6TA 3GH1A 5DN6A 4Z4IA 4XUGB 2V3CC 2FXVA 1T5DX 3CURA 3GXBA 1A82A 5CYPA 4DDTA 3JQRA 4TV8B 5TPWA 4XSGA 3SPXA 3KJZA 3FBGA 3H19A 5T4HA 4FEYA 2X4DA 1JJIA 3UW3A 2WTBA 4H27A 5DCWA 1K4KA 1A04A 2C84A 1M6VB 2JAXA 3OA0A 2M6LA 3KB8A 2VP4A 4XM0A 4H6XA 5E6UA 2MCFA 4PYJA 2VCEA 3CB4A 3A6GA 3W5AA 1QF6A 2C78A 1CB7A 2ZB8A 1KR2A 2R4UA 1IZZA 1G6OA 2O7VA 1P6UA 4XTRA 4GLJA 1H65A 5ESRA 3V97A 1XNHA 2W6JA 3X3HA 5K8LA 4IHQA 1BNCA 4OMUA 5KC8A 5C0OE 5CB0A 3MIZA 1GY8A 3FWYA 4E15A 2EG5A 5AKKA 4HGZA 4Z4VA 5CA1F 4X20A 2VG8A 3SBDA 4OHBA 1JQAA 3NBUA 3C1AA 4NOMA 2IOYA 1NW4A 3V6MA 2QTGA 3T5MA 2H1RA 3IKVA 5C80A 1ZH2A 1FFXB 3U26A 1PE0A 2X5JO 2O8NA 4HZUA 2Q4EA 2AWOA 4M8KA 4OL0A 2O4CA 1Z4NA 2I7DA 1BYUA 1N6RA 3DBLB 3JQAA 4WXPA 4XIYA 5HJEA 2EJCA 3R3VA 2ETVA 3O3MB 5JQGB 1DARA 5HE8A 1M74A 1RKUA 2QUKA 3RREA 4LMAA 4X7RA 3FDXA 3UJ7A 1P7CA 4GPBA 1LK0A 2IEIA 4I4TF 4B3TB 1BQ3A 3P9NA 3KU1A 3IH5A 4FWBA 3SIWA 2V4ZA 3JYLA 5ILQA 5C7YA 4FQ8A 4PZLA 4PVCA 2Q27A 1ODCA 4XLFA 2ZT8A 3IDZA 4ONEA 4AX4A 2DLDA 2GK3A 4Q9AA 2CKDA 3A3PA 4ZOQI 5F98A 1XK7A 2LGJA 3PGVA 5MN4A 1MF7A 1IB0A 2BE9A 3OC6A 1GQYA 1W0KA 3R44A 1A8IA 3Q7QA 1G2IA 1G3MA 1K3TA 4BCBA 1EFPA 3OQIA 1ECPA 4CRWB 4JSYA 1X1EA 4PLCA 3S2EA 3NOXA 3P5SA 5ANRB 3UAVA 3WGHA 1FZQA 2FQ1A 3A1UA 2Z83A 5AH0A 2HPAA 3M5CA 3RBXA 4HGYA 1G8PA 4YQFA 4Q4JB 2Z1DA 2EAUA 5HQ3B 1Q6ZA 3DE1X 4RXMA 3A3KA 2G7MC 2HCTA 1VLHA 4H7KA 4DV5B 4C0HA 2WA1A 1VKJA 4CF3A 3K6JA 5IC5A 1M1NA 3ENWA 2R1VB 2V03A 4PM4A 4BUJA 4XIIA 5T6MA 3WICA 3N28A 1PNTA 4NYMQ 1T8RA 4HX5A 2UVDA 3U3MA 3U81A 4LDZA 4I0WB 4X1KA 3LUDA 2V54A 2P4QA 3K9NA 4KDRA 4PLTA 4KLZA 1JEOA 1YOBA 3CUKA 2GAIA 1PR9A 2AJLI 5EGSA 1F6DA 3EEIA 3GEHA 3S27A 1BZYA 1QE0A 1PTKA 2A5YB 4TSRA 3W77A 3WAKA 4CFYA 2C2MA 4KKUA 1TZKA 4JOSA 4B6PA 1E94E 3G71B 4EHKA 4QDJA 1CRQA 1I24A 2C5SA 1RQGA 1QRUA 2XRFA 4C3OB 4X5OA 1XZMA 2GTIA 4DL9A 2FWNA 2MIIA 3PGJA 1PBTA 4MVJP 2C9YA 1W8IA 4HDKA 5T4EA 2PHZA 4M0EA 