1G7CA

Yeast eef1a:eef1ba in complex with gdpnp
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
440
structure length
440
Chain Sequence
EKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of nucleotide exchange intermediates in the eEF1A-eEF1Balpha complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords ELONGATION FACTOR 1-ALPHA
total genus 130
structure length 440
sequence length 440
ec nomenclature
pdb deposition date 2000-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1g7cA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1g7cA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g7cA01
1AS0A 2J0VA 3NBXX 1FDRA 1U9IC 1YRBA 3CKLA 2ZI9A 1N5KA 1NG1A 3IGFA 3CZQA 3D6TB 2TMKA 4Q9IA 2ODEA 1E98A 4IVRA 4PPNA 3L0SA 2C96A 4C0AC 3W9YA 5TVKA 1QGAA 1N5IA 3GEEA 4QBHA 3W5VA 3GLIE 3RS7A 3NH6A 2A5DA 3WNBA 3CWZA 1NNEA 2J7PA 1G8HA 1Q1BA 5J40A 5FR1A 1XTKA 3SI7A 3PEWA 1Q1ZA 4Q1DA 2BKUA 1QHHA 4P3YA 4JKYA 1X8LA 4Q48A 5FTKA 3IILA 1KY3A 1NF3A 3EC2A 1LW7A 4QM6A 5F98A 5FPYA 2A3RA 2O8EA 2RC6A 4ZCIA 4EAQA 2ZYVX 2V9PA 2WWGA 2IYUA 4NZYA 3GLHA 1NLYA 5SZHB 1KO1A 2VBCA 3EASA 4I4LA 1QHYA 2F6RA 1ZNWA 4BFYA 1OHHD 1RE0A 4CZ2A 4JL5A 5KSWB 2G1JA 2YJTD 4P33A 1N6IA 4MH0R 3RRZA 3SS8A 2GESA 2ZS9A 3DKVA 4F92B 5DI3B 4JZKA 2JJ8A 4TMTA 1E9AA 2PX0A 4LPSA 4OKSA 4U02A 3PG5A 3UXMA 2QP3A 4LBWA 2PZGA 3FHOA 4M21A 3U44A 3K0FB 4HAXA 2GJ9A 1N0VC 2A2ZA 3U61B 3OAAA 3GJ8A 2QQEA 4ESHA 1MO3A 1ZD9A 3DM9B 1E2LA 2ZI7A 1B23P 4HLUC 4B2IA 5FPSA 2QBYB 1VQPB 1CF4A 1N8RD 4LGMA 1E1QA 3V4RA 2CDNA 1JXOA 4IEIA 1R7RA 3WP0A 1XX6A 5DHFA 3MRSA 3RSLA 2H16A 2FWRA 1ZM4A 3TK1A 4TLCA 4BPBA 3QE0A 2H57A 3KFXA 3U6BA 3T5GA 5AJVB 1S1CA 3VHLB 5L3QA 1IN4A 1HTWA 5EP2A 4KSBA 1JJ7A 4EJSC 2YVUA 2J0SA 2J0UB 3LQRA 1GP2A 4EQ6A 2VTKA 3QENA 3THYA 2QU8A 1RRGA 3VQTA 4EPXA 2C9CA 1PVOA 4WQMA 1OGIA 2D2FA 4PO9A 1R4AA 2YOGA 3TH5A 2QPAA 5JJKA 3CPWB 3WBKA 2FSGA 2ZRLA 1F2TB 2GTPA 2ZRJA 1S4QA 4LBVA 3KKNA 3S1AA 1QDEA 1R5NA 4HDOB 1FRQA 5KPDA 1W2GA 1U9IA 3PITA 4XJXA 1XF9A 1MOZA 4N0EA 4ZDJA 2SHKA 4ACAA 1UADA 2MMGA 2QMUA 1KDRA 2OSBA 3LH5A 4BEJA 1OXTA 2QEQA 1JQLB 3THXB 1DARA 3LXRA 3OZWA 5DISB 1DO2A 1Z83A 5JS7A 4TYYA 3WMGA 3P27A 1AKEA 4OBEA 1IBRA 4FIDA 2VL7A 2OILA 4FINA 3OE7D 2FJUA 3K9LA 4BLPA 1ZBDA 5JSZB 1A8PA 1JB9A 4UXJA 2PLRA 3OZXA 3SJBA 4HB0A 2EYQA 4FCTA 1YZNA 5IF9A 3W3AA 2Z83A 1EESA 5B64A 1XCPA 2QN6A 4PAQA 2WPDA 2IA5A 4B73A 5KSOA 2BOVA 2XGJA 2QL6A 3T34A 3CC7B 4UNSA 1E1QD 1KO5A 2O5VA 5FPHA 1GG2A 1MRNA 4YXWD 5LB2A 3E70C 5BQ5A 4HI0E 3LO5A 1W36B 1GILA 2GA8A 1G9XA 2ONJA 1NSFA 5K8IA 3PEUA 4PZZA 3ADKA 1LY1A 2G6BA 3DDCA 3ZVRA 3MCAA 3WHLA 4DLXA 3BFKA 3HYTA 1BH2A 2P6UA 2V7QA 2DCUA 1W44A 2X8AA 3DKPA 3QKRA 4DCSA 3VO2A 3VX3A 2QROA 5KNDA 3W6PA 1NIJA 3GEIA 2Q3MA 3CRW1 1IY1A 4US0R 5J4KA 2YWHA 4LYJA 4WW0A 4XD7D 1G7RA 4LHZA 5E4FA 3VO1A 4JL6A 2V8OA 4Q4JB 2FGJA 2FDCA 1AGRA 4Z8YA 1C1YA 2WBLC 5CB6A 3QXJA 4QM7A 1HY3A 4AYWA 2DB3A 3GJ7A 1RRPA 4CT5A 1LTQA 2KE5A 1M7GA 2FE4A 2R6HA 3T5DA 5L3SB 5EE1A 4B3DA 2EFEB 4XVUA 1ZC3A 4I99A 4WXRA 2X3UA 1SKYB 5GJVC 4Y7CA 1OXSC 1XMVA 2NO9A 3AKEA 3IBGA 4MKHA 4QNRA 4TSFD 4YMSA 4EJSB 4A2WA 5BN5A 1ZNYA 1E9DA 4JVMA 2WWYA 2ERXA 4KV9A 1V43A 1WBDA 1F5NA 1E9EA 1FTNA 1P2UA 2F43A 2IEZA 3W2EA 4NDZA 4ZIRA 3FOZA 2W00A 5F2EA 1EK0A 5CYPA 1WE2A 1XD2A 1MR3F 1Q57A 2GCOB 1VCOA 4L5BA 4TLDA 4DEYA 3L0IB 4B6FA 2ZE8A 2R65A 3BAFA 4KU4A 2YOFA 1AN0A 3N2IA 4ESVA 3OIWA 2BBWA 2RAPA 4C3ZA 5CYOA 1KKMA 3SJCA 4M2LA 4DDVA 1D6JA 1J8MF 1HH4A 3H0KA 3BGWA 2WWWA 1FNBA 3I4LA 2V7QD 3AVPA 2ASEA 4GMXA 4GOXA 5EXSA 3T06B 1XXHB 3K53A 3P4XA 1KRHA 5JI3E 3Q7QA 1ZD1A 2ZETA 4B44A 5HCIA 2GEUA 4XD7A 2JJ2A 2L0XA 4YMVA 3U3OA 1VQ8B 1I4TD 3X1DA 2YINC 1T3HA 4XWAA 2YV5A 5D3QA 4PAMA 3WY9A 1FQKA 3B85A 2PX3A 2WMNB 2IS2A 4FMBB 2R44A 2DPXA 3BD9A 4JVSB 5FOTA 1PUIA 3T61A 3UMFA 1FOEB 3ZS9A 3PEYA 1XTRA 3QKUA 1E96A 2ATXA 3AF3A 4Y9UA 1Z6GA 2OAP1 1V5WA 4MGYR 2XTZA 2IYLD 2BN4A 1NMXA 1G4AE 4JKIA 2VP0A 5DSZA 2QEXB 2OTLB 4YAOA 1A7JA 4XSGA 4HAVA 4HUQA 3I92A 4FK8A 1G5TA 2JJ1A 2I1VB 1XZQA 3ZZ0A 1OW3B 2BJVA 2P67A 4GT1A 4H1UA 5D3MB 1Z06A 5G3YA 3SFZA 1KJZA 3LY5A 3B78A 4E5UA 2FG5A 1IM2A 4QGHA 2CEAA 4PZLA 4NKRA 5DGXA 2WJJA 1LVGA 3A4NA 4OK6A 1FW6A 2XJ4A 3CR7A 2CE2X 1T0JB 5F9HA 4DLWA 2R62A 4TYPA 4C0QC 1P7CA 2YC4C 3IQXA 4A8JA 5L3SA 3PUXA 2EVWX 2BJWA 3K70B 1F6BA 3WYGA 1PLLA 1KNQA 1NMZA 1JPNA 2XTNA 1PV4A 4AWXA 2QTVB 4LJ7A 4PSKA 2WIBA 1ZIPA 5JI2E 2JLZA 3LD9A 1VHLA 1GJRA 1P4SA 4LYHA 2JJ2D 3RWOA 2Y8EA 1E94E 2R9VA 1DAFA 3PR1A 4JJKA 1RJ9B 1EWRA 3CCMB 4IDQA 4V0MA 5HZHA 4CEIB 1FL9A 2HXSA 3ZVNA 5DLQC 3PIRA 4R2HA 1AM4D 3Q5EA 3X1ZA 1W36D 2OLJA 2CLCX 2IYRA 2G77B 2VP4A 2HF8A 4A1FA 1II9A 4YLGA 4CW7A 3X1YA 2R6AA 2OESA 4KODA 2QTLA 2REBA 2QTZA 1D9XA 5HCNA 3U4QA 3QPUA 2FPKA 1E2MA 3CH4B 4NCHA 1K73D 4RZUA 5LBIA 3FWYA 1JJ2B 4IOMA 1BMFA 3DPUA 2ZRCA 1GAJA 1EFCA 2GJSA 4QRHA 3TUIC 4JL8A 3W8NA 2QM7A 4ZPXA 5TARA 2JLQA 4D26A 3P1JA 3GLHE 1KIMA 3CMEB 2A5JA 1NI3A 1G6HA 2GK6A 2ZXUA 2W83A 4MITA 4YXWA 5KO2A 4CIDA 5JECA 3CNLA 4OL0A 1E9SA 4QXAA 5KU1A 4HAWA 4Q4HB 4ABYA 4FN5A 1PUJA 1ZVQA 2QUZA 2FSFA 5F9FA 2N46A 1KKLA 4KFRA 1EWYA 2ZSFA 3QNUA 4PX9A 