1G7CA

Yeast eef1a:eef1ba in complex with gdpnp
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
440
structure length
440
Chain Sequence
EKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ELONGATION FACTOR 1-ALPHA
publication title Crystal structures of nucleotide exchange intermediates in the eEF1A-eEF1Balpha complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 130
structure length 440
sequence length 440
ec nomenclature
pdb deposition date 2000-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1g7cA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1g7cA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g7cA01
1RRGA 2NQ2C 3B1WA 4O2RA 4AG5A 1R4AA 2C9YA 2IYXA 1JBKA 2C96A 1Q1QA 4LV5B 3UMSA 1OJLA 5AUOB 2ZRCA 3FYHA 4HB3A 3THWA 4YMSA 4AURA 2J7PA 3IIKA 3RHFA 2XTNA 1TLLA 2P6UA 3FOZA 4AD8A 1K9MD 3K70C 4M53A 2OLKA 2VRWA 2O8CA 3LO5A 1TF5A 3EASA 3CWQA 4Q18A 5LD2B 3KKMA 1VQ4B 3W2GA 3W2HA 5JMTA 4A6PA 2GF9A 1GG2A 1NMYA 1S1CA 2ZSEA 3FTQA 2HMAA 4UXIA 4A82A 1QHHB 1E2PA 4C0SA 3BH6A 3TSZA 4IOKA 5JWRA 1HQYE 1GAQA 2IYTA 4PPFA 1N5IA 2FV8A 4I1OA 2C9CA 2B21A 2JLUA 5HXBA 2J5XA 1E1QD 4C2TA 2ZRMA 4TLCA 4PZYA 2J45A 1E98A 1R10A 1S9HA 3KFXA 1XTJA 4AI6A 4URZR 4C7OB 5DNYB 3OFND 2HF9A 2HT1A 2KWIA 4OKSA 3TSOA 2NZJA 2QUZA 2CRVA 2QSZA 4Q4AB 1UM8A 3LWNA 4JVNA 5AJYA 4YC7A 3V4FA 4GZMA 1EWQA 4JLPA 4ZV4A 1BKDR 4UNSA 3R9WA 4JL8A 3ZVLA 2AFHE 3GLFB 3OZUA 3OAAD 3PUZA 2RAPA 1E96A 4PO9A 3EZFA 4DBLC 1W4CA 5TY0A 2R6HA 1DVRA 2C03A 2F1IA 2CEAA 4RFVA 3AV0B 1FNNA 4KFUA 4OI1A 4B3DA 3KKQA 4YAOA 1IN7A 3A1TA 4CEHB 4PC6A 3CLVA 4DB4A 1AS3A 3T1VA 2FE4A 2NGRA 3I4LA 3W34A 4CVNA 2P6NA 2O8FA 4GOJA 3P32A 4ZDWA 1JAHA 2D7DA 3LLUA 3CF2A 3KQHA 2FG5A 1IN5A 4RZ3A 3ZH9B 1GNQA 4KAXA 3OJXA 2IC5A 1T8TA 1ESNA 1NBMA 4IRUB 3DKPA 1XZPA 2ORIA 3PG5A 3KJGA 3LQRA 2QQ0A 1NG1A 3I56B 1T5LA 2WM9B 1DE0A 3GJXC 4P4TA 1GRQA 2FX3A 4R98A 2WPDA 4PHFA 3TJZA 1OIWA 1RIFA 1UJ2A 4DCUA 4A0HA 5KSYA 4JLNA 3NC0C 1KSGA 5KU1A 1JI0A 1SXJA 3ZDQA 4ZCIA 2CCJA 1QFJA 2XJ4A 1SZPA 5JBQA 1VG8A 2ZJ2A 3ND8A 4BUJA 5F98A 4DCTA 1U8ZA 1Z0FA 3QXHA 1W0KD 2C78A 3LVRE 2AXPA 2FU5C 2IHYA 1A5TA 5C18A 3TGPA 2QZ4A 2BKEA 3SOPA 4GOKA 2YWFA 3BE4A 4ASUD 4D0NA 1OH7A 5EE5B 5EP3A 4B6EA 4JVSB 5BYKA 5JI3E 2O5VA 2XITA 3WP1B 1TF2A 2VP4A 4TLAA 3LA6A 3PEWA 2OILA 3BFVA 1CULC 4BASA 3L2OB 4C0AC 3IDQA 2ZR0A 1QGZA 3A1SA 2ONKA 2QT1A 3N2EA 3ONWA 3U3OA 4RVCA 3CIOA 1NLZA 4C3ZA 4RSGA 2ZRAA 3W5HA 1VG0B 2QE7A 2W6JD 3AGPA 2GK6A 1RKBA 2N42A 4B35A 1U94A 2QMOA 1KJWA 2ZSBA 4IDHA 2R6GA 2YV5A 4DSUA 5CDFE 5K8LA 1YJ9B 4D6PA 1D2MA 1RJ9B 1ZP6A 1KAGA 3NBZC 2E1RA 2BHRA 1X3SA 4B34A 5C46F 4A36A 1N5LA 2PCLA 2QEXB 3AB3A 3NXSA 1BX0A 4TZ6A 2WIAA 1E0SA 1OSNA 3K0FB 1YJNB 1GKIA 2WAXA 3S1AB 1KI3A 3AVPA 3IKJA 3QFTA 2GKSA 2H18A 4OJQA 2VF8A 4M1YA 4Q00A 2XNCA 4BPRA 2BC9A 2ZREA 5FTNA 2QTZA 4WQMA 4EDHA 1HURA 1U0JA 3IUYA 3SFVA 3FJOA 2H7VA 1M7BA 2W83A 1MO4A 1R5NA 4Q5IA 1R6BX 1NN1A 2ZE7A 4MRVA 2ZS9A 4NZYA 1VIYA 4H9GA 2GXSA 2QSYA 1U9IC 1NY6A 4ESVA 2WJVA 2ZRPA 3DHWC 3KDSE 4HLCA 2BF4A 1GL7A 2NO9A 2LWIA 2V7QD 2EVWX 4TQAA 5CIWA 3RSLA 2IEYA 4XJXA 5J5CA 4A8JA 5IF9A 1OH5A 5EP2A 2ZITA 2R44A 3BB3A 4URUR 4G5SA 3BK7A 3UMRA 1OKKD 2FH5B 2J59A 2IX3A 3K9HA 3GLIB 2GWHA 2D62A 2IYYA 3LRPA 1MV5A 1YR8A 3REGA 3KTAA 5FBLB 4FCWA 3OW2B 4TYWA 4LY6A 1I4LD 3P1JA 4CW7A 3PR1A 1L4YA 3X1XA 5H59A 3PENA 2YZ2A 1Z63A 3AGQA 3CRW1 2G0TA 2FGKA 4QNMA 3ZS9A 4Q19A 4LJ5A 4C4PA 4Q7LA 1DO2A 1LVGA 4Q4JA 4M2LA 1WA5A 2VBCA 3DDCA 3X1DA 4HAWA 4C0KA 3THYA 2O8CB 4I81A 2X3UA 4DIDA 5BN4A 1QBKC 1KI6A 3K1JA 4B76A 1BMFD 4QGAA 3LV8A 2AXNA 2FN4A 1ESMA 1RYHA 1XX6A 4POAA 2MSEB 5G53C 5CITA 1WBBA 1M6NA 2IS6A 2NPFA 3QNUA 1X8LA 3IBGA 4MKFA 5BXQC 5HCIA 4NONA 5IDVA 1BS1A 2XAUA 3AVXA 4F4IA 3AVTA 4MYUA 1NKTA 1FZQA 5CM8B 1W2BB 1US8B 3HYTA 1KC8D 2H16A 1KDPA 4Q03A 1EFTA 2GJ8A 2ZS7A 2FOLA 1DAKA 3LX8A 4X8OA 2V6IA 3N5CA 4B2PA 5FUVA 3QPUA 1XBTA 3ZVRA 2RC5A 5CDFA 3DOFA 2WTUA 1SVOA 1M7HA 3VKHA 4FXPA 3FDIA 1MABA 3SC3A 4B2LA 3NBYC 5FOVA 2J0UA 3W2IA 4GBMA 1XTRA 1O3YA 5EE9A 4RD6A 1IXZA 4MYHA 1T0HB 2ZJ5A 2V8OA 2CXXA 4N3NA 1EWRA 1GKUB 3QKRB 3CZPA 4KI0A 1GILA 1ZAKA 2OAQ1 2XOKD 2O8FB 1E0KA 3B82A 2I1QA 1II0A 4G5OA 1HE8B 2IYWA 3G82C 4P4SA 4PXAA 3U44B 2HF8A 3L43A 3T1TA 1MKYA 3DEFA 4BFSA 3KKPA 3U2QA 1N6PA 5CJPA 3QF4B 3P26A 4FMDF 4TTQA 4LWZA 1GAJA 4FCVA 4GPTA 2W0SA 2R6CA 1KHTA 3FKSA 5SZIA 3T15A 1DAMA 1E1RA 2G88A 3RS7A 1VECA 4M9XA 1D6JA 1TF7A 2FSGA 4PHTA 2OK7A 5AJZA 2H8KA 5KHOC 2WSMA 3B6EA 1BIFA 1YU9A 2D06A 4EFNA 4EPRA 4UNRA 4L4UA 3TK1A 1PUIA 1MR3F 1I4TD 4MGZR 1JR3D 5TARA 4B74A 3A8TA 1KYIA 3R20A 3T5DA 4B44A 3D7MA 1D1NA 4YAUA 1K8AD 3FKQA 4GNKA 3CCUB 1MRNA 1KI7A 1II8B 4DQKA 4P4UA 4XVUA 2OK8A 1E0JA 4B3XA 5JCZA 3UPUA 2HUPA 4ZCLA 3OIYA 1LTQA 5SZKB 3REFA 5AWFC 1ZUIA 1CP2A 1JB1A 1AS0A 1XTSA 3OIWA 4IVPA 1A8PA 3VNUA 2IK8A 3A4MA 4RZUA 4MRNA 2FSIA 4BWYA 5FPHA 1OB2A 2EW1A 1FOEB 1D5CA 2I1VB 4M1SA 1L7VC 4QGHA 4DKXA 5GADl 3G6EB 1UBCA 3AUXA 4LBYA 3LBIA 1TQ2A 1M90D 5DI9A 4AY2A 1U98A 1KSFX 1JJ2B 2PMKA 1CR1A 1A2BA 4DHEA 2CLSA 1V5WA 4F91B 3A6PC 3SJAA 3R7WA 1HTWA 1E4YA 5EMNA 1BX1A 3EZ2A 3KJHA 4Q7KA 3QI2A 2CBZA 