1G7CA

Yeast eef1a:eef1ba in complex with gdpnp
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
440
structure length
440
Chain Sequence
b'EKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDKTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ELONGATION FACTOR 1-ALPHA
molecule tags Translation
source organism Saccharomyces cerevisiae
publication title Crystal structures of nucleotide exchange intermediates in the eEF1A-eEF1Balpha complex.
pubmed doi rcsb
total genus 130
structure length 440
sequence length 440
ec nomenclature
pdb deposition date 2000-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1g7cA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1g7cA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g7cA01
3B9PA 4DC9A 1W4CA 3IILA 2REBA 1VYTA 1JAHA 1KKMA 3C14C 2N46A 3KX2A 2ZJYA 4XD7D 4A36A 5AJVB 4OI4A 4OYHA 3CD6B 4LX0A 3WRXC 3AV0B 1II0A 4HUQB 4RVCA 5FBRB 4S2EA 2ZVPX 4MQBA 4YQFA 4JYBA 2A78A 3Q5DA 4UNQA 5EQTA 3GMTA 1XBTA 2V9PA 2OG2A 3BD9A 1GKUB 2ZI6A 1XB2A 3CLVA 1DAIA 4NH0A 3RWOA 2QPOA 2IYYA 3MG9A 1Q81D 1NL3A 1Y63A 1WA5A 1T0HB 4LPKA 1G291 2BM0A 2B7CA 4TL6A 1XDBA 4HEJA 3CUEF 1CIPA 2FJUA 3FMFA 3LBIA 3OJXA 3RVBA 1JJ2B 4I1OA 5FTMA 1ZD8A 2CCGA 1YR7A 4KBFA 1CR2A 2A5FA 1SM4A 5F3WB 1QBKC 2DCUA 1BYUA 5DSZA 1EK0A 2RH5A 3BC1A 2BEKA 4JIMA 4L9WA 1FNNA 1MOZA 2ERXA 2Z4RA 2RC6A 2ZSFA 2IYVA 4EPTA 4KLZA 1J8MF 3W2EA 2ATXA 2QMEA 2WJGA 1NVVR 3Q3JB 4JLPA 1JEDA 3HPQA 2Y8EA 4QGHA 1E63A 1ZD1A 3UIEA 1FNMA 1RFLA 1E2EA 2EU8A 2VTKA 1AGPA 2WOOA 3K0AB 3X1DA 5K8TA 4C0KA 4L9SA 1CKEA 1V43A 2ZRAA 4FI3C 4NCIA 4X8HA 1DAGA 4F4JA 3PG5A 2O8EB 1BS1A 2CHQA 4PANA 1ZNYA 4AI6A 3ZYCA 1F2TB 1XTSA 4M1OA 3I61A 2OTJB 1G21E 5FA6A 5E4FA 1SULA 3SNHA 1U9IC 2WWXA 3K0EA 1KY2A 3NH9A 3RRYA 4OI0A 1J8YF 1NMXA 2BJVA 4KODA 4JKIA 4ZIRA 4Q4LA 1GUAA 4KYIB 4XWKA 3U7HB 3AF1A 3QBVA 1QDEA 4EQ6A 5KDOA 1Z8FA 2ZRIA 3PCRB 4IFBA 1IN5A 2FGJA 4KAXA 4PPGA 3RNLA 3L2OB 2GEUA 1P2UA 1S2MA 2WSSD 1FRQA 4JLDA 3GLGB 3SJAA 1RRPA 3W8RA 1E2NA 2EYUA 1G3IA 4B6FA 1G3QA 2YWFA 4IEIA 3QSYA 2HV8A 4GP6A 4B33A 5DIFA 3QG5A 2CVFA 4DSOA 5B64A 2W83A 4V02A 1S9DA 2RGXA 4C0JA 4P6VF 2BBWA 2GETA 5AJZA 4MGZR 221PA 1CXZA 2CCKA 1M7HA 3BIFA 3QVVA 3G5UA 2CK3A 1NF3A 1E0AA 4DJTA 1VQ8B 2GCOB 4IVQA 2IUSA 3W8NA 1G16A 3HU3A 3QVUA 4IHQA 5D3MB 5E95A 4MRVA 2WKPA 2JASA 4ITRC 1AZTA 2HMAA 5CK5A 1GRQA 4CRWB 1NY5A 3LNCA 3FTQA 4FWTA 1UADA 2WICA 1F2UA 2CNWA 1OIWA 2QSYA 3T06B 1H8HD 3WNDA 5HTKA 3R8CA 4GPTA 4IRUB 4W7SA 4B43A 4CT4B 5H8WA 3I92A 4D4MA 421PA 4LC1A 1FOEB 3TMKA 1JA0A 1EESA 1ZUNB 3IO3A 3OZUA 1YZLA 2JCSA 4LJYA 1G19A 3LXRA 4FMDB 1M6NA 4YLGA 4M1SA 2AXPA 1N3BA 1JXMA 4TQ9A 4WW0A 1E0SA 2PMDA 2OE2A 1E1QA 2W6JA 5B58C 4A0HA 2E1RA 1JAIA 2IYQA 1QG0A 3ZQ6A 2WHXA 1W36D 2IS2A 3TSWA 2Z6VA 3GFTA 5FUWA 1DAMA 1Z0AA 3K09C 1KI6B 1KHTA 1P9NA 2XSZA 3DHWC 2H5EA 1AS0A 5DNYB 3OIYA 4BLOA 2NMVA 2WKRA 4XTCS 3W5HA 2ZROA 4XJXA 1BIFA 5D3QA 3CZQA 4M1MA 2PJRA 2QAGC 4PPQA 5HE9A 4EIWA 3AF2A 4ZIRB 1KK0A 3W3AA 3LA6A 1KTVA 2VP0A 1LV7A 1OSNA 2OBLA 4RD1A 2IS1A 4M2LA 4G5RA 1DDGA 2ZPTX 4FK8A 2YWHA 3LD9A 1QG2A 1WXQA 1GL9B 1E2HA 3AVVA 2UZ3A 4LJ4A 4Q9LA 5A0FA 5SZKB 5FPYA 1IJEA 4AKIA 1HUQA 1VG9B 2HT6A 1TTTA 3MFYA 2RHMA 121PA 4GMDA 4UXHA 4DLZA 1IQPA 1UKYA 1B2RA 4FMDF 4YDSA 2X1VA 3WBKA 2QORA 1DAFA 1TLLA 2YOGA 4QHTA 2ODBA 1IAQA 4BFWA 3H0KA 2QP9X 2D3WA 2GAOA 4EDHA 3SJCA 3X1YA 2ZS9A 5JCZA 3K70B 1XJ0A 1P9RA 4E07A 2GJ9A 2VHQA 2NOAA 1U90A 4PAMA 3B78A 4HLUC 4WZAE 5GVRA 4A0GA 5D3MA 1EWYA 1KZGB 1ZUIA 1FQJA 2IL1A 3WMFA 4JLOA 5KYKA 3TW4A 3RS2A 1XE1A 2FZLA 3P4XA 4B48A 4XWAA 3VR3A 4LYFA 3WY9A 3WP0A 1P61B 1IXSB 1U8YA 3B85A 3TQCA 3A8TA 3GJ6A 2ANBA 4KCGA 3W6PA 1W5TA 5CYOA 3OZXA 4UKDA 2Z0MA 2OHFA 3TSZA 1QUEA 5KPJA 2RMKA 2WWIA 4EFLA 3R20A 4PQYA 4QRHA 4M9QA 4UNPA 2JLUA 3SBDA 1EGAA 2DWPA 4V0KA 2IYRA 3RHFA 1MO6A 3NBFA 2VSFA 1E9FA 4YXWA 3GJ7A 2P3SA 3R7WB 2X2FA 1VCOA 2HUPA 1XWIA 2Q3HA 2NO7A 1VCMA 3MUFA 3FKSA 5DO9A 4PAQA 1W44A 1KSJA 1GIAA 2XZLA 1HTWA 1IN7A 5CK4A 1RC8A 1UKZA 1X3SA 2ZUBA 2YWGA 2DFTA 4G5SA 2ODEA 3IDQA 4Z51A 2KB0A 2VL7A 3ZS8A 1NKTA 1EFCA 1RYFA 1NMYA 3VNUA 2G6BA 2PZEA 2GZDA 2QT0A 5DE3A 3TE6A 1HE8B 4OKSA 3SHWA 2X19A 4O2RA 4B75A 4LYAA 1Z6YA 1QF9A 4N0EA 3IPXA 3A4LA 1KY3A 1KI7A 4RZUA 2GZHA 2AXNA 2ZS7A 4KV9A 3OE7A 2HYDA 2OESA 1XTRA 2IX3A 4G1UC 3SS8A 1UKVY 1LFDB 3ZS9A 2BF4A 2PL3A 1KMHB 1Q57A 2BIFA 1UEIA 2IEYA 2ORWA 2ZI4A 1P73A 1W7AA 4I1UA 4OJQA 2F1RA 5DN6A 4URVR 4IXMA 1ZJ6A 4JZKA 1ZP6A 2J87A 4IVPA 1TEVA 2HF8A 1E9SA 3AF4A 1FNDA 2G0NA 4Q1DA 3CWQA 5KNDA 2GJAA 1DG1G 2C9OA 4R9UC 2EW1A 2ZUCA 3ZVLA 1GP2A 2DB3A 3IBGA 4YMVA 2IYZA 3EWSA 1GZSA 1KJWA 4C7OA 4ARZB 3VR4A 2H18A 2FNAA 1K73D 4DXAA 2W00A 2ZRHA 4HB0A 3L0PA 2RB4A 1PLKA 2QTVB 4TQAA 2F1IA 3QKUA 2HLDA 3CCVB 1C4OA 2OAP1 4B44A 1E9AA 1T8UA 1M1KD 1E2DA 1FZQA 3N70A 3FKSD 3IIJA 1JQJC 3BH7A 1H8HA 4NCKA 5C4GB 2WIAA 2VLIA 4JLKA 3PEWA 4HSEA 1P62B 3NEYA 4PC6A 4GRAA 2QT1A 4PC7A 3HDTA 3TR5A 4TLDA 1OT3A 2B5OA 3CRVA 3Q7QA 4YMWA 3VHLB 1ZRHA 3BE4A 4BLRA 2R6DA 4GDFA 3NH6A 4DQKA 2AWOA 3RRNA 4ZDIA 1BO6A 4ACAA 4A2QA 2A5JA 5AR1A 4ZDWA 3OFND 2W6JD 2D7DA 4NU0A 3IQXA 3ZLJA 4WOPA 2E87A 2RGBA 