2PMDA

The structures of aif2gamma subunit from the archaeon sulfolobus solfataricus in the gdp-bound form.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title New Insights into the Interactions of the Translation Initiation Factor 2 from Archaea with Guanine Nucleotides and Initiator tRNA.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 93
structure length 414
sequence length 414
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2pmdA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2pmdA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2pmdA01
4TLEA 2CK3D 2J5XA 4QGAA 1M74A 4LYAA 1G8GA 1E2DA 1MR3F 5K8IA 2CDNA 4B2PA 2GCNA 2J9RA 1XEWY 3BERA 3TJZA 2QPTA 4FI3C 2C9OA 2Q21A 4ARZA 4OK3A 3VX3A 3ETLA 4BFWA 3QF4A 4D4MA 4Z54A 4FW9A 5HKKD 4NYJR 1SXJA 2WWGA 1Q86D 2GCOB 3DVLA 3O8RA 3T34A 3CCJB 1NMXA 4LK2A 5LD2B 3MAAC 4TWZA 1G41A 4L4UA 4P4TA 1W34A 4UNPA 1E0JA 4D82A 2O8EA 1LV7A 3CMAB 3FPKA 4NH0A 2PEZA 4OKSA 1NN5A 2JLVA 1BYIA 3I72A 1C9KA 2FFQA 2D2EA 2JIZD 5FL7D 3DM9B 2FN4A 5A0FA 4D0LB 4X8OA 3PEYA 5FOTA 4D80A 2WWXA 1KQSB 1G5TA 1FNNA 3HU1A 4YMUA 1CQXA 2BMFA 2CJWB 3CRRA 2VHQA 5KDOA 1D2NA 3QEJA 1ZD9A 2WOOA 4IVPA 2FA9A 2ZUCA 4M21A 4X8HA 1M90D 4JL8A 1YJWB 3EASA 4C2UA 2NOAA 3TVTA 3C7KA 3QXXA 3ADCA 3D8BA 1AKEA 3N2EA 5DI3B 3ZQ6A 2VP9A 4YMWA 5C18A 4TZ0A 2O52A 2IWHA 5J4HA 2F43B 1VMAA 1U94A 2KSQA 2LKCA 3TW8B 2EU8A 2A30A 1NL3A 2R6HA 1TLLA 1G8YA 2J1LA 2QQEA 5C2JB 4HAWA 1G5RA 3NH9A 1E2QA 4QC2A 3SDZA 2FNAA 2EYQA 2NO9A 1NIJA 2OTLB 1KMQA 3CF2A 2OESA 1WE2A 1FZQA 3P4YA 1R8QA 4OHXA 2A9KA 1AMOA 1RE0A 3QQ5A 2VEDA 4CIDA 2JLXA 4DSUA 3ADDA 3DPUA 5DSZA 5EE5B 1QZXA 1RJ9A 3C14C 1Z0KA 4BPBA 2NZJA 1U8ZA 2XSZA 5CM8B 2IS6A 2P2LA 2RAPA 4D4JA 2QTHA 1FQKA 3RS0A 1GITA 2F1HA 4X8MA 5C4GB 2P6RA 1Z2AA 2JJ1A 1P4SA 1PUIA 2ZU6A 3GFPA 4HYYA 4A8JB 3ZQJA 2ODEA 4TQUS 3T06B 2VP2A 5HZKA 4GP6A 2IYVA 1S4QA 1EWQA 3HJNA 2PBRA 3A1VA 1GJRA 4EDHA 2GZHA 3EG5A 3OESA 3LW8A 4IKEA 521PA 5JZVA 3CF6R 2QZ4A 2WAXA 4Q21A 5HTKA 3DZ8A 3IBYA 4ASUD 3IIKA 4NKRA 1RRFA 2ZSBA 1UADA 2A3RA 1ZUIA 3WBJA 5CB8A 1UM8A 3VQTA 1NIPA 4DCUA 2DFLA 4WXRA 2AXNA 1GAWA 3SI7A 4NHOA 1WCV1 3GLIA 5F3WB 2BVNA 3CPHA 2FJUA 3W90A 2C77A 1W4BA 3BH7A 4Q66C 1CJMA 3T5DA 2GNOA 2ZU0C 1XTQA 3VAAA 1NJGA 3VR3A 6Q21A 3F0TA 5JWOA 2Z4SA 2WVJA 1IN6A 5GV7A 2V1UA 1TVCA 3ICEA 4LGMA 1F60A 5CLLA 1DAFA 4GDFA 4Q02A 1WP9A 4MRRA 1RFLA 1KRHA 2WWYA 3B9QA 1GAJA 3HU2A 1Q0UA 4BFSA 1KJWA 1FX0B 1HURA 1UKZA 1T9HA 4BLRA 1NDHA 2PZEA 5KNDA 1NKSA 2N46A 5IHPA 1OB5A 3QEOA 2BDTA 1V5WA 2ZJYA 2ZRLA 2QE7A 2HV8A 1GZSA 2C8VA 5J4LA 2IF2A 4WZ6A 1VQOB 3AUYA 3LLMA 4TQ9A 4OI4A 1KDTA 4LHZA 1MO4A 1E6CA 4P33A 3VKGA 3FE2A 2P5TB 4TZ6A 1JI0A 3OF5A 5JBQA 3CONA 2YV5A 4I99A 3WP1B 3CCVB 1ZCBA 2W6JD 1PUJA 4IDOA 2YC2C 4Q4AB 1TMKA 3A4LA 4MRPA 1G1MA 2G0NA 3SOPA 1CIPA 3CWQA 4A0HA 4HDOB 5C46F 3K70D 4DBLC 1DBSA 1W36D 1GTVA 5FTKA 4EPTA 4XSGA 2OXCA 4KBFA 5E4FA 2QMOA 2J0QA 1KC8D 1SQ5A 4L9WA 3RS5A 4PHFA 4LJAA 3UMSA 3QKTA 4ZCLA 3OE7A 1UFQA 4OI1A 3TSWA 5TARA 4HLQB 5FOVA 1A2KC 2IXEA 3KJEA 4JBYA 5FTLA 2NPFA 4JVNA 4CZ2A 1PVOA 1FPMA 1KO4A 3HU3A 1DAIA 2WPDA 4D6PA 1G8FA 1AGPA 3EPJA 1N0VC 1E63A 4FMCB 1QG0A 3VKWA 3R8FA 3IDQA 1GRQA 3LBHA 1E1QA 3SJBA 1JR6A 4BASA 4OHYA 4CEHB 4Q1AA 2YZ2A 1KGDA 1NNEA 3AQ4A 5DYIA 3H84A 1T3LA 1WRBA 1GVNB 1GNRA 5HE9A 4AWXA 121PA 1RC8A 3FOZA 1BYUA 2ZYTX 1NP6A 2GBLA 3HWSA 1NN1A 4PR0A 5E7IA 2ZRNA 1P60A 3PVSA 1U9IC 4BWYA 4M9ZA 1F2UA 1AIPA 3EA0A 3RS7A 1XMJA 3CX7A 1L4UA 1KDRA 2PX3A 1BMFD 4MGIR 2HT1A 2J59A 4EPYA 1W7AA 4JLAA 1VIYA 2AL7A 2KBFA 3RSLA 3DO6A 1GG2A 4A4DA 4EPWA 2VRWA 1KDOA 3CRMA 1OLOA 1XTIA 2JJ2A 5P21A 3K0EA 4YQFA 2V6IA 2L0XA 4EPRA 3TRFA 2XTZA 2ZRIA 2A5GA 3KKQA 4KODA 1KKMA 5FBLB 1Z2CA 3QPVA 3UXMA 4BEJA 2ZYUX 2R8RA 4C3ZA 2GESA 1G21E 3SNHA 4MUBA 4URWR 3BB3A 4PPNA 4GOXA 2DWQA 2QGNA 2PH1A 3VR1A 1Q1QA 2BC9A 3IGFA 5C1BA 4LBZA 1F3OA 2BEJA 4O2RA 1E79A 4PC3A 2OLKA 3A58B 4HAYA 4QM7A 1SVWA 3BH0A 2W58A 2OBMA 1Q1EA 1JECA 1Z63A 2CHQA 2ZREA 4DCTA 1FP7A 1N6OA 3B5JA 3O8DA 5CJ2A 4DLWA 4TL9A 2O8CA 2YINC 3P26A 2QY9A 2BKUA 4R2IA 2NG1A 3AUXA 3W3ZB 1JPNA 5KYKA 1Z47A 4LOAA 2JGNA 3U2QA 4JLNA 3M0EA 3U4QB 1J70A 5J4YA 3R8CA 5EE1A 4CEJB 4YC7A 4FN5A 1XJQA 4HUQB 2VA8A 3IIMA 3D7MA 3OZUA 5B58C 4NCJA 4TLAA 4KLNA 3K9NA 2HEIA 1Q3TA 4ZGQB 2OBNA 1W2HA 4HZUA 2BOVA 2ZYWX 2OLJA 1R5NA 1P75A 4PFSA 3V00A 1XPRA 5FOWA 4F4IA 5DLQC 4TMXA 2XZOA 4TTPA 2GTPA 4QHTA 4WZBE 1HUQA 2XJ9A 2G1KA 2RHMA 4JLBA 1FNBA 4JT4A 1U0LA 4XVUA 2W2VA 5HZHA 2ECKA 4N1AA 1MOZA 2RMKA 1NMYA 4DKXA 4I1UA 5KO2A 1CULC 1E99A 3G82C 3QVUA 2XGJA 4KLZA 2E1RA 5JJLA 1VHTA 4TLCA 5CK5A 1Q81D 4ZCMA 3CNOA 1ZVQA 2QRNA 4US2R 1E9BA 4G5OA 3EWSA 3QPWA 2RH5A 4B76A 4NZYA 1KAOA 1L8QA 3K9GA 4YMSA 1QHNA 5CDFA 2OO7A 4AIIA 2FZLA 2CLCX 3BWDD 3RC3A 1ZC3A 1KSGA 1JB1A 2EQBA 3SJCA 3KUDA 4Q4JB 3CCQB 3I8SA 4Z51A 3GJ5A 5L3SA 5EMNA 1COWD 1E9FA 1E4VA 2I4IA 3TIFA 4B73A 4X8LA 1DPFA 1N6PA 4UXHA 1OIXA 2O0JA 2OXRA 3C5HA 4Q7JB 4B2IA 2JLYA 4BFYA 5DE3A 5BYJA 3MMPA 3LAWA 4L5BA 2ZRFA 1JAIA 2IS2A 4MGKR 5E95A 5HKKA 3THWA 4FK8A 1N6RA 3ZVLA 3I5XA 1NG9A 1AGRA 1G16A 4JIMA 1K9MD 1E9AA 1G20E 1NVWQ 