1G7CA

Yeast eef1a:eef1ba in complex with gdpnp
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
440
structure length
440
Chain Sequence
EKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation
molecule keywords ELONGATION FACTOR 1-ALPHA
publication title Crystal structures of nucleotide exchange intermediates in the eEF1A-eEF1Balpha complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 130
structure length 440
sequence length 440
ec nomenclature
pdb deposition date 2000-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1g7cA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1g7cA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g7cA01
1KO8A 2JLQA 5K8LA 2R6DA 2H7VA 3GFPA 1Q57A 3CC4B 2RGAA 1SVWA 1ZU4A 1N6LA 1SVIA 1VG0B 1S0UA 2G3YA 1SHKA 3T15A 4D81A 4QGAA 1OLOA 1IN6A 1U9IC 1VYUA 1YR8A 1KSHA 4YLGA 4Z51A 1YRAA 4Q9JA 3U6BA 3B1XA 4LJ6A 3B8HA 3H1TA 3DMDA 2XB2A 3UPUA 4MDEA 4C7OB 1K5GA 1XFAA 1ZM4A 1CJKC 4BPBA 4DLTA 1P2SA 3M4YA 4OQFA 2WSMA 4ON9A 1HURA 1D8TA 2F55A 2C98A 4LOAA 4RZUA 1EFRD 5SZIA 2F43A 2ODBA 3ZDQA 2KSQA 4ASUA 4AY2A 1W4AA 2RAPA 2RKOA 1TVCA 1NVVQ 1NIPA 2QGNA 2ZRLA 2RMKA 3GLGA 2HDNB 2OHFA 1YHQB 2VTKA 5EXXA 4LPSA 2GXQA 4AK9A 1JR3D 1ZVQA 2RGNA 3ZQJA 4B33A 3UATA 3HPRA 3V4RA 2QPAA 2AN9A 1MV5A 4PHFA 5KNCA 1RFLA 1AZTA 4PZLA 4ARZB 1OIVA 4OHWA 4DWJA 2FOLA 2JASA 2PT7A 5J4LA 4FCVA 1S1MA 4EQ6A 1KZGB 1JI0A 1G6OA 3ZJYA 4LJ7A 5FR1A 1XD2B 4HE5A 1NN3A 3CC2B 1E2PA 2AKAB 1HH4A 4GPTA 3OZXA 1TEXA 1Z6GA 2FZ4A 3CNOA 4LJ4A 2FX3A 2OLJA 2IW3A 3L8YA 3FDIA 2PBRA 4D4LA 3GJ4A 3QIAA 4MRNA 1DEKA 1N3BA 3KJIA 3VMFA 5ELXA 3HU3A 1W1WA 4A2PA 1NJFA 3MWKA 2WSSA 2HCJB 2Q9CA 5L3RA 4DLSA 2VYFA 1SM4A 4QFMA 1GNQA 1YJ5A 2IXEA 1WA5A 2OO7A 2XNSA 3LDAA 5FL7A 3T35A 621PA 4A8JB 2AKYA 1OH5A 3NBFA 3AF0A 3AUYA 3OFND 3VNUA 4M2LA 2GK7A 3DOEA 1ZC4A 5HZKA 1CXZA 4Q01A 3OZUA 3NG1A 1KDPA 3CRVA 1JR6A 3A1TA 3QBTA 3IEVA 5CK5A 2W6JD 3BWDD 4ITRC 3C7KA 4DEXA 1FP6A 2NZ8A 2A9KA 3Q5EA 2GEDA 4QHSA 1XMVA 4QNRA 2JA1A 5AJVB 2J1LA 3CONA 3W90A 1E2NA 5BW8A 1FTSA 2DFLA 2GBLC 5A5GA 4OI1A 3EZ2A 4BLTA 4M1YA 3LRPA 2QQ0A 4WW0A 1QGAA 1XPOA 3IO5A 4JMPA 2E1RA 1R2QA 3PG5A 3CCMB 3VU9B 2VP0A 5KSZA 2D3WA 4Z8YA 1AIPA 2Q3FA 4TYQA 2ZI6A 3EZFA 3EARA 1NBMA 2ZVPX 4BEJA 3ZD7A 2R2AA 3C16C 2BCGY 4H9GA 2P67A 3G82C 2FV8A 3O8BA 4OHVA 1A1VA 1X8LA 2EYUA 1NNEA 3U7GA 1S2MA 1XP8A 3MGCA 1KTVA 3GEEA 1PJRA 1E2FA 1Z6YA 3I32A 3WRYC 1EFHA 5JWOA 4P4SA 1TUEA 4LHVA 3K09C 1FNBA 3NBXX 2NO6A 3IQWA 2OBMA 1E1RD 1Q3HA 4FK8A 1IBRA 3WHKA 1SKYB 4G1VA 1ZC3A 4G01B 4RD4A 3NC1C 3UMRA 2XXAA 2FG5A 1IN8A 2CLDX 1Q22A 4FN5A 1W2GA 3FE2A 1E1QA 5DLQC 1H65A 4F7WA 4UJ5A 2EVWX 4Q7MB 3SEAA 3VKWA 3IDQA 3UK6A 2LKDA 2ZS7A 1NIJA 1SKQA 1XEFA 5C46F 3ZGXA 4EPXA 2IYVA 4XIGS 4HAWA 2V6IA 2GXSA 4ZIRB 1KJWA 1KJYA 2XNJA 4E03A 3HR8A 3CB4A 3OEEA 1LVGA 2GWHA 2XNDD 3OW2B 1T5LA 2GTPA 3RANA 5J5CA 1MO6A 3NKVA 2O8FB 2YC4C 5FI0B 2VHUA 3IQXA 2IUTA 1W4BA 2BBOA 1QHSA 2ECKA 2KWIA 2ZRPA 4QBHA 1AKYA 3CF2A 3A1SA 4HZUA 3O8CA 2D7CA 2A5GA 2QAJA 2HUPA 1CJUC 3CH4B 2QROA 2DWOA 5LD2B 1MABA 3A8TA 2ZI5A 3WBJA 1T4GA 1XX6A 3B13B 4R7ZA 1LV7A 3CO5A 2D2FA 3B5JA 2R6HA 2IF0A 1Q20A 3AUXA 3RS3A 4RCZA 1NI3A 2QZ4A 1N0VC 4PC2A 2QORA 2ZRJA 5GJWC 2OAP1 4HUQB 3P27A 1WE2A 4ERNA 1LF0A 4ESVA 3SYNA 5DYIA 2BMFA 1R5NA 1ESMA 3T5DA 2QTLA 1FX0B 1H8EA 1AMOA 5FUWA 1KSGA 3TJZA 2EFCB 3KQUA 5BXQC 1KI3A 4YMTA 1BOFA 1Y3AA 2ZSAA 2AXNA 4IDPA 4UXJA 4D25A 1TQ4A 1E4VA 3T1OA 1OHHD 2JCSA 3CUEF 4M9QA 4IOJA 3VR4A 4NCHA 1T3HA 3PCRB 2QM7A 2QGZA 4B4DA 1UBGA 2FFQA 2XNCA 1NY5A 4DLYA 2R6CA 4BQSA 4RD2A 4S2EA 2FMXA 2BM0A 3CKLA 1SXJE 2NO1A 1HT2E 1YJWB 2XZOA 1KD1D 5TDHA 3W2EA 2WJYA 4Q9KA 2ANCA 1II9A 4MKFA 4TL7A 4IRUB 2ZETA 3CRRA 2VPPA 1J8YF 3WNCA 4MKGA 4DT1A 4EJSC 3CCRB 2EIXA 1EP3B 5AWFC 4A82A 4HLQB 1Q1EA 4C3ZA 2H57A 3B9QA 4XTCS 4A36A 3AVXA 2BJWA 3E1YE 5H5JA 2OZEA 2QN6A 3VO2A 1D9ZA 2QU8A 3KFXA 2IS6A 4AI6A 3LV8A 4A15A 1W2BB 4HSEA 2EWWA 3UXMA 1DTSA 3TAUA 2V1UA 3AF3A 1U2RA 1OW3B 2W2TA 3E5HA 2PX3A 4W5HA 2DBYA 1T9HA 2PEZA 5KSWB 1LY1A 2QT1A 3CPHA 1W48A 5KOYA 1BQEA 3GEIA 4Q9HA 2LKCA 4C0KA 2PZFA 1E2QA 4L15A 2FGJA 2ZR9A 2QG6A 1P3JA 1XEWX 4PC6A 4DDWA 1QG2A 3R7WA 4LJYA 2H1LA 4OQMA 4A9AA 4HAVA 1KSJA 4AYXA 4IXMA 3S1AA 2QAGB 2ZYTX 2ZM5A 3CXCB 1OXUA 3N70A 3EG5A 3WMGA 5AUOB 2B5OA 2VRWA 3SHWA 5KTYA 4XH9B 2VP2A 3MUFA 3OF5A 4HYYA 2IYLD 5JFGA 2FZLA 4NYMQ 2ZAMA 1VQOB 2A5JA 4P3YA 5D3MB 2JATA 2QP4A 4C30A 3K9NA 4W9MC 1TU3A 1YR7A 2A78A 1OKKA 4JYCA 3I73A 4DUGA 4L9SA 5FUVA 4B71A 1R6BX 1GL6A 2WKPA 5GADl 2HYIC 5F98A 1Z5ZA 1ZBDA 2WTUA 3QKTA 1M6NA 1JQLB 1QFYA 3JVUA 4KLZA 2ZJ2A 4KU4A 5HCIA 2D7DA 1E79A 1G4UR 4DB2A 2FWRA 1YITB 4XVRA 4JBXA 2JIZA 1YZQA 2HT1A 3LAWA 4MKHA 2G83A 2V7QD 4LBWA 2WWGA 2GJAA 4S35A 3U2QA 3ZS9A 3T06B 2J59A 3THWA 5DI9A 1OV4A 3AKDA 5C2JB 4B48A 1WP9A 1GKYA 2OESA 3B6EA 3UMFA 3T61A 3W8NA 1S72B 3LBIA 2NTYC 3SJAA 1FOEB 1YVDA 3CX7A 1KO5A 1KO4A 4AKIA 2ZJAA 2NZJA 4PPQA 4BFZA 3BS4A 4OQNA 2KB0A 4MYTA 4JJZA 1F2UA 3TGPA 1G5RA 2Z4SA 3K70C 5DI3B 2YJTD 1TF5A 2QE7D 1TADA 4FCWA 1Z08A 3DM5A 4W7SA 5EXPA 4AWXA 3AGPA 3ZQ6A 1Z3IX 2GDJA 4GI7A 1GM5A 5JJIA 4PAMA 1IJEA 3I5XA 3U61B 2ATXA 