1QX4A

Structrue of s127p mutant of cytochrome b5 reductase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
270
structure length
264
Chain Sequence
HMITLENPDIKYPLRLIDKEILSHDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKEAGGKMPQYLENMNIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQSEKDILLRPELEELRNEHSSRFKLWYTVDKAPDAWDYSQGFVNEEMIRDHLPPPGEETLILMCGPPPMIQFACLPNLERVGHPKERCFTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the S127P mutant of cytochrome b5 reductase that causes methemoglobinemia shows the AMP moiety of the flavin occupying the substrate binding site
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords NADH-cytochrome b5 reductase
total genus 66
structure length 264
sequence length 270
chains with identical sequence B
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2003-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qx4A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qx4A02
1G7SA 3P27A 4G5GA 4ZCIA 2EIXA 1VQLB 1JA1A 5JBQA 2HDNB 4ACAA 3W2IA 3ZBTA 2QA4B 5AN9A 4TMTA 1FNDA 3WNCA 3JQPA 2VYQA 4TMXA 1TTTA 1N0VC 3VMFA 3WNDA 2J7KA 5TY0A 2DCUA 3G6EB 2CRVA 3B82A 5EMNA 4HE5A 1R5BA 3OJXA 4PC7A 4B44A 2R6HA 1KQSB 1VQ5B 1QVGB 2QN6A 3W2EA 1QGAA 3ZZTA 3AVWA 1S0UA 1EP2B 1R5NA 1GJRA 3CC4B 3VNUA 4RD6A 1D1NA 2BGIA 1EWYA 3CCQB 4M53A 4RD0A 1KJZA 3OZVA 2RC6A 4RCZA 2XNJA 4P6VF 3ZC3A 1SKQA 3W5HA 4N3NA 4YAUA 1M1KD 1DG1G 4DQLA 4AF6A 3U6BA 1B23P 3MHPA 2YWFA 1G7TA 1VQ9B 4QFMA 2HCJB 3E1YE 4RCYA 1UMKA 2B7CA 4M1KA 2VNIA 1CNEA 1FNBA 3AVVA 4N3GA 1GAQA 4RD4A 1N0UA 4LBWA 4B48A 1K8AD 1VQPB 2E1RA 4YAFA 2QTLA 1K9MD 2DEUA 1KRHA 3VNVA 4U9UA 3CD6B 1QGYA 1AMOA 1QUFA 3WBKA 2B7BA 1GVHA 4EH1A 3OZUA 1KK2A 3ES9A 1XB2A 1KK3A 4RD3A 2BMWA 3W5UA 2EFGA 3CC7B 1BQEA 3CRZA 2BGJA 3QFTA 1S72B 4QHYA 1E62A 4TN1A 3VO1A 3OJWA 3MCAA 3G4SB 1Q7YD 1E63A 3J81k 1OB2A 5THXA 1JA0A 1YHQB 4ZGQB 2PLFA 1QUEA 4M0LA 2YWEA 1VQNB 2YWHA 2BN4A 3P26A 4MYTA 1DDGA 1JB9A 3CXCB 4LBZA 1EP1B 2GPJA 3W2HA 1JJ2B 1IB0A 2QMUA 2B5OA 3QSYA 4G1VA 2RC5A 1BJKA 3WNBA 3CCUB 2AHOA 4J0QA 4ZGNB 3OW2B 4G1BA 5DSZA 3CPWB 1QFJA 1N8RD 1M90D 3LYUA 5HXBA 1QX4A 3CCVB 1VQ4B 1Q82D 3CCJB 4FK8A 1YJNB 1YIJB 3LVBA 1QVFB 3CCEB 1I7PA 1ZM2A 1EFUA 1ZUNB 3E20A 2BM0A 3AVYA 4WQMA 4PC2A 1E64A 3U6KA 1W35A 4FWTA 1A8PA 2CNDA 1BX0A 1OB5A 4AC9A 1VQMB 4RD2A 1ZM3A 3SJZA 4ACBA 4LC0A 1GO2A 4NBSA 3QFSA 2VNJA 1YJ9B 1YI2B 1D8TA 2FX3A 3I56B 1QGZA 4LBYA 3AVUA 3AVXA 3WBJA 3CMEB 1G7CA 3FJOA 1DDIA 4Y9RA 1XE1A 1EFTA 2OK7A 1OGIA 2HMAA 4B43A 1YJWB 2XEXA 4F7DA 1Q86D 3G71B 2NPFA 3CCMB 4FN5A 3W2GA 1JNYA 2BF4A 4ZCMA 1YITB 3PENA 3I1FA 2D74A 1R5OA 1IJEA 2BV3A 4HE6A 2C78A 3CW2A 1D2EA 4B3XA 3MMPA 1TUIA 4B4DA 3W2FA 4ZCLA 1WDTA 3LRXA 4ZV4A 1NDHA 2ZITA 1KC8D 1FNMA 4K1XA 2OTLB 1ZM4A 2OK8A 4PGOA 4AF7A 1QFYA 2DETA 4DQKA 2QDXA 4Q7JB 2BVNA 3V76A 1EP3B 1KK0A 1SM4A 2QEXB 4PC6A 4TMVA 1CQXA 4M4SA 5TR9A 1GAWA 2C77A 3AGPA 5FA6A 5GV7A 4M2LA 1VQ6B 1FNCA 1TLLA 4R71A 3FPKA 1EFCA 1B2RA 2PMDA 2VNHA 3CCRB 1HA3A 1FDRA 1H85A 2DY1A 3WYAA 1IJFA 1U2RA 1KTVA 1QG0A 3OZWA 3U2QA 1ELOA 4B47A 4C0SA 4UAJA 3AVTA 3CB4A 4IW3B 4MYUA 1VQOB 1EXMA 1F20A 3I55B 1QFZA 3B78A 2BPOA 3ZZUA 3LO8A 2BSAA 1DARA 1FRNA 3WXMA 1KD1D 2XNCA 2OTJB 1W87A 1CNFA 5KSWB 1W2BB 1H42A 2VNKA 2DERA 4YHBA 3QE2A 3CMAB 5TV2A 2PIAA 1G7RA 3WY9A 4NCNA 3JQQA 4LBVA 3ZZ0A 4Y7CA 3JQRA 1VQKB 4C43A 3CCLB 3W5VA 2X3UA 1VQ7B 4P3YA 1GR1A 4PC3A 1F60A 2QTZA 4H9GA 1BX1A 2VZLA 4TMZA 5H59A 3QFCA 1KK1A 1AIPA 4YAOA 2GQFA 3B8HA 4BPRA 2YWGA 4PC1A 1J9ZA 1TVCA 1W34A 4RD1A 3AGQA 2BM1A 3A1FA 4TMWA 4RJLA 1Q81D 3CCSB 1VQ8B 1NJID 1FRQA 3ZBUA 3VO2A 1ZM9A 3CC2B 4YALA 5H5JA 1QH0A 3QFRA 5GV8A 1K73D 1OGJA 4Y9UA 4YAWA
chains in the Genus database with same CATH superfamily
3W6UA 5EKTA 5IYPA 3KQQA 5TRTA 1N5IA 1NFFA 2IDMA 2O2ZA 3E9ZA 2WKRA 3JRNA 4M7RA 3NYIA 4FEAA 4ARIA 3GCZA 2GHRA 3GRYA 1FP4A 1FS4A 1UD8A 4CG1A 2WKSA 4MYSA 2J4FA 2VJMA 1WX1A 1PUXA 3FTQA 2JJ1D 3GMSA 3PFBA 4IAOA 4XB2A 1JKIA 4XLTA 5JZMA 3CM0A 3PUXA 1WTHD 2A86A 1U2EA 3OJLA 5B1YA 4UVGA 2C3UA 2Q07A 2D0OB 1JEAA 3GBPA 3N7TA 1LK7A 2VNAA 2OYSA 1Y37A 3G13A 5HWSA 3GT3A 1RPAA 2VQSA 2WNHA 3MGKA 4FFNA 1MTOA 5JH7B 3LCRA 2XGJA 3L7AA 2IE0A 2XA9A 3U4AA 1QP7A 2WIJA 5KYXA 4Q3DA 2P7IA 4TMXA 2CYAA 4GYWA 3E81A 4R2HA 3FYUB 2XA2A 3D3WA 2JLZA 5CK5A 4A73A 4PG4A 3G6EB 1T0IA 4HVTA 7GPBA 1ZW6A 3K3PA 2OZLB 3I6YA 2O0KA 1GGMA 4B44A 3WB0A 1VQ5B 3TVDA 4F5WA 2AQHA 1ZHOA 4C0XA 1NTRA 3PFCA 5KTSA 1LFDB 5MF6A 2Z2ZA 3W2EA 3PE3A 4YCAA 5K5EA 2ORIA 1UAGA 1FLNA 3ZZTA 5G3YA 3OCUA 3EE6A 1BXGA 3V2GA 1XMSA 1LB1B 2G9ZA 2GAIA 1AV7A 4Y9DA 4J94A 2WV7A 4DSTA 4BRZA 1HF3A 2H4JA 5LB2A 1SUBA 3PC2A 2XTNA 4M53A 2UZ3A 2CUZA 5I9SA 2WIGA 3E8SA 3JW8A 2RHOA 4HLCA 1E3LA 4AY2A 1LS1A 5EI5A 3RVLA 1DX6A 4ITRC 5ICGA 3ZLVA 5F5NA 3MMSA 3T0FA 4KFSA 1DPFA 1E8MA 4DQLA 2WM9B 2ZPUA 4QOSA 3IHKA 3VZQA 5IC4A 1C9MA 1NVDA 4MJ3A 1AY0A 3FFWA 3UV3A 3OZRA 5EXEA 3HL0A 4JI1B 3OY7A 3WWYA 1SIWA 3DXZA 4DPKA 1VQ9B 5K8UA 3VR6D 3S5UA 5FH9A 3P9YA 3IPYA 3UK6A 1ISSA 3IIEA 2W6QA 3NXKA 4W1QA 3AFOA 4X92A 5JQGF 2WUGA 3GP3A 3K1TA 4IEFB 5CLIA 1H2WA 2UZ1A 1VP3A 5YASA 3NHJA 5J63A 3LUHA 1NNEA 1M2OA 3F3MA 2YXBA 2QVBA 