2PMDA

The structures of aif2gamma subunit from the archaeon sulfolobus solfataricus in the gdp-bound form.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
publication title New Insights into the Interactions of the Translation Initiation Factor 2 from Archaea with Guanine Nucleotides and Initiator tRNA.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 93
structure length 414
sequence length 414
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2pmdA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2pmdA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2pmdA01
1BMFD 2NZ8A 2ZSEA 3UMFA 3JQQA 4LJ5A 1KK2A 3CNOA 2IYVA 3DMDA 2WSSD 1NN3A 1W1WA 2RGEA 4CGZA 3BC1A 4LHXA 2GZAA 1KZGB 1SVIA 1QH0A 1AGRA 3R20A 4Q9KA 2PMKA 4TLBA 4JLKA 2P65A 1QHXA 4C2UA 2IC5A 1VG1A 3ES9A 4CEHB 1XX6A 1BX1A 3W5JA 1G8FA 1N6KA 4AWXA 1ESNA 2OTLB 4QHYA 1JXMA 4B3DA 2QN6A 3WRYC 1Z0KA 3DOEA 1H65A 1HQCA 1XMSA 5BQ5A 2C5LA 2WJVA 1AS0A 1I7PA 4UJ3A 1CEEA 3QG5A 4AG6A 1SHZA 3QUSA 3PEVA 4TT3D 3JQRA 1ZC3A 3HR7A 3QKSA 4GP7A 1OFTA 4AI6A 1Q44A 1KMHA 1FP6A 3K70D 1PUIA 4F92B 5GJVC 1W2GA 2DY1A 2BIFA 4C0AC 3MJHA 1R2QA 4HUTA 2JJ8A 2YINC 3Q7QA 1GL9B 2CEAA 1E79D 2F1IA 2ZJOA 3OFND 3CPHA 3UG7A 4TYYA 5CLLA 1LV7A 5AK0A 2XJ9A 2ZRPA 4GPTA 4JLPA 2C95A 2QT1A 4NYIQ 3IIKA 1HA3A 2DR3A 1DTSA 1VCMA 1KSFX 2OFWA 2IS6A 4C9BA 1EK0A 1YIJB 4WZAE 3NEYA 2OCBA 2HLDD 4GMXA 3DO6A 2WZQA 2ZVQX 2CXXA 2J5XA 2Z0MA 3T1OA 4EPRA 1N6NA 3TUJC 1YZQA 1E4VA 2ZSAA 2OCPA 4K81B 4MDFA 4LV6A 4TL7A 5FPSA 3IBYA 2QNRA 2EW1A 2KB0A 4EQ6B 2WM9B 1XD9A 2G6BA 4RSGA 1TU3A 1SULA 5HE8A 1EGAA 1N6IA 1RPZA 1AN0A 1F2UB 4QBIA 2D7CA 5TMPA 1EG7A 1FUKA 4Q1AA 4B3FX 4ILEA 3AF3A 1UF9A 1P4SA 4UXHA 5GVRA 3GP8A 1PLJA 3KB2A 1XP8A 3F8TA 3W8NA 1GDDA 5FL7A 3O8DA 4I99A 5DN6D 1QBKC 2GVZC 1G19A 2HJGA 3W3AA 1QHSA 3CCMB 1QFJA 2OSBA 4ASUD 3QF4A 4HZUB 4KYIB 1GKUB 1W44A 2WWFA 4L8GA 5ANRB 1W4BA 1KSJA 2QPOA 2WJYA 4L9SA 1N5IA 4OI0A 2JDID 4L9WA 2IXFA 3THOA 5C1BA 4LJ6A 2QRNA 3U61B 4LBWA 3A1WA 1VQ4B 1OW3B 5JJKA 2BM0A 3F5FA 1RRGA 4Q19A 4ZDWA 4OK5A 5DNYB 1AQUA 1OKKD 1KIMA 4HE6A 1JB9A 2CCKA 1S9HA 1TF7A 5FOWA 1YZKA 3L2OB 4PSAA 5EXPA 4ERNA 2TMKA 4OI2A 2RC6A 4Q9JA 4K1XA 1ZINA 1D6JA 3Q9LA 1KQSB 3A4LA 5FUWA 4AURA 3GLGE 1W7AA 4OHWA 2PIAA 3ZLJA 1OFHA 3HU1A 1HYQA 4WZBE 1U81A 2QSYA 4P6VF 4KXFB 4JL6A 4LBYA 2ODBA 2HYDA 1JR6A 1ZD8A 4LGMA 3N70A 3SFZA 3NG1A 5FR1A 1BO6A 1JR3A 4JS0A 4LV5B 4CEHA 1JNYA 3EZFA 5EXXA 2GZHA 2XXAA 1ZU4A 1CIPA 4IDOA 4EFNA 4HE5A 2RGGA 2V8OA 4E07A 3U4QB 4MRNA 1OXUA 3KQHA 4PAQA 2F7SA 4FMDF 5BW8A 4CVNA 4DLSA 1GUAA 3CNNA 3MRSA 4UNNA 3U3KA 5HZKA 1EFTA 4O2RA 3DM5A 4HAYA 1A2BA 4HYYA 1IXRC 2IUSA 2O8DB 4AK9A 1RZ3A 4HATA 4A0RA 4DJTA 1P60A 1YZGA 3BD9A 3CO5A 2X19A 5TR9A 3EPHA 2ZRMA 4J0QA 1OB5A 3SU8A 1ZP6A 3CCUB 1OXTA 1T3SA 2VTKA 5GJWC 5H5JA 4CT5A 3T12A 3A8TA 1HE8B 2ZJ5A 1E2IA 3CRW1 4Y0AA 4KFSA 2EVWX 1NBMD 1CQXA 2FZ4A 4M1SA 2XAUA 1WBDA 4B3XA 2RGCA 1EP3B 4TL8A 1UDWA 1YRBA 5K8TA 1QDEA 4I1OA 4RD6A 5E95A 2P2LA 3CNLA 4A82A 1GRRA 5EP3A 3U3MA 2YWHA 1JJ7A 2WAXA 2CNDA 3S1AB 4JLBA 3QKUA 1Q3HA 2X1VA 1IJFA 2PT5A 4G3XA 4EJSC 2ZRIA 4KCGA 3J81k 5EQTA 4Q1CA 3RRZA 2VEDA 2VH5R 1XEXB 2PL3A 2RGBA 2NO9A 1OF1A 2QTZA 1E1RA 3GEEA 3QBVA 4KLNA 5FL7D 1QHIA 621PA 3O8RA 1YHNA 3ETLA 3PR1A 1CKEA 3SJCA 2WKPA 4JSYA 4O3MA 3PCRB 2QMHA 4L5BA 2ZU0C 3BORA 2B8TA 2ZANA 2VP0A 3IQWA 5E7MA 3CCLB 4DXAA 4ZI2A 5KO2A 3VHLB 4XTRA 4FMCB 3CH5A 2R6AA 2WWWA 4C0KA 5JHHB 4AF7A 1CR2A 3VAAA 4ZDIA 3W5VA 3SS8A 4MRRA 4P4TA 1XEFA 3FGNA 1EFHA 1J9ZA 1ZUNB 5EXTA 4JBYA 1Q3TA 4BRWA 4C0QC 1SVKA 4E03A 4QM6A 3LX5A 2IYLD 2BEJA 4TSFA 4ZGQB 4QL3A 1BJKA 4NDZA 1VMAA 4F4CA 3U3OA 3ZH9B 4M1OA 1JXOA 3U7EB 2XB2A 2A2ZA 3L8YA 4YALA 1VIAA 2GETA 1KO4A 3NC1C 2QA4B 3PQCA 4BLRA 1UADA 1E2DA 1T0JB 1FTNA 1UBGA 1AGPA 1U9IC 3ZBUA 5EE9A 2IUUA 4BFYA 3VU9B 2CLCX 4V0OA 2A7QA 2NO1A 1NVVQ 4BPBA 3A4NA 3K70C 5BYKA 2RC5A 1Z83A 1GITA 4LC0A 2FSGA 4XIGS 1OPXA 1XEWY 1ZD9A 4PTLA 3V4RA 2Q9AA 3KXLA 3KQNA 2NGRA 5EE0A 2IT1A 1OH5A 2NQ2C 1F2TB 1Z8FA 2ZRKA 4AYXA 2CCJA 2OK8A 1GSIA 2E9SA 2OILA 2ZUDA 4Z1MA 1JR3E 1R7RA 3GJ8A 4IDNA 1Z6TA 2Z4SA 5H68A 1FZQA 1G41A 1G3IA 4YXWA 4EIWA 2H17A 4PQFA 5F3WB 1H8EA 1ZVQA 721PA 3CPJB 2OLKA 1QGYA 2PLFA 2ZJZA 4PHTA 3FPAA 5DI3A 5JZVA 5C18A 2GCOA 1YI2B 5J4VA 3K0AA 3OW2B 2FEMA 2AKAB 1E2JA 2MSEB 4Q5IA 1P2UA 2O8DA 3TVDA 1EFCA 2PX3A 4LYHA 4HAVA 3G6EB 1E2HA 4XD7A 2JLUA 3ZVMA 1NLFA 4MGYR 2ZRCA 4GSYA 5B30A 1XMJA 1FNNA 2YV5A 3VR1A 1KO8A 2ZPTX 3CUEF 2ZE6A 4GI7A 2QMEA 1R5BA 4MRSA 4KBGA 2ZYWX 2REOA 1GKYA 1COWD 2JJ2D 1IY2A 1UEJA 3CWZA 4NKRA 3T34A 3TR0A 3V76A 4DLXA 1X8LA 1Y3AA 2CVFA 3QKRA 3IGFA 3KTAA 2Q21A 2D2EA 1CS4C 1TF2A 1XZPA 2JLQA 3I8SA 4R98A 4AD8A 2UZ3A 1SVLA 1QHGA 1Z07A 2OUKA 2RAPA 3DKVA 4W5JA 1NN5A 1BH2A 4BZXA 5DIFA 4EPVA 3I4LA 3KKMA 1ZU5A 3SEAA 1K8AD 2ZR0A 1HTWA 1R5NA 3WNDA 4DCVA 5KPDA 5DHAA 3IUYA 1KO7A 1TNDA 1A4RA 1IN5A 1CJVC 1GNRA 5EE5B 4F93B 1UM8A 4M1TA 1JJ2B 3KZ1E 2GCPA 3VR6A 4PHHA 1SVSA 1E9EA 3IIJA 2ZVPX 2H18A 2BHRA 2VP9A 4ABYA 2Z83A 3SYLA 5FTMA 4A0GA 2CRVA 3OZWA 3TE6A 2ORIA 3D7MA 2FN4A 3I56B 3RWMB 2WJHA 4NZYA 2V54A 5JEEA 1EFRD 3K0FA 2ZS7A 