4Q4LA 1JA1A 4ZI2A 2GXSA 2YHSA 5BYKA 1W35A 1NN1A 2AKAB 1AA9A 1DAHA 4RSGA 3VKWA 4B3BA 3MHPA 4NMMA 4Q9LA 2XZLA 2GNOA 4FMDB 3RS4A 4QKQA 2AK3A 3ZVLA 3AVUA 3ZIAD 4CT4B 1T3SA 2NOAA 1JB1A 1Z0JA 821PA 1IB0A 1J7KA 3E20A 2KI5A 1FMLA 4L4UA 3ZLJA 2O52A 1I7PA 1F20A 2OCYC 1RYHA 1W0JA 4GFDA 3RLFA 4B3FX 2GHIA 4IEEA 2XOKD 1L4UA 1ESMA 2JASA 3TQCA 3L43A 2XSZD 5FOSA 3TSOA 5HKKD 4HATA 3IQWA 521PA 3BFVA 3W6OA 5TMPA 2OEPA 2EFGA 4HE5A 2AFIE 2PZFA 4JLVA 2ZEJA 3WRXC 4O2LA 4KVGA 4M53A 2P3SA 3IHWA 4PTLA 1TQ2A 2OFOA 3CCEB 3ASZA 3ZH9B 3C5CA 3EPLA 1EFRD 1YR8A 3ZJYA 1VIYA 1K5GA 4HAYA 3CCRB 3C5HA 5FFMA 4MKIA 4CEIA 1Z2CA 5GJCA 5SZIA 4PFSA 1KI2A 4JBWA 1IXZA 1QUEA 3A6PC 2GCPA 4Q1FA 4A9AA 4D4MA 3OJXA 1Z8FA 2D62A 1BX1A 1X86B 5KTYA 2C2HA 4MYUA 3EA5A 2QPOA 1PLKA 3KUDA 3VNVA 4NCKA 3AVYA 1UBFA 3THOA 2PL3A 2A9KA 4I1VA 2WICA 4ZGNB 4Z54A 4YALA 3AP1A 3O8BA 2D2EA 1MABA 3UWKA 4C0SA 3UWOA 1FUKA 2QQ0A 3EZ9A 4M1TA 2ZITA 4HYYA 4LC1A 3W2GA 5FOXA 3VMFA 1E79D 3OFND 1ZNXA 4RFSB 1G8GA 1F2UA 1JJVA 3NKVA 1P9RA 3ZQ6A 4NCNA 2GVDC 3H4MA 1UBEA 3FHTA 2C9YA 3OZVA 4C4PA 1ZUHA 2VEDA 1Z22A 4S2EA 1II8B 2CVFA 1CR1A 4N1AA 4Q03A 4URZR 3IPYA 2F1JA 2F1IA 4M22A 5CM9C 1U8AA 2Z43A 1XZPA 5DI3A 3K9HA 4AI6A 5G53C 4NYMQ 5IDVA 1CJKC 2BCGY 4GOKA 4C9BA 4GMDA 3G82C 2P0EA 1Y63A 1G18A 1QVAA 3GJ4A 1RRFA 4B4DA 3PCRB 1HT1E 1KO4A 3B7GA 4A8JC 3I72A 3BXZA 1W34A 3CCSB 1RZ3A 1NL3A 4UXIA 5H70A 5J4VA 4MYHA 2CJWB 1G1MA 4MDFA 5C1BA 4P4UA 5FR2A 1QG0A 4RD2A 1YJ9B 4PC7A 3KJHA 4LHWA 3SZRA 2F7SA 4UQOA 4N3NA 5H59A 4AYXA 1OLOA 4QGFA 3TW8B 2NPIA 1KOFA 1W5TA 4NYJQ 4GNKA 2QPTA 2X2EA 4LYFA 3IDQA 3ZBTA 4RZ2A 1OH6A 1Q81D 3UMRA 4MQBA 2O8BA 1XE1A 2PBRA 4LI0A 3T1TA 5JLJA 4TQ9A 2HT1A 1SVKA 1TEXA 4MGZR 4V02A 2HJGA 2VYQA 5H68A 4ZDKA 2VP6A 1H8HA 1KC8D 2PCLA 1YZKA 2GXUA 3UMSA 4PHFA 4DUGD 3O8RA 3TUZC 3KDSE 1QHHB 1DPFA 5HXBA 4V0OA 1IN8A 1DG1G 1CIPA 5LD2C 1WB9A 4NH0A 5JWOA 2FA9A 3K0AA 5JMTA 3FPKA 3MFYA 1MH1A 3BRWD 1VYTA 3P20A 1R8SA 3MWYW 3QE2A 4W7SA 5FBLB 3GQBA 1OV4A 4TZ6A 2B8WA 4LDJA 3ICQB 4EFNA 1J9ZA 1XNJA 3N70A 3N5CA 1MT0A 1K6MA 4TQAA 2W6ID 4LJYA 3U7FB 2CRVA 5EUMA 5EMNA 1NMYA 1KZGB 4HLDA 1KQSB 1QVRA 3R8CA 4EFLA 2FPMA 1GITA 5TXGA 2GJKA 2CNWA 3DZDA 2ONKA 1NLZA 3CB4A 2VP2A 3THWB 2PT5A 2D06A 3MWKA 3P32A 1XRJA 3AVVA 1WP9A 2XB2A 1XFAA 1ZM7A 1JAIA 2BDTA 2QP9X 1DS6A 1JR3A 1G7SA 3KKOA 1OB5A 2C95A 4BECA 1OXVA 3BB4A 3WMFA 1KSFX 3NHBA 4KFUA 1IJFA 4NL4H 5FTJA 3PUVA 5BYJA 4P0TA 4DSUA 4XSHA 2FGKA 4B47A 3B1YA 2J45A 4D0NA 1OYWA 3FKSD 3B13B 1UAAA 3CPHA 2H17A 4WZAE 1N0UA 3ZD7A 4C7OA 2C04A 1WQ1R 2IYVA 5JWRA 1QG4A 4IJMA 2GEVA 4HLQB 1N25A 5C18A 2X19A 4EPYA 2QGZA 3Q8XB 1VQ5B 1EFRA 4TLEA 5GVSA 1BJKA 3I8XA 1JAHA 2DETA 1P60A 4JIMA 2IWRA 1N6PA 2ERYA 2G83A 5EP3A 3FJOA 1UEIA 1TQ6A 1QUFA 3AUYA 4V0ME 3SYLA 1GL7A 1IN5A 1CRQA 1CXZA 2VP9A 1II0A 1UKZA 1NKTA 2ZR7A 3THXA 1COWA 5EQTA 1X6VA 1NN3A 2ZJOA 3LNCA 2FZLA 1OB2A 2ZRAA 1QHIA 3KTAA 1EXMA 1BYIA 4LHYA 2OE2A 3IHLA 2CHVA 3IO3A 4HB3A 5CB8A 1ZJ6A 3SOPA 1R5OA 2ZJZA 1RC8A 3OEHD 1KNXA 2QENA 1YKSA 4BE7B 3GLIB 2ZVQX 1MV5A 3BIFA 3EPHA 4BPRA 4I81A 1GZSA 4EPWA 4Z1MA 3HWSA 4MYTA 1KO8A 1M6NA 2GJAA 1HUQA 1XXHE 2OO7A 1G3UA 3W3ZB 1H85A 1E4YA 2D3WA 2IWHA 3WYAA 4DLRA 4KJZA 3ZYCA 4MDEA 1NRJB 2BV3A 2WAXA 3QBTA 3R7WB 1S9DA 3U3RA 4DLTA 2WSMA 2VO1A 5EE3A 2QI9C 2IUUA 4OQXA 4Q9HA 4RCZA 1GNRA 1H8EA 1SVOA 4DCTA 1VQLB 1XEXB 2OXRA 2QTHA 4N3GA 4ACBA 4PANA 1KI1A 2ODNA 1SXJE 1S96A 4TLAA 5EZ5A 2Z4SA 3NVAA 3OAAD 2VA8A 3KJIA 2RGNC 3RS5A 3SHFA 4BLRA 4TT3A 3QSYA 2XXAB 4XTRA 1IN6A 2H1LA 2JLVA 3R9IA 2AKYA 3TVTA 3QVVA 3EZ7A 3R9WA 4FD2A 1N2CE 2D7CA 4QGAA 1CULC 1KZ7B 2VHCA 4O25A 4G5QA 3B2EA 1QBKC 4Q5IA 1J2JA 1PZNA 4EPVA 3BH0A 3DOFA 3JQQA 4NYMR 4C7OB 5THXA 2GXQA 3VHXA 4L9SA 2HDNB 4GBMA 1R0ZA 2YYZA 4P32A 3C41J 5IT5A 3EAQA 1YR9A 3DMNA 2WWFA 2QGNA 4FCWA 4Z1MD 1E64A 3AVQA 3KQLA 2ZSBA 1P5ZB 4IFBA 4NU0A 4NBSA 1E2QA 1N5JA 1YHNA 4GP7A 3QXSA 4Q47A 2W2TA 3CRVA 3SBEA 2DERA 3VR3A 1Z28A 3CPJB 1YIJB 5JHGB 2QMEA 1N6RA 2WHXA 2IHYA 1P61B 1S3GA 4PO1A 2WWHA 3V9PA 1A2BA 3LX5A 3ZDQA 5DYGA 4EUNA 4CEJA 4PR0A 3EPKA 2WIAA 4FMDF 1H8ED 3LXXA 1UFQA 2ZRIA 4Q00A 4QBGB 2NPFA 1NJFA 1CNFA 4IDOA 5P21A 1KMHA 4I1OA 3K09C 3SE0A 3GLFB 1SGWA 4EFMA 1A4RA 2RGAA 4RFSA 3SJAA 3MSXA 3QKSB 2OT3B 1Q3TA 1S1MA 2JLXA 4GL2A 1F3OA 1XD9A 1ELOA 2HYDA 1TAGA 4P4SB 1AQUA 5JBQA 1BX0A 1X8KA 1VQKB 4QNMA 4D4JA 1RKBA 1T8TA 1U8ZA 2BEJA 4N0DA 1YZGA 4A0HA 3Q3JB 4TMZA 2ZJAA 4B2PA 4CVNA 1PLJA 1P73A 5DN6D 4JSYA 2RKOA 2A5GA 1IN7A 4HAZA 2FX3A 1J8YF 2VP5A 3L0PA 5EZ6B 1ESNA 2WM9B 1GNPA 3QIAA 1JQJC 2O8FA 2FSIA 4NYIR 2AXNA 4BASA 1AK2A 3SN6A 1DDIA 3OFNA 3GJ6A 1RRCA 2QBYA 1Z3IX 2W0MA 4XWOA 4U9UA 1BOFA 2W2XA 2V4ZA 2V3CC 3V4FA 3ZS8A 4IXNA 5LB4A 4DZZA 3AM1A 4IOJA 4D4KA 3TMKA 3I1FA 1Y3AA 2R6FA 2GBLA 1SHZA 4YONB 5JWHA 1Q3HA 1W2BB 2NO7A 1U0JA 1XCMA 3CCVB 2IUSA 2ZU6A 3JQRA 2E1RA 4B71A 4QFMA 1G8YA 4EH1A 4C0JA 4DEXA 3KXLA 1GFIA 4ZKEA 3RHFA 2VF7A 3CCLB 1EWQA 4NTZA 4FMCF 2G9NA 4EJSA 2ZRKA 1TU3A 3EC1A 1VYVA 3P26A 2Q3FA 2F43B 4Q7LA 3FFBA 1L7VC 2OM2A 2J46A 2QT0A 4C2TA 2RHMA 4M9SA 1OJLA 5KDDA 2J3EA 2GCNA 4PO8A 2CCJA 2OBLA 4JYBA 4DCUA 2ATVA 2YWGA 1G291 1YITB 2H8KA 4Q1AA 1Z6YA 