3QP9A 4CTNA 2Q45A 1RWQA 4JGIA 4MRSA 4WI1A 1XDWA 2R6JA 4AQDA 2J1LA 3NATA 3P4UA 1FFEA 1UBNA 2WHPA 4JEMA 1VA5A 2I5PO 4MQUA 4PW0A 3OJLA 1MX5A 1ISMA 5CH5A 4W5TA 4R1UA 3W5VA 3R3YA 4ZHSA 2RGDA 3WI7A 1B1AA 2NV2B 4URHA 2FE1A 5BR8B 4YP6A 1KQ3A 2CFOA 2P11A 1P3DA 3MT9A 3RLFA 4C1BA 3CA8A 1IEQA 1DQRA 2VPZA 2ZRPA 2BH2A 3PJFA 3WFIA 3MMZA 4IDNA 3E7DA 2JLUA 3I45A 1W2WB 3U7QB 1VMKA 1NN0A 2FPSA 2VDJA 3DE3X 5AR1A 1YZGA 3MTIA 3CNQS 1AGXA 3IP3A 3L8GA 4HFRA 1QM5A 3GD7A 5EI5A 3JSXA 3QUBA 2P67A 3CF0A 3WB9A 1AS0A 3ELBA 5C8ZA 4BAUA 5C46F 1NXPA 5EZQA 5FI5A 2O0JA 5G1NA 3RSSA 3RC2A 2E49A 5ADVA 4U2GA 1EM8A 2C59A 4DCUA 4DXAA 3B6EA 4XCXA 5CBPB 5EJ9A 3W8NA 4UEWA 3ZY5A 2EP8A 4G0PA 4W9NA 4RKYA 1PYDA 3AXTA 3DZIA 4FOPA 2FRDC 3O4HA 4P2BA 4ZOLF 2RHGB 4PFQA 3QLUA 3CQ9A 4DA0A 2PIDA 2ZS8A 4P58A 2QJOA 2OXTA 5E3HA 2OP0A 3V2UA 3MMPA 1L8XA 1ZKMA 4LXQA 2HI0A 4GX1A 5DP1A 5LOVF 5IAGA 2QN6A 2FZ4A 1VHOA 4AP6A 2IHJA 2JB9A 2LRHA 2Y1XA 1G98A 5JAMA 4XIFA 1PR1A 2H2HA 2P69A 2A9PA 4NBTA 2C4MA 4XDGA 2PBFA 4BLQA 4ND3A 3OZUA 2CNWA 3KZKA 3EF3A 1GSOA 2ODQA 2NUTA 4UZUA 1RM3A 3AHFA 5EXSA 1CQPA 4UHDA 3R23A 4P3XA 2WE8A 1MAHA 2JAPA 2YV1A 2YYSA 4WV3A 3R8CA 5C81A 3I2HA 3Q3JB 2D1SA 1BVUA 1L7DA 2BEWA 2GRUA 2R751 4YRAA 3FOEC 2JLXA 5TQ0A 3E58A 3ZHBA 4B2YA 4ENUA 3ENZA 4AC9A 3L8CA 3OC0A 4J29A 1ESMA 1Z34A 2WV7A 4E14A 3DH0A 3IVAA 3MHPA 4NV1A 3R9IA 2LKDA 4DCCA 2RKWA 2GD2A 4IL5A 4CF7A 1Q7CA 3GFOA 2P6UA 1GCIA 1KJYA 4P3NA 4KWCA 4PHFA 5F4MA 1SGWA 4XGQA 2B8TA 1L8AA 1YKGA 3E7PA 4AS3A 2W5UA 4CG1A 4DJDC 2R62A 1MR3F 1J56A 1AKQA 2WJ6A 1RXEA 2HNKA 2NP6A 2A1IA 3NI2A 1FBTA 1PU2A 1CUDA 1T1RA 1HC7A 2X86A 1Z73A 3F71A 1ADFA 2GHQA 2EQAA 4FNOA 5K05A 3NCTA 1X8XA 2IOFA 4MARA 3E5NA 1R5BA 4K05A 5IUJC 4A8PA 3HYSA 5A7FA 3CGGA 4LA4A 1NLFA 1XTVA 4QQFA 1N2CE 5KOHA 5J2TB 3I6IA 1BD4A 2YW2A 3ON5A 4Y1RB 5D5PA 1II8B 2NO0A 3CNEA 2ZJ7A 1VI2A 2QGGA 4F92B 1EI9A 4C87A 5LQUA 2BY4A 2IOQA 5K3SA 4YJ2F 