1QX4A

Structrue of s127p mutant of cytochrome b5 reductase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
270
structure length
264
Chain Sequence
HMITLENPDIKYPLRLIDKEILSHDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKEAGGKMPQYLENMNIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQSEKDILLRPELEELRNEHSSRFKLWYTVDKAPDAWDYSQGFVNEEMIRDHLPPPGEETLILMCGPPPMIQFACLPNLERVGHPKERCFTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-cytochrome b5 reductase
publication title The structure of the S127P mutant of cytochrome b5 reductase that causes methemoglobinemia shows the AMP moiety of the flavin occupying the substrate binding site
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 66
structure length 264
sequence length 270
chains with identical sequence B
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2003-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qx4A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qx4A02
1QFYA 3QFRA 1QUFA 3W2GA 1ZUNB 2QA4B 2DEUA 2VNJA 3JQRA 1VQLB 1FNBA 1GJRA 2DCUA 1EFCA 4B47A 3WXMA 3CCJB 1E64A 1N8RD 3MCAA 2R6HA 1VQPB 2YWHA 4TMVA 1QVGB 2BGIA 1DG1G 3LO8A 1Q86D 1CNFA 4RJLA 1A8PA 1N0VC 1QFZA 3PENA 2BSAA 1OB2A 1FRNA 3W2FA 4BPRA 3ZBTA 1AIPA 1ZM9A 3VMFA 4YHBA 1FRQA 5THXA 3ES9A 4IW3B 3CCMB 4YALA 1VQ8B 2C78A 4ZGQB 4ZV4A 1JJ2B 3CCRB 1SKQA 4Y7CA 1B23P 4EH1A 1NDHA 1D1NA 4ZCLA 1YJWB 3AVWA 2YWGA 1E63A 2DY1A 4PC1A 3V76A 5GV7A 3CCEB 3W5UA 1KK3A 4AC9A 4DQLA 1AMOA 1YITB 4N3NA 1W35A 3CB4A 4TMXA 2XEXA 1IJFA 4LBVA 3WNCA 3U2QA 4Y9RA 1DDGA 1KK2A 2CNDA 2X3UA 4U9UA 1B2RA 4LC0A 1QVFB 1VQ5B 3MHPA 5HXBA 1FNMA 1TUIA 2QDXA 5H5JA 1R5OA 3OJWA 1BX0A 4RD0A 3WNDA 1CQXA 2BM0A 1HA3A 2C77A 4AF7A 2QTZA 3CRZA 3VNUA 2RC6A 2PLFA 1YI2B 3OW2B 2EIXA 3CC4B 1VQ6B 3B78A 1KJZA 4B4DA 4G1VA 2HMAA 1R5BA 4FN5A 4P6VF 1VQ4B 1U2RA 2QEXB 1H85A 4FWTA 1DDIA 1BQEA 3AVTA 1Q81D 5GV8A 2GQFA 1R5NA 1W34A 1KK1A 1EP1B 4LBZA 1GR1A 3VO2A 2B5OA 1EP3B 2AHOA 1QUEA 1KTVA 2ZITA 2DERA 5JBQA 3CMEB 4YAWA 4LBWA 1WDTA 2BMWA 4YAOA 1JNYA 3AVXA 2BV3A 1M90D 2B7BA 1TLLA 4P3YA 3MMPA 1EP2B 4AF6A 1M1KD 1KK0A 1VQKB 4ZCIA 4ACBA 4PGOA 3OZUA 4TMWA 2VZLA 3ZC3A 4C43A 3ZZUA 5H59A 1IB0A 3G71B 1JB9A 3CD6B 2HCJB 3AVUA 3QE2A 1VQOB 4R71A 2CRVA 2D74A 2OTLB 2QTLA 2BVNA 3WYAA 3W2IA 3I56B 3W2HA 3AVVA 1S0UA 1JA0A 3CXCB 1GO2A 1ZM4A 3P27A 3E1YE 2VYQA 3AVYA 3B82A 3CCVB 1VQ9B 1QGZA 3J81k 1QG0A 2QN6A 2BGJA 5FA6A 4G5GA 5TV2A 4ACAA 3G6EB 4PC6A 1VQMB 3LVBA 1CNEA 1IJEA 1G7TA 2EFGA 3FJOA 3WBJA 1Q82D 3CCSB 1F20A 5TR9A 1EWYA 4NBSA 1QFJA 3A1FA 3P26A 3QFTA 4J0QA 1DARA 4RD2A 3QFCA 3CCQB 3AGQA 4MYUA 4RD1A 5TY0A 4QHYA 4ZCMA 1F60A 4N3GA 2BM1A 2E1RA 2VNIA 4YAFA 1VQNB 4B43A 1Q7YD 2YWEA 1N0UA 4TMZA 2HDNB 1G7SA 1GAWA 5AN9A 1ZM2A 4UAJA 1G7RA 4TMTA 4M53A 3CPWB 3ZZ0A 2XNJA 2NPFA 1NJID 5DSZA 3WNBA 4PC2A 3W2EA 1TVCA 3W5VA 1QGYA 1E62A 4RCZA 3JQPA 4B3XA 5KSWB 2PMDA 4NCNA 4M2LA 3OZWA 3QFSA 2OK7A 3FPKA 4RD4A 3CMAB 4Y9UA 4QFMA 2FX3A 3B8HA 3CCLB 1OGIA 3E20A 2GPJA 1EFUA 4RD6A 1H42A 3VNVA 1TTTA 1VQ7B 4C0SA 3QSYA 1YIJB 1OB5A 1K9MD 4RD3A 2OK8A 1YJNB 2VNHA 2YWFA 4G1BA 2BPOA 1YJ9B 2RC5A 4WQMA 3U6KA 4K1XA 2OTJB 1G7CA 4M0LA 3CC7B 3VO1A 2XNCA 4FK8A 3CC2B 1UMKA 4PC3A 4H9GA 4Q7JB 1J9ZA 1JA1A 1KRHA 1QX4A 1GVHA 3ZZTA 1GAQA 1W87A 1D2EA 1EFTA 1FDRA 4B48A 3WY9A 1XB2A 4MYTA 3CCUB 3G4SB 2B7CA 3LYUA 3OJXA 1ZM3A 4M4SA 1XE1A 3I1FA 3LRXA 1EXMA 1S72B 1K73D 1KQSB 1QGAA 1K8AD 4HE5A 1ELOA 1BJKA 3ZBUA 3AGPA 4M1KA 4PC7A 3SJZA 3WBKA 2J7KA 3OZVA 2BN4A 2PIAA 4YAUA 1BX1A 1QH0A 3U6BA 3CW2A 3JQQA 4ZGNB 1W2BB 3I55B 1SM4A 1YHQB 1KC8D 3W5HA 1OGJA 2VNKA 4RCYA 1FNDA 1FNCA 1KD1D 1D8TA 4TN1A 2QMUA 4HE6A 4LBYA 1I7PA 2BF4A 4DQKA 5EMNA 4F7DA 2DETA 4B44A
chains in the Genus database with same CATH superfamily
1LCIA 1QUFA 4JDPA 3L7DA 3TF5A 3AT1A 4N0PA 1N9GA 1PNRA 1WMAA 3B9RA 2CFOA 2QI9C 2AWOA 1G0OA 2F9LA 1MO6A 1MQSA 2NO0A 1VQLB 1FNBA 3BDIA 4WTOA 1DBIA 1GUDA 2Y1WA 3W5AA 1O96B 4G4IA 3R3HA 2EBFX 4HB3A 1G20E 4KAFA 1DS6A 4V2IA 3LYAA 5A4KA 4OBWA 1VQ1A 4XTCS 1X15A 4Y6OA 1YIAA 3F6SA 2VLIA 2I6GA 5LJLA 1N8RD 3E5MA 4IQGA 1ZGAA 3QE0A 3UMFA 1K68A 4XWWA 1QZXA 2XMDA 4NFLA 2YW2A 2BGIA 3L04A 4GNKA 2XNDD 4R1TA 4XLCA 2ZE7A 3BZUA 3P4XA 4KOAA 1E3ZA 2Q4EA 1B6GA 2WTAA 3V4SA 2QD3A 1QQ7A 2GO1A 2MSEB 2FVYA 1JR3D 1Z3IX 1A8PA 1THZA 2A5FA 4NFSA 5JYDA 3L8GA 2RJ3A 3UMRA 1NV8A 3VBCA 1LPPA 3VVMA 3HZZA 3WLMA 2BEWA 3BIWA 3EQ6A 4AN4A 2KBEA 2RGCA 3A3YA 3K9NA 3L01A 1PG5A 2FR1A 3O2QB 3QUTA 1NZDA 3ASUA 1P61B 1UDBA 2CHUA 4HZIA 2AKAB 1KSJA 3V7YA 5F21A 4CN9A 2HIHA 4ZI5A 1UWVA 1ZIPA 3KUKA 4R2LA 1YJCA 3HDQA 3OZEA 1HNNA 1CW2B 1R0LA 1G3UA 4G36A 4NENA 3HJBA 1VGRA 1E6CA 3VPGA 1CXZA 2YH2A 4RA9B 3V5NA 3W34A 5KYYB 1PJSA 1YZYA 3GLRA 4NJOA 4HVCA 5CA1F 2C83A 2PO5A 1HDGO 1Y0YA 1QDEA 4G5SA 5E6RA 4GOOD 1JECA 2E87A 1PQ4A 4PRLA 5ALNA 4EH1A 3A6HA 2VHQA 2BTEA 1GNVA 1MMFB 5EHXA 3DE1X 4PANA 2I3DA 2IIBA 1UD8A 5BSEA 4EF6A 1XAHA 1L8XA 2AJBA 2WHEA 3AG5A 4N5IX 5E2IA 2D0OB 2WSSD 4PC1A 4N7MA 4QOIA 1JDUA 3PUWA 4FXOA 3E48A 1RM3A 5AYVA 4RK7A 2ZUWA 1Z7YA 1DOHA 3F6EX 4WLNA 3OCVA 4UMFA 5DGIA 1TL7C 1MNQA 3LVQE 1MENA 4IP0A 3IMEA 4OUKX 4GLLA 2AS0A 4ISBA 3G1TA 1RJEA 4E5VA 3W8EA 