2WJGA 1KY3A 1OFIA 2ZS9A 1A82A 2GDJA 3K0AA 4LV5B 1KO7A 4A0RA 3E5HA 1HQCA 1G8HA 4Q7LA 3ZH9B 5FL7A 3AP3A 1AZSC 2VTKA 2YNMA 4MKHA 3K0FB 4C7OA 4LI0A 5FOXA 1NVXQ 5L8VA 2P0EA 1S9DA 4POAA 2ZEJA 1M8PA 3SYNA 1OYWA 3T61A 1E1RD 1U0JA 1AQUA 4C30A 3IBGA 2V54A 3EIQA 1W0KD 3R7WB 3LQRA 1OJLA 1VDZA 2HYIC 1BH2A 2QBYB 3CC2B 2IT1A 1BOFA 2ZRGA 4GSYA 3THYB 2GK6A 2CEAA 3NXSA 1BIFA 1G291 1E2KA 3T15A 1O87A 3W34A 1EWYA 3AP1A 3FYHA 3ZIAA 2NZ8A 1K8RA 3FGNA 1Q20A 1KI9A 2V7QD 2ZE8A 2NMVA 1NSFA 2GRJA 2PL3A 2REXB 4LJ6A 4WOPA 1QGAA 2DR3A 1B0UA 2JLQA 2RGXA 3I61A 2AD5A 3FVQA 3I62A 1KO1A 2AR7A 1XXHA 3BBPA 5KSPA 3BIFA 1OGJA 4UNSA 2A2ZA 4DSTA 3NHAA 1R7RA 2DFKB 4OJKA 5EE0A 3RWMB 2LCFA 2AKAB 5AUNB 2GWHA 3NBXX 4KU4A 4F7DA 3ONWA 4KFUA 1ZU5A 4RSGA 5H8WA 3GMTA 4Q4HB 2FF7A 5JS7A 3N70A 3ZBUA 1DAMA 3PIRA 2Q3MA 2ZETA 4L16A 1W35A 4Z8XA 1VQPB 1IQPA 1JJ2B 2C9YA 3I4LA 5FR2A 2PEYA 1OXTA 4Q00A 2UZIR 1SKYE 2GEVA 3NBFA 2F1IA 1G3QA 1AN0A 2FSGA 5IF9A 4LJ5A 4LC1A 1L4YA 1JQJC 4G0NA 1ZM2A 3LV8A 5AJYA 1NKTA 1TX4B 5F9FA 1DAEA 5EE9A 4ZDKA 4B6EA 2BF4A 2CVHA 3THXA 4XJXA 4N3NA 4IOJA 1S0UA 2C2HA 2VF7A 4U00A 3RANA 1VCIA 5EQTA 5KSYA 1ZNWA 1QRAA 4NCHA 1AJEA 1ETUA 3E1YE 3BFXA 1DADA 2ZM5A 4Q03A 3SFZA 2IW3A 4JVSB 3PEUA 1UEJA 1QG4A 2EFDB 1KO5A 2WIAA 4RD4A 5J5CA 2P67A 2Z83A 2P65A 2A5FA 1ZD8A 2HCBA 2IYLD 5JSZB 2ODWA 4Q9KA 2QA5A 1BO6A 1X8KA 4CVNA 2ZR9A 1SKYB 4AKHA 3GD7A 3EAQA 3QG1A 4M22A 1II8B 1Z8FA 1W87A 5KUTA 2J3EA 4NPHA 2BMDA 3LNCA 2VYQA 1MT0A 4TYQA 3W5JA 2XZLA 1E9SA 2Y8EA 2EVWX 3EPLA 4ACAA 2ONKA 4ACBA 2OUKA 2W6ID 3UG7A 2I1VB 4GBMA 4AD8A 1EP1B 1ZM4A 3VNVA 4JSTA 2GAOA 1E2JA 1PLKA 4NL4H 3TQCA 2VNIA 4Q18A 1KJYA 3PR1A 2XJ4A 4E07A 1CTQA 2CNDA 4ITRC 3ZZTA 4PXAA 4KSCA 2RB4A 4Y7CA 1S72B 1YZUA 2OM2A 1WBDA 1KZ7B 5L3QB 2DERA 1D2EA 4QG7A 4M1KA 1PLJA 2PCLA 2MMCA 3BGWA 3SJAA 3EC1A 3UG6A 2QP3A 1XBTA 5FI1B 1HE1C 1VQ5B 2ZJOA 1VQLB 4EFMA 3IO5A 4URXR 4Q48A 4F93B 1OXSC 3A1SA 1NLYA 5AJZA 4Q1FA 1AS0A 2DWPA 1S96A 3ZLJA 2HLDA 3H86A 3KFVA 4PC7A 3P4XA 3UPUA 1QFZA 3CX6A 3WY9A 3FJOA 2VSOA 3G4SB 1QVRA 4UAJA 5JFGA 3K70C 4NTZA 5IDVA 3WMGA 5E3HA 2YYZA 2ZRMA 3EZFA 2IYZA 2CJWA 2VPPA 3KJHA 1IJFA 4EJSC 4F7WA 2XXAB 4KV9A 4JMPA 2IXGA 4PSVA 2QTZA 1Z83A 4FMDB 5B2ZA 4C0LA 1R4AA 1VCMA 2JCSA 4G1VA 3KKOA 2RGCA 1SGWA 3DDCA 1WF3A 4TL7A 2IYSA 1XCPA 3JQRA 2GJSA 2VP6A 3MRSA 3CZQA 2IS4A 5DI3A 4UXJA 3CRVA 4LJ4A 1E3MA 1KYIA 3A1UA 4DUGD 1JR3E 2XEXA 2C96A 3OZWA 3W5VA 1BMFA 2RHDA 5AWFC 1G8PA 4KO8A 2F43A 3QG5A 4HI0E 1DS6A 4RD6A 1T6NA 2BBWA 3CLVA 3GJ3A 4JVMA 4O3MA 1BX1A 2NIPA 3B1ZA 3M6AA 3CB4A 5H59A 3W6PA 3OEEA 1OH7A 4U9UA 1YQTA 3JVVA 2GJKA 2ZSEA 4QJ4A 1DELA 2IS1A 4A36A 2ZE5A 1OXUA 1NN3A 3GJ8A 5DHAA 4C0HA 1TUIA 5LB2A 2VNKA 1NY6A 3GP8A 2NO7A 4Q9JA 2J0UB 5IK2A 1ZUHA 1JALA 1CLUA 2QL6A 3MJHA 4P0TA 4D0NA 4QBHA 2B7BA 3LQQA 4ZO4A 3X1DA 4KAXA 5JRZA 2ZJ2A 1VECA 2BGJA 4A8JA 3NG1A 4IXNA 1GDDA 2W2TA 1E2MA 4O2LA 3L8YA 1IY2A 1KSFX 3PUVA 5CM9C 1F5NA 4RD1A 3SFVA 3DMDA 1N25A 3TAUA 1FTSA 3SHWA 1KIMA 3A1WA 3CRW1 2GETA 4HB2A 4TSFD 5TR9A 4YLGA 3QVVA 3GJ4A 2GK7A 1E2LA 1GP2A 2EWWA 4PPGA 4EQ6B 1HH4A 1Y63A 1M7HA 1JEEA 4DSNA 2Z6VA 4A9AA 3OIYA 3LO8A 2WSMA 4LHXA 4Z1MD 1R0YA 1WXQA 1LTQA 3KL4A 1Z29A 1OKKD 1KI6B 3FDIA 3IKJA 2CNWA 2WKRA 3L0PA 2R44A 1OHHD 3LVRE 1D5CA 5CB6A 2IYTA 1GRNA 1Z6TA 2VP0A 5CIWA 1U8YA 3I5YA 1G19A 2VLIA 4GZLA 4C0BA 4CGZA 1I2MA 2OCAA 2ZRPA 4LCBA 1Z0FA 1MRSA 3NC1C 4OK6A 3SC3A 4YMVA 2R6CA 1LNZA 1A1VA 3LLUA 1XD2B 5FUYA 1FX0A 5SZJA 3PG5A 3CCMB 2VHJA 3P20A 1DARA 1CS4C 1N6IA 4Q9LA 3E2IA 3ND9A 2XTNA 4Q47A 4CYMA 4LBWA 3LW7A 1KK2A 1YR7A 1YZNA 1H8EA 2IYYA 1XX6A 3B8HA 3KDSE 4JL6A 5DYGA 4YXWD 2YOFA 3K70B 2GZDA 1W36B 3KKPA 5TV2A 4XIGS 4MDEA 4KBGA 1J8YF 4EJSB 2GILA 2ANBA 2QAGB 3PXGA 5HCNA 1OF1A 3B85A 3C5CA 1R0ZA 1VPLA 2AXPA 5KOYA 2ZRKA 4D25A 1ZIPA 1YR6A 4R71A 1TNDA 1I4LD 2FU5C 2WSSD 4BQSA 4HSEA 3TLXA 2XZPA 3GEIA 2QQ0A 1N2CE 5D3QA 5CITA 2FGKA 1RYHA 2JJ8A 4JBWA 2GXSA 2MSEB 4NCNA 1VG8A 1N6HA 1R8SA 1VYUA 1EFRA 2QTLA 1EX7A 4WW0A 2QMUA 1NLFA 1COWA 4YMTA 1KK0A 1P9RA 2BM1A 1JJVA 4LYJA 2JLSA 3DKPA 5KHOC 2HJGA 4QGGA 2ZITA 2G1JA 1NG1A 1RW4A 3AV0B 1W2BB 1R5OA 1F2TA 3MWJA 4US0R 4BLSA 5JCPA 1EESA 1ZC4A 3W6OA 3RHFA 3A6PC 4RKEA 4IDHA 3AVPA 3CWZA 2DFNA 1EP3B 2CCKA 2R9VA 1G7TA 2PMKA 1SXJC 3PUWA 4YAFA 2X1VA 3KQHA 2RGGA 4URZR 1E0KA 2WJIA 5EZ5A 1TUEA 1SHZA 3C8UA 4V0ME 2WMNB 2WJYA 4RD0A 1E98A 3RABA 4ZGNB 2FEOA 4HZIA 1E9RA 1T0JB 1FTNA 3K0CA 1E94E 3ADKA 2UZ3A 1YHNA 5K8LA 2JAQA 2QSYA 1GUAA 2V1XA 1US8B 3WHKA 3K09C 1VQMB 1P61B 1CKEA 4CF7A 4ABYA 2CRVA 3U44B 1EFUA 1W0KA 2ZSDA 2VHUA 4PO1A 1EFCA 1TTTA 3PJRA 2ZR7A 1E2FA 2PCJA 3I8XA 2CHGA 1CF4A 1N3BA 2VF8A 4C43A 1W0JD 5H70A 3G71B 3WNDA 2VZLA 2XTMA 3B1WA 2GXUA 2WAYA 2F1RA 2X2FA 3UMFA 2VP4A 1JPJA 4IRUB 4MGZR 1DTSA 2BIFA 3PUYA 1CBUA 2YWFA 1UKEA 3B13B 1JR3D 5GJCA 2ERYA 4JYBA 3W5HA 5JJIA 1X1RA 2BWJA 2YOHA 2WTUA 1DO2A 1G5PA 3PITA 3QF7A 2FSHA 1P7CA 4EAQA 3KKNA 2C03A 4P3YA 4QNMA 2JA1A 3U7FB 3FPAA 2J7PD 2KE5A 4TYYA 1KOFA 2Z43A 3GJ0A 4K46A 3MFYA 3SBEA 1DAKA 1Z0IA 3OAAD 2GVZC 5EP2A 1B23P 3CM0A 1N6LA 1VG9B 3RLFA 4AI6A 4QJ5A 3HPRA 3L0OA 3CCRB 3QSYA 2AFIE 1OH6A 4HDQB 