3UWOA 1QHHA 1E2PA 3K53A 1NBMD 1OF1A 1T4GA 2R6CA 3A37A 4OL0A 1FL9A 4MKIA 1W4RA 3LLMA 3RS4A 4E22A 3UXMA 3SQXA 3GD7A 2ZSAA 1LF5A 2QMUA 1E98A 5JSZB 3CR8A 3VX3A 4KFUA 2AL7A 4DQLA 4LJ9A 3SZRA 4YALA 2QN6A 1YZKA 3QQ5A 4PFSA 4Q4HA 4QGGA 5DYGA 3V4RA 3QKRA 5E7IA 3TNFA 5TVKA 4BLTA 3ZJYA 4JLJA 2PLFA 1DADA 4PTLA 3ZVMA 1ZM7A 3LDAA 3PXGA 5FTKA 2WWWA 4Q4JB 2XEXA 5KDDA 4DSNA 3GLGE 3VX4A 1RJ9B 4OJKA 1YR8A 1QH0A 1EXMA 5JHHB 2X3UA 1NN0A 1EWRA 1NLFA 4XD7A 4NYMQ 1K6MA 1YR6A 1XEWY 3GLGA 2TMKA 1QZXA 2VNKA 4QFMA 4FD2A 3LQRA 4JVLA 5CB8A 2WKQA 2OK8A 4EUNA 1SKYE 3LO5A 3K70C 4PSAA 4BZPA 1DEKA 3AVPA 5FL7D 4R98A 1ANKA 4CF7A 4Q7LA 5CYPA 1R0YA 3T1OA 5FI0B 1W48A 3OIVA 5P21A 4XVQA 5KSOA 2IYTA 3CO5A 3Q7PA 4OHYA 5JI2E 2R6AA 1F48A 2P65A 1MO4A 4D0GA 4DIDA 1DO2A 5JJKA 3R7WA 2P6RA 3W5IA 4DDTA 1LW7A 4HLQB 2G1JA 2XZPA 4EJSC 2Q9CA 3K9LA 5IF9A 1PVOA 1VQMB 2QAGB 3IKJA 5EE5B 4TMZA 4X8MA 5HR5A 1XD8A 3W2IA 1FNBA 1YZNA 1AMOA 1NJGA 1SKQA 1OXTA 4B3FX 3HWSA 4CEJA 4AYWA 4U5XA 1G17A 4DZZA 2GILA 2P6UA 2PZFA 1AKEA 2NO1A 4AURA 4YAFA 2FPMA 2ONKA 1CTQA 2A2ZA 2WJYA 5BN3A 5EXTA 4I4LA 2QEXB 2FSGA 2NQ2C 4YC7A 3QF4B 2AK3A 4MDFA 3I4LA 1OPXA 2J59A 3QPUA 4Z8YA 1S0UA 1W2HA 3OEEA 2AK2A 2GJSA 3U7FB 3SEAA 1E1RD 4LPSA 1W87A 621PA 4RSGA 3PQCA 3QXJA 2P67A 3G71B 4QBGB 1X8LA 1EP3B 3WXMA 2IXEA 4D4JA 2OUKA 1Q86D 3ADBA 3RS7A 2AX4A 2DFLA 5LD2B 1KSHA 3U61B 2DERA 3VTKA 4DBLC 4HB2A 1VQ5B 2DETA 3REFA 5BXQC 1I7PA 3AKCA 4QL3A 4A82A 3K0CC 4GNKA 1TUIA 2BCGY 2C03A 2JAQA 3A58B 2GESA 2ZYTX 1IM2A 2AR7A 3GEHA 3ZVRA 3H2YA 5E7MA 4IDHA 2FPLA 3FKQA 1YRBA 2KE5A 1U0LA 5BN5A 2JA1A 2W0SA 2P5TB 2XOKD 3P1JA 2PMKA 4OQNA 5J4LA 2J0SA 2CLSA 3HP1A 4OHVA 4DUGD 1RYHA 3WYFA 1F3OA 3TVTA 2B7BA 3DVLA 3KJEA 3O8CA 1KI9A 1SXJC 2VSOA 1K8RA 4D26A 1QGAA 1VPLA 1SZPA 2QAJA 4QJ5A 3D6TB 2FFHA 2XITA 3V4FA 2P2LA 4JJKA 4C3ZA 1BOFA 4TYNA 1GG2A 3OIUA 1U8ZA 5DYIA 3CCLB 5FOWA 4A92A 3M0EA 3W2GA 1RJ9A 3K0AA 4MKHA 4DCSA 3IIKA 4TL7A 1AKYA 3A1UA 4WBSA 1E1QD 2QBYA 4QNRA 3RABA 4IJMA 4Q9JA 2IS4A 4PAOA 5JCPA 2XSZD 1G1MA 1II8B 2DYKA 1IN8A 4URXR 1DTSA 2QPTA 2DHRA 3KJHA 3D7MA 2IF0A 3L8YA 4Q4JA 3AB3A 1DDIA 2Q3FA 1ZUHA 4IOKA 4CW7A 3LVBA 1VYVA 4TTPA 4A1FA 2ZJZA 1Z5ZA 1WDTA 4ASUD 4O3MA 3U3JA 2ZTSA 3SBEA 4PC1A 3SFZA 4U00A 1Z0JA 2FSFA 4ASUA 1CU1A 4RD0A 3ND9A 4RD4A 3X1WA 1AIPA 4B3GA 1G20E 4KFTA 4JBXA 2XGJA 1W36B 4XSHA 4IDNA 4BFSA 4AG6A 2CRVA 1R5OA 2JJ1A 3W9YA 3MMPA 5THXA 2F43A 2VHJA 4DB2A 4GBMA 5AUOB 4HAWA 1TVCA 5F2EA 2BBTA 2QI9C 2WWFA 4LSGA 2QP4A 1KZ7B 5HXBA 2B6HA 4Y7CA 1D8TA 1KO4A 2Q0HA 3DL0A 1GRNA 2ZR9A 3JVUA 1ONBA 1QRAA 4IDQA 5HKKD 3CIOA 3EIEA 1TQ2A 821PA 2PT5A 3UPUA 5KDLA 5DN6D 1LVGA 1S96A 3BB1A 3NBXX 4Q47A 2JLYA 3B1VA 3Q5EA 4MYTA 2Z43A 2ZE8A 3CMEB 1NVXQ 4PHTA 1N0WA 4EJSB 3ES9A 1KGDA 5KHOC 3ZD7A 1ZCBA 4MRSA 1G9XA 2ZQ5A 1Q1ZA 2C98A 3B5JA 3SYNA 1WBBA 1DVRA 4M0LA 2VEDA 3VMFA 1PZNA 1U99A 1KDRA 1KNXA 4PQRA 3QXCA 2CK3D 3L0IB 4G5OA 5AJYA 2QRNA 2KJQA 1KK1A 2ZR0A 5C18A 3UG7A 2WPDD 2DFKB 5H1YA 4ZGNB 4QC2A 3U2QA 4OQFA 3EC2A 5IRCD 1M7GA 2C8VA 2QBYB 2WPDA 4QXAA 4D81A 4EFNA 3G0HA 5AWFC 4E09A 3H86A 1QHHB 4TLBA 1Z0IA 1AK2A 3CX7A 2P6NA 2WJVA 1GNPA 2GXUA 2GK7A 3PUVA 4Q1EA 2PLRA 4UJ5A 1W5SA 3SFVA 4TTRA 2CE2X 2VO1A 5FUVA 1XNJA 4HATA 2ZSDA 3I32A 3PIRA 1A1VA 2O8DA 1H8ED 4TWZA 2YINC 1D6JA 3AF3A 4I81A 4JL8A 4W5WA 1T9HA 1UAAA 3VKWA 1KYIA 3CWZA 2JJ8A 4QM7A 2AKAB 2OLKA 1XMSA 1ZD9A 4LHYA 5CITA 3AM1A 3GFPA 2EWWA 5JZVA 1OH5A 1X1RA 3U3OA 4QJ4A 3PUZA 5FOTA 4DEXA 1SXJB 3QJYA 2GTPA 3U7EB 4DLVA 1NIPA 5UKDA 1E0KA 1NSFA 3FHOA 3TKLA 1NRJB 4LY6A 1WB9A 1KC8D 3BJIC 4XOIA 4C2UA 5EMNA 1HQYE 3NVAA 1CNFA 3X1XA 2CE7A 3EARA 4LBZA 2FFBA 2HEIA 4HDCA 2C77A 1UBFA 5J4KA 2IF2A 4O2LA 1DARA 2R44A 1Q7YD 1Q0UA 3AVWA 3EASA 3PR1A 1WP9A 2ZE6A 4OI2A 3RANA 2W58A 1HY3A 4B2LA 3ICQB 1T3HA 4GOJA 3BS4A 3EZ7A 1II8A 3AUXA 3K0SA 1NN1A 4NP6A 4BUJA 3EPLA 1QUFA 2LCFA 2X2EA 1IOZA 4W9MC 1JR3D 1G3UA 2IYLD 3Q8XB 3TGPA 5F98A 3I5YA 4HB4A 3THOA 2W0MA 3QBTA 4MGKR 3QKTA 5TXGA 2YWEA 4US2R 3EPHA 2QE7D 1U81A 1IHUA 1XTKA 2B8TA 3BFXA 3ZIAD 2GNOA 4B2PA 2J41A 2HYIC 1Z2CA 1J9ZA 3SYLA 1WBDA 2BJWA 3ZIAA 2R65A 1XCMA 3TUJC 2F3RA 1J90A 5CDFA 1G7SA 1G4UR 4GI7A 1N6OA 3D31A 1E62A 1J99A 4RD2A 3V9PA 4WQMA 1OE0A 1ZU4A 3DMDA 1FPMA 2NPFA 1G8FA 2IYXA 3E2IA 4DT1B 3QENA 4MDEA 2ZE7A 4ZKDA 2FU5C 4OQMA 4DCUA 2IC5A 2V4ZA 2XTNA 1E96A 4QHYA 1T0JB 1IB0A 3SQWA 3BH6A 4FWIB 3THWB 4LC0A 1N6KA 3JQQA 4NCHA 3AUYA 2O8FB 3C41J 2GCNA 4BFZA 1XJQA 2ZRGA 1GITA 2HJGA 2OSBA 3B8HA 3VR5A 1P7CA 3FE2A 4RFSA 4DEYA 3U44B 1RW4A 1E6CA 1OFIA 1WF3A 5EP1A 4HUTA 2FEOA 3D3QA 1QFZA 3PITA 2GF9A 4IOJA 2Q9AA 4NCJA 3WNBA 1ZINA 3CNOA 2ZEJA 4P4UA 4UQOA 2WTUA 3SYKA 1Z28A 3KTAB 1XEXA 4L16A 1GAJA 1LNZA 2ZRLA 3CF0A 1KQSB 2QUZA 4JVNA 1XTQA 4URWR 3OAAD 3QI2A 2EVWX 4AF6A 2DPXA 3T1QA 1R5NA 1JB1A 4IXNA 3RDPA 3WMGA 4TZ6A 5TY0A 1ZIOA 4JLAA 2XJ9A 1G18A 1NMZA 2KWIA 3K0FA 3AVYA 1CF4A 4LV6A 3FVQA 3TQFA 1CR0A 1GAWA 5M04A 1RKBA 1KI2A 3WMEA 2JLVA 1WQ1R 2WJJA 3HYRA 1N6LA 4A0FA 1FDRA 1M8PA 2YC2C 1PLLA 1ZU5A 1JR6A 1VKJA 1VQ4B 1K5GA 1NSTA 3N2IA 2BBSA 1AS3A 1II9A 3LBNA 5TARA 3MWJA 1WMSA 3OE7D 2YYZA 5TMPA 1VECA 1XPOA 4EFMA 4KSCA 2ZI3A 1MRNA 3KFVA 3DM9B 1GVNB 4ERNA 3VKGA 