1CJVC 1W35A 1ZW6A 2BSQA 1MDFA 1R0CA 2OFPA 3PTZA 1TYZA 3DC2A 2CV0A 3WNCA 3AR2A 4F4FA 1RC1A 4RGVA 5BYKA 3CIFA 1I36A 1W29A 2WMOB 2WNSA 2AFIA 2WYWA 2YWBA 4G1EB 3OQ1A 3PA6A 4DWOA 4U9UA 2FJPA 1HLDA 2JEYA 2O2DA 4G9GA 1I0IA 1CUUA 1XRPA 5I01A 1R88A 2VBIA 1EGMB 2G3YA 1BN6A 2QMQA 4UVGA 3UFXB 4BKQA 1V9SA 3EVZA 4DABA 9ATCA 2O0HA 3NV9A 4O59O 2YCBA 4K9PA 4YNBA 3QJYA 2GASA 3Q6RA 1AV7A 1G8FA 1Y1LA 2FN4A 1I2ZA 1YQWA 2VXBA 3GRAA 4F7WA 3VA7A 3R0VA 5I7HA 4CLRA 4UEWA 2I9KA 3QVSA 5BXQC 5ILQA 4BMNA 1LJLA 4I6JA 3GSIA 4J16C 1LK7A 1B43A 3DM9B 3Q0TA 3AG6A 5F2EA 1V8ZA 2VZEA 3ASVA 1Y33E 4ZREA 3GVJA 1JPVA 5CFNA 1Z7EA 1Z7BA 2RGWA 3OZXA 5KTYA 3CLSC 5AW0A 2ZZEA 1BWQA 1D0SA 1YHZA 3I04A 3Q15C 3SI7A 2CEKA 3RVKA 3AHJA 3OMWA 3JPWA 1JIKA 1QV7A 1RWNA 4N4AA 4O6VA 3PCRB 4KIFA 4YROA 2IHVA 3V4LA 1L8OA 3PUXA 4INZA 4H4CA 4BMSA 4JAVC 4BATA 4AY2A 4DLRA 3B78A 4RORA 4Y2QA 1PS0A 5A0FA 3RO7A 4DHWA 1I30A 3AZPA 3QHAA 2I62A 1B0AA 3O4GA 3WO1A 1MT3A 4RM2A 1Q5PA 4HK4A 4FN5A 1NQUA 2NQ2C 3R1IA 2RBGA 1MIOB 1XDBA 1YDWA 4WZZA 4YTEA 4QM6A 2RHMA 1Z37A 5TVKA 2FP4A 1LPAB 1C9DB 1N32B 2VQFB 4L73A 1J07A 1W6RA 1BQEA 1TQ8A 1FS6A 3LOQA 3VSBA 2G82A 2GM4A 2IC5A 3N86A 2UDPA 3LQ1A 2QY9A 3E9MA 1K2VN 2W2LD 3N2GA 3T7EA 5KJFA 4CG0A 1BEEA 1QO9A 3FYUA 4PWYA 3MWFA 3SVZA 4BTEA 4B40A 3GYBA 1TM2A 2IYOA 2FW1A 3ZWPA 1HYHA 1NP3A 3OD1A 4CTOA 3NNDA 2SCUB 3H3XA 2QD2A 3JD1A 4DIDA 4OM8A 3PUNA 4GH5A 1NR1A 2WU0A 3O9ZA 4PSDA 1CR4A 1L7MA 4Z4WA 1NONA 1R15A 2O4UX 1CVLA 3ASPA 1IULA 4N54A 1M6VB 4ZEWA 1QMGA 2WWVD 1W4BA 1ODKA 4U39A 1D03A 4K9DA 1MQ9A 1VCMA 1IG0A 5HJ5A 3ED1A 1A5SB 2SNIE 3WK8A 3TL2A 1INLA 3PEUA 4DA4A 1KK0A 2OKGA 3BJMA 3EQ7A 3F96A 3QKSA 4HVAA 1P0QA 2I66A 4PYNA 3ZY4A 1XKQA 8ADHA 1LI5A 1TYDE 1DEXA 3UK0A 3WX0A 3CBGA 1JQBA 4XCQA 3BVPA 4YH1A 2OCLA 1IUKA 3R23A 2YS7A 3PNOA 3ZI4A 1LDBA 1T2NA 4PCVA 3I01A 1DAHA 3CNEA 4PFKA 4Y3UA 5IUNC 1N5OX 4MIKA 5LP6B 5H9WA 2XR1A 1UH5A 2QNRA 4CGYA 1SHUX 2ZT5A 4LDNA 3OG9A 1N9GB 1KJIA 2LUOA 2VJBA 5AM1A 4EY4A 5J47A 2D59A 2BZGA 5AI4A 2HZ7A 2I71A 4G8CA 5ALVA 1I4EB 1X38A 2JGEA 4LECA 2VSYA 2YWCA 1M1NA 3EIOA 5JJIA 5CT6A 2XZPA 3KCNA 3BD9A 5FORA 3U7EB 5K45A 4F8EA 4N65A 1XPUA 2IHZA 2AOTA 1ZLYA 2B98A 1TJNA 4LF5B 2A2ZA 3BN3A 3F7NA 2YY5A 3B36A 1E0KA 1KKMA 2RGAA 1WPCA 4LK3A 3CXCB 1T9CA 4KQXA 2CDRA 3G8DA 1ZM4A 3K8QA 3ZBPA 3P9SA 4BKUA 1VKNA 2JB9A 4PPQA 3UFBA 3AVYA 5DVZA 4KMSA 4TZ6A 1D07A 5K1ZA 4BS9A 1B6RA 1KMQA 4EYQA 2VZ8A 2WWXA 4EB3A 5L3SB 2G88A 2XUDA 2FZCA 3J81k 1AD2A 4JLKA 4CNQA 5L3ZA 1ESMA 2Q2NA 5JSKA 2RK4A 3W8DA 2IS2A 3NEAA 4AI6A 1KO8A 4R2HA 1RLOA 3GDGA 2B4TO 4RA6B 3G0OA 4H7DA 4YRZA 2J48A 4JJKA 4NAUA 4A36A 4NBKA 4RFLA 4DM3A 1MJHA 3USCS 2ZDHA 1TZCA 4D9EA 1Y6GA 1RBMA 4PC6A 1VQMB 2R6R1 5CH3A 4D6XA 5C80A 1OB0A 4EENA 4IMPA 1UBNA 5EP4A 4UEQA 2O7SA 5KOYA 3IJEB 4WADA 4JLNA 1KAQA 1UK7A 3VI4B 4Z8XA 3QUCA 3BTSA 4E5DA 1U63A 3RSQA 3WQHA 1AXGA 3MD0A 2MOKA 3IB3A 3M1LA 5E6RB 4NEHB 1CSEE 3E5HA 1BDHA 1FEZA 5ILGA 1JX6A 2YHSA 3HYRA 1PBTA 1JF8A 1AKNA 2KBFA 1RYFA 2UVDA 2ACWA 4KUHA 4AJHA 1ZNWA 2O8NA 3F9CA 4AS2A 3NDIA 1WP6A 3E0XA 3RPEA 5BWOA 5JJKA 3D0QA 3QFTA 1T8UA 1DRVA 3BYZA 1VPTA 3HYNA 3OICA 1TF5A 3PVCA 1TYCA 3RVSA 1AUXA 1YR7A 4IRXA 4BMCA 4R9VA 1J2TA 4U8HA 3RCBA 3WBFA 4D9IA 1NVTA 1C3VA 2EQ5A 2I8CA 3HPQA 1GTSA 4FE7A 4PLHA 2VPPA 3WKEA 5JROA 5KWJA 4IVQA 2P11A 4BE7B 1ZD4A 3MNFA 1K92A 3EH1A 1KI9A 3LQQA 3RIYA 4S0ZA 1E2HA 3AERB 5EMKA 3GA0A 5KMGA 4PPGA 4AMUA 2QZ9A 3ME5A 3OBBA 3QIAA 2AFIB 4YAFA 2ETXA 1I5OA 1YS1X 1SHKA 4CLXA 3T56B 4K46A 2BEUB 2EVWX 1L3BA 1WVIA 3QHQA 2HCTA 4GYKA 4D56A 3GWGA 2BDEA 5BSXA 5DBGA 2YBEA 2O8CA 1IWPB 3D5TA 4M1MA 3F4BA 2XKKA 3UAGA 1SH7A 5IVKA 5AN9A 1ZM2A 2PU5A 1ISRA 4CL2A 4YCAA 3PA2A 3D6JA 3K92A 1E6MA 3N2LA 2X8KA 4M6WA 2YZKA 3IQHX 4CLRB 2DPGA 1ADGA 1NULA 1P4HA 5H02A 3OJFA 3R9IA 4EA8A 3A2KA 4UM7A 1SQ0A 3OZ7A 1HYGA 4TUYB 4G5HA 2AEJA 2CFCA 3IHLA 3PICA 2N0SA 1PW7A 3AV0B 3MCUA 3MMNA 4LF9B 4MQEA 3HPRA 2Q6VA 4YA6A 5FO0A 4FHCA 4MDHA 5IXSA 4MJ7A 3TR6A 3BFJA 1W4RA 1G5TA 5E4FA 3TN7A 1SC3A 3BGIA 4QQFA 3GAFA 1S8NA 2P77A 2QMEA 2W4MA 1SFRA 1U8FO 3GAAA 3W5VA 2RGYA 4EDHA 1M1YE 2PPVA 5FBWB 1OW3B 2OVBA 5KOHA 3AHFA 4A27A 5KVSA 3DXFA 2E4UA 3R5KA 3TSOA 4EO4A 1Y9JA 5DBEX 3ZVKA 3EDOA 2AVDA 4M2LA 2FP4B 2DUMA 2Z4TA 3L8MA 4BO6A 4YR7A 3LX6A 2DQSA 1WXGA 4OGGA 1DQSA 4XRRA 3JZAA 3K5WA 4AU1A 3EODA 5KVCA 4M0PA 5K0ZA 3E4DA 1P2VA 4D81A 1TAQA 3ZE2B 3EQ9A 3N2GB 1TQ4A 3KKPA 1P29A 4Q1EA 3FYUB 1EQAA 4DSOA 5JCZA 1FFYA 4MWZA 1ECCA 1NT4A 3MERA 1F2UA 4GEKA 3UPUA 4P34A 3I34X 3EZNA 1SXGA 1CDEA 3QOXA 2PWYA 1EGHA 2QRQA 5DTIA 4DL9A 1FRVA 4WI1A 1B8VA 1GFSA 3AF4A 4JR1A 2VO1A 1LSUA 4WBSA 2HRZA 3K2QA 2XJ9A 4CQMA 4FOOA 1F0KA 5LLDA 4F9TA 3D4IA 4LDRA 1BRTA 1U2GC 2PH7A 3GD7A 4RJIA 3SYNA 1H23A 1O94C 1UEJA 5IT5A 4OQZA 4BO8A 3CUSA 3N0TA 4C1NA 2EGHA 5DYIA 5CPBA 1MB0A 1RE1A 2BISA 3EA4A 2QRZA 1O08A 5FCDA 5LB4A 3WK7A 4YXWD 3PDIA 3QKSB 4US2R 3EPJA 2OCAA 2PUGA 1OXKB 4BGUA 3NEYA 2HI0A 5ETJA 4KR9A 5JQWA 1P4JA 4OOXA 3WICA 2WYOA 3H5LA 2R6CA 1WETA 1TZKA 2G1AA 4AY3A 3OQHA 4H17A 5HRUA 5ULLA 4IIEA 2QN1A 5LJIA 1XI2A 4EHBA 5A02A 2QLLA 2OHOA 3INTA 3IERA 4ZO7A 5ESWA 4AJ2A 1XJ0A 2LXNA 1KQOA 2HH9A 3EUEA 3PGLA 2DOKA 1SC1A 1BYIA 4ZYZA 