3L82B 3NHBA 3TNFA 2B5OA 1MKYA 4TT3D 4XD7D 1Q1ZA 4KCGA 3NDBB 4CEJA 1SXJE 3A37A 1KI2A 4ZCIA 3LFUA 4QM6A 5BN4A 4PZYA 1XF9A 3W8RA 2RGBA 5F9HA 1GWNA 4JLJA 1I2DA 1R2QA 2CLDX 2QTVB 2QBYA 1GKIA 5FOUA 1YJNB 3KKMA 3AVQA 2GEDA 4PC2A 2QN6A 3FWYA 4IDNA 2FPMA 2V55B 5DIFA 4EIWA 1KNXA 4OL0A 3DOEA 3G5UA 1K8AD 1QFYA 1EGAA 1OXVA 3W8NA 1X6VA 2KBEA 5DH9A 4R9UC 2FDCA 2ORWA 2ZAMA 4Q19A 3HR7A 4URUR 4NDZA 1JB9A 1NVVQ 3ZGXA 1E2NA 4JLDA 4DZZA 2QUZA 2H57A 2QG6A 2EW1A 1GFIA 3O8BA 2HF8A 1P3JA 3FKSD 5AUOB 1CR2A 3TE6A 3Q5EA 3GFTA 1F20A 5L3VA 5FUWA 3VTKA 2FOLA 3BS4A 1MRNA 1ONBA 3Q5DA 1U9IA 3TSOA 4D4LA 5H68A 3RYTC 4EFNA 1VHLA 2ZI7A 4WVFA 3FHTA 1G7RA 3CC7B 4QGHA 1LY1A 4LBVA 1E2PA 2B8TA 4MYCA 2O8EB 1G7SA 1H8HA 4Q4JA 5DISB 5DN6A 2C78A 2G88A 1A7JA 2W6IA 1U98A 1WMSA 2D06A 4ZI3A 4US1R 4ON9A 2VNHA 4B3CA 4GT1A 3TR0A 2YC4C 2XB2A 2IUTA 3AF1A 1W46A 1W4CA 4EPVA 1JQLB 1UEIA 4G1BA 2AWNA 1G6OA 5B64A 1P9NA 4MKGA 5AK0A 1U81A 4JSYA 3R9IA 3ZD7A 3HP1A 2XOKD 4LV6A 4NP6A 3U5ZB 2P6UA 1K6MA 4B48A 2VSXA 3CRQA 2W83A 1NJID 1DDIA 2B92A 1DVRA 3CIOA 2OCYC 1SKQA 4IOKA 4D2IA 1NVUQ 2SHKA 3K9HA 1SVSA 1GL9B 4W5JA 5LDDC 2WKQA 5JI3E 5B57C 2Z4RA 1XMVA 3FMOB 3KQKA 4DJTA 2GCPA 1SVLA 5BYKA 1JEDA 4BFZA 4GFDA 1W5SA 2KJQA 3RDPA 2NGRA 2XNDD 2HJVA 2YHSA 4A0GA 5BW8A 3K0FA 3E20A 1UDXA 4JJZA 2JLWA 2WMOB 1FP6A 2D3WA 5F98A 4AF6A 4AF7A 2Q9BA 3IEUA 4ESVA 4DIDA 4JLKA 2N1BA 1MO5A 3BFKA 3R7WA 1EFTA 2R6AA 3VU9A 3OEHA 2IK8A 1SVKA 2RGAA 2ZRHA 4DLTA 1G64A 1R5BA 4DQLA 3LO5A 2LWIA 3LDAA 3X1XA 4JLOA 1ZUNB 1RJ9B 4IJMA 4D0GA 3C16C 3CNNA 3L0SA 5TVKA 2GBLC 1J7KA 2H5EA 3KTAB 4IXMA 4LDJA 1G3RA 4IEIA 4Y9RA 3CCSB 2Q3HA 4JKIA 2BBTA 4M9XA 4NU0A 4FMBB 1XD8A 1G3MA 1PLLA 5G3ZA 4G5GA 1FOEB 1GKUB 4UNNA 5CJPA 3I56B 4DLXA 4ZIRB 3ZD6A 4WZAE 4GMXA 1LS6A 1HE8B 4DC9A 3ICQB 2E87A 2XITA 3CXCB 1P2TA 3H2YA 3KZ1E 4B74A 1VQKB 4OI0A 4E03A 1ZMXA 1T3HA 1M7GA 1L2TA 2R62A 2Z0MA 2QM8A 4IEEA 1NBME 4M8NE 3IHWA 2C04A 2ZRBA 1DE0A 3P1JA 4HAZA 4PAQA 4AKGA 3CPEA 8OHMA 1QX4A 1HT2E 4M1SA 4ZI2A 4DWJA 1XTRA 2F1JA 4Q4HA 4M53A 3ASZA 4M1YA 2ZS8A 1X8JA 1NN0A 721PA 3MWLA 2IYXA 1XCGB 2XNCA 1XEXB 2VYFA 5FBRB 3VX4A 1GAQA 1KDPA 1HQYE 5FR1A 3JQPA 3H0KA 4C4PA 1KI7A 3T35A 4HDCA 1HTWA 4NYMQ 5FTJA 4CT4B 4AG6A 1J8MF 1VYTA 2KWIA 4RCZA 3DOFA 4RZUA 4KFTA 5B30A 1E0SA 1FQJA 2PZGA 3CH4B 2VH5R 1AA9A 4B3DA 3AGPA 1S1CA 5EXXA 4PSKA 2F9MA 2IUUA 4Z1MA 1KNQA 3MGCA 1ZINA 3KQNA 1NF3A 1E2GA 3FFAA 3HPQA 1F48A 3UWKA 1XJCA 2QU8A 1R0WA 4JZKA 3EW9A 5TXGA 4HUTA 2ERXA 3W6NA 1NLZA 2GEUA 1YITB 1ZW6A 4P4SB 3U3OA 2GQFA 1SXJD 1QHYA 1JA1A 4HE5A 1P62B 2JATA 2R6DA 4UNQA 3CPWB 1II8A 2IX3A 4DHEA 1ESMA 3U6BA 3B1YA 4LPSA 4MH0R 4DLVA 3BOSA 3JZAA 3B2EA 1KI4A 4NCIA 3AEZA 2CK3A 1IOZA 3BB4A 1MH1A 4MYUA 1TPZA 4PZZA 2CMKA 3GLHA 1SVMA 4TYNA 4BFVA 2YJTD 4MDFA 2X8AA 3BB1A 5TMPA 1XMIA 3VR2A 3QXHA 2ZQ5A 3QXSA 2DY1A 4W7SA 4B33A 2V4ZA 5JHHB 3GLGE 3NKVA 4KYIB 2QEXB 2H16A 1D6JA 2GKSA 2CVFA 2ZJBA 4RY2A 3VR6A 1XP8A 3AKEA 4V0KA 5LB4A 1W47A 1JAHA 1IN8A 1YIJB 2JIZA 3TSZA 2WSSA 3QPUA 4O0MA 1VQ6B 3BAFA 3LA6A 4TL8A 4OHZA 1WBBA 3CR8A 2CLSA 2ZVQX 3CRZA 2PIAA 2QT1A 2B21A 1LW7A 3T1VA 3U3JA 1E69A 1F2UB 3W2FA 2ZRCA 3A36A 2ANCA 2DCUA 2XNJA 4G5RA 5DNYB 2YKGA 4DT1B 2MSDB 1AM4D 2Q9CA 4HLUA 1MV5A 1W44A 3L2OB 4FIDA 3EZ9A 2FFBA 4Q4LA 4AYWA 2O8FB 1IN7A 3BRWD 4B3BA 2XXAA 3MG9A 3QKSB 3TQFA 5L3RA 2VO1A 4B71A 2UKDA 2BCGY 4CRWB 4II7A 1IXSB 1TU4A 4URVR 1D9XA 1OB2A 2CBZA 5FPTA 5SZKB 3GLGB 1Z28A 3IIJA 4AY2A 3S1AB 2XSZD 4C0KA 4XTCS 5KNCA 3PFIA 5FUXA 2DB3A 2JJ1D 4JS0A 2WZQA 3QFCA 2VHCA 1XTJA 1YZTA 2KB0A 1IXRC 5EP1A 4QBGB 3SS8A 5GVSA 4G5SA 1WB9A 4V02A 1QHGA 3EZ7A 4XWAA 1S1MA 1U0HC 4RFSB 1JXMA 2YWHA 3QKRB 4BZXA 1I4TD 2VL7A 3KB2A 2D74A 4QHYA 1AZTA 3QXCA 2QSZA 1YZKA 3AVOA 2PX0A 2ZRAA 5HR5A 3X1WA 1IJEA 5EUMA 1H65A 4F4JA 2OAP1 2BGIA 4YAWA 1BX0A 4M0LA 4MQBA 3OHMA 1VYVA 1OSNA 3QIAA 1SHKA 1Z6YA 1W48A 2J0UA 4LUCA 4V0OA 3Q7QA 1EXMA 1U2RA 3WNCA 3VHLB 1KHTA 2O8CB 2RGDA 5KU1A 3SJZA 3VR4A 2EFHB 3T5GA 3UWOA 2J46A 4TQAA 1UKYA 2D62A 4BRUA 2BN4A 1P2VA 2GPJA 2REBA 3VNUA 1OIWA 4QGFA 3B1XA 3QFRA 1QHHB 3LBIA 1M1YE 3C4JA 4YDHB 5F2EA 4ASUA 5CDFE 4TMKA 2EFCB 3I92A 4MA4A 1X86B 3FB4A 4DRZA 4PAMA 1CP2A 3M1IA 1C1YA 4Q7KA 4V0LA 1HA3A 4GZMA 4UJ5A 5AUQA 5EJEA 4EH1A 3AB3A 3QI2A 4OYHA 5FL3A 5GJVC 4M1MA 4WIAA 1DEKA 3LXXA 4FINA 1G7CA 4EQ6A 3I32A 2QE7D 5C4MA 1XCMA 1NBMD 1VCOA 3ZS8A 5AN9A 3OAAA 1ODFA 1M1KD 5JI2E 3H1TA 4V03A 1RRPA 1DAGA 4PX9A 5KSZA 2W2XA 1S8FA 4B4DA 1KI6A 2K5UA 3IILA 3A8TA 3LX8A 1DDGA 4M1WA 4DXAA 4TT3A 2IHBA 2ZUDA 3WYAA 1UJ2A 2ZI6A 4LY6A 2WJHA 2XNSA 1GSIA 3QE0A 2PT5A 4JYCA 3PUXA 3W3AA 2V8OA 3WRXC 1ZM3A 3RSOA 3REFA 3CD6B 2F7SA 2GZAA 2HUPA 3RC8A 3AKDA 2QDXA 2NPIA 2WWIA 3REGA 1S3GA 2W6JA 4BLTA 4C2TA 2WKPA 1OYYA 2WPDD 1KMHB 2FSFA 5FFMA 5L3SB 3GLFE 1NY5A 4PGOA 1WA5A 4JL5A 3K9LA 1E1QD 2IHYA 3VFDA 2QA4B 3SE0A 2GCOA 3X2SA 4A2WA 4GL2A 2QAGA 4FCWA 3VO2A 4GPTA 1KSHA 3B1VA 4JKYA 2EFEB 4KVAA 3K53A 1MABB 2OE2A 4YALA 2BM0A 4DB2A 2BJVA 2GF9A 1E32A 1OXXK 2G3YA 1P2UA 1IN5A 1IBRA 1X8LA 1TQ4A 1GL7A 3PCRB 4AKIA 4HE6A 4C0SA 2HXSA 4U5XA 3SYKA 3K0AB 3B78A 3J81k 3CMEB 1RVDA 1EG7A 2R65A 5K8UA 4E22A 3WXMA 