2PMDA

The structures of aif2gamma subunit from the archaeon sulfolobus solfataricus in the gdp-bound form.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Insights into the Interactions of the Translation Initiation Factor 2 from Archaea with Guanine Nucleotides and Initiator tRNA.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
total genus 93
structure length 414
sequence length 414
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2pmdA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2pmdA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2pmdA01
3LW7A 4BFVA 2XJ9A 4D81A 2ONJA 2KJQA 4CRWB 1LS6A 1JR3E 3LQRA 1RIFA 5FTLA 5FOWA 1HT2E 4Z8YA 2VNIA 3G0HA 1EFRD 2CMKA 1NLYA 2NO7A 3RABA 3QFCA 2P6UA 2ZTSA 5F98A 4Q48A 1S1CA 3HU3A 3UK6A 5K8UA 1QRAA 4FMCF 2HYIC 3VU9B 4GI7A 3HU2A 4OBEA 1VDZA 3R8FA 2A7QA 2BGIA 5EE1A 2IEZA 5HR5A 4KBFA 2A5FA 5G3ZA 3SE0A 4EIWA 4RJLA 1QHIA 4ZIRB 3ZD7A 2FSIA 4V0NA 4PO8A 2ORIA 4UAJA 1FNDA 1EWYA 1KI7A 1VIYA 1VHLA 4PPFA 4TLBA 2V1XA 1NN1A 2Z4SA 2AWOA 2BHRA 2VP4A 1NVVR 1DAMA 3FFAA 3QY0A 2UZ3A 2HF9A 4G5OA 4AKHA 3U7GA 1XTKA 2J3EA 1LFDB 4LJ5A 2CNWA 3ZH9B 4MGZR 4KSBA 4URVR 4CT5A 4Q1FA 2GAAA 4BQSA 3PQCA 4QHTA 5FTKA 4JVNA 2GF0A 3SNHA 1W5TA 3SYNA 1ZIOA 3VNVA 3HJNA 3BC1A 1J99A 3FGNA 1GTVA 1U98A 4DCVA 2ZI3A 3RC3A 4WVFA 5E7IA 2ZJAA 2FF7A 2VNHA 2ZE7A 1WE2A 2VL7A 4Q4AA 4CGZA 2QG6A 3KKNA 2SHKA 3L8ZA 1W2GA 4CZ2A 1RPZA 1SVIA 2CNWD 2PCLA 3IBGA 3DKVA 3WHLA 1W2HA 3QE0A 4OYHA 3I8SA 4MDFA 3AEZA 4KSCA 3OFND 1G20E 4MKHA 4PQRA 3RS3A 2PX3A 4M21A 1TUIA 1QHNA 1AMOA 2BMJA 2N42A 3UANA 5LB4A 2IYVA 4A8JB 1VCOA 1RFLA 2WJHA 5EJEA 4LV6A 1G4AE 1GIAA 1OFUX 4YXWA 4BWYA 4OHZA 1DAEA 4KFTA 2OK7A 4IXNA 3PVSA 1ZU4A 2EW1A 5CIQA 2O5VA 3TKLA 2IUTA 1OKKD 1Q1ZA 3ND9A 4A82A 4DT1B 4DUGA 4K81B 2IUSA 3LA6A 4XWKA 1J8YF 5GJWC 3WRXC 4Z51A 1W36C 2J7PD 5H5JA 1Q57A 3Q3JB 2OFWA 3CCLB 1OH8A 3CD6B 1Z83A 3LBHA 