4ZO4A 1TF5A 3EXAA 5LD2B 5L3SA 3FHOA 1K73D 1YE8A 1JAIA 2A5GA 2ZJAA 1P62B 3QVVA 4XTCS 4DBLC 4Q66C 3OIYA 4ZDKA 4S35A 1P2TA 3SZRA 4A2QA 5FI1B 2GKSA 2AD5A 4BLTA 3AVXA 4QXAA 1S3GA 5H70A 1GOTA 3Q85A 4IEIA 3R8CA 4TWZA 1HV8A 3ZVNA 2GJ9A 2CVHA 1XCPA 1KI4A 4Q4LA 2B6HA 1OB2A 5BN3A 1I4LD 2BBTA 3B13B 1IAQA 2RMKA 2GXSA 1GTVA 2QM7A 1D9ZA 2GK7A 4LBVA 3B1XA 3UWOA 1Z6GA 1GL6A 3NEJA 3W6OA 1WB9A 2FG5A 121PA 4D4KA 3PJRA 4OKSA 2R44A 4EFMA 4OYHA 2WPDD 1N6PA 2GJSA 2QT0A 4M2LA 1AKEA 3UXMA 1XTRA 4BFZA 5AWFC 1E99A 2QSZA 4I1SA 3SJBA 3K70B 1P9RA 3VMFA 2OXCA 1NI3A 4Q4AB 3LLUA 3MD0A 2CHGA 4QHTA 2YVUA 2FH5B 4H1VA 4I81A 2ERYA 2NMVA 1OE0A 2GXUA 4Q47A 5FOSA 4BFUA 3BRWD 4HB2A 3MFYA 2V6JA 3LDAA 2ZIAA 2RGAA 4LUCA 4D6PA 1AA9A 3RRNA 1Z08A 1UKZA 1WRBA 4PC6A 4LSGA 4DLZA 4EPWA 4RKEA 1F2TA 3IKJA 3OEHA 3FTQA 4DKXA 1XZQA 5FOTA 2RH5A 1VQ8B 2I1VB 3NIBA 3A6PC 2UVQA 3PEYA 3BH7A 1YHQB 2NPIA 2OO7A 4O25A 2QBYB 5CB6A 4Q9HA 2VNKA 3ZS9A 3UANA 4KU4A 2R9VA 2R6GA 4D82A 2G77B 1DBSA 1VG9B 4EAQA 4HEJA 3I55B 3RNLA 2AL7A 5FR2A 4TLEA 3QQ5A 2YYZA 4FMDB 2XNDA 3OAAA 1Q1ZA 4QGGA 4LY6A 2ZE8A 2CMKA 3NWJA 4JL5A 4ZIRB 2XJ4A 4Q4JB 2CE7A 1TL7C 2WSMA 3KKOA 4ARZB 3M4YA 4HLQB 2XXAB 3T1VA 1N2CE 4A0FA 4B2PA 2W83A 4KBFA 1ZNYA 4D0GA 2ZRHA 3DZDA 1FFHA 1N3BA 1N6LA 2R6CA 1VCIA 2DETA 4YMWA 3GLFA 5JRZA 4BEJA 2BPOA 1W2HA 3IBGA 5E7JA 1HT2E 3W2HA 3WYGA 1SXJA 3SR0A 4DDWA 2YC4C 2BGJA 3G71B 3A1VA 3E2IA 1AZTA 1I2MA 1Z6XA 5J4LA 4RCZA 3FPKA 1ZM3A 4Q1BA 1A2KC 1G7CA 1R6BX 4A4DA 1M1KD 4JLNA 3GMTA 1VCOA 1YJ5A 4Q00A 2BV3A 2VSOA 4LYAA 3MWYW 4K8OA 5K8LA 2W6JD 1Q1EA 3CX6A 3LO8A 3G4SB 4IDPA 1M6NA 2BMDA 4JVLA 3BERA 5HZHA 2F1JA 4G1VA 5JI2E 1V5WA 5HCIA 1JAHA 1MT0A 3W9YA 4QRHA 1CR0A 3R8FA 4DCTA 2HV8A 5DHFA 2N1BA 2PH1A 4PHFA 4DLRA 4LJAA 2KE5A 3D6TB 3MAAC 3NTUA 1FRNA 1NSTA 5CK4A 4PC1A 1T91A 4PFSA 4F7WA 3KXIA 4IOKA 2GBLA 2WSSA 2H7VA 3VNVA 2OCYC 3KUCA 3C7KA 4LJ9A 1AZSC 1QRAA 3AH8A 5A0FA 1AMOA 1GVNB 1M2OB 4DDVA 4US0R 2AHOA 2ZUBA 4HAXA 5GJBA 2DCUA 2IHBA 1YKSA 3B1VA 1S1CA 3KJGA 4E5UA 2FGKA 4BLQA 1RKBA 2K5UA 2GJAA 5JHGB 1P72A 2XNJA 3AF1A 2X77A 1G3QA 3ADKA 5AR1A 2QEQA 5F98A 3VKHA 2F9LA 3BH6A 1KD1D 1IXZA 1SKYB 5IHPA 2IF0A 4TMVA 1IOZA 5IT5A 1R0YA 2W6IA 2ZYTX 2PLRA 1ESMA 1NG9A 1VHLA 1E79A 1DG3A 2QGNA 3T1QA 2XOKD 2O0HA 1S1MA 3V4FA 1B0UA 4TLAA 1QG2A 1GZSA 1ANKA 1E69A 3B9PA 4PAMA 4MKIA 1QVGB 5DLQC 2PEYA 5JWRA 3SJAA 2PZEA 1YR7A 5KSZA 1E2QA 2ZRNA 3W2EA 4PSKA 4X8OA 2WTUA 1VECA 3C14C 4X8MA 521PA 1SHKA 3R9IA 2VP5A 5DGXA 1IN7A 3ZQ6A 4B2IA 3LAWA 3OAAD 1KI9A 2AXNA 2ONJA 3I61A 4M9ZA 3GFTA 2ZITA 2DBYA 4Y9RA 2GEDA 4WOPA 2JA1A 2VLIA 1W35A 1W4AA 4U00A 1N5LA 3QJYA 4RCYA 2QY9A 2X2EA 3TLXA 1KSHA 3EC1A 2WKQA 4ZIRA 1NNEA 2HDNB 4Q4JA 1XTIA 3KB1A 4LK2A 1Z0IA 5KSYA 1CJMA 4IDHA 3QF4B 3IPYA 2P3SA 1SXJD 5EZ6B 1S2MA 3MCAA 1NMZA 3DMNA 1GAWA 3B85A 3IIMA 2C78A 3PV0A 3SHFA 1S3SA 2O0JA 4ASUA 1VQKB 3ZVRA 2XSZD 4IDQA 3O8CA 1QG0A 4KHZA 3LV8A 4N1AA 3IO5A 2CDNA 1AK2A 2JDIA 2MSCB 3WBKA 2QZ4A 3B7GA 4RFVA 4EFLA 2VBCA 3IO3A 4TMTA 3QEOA 1NKTA 1RC8A 1QUFA 4NYMR 2EFCB 2CJWA 2NO0A 3OZXA 1KMQA 2IS1A 2G0TA 2IXEA 1I4DD 2PZGA 2EFHB 4ZCIA 5BN5A 3U3JA 3JZAA 4RZ2A 3JZMA 4NCIA 2IYZA 1G291 1WF3A 3SQXA 2Q9BA 2Y8EA 3WY9A 1ZNXA 1WCV1 5J4YA 2ZR7A 3T5GA 1QHHA 4WAUA 4LPSA 4P0TA 5EE3A 1G21E 4FN5A 3REGA 3VQTA 4MKGA 1P61B 3WMEA 3TR5A 3QPVA 4JLJA 1GIAA 3U6BA 4GMDA 4F38A 4TQUS 1VQOB 2D4HA 4MUAA 4QGHA 2AKYA 1IJEA 1ZM4A 1RYFA 2AFIE 1N0VC 2Q3HA 1G8YA 2CL0X 2LKDA 3QSYA 1N6RA 1AM4D 4KO8A 4LDJA 2Q3FA 1KI8A 4M53A 2VO1A 2V3CC 1A5TA 4I1VA 3ZVLA 4RD1A 1K5GA 4C3ZA 4OQMA 1W36D 1XB2A 4G5GA 1VDZA 3DKPA 3QOFA 3SHWA 3HP1A 2FPKA 2VSXA 3BJIC 2F6RA 2I4IA 2OFXA 1VKJA 3AV0B 4OHXA 3EA5A 2VNJA 3TUZC 4B44A 2F43A 5CLQA 3N5CA 4JYCA 5KSOA 1XPRA 3CC4B 1KJYA 3A1SA 3GD7A 4PPFA 3RAPR 2FEOA 2W6ID 3GJXC 3KXKA 2IUTA 3OIUA 4LHVA 2ZI7A 2ZRLA 1OHHD 2ZRGA 3RDPA 3RYTC 5M04A 4B3CA 5KHOC 1G3UA 5FH9A 3RSOA 1QG4A 5LDDC 4BGDA 3W2FA 1P7CA 4G0NA 1KI6A 4GOJA 5FL3A 4EPXA 3PXGA 1VQ9B 4Q7JB 3W2GA 3T5DA 5SZIA 4C2TA 1T3LA 2AK2A 5FBVB 5H1YA 1XTJA 1VQPB 4XWAA 3HJNA 1NBMA 1D2EA 4YMSA 2JLXA 2WWXA 1EP1B 3TKLA 4B32A 2D06A 5C4MA 2F3RA 2YWEA 3CPWB 1E32A 3CF6R 1JEEA 2ZQ5A 5AUPB 4V02A 1LW7A 3RS5A 1DAMA 4GNKA 2GEUA 1E4YA 4ZKDA 1T9HA 5HXBA 3THYA 3CXCB 1ZNWA 2PZFA 3REFA 4DZZA 3CX7A 1DVRA 2LCFA 2WV9A 2XTMA 1M7GA 1GO2A 1Z3IX 2PX0A 5AJVB 1A7JA 1MKYA 5CDFA 1M74A 1S96A 4MH0R 1HURA 1HEIA 3SDZA 2H5EA 3AF2A 4B3BA 3C5HA 3KFVA 2VP4A 4PPQA 4NCJA 1NMXA 2GESA 3NH6A 4I1UA 4NMMA 4B73A 3W5IA 2LWIA 4BRUA 1M1YE 4AC9A 1W49A 2VIIA 1YJ9B 3HR8A 3EPKA 1I4TD 1QVAA 2VHQA 1UDXA 5KNDA 3D31A 1XCGB 2Q9CA 1KKLA 2FNAA 2PCJA 4KI0A 1Z6YA 3SYKA 3HPRA 4BFXA 4DEYA 2JLVA 3TVTA 1NJFA 4DLTA 2JLZA 4CF7A 2GPJA 4QFMA 1Y63A 1Q1BA 2QMOA 4N3NA 4R71A 2AWOA 4C0JA 3GEHA 1Z0AA 1JBKA 5FI0B 2C96A 1DAEA 3AKDA 4HUQB 2A5JA 4R2IA 4TQ9A 4WQMA 3ZGXA 4LHYA 2IYSA 1Q21A 1DAIA 1QZXA 3W5UA 5DI9A 1PVOA 2Q0HA 1KDPA 4B34A 3VKGA 4P4UA 1DARA 1NMYA 4Q1DA 1XPUA 3AM1A 1D5CA 2CNWD 2OAQ1 4CYMA 3LLMA 1MV5A 3F3YA 1XMVA 2H16A 1D1NA 2ZE5A 4AYWA 4F91B 3IPXA 2BVNA 5L8VA 2N42A 2RGNA 3E1SA 4NCKA 3PFIA 1E0SA 2H92A 5CJPA 2DFNA 1E98A 1X1RA 3K8YA 3RS7A 