2PEYA 1F2UB 2BBWA 4II7A 3C16C 1J9ZA 2IW3A 4LJ4A 3SNHA 1XPUA 5FPYA 1IB0A 4ZIRA 4BQSA 1X6VA 1TMKA 4FMBB 1F2TB 4RZ2A 5BN5A 3TUJC 4BFZA 3LY5A 2ZI3A 1RFLA 2R6DA 4DDVA 2ZRHA 3CNLA 3O8CA 4GT1A 5KTYA 3NG1A 1ZUNB 1ZW6A 2VHJA 3CH4B 1FNDA 3W2FA 4LUCA 4M9ZA 5G40A 5TB5A 2J46A 8OHMA 1OFTA 4RCZA 2FNAA 4C0BA 4DRZA 3LVBA 3A1WA 1FUUA 1GTVA 1JA0A 4O0MA 1Z47A 3ZQJA 1DO0A 4GP7A 3CB4A 3EAQA 1SXJC 5G41A 2X8AA 1KGDA 4EPXA 3PXGA 1SM4A 1OYWA 4TYNA 4JVLA 4MKIA 3VAAA 1JEEA 3ICEA 1CJUC 1HUQA 2ZR9A 5SZHB 4AF7A 3NH9A 3SI7A 2ZI9A 3BH0A 1NBMD 3I73A 3VQTA 4GL2A 1K5GA 1FTNA 3KXLA 1AA9A 4S35A 1E1QA 3MLEA 4D4KA 3ZJYA 2OLJA 2QA5A 3E1SA 4LJ7A 1AGPA 3GQBA 3I8SA 3NH6A 2EFHB 1QHGA 3OFNA 5KUTA 4QBIA 3FPKA 3B9QA 3TE6A 4YQFA 3IILA 1TX4B 2GEUA 5FI1B 1TQDA 2ZRGA 3THYB 1ZU4A 1ZUHA 3T34A 5AJWA 1XD2B 5KYKA 2O8BB 3I3SR 1G3QA 2PZFA 3RVBA 1E2GA 3UK6A 5E7MA 1Z6GA 1IY0A 1G6HA 4A2PA 4Y0VA 1Z6TA 3B1ZA 3OAAA 4HAUA 3NEJA 2A30A 3C8UA 2ZANA 1BJKA 2RH5A 3AVUA 4PAMA 4V03A 2Q9BA 2BVNA 1N6LA 1P9NA 3AKCA 3L0IB 2W00A 3K0CA 4X8LA 2FDCA 1ZM9A 4GP6A 2BIFA 2FPMA 1X8KA 4F7WA 5GVRA 5F2EA 3EWAA 2HEIA 3AQ4A 3JVUA 3FGNA 2QE7D 1JQLB 3KQNA 5DGXA 1KNXA 2HXYA 4B75A 2F6RA 2ANBA 3QE2A 1FPMA 2ZUCA 2XXAA 2QAGA 1GVNB 2RGGA 1ONBA 3T35A 1Q3HA 4CEIB 1EG7A 3MWYW 2G6BA 4EJSA 4ZKDA 2IUSA 2RGNC 1OLOA 3BXZA 3CRRA 3F5FA 3U4QB 3NKVA 4MH0R 3QKSA 4ILEA 1KSJA 4A8JC 1WB9A 1IONA 1ZMXA 2LKCA 3E20A 2GJAA 5EXSA 5JFGA 1P75A 5KDOA 3QF7A 2DHRA 5L3QB 1AM4D 3CRVA 1FNBA 1GDDA 1NP6A 4Q9JA 3B8HA 1BYIA 3AVYA 2X2FA 4AG6A 1CBUA 3KUCA 1HEIA 3SS8A 2QN6A 2A5JA 4WXRA 2PH1A 1XMSA 1MRSA 3UANA 2WVJA 3U61B 4Y0AA 2VO1A 3ZZUA 3C14C 4E22A 3ADKA 1XD9A 4A2WA 4CEJB 3E1YE 2BMWA 2QRZA 3VO2A 1XD8A 1Q57A 5EE3A 4ZDIA 4RFSB 2MSDB 1SVWA 2TMKA 1GUAA 5KSWB 4JL5A 2A2ZA 3ES9A 2DEUA 2WIBA 1F48A 3BOSA 4LGMA 4D0LB 1QHHA 2QMHA 5E7JA 4IDOA 3BERA 3QBVA 3CO5A 4AF6A 2W6JA 4Q1AA 3UWKA 2CDNA 4XH9B 4RKEA 4URVR 3U4QA 1W36B 2QTVB 2CL7X 4JS0A 1Z07A 1CEEA 1QVAA 4HUTA 2B8WA 2OCBA 2IBMA 2VSOA 2A5YB 3JZAA 4C7OA 3VR3A 5HR5A 4FMCB 4K81B 1NL3A 3WYAA 1HA3A 4IW3B 2CVHA 1XTIA 3WBJA 1J8YF 2WJGA 4Q4AA 3SHWA 2GDJA 2WMNB 5FPTA 5H68A 2OO7A 1DOAA 1UBFA 1Z0IA 3HU1A 4GDFA 4IVQA 2FZLA 1SVMA 3QIAA 5JEEA 2BN4A 2D74A 2HJGA 2KSQA 1KI8A 1ZNYA 2QENA 1ZM4A 1G291 2F1HA 4Q48A 2IWHA 3U7GA 2JLXA 1NLYA 2GCPA 1R0YA 4BPBA 1NVUQ 1R8QA 1ZM2A 2WOJA 1ZVQA 4KVGA 2QM8A 4BFWA 5J4YA 1H8HD 4LZZA 4UJ5A 2O8EB 1W0JD 4OQLA 1S4QA 1E99A 3Q9LA 2GBLC 2V7QA 3K09A 4R9UC 3GLIE 1HH4A 2WV9A 3B1VA 1GRNA 4PZLA 5DYIA 3CF0A 1OKKA 4NCIA 3U7FB 1JR3E 2V55B 4PPQA 5TV2A 1G4UR 3L8ZA 1SVIA 4IEIA 1I7PA 3DZ8A 2WKPA 3E2IA 3ZYCA 2A5GA 4KYIB 4KV9A 2DYKA 3G0HA 3TQCA 2DB3A 1VIAA 2QNRA 5FTMA 4MDEA 1KI2A 1FMLA 1ZJ6A 3JQQA 2JJ8A 2QMEA 3U3JA 1M1YE 1CJKC 4C30A 1AGRA 3NHBA 3JQPA 4PO8A 4HDCA 2P2LA 3BAFA 5JI2E 2BMFA 1EWYA 4LJ8A 1Q7YD 3AP2A 2CNWA 2MSCB 3M6AA 2ZS8A 5IHPA 2P65A 2W2TA 3GFPA 2NO0A 4P6VF 2GEVA 2VPPA 3B85A 3GJ8A 4ZDJA 2O0KA 4PSVA 1N6RA 5D3MB 4QL3A 1XWIA 2ZJAA 3RAPR 4AK9A 1QX4A 3EIQA 4DDTA 3U7EB 1IHUA 4HDQB 1U0HC 4DLXA 1VQNB 3R8CA 1H42A 3RRYA 3R8FA 3MWJA 4B73A 4BLSA 2CLCX 3GJ6A 2OM2A 1W36D 1CLUA 4U7DA 1AZTA 3VR2A 4XSGA 3FWYA 1ANKA 4E09A 3ASZA 1UDXA 5DISB 2G9NA 1P2UA 3RS2A 4MQBA 4RD3A 3MJHA 5K8TA 3CCMB 1RJ9A 4NU0A 4O3MA 1OXSC 3GJ3A 4OYHA 3TMKA 2CMKA 1GM5A 1E2JA 4EQ6B 2EYQA 4LYHA 1MH1A 4YDHB 4KO8A 3K0FA 3A1VA 1K8RA 1WP9A 3S1AA 4D82A 2JLYA 3HJNA 1AZSC 1OIVA 4ZI3A 5JSZB 2UKDA 2VLIA 1WBDA 1N6NA 4DEYA 2XOKA 3Q72A 1FUKA 3A37A 4ABYA 2BBTA 2VHTA 3DMNA 3E5HA 3ECCA 4IJMA 4JKYA 421PA 3W8RA 4QKQA 1S3GA 1RRCA 4NBSA 2PBRA 2QPOA 2QP9X 2WWHA 3IEUA 3SYNA 4BZXA 5ANRB 4P3YA 2DFLA 3RSOA 1QHNA 2K5UA 4I1SA 1R0XA 3CC2B 1XXHE 4PPNA 3SN6A 1G3MA 4PTLA 4QM7A 2YNMA 3CX7A 4TYPA 1C1YA 5FUYA 1GRRA 4Q01A 5E3HA 4TMZA 1R5BA 2EIXA 4E07A 2PJRA 3QG1A 3GLIA 1GITA 2GESA 4O25A 3W90A 1DELA 2OFOA 4OI0A 1JR3A 1P2TA 4NCKA 4JLAA 3KB1A 4QNRA 1C9KA 2QG6A 1GOTA 2YHSA 5CLLA 3WNBA 1F20A 3BJIC 4JJKA 4RZXA 3RS3A 3K9NA 1G5PA 2ONJA 3GEIA 2ZI5A 1I4DD 3GLHB 4B3FX 1N6IA 3CCQB 2B5OA 1FFHA 1D8TA 4DLUA 1R2QA 4K8OA 3B13B 1M1KD 4IOJA 4MRPA 3CPJB 2ZJBA 2ZJYA 3L82B 3ADCA 1E2HA 2B6HA 4M1OA 4TMVA 5EP1A 3QKTA 1VQ5B 1Z2AA 2OTLB 3MAAC 4YMVA 1Q82D 1TTTA 3HR8A 3CR7A 4BZQA 4JVMA 1GNRA 1DPFA 5FI0B 1US8A 4X8MA 1VTKA 5CK5A 2C04A 4YMWA 2EQBA 3N70A 2VSXA 4OJKA 3K0CC 1R7RA 2N46A 4Z51A 3HYRA 4Q7MB 2QMUA 2IXGA 3WMEA 3CX6A 4C0HA 1EK0A 3L8YA 4TT3A 5EUQB 2O8DB 2ZM5A 3BB4A 4JL6A 2BMDA 1GJRA 4RD2A 3LX5A 3W3AA 2QAGC 3N2IA 4V0LA 3WHKA 2JDID 3THXB 3NIBA 2A7QA 3U6BA 2R9VA 1OH8A 2OZEA 4KXFB 1L8QA 4DEXA 4EJSC 3GJ7A 5TR9A 3MWLA 5LPNA 4GFDA 4PQRA 4EIWA 3QKRA 1WRBA 2YOFA 4QBHA 1KZ7B 1SHKA 5CM9C 3UG7A 3FB4A 1OIXA 2R65A 1Q21A 4NTZA 1LV7A 1Z6AA 3A1UA 4LYJA 3NC1C 4N3GA 3FHOA 1KJZA 3U44A 4LJYA 1W87A 3LBHA 2WAYA 4OQXA 2CK3D 3KJEA 3OJWA 3QF4A 4QM6A 5HE8A 3T12A 1A2KC 1P4SA 2EFGA 4BE7B 2F1JA 5LD2C 2H92A 4IXMA 4ZGNB 3C4JA 2IA5A 2VIIA 3DO6A 1ZRHA 1GR1A 4DXAA 1AIPA 3LH5A 2FFAA 2NZ8A 1MOZA 5EZ5A 1GWNA 1XP8A 3GEEA 1YZLA 1TUEA 2R6AA 1CKEA 3MFYA 5AK0A 3GCGA 2RGDA 1Q0UA 3LAWA 5DHFA 2GAAA 1E9FA 2VNHA 4AYXA 3EPJA 1VYUA 2JLQA 4BLTA 5FL7D 2P0EA 4IHQA 1II8A 2G1KA 3AF2A 3PCRB 4KSBA 