1S9HA 2BKUA 1WRBA 3LXXA 4G5GA 3FGNA 4CGZA 1D1NA 2I3BA 2GDJA 3KXLA 4Y0AA 5JECA 1CJKC 3CBQA 3THXB 1TMKA 1YE8A 5BN4A 1OXUA 1OYWA 3QXHA 4NTZA 2MSDB 1OFHA 1WCV1 2J0VA 4DUGA 4GFDA 4I1VA 2VP5A 1N6RA 5E7JA 5C46F 1XCPA 1P2VA 1W4BA 3JQRA 3F5FA 1CLUA 3VO1A 4R71A 4HDOB 1N2CE 2HLDD 2IYUA 1M7BA 2I1VB 2NZ8A 4HAVA 4PO1A 2G3YA 2KI5A 2VPPA 3FB4A 3KL4A 5CJ2A 3V76A 5FUYA 3PJRA 4G01B 2C04A 1S72B 4AF7A 3QNUA 1D2NA 1SVOA 2NTYC 2MMGA 2H57A 4JMPA 3O8RA 1ELOA 4B73A 4RFSB 4F91B 2BVNA 2JLQA 4TYQA 3LQQA 1LTQA 3CCUB 1RRFA 4RY2A 1VTKA 3W6NA 2C2HA 4C0QC 5KPDA 4A8JA 2C96A 1E9RA 2F7SA 2SHKA 4DCVA 2AFIE 4PX9A 3ASZA 2VNHA 1A5TA 4LDJA 5AUPB 2XJ4A 1R6BX 4B71A 2XXAA 1FW6A 3CPWB 1XTJA 1YR9A 2VHTA 1T5LA 3T35A 3EPJA 2QMOA 4MUBA 3V00A 2XTZA 2ZITA 2REOA 4JJZA 3GJ0A 5EUMA 4FCTA 3U4QB 4D2IA 4MKGA 4AYXA 3A6PC 4H1UA 3K8YA 4BLSA 2PX0A 1OV4A 1R0XA 2BKEA 3QKSA 5EP4A 2IUUA 2BCJQ 2XOKA 5K8IA 5JLJA 1BX1A 4K81B 4GMXA 3DZDA 2OT3B 2BBOA 3VU9A 3QPVA 1TNDA 1HT2E 1QFJA 2FSHA 1G8HA 1N6HA 3FMIA 2P0EA 2HCJB 4D0LB 1NVVQ 3GLFB 2VYQA 2CL0X 3RS3A 4PHHA 2HXSA 4CEIB 2CJWA 3SJZA 2FEMA 1KO5A 1IY0A 1RZ3A 2HF9A 1R8QA 3CRMA 4KVAA 1GILA 1YI2B 1E9CA 4D4KA 1OJLA 4QOSA 3MSXA 2J0UB 4IFEA 1GVHA 5AN9A 3C5HA 1JBKA 4NDZA 1IN6A 1QG4A 2AKYA 1OXXK 2XNJA 2R2AA 3EZ2A 1OLOA 2ZE5A 3WHLA 4AC9A 1CULC 2BHRA 4Q7KA 4EAQA 5FBWB 4QJ3A 5JS8A 2DY1A 2Z4SA 1UBEA 2IBMA 3LW8A 5BWMA 2QSZA 1SVMA 3S1AB 1V5WA 2WVJA 3NHBA 1DO0A 4KSBA 4EH1A 1KO1A 2AFHE 5CIWA 3T5GA 4CEIA 2OAQ1 4TMTA 4XH9B 2Q21A 2QPAA 3VAAA 1CP2A 4LHXA 5CLLA 1AJEA 2QRZA 2VNJA 3G6EB 3F3YA 3K9HA 1YVDA 4JKYA 3RRZA 1FMLA 2YHSA 2IYSA 4TMKA 1DAEA 1P5ZB 4BEJA 1JPNA 1ZM3A 2GZAA 5L3RA 5IDVA 1OH8A 4MYUA 3OW2B 4Q66C 3AKDA 1G6HA 5EXXA 5KOYA 2ECKA 4WXRA 2QTLA 4I99A 1W35A 2G77B 4CEHB 1K8AD 2BMJA 4JT4A 3THWA 1J70A 3ADDA 5EXPA 2ZRPA 4YONB 4TLAA 2WWYA 1H8EA 3CX6A 2JJ1D 3F0TA 2FGKA 4DWJA 3VKHA 1KK3A 1KAGA 1T3LA 2OXCA 1F5NA 5SZIA 1KI4A 2YV5A 4HZIA 2YZ2A 1YJNB 4LGMA 1IXZA 1I4DD 2EFCB 2OBMA 2VBCA 1S4QA 3FHCB 4M1WA 4A6XA 1S1CA 5FOVA 5GV8A 2EQBA 2EFHB 4XSGA 4FXPA 2FOLA 3ONWA 4BPBA 2F55A 2A9KA 2JLRA 3B1XA 4UNNA 2WSSA 3AP3A 4Q1CA 3UANA 3GLFE 3MJHA 4GP7A 4MYHA 3PEUA 2OM2A 5FBLB 4Q02A 3GEIA 3CH5A 5DISB 2AD1A 4DDVA 2PEYA 1GL6A 4MRPA 4X8OA 4ZDKA 1HA3A 2GAAA 3CH4B 2CHGA 2BPOA 4IKEA 4LBYA 4UXJA 1U2RA 2QROA 3SHFA 2QNRA 4P4SB 3B9QA 2G0TA 4KHZA 5AUNB 3CF6R 1PV4A 2ZJBA 1LB1B 2D62A 1XMVA 4F7DA 1CR1A 3GLHB 1XPRA 1SVLA 4OK6A 2G9NA 2RKOA 3DM5A 2FE4A 4KXFB 2DWQA 4Q18A 5FTLA 3GP8A 4TYPA 5GV7A 3C7KA 4JVSB 5FBVB 4PO8A 3P26A 2QQEA 4CDGA 4OK5A 1JXOA 5EZ6B 3GFOA 1KOFA 2REXB 3C4JA 3HU1A 2W6IA 3KB2A 4W5JA 1G3RA 2ASEA 2FN4A 2RGDA 4DKXA 3VU9B 3TRFA 1E1RA 4RFVA 1XXHA 4NPHA 1L4UA 2J3EA 3MWYW 1Z63A 3KJIA 1AGRA 1Z0KA 1U98A 3EC1A 3AVQA 2XNDD 1YIJB 1IBRA 3LY5A 3E1SA 4FMCB 2ORVA 1KI1A 3W5VA 4U7DA 1Q12A 3SU8A 2MMCA 2ZREA 3W34A 2ZYUX 3X2SA 3H4MA 3QEJA 1X1SA 1ZMXA 3T1TA 5CLQA 2VP2A 1BMFD 1CQXA 1NVWQ 1U0HC 3BORA 1FFHA 2ATVA 4X8LA 1NJID 2OO7A 5A4JA 2Q9BA 4FCVA 3K0CA 4EJSA 1NKSA 4O25A 4BECA 3OJWA 2O52A 3NHAA 2A7QA 4Q00A 2V55B 1IXRC 1E32A 4J0QA 3BGWA 2C78A 4QBFA 4WIAA 4JL5A 1A2KC 1MR3F 4D80A 3AQ4A 4GT1A 3VR1A 3NDPA 1XJCA 2OK7A 1W49A 4L4UA 1ETUA 1HQCA 2IK8A 3ZVNA 1N5JA 1Q3TA 4TT3D 3ZZ0A 4ZI2A 1G8GA 1B0UA 4P31A 3VFDA 2FFAA 1TU3A 4US1R 4JSTA 4QBIA 1RIFA 3LWNA 1KD1D 4MUAA 1GFIA 2J7KA 1NLZA 3KQHA 1G7CA 1BKDR 1FUUA 1JI0A 3VR6A 3CRQA 4P3YA 3UKDA 4KITB 3DO6A 1US8A 4CVNA 5KUTA 1E2QA 1GSIA 3S1AA 2YOHA 4HB3A 4KO8A 3RRMA 4DDWA 4I1SA 1KK2A 4TN1A 3QXSA 4C4PA 1K9MD 4FIDA 2GK6A 4OI1A 2W6ID 4C7OB 3TIFA 3AF0A 1W2BB 4DLWA 3IPYA 3L43A 3NC0C 5FPSA 4IW3B 5FOXA 4TQUS 2XB2A 1VG8A 1GM5A 1BQEA 2BM1A 1L8QA 4TMWA 4LZZA 1KMQA 4N1AA 5K8LA 3HYTA 3NTUA 1P6XA 1H85A 3JQPA 1JNYA 3FOZA 3AP1A 1YU9A 4AG5A 1E79D 4LK2A 4PPNA 1TUEA 1R2QA 1KJZA 4XWOA 2GRJA 1LY1A 2L0XA 4Q03A 3SDZA 2O8CA 5AUQA 4JVMA 1JA1A 4TSFA 2QL6A 3DZ8A 3CRRA 3GQBA 4HI0E 5JJIA 4CIDA 2O8DB 2BGIA 1HYQA 1OGJA 3W3ZB 2ZETA 4AKGA 4ACBA 2OLJA 3X1ZA 5LD2C 1R5BA 3T5DA 1VQNB 1SVWA 3IQWA 1E2FA 1E99A 1SHKA 3ZZUA 3TBKA 2ZRMA 2ZU0C 3OAAA 5CM8B 4A8JB 2G88A 3CC4B 1JJ7A 1CS4C 2BMFA 1S8FA 2QAGA 4G3XA 4NE2A 1VYUA 2R6HA 3CC7B 2R8RA 4KU4A 3ZGXA 4NCNA 3EZ6A 3NC1C 1W4AA 1XEWX 1GO2A 1M1YE 5FUXA 3SJBA 3UMFA 3U7GA 2QEQA 1HT1E 1EFHA 4HAYA 1RVDA 3GJXC 5G53C 1P2SA 4WVFA 2ZSBA 1D9ZA 1XEXB 3LV8A 3QF4A 3RWMB 4DLYA 3EZFA 1N5KA 2JDIA 3KKOA 2R62A 4NYJQ 4TTQA 5H70A 1NP6A 1SVKA 4DCNA 2OTLB 3WNCA 1F2TA 1X86B 3FDIA 4PR0A 2ZRDA 1IN4A 1CRQA 3J81k 2MSCB 4IDOA 3K0FB 2JIZD 4LUCA 5GJVC 1KKLA 3TAUA 1UFQA 2OV2A 2GXQA 1E64A 2PT7A 2V1XA 3LVQE 1XMJA 3PEYA 3C16C 1FTNA 5G3ZA 1OKKA 1RRGA 2VH5R 3CRZA 3LX5A 4ZI3A 1TX4B 1XF9A 2IS6A 3CXCB 4JLVA 2BEJA 2ZYVX 2R9VA 1YJ5A 3LBHA 4D6PA 2CJWB 1Q44A 4R2IA 1VHLA 2HDNB 1XD2A 3IBYA 3LAWA 3M1IA 4LCBA 3UWKA 2H17A 4PC2A 2WWGA 4JT2A 2GBLA 6Q21A 3A36A 1OYYA 1TF2A 2N1BA 1E94E 1DS6A 3QFSA 1R4AA 4QGAA 1LS6A 4W5HA 3IEVA 4Q4HB 3ZDQA 3FYHA 1T3SA 1Z08A 4FCWA 3W5UA 4B76A 2XAUA 1S3SA 4LYHA 1E9DA 5H59A 2X77A 2CLDX 4GZLA 3A4MA 5GJCA 3ZC3A 1ODFA 5GADl 3UMSA 5DI3A 2RGCA 4RKFA 1MO3A 2VYFA 2PCLA 3QY0A 1UEJA 2PEZA 4FINA 1KO8A 1NG1A 2ZJ8A 2GEVA 4FMCF 3AEZA 2XZOA 2FDCA 