5H5JA 1ZU4A 2J9RA 5DNYB 2AXPA 2HF9A 3K0EA 4F38A 2QSZA 4JLMA 2RC5A 1T9HA 1ZW6A 2QAGA 3FMOB 1IY2A 3K0AB 3L2OB 4WOPA 2C8VA 1BO6A 4IXMA 1RFLA 1T0HB 3CRQA 3EZ6A 5JEDA 4R98A 2ZRNA 3HJNA 3KKPA 5G3ZA 2O8DB 1VIAA 2O0JA 3AVOA 4HSEA 2MSEB 5B58C 3MUFA 3QKSA 1IQPA 3EA0A 4NONA 5E7IA 1LF0A 4DLSA 2FFHA 1UDWA 3B82A 1WBBA 2R6GA 1GVHA 1LF5A 1OIVA 3IO5A 3M4YA 3NBZC 3QY0A 1G3RA 4B35A 2PJRA 4WIAA 1FZQA 4JVNA 1ZM3A 1E2IA 1I4DD 1MRSA 1N0WA 1JI0A 1YE8A 3DMDA 2QZ4A 2ZJYA 4A2QA 4XIGS 2ZROA 2GJ8A 1M90D 2DWQA 2ZAOA 4QBFA 3V00A 1EFUA 1QVFB 4RKEA 4XWKA 4IDHA 1UM8A 3NEJA 3U44B 1JR3E 2GQFA 2EFCB 3FVQA 4TT3D 5FTLA 4LCBA 3FHCB 4Q4JA 1DE0A 3JVVA 3LW8A 1Q22A 2C99A 4H1VA 5FL7A 4OHVA 1NN0A 3CF2A 3WYFA 1G3QA 1YVDA 2EYUA 3PV0A 3QKRB 5C4MA 2GXAA 3CCJB 2BM1A 4X8OA 1KI6A 4LJ9A 1W7AA 1YZLA 4A8JB 4OJQA 3LVRE 5FPTA 2H92A 5IK2D 3VAAA 3AVXA 4KBFA 4MRSA 2IYSA 2AHOA 1X8JA 3W5IA 1JR3D 1Z08A 3ECCA 2EFHB 3CCQB 4TN1A 3EZFA 2LCFA 2AWOA 1K8AD 3OW2B 3ND9A 4QOSA 3R8FA 1NVVQ 5KNCA 1N6KA 2HLDD 5GJBA 2XB4A 3N2EA 4LBYA 4JLJA 3GEHA 3M6AA 1E0JA 2AR7A 2VRWA 1ZIOA 4O0MA 3SJZA 4KSCA 3KTAB 1W4BA 4YMWA 3H84A 2D7DA 3R20A 4II7A 5CK4A 5JFGA 3A8TA 2P6NA 1ZYUA 4HAUA 1VG1A 4ZCMA 4RVCA 3W5UA 4MA4A 3UG7A 3LAWA 1QGZA 2GF0A 2EFDB 3ADCA 4Q7JB 2BMWA 3T1QA 1U2RA 1MO6A 2XNDA 1WMSA 3GLHB 3MWJA 4NYIQ 1G7CA 4ASUA 3LLMA 3EW9A 5JCPA 3CWQA 1O3YA 2F3RA 421PA 1VQMB 2N42A 2DWPA 1E0KA 1FP7A 1TVCA 1AZTA 1GRNA 1XXHA 4I1UA 3SHWA 2YWFA 1XEXA 1TL7C 3KZ1E 2QRNA 5GJWC 5A4JA 3AKCA 1TQDA 4DKXA 3SDZA 4DQKA 2EQBA 4W5HA 4A36A 5IK2A 1ZMXA 2WTUA 1M1KD 3NWJA 1JEDA 1SXJA 4LJ8A 1KAOA 3EG5A 3OEHA 4UNNA 4AKIA 4LBZA 2VH5R 2IC5A 4QHSA 3TUJC 4B3CA 4ON9A 2O0KA 1TU4A 2X1VA 3QPWA 5CLLA 2PT7A 5C4GB 4Q66C 4TYQA 5JJLA 4E07A 2CK3D 4AG6A 5B2ZA 4QJ3A 2I1QA 2FEMA 3B60A 4LC0A 1G41A 4L15A 5FOWA 3QEOA 5GV8A 4GOJA 1YR7A 1QHGA 4M9QA 4M1OA 2IT1A 5BN4A 1IXRC 1B2RA 3HYRA 1OYYA 4KLZA 1KI6B 2ZUDA 1Z0IA 2LKCA 2ZIAA 4WVFA 4A15A 1QFJA 2X77A 3NG1A 4OI0A 1E2FA 4IOKA 4OHZA 3KB1A 2NTYC 1VCMA 2IXEA 3S1AB 4U7DA 3PJRA 4G1BA 5KDLA 3RABA 1J99A 1OT3A 3IBYA 2R6CA 2XTMA 3BB3A 4ASUD 3I61A 1GTVA 2CL6X 3X1XA 2IS6A 1KK0A 1W0JD 4D4LA 2AD1A 5CJ2A 2NO6A 4DDWA 3NBFA 2XAUA 4WBSA 3TAHA 4M9XA 4UXHA 3GJ3A 4W9MC 4URWR 5DO9A 4MGKR 2VHTA 3A1SA 2RH5A 1GM5A 4DLVA 1UBGA 1RJ9A 4Z51A 5L3RA 2ZSEA 4KLNA 1F48A 1HQCA 1CEEA 1XPRA 2HMAA 2KSQA 1VHTA 1P9NA 3JVUA 1Q1QA 4U00A 2GBLC 4Q4AA 4OI1A 1BKDR 3ETLA 4OYHA 1P62B 4G5SA 3CC4B 3QF7A 2RGXA 4LJ6A 4CEJB 2CL7X 4JS0A 1QH0A 2MSCB 4OI2A 3GFOA 4OHXA 3T35A 3ADBA 1VG8A 4X8LA 3ADDA 4YC7A 3BB1A 4UAJA 2V55B 1DAIA 3CUEF 4TZ0A 2ECKA 1S8FA 4BRUA 3CRZA 1XEWY 3OF5A 1JXMA 1ONBA 2E9SA 1W49A 3PUYA 4W5WA 2A5YB 4Q9KA 4YDSA 2CLDX 2O8FB 5KNBA 3OIUA 4AKHA 2ZJ5A 3QFRA 1NVVR 1W48A 3CX7A 5E7MA 3QEJA 4D81A 1D2MA 4GRAA 3FPAA 2WWIA 2WKQA 4PHGA 4U5XA 3LV8A 1CBUA 2Q0HA 3SC3A 1YR6A 3VR4A 3BE4A 3RDPA 5B57C 4A2PA 4DB2A 4QG7A 4DIEA 2HV8A 1E99A 1W36C 3T1OA 1A5TA 4YAUA 2BHRA 2HJVA 4C2UA 2D74A 2RGDA 5DH9A 5J47A 2PEYA 2JLUA 3CX8A 3K8YA 2HLDA 1CNEA 1GWNA 1XEWX 1E2EA 2ZU0C 4HE6A 1QZXA 1IOZA 2ZUBA 3A36A 1W5SA 1OFTA 4ARZA 3DHWC 3CC2B 3VFDA 1H8HD 4W5JA 2FFAA 3WP1B 4OQNA 1QHSA 2ZE7A 1VQ6B 4ZV4A 3OZUA 1SVLA 3KQHA 5FI1B 4TMWA 4BFWA 3RVBA 4R71A 2IYYA 1D5CA 1SZPA 2NO0A 1N6HA 4QGGA 2ZSDA 5DE3A 4G3XA 2EWVA 1R8QA 1Z07A 2GKSA 3E1SA 3U3JA 4ZIRB 3KXIA 1Q20A 2IS1A 2VNJA 4IKEA 3VNUA 3B1VA 2FEOA 2CL0X 5JSZA 3EPJA 4PPFA 4JYCA 4LZZA 4E09A 2ZVPX 3O8CA 1G5PA 2OZEA 1Q0UA 2B92A 4MKGA 3MJHA 3ND8A 1Z0KA 3W5HA 2BBSA 3AF2A 4MRPA 3W8RA 3FFAA 5FI0B 2FFBA 1S72B 5HE8A 2W6JD 1X3SA 3NHAA 4Q1CA 1QF9A 3KJGA 2CNWD 1II8A 4JLNA 1LS1A 1EP1B 2WOOA 2GAAA 1XJQA 4LYAA 3HU1A 2QP4A 4OK3A 4DDTA 2GVZC 4URVR 4US2R 3AP3A 4NCIA 1NDHA 4B34A 1JNYA 2RCNA 3NIBA 3UK6A 3E2IA 3K0SA 5FBQB 4DT1A 2V6IA 3M1IA 3RRMA 1P9WA 1KYIA 3U60B 1TF5A 3REGA 1TX4B 1E9FA 3CW2A 5AWFC 5LD2B 1Q21A 1P6XA 3B1WA 4M1KA 2A30A 3CIOA 3TNFA 5K8LA 3PFIA 1ZU5A 4AC9A 1I2MA 4DLYA 5J4YA 1TNDA 3NXSA 4K46A 4EIWA 3NDPA 8OHMA 5KDOA 3OESA 6Q21A 2YWEA 1KAGA 5AUQA 2BC9A 1GAWA 3B5JA 1OFUX 2GWHA 2HCJB 1C4OA 5EP1A 5C46F 3G0HA 2OFWA 4TLBA 4AURA 4KXFB 5DYIA 3AVTA 2WOJA 4ARZB 4DSNA 3EX7C 1E0AA 3AP2A 4LOAA 3VKHA 1W47A 3T1VA 1JEEA 3FKQA 4LUCA 3CONA 2BIFA 2OV2A 3A1UA 3ICEA 2IW3A 3TAUA 1US8B 4RD3A 4WXPA 4C0KA 1SVMA 1XD8A 1XTIA 1KTVA 4EQ6B 1KK1A 4WA7A 1TF2A 4V03A 1IAQA 1E4VA 4JLBA 2ZJ8A 3KQUA 2IXGA 2Q9CA 1HURA 4Q7KA 4TQUS 4XTCS 2J1LA 1TEVA 4TL8A 1TQ4A 1GSIA 1WF3A 2F1HA 3K9NA 1S0UA 3WMEA 4PSVA 1XTSA 1KMHB 3RANA 1M7BA 1L8QA 4UNRA 3C8UA 4LV5B 4D80A 2FNAA 2BSAA 4MRVA 4UJ5A 3RSOA 2CBZA 3U5ZB 2KWIA 1PJRA 1OSNA 1U99A 4F7WA 4HDCA 2UVQA 4KFSA 4URYR 4C43A 3Q9LA 3QFCA 1NJGA 1Z6AA 3IPXA 1GNQA 1F60A 4Z8XA 2XEXA 3FGNA 4DHEA 1DVRA 1RIFA 3TJZA 1QVGB 3GLFA 2ZQ5A 1GRQA 2PCJA 1D8TA 2J59A 4RKFA 4V0LA 2YNMA 1T5LA 2DFTA 1FNDA 2BEKA 4S35A 2OK8A 3G5UA 3M0EA 3B9PA 1ZNZA 4MRRA 4D2IA 4B43A 4FXPA 2P6RA 3U7EB 2FZ4A 3VU9B 1R2QA 2IYZA 1CS4C 2F9MA 2KBEA 5CDFE 1S2MA 2RGEA 1GVNB 3GJ5A 3L8YA 3CPEA 1B0UA 1U8YA 3EWAA 5IRCD 2IX3A 1XB2A 4TWZA 3AQ4A 3B8HA 2C9OA 1TUIA 1W2HA 2D4HA 2A5FA 3GLGB 3NEYA 4CEHA 2DFLA 4KHZA 4BLSA 1CRPA 4V0KA 4TSFA 3JQPA 2PIAA 2XZPA 