4G1BA 1W2HA 1Q81D 2RGCA 2ZRNA 2WWFA 3TNFA 3H1TA 1COWA 2OV2A 3FFAA 4ACAA 4WXPA 3LXRA 1NJFA 3SBDA 2QTFA 1KK1A 1Z06A 2BBOA 4WZBE 1P9RA 2HJVA 3EG5A 4UNPA 3HR7A 1U81A 1N0VC 1AK2A 1U99A 4F4CA 3QFRA 2Q3FA 3W9YA 4NP6A 4RJLA 5GV8A 1P5ZB 3AKYA 3I61A 1SVSA 1IXSB 2XX3A 1Z08A 3EARA 1VG1A 1XFAA 3UWOA 4W9MC 2OTJB 1F2UA 4DJTA 5GJBA 2F1RA 4B32A 3BBPA 5CB8A 1RZ3A 1Z0AA 2ASEA 4BRUA 1QHXA 4C0JA 2WJJA 4D25A 2XSZD 1F2TA 2ZUDA 3B1YA 3V9PA 1EFHA 3CRQA 3MUFA 5FOTA 4DWJA 2H57A 2OCAA 2XNDD 4B3BA 4TTPA 1U0LA 4G01B 2FF7A 2CNDA 1Z6XA 1KI9A 2REXB 3EA5A 2FFQA 5FBRB 1KK3A 5AN9A 3KKNA 3CR8A 4HZUB 2AFIE 2RGXA 5DI3B 1ZD9A 5CYOA 2AR7A 4Q9HA 3QFCA 4EH1A 4HLUA 1D2EA 1GSIA 1LF5A 1KDTA 3WRYC 3I32A 5DH9A 3TW4A 1NVXQ 4IFBA 3W6PA 5DE3A 4A0RA 1NSTA 3OF5A 3QUSA 3MD0A 2IS4A 1G8YA 1NRJB 2QM7A 1FTSA 4KBFA 3PVSA 1FQKA 1QFZA 1UFQA 4QJ4A 3QKUA 5DLQC 1G5TA 1E2MA 1GVHA 4JYBA 4U02A 2ZSDA 2J9RA 2PCJA 821PA 2G77B 1G5RA 2GETA 2ZJOA 4AKHA 1LS6A 1RVDA 1VHTA 1ZYUA 2YYZA 4I1VA 2IUUA 1ZCAA 4W5JA 2JIZD 3PFIA 4LDJA 3RYTC 1G7TA 2VL7A 2FWRA 3PUXA 1IN6A 1XD2A 2ERYA 4K46A 2O8BA 1AQUA 4B3GA 4XTCS 2JASA 2C9OA 2CNWD 1CF4A 2Q0HA 1QVGB 2AL7A 2B7BA 2ZAOA 5L3SB 2BEJA 1NVVQ 3PUYA 3NDBB 3H2YA 4IOMA 4AIIA 4E5UA 3O8RA 5JCPA 1H8HA 2Q6TA 1P62B 1R0ZA 1KMQA 1W0JA 5AUQA 4HSEA 3ZD6A 4G1UC 1KDRA 5FOSA 3QPWA 4DLSA 5KPJA 3D3QA 2CHVA 5DHAA 2WJHA 2H17A 2Q3MA 2IYSA 1T3HA 2ZR7A 3SQWA 1M74A 4EAQA 4PSKA 2QPTA 3F0TA 5DN6A 1XTQA 1PUJA 1ZC4A 5EZ6B 2AWOA 2IF2A 4CEIA 4GMXA 2PL3A 2EU8A 2BPOA 1MT0A 1QHYA 3BD9A 3B1XA 1B23P 3M0EA 2WHXA 3TQFA 3VHXA 1AKYA 1XF9A 1VQMB 2W2XA 1VQKB 2UVQA 4F92B 1OGIA 4U9UA 5HZHA 5KDLA 2HCJB 3DL0A 1G7SA 2OBLA 4I99A 2BJWA 5L3QA 3GMTA 4DSTA 3VR4A 2FFBA 2B8TA 2W58A 1TPZA 4B6FA 5L8VA 2G83A 1DBSA 4TYQA 5JJIA 3AVVA 2NIPA 1OYYA 3WNDA 4DIEA 1RC8A 4LCBA 2XEXA 1ETUA 3QFSA 2FZ4A 3SYKA 1NF3A 4TWZA 4GOXA 3AUYA 5B64A 1ZM3A 2DFNA 1KI1A 1KNQA 1SULA 2ATVA 4CEJA 2OE2A 3K9LA 4TQ9A 4EFMA 4Q1BA 1XB2A 2GVDC 1UBEA 1CTQA 4LHZA 4RFSA 1X1SA 2OUKA 3H84A 1W4BA 1XJ0A 5HTKA 3AP1A 1DADA 3EC1A 3MSXA 5FOWA 4F93B 4EPWA 4WA7A 3QSYA 3CCVB 2A5DA 4NE2A 1XXHB 5KSOA 1E2EA 1OXVA 1JJ7A 5C1BA 1A1VA 1E0AA 2W6IA 4JT2A 3SEAA 1JEDA 3VR1A 1U2RA 4PZZA 1TAGA 3OEHD 1OFUX 1TNDA 1KI4A 4P31A 1VYTA 1LS1A 2QDXA 2PLRA 3AVQA 5HKKD 1UADA 5J4KA 3ZIAD 3RC8A 2UZ3A 3PIRA 2X1VA 2ZROA 3Q5DA 1KRHA 1PVOA 1F6BA 2J0QA 2GJ9A 1QG2A 3KXIA 3ZC3A 4PC3A 1A7JA 2MMCA 2W2VA 2GA8A 3V00A 3PEUA 2FMXA 1NJGA 2P3SA 1E63A 2VTKA 3NEYA 4UQOA 5TDHA 3LFUA 4CGZA 4YMUA 1PLKA 2P5TB 2NO1A 4NDZA 2OCYC 4HB4A 3VR6A 5FBQB 2O8EA 1Q12A 3LBNA 1F60A 3NHAA 1KO8A 1OF1A 1EFRA 1YITB 4N1AA 4A15A 3QPVA 2BWJA 2HLDA 4TLDA 4HATA 1N6HA 4DVGA 4E03A 1VHLA 3GFTA 1PLJA 3EWSA 4JBWA 4LBVA 1G21E 4MA4A 1KSHA 5LBIA 2QAJA 4LHWA 4TT3D 4Q66C 1E2FA 4KSCA 4UNNA 4DCNA 1EXMA 1P2SA 1P73A 5AJXA 1EESA 2EFEB 3A4LA 5K8UA 2Z43A 4OK6A 2RGBA 4MKGA 4JJZA 3VR5A 4MYTA 2GTPA 4CT4B 1WMSA 5IK2A 1NMZA 3BWDD 4QGFA 4U00A 4D2IA 1RPZA 1WDTA 4KLZA 1Z28A 4OHXA 4LSGA 3GLHE 4LOAA 2QTLA 3U60B 3UKDA 1JAIA 1EGAA 3CRZA 2NOAA 2OESA 2R8RA 2REOA 4DB2A 4EPYA 5H70A 1BOFA 5ELXA 5J4LA 2QBYA 3OEED 5FL3A 3TUIC 4BLRA 4LHYA 4G5GA 2CHGA 1XJQA 2P5SA 2WKRA 1KOFA 3QBTA 4GRAA 4RD4A 1Y63A 4L16A 4XWOA 3QEOA 3QG5A 2RKOA 4XWKA 2VNKA 3E70C 4NCJA 4QJ5A 3KXKA 3WMFA 5BYJA 1G7RA 5D3MA 3RRMA 4MKHA 1NY5A 1LB1B 2ZVQX 5FPSA 3KX2A 3Q7QA 4JLKA 2DBYA 4Z1MA 4MYCA 1FL9A 4PFSA 3VFDA 3EZ7A 4B47A 3TKLA 4LHXA 4FWTA 4LHVA 2XGJA 5G3YA 3AVWA 2GAOA 3WBKA 1N0WA 1E62A 3SYLA 1QG4A 1E2NA 2I4IA 2WKQA 4A92A 2JLZA 2DFTA 4BRWA 3HU2A 1T3SA 3CCSB 3LQQA 2IYVA 3QOFA 4HI0E 2FSHA 5G3ZA 4EQ6A 3X2SA 1XCMA 3R9XA 3TAUA 2JDIA 1G8GA 1W5SA 1MO5A 1CR4A 5A4JA 1Z6YA 3U6KA 2C77A 2QEQA 1COWD 4ZGQB 1N3BA 2ZE5A 3IIMA 3MG9A 4QHSA 4V0NA 4WAUA 5GJWC 5JSZA 2WWIA 4QRHA 4TLEA 5FUWA 2J1LA 1PZNA 1CXZA 3AKEA 1VCOA 2W0MA 1HY3A 4UXHA 4DLRA 3GD7A 3RC3A 3TW8B 4B71A 2ZSFA 1Q1EA 4JLBA 1GL9B 5J47A 1G20E 2F3RA 4G5RA 4ARZB 2CK3A 1KKMA 4V0OA 4YXWD 3OZVA 5D3QA 2RC6A 4HAXA 5JHHB 3MGCA 1T91A 3WXMA 1NJID 1T4GA 2H1LA 4L15A 4DCVA 1YIJB 2JLSA 4HE5A 1IXRC 1UEIA 3VO1A 4HLUC 2X2EA 1HQCA 3PUVA 1G8HA 3RNLA 4HB0A 1D2NA 1KK2A 2PX3A 4B33A 2NO6A 2BEKA 3IHLA 4N0DA 1TEVA 2GCOB 4M1KA 1AJEA 2GXUA 4JKIA 2EFDB 2A5FA 5IRCD 3W5VA 1CIPA 4JZKA 3ZLJA 2ZRIA 2VP0A 1G9XA 2Q9CA 3P20A 1LW7A 2XTZA 3SQXA 3QENA 1OXXK 4NYMQ 5JJLA 2GRJA 5B58C 3TBKA 5FL7A 3WP0A 1P72A 1G8FA 2AD5A 4DLYA 3UG6A 2VYFA 3GLHA 3VU9B 4HYYA 1QRAA 5KDDA 2GXAA 3TH5A 3MMPA 4S2EA 3BORA 3G71B 1JALA 2ZRFA 2IYRA 2IT1A 1VQ9B 1Z83A 3I1FA 1BO6A 4M1MA 5FBWB 4HLQB 1KJYA 1UKYA 1J90A 2Q21A 3KQKA 1D9XA 4FMDB 5JWOA 4AYWA 3IGFA 1OE0A 1AN0A 1KTVA 1VKJA 4FW9A 4HUQB 2KBFA 5JS7A 1YJWB 2D3WA 3IHWA 5FTKA 4C43A 3CRMA 2V1UA 5FBVB 3TR5A 5LDDC 3MCAA 5UKDA 4L9WA 1E9CA 3RWMB 1YZQA 4MUBA 2YWHA 3L0OA 2ZTSA 3EW9A 4JLVA 2ZUBA 2XSZA 2YOGA 1KO4A 2AX4A 2DWPA 4DZZA 2O8DA 4PPGA 2ZXUA 2XNDA 1DAIA 4XSHA 3Q85A 2HXSA 4KVAA 2ZEJA 2WICA 2YC4C 3AF0A 1NNEA 4Z8XA 3THXA 3CONA 1SQ5A 1YHQB 1M7GA 5F3WB 2RHDA 3EIEA 3PEVA 2V9PA 3WRXC 5A5GA 2KE5A 3CZQA 2ZPTX 1YR7A 3TSWA 2FPKA 3K0EA 1EP2B 3PITA 1DAHA 2YKGA 3QY0A 3ADDA 1SVLA 1BQEA 5TVKA 3JVVA 1WF3A 2OFXA 2VHQA 3IPYA 4FD2A 