3CKLA 1XXHE 1S2MA 2OFWA 4NYIQ 4DLUA 1XEWX 1E2HA 2ZROA 3GJ6A 5FA6A 4LPKA 4DSOA 2FX3A 3TVDA 2RC6A 3BORA 3JVUA 1KSJA 1ZNYA 1YZLA 3GLFB 1L7VC 4NMMA 4ERNA 2PLRA 3EXAA 3BFVA 4KVGA 5FOSA 5KNBA 1UBFA 3P27A 2OZEA 1TQ6A 5E7JA 1AKYA 1LVGA 1XTSA 1Q44A 4DLZA 3CH5A 4PO9A 2ODBA 2ZYVX 3VMFA 1XB2A 1IY0A 3U7EB 4EFLA 1D2MA 3U3MA 3AGQA 4MITA 2G6BA 2I1QA 4IOMA 3WMFA 4CT5A 5LD2C 2A7QA 1UPTA 3KXKA 4LRWA 2IL1A 1VCNA 3I73A 1TQ2A 5SZHB 2O5VA 2DBYA 1N8RD 1CJKC 4BUJA 5TY0A 2XB4A 3KQLA 3DM5A 2FV8A 4BFTA 4DVGA 2C95A 1T5LA 1Z08A 4PC6A 4DB4A 2X19A 1E79D 5FUVA 1E64A 3IQWA 1DOAA 4PHTA 1XZQA 2FE4A 4ZV4A 3THOA 2O8BB 1BS1A 3F5FA 5KDLA 2A78A 2A5DA 4Q1BA 1Q1BA 2RGNA 2CCGA 4OHWA 1FNMA 1Q82D 4AC9A 2ZXUA 5G41A 4IVQA 3PV0A 3LD9A 1J99A 1Z3IX 1XMSA 1NJFA 3AM1A 3GQBA 3W5UA 4Q7MB 2G77B 1LS1A 3TK1A 2BSAA 3KB1A 1SVIA 2WBLC 2CXXA 4YONB 1FRQA 1TU3A 1XZPA 4PTLA 4I1SA 3T1QA 1GL6A 1YKSA 4TTQA 3LXRA 4OQLA 3OJXA 5KSWB 1QDEA 4A6XA 1XE1A 4L9SA 1P6XA 1XFAA 1KO8A 1GRRA 1TQDA 1ZD1A 2XAUA 3JQQA 3THXB 4OBEA 2RGEA 2LKDA 2ZUBA 2D7CA 3C41J 1TF5A 4P32A 5JCZA 3DKVA 4ESHA 1N5LA 2ZSFA 2RKOA 3FTQA 4JBXA 1FMJA 1HT1E 1G9XA 1H85A 4B32A 3WYFA 3V76A 2OAQ1 1LF5A 3F8TA 1AS3A 1G6HA 5IT5A 1NI3A 3W5IA 1IONA 5BXQC 4B34A 4LSGA 5J40A 4BPRA 1ZBDA 2AN9A 4KJZA 1I7PA 1YZGA 4YAOA 3SU8A 4OQFA 2O8DB 1KTVA 4XSHA 1QUEA 2XX3A 5LPNA 4G5QA 1M7BA 1FMLA 2IUSA 3QOFA 1T4GA 1ZCAA 4BEBA 2PJZA 1FUKA 5HCIA 3ECCA 1XU4A 1Q21A 1VKJA 4Q4AA 4BLPA 1YR8A 3NTUA 4EUNA 1N6KA 1OPXA 5AUPB 1K73D 2A5YB 3CZPA 5EUQB 4WQMA 3GJXC 4W5HA 1RZ3A 3U3KA 5FBVB 3WP0A 2HCJB 4KHZA 2ZE6A 1A5TA 1VIAA 4QJ3A 2OK8A 3GJ7A 1OH8A 3U7HB 3EIEA 3TUIC 4TLBA 2FZ4A 4O25A 5J4VA 2GJ8A 3UK6A 4OHVA 2YWEA 4DLRA 1JJ7A 3ZC3A 4PC1A 2YWGA 1ZYUA 1NVVR 2AK3A 1E96A 4PO8A 4EKDA 1TF2A 3IEVA 421PA 1G3UA 5EXTA 2A5JA 2BBSA 5JS8A 3SQXA 3TGPA 4CEHA 3QFSA 1VG0B 2GA8A 1K5GA 1Z06A 1U99A 1UDWA 4ZDWA 2ORIA 1ZJ6A 2P5SA 3Q72A 2QMHA 2UVQA 4BZPA 2QEQA 2FFHA 2DYKA 3V9PA 1HY3A 3K09A 2JLZA 4LJ7A 3KJGA 3MWYW 1DAHA 3ZJYA 5GADl 1ELOA 1KKLA 4DCSA 2DFTA 5AJVB 1WDTA 5JEDA 4RFVA 4WXPA 1BKDR 2OCPA 4V0NA 1W5TA 2DPXA 5FBQB 1H42A 3TR5A 3RRMA 4DDTA 4AYTA 3AF2A 4DLSA 1QF9A 1G3IA 4TYPA 4YDSA 4P6VF 2ATXA 4A2PA 1Z5ZA 1W4AA 3WYGA 5KDDA 1W1WA 4TLDA 4S35A 3TH5A 3WMEA 2IYRA 2BJWA 3ZIAD 1GVHA 2X77A 821PA 1E1RA 2G0TA 5EXSA 5J4KA 2ODNA 1YR9A 4LHVA 1EK0A 4PPQA 1CJUC 3RS2A 4CEIB 1DO0A 3CF0A 1AQYA 5FI0B 4LHYA 3U3RA 4F4CA 3AKCA 1SZPA 1Q22A 3NWJA 1CXZA 2ZI5A 3PEVA 5BN5A 5D3MB 2EFGA 2BMJA 2DHRA 3Q8XB 5A5GA 3W2HA 2OBLA 4F91B 2E9SA 2IEZA 2J0VA 4HAUA 5EP3A 3D6TB 3OIWA 1X3SA 1CR0A 1ESNA 4ZDJA 3OJWA 2NO6A 2V7QA 1XPUA 2FG5A 1N5JA 1OV4A 3KTAA 1SM4A 2W0MA 1VQNB 1HYQA 1XDBA 2V9PA 2EIXA 4TYWA 2F3RA 2OG2A 1QHSA 4LZZA 5G40A 4ZIRA 1LB1B 2PZFA 2FPKA 4F38A 1TEVA 4KYUA 4JVLA 2CL6X 3K0CC 4FMCF 1HV8A 2C98A 2GXQA 4HB3A 5AJWA 1YE8A 4PQYA 3EX7C 1AK2A 4KFRA 3AF4A 4GOJA 4UXIA 2NO1A 2QT0A 1XEFA 3U4QA 3IPYA 3O47A 1OGIA 2IA5A 3EA5A 2G9NA 4HUQA 4LJ8A 3A1TA 3D31A 1RKBA 1K5DA 2JDID 4NE2A 5FTNA 3P32A 1UBEA 1J2JA 1A4RA 1P73A 1KI3A 1UBGA 4OJQA 4B47A 1XEXA 2ZR0A 3CC4B 4XH9B 5DO9A 3WRYC 1T8UA 2R6GA 2OHFA 1QH0A 3BD9A 4JLPA 4M9SA 2OCBA 3NIBA 4LV8B 5BWMA 3QNUA 4C0JA 1OE0A 4BLOA 2GXAA 2FMXA 2G83A 2H18A 2CHVA 4I1OA 4H9GA 3AF0A 4M1TA 4NYJQ 4KITB 1IN4A 5AJXA 3CW2A 3BH6A 4BZQA 3F3YA 2AFHE 2QAJA 2F3TA 1OIVA 2HT6A 3SHFA 2VBCA 5EP4A 4E5UA 1GR1A 1NBMA 3U7GA 3OIVA 4RZ2A 2WHXA 1J90A 1FDRA 2YOGA 3EWAA 2BBOA 3KX2A 4NYMR 3PENA 4ARZB 2J41A 2OV2A 4IOLA 3QF4B 1SXJB 1E9DA 4I4LA 4PQRA 3VR5A 4LC0A 1N5IA 1II0A 2R2AA 3ZBTA 2B7CA 3T1TA 4UQOA 2KI5A 2F55A 4P4SA 4PPFA 3B7GA 4RD2A 3LY5A 4MUAA 2AKYA 4R2HA 4JLVA 2QENA 4B3XA 2FGJA 1D8TA 2FWRA 2PT7A 4DEXA 1G17A 2J0SA 4HB0A 1XWIA 2QORA 3HYTA 3EC2A 4QBFA 3MWKA 4IVRA 2J7KA 4MRVA 4ZKEA 3OW2B 2QM7A 2Q0HA 4DLYA 1FW6A 2QTFA 2HLDD 3CNLA 2H7VA 3BJIC 4GI7A 2WV9A 2GAAA 1XRJA 3L8ZA 4HLDA 2ZJZA 3T12A 2VHTA 2ZRJA 3DL0A 3SZRA 2OSBA 3TMKA 4W9MC 4DCNA 2H8KA 3MHPA 1C4OA 3AVVA 2BV3A 4LJ9A 4TMZA 4Q1CA 4DDWA 2P3SA 2VNJA 1F2TB 3N5CA 4QBIA 1QVGB 3RAPR 3FFBA 3GFOA 4ILEA 1R10A 3IHLA 1E0AA 1N6NA 3CUEF 2VIIA 5E7MA 3CCEB 1LFDB 1P5ZB 4MGYR 4M2LA 2MSCB 2WIBA 4B2LA 1N0UA 4IDQA 3CCUB 4QKQA 4M1OA 4TMTA 2IYUA 3ZVMA 1CNFA 2D4HA 5JWRA 1BQEA 3WNBA 1UKVY 4DT1A 3MLEA 4LYFA 5ELXA 3GLIE 4MYTA 5GJWC 4TN1A 1OW3B 2Q6TA 1UMKA 2O8FA 1VQ7B 4HEJA 1VQ4B 1OFHA 2DWOA 1AS2A 3OEED 4N0EA 3THYA 3QKSA 1DG3A 2JLUA 1ZM7A 1YI2B 3AF3A 2I3BA 2WM9B 1D9ZA 1S9HA 3FMPB 4QNRA 3QXJA 3PEWA 3VO1A 1ANKA 1CRPA 1HEIA 2QP4A 3EZ2A 4YHBA 1P2SA 2X2EA 1A2BA 4DUGA 2OFXA 3GLGA 5GJBA 3CR7A 3S1AA 1G18A 1GOTA 1FL9A 1NRJB 3UMRA 2O0HA 4AG5A 5IK2D 3T1OA 1W4RA 2ZVPX 3G6EB 4QL3A 2WWHA 4FXPA 5FPYA 1J9ZA 1TAGA 2Z5FA 3IPXA 4CW7A 4U7DA 1E2EA 5K8TA 1MO6A 1VQ9B 5CK4A 5JHGB 5AR1A 3AVTA 1U90A 2ZPTX 1YHQB 3HYRA 5EZ6B 3FHOA 3VHXA 4B75A 1XPOA 1QGZA 4RFSA 4AK9A 5G53C 3QKRA 2PMDA 3A4MA 3AH8A 3R9XA 5ANRB 2ZRDA 3KXIA 4A2QA 3I1FA 1NSTA 3MSXA 3GLIB 2AHOA 1FRNA 4MYHA 4DDVA 2AWOA 3NC0C 4UKDA 1JXOA 4JLMA 1QBKC 5JEEA 4PHGA 1XTKA 2MMGA 3DMNA 3HDTA 3U60B 5HXBA 2BMEA 3EIHA 1KI8A 4MRSA 3SYLA 3UANA 2VQSA 3KQUA 3MUFA 5HPYB 2P6NA 1E4YA 2CNWD 4W5WA 4FD2A 