1M6NA 3Q5EA 2JATA 2WWXA 4B33A 1E6CA 3NG1A 5JJIA 5FBLB 1CJUC 4IEEA 1P75A 3QVUA 4BFZA 2GJSA 4LV5B 3TBKA 3WHKA 5JJLA 2A5JA 4BLTA 1E9BA 4L16A 3AF2A 1XXHA 1Z5ZA 1BIFA 3PEYA 5G3YA 3GJ8A 4L15A 2CCKA 1N6HA 3C41J 5EP1A 4AF6A 3KQKA 3QENA 2J7PA 3QIAA 4Q7KA 1VG9B 1X8LA 4DEXA 5FBVB 4S35A 4EUNA 1SVSA 2VP0A 1GUAA 2QE7A 2WVJA 2ZRCA 5K8IA 1GAQA 2XZPA 3FFBA 4B3DA 3U2QA 3D31A 1QG2A 1FNMA 1LB1B 3AVPA 2J1LA 4P3YA 1NLZA 3E1SA 4IHQA 3W3ZB 1LS1A 5EXPA 1E9RA 1NMXA 4GL2A 1E2HA 1I7PA 4RY2A 4PO1A 5JEEA 2A78A 4YHBA 1OW3B 4XVRA 2IS4A 2VHCA 3B9QA 4CVNA 1PV4A 5FUVA 4B3XA 3U3KA 4B73A 2VH5R 1N25A 4ZPXA 5FL7A 4DCSA 2XITA 5FBWB 4Q00A 4UXIA 4D6PA 1TL7C 4Q7JB 3OIUA 1RVDA 4C2UA 2O8CB 3NIBA 4O2LA 3FHOA 4LHXA 5SZHB 4P0TA 4BFXA 5GV8A 4LBZA 2J46A 2X8AA 3SU8A 3CO5A 4HAXA 1D2MA 2QM8A 5BN3A 2GILA 2W6ID 3B2EA 3EWAA 4ZDWA 3ZDQA 1JJ7A 4BE7B 3FDIA 3B9PA 3KQHA 1MABA 1NKTA 5H1YA 2WWHA 3SJZA 4R9UC 3ZQ6A 1DVRA 4B2IA 3GLIA 1XEWY 4FCWA 3LDAA 1Q82D 1ZM4A 4PX9A 4DCUA 5JRZA 5FTNA 3K0AB 5EE5B 5KSYA 2CDNA 1HH4A 4XOIA 4CEHB 2IC5A 3CPWB 5C46F 3PFIA 4DSUA 4XTRA 4LYFA 5CK4A 4HLUC 1FRQA 4D4JA 1E1RA 1KI2A 4TZ0A 5FPYA 2V54A 2IF0A 1YZQA 1ANKA 2R9VA 4P4SB 4P32A 2FSFA 3E70C 5CYOA 4F93B 2W2XA 1HA3A 1VCNA 3KTAB 4QGAA 5J5CA 1RJ9B 4ESVA 2H57A 4D4LA 4ZI3A 2PT7A 3ZD6A 1WRBA 4MYTA 2A9KA 2B5OA 2H7VA 2QQEA 4RD6A 1ZM3A 5C4GB 1T5LA 3UMSA 5AUNB 1KQSB 2IYTA 2RGDA 1S3GA 2IX3A 2BCJQ 1XDBA 2AWNA 2UZIR 2ZIAA 3CNNA 1GO2A 2CE2X 3NH9A 5FOXA 1S72B 3B78A 3CRZA 4AC9A 1KJYA 5J40A 5JSZB 3KQNA 1BQEA 2FNAA 4U9UA 1XNJA 4Q9HA 2REXB 3JZMA 4A36A 1ZNXA 2ZYTX 5GV7A 2XSZA 3ZIAA 3U7HB 1KO4A 1ZBDA 4W5WA 3U61B 3X1WA 4EPTA 4N3NA 3KFXA 4YAOA 5G40A 4GP6A 4R2HA 2RCNA 3ZVRA 5FTMA 4PQFA 1NJGA 1OV4A 5FL7D 2I3BA 1IHUA 1CTQA 3QG1A 1WF3A 2XXAB 1X8KA 2N1BA 2Z0MA 3BB1A 4A6PA 1EP1B 1Q12A 2C03A 1DAKA 3DZ8A 4PO9A 2N46A 4I1VA 4HLQB 2ZUDA 5AJWA 4ZDKA 3L8YA 2EFHB 2A30A 4OQNA 4Q4HB 2AKYA 1ZD1A 2F3TA 2J87A 