2V54A 3OWXA 4EI7A 5LUAA 4EHKA 3N2GB 4Z99A 1GZVA 3WBFA 1IBRA 4OX9Y 4D4MA 1R18A 1AX9A 2BL4A 4IRUB 1D4OA 2ZB2A 3PXBA 1GFWA 1YL7A 1JTVA 2QY9A 4YDHB 3DJYA 1SRQA 1T5BA 4ZTBA 3LNNA 4B48A 1PZEA 1ZHFA 3T94A 1AA9A 3UN1A 1PDWA 5T6MA 1MW9X 3E5MA 1VQPB 3ETHA 4KIGA 1E32A 3SU8A 3ET4A 3H11A 1R66A 1ST2A 1ZGHA 4YDQA 1GNLA 4YAEA 2OO3A 5CFZA 4WFQA 1KZYC 2JC3A 4JJGA 2JGIA 3ZIAA 3GJ0A 2H63A 2YZGA 3L6CA 3L6UA 4OF4A 5U1PA 3SC4A 5JS8A 4UATA 2PEYA 3RNOA 2HSGA 1RYDA 4X9XA 1NF8A 4BMSA 1R64A 3P9XA 3V7YA 2R1UA 3PLRA 2H2AA 4LMRA 5UKDA 3IPRA 3DZHA 2DG2A 2GPNA 2XX3A 5JUWA 3PHBE 2PUEA 1MB2A 3ES9A 2FZ5A 2E82A 4BNNA 2C57A 3AI1A 2Y71A 1OV4A 2D1QA 3CNNA 1E99A 1M7HA 3BHJA 2EBHX 1JAHA 2WKQA 4JK3A 3W5UA 4JP8A 1OH8A 1M6VB 2B8WA 3RWOA 4OU5A 3Q12A 4KW7A 1R0CA 1W49A 1VHWA 2ZL7A 4KKUA 2YOHA 4RDJA 2ZRDA 3D4PA 3DGEC 3IPAA 3WSTA 1V8BA 3D2BA 1G3IA 1HMPA 2F9LA 4TN1A 3R7LA 3DYVA 4U2EA 4YV7A 2C4KA 3DMTC 1U9CA 4WINA 2IBSA 4BVEA 3THYB 3J81k 3NNNA 4AG6A 5KCZA 1MOZA 4DW8A 1K5PA 3ANNA 4HX9A 5DHTA 5EHIA 4ZTUB 3CVYA 1B0ZA 1DC6A 1FP2A 3OD1A 2O8DA 5B53A 2BN4A 1HG1A 3P26A 4NBRA 4QYWA 2AI3A 4I3HA 2C9MA 2G76A 3TJRA 1JB9A 1JIQA 2AC7A 4DYHA 4NY1A 3GNTA 1ABBA 4LBZA 1GGJA 2IOYA 3HKCB 1JI3A 5LD2C 5IYZA 3RAEC 3QV1A 3KVRA 1HYHA 3IUYA 2P2CA 1ZS9A 4WZAB 2GILA 4O3MA 3PT9A 3TQCA 1SKBA 3HQ4O 5B4TA 1AUXA 1P9OA 2FZLA 2DSTA 2H9YA 5D84A 2MR5A 2WJIA 4O2RA 3R8FA 4YCJA 3L46A 3NNDA 3W04A 4AJPA 4E5NA 3QBVA 3WNQA 1WP4A 1TO6A 2PD3A 3GBVA 2XCIA 3UV7A 3BCRA 1GQYA 2QP3A 3V00A 2RAPA 1TA4A 5CLJA 2YN4A 5DSZA 3CTAA 5DWDA 5B3LA 1EUDB 1Z7EA 2ZRLA 5C0OE 4PN7A 4FBMA 3DTVD 2JD2A 1TZ2A 2J41A 4MQLA 2YV4A 4KFUA 5TNXA 4YY3B 1J9EA 1KMMA 2PMWB 2BRUA 1FTSA 4H1VA 3BKXA 4MGHA 1G5QA 4F4JA 3PXEA 5BSRA 2X0JA 5CNJA 1CETA 4OHPA 2IS1A 4FS3A 5B64A 1LBQA 5HPYB 3WMWA 1SIBE 1IE3A 3M49A 3DOEA 2FSVA 4QT4A 1YS2X 1MO6A 2Y1CA 1V9LA 3ODPA 2PT5A 4I9HA 3HRIA 4PPFA 5CUQA 5FPKA 3WL5A 3KZXA 5AKGA 4OQFA 3MINB 3EWAA 1GQOA 5AW3A 1PR3A 2HWXA 2QMYA 1Q0UA 2XMPA 2WV9A 2IHZA 2A5DA 2Z3VA 3ZHRA 3GLFA 4F4FA 5KNDD 1Z18A 4KJZA 1NVXQ 2B4QA 4ZI5A 1QQTA 3IODA 3EUAA 4WXMA 2XGGA 3IT2A 2Y1GA 1OT3A 1WDWB 4CL3A 2ZT5A 2JLYA 2FEWB 5HIIA 4XOUA 4NECA 2Q1WA 2LBPA 4QU9A 4C07A 1JQ5A 1SVOA 4PX2A 1WF3A 4PAWA 4EK9A 1UWCA 2X4DA 3AX6A 4ID3A 4AO6A 1RXEA 2E4YA 5AVYA 1O6GA 1ZA1A 3K4QA 5LDDC 1LW7A 3GOQA 1HT3A 4YO8A 1U0EA 1QMPA 5KTRA 1J22A 3GJRA 4GRDA 1NULA 2M5SA 5DNAA 4TYYA 3FDXA 3WRXA 1UKCA 2FX2A 5FQNA 1RM0A 4E94A 2N0SA 4LPKA 4E7OA 2J5QA 3LSYA 3PUKA 3QMMA 2WWHA 3VV2A 3AH8A 4IDNA 5HGJA 2BP7B 2ALJA 4U7HA 1TLFA 2F1HA 1U0SY 2BJWA 5PNTA 2PS9A 1TM1E 1KMCA 1LPAB 2PE3A 3AHEA 3N2KB 3L9WA 3C45A 2KSQA 3QE3A 2GNAA 3L4SO 1UFKA 3PRHA 4XPIB 1X8XA 4LCJA 2BTOA 1JQ3A 2XPCA 1IY1A 3AUXA 3DVRX 4H7KA 3COPA 3FBGA 4HF7A 5DBIA 3NRCA 1T6XA 1T8SA 1ZZGA 1RR6A 1PJQA 2PX0A 3EDYA 4FE7A 4IDHA 5DSTA 3AF6A 1IJKA 4LEIA 2VDNB 2VDPB 5AI8A 3DB1A 3P96A 5CDHA 3VZPA 4ABTA 1K8RA 4D0GA 4Q7QA 4Y6QA 2HA3A 4DJFC 2CBXA 3LKZA 2FWAA 3E4DA 3PXXA 4LJ9A 3SJ7A 3U13A 4XOTA 2WNIA 5C4MA 2G07A 4CT4B 2HJVA 3EH1A 5ABPA 4KO3S 5E4YA 3FWPA 4L6AA 4MW2A 4AKHA 1W29A 2VPYA 3FSRA 3IB6A 3GDGA 2M6LA 2HNBA 4G7WA 3PIDA 2RH5A 4EQZA 3KYJB 4H7IA 1IJEA 2GJRA 2XDYA 2EG9A 2VHVA 2ZYSA 5E4FA 2PVCA 3O38A 2J0VA 3QW4B 5DO9A 1BROA 4XMYA 2O3RA 4IJUA 4K3VA 1HXHA 1XMPA 2GBPA 1WXDA 3CUTA 2VDQB 2FGJA 2J8ZA 5IEBA 3AEUB 1SXHA 1CUFA 1G63A 4U2BA 4ZJYA 1KC8D 5AQEA 1JMVA 3L1JA 2EKZA 3OOEA 2QLMA 3IOYA 2AJLI 3K92A 4JL6A 5JD4A 4KR3A 1JHYA 1NW7A 3A35A 2RGNA 4JX8A 4KRFA 4FCWA 1VLQA 3RVNA 1NXOA 3KT8A 5FOVA 4DAEA 3IXLA 1DLJA 3BD9A 2ASEA 2CFIA 4EZEA 3MFQA 4QYTA 2AOVA 1SUCA 4HNRA 5BNIA 2B35A 3E3AA 4J6FA 2ID7A 2YHAA 3MTGA 2XJ9A 1QQ5A 1H22A 4CFYA 3T95A 1OXVA 2JGEA 2QDXA 4LHEA 1U7HA 5CXUA 3GQBB 1LA2A 4KGVA 2PMFA 3IXMA 4MIYA 4EHBA 3DCJA 3QA3E 1BQ3A 4PFSA 4Z4UA 4DIDA 5EKSA 3CSUA 4E2ZA 5DM2A 3Q2KA 4GOMD 1B41A 4C4OA 4BB5A 1Y0RA 2HF9A 3M3PA 2GWHA 3VX3A 4DA4A 3BJMA 1K0FA 2AR9A 2NU7A 4HQ6A 1WHTA 4OLBA 2ZUDA 2C3YA 5HOEA 2ORED 1F38A 1DADA 1O6FA 1SUFA 4QSHA 1IHUA 4I36A 3TSWA 4ERNA 4FPXA 3AVQA 2FOXA 1AUOA 2J0UB 3X1MA 5LZ9A 1F0YA 5JPDA 3X1KA 3U80A 2FVGA 2V4UA 1FBNA 3CR8A 1Y8ZA 1Z5ZA 3MJSA 1ZNXA 3EA5A 3FHLA 4OX9B 1UANA 4I6GA 4ESEA 1JQJC 5EHNA 2OCBA 4GSKA 4WNCA 3SKYA 1LWOA 4RA6A 3M8KA 4F3NA 4TZ6A 1FXWF 3WYAA 5FWDA 5ADWA 1P5HA 2JGNA 4BJ5A 5HKAA 5CYOA 4P2NA 3ZHUA 2D59A 1BHSA 1KKLA 1IN1A 4XVUA 1H23A 2WWVD 3M70A 2VEOA 3PC6A 3HCWA 1C80A 3Q4GA 1WTCA 4J16C 1OI4A 5IBPA 1X8JA 1E9SA 1NNUA 5IBRA 3E05A 2BTQA 4P4NA 2PUAA 1SOAA 4JHXA 4DGSA 5CEJA 3B60A 5KJCA 5DTJA 4NRDA 1PT9A 1M8KA 3PIIA 3S4YA 3DKKA 4AZSA 4XJSA 4A8JB 1JLMA 4IW3B 3ZE0B 4K5QA 3TNJA 1LV8A 4FFRA 3T06B 3UENA 3E7XA 1F20A 3R7FA 1NR1A 1ETUA 1YSCA 3KU1A 4TLEA 2VSQA 1EUZA 1HFJA 1RAAA 1WMAA 2JAXA 4HFNA 6YASA 1Y3FE 1WMSA 1Y1TA 1Z06A 5FYDA 5T8KC 3UAXA 2WYUA 2WM3A 4K6KA 2GD0A 3ZV3A 2YZMA 3QMWA 3E22B 1AXGA 4C7KA 1KYYA 1NLYA 1V39A 1E6KA 1BGXT 2P62A 1W2BB 2L17A 3EDOA 4G3XA 5JR3A 5K8JB 3EMKA 3R6WA 1I0IA 4CEIA 2J6IA 5K03A 3ORSA 1ESNA 4KGZA 4TXMA 1JH9A 3HY3A 1TF2A 1BHJA 2PIAA 4UBKA 1N5DA 2IOFK 3EXG1 3MQ2A 2WMYA 1WD5A 3QPBA 3LNTA 3MEQA 4HTAA 4J0JA 5DYIA 3W8NA 5KJ6A 3JV7A 4UPDA 1HX7A 1V25A 4CCAA 3T7AA 3LCVB 3P9CA 5HKBA 