3W2IA 3LWNA 5EE3A 4A0FA 4BGDA 2JEOA 4BECA 1LF0A 1QUFA 2CCJA 4LYHA 3QE2A 4PQFA 1MO3A 2ASEA 4MKIA 4TSFA 3LVQE 1T0HB 1QHHA 4HAXA 2AK2A 2TMKA 4IFBA 4L15A 5KSOA 4IFEA 4KSBA 1TADA 1Z07A 4PSAA 3BK7A 3IO3A 3OFND 4ZDIA 2PJRA 5JECA 5SZIA 1E9CA 1TEXA 1OKKA 1T91A 1W2GA 2GF0A 5FH9A 2BKEA 1V43A 2FH5B 3AVUA 1CJVC 1OHHA 4G3XA 1H8ED 4URYR 1ZNXA 5JSZA 1YRAA 4A82A 2VSFA 4S2EA 4LBYA 1G4UR 2QNRA 1PJRA 2GVDC 2QPAA 1FFHA 1O3YA 3CX8A 3CPJB 1KK1A 1RYFA 3FKQA 3NBZC 1CEEA 1OFUX 1Q12A 3JZMA 4JJKA 1YU9A 4IW3B 1YJ9B 2ZJ5A 3KUCA 4G01B 4AYXA 3UATA 3X1YA 4Q9IA 3NH6A 5CIQA 1IHUA 3KFXA 1QHXA 3NBYC 2QROA 2ZE7A 4YXWA 4AKEA 3CO5A 3PUZA 1Z22A 3U61B 4R7ZA 1EFRD 3M4YA 3Q9LA 4OQMA 4TL6A 1OFTA 3SN6A 3TKLA 1SVOA 4HAVA 3H4MA 1KMHA 5G3YA 4DDUA 3AKYA 3GEEA 2ZSAA 2GJAA 2IC5A 3NEYA 3GCGA 5L3QA 1N5KA 1YZQA 3D3QA 1YRBA 3QY0A 1KI1A 1PZNA 3ZZUA 4JT2A 4RCYA 1IXZA 1OT3A 3AVYA 1MABA 3SEAA 2WWWA 4Q1EA 1II9A 3QFTA 1P9WA 2WJJA 4LX0A 4RVCA 4PANA 1CR4A 2ZI9A 2IWRA 2EWVA 4KFSA 4B35A 4H1UA 4NCKA 4LHWA 1UAAA 4UNRA 2X3UA 2HXYA 2C99A 3ZYCA 2OFOA 2O0KA 4H1VA 5JJKA 221PA 2OK7A 2ZI4A 5TDHA 4D81A 1CJTC 1XNJA 1Y3AA 1Q3HA 3QBVA 4K81B 2HMAA 3FMIA 3O8CA 2ZTSA 3I3SR 1GKYA 4TMVA 3GLFA 4OK5A 4U02A 3GPLA 2D2FA 1ZIOA 1GNQA 1R6BX 1SULA 3FMFA 5GV8A 3B82A 1TL7C 4OQXA 1GO2A 3VU9B 4Q5IA 4NYIR 4PHHA 2QI9C 4XOIA 2R6FA 1VG1A 4BRWA 3UIEA 2ZJ8A 3ZZ0A 3AVWA 1KJZA 2ZANA 3KJIA 4YAUA 3NDPA 4B3GA 1ZU4A 1M34E 3C15C 1Z6AA 4XWKA 1GIAA 4HB4A 4RZXA 3B6EA 3FHCB 2GHIA 3RRYA 1EP2B 2REOA 2C5LA 5J47A 4N3GA 2CL7X 3IUYA 4HLUC 3E1SA 2QP9X 2FEMA 2O8BA 3W2EA 5CYOA 4L8GA 3OIUA 4XWOA 4PZLA 4XVRA 4A92A 1W0JA 1Z0JA 1IM2A 4RKFA 3ND8A 4I1VA 3TBKA 3EPHA 4LJYA 2F6RA 2J45A 2W00A 4EPXA 4QRHA 5HE8A 2W0SA 3ADBA 3TAHA 1ZAKA 1GILA 1FNDA 5JWHA 4Y0AA 3TUJC 2WJVA 4XVQA 3Q85A 2RCNA 3X1ZA 3NVAA 1JR3A 2ATVA 3RVBA 1EWRA 4ZKDA 2VP5A 4MRNA 1JBKA 2AD1A 1XD9A 4IDPA 3OZXA 5LBIA 2NQ2C 1M6NA 4HZUB 1JNYA 2BEKA 2CL0X 1Z6XA 2HDNB 1S3SA 4P4UA 4RJLA 3AP2A 4GMDA 4N0DA 2J7PA 3MD0A 2CE7A 4ZPXA 2H1LA 4RD3A 5FPHA 1YVDA 4E09A 5FPKA 1B2RA 5JRJA 2H17A 1E9EA 4LWZA 1T5IA 3GLHE 3E70C 4A6PA 5IRCD 1F6BA 1Z0AA 1N0WA 2PLFA 4FMDF 4XD7A 1QGYA 3QUSA 5KTYA 4HATA 3N2IA 4WAUA 2DETA 3OZVA 2JDIA 2IBMA 2IXFA 3RNLA 3SQWA 2DEUA 1KZGB 4Y0VA 1E62A 1XD2A 3RRZA 5EXPA 3K1JA 5DHFA 1RPZA 4FWIB 4BFUA 1QVAA 1VTKA 3OE7D 1KK3A 2V3CC 2D7DA 4Y9UA 1YJ5A 2NTYC 4DQKA 1Q57A 2H92A 3DHWC 3AVXA 4GP7A 2O8DA 3NEJA 1GM5A 3K8YA 4QFMA 5M04A 1QFJA 1CU1A 2FPLA 4BLQA 2IF0A 2CE2X 1H8HD 5FPSA 4EJSA 5JLJA 5CYPA 5DN6D 3R20A 3SBDA 3FKSA 2IYWA 2OILA 3GLHB 4DEYA 2IEYA 1PV4A 1VQ8B 5CLQA 3THWB 1G4AE 1Z0DA 2FFAA 3TUZC 4PAOA 4A15A 3CCLB 3L43A 1T8TA 3LRPA 3QJYA 3ES9A 3EZ6A 3ZVNA 4G1UC 2Q9AA 2EYUA 4UJ3A 4WA7A 1X1SA 4J0QA 2F9LA 1KAGA 1M2OB 3W9YA 1U8AA 4AURA 4C7OB 2ZI3A 5H1YA 2B6HA 3QBTA 2HF9A 3BC1A 4Q1DA 3MCAA 2RC5A 1ZP6A 4RZ3A 4XTRA 4BE7B 1RRCA 3SR0A 1CRQA 1FNCA 2JJ2D 1W49A 4WBSA 4I81A 3CBQA 2XOKA 3Q3JB 1BJKA 4R98A 4C0AC 5GVRA 3B9PA 3EARA 2JASA 3HR8A 1W36C 2ZS7A 1OH5A 5JMTA 2QAGC 2N42A 3TW4A 2ZJAA 2C9CA 1ZRHA 3OEHD 2FSIA 1EFHA 1KY2A 3LX5A 2OEPA 3UKDA 1D1NA 4C9BA 2BPOA 2ZAOA 2WICA 1DG1G 2XNDA 4MKFA 1Q7YD 3MJRA 4D26A 4OI2A 4GRAA 5TB5A 1E2IA 3WBKA 4OQNA 3LH5A 1US8A 3B60A 1CNEA 2B8WA 4NONA 3BE4A 1R0XA 4B44A 4B43A 4KXFB 3WHLA 1UBCA 3W2GA 1XXHB 2QRZA 4M9QA 1GNPA 5KPDA 3U44A 4K8OA 5FTMA 3LVBA 4CEIA 4B3FX 5A4JA 3R9WA 2BCJQ 3EPKA 3V4FA 2NO0A 2WWFA 2V6JA 4FCTA 4A1FA 5H5JA 2Q3FA 5D3MA 3RWOA 3L0IB 1IB0A 2QGZA 4C0QC 4KI0A 2GJ9A 3QENA 2ZIAA 1EX6A 3G0HA 4P31A 2OTJB 3ASYA 4Q9HA 1JA0A 3ZDQA 4V0MA 1QVFB 1FUUA 4HLCA 2ORVA 4K1XA 4BFXA 621PA 1Z6GA 2IYQA 3LBNA 1IAQA 4F92B 4Z8YA 4B6FA 1KD1D 4Q01A 3K0SA 4DIEA 1ZM9A 3KXLA 4D4KA 4TTRA 5KPJA 4GNKA 3QKUA 1WQ1R 2OT3B 4GOKA 2HYDA 2J87A 1XJ0A 1IY1A 1A8PA 4QOSA 1UF9A 1I4DD 1ZNZA 4TMWA 3DEFA 5FBWB 3GEHA 3VKHA 4CDGA 3RRNA 3Q7PA 2RGNC 4A8JC 2AX4A 4NBSA 3I55B 2JLRA 3U6KA 1NMZA 2WOJA 4QHSA 3ZVRA 1T3SA 5BN3A 2QMEA 3V4RA 2QPOA 4FCVA 1P72A 5THXA 2YVUA 5DI9A 4FWTA 3PQCA 1RIFA 5DGXA 4DCVA 3DZDA 4QXAA 1CR1A 1TF7A 3ZS9A 1QHIA 2BMWA 1RRGA 3A4NA 2ONJA 1QG2A 3IQXA 4IHQA 4M4SA 2BHRA 3OFNA 5BQ5A 3BXZA 3RS3A 3RS4A 5UKDA
chains in the Genus database with same CATH superfamily
3F46A 4C89A 2CK3D 4MAMA 2J5XA 2I1WA 1AD2A 1KVSA 1M74A 1USGA 1V5EA 1WSDA 3FTPA 4MR7B 3TJRA 4CF4A 4B2PA 3AQIA 4TS9A 3LKZA 4WZEA 5AW2A 1XEWY 1NVFA 3VZRA 1IIRA 2QPTA 2AA3A 4HRAA 3ZDZB 5HKKD 4OK3A 4BFWA 4GKVA 4Y2GA 4KQEA 2Q2QA 4FW9A 4NYJR 4P3IA 3UXYA 1SXJA 4S0XA 5BNZA 3O8RA 4Q6WA 3CCJB 1NMXA 2J3KA 3KR1A 4UNPA 4XGIA 4L4UA 1PGJA 3D6HA 5LD2B 5JS1A 4QAQA 3QELB 1M2HA 2W43A 1LV7A 4I36A 4EHDA 2DH6A 3CMAB 3FPKA 2JIQA 2PEZA 4OKSA 4YP0A 1NN5A 3S68A 5BMVB 4IFTA 3COSA 5KVSA 1L5WA 1V8DA 1LPNA 5FL7D 5F23A 2LIPA 2LGJA 3FOCA 3Q1KA 5CLHA 1GQYA 4QQNA 2OO5C 1IDN1 3UFXB 2WWXA 1G5TA 1V16A 1WUHS 1C3OB 2FSVA 4KR0A 5F51A 3FPSA 1CQXA 3S99A 4ZGGA 5C35A 1IMOA 5KTRA 3P9ZA 4IIJA 5A4FS 4BVLA 4HGOA 3QEJA 4XLAA 2WOOA 2CDCA 2Q3BA 3AF6A 3HZOA 4RJIA 3KM0A 1RKQA 2XE6A 1YJWB 3KUUA 4FLFA 2YMPA 5AK4A 2CNKA 4MVCA 2HWXA 2QSUA 4H4DA 3O0TA 3ASVA 3AT1A 2NOAA 4L7VA 3UJCA 5MFZA 1C41A 2GAFA 2BT4A 3QPDA 1KZYC 