4CEIB 4GNKA 3L43A 4UXIA 5FOSA 1XEXA 3FVQA 4OQXA 4GOJA 5G3YA 2BDTA 4B6FA 4EPVA 4B3DA 1XXHE 3ZVMA 1VCNA 4DSNA 1QVAA 5BWMA 4DC9A 2KJQA 2FU5C 4QHYA 2V6JA 2WWIA 4HLCA 3VKGA 4URXR 2HJVA 3BE4A 3U44A 1OPXA 1LS6A 4P33A 4UQOA 1TUIA 3SFVA 1KOFA 3U7FB 4LYHA 1U8ZA 3X1YA 1Z6AA 5KSPA 4ESHA 1F2TB 3M0EA 3THXB 3WY9A 3P26A 1JB1A 3CRMA 3IHWA 2NQ2C 2A3RA 1COWD 1VQ4B 2RB4A 4DB4A 2FSGA 3E2IA 5J4YA 2DY1A 1Q86D 1F48A 3A4MA 2ZE6A 2E87A 4Q47A 4BRWA 3Q5DA 5AUNB 2O0JA 1XXHB 1E0AA 3U3MA 2RGEA 3AF2A 3SFZA 2UZ3A 4EDHA 2JLYA 4GDFA 1DO2A 2P5TB 3CNNA 2F1RA 2NOAA 4FW9A 2ZYVX 3FOZA 2FNAA 5GVSA 1UDWA 4G5QA 1TX4B 3K1JA 3QKRB 4QM7A 1LS1A 4C2TA 1JR3E 1TQ2A 3H84A 5A0FA 4U7DA 4GSYA 2GJ8A 3K70D 4IXNA 4ZDJA 2JLWA 2Z83A 3CM0A 4CIDA 5DNYB 1W0KD 1AQYA 2ZROA 3BC1A 3QG5A 1O3YA 2IS2A 3OZWA 4LHYA 1OH7A 4QBIA 5LDDC 3BK7A 2ZS9A 2QTFA 2ZTSA 4A6XA 2BC9A 1KI4A 4B75A 4HUTA 4YAWA 1FUKA 1PLLA 2GJSA 2FFHA 3EASA 4CEHB 1SXJC 3O8RA 3KJEA 1QG0A 4YDSA 1S9HA 5DN6D 3DKVA 1Z0AA 3CWQA 3F3YA 5FOUA 1CIPA 3L82B 5HCNA 3I56B 1ESNA 2VSFA 3RDPA 4ILEA 4LY6A 1ZUHA 4Q03A 1IB0A 4A0HA 2WWXA 1E99A 1E62A 2QSZA 3GJ7A 4FINA 3QXXA 5EE5B 521PA 4QG7A 1ANKA 4P6VF 2ZYUX 3JVVA 1HQYE 1GG2A 4ARZA 1CP2A 4BLRA 5EMNA 5JBQA 3JZAA 4EPRA 4GP6A 3RWMB 3CH5A 4A1FA 4HAYA 2Q9BA 3LVRE 1Z6TA 1IOZA 5HE8A 3VHXA 5THXA 5DIFA 3CF0A 5IDVA 1XD2A 4Z1MA 1K8RA 4LJ9A 4DDTA 3AF1A 3GLIA 2H92A 3EC1A 4TYPA 1RIFA 2VNKA 5P21A 3SYKA 2DFTA 1VCIA 2OCPA 2VEDA 5DO9A 2XJ9A 1J8MF 1G4AE 4FWIB 3RS0A 1G20E 1A2KC 4L16A 3LQRA 2IL1A 4C0BA 2XTNA 2ZRKA 2ORWA 5CM9C 5DGXA 1Q82D 2IYRA 4UAJA 4V0NA 2BF4A 5EP1A 3TW8B 2CNWA 4Q7JB 2CK3A 3GEHA 2IX3A 2C5LA 1I2DA 1KNXA 3KL4A 1R0WA 1NLZA 4MITA 4ZPXA 1MKYA 2O52A 4U5XA 4V0MA 4A8JA 1XJCA 5EP3A 1KI6A 5AJWA 2WPDD 5FPTA 3REGA 1KO1A 3PUZA 4HE6A 1VCOA 4BASA 1KAGA 1M2OB 1G291 3EZ9A 3GJXC 2MSCB 1Z2AA 1FRNA 2BBTA 3ZYCA 3QPUA 2GPJA 4F91B 4B2LA 3LBHA 4LYFA 3B85A 3GLHB 2H17A 1TU4A 3QQ5A 1N6PA 4LCBA 3X2SA 4TLEA 3K53A 1GVHA 1QGYA 3JZMA 4MUBA 4TL9A 1FNCA 2C9CA 4JIMA 1KMHB 2HMAA 2OV2A 4UNNA 1NSTA 2GZAA 1R0YA 5TB5A 4LYAA 5KU1A 2CRVA 2BMEA 2GXAA 1HQCA 2WHXA 4TWZA 2QA5A 4M21A 4UXHA 1GOTA 1YJ9B 2CL0X 5EJEA 1VYTA 2OEPA 3VU9A 4LPKA 4M9XA 2GESA 3RAPR 2GJ9A 4EH1A 2BV3A 1X8JA 1D5CA 1J9ZA 3BFVA 3GFOA 2O8BA 2ASEA 3R20A 1E64A 1ZD8A 2QMEA 1XTQA 1B23P 5HKKA 4JLAA 1W46A 2CHGA 1GAJA 4H1VA 4U9UA 2L0XA 5E7IA 1M7HA 1KI1A 1TQDA 2ZRDA 1GNRA 1UM8A 1P72A 2C99A 3B2EA 2MMGA 4LBZA 2FSHA 2VA8A 1E9SA 2WMNB 2WSSD 3BH6A 3AV0B 3DM9B 1L4YA 4PR0A 2WKRA 4POAA 2RGGA 4R71A 1XCGB 4XVQA 5FL7D 3R9XA 4XD7A 2J87A 2ZRNA 4K8OA 3RSLA 3VNVA 1OFIA 3GD7A 1RJ9B 3G0HA 2REXB 4V03A 4D0GA 4E22A 4Q4HB 3SHFA 1GZSA 3W3ZB 2WAYA 3GP8A 4O2RA 1UEIA 2CCJA 2QUZA 1GP2A 3WYGA 4PFSA 1OT3A 4RKEA 2RGBA 1K9MD 4KYUA 3SJZA 3K0EA 4NTZA 3KXKA 2BEJA 2CVFA 1WDTA 3F5FA 1N6RA 2EFDB 4DXAA 4JVMA 5TR9A 1KJZA 3ZVRA 2P6NA 3Q8XB 1OJLA 3H4MA 4EFNA 2WBLC 2N46A 2ZQ5A 3ASYA 2WM9B 1HA3A 2JLZA 1G18A 1K73D 1XTJA 4JVSB 2XOKA 4WXPA 1C1YA 2TMKA 4FMBB 4EFLA 1Z83A 4GBMA 4LJAA 1M1KD 4BEBA 3GLFE 1B2RA 3VR6A 4DIDA 1SZPA 1W7AA 4DCNA 1R0XA 2WOJA 4LBVA 1UKZA 1W87A 4R9UC 1KKMA 1DARA 2ZJZA 1W35A 5E7MA 5KPJA 1VMAA 1NBMD 4HDCA 1HTWA 4TL8A 1Z0IA 4G5OA 3U60B 1JXOA 4ABYA 2FGKA 3EIEA 4X8LA 1FTNA 2B92A 3KKPA 1VYVA 1BMFA 4TQAA 1Q3TA 1Z8FA 4ZO4A 4HUQA 3QKUA 1KSFX 3QFRA 3FMIA 3U3KA 3D3QA 3BJIC 3NDPA 2OE2A 5IT5A 1VDZA 1EWQA 3GLFB 1N25A 3K0AB 5JEDA 2ZITA 3I61A 4LV5B 2GZDA 3A1UA 2IS1A 1FZQA 1QHXA 4MDFA 3LO5A 2J5XA 3WP1B 3ZD6A 1EWYA 2UVQA 2WJVA 1X6VA 2YC2C 1E1QD 1FMLA 2G88A 4PO1A 3NDBB 2IYYA 4OHYA 1KYIA 3UG7A 1FNNA 3KTAA 2QBYA 1CJMA 4QRHA 3MCAA 1YRBA 1A4RA 5JSZA 2DHRA 1CR0A 2MSEB 3SZRA 4JT2A 2VYQA 5E4FA 1LB1B 1UBEA 2A5YB 4GRAA 4TTRA 2D74A 2XZLA 1NVXQ 3D31A 3C41J 2J7PA 1OFHA 4ZDIA 5JJKA 3QXJA 2IEZA 4GMXA 3PEWA 1CR1A 5SZJA 3W5HA 4ZGNB 4IHQA 4KXFB 1QHHA 4TLCA 2YVUA 3DOFA 2LWIA 4JL5A 2BOVA 4JS0A 1OIXA 4Q5IA 4F7DA 3CCSB 1GRQA 2A5FA 2QMHA 2VL7A 3FHOA 1G6HA 4Q00A 3FWYA 4B47A 1WF3A 2QMOA 1S3SA 2Q0HA 2BMDA 4DLUA 5AR1A 1UF9A 5B64A 3OJXA 2BVNA 1XZQA 3ES9A 1G7SA 1QHGA 2CMKA 3FYHA 4MH0R 1Z22A 3UIEA 4IVQA 4O25A 1A82A 4HDQB 4I1OA 1UPTA 3Q3JB 3EZ6A 5E7JA 1DE0A 5FBQB 2ZRCA 3CZQA 4YALA 1QZXA 3LVBA 2FH5B 1J70A 5G53C 1QHYA 3C5CA 4WIAA 4CEJA 3ZLJA 2DWPA 1JXMA 3QF4B 4NYMR 4BLOA 1H8ED 3RRYA 3MD0A 2F1HA 1SGWA 1I7PA 1ZM2A 1ZU5A 2QAGA 2R62A 3X1WA 3AB3A 3KKOA 4Q66C 2HJGA 5D3QA 1MRNA 2VLIA 3GCGA 3CRZA 3UANA 4M8NE 4Q4LA 1UAAA 1RC8A 1Y63A 4BUJA 2YINC 4M4SA 1OH6A 5JRZA 3W5UA 1DAMA 3PITA 1SVMA 3IEUA 1E2KA 2GJKA 4TT3A 1T6NA 2F1JA 3VO1A 1EGAA 3AH8A 3IPYA 4JYBA 3OESA 4R2HA 4EJSB 5D3MA 4B35A 4TZ6A 2GKSA 2BMWA 4XSHA 3T5GA 1UBCA 2GAAA 3K0FB 5E95A 2BMJA 4N1AA 3TRFA 2YWHA 2C78A 5KUTA 4JT4A 2PJRA 3IGFA 2GK6A 3CPWB 1GO2A 2GVDC 1B0UA 1D9XA 2PH1A 1YKSA 5FPHA 1K5DA 3SS8A 4YMSA 2NO7A 4I1VA 4QL3A 2O8EB 5FFMA 1E9RA 5C1BA 4CVNA 2XSZA 4Q19A 3RSOA 2J0UB 4R2IA 3EPJA 3CC7B 4B43A 4RZ2A 3EX7C 2QEXB 2BM1A 1G8HA 4JJKA 1E63A 1WRBA 3BIFA 3MFYA 4PQRA 2HXYA 3H86A 3IKJA 1G3UA 2C04A 1E69A 4V0KA 4D4JA 1JB9A 4WQMA 1H8HA 2G1KA 4J0QA 2QSYA 2WV9A 5DISB 1CULC 5DI3A 2QRZA 4BLSA 4GFDA 4QOSA 3CCLB 4D26A 3EPHA 4MRVA 1GTVA 1L4UA 4KBGA 4LV8B 1E9EA 