1DQPA 1FS6A 1CDDA 1PGJA 3A6KA 3B1KA 3GA7A 1YV9A 4GQNA 3HDTA 4LSGA 1KDVA 3F7OA 1KMHB 3E1GA 3IBSA 2FQQA 3JSXA 4WASA 4QBFA 3GG2A 2GZ3A 2RHLA 1B2LA 3OFNA 2FSVC 2Y92A 1D9ZA 3DTTA 4HEA1 2EFDB 3ON5A 1AHNA 2VAWA 1XRNA 3I34X 5LZ7A 1H0HA 2PLAA 3BBLA 3ICPA 4OI2A 2Q1YA 2LW7A 4IJQA 4V0LA 1XEWX 3MCTA 4AQDA 3AXSA 4C87A 4N0QA 3H2JA 4H18A 4PR0A 2NZJA 3WFJA 2ZZNA 1AZLA 3GHYA 3EEQA 3R3YA 4F96A 2I9PA 1KPGA 3SXUA 2YJ4A 3AG6A 2GEJA 4RY9A 1EUQA 1RM4A 4PIPA 5DGDA 5IC6A 4Z2AA 4INJA 2X53S 3L0OA 1E4EA 2WJGA 4Z4TA 2I8LA 4WJKB 2IS2A 4B2IA 2GJ9A 1T1EA 4BWVA 3WGKA 4V1CA 1SXPA 3TKYA 4G7XA 4EBBA 4QXRA 3WRXC 2GPAA 4OJTA 2WJVA 4MP8A 3FFBA 4R2IA 1SIOA 1OLOA 3D59A 5KINB 4L5BA 3JQGB 4KRGA 4G6IA 2QTNA 3H7AA 1L8QA 4IR7A 4MINA 4POOA 3SHQA 1T26A 4C29A 2F48A 5CVTA 1W93A 3HH8A 2J3EA 1Y34E 2NSJA 4LZLA 3RVRA 4DILA 2H8GA 2Y05A 2QRVB 3DUFB 3HYCA 3UFXA 1MG5A 4AL4A 2H4YA 2X1HA 3RUCA 3TS1A 4FFVA 4YIHA 2HF2A 1IOZA 2D2VA 1YA6A 4HG2A 2EXXA 4IQ8A 3RCBA 2YNMA 3IP5A 4NPAA 4PG8A 4F8JA 2IPOA 3NNSA 2ZTLA 1OX4A 2OL4A 3P27A 1XRPA 2A30A 2P79A 2ZYTX 2NVBA 3DOHA 3WYBA 1GPBA 3H1BA 3ZTTA 1U1CA 2HA2A 1IY0A 1ZEMA 3D2AA 4PQYA 5IKMA 5DCWA 3TO5A 1HNXB 4U7JA 1LLFA 4PYOA 3ETGA 3L7YA 3H18A 1W5EA 1YMUA 4MRRA 5B3AA 1VBNA 1D4ZA 2D0DA 4NABA 4R40A 3DO8A 4UBOA 5DVZA 2Z9DA 1LXCA 2QA4B 5H4HA 4QA9A 5ALRA 1MX1A 5HK8A 5EUQB 2GEVA 4TMYA 3NBYC 2PZLA 2X5NA 4TMTA 1GXSB 1VHDA 2B8EA 1CQPA 3ELBA 3H2SA 3C8ZA 4L22A 1SJ9A 2ZRBA 4AURA 4RANA 2R97A 4YRAA 5IZCA 2OWEA 4V39A 1XTTA 1VE7A 3NFYA 3VMFA 3BWVA 4N4AA 4UOZA 4GWLA 5LFAA 1QSGA 5JJLA 1FQJA 2HBYA 1UL1X 4JNCA 4PWYA 4RTNA 4HGOA 2C8KA 5BWLA 2I4RA 3KQOA 5KI6A 2BFOA 3TQRA 3ZPXA 1CD5A 4MP3A 5A0TA 1IC6A 1C1YA 2VF4X 1RKUA 1J2YA 2Q1UA 3L8GA 2YR0A 4TQ9A 4LKRA 5H9VA 5AW0A 4JP3A 5I01A 2HN9A 1V5IA 1MRZA 4XGIA 2OZEA 3MW8A 4JX9A 2PKCA 3U81A 4DV1B 3UT5A 1IK4A 1OROA 2XMDA 3E18A 3ZX5A 4B45A 2DIEA 1UK7A 4KGXA 4P38A 3NVAA 2VDLB 3NPMA 4R1LA 5EZYA 3WVNA 4G5SA 5JISA 4BGDA 2GM5A 1LRKA 2VDRB 1AUPA 3A3KA 4OHRA 4W63A 4H6PA 3WDSA 2BMAA 3F4LA 4JQZA 5E2BA 4YCSA 1E0DA 4P6VF 4LDRA 4M99A 3OE1A 3GVIA 4HGNA 4OGLA 3ORYA 4QV2A 2XT0A 3IBTA 3OC6A 5FUYA 1XZHA 3ASVA 4Y9SA 3A6DA 4DTCA 2WZPP 4YAUA 1U5BB 1E4VA 2CKDA 3NKLA 3W3AA 3L3BA 2NZWA 5IYNA 1NGSA 1KAQA 1ECLA 1T25A 3MB5A 3O83A 5D85A 4EHHA 2WSSD 3VYSB 1A7KA 4X5OA 4YH1A 3I61A 1TB4A 3TR6A 4C01A 5EUMA 1OLXA 4R3UC 3TL3A 1ZM7A 3OQHA 1P29A 4MOWA 3NEYA 1PZFA 3ZPNA 1WM1A 3SNHA 1X7XB 2I55A 3EQ2A 2YRFA 1WP9A 3WIBA 2XLCA 1EINA 2Q3HA 3BA1A 4PXYA 4FR2A 3MZ0A 2RH4A 4FZJA 3GJQA 1PZHA 1SVWA 4CXMA 2R1VB 1QVRA 3ESCA 3LC7O 3W1WA 4EO4A 1ZEJA 3ZE9A 2WG1A 2CLOB 1UBGA 2A0XA 3BS4A 1NYRA 3PVSA 3VC7A 5A62A 2IXDA 3RT7A 1YT5A 2IJGX 4LHYA 4UU7A 2H51A 2JK0A 1YMVA 4JYBA 5LL6P 4Q05A 4LXHA 1TKRA 4XOPA 4GVPA 5AESA 3UMYA 3DZGA 1V8FA 1PR9A 2F1JA 4XX1A 4L02A 5FT9A 2HDWA 3D54D 3I9JA 1N2SA 2NT4A 4X20B 2DT8A 2CXNA 2I6QA 1M33A 1ZH6A 2MT9A 5JXJA 4Q9LA 4OLAA 1QUFA 3CNBA 1UMCA 4X7MA 4AULA 4EJSB 2GJPA 2X0EA 1Y9DA 1IM8A 1TQ8A 4X62B 3VYTB 5IDQA 1JXMA 1LF5A 2VQEB 4OQXA 4TYPA 1O2DA 5HCUA 4HLDA 3T12A 4JI2B 4K46A 4DR6B 2AOUA 2H2GA 4RGVA 2C5SA 5AVKA 2IRWA 1Z73A 3JZMA 3MUNA 1JKMA 3F0TA 2IYZA 3S99A 2K6GA 1QX3A 4FMBB 3MOIA 1GZ5A 4PCAA 4TSFA 1QYWA 2QTGA 5JMTA 4TYWA 3C3WA 3D5EA 4BKQA 2HV8A 5CDGA 3GLGE 3PTLA 3ZDXB 1PYOA 2OAEA 4MGIR 1T10A 3I05A 3NHMA 4KEAA 1R0ZA 4RTSA 4E33A 4GZ6A 1I5RA 4R8SA 3C43A 4MDFA 1RLUA 4CIVA 4ITUA 3LTNC 1G3QA 2ZI3A 3BL8A 1VPLA 1ODKA 1V5EA 2XWSA 2RHWA 4NOLA 5ULLA 4ES6A 3C8DA 1BNCA 2E1PA 3AY7A 4RA9B 2ZE7A 4PQFA 3BRSA 4L5YA 3M4YA 1E3EA 1FU4A 1K66A 1NVAA 2TMGA 3VI4B 2ONYA 3H5WA 3NT4A 3ODGA 1CXZA 3ITDA 1F6WA 4FKZA 4WA8A 3LY5A 4QJBA 3C5HA 1EFAA 2C96A 2VP9A 3HB9A 3KFVA 4IUBS 3TD9A 1MC5A 3D0KA 1FX0A 3SFVA 5KNBD 3CESA 5CPFA 1P5ZB 2ZREA 1WPGA 2P4QA 4LRXA 2I1VB 3VOTA 5K45A 4IX9A 4R9NA 3DFUA 1PG2A 3UXMA 2QI9F 3KJEA 1OWMA 3T4EA 4BLOA 1Z5UA 2OM6A 1C1XA 3EGVA 2QJRA 3FRJA 4FONA 5E6RB 3R8XA 5DLPA 4F04A 3ANYB 2PKYX 4UTPA 2FPPB 2LZJA 1FNSA 3N76A 3RFTA 4R1TA 4I46A 2V0CA 1YAJA 3DNPA 1U7WA 5DULA 3OQVA 4GZMA 1XR3A 2A4MA 3DAPA 1MV5A 1PQYA 3R23A 4HAZA 3W5CA 2BFBB 3OLWA 3RVMA 1LU9A 2I87A 1QTQA 3D1JA 2Q8PA 4O4JA 2AMFA 4ALLA 2ZJAA 2LKCA 1RBQA 4OUKX 5F3WB 3CCVB 4YMSA 3H11B 3K0CA 5A5VA 2R44A 1CRWG 1A0OA 2DTDA 2G0AA 2FZVA 2GPBA 4D8TA 1CZUA 3LF2A 4KAJA 1KY4A 2KMLA 2PG3A 4EFNA 1PS0A 3O7MA 3HTXA 2I1LA 4GP9A 1Y4DE 2Z4TA 2ODBA 3AUTA 5FULA 1RRVA 2NYUA 3W4KA 1YVDA 3AVYA 2UVDA 1IB6A 5MFPA 4YPOA 4PC2A 5IS2A 3CO0S 4PN3A 1JEYB 1RI1A 3UK0A 3VKHA 1UKVY 2BEUB 1WPCA 4P86A 1TVEA 3UTCA 1SXJA 1E60A 2Z3ZA 3QVMA 2OESA 1DTWB 1NUSA 5FOUA 3U39A 2M1XA 4HB4A 3SF0A 3QY9A 3DO6A 4FZVA 4DS3A 5K01A 4Z4VA 2BMFA 2P9FA 2WWGA 3R0XA 5A0VA 1K63A 5C8DA 2BFDB 1DRWA 3I32A 4PZPA 1OZ0A 2CNLA 3CX8A 3GFRA 4XARA 2CSUA 4XSGA 1F7VA 2HPHA 4X84A 4CIYA 1QRSA 4HNUA 3UB4A 5HUQA 4MMZB 3WK8A 1JIKA 3MTEA 4JYMA 3ZR4B 1AQIA 4ZEMA 3ASZA 4QSMA 4F6CA 3KQHA 3LT0A 2ZRGA 4J1NA 3QFSA 3U0VA 4KO1S 4PGFA 5DX1A 2Q41A 3EQ9A 2BEVA 1F14A 1N6NA 3K09C 4FZRA 4O2AF 4JT9A 4P83A 2IH5A 1PT6A 3OMWA 3BCDA 4G6ZA 3DYIA 4F72A 4MEJA 2P11A 5AVXA 3AU9A 2JFFA 3HBAA 2N75A 4IOJA 1H4VB 4BNGA 3B9BA 3CKLA 4OQ4A 3LYHA 1G9TA 2BHLA 2G9QA 1LF0A 2A94A 3AETA 3OH8A 4CI0B 