4PC3A 2VHUA 1OB5A 1CNFA 2CVFA 2A2ZA 2P5SA 4KODA 4QXAA 1VYVA 4YDSA 2QMOA 5FOSA 3NEJA 4E07A 3DL0A 3C16C 1GRQA 2OT3B 2VZLA 4R7ZA 1GJRA 1N6RA 1DTSA 5EUMA 4A0GA 1NMZA 1GFIA 5HPYB 1ZUIA 4XD7D 2OAQ1 4YAWA 1ZNYA 3UMRA 4LYAA 5CK5A 3BB3A 3QKRB 4L9SA 4RZXA 3DOFA 1VIAA 1XTRA 3W5JA 1DADA 4RVCA 2P6RA 1XRJA 3NHBA 3WY9A 2IYZA 2GCOA 4AF7A 1NBMD 4DXAA 4RZ2A 1ZW6A 3T34A 4D0NA 1GL7A 1LVGA 5EMNA 1JECA 2RGNA 3KTAA 2PLFA 1HQCA 3W5VA 2O52A 1Z2AA 421PA 4QJ5A 3AF4A 3C15C 4EDHA 1SGWA 3TUJC 4QKQA 4F7WA 4WW0A 1Q20A 5EQTA 2VBCA 5CDFE 1S9HA 2MSEB 2RAPA 1LF0A 3CIOA 3B7GA 2ERYA 4LBWA 3CZQA 1IOZA 4G1VA 4M1WA 3SJBA 4TLCA 4XVQA 5DI3B 1VTKA 3HU1A 2PEYA 1T4GA 1KGDA 4NYMR 5JHGB 1KI4A 3H4MA 2MMCA 1Q86D 1PJRA 2X2FA 3WNDA 3KUDA 3MAAC 4C4PA 5KHOC 2BBOA 1RC8A 1KDTA 1I4LD 1HT1E 4RD0A 1NP6A 3SEAA 5HCNA 2JAQA 2TMKA 3GLFE 2NG1A 2YYZA 2F55A 3W6OA 4JYBA 1NN3A 2IXFA 3CPJB 5FOVA 2NPIA 5LD2C 1QUEA 1JA1A 5KDOA 3CC4B 1O87A 2OE2A 2GPJA 1DBSA 4B32A 3ZS9A 4E09A 4B3BA 4HZUA 2XNSA 5TV2A 2BMFA 1CU1A 1EFHA 1IXZA 1P72A 1Z0IA 3LAWA 4GT1A 1W2BB 5ELXA 4Q1BA 1G3MA 1VQMB 3QQ5A 4URUR 5JHHB 3CXCB 2C8VA 1GVHA 1COWA 4FCVA 4UNSA 2F1HA 1AZTA 4PPGA 2OM2A 1N6LA 4YALA 3C7KA 3ZQJA 4A9AA 3BFVA 1XEXB 1FDRA 3I4LA 2YWHA 1ZNWA 5L3SB 3B1WA 3VKHA 2J0UB 4CW7A 4XVUA 4IW3B 2LCFA 1CIPA 4F38A 3UG7A 1II0A 1Q3TA 4OK5A 2ZUCA 1KSGA 2WTUA 4WXRA 1YE8A 5BN4A 1UBGA 1JA0A 2ZPTX 3H86A 4Q47A 1J2JA 3K9HA 2CHGA 3QXSA 3MSXA 3RDPA 4Q21A 2VLIA 1J90A 1NLFA 1XBTA 2R65A 4A2WA 3QPVA 1AKYA 3UG6A 1H42A 1NBMA 2ZSEA 1KI1A 2ZJ8A 1UKVY 1X1RA 2PCJA 3E5HA 3OJWA 2VNKA 3QSYA 1DO0A 2FWRA 3U44B 1XJCA 4AYWA 5JLJA 2E87A 1R0WA 1FFHA 1SXJE 1E2DA 1M7HA 1CJMA 4NYJQ 4Q4JB 5SZIA 4DSNA 1MR3F 4DDTA 4AYXA 5BYKA 4YMWA 5BYJA 1QUFA 3LLMA 4JLOA 4EPYA 4CYMA 1E64A 2CHQA 4YAFA 3TVDA 2WIAA 5DI3A 1KK1A 4M4SA 3IILA 1VCMA 3CW2A 1AGPA 4KCGA 2QP3A 4PHTA 3GLHB 5FBRB 5SZJA 1WP9A 5CM9C 4EFLA 1A2BA 3AB3A 2QTFA 4LJ7A 2B7BA 1OXVA 