2V6FA 1UXIA 4HQNA 4C4RA 2X13A 4LZNA 4GUAA 2HZ7A 1BXGA 4X92A 1E2BA 2FW1A 2MSKA 1NRJB 2PS1A 3PHIA 4JYAB 4IO1A 1WHTA 3G2KA 3WGIA 4LOJA 4Q03A 4L57A 3SKVA 4DY6A 4HYYA 2JLWA 5K51A 2B83A 3T7EA 3COJA 2WJIA 1ZGJA 4P4SB 4L8WB 3VI3B 2AFIA 1TQ8A 5ARDA 2BGTA 1XI2A 1XZEA 3KKOA 1VQOB 4E11A 2DC1A 4IIHA 2W2OA 2H7CA 4ZT3A 2GA8A 3GLIA 5I7HA 1JFSA 2ECKA 5AJZA 1PNOA 2AH5A 4B3XA 1TQ2A 3RBVA 2BSAA 4PZ0A 1TAUA 4H6WA 3AFNA 3MWEA 1RWXA 1KFKB 4ZO7A 1G3QA 1EHYA 1LPNA 1QCZA 4TUYA 1DBVO 4FNAA 5G1OA 5AESA 3RE1A 2AI2A 3ZS9A 5DLYA 4WDRA 5LP6F 5B53A 4DDWA 1W93A 4NULA 3ZDQA 5GADl 4JI1B 1OZAA 4Y6OA 2IHTA 3HQ4O 2JLQA 3UKOA 5IJ9A 2PGNA 1WVGA 2W70A 3CCEB 4B0OA 3SG0A 4B5LA 5JCPA 1PKXA 2BV3A 3H5NA 5BOSA 5GJWC 3HJAA 3B60A 1RCFA 1O8BA 4P53A 4Y6LA 3U9LA 3UHPA 2WM9B 3S2ZA 3V4ZA 2IIQA 1E43A 1NZFA 3BRQA 1E58A 1NJ5A 1L5HB 2AN5A 3LT2A 4N8DA 5T6BA 1IDN1 1QF7A 2XD4A 4LJ9A 4PIMA 4UQOA 4G9GA 1L5KA 2Q8NA 1YLOA 2X1MA 5TV2A 2I9KA 4LNUA 3G02A 1I0IA 4FM9A 1XP5A 1EM6A 1ACJA 1UXHA 1RPTA 1G0OA 3G9QA 5TVKA 3AZQA 1EGAA 3NAQA 3PXXA 1NY5A 2JIZA 1XTSA 2OGWA 3O4IA 4U3JB 5KYWA 4DC0A 5FD8A 4M46A 3R0JA 4LXGA 1NAIA 2MDTA 5DM0A 3UJ3X 2GKOA 2JD2A 1IBRA 1ZUD1 3OFND 4MVJD 4DK0A 4NE2A 3TRHA 1LSSA 2PX5A 1D2MA 2QPLA 5G02A 5CG2A 1XU7A 1S8AA 1USKA 2P1ZA 3G6KA 1FIUA 1HT0A 2ROQA 4I3FA 3DUFB 4JJEA 1TJNA 4UTVA 4GR5A 2XMCA 1OE0A 4LF9B 1GVNB 5E7MA 2Q28A 3LPNA 3RHFA 4GZMA 4PAMA 2P35A 4FMCF 1V3TA 2QTHA 3PXBA 1CUUA 3EIOA 1A4RA 1YRBA 3PPXA 4JB2A 2KVOA 2Q46A 3AM3A 3QLTA 3HEBA 3JAMA 4CDNA 1WNTA 1D3AA 3UUGA 1N5JA 2VYVA 2BI8A 1G8YA 5C53B 2C5AA 7AT1A 3S5UA 1YF3A 3JQPA 2VS1A 3K0CC 3LCRA 3M4XA 4V24A 5IYQA 4WZAE 1D09A 1EVIA 1Q1EA 3U9TA 4OQNA 4M60A 3H2SA 3KAPA 3LI2A 3V4SA 5BWOA 1R4MA 4MWCA 3ZX5A 1WA5A 2O0KA 1V1MA 3CCVB 3LL4A 9LDBA 5J23A 2IY9A 3WGUA 4X66B 1QFYA 1SOVA 3N70A 4JB0A 1OIWA 4G36A 4BJ1A 4RD2A 1R2QA 2CL5A 1EK6A 1P9LA 3DPIA 4IQ4A 1T9DA 4NECA 4CN9A 4P83A 2MINA 3GLRA 3G0GA 4HXYA 