3HYLA 3O8BA 4YRIA 1GCAA 4HDKB 1LI7A 2VHZA 4F91B 2EKPA 2H08A 2Q1SA 1N6IA 2QRMA 4PBSA 1K6EA 5I47A 4O2AA 3NM6B 4FFDA 4QDZA 1CR0A 1JBEA 2ZYAA 4W99A 3W5JA 2XUOA 3ZNQA 4WOJA 4HMQA 3PA2A 1TU4A 3ENNA 5FOQA 3ZJ4A 2GUGA 1WRBA 3IP8A 3UWPA 4XGNA 3L7IA 3IDAA 4RWEA 3ZE1B 3DBHA 3FUCA 1ST3A 4N82A 2BONA 4XDZA 3ANTA 2NPFA 4J7CA 3W4JA 1UEXC 1UBTS 3I62A 3CCMB 1CZKA 1W25A 5JMPA 4HFJA 2JG3A 4GNRA 2PUFA 4QUJA 1MN6A 3RPEA 2I65A 2WDZA 1JJAA 3QKIA 4G1FA 4O0MA 4RSGA 4EAQA 5BQ5A 3HUDA 1PU2A 1ZK4A 3KNZA 4FFOA 2J33A 1M2EA 2K7FA 1CRQA 2Q3JA 1YITB 3ACBA 1G2IA 4E51A 5LMNB 1Q9SA 5E6UB 2BV3A 3OT4A 3TOCA 1ILWA 5GM2A 3C24A 4A0GA 1G4AE 1S1MA 3X2FA 1D2EA 4B3XA 1CEQA 2IZ5A 3RRYA 4EJ2A 4LDJA 1TUIA 5JU6A 4DR3B 1A98A 2BKAA 1AZSC 4K86A 1X9HA 4N18A 1U6JA 3GEMA 1K89A 4BO5A 1N9ZA 3MTAA 3OQJA 5BXQC 2DFNA 2JH8A 3S1AB 1Z15A 4UFOA 1Z8FA 5EFOA 4I0WB 1KS2A 2I7VA 5E9JA 4K1XA 3TQSA 3R3SA 2ON6A 3D3WB 1J2TA 1XI2A 1UZMA 4C4PA 4BVLA 1UM9A 1II8A 2PX8A 3UB2A 3V7UA 1P2TA 3V2UA 3JU3A 3WQSB 4XSVA 3SWWA 1CJBA 4M86A 2VR1A 3A2LA 3MWFA 3EQ8A 1ZH2A 4L3OA 2RD2A 3JR3A 3AFNA 5E9QA 1ZN8A 3DPSA 3P71T 3QVWA 2WKWA 3UHJA 1Q1QA 4W5JA 4TYQA 3EIWA 4Y8VA 5J1TB 3E7WA 4DT1A 4C04A 3SVTA 1XPJA 4IDBA 3DB2A 1N4AA 4OK3A 4J29A 1KWKA 4RZSA 3BY2A 4WGFA 2IBMA 4C6TA 1GAEO 3MJDA 4FMPA 5K0JA 2WM2A 4X3CA 3AHIA 2L2QA 1QH8A 3DMNA 3AGPA 3ZN2A 4X8OA 5EE1A 1E4EB 3LZ6A 4J0EA 1NX6A 2Z5FA 1U6KA 5D01A 1GILA 3QNWA 5DW0A 3GLHB 1DOHA 2MDTA 1TLLA 2QX9A 4BO9A 5AKXA 1HLGA 9GPBA 5I8ZA 1O0BA 3MLAA 3G0IA 3AR6A 1SOWA 3FKSD 4FXPA 5JS1A 3FNBA 2GEUA 4MPPA 4YBZA 3BHMA 5ECGC 3K31A 4F46A 4WFIA 4EEZA 3HS3A 5K2OA 1SK8A 3DAFA 1YNSA 1RYZA 3FUUA 2DY1A 2V7WA 4TV8A 4YRGA 4CKCB 2V31A 1Z0KA 4Y1RA 1GAJA 1MJNA 3HHPA 3WOHA 5C8YF 1W4LA 2ZI7A 3ED5A 1ULBA 5B55A 3OCVA 1Y9AA 5LDHA 3Q72A 4FHZA 5JW6A 3OZWA 1UDRA 3U2QA 3D8NA 1GDDA 4HAWA 2EIHA 1G6HA 2AG5A 4CTJA 1JLSA 1RACA 2CMFA 4A2PA 5CCEA 4HAUA 3MAGA 3NH6A 4B4VA 3B3JA 3BHNA 1WE2A 2XE8A 2NXNA 3CH7A 2O3SA 4CW7A 1NBME 3MJCA 3TTTA 4IMRA 2R8EA 4MI3A 1QZ3A 4Q3EA 9LDTA 1ARZA 2D7JA 3VR4A 4LGVA 1HKUA 2B69A 3GP5A 1QOZA 2QM8A 1JE0A 1I8DA 1ENOA 3LF1A 4JC4A 1G21B 3WDKA 3H3XA 2I2XB 3SC2B 3UKDA 1NRJB 1OFUA 5D3MB 2FDCA 5I9NA 1PSDA 2D0PB 1VYTA 3CZ5A 4DCUA 3E3LA 4J4BA 1L1EA 2PN1A 4RMNA 2QVGA 5CM2Z 1XD2B 3O91A 1QCCA 3KQKA 3OTHA 3RT1A 3KOUA 3HACA 5L4LA 4G5RA 2QD2A 4M49A 3L8CA 3B13B 4ZVSA 1PD1A 2J46A 3OIYA 4WOKA 1ACMA 3D02A 4DSZA 3CT4A 4DMGA 1M34A 2MINB 1RHJA 4LBVA 1EIZA 2NNLD 3ID6C 4H1TA 4N5HX 2DPXA 3RS0A 2XMQA 1PE0A 1QYDA 3T5CA 4QXPA 4MS3B 2ZSEA 1EBFA 1MFZA 2ZWOA 3BSSA 3KPUA 2WW8A 2FG6C 2BELA 2RGDA 3LL4A 1YJ8A 4XQCA 1F6BA 5CVUA 1ZJYA 4KIUA 5BVGB 1F60A 4ME6A 2B1JA 2Q3DA 4HMPA 3VR2D 4RZ3A 5BO5A 2QTZA 3E2PA 3K70C 1KXZA 1XBTA 4GI1A 4EG0A 1H05A 4QE3A 5DHUA 1VPEA 2OMKA 3AI7A 2HD4A 3CRW1 4UQLA 3DOUA 1Z37A 4QXQA 1MUUA 4OUDA 4RHTA 3O1JC 4PINA 2NAFA 1GGFA 2VNSA 3OE5A 3RIYA 3JD2A 3QFCA 3AF3A 2H2FA 5LDGA 5ALIA 3VZRA 3W8RA 5K0EA 1I1HA 4OV6B 1P9NA 5AOBA 2WAMA 5M7EA 1CR1A 3RRBA 4RF4A 5DWQA 1DO8A 1EHCA 4Z0TA 1A9YA 4Q9DA 3B8HA 1L5RA 3H05A 4WESB 3Q7SA 5CURA 4FE3A 4F2PA 1WBJB 2QA5A 4PC1A 3VZCA 4E0FA 1J9ZA 1EX1A 1N92A 1P2GA 5K0NA 1WB6A 5IX8A 3CMCO 4BN0A 5HZKA 1W19A 3PUYA 4IHJA 4MLPA 4QT0A 1CP3A 2GZ1A 4RD1A 1DRUA 3OCZA 2BM1A 1VJ5A 4NZMA 3T3OA 5IXYA 1KAOA 4HWRA 1CK4A 2GKGA 4LG1A 3VKUA 3WIUA 2ZXFA 3HMQA 4PSAA 3A27A 2QOEA 4WD3A 5AKLA 3M1AA 4EUFA 3FTCA 5BSXA 2VPZA 1SCUB 5JMOA 3RVSA 2IKQA 4QYSA 4XEUA 3STHA 1POXA 3U4QB 1QWOA 4BNZA 3SI7A 2JATA 3M7IA 4CLEA 3RABA 2HQBA 3H87A 3NHPA 5BW4A 3E35A 2D62A 1WXFA 2QZZA 3N8IA 3L4BA 5F33A 4AP5A 4BO7A 3Q10A 2QYSA 4IGIA 3TRHA 5AM3A 4Z7QB 2J3MA 1YKSA 1IEQA 1Q15A 3L02A 1KIAA 2PMBA 1UT8A 1V4VA 2O0LA 4V0QA 4ZA2A 3TXAA 4F4IA 1M5RA 1OJLA 4JA0A 3DZBA 1Y6QA 5T57A 1PL0A 4XORA 1J2RA 1RWQA 3HCEA 4J3JA 4O2BB 1FY2A 3E5RA 1II9A 5ALFA 3TWOA 2BE7A 5F7ZA 5JAUA 1K28D 4GW3A 1VQLB 1DBPA 3CLSC 4HBGA 3O8DA 1M8FA 4PQGA 3D26A 5JBQA 3H5RA 4L2IB 4NFYA 2IL1A 3OTWA 4I7EA 4QTXA 4EYSA 2VT6A 3AY6A 3D0QA 3PHHA 1HPLA 1Y5RA 1PJ4A 2QV0A 5AN9A 3LOQA 1MMFB 4GRIA 4N3CA 4U2CA 1EFHA 2IHKA 5BN4A 2OAGA 4JVMA 4H3SA 4ND3A 2C4TA 4YMIA 3DFKA 4A4DA 3KR2A 2VRCD 1ZKDA 4K9RA 4M8LA 1WVGA 4BVKA 3LW8A 4UHDA 2J7PA 3WNCA 1V3UA 4MW4A 3G2PA 4CDMA 3NDRA 1LSJA 1PD0A 2R86A 4N9WA 5HF8A 1GPJA 2BMDA 2RAUA 4N39A 3VOAA 5KB3A 4BGEA 2ONZA 2Q4OA 4JB0A 2DCUA 2IUYA 3H3FA 3OQ1A 3R3UA 1CC1S 3F4BA 4EHLA 2PGNA 2CNBA 2EARA 2XSZD 4M89A 5KYVA 1QVGB 1AN9A 1WXGA 3I6ZA 3KVVA 1TJYA 3MBOA 3D5TA 4MR9B 3TTWA 2QI9C 4HRXA 5LA6F 3UOAB 4DCPA 1YRYE 4OAQA 1KVTA 1NG1A 2QM3A 3EEYA 2R25B 3TRJA 4YR7A 3N3BC 3P4UA 3UYKA 5JY1A 2AJ8A 2F9MA 2YY6A 3GHHA 2ZR8A 5GGYA 1T13A 1REQA 4G0PA 5CFRA 2JFVA 1HQCA 4Q4HA 4F11A 7ADHA 2QPOA 1KFKB 3HUFA 4BNWA 3F6BX 4I99A 2V59A 3PPWA 4JQOA 4QKQA 3RJ9A 4KR2A 5EHQA 1QF9A 2A9FA 1ZD2P 1YFLA 4OJYA 5FOSA 2BDTA 3EXEA 4E1AA 2WB2A 3W5HA 2J5KA 4RL4A 3GMTA 4MA0A 4N0EA 1D09A 1J97A 1YE3A 1WP6A 4FSDA 4GE3A 2AV6A 1M5TA 4UNPA 3ZCUA 3BH4A 1THGA 1A5ZA 3IS3A 1VJ1A 3T3HA 3RUHA 4XI9A 4AZ0B 5KYYB 1JYFA 1JQEA 4QECA 4DNOA 2A5LA 5HZHA 3EZ6A 2F00A 4U6SA 1J2EA 2IT1A 2ZSJA 3N07A 3N86A 4FXOA 4L0CA 1M34E 4QOHA 4ARVA 5AVZA 4EHNA 1GZHB 1L7VC 2NTEA 2X4LA 3BXFA 3KAJA 