1RLTA 3FSJX 5DI3B 3HVKA 4ER6A 3ZQ6A 3T41A 4DQXA 1FW6A 4JKOA 1VP9A 5AM3A 5C18A 2O52A 5TEVA 3KUXA 2IWHA 1MT3A 4F6CA 5JZSA 4P53A 5GMOA 1VKOA 1GZ7A 4NARA 2Z95A 1NL3A 1NP3A 1P4RA 1PJAA 2J1LA 1JFSA 1E2QA 2FNAA 2NO9A 3VAZA 1NIJA 1RZVA 4EG3A 3ZDYB 3EH2A 3D0RA 3MJEA 4I3FA 1FZQA 4QODA 1R8QA 3THRA 3WJ2A 4G09A 1RE0A 3AINA 4D9HA 3HO1A 1DLIA 1O95D 4AVZA 3JPYA 3QU7A 3RS8A 1JKMA 1ENZA 3ADDA 3DE5X 3DPUA 5DSZA 4BFLA 1R6XA 1JKXA 5EE5B 2AZDA 3DFMA 1Z0KA 3PHLA 1WXWA 2XVAA 2XSZA 2P2LA 2RAPA 3JXEA 1Y8CA 2QTHA 4D4JA 4GLLA 1GITA 3C3CA 2F1HA 4OLHA 4X8MA 4FZJA 4PIVA 4GVLA 5C4GB 4D4GA 3V2IA 2EG9A 4A8JB 2ODEA 3FNEA 4DNRB 5CAEA 4INOA 2B98A 1UPXA 2FFRA 4ZVPA 2JCGA 1XPJA 3T06B 1RP1A 3D4BA 2W6MA 5HZKA 1G2OA 3ZYZA 3TCKA 3STVA 4N5LA 1GJRA 3KAPA 5CVDA 3OT5A 3RO7A 2GZHA 3EG5A 4C6HA 1CZKA 2A67A 3BIXA 4EZIA 3OPOA 3LW8A 5K4GA 1Z4KA 2AGVA 3DJYA 4UHBA 4Q21A 3DL7A 4WVLA 1HNNA 3DE3X 1RRFA 2ZSBA 1NULA 1UADA 2A3RA 2VOEA 3R6WA 1UM8A 1YUNA 1NIPA 3C6KA 4IILA 4ALKA 2EKZA 4DCUA 1AMUA 1XRMA 4ITVA 1YRLA 3ORSA 4JD5A 3BH7A 4GLOA 3T5TA 3K9CA 1UPBA 1MH9A 3IHKA 3NUZA 2PRZA 4P84A 4MWEA 6Q21A 2NXEA 3F0TA 1QZTA 1YMVA 2Z4SA 3FMGA 3V4OA 1CK4A 1K6XA 5A6SB 4Q7QA 1C14A 2V1UA 3ICEA 4LGMA 4GDFA 4QSMA 1V5FA 4NK4A 3N7UA 1RP7A 5EMHA 1KRHA 1FRFS 3HU2A 4RPIA 1KJWA 1UKZA 2IP1A 3KYCA 4GLFA 4NBNA 2FRDA 3G1TA 4BLRA 5KNDA 4MGEA 1HF3A 4Y2XA 3KR2A 1HX7A 1A2OA 4HN9A 4DEVA 2ZRLA 3WLNA 4P34A 1GQ2A 2GYVA 3OD5A 4PBRA 4Z4SA 4ISCA 3AUYA 4AB1A 3LYHA 4LHZA 2GJRA 1E6CA 3ELUA 4H35A 1AV6A 4XN0A 1CY2A 4X8IA 1JI0A 4FDTA 3O4IA 4MVJH 5CCBA 3AY7A 3CONA 5E3IA 5JD6A 4DMLA 1PYDA 3HABA 3UWMA 3HCDA 3WP1B 4NNJA 4K3VA 2C42A 1PUJA 1TC1A 4UBNA 1G1MA 2G0NA 4GD3Q 1CIPA 3S1LA 1EXDA 4QUBA 4FEYA 4UDOA 3K70D 4DBLC 2AMJA 1C9EA 4RVFA 4AY5A 1GTVA 2C00A 2OXCA 5A5DA 4KBFA 2Z6BD 1KC8D 2YIMA 1XZHA 4J94A 1GXSB 1T34A 3AIKA 1XDUA 5ALPA 4ZCLA 2PL9A 4PZ9A 3RGGA 5TARA 4HLQB 2QG4A 5FOVA 3Q0EA 3Q6MA 1A2KC 1XSEA 4RPGA 3UGJA 5ALMA 2FQ1A 4JVNA 1ZH6A 2PWBA 1N1MA 3MTBA 2ZT5A 2C4HA 2MSWA 2DTEA 4N9WA 3T54A 1WCIB 1AGPA 2BMAA 1N0VC 4JB3A 4KXQA 3VKWA 1LLCA 3R8FA 2HU5A 4MICA 4M0CA 2BP7B 2IIQA 4ZANA 1JR6A 3O4HA 3OKAA 3TD6A 2XLBA 2FMTA 3WB1A 2OC9A 2Q1YA 2YZ2A 3RYCB 2PH5A 4JVOA 5DYIA 1UXOA 1T3LA 2L19A 3DT9A 3OZGA 1GNRA 5HE9A 4AWXA 1RC8A 2PWPA 2PAAA 5AVWA 1NP6A 1Y6FA 5L53A 1VJRA 1SZDA 2AW5A 3KZOA 2GN6A 4Y8VA 3UTCA 4IQ0A 4BWYA 2JANA 3FNHA 2OP0A 4M9ZA 3RS7A 1DJOA 1L4UA 3REQB 4MUNA 5B7NA 5B7GA 4Y6SA 5BSFA 5KAMA 2FQWA 1RHJA 2OGUA 1OUMA 4YUYA 3VTZA 2HT1A 1O77A 1VIYA 5A71A 1UK9A 1JFFA 2YDXA 4H6VA 3FNRA 4F1WA 1JG7A 1LCIA 1FSSA 3LL4A 4FBLA 4P54A 1KY4A 3EJ6A 4I8IA 3SBXA 2VRWA 1KDOA 5HFAA 2PDAA 3EBOA 2R5NA 2JJ2A 3V7WA 1RRVA 3ID6C 2F00A 2JI4A 3SC2B 4OYLA 5UKDA 3ZGZA 1MGPA 1WMDA 4JLWA 1A88A 3ITDA 5IDQA 2X0JA 2HHLA 2A5GA 4FSDA 5K9ZA 3JASB 3MLAA 1LPPA 1F2VA 1PU2A 2IDKA 4IL5A 4D1YA 3GCZA 3QPVA 1G2QA 4J29A 2R8RA 4BEJA 2Q2NA 1G21E 5C3MA 4URWR 5GP1A 1KYWA 2GBGA 4GOXA 4PPNA 3G2NA 3VR1A 3Q39A 1EQ2A 4FMPA 2J5BA 2WUWE 3KEOA 1M1NB 3IGFA 1KQPA 1I9CA 2QVXX 4I9FA 4UUBA 4AO8A 1WNTA 1F3OA 2Q41A 3M9XA 2BEJA 4S3MA 4UU1A 5JC1A 2P4SA 1UIMA 1F17A 3F6CA 2P41A 2FEKA 4QM7A 1DU4A 2Q2VA 1CRLA 1ZOOA 3IQHX 2W58A 2YXDA 2OBMA 2V5AA 3M81A 1E6LA 3K9WA 2PX5A 4LTMA 3JQBC 5DXAA 4U6NA 5LQAA 3VPDA 1E5QA 2BONA 3AC0A 2H3HA 1KOGA 4JI1B 3EDOA 4RIEA 5CJ2A 5HQ3A 4WK2B 5IVKA 2BFFB 1FYDA 1TW2A 2QY9A 3MZ0A 4R2IA 2I8CA 4LK3A 4Z86A 1JPNA 5E3JA 1IEVA 2X0RA 2H51A 1E59A 4D9KA 2P2CA 4EA7A 5KYKA 2ZVJA 1PHPA 3U2QA 2CY0A 4RH1A 1O7JA 4HRVA 3R8CA 1CJBA 1U7OA 5EE1A 3R1IA 4G7WA 3C7CB 2I4RA 2BKVA 1L5YA 1JUDA 3WGMA 4AX4A 3OZUA 2O1WA 1RCTE 2VXYA 3JQCA 4EGAA 1B16A 2UZ4A 2AUTA 1Q3TA 3K3PA 4HTAA 4L75A 4ZWNA 4Z5XA 2FKAA 4K7JA 4JROA 1UKBA 1J06A 1PT9A 1R5NA 1E66A 2EGHA 1F7UA 3JZFA 5DLQC 4TMXA 3EA4A 4F4IA 3FW1A 4ALIA 4WZBE 4ZXPA 1EH5A 2ADOA 2XJ9A 2QRGA 3A04A 1FNBA 3KWMA 1U1GA 1U3VA 1YZHA 2ECKA 1ONNA 1VHEA 3BCFA 3FDJA 3LT5A 3P9RA 4U2GA 3G9XA 1Y4DE 3TZCA 4P2GA 4D4HA 2OTCA 4TMFA 3X2FA 4KQCA 3Q9UA 4I1UA 5LM3A 1CULC 1I1HA 2WD9A 3RE1A 1T2AA 5BNIA 4XPIB 3H9NA 3G9QA 4MR8B 4ZVNA 1L5MA 2ZSKA 4CMEC 1Z34A 1CQJA 2H59A 1JH8A 2PK3A 1JG3A 4RORA 3WHPA 1AV7A 3SKBA 1SEVA 2Q50A 3CCCA 3EWSA 3OP4A 4R1MA 5KU7A 2RH5A 5L51A 1CEYA 4X24A 3A2MA 4NZYA 3ZHUA 4F8EA 3H2IA 4ND8B 4BO4A 4YMSA 5CDFA 3FB1A 2J9FA 3MWEB 2Z57A 4J9VA 3MOIA 2DX7A 3ROFA 4CQMD 1FFBA 2CLCX 1CUWA 1JJFA 2C82A 3RC3A 4WK6A 1ZC3A 1ZMRA 2CVZA 1JIIA 3I8SA 4CCWA 2A1UA 4LZNA 1ZI8A 5L3SA 2HJSA 2JIBA 1YWGO 1E9FA 4OGFA 3I12A 5J2TB 1QB8A 4ZYWA 4J0EA 3NUQA 4RJTA 1BFDA 2FVGA 1Q0PA 2PQ6A 4X8LA 1CW2B 1MP0A 1Y1KE 2VYCA 4IUYA 5H9VA 2OXRA 2AH5A 4BNLA 5BO5A 2VJYA 2P9FA 3WQQA 4KO4S 4BFYA 4CFSA 2QSJA 3F49S 1C9MA 4U7HA 3DWIA 3USZA 4R0VA 1TMYA 3E9MA 4EWLA 1KZ6A 2PFGA 3OMXA 1F8GA 2PMFA 4PBTA 2M9MA 2IS2A 4GKKB 3CE9A 1BVYF 2TECE 3VZSA 3R3ZA 4KIFA 3DEJA 3PF8A 2NYRA 2WJGA 1PJCA 2RCYA 4FGWA 2GDJA 1QP4A 3QZUA 4DMHA 1RWMA 1GUZA 4TV8F 5MDHA 3ZH9B 4KR7A 2V7XA 3DTYA 1V4VA 3SSMA 5DHTA 3OLVA 3PSAA 2YNMA 3FYSA 1QWOA 1R50A 3LUCA 4FFNA 4LI0A 6GPBA 1QBGA 5FOXA 4NFHA 1NMEA 1T0UA 2A86A 2R47A 2YS6A 2XT6A 3PA8A 3PRKE 4NABA 3ER8A 1K66A 4NMWA 1KU0A 