5JFGA 4FK8A 2PKEA 2ZAYA 4RTOA 4KR3A 5BT9A 3BQ9A 2ZVDA 4C04A 1M5RA 2LVBA 2PUTA 5BSRA 3CINA 3ZYCA 1QX4A 4GPAA 4IUYA 3FAZA 1JDZA 4GMFA 4IDQA 3V8RA 1IN5A 4OBXA 5E0OA 5LLTA 1CY7A 3CS3A 4ZU3A 1PFWA 2REOA 3FCSB 3M8KA 4XGNA 3UGTA 1UXHA 1EFTA 5K8UA 3CLTD 1JQ3A 2FE1A 4V0SA 4P3IA 3P9CA 2FGKA 1JDVA 4WZKA 1R9JA 4QOFA 2J87A 3TGWA 1ZJ4A 2PKYX 4F2GA 1Q15A 4JOBA 1I7DA 1K2WA 1YIOA 2B25A 2GZ3A 2LCIA 3EN0A 1A2BA 1EFRA 1M2WA 1U80A 1ZRHA 2O7RA 2Y4NA 1Z0SA 1JLLA 2FF5A 2XADA 3BHMA 3DEZA 3HXLA 4O5AA 2G5CA 4IKOA 4UASA 3TB4A 1SK8A 1NVDA 1TT7A 3C5WP 2IYNA 1I6LA 1Z07A 2C4VA 2ZI3A 5TS2A 1EXMA 1WNFA 3H05A 3CF4A 3IE2A 3L7YA 5IU6A 4CCWA 4EZIA 2GN4A 4D4LA 5LXTA 4EHDA 1MR3F 1TIKA 4D3XA 2CWWA 3MTDA 3Q11A 3RAFC 2P6NA 1YI0A 2XB4A 1J09A 5EKDA 4W8OA 1F9AA 2FTKE 3OF2A 4PZ0A 4WZAA 1O57A 1KBZA 3KNZA 1FP2A 1IZ7A 2FG5A 1G5IA 5FNVB 2VTBA 3VPAA 2WJ4A 1AU9A 1R5JA 4KGVA 3K94A 3T1YB 3M6MD 4TS9A 3T7AA 1ZUD1 1NJ6A 3LA8A 5EUMA 4IHJB 1UOEA 4YCMA 1M2JA 1XRSB 2J32A 3GWZA 3ROQA 1F5SA 5JXIA 4GBJA 4UFOA 5EHIA 3PHJA 4KH0A 1NMQA 1NOIA 3DEJA 3CLHA 4Q9LA 3GC6A 1KDZA 2JLVA 1BJTA 2W2TA 1BXZA 2IYZA 5LZ5A 3TIXB 5BR1A 4XLFA 3RG8A 2IU0A 4W5OA 2VBVA 5JDIC 3GDOA 2GDZA 4IRMA 4KLZA 3TIGA 1J99A 1SVSA 5CB6A 5IF3A 1IL0A 3UWDA 3GJ4A 3NFRA 3STTA 1GDDA 3Q7EA 1H2AS 3FUUA 1BOFA 1SPBS 1WXFA 1A2KC 2YXPX 3D2AA 3WYDA 1NMYA 2Z1MA 5LP6F 5AVOA 5DHSA 3N1UA 2QM7A 4C30A 1HYEA 4JB8A 2JJMA 3TQFA 2C2WA 3EX7C 2CNBA 2PS1A 3DXYA 4WFQA 1CUHA 1FX1A 1QK4A 1QHGA 1BEUB 1HWYA 1ZNYA 2AMJA 2C2ZA 4XOIA 4CHTA 2ZUSA 3NBYC 2KWIA 2DETA 3DBRA 1PNTA 3H11B 4OQFA 2QW0X 3C8MA 3P0IA 2P90A 3AEQA 3ZU5A 2O8CB 4JGGA 1MEOA 1QVWA 1PL8A 1W59A 4RE5A 3TJZA 1XRMA 5DN9A 2HWKA 4AJIA 2DQKA 1BMFA 3RFFA 4YUXA 2JBAA 4O1HA 5DASA 4A2QA 2XT6A 3GQBB 2ZJ7A 4LJSA 1D4ZA 3LQYA 5E3HA 1LGYA 1N0IA 2QTMA 1PVOA 1W0KA 3RFXA 1Q0PA 1Y1KE 4ZCTA 2APJA 1E64A 3GPDG 2P67A 4MOWA 4NYJQ 1J5EB 3EC2A 4MQEB 1ZXBA 4HEA6 5EIWA 3WLRA 4RWZA 3ICEA 4IDCA 5DISB 3LHKA 2OCKA 1B0PA 5DCLA 1XZCA 3G5LA 1YUMA 2Z6VA 2NXEA 3A05A 1ZX1A 3AMVA 4GE3A 1U0TA 4CF3A 5KTRA 2HMVA 2FZVA 4PPYA 1KY4A 4DV4B 4FLEA 4TLAA 1Z4PX 2DHDA 4LJKA 4RK5A 3IRVA 4DANA 5GJCA 4DR4B 2OO7A 1NQVA 2NYUA 1CNFA 1Y5LA 3VDMA 4DN6A 3DV9A 1EFRD 3B70A 4MZXA 3K4QA 5IAKA 3KP1A 1F3OA 1ZN2A 5FUMA 4UFPA 1QZTA 3R5XA 5CYPA 3OLYA 1YJXA 3W9SA 4K9KA 1Q0SA 4F97A 1J56A 1T9AA 2FWIA 7MDHA 4KE8A 5BQXA 3MRSA 1E9RA 1V6AA 1EP9A 2I2CA 2XOXA 3F3KA 3LF1A 4TRJA 2ZBRA 3ZXUB 3ZCRA 3UNXA 4Y98A 1ULBA 3PDWA 3A37A 5TSDA 2C3OA 3RS9A 4LX8A 1HDIA 3FXAA 3H19A 1MB9A 3HN2A 2P75A 3LFHA 1NI4B 3PUMA 4CW7A 3U7QA 4H7HA 2XUIA 3EBLA 4FEEA 4Y7CA 1B23P 1SAYA 2XE6A 3I83A 1J24A 2GGSA 3ITDA 3JQBA 5IN5A 3RC3A 4BP9A 1NBWB 1HKHA 2YVKA 3COSA 3HB5X 2HJSA 2DFLA 2PQ6A 3FWHA 4UTOA 1SXPA 4E4RA 1QTNA 1REQB 3WA7A 2F90A 5FPQA 2VIIA 3O8CA 2Q5QA 4BRSA 3JQEA 4WKNA 1XEXA 1D4FA 1NZJA 2BEVB 4MVJF 2PRJA 1YQEA 1DV1A 3H86A 5H83A 2H2WA 3EZGA 3FGNA 4JLAA 3ZJ5A 3GJ3A 5EZYA 5L3QA 4GUAA 3QLVC 1PD0A 3IP6A 1CS0A 4PEVA 3LQFA 3KCQA 4JEHA 2GCEA 4OK3A 5LNK6 2AKEA 1S4QA 1M8JA 3BGOS 1B73A 4QTXA 1Z0DA 4DLWA 2L19A 1VSUA 4PU0A 3GELA 4C6RA 2YYYA 3QVTA 1N6NA 2C8JA 2XITA 2ZZQA 4KO2S 4URZR 1DVRA 3VC2A 4G85A 1JEOA 1RAEA 2VHVA 2J5BA 3N05A 3TGLA 3G13A 1SZPA 5EJ7A 3U61B 2P30A 4HYEA 3NTQA 4R1LA 2X58A 3HGQA 1ADCA 4TUYF 3P2YA 2OO3A 1XJWA 4BX2A 1IM5A 2PLRA 4YUWA 3VU9A 3MCVA 5FOXA 1OGYA 2JLRA 3ZD7A 5H5JA 3DS8A 1ATZA 4Z4VA 5CDSA 1QOZA 1A8HA 2CFRA 4RD0A 3IQFA 3WNDA 3NHUA 4IFEA 4IF6A 3UJHA 2AUNA 3N6VA 1BMFD 2XDAA 4TTVA 4A92A 4YV7A 4DG8A 2CVHA 2P9GA 4BEVA 3MJFA 1W0KD 1PFKA 2DULA 3DCYA 4D6PA 1TXGA 3HJRA 4RYLA 1JLLB 3DAYA 2IV2X 2J3IA 4CLEA 1KY2A 4J3NA 2EIXA 4UVHA 2WAAA 2VAXA 4DLTA 1W1IA 3I8SA 1BAPA 1VIMA 1SR8A 3U4DA 3BY2A 5D3ZA 3K4PA 1UBLS 2Q2VA 3A2NA 2R79A 4JP8A 4YN3A 3FTQA 1E1NA 4TLEA 1SG6A 5LOVA 5DEIA 1EE2A 4HLUC 4BX8A 1U4SA 1B3RA 4CL8A 4WY8A 3DMTC 4WZAB 2VTBB 3SLRA 2I29A 2JFUA 3DULA 4PVCA 2OYSA 3SOPA 3BKXA 1KI8A 2YBDA 1M1UA 3BDAA 2RH5A 2AZTA 3BAFA 4HPXB 4BQPA 1R5NA 4CMGA 2IXEA 3MMSA 1IXKA 1YLOA 1WB6A 1IN6A 2G25A 2Z4RA 4Y2XA 4LBZA 5IAJA 1PE0A 3V1MA 6LDHA 2AZXA 4ZCRA 3EIWA 4RABA 5IHXA 3JYQA 5TIIA 3G5TA 3GOHA 2BY4A 4WBNA 3QBTA 4P7FA 1K9SA 3A4NA 4NZNA 1QQ5A 5JBQA 1UANA 2VA8A 3A7EA 3RS0A 5E1BA 4M1QA 1FYVA 3THSA 2KE5A 3RV3A 2B1IA 4JVOA 2JW5A 2VJQA 3R7DA 1MPTA 3F1KA 4PRKA 4RUKA 1HSOA 3MSXA 4LMPA 1XTBA 5IAGA 2OSBA 4CGZA 5IJXA 3TL3A 1UPAA 4F1KA 4UXJA 4UJ3A 1HT2E 4KR0A 1LPBB 2A1TS 2QD4A 3INRA 3JYLA 3HKDB 1SXJE 1ZPDA 4Y2GA 2XTJA 1J33A 1BS2A 1RXCA 4P81A 3SS9X 5BQOA 4EG4A 4FR5A 4IAOA 4Q48A 5KAMA 4WASA 3DQQA 4QG3A 3WQSB 1H2ZA 1G64A 3S5JA 1KDPA 3ND9A 5CRIA 3T7DA 3VU0A 4Z3OA 1JDBC 3AVQA 3NUQA 3A11A 4CDRA 3THXA 2GBGA 2C1EA 2VP4A 1E2BA 1SQFA 3PUIA 4MVJE 5K8TA 1EWKA 4LF7B 1T1SA 4X7CA 1J8DA 1KI4A 3Q3GE 3R3WA 2H6EA 2EP7A 2OHJA 3LYHA 1BW9A 4IIFA 3IV9A 5JCOA 1OMOA 3MS2A 4G7XA 5COAA 5G0SA 2CRVA 1BHSA 2Z30A 3SDBA 1SBTA 2OTLB 1GGMA 3D7NA 4MPPA 2EFEB 4DV2B 2EX0A 4X00A 2Y2VA 4YP1A 3S2ZA 5TXGA 3RF6A 4JYBA 1KZGB 2Q0SA 1E3SA 2ZJ0A 1WD5A 4YEJA 5AKIA 2GN1A 3RRXA 3ZWYA 5E6UA 4ZV7A 2ZJBA 3V97A 4WUVA 1FSSA 1U3GA 4EPTA 3R5JA 2FRXA 5A89A 1KBQA 1DXQA 2I8LA 3RR2A 1RU3A 1XN4A 1G3RA 3RYHA 4C4SA 4X1IB 3AFNA 4FMPA 4KN6A 4G0OA 