2BC9A 4WN3A 4CDNA 3GNSA 4CMCA 3DE0X 4Q02A 2J09A 4M1KA 3D31A 4QX6A 1RZRA 4Z1OA 2YV5A 1ADYA 2QN2A 4QOIA 3O9ZA 3SY8A 3T4XA 2R6DA 2OCIA 3WLKX 4TS9A 1L7XA 4YT2A 5JSUA 1IHXA 1BS1A 4XN0A 4KKTA 1B0AA 2OAP1 3HEBA 3AETB 4FWIB 1ORTA 5AKHA 1YTLA 2UUAB 3QW2A 4K2AA 2QRNA 3WZMA 3T99A 5IAAA 5E9WA 4IZ6A 3GA5A 1JLHA 1YE8A 1PTKA 2D2XA 3PDWA 1JYEA 4WZTA 5FFMA 1K8AD 1HK7A 2R6ZA 2AT1A 1Z2DA 4JELA 4EYEA 4YAFA 2QTCA 621PA 1EXDA 2IP2A 4KWHA 1W6RA 2DEUA 4NC9A 2QTRA 5JAPA 3VNVA 2JCBA 4DHWA 4EW1A 3JWIA 3A2MA 4MROA 2CJFA 4P7BA 4PFQA 3FOFC 1U3UA 3V4LA 7YASA 1OA1A 3OCWA 4FDVA 4RQBA 1E1QD 4TS3A 4ESVA 4OJMX 2OLJA 4JI3B 1Y8RB 2ECFA 2FGKA 2PVSA 4LNUB 2GKOA 2DHQA 1OQAA 3CLUC 3TIGA 5MDHA 2PGLA 2NAPA 4ZEOA 2JLXA 4V3CA 2Q4DA 5HW0A 2VBUA 2RGEA 4YGYA 2JD1A 3VU9A 4WTOA 1LNSA 1H2AS 1NVVR 1KK3A 2ODTX 4C6SA 1AMNA 1BKDR 1PP4A 2K7ZA 3U61B 3B38A 2FG5A 1FX0B 3CTPA 3FUWA 4O8CA 3N05A 3E53A 3OQNA 1QOPB 2ZRFA 4KITB 3EMDA 3ZDZB 4KPYA 1MG0A 3EAGA 4G0ZA 4Q5IA 1QTRA 4ZAZA 2WFLA 2Q49A 3NTUA 1XLTC 4DV6B 2AXNA 4UZSA 1CR6A 3HNPA 5ARBA 2XDAA 1PVOA 1O9HA 1QLWA 4OP1A 4DNQA 3KKMA 3VO1A 1Q7YD 1F2UB 3PYXA 4E1BA 2V5UA 3VZBA 4D0RA 2WYOA 4AKIA 1GT91 1Q0TA 3PNQA 4JSYA 4JLOA 3FNQA 4Z5XA 1Z0JA 2JGAA 5JANA 2AZXA 4D8XA 2XZLA 3G7UA 5EHZA 4NK4A 4F2DA 1P7WA 1ZVQA 3HB0A 3NBUA 5LJIA 1JHQA 1KTIA 1XWFA 1H3FA 2AEMA 2CY0A 2H5EA 2OCXA 2WAXA 2A8YA 5DLQC 4C6HA 2FPIA 4RXMA 4U7GA 3R0VA 2YUIA 3KWLA 4RACA 2JGJA 2JI7A 3W2HA 5KNBA 3ROGA 1BDHA 2P2SA 4WKBA 1QE3A 4RVUA 2PRYA 1KOLA 4KQ6A 5C46F 1P74A 1W2WB 3CZMA 1BMDA 3KTAA 3PNYA 3N0RA 5ELXA 1X74A 4NFSA 1U8EA 4OOVA 4ZGNB 3LHDA 1FF9A 1UT5A 2D2FA 4Q19A 1U63A 1Z4LA 1J8VA 4HWSA 2ZXEA 2QJTA 4N3AA 1VOTA 4K9PA 4PZZA 4AWAA 4CM4A 4PNZA 2LDBA 3K1AA 3WICA 4HC4A 2JLAA 4X20A 4K9MA 3KOYA 4HN2A 4JGBA 4YJFB 5LMZA 4IIBA 5KCMA 3PI6A 3PFIA 1QHHA 5IT9A 2NUAA 1MO5A 1L5QA 2AQKA 2Y66A 2JGKA 1YS4A 4OQDA 5EE3A 4GLOA 5CDFE 4QTZA 2FPPA 2DPMA 3N2KA 1CS0B 4QAJA 2GBFA 2YDXA 3CCEB 2P5SA 3I1YA 1SHLA 1TIBA 3O3OB 2HZBA 4LJRA 5E6UA 4R0NA 3KKPA 5ALYA 4X7EA 3BM5A 3CR7A 3PU6A 2W71A 5H80A 5DS0A 3AW8A 4F9EA 4G2NA 4DJDC 4GSLA 1RRFA 1E64A 1H5NA 1MORA 2C58A 3BC1A 3MRXA 3UG6A 2WJWA 3W3AD 1O94D 4DR2B 4UNQA 4BKUA 2R7MA 2XMRA 4K26A 3IXQA 1IDN1 3UK1A 3DC7A 3O73A 4BE4A 5I51A 1L3CA 1M75A 4ZN6A 5LQKA 1M10A 1XA3A 2O2GA 1IM5A 2QMQA 4GUDA 4LDZA 1OB0A 5DU2A 3GJSA 2FA9A 1RYMA 3KZOA 2Y6UA 3QIAA 1EXVA 4DV5B 2B2XA 2XD9A 3H1EA 4JLAA 4TM7A 5AO9A 4MQ5A 3DULA 3ZDAA 1XSEA 1DTWA 4GDMA 2W7TA 4LYJA 2Q4TA 2C0CA 1H2XA 1NX9A 2X8WA 2X9LA 2YWDA 2QPAA 1G42A 3JYHA 3EEBA 1YJ9B 4I81A 1ZN9A 4JVNA 1YB4A 2NO4A 3CRRA 1TI7A 5B2ZA 2ZI4A 3U3KA 1OJ7A 1R74A 1D8TA 2IVFA 4RM0A 3LXRA 5EJFA 2I2DA 3KUDA 3NBZC 3OTIA 2CK3A 5HFAA 4LBYA 4ZZ3A 5GQSA 3HXMA 3QI2A 1T2NA 2Q3FA 4LXUA 2EZUA 4WNAA 3AVUA 1ECFA 4MVJI 3ULKA 4DA0A 3GQVA 2MYTA 1V37A 1Q7RA 5L7TA 3SC6A 5IULC 3LNCA 1FTQA 5CT8A 2QVCA 3Q11A 4JGGA 4MWBA 1IL0A 1FTGA 4ETIA 5EJ4A 4FFBA 4ND8B 2E4WA 1NQXA 2H1CA 2R11A 2YXPX 4MWSA 2YZ7A 2OQ2A 2O6HA 1IU9A 4G9EA 4W1SA 1M1XB 2BTEA 1JIJA 1P2SA 1PO7A 3AIOA 3EIQA 3NEAA 1E2BA 4OY3A 4BCDA 2DPYA 5DLYA 5CD1A 4MVJD 1E2NA 3QBDA 2C5AA 3KEGA 3HV2A 4CCWA 1T3ZA 2J0QA 1PSZA 2RFLA 5CDFA 4IHQA 1IZ0A 3IP9A 3RD5A 3VHQA 1YASA 1NV9A 5GJCA 1K7XB 2HLPA 4MRMA 1ZOLA 1JI0A 2PZEA 3P5BA 4N5LA 4OQZA 5B1DA 1Z4NA 3MA0A 2RBKA 3QLVC 3TLCA 4DV3B 3D1VA 1G3RA 2V7PA 8AT1A 1Y7IA 2BFCA 2GKSA 2MOKA 3HBLA 3HDGA 2WF6A 3Q7TA 4YTEA 4WVFA 5FXMA 1RQ2A 1LH0A 4N8DA 3PENA 3MWEA 3DOCA 4BLWA 2NVWA 4F8YA 1G2QA 1ZUD1 4JSTA 2J7PD 4UU8A 2CLIB 1KDPA 2DLCX 3RW9A 2JFHA 4KXUA 3MMPA 4R1QA 1LD3A 821PA 4WAUA 2ADOA 2WHYA 1IMJA 4DABA 3W2FA 4ZCLA 1EDBA 2C1EA 2PFSA 5EQJB 5FCDA 2PWPA 1P39A 2W4QA 2O4CA 1Z5WA 1Y33E 3EVDA 3HFGA 2WQ6A 3THYA 1OH7A 1CYEA 3NBAA 1LZKA 2HJSA 2JGLA 2OWDA 1F2UA 1JVNA 3FF4A 3K70B 5AW6A 2FPOA 4ND1A 1PZNA 5BN5A 2ZCJA 1XTSA 5BQXA 1GUYA 3IUPA 1AQYA 1YZFA 2GAJA 1ULSA 1CFZA 3OZEA 4K6GA 4AKTA 5JZOA 4W5QA 1XLUA 1G5FA 1V3QE 1B73A 3VKWA 4EKYA 1G38A 1W1IA 1LGYA 3DF7A 4AJOA 2FFQA 3RAJA 1T1GA 1Q74A 3BD6A 3V76A 1KC1A 1NSTA 1EP3B 4EW3A 3KB6A 4NQRA 4IINA 4TKLA 5K3DA 2PO7A 3MWDB 3FUVA 5DTIA 1UJ5A 3AUUA 2BBSA 2C2ZA 3FRIA 5DLEA 2HWWA 4ANFA 2W8BA 2W2OA 3DZKA 3Q38A 2LXNA 3H6KA 1AN0A 1MOQA 3QPDA 5IVKA 2PL5A 1D5WA 2PYZA 4LQDA 2QT1A 3L1IA 3F3YA 2EJVA 4CMIA 3KIPA 3FYTA 4NYJQ 4KYUA 4YRLA 2WU4A 1I8TA 1XTUA 1KA9H 1R9NA 1N2XA 1WB5A 2AYXA 4MVJM 3M9LA 4XLEA 1QIMA 2A1TS 1RM5A 4YHHB 1Y3HA 4MIOA 3FKSA 5CVDA 5A6VA 2R8PA 1TZJA 2X42A 2G17A 4FKMA 3SIRA 4DIOA 2QTAA 1MBZA 3ROPA 4AS3A 1X7WA 1T9AA 2ZTNA 3VPCA 3NAGA 5LKAA 1XD9A 1ZSVA 3ADBA 5CCDA 3OQPA 4KC0A 4HL6A 4IFIA 1BYIA 2CT8A 3FVWA 3MM4A 1QF7A 1OAAA 1SGWA 1Z74A 2REBA 4IFBA 3CPHA 2OBFA 4RZ2A 4Z4RA 5ERYA 1VA5A 4U7DA 3BTUA 4DWJA 2ZZQA 2OECA 1ZN7A 3DMHA 2ETVA 2PX4A 3OSUA 4S12A 2HNKA 5EMJA 1E2PA 4GR4A 4RHEA 4UM9B 1CVRA 1I3KA 1YJBA 2C9DA 2HSWA 2PZBA 2FQWA 1Z39A 2GN4A 1HL3A 4KUEA 3N2ZB 4L76A 3ZWWA 4JMPA 3ONDA 4JB8A 2X85A 1VQOB 2YKGA 2YYSA 2YJGA 3EASA 4KFRA 4IUYA 2AKYA 5H1YA 2QE7A 3BWDD 3I0NA 3NETA 3OICA 5J3OA 4CQMD 2H1HA 2PWYA 2BSAA 3WXMA 3VSBA 1FFSA 3IVGA 4IYRA 4RK6A 4EVIA 1W87A 3IIKA 3KXLA 4WCFB 3JALB 4N9QA 4KKSA 2HM7A 4GI7A 1TX4B 5EMKA 4XEHA 2Y4NA 3K96A 