3NKVA 1V43A 4DC9A 1XU4A 5FUYA 2J0SA 2G88A 2BMFA 3GLHA 4KFTA 2HT1A 2ZAMA 3TW4A 3ZQJA 5TY0A 4Z54A 4OQLA 3X1DA 3AKEA 2ZUCA 4DRZA 1FNDA 3P32A 1LNZA 1YJWB 3WP0A 3NHAA 4EKDA 1MRSA 4C0LA 3OJXA 1NKSA 1J8MF 2JATA 5DI3B 4W7SA 2G3YA 3BFKA 4NYJR 4NPHA 5L3RA 2GCOB 3K0AB 1GAJA 1MO5A 4BLOA 3O8BA 4WXRA 3OE7A 3EASA 2JIZD 1S0UA 5P21A 3AVVA 1OLOA 3ZC3A 1UBCA 2YHSA 821PA 1E2KA 2XZLA 2WAYA 1PUJA 2REXB 4G5RA 3QPWA 1F6BA 3AF0A 3CCRB 1NRJB 2F1HA 3N2IA 4URYR 1WMSA 1IBRA 4XWOA 4TYWA 3E20A 3KL4A 2GVDC 2ORVA 3MG9A 4TMWA 4JLMA 3RHFA 1SKYE 3QKRB 2W0SA 1NN0A 3KTAB 1U98A 4L15A 4Q48A 3FB4A 5AJWA 2BBSA 2JJ2A 1COWA 2CL7X 2XITA 4JVNA 2H57A 3EZ7A 3LBHA 3B2EA 4YHBA 5BYJA 3AP3A 3THWA 1N5KA 4KYUA 2C98A 3LFUA 3CONA 5J5CA 3SQWA 1IY0A 2EIXA 1BYUA 2PEZA 1E9CA 1T0HB 3FKQA 3OZUA 1VYUA 4QGAA 1UJ2A 3V9PA 1IN4A 1KAOA 2FV8A 3MGCA 1PV4A 1TUIA 3OHMA 1YVDA 4XVUA 2Q3MA 2VZLA 4KV9A 4A9AA 2OBNA 2QPAA 4FXPA 1NVUQ 4B6FA 1OH6A 2V9PA 3DHWC 4RJLA 2IYTA 4R9UC 4NE2A 3CB4A 3WRXC 1G8GA 2DWQA 3RANA 4OQFA 3K0FB 3ZZTA 2HXYA 3HYRA 2HCJB 4D2IA 4UNPA 1K9MD 1DO2A 3WXMA 5CDFE 5L3SB 3W3ZB 3B1YA 3VR3A 4G5SA 4TN1A 1EFRA 5LD2C 1YQTA 3QXHA 5D3MB 2YZ2A 4C43A 1E6CA 4FINA 4GRAA 4N0DA 1XD2A 3NBXX 3G5UA 3VX4A 3AVQA 2GBLC 3U6KA 2O8EA 1VQNB 3CF0A 3ND8A 4V0NA 4D4JA 2IHYA 1EX6A 4MRVA 3SFVA 4PXAA 2DERA 3LBIA 1W0KD 3G0HA 4G1BA 3MUFA 2REBA 5EZ5A 2QEXB 1H42A 3AUXA 3F0TA 3B6EA 4M0LA 1CP2A 3ECCA 2YKGA 1I2DA 2FJUA 1E2GA 1SVOA 4DCUA 2B21A 2Z4RA 5EUQB 1E1QD 4YQFA 4NONA 4IVRA 1S72B 1Q57A 2XZPA 2BC9A 4HUQA 3SI7A 2WJGA 1VG0B 3EPJA 2VNHA 2CLSA 2RHMA 3OF5A 4D4MA 2WPDA 4PZYA 4Q1FA 2BDTA 5DYGA 3LW7A 2BKUA 2DWOA 2Z6VA 3L0SA 4GT1A 2C04A 4IOMA 5B57C 1CF4A 2JJ1D 5FPHA 4CRWB 2ZJYA 1XF9A 3QE2A 3CX8A 3QY0A 4P31A 1NIPA 4XJXA 3IHLA 1AS3A 1E94E 2QTFA 2VF7A 4Z8XA 2YOFA 3RS0A 1XXHA 5CITA 1OH8A 3BFXA 3WHKA 3Q5EA 5G41A 2CCGA 5KDOA 1Q1QA 3TQCA 2WHXA 3FHTA 4IHQA 4PO8A 4G5QA 5ELXA 3EAQA 4MUBA 3A4MA 3VR2A 3LO5A 3U7FB 1R8QA 3OE7D 2J3EA 2HYIC 1CBUA 4WVFA 1M90D 1RIFA 2OT3B 2V7QA 3VFDA 1KNQA 4C0BA 3TGPA 3CZPA 1ZC4A 1TU4A 3GFPA 4LHZA 4RZUA 3OESA 1FMJA 4B48A 1D9XA 3VR4A 1E96A 3CPEA 3ADCA 1XTSA 4B4DA 4Q7KA 1JQJC 3HPQA 1BOFA 2NPFA 4K46A 6Q21A 2VPPA 4NHOA 3JVVA 4QGFA 1P6XA 2KBFA 5FOVA 1W47A 3LVRE 4EPYA 1N0UA 1Q7YD 1DEKA 2H1LA 1GNPA 1UEIA 2Z5FA 4W5HA 1OGJA 2L0XA 3GLFB 1CRPA 4RFSA 4DLWA 1SXJB 2OE2A 1YR6A 2F1RA 3AVUA 4CIDA 2GAOA 2ZRAA 4NL4H 4PC7A 3H4MA 4A2PA 3WMGA 1K8RA 1KY3A 1E2MA 5KPJA 4DLYA 2O8BA 1UPTA 4UJ5A 2GDJA 2ZRFA 4TTRA 3H2YA 3TIFA 1OIWA 4HLUC 5SZKB 1E9SA 5UKDA 5CIWA 5CYOA 2WWGA 4M9QA 2PBRA 3FFAA 2G9NA 2GEVA 2CE2X 2CHVA 3AF4A 4IKEA 3KKPA 3FVQA 2BJWA 1J90A 1FTSA 1G6HA 1XJCA 2W6JA 4S2EA 3CZQA 1OV4A 4PO1A 5JS8A 1II8A 1OGIA 4A6PA 5HPYB 2B7CA 2F3TA 3U60B 4QJ3A 5FFMA 2ZI3A 4OI1A 4DDUA 4NH0A 3TH5A 3B5JA 1G18A 4L16A 4WIAA 2FX3A 5LB4A 3U3RA 3E70C 1YZNA 2BMJA 4BZQA 4HB0A 5EP2A 3Q5DA 3CW2A 3QKTA 5CM9C 4C7OA 1KC8D 2QP9X 1XTKA 2ZJ2A 2IL1A 3HYTA 4MGIR 4A92A 5AUOB 1FRQA 5D3MA 2IXGA 4P3YA 2BM1A 1YR9A 4QBHA 1H8HD 5G3ZA 1RJ9A 1FNCA 2RHDA 1JA1A 3BH0A 2W00A 4MYCA 5DYIA 3SBEA 3SYNA 2FWRA 4ZCMA 4MKHA 2GK6A 2PJZA 4UNRA 5JJIA 5BWMA 1NDHA 4JYBA 3NBZC 4AF6A 2QQ0A 2FFQA 5K8UA 1FOEB 3O47A 2QA5A 3ZZ0A 3CM0A 1DPFA 2PCLA 3A1UA 5GV8A 1CJUC 1U8ZA 1NF3A 1K5DA 4H9GA 3WMFA 2BWJA 4MYTA 2XNSA 3PUXA 4UAJA 2KI5A 4BQSA 4Q7MB 1LVGA 5IRCD 4JVSB 2VHJA 1OFIA 4Q9IA 1OYYA 3LXXA 2QP3A 2EWVA 2ZI6A 5TB5A 2CL6X 3WP1B 3GJ4A 3EC2A 2ZM5A 5TVKA 3NDPA 2RKOA 4UKDA 4CEJA 3T1TA 3K1JA 2ZYVX 3ADDA 5HE9A 4V0MA 4XOIA 2H8KA 3BB3A 1ZRHA 4OI4A 5G40A 4PSVA 2AFHE 1ZD1A 1JA0A 1NJGA 2YJTD 3P27A 2XOKA 3GJ7A 3FE2A 4R7ZA 4UNSA 4DCNA 1JECA 3AQ4A 2J0QA 5GJCA 3AVWA 1EFUA 4KODA 4WW0A 1KGDA 4TTQA 3X1XA 2XEXA 3QVUA 2GZDA 1KHTA 2V7QD 3KKNA 3QIAA 4LYFA 4LJYA 1KO1A 4DIDA 2Q6TA 1X6VA 2WIAA 4M9XA 1GVHA 2ZS8A 3ICQB 3VKWA 2DWPA 2O8CB 3CRRA 1G7SA 4BUJA 2KJQA 4QNRA 1L8QA 3KDSE 2OBLA 3UKDA 4PQYA 3AP2A 2YWGA 2ANBA 2BBWA 2ZJ8A 1KY2A 2AX4A 3D8BA 1YZLA 3FDIA 5FUXA 1GR1A 1SVWA 1Z2AA 2X3UA 2I3BA 5F2EA 4MKFA 4F7DA 1ZCAA 4Q9LA 2J0UB 2EFDB 5L3QA 1U8YA 5TARA 3AB3A 3UPUA 3RS4A 1DG1G 2NOAA 5F9HA 3GQBA 4QG7A 3BWDD 2ZJBA 3P20A 1EP2B 5L3VA 2V55B 2O52A 3GJ0A 3ADBA 2EQBA 2ZTSA 1AQYA 2XSZA 5GVSA 2CJWB 3JQPA 1N5JA 3EPLA 4QKQA 4CEIA 1YU9A 1Q20A 2QTHA 1VQ5B 2NO6A 2C9YA 5CK5A 3JVUA 4CDGA 2QROA 3Q7PA 3RRMA 2W2TA 3GPLA 4NYIR 2X8AA 5TDHA 2R65A 5CIQA 1BS1A 1ZIPA 2ZRJA 1W4RA 2XGJA 4TQAA 1NP6A 1YZTA 1SKQA 1J7KA 1QHHB 2VL7A 4O2LA 3UK6A 2ODWA 3K09A 1US8A 1N25A 2GF9A 5CYPA 4UXIA 2JAQA 5B64A 3Q72A 1EWQA 1OIVA 2MSDB 4BFSA 4B75A 3OZVA 3UMSA 3LW8A 4MGKR 3Q3JB 1RRFA 4JT4A 1S8FA 3T61A 4FCVA 1KK1A 1P75A 1PLKA 1WP9A 1XJQA 1EX7A 4D0LB 1SVMA 3THXA 3GLIA 4UNQA 4OBEA 2BBOA 2ZR9A 2P6RA 4QM7A 1C4OA 1QHYA 4B47A 2QI9C 4E22A 3BE4A 4TYQA 1PZNA 3A1TA 3CCEB 2XB4A 5JECA 3AKCA 4O0MA 2G0NA 1ZUHA 5KDLA 3R7WB 2ATXA 3WNBA 1EWRA 1XD8A 2P67A 3GJ5A 2D7DA 1J2JA 2OESA 1UKEA 2WMNB 4TZ0A 1XTQA 3DM9B 1W5SA 2F43B 2ZXUA 1A82A 1MOZA 4TL9A 4U5XA 2AN9A 4N3GA 2QTVB 3LX8A 4KSCA 4US1R 3SBDA 3W6NA 2JLRA 2R6DA 3DPUA 1D2MA 1FMLA 1Z29A 1Z0DA 3B1WA 3EX7C 3CCQB 4TYNA 3K9NA 5IDVA 2GJKA 1Z6AA 2VQSA 3TJZA 2B7BA 