5KYGA 5HUJA 2NO7A 3C87A 3FVQA 4MW1A 1RBMA 4Z0HO 4GR4A 2EQ5A 4DSTA 4QVGA 2QP4A 3VR6A 1HPLA 2DPLA 3PV0A 4X7PA 4J0HA 5DH9A 1X9HA 1PJQA 3KZXA 2F8MA 3C7TA 5AQEA 3PI6A 2EP5A 5GOTA 2P5UA 1UP6A 4JJKA 1F17A 3CCSB 1TYEB 2AK3A 2VF2A 3WQRA 3ZWDA 1OAOA 1XRPA 1IRIA 4AK9A 2D62A 3WAGA 1E3TA 1O2DA 3B1KA 2OOSA 4JMLA 1FLVA 1OFIA 4EFNA 4NRDA 1T0IA 2WLSA 4RENA 4AYXA 4DVJA 4MKZA 2F62A 2YX1A 3FLAA 4D9BA 3GFFA 4H17A 4JYMA 1Z0AA 4KL8S 3WMGA 4BLWA 4M98A 4C3UA 3BEDA 4EGSA 4DM3A 5A4FS 4TL6A 3QFCA 2PEZA 4D43A 1BPLA 2OZEA 1YOVB 3ENVA 4PLZA 5E4FA 4ALIA 4ZAYA 4BQFA 3L0YA 2ZIEA 3L0OA 5GAJA 2XYRA 3QVMA 2ORVA 1DUSA 1RU3A 1VSTA 3B53X 2OD9A 1W6UA 3G85A 3MOSA 4ETIA 1M7BA 2CJYA 4N3AA 4DWVA 3MJVA 3GX1A 5AVYA 2Q6TA 2DBVO 2WAYA 1YVDA 4FJ2A 4DNRB 3JQ7B 3R3WA 1PV2A 5AJTA 3VR6H 5DJ5A 5DMHA 1YAHA 2JFFA 4XAQA 4CQMD 3W0LB 4LECA 4AKEA 4RORA 2IYRA 2NQ8A 3ZDYB 4MGZR 2F4NA 1S2GA 2BMFA 2ZXIA 2YJGA 2QAGC 4RD0A 2WQZA 4TYQA 4LJRA 1R27A 3OIVA 5LNK1 3ND6A 1OT3A 3L8DA 1JYFA 1N0HA 3I32A 2R6HA 5JQGF 4C4OA 1KDOA 4X6XA 4CE6A 2HT1A 2IP2A 1UJCA 2AJ8A 2BMWA 2IHZA 4DV0B 3DAHA 3PG5A 3Q6RA 2CMDA 3IKTA 1MMFB 4FHGA 5JWOA 4C21A 2D3LA 4K9RA 2XA9A 3CV3A 4RPIA 4G25A 4D3SA 1KY5A 1M6WA 2GLXA 4R2LA 2O06A 4DLTA 4M1TA 1JP7A 3I5XA 1Q7EA 3I1JA 2GF9A 5LN1A 1JU3A 3LY7A 4Q7JB 1XK6A 3MGKA 4OI2A 2QD5A 1KI8A 2XZOA 2BHTA 4Y9UA 2C0CA 3DEYX 1DWPA 3LUKA 1VYTA 2E6KA 2H1SA 3HBNA 3THXA 3BB1A 3I0NA 3PYXA 5K0GA 3SEQA 1PL7A 2A84A 4BJ5A 3RTBA 3GIWA 4LZZA 3DDHA 4LX0A 3UCFA 3TD9A 4CM9A 2RHOA 2A3NA 4GI2A 4MAAA 3WL6A 1D4AA 1P39A 2K6GA 3G2NA 3D6TB 4G2NA 4XPIB 5EJ2A 1LVGA 2NYUA 4RK6A 4OHKA 3UQZA 4Q0MA 3BZBA 3DM5A 3ZIUA 4HADA 1NVUQ 4CTMA 3P27A 3D3WA 5ITVA 3WMFA 1J21A 5A88A 1J8MF 3FRJA 1VP3A 1YITB 2BWJA 3P0JA 3ZCUA 3STHA 3WFZA 3PDIA 4ZI5A 4X7FA 3CVXA 2OFFA 3S5JA 3CEAA 4IZ6A 4EA8A 3A6DA 5A04A 1KDTA 3FTPA 2HBQA 4QPDA 5GJVC 2C4UA 5I7EA 3A05A 4HDOB 4U39A 5IJZA 3TTYA 3DF7A 1RC0A 3AIKA 3AFIA 