3GLIE 2V1UA 1FX0B 2WIBA 1W2GA 1L7VC 3CNNA 2GJKA 1KAOA 2BOVA 5A5GA 2AD5A 1TADA 2H8KA 4ILEA 4A4DA 3TJZA 3OFNA 4HZUB 3ZD6A 5DHAA 1W36C 5L8VA 1GKIA 1MH1A 3NBZC 5J47A 1L2TA 5CM9C 3QFTA 1FQKA 2A5GA 3QE2A 1XU4A 2R6FA 3DPUA 1MO5A 1FRNA 1PUIA 3AVUA 2J1LA 1NIJA 3H1TA 1G3MA 3UK6A 1CJVC 3ZQJA 4V0NA 2GVZC 2JIZA 4V03A 4Q9HA 3DMNA 3EW9A 2IEZA 1N0VC 2FZ4A 3EAQA 2YNMA 3CCEB 4Z54A 4GZMA 5IK2D 1BMFA 1G5RA 1SVIA 4Q48A 4QKQA 2IHYA 2R6GA 2FV8A 3UATA 2GQFA 5JWOA 1KJYA 2IW3A 3MLEA 2N42A 3U3KA 3LFUA 5FTNA 1CJTC 1Q82D 1TEXA 1ZBDA 2ODNA 2W2VA 3QFRA 2KBFA 4V0ME 1G5TA 1C1YA 3ICEA 2X8AA 4MGYR 2F9MA 4YHBA 2ZS8A 2NO6A 2OXRA 1P9WA 3U44A 1JR3A 1LS1A 1PJRA 2RGNC 3W2FA 3HU2A 1NBME 1C9KA 1G7TA 3U4QA 1VDZA 1W0JD 1QVRA 3QE0A 3VNVA 4TT3A 4V0OA 5TDHA 1Y3AA 4EPVA 1YRAA 1E9EA 3GEEA 5L3SA 1VCNA 2CL7X 5FBQB 1VMAA 4R7ZA 2WOJA 1E2IA 1O3YA 1XD9A 5FL7A 2V6JA 1Z6XA 2WAXA 3HR8A 4KLNA 3U6KA 4C0HA 1OH7A 2JLWA 1I4LD 5IT5A 1HE1C 1EX6A 3LRPA 1AZSC 5HPYB 1ZM4A 4LI0A 2ZXUA 1ZNWA 3RSLA 3CCRB 3GCGA 4LHZA 4ZGQB 4A15A 2V7QA 1NDHA 1P60A 4ON9A 4NZYA 4TLEA 4Z1MD 2HCBA 2J7PA 5EE1A 1Z3IX 4K8OA 3T34A 4AKEA 4PHFA 5DI3B 4DSTA 3TUIC 4F4IA 2C9YA 2KSQA 3L8ZA 2BMEA 2KBEA 2G83A 1MV5A 1QVFB 3L82B 3U60B 2CXXA 2F1HA 3QXXA 2GBLC 4OHZA 5B30A 2ZANA 3EZ9A 4PXAA 3AVXA 1OFUX 1TPZA 4RZ2A 3MJRA 2GF0A 2ZRNA 4U9UA 1KIMA 1Z22A 4NL4H 4UJ3A 4PSVA 1OIVA 2XXAB 1QHNA 1QHXA 3WHKA 1W46A 3CCMB 2W2TA 4M1YA 2QA4B 3K9NA 4FN5A 4JBYA 4YAWA 1JPJA 3BBPA 4P4SA 3MWLA 4B3CA 4BZQA 1ZC4A 4JL6A 2GXAA 3BAFA 2HT1A 1BJKA 4EPXA 4HAXA 3B7GA 1E2LA 4PZLA 2XNDA 1NN3A 1SQ5A 3K09A 3MAAC 4V0LA 1Z6AA 4IOMA 5FI1B 2ZJ2A 2YKGA 1ZM9A 2EIXA 4P33A 4F38A 4A2PA 4URUR 4KYUA 4NMMA 3KXIA 1QHYA 2ANCA 4URZR 2IXGA 2QZ4A 3OHMA 2VNIA 1DG3A 5K8UA 4JYCA 1GWNA 2J0UA 2QGNA 1GDDA 5BQ5A 2NO9A 1YJ9B 4PPFA 4TZ0A 1XPUA 1KDOA 3B13B 1COWA 3CNLA 2VSXA 3FMOB 5ANRB 5KSYA 2FPKA 1FNCA 2WV9A 4D82A 2AHOA 2BSAA 2A30A 3B6EA 2F1JA 4UNSA 2WSMA 4JLNA 4U02A 4OHXA 3AGPA 2FH5B 4Z1MA 1TU4A 4Q19A 1DE0A 1OXVA 4A9AA 3P27A 3FWYA 3A1SA 3KKPA 1VQ6B 5J40A 521PA 2EFGA 8OHMA 3U3MA 3FFBA 2IXFA 3CPEA 3QKRB 4Q9IA 5GVSA 2EWVA 1VIYA 2ZJAA 4KFSA 4M22A 1KO7A 4M53A 1OB5A 2O0KA 4NONA 4D0NA 1P72A 5FPKA 1G8YA 4RCZA 1GRRA 1OFTA 3E5HA 2CHVA 2IT1A 4DLTA 4US0R 3QOFA 3BFVA 1MKYA 3MRSA 2IHBA 4Q7JB 4B34A 3THYB 1U9IA 1VQPB 3VQTA 3NIBA 2WJHA 3GLHA 3W5JA 1SHZA 5FTJA 5L3QA 4NYJR 3EWAA 1XMIA 4C2TA 1E2MA 3W2HA 2CBZA 3ECCA 5FR2A 1QX4A 4M21A 1Q21A 1CR4A 1G8PA 3KDSE 4IOLA 3TR0A 3B1WA 1HURA 1R0ZA 1T8TA 3BB3A 4A8JC 3ZBUA 1N6IA 1US8B 3A1VA 4LHVA 4AK9A 5L3QB 3B82A 1FP6A 5LB4A 3EPKA 2A5DA 5HCIA 3I1FA 1BX0A 4URYR 3DKPA 1M34E 1P4SA 2CDNA 2Z5FA 4BFUA 2QY9A 1ZAKA 4MKFA 1A2BA 1YJWB 2QTHA 1N0UA 2FX3A 1GOTA 3N2EA 5FPHA 1COWD 4RD6A 2JATA 5J4YA 4UAJA 3RC8A 3CCSB 1A82A 3AKYA 4C9BA 1DAKA 1IY2A 4LJ6A 2P5SA 1FP7A 3I55B 1VQ9B 3NDBB 3A4NA 2G1KA 3CPHA 3C5CA 1DBSA 2FG5A 3TK1A 4BWYA 5LPNA 1AS2A 2GWHA 1W1WA 2IUTA 5LBIA 1EWQA 1PLJA 5JHGB 3ZZTA 2OCAA 1VQ7B 4KFRA 5JEEA 1X6VA 1YHNA 3KKQA 1AQUA 2ZYWX 1N25A 4AWXA 4D4LA 4AY2A 1K5DA 2GEDA 1JALA 2F6RA 1M74A 2F9LA 2ERYA 3CF2A 3Q9LA 5FOUA 2ZI9A 2H7VA 4LJ7A 3IO5A 5HKKA 1UBCA 1NI3A 3QG1A 3CR7A 4C0SA 1NBMA 3KQUA 3RSOA 4P0TA 3U5ZB 3CPJB 4L5BA 3DEFA 3KQNA 1DAHA 2ZJ5A 4PZZA 1IONA 2QGZA 2ZR7A 3RC3A 4DSUA 2VIIA 2ZVQX 4NHOA 3I3SR 3QFCA 3RS0A 4BEBA 2V8OA 4JS0A 4B4DA 3KKNA 2VHUA 4HLUA 4WZ6A 1SXJA 2QTFA 4MRNA 1H42A 1JECA 5HZHA 4OBEA 4HAZA 2J7PD 4OQXA 4Q7MB 5AJXA 1ZYUA 2YJTD 5FR1A 4TMVA 3B1YA 5TV2A 3PEVA 1Q20A 2VP6A 3Q85A 1N5IA 2ODWA 2LKCA 3KB1A 5ELXA 2IWHA 3BK7A 4YDHB 5C2JB 1OGIA 2VRWA 4QG7A 4LHWA 2ZUDA 3ZH9B 1VQLB 2CMKA 2QENA 1UM8A 2ZSEA 5BYJA 3VO2A 4HE5A 1ESNA 1O87A 2FA9A 2NPIA 1T5IA 3NKVA 1XRJA 2PZGA 1E2GA 2V6IA 3H84A 4ZDJA 4IVRA 2ZRCA 1PUJA 1AN0A 2GPJA 2GCOA 2HJVA 1HH4A 3C15C 3LH5A 2EYQA 1GR1A 1SXJE 2CCJA 4PSKA 4ARZA 3GLIA 4KJZA 3SR0A 1XZPA 3KXKA 5DLQC 1ZC3A 1MRSA 1KDPA 1WE2A 3THYA 2QDXA 4LV5B 2OBNA 5JJLA 5LDDC 4JSYA 1YHQB 1S3GA 1NVUQ 4RD3A 2Q3MA 1DOAA 2VZLA 5CIQA 3R8FA 4MGIR 5EE0A 2QM7A 2JLSA 2GXSA 4NBSA 3AVTA 1VG0B 2RGNA 2ZIAA 3G82C 5KNCA 4DRZA 4B3XA 4L8GA 3GLHE 3O8DA 5HE8A 4GSYA 1XFAA 2OFXA 4EPYA 1QHSA 1UMKA 1YQTA 4AIIA 5L3SB 4PC3A 3TUZC 5DGXA 4G1VA 5L3VA 4TYWA 1EFTA 2FSIA 2C5LA 2PCJA 3P4YA 5EP3A 5FH9A 4MYCA 1XTIA 4Q01A 4DCTA 3WRYC 3WBJA 3G4SB 4MH0R 3SN6A 4JLMA 4QNMA 4XTRA 2XNSA 1TQ4A 2QM8A 2VF8A 3EIQA 3OEED 4LWZA 1NY6A 2I1QA 1Q3HA 3CW2A 3EG5A 3HPRA 2NIPA 3IHWA 4HDQB 5G40A 1E4YA 4B32A 2QP3A 2QE7A 2QQ0A 2WAYA 2V54A 3IGFA 3KUDA 4AD8A 3EXAA 4MRRA 3CM0A 3UMRA 4LYJA 1XXHE 2ZAOA 4KVGA 2H92A 3TLXA 2O5VA 1X8KA 1S1MA 2VP9A 3NBYC 4Q1AA 4QGFA 3M4YA 2RGAA 4G5QA 4L15A 3AVOA 2H1LA 5BYKA 2OFWA 4G1BA 4M1KA 3WYAA 4ABYA 5C4MA 3QUSA 3P32A 1M2OB 5J4HA 4F4CA 4P32A 1J7KA 2ZRJA 1P3JA 3L0OA 1GNQA 3TVDA 1Z47A 1L4YA 1MABA 5JBQA 1F2UB 3RS5A 1P75A 3DOFA 3GJ4A 5CJPA 5KSPA 4CZ2A 4QHSA 1D9XA 4XVRA 1Z2AA 1KI6A 2D06A 3PUYA 4M9ZA 3RAPR 4B74A 4EPWA 5H5JA 1R10A 1B23P 1YKSA 4PGOA 3T12A 2CLCX 3PFIA 2WZQA 3R9WA 2GCPA 2YC4C 1BH2A 1GTVA 3UG6A 4RZ3A 5EXSA 1N6PA 4ESHA 1E69A 2ZRBA 1Z83A 4Q1BA 3L0SA 4HLCA 4TSFD 1Q1BA 3TSOA 3PUWA 3IHLA 1JR3E 1E9BA 4HE6A 2EFDB 5E3HA 4QBHA 3RLFA 5DI9A 3KJGA 