2P5TB 1G8PA 2WOJA 3UMRA 1KI6B 4ZKEA 4GZLA 3V00A 4PR0A 3DL0A 1OHHA 1DAKA 2ZEJA 3H86A 4Z8YA 4BEBA 1OT3A 2J0VA 4QC2A 3WBJA 3AP1A 4G1UC 5FUVA 1ZM9A 4C30A 5A5GA 4RZXA 2YOGA 4A8JB 4KJZA 5DISB 1Z28A 1X1SA 1OFUX 3DVLA 4BECA 1OXVA 1Z0JA 1KI1A 2A5YB 4PQRA 3TQFA 2VP2A 2FZLA 4FD2A 1Q0UA 2V1UA 3THYB 4KITB 1G6OA 4LJ4A 1G20E 3X1YA 4DEXA 1TEVA 4EUNA 1E9AA 2O8CA 4M9SA 3H1TA 4Q02A 3GFOA 3ICEA 1P73A 4M1MA 1IM2A 2FOLA 2YC2C 1G1MA 3P1JA 4II7A 3ZDQA 5AJXA 1NVWQ 3LY5A 1HY3A 2IW3A 4YDHB 2DB3A 2BCGY 1YZUA 2G1JA 1SM4A 2BSAA 5C2JB 2J0UA 2WWIA 3LNCA 4QJ5A 4LYJA 2A78A 4BWYA 3G82C 2ZRBA 3CRZA 1JI0A 1AIPA 2F55A 1GWNA 2DFLA 1PJRA 3TUIC 1KI3A 2FGJA 4YMTA 3PVSA 3RRYA 5HTKA 1Q86D 3GLFE 4WXPA 1Q12A 2ZU6A 4FMCF 5FPKA 1SXJE 1Q22A 1TQ6A 3EZ2A 1N6OA 4LJ8A 1RRCA 1RE0A 2QE7D 4RZ3A 4IOJA 3BOSA 5KNBA 2A5DA 1TTTA 3KQUA 5E7IA 3MLEA 2GRJA 1QVRA 4KFRA 5LPNA 1X8JA 1G7TA 1IB0A 2ZRDA 3C4JA 4DUGA 5CB8A 4DWJA 1F3OA 2OXRA 1G5RA 5GV7A 1UAAA 1ZAKA 1VYVA 2V4ZA 4ZPXA 1K6MA 3W34A 3CR7A 3DZ8A 4RKFA 2JLYA 3U7GA 3OJWA 4AKIA 3TMKA 3TSWA 1MR3F 5FTNA 2HF9A 4D80A 1NSFA 2VNIA 1ODFA 4LOAA 4D25A 1NY6A 3RC3A 2CHQA 1LTQA 3NDBB 5HKKD 2CNWA 4QBGB 2GWHA 3GLHB 3W6PA 2HJVA 4HZIA 4GZMA 4IXNA 3PUYA 3P4YA 2EFEB 5KUTA 1QVFB 3N2EA 1XJ0A 1U0JA 3KUDA 1MH1A 2MMGA 5AJYA 2IEZA 1G4UR 3R9WA 4IFEA 5EJEA 1R8SA 3LBNA 4NP6A 4I4LA 2HMAA 3WNCA 1YRAA 4B74A 1OXSC 2BMEA 2IEYA 3R7WA 5G3YA 4CW7A 1KJWA 3M0EA 2ZS9A 3ZZUA 3LRPA 1RYHA 5KDDA 5JCPA 2GJ8A 2OCAA 4V03A 5EE1A 3A36A 4JLAA 2A9KA 2C9OA 1N0WA 2ONKA 5AJZA 4Q01A 2JIZA 5IF9A 3TK1A 4M1WA 5TV2A 3H0KA 5JBQA 4D81A 3LWNA 1NIJA 2BF4A 1Z63A 1KJZA 4AYTA 2JCSA 4BPRA 3IILA 1E63A 1QHNA 2YWFA 4ESVA 2HUPA 1G7RA 3KX2A 2EYQA 1GFIA 3WYFA 4P4SA 3THWB 2A3RA 2E87A 1LFDB 3NBFA 2QRZA 5E3HA 3ZD7A 1Z0FA 4A8JA 1E64A 3NHBA 1L2TA 5KOYA 2NG1A 4XWKA 2FSHA 4JT2A 1DADA 2ZETA 3DOFA 2XZOA 1GP2A 4OHYA 3ZD6A 1IN6A 4A15A 4B2LA 3L0OA 1E2PA 5HCNA 1NVVR 1MABA 1JJVA 2RGXA 2WVJA 4NBSA 2WWYA 4URWR 1XCMA 2IYRA 2W2VA 2QMUA 5AN9A 1DAFA 1HUQA 3U44A 4HB3A 5JWOA 1R4AA 1WXQA 2XTZA 2IYUA 1E9DA 4AKEA 1G5PA 4L4UA 4R2HA 4FWTA 1N8RD 1CLUA 3QXJA 2IWHA 2BN4A 3BGWA 1RFLA 4Q7LA 1FNMA 4IFBA 1FL9A 5E4FA 4NCNA 3A58B 5EMNA 4B76A 1KK3A 1NJID 1T8UA 4YONB 1XD2B 4FMBB 2QENA 3ZJYA 5JJLA 3H84A 2QAGA 3HDTA 4IRUB 2O8EB 4DT1A 4LZZA 3CC2B 1T5LA 3QEJA 1LB1B 1F20A 1LS6A 2DYKA 3ZYCA 3BAFA 4TL6A 1U0LA 2ZE7A 1ETUA 3X1WA 4HDQB 1W4CA 4PGOA 1YJNB 3SC3A 3T15A 2OK7A 2PMDA 4UQOA 5FTJA 1W0KA 4DUGD 1MO6A 4NCHA 2GHIA 4TLCA 2O8FA 1L7VC 1M8PA 1U94A 1T4GA 5KNCA 3FJOA 3VNUA 3CRMA 4OQNA 4JJKA 1E2NA 1E1QA 3IDQA 3RSLA 4XSGA 1ZW6A 1KRHA 4YC7A 5KSWB 4C0HA 3PUVA 4WZ6A 4B35A 2FDCA 5IK2D 1KK0A 2GQFA 1JPNA 2WMOB 1G4AE 5KTYA 3EZ6A 2RCNA 3RWOA 1G5TA 1ZIOA 4IVPA 3VHXA 5TXGA 3ZIAD 2VYQA 4QHSA 3U2QA 1U2RA 1XXHB 5AUQA 1U0HC 1WE2A 2JJ1A 4DLUA 1W0JD 3FMOB 2C03A 3KKQA 1Z47A 3BB1A 1R0WA 2ZSDA 4FCTA 5JSZA 3NXSA 3KJEA 4JJZA 4JLOA 2EWWA 3KQLA 2IS4A 4AKHA 4Q21A 4HLCA 1E3MA 4RD3A 1CR4A 2VHUA 2EU8A 2GF0A 3K0CA 3U5ZB 1ZUIA 1XE1A 3CRVA 3M6AA 5J40A 4OHZA 3R9XA 1UKVY 2HCBA 1O87A 1J99A 3HU2A 1TX4B 2CK3A 4TMKA 5JWHA 5SZHB 4V0LA 4OK6A 4DDTA 1CXZA 1VQ7B 2G1KA 3L0IB 2NTYC 1P5ZB 1S9DA 4MYUA 4UXJA 2WICA 3PEWA 3UWKA 3LD9A 4BE7B 3ASZA 2GXAA 4RFSB 1XFAA 2GXQA 4G5OA 2IYQA 3QXXA 1SXJC 1LF0A 3D3QA 2OLJA 3B78A 5GADl 1R10A 2O8BB 1NL3A 4YAFA 1FPMA 8OHMA 4NYMQ 3CD6B 2J59A 1VHTA 1CJKC 4Y0VA 3SJZA 3GCGA 5D3QA 1NBME 2OAP1 3TSOA 5HR5A 3P26A 1XDBA 5K8IA 1VG8A 3I1FA 4DQLA 2B5OA 1E2EA 3MJRA 1X86B 3BBPA 1E2LA 1E0KA 3QFSA 1FQKA 1TAGA 2BKEA 5FOUA 2QDXA 3EW9A 4BLPA 3K0SA 1ZNZA 2VSFA 3IQXA 4D0NA 1II8B 5EUMA 4N0EA 1E0AA 1Z2CA 4TMZA 4ZI3A 4XVQA 2VF8A 4MRPA 1X3SA 1E0JA 4JZKA 4DSUA 4YMVA 1P9WA 3K09C 3PG5A 3VX3A 1R5OA 5FPTA 4C7OB 3KFXA 1TMKA 4EQ6A 1Z5ZA 4DB2A 3I62A 1AJEA 4OK3A 2ZI5A 2NO7A 2HF8A 1FDRA 1XRJA 2AWNA 1RJ9B 3BS4A 4GFDA 2WJJA 2OV2A 1YITB 1F2UA 2FPMA 1EESA 4B71A 1EWYA 4ON9A 4XSHA 3IHWA 4JKYA 2AK3A 1H8HA 3CCSB 4B6EA 2D62A 2V1XA 4JKIA 2X2FA 3QG1A 2IF2A 1U8AA 2XTNA 3B8HA 1ZM7A 2B8WA 5JMTA 1UBEA 4OJKA 1QGZA 3HWSA 1NY5A 5LBIA 3OIWA 4JLDA 1W36C 1NG1A 3W2IA 1TQ2A 2BEKA 3ZS8A 4HZUA 1D8TA 3WYAA 2B92A 5F9FA 1QGAA 1LS1A 3FOZA 1WA5A 1ZM2A 1KKMA 1UFQA 4QBFA 3QXSA 4KFUA 4Q03A 4WBSA 3AGQA 4ZV4A 2FFAA 4H1UA 4BZPA 2XNCA 4CEJB 2JLSA 1ELOA 4C0SA 3CCVB 1UKYA 5H8WA 3A37A 3IEVA 4IVQA 4PC2A 1GKIA 2IK8A 4QNMA 2KWIA 5DH9A 2KBEA 1W48A 5FA6A 4YAUA 1R0XA 1IY1A 4B3GA 4FIDA 1GL7A 3U7HB 4Y9UA 3CLVA 1NVXQ 2JLWA 2P6UA 3GLHE 4A0HA 1GRQA 3RLFA 1SQ5A 4W9MC 4Q4HB 1A8PA 1W46A 2ANCA 2BJVA 1L4YA 2WKRA 4JSTA 1BQEA 3AKYA 3EZ9A 2R8RA 2DHRA 2ZSFA 1JR3D 3I73A 4KSBA 4A1FA 4BFWA 5FBRB 3QENA 4AG5A 2CK3D 1KDOA 3EIEA 3BIFA 4QOSA 4F4JA 1BX0A 4ZCLA 3K9HA 5EXSA 3BB4A 2AR7A 2E1RA 1OSNA 2IBMA 1BYIA 3MMPA 1VIYA 2W2XA 2ZAOA 4LHWA 4OQXA 4GP6A 2R6HA 5L3QB 3EA0A 4TMXA 4HSEA 4PC3A 2GILA 2F9MA 3QFRA 3U4QA 1B2RA 2ATVA 1E2FA 3SNHA 2YOHA 3FMPB 2IA5A 2WOOA 3WHLA 4GDFA 1II0A 1Z06A 2IYXA 4A2WA 3AVOA 3AVTA 4U02A 4C4PA 5KYKA 2J87A 3AUYA 1M34E 4YMUA 3CH4B 2ECKA 1VPLA 4FCWA 2IX3A 3B82A 3AGPA 4CEIB 1IONA 4IW3B 5BN4A 1II9A 3DEFA 4U7DA 1IN8A 1J8YF 3X1ZA 3GJ6A 1VCNA 4TZ6A 2PJRA 1NLZA 