4KXWA 3MINB 3R7WA 4CQLA 4F2PA 3ONYA 3CCVB 2QL5A 1XMIA 4BNNA 2CJYA 4P5EA 4RKRA 1T0UA 2PHZA 2KMLA 2OENG 2B4RO 3P71T 2QN6A 5JYEA 2J33A 5FNVF 4GZ5A 5EQTA 1GL9B 5LBIA 3G6WA 4MEBA 3L1UA 1D1TA 4BU0A 1IXYA 1HY3A 3AETB 3N39C 3B13B 2XQFA 3CG0A 2VBTA 3FWNA 1FTQA 1X7YB 4IHJF 4G0XA 4R1SA 2JHPA 1J90A 2JFFA 5I7OA 2DSTA 2JGLA 4MVJM 3TOXA 2A0KA 5ALHA 2IHKA 1FDWA 1NJ1A 5A4FS 1P5RA 1KR5A 2VNAA 5FV4A 4PYMA 3N53A 2ZYIA 1SU8A 4Y6GB 1QHHA 4WCFA 1V8BA 3KT3A 4MULA 2OLEA 4YACA 3PHLA 3PF9A 5ALJA 5I47A 3KEOA 3U7QB 1QOPB 3W4IA 3W5SA 4ARUA 1XKTA 1ZIXA 4C5AA 5KTNA 1CB0A 4TTSA 1N5JA 2HADA 2E82A 2FUNB 1APBA 2NTNA 3RUDA 3WRYC 1NKVA 2ORVA 1YQGA 2IUYA 4O29A 4EZBA 2O0MA 3GJ8A 3BMCA 3P26A 1ZSVA 2F48A 1JB1A 1XEXB 1SOVA 1XCBA 3SC2B 5I7UA 1EMDA 5C8DA 1K63A 4UMEA 1LD3A 3OQIB 4JSTA 1N75A 5EZYB 1Q2XA 2CFIA 3H87A 2HCBA 3EF0A 3UWPA 4PRZA 1L1FA 4DM4A 5TY0A 1Q9SA 1CR2A 3UMYA 3PRKE 3LLSA 5HYVA 3S8MA 2EKPA 3MRVA 4NWIA 1R4NA 2JNWA 5DCUA 4YRTA 2QAGC 2W2VA 4E32A 1QAMA 4NPHA 1IUNA 3V8QA 4KC0A 1HDCA 1SBIA 1HZZA 2R85A 4XWGA 3H94A 3FVRA 4PINA 2HNKA 2OB1A 3VZBA 1KYTA 4CCSA 4XPIA 1MAAA 2UZ0A 2I03A 4I5GA 4MITA 1GXSA 4MLDA 1M7BA 3LDGA 4KRYA 4WE3A 3F5FA 4OHVA 4DDTA 3M6FA 4ZA2A 5BN3A 1X9GA 4AK9A 2XOEA 1RJ9B 2N3ZA 3ZNQA 1DAGA 5ES4B 1CR0A 4M54A 4FYYA 4OJTA 1S3GA 2GPYA 2FB9A 2NSJA 2IF0A 3HUDA 3BWMA 4ROSA 3DMRA 4EGSA 2GPSA 2YJ4A 3PXEA 1C7RA 3LHIA 1FLVA 3OOJA 2J3QA 1J7KA 2NADA 2GEUA 3CW9A 2C0PA 3L5KA 1JJAA 4KFCA 3SLKA 1HTWA 3PPVA 3F67A 4C4PA 3T9DA 5K6TA 2IZ0A 4Q37A 3FFAA 1EVIA 1X3LA 3DCJA 4HOYA 1U11A 1YR8A 2RJOA 1Z8HA 2H5EA 3DZKA 3A2MA 3IILA 3VH1A 4KU4A 4QOJA 3SC6A 1HNZB 5FWYA 1R2QA 2P0YA 3KKQA 1NC1A 1IAVA 2ZVJA 3U19A 4R1NA 4L8GA 5LOVB 1YT5A 4G89A 3WGOA 4WZ6A 3C48A 3EXHC 2A33A 3RNOA 1VE1A 4BO7A 3KQQA 1DKOA 1HRDA 5EA2A 4OP7A 1PCXA 1K5GA 3EXAA 3L7NA 5EZSA 2B21A 4P08A 2VJJA 1LNQA 3PFIA 1LUAA 2JFWA 5JC1A 4MUIA 2DWPA 2R5NA 4L0DA 5JS6A 3X2EA 1LRJA 3DF7A 4TLMB 4D8YA 4E22A 1JP7A 5COBA 3KYDA 3GNLA 6Q21A 5IVDA 1TEHA 4TXLA 1W2WB 4AKTA 1FNSA 1UKCA 3EF3A 3FUCA 2C9MA 4HQNA 3GIRA 2HBYA 1OI2A 1YZNA 3EA0A 4UZSA 2G09A 3CF2A 4D4HA 1H0HA 5L95A 1SCQA 3JU3A 3KVNA 4MVJH 2OBRA 4RD6A 2GR9A 2XGSA 4D9KA 1QQTA 2H2GA 4W5QA 1KVUA 1US8A 2X14A 3EB9A 3UUFA 5IT4A 3OTIA 3NPAA 4GC5A 4TT3A 1T2AA 3N0WA 5F5XA 2BMJA 4C21A 4GVPA 4LJYA 4OJMX 5IW8A 4C0BA 3KDAA 3CXRA 1LPOA 3VNBA 1K7YA 2FMHA 4M7OA 2HHCA 1CZHA 4FPXA 4H3HB 5KKCA 3R0QA 2OY0A 5HJEA 5LVAA 3FMOB 3MWGA 4AVZA 2WSMA 3GROA 3MUFA 5JG7A 2BKLA 4BDSA 2PSSA 4F5DA 1NWCA 1B1CA 1E3JA 1N2BA 2LTAA 3ICWA 2TMDA 2IP4A 4G37A 3C3JA 4P3PA 2WJPA 4P1ZA 5CR9A 5DNEA 3WYBA 4AJKA 5LMNB 3AJEA 1BD4A 4OOSA 1HOTA 1M72A 5DBIA 3ZLBA 3GFVA 3NDPA 1R66A 3GRRA 4RXTA 3CC2B 3ISJA 2JLQA 1O95A 4BYGA 3FOAA 1XMOB 3E9DA 3WLHA 1VHLA 5TDHA 3L7MA 1JHQA 1QHFA 2C9CA 4TSKA 5A5EA 3K30A 2WD9A 4MP8A 2CNNA 5DM2A 1P31A 1AMNA 3ZWDA 1RAIA 1U8YA 3FW1A 5E6UB 4EA9A 2DWUA 2GN0A 3GUUA 2ORWA 4N0DA 4DOMA 3EGIA 4R5HA 3UW3A 4E5NA 5BORA 3ASTA 3VO8A 3HC7A 2VDOB 3H99A 4QPPA 5F77A 1I80A 3FCYA 3F9RA 5AUNB 1E7WA 3M1YA 3FB1A 5BW8A 3ASYA 3T94A 1P7YA 2CZQA 2IZOA 3WLEA 2IEBA 2VCYA 3GEGA 4LNAA 3T1TA 3GJ7A 3IBYA 1VHTA 4JROA 1GZ3A 4YFVA 3JQ9A 4IJKA 1XTVA 3T99A 2CL0X 2FQXA 3R6DA 5F7ZA 3WZLA 2P9HA 4B33A 4HX9A 1AT1A 1GPLA 4YHHB 4L4SA 4WZBE 2C84A 4U1RA 2I76A 1HT3A 4UHCA 3I1IA 2LV8A 4X41A 1L5KA 4KVGA 5EP3A 1U0FA 4TZ0A 4RSHA 4FFOA 1KQPA 1O2DA 1XP5A 2I1WA 1D04A 1VGVA 1VPVA 3P7MA 4MRVA 2BELA 4QA9A 1DG9A 3RWOA 1C3LA 1XRNA 3N7UA 4EY6A 1H2BA 1YS7A 3RU2A 5IH7A 1ZR4A 3DMYA 1RBYA 3CW2A 2P8JA 4RTJA 4B4WA 2AA3A 1DOZA 1D6SA 2AZMA 2ZQZA 4N0QA 2XX3A 1LPSA 1X8KA 1R9MA 3DLBA 3FOBA 2L0XA 2GM3A 1K75A 1YRQA 5A71A 4TYMA 4U6NA 2FMUA 4G1CA 1RWKA 3HRHA 1DKQA 4Y1FA 4Q1DA 2F4NA 1DAPA 1CTQA 1ZG3A 4D96A 5FX2A 4TTTS 4LG1A 1P4RA 2YJNA 2JBHA 2XNSA 3QEKA 2E7ZA 4YJ2A 2NX2A 1DV2A 1PR3A 1DKPA 3NGXA 4TT3D 1KO4A 4Q3DA 1NVFA 3AB8A 3N2EA 5CLLA 3R7AA 2GZSA 3NX4A 3L8DA 1R4NB 5K8VA 1EVLA 2EJWA 4P5DA 1C1YA 3IBGA 2AJ8A 3ONNA 5HKLA 5B6JA 4JI8B 1GLGA 5DI3A 1P0PA 3E9ZA 5EHZA 3SR3A 3RV4A 5K09A 2GD6A 4LISA 1MO3A 5C8YA 3EG5A 2H29A 4LN1A 3NPMA 1GXSB 2D5IA 5CXUA 1RZVA 1VG8A 1H1TA 3PWKA 2DQYA 2YVUA 1N3BA 4IJWA 4S0XA 3JQRA 4MAAA 1UKBA 2O7NA 4V1CI 2JRLA 2GK7A 4MQ5A 4YAGA 3KPWA 4YJGB 3QIVA 3DKRA 2W2KA 5LC1A 3NTLA 1W5AA 3HVHA 4J07A 1DBSA 4ZYLA 4LHXA 4PSVA 3WLLA 3BMQA 3PB3A 4OPOA 2A8YA 3QNWA 4TTJA 4YRRA 3LHSA 4R83A 1K6EA 1GZVA 2PX3A 1HL7A 3HL0A 4I3GA 3G0IA 4OKSA 4OQEA 5FKJA 1WDLA 2FHSA 3M6AA 1U90A 2JAHA 1UF9A 5BV8A 2JFGA 3MT7A 5DI9A 5DV9A 3R3XA 1JAHA 3HYTA 1J2EA 1TUBB 2ZEJA 4TMVA 4LRWA 2FG7C 1QG6A 1U1FA 4QDXA 3TSWA 4ARVA 3WK5A 1U0RA 2W43A 2J7PD 2WZDA 4FP9A 4N0EA 5CA0B 1XSEA 3ZQJA 4BMVA 4Z4IA 3RHZA 3QWIA 4GMXA 4K9LA 1B4DA 1H0KA 5DBFA 1CJUC 2AW3A 3S3TA 3VKFA 1TKBA 4MUJA 4LI0A 3FHLA 2FGJA 4GPBA 4AURA 2G7MC 3FI0A 4NJMB 1FRNA 3UJ8A 2HLHA 3NIGB 2Q0QA 5E9QA 1DXOA 1MQAA 1HETA 3RBAA 4PLVA 4I46A 4ZN6A 5A3QA 2J59A 3S5UA 4YYEA 4Q1FA 1M1YA 5JYBA 2O0LA 3OD5A 2QRKA 2Z9DA 2ZETA 3KYDB 4MK4A 3MTBA 4KVAA 3UJ3X 5U4QA 5AUPB 2P68A 7GPBA 2H1VA 2QK4A 4ZDKA 4R68A 2WUWE 4YALA 1U3TA 1A69A 4MRMA 1BO6A 1YNOA 1ZP6A 1TAUA 3CCRB 4ENSA 1WSVA 4N18A 3O9VA 2H1RA 4K9QA 2RH9B 2VJOA 1EFPB 2DBQA 