2KB0A 2ZJ8A 3JQRA 3IPXA 1X1RA 2WSSD 4D4JA 1KMHB 3RS4A 4OBEA 4FWIB 5DN6D 3GEHA 4IDPA 4XTRA 3TVTA 2ORWA 2WWWA 2ECKA 1E64A 1J8MF 1YZUA 2IUTA 2CJWA 1XMJA 4JYCA 3RRNA 1JJVA 3WMGA 3LW7A 3U3RA 5SZJA 1XU4A 2BM0A 3W3ZB 3CCJB 1CU1A 1CQXA 3I5YA 4OL0A 5JRJA 1QHSA 4JT4A 4QOSA 2G1JA 2JIZA 1TL7C 3CWZA 3WHLA 2GVZC 5KNBA 4BFXA 1SGWA 4NYIQ 5FPKA 1JA1A 3FHTA 4YDSA 1NVVR 2ZSAA 1NN3A 3CMAB 4Q21A 1W36C 4FI3C 2QBYB 2GJKA 1WQ1R 4WZAE 1EFCA 3Q8XB 1KY2A 5C2JB 1VQ8B 4DDUA 1YQTA 1GAWA 2VP6A 2R2AA 3C5HA 1DS6A 3IQXA 2Y8EA 2BM1A 1EX6A 4DSNA 3AEZA 1YR9A 1OV4A 1K5DA 1U9IA 1CS4C 4TLBA 4CRWB 1U8YA 3QQ5A 4NMMA 3RLFA 1NKSA 4PGOA 3EX7C 2ZRJA 2CCGA 5TMPA 1IN8A 1VQLB 1BYUA 1PV4A 1W47A 3SJZA 5DSZA 1NIPA 2W6ID 4A1FA 3CNNA 1Z0DA 5HCNA 4ZCMA 1YZTA 4IXNA 2XZLA 2PIAA 1JNYA 1T6NA 1FDRA 1CRQA 2IXEA 2ZVPX 4LRWA 2XNSA 3JZMA 2C5LA 3ND9A 1E2IA 2Z83A 2IWRA 3T1OA 3U7HB 5JECA 1XZQA 2CE7A 2PEZA 3CPEA 4JIMA 5EUMA 3K70B 1VQOB 2OXCA 2UZIR 2JLWA 1S8FA 1UF9A 3I72A 3OHMA 1S96A 2BSAA 1M8PA 1XEXA 4HAYA 2JJ1A 2ZETA 3D31A 4HZUA 4MRRA 4FCTA 2BCJQ 4JLOA 5DI3A 2VP5A 4OHVA 4P0TA 3CMEB 3I5XA 1EFRD 3BB1A 3Q5EA 2GCNA 2A9KA 1X86B 2HLDD 2JLVA 1JECA 3L0SA 2CHQA 1E69A 3OZXA 1E94E 1CJVC 1Q1BA 1II9A 2DY1A 2G0NA 5FR1A 3CC7B 1QVFB 4JLDA 3CCEB 1IBRA 2BV3A 2AKYA 4V0ME 1ZM7A 5JLJA 1XJCA 4OQMA 1CJTC 4LV6A 3GJ5A 3KKOA 3GLGB 3QJYA 3EPHA 5F9FA 4MITA 3OEHA 3THOA 2IYUA 3FMOB 1AMOA 5HKKA 5IK2D 2PJZA 3LO8A 1P60A 3CM0A 2YWGA 3ZIAA 1FNCA 2ZAMA 4CF7A 1S2MA 2ODWA 2PX0A 3P4YA 4LI0A 3KJIA 4EPVA 4AYTA 2AK3A 1AKEA 1DG3A 4WVFA 3K9GA 2V54A 2ZYWX 2J41A 3OESA 2DPXA 3AF3A 5FTLA 4TYYA 4IDNA 4GMDA 5BQ5A 1FX0B 1YRBA 2RHMA 2LCFA 2OBMA 5L3SA 3CXCB 3CPWB 4WW0A 4DLZA 1GKYA 3X1ZA 1E9DA 1E2QA 2ODEA 2GZDA 1PLLA 4N0EA 1W34A 2DERA 1ZC3A 2KBEA 1DDGA 1KO7A 4HDOB 4M22A 3A4NA 1R8SA 4TL9A 3A36A 4Z1MD 4Q4HB 3BH7A 1E2DA 1E4VA 2VNJA 4IEEA 2CL6X 3CX8A 1QDEA 4BLPA 1W4RA 3ZD7A 3R9IA 2FJUA 3T1QA 3CC4B 4YAFA 1NSFA 2P6RA 4LYAA 4XD7A 2FA9A 3CCRB 4OQFA 4Q4LA 3ICQB 1E32A 1MO6A 4OK3A 2PMDA 3B2EA 3PUWA 2HV8A 3BS4A 2GHIA 4DCSA 4PC1A 3KZ1E 4JSYA 4C0LA 3VKGA 4C0QC 4CIDA 1QG0A 3O47A 3O8BA 3K70D 1FQJA 1GL6A 1ZNWA 1Z2CA 4TSFD 5J4HA 2ZRDA 2HCBA 3DVLA 5DYGA 4LK2A 4KJZA 3CD6B 1ZIPA 4IDQA 3OEEA 2AN9A 1E79D 3RWOA 4WIAA 3OE7D 3K8YA 1NN0A 3TRFA 1E3MA 4XIGS 1KK0A 4HE6A 3RRZA 4V02A 2ANCA 1VCMA 2QP3A 2BGIA 1G3RA 1YE8A 2Z5FA 1EP1B 1J70A 4KHZA 5JWHA 3W5JA 2QPAA 1E9SA 2J3EA 2XB4A 3QXXA 2CJWB 2N1BA 2D4HA 3DM9B 3LW8A 2WWXA 1XXHA 2WJYA 3CPHA 3EA0A 1W48A 4MGYR 1W46A 5P21A 3T5GA 2B92A 5IT5A 4NYJQ 1UBGA 1NG9A 221PA 4V0MA 5BW8A 1ZD1A 3K53A 4OHZA 5J40A 2EYUA 4KFTA 4QC2A 2BJVA 2GEDA 4HZIA 1YKSA 5FA6A 1FMJA 1FP7A 1QGYA 4HEJA 1CR0A 4Y7CA 4MGIR 3OZWA 4OK5A 4CZ2A 1UKEA 3ETLA 2WWGA 4FINA 4X8HA 2F55A 1G3UA 1AS2A 4MUAA 3RANA 4H1UA 2VH5R 1Q20A 3DOEA 3PJRA 4M8NE 1XDBA 3P27A 4MGKR 2X19A 4BECA 4DUGA 1P3JA 5LB4A 4LPSA 3SE0A 1NVWQ 4TN1A 4RD0A 1N25A 4NL4H 4FN5A 4AKGA 4L9SA 1KY3A 1KO5A 1LF0A 1ODFA 3A58B 5JHGB 1HYQA 4F4JA 3FMFA 2ODNA 5B2ZA 1H8EA 2IS1A 1VG9B 2KI5A 2B7CA 5CLQA 4YXWA 4JSTA 3SJCA 2IHBA 4IKEA 3WYFA 3GP8A 4LYFA 3CNOA 1G7CA 4QBFA 5CK4A 1G17A 2JJ2D 3OIUA 3KQLA 3CBQA 3ZVMA 3U3KA 2IYZA 1RYFA 3M4YA 3SFZA 2QT0A 4I4LA 3K09C 2OHFA 3M1IA 1OHHA 4NYMR 2XNJA 1XRJA 1GIAA 4A6XA 1L2TA 3K0AA 4PSAA 5AR1A 4D26A 1Q3TA 3KUDA 2ODBA 4KCGA 4LBZA 1XEXB 1CNFA 4B43A 2IYQA 4D80A 4R2HA 4D4MA 3FPAA 2O52A 1OB5A 5EXPA 4Z8YA 4NHOA 1L4UA 2VQSA 1UMKA 4DQLA 4RY2A 4M9QA 3HDTA 4QHTA 1T5IA 4R7ZA 2IEZA 2OSBA 2Z6VA 4ESHA 3MWKA 4AC9A 2ATXA 3O8DA 1O87A 3EZ9A 2C2HA 1DAEA 1E2LA 3WNCA 1N2CE 4IOLA 2XB2A 2CLDX 2AWNA 1IQPA 4WZ6A 4XVRA 2NTYC 2WMOB 3ZZ0A 4QHYA 1S72B 4YHBA 2ZU6A 1G19A 2QQEA 2F43B 3HPQA 1SKYE 1S0UA 1K73D 2RGNA 3DPUA 2GZHA 2RB4A 3FFBA 4D81A 5KNDA 1S9DA 2BMJA 3IBYA 3VKWA 1HV8A 3IQWA 2XJ9A 5KOYA 1KD1D 4PQFA 4RD1A 1VCNA 2OT3B 1E2KA 3EPKA 5H1YA 2VP2A 3SR0A 3U5ZB 1Q44A 4I1UA 1GP2A 4WBSA 1QZXA 1YI2B 1RW4A 2PT7A 4C9BA 4YAWA 3C5CA 2ZYVX 5EE1A 1DG1G 1CJMA 3QXSA 3THWB 5KPDA 4C2UA 3T61A 3EXAA 4US0R 2OXRA 2RMKA 4R2IA 4TMWA 1VMAA 1LFDB 1XNJA 1ZCBA 1YZNA 4GZLA 3HU3A 5EJEA 1F3OA 3SU8A 1VCIA 4KYUA 1W44A 3VHLB 4A0GA 4US2R 4FIDA 3X1WA 4M1TA 2JA1A 2WSSA 4DT1A 2BDTA 1YHNA 3VTKA 5CJ2A 4US1R 4ARZA 3AM1A 3UIEA 1TU4A 1FP6A 2EWWA 2OG2A 3W5IA 2FEMA 1I2DA 1J2JA 2ORVA 3AP3A 1NI3A 3LDAA 5FOUA 5CYPA 4AWXA 2VHUA 4OQNA 4IFEA 2VEDA 1ZIOA 1PJRA 3CKLA 2BOVA 4NYIR 4Q1FA 2X77A 3H4MA 2REBA 4JBXA 3KQUA 2GNOA 4Q02A 1ZNZA 3KL4A 3D8BA 1JB9A 2GCOA 4MRSA 1QGAA 2BCGY 4BEBA 1N5KA 2FFHA 4LPKA 1WE2A 5JZVA 4W5HA 2ZI7A 4OI2A 2R6FA 5EP4A 2ERXA 2QRNA 4TQUS 4A9AA 2YOHA 1OFHA 3ZZTA 2JJ1D 1GZSA 4ZI2A 3C41J 2Z4RA 1SHZA 3CF6R 2P67A 1HE1C 3FMIA 2ZIAA 3I8XA 2CE2X 1J99A 2ZE8A 1G6OA 5EE0A 5DIFA 3VU9A 4URWR 2GBLA 2QROA 2JLRA 1JXMA 2XZPA 1Z5ZA 2GF0A 2V3CC 5FTJA 5C4GB 4DSOA 1IY1A 4JLJA 1XEWX 3L0PA 1IY2A 521PA 4D4LA 5H5JA 1TQ4A 4HUQA 4L5BA 3BIFA 1DARA 2Z4SA 1VQ7B 1H65A 4QBGB 3P4XA 3UMFA 4B4DA 1YZGA 4CT5A 4EFLA 5B57C 1XEWY 1TADA 2DWOA 2GZAA 2IL1A 2CCKA 2OCPA 2SHKA 3AF4A 4YONB 4V0KA 1ZU5A 4FMCF 4KBGA 1G8PA 1SXJB 1K6MA 3NTUA 1NDHA 1YJ5A 4TMXA 1KKLA 1QVRA 5E4FA 4BFUA 1U8AA 1W4AA 2NMVA 5M04A 3W8NA 5GJCA 4XVQA 3ZBUA 