1OIXA 3CX8A 4DLSA 5EE3A 4DHEA 2BGJA 1NNEA 1UDWA 3DKVA 4ZO4A 3BXZA 4DVGA 2AWNA 2C95A 4YMSA 1VG1A 1JB9A 3BH0A 4YAUA 3ASYA 5KTYA 1VQKB 4LOAA 2D4HA 2ZJOA 4Q1FA 3K9GA 3GJ8A 5B57C 3OF5A 2XTMA 5KSWB 4IEEA 2YVUA 3KTAA 4OQLA 2AN9A 3LVRE 2FFQA 4LV8B 1IY1A 2JDID 3FHTA 2NG1A 1YZUA 2MSEB 4C0BA 4PZYA 3ETLA 2VF7A 2IYWA 3HR7A 4Q21A 1NLYA 3BB4A 2GA8A 2RCNA 2F43B 3SOPA 4DB4A 1E4VA 2FF7A 1I4TD 721PA 1W34A 3VR2A 4YMUA 4HZUA 3FFAA 3I5XA 1GNRA 1OKKD 2IA5A 3MGCA 1F60A 1AQYA 2B21A 2OCYC 4M8NE 3ZBTA 4ZCMA 1OB2A 3ND8A 1E79A 5AJWA 1SXJD 1GL7A 4TMXA 4A2WA 1N6NA 1KMHA 4BASA 3EA5A 4N0DA 1TF7A 4P4TA 1P2TA 4Q4AB 3NXSA 1KDTA 4AKHA 5HCNA 3LO8A 2C9CA 1YZGA 3CCQB 3BRWD 1NG9A 4TLCA 3NG1A 2A3RA 3EA0A 4JBWA 1T6NA 3NEJA 4K1XA 2PH1A 2EFEB 4WXPA 4Z8XA 2ZRFA 3O8BA 3THXA 3LW7A 4B2IA 1G6OA 1OHHA 4Q4AA 2WJIA 4OK3A 2J46A 4II7A 4M9XA 1I2DA 1N5LA 1EP1B 5JFGA 3MHPA 4H1VA 1H65A 1ZVQA 2DWOA 4A6PA 2PBRA 4Q5IA 5SZJA 4F7WA 4LJ5A 2CVHA 3EIHA 3FPKA 4WAUA 1QVGB 1ESMA 4EQ6B 4BLPA 4E03A 4BE7B 1U94A 5BW8A 4PHGA 2OCBA 1KNQA 1ZCAA 3C8UA 1MT0A 1VHTA 2UKDA 3AH8A 5EUQB 1OW3B 1BYIA 2CEAA 4YXWD 1GAQA 2B8WA 4Q9KA 2DBYA 3CMAB 4WZBE 3U3RA 1EX7A 2C99A 4BQSA 5J5CA 3GPLA 1VCIA 4FMBB 1Q1QA 3OEHD 2VP4A 3KKMA 1HEIA 2O8FA 5IK2A 1XZQA 2RGEA 3OEHA 4NYIR 1UDXA 3WP1B 3MWKA 2JGNA 4IDPA 1D5CA 4LJ8A 4TL9A 4V0MA 3EX7C 2PX3A 4MA4A 4YMTA 5JWRA 4LBVA 3K70D 2JLZA 4TYYA 5EJEA 4PO9A 2WWHA 1XCGB 1FX0A 2D2FA 2ZAMA 1TQ6A 2GJ8A 2DEUA 2CNDA 2Q6TA 1LF0A 3DOEA 5JRZA 1OXSC 4MITA 2WBLC 1KSGA 3LLUA 2GKSA 4BRUA 2NO0A 2HXYA 1W47A 2LKDA 5EP2A 3QKSB 1CJMA 1W0KD 4GOXA 5KSZA 4GL2A 3I72A 5F9FA 4C30A 4POAA 2O0JA 1W0KA 2PIAA 3CRW1 1XX6A 3WYGA 1SVSA 3CB4A 1CBUA 3IEUA 2Z83A 2J45A 5JMTA 1TQDA 4CT5A 2QA5A 3GLFA 2DR3A 4B3BA 3I8XA 1Q22A 2XX3A 2QU8A 5JRJA 2WMNB 1KRHA 2PJZA 2V7QD 3OZWA 3KZ1E 2OCPA 4O0MA 3SI7A 2ZI7A 3W90A 1VIAA 1NJFA 2OZEA 3E1YE 1G5PA 4RJLA 1G41A 3U6BA 1X8JA 1RPZA 4BFVA 1CJUC 4BPRA 2A5YB 2ZI5A 5G3YA 2FMXA 3OESA 4M9SA 2ZM5A 3B1ZA 1GJRA 1TAGA 1Z6TA 5J4VA 5JSZA 1N8RD 2JJ2A 1R7RA 3B60A 5JWHA 3QEOA 2OEPA 3F8TA 2QTZA 3R9IA 2CNWD 4DDUA 1E3MA 1QFYA 3I56B 1XEFA 1FTSA 1EP2B 2GHIA 3IIMA 5CB6A 5GJBA 3KUCA 5DH9A 3SE0A 1D2EA 4N3NA 4C43A 1ZNZA 3Q72A 1E2KA 1Z6GA 1KI8A 1HV8A 4BGDA 1KSFX 3TH5A 1W0JA 3NWJA 2BMWA 2VHCA 3CCJB 2CL6X 3W6OA 5SZHB 1UF9A 2W2XA 2RGGA 1NN5A 2UZIR 5IHPA 3IUYA 2H16A 4AYTA 2J9RA 3VHXA 2WMOB 3KQKA 3SC3A 3CKLA 4HLDA 3M6AA 4BLQA 1CRPA 3PENA 4EKDA 5FPTA 1Z07A 3A1WA 1Z0FA 4G0NA 2B92A 4HYYA 5JI3E 1Z29A 1U8AA 1UKEA 2D74A 4B3DA 4ZPXA 4C0AC 3TAHA 4BZXA 1AA9A 3ADCA 5TR9A 1ZIPA 1QGZA 3D8BA 2QMHA 4F93B 1FMJA 3T1VA 2O8BA 3QIAA 4H9GA 3OZVA 4OHWA 1ZW6A 1KI3A 3JVVA 3I73A 4CEJB 1SGWA 3GJ3A 4LBWA 1XXHB 4FW9A 1A8PA 3K1JA 4NKRA 3R9XA 1E0JA 5HZKA 1QVAA 4KI0A 4S35A 2JJ2D 1UJ2A 3QPWA 2ZU6A 4HAUA 2K5UA 4M4SA 3ADKA 1YZQA 4KBGA 4WA7A 5H68A 4GOKA 3FJOA 2BWJA 5FOSA 5LB2A 2QG6A 1MABB 4B47A 4EPRA 4M1TA 1G64A 2O8BB 4BRWA 2JEOA 5CDFE 4ZCLA 1A4RA 2XNCA 3CZPA 3GJ5A 5AK0A 2UVQA 1OHHD 4JLBA 2RAPA 1TL7C 5TB5A 3PVSA 1QHIA 1R0WA 1F6BA 4UXIA 1RE0A 3KQLA 1A7JA 1GKYA 2RC5A 2BV3A 2E9SA 4ZCIA 2WM9B 4ESVA 5F9HA 4QM6A 4A0RA 1XP8A 1E2JA 4Y0VA 1M90D 2OILA 2O8EA 5FL3A 1SKYB 2BC9A 4R2HA 4CYMA 2XB4A 2V3CC 3E20A 5KU1A 1UPTA 3CONA 2FWRA 2VA8A 1EG7A 2RHDA 2DFNA 3DDCA 1J2JA 1T91A 3QF7A 1QHGA 4TL8A 1UBGA 4LJAA 4DT1A 2D2EA 4RCYA 4B6EA 1Q1EA 2NZJA 1AM4D 3MD0A 1TF5A 2GVDC 5JS7A 5KNBA 1OH6A 3AKEA 3T15A 5JEDA 3T61A 3TW8B 4D25A 2JLXA 5KO2A 4DLUA 4K46A 4PQFA 1U0JA 4DLRA 2LWIA 4YAOA 3O47A 4RZXA 5C1BA 4BFYA 3E70C 4RKEA 3OIWA 5G41A 5B2ZA 3RYTC 4C0LA 3P20A 1Z0DA 3A1TA 4B35A 3KFXA 1R8SA 1YZTA 3BERA 1IJFA 2VQSA 3PV0A 3B2EA 4ZV4A 1EFUA 2IWRA 1JJVA 2OFOA 5EZ5A 4Y9UA 3BOSA 2O8CB 2BN4A 3N5CA 2J5XA 2D7CA 2BMDA 2J0QA 4BFXA 4CEHA 3CC2B 4NYIQ 2F3TA 1F20A 1XD2B 2ONJA 1ZM2A 2ORIA 3REGA 4DLXA 2YOFA 5GJWC 4XVUA 4ZKEA 5EE9A 3PUXA 3GLIB 1YITB 3FMPB 3I8SA 4E5UA 1DPFA 1Z06A 1EFRD 1I2MA 1FUKA 1ZNXA 2O0HA 4NYMR 4XIGS 4BFTA 3HJNA 1JEEA 3MCAA 1EFRA 1D2MA 1G4AE 3LX8A 2BDTA 5DHFA 5FFMA 1RRCA 1G7RA 2I4IA 2NGRA 3JZMA 4N3GA 4UNRA 3BWDD 2ZRKA 4F92B 1CEEA 1QGYA 3I62A 1JQLB 4LRWA 3JZAA 3AP2A 3FPAA 3AGQA 1DELA 3BFKA 1VQOB 4DIEA 4HUQA 4Y9RA 1CNEA
chains in the Genus database with same CATH superfamily
4M1QA 5FF9A 5FWXA 3THRA 2NUAA 3WHPA 3FTNA 3UAYA 1DUVG 1VYTA 1KMMA 3X1MA 2N46A 1WKVA 5BOSB 1GUBA 3H9QA 3OMXA 2QUBA 3KX2A 2Y1CA 4DV5B 1KZ9A 3NHZA 2FPRA 2HJ9A 3T54A 5L7TA 4OYHA 4H31A 1PW5A 1CY7A 1SBCA 2MYPA 1II0A 2ZBEA 3UCXA 1KJIA 1BD3A 3SX4A 3WRXC 3F6RA 4GBED 4L50A 2PT9A 1P0MA 2ZVPX 4IZHA 2R4UA 3E7FA 4YQFA 3TDNA 1ZG3A 2CMHA 4UNQA 4EHNA 3TOZA 3T1HB 4YELA 5IYWA 3PQ6A 3GMTA 5E4YA 2VYCA 3AFHA 4C3OB 3GLVA 1K98A 3NALA 3DNFA 4GKKB 3QU4A 2V9PA 3KZOA 2VJIA 3BD9A 3TS1A 5BWNA 3OX2A 1XB2A 1D4AA 3KR1A 1YMVA 4OUDB 5H80A 1Q81D 1Y63A 3LU1A 4R16A 4LPKA 4CTJA 4UOEA 1W94A 3F7OA 2IPOA 1LPPA 1UIMA 3WLHA 3AF6A 1GPBA 4I1OA 5FTMA 1ZD8A 2CCGA 4KBFA 4NZMA 5C3UA 4ZFNA 2PRZA 3BXGA 1AH2A 1CR2A 4XLEA 2A5FA 1OVMA 4FIZA 4CLOA 5KU7A 1Y6JA 5KJEA 1EUDA 2QYTA 5TMBA 2I65A 1MU0A 2H6EA 4L8VA 1WNTA 4ZGWA 2Z4RA 1UXHA 3Q6NA 2V7TA 3EA4A 1NUSA 3WI7A 5DN9A 5D5HA 4JHLA 2WJGA 1Y0RA 2IZ1A 1NVVR 2QMEA 