1OB5A 3AP2A 3VR1A 1UEJA 1U0JA 3OIWA 4E5UA 5EE3A 4CEIA 4I4LA 2IWHA 2HV8A 3QPVA 3TH5A 4BECA 1G3QA 1AM4D 2VIIA 1KMQA 5SZKB 1ZINA 2ERYA 3MLEA 1UDXA 1ZYUA 3T34A 2H8KA 1E4YA 1VHLA 2W58A 1V5WA 221PA 4CGZA 3LXRA 2C77A 4BZPA 1CNFA 1G5TA 3B60A 5B2ZA 1WMSA 3EPLA 3KZ1E 1VIAA 1R10A 4DZZA 1RVDA 1OKKD 4TLBA 1XMSA 4DUGD 1YZGA 2Q9AA 1ZRHA 1TL7C 4Q7KA 3QY0A 3W2GA 2IYUA 1VQ5B 1F2TA 1LTQA 2PL3A 2YOGA 3THXA 1CF4A 2ANBA 2J0SA 1GILA 3PVSA 1E79D 2R65A 1E0JA 1G8FA 2BGJA 3RVBA 2JIZD 2VP5A 3HU1A 4PAOA 3V9PA 1TLLA 3QI2A 3RC8A 4QGGA 2GHIA 2JJ2D 4BPRA 2IXGA 1P2UA 4WOPA 2GETA 2VH5R 3REFA 2ZPTX 2GCPA 4TTPA 4DLXA 3K70B 1FQKA 2VSOA 2ZRMA 3QKRA 1XD9A 5FPSA 3TK1A 1VQNB 3HWSA 4HLDA 4YHBA 1E9BA 5FOWA 1ETUA 2BBSA 1IJFA 2XTMA 1AKEA 3DVLA 2QI9C 2O0HA 2YKGA 1SVLA 4F38A 3QG1A 3IILA 1FDRA 2ZSFA 4RVCA 2GCOB 4BFSA 1E2LA 4ZCIA 3SBEA 3I3SR 2YWFA 1ONBA 1U90A 2JGNA 3OIUA 4II7A 5SZHB 3SOPA 4FMDB 4RSGA 4D4MA 3U5ZB 1ZCAA 4Q18A 5CB8A 4CEHA 5HXBA 1R0ZA 1XCPA 2ZRGA 3W5VA 2BWJA 2EFEB 2IWRA 4DLVA 3W3AA 2ZRIA 3KUCA 2ZE5A 3T1TA 2ZJOA 2V9PA 1HE8B 2CVHA 3K0CA 5AUPB 4MYUA 1AN0A 2PLRA 2IEYA 1KZ7B 2ORVA 4AYWA 3IUYA 5EP2A 3X1XA 3A1VA 2ONKA 1ZNXA 2FFAA 4FMCB 3OE7A 3C8UA 5AUQA 1WBDA 4UKDA 1W34A 4NCKA 4BFTA 3KDSE 1CEEA 5IK2A 1T3LA 1FNDA 4I81A 5M04A 2XGJA 3FGNA 1D1NA 2EU8A 4HB2A 4EAQA 4NBSA 1S96A 1W4RA 4HAXA 1GITA 1OGJA 1QF9A 4FMDF 4OYHA 5FUXA 1K8AD 4Q1FA 4AF6A 4A2QA 3FKSD 5K8TA 1FRQA 1J90A 4YMUA 3O8DA 2W2VA 5IF9A 4Q1AA 2G0TA 4B3XA 4MGKR 1D6JA 3P1JA 4MRRA 4A0FA 2XJ4A 4B73A 1C9KA 1CKEA 5CDFA 3GLGE 4NL4H 4GP7A 4XWAA 4LGMA 3R9WA 3W8RA 3FFAA 2I3BA 4JBYA 1F60A 3QXSA 1E3MA 1CQXA 1TF7A 2ZRHA 4FMCF 3CX8A 3FMPB 4CF7A 1AS3A 1KHTA 1M7BA 3LH5A 3W6PA 1RKBA 3EPKA 1QH0A 1ZNZA 1GWNA 2C96A 3IIKA 3OFNA 3AVWA 1W0JA 3RLFA 4AIIA 4Y7CA 2W0SA 1SXJB 3NBZC 4FI3C 1G7TA 5GV7A 3NH9A 4PO9A 4NMMA 2YV5A 3RRMA 3AVTA 2PJZA 4QC2A 2GAOA 4F4IA 1UMKA 5TV2A 2IYSA 3CIOA 1SVKA 3B1ZA 1D2EA 5GJVC 2PEYA 3BD9A 2Z0MA 2ZREA 1I4DD 1VG9B 4V0OA 2RC6A 4TL6A 5CB6A 3U7HB 4FD2A 2SHKA 1NJID 3CPEA 3GLHA 4P4TA 1AS2A 1P2VA 1TMKA 5FA6A 3ADCA 2OK7A 2X77A 4GOXA 3TSZA 5C4MA 1XZPA 4K81B 5CJ2A 5GJCA 2YOHA 1KRHA 4NHOA 3P4YA 5DH9A 1YE8A 2AWNA 2ZRFA 2BGIA 5JCZA 4G1BA 4Q9LA 1OXVA 1WCV1 5EQTA 2NIPA 3RABA 1GAWA 1Z07A 1KAOA 1IXRC 4ACAA 1X1RA 1ZIPA 1DAHA 3QFSA 1RRCA 4Z1MD 1ZUNB 5CM8B 1E6CA 1R5OA 2ONJA 1AA9A 4LUCA 4JLPA 2CHQA 1NN0A 1J99A 2X2FA 1Q1QA 3CWZA 4GOKA 4Q4AA 1YQTA 2XITA 3QPWA 3AVVA 2WWWA 2RHDA 1W2HA 2IYWA 3BH0A 2O5VA 2V1XA 2FJUA 3HU2A 4PQFA 4KVGA 4EPTA 1XE1A 1GL9B 3I72A 4QGHA 4M1SA 2HLDD 2CK3D 2CNWD 4NCIA 3LNCA 4KFRA 2F6RA 3LFUA 3LD9A 1P5ZB 2VP6A 4LDJA 5BYKA 4KV9A 1Z29A 2R8RA 1KI8A 2VQSA 3BB1A 1A5TA 1Z0FA 3IPXA 3WP0A 4Q4HA 2XX3A 3W34A 5B30A 1L2TA 1FPMA 5F2EA 1NBME 5H68A 4B2PA 1BO6A 5FL3A 1K6MA 3VX4A 3WNDA 3VAAA 2GEVA 2ZEJA 4GL2A 5H59A 1NJGA 4M1MA 1GRRA 2GBLA 1ZM9A 1GKIA 4V02A 2WIAA 4PO8A 2XNDA 5JMTA 1NLYA 1CJTC 2OT3B 3EWAA 3QXCA 4BFXA 2JDIA 2PZGA 3MSXA 2C9OA 4W5WA 3AVUA 1JA0A 4G3XA 4IJMA 5FOXA 5HR5A 2JLVA 3QKSB 4BE7B 3B1VA 2DB3A 1OB2A 1EFUA 4JSTA 4L4UA 2P2LA 2A7QA 5KDOA 2OXRA 4BRUA 3DDCA 4DDUA 1HYQA 3CPJB 1Q0UA 1T0JB 2IYTA 4OK6A 1BH2A 2ODNA 4KYIB 4QBGB 4BLQA 3BORA 3HYRA 2ZU6A 4OK5A 5JWHA 1ZCBA 4JSYA 2W00A 3NVAA 2ZSBA 5FBLB 3RC3A 4DIEA 5JI2E 2C8VA 1SULA 3K09A 5B58C 4JL6A 1H85A 3D8BA 3H2YA 1XTIA 2QDXA 4P4SB 1RRPA 2IC5A 2PMDA 3B1WA 1FP7A 1EP1B 4UNSA 2LCFA 4C0QC 1CR2A 1JECA 3K9LA 4JVLA 3K0AA 3OEHD 1YU9A 3PENA 4M1OA 2N42A 3U4QB 1DELA 1VIYA 4YONB 1GVNB 3WMEA 2DETA 1RPZA 1BX0A 3HJNA 2C95A 1CBUA 2B21A 4XD7D 1UFQA 1QRAA 4O0MA 2IS4A 1GNPA 3BB3A 4XVUA 5H8WA 1G8GA 2IF2A 5J4VA 4G1UC 4LC0A 1X1SA 1XPRA 2OCAA 2CLCX 1X3SA 2RGDA 1BYUA 2QTHA 3W2IA 1JALA 2OAQ1 3X1ZA 4XWKA 3KKNA 1LW7A 4C7OA 1M1YE 3ADKA 3NIBA 3B82A 3LXXA 1QVRA 3W5JA 4WBSA 1QFZA 1T8TA 1IAQA 4RCYA 1NSFA 2WMOB 2VHQA 5L3QB 1Q44A 1L7VC 3RYTC 2JJ1A 3ZZUA 2XOKD 4L9WA 4NYJQ 3OZVA 1S4QA 4YXWD 3EIQA 2JEOA 1AJEA 1E2GA 4IDOA 2CLSA 3A6PC 1YZTA 4KJZA 4D0NA 1M7GA 1XWIA 5FBRB 2WVJA 2JJ8A 1AS0A 1YJNB 2CCKA 1P9WA 1NN1A 4TZ0A 3NTUA 4NDZA 2OSBA 4C0JA 4MYCA 1EG7A 4WAUA 2RGNC 3TLXA 2JLXA 3AKEA 1DAEA 4BFWA 3FPKA 1KC8D 4DEYA 1IY2A 3K9HA 4TLAA 1F3OA 1CLUA 2FPKA 3BRWD 1XJ0A 1BMFD 4JLKA 3TIFA 3R8CA 1G17A 1QG4A 3CX6A 2O8CB 2OK8A 3IO3A 2ZAOA 2ZR7A 4X8HA 4EFMA 1CTQA 1NRJB 3IBYA 3QF4A 4KFSA 4RD1A 1M34E 4MUAA 1N0UA 4OHXA 1KK2A 1JPJA 1IXSB 4IEEA 4Q4JB 3V4FA 2DEUA 2VP9A 4OJKA 5DYGA 2VBCA 3QENA 3ZBUA 4Q7LA 4LJ5A 2J0QA 5H70A 3QNUA 4CT5A 3NC0C 1ZW6A 5FOVA 3FHTA 3FMFA 4EJSA 5JRJA 3BXZA 3PEUA 4FCTA 1Q12A 2G77B 4OK3A 3P4XA 1E32A 3K0FA 3U3OA 4AURA 4DCSA 3F0TA 1Z63A 4DT1B 3QVVA 1VG1A 2GF0A 2CE2X 3PIRA 3L0PA 2WWHA 1E2IA 1KY3A 2J7PD 5TARA 5L8VA 2REBA 2IYQA 2HEIA 4QHTA 3W9YA 1VQ8B 2PCJA 3LA6A 2GZHA 4ASUD 1PZNA 3CCJB 2R6AA 4NCJA 3R9IA 1A8PA 2VP4A 1FNMA 1NKTA 3ADDA 4C4PA 3AGQA 4M22A 2GA8A 2J0UA 1A2BA 4LHXA 5JWRA 3MJHA 4YAUA 3LLUA 1Z28A 3W2HA 3KQNA 3CNLA 2N1BA 1AGRA 3KQHA 2NO0A 4DHEA 2HXSA 1PLKA 6Q21A 5IHPA 3PQCA 2R6GA 3HP1A 3I8XA 3MAAC 3QEJA 2HT6A 3I92A 4IOKA 3X1DA 1JQJC 1N5JA 3G71B 3AEZA 3FKQA 1XJQA 3OAAA 4IFEA 3AVOA 4U02A 2PCLA 4M9ZA 2K5UA 4OBEA 4AD8A 4P31A 2J3EA 1U8YA 2XZPA 