2WSSA 2I66A 3KXDA 1OAOA 3PD0A 5T4HA 2E4VA 4MGEA 1EWQA 5L3QA 5AI0A 2NTVA 3PBKA 3AR3A 4Q7KA 3WGLA 4OMUA 3WYNA 4ZIRB 3ZZ0A 3NWEA 2BGTA 2IHTA 1VHLA 4ZCQA 3JCZA 4EP1A 1TCCA 3LC2O 2ZYUX 1FOEB 1ZITA 3SZ3A 2ZTGA 3KOOA 4OGWA 5A71A 5CDSA 2J08A 3SBEA 4BUZA 3IAEA 4LOLA 2VF2A 1V6SA 4AIIA 1PVDA 1Y1PA 4AXBA 4N7MA 2X7HA 5LB4A 1PRYA 1WXEA 2CMGA 2K87A 3M83A 1FFCA 3HKBB 5L3QB 4H1UA 2YOFA 4MQEA 4TTRA 1F6DA 1IH8A 3V32A 2CD9A 5K3FB 1BE6A 2WZNA 4K8OA 2ZJYA 5FFNA 4KE7A 3CJRA 4NV3A 4F1KA 3SQOA 4DEYA 1VJTA 3HMKA 4RQUA 2JJYA 2FSUA 1DJQA 4KQIA 2H1WA 4BQEA 3OZCA 3STYA 3TVTA 2Z6AA 2E0IA 1KEKA 2IXBA 5CA0B 1F7UA 1EAYA 1E6CA 4MRVA 1O08A 2F8TA 1CEEA 1O87A 1GNTA 1G60A 3WK5A 5AW7A 1CQZA 3NQ41 4B31A 4HPXB 3VJLA 3L0IB 1HSZA 1M2NA 4D3DA 1Z25A 3GUUA 5TDHA 3SR4A 1WVIA 1JDJA 2O2XA 4CRWB 4XE5A 4GKVA 4RH1A 2OLEA 4MEBA 4DE5A 1UC8A 3OTQA 5IJZA 1TYZA 1L5YA 1U9ZA 3FBWA 4MQFA 5TPZD 4E31A 4JLMA 4NCBA 3OWOA 1ZPDA 2YTZA 3DT8A 4BQIA 1OXBB 3GLIB 1GGEA 1UBEA 2KJQA 4IHAA 2GVZC 1O4WA 4J8PA 4BP9A 3N8DA 1GTJ1 3I6IA 1FLAA 4CV3A 1ECGA 3HCBA 4JLPA 3O0DA 2YJ3A 3G0GA 3KQWA 1V16A 1PG0A 3BRWD 2IE8A 1L4GA 1VHTA 1YDGA 3MS4A 4TKUA 4ZCRA 2AQ8A 2XF8A 2XVMA 2AE2A 3E5NA 2XTMA 3MOGA 4LZPA 3TMYA 4P31A 1UFOA 1C5KA 1YZUA 4R51A 1KP3A 2WP0A 2FEAA 3QUTA 4Q18A 1R12A 5F9HA 3EGEA 2P41A 4X6YA 1NPDA 3SQDA 4LGYA 1V1RA 4UJ3A 1FJXA 2JI4A 3UJ9A 5KX5F 1ESDA 2RHDA 2ENWA 3QELA 4A5SA 4WLUA 1FC0A 4H7PA 1NOIA 4D57A 1UH5A 1UD4A 1U7UA 2JFXA 3ZOKA 3TECE 1EM8A 3F5DA 2F3QA 2WWWA 3BKWA 3GGJA 3K2EA 4YRZA 1H1LB 1G8HA 2IXTA 1X7GA 3DM5A 3O47A 5E6SA 5FNVB 4RMHA 1WY7A 4L16A 5EJ2A 2VYND 2YY7A 2OP0A 1RHMA 1ABFA 4LZWA 4MKXA 3SX2A 3G0HA 1U7OA 2FP4A 3LY9A 4ZYXA 3TFOA 5IVPA 3GEBA 3CMMA 4HBZA 3T6KA 4UREA 1XFDA 5E9AA 5HMLA 1UWVA 4HN9A 1K6IA 4TLDA 2BI8A 3D7KA 1IATA 3CNLA 3JD1A 3KEQA 4GSYA 2CFOA 2VK2A 1S8FA 4GPAA 1KQSB 2A59A 2NNWB 4JI8B 5BWBA 4D82A 2CKMA 3I5YA 1JPUA 2VTBB 2EYQA 4RPBA 1ID1A 1OV6A 1RYNA 2UZ4A 2FRVA 4A15A 1QGAA 2AG1A 1V96A 2ZR0A 1Q0HA 1CJKC 5I7HA 1B76A 2YMPA 2ZW9A 3HNRA 5CH5A 1R0RE 5JJIA 1ZD9A 3PC8C 5LYJF 4DZRA 3UWOA 4CF3A 1YA8A 1D1NA 1UEIA 3H94A 2H0RA 4FC7A 1UD6A 3E7DA 5IUNC 1EWYA 2ERXA 4OXQA 1TMOA 3VPAA 1O89A 4GAEA 4R54A 2O8NA 1ZKMA 2B2NA 1T6NA 2AL7A 3DBHB 1RKQA 4MS3A 3L05A 3HAGA 1MRSA 3OURA 5FADA 1QZTA 1XTIA 2ZYWX 1Y0YA 4KV7A 2AFIA 2ZU6A 3RSGA 5I7FA 3PD1A 1FK8A 3HZRA 5J2TB 5CVJA 1E1CB 1Q50A 4OPOA 3ND7A 3PUWA 4EPVA 2DR0A 4LRTB 2OT3B 1ONPA 5K20A 3WB9A 1PX2A 2QM7A 2W6ZA 3X1YA 1AKMA 3GLFB 4QBTA 2AFIB 2J67A 3BCUA 4Q1DA 4QIHA 5T67A 4E5VA 1FNNA 2NG1A 4EKEA 5CBKA 5EJ6A 3CISA 4I55F 3VZSA 3EXHB 3AO0B 2JIBA 1I7NA 3I1IA 1NLMA 3PEEA 2G4LA 3UWKA 4M9UA 1PJ8A 4OFXA 3OMXA 4GX2A 2ERYA 1NY6A 4M0PA 5TVKA 3UOWA 2IEGA 2PD4A 3D64A 1Z2AA 3S5JA 1QV9A 3WI7A 1WCV1 3TQIA 5EXTA 4HHEA 2CDAA 1EB8A 4IH4A 5LA6A 2YOGA 1T8WA 1RWNA 2AN3A 1DKOA 1YF3A 2V7EA 4JLNA 3T3IA 3TINA 4M9ZA 1FEZA 1CZNA 2PZKA 2ANBA 4JR2A 4MVJF 2GBLA 2WJ3A 3FHCB 1U9IC 3JXEA 5B4VA 4DDVA 4U9UA 3U56A 4ARBA 4BFYA 1B42A 5TEWA 3HN2A 3IO5A 2CYBA 2HBZA 4D3SA 1EI9A 2ES4A 1GVHA 1J0CA 1MAAA 3DCIA 3PQ5A 4HV4A 2QGFA 2X14A 3KQUA 2QQFA 2OKGA 4G8JA 2OMEA 3K0CC 2BTQB 4O4LF 5LNK6 2RKWA 5EPOA 1XV5A 4QEZA 2R79A 3BQ9A 3FGOA 1ZGBA 3PFWO 3WL3A 1KERA 1KR2A 1CU1A 2UZAA 3MS2A 4RD3A 1DOZA 3AF5A 2VWPA 2O52A 2YS7A 3NHRA 4KL8S 5JNTA 2DUUA 5H68A 2F4VB 3GNQA 3I2KA 3WFIA 2QNIA 4NBLA 4U7PB 4BDSA 4LTMA 1IN7A 2IHVA 2QNBA 4P0TA 1H2HA 2PCLA 3A3NA 3ASTA 5LZ4A 4JDUA 3SAJA 3EGXB 1E6WA 3LPCA 1JHZA 5HKOA 1EVQA 4OBXA 3OJWA 1YMQA 1VSVA 4Z0HO 1D2CA 1KI9A 3TR0A 2G1UA 3P94A 4Z86A 5HX7A 4M7PA 4BRSA 2BRUC 6ADHA 1JB1A 3CPEA 1JA0A 2JZNA 2V9PA 3K9WA 4K40A 3HDVA 3VR0A 2Z09A 1SOUA 4O0LA 1NPYA 2HQ1A 2IEDA 5HP4A 2WF8A 2JCGA 3HCAA 3OZTA 4W7IA 1E7WA 3PEFA 2VSYA 1GIAA 1H9AA 2FPUA 5KX5B 3I6BA 4FB5A 4H35A 3NC4A 3MINA 3QNUA 4TV9F 5ICSA 1JHAA 4PR3A 3EW7A 3RAFC 2YFQA 5AYVA 2WMNB 1IB0A 4FYMA 2B5OA 1US8A 3T61A 3AR2A 3L2OB 3ZLUA 2FXIA 4D4LA 2W5UA 3G5LA 1T0JB 2VZEA 2HBQA 1Q7TA 1SNYA 4C21A 2E2WA 3HXPA 3ZWAA 2JI8A 3LG2A 3Q3GE 3R1IA 5EGSA 1QOQB 3UK7A 4RJJA 4PABA 2RKOA 4LYEA 2SICE 4HAXA 4UJ5A 2IXGA 4MH0R 2JKZA 4G65A 4GMKA 3DEAA 1CP2A 4D81A 2HIGA 4IFEA 2ZOSA 1OZFA 2AI1A 2W58A 3EXAA 2A1UB 2VPPA 2XNKA 4KH0A 5L7WA 3L1UA 3VDQA 3H42B 3R44A 3TB6A 5EJ8A 2AX4A 1X7ZB 2WOOA 4D9BA 5FPPA 3H2BA 3EC2A 1WDKA 2ZVQX 2O6LA 3FCCA 3RKSA 4TKVA 5K3BA 5DM4A 4P82A 2DJIA 3WKCA 2GCNA 3C87A 1O95A 3BK1A 4P0PB 2RHTA 2BEWB 5LYJB 3GCWA 4LXYA 4MSUA 1M8JA 3GRZA 5LU8A 3FW1A 1TEXA 1NXSA 3PYLA 1O6CA 4CQMB 3PF9A 4ZDWA 3RVBA 3CF6R 1I2MA 4Y6PA 3GF4A 1IJBA 1RU3A 2AFHB 4QPNA 4RORA 4CODB 3DS8A 3QKSB 3ZW7A 1E4OA 4CCYB 1NVEA 2ZDQA 2W11A 4UOEA 1IN4A 1X3LA 1EA7A 5ED4A 1VLZA 1VTKA 3REOA 2FPGA 2YUTA 4FQ8A 2I6UA 2QB5A 4HWOA 4IV8A 1ZM3A 4L4XA 3SJZA 3ZU3A 4B8WA 4B73A 3WHPA 1RPJA 3A8JA 5DFAA 2VBSA 1QRAA 3B2QA 2EL9A 4Z4YA 1V2GA 2AIRA 3AIMA 4WFJA 3WLAA 4ARUA 5LPNA 2FHPA 1PJBA 5IJ9B 3TF5A 4D4HA 4ER6A 4CFZA 2OHVA 4WJLA 1O96A 2VHTA 1NA5A 2WJPA 3AJAA 2PA0A 1E9RA 4B2PA 4KHPB 1BO6A 1M6VA 4FCTA 5FA8A 2DTEA 1L5OA 4J7AA 3UFBA 1I7QB 2J07A 2GCOA 2XIQA 3QYFA 4IJWA 5GOTA 5MHTA 4MLCA 2ZZKA 1ZR2A 3VBEA 4PYKA 5IJXA 2C8LA 2IYNA 3GXOA 3SYRA 2AYYA 2Q2WA 3Q5DA 4P36A 5DCUA 2JAOA 