4HAZA 2UZIR 2ZSBA 2LKCA 4DSOA 1U99A 3BFVA 2P5SA 3DDCA 3FYHA 2EYUA 2JEOA 1UMKA 3BK7A 2C2HA 2ERXA 4W5WA 2R62A 2QGZA 5JCZA 3L82B 3NVAA 2C8VA 1QX4A 1F48A 1RRPA 2P6NA 1US8B 1KO5A 3MSXA 1YR8A 4TTPA 2QP4A 4HB4A 1GRNA 3TW8B 4BFTA 5SZJA 1WDTA 3I72A 5G53C 4GOKA 1FX0B 1CULC 1TPZA 3MWJA 4EPTA 3SOPA 1KDTA 1GAQA 3B9QA 1FNBA 1FP7A 4LI0A 4YAOA 4EJSB 3S1AA 1E1RD 4JIMA 3THXB 3GLIB 2QQEA 1XNJA 2PT7A 4DSNA 4TLDA 3QNUA 1XEXA 4JBWA 1G3MA 1OIXA 3C41J 4XH9B 2QM8A 1A1VA 1MRNA 4URXR 1GJRA 5EP1A 3T35A 3C8UA 4FW9A 3E5HA 3IEUA 3LA6A 2NIPA 3TAUA 2IWRA 4NYJQ 5FOXA 1W36B 1KYIA 4RVCA 2CBZA 3LVBA 1DDIA 2UKDA 5J4HA 2JASA 4Y7CA 1JB1A 3LQQA 4LV8B 1DAHA 4DLVA 4PAOA 2RB4A 1OJLA 2VYFA 3EARA 4KLZA 4TSFD 2OEPA 4KVAA 1VYTA 2FSFA 1VQ6B 1L4UA 3C16C 1CU1A 3PUZA 2OHFA 5J4KA 2VRWA 1KSGA 4DSTA 3CBQA 3PEUA 3LQRA 4MITA 1S4QA 4MA4A 3CMAB 1J70A 3VO1A 1W5TA 3P4XA 1W34A 1O3YA 3RS3A 5FTLA 4HI0E 4X8HA 1G3RA 1T3HA 1WBBA 3B1ZA 1XEWX 1SZPA 3RABA 1G64A 1QUEA 4LJ7A 2DFKB 4JLVA 5LB2A 4ZGNB 1XXHE 2C99A 4M1YA 4A8JC 4P32A 1D2NA 4Q4HA 3VU9A 1DO0A 3ONWA 1E9FA 3FWYA 4FI3C 2QU8A 4XVRA 2VP6A 3AVYA 4OJQA 2WIBA 5AUNB 2FSIA 1WQ1R 3K53A 4IOLA 1G8HA 4Z1MD 3TSZA 2HXSA 2N46A 2ASEA 1GNQA 2FA9A 2V6IA 1EXMA 2R6FA 2J9RA 3OIVA 4PZLA 5A4JA 3FKSA 4DQKA 1PLLA 1P2VA 2OG2A 3BXZA 5CJ2A 4CZ2A 4YXWD 2O5VA 3C5CA 4A6XA 5BXQC 1H8ED 4X8LA 4PANA 4RD0A 1IHUA 2NZJA 1P9NA 3X2SA 1OH7A 4MDEA 2WWHA 4MGZR 4TYPA 2VA8A 2OFOA 3HU3A 1G16A 4PPNA 4DHEA 2QORA 2IYWA 3L43A 4FK8A 2ZI4A 3Q8XB 3FHCB 3K9LA 3UIEA 5DSZA 3B60A 1OYWA 4XD7D 2QAGC 4G01B 3NH9A 4PO9A 3TRFA 1UBFA 1DAGA 3TBKA 3PIRA 1C9KA 3M1IA 2OTJB 4YLGA 4B43A 1TVCA 5THXA 5EP4A 1T5IA 1CNEA 1KI7A 221PA 1NN1A 3TNFA 1ZBDA 4DVGA 2YNMA 5B58C 5C46F 1HQYE 5FBLB 4GBMA 1QFZA 2DEUA 2GAAA 4LCBA 3KJIA 3C15C 3ASYA 1VTKA 4QJ4A 2QE7A 2CLDX 1LF5A 5JI3E 4HAUA 1Z22A 5FBQB 3OEEA 4LBZA 5JS7A 2J7PA 3VR5A 2Z43A 3EIHA 4LRWA 2VHTA 1DE0A 1C1YA 2SHKA 5FPYA 1JQLB 3K0EA 4NTZA 1CTQA 4HAWA 1KTVA 1E9BA 2QL6A 2ODEA 4U9UA 4M8NE 4D4LA 1P2SA 1IQPA 4LWZA 1JEDA 3MWLA 3SN6A 4RD4A 2I1QA 1FX0A 421PA 3NBYC 1B23P 2A30A 2RGNC 4OL0A 2GA8A 4URUR 1P3JA 3FMFA 1GM5A 4EJSA 3GLGB 1G17A 2G83A 4YDSA 4NU0A 5HKKA 4OHVA 2WBLC 1Q81D 2BOVA 3CIOA 2FFHA 1TQ4A 4Q18A 2VHCA 4RY2A 1FQJA 1T6NA 1TQDA 4PPGA 2FE4A 4AIIA 1KAGA 4ESHA 1R0ZA 2ORWA 1LY1A 3RC8A 1F60A 4KAXA 3EIQA 4D26A 1GG2A 3TAHA 2QUZA 1BMFA 2AXPA 2FMXA 4M22A 5KSPA 2D74A 3T06B 3CCJB 1G9XA 2MMCA 1W2BB 3K0CC 1OXXK 3LVQE 3SE0A 5FBWB 1ZMXA 2QAJA 1BIFA 2ODNA 4IXMA 4B33A 4P33A 4LC1A 3ZBTA 1ONBA 2P0EA 3FMIA 4E09A 3LXRA 4IEEA 2FU5C 2OZEA 4M21A 1RW4A 2FPLA 4FWIB 1QF9A 3AEZA 4URZR 4Q1EA 3QPUA 1Q82D 3GJ3A 4A36A 3EG5A 1TLLA 5B2ZA 3K9GA 3EWAA 3QBTA 1CRQA 2J45A 2W0MA 4RD2A 1E62A 2O0KA 5JRJA 1T8TA 4V0KA 4ZDJA 4HDOB 3W90A 3QKSB 4WA7A 4MQBA 3CR8A 3EWSA 3NC0C 4JMPA 1M7BA 3L0PA 4P4SB 3VTKA 5KU1A 1KMHB 4V0ME 1DELA 1U9IA 3KJHA 2BGIA 3W5HA 2ZYUX 4TT3A 3RVBA 4BFVA 2FFBA 1CJTC 3UATA 3MHPA 1IXSB 4HDCA 1FW6A 2FF7A 1HE1C 1MABB 3CC7B 1X8KA 3QXCA 4US2R 5H59A 1ZYUA 4Q4AA 1KZ7B 1JPJA 2WJIA 1XMIA 2A5FA 2D2FA 3KQKA 3FKSD 3OFNA 1XPOA 3ND9A 3U44B 3I8XA 3OEHD 1AKYA 5DE3A 3QFCA 2J7KA 2OM2A 2QPTA 4M4SA 3QE0A 4DIEA 4IJMA 2J41A 2GNOA 1FUUA 4CT4B 3LH5A 4KVGA 2R2AA 2OBMA 2HLDA 2IS2A 3AVPA 3I3SR 4GOXA 1RVDA 2QAGB 4AY2A 1DOAA 2QBYA 4DT1B 1HH4A 1BKDR 1VQLB 2GTPA 3RS2A 5JLJA 4ACBA 2XNDD 3CRQA 5J47A 4HLDA 2KSQA 1ZJ6A 2D3WA 1W87A 3UG6A 1U90A 4EDHA 5JFGA 3MWKA 2RGDA 4DB4A 3I5YA 1XBTA 3I5XA 4M1KA 2AD1A 1DDGA 2O8FB 1KI2A 2BMWA 5FTKA 1TEXA 4PHGA 4ARZA 2QTLA 4JL8A 2JGNA 2GCNA 3E1YE 3OEED 3PUWA 5CM8B 4ACAA 1CR1A 3CKLA 1KDRA 3I32A 4LX0A 2J7PD 3CMEB 5DN6A 3I92A 2DPXA 3QFTA 5C4GB 4POAA 4EH1A 2HEIA 1JALA 4BLSA 1NLYA 1KOFA 4ITRC 2W58A 1XWIA 4AKGA 3QI2A 1TADA 4JBXA 2BCJQ 4Z51A 4GL2A 4URVR 3QF7A 3CF2A 2ZROA 4F4IA 2DFTA 5DO9A 5IK2A 4DCSA 1AS2A 4JVMA 4HLUA 4BASA 1H85A 1SGWA 2ZI9A 2XX3A 4YAWA 3VO2A 3PITA 1OKKA 3PENA 3FFBA 5JEDA 3GLGA 1MO3A 2C77A 3GEIA 2J1LA 4MYHA 2ZREA 3ZIAA 1QFYA 4PZZA 4PX9A 2IYYA 1VQMB 2QG6A 1KNXA 2J46A 1DS6A 1GILA 3W8RA 1F5NA 5JSZB 1ZCBA 2EFGA 1MO4A 3GLIE 1W0JA 2C9CA 1M7HA 1CNFA 1E9RA 1N6HA 1HT1E 2HT6A 3L8ZA 4LPKA 1TUEA 3CWQA
chains in the Genus database with same CATH superfamily
4K9NA 1UC5B 4HLNA 4LJ5A 1DMRA 1TGVA 3C3XA 3I5AA 3CNOA 3TFWA 4IM7A 3EHEA 3OFJA 3WKEA 4PN3A 4Y2GA 6GPBA 2GZAA 5K0SA 3KR1A 4IX9A 5IZ4A 4G23A 4F5ZA 1QHXA 1CY1A 2CNOA 1L1FA 1VG1A 2Y1OA 4CEHB 3RTCA 3COYA 4Z4VA 1XKLA 2P3LA 4YHHB 4J9VA 5K2MA 5JNTA 3KBOA 3O3MB 2VBFA 1L4FA 3OT1A 2OO5C 5LQCA 1OCEA 1PZXA 5DHPA 5GTDA 2QJOA 2QN6A 1VJSA 2IVFA 1TJPB 5K3SA 1H65A 2Z04A 1URPA 2BKXA 3MYRA 5CVVA 3NV9A 1PFWA 2WYHA 3GVHA 3VPGA 5FD8A 3SEZA 4EGSA 3I2IA 1E6UA 3RG2A 1RJGA 1SMKA 3KHKA 1I80A 2HK8A 4KE9A 3ZE6A 3HBFA 3GH1A 1ZC3A 2XQJA 3W9SA 4A0QA 4GP7A 1E7WA 1N5OX 1OFTA 4QPNA 5KVAA 4AI6A 1KMHA 2CEKA 2PAAA 3WK9A 5D1HA 5JNVA 1FP6A 4GSKA 1TW3A 5GJVC 2YY6A 4NEQA 2XB8A 5IX8A 3HXKA 1RHQA 2YINC 3Q7QA 3CN7A 3ANLA 3LDGA 4TRRA 3OFND 3TVYA 2UVDA 2EEPA 3MERA 5AK0A 1P4RA 4JLPA 2XTJA 2O6LA 4P7KA 4LQ4A 2AC2A 2HFJA 3IIKA 1JEYB 4HWTA 5LYJF 3DTTA 4MPPA 4LXTA 1UMCA 4ENPA 4NX2A 5EFZA 1H4TA 2C2KA 3NEYA 