1WR8A 3A10A 2CN1A 1SBCA 3KSAC 1ZAKA 2FOIA 5T64A 1YJWB 1SVWA 3L1JA 5BVHB 1TU0A 2WU3A 5IEBA 4BAZA 4LJ5A 2PY6A 4RIGA 3D3WA 4AMGA 1GKUB 1OC2A 2PWPA 3GVPA 2ESRA 5AHKA 4TMFA 3AOGA 2HF7A 2QXTA 4B85A 1V16A 1IJKA 2BI7A 1M2VB 1P4SA 2QRMA 2TS1A 3OPNA 5D5PA 5IANA 3PL1A 4AUNA 2XBUA 3I61A 5B53A 3CFYA 4C4XA 4X1OA 3KLBA 3NEJA 3O2JA 4FIZA 3UMSA 3E03A 4NHEA 3TBFA 1G5HA 5A5GA 1K3FA 3PQ6A 3EVGA 1AKEA 3OQ6A 4U7JA 5F51A 4QOEA 1N5DA 3IIEA 3LPCA 3ASZA 2P3OA 5HMLA 4D4KA 3ZK8A 1IE3A 3GEHA 1R1DA 2XNKA 1B8PA 3K9WA 4QXQA 4URWR 4KFUA 4AJOA 3SEAA 4E6PA 5E8JA 1ZBDA 1ISGA 5K4GA 1R0BA 2I5PO 3M1AA 3B1VA 4FEAA 5CGQB 5CB4A 3D43A 1E9FA 5LYJF 4Z2YA 4D02A 4HBZA 2B5VA 2ZSJA 3ZDCA 2F3PA 3I73A 4MUHA 3F8SA 4E09A 3ZE9A 5KO2A 3ANXA 3E81A 1FF9A 4KX3A 2YJ5A 4S05A 4OYRA 3KPYA 4RKYA 3RUHA 2RE8A 3GCXA 4JH0A 1ZWLA 5IULC 3GLFA 2VXCA 2W7TA 4DIMA 1XRRA 3EYWA 3FOFC 4RTMA 2WF6A 2HA0A 3P19A 1UBMS 1Z5ZA 4OOEA 1UZNA 3UG7A 5A5FA 4G7WA 4Z9FA 5F1OA 1EVKA 3ABZA 1WPXA 2FSVC 2OCYC 3SQLA 1YQUA 4OG2A 3UKJA 1PGPA 1XNGA 1Z6PA 4P6VF 3NWOA 4F3NA 3Q8MA 2D7DA 5INTA 1G41A 1XALA 1E6LA 1UJCA 3FTNA 1EJ2A 3OIUA 4E31A 3QU4A 3RU9A 3U3RA 3IP8A 4ARZA 5AVVA 2AXPA 3PC8A 2ZSAA 3WYFA 3BXOA 1JFVA 2GEBA 1ZNZA 3KQYA 3V33A 2OG1A 1EP1B 2BCJQ 5BWCA 1RI5A 4C0KA 5BVGB 4EIWA 1GR1A 1YA4A 4ZRNA 1TW2A 4C88A 3RVQA 3OEWA 3G9QA 2VYND 4AWXA 5HG0A 4R0VA 1ZVKA 4ZT2A 3L84A 3H9NA 3USZA 4Y6SA 3WL8A 3G23A 4PYQA 1CQPA 2QLBA 1F8UA 1Q16A 2PSHA 4Q9JA 4NS1A 3DLTA 1H66A 3FTEA 1P9LA 4C78A 3OJLA 1G2OA 4HDKA 2BT4A 1ABBA 3WB9A 2QSZA 2I1VB 1PW5A 3L1HA 4QBIA 1TCAA 5IYZA 1NLFA 1RBQA 3I1YA 3O4VA 5I7VA 1EEXB 1YVDA 3NJRA 2AJDA 5DZSA 1J0EA 1I6WA 3D6FA 1D0IA 3Q3JB 4WCDA 1A97A 4MMZB 1HFJA 2GEVA 1C3JA 3FKQA 3CVUA 1BNCA 4QQ8A 3TCXB 1E5VA 5CGZA 4ZCQA 3P45A 3CG4A 1E6UA 1Y7HA 1XX6A 4TMWA 1N5MA 1PZMA 2CCJA 3N2ZB 4RY0A 4YJFA 4OU4A 5EIOA 4CTNA 1CFJA 1X6VA 5IPFA 3AVUA 2LDBA 1XHEA 4XTRA 4D42A 1NM5C 3GA7A 4OQMA 4LSZA 2HTFA 2HIMA 2XWJI 4JJ7A 4R84A 4ZVKA 1M33A 4FEYA 3MFQA 1KVTA 2CWDA 1T3SA 4JI1B 2IHYA 3WISA 1N7JA 5F9HA 3KUXA 2J3JA 3MWEB 2IY8A 1A3CA 1GRQA 1KNXA 2YRWA 3KK0A 3KVOA 4YP7A 5I3CA 3V00A 1BXKA 3HY3A 4ECAA 1XPRA 4KW7A 3JTMA 3K0EA 5A88A 2Z5VA 1DBQA 1Z13A 3B1WA 3D2LA 3E7FA 1XLTA 3UXEA 3WGLA 1E32A 1EGQA 3KR0A 5LWQA 2EJVA 3TXXA 1GUZA 1EFHA 2AW5A 4NMLA 1JHMA 1C0KA 2I6QA 4HNAB 3B82A 1X14A 2FUCA 4FM9A 1GPH1 3QKWA 4XW2A 1WA5A 3NAMA 1E1QD 3O8LA 2A9JA 2YDXA 3EOZA 4O4JA 5BSMA 5CFPA 3GJYA 3W04A 4PAOA 2XRFA 3QW4B 2WM2A 4Q3EA 1F0NA 4ERXA 5FA6A 3UTCA 5FL3A 2A9OA 1CR1A 1UM9B 1YRLA 2HU8A 3JWHA 2W70A 5ALQA 3PJEA 4OVKA 5FAXA 5J59A 3G8BA 4W9NC 3TTVA 2XE4A 4HT3B 5KWVA 2WJGA 4IPTA 4PYOA 2GETA 2FZGA 1YBVA 3AXTA 1CNEA 4YC7A 4RGYA 3LW7A 4CEIB 3G5MA 5AK0A 1MB2A 1YD7A 1JU4A 3UAOA 3FJOA 2HM7A 5AW2A 4EJFA 4FDVA 4XB1A 1S1MA 3ROZA 1M83A 1VKRA 1DE0A 2QD1A 1U28A 2D7CA 2H1CA 1FDSA 2I2DA 1CVRA 2OAGA 3C8ZA 3QWFA 5CT9A 4EPYA 1MO5A 3MA0A 4A2PA 4MROA 1FDTA 1NVUQ 3ZDRA 4ARSA 3KX2A 4YY3B 4CKXA 4C6TA 2CHQA 4NBSA 1J7JA 3MAAC 3OT1A 3GNTA 3IAFA 3GJTA 1J70A 1HDXA 5TJ9A 5BSVA 1DO8A 3AEKA 2ZTMA 1B14A 3COVA 4U2EA 1TM3E 3CHYA 1H22A 1J00A 3A4MA 3KOXA 3JYPA 3WQRA 2RARA 2AFHA 2ZIWB 2WUEA 1DBPA 4FFDA 3PE3A 5GPBA 3ZHXA 1FJHA 1EUCA 1ZNQO 2FMFA 2JASA 2O1XA 1AK1A 3HN7A 1QVZA 4Z7JA 2W48A 2CV2A 2ZYGA 3SSNA 1KFKB 2IGBA 4U2DA 4N3GA 5HF9A 4L95C 2FRDC 1P0CA 5KHOC 1XTRA 1U7TA 2I3AA 3KSDO 3NO4A 4Z99A 3P9KA 3TNLA 2IU3A 5MN5A 3TDKA 2VNSA 4MKRA 4MYCA 4YCLA 4AQDA 3PPXA 5EE0A 2RGXA 3P4UA 4DUZB 3SZGA 1S3IA 3K1TA 4XD7A 4EG8A 1JI3A 5CW2A 1YJQA 1AZSC 3ICVA 2ZRMA 1G2PA 3LP8A 4PHTA 1UAAA 3CH6A 2DUJA 5LQRA 1ZCFA 2IQIA 4I9HA 4D26A 3A7DA 1RABA 1RHMA 3ESCA 2EW2A 3GT4A 4YJDA 1Q0UA 3PNPA 5CT5A 4RQUA 5TEWA 4HC4A 3UKDA 2HFJA 2CW5A 1D8AA 1KEZA 1N2IA 1UADA 3KVVA 1DAKA 3EMBA 2XMPA 1VIVA 1VXRA 1N8TA 3EBPA 4PYIA 3E61A 5BUSA 1MT0A 5CA0F 2J3HA 1UXJA 4QNNA 4TPKA 4G3XA 4DNFA 2NO5A 4CLOA 3DBHA 2NWQA 2DU8A 3EWIA 1WL8A 3SKXA 3GLFB 5C2JB 5T4FA 1VKJA 2BHRA 3EEIA 3SCZA 4YRNA 1KOFA 2G5TA 3IO5A 1OVMA 4O0LA 3X2FA 4HSEA 3GGSA 3LP5A 1YDEA 2D9RA 1EINA 2EZ4A 3HLTA 1QK3A 2B1GA 4KWIA 5CM8B 4EI9A 3RTEA 4DLNA 3T7IA 4JHLA 1FQOA 1V8DA 2LWIA 3BXHA 3LQ6A 2FYTA 1U9IC 1CLUA 2IDJA 3ZWXA 1VOTA 3C45A 2QNIA 3OE7D 1QU2A 3C6ZA 4PABA 2O57A 4FYPA 5K0BA 3F4LA 1R00A 3M3DA 2PGOA 2HRBA 1CUWA 1U31A 3M5WA 5AJUA 1RMTA 3TR5A 4RD4A 1JH8A 3CX7A 3DOUA 1K5PA 4IG9A 5JU6A 5TVGA 1WU8A 1M2HA 3ZGVA 2QT0A 2ZR7A 3TLYA 4RHFA 4B32A 2H7VA 1SG0A 5C52B 1QS0A 5EHGA 1RYNA 3D1JA 3W1EA 4A0RA 2DLNA 1HM5A 1IQ0A 3PQ7A 2ZS8A 1LZLA 1HLGA 3L0ZA 3O74A 2GREA 5LMZA 1ZISA 2EXXA 3PBKA 3QU9A 1XQXA 2NVBA 2V97A 1LX6A 1J06A 4GMDA 2F3QA 2ZYUX 5KKNB 2WB2A 1NXVA 1I13A 1T9DA 1OA0A 4G1FA 1R18A 2QORA 4G6ZA 4NY1A 4X60A 4HF7A 4YRCA 5EMMA 1Z6GA 5FI1B 3QSYA 1L5VA 1GPUA 4MHOA 3ZXIA 4BNJA 5AM5A 1DFGA 4BQSA 5BO5A 2QQFA 1L5GB 3MPUA 1NUUA 2VK2A 4MW9A 1R3DA 3JW8A 5E1OA 3R0IA 4D74A 4NAVA 3RIMA 4A9AA 1N36B 3GLSA 4I19A 1HUQA 5AOCA 5JEEA 1WMDA 1C7QA 3DMPA 2BPOA 2J9FA 3MAJA 1IXSB 3IVMA 4WOBA 3T5BA 4TRNA 3TTUA 1CF9A 2JIOA 2O2HA 3WGTA 3SFTA 2AX4A 2XUGA 3UKOA 3QBDA 2VAVA 1KI1A 2IPAB 1NYLA 2CF6A 2VT6A 4V3CA 3BH0A 5FI3A 2CF5A 1A5BB 1JA9A 1SXJA 2NGRA 1C9KA 3CNOA 3GT7A 3ICPA 3NHMA 5B6PA 1S9HA 4CIVA 