3RFTA 5KNCD 2ATCA 1KEEA 3SIWA 1EWTA 3VR2D 2I4MA 3DOCA 1S4MA 1HEUA 1WS6A 4MZDA 2PGXA 3MLBA 3K94A 4L9SA 1VB3A 3EF0A 4F4JA 2ZRAA 4OHBA 2WIGA 1DAGA 4K2HA 4OBWA 4L08A 3Q7IA 1BS1A 3BDAA 3GJSA 1ZNYA 4PANA 1CDZA 1YR2A 1WSDA 1JHVA 3DTTA 4GR5A 4QAJA 4YJKA 4AJEA 16PKA 2XNHA 3HL0A 3C98A 4MW7A 1V16B 3KQYA 3QEAZ 4G6ZA 9GPBA 4PIVA 5FA6A 5E4FA 5K7SA 1FK8A 1R12A 3SNHA 2EZTA 3QM1A 5IKPA 3JQAB 1Q5PA 2WFLA 3NH9A 3A1EA 4W6QA 3RRYA 5C53B 1G59A 2WM8A 2WJ3A 1VL6A 4JKIA 2Z56A 1JJIA 4XDZA 3PGMA 4S0ZA 2WZCA 3O73A 3U7HB 4DV1B 1QLJA 5KDOA 2A9QA 2HNAA 1SOAA 3WQBA 5JFOA 4MHTA 1HNWB 4AVZA 1AK9A 3GZNA 4KAXA 3OCCA 2XZTA 4X1YA 3LUBA 2NYUA 4BB6A 1MOSA 3OZEA 2GEUA 2HDWA 3M33A 1P2UA 2WSSD 2YVQA 1L4HA 4TVKA 3GLGB 3F6PA 4L5AA 1IXKA 4X3PA 5CT8A 2FR8A 1RRPA 3IAM6 3KBBA 3P9CA 4DYDA 1E2NA 3DHNA 1G3IA 3MYRA 4B6FA 4YP6A 1PK9A 1G3QA 2YWFA 3ZE2B 4IEIA 4O8CA 3U09A 4GP6A 2HMSA 4B33A 3NT2A 5CXUA 3QG5A 2CVFA 3G8CA 1WZUA 3OMWA 4PYRA 3SGLA 3H9EO 1VLYA 4KIWA 1NHGA 1U0OC 3GN2A 4RSHA 2GETA 2GN6A 1A7KA 1CXZA 3Q6RA 2AFHB 3QVVA 2WHPA 1NF3A 3R6LA 3L3BA 2WZDA 2ZYGA 5ILGA 4DJTA 4DA9A 1TJ4A 3QVUA 1SHJA 5E95A 2WKPA 5CK5A 3DO5A 1Q6ZA 3LUCA 4CRWB 3LNCA 4YRAA 2G9QA 1FLVA 4QNNA 5CX4A 3WLMA 3OM0A 2ETXA 3ENQA 4I6JA 1ZBQA 3WE7A 2IELA 1Y1KE 4GPTA 4JP1A 4W7SA 2DQYA 3DKRA 4JJAA 3JQEA 4XYGA 5IJWA 3U0VA 4D4MA 4M0PA 2PA3A 2OZVA 1EESA 1ZUNB 1J0AA 4RKYA 2OKCA 5LL6P 1CVRA 2XQFA 2G71A 1M6NA 3Q6QA 4YLGA 4M1SA 2AXPA 1F1JA 1REQA 3D2LA 5TMEA 4GVLA 4HGNA 2VJMB 4KUHA 5LMCA 3IBCA 1G20B 5ARCA 4O4JF 3W1VA 4HDKB 1T9CA 1GUDA 1CZOA 3ZQ6A 2TMYA 5A9TA 1BW9A 2E89A 4BNVA 1W36D 1R8YA 3T9DA 1Z0AA 3O26A 2SNIE 3K09C 4UPVA 2BFFA 2AXQA 4HQLA 2RKWA 3A9VA 3W7VA 1ZVMA 1AS0A 3OPVA 5LYJB 3SXJA 3EZXA 5K4GA 5A62A 3DDNA 4BLOA 2VOEA 4XTCS 2WW8A 3ANTA 4QRIA 1QPGA 4U0KA 3IR5A 3QXGA 3AF2A 4CF5A 5B7GA 4ZA2A 1U5CA 3DT6A 2NXEA 1IG0A 3E05A 3GBPA 3QV2A 1FDVA 4XARA 5ALLA 4C4TA 4CNQA 4QVKA 4HR7A 1IZ8A 4M2LA 4C4RA 3L4KA 4O4LA 1BMDA 4TKVA 1DDGA 2V7UA 2AJCA 3F5QA 2OBRA 2VCHA 2A88A 4BVFA 4EB6B 1QG2A 3NATA 1GL9B 5KCZA 1T5OA 2WDPA 1L7PA 1PQUA 2Z1NA 3AWDA 3UAGA 1IJEA 1K8ZB 4JBHA 1HUQA 3VOAA 2HT6A 3M6FA 4URFA 2GO1A 5GQSA 1B2RA 4WZBB 1F17A 4BKOA 4YLYA 1KGSA 2B0CA 1GZ4A 4GX0A 5K51A 3JWGA 1KFEB 5EJ4A 2YOGA 5DM4A 3R0VA 3V3KA 4KRYA 3PA1A 2X8LA 1IAQA 4XYMA 5GZ1A 5KYUA 3SM9A 3WKCA 2QUKA 2Y4OA 4L6AA 1Q0PA 1NXOA 3H4VA 3BX1A 4OGLA 4Y9SA 3ZQUA 4M1ZA 4EDHA 3CW9A 3VR4H 1XJ0A 3SEQA 4CM7A 4EECA 4E07A 2GJ9A 2O1XA 3ANYB 2DCMA 4LNHA 4TROA 5D3MA 5IUKC 4X07A 3HXMA 1ZUIA 2EDCA 5KYVA 2X7JA 2C57A 1C7QA 2W6ZA 2C4KA 2BP7B 4JLOA 3LSTA 3RWBA 1JE1A 3Q6IA 3STYA 1DTWA 3ZWNA 3P4XA 4IZIA 3VR3A 5KHLB 1T1SA 5DCLA 1WP6A 3ZLUA 3WY9A 3WP0A 1P61B 2HWWA 3IEPA 4X00A 3GJ6A 3TQCA 4OQZA 1N2HA 4BLWA 3OZXA 2ZJFA 3RQIA 1NQUA 3ABSB 1MEEA 4BE9A 5KPJA 2I6FA 3QVJA 2OBTA 2CVQA 4K5QA 4EFLA 5JNLA 1VP9A 4DKJA 4M9QA 3LOPA 4ZYZA 2Q5CA 3KM0A 3RHFA 1DQYA 1MO6A 3ENKA 3AILA 2YVLA 1TPYA 2P3SA 1GPNA 3TQQA 1GA1A 1EMDA 2ZJ7A 1KMIY 1RRMA 4RUKA 5DMXA 2Q3HA 1JHXA 4OOVA 1GV0A 1VCMA 2JGJA 3MUFA 3V2HA 1EFLA 1BW9B 1KSJA 1X7YB 3B5IA 3D1LA 4QUIA 3ZTWA 4RTQA 4MHOA 4PYNA 2CXTA 4PTYA 1DP4A 1YMQA 1U2TA 3MMSA 1X3SA 3ZJVA 4AMGA 2ZUBA 2IIBA 1F6DA 4Z7JA 4CQLA 1CEXA 3IDQA 4DLAA 2KB0A 2PMWB 3EQ7A 1QO7A 1EFCA 1GNVA 2GN9A 4OMUA 1RYFA 1L7OA 1LQTA 3O9ZA 1E5XA 5EJ5A 3D4NA 3R24A 1SZCA 2RH8A 3OOJA 4PX2A 1M6HA 1VKZA 3I04A 1TVKB 3H97A 1TLFA 3OPYB 3QVXA 3I1YA 2CB9A 5C5IA 4B75A 2FXVA 3SYMA 4YUZA 1YZYA 4ZOEA 1T0UA 1NJ6A 3EEYA 1R5JA 3VKHA 3DMRA 3V1MA 4KQCA 5JSUA 1KI7A 4YRTA 2NYRA 2GZHA 2AXNA 4KV9A 2NU9B 5IHXA 2OPHA 2PXXA 2YN0A 3HCEA 5AKZA 3NHPA 2X9VA 4G1UC 1E3XA 2Q5FA 4LI3X 2H5IA 3JQCA 3IESA 4ZI5A 2BF4A 1VLMA 1LSJA 5A05A 1W7AA 2IEYA 4GVPA 3TM5A 1QNLA 1N1DA 2F1RA 1UPFA 1UOEA 4K26A 1B42A 1ZJ6A 1MFPA 2BCEA 2NZUG 3ET4A 5B6PA 1K5PA 2J87A 1TEVA 2EQAA 2HF8A 4MARA 3ZUGA 4AQYB 3T38A 4BNYA 1FNDA 3DXFA 2VJCA 3CWQA 1DT5A 4C5AA 2VAPA 4IJVA 3DDSA 1R6XA 1ZMRA 1SAYA 1JTFA 5HOQA 2ZUCA 1PR3A 2HF2A 2KYRA 1P3Y1 4HYTA 4OMCA 2DB3A 1NMSA 3MHTA 3JZFA 1GZSA 1KJWA 1QMPA 2OR3A 4ARZB 4X62B 4I3FA 4BO5A 3R77A 3ESRA 2H18A 4E21A 5A5EA 4UEJA 2FNAA 3G2OA 4A73A 2W00A 4KO2S 3SQDA 2J32A 2RB4A 4TQAA 4YT2A 1RKVA 3QKUA 4XXHA 2HLDA 3CCVB 4YP5A 2OAP1 5I9MA 5I7VA 4L0CA 1T8UA 1M1KD 1E2DA 1JHRA 1U3WA 1T36A 3N70A 1O77A 3IH5A 3TLZA 4XLFA 4KK3A 4RHEA 4NCKA 4WLEA 2OYNA 3BD8A 3DTYA 2ODPA 2C3PA 4HSEA 4PSUA 3VR5H 2QT1A 4PC7A 2WJ6A 5BN5B 4AF8A 2X1LA 3F4KA 2O48X 1OT3A 2QVXX 1HFEL 1ZL2A 1D7AA 4X20A 2WP8J 4JJGA 4MVJF 3W8EA 4BTVA 4CN8A 4DWVA 3L6UA 3P94A 3L1IA 4DQKA 2OM6A 1FJ2A 1JHAA 2QR2A 2WSLA 2AWOA 3ESQA 4MTCA 4UNIA 5AHKA 1YWGO 4N9QA 4ZDIA 2YJGA 3IIIA 4ACAA 1XVIA 4OPVA 1VHJA 4RTOA 2NP6A 2QIPA 3EZYA 1UJNA 4D4IA 3UWOA 1MQ8B 1E2PA 3JD4A 2ZUVA 4DDHA 1T4GA 4JFAA 3L6RA 1VE6A 4UMEA 1FL9A 1VP3A 3PE6A 4ADSG 1NT4A 3JU3A 5B1SA 2GLTA 3RS4A 1JDZA 4E22A 4ISCA 2F8SA 5K3AA 1S2LA 4MXDA 2Z30A 3CR8A 2E37A 3O90A 4DQLA 4KFUA 3SZRA 4CM9A 4P9SA 1BH6A 1YZKA 3OG9A 2B37A 4FFOA 3QLUA 4JYPA 4OXRA 3QKRA 3VH2A 1AQIA 3TNFA 4FOLA 3PGVA 5JD3A 4JLJA 4BLTA 2LUOA 4EG7A 3K1ZA 2JGRA 1KJ8A 4PTLA 5FHRA 1FU7A 2FP3A 2O4UX 3RROA 1OMOA 3G9ZA 3TCNA 1SQFA 2CMGA 2NU9A 2XUZA 4RLQA 