3ZJ4A 2Q7XA 2VT7A 1AQUA 1T3ZA 4XLZA 4II3A 1W0KD 4BNNA 4HQOA 3ND5A 1XF1A 1DBIA 4EYQA 1YS2X 2C2YA 2WVGA 2FJPA 3GLVA 3ICCA 3S70A 2B37A 4DY4A 1MX5A 3NXSA 1G291 4RGVA 5LQRA 1E2KA 1VPEA 3KPJA 3VPGA 5H4HA 3ONFA 3PUJA 1GCIA 3WHIA 1SBHA 2ZP1A 2WP0A 2W7TA 4HYTA 5FWXB 3QOXA 1ITZA 3HL4A 3GRYA 3R0JA 5JTUA 3NLLA 2ARKA 3FGNA 2ZDGA 2X4IA 3HO6A 2FWAA 2XCIA 4LNAA 1QGAA 4OQYA 5DXJA 4DQVA 2E85A 3FVQA 1WAMA 4P08A 2WQ7A 1V9SA 3PDCA 1IPEA 4G0PA 2A2ZA 3LNTA 5IULC 3VPSA 2WD7A 1CZOA 5EE0A 4KK3A 3VU8A 1EEXB 4XB2A 3L01A 4IBOA 3C0KA 1FXWF 3VSBA 3NBXX 3JQFC 1UWCA 3A32A 4B85A 1RHMA 1IG0A 1IXYA 4F7DA 4JBIA 4RSGA 3WV5A 2NO5A 1P2GA 3AUKA 3MGKA 1ZI6A 1AOXA 1DAMA 2UVPA 3GROA 2Q3MA 4L16A 3W6ZA 4EUHA 4JUAA 2C5FA 3EMVA 2C9YA 3I4LA 3S3TA 3WRVA 2PEYA 3CVUA 5LXTF 2CB0A 3U7IA 3QWFA 4J43A 4CHGA 5IF9A 2BKAA 2FSGA 3JR3A 3CCFA 1W52X 5AM4A 2YRFA 4QPCA 1I18A 4G0NA 3PZBA 1EDOA 1M34B 3UZUA 3I2FA 2XGMA 4ZDKA 4B6EA 2IZOA 3FCEA 2CVHA 3HXTA 3WXBA 1S0UA 2BEWB 2VF7A 1RZUA 1TDJA 3RANA 4YPOA 3RIGA 2AJ8A 2W2KA 2PUHA 1NW4A 1W4ZA 2IP2A 3F9IA 3QVWA 4MYRA 5K4HA 3HCRA 1RTKA 1TAQA 3E1YE 1DADA 4LHSA 1UFOA 3RADC 2ISQA 2I6TA 1T26A 4CU2A 2ZUEA 1UEJA 2P8JA 2ZIWB 3AESB 1HBJA 4K6CA 3CNEA 2P67A 1YUBA 2WYHA 1Y1RA 2ZZFA 3LHKA 1U28A 3TL6A 1ZD8A 4DRYA 1BE1A 6REQB 4OFZA 4Q9KA 2QX4A 2SECE 2QA5A 1X8KA 3C6BA 2JEZA 4CMIB 4CVNA 4EUEA 1NXXA 3D3WA 3OBBA 2ZR9A 3GYGA 1SKYB 2C59A 4M99A 3USCS 3C1AA 4E5YA 2AHRA 2IU4A 4CDRA 5ERYA 2O5EA 4M22A 1E1CB 1Z8FA 3G0GA 1UQRA 5KUTA 4TV9A 4NPHA 1YB5A 2A57A 2XKKA 1M2WA 3W5JA 1KFJB 2XYHA 3IS3A 1ZFNA 1NAHA 2OGSA 5HXAA 3SSOA 4ACAA 1Z13A 5FHQA 4RDCA 4LMPA 2ZTNA 4GBMA 3KV3O 1ZM4A 1U0OC 1LXCA 2I2BA 2ZDHA 2GAOA 3E03A 4JLUA 4JSTA 1PK9A 3TQCA 1UH5A 4YJ2B 5CA1F 1KJYA 2X5XA 2AZMA 4J9UE 4IGEA 4XGNA 4NCAA 4ITRC 2FZEA 4FQ5A 4B4KA 1E1KA 3M33A 5E6SB 1HL3A 3ADPA 1UT6A 3VR0A 3D2CA 2GHRA 1KZ7B 2VDKB 4QG7A 4XDZA 3D6AA 4M1KA 3D8NA 3CLUD 3EMDA 3MJCA 1RZRD 2XECA 5COQA 4CF5A 4PLYA 2A88A 4N41A 1ZITA 2HHAA 4QOIA 1H1LB 2J09A 2QT9A 1RQ7A 4QPDA 5FI1B 3UG6A 5BV7A 2HO4A 2QDKA 4URXR 1LU9A 2GPSA 3ESXA 5EYPA 2I3AA 4FYHA 1GGEA 3D0QA 4FX2A 1VMKA 3H9UA 1AS0A 2DWPA 1D3AA 1AUQA 4P9SA 1ZKMA 4R6WA 3KFVA 5LP6C 4ZGWA 4PC7A 3NHLA 3P4XA 3VPXA 3ZLJA 4L8LA 3CX6A 3WY9A 2PMCA 4ZT7A 2VSOA 4C7KA 3BWYA 3K70C 5JFGA 5E3HA 3WMGA 1UL1X 1QPBA 2VH1A 2VPPA 4HX2A 2JFUA 4RTRA 2HBRA 4Y2SA 3V4ZA 4JT2A 4JMPA 1L6RA 2X5NA 3MMZA 2IXGA 2NVUB 4IZOA 2QTZA 1A0OA 2WJ3A 1QQ7A 3T7DA 1FXSA 4FMDB 3SDBA 4KH1A 4C0LA 1Z16A 1V9CA 3EPRA 4R8LA 1VCMA 2XT9A 2RGCA 1WF3A 3INNA 1H0HA 3E53A 1PJ2A 3V8PA 1Y1QA 1ULTA 2GS9A 3DBRB 3IA7A 3L8HA 5CX1B 5JASA 5CCXA 4GRDA 2IS4A 2TRSB 1U7TA 2WNIA 4JODA 1JR3E 2C96A 1Z2PX 1WO8A 3SZ3A 1N1GA 2RHDA 2H9AA 2ZYIA 3BXPA 3OOYA 2F43A 3SLKA 1BXZA 1DS6A 2GN2A 4NRDA 2QRQA 4DLAA 4I8XA 4OP2A 2OYSA 1FP2A 2GT1A 3GJ3A 3PUMA 4EA6A 1U0BB 3PEEA 3LU1A 3PXAA 3CB4A 3GXBA 5E9QA 3W6PA 1SB9A 1HGXA 1WZCA 2RKWA 1DELA 2Y1OA 1JLRA 4EG5A 3MK31 1K0FA 1OXUA 2AI3A 3Q6NA 5DHAA 3WGVA 2R1VA 5LB2A 3UV3A 1SZCA 3IR6A 2EZ4A 5GZ3A 2J0UB 1EVJA 3OC0A 2CFTA 1JALA 4AKTA 4MUYA 2PSEA 4N01A 4ZO4A 2AUMA 2HK6A 3WGOA 1W59A 1X1CA 1SC9A 2HPZA 3NG1A 1UD8A 1LDYA 5ALIA 4B2YA 1SR8A 3O92A 3C43A 3CVXA 4UHHA 3PUVA 5CM9C 1F5NA 1MX3A 3I52A 3V48A 4RCVA 4QUHA 4Z1OA 3TAUA 4G07A 3JVEA 1FLAA 1KIMA 1OFUA 2BGUA 3CLHA 3PFHA 3F90A 4X00A 3DLBA 2JK0A 4RHYA 1WB6A 3X2EA 4BWVA 3V9AA 4HB2A 3OPXA 3BKXA 1WPQA 1XAJA 4UBLA 1P1CA 3DV9A 3D7RA 4WPGA 10MHA 3GJ4A 3IAEA 2HV9A 4PPGA 1HH4A 4K03A 1M7HA 1NF9A 2XQJA 2ZRQA 3NM4A 1EDDA 1I2CA 2CNBA 4WHMA 3VM6A 5HVNA 2PLAA 3DAYA 4G36A 2JHPA 4HF7A 3OQNA 2GPWA 2WSMA 1PSZA 3MB5A 3N0RA 4I5IA 2PLNA 4MKXA 1R0YA 3W5DA 1LTQA 1Z29A 4F2WA 1OKKD 3HHEA 1KI6B 1MXHA 1SNYA 2OCXA 1B00A 2PR7A 2R66A 1GTZA 3AMVA 2VHXA 3C97A 3HZRA 3L0PA 2R44A 1OHHD 4QPPA 5BR4A 3ZHSA 1D5CA 4N3AA 2UUPA 1DKUA 1A9PA 1BXGB 2JH9A 3ECAA 2Q8PA 2ZYHA 4EA9A 1U8YA 3HDGA 4ND1A 1MBZA 4HFJA 4PLTA 1O5TA 2VQDA 4PX5A 2X0NA 4LCBA 3GGCA 1UZLA 2H07A 3BSWA 3IBCA 4AMZA 3ETJA 3LGXA 3RCBA 1E18A 1DMSA 2QUHA 5ETJA 3ZI7A 3CCMB 1ZGAA 2VHJA 2VSYA 1ST2A 4WXYB 4I8DA 5BMOA 1CS4C 1UJMA 2G9UA 2G40A 1VHWA 3VH4A 2QTRA 1L7PA 1DKOA 3LT0A 5LP6B 4I3GA 1H8EA 1WV0A 1D09A 1XX6A 3B8HA 1Y8RB 2DUMA 1QFSA 3FAZA 4ZI7A 4YXWD 5JAHA 3K70B 1Y80A 4OYRA 2OQVA 5ARBA 5JD4A 1UKAA 4BZZA 1DAPA 3KKPA 4MDEA 1I3OA 2R96A 1M6VA 4IIDA 2QAGB 2ANBA 2YW2A 4LQDA 1Z17A 4Y2VA 3DH0A 5DGHA 2JG3A 4DIKA 3C5CA 2Z56A 1SUCA 5BW4A 5FLYA 3OEYA 2HSEA 1WBDA 4R71A 4TVKA 3FYTA 3VPHA 1CC1S 2O9JA 1T25A 4HSEA 5A5EA 5EL0A 2XZPA 3IRVA 2VPYA 3H2ZA 4EI2A 3IXQA 5D3QA 5K3FA 3SS9X 3TTWA 3BY2A 1U0NA 2FGKA 4JBWA 2CFOA 1N0HA 1QMGA 3IVAA 5LWQA 2W6QA 5CVTA 1YXMA 3VUFA 1ZMTA 2EZUA 4U2FA 3JSXA 3QU9A 4XCXA 5KYUA 4MIEA 5K0ZA 1JJVA 2BFMA 1ORWA 3DKPA 3G85A 1VSUA 3AONB 4U9IS 4IIXA 4OVKA 5D51S 4HIZA 4OMCA 3SKVA 1Y6GA 3BCSA 4WLUA 1ZNQO 3HUDA 3AV0B 1W2BB 1R5OA 1F2TA 3FWHA 4QYWA 4BLSA 1AKMA 4DXHA 1N78A 1A97A 4HX5A 4YRNA 3A6PC 2I6QA 2ZK7A 2DFNA 4PQGA 3W4JA 2FMIA 4F46A 1SXJC 3KDPA 2AYXA 1MHTA 3K6SA 4YEJA 2QZPA 3D3NA 3GLTA 1TUEA 2MDTA 3PFBA 5EZYA 3BMXA 4MZDA 4B3SB 3K0HA 3T5MA 1JBEA 4RD0A 3OM1A 4RMNA 4E4RA 3RABA 4ZGNB 