4HB4A 4YAFA 2FA9A 3CCVB 3SQXA 3ZVLA 1FL9A 3KFVA 4PSVA 1Z47A 3R8FA 3SDZA 3SU8A 4EUNA 4KO8A 3ZC3A 3W5IA 1FFHA 4HEJA 5J4HA 4KODA 1IHUA 4JZKA 3LX5A 3L8ZA 2ZSEA 4RZXA 2G9NA 1NG1A 4ZKEA 3PUYA 1TPZA 4L8GA 3QSYA 1EFTA 3EIHA 2ZI9A 2AX4A 1VQKB 3JQQA 1R8QA 3HDTA 3IIJA 4N3GA 3N2IA 5CYPA 1HEIA 5HZHA 2NMVA 2ZE8A 2E9SA 2BPOA 1P73A 4OI0A 5BN5A 1GJRA 1U81A 1FW6A 1E0KA 3GJ6A 2ZU0C 1MO3A 1YZKA 5C4GB 3VTKA 1G1MA 1S8FA 1F20A 3B7GA 1ELOA 1UJ2A 2G1JA 2QY9A 1F5NA 3AKCA 2W6IA 2BN4A 4KVAA 2QP3A 3SI7A 2ZI3A 2ZRBA 2IT1A 2B6HA 4YQFA 1VKJA 5AK0A 5CITA 3QE0A 4DBLC 5JLJA 4Y9RA 3E1SA 5AN9A 4XSGA 3PFIA 4XOIA 1T5IA 4ZIRA 4ZCMA 1OGIA 2XSZD 2ZSDA 2J41A 1E2JA 4OQLA 2O8FA 1Z06A 4B3BA 1GRNA 1W0KA 2OXCA 1N6OA 3GJ3A 4DCTA 2V55B 1EP2B 1IN7A 1P61B 4F4CA 3ZVNA 4PC7A 1M90D 1E2MA 4D4KA 3O47A 4NCNA 3FJOA 2HYDA 2OM2A 2ZJBA 1H8HD 4B3FX 4A0RA 4CZ2A 4B44A 3CLVA 1ODFA 4URZR 1D2NA 3C5HA 1AZSC 1KNQA 1U0LA 1XNJA 4QJ3A 3CCUB 2VNJA 4IDNA 1NP6A 1MOZA 1IM2A 1BX1A 5KPDA 2QA4B 3EA0A 4C43A 3PUXA 1ZJ6A 4JBWA 2ERXA 4Q1CA 1HE1C 3ZIAA 5JZVA 1XDBA 2BKEA 1MR3F 1E9FA 1FX0A 5K8IA 2GVZC 4FXPA 5CYOA 4D0LB 2NG1A 4Z54A 3PXGA 3U44B 1WB9A 1XMIA 1G19A 4IDQA 3AKYA 2ODWA 4B6EA 2EFHB 1II8B 4KI0A 5KNDA 2Q21A 1SVOA 2G6BA 5L3SB 3RNLA 2WWFA 5G3ZA 1QBKC 2OCYC 1P60A 4LV6A 3JQRA 1DDIA 1RYFA 4A4DA 3QFTA 1T8UA 1GIAA 1U99A 3L0IB 5LB4A 5H1YA 1J7KA 1YR6A 1F6BA 2HCBA 1NVWQ 3E70C 3KXIA 421PA 5JEEA 4TMTA 3WYAA 1U94A 3LX8A 5AJXA 3CF6R 1P9RA 2F1IA 4WVFA 1OFUX 3LLMA 4WZAE 3SQWA 4PQYA 1Z0JA 1UKVY 3OEED 3NBYC 1XMJA 4OHZA 4UNRA 3SE0A 2OBLA 5E3HA 1G5PA 2Z4RA 3VR2A 3MRSA 3ND8A 1N6NA 4CT4B 1JA1A 3CD6B 1WQ1R 2IXFA 5KNBA 2WPDA 1NF3A 2QRNA 2WIBA 5EXTA 3LWNA 2B7CA 2OTJB 4WZBE 2YWEA 1XCMA 2NGRA 4HI0E 4WXRA 1SXJA 4URUR 2ATVA 3RS7A 2YZ2A 1IY0A 1W4CA 2DWQA 2BIFA 1DADA 2BBWA 3FTQA 2WWYA 3DO6A 2A30A 3PV0A 3KX2A 5ANRB 1LNZA 3AVYA 1NL3A 4BZXA 1Q21A 3GLIE 4QM6A 2PT5A 2WJGA 1QX4A 4TSFA 3M6AA 2PIAA 3NHBA 3DMNA 5DHFA 3ECCA 1IN4A 2W0MA 5FOTA 4CW7A 3GPLA 1YZLA 1G7RA 1KDTA 2W83A 2ZUBA 5FTJA 1KGDA 1Q1BA 4Q1DA 4E07A 3EA5A 1SVSA 2J45A 4UJ3A 5KDDA 1G16A 5J40A 2OCBA 5KO2A 2PLFA 1RZ3A 3OE7D 2KBEA 4V0ME 2AHOA 2CJWB 3A4NA 5AJZA 5IK2D 4DJTA 4BFUA 4B34A 3K9GA 3UKDA 2RH5A 2WJIA 3GLIB 2QEQA 2GRJA 3TKLA 3P20A 2P0EA 1IN5A 2ZUCA 2NPIA 3BFKA 3RHFA 4GZMA 1TNDA 2VF8A 3PR1A 5UKDA 5JJLA 5FUYA 1Z2CA 4NE2A 3H0KA 4I1UA 4PPNA 2GILA 1QUFA 2OFOA 2FDCA 3TSWA 4AG5A 2NO9A 1AK2A 2CL7X 4PGOA 3J81k 4N3NA 2OG2A 3RS4A 2JLRA 2WOOA 4IOLA 4Q1EA 1IY1A 4DLWA 1KI6B 2WAXA 4NKRA 1QHIA 1DAGA 1DAFA 4JLDA 2AL7A 4MA4A 2ZJYA 3TVTA 2B8TA 1W0JD 2QP9X 4US1R 1QFJA 2GCNA 1BYIA 2WJHA 4DLZA 5KDLA 2AWOA 4KITB 1R5BA 3M1IA 1PV4A 3THYB 2H18A 1E2EA 3LW7A 4OI4A 2X19A 4G5SA 4D2IA 1GUAA 1CJVC 2P6UA 3MWLA 1E9DA 4JKYA 3I1FA 3BFXA 3KXLA 4HLUA 4P32A 4ZGQB 1TQ6A 3DPUA 4HATA 4B76A 4BLPA 1VPLA 4QKQA 721PA 1VTKA 2IHYA 5FTKA 3QKSA 5EP4A 4DSOA 4RFVA 4DQLA 1XU4A 1LF5A 4OJQA 1MRSA 2W2XA 3A37A 1X86B 4LWZA 1SKYE 2GXUA 2R9VA 3PJRA 3KB2A 5CK4A 3TBKA 4LK2A 1ZP6A 3NH6A 4PHHA 5GJBA 4TLDA 2P3SA 3TSOA 3FFBA 4MGYR 3A4LA 2O8BB 5LBIA 5L3VA 4IEIA 3MWJA 4B3GA 2A5DA 2OUKA 5K8UA 4EPYA 3SC3A 2AD5A 2DFKB 2V3CC 3CCEB 4O3MA 4FIDA 1GKUB 1ZNWA 1KK1A 3LW8A 5JHHB 1DDGA 3MWYW 4QNMA 4WZ6A 1VCMA 4DCUA 3I62A 1G9XA 2I4IA 4M53A 3RS5A 4AC9A 1BS1A 4C2UA 1CS4C 1XXHA 1TTTA 3A1WA 1IONA 3ONWA 1GFIA 3ND9A 3UMSA 5JCPA 1R7RA 2DPXA 2WKQA 4URVR 3U4QA 1US8B 2J9RA 3AVQA 2AFIE 1XF9A 2I1VB 1NY6A 2F9LA 4H1UA 1DBSA 1T0HB 3A58B 2VSXA 1W36C 4YDHB 1JBKA 4JLJA 1HUQA 4MKIA 4RD6A 2D4HA 3KJGA 1XEWY 1I4TD 4LHZA 4OKSA 3TR0A 4TYWA 1OH8A 1QVGB 2ZI4A 1NMXA 2QENA 2QPOA 3AF4A 1LFDB 4YAOA 2F7SA 2Z6VA 3PEVA 4RFSB 5J47A 1DO0A 1G3MA 5TY0A 4NYJR 4DDVA 1MO5A 1WBBA 2RHMA 2EQBA 4JL8A 2ZIAA 5F9FA 2O8DB 1KIMA 1EFRA 2JDID 4ZDKA 1E2HA 3U6KA 2IA5A 2Y8EA 4XTRA 2XAUA 1XTSA 1HV8A 1ZIOA 5EZ6B 5L3QA 2AD1A 3DZ8A 4G5GA 1JR3A 5CLLA 1ZNYA 3CZPA 5JECA 2GF9A 2UKDA 1Z6XA 2AK3A 3FB4A 3QUSA 4Q1BA 1RYHA 2FSIA 3MJRA 3AM1A 3QJYA 4IDHA 5BN3A 3GQBA 1PVOA 3MHPA 5KSOA 2VZLA 5GVRA 1E9AA 2FF7A 3AP3A 1KK0A 4HDOB 4ZI2A 2CNDA 2FSFA 1JAIA 2X8AA 1N5KA 4MQBA 3OHMA 2P5SA 3B78A 4JKIA 5BYJA 4CDGA 2DR3A 1P9NA 2UZIR 1GDDA 2NPFA 3TVDA 2KBFA 1KKLA 4V0LA 2O8CA 2MSDB 4QGFA 1HY3A 1PUIA 2R44A 3KQKA 3L0SA 3T1VA 3WRXC 4KFTA 4TYYA 4M1WA 4NYIR 2JLSA 1L8QA 1PLJA 3VR5A 3CW2A 4DRZA 1EWRA 4NP6A 4LSGA 4PX9A 1VQPB 5FR2A 3D7MA 1U9IA 2BJVA 1VQ7B 4I1SA 4Q4JA 3GFTA 1W36D 1N6IA 4N0DA 1DS6A 4JLBA 4MYHA 4KAXA 2G0NA 1DVRA 3KTAB 4KBFA 2R6FA 4WA7A 3UG6A 2QBYB 2B8WA 3L2OB 2BEKA 4B3CA 1E98A 1RE0A 4AYTA 2EYQA 1NMYA 5JSZB 2ZS8A 4TMWA 3Q9LA 1HT1E 5HPYB 3OJWA 1NG9A 1ZMXA 1AQUA 1G64A 4C0SA 2V4ZA 2RC5A 3NHAA 1VQMB 4PAQA 5FTMA 3TQCA 5KSYA 5FPYA 1N6KA 2OLKA 5CIWA 5EUQB 3W6OA 3TUJC 4X8OA 2FE4A 5DE3A 2QQEA 4A8JC 1KK3A 4A6PA 1V43A 1IQPA 2ZJ8A 1QHHB 2W6JA 4D82A 1GL7A 2F43B 1ZUIA 4E09A 1OIWA 2CHVA 3GLGB 1TAGA 4M1KA 1NDHA 2MMCA 4R98A 1DG3A 2JJ1D 1I4LD 3VR3A 1CR4A 3DEFA 5CJPA 1G3IA 8OHMA 2VNHA 4Q9IA 1W5TA 1KMHA 1NVUQ 4Y9UA 1E0SA 3HPQA 3TUZC 1KY2A 1ZM7A 2P6RA 1EFCA 2DFNA 4US2R 2REOA 3LBNA 5EE9A 4PPFA 3FPAA 1W44A 3I4LA 5CLQA 4EQ6B 1P4SA 2AXPA 1UADA 3KUDA 2CEAA 4P4UA 4BFVA 1UKEA 1N0WA 1NKSA 