1IOZA 1B0UA 1W2GA 2FEOA 2VNIA 2J7PD 2PZEA 3NWJA 4G1VA 3W2EA 3NBXX 5HE9A 3SBEA 4AKEA 4PQYA 1OXUA 1IJEA 4NCHA 1UKZA 3QXJA 4K1XA 2OFWA 2IYLD 4TTRA 3SHFA 3NVAA 3AKDA 4NCNA 3VX3A 4LJ6A 1HT1E 4GI7A 1KMHA 3TIFA 2D2FA 4W7SA 3GLGE 4ERNA 2YC2C 1JQJC 1CRPA 121PA 1YRAA 3ZVNA 4XD7D 4PHGA 1I2MA 1EP3B 3MRSA 2F9LA 3FE2A 3K0AB 2CL0X 2WWYA 4XWAA 3I62A 5JJKA 1E9EA 1T0JB 4HAZA 4LX0A 1UDWA 2HDNB 3LNCA 2JAQA 2AD1A 4PANA 2QGZA 4G5QA 1N8RD 1LNZA 1YR6A 3H0KA 1Y3AA 4W5WA 4ZO4A 1ZBDA 4B3CA 3B9PA 4LC0A 721PA 1A4RA 1T8UA 4DLTA 4KITB 4UNQA 1RE0A 1EFUA 4BEJA 1IAQA 5AUPB 5K8IA 1U90A 4L8GA 3CUEF 1MO3A 621PA 2PT5A 2NPIA 2ZJZA 3VMFA 4LJ9A 3T06B 4F38A 1VYVA 2RCNA 4ON9A 4QGGA 4U5XA 4FK8A 2IS2A 4ZPXA 2ZRBA 5A0FA 5HZKA 4B48A 3BC1A 2IF0A 2RGEA 3BFKA 3LD9A 4Q47A 4PC7A 1Z0KA 3DM5A 4PHHA 1YZKA 1W1WA 2NO7A 3PEYA 2YWEA 3DKVA 4M21A 4M0LA 4URXR 4JLMA 2VSFA 3GJ0A 1KZGB 1QUEA 1J7KA 4A8JB 1AQYA 3NBFA 4HAVA 4H1VA 2AHOA 4Q9LA 2HYIC 4AKIA 5GV7A 3HP1A 4YALA 1R0WA 4P33A 4UJ3A 2WBLC 4ZDKA 2DFKB 2Q3HA 5FH9A 1E9RA 2FSFA 3I55B 2PZGA 3KTAB 3RS0A 4BFYA 2I3BA 3AVOA 5FUXA 1DDIA 2WPDD 4KFSA 1NN5A 1Q86D 1P6XA 4UKDA 3W6OA 1XPOA 5J4VA 2BMEA 4DUGD 4TSFA 1SXJD 4DDWA 1GNPA 1F5NA 2ZE6A 4Q4JB 3LVQE 3RDPA 2CVFA 2QORA 3IO3A 3GLFE 1HT2E 2LKDA 4UAJA 4YLGA 4Y9UA 3MJRA 1KI6B 5E7IA 2ZI6A 1E79A 3AF1A 3OE7A 3QE0A 2AK2A 3NDPA 4PC2A 2ZYTX 1G41A 4TMKA 2L0XA 1H8ED 4CDGA 4DT1B 1FNMA 2D7CA 4URYR 5KSZA 1UKVY 1P9WA 2A78A 3QVUA 3UATA 4DLVA 1QH0A 3C7KA 4NYJR 3ADBA 1QHIA 5JEDA 2GXQA 4BLQA 4QJ3A 1DTSA 1Z22A 5FOXA 4OHWA 1XCPA 3F3YA 4DLWA 2GILA 5EXXA 1DAGA 5GVSA 4PO1A 4B2IA 1OHHD 4RCYA 4TL6A 1W7AA 1OFIA 2D2EA 3GLGA 4A0FA 3DZDA 3QEJA 1VDZA 4OI4A 2J0VA 1G64A 4PR0A 4TMTA 3V4RA 4M9SA 1VPLA 3ASYA 1EX7A 1DAFA 1GFIA 1ZD8A 1ZINA 3FMPB 5FR2A 3ZS8A 2IXFA 3CH5A 1E9BA 2J7KA 1TQ6A 4LC1A 1G3IA 5TXGA 3UXMA 3FHCB 1Z0JA 3QVVA 3TLXA 5F9HA 2GPJA 3W5UA 3I92A 3IIJA 1OXTA 5JS8A 1MABB 3PV0A 1SKQA 5GJVC 1E9AA 4Q7JB 2VA8A 1CNEA 2J0UB 3B78A 2QGNA 3H86A 4IVRA 1FX0A 2DWQA 3K0SA 3FVQA 4BLOA 1ELOA 2G3YA 3KFVA 4P32A 5CIQA 5DO9A 3TR0A 1P2VA 1W0KA 2PLFA 2OAP1 1GO2A 6Q21A 3QXCA 4BFTA 1QUFA 1KQSB 4R71A 1Q1ZA 2HYDA 2VP9A 5L3RA 2VZLA 4P4SB 4ASUA 4XOIA 4CEHA 3CW2A 1KAOA 5HPYB 4O2LA 4Q4HA 2ZRLA 5KO2A 4GSYA 2XTMA 4D0GA 2JJ2A 1X8JA 4OHYA 4QFMA 4J0QA 2Q9AA 2O0JA 2WOOA 4PX9A 2A3RA 1SKYB 2QL6A 3ZQ6A 2E9SA 4Q9KA 4CYMA 4Q1CA 5BWMA 2QY9A 2V1XA 1XCGB 4MDFA 2NG1A 3IEVA 2MMGA 1P61B 1WXQA 1JPJA 2FGJA 4NH0A 3GFOA 1TUIA 3TVDA 4A4DA 1TEXA 4KODA 2QTHA 4KLNA 2ZU0C 2VYQA 2GJSA 3EPLA 5JRZA 4UXJA 3G5UA 1G18A 4A2QA 1RRPA 4EUNA 2JATA 2OEPA 1G1MA 4DC9A 2JCSA 2V4ZA 1YVDA 4BFVA 2BKUA 4M1WA 1W35A 1OPXA 2ZRKA 5EQTA 3WYGA 4Q1EA 2F9MA 2JGNA 3GLFA 1JPNA 3HWSA 3MHPA 5L3VA 2R62A 3J81k 2BBSA 2C8VA 1Z29A 1S3SA 1G16A 3X1YA 4BZPA 2EWVA 4QXAA 3CCLB 1OW3B 1SVKA 1WCV1 4ZKEA 2VF7A 4QG7A 1FRQA 1M34E 1T9HA 1W5TA 1XTKA 1N6KA 3Q3JB 1XMIA 3R7WB 3C15C 3TUZC 2Z0MA 3D6TB 2KJQA 3RS5A 3VNVA 1NMXA 1W49A 5FFMA 5C4MA 1KDOA 1FW6A 3BFXA 1BH2A 1IJFA 4NPHA 5AJVB 1ZNXA 3V76A 5E95A 4TL8A 2DR3A 1C4OA 3OIVA 4ZIRB 2GQFA 3SDZA 3DMDA 2AKAB 5B30A 1CR2A 4EPTA 5LB2A 1S1MA 1IM2A 2ZI4A 4RKFA 3B5JA 4TL7A 2FPLA 1UEJA 2F7SA 4Q9IA 5H8WA 3EC2A 3EZ6A 4LV8B 1XMVA 1A82A 3LXXA 3WY9A 1NLFA 4JBYA 4NKRA 1OH6A 2WZQA 1R5OA 2J0SA 2F3TA 1UPTA 1H85A 1Q22A 2GK7A 3W6NA 1BMFA 3G4SB 2VHCA 3BRWD 1TU3A 4HLDA 4KFRA 2HT6A 3B7GA 1RRFA 2V6JA 1B2RA 4PAOA 1N6OA 2ZYUX 4JMPA 2H5EA 5THXA 3GJ4A 2XZOA 1DEKA 1D9ZA 1G4AE 2QU8A 3FKSD 4TZ0A 1IN4A 1Z8FA 1E1RD 4EKDA 3Q7PA 2DCUA 1QF9A 3HPRA 1P7CA 5CB6A 5KSPA 1XE1A 3SJBA 2YVUA 5EXTA 1JR6A 2QA4B 3RABA 1UAAA 3IO5A 3EIHA 4LJAA 4M4SA 3ZBTA 2QP4A 3TAHA 4F7DA 4Z54A 1T3LA 4LBWA 2RGAA 2C98A 4YMTA 5BN3A 1N0UA 1KO1A 3BGWA 1TVCA 5KNCA 3PQCA 4Y9RA 5AUNB 3GPLA 4G3XA 1QFYA 2O0HA 3VX4A 1E6CA 2WJIA 4PAQA 1XPRA 2ZQ5A 2C99A 1V43A 2YJTD 3AH8A 1OGJA 1N5JA 3ZGXA 2OBNA 1NBME 4Q1DA 1M2OB 2JEOA 3KB2A 2DETA 4BGDA 1LY1A 1Z3IX 4ACBA 2XXAB 2QAGB 3F8TA 2BGJA 2F43A 2J87A 1KIMA 3LLMA 4WOPA 1XEFA 4HB2A 1VQPB 1FRNA 2E87A 1NIJA 4G0NA 3SZRA 3U3MA 4EJSB 2C95A 3B60A 1OT3A 1SXJE 1JXOA 2QI9C 2YINC 2EFCB 1VQ6B 4KU4A 3QKSB 4ITRC
chains in the Genus database with same CATH superfamily
1GL3A 1TGYA 2NQ2C 2QL5A 3N39C 3LRXA 4GBED 4AG5A 2FEAA 3FUVA 3TZHA 2C9YA 4XL9A 1JBKA 1W9MA 1LBHA 2IIVA 1JG4A 1P7PA 2VYVA 1AKMA 3E8MA 3MWDA 3Q1KA 4LV5B 1DWOA 4PCUA 5TSDA 1VSQA 1T3GA 3FCXA 1JFVA 4PNZA 4KW7A 2WINI 2Q07A 3THWA 1P0QA 1VHDA 2CGEA 2J7PA 2JH9A 2YTZA 3HY4A 5DK4A 5EY5B 2P6UA 5BSRA 4BNJA 2R5WA 3R3VA 1KVRA 4NARA 4UE6A 4X94A 1N9KA 1VI6A 4JBLA 1KQFA 3HZZA 5T8KA 4LTNA 3WGKA 2OLKA 3G9UA 3SN6A 2VUUA 3K70C 4NAHA 3DHVA 4Q18A 4LF6B 1Z88A 1IDOA 2JHCA 1VQ4B 3W2HA 2EFJA 3AOEC 3R3SA 4I6GA 3VOTA 4E4YA 5I8PA 5JMTA 3B89A 1GG2A 4LTMA 3PC3A 1HFWA 2GGSA 4RIEA 1VIDA 5FXMA 4ZGBA 3ESCA 4UXIA 4YP1A 4JWKA 4FFBA 5SICE 5EJ8A 1GAQA 4Y1RB 4BKMA 5KWEA 3T3GA 3NWPA 5KYXB 2VHXA 4KSYA 2JLUA 4OKNA 3SSMA 1WPCA 3HCFA 1PR5A 2EC5A 2ZRMA 4C2TA 2J45A 5JY6A 1E98A 1FYFA 5EKSA 2O06A 3RJ9A 2P9GA 3LUHA 5A9SB 2XYQA 3MNFA 2A94A 2QT9A 2HF9A 1ZR2A 2HT1A 3VISA 3FPGA 2X9LA 4OKSA 1CF2O 2NZJA 5FNVF 1R12A 3AB7A 4AY3A 4BCCA 1UM8A 2MINB 3KT0A 