3R0JA 2YV4A 5GONF 1ZVMA 3I2GA 2J5XA 2ZBGA 1N6NA 2VS1A 3WBFA 1JBQA 1FDWA 1YZQA 2CZGA 4K81B 2ZKLA 4PFKA 4MDFA 4LV6A 3RSQA 3IBYA 3ZHUA 4YP6A 2EW1A 1XD9A 2G6BA 3K9QO 3OUUA 1A8SA 3KL2A 5KMGB 2HBZA 3FSEA 2OG1A 5BSMA 4G36A 2CYAA 3W7VA 1D7OA 3AF5A 1MUUA 5BWOA 5IJAA 1F2UB 5T5QA 2ZYSA 1LUAA 3KTDA 2D7CA 4NFSA 2FP4A 1R1DA 4ZFNA 5CDGA 3BCDA 2FFRA 3FBGA 2D2IA 3ER9A 3BD8A 4F3KA 1H6CA 4B3FX 2AG6A 4ILEA 1W88B 3LC7O 4NMHA 1J2RA 1P4SA 3GNSA 1W96A 4R8MA 4YRDA 5DWVA 5GVRA 3GP8A 1PLJA 1ZQ1A 2A6PA 1XP8A 1Y33E 2FLWA 3C0KA 2VF4X 3KB2A 4DNOA 2GK3A 4X95A 4XWTA 4U7HA 2PPLA 1BA3A 2RB5A 1KYYA 3DMFA 5B6JA 1Z5UA 2HJGA 3W3AA 3JWEA 1QHSA 2DY0A 3BJMA 2DTEA 3CCMB 1YQDA 2AH5A 3GFQA 4IFTA 3E5MA 2WYIA 3T7IA 4E14A 3LNNA 2O4CA 2XWPA 4HZUB 1K6JA 2WR8A 2WWFA 3REQB 1W4BA 1KSJA 1BCRA 3ORSA 1U3CA 1A0OA 4OPMA 4KMSA 4L9WA 2IXFA 3HB7A 3HEAA 1U8UA 4UHFA 5T4FA 4Q37A 4DL9A 4BNGA 5C1BA 4LBWA 1V7ZA 3HXTA 1E6KA 1OW3B 4M7RA 2XUZA 1FMCA 1KY5A 3PWKA 3ZWYA 1J0EA 2GCGA 5AOCA 2AEFA 4MV1A 2VC2B 4ZDWA 2JIQA 2R8OA 4MNTA 1EZZA 3QYPA 5DM4A 4K7JA 1QR2A 1XE3A 1RI1A 2VCEA 4MCIA 2J3JA 4KPUB 4P3OA 1UXOA 3C1OA 1E59A 5ALIA 3OE4A 5FA5A 4ERNA 1W581 1NNLA 2DWCA 4LGCA 1ZINA 1NYLA 1R6TA 1U02A 2WILA 3D02A 4FPXA 4N7MA 2QVGA 1IBKB 3V4VB 4XGIA 4D43A 4ECAA 1BKYA 4JKOA 4KX3A 4HGNA 4B40A 1BGVA 5C4IA 1UD6A 2A4MA 4G0XA 4IQ0A 3TG8A 1OFHA 2XE8A 4BX3A 4J1NA 1J42A 2BF7A 2A14A 4H1TA 1W29A 2QSYA 1X7WA 4O4JB 2YVAA 4P6VF 3I9OA 4KIGA 3S2SA 2R1TB 2CW5A 2NADA 4FFVA 1NVGA 3OF3A 3KETA 1YIDA 1OTYA 5IAEA 1JR6A 2C20A 4LGMA 5DNDA 4JOSA 3WRWA 4J16A 1L8OA 5B1EA 4C1BA 3HBNA 4IMPA 1JR3A 3KPWA 1F7UA 3EGEA 3SIWA 1QORA 1OWLA 1JNYA 5F3DA 1DMSA 3DZHA 1R0SA 1WSVA 2EP7A 2GZHA 3CV3A 5H16A 3A06A 3UK0A 4BNLA 1I5RA 1QNFA 3V1MA 1N3LA 2G9UA 2RGGA 3IVAA 5IM4A 4E07A 4BMSA 1T3GA 3AY6A 3KQHA 3RSHA 1LX6A 4QECA 4EATA 1ZI8A 2XYGA 4FMDF 4YYEA 3VH1A 1YQGA 2WIFA 3A3OA 3WWEA 5HZKA 3D3NA 2MYUA 1EFTA 3GI1A 3HCAA 3LUDA 3DM5A 3FYUA 2P3MA 1DZ3A 4LDNA 5KX5A 3UJ8A 4HYYA 4OHRA 2B20A 4AK9A 1O95A 4A0RA 4DJTA 4X91A 2FSUA 2YJZA 1YZGA 1O0CA 1SEVA 2X19A 3ZXUB 4WE3A 4ZC8A 5TR9A 1N2CB 1Y4AE 3IV7A 2JANA 5HF5A 3UMYA 3SU8A 1SH7A 1BCSA 5BN4B 1T3SA 1C8KA 3FWPA 1S2GA 2JLBA 5H5JA 4XYGA 3LS2A 4QFBA 1M3SA 2JHCA 3A8TA 1JRLA 1IZ8A 2QL5A 2WF5A 4L5JA 5CVCA 3DSRA 3EVBA 1A50B 4CMGA 4JJGA 3V97A 1G63A 4FN4A 2FZ4A 1RQNA 2QT9A 2NUAB 2ZPAA 1L7DA 3DG9A 3NHRA 4H7EA 5F5NA 1NI4A 2C97A 1NM5A 3GHYA 3BWMA 4R68A 2A0YA 3VISA 1Z88A 3LUGA 3UWMA 4IRMA 1YRBA 4IYRA 5FLYA 1X1AA 1TA4A 5E95A 3CNLA 3ZJTA 1JI3A 3VR4H 3IDFA 1R12A 3SLKA 4G89A 4P6YA 3U3MA 3ZCXA 1PL0A 3S2FA 4JLBA 3QKUA 1ESZA 1XZ8A 1IJFA 1SUPA 2LIVA 2B69A 4G3XA 4QLAA 1N9KA 5FBHA 5C7IO 4BMXA 4UMEA 4W99A 3P4UA 2PBZA 3RKUA 4BC0A 4Z4RA 1COZA 1JHVA 3GEEA 3UHPA 1OF1A 1E1RA 621PA 5TRTA 1QHIA 3W2TA 2O4UX 2D8AA 1VKOA 2FZ5A 3PR1A 4IG9A 1ACJA 2AZ4A 2WKPA 1GPWB 4O3MA 3F7NA 1H6AA 2QMHA 3L7OA 3I5UA 3BORA 2VP0A 3RIHA 5KO2A 3IRUA 5E6UB 3VHLB 1X80B 4Y18A 1OMOA 1TRHA 4DILA 3WL3A 2V97A 5A9TA 2Y0EA 1UBOS 1CR2A 1T2FA 2R60A 2WUFA 3CWQA 4A23A 1GCIA 3GLTA 3FOZA 3P5BA 4NZZA 5ARDA 4P4TA 4JI3B 3OD1A 1XEFA 1U63A 3IAHA 4EHBA 5LKRA 2DU8A 5EXTA 2AN4A 3DYBA 4KZPA 4C0QC 3MUEA 4E03A 1FS5A 4WRRA 4NDZA 1QV9A 2L18A 3EQZA 5EJ8A 4EB6A 2HTEA 4M1OA 1CUCA 4B4KA 4KAJA 4MR9A 4MAMA 4EMUA 1X1DA 3ON5A 3GROA 3R74A 3TTVA 1J4AA 1ADYA 1DKQA 2ZBQA 4ZVPA 3S70A 5CFMA 1VIAA 3R76A 3S2EA 2EV9A 4PLZA 3PQCA 4BLRA 1AU9A 1YRWA 3WA7A 3HL0A 1FTNA 1UBGA 1AGPA 5E0OA 1S5PA 5JFOA 4RK7A 4BFYA 5KYXB 1GQQA 4J0HA 2CLLB 1F12A 4FYWA 4MKZA 3U9TA 4XDYA 3ZU2A 4BPBA 2Z2KA 4JBIA 5BYKA 1SFRA 1WL8A 2SCUB 1Z83A 1NUSA 1PKVA 2GJPA 1GGNA 4XIGS 3NHJA 5ER9A 1GN9A 5EZYA 4R2MA 1E4EA 1MX3A 3E2MA 4PTLA 4PLFA 3WAKA 4IGAA 1C29B 3KQNA 3U1TA 3B38A 2IT1A 2O8VA 2VJNA 2NQ2C 3LKDA 4YR7A 4AYXA 1YRHA 3CNEA 2V0CA 2NU8B 1JR3E 1NKVA 4IDNA 1X9HA 3ORFA 3LLVA 2DQSA 3QLVA 1NX9A 3CGWA 5IANA 2UZAA 4EIWA 5MN5A 2V7BA 3HJRA 1I13A 3L0ZA 1QGUA 3MWFA 4PQFA 3O84A 4F85A 5HM8A 3NMUF 1AO3A 1QGYA 3KLPX 4PHTA 3EHDA 5DI3A 5IC6A 3N75A 4P3PA 5JALA 2GD1O 3SMQA 3ZWMA 3K0AA 4ED9A 2VTDA 4H3KB 1ABFA 1PR1A 2EZ9A 3BRSA 1YIAA 1MOSA 2XHEA 3ZV5A 5IT9A 2JLUA 4BB5A 4LISA 1NLFA 1P7WA 2A0WA 2JGDA 2ZRCA 3KYDB 2GZ1A 1XMJA 1ZMOA 3NPMA 1FNNA 1RT9A 1ISJA 1KO8A 2ZPTX 1N2ZA 2HQRA 1BMDA 1C0EA 3I1JA 2QMEA 5FULA 2VQFB 4V2UA 5TPZA 1R5BA 3HO6A 1FDTA 5ERXA 1UWKA 5U4XA 2C7RA 2ZYWX 3TEMA 1NUAA 4PHCA 2JJ2D 4YJ3B 4B09A 1IY2A 4WMLA 4OXNA 2DKFA 3OJOA 4RA6B 5FBZA 4AKTA 4DLXA 5BR8B 2JH8A 5B1HA 4L4ZA 3R09A 2WMYA 3T7EA 4AD8A 1XZPA 2JLQA 3I8SA 3LECA 3E27A 3ZW9A 4C3OB 4PLWA 4KUHA 1NBOA 4BZXA 2VYND 3K30A 3KKMA 3OIGA 3O8QA 4D56A 3CB2A 1K8AD 4DMCA 3WNDA 4DCVA 4J0FA 5HQ3B 4EW6A 2MHCA 2VJJA 3IUYA 5KPDA 3JRWA 3H18A 1BVRA 1MAAA 2M5SA 1TNDA 1WY7A 1A4RA 3NS7A 2AA3A 2H4HA 2VAPA 4FX2A 5EE5B 1K88A 3KIPA 3RQSA 3EFOA 1W5EA 1Z62A 3VR6A 1PIWA 2QD3A 3Q3EA 1CIJA 2O7QA 4G9EA 1VHDA 4N49A 3FPEA 2Z83A 3D43A 5ALRA 3VAYA 1PR9A 1SBTA 2CRVA 3O95A 1Z6QA 3TE6A 2ORIA 3V2IA 3UXHA 3D7MA 3IJ5A 1NJ8A 3N9IA 4OREX 5EHNA 1RPNA 2HN9A 1UBJS 3STHA 3GFGA 3RWMB 2WWRA 4NZYA 3WKDA 2VH2A 2C2YA 1SBYA 2ZS7A 3GRKA 3PFWO 1JXQA 2ES4A 2CFIA 2CD7A 3OLYA 