4CM6A 3D7MA 5AW4A 2HU7A 2UYGA 1R9NA 2ZWPA 1XTQA 1WCIA 1Z5NA 2WW8A 3GRUA 2WWIA 3HUTA 4PLPA 4QWMA 5I4IA 1BGXT 1PR5A 1WKBA 2Z9CA 1KRHA 1FXUA 2RHWA 3PNKA 3FPJA 4ZC1A 2GBLC 4IIDA 1A4RA 4AFNA 2YXLA 4DPMA 1KETA 3DPUA 3EGXA 3EVCA 3KEFA 3REGA 3A32A 3U40A 1W87A 4P31A 4RMHA 3OOWA 4XCVA 4B48A 1UM8A 3LVRE 3RC7A 3AVOA 4XLZA 1Z28A 1XB2A 4ZVOA 3OZDA 5JZ9A 2RONA 1GPDG 1I3OA 3AF1A 5AH0A 2NUPA 2WB4A 2AKYA 2C2BA 1GAEO 1ZSNA 3KHUA 4I6EA 3CLKA 2QSUA 7AT1A 3I62A 1U1EA 3Q8WA 2Q4TA 2CMFA 5G0TA 5C1BA 3NS7A 1DC5A 4LFCB 3JYNA 3OY7A 4JNCA 5D51S 1CY6A 2NUBA 2E2WA 2PKWA 2UZAA 3LRXA 3THOA 3RC8A 1HDEA 3NI2A 4MVXA 4P93A 4HLCA 3OIDA 3HR7A 3PHIA 5EJ6A 2QTAA 4J3JA 1BWRA 2FW0A 1VC2A 5FLKA 4OYHA 4UBNA 1AKYA 1NYTA 2JH8A 1C2TA 1OAOC 1B8OA 1EE1A 2EWVA 3GDHA 3OEHD 3PHCA 3OWHA 4REQA 2O2YA 5D8DA 1BJKA 4R4JA 4BFTA 3BRCA 3OCXA 2B9VA 3D4OA 1TMYA 4PC7A 4FD3A 4ZODA 3TRDA 2QGGA 1EDZA 5JDCC 1K5DA 2X77A 2JIBA 1K8YB 1L8QA 3EXEB 3IEMA 2ZJ6A 4R41A 5CYFA 2C9ZA 4LOIA 1J0CA 1NBME 4IIYA 4EVRA 1I8TA 3M9LA 1PLLA 4KV9A 4BKPA 2V74B 1B0ZA 2C4KA 3TZQA 5ADUS 3PQ4A 1JG3A 1TQDA 3LXRA 3BSYA 3OT1B 5GOZA 4AZ3B 2NVWA 1RXYA 5G3YA 1RPJA 1GTG1 3QV1A 5ILOA 1EVQA 1WZEA 4K05A 4YWJA 5K8LA 1V7ZA 1Y3IA 4DDMA 2E4YA 2AFHB 4LYGA 2R1TA 1EUCB 2OMEA 2V7PA 3SR0A 4Y9DA 1A7KA 1X7WB 1Z8DA 3NHLA 3NANA 3TBHA 2IUEA 2V8OA 2VCEA 3QKRA 2JH9A 1EXDA 3LDUA 4DIUA 3B12A 1HBJA 5I9MA 1W1WA 5AIAA 4LJ8A 4NATA 4B44A 4MR7B 5CUQA 1L2TA 1NPDA 4FU0A 4OAQA 3Q2IA 4GKAA 4A82A 1QP7A 3FYHA 3F2IA 4OQXA 3OQNA 3ZCSA 2HWXA 4F3TA 4OHYA 5CCXA 1RAAA 3PC3A 2GYWA 2WM8A 4JJ4A 1JBKA 5AICA 3SJ7A 1RQPA 1C1DA 3LXXA 1IN1A 4C06A 1HVXA 4QDUA 5K03A 2FWJA 1PLJA 4G0WA 1XTPA 3FH0A 4NZMA 4RIEA 4Z4TA 1IK4A 5FQNA 4AUEA 1I4OA 5FOVA 4B82A 4BJ5A 2BFEB 4EABA 3DLHA 4QREA 2MWMA 3DBHB 4CLOB 2IP2A 1C5KA 1QG2A 3CH7A 8GPBA 3WLIA 4Z2AA 4DLUA 4QE3A 1QVGB 4IZOA 1EQUA 1LY1A 3AB3A 4DNQA 5LQUA 1MC4A 3LD9A 5K6RA 1PS9A 1QYIA 5T7BA 5CIQA 3I5MA 1IXRC 1E66A 4QJ4A 1OE0A 2X4DA 4QZVA 3ZWKA 4BQIA 5CJJA 5C7YA 1QRDA 1HYBA 2ZCUA 4NCXA 1TPZA 5GTDA 3GVLA 2DKNA 2ZVPX 3FRHA 3VXKA 5C32A 1N0VC 1E7YA 1Y80A 2I34A 3ABQB 3RVBA 3PXCX 2F3SA 3VR4H 3MILA 4LZWA 4OF4A 3DNFA 4FXUA 1EE9A 3WXBA 1ENOA 1C4WA 3F8WA 3HCCA 4NABA 3S1LA 5KNDA 4MHSA 4QVAA 4QNRA 5THKA 4ITUA 2FFBA 3RFVA 1ZM9A 1T35A 1X1TA 4K6CA 1SWWA 1O58A 4Y18A 4ZKDA 1JMVA 2GI4A 1L7NA 1NI3A 1KZ9A 1RLIA 1YC5A 3A4VA 3H3JA 3OFJA 3Q8XB 4KUEA 3VZQA 5ITZA 2VEOA 2I0FA 3OAAA 1BH2A 3S2YA 1QS0B 1M1XB 3IOEA 3GLKA 4FONA 3S1AB 3RS2A 2QX6A 4ZGQB 4PTZA 2C5SA 1N2CE 2Q45A 4K81B 3DFZA 5LUAA 1RI4A 2QR3A 2EZUA 2CJWA 3UPDA 2OB2A 1U1DA 4XDZA 4JBHA 2GBCA 1AUPA 1K6MA 3WIVA 2BW0A 2P4QA 4W5NA 3R6TA 5EJAA 2ZJ8A 4G65A 1JEAA 3JD3A 3JS5A 3A2LA 4PNPA 3S28A 5EE5B 3ZIDA 1YKGA 3LFTA 2UXBB 4BGDA 2ZWMA 3H5OA 4KDFA 2PBZA 1N6LA 2VRWA 3CT6A 1TLTA 5SICE 3WYGA 4DLZA 4X8LA 4YLYA 4H35A 5I7AA 4CF4A 1NFFA 1X7ZB 3DZFA 4ZZ2A 4AKSA 1N2OA 1JEJA 1W581 2K87A 4DDWA 1KJYA 4FKMA 4QO8A 3ZDYB 2PT6A 4N5LA 2Q5CA 3M4NA 2I6UA 3JSXA 5EQDA 2IHNA 1UT6A 1UDXA 4WLOA 1JVSA 1N3YA 4Q3CA 3V7WA 3RYCB 1N8SA 3H2ZA 2D3WA 3BH4A 2IYQA 2R8RA 3GZJA 4J0KA 3QELB 2LR0A 1JR2A 1PT7A 1QE3A 3IP9A 1E2LA 2W0SA 1WCIB 4H0FA 5IZ4A 2RKBA 1FFWA 5I7EA 4LKRA 4XYGA 4BY9E 4NBUA 2JGIA 3MHPA 2IS1A 1ACJA 4B9AA 1JE0A 4URYR 3E3LA 4XAQA 3HSYA 1DSSG 5WRFA 3R3SA 3DBLB 1W76A 2AN5A 2XCRB 1GYQA 4WN3A 5C7LO 3GAZA 3D8HA 3EGXB 3SXPA 1P5FA 1EQ2A 1Z2DA 3I9NA 4MYSA 4DV0B 1Q1ZA 2GZDA 1Z74A 3ETLA 2O3QA 1QGDA 1Z6QA 4NCJA 4Y2TA 2XOKA 4UBIA 3W90A 4AJJA 2OCBA 5J4VA 1NJ2A 2F8TA 1Q1QA 3FR7A 2H17A 3L41A 2AMVA 2RC6A 5H4GA 2NUPB 1LBEA 3T4UA 4I9NA 4RKEA 4F85A 4F5EA 2O48X 1YJBA 3T9FA 4AJPA 2X1VA 3T7SA 1T4BA 1IWBB 4KQCA 1XRQA 2Y8EA 4HFMA 1URPA 3ZDEA 4CM8A 4D82A 5IMSA 3UMJA 4QVGA 2OAP1 3DYBA 1O5TA 3DVRX 5DPMA 1TC1A 1ODTC 4RVSA 5EJFA 4BLPA 1BFDA 4HGYA 1EI9A 1IY0A 4G1VA 1WUKS 3IMFA 3ZWOA 1KY5A 1LDMA 1SVIA 3BICA 2R1UA 1EAMA 1ONOA 4TS1A 1B8UA 3TNDA 4REQB 1MFPA 1XZHA 3HUEA 1G8SA 4FGLA 5AR1A 5A6VA 3DMHA 1RTKA 2C5LA 4KHPB 2DPHA 4IGKA 3VYSB 3C3DA 3HABA 2GHQA 3O0TA 3EVEA 3ZOZA 1KK1A 2C94A 4YBRA 1X2EA 5KNDD 4COOA 4QM7A 3CEJA 4DMUB 1Z2EA 1U9ZA 1DIHA 1RCTE 2B3TA 2GEFA 2ZJ2A 4L50A 4JI3B 2VQ3A 5AHWA 2X2EA 2ZR0A 1IYZA 3BCSA 1RBZA 4H1VA 1F8XA 3EMVA 3OAAD 2BMWA 1P2BA 1Z5OA 3I1JA 2CXRA 2QM8A 1M90D 1I7SB 3WDMA 4BEJA 2JFYA 4F4UA 3QU7A 3Q7QA 2XVZA 4NE7A 1RM4A 1ES9A 1ZD8A 4K1LA 4G24A 3LUCA 1EP2B 2EYUA 2R1TB 3SBXA 1IHOA 2VCHA 4EEZA 4YAIA 3WGIA 1R9GA 4AF6A 1M1KD 1NMEA 1VQKB 1V9LA 3TEJA 3ZHVA 4B4UA 3W5BA 1JILA 2OT3B 2UVQA 2XGOA 2PL3A 3LDFA 2AN1A 2PWAA 4FWIB 2VSOA 4KR2A 3QKRB 4PGOA 3HCRA 3KWLA 1ZJYA 4P3OA 5BPHA 3GZNB 2AH5A 1KZ4A 1NBIA 2N9UA 1I2BA 5J2TF 3IYLW 3JVEA 1ZZEA 5DOZA 1E6KA 3R9WA 5K3BA 4BJ3A 1A4IA 2YJZA 4CT4B 3HJAA 2DIEA 4B81A 2BTOA 4R1MA 3VU1A 5AM4A 3DZGA 1KAEA 5JD3A 4BNXA 4LVNA 4I4IA 1N92A 1C50A 1PGJA 1C1DB 4BC1A 4DLVA 4HNGA 1LLUA 1T6NA 4OSPA 2BVNA 1H9BA 1SXQA 5AP9A 2ANBA 4ZZ1A 2JCXA 5BSTA 2X8AA 1JA0A 1C7JA 2H1LA 3L9XA 4L4XA 4DCNA 1GQ2A 1IBRA 3UZUA 3WBBA 4FX5A 4MPJA 3IAM6 4QUZA 1OXMA 1XA0A 2XOKD 3CF4G 1DWOA 3JPYA 3HDHA 3LGXA 3UQYS 1VI5A 2AMYA 1CDZA 1RAGA 3BFVA 3E9CA 3EGCA 3G68A 1VQ9B 3UUGA 2R1VA 3ZGOA 1FL9A 1XU4A 3AFGA 5CXXA 2XECA 4OGLA 