4C0AC 3Q7PA 3T1QA 4CEJB 3EC2A 1FUUA 2V54A 1SHZA 3ADBA 2CCGA 4KFUA 3ZZ0A 1N5LA 4OI2A 4F92B 4ZV4A 5EUMA 1VQ6B 4LX0A 1E9CA 4A0GA 1AGPA 1YR9A 3THOA 3DHWC 1OXTA 1E1RA 5FBWB 5F3WB 3P32A 3U7EB 4TYNA 1R8SA 3PEYA 4QXAA 2OTLB 4L5BA 3TAHA 5TMPA 3ETLA 1EK0A 3NXSA 1U8AA 2QTVB 5B57C 2IUSA 1MO4A 3UWOA 2A2ZA 2IBMA 4JVNA 3V00A 4DLRA 1RJ9A 2KE5A 3K8YA 4IFBA 4NONA 1OE0A 4W5JA 3AP1A 2IK8A 4XWOA 1CRPA 5KHOC 821PA 1JPNA 2ZXUA 4P0TA 2ZE7A 3CBQA 2RCNA 3BOSA 3WBKA 1KDRA 3SBDA 4B74A 2KI5A 2JJ2A 1JJ2B 4K46A 1YZNA 3CRQA 4UNQA 3NWJA 3Q72A 2AK2A 4PZZA 4JLMA 4QJ4A 3DL0A 5EE1A 5G41A 4A92A 2OILA 1XTRA 1R4AA 2D2EA 2DYKA 2Z5FA 3SN6A 5J4KA 3GMTA 1CRQA 1KQSB 3IHLA 1N8RD 5FBVB 4D80A 4K1XA 2YHSA 4URWR 1XD8A 3KKMA 2QMUA 2ZRAA 4TTQA 2ZJ5A 3E20A 1MT0A 3OAAD 4OL0A 2V8OA 2GQFA 2B7BA 4A2WA 2C9YA 3Q85A 4KLNA 1S9DA 4JLVA 1FMJA 2C03A 2Q3MA 2X3UA 4M1TA 1E94E 2BKUA 3RRNA 4PC1A 1DG1G 4AF7A 4DKXA 3VKHA 2IYXA 3W6NA 5LD2C 4LHWA 3LVQE 2D62A 1J2JA 4JLOA 5FTNA 2X1VA 2Z43A 4Y0AA 5BN4A 4CRWB 1OXXK 5HKKD 2ZYWX 3GJ8A 4NU0A 2WICA 3QFCA 3RWOA 2BSAA 1KI2A 3EAQA 4PANA 4PSAA 1QGZA 1ZM3A 4UNPA 5DSZA 3GLFA 2VF7A 2XXAB 4BZQA 1XBTA 1QHNA 4PC3A 1OHHA 4D6PA 5BQ5A 4F4JA 4GMDA 1T3SA 3GJ5A 4TMXA 1YZUA 1II8A 1C4OA 4KCGA 4Y0VA 4B32A 1RRGA 4G5RA 1N2CE 4KHZA 3I55B 4LJ8A 5L3SA 5G40A 4ZI3A 3T12A 3LQQA 2I1QA 1NMZA 3MG9A 1GAQA 4MRPA 1ZD1A 2GNOA 4LRWA 3SYLA 4M0LA 4ZKDA 4C9BA 3CMEB 2CDNA 2C2HA 2W6ID 3FKSA 1ZD9A 3QEOA 3G4SB 1JJVA 2FEOA 4ACBA 4LBYA 4KSBA 2RGCA 3ICQB 3GJ0A 2Q3HA 4U00A 4DCVA 1G21E 5LB2A 1VECA 5TVKA 1EX6A 2QNRA 1MH1A 5AJYA 3VHLB 4BFYA 1BKDR 3QE2A 1O87A 4HZUB 3CMAB 3KQLA 3DKPA 1FQJA 1ZAKA 1P75A 1MABB 1OSNA 2ZVQX 2ZANA 5FI1B 4AKGA 3CR8A 3C4JA 4TQ9A 3U3JA 1NVVR 4GT1A 2CBZA 2HF8A 3BH7A 1NN5A 2OFWA 2DCUA 4EPWA 3EZ7A 1XTKA 1GSIA 2VHCA 5JS7A 1BIFA 2ZI7A 3CR7A 3EWSA 3I8SA 2YNMA 2YWGA 2CE7A 5DHAA 2JAQA 2BHRA 3TUIC 2FPLA 2IYZA 121PA 1S1CA 1Q81D 3QVUA 3VFDA 4FWTA 1JEEA 2RGXA 3ZIAD 2FFBA 3G6EB 3G5UA 3QXHA 3MMPA 5JS8A 3RRZA 1TF2A 5CDFE 1RW4A 1E96A 1G8YA 4HAUA 5HTKA 3CCQB 1QVFB 2WJJA 1OYYA 2WZQA 1VHTA 2QL6A 1P6XA 1M74A 5JI3E 1N5IA 2XTZA 1KO7A 2QAGC 5TXGA 4IVRA 1XPUA 3LO8A 3QF7A 3F8TA 1VG8A 1D2MA 4NYIQ 5EZ5A 4PHGA 4TMVA 2CJWA 2P65A 4MGZR 3WMFA 5FTLA 1II0A 5A4JA 3SJCA 3PUWA 2J7KA 3TMKA 1OF1A 3ZZTA 2PX0A 2YOFA 3EXAA 4RKFA 4I99A 1H42A 1Q7YD 3SJBA 2BCJQ 2QTZA 3GLHE 4DSTA 1EESA 2V7QA 2ODEA 4NZYA 1EXMA 5GV8A 3V76A 2HLDA 1DAKA 3ASZA 1EX7A 1JNYA 3SR0A 4X8MA 3SNHA 1OFTA 3WNBA 2QM8A 3Q7QA 3BB4A 2O8EA 2PMKA 3RS2A 2FEMA 1OXSC 1DPFA 2EWVA 4KSCA 2YYZA 3OIVA 4JLNA 4C0LA 4M9SA 3KB1A 1SXJD 3D6TB 2GEUA 2VHTA 3AQ4A 1YI2B 5EXSA 2QE7A 3IBGA 3OIYA 2XEXA 1T91A 3THYA 3W2FA 2IHBA 4Z8XA 4ZCLA 3R7WB 1BJKA 1XB2A 4YC7A 4XJXA 5LPNA 1VQLB 3S1AB 5FPKA 1JAHA 1UBFA 3ZS8A 1JEDA 2AR7A 4HZIA 4RD3A 2AFHE 3LY5A 4TSFD 2F9MA 1CU1A 4HB0A 1P2TA 4HLUC 4IW3B 4IVPA 3BAFA 3TNFA 3HR7A 4MRSA 4PHTA 4PSKA 1Q1ZA 3U3RA 4TMZA 4NPHA 3N2EA 4O2LA 4DQKA 1JJ7A 4CYMA 1W5SA 4RD0A 2DERA 1P7CA 4IOMA 4TT3D 1U98A 5JHGB 2CXXA 3TQFA 3EW9A 1W47A 3B9PA 4DVGA 4LI0A 1DAIA 1GR1A 2ZUDA 3N5CA 4EKDA 2IUUA 4GZLA 3QBVA 4RY2A 3WYFA 3A36A 1COWA 4Q4AB 2HF9A 1Z0KA 1X8KA 2EW1A 1G41A 4RZ3A 1YIJB 1G8PA 1YHNA 1DOAA 3BERA 3I5YA 1RRFA 3OEHA 3THWB 2FPMA 2VNIA 1S3GA 4TMKA 2H5EA 3TR5A 3ZH9B 1KDOA 1N6HA 2OBNA 4AG6A 4TN1A 2VHJA 4HB3A 2VO1A 1P62B 2ZR0A 3WXMA 2J46A 1US8A 1KI7A 3IIMA 1WXQA 1KI9A 2F3TA 4F93B 4QBFA 3B1YA 1NLFA 4YMWA 3HYTA 1F2UB 2D06A 2QT0A 2X2EA 3CRW1 1XRJA 4B2IA 3BGWA 5IRCD 1QDEA 4RJLA 2CL6X 1E2DA 3NEJA 4PXAA 1U0HC 4YMVA 2EFGA 1TEVA 4RFSA 4ZDWA 1I2MA 2QPTA 1CNEA 3AVPA 1OYWA 4URYR 4US0R 1VQ9B 3VQTA 2GCOA 4G0NA 3FHCB 1G3RA 1XEXB 3PUVA 3ZBTA 2O8DA 3UWKA 2H16A 4LYJA 4Q21A 5DN6A 1M8PA 4YXWA 3TW4A 3KJHA 4AKHA 3FMOB 2F3RA 1QUEA 4Q48A 5F9HA 3NEYA 1G7CA 4HAZA 1IXZA 4QJ5A 4BWYA 3K0SA 4PTLA 4TQUS 4AKEA 3ICEA 4EIWA 2PZEA 4LZZA 3C15C 3WHLA 1Z0DA 2FN4A 3C14C 3KKQA 4BGDA 5HE9A 3BBPA 5KYKA 3JQPA 3TE6A 1W49A 3K0CC 2Q6TA 4Q02A 3VX3A 3QOFA 4NH0A 4C0HA 4IKEA 5CIQA 4DSUA 3DZDA 2JLUA 1PUJA 5EE0A 4PPGA 2J0VA 2OFXA 1SQ5A 4LC1A 4N0EA 2XB4A 2O0KA 4PZYA 4MGIR 1A7JA 3L0OA 1W36B 5C18A 2ORIA 1UKYA 5FH9A
chains in the Genus database with same CATH superfamily
1KO8A 5JISA 3OCCA 5F3RA 2OLEA 1Q57A 3CC4B 2FRDC 2GBGA 4X07A 1VG0B 3JD4A 2Q4TA 5JZ9A 5KJ6A 3PC4A 1RHRA 2PFKA 4GH5A 2CXUA 4D81A 1E77A 1LNSA 2R8PA 4U2CA 1ECFA 2HZBA 3NANA 3NWOA 4G89A 4Z9BA 1AD2A 1KSHA 4NQZA 5K6AA 3CZRA 1PFYA 4JLSA 2QMZA 4BVKA 5JR3A 1J0EA 4B83A 3DMDA 1T5HX 4C01A 3DXFA 4C7OB 4FYJA 5B1SA 1LSUA 4RO0A 1ZM4A 3QQPA 3AFGA 1Y89A 1XPUA 3F6EX 2RKWA 3ZDXB 3OTGA 3UICA 1YB5A 1P2SA 3NEAA 2OHXA 2UYQA 3WK4A 2WSMA 4S0XA 4CCWA 1HURA 3AY7A 1D8TA 3EFBA 4W5NA 5SZIA 3HQ4O 2ODBA 5IZ4A 2Q5HA 4FE4A 2RAPA 5CW1A 3GZNB 1NVVQ 1NIPA 2HL6A 1E5TA 3GLGA 3MJTA 2OHFA 1HLGA 5ESXA 3EVDA 4LPSA 3IDOA 4I5FA 1JR3D 4EHHA 3G2IA 2W5UA 1TYZA 2HPHA 4MDHA 4PG7A 5DLDA 1J4AA 3HPRA 3ZQJA 4YJ3A 4DHWA 2UUBB 2AN9A 1OD6A 1GPNA 5KNCA 1RFLA 1TZKA 3H7AA 1E1DA 1YCFA 2JFOA 1OIVA 4MYSA 3SXUB 5EHXA 2QG9A 1OMOA 4V3CA 4KXVA 2G7ZA 2PT7A 4FCVA 5J4LA 4BDSA 1O2DA 1PKVA 5ILQA 1XRRA 1GGFA 1VSTA 2CFCA 3VHXB 1JI0A 3RVRA 1AOXA 2VT2A 3KV1A 