3ESBA 4O1MA 6ABPA 1P4AA 2GZSA 2VNSA 5CH8A 3T9EA 5B2EA 1BKDR 4EMSA 5C7LO 1EWQA 4Y6QA 4N5LA 3PI6A 5ALSA 5HK9A 3GLFB 1IEXA 1IBCA 1USGA 4K3UA 3EQ9A 3O4GA 2VJAA 3OAAD 5AVOA 1UMCA 2AUMA 3OEYA 3QTLA 3RK4A 2P11A 3KPJA 1ZIXA 2CEAA 2IQ5A 1GDTA 2IYFA 4PTZA 1XI2A 1L5GB 4TSKA 3UW3A 4OI1A 2RFLA 4Z9YA 1QAMA 4BP3A 1YT5A 4WXYB 1IN7A 3D7NA 2W71A 4IIJF 1VPTA 4PC6A 4RA6A 2GZRA 3D7KA 4EGAA 2YRXA 3G2JA 3I4LA 1Y33E 2P6NA 3C1UA 3W34A 4GOJA 4D5EA 2EJCA 2QTWB 3I04M 1JAHA 3CFYA 1DJNA 3WKCA 4FYVA 3TZLA 5IMBA 3EFOA 4MMYB 1C7RA 4K88A 5ERXA 4BQRA 1Y9JA 4L4ZA 2YS6A 4BNTA 4EYKA 3WLRA 1GPBA 2I9PA 3T7EA 4XIJA 2WM9B 1DE0A 1UP7A 3GJXC 3H9GA 4IYRA 4I4TF 1P45A 2WPDA 4XEUA 3BMOA 1DIAA 1WSWA 4ZV7A 1UJ2A 1RIFA 4DCCA 4RESA 4QOEA 3T5CA 1RCFA 4A0HA 2FLVA 4H77A 5KU1A 2Q6KA 5K0BA 3ZDQA 4ZCIA 3W9SA 4S2UA 5F98A 1VG8A 5JBQA 1XKXA 3ND8A 4OGKA 2FMUA 2H1RA 2RONA 2OVFA 3PHLA 4L72A 4IXDA 3BXGA 1DC5A 2BP7B 3EFEA 1RAFA 3WLSA 2PH7A 3KKZA 4PGHA 2V7BA 2F1MA 2YIVX 4DA6A 3ORSA 1FSZA 2BKEA 2EZ4A 3K5WA 4GOKA 2YWFA 4MQ5A 4DG9A 2K7FA 1OH7A 3JQ9A 4L08A 1KP2A 3ITEA 4AZ0B 2VRCD 4TVKA 2BHTA 5KVCA 1ZA2A 4JIGA 3ET5A 1Z2EA 1OY1A 2FRDC 5K3FA 5AQ1A 4LXXA 5BYKA 2FEKA 2O5VA 3DR3A 3BZWA 3T3DA 5EIAA 2VP4A 4LF8B 4JY7A 4C0AC 4CCYA 4B0PA 2ZR0A 3DAPA 5BSGA 1RKUA 2FPIB 1BROA 5F1PA 3U3OA 1VJ0A 3WLLA 1H5NA 4KN9S 2M6SA 4KE7A 2ZRAA 3KHTA 4RSGA 4CKEA 1L5ZA 2R96A 3M8KA 5I48A 1EUCB 1RKBA 4LECA 4B35A 3SS7X 2QMOA 2X23A 2ZSBA 3EWIA 3G0OA 2YV5A 4IHAA 5D51S 3FYUA 4DSUA 3EVCA 5K8LA 3I6IA 3JQEA 3AHGA 3U19A 3COWA 3ICWA 3VR3D 1D2MA 2B4KA 1RJ9B 1ZEJA 2BHRA 3AY0A 1Q1GA 5C46F 2FJPA 2PCLA 5D6NA 4X93A 3AB3A 1FB5A 2FG6C 1I30A 3K0FB 3ZTYA 2PDAA 4OYYA 3QFTA 3D1VA 2EX4A 4M1YA 4D3ZA 4N9WA 1TM5E 3O3OB 4U2KA 1Z34A 3LGSA 1EBUA 4W9NA 3LSYA 3A6JA 2HMUA 1HURA 5GIPE 1UFRA 2LGJA 2Q1UA 3QLVA 3TYXA 1OLXA 1JZQA 3AR4A 4ARIA 2VRBA 4F0JA 3CHYA 1AO0A 5IYRA 2ZE7A 3DQZA 4NZYA 4CI9A 1R1DA 5ALQA 4H9GA 2GXSA 4M0DA 4B3TB 4ESVA 3ANSA 2ZRPA 2IYPA 3R7NA 4N6NA 4Q9DA 2BF4A 5CIWA 2A6PA 2AOTA 2LWIA 5I7SA 4R2LA 2IEYA 4ZP1A 5J5CA 3S6JA 5IF9A 1IOVA 2Y1GA 4KP7A 3Q3GE 3UMRA 1OKKD 1K3UB 4IIDA 3K9HA 4ZAVA 4UDYX 2P79A 3LS2A 2IYYA 3Q88A 4R8LA 2Q7DA 2POCA 5ED0A 3G2QA 3KTAA 3GRRA 5T67A 2G82A 2FMFA 1WY7A 4TYWA 1I4LD 4HXFB 3H65A 3LKBA 2V45A 1DKMA 1PG0A 5H59A 1DMRA 4OXRA 3CRW1 1NXOA 3EODA 4B5LA 3R09A 4PEVA 4QNMA 2IZ7A 4XJTA 1ZESA 2EGGA 3LKVA 4F3KA 4D79A 2RHLA 3BMCA 4Q7LA 1R6AA 3RJMA 1DO2A 1LVGA 4Q4JA 2C3MA 3H7AA 1Z5UA 3LXMA 4E5DA 2VA9A 2X3UA 1NE7A 3UK2A 4BO6A 1Y5NA 5BN4A 1QBKC 4X90A 1KI6A 3PIDA 2XT9A 1Q5PA 4MW7A 1BMFD 4B76A 3PS9A 3WX0A 3CR3C 2FN4A 2B2NA 3H19A 4NZZA 2C83A 2EFYA 2LBPA 1RYHA 2QVZX 3HWRA 3O38A 2GBIA 4POAA 5DTQA 2HTFA 1WBBA 1G2IA 1X8LA 5IJ9B 4MKFA 2OOSA 1UXOA 2E1PA 4IQFA 5DEOA 3NIFB 4G5YA 4NS1A 5IDVA 2XAUA 4ZVQA 4F4IA 3DO8A 4CQMB 4X20A 3AVTA 1H6AA 4DG8A 5JW6A 1ZMRA 3TTUA 3A8JA 2C4TA 2H0AA 1W2BB 1BGVA 1PL8A 3MA0A 3HYTA 4FNMA 3T7DA 1NQXA 5IASA 2H16A 3TTWA 4A73A 4XN0A 3C6XA 3KSZO 4QTYA 1EFTA 2GJ8A 4S1PA 3PC4A 3GHHA 3LX8A 1K97A 1NQUA 4IIFA 4X8OA 3IAUA 1TLTA 2C5AA 2OHXA 2V6IA 3UA3A 4ND4A 3RSSA 2VK1A 2Z2XA 4R9SA 5T4HA 4B2PA 1HQKA 3WLAA 4C5BA 3PQ6A 4L1KA 4TKLA 4BLUA 2RC5A 4KLAA 5MN4A 2P9YA 2WTUA 1JTEA 2G07A 2PGIA 4MEBA 4P82A 4YAKA 4JGIA 1SVOA 1ULTA 1EFPA 2ENUA 1M7HA 1JEYA 2CMFA 2WB4A 4FXPA 1MABA 1UKCA 1ZD2P 2Q2QA 4WFIA 3SC3A 4B2LA 3OT4A 4AULA 2NU9B 3VI3B 1O3YA 1P6QA 1SZJG 1U65A 2Y77A 4YCAA 4B6SA 2BFEB 4UTVA 3DVRX 4BYGA 1SPBS 5ABPA 1DIBA 1SBYA 2H0QA 3O2SB 2A9QA 4S24A 1GILA 4N39A 5K20A 2OAQ1 1XO1A 2O8FB 3ESRA 2VQEB 1II0A 2FN7A 4G5OA 1HE8B 3E5RA 4MPTA 5FJIA 4AJOA 4DL9A 2MU1A 4MVJM 3O8QB 3U44B 3VC1A 3T1TA 2D8AA 3DEFA 4V39A 2P41A 4QT0A 2O7NA 3KKPA 4NEQA 5CJPA 3A7DA 4RPKA 1FXSA 3KR0A 5CBKA 3N7UA 3MS2A 3QF4B 4FMDF 3FHJA 4Q24A 2W0SA 4EMBA 1KHTA 2QN9A 4J0HA 2R0QC 2G88A 4F96A 4M54A 3E22A 4ZRNA 1R3UA 4AO6A 5BOSB 1IUKA 1D6JA 4CM5A 2OK7A 3KU1A 3HBFA 5KHOC 3F9RA 5DHQA 2W8BA 1BIFA 3KAJA 4UNRA 5E4JA 1OGYA 4K5QA 2FWBA 1M67A 1MR3F 1JU9A 2F00A 1PR3A 4K9LA 4P22A 1ILEA 2X58A 1ZOPA 3F96A 4IJQA 2IJGX 3A8TA 3FGZA 2ZKIA 3H5TA 1WXIA 1MB3A 1XVAA 3T5DA 4OXNA 4BWFB 5HJEA 1E3DA 4KO3S 1K8AD 4Q3CA 3RROA 5C5EA 1BHQ1 1KYVA 6CHYA 1AB5A 4Z9AA 1KI7A 1MENA 2HY7A 4UM9D 1II8B 5ARDA 3UB3A 4P4UA 3PYMA 2OK8A 4XVUA 3TZKA 1KEEA 4OMDA 4LHSA 3GJZA 3OIYA 1C50A 4MW1A 3REFA 3SMQA 1A8IA 4BVGA 1ZUIA 1MOPA 3KPWA 4HDMA 1IIBA 3OIWA 1ZUWA 2IUYA 3VNUA 3A4MA 3R5HA 1N1DA 4LJSA 2FSIA 5AHOA 3S2SA 3NPMA 1OB2A 2PLAA 5DN9A 4KPGA 4EUEA 4M1SA 1CK4A 1M6VA 5BNIA 1E20A 4RX1A 2ZUFA 3G6EB 1UD3A 1U2ZA 4Y67A 5DI9A 3UJ7A 5KYUB 1JJ2B 4QRDA 1Y8RA 3UYKA 4G8JA 2BDEA 5CHYA 2AUTA 4RENA 4UHDA 3KJHA 4HFJA 3UN1A 1FP4B 1B0AA 2CBZA 3LY9A 5IWAB 1F2UB 1NQAO 5EXEA 3B52X 4HC4A 3FFXA 3P0JA 5FPYA 5LYJF 4Q3EA 4V2UA 1X6VA 2X9GA 1EVZA 4MRMA 3TLJA 1RXCA 1BHSA 1Y3HA 3EZYA 2E1BA 3P9IA 3UA4A 2IV2X 4DMFA 2ZZEA 1H2RS 3PC7A 3CNLA 5CHEA 4GT1A 4INPA 5GONB 3O8CA 1ZUNB 1M6YA 1M6HA 1ZW6A 2VATA 3ST7A 1V45E 2WMYA 4TYMA 1ZL2A 3H3JA 5G40A 5A6SB 5TB5A 3RS8A 1NI4B 3K2QA 3JAMA 2BFNA 1TXGA 1DEHA 1GTVA 4FFPA 1Z47A 4UVGA 1DO0A 3W5BA 2NUAB 1LDMA 2YIMA 3E7FA 3EAQA 1TFRA 2R68A 1YFLA 1FFSA 1DKOA 3G9TA 