4OUKX 4KQJA 3TLMA 5L3SA 5CAEB 4BQPA 3QVVA 4DBLC 1P62B 4WN3A 4LZJA 3ZWCA 2FR8A 2PH5A 3CFYA 2PM8A 4CLDA 4DKJA 4BFCA 3CU5A 3GA5A 5HS4A 5M29A 4WKNA 3IIIA 3ISJA 5YASA 2ZT7A 1WSRA 1NVAA 4NZMA 3HB0A 4F3YA 1TYEB 4JI1B 1S4MA 3ZVNA 1C7QA 3IQEA 2GJ9A 4W8HA 2Y6UA 3VU3A 1KGSA 3NTXA 3MCTA 1A9OA 3E3LA 3C3JA 1ZMBA 1KI4A 4RL4A 5J2TF 3G7NA 5BN3A 5BWNA 1I4LD 2I22A 2YR0A 1AKNA 5MFPA 3EIXA 4QJIA 1YULA 1IAQA 2RMKA 4O2BA 4XR4A 1JIQA 1RTTA 2DSNA 3C6ZA 4CODB 5ICMA 3MHTA 1ZGGA 2C7VA 4JOCA 4YN3A 2GK7A 2R5FA 1K7SN 3KYJB 3L05A 3D2AA 3W6OA 3LOQA 3H3FA 3MWDA 3DVAB 5LN1A 2XOEA 4FU0A 4EHHA 4ER3A 3DKKA 2GJSA 3NYIA 4M2LA 1WG8A 1AKEA 2LP4Y 3W78A 4C4TA 1BDJA 1XTRA 2NYUA 2HMUA 3ER6A 1JR4A 2LR0A 4BFZA 4DUYB 4E0FA 1OWOA 1E99A 1L1QA 1UPBA 2VBSA 2PPVA 4IIXA 3SJBA 1IWPB 5KCZA 1N7HA 1NI3A 3DE7X 3DKRA 4PRKA 5CBPA 4QHTA 1SCNE 1EUDA 1RP7A 3ZV7A 2FH5B 5AH0A 3D3WB 2NMVA 1OE0A 1HLDA 2IODA 3QWAA 5FOSA 2ZSIA 3EUWA 4FD3A 4HB2A 2ETVA 4ECEA 1CW2B 4GXRA 2MSWA 1CZKA 5EHQA 4C3VA 4D6PA 1A95A 4Z4UA 2C3UA 3LGSA 3RRNA 2PX2A 1UKZA 1TDJA 4PC6A 3IERA 3ABQB 4G2TA 1F2TA 5DGCA 3R2JA 2I03A 3OE1A 3NIBA 1PV2A 2UVQA 2WYUA 2ZYRA 1G20A 2C3OA 1FUEA 4KQHA 3HM9A 1WCIA 2NPIA 1IU9A 2XDQB 3I2FA 1E9VA 3PICA 4I4CA 3ZS9A 1MOPA 2R86A 3UANA 3UT5B 1QSGA 3KQYA 5D2CA 5DSXA 1QQBA 3O9MA 1N33B 2RCYA 4L5CA 4EVIA 1Z13A 3I55B 2D0DA 2OCXA 3RNLA 1NRWA 1WSWA 5FR2A 4ALLA 1G5IA 1X2BA 3R6JA 5CYFA 1ORDA 2HA0A 2XNDA 3OAAA 1Q1ZA 1WABA 1XAJA 2GD0A 2AZXA 5THKA 3TCXB 3BT7A 2IU3A 2C3PA 4GW3A 4EO9A 3H2GA 2Q5HA 1CZOA 3VYUB 4ARZB 3KKOA 4UMDA 1A1SA 1EIZA 1W52X 3KSMA 4BKPA 4DPLA 4HLQB 2P4EA 2UU9B 3NHLA 3AERA 4KBFA 5IJ0B 3GGJA 4L6AA 1N3BA 1U0EA 1N6LA 2R6CA 2M6SA 4MWEA 4P5DA 4Q3BA 4R0MA 4HNSA 2DETA 1UMDA 2X0IA 3R3UA 5ENVA 5EMKA 4BEJA 1W2HA 2PLAA 2UYQA 2WIDA 3LCCA 5E7JA 3SLGA 2KPOA 3SR0A 3WYGA 4WA8A 3G05A 2IY7A 3QKWA 4J7AA 5F9MA 3TINA 3VSCA 3FPKA 2GN2A 4Q1BA 3GLRA 2AOXA 1SD5A 4OXKA 5DHSA 3TZCA 3WIVA 1M1KD 3GRVA 5IFKA 1Z68A 4Q00A 1T3ZA 3UB4A 2VSOA 1AXRA 2YVQA 3AR6A 4N5DA 4P7JA 4D6YA 2ZUVA 1USVA 5K8LA 1PFGA 1WBJB 2HDHA 2HIAA 4IDPA 5AHRA 3GFBA 4ZU3A 5GONA 2BMDA 2Y0CA 1A9YA 1VSVA 2W6ZA 4DCGA 5A02A 4G1VA 2GB4A 3G68A 1Q0ZA 2I67A 3NNNA 4QOIA 3I6IA 3IXMA 4D4HA 3DB1A 5HCIA 4A8HA 4BP3A 3W9YA 1ONPA 1J1ZA 4UZFA 1RYDA 4PGGA 4DCTA 4DSZA 2BT4A 2XVMA 3K4PA 5HMMA 3HACA 1ZHFA 2PZBA 4N9QA 4PHFA 4UBKA 1RAEA 3D6TB 3L40A 4U2CA 5CK4A 5G1NA 4REQB 1JIJA 1R3DA 1T91A 2HIGA 3GYBA 4D9BA 2OGZA 4YELA 4PQGA 1GAEO 4U6QA 5LA6F 2PRJA 4CF4A 3BYZA 3MJDA 4AULA 4NCBA 1Z7EA 2QN3A 1INLA 5KNBH 5G2OA 3DF7A 2GBLA 2WSSA 1RXIA 1U9CA 2OCYC 1Y3BE 1E61A 3KP1A 3C7KA 2QKYA 3DTYA 3N39C 5A0FA 4D99A 4KP7A 3BMNA 2PWZA 3OT1B 3TR6A 4JYPA 2BZSA 2H4ZA 4A1OA 2NZYA 3SP1A 2AHOA 2G6TA 4RMHA 4RVDA 5LBUA 3KPUA 4MMXB 2PKWA 4I9HA 2DCUA 3VTZA 1YCFA 4EHIA 3B1VA 4G56A 4YACA 2FGKA 2FUCA 3GFVA 4J0JA 3DUFB 3Q3GE 3O3OB 1N9ZA 1S01A 1LRKA 2XTAA 1OROA 3O4VA 1Z12A 1Z74A 1GEGA 2JH9A 4ONEA 3RWBA 1GU7A 2X77A 4RLQA 1U3DA 1G3QA 2F8SA 3HP4A 5AR1A 2WC1A 4EGCB 4E31A 2F9LA 2QSUA 3BH6A 1KD1D 1IXZA 1N32B 3CEHA 4I50F 3Q38A 2H1OA 4XQ9A 3EVZA 4PWZA 5IHXA 3WGNA 4CEJB 3TZBA 3IESA 3ASTA 4HIZA 1X74A 1U28C 1HR0B 3ZHTA 1NG9A 2AE1A 1UMCB 3T1QA 2ZBDA 4FZJA 1E3ZA 2XOKD 3QUBA 1KAEA 2G17A 5BMVA 1MAUA 3O38A 4OIMA 1T8RA 2DP4E 2FWNA 2QDKA 4EENA 2BP7A 1E69A 3C8HA 4CCAA 4LDQA 1NTOA 1DKMA 3AEXA 4MKIA 1B4DA 1RWKA 5DLQC 5F12A 3JY6A 3RYHA 1R8YA 5CHYA 2A0UA 2IDJA 1L8XA 3C2QA 1LK0A 4UD2A 1E2QA 4QDZA 3W2EA 3OSZA 2IYNA 4LAFA 4QUJA 3SWWA 2QNBA 1H94A 521PA 4KRYA 3SZ3A 3U4IA 5G1PA 4U1RA 3Q9UA 4NHEA 2FP4B 2NTEA 4P83A 1KI9A 2AXNA 2ONJA 4M9ZA 4NDNE 4GM1A 1WO8A 2GEDA 4WOPA 4X94A 1SCAA 3E6AA 3K1YA 4RCYA 1TYAE 1V1RB 3MT8A 4GQAA 2CB0A 3AXTA 3WFJA 2VDPB 5I7VA 3F1KA 3LXUX 4JCOA 1A76A 1M1YA 1VP3A 1X8XA 4JQZA 1YMUA 4K88A 4LK2A 4RV4A 4AUKA 1L7BA 3L9WA 4B3HA 4DOMA 1BCRB 3OSUA 4LHEA 1GAWA 5K1ZA 3IIMA 1MAHA 1KP2A 2FUG1 4ZCQA 2HF2A 1J0BA 1HE3A 3JASB 1TM7E 1S3SA 3RRFA 4E4YA 1MC8A 3ZNQA 1EDEA 4DQDA 5KTNA 4QXPA 1C0PA 2X5NA 3GRPA 3Q3IA 1QE3A 2JDIA 5AT1A 1WMDA 3IDAA 3B9BA 4J3FA 1UBUS 2VBCA 3E7PA 1U8CB 5HKLA 3QEOA 1NKTA 3I6BA 1YKFA 4NYMR 1CY0A 1FP4A 2EFCB 3RVMA 5BUSA 3OZXA 3NO4A 2A35A 4NI5A 3TD2A 3NWBA 3SGLA 5ITVA 3I9JA 1I4DD 3OX1A 4K6KA 1V6SA 5E6RA 3U3JA 2GA9A 1Z82A 2VK1A 3JZAA 2VJPA 2P78A 3KQQA 5CFPA 3RUHA 1OWPA 4LOJA 1AZLA 2YWDA 4M8KA 3ZY5A 5BOSA 3F78A 1G291 1WF3A 4NS1A 2WP8J 1J20A 1MC1A 2Y8EA 3OX4A 2VDJA 4H18A 4WFKA 1Z16A 1YB4A 4FHFA 3ZX5A 4DM7A 4CCYA 3ZGLA 1YGPA 5EE3A 5L53A 4L50A 3I28A 1P5FA 1RAAA 3INGA 3REGA 4QARA 3VQTA 4OMCA 4KTVE 4PZUA 4EHAA 3WNQA 4N41A 4KYVA 3P9KA 3TR5A 1QFSA 3LSYA 1XA3A 2QZZA 1X1EA 3OI7A 2VXBA 2G9RA 3OLQA 1MFPA 2R8YA 3ID6C 2YRXA 1K7FB 2D4HA 2FB9A 1MBZA 2IE0A 5A71A 1XC7A 2Q3HA 1JQDA 1HBJA 3RCBA 4LDJA 4DW8A 3OHSX 2D0PB 2GASA 4M53A 4BWFB 1C1XA 5AW5A 4PZ9A 4C3ZA 4ENUA 3PKZA 4OQMA 3GIRA 2PZAA 1ZD5A 2GAFA 3AR8A 4B6FA 1JFVA 2R8XA 3DKPA 3PZBA 3TPFA 3FYUB 4LMAA 4CIYA 3SHWA 3HP1A 4D5EA 3BJIC 3G2OA 4UM9B 1MTOA 4NE7A 2OFXA 4E2XA 3M5WA 4LRXA 3EA5A 1Y3HA 3FDFA 3UOGA 1Y4ZA 1VDMA 4B44A 4UTZA 1JTVA 5CLQA 4YEDA 3CYFA 3N5CA 5G0TA 1W6RA 5KSOA 1XPRA 2GK4A 5DNWA 3CC4B 