3ZZ0A 2QMEA 2JJ8A 3P32A 4JSYA 4YONB 4B2PA 1U9IC 1NJID 1HQYE 2IWRA 4UKDA 1M34E 4HLDA 1KK0A 2H18A 3L43A 3H0KA 1TU3A 1TUEA 1MH1A 4M0LA 3IQWA 3FOZA 1Z0JA 2JASA 5AUOB 4AG6A 2GK7A 4KLZA 1VG1A 2DWQA 1F2UA 3THYB 4HAUA 4HLCA 4R2IA 5IK2D 1H8EA 2QSZA 2IS6A 2IEYA 1TEXA 5B57C 2XTNA 3REFA 2CL0X 2D06A 3NDPA 4CDGA 1Z6YA 1LNZA 3GJ7A 3QFTA 1EWQA 3OIWA 1P73A 1F6BA 1XTQA 2BOVA 3EIQA 2QMUA 1YZTA 2ATXA 3K09A 1OFHA 1MO5A 1OXXK 3HDTA 2O8FB 2J0UA 2RGXA 3T12A 3QKUA 4C0SA 3K9GA 3RSOA 2BMDA 4MKGA 2W00A 3MD0A 2D62A 3O8CA 2O8BB 2BM1A 3EPKA 1FL9A 4BFWA 1X3SA 3D6TB 1Q22A 3B8HA 3AH8A 2O8BA 3EZFA 4ASUA 3FHCB 2NO0A 2ZI4A 1ZUNB 3PCRB 1TQ4A 1IB0A 1Z07A 3C14C 3V00A 1G3RA 4PC6A 3V4FA 4E22A 1JBKA 2C98A 3VTKA 4KVAA 4LJAA 3GFOA 2ZRLA 2A5GA 2QPOA 2EIXA 3NKVA 4OL0A 1VYUA 5FL3A 2DPXA 1Z0KA 1N5LA 2VP9A 2OG2A 4HYYA 4DDUA 1E1QD 1E9CA 2RC5A 1G7TA 1R8QA 3NVAA 3WBJA 1RKBA 1R10A 5HZHA 3VFDA 1YR8A 2ZRDA 3T1TA 3MWLA 4NTZA 3AKDA 1G7SA 4DBLC 3EWSA 1GM5A 2VHTA 4MDEA 1QH0A 1G21E 3PUXA 4ZIRA 2H8KA 1KI3A 5KU1A 2E1RA 1UDXA 2WBLC 2RGCA 3QKSB 5HE9A 5DN6D 4GPTA 2GZHA 5GADl 1NN5A 2ZRNA 3D8BA 2NO1A 2G1JA 3PEWA 3VKGA 1UPTA 2IYLD 1TU4A 2ZYUX 1RRGA 3RS4A 1U8AA 4OQMA 1Y3AA 3EG5A 1F2UB 2KI5A 4NYJR 4RZ3A 1P7CA 3THYA 4WBSA 3T61A 3GLFB 2B21A 1FW6A 3W6NA 2BBSA 2FPMA 1KNXA 2QSYA 1OHHA 1XWIA 2ZUBA 2V7QD 4B75A 3SI7A 3VR5A 4C0QC 4LHWA 2IF2A 4LZZA 3I62A 5AJVB 4B47A 5FTJA 3NC0C 5FUYA 5KO2A 2ZJ5A 2BKUA 1W0KA 2ODBA 2JJ2D 4II7A 3ZC3A 2BGJA 2C9CA 2Z43A 1FX0B 1KJWA 3IQXA 2ZVQX 4JLJA 1K6MA 2QRZA 2DETA 4JBWA 4QJ3A 5B64A 3QF7A 4BUJA 1CULC 4GMDA 2OTJB 2IBMA 2WV9A 2CL7X 3U6BA 3B5JA 5KNDA 5JFGA 1I2MA 4MKFA 3DO6A 4P4UA 3KFVA 3VO1A 1CJKC 2YINC 2QL6A 2ZI6A 3B1YA 1G6OA 4EPVA 1SXJD 4OK6A 1AN0A 2NO9A 4WAUA 5B2ZA 1ZU5A 4GOXA 1ZIPA 1VCIA 3SHFA 2PZEA 4TL9A 3S1AB 4U5XA 4WZ6A 4IDPA 1M8PA 3IKJA 2BMWA 4TTQA 3B13B 1MKYA 3S1AA 4IDOA 3VR4A 2ZXUA 1AJEA 3LO8A 1COWD 3B60A 1U0HC 1DEKA 2NOAA 