4JOSA 3QI7A 1YJBA 4LYYA 4YJ3F 5CLHA 3VX4A 1RJ9B 4OJKA 1YR8A 4RQTA 3PF9A 1FEZA 1EXMA 2XA2A 4RDCA 1Q7BA 4TPKA 2X3UA 1X0XA 1Z5OA 1GGHA 2PPLA 5HF5A 3N75A 5TQJA 5FKJA 2GM4A 1N92A 2PT6A 2X6RA 1SUEA 4JDUA 3GLGA 4Z6KA 4YFYA 4FUQA 4MWEA 2VNKA 1IAVA 4KXLA 4X63A 1RZVA 1PNOA 1NASA 2OK8A 1ES9A 3AETB 5IYRA 3ER8A 2UXDB 1SKYE 2DIEA 3ZGOA 2WYRA 1DEKA 5LZ8A 1YQQA 4R98A 5HQ3A 5JYCA 1NRKA 1XZKA 3PFGA 4YJHB 5CYPA 3SHVA 3JASA 5AVRA 2FPPA 2WE7A 2G70A 4FLMA 2M5SA 2CKDA 4BMOB 1N05A 1Q84A 4XVQA 3Q7PA 2DKOA 3MT9A 2RGWA 3VZSA 2PWYA 3OJ0A 5KTNA 2D1FA 3F90A 3RYHB 5A9SB 1VE7A 3GEGA 5BUQA 1SEVA 5JJKA 5F9MA 3OX4A 3W5IA 3OMLA 4M3NA 2G1JA 4EJSC 5LOVF 3FZNA 5IF9A 3TMAA 5DYNA 2DSTA 2FHPA 1N2BA 5LIRA 4NLLA 5HR5A 2FSVA 1XHLA 4HXEB 2HY7A 4OIFA 4BMXA 3P0HA 1YZNA 1NJGA 1OXTA 4CEJA 4MVYA 1THMA 1WMAA 2JCBA 1MFZA 2ZB4A 3FUUA 4AYWA 1HZEA 4F11A 3B9RA 1PYGA 5JC1A 1QTQA 2HNBA 1BS2A 2DPHA 3AUJB 2ONKA 1VGRA 3AOGA 2G08A 3EPPA 2R00A 1P1IA 1CTQA 2J3IA 2WJYA 4KE9A 1JJBA 3G2QA 4NQZA 2QRVA 2QEXB 2NQ2C 2WAAA 5K8CA 1PWYE 4JITA 2V9ZA 2XUKA 2P6PA 4MDFA 4HPXB 3RBVA 3MRTA 2K4MA 5M7EA 5IBPA 2OPBA 2ZZGA 1CF9A 2DTXA 2XVAA 3ZIDA 4W8HA 4OA8A 3NYRA 3EDOA 3TTSA 4H16A 621PA 2XMGA 3OD5A 4RSGA 2WILA 3C87A 2ZQZA 1RE1A 5LSAA 3IKTA 4LRUA 1MQSA 1EFKA 3ZKWB 1T2CA 4LMAA 3RSHA 2OCGA 5JPCA 3TF5A 4ZVKA 2EEPA 1Q86D 1W88B 1C80A 1AGYA 3ADBA 1J9EA 1Y3FE 5D86A 1AQJA 3RS7A 4WACA 2ZLBA 3BAZA 4MUEA 4IHJF 4E5NA 5LQAA 1EA5A 2XA9A 3RC2A 4EM6A 2FRDA 3BD6A 4YN3A 3T7TA 5KQGA 1Y48E 5H7XA 5JAIA 3C0KA 5IUNC 4P26A 1PYOA 1QV9A 5AOCA 1XTBA 3DGFC 3NPMA 1JHUA 3RK4A 2EGHA 4II3A 5IYQA 2BCGY 2JAQA 4K9LA 2Z6QA 1EUZA 4P93A 3A58B 3NM5A 3CE9A 5FLEX 1GQYA 1GZ7A 2FG6C 4ZCSA 1YDEA 5DXJA 5E7MA 3H2ZA 4FS8A 4KLRA 5EN4A 5HQ3B 3A9RA 2FVYA 3FKQA 2J67A 2KE5A 1U0LA 2VHVA 2EBUA 2IITA 1SHTX 2W0SA 4BNDA 1QR6A 2P0YA 2VDKB 1X7DA 3A9TA 3WGOA 2PMKA 4FE4A 5J4LA 2JZCA 2B69A 4RTMA 1GNLA 4I19A 1H4TA 3HP1A 4OHVA 5DEOA 3RADC 5AVKA 3RFVA 4C7XA 4QUEA 1JSRA 2CNNA 2G6TA 3DVLA 3ZCUA 3VSEA 4EW2A 3O8CA 2AA3A 2VSOA 1ZZGA 4DCJA 4P6YA 1QGAA 1VPLA 2BP7A 1SZPA 1XKXA 1JFRA 2HPVA 1NBOA 2FFHA 2QAJA 2XITA 2ZZMA 2P2LA 2EHDA 2BEWB 3JQ6A 2QTTA 4GSKA 1JILA 3FTFA 4DMHA 2NVBA 3PYMA 4A92A 4JQZA 1RJ9A 1XRSB 4XQ0A 1VF7A 4DCSA 3WL4A 3PDWA 5ALSA 1AKYA 3A1UA 5EOVA 1T5BA 2JH8A 1GSOA 4ZREA 1MORA 1TT5A 3BWEA 4KIJA 3IT1A 4N8EA 1Y3CE 3CLTC 4IJMA 1VBKA 2JS7A 4P7GA 2OZKA 3MN1A 1B8OA 1BCRA 1V9CA 4ND3A 1FDTA 2WJZB 1U7PA 1QK5A 1YIOA 5DCUA 4DEVA 4MR9B 4WI1A 1CB0A 4BO4A 4BBPA 2P77A 4XFKA 4QZVA 3BNWA 1N3LA 2AIRA 5EJ6A 3D7MA 2B61A 4CNBA 3L8YA 1UD8A 1RHQA 3OZGA 2OORA 3LVBA 1E7WA 3HVHA 4ANFA 2PYIA 2ZBQA 3Q9UA 2ZJZA 3PI7A 4RIFA 4C1NA 3OT5A 5JZBA 1LBQA 3LHFA 5K0TA 1W88A 2Y1GA 4DFDA 2AOTA 4NF2A 1J0DA 4BQPA 2WB2A 2PBZA 1NW6A 5A9RA 2ZT5A 3A4VA 4XJVA 3LLSA 5HIAA 5AXBA 4CODB 3X1WA 1AIPA 4RPJA 3GG2A 5EKSA 5EWLA 4KFTA 2XGJA 1ECCA 3O4HA 3C7AA 4KMRA 2M98A 4YIKA 4BBJA 3BSSA 1BHJA 4NCXA 4GU5A 4TQGA 3WNVA 3W9YA 5JPDA 1PTJC 3ILXA 2CW5A 4KPGA 3WL3A 3FZEA 5F2EA 3ND6A 2XUIA 1V47A 4OSOA 1NQOA 4U63A 2TYSB 1KO4A 3DL0A 3QNWA 1X42A 1JEYA 2ZR9A 3JVUA 3AHHA 4XKVA 4IDQA 3S28A 2V6MA 1PWXA 3KPYA 4OQDA 2F64A 4MLCA 4HQFA 3CMMA 2WINI 2YV1A 4RE5A 4XW2A 3WGIA 5KDLA 4DV3B 2JCGA 2QS9A 3FVTA 1GUZA 1S96A 3BB1A 3RT9A 4ONEA 1KEPA 1M6VA 3EGXB 1I7DA 2ZSIA 3C6QA 4I1IA 3TTVA 1MB4A 3A1CA 3RC7A 1NVXQ 3HM2A 4OB8A 1EJBA 4WEQA 3M9LA 3NBAA 1V7PC 3KCNA 1G9XA 1LI7A 4XLLA 2ZQ5A 3R3YA 4DMLA 4YJ2A 3T5PA 2FHSA 2WC1A 4ZI7A 3D7RA 2G63A 1DPGA 1HZJA 1PEDA 3ZE6A 2WU4A 3VMFA 1AHIA 2C3MA 4UEWA 1KNXA 3KYIB 4EG6A 1O0BA 4Q3OA 2YXLA 3WGTA 4C04A 4G5OA 1TGVA 3Q7TA 5IVKA 1VIDA 3MUNA 1KK1A 4NENB 1TYEB 3JQ7B 4MVJM 2WPDD 3F7MA 5H1YA 5J5VA 3UG7A 4A5SA 1F9EA 3U2QA 4OQFA 5BP7A 5IRCD 4O59O 5ALRA 2PUDA 2VTEA 3B12A 4D81A 4QUGA 3HCAA 6PFKA 2W2LA 3KVNA 4ZAYA 3RIXA 1QHHB 1Z0IA 2XYQA 1FFCA 4B84A 4LW8A 4EELA 3G6KA 1ECLA 2WWVD 4HQRA 4UE6A 4HH0A 2GK7A 4MS4A 4M7WA 1WCIB 1K06A 4IIJF 1A2OA 2GPNA 2E7ZA 3TEMA 1QZUA 5T8KA 4JB0A 2VO1A 4ICIA 4MQEB 1CE8B 4ZGGA 3PC6A 4I4TB 5BSVA 4HATA 1X7GA 2ZSDA 1GTG1 3DE1X 1RQXA 1AHNA 4YJGA 3HN6A 2O8DA 2CC2A 3BGVA 3COYA 3GOQA 4QXOA 4TWZA 1HPLA 2FFJA 1HLGA 2W6NA 3AF3A 3H9UA 3UJBA 1UAAA 7MHTA 1KYIA 3NXKA 2D3NA 2G8NA 4LDPA 4X06A 1NPDA 1SK9A 1Y7LA 1R8JA 4RPDA 2IW1A 3FYSA 1XMSA 5AKJA 3RVRA 3RSGA 3W4IA 1H66A 1UBRS 2EWWA 4X05A 2IPAB 3DFKA 2CXUA 5EESA 2DE0X 4QJ4A 3U3OA 5F4OA 1Y33E 2G40A 3FCYA 3PUZA 5CNIA 1EUCA 4KP7A 2BHLA 2C0PA 2LDBA 1NIPA 3AYXB 3CISA 3M9XA 3BQNB 1SKBA 4DC1A 5HZBA 1BC5A 1GZUA 5EJ8A 1KC8D 3NWEA 5IVPA 4D45A 1JAXA 5EMNA 1HQYE 2X1HA 1CNFA 5BSWA 2I76A 2YZMA 4I4TF 3UVEA 4X6YA 1TIKA 2ZTLA 1IUPA 2IYFA 4DC0A 3H17A 5J4KA 2PO5A 2AJBA 1ZOOA 2Y92A 3L8FA 4CKWA 3EMDA 1Q7YD 2Y77A 4JNCA 3AVWA 3QUTA 3IPLA 1WP9A 2QV0A 3JAMA 1J49A 3RANA 3KLNA 3BRQA 1HY3A 2QTNA 4JC5A 4B2LA 4OYRA 1EVJA 1H05A 1T3HA 3QUCA 5FRDA 2CYAA 2WMYA 3EZ7A 2C42A 3I6MA 1NN1A 3F1KA 4PU0A 4BUJA 3EPLA 3K0SA 2AN3A 1UZLA 3O0DA 4OFZA 3ZCPA 2M1ZA 4W9MC 2WT9A 2B98A 2J30A 2Z3WA 3ORQA 4HB4A 3UH1A 4ATNA 2W0MA 1NC3A 2H1WA 3EXG1 2YWEA 2H8GA 4FFBA 4EUHA 1K97A 4US2R 3IR6A 2Q99A 1U81A 3UZUA 2CJPA 4B2PA 1DWQA 2NVUB 2B25A 2VXYA 4RESA 1J9ZA 4WKPA 