4RIGA 5TMDA 4M6WB 3T52A 4MA0A 3QU7A 3V6LA 2FWJA 1YK0A 4NSNA 5BSHA 1I5RA 1F17A 1ZA2A 3OH8A 4ENSA 3CJQA 1YFKA 1EM8A 4Q0MA 3ISVA 3PGA1 5JG7A 4P35A 4BV2A 3SWWA 2GZRA 4NXMB 1YE3A 2ABWA 1Y6JA 3IXQA 3LK6A 5HOQA 3FDIA 4LHSA 4H7KA 4HFMA 4MRNA 1R64A 3O82A 1N3BA 3KJIA 3MYRA 5DNDA 3WQBA 3BM5A 4KQ1A 5IJ0B 3ZXYA 2PGJA 3TMYA 1P1CA 1C0EA 2BI4A 2WSSA 2VEOA 2WF6A 4IMJB 4DLSA 2VYFA 1L4MA 5CCEA 4MKZA 1YB1A 3KKEA 1GNQA 3T35A 3TF5A 4O4LA 3L01A 2Z3WA 1G6Q1 1GLNA 2AKYA 2BLNA 2P3OA 1CHDA 3AUYA 3QUBA 3I5MA 4CFZA 3AINA 3Q9SA 4M2LA 1TTQB 3JRXA 3RO7A 1LRKA 1WUIS 1F51E 3VH4A 2ZL6A 5J59A 3QYFA 4X6UA 1M2JA 3SHTA 4I4NA 3UJAA 2PT6A 1Y8AA 3RASA 1OBOA 1J0CA 1PGJA 2M6KA 3JASB 3WNQA 1FVFA 1Q5PA 3TW0A 1A71A 1UODA 2HCTA 3PE4A 1KFKB 3QBTA 4HVCA 3IEVA 5CK5A 4EX6A 4GMGA 4DEXA 2HRBA 4IJ5A 5BQPA 1FP6A 5FUBA 2A9KA 3Q5EA 3ROPA 1UIMA 1PBNA 2BFMA 5HQTA 2JA1A 5IWAB 3VJRA 3Q0IA 2QUBA 4X97A 4AMGA 2YIMA 4L0QA 4Z5XA 4N0MA 5AJVB 3R2JA 4L6IA 2J1LA 3C1TA 3CONA 3VR3D 5BW8A 2CHEA 1BU8A 1ES9A 1HZZA 2DFLA 3BE5A 5A71A 3QELB 4AO6A 5A5GA 4M1YA 2IYAA 2B4YA 2W8BA 2ZVJA 3OLXA 3TLYA 2VPTA 4DK1A 3GDHA 3ROXA 2E1RA 4BKOA 3L7YA 4Z4YA 4ZO7A 3VNQA 3RLIA 2JBAB 3PNOA 3CCMB 2C57A 3K3PA 3VU9B 2D3WA 5JXIA 1AIPA 2P8SA 5LNK6 2ZI6A 4AB1A 2NX2A 2M6SA 3NZEA 1F8UA 5HQJA 1IL0A 2HN9A 5HIKA 3L1KA 4PS1A 4PBRA 2C5EA 3C16C 1NUSA 2FSVC 1DJQA 3K92A 1QTIA 3UJHA 1I18A 3OLVA 2Q1TA 1QS0B 1XP8A 3MGCA 1KTVA 3V6MA 3TJRA 5K0SA 2IEIA 3KO8A 1FJGB 3IOCA 4BNXA 3IP8A 5BOSB 1E2FA 3O1LA 2XQVA 3I32A 5D87A 1EFHA 5JWOA 3DYVA 3OBIA 3N0VA 1TUEA 1ZUWA 4P4SA 3ET4A 4LHVA 4DV7B 2A4KA 3VZSA 2YL2A 3L6OO 2NO6A 3DHNA 2OTCA 3ZHXA 1BFDA 4A91A 4FHEA 3WKBA 3G02A 2RHOA 1QM5A 3U81A 3OVMA 1OZAA 2HK9A 1N9GA 2XXAA 1HMYA 1IN8A 2C5SA 1W2GA 2XMGA 3R5HA 4FFMA 4MUXA 4QVGA 4W9NC 4BNNA 5DLQC 3KKZA 1H65A 1IEQA 5KW9A 2G0AA 4UJ5A 5FLKA 1TC1A 1S7CA 2QW1A 4LNHA 5AHOA 1AO0A 2HB6A 4B0PA 1P45A 2FPUA 2R4UA 4DNFA 3SBXA 3BXPA 2YJGA 1R50A 4ZA2A 2PU7A 2ET6A 2V7PA 3ZPNA 4IIHA 3AFOA 1EFVA 3RHSA 1Z4PX 5ITZA 1AN9A 2CUTA 1E89A 3KVRA 2QN3A 4S0ZA 3FVVA 1U0BB 1NKVA 4XQ0A 3E7XA 3ZY4A 5JVDF 3CH6A 4DR3B 2XNJA 4YS6A 1XN1A 4FPXA 3HR8A 3CB4A 1RIIA 3GAMA 3LUFA 5KIAA 2XNDD 2PKXA 4GPBA 4LQLA 1T5LA 1VHJA 4BYMA 2A9VA 5J5CA 1MO6A 3ANNA 3ZU3A 2YC4C 4I9GA 3EJ6A 1UMCA 1UXJA 4B9AA 3IQXA 2ZL5A 1VL1A 2AFIB 3DDNA 1USKA 4KXUA 1QH8B 1AKYA 1RWMA 2Z8XA 3CF2A 5K03A 5MFZA 4MW7A 3HBJA 2A1TR 2QAJA 4BAGA 4EYGA 2QROA 4EHJA 2AEMA 1T4GA 1XX6A 2J9FB 2PD6A 3HA2A 3WK8A 4C76A 2W6QA 4ARIA 1Q95A 1Z0UA 1MW9X 1E1KA 2GPYA 4RCZA 2I5PO 4JAVC 3K2EA 4HDNB 4EARA 4PC2A 1U8UA 3JATA 2QZPA 5FEMA 3LQEA 3FSEA 1YLOA 1J8QA 3IBCA 4QQFA 3DWIA 3KOYA 1R6DA 1Q6YA 3NHPA 5GZ1A 2WFAA 1K89A 2BMFA 1T8RA 2XA2A 4GGMX 6ADHA 2H7YA 4MXDA 3TJZA 1J33A 4N8DA 4PX5A 3KQUA 2VWQA 3V4VB 1THTA 3GLGB 4KW7A 5IYPA 3KZXA 3OMWA 4LI3X 2B8EA 4G0YA 4MLDA 4CQLA 3T1OA 1E4VA 2EZUA 3JQ8B 1P2BA 4B0OA 2C2KA 3JZIA 4CIWA 1XFDA 4R40A 5KX5F 4AN0A 3T3IA 5FJJA 4B4DA 3CLSD 3ZCVA 4O2BB 3VOAA 1NI4A 4F0JA 3QOXA 3E9QA 3ZYZA 3MWDB 3RGWS 1SXJE 2BFCB 5LQUA 1YJWB 1TEHA 4WZEA 2XZOA 1KC3A 4TOIA 4O4IB 4KN5A 4QFBA 1EJ0A 1II9A 4MRMB 1BFKA 3ROFA 3DF7A 1CY8A 2ZETA 1Y80A 3G2MA 3WNCA 4I0WB 4MKGA 1DBRA 4Q3KA 4UE6A 1LDBA 2EIXA 1H22A 2WTAA 5LCXA 3CSUA 3N2NA 1PBTA 3RBVA 3WK5A 4HLQB 3X1KA 4FR0A 2QQFA 1O94D 3IBFA 4KX5A 2H57A 4OUKX 1K9VF 4JCOA 1K08A 3AVXA 4P86A 1UOOA 3E1YE 4L02A 4XTCS 4BV3A 2G06A 3HFSA 3VO2A 3V55A 2OY0A 3DMFA 1ESEA 4ZO6A 4D1YA 4FIZA 1XA3A 5TQ2A 2J85A 4EHAA 1VLJA 3OOYA 1U2RA 2XUAA 3M6XA 4W5HA 2QRGA 1SAYA 3E5HA 2Y92A 5TMEA 3DNFA 4KR9A 5L51A 3HKEA 3K35A 1VM6A 3ABOB 3DTVD 5KSWB 3PCXA 1Q0PA 4C6RA 1ADBA 1QH9A 4TSKA 2YZKA 3WKDA 2W43A 3E1KA 5KOYA 5ESDA 2BFNA 3GEIA 2I7XA 2DFVA 3PA1A 1G98A 1L3CA 2AMJA 2PZFA 3BMOA 2FGJA 2WKSA 4C0KA 2CFSA 3BWYA 1XEWX 2JFFA 1SUWA 3V8QA 4Z4SA 2ZBVA 4PC6A 1JU4A 2C84A 5ER6A 3WLFA 2C4NA 4RX1A 2QGFA 3ASSA 3QW2A 5A3SA 3D8NA 1JE0A 4JP8A 4NZ9A 5BSYA 4JDPA 3AIIA 1FMCA 2HIMA 3DTYA 3I1YA 4LJYA 4NU8X 2Q5CA 2ODAA 4U7PB 4WNIA 4ZAYA 4RV5A 5B4UA 3S1AA 1JDNA 2ZM5A 1Y33E 4ND8A 5KYYA 1OXUA 4FXUA 3N70A 3RUDA 2B5OA 2XMDA 2Z2ZA 3LRTA 6NULA 2QUIA 3OHSX 1NVDA 2ETXA 4FE7A 3SHWA 1J1UA 4PYRA 3K20A 2ZSUA 3BQMB 2G1PA 3PUMA 2JFYA 2VP2A 1T9GS 3O7WA 3OF5A 4HFJA 4TKUA 3G9TA 5JFGA 1XALA 2ZAMA 3JQ9C 1SK8A 2A5JA 4P3YA 5KI6A 5E2AA 1IJBA 1S8OA 3EQ2A 2JATA 4C30A 3N05A 3T1NA 1CQIB 1TU3A 1YR7A 2EARA 3AU9A 4GPIB 2C2ZA 2I4MA 3DQZA 4QYIA 4WKCA 3L6EA 2JIPA 4KQWA 2PTHA 1QPBA 3Q7RA 3FROA 1C7FA 1QP8A 1RD4A 1DNPA 4OHKA 1PWZA 2PGXA 1JQLB 5JAPA 4ALLA 1GUYA 3IYLW 4DA0A 2D7DA 5JH7B 1X0VA 2H85A 4I55A 4DB2A 3G8DA 1XK7A 4K3VA 4X1KB 4JBXA 3OD1A 2WNHA 1KDYA 4MKHA 1KEWA 1L7PA 1N2SA 1ZICA 2G83A 4G63A 4ES6A 3B1KA 3F4KA 2WWGA 4REQA 2VTVA 1ACLA 3IDZA 4XE5A 5JYEA 2OQRA 5KYGA 3THWA 3FLEA 5FDFA 2VJLA 3ZBQA 1OV4A 1WCYA 3AKDA 5C2JB 4B48A 3N8GA 3WLKX 3WLRA 2PFGA 3B6EA 1XMQB 2IU4A 1S72B 1JHRA 4CUKA 5EMKA 4FFPA 2VYND 3AO0B 5D5QA 4YJ2A 3CX7A 2I34A 1BVYF 4CLXA 3IFSA 5JJCA 2ZJAA 2NZJA 1KMMA 5G0VA 3RVJA 4BFZA 5ICMA 4MYTA 4JJZA 3OX3A 3E7DA 3MWFA 3H1PA 2Z4SA 3K70C 4Z4VA 3A32A 1YX2A 1C7JA 2XQIA 3N76A 1T6YA 3NX4A 1TF5A 3HI4A 4GLLA 4JK3A 1HRKA 2QN7A 4WKBA 1Z08A 