1KTVA 4EAQA 4B76A 4BFSA 2DY1A 2WPDA 1N8RD 2HXYA 2ZJBA 3AKCA 1CQXA 2W6JD 3OW2B 1E1QA 3TGPA 4V02A 1Q1QA 4EPXA 1YIJB 3OZWA 3Q8XB 1SXJB 2NQ2C 4NMMA 4MUBA 3A1TA 1VMAA 1G3IA 3AVVA 1Z29A 4P33A 2Q9AA 1BH2A 1EP2B 2JIZA 1KK2A 3LH5A 4QOSA 3T5DA 4L9WA 3E2IA 1OJLA 3RRMA 5G53C 3U6KA 1NVVQ 2B8WA 2C2HA 4ILEA 4LX0A 4BEBA 4DSOA 5JSZA 1YZUA 1KI6A 4F7DA 4TN1A 2RGBA 5JS7A 1W5SA 1G9XA 3ICQB 1I4TD 3P27A 1E1RD 1EESA 2D2FA 3U4QA 4IFBA 4TMZA 1SVLA 4IVQA 4TYYA 1E69A 2ZSBA 4G1BA 3GEEA 1T3SA 2V7QA 3PEVA 4NE2A 4FXPA 2WOOA 2QBYA 1GILA 1OXTA 1UDWA 3A1WA 3KXIA 4WIAA 3U4QB 1G291 2V3CC 2QM7A 121PA 3GP8A 1T9HA 2OUKA 4M1YA 1VG0B 1T5IA 2Q3HA 1IXRC 2ZE5A 3VR2A 4Q7MB 3AGQA 3M4YA 2V6IA 2DFNA 4ZGNB 2O0HA 4PC2A 1T0JB 4D0LB 4M1MA 4ARZA 1JPNA 4BZPA 3FMFA 3VHLB 4C0AC 4D80A 3E20A 2ZRIA 3CWQA 4DLZA 2JLUA 1JJVA 3NBYC 1ZD9A 1W47A 4FK8A 1NMYA 5KUTA 3CPHA 3L0IB 4LHYA 4TMVA 5FR2A 2GQFA 2BEKA 1CS4C 2BF4A 1KNQA 1SVKA 3ES9A 2QA4B 2OCAA 2GXSA 5AJXA 2ZRMA 3CMAB 4X8LA 3Q72A 4JLDA 3I8XA 3LVRE 2DB3A 1Z6XA 4DVGA 3BBPA 3GJ0A 4NZYA 4HAVA 2ASEA 4U02A 3CCSB 4L5BA 1W4CA 4DSTA 3ZJYA 3GLGA 2QE7D 2KB0A 2P2LA 4Q9IA 2JDID 2NZ8A 4FMCB 2GNOA 5GVRA 1IONA 1ZJ6A 3VO2A 4QFMA 3EC1A 3AGPA 1R5NA 3PG5A 4CEJA 3QXXA 1N0VC 2PZGA 5B58C 2ECKA 2CBZA 4L4UA 1OH6A 1AKEA 2CJWA 4LY6A 3MGCA 1RJ9A 3LY5A 1MRNA 3QOFA 2ZRHA 2VA8A 3V9PA 3CWZA 1C9KA 1JB1A 1EFUA 5GJBA 1KMQA 1DDIA 2PZFA 1EXMA 3GJ4A 1E2LA 1P6XA 1W48A 4EQ6B 4V0KA 3SN6A 4M1OA 1RE0A 2HF8A 4D25A 4B6EA 3W8RA 2JLVA 2ZI5A 3BH0A 2UVQA 3J81k 1S1MA 1F2TA 4HB4A 3JQRA 3N5CA 5JEDA 1J70A 3VAAA 1GSIA 4Q03A 1LY1A 4TQAA 4A1FA 3GPLA 4NYIR 2H16A 2P3SA 4K46A 1MT0A 4Q5IA 3CCRB 2OTLB 3U3RA 1DE0A 5CITA 4X8OA 1JPJA 1IJFA 4H9GA 4C3ZA 4PAMA 4QNRA 3RNLA 2HT1A 5IRCD 4TWZA 1M1KD 2FGJA 1ZINA 821PA 1CXZA 2V8OA 4LHVA 1N5JA 2CK3A 1AS2A 1QBKC 1FNCA 4JL6A 4Q66C 2FE4A 2MSCB 3IPYA 4LCBA 4YMTA 5IHPA 3BRWD 1ZC3A 4HZIA 1XEWX 5AR1A 1N6PA 1EWRA 1GNRA 