2FEOA 4HZIA 1RYEA 1E9RA 1T0JB 2XEDA 3KKEA 3FPGA 3H3XA 2GH1A 4LECA 4E08A 3TFOA 1K8YB 3KLPX 1YHNA 1UMCB 2AV6A 1NXQA 4DJJA 4G9GA 1XQXA 1GUAA 1U6IA 2IXBA 5KTMA 4AJ1A 4PINA 1US8B 4WNIA 1E5VA 1VQMB 4XYLA 1Z0SA 4JI6B 3N28A 4DREA 2PUJA 3ZW8A 4FHFA 2JGDA 2JVKA 2OBBA 1TW3A 1EFUA 1E5LA 1T43A 2BHTA 3CEPB 3LS2A 4CRWB 4RF5A 1TI7A 5DXFA 1EFCA 3L7YA 2DBVO 3DS8A 4J7XA 1BVUA 1V2GA 5BYAA 2CHGA 3FIUA 2VF8A 4X85A 5M34A 1W0JD 5H70A 5J35A 1OASA 4KPUB 2NP6A 5DYTA 4GR4A 4RJKA 5LJIA 3BF8A 3HLKA 3AI7A 1T13A 3JQAD 2PKQO 5HQTA 3WRYA 4HADA 8GPBA 1M2KA 3UMFA 1PYOA 4M6WB 4IRUB 4MGZR 1I1NA 2BIFA 4P2NA 3KVOA 1CBUA 2JHCA 3B6IA 4TS4A 1YB7A 1D2GA 1H2FA 3RUPA 4KIUA 3QBEA 1X1RA 2BWJA 5SICE 2RD2A 4BXOA 1KFCB 1PT5A 1EWTA 1ETHA 2QLNA 3QF7A 4GYKA 4L5CA 3QLVA 4GZ5A 1HOTA 4O5OA 4MVJD 4CUZA 1HM5A 2C03A 3U7FB 3WFZA 3GJ0A 4K46A 3FOEC 5YASA 1QVWA 2ZTUA 3OAAD 4YQEA 2GVZC 3MAJA 4FOPA 4KAAA 4YJDA 4YRLA 2MSNA 1MOPA 2WW8A 5LLTA 4AI6A 3HPRA 2W42A 1B14A 3L0OA 4K6KA 4Y6QA 1M8JA 1WXIA 4RTMA 1OH6A 1ZK3A 3PLRA 3HKEB 2COEA 3L82B 4CV2A 4XD7D 2Y05A 2JC3A 5IJWA 4LF9B 3NDBB 4JT9A 3A37A 1M2VA 3FSRA 2X9VA 2XWBF 4ZCIA 1AT1A 1XTTA 4E2WA 1XF9A 4FFBB 2RGBA 1B8VA 2VNAA 4JLJA 1E1NA 2V6BA 1BQ4A 1XN4A 3NHMA 3S1SA 3UGKA 2YHAA 4YRIA 1W1IA 1DAOA 1YJNB 5BQ3A 2R751 1NW6A 1LKZA 1VL8A 3NAZA 4FZRA 3ANMA 1JYSA 3MWGA 3ZQUA 1NYRA 3CN7A 3G5UA 3DLIA 4G9EA 3EZLA 3O82A 1QFYA 1EGAA 4LRTB 4RM2A 1PEDA 5AVYA 4R9UC 3GFSA 1CZUA 1LTHR 2NPOA 3D8TA 4B09A 1JKJB 4BNZA 1NVVQ 1WCWA 4DZZA 1XMXA 3H75A 2QUZA 2EJBA 2H57A 4Y6LA 4P26A 1GFIA 2EW1A 3O8BA 4HNHA 2HF8A 3B38A 4B8WA 1GYQA 4CFYA 4WNYA 2WQ6A 5IH7A 2CV1A 1DKMA 5AUOB 1CR2A 3TE6A 4CQMB 3Q5EA 1XKLA 1O96A 3GFTA 4PCAA 2RH9B 3IEKA 5L3VA 1EMDA 2FOLA 3NXKA 4XIYA 2AEJA 2CUZA 3TSOA 4D4LA 2D3NA 3R5HA 5ALZA 1VHLA 3FHTA 1K4KA 1QH1B 1MV8A 4O4LB 4FWBA 4OAQA 4YNBA 3ZIDA 3UQZA 4QRDA 1E2PA 2B8TA 4KX5A 1H8HA 2FRDC 3HB7A 3O7WA 4Q4JA 4B1FA 5DISB 4CKCB 1KQGA 1CQPA 1NU6A 4Y2HA 1EYZA 2C29D 1LEHA 1NJSA 2G88A 2GBPA 2ZJ6A 3EQ2A 1U98A 3WKDA 3AIIA 5H81A 1ZH4A 1Z3CA 2VNHA 4KIWA 2G80A 4NLLA 3TR0A 5J2UA 1O8BA 1W4CA 4GKAA 4G1BA 2AWNA 2QXTA 2I54A 3Q3VA 2VDWA 4MKGA 4AZ3A 4D99A 3OHPA 4JSYA 3R9IA 2VH2A 3DQZA 3HP1A 3RF7A 4NP6A 1P33A 4AP9A 3HVRA 2P78A 2GREA 2W83A 4RZIA 2GEBA 2OCYC 2HA2A 1HG0A 3DZKA 4ND5A 5DHSA 3FZNA 3FR7A 4UFPA 4F06A 4FXOA 5JI3E 3F4LA 4RQTA 3FMOB 2J5QA 5AVZA 4LSZA 5AOAA 4BFZA 3ZGNA 4YRTA 1W5SA 3F6YA 3RAJA 2NGRA 4BV2A 4EHNA 5BW8A 2OVBA 5FNVB 2V7UA 3U4GA 1ISHA 2YWJA 3GRPA 3JQ6A 1VXRA 1XQ1A 2FXVA 5IKMA 4LNUA 1L8XA 2D3WA 4MVWA 1UZAA 1LQ2A 4AF6A 4AF7A 3HVUA 2Q9BA 3RAGA 4CLXA 4DIDA 1QGDA 5BUSA 4Q16A 3CLUC 1YJQA 4AZ3B 4F5ZA 1RJDA 1EFTA 1SCQA 2VUSA 3AJEA 5EHZA 2WUGA 4FGSA 3LLVA 4H60A 4YYZA 2ZRHA 1UJNA 4DQLA 5B36A 5H80A 3R3UA 1FDWA 1TK2A 1IBLB 1KPIA 1ZQ1A 4UPVA 3TRHA 1T4DA 4DMFA 3G1WA 1WP6A 5TVKA 1R6AA 5C8YA 4C7OB 2H5EA 4LDJA 3I09A 4OGLA 4OTZA 1NI4B 1CQWA 3STUA 1J0EA 2BBTA 2ZCVA 3GUHA 1PLLA 4G0YA 2CXNA 5EWJA 5G3ZA 4G5GA 3ZD6A 2B1QA 1TGVA 2Y0CA 4R3NA 4MQMA 4R8VA 1DKPA 2POQX 4WZAE 4DC9A 5K3EA 5IBCA 2E87A 4IH9A 2CLIB 1IRIA 3LFHA 1ZMXA 2KVOA 2R62A 1B2LA 3N75A 2Z4TA 4BVBA 4G2NA 1S3FA 4AZTA 5HGXA 3IHWA 3OOHA 4Z53A 4GP9A 4AKGA 4FS3A 1EVQA 1Y48E 1P2DA 1T15A 4BMOB 1L1QA 3X3HA 4FGUA 1XRSB 3ASZA 1AMNA 2EWMA 3TZKA 1X8JA 2HA7A 3BE5A 4HDAA 3ZX4A 1N3IA 2IQ5A 3NGLA 4PRLA 4ROSA 1U3UA 5DYWA 4CL0A 1P45A 1U31A 2XNCA 4I55F 1JKIA 2WHRA 3N3AC 3BICA 4NV0A 4YQYA 5FBRB 3VX4A 1QKIA 4JWTA 1HQYE 1W93A 5FR1A 3JQPA 4ROXA 1ZQ9A 1V45E 2E89A 3GJQA 1M5RA 3H0KA 1BCSB 1RADA 4BBPA 4GM4A 2PUCA 3TKAA 3SQMA 1LBHA 1I30A 3T35A 1D0SA 4GEKA 5K45A 4XX1A 1M6WA 1Z38A 5DLPA 1MW9X 3KQWA 1L1FA 4BDSA 5JR3A 5C8VA 1DWQA 1VYTA 2FMUA 2KWIA 4IH1A 4MJXA 3VKVA 1TE2A 3UMGA 3DOFA 3UHAA 3FTFA 1ULBA 3DJFA 2FEWB 3H1FA 3AGPA 1S1CA 3RUHA 1T0IA 2D13A 2O50A 4MPRA 4PSKA 4KNYA 4Z1MA 2G17A 3IJEB 5K0EA 3MGCA 1JA9A 2AC4A 2HFKA 3FFAA 1E2GA 5DBHX 1F48A 4WOKA 1XJCA 1UD2A 2ES4A 2C3YA 1F14A 3CUKA 3NWEA 3EW9A 4HUTA 2ERXA 3WS7A 5SYMA 2W8BA 2GEUA 2L82A 3AR6A 5ALKA 1YITB 1QR6A 2VYVA 4U7WA 1HE5A 1JA1A 2G08A 2YMMA 2X0DA 5IXYA 1ISRA 1O58A 1ZSNA 2QJTA 2R6DA 2ZTLA 2O6HA 1II8A 3AHDA 3OOWA 4YROA 1L8LA 3PFWO 1IG3A 4LPSA 2O8VA 3JZAA 4MH0R 5AT1A 3B2EA 4UEOA 4WRRA 4W7HA 3NBMA 3BB4A 4QYMA 2OHJA 1IUKA 3KZXA 3RT9A 1YQ9A 2DPYA 4FVTA 4ENRA 5BV2P 5CPBA 3DCIA 2X8AA 3BB1A 2EGUA 1XMIA 3HJBA 4MDFA 3ZKAA 3NKFA 3EUWA 3QXHA 3IQIX 3QXSA 4HBGA 4W7SA 3UN1A 1CS0A 1UK8A 4ID3A 2VDOB 4V38A 1NVMB 3UWDA 3ANTA 4JNKA 3GLGE 1KRWA 4B31A 1H4TA 1KJNA 3ZWOA 4GOOD 4OPMA 4CMKA 1PD0A 4FFSA 4RY2A 4PYKA 5EMJA 1UOPA 3AKEA 1UIRA 1WVIA 3L7OA 4V0KA 3ZE2B 2QLLA 3FUWA 4LA4A 1M2OA 1VLMA 2FHSA 3QPUA 3KJFA 4JP3A 3ZI0A 4CNQA 3PWKA 3IV6A 4OHZA 1NFQA 3CR8A 2CLSA 1C9DB 4ER3A 3CRZA 2OR3A 3WL8A 4BNGA 2QT1A 4JELA 5DBIA 5HIMA 2G7ZA 2J9XB 5ALWA 4YV1A 4IDAA 2HBQA 3F5SA 4NWIA 3U3JA 1HLDA 2ANCA 3A36A 5DNYB 2Z6QA 4NNOA 1YKFA 1WM1A 2I6UA 3LRXA 4L8VA 4DT1B 5K0CA 2YKGA 3E35A 5JPCA 4X1IA 1JDVA 1VBKA 4F1JA 1W44A 3P45A 1IY9A 1I2BA 1I51A 3IP1A 5LQDA 2O8FB 1IN7A 1RI3A 4NQZA 4DMMA 1S8OA 4GPAA 3G0DA 1X1DA 1DZ3A 3L7JA 4B3BA 821PA 2RK3A 2XXAA 4Z9AA 4D0RA 3BJZ