4PIPA 3VVBA 3ZDXB 4COKA 2JH9A 3USCS 4C0BA 1U7PA 2D6FA 4BLOA 1LTHR 3CCMB 3OJ0A 5BVGA 4XONA 1K2VN 1RMTA 2ZJ3A 4BJ6A 3Q5EA 1C14A 4DB4A 3CRNA 4EA9A 1IK4A 1TM3E 2VJCA 1R6DA 5BSEA 4CCYA 5FUYA 4J6EA 4YLYA 3TW0A 3VPSA 4EGCB 1W5FA 5IAKA 5D2CA 1H4QA 1U5BB 4NMXB 1PJAA 5DM70 3A35A 4RA9B 2R8ZA 2XQGA 3KE9A 3LO8A 1JX6A 3ES9A 1UKVY 1S3IA 1XQ6A 4UDXX 1DI0A 5COAA 1RM5A 4MIKA 1FDOA 3LLUA 3I30X 1SKYB 1OC4A 1PG0A 3ML1A 3ZX4A 2CXNA 5FFFA 2B30A 2DOGA 1BQEA 2GREA 1WF3A 4XA8A 1HYBA 5HM8A 5HILA 3AGPA 4YMVA 2IK8A 3NT4A 1QTIA 1N2JA 2BM9A 5C51B 4LY0A 2QTMA 3SAJA 4KQ2A 3PLAE 3OU2A 5IH3A 4QV2A 1J90A 3ASYA 4TL8A 4TMYA 4WA8A 3F3MA 4HH4A 4F93B 1R9JA 2A5DA 3JCZA 1KZYC 1H69A 2DFNA 3AV0B 3D3EA 4GC5A 1RT9A 2ZR8A 3EXIA 3IJEB 4GDMA 5AIAA 5ICEA 1D2RA 5IN4A 2C2OA 2DR0A 1OLSB 2VYNA 1EPUA 1I2DA 4HATA 1HT2E 4PCAA 1GZHB 3EULA 1C4OA 4YMTA 4WRRA 2IS2A 5AN9A 4HO1X 1P1RA 3F74A 2H7YA 3OF5A 3DZBA 4EYEA 5BN1A 1UXGA 1T6BY 2XWPA 2XA2A 2YZ2A 3F5SA 3E82A 2TECE 3NHSA 4HQKA 1Q6YA 3LDUA 1TEZA 1VJTA 1Q92A 1ZCJA 2BGGA 4AY3A 5J3JA 3DDZX 4IY1A 2ERCA 4NENB 3C5CA 4X85A 5HKKA 2EV9A 2JRCA 2G77B 2VCHA 3IFSA 1SVKA 1X0XA 4QUGA 1T5OA 2YIJA 3BGWA 4W82A 5LQDA 3AVOA 4L8GA 4KQMA 2ID9A 1RPZA 4OBWA 3QE4A 1VOTA 4GICA 5DGHA 1ZBDA 1RWWA 4GPD1 1UJ6A 2ZBGA 2G4CA 3D7KA 5K0FA 4EMTA 5BNTA 5KTYA 4C88A 3R9WA 4BFLA 3DVLA 5KMGB 1U3TA 1FW6A 2MSLA 1O97C 5D01A 2X3UA 2ODAA 1BMFA 4GT1A 3L4BA 1DV1A 4KOAA 5EG5A 4XCQA 2IV7A 2H4JA 5SY9A 4ODIA 1HSZA 3VPXA 4F5WA 1DBQA 1XTPA 1TF2A 4ZDIA 4XWTA 4TMFA 2Y4OA 4HOYA 2AJDA 3AESB 1I10A 1CJMA 4YALA 1A95A 5DXJA 4C0LA 1W34A 3PIRA 4MZXA 3ANNA 3K9WA 5B57C 4ZGQB 3L92A 1ZI9A 4EFMA 5AW9A 2FLKA 2WPNA 4M38A 3FLMA 4XJTA 3TKYA 3AEZA 1FRQA 1HFWA 3F7NA 1NU8A 2BF4A 1YH3A 4QDXA 4KQGA 3SC2B 3K0KA 2PJUA 1EB8A 1EWYA 1V7ZA 1VE5A 3F3SA 3IDAA 3K7EA 1BCSA 1ADYA 3KT8A 4HNHA 4NU8X 5E9QA 3RS9A 5FX2A 2XA1A 1LRLA 3UFXA 5BSYA 2R6CA 2RGGA 2UV8A 1QUFA 3ZJYA 4CETA 4YP5A 2R8PA