5DX1A 5F1KA 1QH1A 1KY4A 3ZOZA 3HB5X 4BC1A 4HN4B 3KAPA 4P92A 4GI7A 4M88A 3V9PA 3WYCA 1ZGGA 4EY4A 4WQMA 1ZU4A 4JXKA 1FPMA 5B58T 3BREA 3G8AA 3WGNA 3E2IA 4O5AA 3LCUA 3L1HA 4S1NA 4MDEA 3ZWYA 5F2KA 1EZ1A 4PLVA 2JIQA 4ZZ2A 1UR5A 4L9RA 4ZO9A 4E4RA 3SC2A 4RJJA 3ZGVA 1IB0A 5CGZA 2I80A 2Y2UA 2NZYA 4LKOA 3S68A 1RI2A 3QTLA 4X64B 5DNAA 3ZHOA 1QF6A 1N6KA 4NCHA 1MC5A 3JATB 3D2AA 4RY9A 1BE8A 2QRVB 4HPJB 3D7NA 3N07A 2IOFK 3Q6MA 4BMVA 4B6OA 1GITA 3EG9A 1T5EA 3AL2A 1P7CA 3HB9A 3UN1A 4WY8A 2GASA 3O6VA 5JV5A 3KHSA 3U44B 3OKCA 1JQAA 4DRXB 1WF3A 5EP1A 1E60A 2EX4A 3LWDA 3TBHA 2Z8YM 7ADHA 1KH1A 1R3DA 4IV0A 3CNOA 1CCWA 2FQWA 4R69A 1Z28A 1OFUA 3DBVO 4AROA 1S2GA 5CA0A 4AJHA 2PV0A 2QUZA 1CRWG 1U8UA 2ZB8A 1KARA 4FQ8A 1E3WA 3EOZA 4AF6A 3ONFA 4RQUA 1UJBA 3A06A 4LOJA 5AW2A 3RVDA 4KN9S 3RDPA 2WT8A 3WMGA 3LIIA 2YVKA 4A6EA 2IUYA 2GD0A 4JLAA 4E30A 4F84A 4G4GA 3NYIA 3GZ4A 3C2QA 3OOSA 3P5BA 2A1IA 2QHXA 1KYVA 1MF7A 1SXHA 3W6ZA 1UOOA 3NNNA 1TM1E 4GPAA 3KR2A 5H02A 3NC4A 3NV7A 5EGNA 1PJ6A 1RLMA 5CDUA 1ENZA 3JQGB 2JLVA 2WJJA 4A0FA 4TKZA 2Z5GA 2YC2C 1J33A 1OYOA 1PLLA 2YHAA 3QJGA 3I2FA 1ZU5A 4QYTA 4U8GA 1JR6A 3L49A 2P9YA 2VTVA 2O57A 3LBNA 4A1OA 3L41A 5TARA 1UDCA 2IRWA 5TMPA 1VECA 1XPOA 1TA0A 4U6SA 4CL0A 4EFMA 4KSCA 3COSA 2QQFA 5JJ5A 3QUAA 4RLHA 1MRNA 3KFVA 3O31A 3IBSA 4M9CA 5ITWA 1DIBA 3H87A 3LXXA 1WRBA 4XGNA 4CGZA 1D1NA 1ZW1A 4LRQA 2CD9A 2P1DA 1CJKC 3CTAA 4FC7A 1TMKA 5HTOA 3THXB 5A02A 4IFIA 3J81A 3ZLVA 2H2FA 1TVMA 2PKCA 3QXHA 2MSDB 3E61A 3ZDFA 4PN7A 1OFHA 2YHIA 5LR6A 2VBSA 4RTKA 4R9SA 4CMAA 4GFDA 2QJWA 2XF8A 1TZCA 2Q07A 3QFFA 1N6RA 2K7FA 2JKYA 2UVPA 2VEOA 4TS9A 2IXAA 2BD0A 4D43A 3ZE0B 3PZRA 3EVAA 2YMPA 1D2HA 2HREA 2QGFA 4U2GA 2PL5A 2CDBA 5JNWA 4HDOB 2CL5A 3BRWA 3FPFA 4QOEA 2UAGA 1W29A 5A89A 1M7BA 4K1LA 4OGFA 2ZTVA 2H1HA 1ZH8A 2KI5A 5H16A 4ZYLA 3L7LA 1I2BA 3H5VA 5DYWA 3KSZO 3NHWA 1KXJA 1ZQ9A 1Y8QA 3PJRA 2GSWA 2LV8A 1L5SA 4DBZA 5HIKA 4B73A 4RFSB 3D64A 1QVWA 2BVNA 3V9AA 1SD5A 1O89A 4QLAA 3DV0B 4II2A 1V5EA 1ECBA 1LTQA 4GOLD 3LWZA 4RY2A 4IDAA 3OTIA 1Q7TA 3FX2A 4HEA6 3TZCA 1J6UA 2C96A 3TE7A 1DTEA 4KI7A 1J2EA 1CZRA 2OAGA 3C4VA 3EHDA 2AFIE 2FQQA 3LUHA 5CHEA 2AN4A 2DT8A 2ZR8A 4LDJA 2XJ4A 2Q1SA 5AUPB 2I7TA 3NW9A 3A2LA 1R6BX 3CLSD 4YWJA 1DUIA 2ZQYA 3CPWB 3KYJB 1T5LA 3MB8A 4EKNB 2EOAA 4OY3A 4I50A 3RAFC 4RW0A 1T2DA 5A6SB 2BUBA 4YMIA 5HA5A 5A3JA 4LNUA 4WNYA 2EC5A 3O93A 1N5DA 4FCTA 4F2GA 1GPKA 3IPCA 1MAAA 3KJQA 4D2IA 2VRCD 3U4QB 3IXLA 3BIXA 4AYXA 1WABA 5KTOA 2I6XA 2WWTA 5JS2A 4BLSA 2GYWA 1ZD3A 1GDHA 1Z62A 1E66A 1OV4A 1R0XA 3QKSA 2IH4A 2BCJQ 1KOGA 3QK7A 4NS4A 2XVZA 3CTMA 3DZDA 2FY8A 3THSA 3AJEA 2BBOA 1GQFA 2X5OA 1GUYA 1TNDA 4UU1A 4UOQA 5C81A 2JFNA 4YP9A 3FMIA 2P0EA 2HCJB 4MCHA 4D0LB 5B6JA 5JH7A 1ABFA 3PXAA 2CL0X 4MQ6A 1IEVA 2HXSA 1SUIA 4C6SA 2FETA 2FEMA 1KO5A 2AT1A 1UBKS 1ILWA 5HMMA 5KQPA 1XJ5A 2HF9A 3WNZA 4KVAA 1XT6A 5IW8A 3K8OE 5JSKA 1DHTA 4QOSA 3RODA 2YIMA 1L7RA 1XU7A 2PMCA 4GW3A 1GVHA 2G9ZA 4U9IS 3HCRA 3WLSA 3ZI0A 1JBKA 2PNJA 4C05A 1IN6A 1QG4A 2HHHB 1OXXK 2R2AA 1ESEA 4L02A 5LA6B 4KNYA 4XLZA 4MLPA 1UJ5A 5HWSA 1C8KA 3OFVA 3WA7A 3D26A 2WLTA 4KDEA 1UBEA 1WCYA 2MCFA 3A8KA 2VBTA 1N2SA 1OU4A 3LW8A 3GIRA 3S1AB 1QPBA 2PM8A 4TGLA 4HDRB 2AFIA 3T5GA 4L2IB 1G8KA 4PZAA 1FYWA 3UB2A 4A10A 4AMBA 4XH9B 2Q21A 3VAAA 4IH9A 2ZXIA 3R44A 3RNOA 1Z74A 1AJEA 1H9CA 2X8WA 3DWFA 2PS0A 3F74A 4CKZA 2V5VA 4JKYA 3RRZA 4LOHA 2I03A 3H0CA 5I7WA 1ZM3A 2GZAA 1U2DA 4IG9A 3DBRB 4HDSB 2JAXA 2RG7A 4MYUA 3DV0A 1QE3A 5EXXA 2ZB7A 4GMFA 5KOYA 2BFOA 2V7XA 1SJ9A 2ECKA 2ID4A 5JCOA 4CKYA 1U63A 4I99A 3I5MA 1W35A 3COWA 3D8SA 4ZODA 2XY4A 5LXTA 1RT9A 4BO1A 3HJBA 2BMJA 2CYBA 3PP8A 1FU8A 2R86A 4H7EA 3ADDA 4I9UA 2N3ZA 2ZRPA 3H2GA 4YONB 4W5OA 4TLAA 1C9EA 1H8EA 4E2WA 5CXSA 2JFOA 2GFIA 3F0TA 3FNGA 4ZU1X 3TWOA 4R2MA 1KK3A 5SZIA 2EJVA 4NPAA 4LFBB 3W1EA 4CQJA 4BZWA 4Q9NA 2YZ2A 2GM9A 3KJZA 1IXZA 4AZWA 2EFCB 2VBCA 1A8QA 1S4QA 1R37A 3S2FA 5E1DA 1U7XA 3AY3A 3UJ9A 1RAGA 1U2DC 4X8IA 4N18A 1YUNA 2MJLA 3DFZA 4MW2A 4P84A 4FXPA 4KXUA 1RM4A 5EINA 2F55A 3KV3O 2A58A 3B1XA 3ZKAA 3EGVA 5C8YF 3AWIA 2O3QA 1F4VA 2O20A 3MJHA 3B53X 1D4ZA 1AZLA 1SUAA 3ASVA 1PBNA 3QELA 1NUHA 2X14A 5DISB 5M5BA 2C2BA 4WV3A 2LRHA 3GRYA 4X8OA 4ZDKA 4E5PA 2PWAA 3V1KA 2Y99A 3D0OA 5ER9A 2CHGA 5IH7A 2BPOA 2QYHA 2QMQA 3GUZA 3PRKE 4UHBA 1XZFA 2HGSA 3NO4A 1L4NA 1T1RA 2XB6A 2GCGA 2VJAA 3Q5GA 5JSYA 2OV8A 4JB2A 4GG1A 5C8ZA 4N5LA 2QNRA 5BOVA 2G0TA 3KQTA 1P4RA 4KHZA 1QTNA 2ZJBA 3UUGA 4JYMA 2QWXA 2IVFA 4F7DA 3IS3A 3GLHB 2F4VB 4B87A 3MINA 4G0PA 1GTMA 3QMVA 1ONNA 2APJA 1T2NA 2VPTA 4LXTA 3DM5A 4Q18A 4UOZA 3UICA 5FTLA 5JCXA 4K6FA 4I5GA 3R3HA 2AFIB 1WXWA 2QQGA 4JVSB 4QUKA 4LOLA 4PO8A 3LSYA 2I0FA 4XKWA 2V5AA 2I8AA 1NB9A 3D6HA 2WHRA 1DC7A 4IFTA 1JIUA 5EZ6B 5JSQA 1OWOA 2BEUB 2BHNA 3GFOA 2E6KA 4I55A 1QYWA 5K6AA 3KB2A 3I2HA 3PGA1 1KJNA 4RHUA 4FT2A 3HJUA 5FWXB 1G2QA 4KYVA 4RFVA 4MWOA 2X6YA 2F59A 4NE9A 1NYTA 4G26A 1SU4A 3HRHA 4C7VA 2ZATA 4TTSA 3CSDA 4HN2A 1L5VA 3AVQA 2A9OA 1YIJB 3EC1A 2NV6A 3E1SA 4IP0A 2ORVA 4QATA 1J1UA 3A31A 4IXWA 4U7DA 1L9XA 4F9GA 3MILA 1EVIA 3W34A 4CBVA 1M0SA 1Q9SA 5C37A 5CFPA 5SV2A 3ZI4A 2OD9A 1NMEA 4LF6B 1VFPA 1ACLA 2FN7A