4D25A 1FPMA 3KX2A 3EWSA 1NP6A 1CJUC 5AJZA 2JA1A 5E7JA 1Z47A 2NQ2C 1Z0AA 3K09A 3UPUA 1WXQA 4TMVA 1OF1A 1M7HA 4KCGA 1A2KC 1YQTA 4AF7A 1VQOB 1AS2A 4ZO4A 1MO5A 5JRJA 4RD1A 1RVDA 1S3SA 2PJZA 1Q1EA 3WNCA 3CF0A 1DEKA 3CH5A 4Q21A 2ZR9A 1YJWB 1AKYA 1TPZA 4AK9A 5CIWA 1E9CA 2C03A 2JAQA 2O8DA 4GSYA 1N5LA 1TADA 2GAOA 1XD2B 2GCOA 1W4AA 2ZAMA 2A78A 3GP8A 2QAJA 1YJNB 3PENA 4R9UC 1TF7A 1LNZA 4Q4AB 3WRYC 3IUYA 1ODFA 2ORVA 4PPQA 3MJRA 4ZDWA 1NJID 3K70C 5FBWB 3C7KA 3I5XA 1IONA 1AIPA 5ELXA 3QI2A 4OK5A 2ZREA 1AMOA 4MUAA 1EFTA 2GEDA 4FMCB 1OFHA 3IKJA 4BUJA 2BBTA 3PUZA 2DWOA 5DHAA 3VR6A 4M8NE 3GLIA 2P5SA 3FMFA 3AGPA 2VPPA 1E1RA 5A5GA 2HYIC 1DADA 3FTQA 3QUSA 1R10A 4X8HA 3A1WA 3LFUA 4X8MA 1XPOA 1HA3A 2BKEA 3TW4A 4URUR 2DFNA 3FDIA 3BH6A 3TSZA 3MGCA 2ORIA 1XBTA 2OAQ1 2JGNA 5JS8A 2BBOA 1SM4A 3A1TA 4PPGA 3U7GA 4AD8A 4GPTA 3A4LA 3MD0A 1P75A 4KBGA 1I2DA 1N3BA 3B9QA 4JJZA 4RD6A 4TYNA 3V76A 2QE7A 3TR5A 4QJ4A 4ILEA 1S9HA 4MKFA 1NKSA 5JJIA 3B1XA 1VG9B 1KSGA 2IYXA 3LVQE 4QJ5A 4D82A 1A1VA 2ZPTX 4A0FA 1BIFA 2ZI4A 1T4GA 2ZI6A 2ZRHA 2F1RA 1K9MD 2WAYA 1FQJA 4B33A 3AKYA 3AUXA 4TTRA 1EFHA 1IXSB 3NDBB 1ZCBA 4C0HA 5KUTA 1P2SA 4Y0AA 1KDOA 2NGRA 4DIDA 3KUCA 3VTKA 2QAGC 1OIXA 1ZM9A 3Q7PA 3RAPR 2WJYA 3K0CA 5CLQA 1G6OA 3I73A 2XSZA 3IIJA 5HKKA 5H8WA 3HDTA 2R2AA 4I1SA 3W5JA 2BF4A 3I55B 1F2TA 1ZD8A 4TYWA 1M74A 1N6LA 1HE1C 2V1XA 4HEJA 3RC3A 3W6NA 1OE0A 4JLAA 1G8FA 2I4IA 5AJWA 5BXQC 1SULA 2NZJA 2O0HA 4YAWA 1VCNA 1Q7YD 4QBIA 1SVIA 3G4SB 5TB5A 2QY9A 4GDFA 2VHUA 2QSYA 1GKUB 1LB1B 1GIAA 4LJAA 3I56B 2GETA 2ZS8A 2ODBA 4ZGQB 1G5RA 1KI3A 3RYTC 4Q19A 2QA5A 3PXGA 2O8CA 3OIVA 1T3LA 5HTKA 2ZYUX 2VNKA 3PEVA 1R0WA 5KPJA 5FL3A 4PC3A 2PH1A 1RYFA 4B48A 4JLOA 3THWA 2IK8A 1FNMA 2DYKA 1HT2E 1YRAA 1YZUA 2Z0MA 4O2RA 3AGQA 3K0FA 4KI0A 1SVSA 2A7QA 4KYUA 2CHGA 2ZYWX 2RMKA 1UKEA 3MAAC 5FUXA 4DT1B 4PZYA 2GDJA 2J5XA 3C14C 2AFHE 4A82A 4HZUB 3B6EA 2DFKB 2JIZD 2FPLA 2OBMA 4BWYA 3CD6B 2OK7A 1G20E 3LX8A 4YMUA 1Z0DA 4DCNA 3CXCB 3J81k 4LX0A 621PA 3ZBUA 1T91A 2W0SA 4NYJR 2AK2A 1K8RA 4POAA 5EUQB 4BGDA 1VG0B 2ZYTX 1XMSA 2ZRMA 4AKEA 3QVUA 3GFTA 4F7DA 1Q44A 4B32A 1ZP6A 4DC9A 2G0NA 4MRNA 1EX7A 1XEFA 4G1UC 2LKDA 2AL7A 2FSHA 2BMFA 1KK2A 4LSGA 3SBDA 1ETUA 4HDQB 3GFPA 2C78A 2ZR0A 3H1TA 4PAOA 1H42A 3ZD6A 2AN9A 4PGOA 2ZRPA 3CRRA 1UBCA 4LV6A 1VQ7B 1YZTA 4UJ3A 5ANRB 1R6BX 1KY2A 2VF8A 4D6PA 4O3MA 4JVLA 2BPOA 4FWTA 1O87A 2AWNA 2KJQA 4CDGA 1ANKA 1XJCA 1GL6A 1LV7A 1QG2A 5CK5A 1G3IA 2VNIA 2QAGB 3F3YA 1HV8A 1YI2B 4M1SA 4LY6A 2OBNA 4Q01A 1E3MA 1LS6A 3HU3A 1GAQA 4BZXA 4PC1A 1OH5A 4R7ZA 1G8PA 1CR0A 3TRFA 4BQSA 1FFHA 2J0QA 4Q7MB 5EXPA 1VQ9B 3WBJA 3CNOA 2J41A 4KO8A 4OQFA 3BWDD 2B7CA 1US8A 2JLRA 2ZRFA 3QG5A 1KGDA 1UJ2A 3LBNA 2VYFA 2J7PD 3DOEA 2O8CB 4B3XA 4Q1BA 2IUTA 3CO5A 3U6KA 3F0TA 2O8EB 3CMAB 5FA6A 2UKDA 1R5BA 1W4CA 2CCKA 2W58A 2YOHA 4PQFA 4TMKA 1H65A 3ASYA 1D9ZA 2WZQA 4LK2A 2XNDD 4E22A 3SYNA 4ZI3A 1OGJA 4P4TA 2XXAA 1SVWA 3LBIA 3MG9A 1TLLA 2MSDB 2W6IA 1OFIA 1FX0B 4B3GA 5E3HA 4RFVA 3RS0A 2G0TA 1D2NA 2ANCA 5BWMA 2VHQA 2G88A 4YHBA 2QTFA 4QC2A 1CLUA 4DBLC 2XZOA 2NG1A 2BCJQ 1DTSA 2P2LA 2OTJB 1QGYA 2Q9BA 2WWXA 4LWZA 2VSOA 1RPZA 1OH8A 1NVUQ 4F93B 2VNHA 1UF9A 5AN9A 3K0CC 3OEED 3ONWA 2XITA 2B7BA 2Q9AA 5HZKA 4QHTA 2QDXA 2OCPA 5L3QB 3DO6A 3ZZUA 1W0KA 5KSZA 2XNJA 2DR3A 3LLUA 2WKPA 4DJTA 4DUGA 2REXB 3THYB 5JRZA 3RS2A 2FOLA 1TMKA 2JDIA 3JZMA 3HR8A 1GRRA 2VLIA 4L9WA 4B6EA 4PSAA 4G5GA 3CCUB 1U98A 3F8TA 4ITRC 4NE2A 4BFVA 1XCGB 5FUWA 1MO4A 4NP6A 4TTPA 1EG7A 5K8TA 1AZSC 3ZVMA 3PUWA 1JECA 4IDNA 1KD1D 1KDPA 5K8UA 3IEVA 3SQWA 2F9LA 1QFZA 4RY2A 3FMPB 5FUYA 2QMOA 3SR0A 4EDHA 4AKGA 2EWWA 1SKQA 3I5YA 2JLWA 1F2UB 1W87A 2WSSD 2GK7A 3QKTA 4WZ6A 1HE8B 1CP2A 5E95A 4G01B 2CHQA 5FH9A 2NMVA 2FN4A 1P72A 3Q72A 3CZPA 4BFXA 4G1VA 3I32A 1XDBA 3UIEA 2F3TA 1SXJC 1FRNA 2ZE6A 3BK7A 3QOFA 3I62A 2QNRA 1ZUNB 4PC6A 4RZ3A 2LWIA 5EJEA 1OKKA 3QXCA 1KO7A 1UKVY 3OEEA 1U81A 4GZMA 2BVNA 3QPVA 2R8RA 1OH7A 4R2IA 4P4SA 1E2NA 3GD7A 1GR1A 4G5OA 4UKDA 1CKEA 1P3JA 3E1YE 1XJ0A 4OJKA 1E63A 2B6HA 1N6NA 3OIYA 3NTUA 1W0KD 1E0SA 2R6DA 1K5DA 3D7MA 4PHHA 2MMCA 4PHTA 2XX3A 4TMXA 2CJWA 2H5EA 1E2GA 4TL7A 3KXKA 3K1JA 3OE7A 1XTQA 1E9BA 4RJLA 1GKIA 2JDID 5FTNA 5TY0A 3A58B 3GLGA 3FMIA 3NC1C 1DAKA 1E69A 2J0UA 5EXXA 2ZSAA 1G17A 1Z0FA 3LO8A 1X1SA 4GI7A 5FBRB 3TGPA 2ZI5A 2NIPA 3KL4A 1M1YE 5DIFA 1XU4A 2WPDD 5CJPA 3G6EB 4RCYA 5FOUA 1Z29A 3FYHA 4OI4A 3GLGE 1ZAKA 1VQ4B 3L0OA 2JEOA 3D31A 3UG6A 1FNCA 2ZM5A 1E2KA 2WSSA 1UMKA 1RW4A 2QT1A 2P65A 3CNNA 3O8DA 2CCGA 4Q02A 3ES9A 4YAFA 3QF4A 3AKDA 2QE7D 3W2IA 2IYWA 5KYKA 3LBHA 1P2VA 1NY6A 4BEBA 3SEAA 3SFVA 4A4DA 3Q5DA 3K70D 4CYMA 4WAUA 3KKMA 2Q21A 2WMOB 3BC1A 3X1WA 4LJ5A 2P5TB 2JLSA 3TQFA 2BMDA 3EIEA 3HPRA 1VKJA 4HB4A 2ZTSA 3UKDA 4DLUA 1KI7A 1FNNA 2B21A 2GILA 2WJGA 2QA4B 4BRWA 2EW1A 4DSTA 4MUBA 1UEJA 1G19A 2C5LA 4OQLA 1NN5A 1C9KA 1FUUA 2RGGA 1T8UA 2RGBA 2KB0A 4PQYA 3FKSA 2W2VA 4C30A 2W6JA 3CR8A 1NLFA 5KOYA 1UDXA 1E9RA 1XPUA 1VDZA 1NVXQ 4Y9RA 5KSPA 1I4LD 4L8GA 1T5IA 4BFZA 2BGJA 3NH9A 2VZLA 1E62A 2EU8A 3WHKA 3QBVA 3D3QA 4BFSA 4BFTA 1W1WA 2VSFA 2PLFA 3GJ0A 4XVRA 4KITB 2FH5B 1WDTA 2WJHA 2G3YA 4DWJA 