3B1VA 3NR2A 2MSKA 2RI1A 4LNUA 4BFCA 3BWEA 2Z5VA 1NTOA 2CXXA 5HA5A 1T5DX 4EELA 3BIWA 4ZQFA 3ZV4A 4B87A 3TSZA 2I9KA 2ROQA 3D4OA 1WJGA 1VLLA 1XRRA 1RP1A 2RGNC 3A1WA 2JCXA 3IRVA 3NYWA 3P9QA 3WP1B 3ZWYA 1DBQA 4B43A 2CLCX 3H4VA 4Q3NA 4R2JA 1HDCA 5DGTA 5KQMA 2X6TA 1W0KD 1Q86D 1M2GA 2XNHA 2C9BA 2O7NA 3PC8A 4XUCA 1WZIA 1S9DA 1SC9A 2GAOA 2ESRA 3A9SA 5D6OA 3WGZA 4QJ3A 3VA7A 2NXWA 4WL0A 2PRKA 1A1VA 2ARKA 1UJBA 3ZD6A 2I2WA 3T51B 1Q2XA 2IY9A 2OFOA 3MSXA 4CKBB 3RJTA 1TO2E 4JLUA 3DT9A 4QOGA 3LGSA 1TGVA 1MD9A 2P30A 1CB7A 3Q39A 4AJ9A 1M7BA 5FBZA 1C1DA 4TSKA 4DJ5X 1A2KC 3KQMA 3OX1A 1PL7A 4G41A 6AT1A 2CL0X 1R7RA 3BIXA 3DEYX 3EG9A 3AMVA 4FYJA 4PICA 4RIGA 2OHGA 4ROSA 1ZJJA 2RHBA 4GBMA 1VHJA 1MQSA 4CF6A 4ZV4A 4EKNB 2H4HA 3I39X 3LA6A 3DOFA 4CE6A 1QIHA 3T3MB 1XCMA 5AM1A 4BNLA 2ZAYA 3OZAA 2F3UA 3PVDA 4UBLA 4XQ9A 3NKVA 5FLKA 3RV3A 5AUNB 3DMPA 3Q2OA 3D6NB 1N9GA 1KO4A 1NHGA 4DG9A 1UBUS 1ZGGA 3GEPA 3PLNA 3FSJX 4IH1A 2BR5A 5EUCA 2Q3EA 4R1SA 4TV9A 5DBOA 3RS5A 5IXJA 3EWNA 3K0FA 3G59A 2Q3MA 3DC2A 2O8EB 2QL5A 3DLHA 1GUZA 4NG5A 1EWTA 1GGHA 2IGBA 4MXDA 4BFLA 5IRCD 3O94A 4QVKA 4GM0A 2UZIR 4ENUA 4OCZA 2PMCA 1G17A 2GEFA 4ZJPA 2GBLC 3HCDA 2VRBA 2D5LA 4Q1EA 1FSSA 3VHXB 3M6WA 5BV2P 3AK4A 3L7NA 4BO0A 1E66A 2FJ0A 3DZCA 4B9EA 5BORA 2BI4A 2ORVA 4Q4AA 1HQDA 4LISA 3VNSA 3W1EA 1Z7GA 4N8SA 4QFBA 4WFKA 1P73A 3WLIA 3VQTA 5CA1B 5IVHA 4GOXA 4G0QA 5A9SB 3QBJA 3ZGLA 4EG5A 2Z6QA 2FKNA 3GJ7A 3I2FA 3TLAA 3MXOA 4DNXA 3Q8MA 4X7BA 2EP7A 2D1TA 2O2JA 2HRRA 2PXXA 2V6BA 5FTMA 1U81A 1KJ9A 4KCGA 4CR6A 4ZJZA 1XUOA 1IWPB 1VE1A 5B12A 1HZJA 3N2YA 4CKZA 5EIXA 1P4JA 3STUA 4Q4CA 1HA3A 2PBLA 4BLSA 5JJBA 2ZPTX 5KYKA 3WQQA 1RJFA 4LIPD 4DDUA 1QP4A 4CT0A 2GNPA 1DJLA 1YJ5A 1BJTA 4I50B 2OHFA 1A4UA 4MUXA 1KEEA 3D7SA 4I4TA 2X13A 1P4RA 3TCNA 4RJIA 5E95A 1DHTA 2R1VA 3VO9A 4COKA 1P4SA 3JQ9A 1XALA 4DKJA 1QS0B 3PR1A 5FO0A 2ZBFA 3H8SA 1R9MA 4HH4A 4I4IA 2PUCA 2A0UA 4AZ0A 2JH3A 1VIMA 4MUYA 4B46A 5KYYA 4E2YA 4RX1A 4UE6A 4BXOB 3WKEA 5KNCA 5FLXA 3H86A 3TZLA 4ITVA 2D13A 2EP8A 1P9LA 2R7LA 1JG4A 2SCUB 3KHTA 3NJRA 3OIFA 3H83A 4BZWA 1OU4A 4UHHA 1W48A 3F90A 4B3SB 4MQ4A 4Q9IA 2K2QB 1Q19A 3TTVA 4CGYA 5TQJA 3ILXA 4ENPA 3A9TA 5AP9A 4TQUS 5TQ0A 3EVCA 3ZVMA 5BSKA 4D5GA 4AYWA 1TGYA 5EEHA 2GR9A 1NUTA 1FRNA 3HN6A 5I9LA 1SHKA 1QQAA 3DMRA 2OFXA 3AWDA 2VPQA 4YA6A 3SZLA 3WSWA 1XTPA 2RJ3A 3H97A 4G5HA 2R00A 4CF7A 4GBED 5JNRA 3UW1A 4QLBA 4PZ0A 5EZ5A 1VG8A 3C5EA 3HYRA 4EJ0A 1Q7CA 5ESXA 1EMDA 3QVUA 3FROA 5JFTA 5JYBA 5KC9A 1RAEA 2BBTA 3R20A 2JL1A 4NIMA 4CIXA 1MB9A 4P98A 4IDGA 5T3UA 2C8JA 1EFVB 2PZGA 4GLJA 4M36A 2AFRA 2JFOA 5REQB 2Y76A 1KWGA 3Q3JB 1KNQA 2QPTA 2X40A 2V8BA 2AD5A 3JRWA 4LJ4A 1YR2A 3OA0A 4MS1B 2QVXX 3WK6A 1M2FA 3GN2A 2H7VA 3DTVB 4LOAA 4KN6A 1JW9B 4JI5B 4YFVA 3T7KA 3JVEA 1IEWA 5C3UA 3V9PA 2R8OA 4EGQA 2PZAA 3SVLA 4TZ0A 5DTQA 2P3OA 1DRKA 2P9BA 3H75A 4K2HA 4UUNA 1YS9A 4H9GA 1K9VF 2C3MA 2QJFA 3K8OE 2HF7A 1JU9A 3DM9B 2C7OA 2A9QA 2ZIZA 5DT9A 5EWJA 3TLMA 1RXSA 2XHZA 2Q27A 5IU6A 2WK1A 3KFXA 1X1DA 3BQNB 4D9IA 3KSDO 1WSBA 5CU7A 3K9FC 1MX3A 3GPIA 4OKNA 1Z4OA 1OLSB 3LGXA 4KQXA 3CPJB 5TT1A 3SJCA 4D45A 1P0CA 4R6WA 4LVOA 3DOJA 4Q3CA 2QIOA 8ADHA 3TPFA 1HGXA 1QHHB 4WW0A 3V1TC 1RXIA 4ZYTA 2O5RA 3L5OA 3ZTYA 2OBTA 4FI3C 3WXBA 3C3PA 2FWIA 3LHSA 3M6FA 4FT2A 3ZW8A 4OJKA 4ESOA 4EYQA 3E2MA 5JRDS 3PXDA 4DJTA 2WD9A 4NZPA 4I1PA 2FG7C 2XH8A 5B7PA 1WB9A 2NO9A 2O8BA 4IJMA 5FEUA 5HUJA 2NQ2C 5SICE 3ZU5A 4UFNA 3VOSA 3EXFB 2W2PA 3D43A 2ZAIA 5E6SB 2WD7A 2J9FA 1L8OA 3WLSA 3VOBA 4GGMX 2Z1NA 2IOFA 4QM6A 4LI3X 1HNZB 3DBOB 3HYTA 1TEVA 3HPRA 1FLVA 1GDHA 2AA3A 1AF7A 4UULA 2IUFA 5AKJA 2Z2YA 4QJ5A 3QFRA 5GV8A 1K73D 1ABEA 3ABQB 4TTSA 1YIDA 4YI5A 2X2FA 1XEXB 1OGJA 3QJ5A 3MHTA 2BFEA 2HBRA 3I9V1 2D3NA 4MWEA 3R74A 1H93A 1ZGZA 2VYVD 1VE9A 3HWWA 4O4JF 5C81A 3LWNA 2RGRA 2XTZA 4JY7A 1Q7EA 2CB0A 2WP8J 4KMOA 2QMHA 3UMBA 4E88A 2O54A 1HMYA 1DBSA 2WJZB 3NEJA 3RTBA 3SDBA 3V8BA 3ZQ6A 4L5JA 4JQYA 4WX2B 2G80A 3KUUA 3OU2A 3N6XA 5T3YA 1U2PA 3WL6A 4XJTA 1EUYA 3FZEA 4MGZR 4TUYB 4XX0B 4XDGA 2WAYA 4DCVA 2ZJ2A 2GK7A 3H6GA 3R3JA 4I50F 2PH5A 3GMDA 3I01A 4EUSA 4CJXA 3NXSA 4E5SA 1W46A 3VYVA 1QZUA 4PSUA 1X1EA 2QX4A 4NU5A 4CNQA 5IM4A 3SEQA 5HQ3A 4Z9BA 2VJQA 2XXBA 4I9UA 2GJ8A 4K6MA 4BMZA 5J5CA 3IEMA 1E0AA 1KPHA 3EOZA 3O75A 1WMBA 5HJEA 1JT2A 3GU3A 3ELYA 3REQA 3RYTC 5I4CA 1I10A 4HLUA 3QUSA 4KZPA 2PRIA 4UBMA 2GJSA 3B82A 2GCEA 4RWZA 4TXNA 4UEJA 1SCQA 4FOLA 1E3IA 5EQFA 1E1CA 4UASA 1HRKA 5CA0A 1CLEA 1T34A 1VA4A 1U99A 4Y67A 4TGLA 4LQLA 3WMXA 3QEAZ 3O4FA 3HXLA 3GK3A 3CHYA 1M2VA 2C5BA 3IQXA 1X6VA 3SXPA 3TNDA 1EP2B 2ZYHA 1VYVA 4EB8A 4G1EB 5G0UA 4YYZA 2QBYA 2VQ6A 5KOJA 4FW8A 1GSAA 4DDHA 5J4YA 1C0IA 1ZOSA 1KZLA 1RLIA 1U0JA 5JNUA 3K8YA 1IUKA 2XNJA 1R0BA 3P0HA 3RUIA 4YRMA 3TJMA 3BWXA 1AKQA 1J99A 4J7XA 2TMKA 3T3PB 1N1MA 1ZQ1A 4Z4FA 2O8FA 1N57A 3L0SA 3C16C 2A5FA 1DG1G 3Q3IA 4Q37A 1I2ZA 1WUIS 4LOJA 4XIGS 2BFWA 3TCKA 2J5RA 3KTDA 3LA8A 1TEZA 3JD3A 5EYPB 9ATCA 1PFYA 2M9MA 3TFQA 4CMHA 4GP7A 1CRPA 1V95A 1A04A 3UBMA 4FD3A 4DIFA 4YYEA 5C1DA 4PO1A 4RABA 4KUGA 2PBZA 2QQ5A 2I4LA 3M6IA 1Z17A 3Q1KA 3QLJA 4ZI7A 3UNXA 5AW4A 2RK6A 4QUIA 2C2BA 1VXOA 5E2AA 4AICA 3C14C 4ND6A 2AN1A 2PZFA 