3A1SA 3GD7A 2NV6A 3ORYA 3RAPR 2W6ID 2ZIZA 3KXKA 3LTEA 2IUTA 3OIUA 1JL3A 4QGBA 2ZRLA 3EIFA 3OIFA 4XASA 3BKWA 3RDPA 3RYTC 4B3CA 5ALJA 1G3UA 4U7GA 3KB6A 3RSOA 3ZWPA 5C32A 5LDDC 3SC2A 1JWLA 4BGDA 3W2FA 1NVFA 4C01A 4M0MA 1KI6A 2ZZNA 4FJ1A 4E5PA 2ZP1A 4Q7JB 4K05A 2WABA 3R41A 4NOJA 1NI4B 1CE8A 1PJ3A 4N65A 5D7BA 1O5TA 2G04A 4LECA 1SBQA 5FBVB 4K6OA 1V71A 4R6WA 3TDNA 3COPA 3A6GA 1GTSA 3TKLA 1GZ6A 1PCXA 4URFA 1AKTA 1Y6RA 4Y2TA 4B32A 4YT8A 1RYYA 3UXEA 3BE6A 3EE6A 4AJ9A 1CDOA 1BTOA 1DKPA 3WADA 2YIVX 4HX9A 4BKQA 3C74A 5LFAA 1LW7A 3E7WA 3U1VA 2LE0A 1GYPA 4H1WA 3AI2A 3GGOA 4GNKA 1SHLA 4ZKDA 3KALA 1T9HA 5HXBA 2HAEA 1QANA 1DINA 2HA5A 1X9GA 1XR3A 3M6LA 3NVKI 1W6UA 3CX7A 2LCFA 4JJAA 1JKMA 1D4ZA 2WVGA 1GO2A 2ZIFA 3ZCPA 4CTOA 1VPVA 3DFUA 4ND1A 2V4DA 4DM3A 2PX0A 2P4UA 5AJVB 4ZT3A 4BEWA 1VE3A 3OT4A 1FFCA 3S40A 1HURA 1EA7A 4ZCTA 2H5EA 5DNUA 3LG2A 5CCXA 3OKXA 3ZK7A 1BEUB 4PPQA 1CERA 1M8FA 2RAVA 3V8QA 4NCJA 2CSUA 4HTFA 4NMMA 1LRLA 2GNAA 3W5IA 4B73A 1WCWA 1M1YE 3ASPA 3DLAA 2E89A 2H2FA 5F4MA 3HR8A 2J9FA 3KV3O 3U37A 3EPKA 2H1SA 3NCTA 3K2QA 5C3MA 4I9FA 1KKLA 4C20A 5IT0A 1MHTA 4ZZ0A 1UQTA 3FSRA 4DDHA 2FHPA 3TE7A 4B79A 1N78A 3JWGA 1N5MA 4MPTA 1YR2A 2JLZA 1C0LA 1QH1A 1WTHD 1Y63A 1SU7A 1XA4A 4FGUA 5JMWA 3UFXB 1T8WA 1X19A 1RU3A 4MR9B 1E60A 4IIYA 4C0JA 2Q45A 3C3EA 1DBPA 2GFHA 4TQ9A 1JWBB 2OVBA 4UCXA 2A5JA 5EMJA 4YJ2F 5FRDA 1U0TA 5KAPA 3D4IA 2IYSA 4I46A 1TJNA 3TQTA 3BMOA 1Q21A 4ZVSA 4HN9A 2Q0HA 1KDPA 5EIXA 4M89A 1J0XO 4P4UA 4DLBA 1G98A 2EKZA 4NV1A 1ABEA 3X1MA 1NXQA 5A2GA 2ZUUA 2BEVA 1D5CA 3ZHQA 3PIDA 1GZ5A 1ML4A 1SC6A 4Z7JA 4CU2A 2G5TA 1D1NA 2XUDA 5DLEA 3IPXA 2N42A 3E1SA 2KVOA 4NCKA 5EZYB 1E0SA 5CJPA 1VLZA 4HTAA 1B6GA 1KJNA 1X1RA 1RSZA 3K1AB 2G7ZA 4DC9A 1OBFO 5FUYA 1Y1PA 4DBLE 4O0LA 2BMFA 1L4KA 3TW4A 3ZQJA 3ZV3A 2BISA 2XUJA 5A0VA 3MMNA 2AUMA 2DWUA 3ECSA 2HA2A 5GOZA 5TJ9A 5KOJA 5HIJA 1JKJA 3AKEA 2XXBA 2ZUCA 1FNDA 4EABA 2ZCJA 1NGSA 2ZUTA 5JPDA 1QGUB 4EKDA 2HPHA 3OJXA 2N47A 3WMRA 2IQIA 3EFEA 2QRLA 3A05A 1ZEMA 1BAPA 2CUTA 3JZDA 2QN9A 4HADA 5DI3B 1FFDA 5A6VA 1TRKA 1IZ0A 1YBHA 3K0AB 4MZDA 4P3NA 1MO5A 4BOYA 3GOQA 1YAJA 2FWIA 1UCFA 5J2TA 2PV0A 2EBUA 3SG0A 2A94A 4JMLA 2YMQA 3MT9A 5F1KA 2JI6A 1ISHA 1CZUA 4LA4A 1E2KA 4H0CA 1JX6A 5DX8A 4YRJA 4EP1A 2REXB 3HWWA 4G5RA 1K4MA 4NFHA 1EEXB 1WHTA 5I7RA 3AF0A 1ACMA 1NRJB 2JHGA 4H4EA 4URYR 4DTIA 1WMSA 4B7AA 3SZGA 3E20A 4JLMA 1ZIXA 4MAAA 2OCGA 1NN0A 1SXIA 4L15A 4ZVOA 4MHTA 2H59A 3FJ1A 1ZGZA 4HQLA 5AJWA 4GBED 3GT4A 4JVNA 2O1XA 3UOAB 2E5LB 4J1QA 1RWWA 1QH8A 2ET6A 3AP3A 4MIKA 2NVOA 2V7EA 1ZO8A 3FCUB 2C98A 4KYUA 3O8QB 3ZHYA 2H1FA 1E6MA 1P7VA 2J09A 1IY0A 3JAWA 3RH0A 3OOWA 3FKQA 2ZM6B 1XGKA 4RZIA 3LT4A 1AA6A 1CYEA 3OO1A 4YX9A 2JFVA 5MHTA 4WJZA 3EFOB 3V9PA 4AB1A 1KAOA 2FV8A 3BQJA 4Y9DA 4F06A 3AU9A 1F4LA 3OHMA 2V7VA 4CMCA 4KV9A 4A9AA 2Y4NA 1NVUQ 2VJKA 3BQMB 4ZO9A 3I9V6 4YWJA 5SY4A 3U7IA 3TMYA 1UOOA 4RJLA 3PRKE 3FHLA 1KEEA 1ECLA 2XF8A 5LMZA 1CUFA 5K0LA 3A1CA 2XWQA 1QYWA 1I7LA 1XHLA 3UK7A 3TW0A 1QGDA 2HXYA 2HCJB 1FSSA 1V8ZA 3JU4A 1SBNE 2YJ6A 5CPBA 1PUXA 3W7AA 1BXZA 4JGIA 5L3SB 1T1GA 3OPQA 4PN7A 2IV7A 5CP8A 3VDRA 3WWYA 4TN1A 4B4OA 1EFRA 4FB4A 3Q2IA 4HEQA 2VDLB 4Q16A 3TX2A 1BFUA 1Y9DA 2YZ2A 3FUCA 4WBXC 1E6CA 5LQSA 4DM4A 4MQFA 3NBXX 4UHCA 2D4AA 4QWWA 3U6KA 1P0MA 1SA0A 4V0NA 3STYA 4BJHB 2O8EA 3FCCA 4BAUA 3AFGA 3UOWA 2BI7A 1W0KD 4LYEA 3ZTYA 2QTWB 3SLRA 2QEXB 5CLGA 4PFQA 4JUBA 4N5NA 2QIOA 3B6EA 2II6A 2QRPA 5CM2Z 4EX6A 1SR8A 2BEWB 4JXZA 3E84A 1IBSA 4MA0A 5EUQB 4F2DA 2HV9A 2E85A 5ECYA 5CDHA 2XZPA 3L3BA 5HQTA 3DAOA 3WLTA 3DXXA 1ZN9A 2H2GA 4C7KA 2C84A 4E32A 5D86A 2YZMA 3VVLA 4UMFA 2CLSA 3Q6RA 2G08A 4COOA 3QE4A 1QKIA 4C4ZA 2O6HA 3OF5A 2CFOA 4UTRA 3LW7A 8AT1A 1PT6A 5CBPB 4RK5A 1U2GC 2ZZGA 1EUDB 2Z6VA 3ETHA 3L0SA 2C04A 1NNUA 3FFXA 5DM0A 3JYOA 2ZJYA 1RTKA 1U2PA 3CX8A 3N2KA 4UZUA 3ZXXA 4FI3F 4JJ4A 3IHLA 1XFOA 3WB9A 3ZY6A 4K2AA 4QRIA 2QTFA 2VF7A 2IOYA 4Z8XA 3A6JA 5ALTA 1VBNA 2PLWA 2R1UA 3E8XA 3WHKA 1W4ZA 5EUBA 3ISXA 3Q5EA 3T7DA 4C7BA 3HZZA 5KDOA 4D98A 3GUVA 3EQ9A 3D4LA 2WHXA 3QVLA 5COAA 4IHQA 1MAVA 3M6WA 3FHTA 3WB2A 4DBVO 1G20B 5ELXA 5HF6A 2W4MA 1WCIB 2O06A 3C1UA 5LA6A 3LO5A 5TJHA 3V8VA 2AI2A 3QVJA 4DNPA 3P9QA 2ON6A 3OE7D 4CL0A 3U7FB 2OGWA 2HYIC 3CA8A 1ZXLA 5I9BA 1NVMB 1M90D 1RRVA 4O6VA 1KOLA 3FDXA 5IBCA 2OT3B 3AT1A 4ZQFA 4C0BA 3HO8A 4AJNA 1RI5A 4LHZA 3SC6A 1E92A 4N8DA 2JFPA 4TWBA 3WO0A 1CSEE 3ADCA 4F9GA 1W5BA 1NJSA 1TMGE 4LOLA 1BOFA 1RKVA 5JSFA 4TUYF 1F9EA 1NZFA 2JCGA 3AERB 5IJ9A 1I2ZA 1NLUA 2FW8A 3HNOA 4N8SA 2CUZA 4X92A 3LVRE 1UOPA 2QTNA 1QQ6A 4MKRA 1UMDB 3K6RA 1GNPA 2AF3C 2L0XA 4DSAA 4LN1A 4NECA 1O4WA 1VOTA 1RXEA 4P5PA 1YR6A 3AVUA 2FN8A 1R4NB 2VUUA 4TWAA 4LQCA 2ZRAA 2QZPA 1XZHA 2Z9BA 3SS9X 3R5TA 4FGLA 5ARCA 3WGQA 3E81A 3ZX4A 3D0OA 4RZQA 5J9FA 1P3DA 1YSCA 4TTRA 5DM70 4RIGA 4DADA 1Q6ZA 2WU8A 1PSZA 2EBWA 4J0DA 4JX8A 3I53A 1NATA 3LX6A 1WCYA 4HLUC 4L76A 1E9SA 4RHFA 4YRFA 5GONB 2X8JA 2W93A 2XQVA 1D0IA 2PBRA 3A9CA 2GEVA 4L7VA 2G9NA 3G13A 1WCXA 3KKPA 3WI7A 3S28A 4MLDA 1PYGA 1FTSA 4S2EA 3CZQA 1RCUA 4B6JA 3DDYA 1Z8HA 4X44A 2X6XA 4Y2PA 3G3EA 4XJVA 4BRZA 2UYGA 3VR3D