5TR9A 2ZE5A 1G64A 5G41A 3QG1A 1COWD 3L82B 2GRJA 2OCAA 3RNLA 4FI3C 1DELA 4PC2A 3VU9A 1AJEA 2CXXA 3RS3A 2FMXA 4Y0VA 2IF0A 2WJVA 3PVSA 4C0LA 4AY2A 3DL0A 4LRWA 3RC8A 3JZAA 3GJXC 3G71B 1KJWA 3CM0A 5KHOC 4M0LA 1G4UR 1ZCAA 3UATA 4FW9A 3BERA 4DSOA 1KI9A 3DVLA 4UNQA 5FTMA 3SNHA 2CE7A 4OHYA 2XNSA 3GCGA 4IDPA 4D0GA 3U2QA 2JCSA 2JJ1D 4B74A 1NG9A 1E32A 4M9ZA 2DEUA 5FPKA 1NVWQ 4BLQA 4ZDIA 5M04A 3QJYA 5GVRA 1IJEA 3KFVA 3ZZTA 4JT4A 4CRWB 4M1MA 4K8OA 4V0NA 1XTJA 2E87A 3AVWA 3H2YA 3RRNA 4A0GA 5C2JB 3KQKA 5LDDC 1E2JA 2RGNA 4F4IA 4JBXA 3IEUA 3QXXA 2ZS7A 2JLYA 3HP1A 5EE9A 1Q82D 3QF4B 3EIHA 3KKQA 4Q9JA 5IHPA 3AB3A 1YZQA 2EIXA 2O8BB 2V54A 1J70A 1WCV1 1U90A 1CR4A 1KDTA 1IY0A 3GPLA 3D8BA 4DDUA 1UKYA 5TDHA 3TKLA 2DHRA 3VR1A 4P6VF 2ZRDA 4UNPA 4D0LB 5J4HA 3FE2A 3BBPA 4BLOA 4EKDA 2IL1A 5CM8B 1DG3A 5HE9A 3QXHA 1D2EA 3MWLA 1GOTA 1VCIA 1VECA 1N6OA 2ZI3A 1NIPA 2V6JA 3CX6A 1M8PA 5DN6A 1MABB 4DRZA 5L8VA 3CLVA 3E5HA 1OKKD 1R0XA 2IYTA 3FB4A 4QL3A 3TIFA 4J0QA 1HQYE 4ZCLA 1HEIA 2QG6A 4BFUA 1VPLA 4A0RA 3QQ5A 5BN3A 4IVPA 1OIWA 4HZIA 5GADl 2OXCA 1E2DA 4K1XA 1YHQB 4US1R 3R7WA 2WJIA 3A37A 2ODWA 2Z4RA 3EXAA 1ZC4A 3CF6R 1UPTA 2WKRA 4B75A 1E2PA 4LHXA 4P31A 2VSXA 3NC0C 3T15A 5AUNB 2DY1A 3REFA 5L3VA 3WNDA 1BMFD 4IFEA 5F3WB 1KMQA 4DXAA 4RD4A 4BZPA 1ZUIA 2G1KA 3RWMB 5EE5B 2BGIA 3ZGXA 3BS4A 1SKYE 1CTQA 5HPYB 2YKGA 2F55A 2QMHA 1KSHA 3LDAA 4RD0A 4OHWA 1L4YA 4IW3B 3OHMA 4AYTA 1YU9A 1Q12A 5J5CA 4JBYA 5AR1A 3BFXA 2OG2A 4FCVA 3DEFA 2XOKA 1WRBA 1CJMA 1TTTA 2I3BA 2Z6VA 5DI9A 4RZXA 3CBQA 1FP6A 3R9XA 5FUVA 2NZ8A 4BZQA 3VKGA 1X1RA 2XJ9A 3GMTA 1KJYA 1YJ5A 2N1BA 1E1RD 3HPQA 4Q1EA 2CNDA 2C77A 121PA 1SXJD 2AX4A 4BLTA 3VX4A 3VR2A 4JT2A 5HR5A 1Z63A 4TL6A 1VQNB 1QHXA 3AF4A 3ZIAA 4QHYA 4H9GA 1AGPA 2IF2A 2OFXA 4YDHB 2RGCA 2FU5C 4AG5A 3LWNA 4XVQA 2PMDA 3AV0B 4DLZA 1P2TA 2VHJA 1Z5ZA 2JATA 3QFTA 2PEZA 4IVQA 1CJTC 1JA0A 1XWIA 2GZAA 4HLUA 2YC2C 1Z6TA 2GZHA 2Q6TA 3L8ZA 4G5RA 1QX4A 1OPXA 2HEIA 3F5FA 2RHDA 3KJEA 1A82A 3WXMA 1XP8A 1E6CA 3AH8A 3BJIC 4YMTA 3AEZA 3NBYC 1AQYA 2X2FA 3K9GA 4YQFA 4JLKA 3Q85A 4ZKDA 2GPJA 5GV7A 2UZ3A 1KK3A 4DVGA 1SXJB 1T6NA 3TR0A 4B76A 1M2OB 5JEEA 1R0YA 3CRMA 3UANA 4AIIA 1KHTA 1CR2A 1NY5A 3I3SR 3VR5A 2J87A 3KB2A 4DQLA 1VMAA 3RRYA 3TVDA 1OHHA 4KFTA 4Q4HA 1EGAA 3ZQJA 3C16C 4HLCA 2H7VA 5FL7D 4XH9B 3SYKA 3MLEA 4JSTA 2J7KA 1XMIA 2OCBA 2RB4A 1AS3A 1SQ5A 3TSWA 3U3MA 2ANBA 5JZVA 1FMJA 3H86A 5TV2A 3SQXA 2REOA 1EX6A 4LHVA 5LPNA 2FF7A 1J90A 2Q3HA 2ZRBA 2ZRGA 4IOLA 4CF7A 2FFQA 4DCVA 1GUAA 5D3MA 3KQNA 1TUEA 1U0LA 4K81B 5AJXA 3IIMA 4L16A 4B2LA 1E79A 4GP6A 5A0FA 5AJYA 2CLSA 2HCBA 1JR6A 3B1ZA 1ZM2A 4F4JA 1DO0A 1EP2B 4IHQA 1VTKA 3DZ8A 3PQCA 221PA 1DBSA 4PXAA 3MMPA 1KI4A 3X2SA 5AK0A 4F4CA 1GO2A 1W46A 2OUKA 5EXTA 2CMKA 1G7TA 1FTSA 5B30A 2YZ2A 2WV9A 1DAMA 1NBMD 1JALA 1M34E 2BM0A 4LPKA 5H1YA 5SZKB 3IIKA 4G0NA 4KVAA 3LA6A 4LV8B 4EPRA 1LFDB 4ERNA 4NHOA 3HU2A 4F91B 4M4SA 1BS1A 1D1NA 2BMEA 1G16A 4C0BA 4HUTA 3I8SA 1WA5A 2VQSA 1XMJA 2IEYA 2IS4A 2QRZA 5EE0A 5FBVB 2ZANA 3GLFE 3ZC3A 5UKDA 5JHHB 2ZJBA 3OJWA 4AF6A 1KSJA 4LJ4A 2CVHA 4CGZA 4WZBE 4TL9A 2IHBA 2Z5FA 5BW8A 4JLDA 2H18A 3O47A 3W90A 5AUPB 4KAXA 1G3MA 2XNCA 2BMJA 3EZ2A 4XOIA 2B8TA 5CDFA 2B5OA 1Z6XA 3SU8A 1CU1A 1EP3B 1GL9B 2HUPA 1QFYA 3DM5A 3A1VA 3P4YA 3W34A 5KSYA 2AD5A 1GDDA 1ZINA 1HYQA 3T12A 3TBKA 1G21E 2NO1A 4KYIB 4EPTA 3EARA 5J4LA 4IRUB 1CQXA 1OXUA 3TLXA 2K5UA 1Z2AA 1ZRHA 4JLPA 4Q18A 2CK3A 2ORWA 4M1WA 1NBME 5AUOB 3W2FA 2V1UA 5G40A 2IXFA 2KBFA 2QM8A 3AF0A 3A4MA 4JMPA 1NSTA 3QFSA 1GKYA 1QHNA 2GF9A 2JIZA 3AF1A 3C15C 4PQRA 4NPHA 2VIIA 1FX0A 2WVJA 5EP4A 4A92A 1JBKA 1VYUA 4HZUA 1BQEA 2HXYA 1U94A 2QORA 5CIQA 1NBMA 3TE6A 5CITA 4URXR 2HT6A 3HR7A 1QRAA 1U0HC 721PA 2BWJA 4CEHB 2OLKA 3EIQA 3U7HB 4A6XA 4MYCA 1IHUA 4HUQB 2ZJ2A 5SZJA 2C98A 4A6PA 2DBYA 1DDGA 2IYQA 3LW7A 1SHKA 1L2TA 1BYUA 1CJVC 2FV8A 2PMKA 4TTQA 1JPJA 4GZLA 3LVBA 5JCZA 4MGIR 1E2HA 4E03A 1Q86D 4FWIB 1DAGA 1W4RA 1KI8A 3W2HA 1DAEA 2GZDA 2ZUCA 3LRPA 4M1YA 1OXXK 4OQMA 5FOVA 2PZEA 3BORA 1DOAA 2IBMA 2UZIR 2OHFA 1MKYA 3U3KA 4NCJA 4HB2A 3C4JA 3U4QB 3BOSA 4DB4A 3BH7A 3LQQA
chains in the Genus database with same CATH superfamily
4BP1A 3KT8A 5JZMA 3B52X 3KYDB 2FSVA 5EA2A 1OB0A 3OM1A 4MVCA 1N0HA 2ZI9A 1N5KA 4G5FA 2H85A 3IGFA 2ZB3A 3T7CA 3IRUA 1Y6RA 3W9YA 5TVKA 2ZVDA 3BEOA 3OE4A 3NPAA 3W5VA 3GLIE 4C1NA 3ABZA 4Z9AA 3NH6A 4PQEA 1K4YA 2PGXA 1TPYA 1KXJA 2E48A 5HQ3B 3RTBA 3OUUA 5J40A 3A7EA 5A3RA 2P6OA 3SI7A 1Q1ZA 3CWCA 2BKUA 1QHHA 4P3YA 3OPYA 1BMQA 1X8LA 2GZSA 4Q1DA 3RPEA 3EC2A 3B3QA 4KDRA 4CI9A 2RGRA 5F98A 1YLOA 1I51A 3JYHA 4QECA 2A3RA 5CLHA 4AQ7A 1JFSA 4FEYA 3OZTA 4RZHA 2IYUA 1NYTA 4B85A 2NTJA 3M8KA 5SZHB 1KO1A 2R66A 2VSYA 1FP4B 1GGFA 2PKEA 3IOBA 4RFLA 1EFVA 3PFCA 1TE2A 1OU4A 4RKWA 2CDRA 2PKQP 4Y6LA 4BFYA 2G1JA 1WHTB 1N6IA 2PH5A 4MH0R 1P1HA 3RRZA 3UJ9A 2E85A 1WOYA 4DDUA 4N5MA 3SDSA 2ZS9A 3E5MA 4N0MA 3DKVA 3ZX4A 1UT5A 4EHLA 3LSTA 4LPSA 1ZH6A 3WB0A 4EABA 4DUZB 4R9RA 1Z73A 3E22A 3P9CA 2QW0X 1EWVA 1V8ZA 2PZGA 1D1PA 2QP3A 3FHOA 3INYA 3N9IA 3K0FB 1GN9A 1QOPB 1UCFA 1OBVA 1X1DA 3EISA 5IYNA 4G86A 4QFDA 4HAXA 2GJ9A 1N0VC 2A2ZA 3D4PA 4NAUA 1RAAA 