3N0VA 4EPXA 1OI3A 1OYWA 3DWEX 4TYNA 1U6JA 1L5MA 3KKKA 4JVLA 4MKIA 2WM3A 2ZR9A 1GKKA 1WS6A 1PR2A 5AKLA 1MU0A 1I18A 2AX3A 2H2IA 2ZI9A 3G0GA 5J2UF 3CESA 1XDGA 1R27A 2VAVA 3VQTA 4J75A 4DMGA 1K5GA 1WCXA 2FY8A 3JQ9C 1H1TA 2XQKA 3OA2A 1OA1A 4RZHA 2RGRA 2VHZA 3WB2A 3K8ZA 3O4VA 1AQJA 5TRTA 4XM0A 1AGPA 1FLDA 4ENTA 2EFHB 2VDRB 4ZVMA 4C4AA 4H6PA 4X1IA 3ZU6A 3FPKA 2P3MA 3QVJA 5DLEA 3RC9A 4YQFA 1J00A 1JG3A 1QPGA 1TX4B 4N01A 4BU0A 5FI1B 1TQDA 3ONDA 4YP5A 4EM6A 3G05A 1T1RA 1H94A 1ZUHA 3T34A 5AJWA 5KYKA 3OHSX 4LDPA 4RMGA 2IPXA 2PZFA 4K3VA 4N3CA 5FUQA 1SU7A 2I87A 4Y0VA 1RDFA 4HAUA 3FYUC 4RADA 5F78A 1QGOA 3VJKA 1JQ5A 3D0RA 3K8QA 5ALIA 5B3KA 1Q0PA 3MTEA 4XFDA 1Y6FA 2NNWB 3WISA 3AHIA 4D98A 4JENA 1JWLA 3L0IB 4X8LA 3KTFA 2FDCA 3K92A 3JPWA 3V33A 2NTNA 3RO7A 5U4XA 2EAUA 3N6VA 2F3QA 4EUSA 3EWAA 2L2QA 2HEIA 3AQ4A 4EY6A 1MJNA 3LPNA 1JLRA 2HHJA 5DGXA 5K3BA 1KNXA 1Z4JA 1P29A 2F6RA 2ZTUA 3NLLA 4N82A 4W9NC 1EZZA 3V4LA 3ZCSA 1OU0A 4J4HA 2QAGA 2RGGA 3QLVC 4N49A 3PT5A 1GCGA 2AEEA 2J4CA 1XZCA 1ZL0A 2IXBA 3H1EA 3MS4A 4LW8A 3TCKA 4WOCA 5I3CA 2V5AA 1FSPA 2GCEA 5BQ3A 2IPNA 2HIMA 4AZVA 4EJSA 2H1OA 3PD0A 1JHYA 5ES3A 2IUSA 2RGNC 1OLOA 1GA4A 1P6UA 3AR8A 3DYVA 1KSJA 2OP1A 2EL9A 4EY3A 1LDYA 1WETA 5CNJA 4EECA 2DHRA 1VSUA 2VPXA 3CRVA 3P52A 3R5SA 3ZDZB 2QR2A 2PUFA 3AVYA 1CBUA 1Y4AE 1NPYA 3SS8A 3F1LA 3IEMA 1KAMA 1N33B 5HRCA 4O1HA 2D2IA 1P0IA 1UOEA 1Y81A 2X3YA 1TZJA 3G2IA 4GYJA 4Y0AA 5EAIA 3U61B 1VZ3A 1FW8A 5KMGB 1NVGA 4NABA 1XD9A 1THZA 3DAFA 4CEJB 1BZYA 2BMWA 1KBOA 1RRMA 4N18A 2OCLA 4FOLA 4OQYA 5GAJA 3QELA 3C8ZA 3HP4A 3DDSA 4TUYA 2TMKA 3SLGA 1A8QA 5CM2Z 1NVMB 3ES9A 1RYZA 5E7JA 1BCRB 3CO5A 3AIMA 1BEEA 2GZ2A 2CDNA 4XH9B 5KQRA 3TFWA 2QRVB 2QTVB 4JS0A 1LPBB 1Z07A 4HRYA 1DRKA 2GN6A 1OUMA 4OSEA 2X0EA 3CZ9A 3WLMA 4HUTA 3U5TA 5HR5A 2WYVA 4J94A 1YBAA 4UTPA 1G38A 3K1TA 1QQAA 5FRDA 5JMPA 4HWRA 2CVHA 1XTIA 1HLGA 3VDXA 2PUAA 3Q6QA 4UBJA 2GDJA 2WMNB 2OB2A 2IEGA 1DOAA 2HC9A 3ZHXA 4X0CA 3DZIA 4GDFA 4R5HA 1KU0A 3AJDA 4IVQA 1QP0A 2DR2A 4OB7A 2RHWA 1SVMA 3QIAA 1VP3A 2HJ9A 4IMPA 4Q48A 4UBOA 1KI8A 1E3ZA 1O94D 1PW7A 2IWHA 3DWFA 3D6FA 4ZAXA 3HADA 1V7ZA 3IXMA 4D92A 4BPBA 1FP2A 1YBHA 5JZMA 1R8QA 3ZHSA 4OMCA 1R0RE 2QM8A 4P7JA 4I9NA 1H8HD 4LZZA 2BR4A 1L5OA 3WLOA 4Z2AA 2VSYA 4GL4A 1ZICA 4MS3B 5SY4A 2H51A 1E99A 5F76A 2GBLC 3A9VA 3B20A 1ONPA 2UZ1A 2H85A 4GLJA 1E1CA 3TSYA 2Y1KA 2NV0A 1NT2A 1E60A 4G9GA 2C0QA 2NZUG 2WV9A 3BREA 1YMUA 4PZLA 3CF0A 3OD5A 3N9IA 2HLNA 2Z9BA 4NCIA 1JR3E 2V55B 4JJ7A 3TQOA 4DR2B 4J90A 1B16A 5H80A 4RHXA 5C8YF 4IEIA 4RVHA 4BNVA 3E2IA 2XWBF 1JV2B 4D3DA 1PR6A 3LT2A 1EEXB 4KYIB 1DFHA 5EIEA 2A67A 4TGLA 3RVQA 1VIAA 2OHOA 4G1EB 5FTMA 5B53A 3ZWNA 4NVRA 3RPEA 4AUEA 4ETMA 3JQQA 4X7FA 1FC0A 2CY0A 2JJ8A 4A8PA 2FCAA 2QMQA 3ZDFA 5LMNB 4D6YA 4E15A 5B1EA 1OLSA 2GD0A 3ZXXA 3HXOA 4BNWA 2QZJA 4PO8A 2H1IA 5E3IA 2D3LA 3HNRA 4CM4A 4OM8A 2VN8A 2IELA 4L6CA 5TS2A 2QTBA 2X0FA 4CKCB 5LJLA 4E6PA 5F3DA 3AK4A 3AP2A 3BN3A 3M6AA 3INGA 3IT1A 1SC3A 4CUZA 1QORA 5NLLA 2VWQA 5BRJA 2A8YA 4P6VF 2R751 2VPPA 3GJ8A 3GEMA 3HB1A 3AF5A 3E9RA 3IOYA 3L8GA 4QEKA 4RMHA 1N6RA 3DONA 6REQB 5HS4A 1XWIA 2ZJAA 2J48A 1P0PA 2R1VB 4BGUA 3EW7A 3AB8A 5COAA 5DHUA 3PK0A 4I50A 4DDTA 1VE6A 1IHUA 4M89A 3N87A 2V97A 4TTTS 3EXHB 5FWAA 1U0HC 2GEFA 3BDVA 2D6FA 4DLXA 1JDSA 1V3VA 3EVBA 4I5DA 1DQZA 1SVUA 1YWGO 4XWYA 5FP0A 4B6OA 4BLSA 4B73A 3R8FA 2CLCX 1ZH0A 3GJ6A 3HBLA 1SBNE 1W36D 1CLUA 3D3JA 3E58A 3PPVA 5DNAA 4U7DA 3ASZA 3E2MA 8MHTA 1M0EA 5DISB 4IJUA 3RS2A 2ABWA 4RD3A 2E89A 3MJHA 5K8TA 1MJGM 5CDTA 1PBNA 3GJ3A 1GM5A 1A88A 2CMKA 2I22A 4PQEA 1MB2A 4PYOA 5EJ5A 4JCCA 1ORIA 4AUNA 3RTGA 2NNLD 1MH1A 5JBIA 3R9XB 3SLDA 1Y3IA 1U9JA 1Y9DA 2C2OA 2KHZA 2ZIZA 3D3NA 3L1JA 4LYDA 5FPQA 3QHAA 1K8RA 4PG8A 3MQ2A 2JLYA 3HJNA 4JQYA 4ZZ2A 3N76A 3KC2A 3PR2B 4NV3A 1ORVA 2G80A 2UKDA 3JS5A 1VLJA 3UWDA 4MP8A 3WK8A 5GZ3A 1KOJA 1N6NA 2GASA 1W1UA 4HEHA 3L84A 4KO1S 5H7XA 4KPUB 2XOKA 3P7MA 3Q72A 4ABYA 3A2KA 3DMNA 3E5HA 3ECCA 4RQBA 4XYGA 2WA1A 3E9DA 1GZVA 4IJMA 4JK3A 4MVJA 1RRCA 2PBRA 2QP9X 3IEUA 2ZB3A 3S2YA 5ANRB 1W5FA 3MJEA 2BH2A 1Z0SA 1WF6A 1KQNA 3QV1A 1GNVA 3FVWA 3IUBA 3EC7A 2VJPA 1G3MA 2B35A 2PO5A 3GGOA 1QTRA 3CX7A 1J07A 1QG6A 2H1HA 3FWHA 3K1YA 5FBZA 5FUYA 2REQB 5IC5A 2EIXA 4ROXA 1T4MA 3DYIA 4NH4A 5AVUA 3GLIA 4O25A 2I0FA 4O59O 5EWJA 4DNPA 2LV8A 1XZBA 4NE7A 1B8VA 1T5DX 1SMKA 4DM3A 4JNCA 4YRNA 1BFUA 1RYDA 1QIEA 4JLAA 1ARZA 5BXYA 2CF4A 5JAOA 3KB1A 3VR5D 1TYZA 2GYYA 2VSQA 1Y48E 2ZB7A 3GHYA 3ZHTA 5JAMA 4D02A 4RZXA 3ZW8A 4MULA 2XBLA 3GFRA 3ZI0A 3SDSA 2BGKA 4RK0A 2OC4A 5JCJA 1N6IA 3CNHA 3UMJA 1FFHA 3PSAA 2QN1A 1JL3A 3HLYA 3MGBA 1J7JA 1ODCA 1M1KD 3KVOA 4MRPA 5A7FA 3F6SA 3L82B 1PF7E 3LQ1A 2XUZA 2D9RA 1Y3CE 2I4OA 4JDUA 4REOA 4CR7A 2OTLB 2H1SA 5JZ9A 3GVIA 4G56A 5EHIA 4O1IA 3CR7A 4Y8VA 3MBOA 1GNRA 4JVMA 2DQZA 1US8A 3C3PA 2QM0A 2VZ8A 4UUQA 1BA2A 1Y4SA 2ZYRA 4J0KA 3BDAA 1XJWA 3GZNB 1R7RA 3G6KA 4IMJB 1RJFA 1ZIDA 2CLLB 2XUHA 3I6MA 3IUQA 5IKOA 1NHGA 2QMUA 3TPZA 2VBTA 3WMEA 5ESDA 2BLNA 3O5AA 1U0EA 3K5PA 4DQUA 2O19A 2ZWOA 1QONA 1YRLA 2A9RA 3L8YA 1Y4UA 3BA1A 3O8NA 3MF4A 2W6QA 3GDGA 3PUMA 4GI2A 3BB4A 5CDHA 3REQB 4MW0A 