1F0PA 4X6YA 4BNGA 3WL7A 3WQHA 1WLYA 3OOHA 4BX2A 4W9MC 4HGYA 3WKCA 3VYTB 3ASRA 3IAS6 4YGYA 1AMUA 3I5XA 1Q19A 2BEWB 1HMPA 1VE3A 1Y1TA 2G63A 1Q7BA 2NU7B 2YW9A 3JQ7B 3KKKA 4F2WA 1TVKB 1BH6A 4RWEA 3X44A 4LXQA 1R4MB 1RHUA 2GZMA 3CNBA 3G8CA 1UK6A 2D0OB 3BGVA 2OCXA 2BDTA 4GOJA 2HREA 3LX4A 4WFIA 3SXPA 4B3DA 2X7JA 1IHPA 3D2LA 2PG3A 3DOUA 5EZYA 4V0QA 4UVDA 1QVAA 3NR2A 1K0FA 4AIRA 4F2GA 3N2ZB 2BEVB 1KR2A 2KJQA 2OBYA 2ZSHA 2X7XA 4R01A 3QBEA 4GBGA 4BKQA 2XWQA 4LRSB 1LS6A 4P33A 3U7FB 1TUIA 3X1YA 2C5FA 4F9EA 1B93A 3PUHA 2PKCA 3M0EA 1BPLA 4ESHA 5B3LA 4YHHB 3ZU5A 3P26A 1JB1A 3IHWA 2A3RA 3NDJA 3P0RA 3F2IA 3GHYA 3VPHA 5IYRA 2PNFA 4CMCA 1QVZA 3I2KA 4BDTA 1QXSA 2PBLA 2XY4A 2AG0A 2Z04A 2FW0A 1X7GA 2O0JA 2XZTA 4B4UA 2NVWA 1U3GA 5FUMA 1NU6A 4GAEA 2RGEA 1E0AA 4MTLA 2XT9A 2P9HA 2P9ZA 5EI5A 3CNNA 1NASA 1SC6A 4J7CA 2FNAA 4ND7A 4H7JA 3RIGA 2WV7A 2PA3A 2XQJA 5DCLA 3IULA 4FUTA 2G40A 4K1LA 4C2TA 2A3NA 3BHMA 2CYAA 2PR2A 2Y1LA 3AR7A 5A0FA 4DJFC 1BCSA 2GJ8A 2AIRA 4G1FA 4U7DA 5CNJA 2Z83A 3RNOA 5BUCA 2B4KA 1AHNA 2HPVA 1O3YA 1IULA 1QGDA 3Q3EA 2IS2A 2J9ZB 1CDEA 3QE3A 4QBIA 3QU2A 2AHRA 3NRBA 4OLFA 4RCVA 2CHUA 3RUFA 1RJFA 4ESEA 3BK7A 2AMYA 1C8BA 4BBZA 5LQAA 4N41A 4JJ6A 4E5KA 1KPIA 5I9TA 4A6XA 4ZKDA 3H5AA 1H2FA 2J6HA 5C1PA 5JZOA 3IX7A 1V5GA 3JQFC 5KYXB 5HFJA 2C7RA 3EC7A 1OLXA 1G21B 3O8RA 4KXWA 1KP9A 1Z34A 3N2KA 3L05A 4XYGA 3AHFA 1QG0A 1TJNA 1XYVA 3CJTA 1W5EA 1VBNA 3BWXA 5EN4A 1C1DB 3CWQA 3GAFA 4HXGA 1CIPA 4I4TF 1QE3A 1I3CA 1U7PA 1CV2A 3AETB 2P9GA 3K15A 3L82B 4M49A 5CH5A 5HCNA 4PGMA 1C3JA 4Y1GA 3B89A 2AR0A 1ZUHA 5AM4A 3OM0A 3ZQ4A 1WTHD 5BN3B 4ZYLA 1G1AA 1SVUA 2DECA 3M6WA 4MCIA 1YDEA 3GJ7A 4D41A 2G5GX 2BCEA 4HEA6 3RE1A 1HQKA 4C7XA 5A5EA 4EG4A 1ANKA 4P6VF 3JVVA 5K2MA 3STXA 1XCOA 2X5KO 5J63A 4QDKA 4ARZA 4G36A 1TW3A 3V8NA 2JGMA 4ZYYA 1DKMA 3RWMB 1EQUA 3SZMA 3ANMA 4N54A 3AL3A 4WT7A 1IOZA 4GSLA 1BZYA 4Z1MA 4NV3A 2DC1A 1NBOA 4AZ3A 4PONA 3D9QX 4RDKA 4TYPA 1RIFA 2VNKA 1USVA 2WZBA 4QOHA 5DBIA 3IDSA 2VEDA 1PU2A 2FG7C 2ONZA 2Q3EA 1UXGA 2XRMA 4AUEA 4TRRA 5CFMA 3VTAA 2RFLA 1T4BA 2XBMA 4F1WA 2XTNA 5DGXA 2ORWA 4NRDA 5HQ3B 1WCIB 2CWDA 4YMLA 1G8AA 4RELA 2BF4A 2M9MA 2CK3A 3GEHA 1IPHA 2C5LA 1I2DA 1KNXA 1AX9A 3M1LA 3B9BA 4MITA 4OXKA 5CTJA 5CDGA 3R3JA 4B7UA 3VJMA 2O52A 3RT9A 4U5XA 1FTGA 3AV3A 1CR6A 1XJCA 5CP8A 1LDNA 3PQ5A 5AJWA 1Z15A 2XDAA 1J42A 5KCMA 5CA1A 4EI2A 3KE9A 3KK0A 3ONDA 1KAGA 3Q1KA 2ICAA 4RA6A 3ZH2A 1X42A 1Z2AA 3ANYB 1VLZA 2FPXA 3QPUA 2ZIVB 2LZJA 2QM3A 1PFGA 1EAYA 1PJLA 4B2LA 2ZK7A 2A0UA 4UHEA 1QZ3A 3RVDA 1TO2E 3HRHA 1XZFA 3A2LA 1QGYA 2A0KA 2VJYA 2OVBA 4MUBA 1D2CA 3ZWNA 1FNCA 2C9CA 2VRCD 4NC9A 3KQSA 1RXIA 1BA2A 1U02A 2HMAA 2JFGA 3TFQA 3TZHA 1T4DA 4OUDA 3Q2OA 5D51S 2BTQB 4EFDA 5JYDA 4JDUA 2EZ4A 4OA8A 3ZE9A 1U6KA 4LYAA 3CUKA 4DT1A 2BR5A 1T8YA 1DFIA 2ZWVA 5F1KA 1URPA 1HQCA 1SC3A 4N18A 2QA5A 2ACWA 1DCFA 1YJ9B 2CL0X 1YR3A 3GGGA 5EJEA 1DDOA 4RJ2A 1MC8A 2NNWB 2QVZX 1H66A 1GCIA 1A88A 1S2GA 2GJ9A 2BV3A 1AKWA 3EGDB 3H11A 4HMPA 3DHVA 3TXXA 2RHRA 3UK2A 1D5CA 4K9PA 1AV7A 1OLUA 5LXTB 1N2HA 2DLCX 4L5CA 3KSDO 4K88A 4URFA 1B23P 2QK4A 1AF4A 1WWKA 1GAJA 4U9UA 2Q5JA 2L0XA 3D7SA 4CKBA 2ZRDA 1TQDA 4AJNA 2DHDA 3NM5A 1HEYA 3EFEA 4KQ6A 3B2EA 4N39A 4IEFB 4YEDA 3V7NA 2J3KA 5IN5A 5TNXA 3CTAA 1BW9A 4WKNA 5FULA 4XLAA 4HDKA 3R7BA 2WYUA 4R71A 1XCGB 3G2NA 4LDZA 4XVQA 5FL7D 3F97A 1QP7A 2ZRNA 3DD1A 3CN7A 3KTOA 4XWYA 1CQWA 3SR3A 4AO7A 2C54A 3BRSA 2V6MA 4QXOA 2VBGA 4FHGA 1H2HA 4WN3A 2REXB 2OBBA 4D0GA 4E22A 2CJXA 1QCZA 4UU7A 1V1JA 4H0NA 5ES3A 3TD6A 1R15A 9LDTA 3UT6A 3EUEA 2L82A 3LBAA 1EE1A 4HH1A 5IH7A 1VLHA 1L7EA 4OGKA 1UL1X 5TSDA 1I7DA 1UEIA 3WSTA 2P78A 2QUZA 4BZPA 4MQ6A 4ZT4A 1GRCA 2FEKA 2LDBA 2EBHX 3L84A 3FOAA 5JS6A 4M3NA 1K9MD 4NTZA 3KXKA 4L6CA 1K8YB 2HDOA 4DXAA 4UMVA 2XUIA 2P6NA 3GSIA 2XYPA 3CRNA 3AR4A 4JVOA 3ASYA 1FYWA 3QYJA 2V7TA 2IUYA 2JLZA 1A50B 3OY7A 1KEEB 4CCAA 2Z6QA 1J49A 2W6OA 3COVA 1C1YA 2TMKA 4TMYA 4EFLA 1Z83A 4GBMA 5ITVA 3GLFE 2XYVA 4HDRB 1LPAB 4JGIA 5KYTA 3VR6A 4DIDA 2H2IA 2V9CA 2D6FA 2W2NA 4DCNA 1R0XA 2WOJA 3UMJA 4G1MB 1ULZA 3KQOA 1RRMA 1T2AA 3HO8A 4WJLA 1O95C 1DARA 2ZJZA 3SKXA 1W35A 1ADCA 1PK7A 1FUEA 3E15A 4G4IA 5E7MA 3QX9A 1YAJA 4CMJA 3JZDA 1JXOA 2C5AA 3DBLA 4ABYA 1QIHA 5CFNA 3R6GA 4X8LA 2B92A 1VBMA 1WXFA 2DBRA 2GEKA 3KKPA 4M1EA 3UUWA 1LGYA 4HGNA 7REQB 1BMFA 4R41A 2AZXA 4HUQA 4ZANA 1KMNA 3AJRA 1HYHA 3QFRA 4MWDA 4WOCA 3HUDA 1JTEA 4BJ5A 3D3QA 5BSGA 5MN4A 3PNBA 5JSKA 2Q1YA 3ZCQA 5IT5A 3L3BA 3W77A 7YASA 1ZQ1A 2WFMA 4GI5A 4HO1X 4JOCA 5LP6B 1A98A 3A1UA 2E3JA 4LV5B 3T9BA 3H8JA 5CT5A 4QUDA 3WFZA 2VT3A 5DBEX 2QVCA 2XDYA 4MDFA 1CX9B 2J5XA 1VOTA 4UPVA 3CG0A 3G2OA 4IIVA 1UEXC 4FVTA 1A04A 4Z9FA 2FQWA 4DDKA 4DIMA 1FMLA 4NZOA 1B3BA 3NDBB 1QHFA 3U7JA 3UG7A 1FNNA 3RRXA 1XKXA 3JD3A 4YROA 5A1JA 2LV8A 3PVDA 3D81A 4QRHA 4Q15A 5DX0A 3MCAA 4EMBA 5JCOC 2WSIA 2JS7A 5ICSA 4GKKB 5AM5A 2DHRA 2K87A 1VLQA 1EGVB 1HK7A 1LB1B 3JQBC 1UBEA 1ZJYA 4Q37A 1A8QA 4YAJA 1UBJS 3C41J 3AHIA 1QCDA 2J7PA 4O2AB 1OFHA 3KPVA 1XTVA 3HYLA 1LLCA 3EY9A 3VDQA 2GI4A 1YJQA 4GMXA 3PTAA 3W5HA 4ZGNB 3Q88A 3MMXA 1BE6A 5DXAA 3K30A 3EVEA 1MOPA 3H5RA 1U3DA 2C83A 4Q5IA 4K9MA 4OO3A 