3HA7A 3X44A 4QFBA 4CKBA 1TJ5A 1XZIA 2HY7A 4E03A 1QCYA 1VG9B 4FQ8A 1XLWA 3MMXA 3AKDA 3G1WA 4C08A 1O9BA 1VJ5A 4BBAA 3BWYA 4LHZA 2GNAA 3KQHA 5TGTA 1V1RA 3EAFA 2CXSA 3DPSA 2VQSA 3OIGA 4ACAA 4E1AA 5H4HA 5DHAA 2I55A 4X45A 5DK4A 1K89A 3PLNA 3QX7A 4I1RA 4X7EA 4M1YA 1I2MA 2II6A 5ITZB 1P9WA 1E8NA 121PA 2W22A 2NG1A 4KYUA 2CMKA 2WWTA 3THWA 2RCYA 1M8GA 2FZEA 2ZWIA 1F7VA 1X9IA 2FX2A 3Q7TA 1YMVA 3DAFA 5JLAA 4ER5A 4UZUA 4UXIA 3KQNA 4HAZA 2OGWA 2CJWB 4RZ2A 5HK8A 4BZXA 3QUSA 3E3OA 2IZZA 4YRGA 1EWYA 5A05A 1F8YA 3HN6A 1JAYA 2GUWA 2W8BA 3HLKA 4IIUA 2GLXA 5GP1A 3L7JA 2OYCA 4O3FA 3NUZA 2FN7A 4B7UA 1KBOA 1DARA 4I1YA 4L8YA 2MDTA 1IHPA 3LKDA 2P2DA 3G59A 3QPVA 4IH4A 4JT8A 4GXQA 4E6EA 2OGZA 2CNWA 3UB3A 3KR1A 4KPYA 4WESA 2EKLA 5DN6A 4GWKA 1Z9BA 4LMRA 3JQ8A 4LY9A 4D0LB 2HEIA 2ZI9A 2V7TA 1U98A 1Y37A 5GQSA 2HSEA 3I2GA 4FCCA 5FF9A 2WYIA 3WWEA 2DHCA 1OU4A 3FR8A 5FTKA 2H9IA 3L4KA 3VDNB 3ZHCA 2B34A 2CUZA 4LMBA 2H5JA 1IVYA 1EA7A 5DWDA 5K3SA 3V8NA 2RHDA 2QY6A 2VKTA 3KO8A 4XUCA 2O23A 2JHCA 1TNDA 3BF7A 1XQ6A 2ISSD 1LLQA 3FSEA 3PT9A 3PFKA 2CL6X 2PSFA 3WC4A 4N03A 4D3ZA 3CPXA 1YS6A 3AKEA 4CIYA 5FUWA 1VJ0A 5K51A 2B7LA 3MTJA 4ITRC 2F1KA 3CM0A 4OXNA 3RM3A 2CDBA 2I2XB 4H18A 3VSCA 1QP4A 3CPWB 3BZWA 3IOCA 4R69A 3RT7A 1TO1E 1IU9A 2G63A 1P1BA 2OGSA 3RU7A 5L53A 4X71A 2QUIA 4I8IA 3BCDA 1JHYA 2Z08A 1XP8A 3L7OA 3O4JA 5FFNA 3O3CA 4JQCA 4KH1A 4KQEA 2X23A 2FX5A 4QEZA 5DP2A 3WNBA 3NZEA 4LRQA 2FPGB 2BONA 5AKEA 5J1TB 2YN2A 1M7HA 1UPUA 2OECA 4PC2A 3OCUA 4JBXA 1KQFA 1TAGA 2H1HA 5GGYA 1ONSA 3IAS6 4RCZA 1TE2A 3IVCA 4FDLA 4KGXA 4R1QA 4R8KA 3UJCA 4I50B 3SE7A 1ULUA 2PBRA 3AXSA 5FOTA 3QW2A 2P9FA 4RPIA 4BNLA 1L5RA 5AVJA 3IR5A 2J41A 1D6MA 3GUZA 2IDZA 3H18A 3EAQA 1GTZA 4JZYA 4ZO6A 2R7NA 3EFHA 4LIPD 2WZNA 1QGED 3BWXA 4ZYWA 1CD5A 5KQRA 1NKTA 1LNSA 1NWHA 5JT1A 4KNVA 2F17A 1AM4D 4N5MA 1Y98A 1A9YA 1BFUA 1Z25A 2AXEA 2HOQA 2Q21A 3O8QA 1FFSA 1GQOA 4FHEA 2VRBA 4H3VA 5HJ2A 5K7SA 5LQJA 4XQEA 4CXMA 5I4CA 4N3BA 4S12A 2GPJA 2R00A 3FPFA 4EK9A 3CLTC 5IVPA 4C0QC 1EFUA 1UDRA 5IKPA 1ZONA 4D8UA 3B2EA 4XIGS 5TE9A 3SMQA 5AHRA 3GJQA 1Y81A 4D5EA 1Z83A 4B5KA 1DBVO 1U8UA 3EZ6A 2C54A 4JL5A 2ZSFA 2BUCA 2B1RA 2BM8A 1Q7EA 2Z5LA 1IK6A 1FMTA 1CE8A 1P4GA 1RPNA 2AL7A 2PX0A 2ZIAA 1RC8A 2GJAA 4F0JA 1W47A 4CTKA 4DCCA 4W7SA 1JKFA 2IL1A 3CB2A 3S44A 1ZU4A 3A6EA 1EPUA 1B15A 1W96A 2XUZA 3D0RA 1ULAA 3D5QA 4FFNA 2VNHA 1PZXA 2X5OA 2PA3A 4H7FA 4PZLA 2DJ5A 4W1SA 2DC1A 4DBLC 2XRMA 4EO7A 3ZJVA 1T13A 3N6XA 4Y8VA 4CU5A 3DZIA 4DCJA 4FHGA 4AKHA 1AO3A 1NQAO 4FFRA 5E9WA 4ENRA 3GCZA 4LW8A 4C89A 2WNHA 3DFFA 3L18A 5JZBA 2NXWA 3HWX1 1U0OC 4KMRA 4XGIA 1G9XA 4RK0A 3USES 2AC2A 2EOAA 1AB5A 2WVJA 1R7RA 4KFRA 5JAQA 4BMDA 1MOQA 4IJVA 4J16A 4AF8A 4B6QA 1UBEA 3KB1A 4N39A 4O2RA 4YR9A 1X7GA 2XVXA 3G2QA 4MGZR 4P3NA 2PUBA 1KQ3A 3CY6A 2FZ4A 2R11A 3INGA 3MT8A 4WACA 2C59A 1PFGA 3I9V6 5HBRA 4RJTA 1T1GA 2XHZA 5HP4A 3JQCA 3M9XA 1PK9A 1Y3BE 3PI7A 4A26A 3LQEA 1XQYA 1G1MA 2EFYA 3P2OA 3PFBA 2HFKA 4XFJA 4F5YA 3OPYA 1NVVR 3GT0A 5HW0A 2WI8A 5C37A 3CWZA 3WR5A 1Z8NA 2J0UA 2PX6A 2RKOA 5CLIA 2R3SA 4QRIA 2P2ZA 2F43A 2Q0HA 3TBKA 4ZEOA 2HSWA 4XB6B 3QVXA 3EK2A 2B4KA 4M1TA 4CKBB 2VHZA 2X4IA 2Q9UA 3GLHA 5IVIA 3T53B 2ZIEA 4KPEC 2G28A 3QTBA 4G4GA 4B74A 4LJAA 5DT9A 1U4OA 1V1RB 4WNAB 3GUHA 3TZCA 3PXDA 1KQSB 1KPIA 3FMIA 5LD2B 1NW9B 4K6GA 3V4FA 3T06B 3DG9A 2I6FA 3BD7A 5FWXB 4Z0HO 3RREA 2VK8A 2FPKA 4GKJB 1QR6A 3DWEX 4AKGA 5F1PA 2FPOA 3HUUA 4J0HA 3GP8A 2PLAA 4PSAA 1Z5WA 4HLDA 2XWBF 1PV2A 3Q9NA 3QF4B 1VP3A 5FFFA 1N9ZA 1NOKA 4YAUA 3LSYA 1KEVA 4HB4A 4LSWA 3JARA 2ECOA 3V4ZA 1BQ4A 4QC2A 2ATEA 2C7BA 1P3Y1 3NJ4A 3WZMA 1FFAA 4A4DA 5I3ZA 1AK9A 3HXQA 4KIGA 2XMBA 4KXQA 4AECA 2W8BB 5AO9A 1GRNA 1UWCA 3BMNB 3HV2A 3I0NA 4FW9A 4MW5A 3DUFA 4TVKA 1K86A 2OZEA 2PZEA 1C7FA 3H7IA 4CLHA 2Y0PA 1GGFA 3F8TA 5FBQB 1G21E 5FADA 5CVUA 4RFSB 2F3TA 4JJ6A 3CX8A 1DIBA 1Y9AA 1CUCA 3NORA 4EUEA 4QXMA 4CVNA 4TN1A 2Y6UA 4BFYA 3JQ8B 4YK7A 3V48A 1DGQA 4HXFB 4HE6A 2P1ZA 3F7TA 1YRYE 4IILA 4WNIA 2UXDB 1GA6A 4LBYA 3HHEA 4LSMA 2PH1A 3DDHA 1BYUA 4KN5A 2WYRA 1CIVA 2HCFA 5BN5A 9MHTA 3OIWA 3QH4A 3HFJA 3H9GA 3I6ZA 5EAIA 2IXFA 1RRGA 3O94A 4UW9A 4GECA 2WUFA 1D0VA 3DR3A 1G8YA 3COYA 1NNSA 4DV1B 4Z4UA 1QFYA 1RLJA 2LKDA 4TXJA 4XASA 4ZTBA 3HJCA 1U81A 2DEUA 3GFFA 4WOCA 3R75A 1M34E 3VV3A 4MCIA 3WDLA 2HNAA 1ZFNA 2QM0A 4M8IA 4MKIA 4QPDA 1ZIDA 4J91A 3T61A 5C4GB 1L5YA 1VE3A 4KG7A 3S0JA 2JZNA 3C3MA 5L51A 3WL7A 4R8MA 4RZSA 3ROXA 4MDEA 3N2KA 1UMCB 2LE0A 1Q7RA 1I01A 3D7RA 2WNIA 4ZAZA 4F5ZA 2YMPA 1AQJA 4YJHA 4ABTA 4Z4CA 5FBZA 1JKJB 1BU5A 1Y8CA 3SDSA 3I2JA 3L0SA 1RRVA 1YACA 2D1QA 1DP4A 2DFPA 2O20A 2QKYA 3NGLA 3SX2A 3L6UA 4C2AA 3HNOA 4JR2A 1E5QA 1YJ8A 3C3WA 1QIFA 4B6OA 1WDKA 2X22A 4RPDA 3RRMA 2WPNA 1G5PA 5M34A 3AP1A 2R8XA 4YRDA 1Q86D 4NL4H 2IIPA 4QX6A 5L6LB 3G9XA 4Q4JA 2ZZNA 4ASUA 1JJFA 4AO8A 3OIVA 2BFCA 2ZBUA 3DFUA 3G8CA 3JAKA 1BCSA 2D5CA 4X0EA 5K6AA 1MEEA 1GDHA 3F5MA 1A98A 4FE4A 4XB2A 3JR7A 1JPUA 3D8NA 3SDZA 5TRDA 3SEFA 2B1QA 4BPRA 4H6WA 2XYVA 1PS8A 2C7RA 1E9VA 3ZY3A 1KMMA 3LGAA 1QZZA 2PQ2A 1K27A 2Y71A 1V11A 4G01B 4QUAA 3GLIA 4P54A 4D97A 1SCUA 5ICEA 2FLVA 1YULA 3ESQA 5TPZA 3DZDA 1NTRA 3F5SA 3WIBA 4BVBA 5J23A 