4PZCA 1R6TA 4AKGA 2HCBA 4DK0A 3AI2A 1UFQA 5BURA 1JG3A 1YB1A 3HCCA 4B34A 5CCXA 2HYIC 1DEKA 3Q6RA 1XKQA 2ZJ1A 3C3AA 3D8SA 3VR3D 1J2UA 1GNPA 2ZIWB 5F23A 3EZNA 3INTA 4QPJC 2J5BA 4DM3A 4O08A 1X80A 4EA8A 1H1LA 1U9YA 2BFNA 3AFGA 2VPXA 1P1FA 4YI3A 1XQWA 5EXDA 5KDOA 1Q22A 4RVNA 3O95A 1Z8DA 2YCLA 4RXUA 3PNLA 5IWCA 3G2KA 1ISRA 4GRAA 4YDSA 4YRPA 4BLQA 5ERXA 5A8AA 3EGWA 2XLBA 1EK5A 1GLNA 1OBCA 1LBHA 2Y1EA 1MIOA 4F1WA 2Z04A 1R5JA 5K8IA 1P18A 1XZLA 3E5HA 1O58A 2FE4A 2C84A 3OJFA 4FMDB 4JEHA 5FWAA 4JROA 4XKJA 4JU8A 5MN4A 3FYCA 4OOSA 4IIGA 3P9IA 1CUEA 3GAAA 4MJ7A 2Q6IA 5CTJA 3IJEB 3TBKA 3TTXA 2FJUA 5BPHA 4N7RA 5FNZA 4CQJA 2R84A 2KI5A 1JJBA 3V46A 2IS4A 2BM9A 2GD2A 2V6MA 3DV0A 3KAKA 1XAHA 1W44A 5AVVA 2B20A 1U0OC 3LD9A 1RDFA 2QP4A 2GVNA 3B12A 2AK3A 4Q00A 4KO8A 3T7CA 3KZCA 4B82A 1H2EA 1H8HA 3CXRA 1WNFA 3RYFB 5HGXA 3I2GA 1COWD 4D44A 5FWXB 1PV2A 1VMKA 2XCLA 3T38A 4Y2SA 1NVVQ 2O2HA 3BILA 3FXAA 3S1AA 1B6GA 4PS0A 1VKOA 3DQQA 3HLKA 3IEUA 1WHTB 2XOEA 4M1TA 1EDDA 1DZIA 1XROA 2FSGA 2PLFA 3A06A 1QUEA 4MZDA 3TUJC 4TUYF 5HTOA 1O6BA 4LMPA 2QZJA 2NQ8A 3LXMA 3COJA 1VM6A 2X4GA 2QD4A 3OLXA 4PTYA 4X07A 1N77A 4XM1A 3ZWBA 4ZZ0A 5LYYA 3NCHA 4BMOB 1DVRA 5EMHA 3LP8A 2VI5A 4DFDA 1WUHS 2AJBA 2NQTA 2W83A 3B48A 1NIJA 2HLDA 1U2DC 2Z5LA 3DH0A 2X8BA 2QMUA 5AW2A 3NIGB 2BGGA 1J6UA 1VMEA 2VSNA 3NTQA 2B9VA 1XZGA 5DOVA 3FFTA 1UWLA 2IZ0A 4LMAA 4TUYA 1PT5A 2HHHB 1FUUA 5F35A 4Z7JA 1U0HC 4NK5A 3WQHA 3MAAC 2I33A 1TUGA 3K4PA 1Z83A 4RK0A 3I12A 4HWPA 3PCRB 4I3GA 3UATA 4D9NA 3FVTA 4DYDA 2J3QA 3PJDA 4BLTA 3LYUA 5JYCA 5AHOA 2LCFA 2P75A 5JPCA 4IGKA 3CN7A 2V7VA 1JPNA 2LNDA 1Q82D 2H1IA 2H7YA 1N3LA 1W76A 3BMOB 4PANA 1L0BA 1Q12A 3OZ7A 1UJ6A 4ER0A 3IMGA 3LVBA 4P80A 3OPVA 4KXYA 5E8RA 2ZL6A 4EQ6B 4NXNB 2GETA 3GUCA 3MF4A 4KWTA 5TMPA 1P45A 5H8WA 3IIJA 2GSWA 1XTVA 1OHHA 4RLSA 4Z9FA 2P9ZA 1ZUNB 3HN7A 1NYTA 1NQTA 2QN1A 3PUJA 4E46A 3RKUA 4F5YA 5T4FA 2GJ4A 2A2ZA 1W35A 3HDYA 4KLRA 3QVSA 4RK5A 1NE2A 4AG3A 3AYXB 1D6MA 1QVWA 3ISTA 1EPUA 2GCGA 1VECA 2C88A 4NBNA 4EGFA 3B7PA 2CLEB 4JBLA 4ZCSA 3KSUA 3N7AA 4DDKA 1L6IA 1COZA 2ZUFA 5BV8A 2HSEA 5DP2A 1Y7PA 5HJ5A 1Z4KA 2FV8A 3DKVA 4G01B 2V6IA 3RFXA 1MEJA 3L6DA 5REQA 2JW5A 1C8KA 3B6KA 4Q3BA 4LRSB 3RGGA 2BI7A 1HDIA 1JFRA 4GO1A 3WLNA 4F3TA 5F9MA 2VH1A 2ZJ0A 3NHSA 3Q98A 4WLVA 3GPLA 1T5HX 2OYCA 3FLBA 2H8KA 4NG4A 3TRIA 1MDBA 1QRRA 1KAMA 5HCIA 1YDMA 2H5IA 1WORA 3ESYA 4W7HA 3RS8A 1RQLA 1KYZA 1QGZA 1UXGA 3M3HA 4DB4A 4Y2VA 3SS7X 1E3MA 3WS7A 1ZR4A 2PUHA 3OKAA 2ZJ5A 3H1PA 4YGXB 2GHIA 3UGTA 5JHGB 1KP9A 3FG9A 3WAJA 3OZFA 2PGIA 3HKBA 3I0MA 4P3XA 4Y2PA 3PJGA 2HEIA 4GM4A 4ZAWA 3VNBA 1JAYA 1R0KA 2CJWA 2ZB3A 5CVEA 1E61A 2Q28A 2PYDA 2Z6VA 1L4LA 2C3OA 3WRYA 5K05A 3UT6A 2AMYA 2R1TB 1H9CA 5ICFA 4XWGA 4YJ2A 4J76A 1C7QA 1OBVA 2SBTA 4JUDX 1UXIA 4DEVA 1UKEA 3HA3A 2I8CA 1Y6JA 2PXHA 2PWBA 4G09A 3LQKA 4J90A 2R47A 2IP4A 4FJ1A 4BNDB 4B2YA 4DR5B 4MULA 4RO0A 2GHTA 3C3CA 5EPEA 2QLNA 1KJJA 2OUIA 1I0ZA 1IOLA 1NVGA 3O8QB 3PCTA 3PKZA 4HGYA 1SXJB 1U8TA 1P4AA 2ZM5A 2DE0X 3CKKA 5TARA 4B4WA 3KB8A 1UM8A 4OHCA 1OC2A 1X9IA 1G66A 2CVOA 5T6BA 2AE1A 1T1SA 2V9CA 3P0IA 4L73A 3NHYA 4N0DA 3SSOA 4BX3A 5JJKA 5ESDA 1XNRB 2AR0A 5ECWA 1CQJB 4PTZA 5GWXA 4N0PA 3JWJA 3BSWA 4R4JA 4RV5A 3ZY5A 4EARA 2WPDA 3JQAA 2X1VA 3RU3A 3IPLA 4AU1A 5C5EA 1DAMA 4ZT4A 5IMSA 2DM6A 3GR6A 3B3QA 4C08A 1OLXB 1NDHA 1PQPA 3E61A 4K6OA 3A2NA 4AI6A 2RSLA 4ML3A 4B80A 2I80A 4NYMQ 5I8PA 4N6OA 3KALA 4X1IA 3TLYA 3V5NA 3ZK9A 1Y3CE 3ZXXA 1UK9A 4EKDA 1BCSB 2XNSA 4DUZB 3HUUA 1ML4A 1Z6PA 3W34A 2IHYA 2OK8A 3A3GA 4RM2A 4B7CA 2HWUA 1PR1A 4HH1A 4EF4A 4DN6A 4RMIA 1T35A 3TE6A 4C7JA 5KBYA 1BE0A 5G2OA 3T4UA 4KVZA 3BWBA 1FMCA 2V58A 2BHSA 3AKDA 3KYDB 3N74A 1MT3A 3ASSA 2YWXA 2CXOA 4IIDA 4L8GA 4MVJG 5HRUA 1IPEA 2OO7A 1T9KA 2PNJA 3G7SA 5EWMB 1U3DA 4CLHA 5DKFA 4DQUA 4S1VA 1VBMA 3F46A 4XQGA 1T5TA 1DUVG 2HTFA 1N9GB 3F7MA 3G3EA 3LU1A 1GARA 1YBAA 3VPDA 2IEAA 3DLIA 1JIUA 3M9WA 4Y6GB 2ZR9A 4QVAA 3ZJVA 2OKCA 3E3OA 3R09A 2WTAA 2W6JD 5DHSA 4BQRA 2D4AA 4MAMA 4G0XA 4U1RA 2G77B 4H7FA 3ZHQA 3KWJA 1CY4A 2XI4A 1RWBA 3JU4A 1PJ5A 1GV1A 3IMKA 4ZHQA 1R9GA 3JQ8A 5KYTA 1KSHA 4L57A 2QUHA 4ZQIA 4AKEA 3PZBA 5AJZA 4U63A 1C3LA 3TIFA 1NVBA 4UC0A 4TS4A 3HPQA 2WAOA 3M1YA 5J5VA 1JHMA 2A14A 3JZIA 3IT1A 2VHQA 3LDHA 2XB9A 3HI4A 4NYIR 5FBQB 1AK9A 1KO7A 3BFJA 1TYBE 4IGFA 3FCUB 1XAIA 1FFDA 1USUA 1M1ZA 2B1QA 4XTRA 1QNFA 2ZYVX 1BC5A 4MKFA 1RYBA 2Q6LA 4ZOLB 2ZUSA 3UF0A 2QAGB 4JUIA 4OU4A 5D5HA 5SYAA 1FW6A 2QRQA 2FSIA 4C6TB 2VJKA 1XK7A 1W4ZA 2J6HA 3CUKA 5ENVA 1SHZA 1E2QA 3R3ZA 4ND8A 2B92A 5IAKA 3HR7A 4IL5A 1FFHA 3BMNB 2BGRA 3KVNA 3KDPA 3MXTA 4BTEA 3H13A 3KPJA 1RPTA 4FEGA 6NULA 3CB4A 1KEZA 3TH5A 4DWWA 3OCYA 1T0UA 4EYKA 1B7GO 4XLHA 2NVOA 3DNMA 4GT1A 4FHEA 5HQJA 4C0KA 4G5FA 2JAHA 2DBRA 4KBFA 1SVMA 2CCKA 3U62A 3GT7A 1ZCFA 3LHIA 1JSRA 2XOXA 4PRKA 2G71A 5TQ2B 3LO8A 2I71A 1ZCJA 4MCIA 1DDOA 4XVHA 1F9AA 4KR6A 2XNCA 2OTJB 3O2NA 4UU0A 5AHXA 4IO0A 2XGSA 4A91A 1XLVA 1TZCA 3C8HA 1G5PA 4YJGB 3AEYA 3OU7A 2W9XA 2R5FA 3PQCA 1OFGA 1UDBA 3DYBA 5EKDA 2YBDA 2XXJA 3CVJA 4RAOA 1S4QA 2Q7XA 4YRRA 3WJ7A 2AVDA 4MP6A 4ECAA 1UBSB 3BTVA 1QDUA 2IPMA 3JYPA 3HRHA 4HOYA 2OV6A 2HT6A 1KJWA 2X0DA 1Z2CA 2D06