5EOVA 1T5TA 3OAAA 3P2KA 2RIRA 2C2MA 4ESHA 4ZI7B 2GHQA 1I33A 2CDAA 2ZI7A 1R3UA 2QBYB 5FPSA 4KWCA 3U7GA 3SY8A 1CF4A 1N8RD 2JKVA 4LGMA 4QAQA 5FNVF 3NRJA 3V4RA 1ZOOA 1NNLA 2XRYA 2LDBA 2GN2A 3AHEA 3EGVA 4FBMA 4WOJA 4K6FA 4BPBA 3HLKA 4FBLA 4QQFA 2DKOA 3AHFA 2Z5LA 3U6BA 2AH5A 3P9YA 1S1CA 4O8ZA 5AJVB 1BFDA 1NXOA 3ELUA 5EP2A 5T4EA 4E6PA 2BR5A 3RT7A 1U7TA 1GAXA 3LGSA 4TVOA 4UUQA 4B8ZA 4QUZA 3K94A 3ZUGA 2VTKA 3B6ZA 3KHUA 2QU8A 4RM3A 3PQ7A 4IYJA 1VL5A 3LGXA 2JFZA 5EMJA 1OGIA 1LVUA 2X23A 4JXJA 2YOGA 3MW8A 3MFQA 4WX2B 1PS8A 4JLSA 3KKNA 1NXTA 3N0XA 2ZLBA 2EX0A 4LBVA 2WTNA 1LCIA 1QDEA 4Z0PA 1W2GA 1C7JA 1SHUX 1U9IA 2R6JA 3QVWA 1XF9A 3GEMA 4XJXA 5JS1A 3GCZA 1OWNA 1ZRMA 3Q15C 4ZDJA 4ACAA 4OX9B 2QMUA 4BEJA 4RELA 3VPXA 1N75A 1JQLB 3IE2A 3TR6A 5DTEA 1Y1PA 5JS7A 1YQEA 3M3DA 1AKEA 4TKUB 1VKOA 1JKMA 3STYA 1ECLA 3OE7D 4GGMX 5E4TA 5E4YA 4RQTA 3H5LA 1MDBA 3GFRA 5JSZB 1A8PA 2H7XA 3MQ4A 3OZXA 4PIMA 4KTVE 1IK4A 4RHCA 2M6LA 3JRXA 1VJGA 1Y8AA 2GOYA 1XCPA 1I4OA 4V2IA 2WPDA 1PS0A 3BD6A 4B73A 4D9JA 4PYJA 2AG1A 4FM9A 1UFKA 1RR6A 4UNSA 4URHA 4AP6A 5EUCA 5LXTF 2EP5A 5FPHA 3KYCA 2W43A 3RBVA 5CD1A 1NBEA 4YXWD 3IDFA 3NUZA 1RYDA 1GILA 1WXDA 1Y33E 2E18A 3ZK7A 5HIKA 5K8IA 4PZZA 4KQWA 3SIXA 3DDCA 1XTUA 2G1UA 2PZBA 1SQSA 5JH7A 3VZPA 2V7QA 1HDCA 2X8AA 1JVBA 1JTEA 3UM9A 3QKRA 3KU4A 1CV2A 4UCFA 5KNDA 1EGQA 4LTMA 4P5EA 1ZMBA 3W8DA 3SC4A 4HH1A 1D0VA 3CRW1 2GARA 2F8MA 4O4LB 4ZC1A 1CEQA 3UBMA 1NONA 2YWHA 1OD6A 4LYJA 4DYDA 3GCWA 2X15A 5FHQA 3SM3A 4MUEA 4OLHA 4OP1A 2WJ4A 1TZJA 2CNKA 3QJGA 4RVGA 5E3IA 3LYHA 4G4SO 2FR0A 4QARA 4Z8YA 1GZDA 4X1OA 4ZAVA 4I2VA 4QM7A 1HY3A 1VMKA 2GTHA 5F52A 5BQPA 3GJ7A 4QYIB 1PR9A 4W6QA 4B80A 1QV9A 5G0TA 4E2XA 2KE5A 1DIRA 1W73A 4FBGA 3UK2A 3JQAD 3T5DA 2NU6A 2JGIA 2EFEB 4D9NA 4XVUA 5GJVC 3WDMA 1SKYB 1KYVA 1OXSC 2QUKA 4MKHA 4ZAYA 1CS0B 1ODSA 1QGED 1U04A 2AMVA 2VAVA 1JYSA 4A2WA 4KFCA 3GAZA 2WWYA 3TZ6A 5EJAA 1F5NA 1TA9A 1S02A 3MUEA 3UW1A 4B45A 1QMGA 2PZKA 4HX5A 4ETWA 1KL7A 4NDZA 4ZIRA 2W00A 4FYJA 2ZRQA 3FZNA 1WE2A 4TLDA 3ZV6A 3N2GA 3KDAA 5K0FA 3E0QA 3AFIA 3UF0A 5B6PA 2X5XA 5JAZA 2FW0A 2LBPA 2O20A 5I9MA 3N2IA 4ZMSA 4ESVA 4X64B 1G8MA 3NANA 4C3ZA 2N1MA 3GOQA 1KKMA 3SJCA 3FZGA 4EY6A 3D4OA 3TL2A 4DDVA 2JZCA 3DBLB 3F90A 4MKZA 4L22A 3UGJA 3UGTA 2IGBA 3G0OA 3BIJA 3ZGNA 2N75A 4IH1A 4JY7A 3RFFA 1KRHA 3AJAA 1FTGA 3ZHRA 3Q7QA 3JPWA 3CN7A 3KL9A 2Y1CA 4B44A 2GEUA 3LLVA 2FUKA 4XD7A 3ASTA 1JEOA 2REQA 3BXOA 3H8JA 3IDOA 4HS4A 1J0XO 2YNMD 1T3HA 4LY9A 3U3OA 1SN7A 5A9TA 2NPOA 2EDAA 5AI8A 3HKDA 5EMKA 3V2GA 2VDWA 5BN3B 1AH2A 2Q4TA 3NV9A 4KR9A 3UJNA 2PX3A 2Q7DA 1FBTA 3CLTC 4CKWA 5T67A 4DZTA 2WVAA 5IYPA 1SCJA 2FK7A 3G8DA 4FMBB 4ZA2A 2R44A 3M4NA 3OZDA 5DOVA 1TYDE 1JDVA 1PUIA 3CX3A 3CUKA 2JRCA 1TEHA 2GM3A 3WJ7A 5LZ4A 4H7IA 3RFTA 2C3MA 2NZWA 4LY3A 5AH0A 3MSCA 3WL7A 2V3VA 2EAUA 5TGZA 2OAP1 3RFXA 2AJCA 5ENZA 3ZW8A 4BTEA 2DHCA 1G4AE 1A8IA 5ISMA 3OCUA 3UJ7A 3EIOA 2QEXB 1MIOA 4FK8A 1RC0A 2JJ1A 4Q37A 1XZQA 1OW3B 3WGGA 2OBRA 4CNQA 5CR9A 5AKZA 4UAVA 4DDMA 4CXMA 3AX6A 3LQ2A 4BY9E 3B78A 4B4WA 8ATCA 3EGEA 3GFBA 5LMZA 1H4QA 2FG5A 1JWBB 1DINA 1IM2A 4L02A 4L75A 3WBBA 4AMGA 3ADBA 4JI0B 1SUSA 4NKRA 1F17A 2EBWA 1LVGA 4ALJA 2YZGA 3A4NA 3K73O 4YRKA 1FW6A 2QL9A 3CR7A 1JVNA 3G2LA 5E6RB 2R62A 2HSWA 1CY6A 1VHJA 4Q9DA 4TYPA 4C0QC 5IT9A 2AEJA 2VPTA 1F6BA 3DXFA 3P0HA 3WYGA 4D9IA 1JPNA 1NW5A 3VHRA 2H48A 3R6JA 4D02A 1L7XA 3WWOA 5L95A 3IUQA 1ZIPA 3ZLBA 1M66A 4KRGA 1U7UA 3LX6A 3SMVA 1GJRA 2MIIA 3NHZA 2JLZA 2D1YA 3ZNQA 2WWTA 3RWOA 1K7SN 2NVUA 3CPXA 3CKYA 3GZJA 3FW1A 3KVYA 1F0PA 3R3JA 1DAFA 5AXDA 2BTEA 4YRRA 2E5FA 5IBCA 1JDSA 4P3IA 4G0MA 4JJ7A 4V0MA 2MYNA 5HZHA 1BXKA 4H60A 1FL9A 4I4CA 5EQDA 3ZVNA 1KJ9A 3PIRA 1W36D 1PWEA 1U3TA 3NOOA 5JQGA 3FWNA 4ND8A 1KJIA 4R2KA 3RU2A 3ZGOA 5AVZA 2H1OA 1OLSA 2YV3A 5BQOA 1ORVA 3FPFA 2AI1A 4A1FA 1USVA 2NTNA 4CW7A 3GMIA 4Y8VA 4AM8A 2SBTA 4OU5A 2O5CA 3QPUA 4RZUA 1E2MA 1BDJA 4DR4B 4XL9A 1P91A 4GS5A 4C6RA 1BMFA 1R18A 1TA0A 4UEQA 1JIKA 1I6MA 2EL9A 4N5NA 1RCFA 1O8CA 4RQAA 4IJ5A 3JWPA 4HH4A 4D57A 4E5PA 3FCEA 2AG6A 3BSWA 2ILTA 3RTAA 1NTRA 3L05A 3RJ9A 4KPFC 3ROEA 1MH9A 5CVUA 1W9XA 1JFVA 2A14A 4R1TA 1WXEA 1C1XB 3SF8A 3UCFA 5JECA 5KO2A 1TAQA 3HZRA 4E0FA 1D03A 4OL0A 4N0QA 4BVJA 1GZ6A 1XZDA 4Q4HB 5CDSA 4ABYA 4FN5A 3C3BA 5IARA 3LG2A 4ZYZA 2W6NA 3UYKA 2WAAA 3PE3A 3CGWA 5K6AA 1Y81A 2IPOA 3BWBA 1UDAA 1H22A 4J91A 4PINA 3QX3A 5F9FA 2X22A 3TIGA 5TRDA 3QNUA 4G9BA 3KR1A 3DFMA 3PXXA 2GXSA 2BFPA 1OJ7A 7REQA 1NN1A 3QVKA 4RSGA 1RWQA 3MJSA 4B1FA 1JS1X 2C42A 1I7LA 2OY0A 2RGYA 3DC7A 3O6VA 2XZLA 2HC9A 3LUAA 4Q9LA 3MQ2A 1X77A 4CLXA 2Y4OA 3LF1A 6REQB 5FWDA 2FWJA 3OZGA 1T3SA 4RO0A 4WEOA 4BMXA 1GZ7A 2M32A 2QG4A 3GL9A 3HKEA 4LCJA 1IB0A 1J7KA 4UREA 4HWKA 3STUA 3JAKB 1PBNA 1JYFA 4CR8A 1FMFA 1V37A 1I24A 3CSDA 2O52A 1L7RA 5DVZA 2CF4A 1F20A 1UC5B 2OCYC 3AUFA 3I6YA 5A7FA 5JO0A 5HVNA 2GHIA 2V4DA 3AI2A 3VYSB 3WWZA 4FFWA 2W37A 4YV2A 1M34A 3AIKA 4X90A 4DM7A 2YUIA 521PA 1PWYE 1Q7EA 2XY4A 2EFGA 4HE5A 4EUEA 3AB8A 1V6AA 4KDFA 1Y5NA 2HX1A 3IULA 4O2LA 5AKLA 3W8EA 4M53A 3DWFA 3FRJA 3OZEA 1TQ2A 2OFOA 3ZH9B 3EPLA 3C5CA 1L8LA 2Z2KA 1MX1A 1XZMA 3DVQX 3AM4A 