3IBCA 4OI1A 3DZBA 4HH1A 1KDYA 4C7MA 1JJ2B 1OI3A 2WIGA 1S3FA 5C3MA 3ZXXA 5BMVB 1ZIOA 1VL5A 2YOGA 2Z6BD 2OO5A 3PVDA 1PJLA 5CD1A 3FMFA 5AW8A 4ABYA 1QHXA 5EWMA 3SJCA 2HD4A 4RMJA 2FPUA 2YWGA 1FP4A 2X3FA 5SY6A 4ZI3A 3Q5EA 5HQTA 5DYNA 1YI8A 1ZK0A 4M1ZA 3ER9A 4U4AA 1COZA 5D00A 1ITZA 4JASB 3KJEA 2XAAA 2CXPA 4MV0A 3GA5A 2PV0A 3CO0S 1N2ZA 4EVSA 3OPMA 2L82A 1YA8A 4X90A 4FJ0A 4UVDA 1ZLXA 2BP7B 4J7CA 3P9PA 3KKMA 4JC4A 3U1BA 2X1MA 3VR4A 1C0LA 4WJZA 3HEMA 4XYEA 4I3HA 1JKIA 3UCFA 4BNIA 4O4LA 2VJKA 1XEWX 4WFKA 1WQ4A 2WICA 2V65A 4Q4CA 1POWA 1UBRS 1QPGA 1U02A 2HHLA 3MCWA 1KK2A 3AUXA 1PSZA 3CUVA 3ZEAA 3ZE0B 4KQKA 1U1GA 4IZ6A 2MSDB 2CLFB 1LTKA 1VQ5B 1G6HA 2XUJA 3GD5A 1O77A 3IGFA 1G3IA 1T10A 3GO4A 3IMGA 4I1UA 3L5OA 3EDQA 4FGJA 4QULA 1SEVA 2C3UA 5AVKA 5KNCH 3B20A 1OC4A 1J8VA 3OQMA 2P27A 3MXOA 4G5FA 1E3TA 2C97A 1P7CA 2IYWA 1LSSA 3A1CA 4U5XA 3AL0C 1OYVA 2ZE8A 3BXZA 4OQYA 2CL5A 1YXMA 2VPZA 4NBNA 3QX9A 4B73A 2YHIA 5AVUA 5IBRA 3JQBC 3MUEA 3VNUA 3RWMB 3ZS9A 2J0UB 2OKCA 3RS8A 3ZU2A 4I50F 2F43B 5FO1A 4US0R 1UFRA 2PZFA 4WKOA 1OROA 1WF3A 2FDRA 6ADHA 4MR8A 5BR4A 2ZJYA 4CTJA 4FVTA 2EBHX 3D6NB 4FKZA 2PZBA 4KO1S 2H65A 1WOPA 1V4BA 1CR6A 2P6UA 2BI4A 3GLHB 4YAKA 4LC9A 3V1NA 3CVVA 2J3DA 2PR7A 4DS3A 2EERA 2ODWA 4IX1A 4M46A 5CDYA 1RJDA 1YB4A 3VR2A 2PE3A 1X87A 1XYYA 2WG1A 2XZOA 1ZGHA 3IPAA 5K3FA 4JLSA 4ASUD 4AP9A 1H85A 2ZU0C 4PLWA 2PLWA 2EF1A 3L9WA 4TWIA 4ZAFA 5G0WA 5FAKA 2EC5A 3K96A 3M49A 4B75A 4RCVA 4JI6B 3U60B 4LTDA 4D1YA 2YS6A 4DR6B 2VRCA 1X80A 1M8KA 1S4MA 2J31A 3WAKA 4EYOA 1KP2A 1YB2A 1E99A 1ZKMA 2I3GA 4EG5A 5JHHB 4F3CA 3IVAA 1YU9A 4Y0NA 1NX9A 3NBFA 4LOHA 1N8KA 1O94A 4YWHA 1NF2A 3PT5A 2PJZA 5TPZD 4M76B 1QB8A 1YBAA 2R5FA 2ZSUA 4WEQA 3RDPA 3GUCA 4D0SA 1M10A 5LQCA 1MJGA 2D2XA 2B7BA 4RC9A 3NHSA 4EKGA 2P3SA 4H27A 4EHHA 4EDFA 2YIVX 2AFRA 2OFOA 3A1VA 3G7NA 3I9MA 3DE2X 4NR0A 1L6IA 1SD5A 4JNKA 2Z58A 3C4QA 3KKEA 2XIJA 3TEMA 4DT1A 4GMGA 5CVVA 5AJYA 4DZZA 2X4LA 2Q46A 3FHOA 3MLAA 4PLTA 3JZDA 1V41E 4GPZA 4ZT7A 1CRZA 3QE4A 3AC0A 3LJKA 2V59A 4JL6A 4KKXB 5KTMA 4F11A 4KNYA 1U8EA 3AF5A 1XA4A 5JNWA 4XEUA 4JJAA 4KGDA 5H59A 1SULA 1XZEA 5KYWA 5KCZA 3G71B 3QEJA 3CD6B 4MB6A 4DR2B 5JRZA 2Z8YA 3VR4D 4L4ZA 1Y89A 3QLUC 2WT4A 1ZMBA 2EX1A 4XD2A 1MX9A 4MV9A 1RD4A 1POXA 5GM1A 3BXFA 3L1IA 2HMWA 1Z4LA 4DLKA 1RZRA 3SM9A 4C14A 1M2EA 2FV8A 4C5BA 5JD5A 5LKRA 1RYZA 3GFRA 1RRPA 2PWZA 1U0HC 1DFIA 3FGZA 3PC2A 2DFTA 1S2GA 3N2KB 4RZUA 3WKAA 1NLZA 2VJIA 2J9GA 5FTWA 2D1YA 4WMLA 2E6KA 3LX8A 4EMSA 3I56B 4HUJA 2H4JA 3VHRA 4PIPA 1A2OA 3AVVA 1JE1A 1BG6A 3SHVA 3U44A 3DW1X 3N8GA 1GO2A 2NV0A 5BQPA 2YOHA 1BHO1 2PDAA 3H4MA 2QV7A 3WGHA 1ODIA 1CB7A 1GZHB 2XGMA 3EGWA 1NL3A 3OOEA 3AHIA 4TSFD 4RVUA 3T3NA 4W1RA 1LWOA 2CJXA 2VYVD 4V2UA 5D3MA 1EM8A 3DF9A 3QVUA 4DIBA 4V0MA 4YLGA 3WSVA 3BHNA 1U65A 3OETA 5EERA 5HFJA 1QORA 1QG0A 1R37A 4Q4JB 1ODLA 1PSDA 2I3ZA 4W63A 5F73A 2BFCB 2OXTA 1VJRA 1BCSB 2XB9A 3A4IA 4KACA 1ENPA 2M6LA 1DCTA 4Q01A 3JQFA 1EJ6A 3KOUA 2PGAA 4AZWA 3V8MA 5ER9A 5JC8A 1BE8A 5E1DA 2AXNA 5IYWA 2DECA 5I9NA 1XMPA 3QFHA 1SKAA 4FLMA 1FDIA 3SQNA 2NT3A 2BGMA 2C9OA 2VF8A 4QOGA 4XUGB 3GLIB 1LBSA 4Q3BA 1VSQA 2Y05A 3M6XA 1OFGA 1SCUB 1U0JA 3N87A 1RKVA 3E18A 3AEUB 4TXMA 3K9CA 1IBCA 4PAMA 3D3EA 4WZBA 3VZRA 1V8PA 4BP8A 4K9OA 3BMOB 3KR9A 3LO5A 3ZDQA 1F6BA 1U7UA 1Q82D 2ZIXA 6ABPA 4LE1A 1P1FA 5CCDA 3CCSB 5DDIP 3WGJA 2JGFA 2ZAIA 3GMTA 1Z12A 1NYRA 4LJRA 3FNGA 1WZCA 4D9BA 1DJPA 3F73A 1O94D 2O14A 4WL0A 2WRZA 1U0LA 2HLDD 2P6PA 1YQDA 4RD2A 1Z56C 3E3NA 1TVEA 2D1SA 2QI9F 1WUIS 1ZSYA 2ZE5A 1E2DA 4IDFA 4L78A 3TTWA 4ZJZA 5A04A 4QGGA 2UUCB 1A8UA 2W58A 4RPCA 4IY1A 3REQB 3C6YA 4XDYA 1MX1A 3WL4A 3ZV5A 1TRKA 5IWCA 4UAVA 3N74A 3PP8A 1N1GA 4KTTE 1H4QA 1BMDA 2JDID 2VF7A 1L4FA 1TECE 4O4LB 5CVEA 2VK1A 3FPAA 1UD2A 1Q50A 1TA4A 1CFZA 1NF9A 1RP7A 1NUAA 2GCIA 3LKZA 1N3LA 4HYTA 4P7GA 3RHTA 3R8CA 2CSXA 1VPEA 3LQKA 4HWPA 1FW6A 1Q22A 1Q7YD 4LJ4A 3LZCA 1MABA 1AQ6A 2Z8XA 3BILA 4A03A 3LNTA 4K2HA 4TV8A 3VFDA 2WAYA 3H9EO 1NB9A 4NULA 5ICGA 2ZZMA 2WJZB 3QUBA 1E1DA 4QDKA 5KQSA 2HJGA 1FCJA 4ADSG 3HM9A 3PITA 4F86A 4WCFC 4UUOA 1RZRD 4YRJA 1EVJA 2WDZA 3QMPA 1Z38A 3R44A 5B1YA 3NETA 3BC9A 2X40A 3ORQA 2YHIB 3WMEA 4D3SA 3NP7A 3P0HA 2I4IA 1NMZA 2CHEA 4JMLA 4ZAXA 5K0NA 4BEWA 1MW8X 5AK6A 2ECPA 3ZZ0A 1A1VA 2N1BA 3VVCA 1YAJA 4EJ0A 2NPFA 4ZIRB 4B83A 1KC3A 4ZI7B 1A5AB 1WV0A 2X9NA 3E15A 3RJ5A 3VKUA 4UTNA 1ZM7A 4E1VA 3JATA 2J9XB 3GAMA 5SZIA 1PJTA 521PA 1DQPA 4MS4A 1QGYA 4K8RB 1E62A 2AX3A 4V02A 2XBMA 4MIYA 4NG5A 6REQA 1E1YA 3JYOA 5LL6P 3NONA 1F4LA 2QAJA 3DOFA 3OCWA 5J4KA 4CMKA 2C31A 1XTZA 2EP5A 1ML3A 1KI7A 2Q6TA 5FR2A 3TNJA 5KQLA 1T5LA 1HZZC 1FTGA 4KBFA 3NDJA 3ROFA 3GVXA 3TYXA 1SCDA 4RDHA 4RPKA 2VQDA 2X5KO 3VTKA 3BK7A 2W00A 3F5DA 1X80B 1BGWA 3Q1KA 4J03A 4PICA 3O6VA 5J5CA 3D2BA 3VAAA 3OX3A 2A84A 3C3CA 5EY5B 2O8FA 5BN3B 1EFDN 3QBVA 3UJDA 3D3KA 5ALPA 2H2FA 2FPIB 3EXFA 3B5JA 2OOKA 3SKYA 2REQA 3LK6A 1W19A 4HEQA 3UK2A 1RLUA 4CM5A 3FPBA 1TKCA 3RTBA 2H7CA 3DBIA 3U3ZA 2WHPB 1D2MA 2NYVA 2PRZA 1G6KA 2MSNA 2ISCA 3BRSA 4IH9A 4IWNA 5F35A 4YUAA 1GA1A 1T2VA 2IA5A 3HO8A 2O7VA 5FLYA 2EF0A 4PYRA 3NOVA 2D3TA 1KKLA 3QLVA 3ZCPA 2LIVA 3OZBA 3JAMA 1PYOA 1RWXA 3PJDA