2M5SA 1HF3A 2XDAA 3LX5A 3T5TA 3JW8A 2QAGC 5EJGA 1TK2A 2DECA 2J67A 3KV3O 3LMKA 3DFKA 3FSEA 3UPDA 9GPBA 2WU0A 2XVMA 1JIIA 2DXIA 2A7QA 2Z2JA 1PQPA 6NULA 5CXUA 1EVIA 2RBGA 4EJSC 1WG8A 1HRKA 1OI2A 4DEXA 3BICA 3MWLA 4A16A 5LPNA 1VBMA 2M32A 3F49S 5FH9A 3AEKA 3HKCB 1KPIA 2JCBA 3Q3HA 3FFTA 2ZSUA 2GLUA 2GZ3A 3L4KA 3W6UA 3PR3A 5TMEA 2QYSA 3VI4B 1LV7A 1Z6AA 1NVAA 1U7PA 3CZAA 4HNSA 2WSIA 2QN3A 3T1NA 2WHQA 3NT2A 3BJRA 1G9TA 4B6JA 3M7IA 3NXKA 1NVEA 1HE5A 1U7UA 3OJWA 2BM8A 2IZOA 1N32B 2MR5A 1NOKA 1FFAA 3BIWA 4HDRB 3RVKA 5BMVA 1PYGA 1E4OA 1Z4IA 3NTOA 1A2KC 2PWZA 3ACBA 3CP2A 4TMFA 3RTEA 3TFQA 2ZSJA 3VH3A 2EFGA 1U7OA 4CMBA 5HZAA 2ILTA 2V8BA 1E7WA 4FMPA 4IZOA 4P7BA 1U3WA 1D1PA 3DO6A 4GOMD 5JAPA 1GR1A 1K0FA 1AIPA 1LQ2A 2FFAA 4HR7A 2ZZQA 1H1DA 2NZ8A 1GWNA 1XP8A 3A70A 3GEEA 3L7MA 4PLTA 3RVSA 3UWSA 4LG1A 2ACWA 1CKEA 3O91A 1XRLA 3DAOA 3DFZA 5I9BA 2RGDA 1Q0UA 3V2IA 3VYRB 2VJNA 5IM4F 2XMCA 2DLCX 4LE1A 2OCIA 1P91A 1V0JA 4BLTA 2JLQA 4BP8A 5CFLA 3HJBA 4QECA 5IABA 1MAWA 2A92A 3JR3A 5C0OE 1Q7GA 4ZJZA 9LDBA 2PN1A 1LVHA 1XZNA 3AF2A 4ZO6A 3N8HA 1W2HA 1LLCA 3TNFA 1ZISA 3JQAB 3H1TA 2BRUA 3FFAA 4WXPA 4QVJA 5DSTA 1O9BA 1NJFA 1N3YA 3SBDA 4A6EA 3RIHA 3KQYA 1IZ0A 2J9FB 2JCVA 1UXHA 4UNPA 4L0DA 4WEOA 1UJNA 1AK2A 1U99A 1Z6ZA 1VHEA 1L7OA 3LPMA 3QFRA 1ZJWA 2Z6BD 3RYIB 4NENB 5EIFA 4GNRA 5AJUA 5GV8A 5BN1A 4UUNA 3I61A 1SVSA 1BJRE 1MDBA 1AXEA 1JKXA 3BCFA 1HT0A 4CCSA 1DO8A 5JAUA 5BOVA 5E8JA 5EIHA 1XYYA 3PNBA 4EHLA 5EL0A 3C97A 2F1RA 3BBPA 4MAFA 1NVDA 5GGXA 4C0BA 5CB8A 3D64A 1GQOA 2OGSA 1LV8A 1QHXA 3MPUA 4C0JA 5B7QA 4D25A 1F2TA 5F33A 1EFHA 3MUFA 4TWRA 1PS8A 5KBYA 2H57A 1TQHA 3NRBA 4RL4A 3G0CA 4CM9A 3KEQA 1CZUA 1N2BA 4TTPA 2QV7A 4FKMA 1IJKA 3OM0A 2XE8A 1GQYA 5H3CA 2P5UA 1L7PA 2FF7A 2CNDA 3EEYA 4E14A 2YVKA 3ROKA 4LF5B 1KI9A 1GPKA 2C2GA 4LXTA 2FFQA 2X2OA 3WOHA 1QZTA 5AN9A 2AFIE 2RGXA 4Q9AA 1UD5A 4IBOA 3NVKI 1M1NB 3ZE7A 4MUKA 4Q9HA 1IQ0A 3QFCA 4HLUA 3RRBA 2G67A 1ZGAA 2ERCA 2Q0SA 3W6PA 2OA0A 5DE3A 5M29A 1KPGA 2FG7C 3OF5A 4JH0A 2WAAA 1SCAA 3DE1X 4HNUA 4IYJA 2GLXA 1R8JA 4DIOA 2QM7A 1U3VA 2ZATA 1UFQA 3QBDA 4X1YA 2V96A 3G49A 3TEJA 5BT8A 5JVDA 1C3VA 3Q6RA 1AKWA 4OD0A 2W48A 1V37A 4JYBA 4GC9A 4L5AA 1FDIA 1XCLA 1FS5A 2J9RA 1GZ4A 3FNGA 4M7RA 3Q7RA 1D7AA 1TD1A 2G77B 1G5RA 1EU1A 1H3FA 2ZJOA 1RVDA 3HKDB 1ADJA 1ZMOA 1ZYUA 3L07A 4DMHA 3JQ6A 4WY5A 2IUUA 1P9OA 3KQQA 1NPDA 3KEMA 1G7TA 3SSNA 5KNBD 1FMTA 5FOQA 1ZMTA 3OU2A 3ZLBA 2C5SA 4PLWA 1XD2A 1IVNA 2ERYA 3CKYA 4K46A 3VDMA 3QMPA 2CYBA 1M1YB 1AQUA 3D7LA 4MB6A 4U6QA 1Q17A 2Y1LA 2ZBPA 3OPYB 1ZCZA 3OZTA 5TJHA 3RIGA 2CNWD 5A3JA 1WP6A 4ZVSA 2IH4A 1JT2A 4F2WA 1V26A 4M46A 1ZHHA 2Y27A 4MW4A 5L3SB 3VPXA 2BEJA 1NVVQ 2ZP1A 1OYVA 2B5VA 3F5SA 3B6ZA 4LQLA 4OMFG 4AIIA 3U4MA 4ISCA 1RPNA 2DFPA 4E5VA 1O95A 1P62B 1W0JA 5AUQA 4B3IA 2I7TA 1EJ0A 2ZGVA 3IA2A 1KDRA 3BTOA 4G1UC 1JLHA 2JJYA 3W05A 5KPJA 1K7SN 2XUAA 1N78A 4ZHQB 2QX4A 2AZXA 2E7ZA 3JD0A 1BXGB 3JYOA 4GICA 3ZGZA 3T53B 4JOCA 2Q3MA 4WZBA 3HBJA 2ZR7A 2EQ5A 1CT9A 2WSYB 4UFPA 4C05A 1XFOA 1BVUA 5DN6A 3K5HA 2RGYA 3LX6A 5C1IA 1ZC4A 4KWTA 5EZ6B 1PFUA 1BWPA 4B4KA 3BWCA 2PL3A 2EU8A 1MT0A 4MMXB 1YU6A 3WGIA 4DIUA 2PE5A 4B7ZA 2X4GA 1L5WA 3AFOA 1XF9A 4F92B 3BRCA 4DV0B 3I6QA 4R81A 4TTVA 3PGXA 2HCJB 3LTEA 3E1GA 3UUFA 3DL0A 3A3GA 1FDTA 3OX1A 3A35A 2BJWA 3GMTA 4QYTA 5DMXA 5BYBA 1XA3A 4RK6A 3UAGA 2RJ3A 1Q50A 1M0TA 2C31A 3PL5A 3VR4A 4HOYA 5L8VA 4B6FA 3D4OA 2R2GA 4BQFA 3F6EX 4TYQA 2CUNA 3AVVA 4JJ6A 1H2ZA 2QN8A 1Y6RA 2K6GA 4RMIA 1M6EX 3FSGA 2OORA 3KYBA 2AQIA 2D5AA 3SYKA 1NF3A 4TWZA 1A76A 1TM7E 2DUUA 3DCIA 4B9EA 2DFNA 4F97A 4AVZA 1KNQA 1U8EA 1WW8A 4L3WA 4OAPA 4O02B 3K9LA 4UASA 4ZI5A 4TQ9A 5LQSA 3L79A 4YJ2A 1JEQA 1J0BA 3GMDA 2RH9B 1CTQA 1V9CA 3D9QX 4LTDA 1X1SA 3H84A 4TLMB 4WX2B 1GPAA 5KOIA 1W4BA 3K16A 5HTKA 4R5MA 1RM4A 4MQMA 1FYWA 4LMRA 4UCQA 4X3CA 4G85A 5FOWA 3WB9A 2RI6A 4JP8A 3AM3A 1MC5A 3ZD9A 4QJIA 1XXHB 1X7YA 1J9EA 1JJ7A 1P1FA 4H3HB 5C1BA 1A1VA 2F8SA 1E0AA 2W6IA 1KAEA 4XLZA 4JT2A 2O3SA 3W8FA 2A1UB 2AXQA 1RJWA 1ILWA 1ZH8A 3GR6A 1OREA 3VR1A 4K9DA 1RS0A 3SXPA 3ZU2A 4BKQA 4FZVA 2Q45A 2O4UX 5AVYA 3O9VA 2JVKA 1YUNA 2NAFA 3RC8A 3ZIAD 3NHYA 1OYOA 5DIZA 2AT1A 2UZ3A 4P3NA 3WO1A 3PIRA 4BVJA 2X1VA 4DR3B 4UZFA 1X9IA 1BFKA 2ZZMA 3PNQA 4D0SA 5HQTA 4BQQA 2BUAA 3GGDA 4YAGA 4PC3A 4ZQGA 5LNK6 2W2VA 3RSHA 1NUTA 1FTWA 3GOHA 4TKUB 1RABA 3Q0TA 2D5IA 3SP1A 4ZEOA 2KVOA 3GAZA 3ZIDA 2YV1A 1E63A 3NEYA 4FYWA 5D1HA 4CIWA 3IE1A 4CGZA 1XLTA 1RKVA 5IFKA 2NO1A 5KTRA 1M33A 2OCYC 2DUMA 4IHKA 3ND7A 2XD9A 4BBPA 2O8EA 2RSLA 1Q12A 4OAQA 2QTTA 1JVBA 5HBRA 1KO8A 1BLIA 1MAAA 1VHJA 4NOJA 1K4YA 3ILXA 3EOBI 2BWJA 3H8JA 1EDEA 3QVTA 1GPYA 3QLEA 4HATA 1WTHD 1K75A 3G8CA 3HY3A 1G2QA 1PNOA 1VHLA 3KQVA 4KYTA 3GFTA 4G89A 5LBIA 5KC9A 4KMRA 2D7JA 2DVMA 3GI1A 2H08A 1T36B 1PQ4A 1JIUA 4PCAA 2H1CA 1YL7A 3Q6MA 1PJBA 4DCNA 3HU5A 1EESA 2GS9A 3W3AD 3CT6A 2QQ5A 2Z43A 5CB0A 4U7TB 2PGLA 4IDBA 4MKGA 4XM2A 1ZKDA 2E5FA 3R7BA 4MR8A 5ITZA 4P0QB 1WLYA 1NMZA 1J8DA 2SKCA 4U00A 1UT6A 3STUA 2A0KA 1WDTA 3V4SA 3CMMA 4KLZA 1DQSA 1RWOA 1Z28A 3F6YA 2XF2A 4GRDA 4LSGA 5ALYA 1Z4QA 3VRHA 9ATCA 5LZ7A 4DV4B 3BCHA 1FYEA 4JV5B 4EPYA 4JLUA 2KMLA