4DJFC 2C3OA 3PGMA 5DBHX 4MKIA 4TZKA 1REQA 4PFSA 1HSZA 2MU1A 4JBWA 5BR8B 2LGJA 1W9MA 3MCTA 3D6AA 4H4EA 3HKBA 5CGZA 3A6PC 1IBSA 5K0JA 1Z8FA 3DT8A 2CLHB 5KTYA 2A9OA 1PLKA 4NCKA 1E43A 3A0RB 3R6TA 4RF3A 2WICA 4AUKA 4ENPA 4Z54A 5A9SB 4H35A 3N3BC 4OGWA 4YALA 3JWEA 4UPVA 4G36A 2D2EA 4NV0A 4P08A 5K3AA 3T7DA 3TX6A 3UWKA 1Y8ZA 1UMCA 3ZDDA 3EZ9A 2ZITA 4E1AA 3N3AC 5JJKA 2CSUA 3VMFA 4II3A 4U7WA 1H5UA 1Z36A 3DCIA 3OFND 5AXAA 4EHNA 5B36A 2CVPA 3OZSA 4HKTA 4J94A 1F2UA 1JJVA 3BFPA 3CZ5A 4CCAA 3ZQ6A 1PNQA 2YTZA 2GVDC 3AEUB 3B5IA 3E0XA 4GLBA 4RMGA 1IULA 5DT9A 3VR6H 3UPTA 3VO9A 1YB6A 1UKAA 4QGBA 5KTNA 4FFPA 3EXIB 1W0CA 1NX9A 2J9FB 4GX5A 4RGQA 2OMKA 2VEDA 3UCXA 1Z22A 4URZR 5ALTA 3VOBA 1CR1A 3O73A 1SC1A 4O1IA 2Q5LA 5K3FA 4GWGA 4FT2A 1QRTA 1U8AA 3DTVB 3M7IA 3JQ9A 5G53C 4NYMQ 3OW7A 1CJKC 4C2BA 2EW8A 2BGWA 2DVMA 1VFNA 1YWGO 4N3AA 3GUHA 3RVDA 3O4JA 2P0EA 1LPAB 3DDNA 1Y63A 1QVAA 3L49A 3OTWA 1GTMA 2AQ8A 4CQNA 1KO4A 3QFHA 2H11A 2PG3A 1QANA 3BXZA 3EOZA 3I72A 3OZ7A 4RABA 3CCSB 3L7OA 5H70A 3DE2X 3VR5D 3VDXA 3IESA 1IPHA 4P4UA 2H1VA 2DJ5A 5FBZA 2Q7OE 4ZQBA 3WBFA 3E9ZA 2F7SA 3ZWQA 3AW9A 1MAHA 2GBGA 2R8EA 1JT2A 1YRHA 1Y6ZA 1LUAA 2NPIA 3T3EA 1FS4A 4DAEA 1T24A 4DGQA 2J07A 3BXEA 1P2BA 2X2EA 5D7BA 2R1TA 3TI9A 1Q81D 2DZDA 4PG4A 3WNZA 3O1LA 2QTTA 4QDJA 2FKAA 3PFWO 1Q17A 4UBLA 3RM3A 3L6DA 3H0CA 2MSWA 8LDHA 4MGZR 5FLYA 2VYQA 4E6EA 3MB8A 1T4BA 1UZUA 3KQQA 3MJFA 4ND6A 2VP6A 1EFDN 1QTRA 3H4IA 2HWYA 3OKXA 4UM9D 4X62B 5T5QA 4RTRA 5DCUA 3TE7A 1M73E 1SHTX 2ZIWB 4DUGD 4CODB 1QHHB 1DPFA 4CLRB 1I2AA 3EZNA 4ND3A 4YV0A 4LXIA 2DBQA 4LOKA 1WB9A 2V6FA 1P6QA 4NH0A 1Y9ZA 3T41A 3W5DA 2E4XA 5JCOA 4LWQA 3AR2A 4DCJA 4YXFA 3VDRA 5TC4A 4ZCPA 3GPBA 3OOEA 2B94A 2YW9A 2XADA 3AYZB 3DCNA 3MWYW 3OPOA 3A35A 3GQBA 1GUDA 4HQ6A 4W7SA 2ZSJA 2B8WA 1JSXA 3NBMA 3LYLA 4IV0A 3TLGB 2UUAB 3SFTA 3P19A 3S29A 3C5WP 1J9ZA 4ZJZA 1X7XB 1XNJA 5JPCA 5D1HA 4G2NA 3ZWVA 1HWYA 1IQRA 1C4XA 4TQAA 1ZXLA 3Q9UA 5F77A 3U7FB 3V1NA 2JHAA 1KQSB 3BTSA 3OKPA 4MUKA 5JG7A 1JX6A 2VF5X 2VP3A 2ONKA 1NLZA 2ETXA 2VP2A 3ETGA 1FRVA 1X39A 1XLWA 1I32A 2V5UA 2D0PB 3BEDA 3P32A 3KCNA 3OM0A 2GAFA 1JAIA 3LY7A 3TZHA 3CFYA 1XAIA 1DS6A 2CBGA 3OT1B 5EIXA 1GUFA 1OB5A 2E4YA 5H3CA 4YRMA 2C4TA 3BD7A 3PT9A 1L7EA 4JELA 2ZUSA 2R7KA 3AEXA 4MO2A 3ODPA 1IJFA 1MXFA 3AR9A 3Q0IA 4FGWA 3V7YA 2B9VA 2CEKA 2O8VA 3I45A 4RMIA 3SJUA 1KF0A 1HYHA 4B47A 3CS3A 1QYCA 2V7XA 2Q3DA 5F5NA 1GPKA 3BE5A 5JXJA 2PGOA 2HIHA 2NAPA 2BFWA 3PHIA 4QQRA 5EJMA 2IV3A 3ZD7A 1XCJA 2CFRA 2GUGA 4GLJA 4C7OA 1WQ1R 3TZEA 3VSCA 2PU5A 2PRIA 3FVWA 2GEVA 2UVPA 4RHEA 2BFFA 5I7FA 2NV0A 3AXSA 1L4KA 2AA3A 2QGZA 2Q4RA 1USKA 3AUKA 3KPWA 2EEPA 1NGSA 2HA4A 2J3JA 2QJRA 4RJ2A 3Q10A 3I8XA 2IWRA 4EHAA 4EZIA 5GVSA 1N6PA 2ERYA 2QTAA 3WR5A 1QIEA 3FJOA 1UEIA 1WORA 2I3DA 3ONVA 3A9SA 3EGCA 4M8LA 3RCBA 3AUYA 4L51A 1GL7A 1CRQA 1V39A 4M0MA 2VP9A 1QO9A 1UKZA 3KDPA 3P9IA 5CD9A 1T5BA 1K9VF 1MAUA 1ZIYA 2P2CA 3I34X 3CEPB 1K8XB 1MT3A 3IVAA 3NDIA 2DQYA 1GTG1 2OVBA 2X9NA 1V3QE 4TKVA 4N9WA 5CHYA 1BYIA 4J1TC 2OE2A 3K2QA 2NU9B 3THRA 3FWKA 4ES6A 4DREA 1OXMA 3MCUA 4HB3A 3UT5A 4BC1A 4AULA 5JYBA 1V1MA 3QIVA 1RC8A 4B5LA 1VKNA 5E9AA 4EB6B 3GLIB 4BE7B 3U7IA 3K5HA 4ZQHA 3EPHA 4MR7B 4EPWA 4Z1MA 3F3SA 4MCIA 5AHKA 4MYTA 1KO8A 1M6NA 1YUMA 1KEWA 2OO7A 3W3ZB 1Z74A 3UJHA 2IHZA 4CM4A 5LU9A 2JK0A 3H9BA 2CFSA 1ZZGA 4DLRA 1LDMA 2BV3A 2WAXA 5J2UA 5M7EA 4K9KA 1W6RA 5E2BA 1PFWA 2QI9C 2XLBA 4GLFA 5AOCA 3MTAA 3TS1A 4RCZA 4ISCA 4NZZA 2NUTA 5LLTA 1XEXB 5JNRA 1QSGA 3J7TA 3NETA 4J0DA 4PANA 1KI1A 3CRNA 4A23A 1S96A 4MOWA 2B8NA 2E82A 4KMRA 5B12A 4XLCA 1VCHA 4FHDA 1JWLA 4BLRA 4MQUA 1DQSA 3OD5A 1HNZB 4WY5A 5HHTA 4O8CA 4TM8A 1IN6A 2H1LA 2JLVA 1Q7GA 2BFAA 1I1QB 2W4IA 3CXRA 1M33A 2HA5A 2IYAA 3OC0A 3TLKA 1DGQA 3IQDB 3HJFA 4L07A 4CN9A 5A8AA 4W5TA 3EX7C 3RJTA 4FD2A 3EMDA 1N2CE 3C8DA 3V7WA 1CIVA 1CUVA 2Q4EA 3A6EA 4CMJA 2ODPA 2JAHA 1CULC 4XARA 1NWCA 4FFOA 3BRSA 3B2EA 4G5QA 4O25A 5TF4A 4I9FA 4Q5IA 5IHXA 1PGQA 5KCZA 2VYND 1E5VA 2BJHA 2C97A 4KUHA 5KTPA 4FOPA 2PWZA 3DOFA 3OT4A 2ZUEA 1NASA 2COUA 3H2ZA 3VHXA 2PTGA 3HXTA 3L9WA 4L9SA 4TKMA 4G5XA 4GBMA 1UOPA 1VRVA 2YYZA 3KUUA 4P32A 2J5RA 3C41J 4Q15A 4DCCA 4UVEA 3QELA 1VKHA 1AXGA 3MAJA 1VPTA 1NVKA 3P2OA 6CHYA 4YUAA 2FJPA 1PEDA 4MPDA 5HBGA 2CV0A 5KQPA 4YRNA 4Q47A 3DV9A 3MJ4A 3C1OA 2W2TA 3CRVA 5FNVB 1UD4A 3VR3A 1H69A 2WHXA 1JG7A 1S3GA 1TO6A 4YROA 4DV2B 1A2BA 1EEHA 4CEJA 4JJ6A 1D04A 2IQ5A 5DYGA 2C2YA 4JHLA 2FAXA 3I9NA 2E6KA 2W6CX 3HZZA 4KMSA 5DWDA 1J8DA 4H59A 5WRFA 3LDUA 2G4VA 2NPFA 3B2NA 1ML4A 3RVJA 4YELA 4B31A 1U7OA 4BC0A 4N18A 4PNHA 5BSEA 1RT9A 2O2DA 3ETEA 1CNFA 1BXRB 3BWEA 1EFAA 3SS7X 2BFDB 3GLFB 4HHEA 4UMEA 2OV6A 3R09A 4O5AA 1D6SA 1SGWA 4EFMA 3HFGA 4TGLA 3NWBA 1ZOIA 1V2GA 1HTTA 1I1HA 1TJ3A 1EGMB 2QKYA 4KVZA 5DBIA 1R9NA 3QKSB 4OIFA 4RJJA 3SJAA 4CM1A 1JXAA 1J97A 3I28A 5DBOA 2C5AA 4B4VA 4B83A 2FQWA 3BIWA 2NU7B 1QGDA 1X8KA 2VDLB 2BDUA 5CA0A 1FFXB 3SDBA 5KQRA 3T99A 1T8TA 1Y8RA 5FEMA 3PNYA 2FEKA 4N0DA 1SBCA 1YZGA 4B2PA 1PLJA 3GFFA 3L6OO 2C8LA 3U26A 3RGGA 1ZITA 3U56A 3FMVA 3L0PA 4KXWA 1ESNA 2Z2IA 1B26A 4IGAA 5DNCA 2I1LA 3OPXA 2OL4A 1O5OA 1ZJWA 3QIAA 4PWYA 