4F7DA 2ZIGA 4DA6A 2QMHA 3BAZA 4U8GA 3FHOA 4CKEB 5J23A 1G6HA 3TG8A 2EJUA 4B47A 1T2EA 2QMOA 3W8EA 1CUDA 3I53A 3RSQA 2FXVA 4BNLA 3A2MA 3HCRA 3IAEA 4IJWA 3QMVA 1UF9A 3ENWA 5ICEA 5K0ZA 1XZQA 2CD7A 3M6FA 2XRFA 4QELA 3FF1A 1P1FA 1Z22A 2MSWA 2XIQA 3G8YA 1A82A 3M7IA 3QVLA 4HDQB 4O25A 4I1OA 1UPTA 3Q3JB 5FBQB 2ZRCA 4K26A 3THSA 3ESYA 3LVBA 2TYSB 1U8XX 3ZLJA 5B53A 2P9JA 4HCJA 1ZGGA 3WGZA 1JVBA 5EKDA 2E7ZA 1GGVA 5C8YF 2O19A 2NZWA 1I7PA 1ZU5A 2NAFA 2HA5A 4UU1A 2J0QA 1C1HA 1WXDA 1CB7A 3DSRA 2HA7A 2E1BA 1P5JA 1Y63A 2HQRA 4BUJA 4M4SA 1K7CA 4F3YA 4EL5A 5JRZA 1OH6A 3KVYA 4LXXA 4B85A 3CP8A 3W0LB 1XKQA 4XR4A 4RY8A 1JEOA 1PV1A 2CKMA 2F1JA 1JHMA 3AH8A 3IPYA 3V7UA 3CPXA 2F3UA 4QOFA 1QE5A 3S2ZA 1BDJA 3EUFA 2MSKA 4XSHA 4EA9A 6LDHA 1UBCA 3D6JA 3D6NB 5E95A 2E37A 3AOEC 2XKJE 3KZNA 4N1AA 3FZGA 5BVGA 2O2ZA 2BGGA 2YWHA 4HRVA 2JI7A 4IFTA 4A73A 4ZTZB 3CLTD 3GFVA 2WTXA 2VOJA 4QO8A 3IGFA 5JO9A 2F8MA 2UYYA 3FBWA 4TTIA 5L7YA 3DE0X 3S70A 2AEFA 3ITDA 5LQSA 4V1CI 2HPAA 4J8PA 5BV1A 1KWGA 3QE9Y 1SA0B 2R96A 5FPHA 1H2ZA 3EEOA 2DPHA 2Q8PA 4DCOA 1FDWA 3UJBA 3SS8A 4FW8A 1PJQA 1QAOA 1RLOA 4B1FA 3I2IA 4UHHA 2ZDHA 5JJ5A 1QK5A 3UENA 4DM7A 4N76A 1ISMA 1M0WA 1HQDA 2XSZA 1MBZA 4Q19A 5SYMA 5FLXA 3CC7B 2CXQA 3TD9A 1ECGA 1NVMB 1YUBA 1YB4A 2IPAB 3G8AA 4GRDA 2C07A 4KN6A 4ZN6A 1SKMA 3RW9A 4GKBA 2FRVA 2HXYA 1JIVA 1FQWA 4UDXX 3VYSB 1WZCA 3P0EA 3DEAA 4DARA 4BNIA 4WQMA 4EECA 5IEJA 1NYQA 4MAMA 3GHHA 3A8JA 1KAHA 3LT0A 2IGTA 4J0QA 4CTJA 4K6HA 4LEIA 1CULC 2AH5A 1RM4A 4MV1A 1KZ1A 2ZUTA 4D26A 3PJFA 2XVYA 3L18A 4LV8B 3WZLA 4NULA 1ZH0A 2XD4A 4AW9A 4BZZA 2PKQO 1KKUA 8MHTA 3OIWA 4WNYA 4E5UA 1P5HA 3K32A 2IZOA 4A8PA 2PWBA 2IWHA 2HV8A 3UV6A 1HDZA 4GNRA 1U7OA 1MB0A 4BVAA 3TH5A 1K5HA 1TKAA 5CNKA 4BECA 2AC2A 1HDXA 4AP9A 2ERYA 4MK4A 3WV5A 1YA6A 3EDCA 3WLTA 4CGZA 2B5VA 1GN9A 1H1TA 1Z2NX 2BSXA 1G5TA 2EC5A 3B60A 3BA6A 3JD1A 2ORYA 3MUNA 4RE6A 5BN5B 3VV2A 2GK3A 4DZZA 1RVDA 4TLBA 1V16A 5IULC 5IW8A 4DUGD 1CP3A 3B3GA 4D9JA 4MP6A 5E7QA 1MTOA 3Q9NA 3R4VA 4OBWA 2F1MA 3IV7A 4GZ5A 2QQ5A 2YFHA 4Q7KA 4XKJA 3QY0A 5IUKC 1OC4A 2IYUA 3GIWA 3R7NA 2FFRA 2YOGA 3THXA 1ZGZA 3ZHVA 1VDMA 2BM9A 5BV2P 5HKAA 2R65A 1G8FA 2BGJA 3WAGA 3RVBA 1ZXXA 3EUAA 3QLJA 3HU1A 4DIOA 3HXOA 2GHQA 1Z2OX 3RODA 4B3IA 3RC8A 5KMGA 4QGGA 5F64A 4W5RA 1XZLA 2JJ2D 3REFA 2EAUA 4V0SA 1H1LA 3K71B 3NVKI 1OAAA 5DP1A 3GW8A 1N78A 1FQKA 4IX9A 4TUYA 2NZVG 2VSOA 5HDQA 4W8OA 4C4ZA 3DAOA 3FR8A 3TZQA 3TK1A 1YE5A 1VQNB 1E1CA 4BP1A 3HWSA 1BGVA 4WNCA 2O2YA 2R00A 4YHBA 3BSYA 3ZKWB 5HOEA 5FOWA 2EEZA 1U0SY 3QPAA 4MIEA 3RARA 4CQMD 4RTKA 1IJFA 1WW8A 3FPPA 1ODJA 2AUMA 1N2CA 3OICA 1NXTA 3UH1A 3TQHA 1JDUA 1W85A 4ARCA 1X1TA 2VZEA 3UNXA 4I5GA 2IU6A 5HRAA 3FI9A 5ENVA 1OWLA 1IK4A 1RQXA 3GLTA 4RVCA 4FFDA 4V39A 3A28A 4ZCIA 4QPCA 4Y2TA 4ZU6X 4PG8A 2AGVA 3EEFA 1B1AA 1GN8A 2R8OA 2ZTLA 1J39A 3OCYA 5KTTA 4Q18A 2M6RA 1BCRB 1GGKA 3N9IA 3WXBA 1ORWA 2EFEB 2YNMC 3L46A 2XXBA 4DSAA 1ZN9A 1P1HA 2X42A 5DWQA 2ZE5A 4W8HA 3B2NA 3WYCA 2ZJOA 1J2UA 1PAUA 5ALIA 1EFDN 2ZL7A 2HWKA 3N28A 1AN0A 4HL6A 2PLRA 2WU8A 4I3GA 4RDCA 4DAEA 4BE4A 4YPOA 2NSDA 5IYWA 2CUNA 5EP2A 3WNZA 2E4UA 1FSGA 1QDLB 2G5CA 1ZNXA 2GARA 2FFAA 3A1VA 4GOND 5DX8A 1K0UA 3C8UA 1WBDA 3NO4A 1N1MA 1XQBA 1D2HA 1W34A 1EWVA 1P19A 4BTLA 3D6VA 3UB2A 3M1YA 2VBSA 2XVAA 3WADA 2XGJA 2FKNA 3T7TA 4RACA 5JQGB 3HCOA 4EAQA 4NBSA 1SH7A 1XJ5A 1GITA 3U19A 2R87A 4FMDF 2AE1A 2EOAA 5IHXA 5BMVF 3ON5A 4GDMA 3ACBA 4B7XA 4YMUA 2NSLA 1RC1A 1AF7A 2PT9A 4RKRA 4B3XA 5JCJD 2OVFA 1ZD3A 2XJ4A 3L93A 1Y4ZA 3OWHA 1WD5A 5D1HA 1OZFA 5C1DA 1QYWA 2W2KB 4XZ3A 3OCVA 1U80A 3FFAA 2NNLD 3DAFA 2VP3A 3OPMA 2ZRHA 3CX8A 3FMPB 4IV5A 2HMSA 1M7BA 2BP7A 1PNOA 5KTOA 1JFTA 3EPKA 1QH0A 2CXHA 1GWNA 3HB1A 3KIPA 1B0PA 1A9SA 3AIOA 3VSAA 4Y7CA 1MORA 4O2BF 4P98A 1SXJB 5A1TA 5ALSA 1NPDA 3N0TA 4PO9A 4PV7A 4F4HA 3V1MA 2PJZA 1ISHA 5FUQA 4DUYB 1NX9A 1UMKA 5FI3A 3ICVA 3KL9A 2AR9A 2J5BA 1D2EA 2O2DA 3LP8A 2XCLA 1YL6A 3DKIA 4ZV9A 2DOKA 3H5WA 4HR7A 3DFKA 4DV3B 5BQXA 2NO4A 3CPEA 1WJGA 3GLHA 1AS2A 2NLOA 2UAGA 3GGJA 2WWTA 3DAYA 1AXEA 4YJ3B 1SCUA 1K7YA 3GT7A 3PC8A 4GOXA 3TSZA 2CF5A 1Z35A 4P54A 5JOQA 1XZPA 4K81B 1I32A 3S8YA 2W2PA 2C2MA 2QWXA 4BNWA 2YOHA 2J4DA 1XQ6A 1XI2A 2PLAA 4IZIA 1AQJA 1YE8A 4GO1A 1R0RE 2J9YB 1Y3FE 3FPGA 1I5EA 4TZTA 2BGIA 2C2YA 1UJCA 2R751 4B79A 5E6RA 4U6NA 2HJWA 2IHUA 1JKFA 2NIPA 3RABA 2AN3A 4QATA 1KAOA 1X1RA 4IXDA 1ZIPA 4Y2XA 3ZW7A 1HYGA 1TI7A 5PGMA 4XDYA 2Z5GA 1E6CA 1R5OA 2FZCA 4X7FA 1AA9A 3QE4A 1BDBA 4LUCA 1NN0A 1J99A 1N92A 3Q6MA 1Q1QA 1ISJA 1E3TA 2OHGA 4AXBA 4GOKA 1ISSA 1H6DA 2XITA 3D4PA 3NWPA 3AVVA 1W2HA 2AFHA 2GYWA 3MYYA 2X0FA 3BH0A 2O5VA 2HBYA 2V1XA 1DL5A 5DOZA 2VH1A 4PQFA 1APBA 3BE6A 4L8YA 5IDWA 4LKRA 5D3ZA 4AQYB 1AQIA 4P80A 1NJ8A 3PGMA 4UHFA 2VATA 4Y30A 4IXTA 4KX3A 4YQYA 5U4QA 4YYEA 2IIVA 5C4IA 4XXHA 4E12A 1VZ3A 4B81A 3I52A 2D8AA 1YKGA 1E7RA 1ULTA 3LFUA 1QYDA 1P5ZB 2VP6A 2RHTA 3JD2A 4A27A 2COUA 3OT4A 2M1ZA 2R8RA 1B8UA 3BB1A 3DL7A 5K1ZA 3WP0A 2XX3A 1ZPDA 3F73A 3CUYA 3OKXA 1HDYA 1GFZA 5H68A 3Q5GA 3RTAA 1BO6A 2X9QA 5FL3A 4ROTA 3VX4A 2W48A 3C4QA 4G8CA 2QZSA 4D8UA 4L5YA 1OLSA 3LUHA 4UPDA 2GPAA 2NSJA 2W2LA 2IX9A 1U7XA 4F4DA