1AGNA 1JQJC 1PD0A 1T1IA 2AXNA 1RU3A 2YWCA 2WYVA 3O4FA 3SN6A 2AMYA 2G6TA 1DDIA 3OFNA 4MA5A 4F8JA 4BXOA 3RLIA 3GJ6A 1Z3IX 4L76A 4FDTA 5DTMA 4XWOA 1ZGHA 2P3OA 2GGSA 1A88A 1KVTA 3PDHA 4D6YA 4EAAA 5LB4A 2BFEA 4IOJA 4UBIA 2J09A 3I1FA 2LVBA 3IT2A 4UBJA 2GBLA 5CPBA 3TMKA 4YONB 1Z7BA 5JWHA 1NHGA 2YXPX 3E27A 5DEOA 1UL1X 2NO7A 2OUIA 5B4UA 1XCMA 4G4GA 1QTQA 3NIDB 2FN3A 2E1RA 4JITA 1EBFA 3LZDA 4RLFA 2L69A 4JZYA 4FKMA 2OPBA 4DEXA 3KXLA 4RPGA 4ZKEA 2VF7A 4P81A 3GSIA 3A27A 2WSYB 3G5TA 3W77A 5BOSA 3H16A 2C8KA 2H4FA 4FMCF 2G9NA 3COZA 3EVAA 4QPNA 4DLAA 3EA4A 4EJSA 1TU3A 2ZTVA 1RJGA 4Z3KA 3EC1A 2JBAA 3G2MA 2Q3FA 3H5IA 2F43B 4IDDA 2OM2A 5F2KA 4IH4A 2A33A 3NT2A 3EIFA 4HPXB 2YYSA 4M9SA 2L19A 4KYTA 5DZSA 2R7NA 2XMGA 1IEWA 3P2EA 2C84A 3AUJB 1Q6YA 4DCUA 1NBOA 3DFUA 3IL2A 5B1SA 1BU8A 4TVSA 1VLYA 1XE3A 2HTEA 3FJYA 4JQYA 2EDCA 2CHEA 3GIDA 2HF9A 2EW2A 3K0EA 3N74A 4F38A 1M5TA 4N7RA 2RC5A 4XM2A 3K0AB 4CBVA 4KMOA 2C8VA 2CKMA 4R54A 1RFLA 1T0HB 2UYQA 4MDHA 1FJXA 2ZRNA 2K6GA 4Z9XA 5U4XA 3DHEA 4QUDA 1YQXA 3IE0A 3AVOA 5E1OA 1ODCA 5IXJA 1VPVA 2YV1A 1CUHA 2CLOB 4RPDA 2X1HA 3KOOA 1P5RA 1JHDA 1RHUA 2P2NA 2QOEA 2ZUTA 4X8IA 1OAKA 4F46A 2GSDA 2V97A 5LZ7A 4L1KA 3CVJA 2VYVA 2ZULA 2A3NA 3OFKA 1R6TA 1KPGA 3CY6A 4JDUA 3SVTA 1O4WA 1GVHA 1G63A 2IYFA 3IO5A 4FGSA 4NFYA 5CM2Z 1RXWA 4QNNA 2OQ2A 1FZQA 4M9CA 3I52A 1I4DD 1E2IA 2SECE 2B36A 4P98A 2ZROA 3LUCA 4YLYA 2VAWA 2JJYA 4Z4RA 4C14A 3GH1A 2ZAOA 3V00A 4FHCA 4RKEA 3L8CA 2KW5A 4IDHA 4J7AA 4WCVA 1UM8A 4YRCA 2DUMA 1YCFA 2GQFA 1WIWA 2EFCB 3FVQA 1BFUA 2GJRA 3MC1A 3WRWA 4CM6A 3DP7A 1WMEA 2C0PA 2HMUA 2I80A 3OIGA 3ZE0B 1PJQA 3ZWBA 5CFRA 5AQEA 5FTLA 3FHCB 4Q4JA 3HKEB 1FFGA 3B6JA 5HXAA 1ZS9A 1XTPA 3PNBA 1DE0A 3JVVA 3OFSA 1H3EA 1N2BA 4PAAA 3WGOA 4AWAA 1ECGA 3ZCRA 1RAIA 3MJTA 4I4TA 4OHVA 1NN0A 1POXA 5FQNA 5KZMB 2EYUA 4UEKA 5BSRA 5C4MA 1IU9A 1NC3A 2FZCA 3ONFA 3CSSA 4X8OA 4KG7A 4DWVA 4W5QA 1RRKA 2AVNA 3H05A 3LKBA 3TTVA 1GGHA 3EVNA 4LJ9A 1W7AA 2L2QA 1JLLA 1XRNA 4OJQA 2OECA 4CL3A 3U4IA 2YWBA 4NAHA 3FOWA 3AVXA 1XKLA 1Z08A 4S2UA 3F1KA 1U3DA 4TN1A 5KX5B 3OW2B 5CAEB 3F46A 4QOSA 5IP5A 4PG5A 1Y7HA 4WZLA 5AVXA 1RLOA 3WGMA 1MG5A 3X44A 3G88A 2EP8A 2ZL6A 3PA1A 2JI7A 2VAMA 4X6XA 4LBYA 3QVJA 3GEHA 3PL5A 5EJ7A 2CGEA 3M6AA 3UXYA 1MCZA 2SCUB 2UVDA 2VRWA 3H1PA 2CC2A 2POQX 4QO8A 5HOEA 2IKQA 1WHSB 4M0PA 4KSCA 3M5DA 4BNDA 3KTAB 1UP4A 5EHZA 5K09A 3QPDA 5JFGA 2P3QA 2P2DA 1AUPA 1PVDA 3TDNA 2YIDA 1LSUA 4HAUA 5I5GA 3WWPA 1C41A 4ZCMA 3TIVA 5C35A 3UGKA 4MK4A 4O02B 3UT5B 3ODGA 4B6PA 2VBFA 1VL6A 3DE0X 3FFWA 2GKOA 2I8LA 2EFDB 2JVJA 2H2FA 3BMXA 3T1QA 1PBTA 2XNDA 2W9XA 3LPMA 3MWJA 5JDCC 3UHFA 2VDNB 4AURA 3DEKA 3QMPA 1TMYA 1QVWA 3AI1A 3LLMA 4G0ZA 4BL5A 3UYLA 5JCPA 2PZAA 3FPGA 1W1IA 1AURA 1VQMB 1KJNA 3A4YA 3WTBA 4HNTA 1AXEA 1EQUA 5CVDA 1NF8A 4D5GA 5EJ5A 5JYDA 5I47A 4LDQA 4ZICA 4RORA 3SVLA 4V1CA 1JWAB 5BVHA 4CU2A 3GUVA 4DKXA 4F1WA 5I6DA 1KE2A 1CIJA 2EQBA 1S89A 2XE7A 3TL3A 3WRVA 3C5EA 1JEDA 4MARA 3EG5A 4TV9F 5JBIA 2VH5R 2XGMA 4K9RA 4JQZA 1Z5GA 1TU4A 1RYZA 2VR1A 4ON9A 4ENWA 1I18A 1N7HA 1XAHA 2PT7A 4AN1A 2AJTA 2GFHA 4TYQA 5IPFA 2P9ZA 5JJLA 2JFHA 1QYVA 3IDAA 3VPSA 4AG6A 3VU1A 5LP6F 3NQ41 5JSKA 2QZPA 2PS3A 2FEMA 2ZK7A 4ER0A 9LDTA 5FOWA 2QMYA 3KZNA 3QEOA 4IO1A 5AVVA 4B7ZA 2RHOA 1EU1A 4ROTA 1P44A 2CKDA 2IYPA 2VJPA 3O3NB 5LOVF 1DEHA 4QLBA 4FCCA 1C50A 5CT8A 2W6PA 1L7QA 5T6MA 5IJZA 1ODKA 5BN4A 4ALNA 2V1UA 1JSCA 4D92A 2LCIA 1DCTA 4PLCA 1KI6B 3B6IA 1XKTA 4NMLA 1Z0IA 4A15A 5B7GA 4J3NA 1NDQA 2JGEA 3C87A 5JZBA 4BIIA 3RBZA 3CP2A 1JDBC 3RUEA 3N8HA 3CKKA 1CG6A 1VI5A 4P0PB 4PY2A 4TWRA 3FM9A 1VCMA 1S7GA 1SCNE 4NDNE 3VOTA 2DPHA 3KYDA 3NCHA 3ANMA 2W8ZA 3PQFA 4MQLA 3BB3A 4LX8A 4E2FA 1TZ2A 5BW5A 4YBZA 2CB0A 2FWBA 4EEZA 3M83A 3X2EA 1VJ0A 3JYOA 1KK0A 4DPLA 1PTJA 1XVUA 1PZHA 3SS9X 1W0JD 4XGRA 2YNMC 3E6AA 4PFKA 5CJ2A 1PL7A 2E3JA 2XGGA 4A7PA 4CLRA 2OAGA 3PHGA 5HJ7A 4IIJB 1YA6A 3K9BA 4DQ0A 4UD2A 1PZXA 5JYCA 2O2YA 4URWR 3SLKA 1A9XB 4LG1A 3NTOA 1LNQA 1KYZA 1TVKA 3PCXA 3D2CA 4DV4B 1ADYA 2QIPA 1TJNA 3GF4A 4CMAA 1XRPA 2ZSEA 4FJ2A 1BXRA 4UTZA 3I2JA 5LBTA 3S28A 1CR6A 1DJNA 1E3TA 3LLSA 4U00A 1HZZA 1VGQA 2YZ7A 4OYHA 1EDOA 2DWCA 1U4OA 2YRWA 2CL7X 1QH0A 1W29A 4OHXA 1J5EB 2K2WA 2ZB7A 3ADDA 2ZOSA 3LTEA 4BKOA 4IH9A 2HBRA 4HDNA 2V55B 1DAIA 3CUEF 1UDCA 2VDMB 2ECKA 1LXCA 3OZAA 4FS8A 4N5DA 4CU5A 1EGHA 4BRUA 3IKTA 3WQRA 2NP6A 3OF5A 1JXMA 1PYDA 2G28A 2E9SA 5DNWA 2YFKA 4B6QA 4U6NA 1LPSA 4HXFB 5C31A 2A5YB 2VK2A 4XW2A 4LDRA 1RQ7A 3GIRA 5JXWA 5KNBA 3BWCA 3OIDA 3V8NA 1ZMOA 1UK8A 2VH2A 4I14A 1QE0A 2G82A 3ZJVA 3D0QA 3KOXA 5KREA 1M6WA 1IUPA 4QV2A 3OIUA 4KLRA 4WNIA 2QRVA 2X7JA 3C8HA 4QOFA 4GBGA 4Y30A 4JEUA 7ABPA 1JI3A 5IC4A 2DSNA 4FGUA 3I39X 2WKQA 4PHGA 4U5XA 5AOAA 1NU8A 1L4GA 2Z3ZA 1IOWA 1CBUA 3LV8A 5INTA 4BQOA 4F8YA 4MUYA 3VR4A 2AZ4A 4LKOA 2X0KA 4DIEA 3ENQA 5IYRA 4JX9A 3GEBA 1W36C 2YHIA 3OOSA 3S0JA 1LPBB 4BHTA 3E1KA 4LDZA 2BHNA 2XMZA 4OV6B 2VJAA 1PJCA 1FU7A 4EJFA 1ZK1A 4FFMA 2PEYA 1RJDA 4WXHA 5EYPB 4HR7A 2OMEA 3K8YA 5ALFA 2VT6A 3D54D 3EUEA 4BNVA 1GWNA 1DUIA 1XEWX 1ISFA 2ZU0C 1IOZA 2A6PA 1Z5UA 2ZUBA 3A6DA 1ZX1A 3PUKA 4BO7A 1WD5A 2OLEA 3DHWC 4RDHA 4MAMA