4HDOB 2J7KA 2XX3A 3VQTA 3GLIB 1NDHA 1ESMA 2ZYVX 1Y63A 3QXJA 1E2QA 3UPUA 3VNUA 2J5XA 3CRRA 3CONA 1OHHD 4B35A 1Z2CA 1Z6GA 4YMVA 1OB2A 3IO5A 3PEUA 4YLGA 5JBQA 3G4SB 4PGOA 2PL3A 1D9ZA 3ZLJA 3BOSA 3B82A 5DISB 2WOJA 1P2VA 3K0EA 1OH7A 3CNLA 3ICEA 1AQUA 3FKSD 1AIPA 3EIEA 2X2EA 3X1DA 1G8HA 2D2EA 1Z8FA 2OCPA 1FZQA 5EE9A 3R9IA 4F92B 3K70B 2Z4RA 5GJCA 1SKYB 1VQOB 2R6GA 3V76A 3U3OA 1ZNZA 5DNYB 2AN9A 1YZNA 1E0SA 1HYQA 2AL7A 2VIIA 4G5QA 1ZM9A 1IN4A 1HURA 4Y7CA 2XB2A 4DLSA 2XSZD 3ZIAD 2ZJZA 2WSMA 1OSNA 2B7CA 4RKEA 3CCQB 4DLVA 2FFBA 1A82A 3G82C 3RSLA 4A0RA 4ESHA 1SZPA 2YJTD 4V0OA 1G18A 4YAUA 5JWRA 3F3YA 1P2TA 5EP4A 1KO5A 4JS0A 4JMPA 1S9DA 1E2PA 4G01B 2RB4A 3HWSA 3Q9LA 1XPUA 4TL7A 2QU8A 3IIJA 3THWB 1G3UA 3CNOA 1Z06A 1OE0A 1Q7YD 4PPQA 1YRBA 3CCVB 4TMTA 2VSFA 2ZU0C 3IHLA 1OFTA 4XTCS 4NHOA 4PHGA 2GJKA 2J59A 3TSWA 1TEVA 1TADA 2O8CA 2WMOB 1C1YA 1E0JA 4LJ6A 1QDEA 3ADDA 3L0PA 4DIDA 3WMEA 5FFMA 2P65A 5C2JB 1P9WA 1YJNB 3MUFA 1H8HD 1XXHE 3CRMA 1OIWA 4J0QA 2QQ0A 1KO7A 3FE2A 3UATA 1KSHA 3F5FA 1W0KD 1EGAA 4GDFA 2HJVA 4MYUA 4HAZA 1QFYA 3LNCA 3TQFA 3BORA 1Z3IX 5DIFA 5CYPA 3I55B 2BBTA 4ZKDA 4PPNA 1UKEA 4JLKA 4Y0VA 3MFYA 4C0LA 2BPOA 3K9LA 5FOUA 3E1YE 5HXBA 2PLRA 1E2MA 2YV5A 4MRSA 1YKSA 3K0FB 3TLXA 1H8ED 4IOLA 2F6RA 2ZSDA 4RFSB 2GCOB 3K9NA 3ASYA 3G71B 2GJAA 3P20A 2D74A 2FA9A 4BRUA 3K0FA 3V4RA 3GCGA 1GAJA 3EARA 1QF9A 3X1YA 1K5DA 2QPAA 4JYCA 2O0KA 3SYKA 1UBEA 1GWNA 1DARA 2BCGY 2R6FA 1VQNB 2WSSA 3MJRA 1B0UA 1US8A 5JZVA 3VKWA 1JJ2B 4EPRA 2VP6A 2QTVB 2XOKA 4DLYA 3ADCA 1KMHA 5CLLA 2R6AA 4GOJA 4BLPA 2G1KA 3C8UA 4K8OA 1W4BA 4Q4JA 1NSFA 1LTQA 1CP2A 1CR4A 3F0TA 3THOA 2ZEJA 1H85A 5TDHA 1UEIA 3DMDA 4RSGA 2W6JA 3IPXA 2HJGA 3KQUA 2ZRFA 1BOFA 2ATVA 4ASUD 1NSTA 5HKKD 2EFEB 1SKYE 1VQ5B 2FPLA 2FZ4A 1DAHA 2GKSA 4ZCIA 1E2NA 4LV8B 4AURA 3W2GA 2YWGA 1B23P 1E9SA 3L0SA 1TQDA 3B6EA 1MRSA 4M1KA 1T0HB 3SQXA 2QGNA 1YVDA 3FKQA 1HTWA 1QGAA 5FPHA 1R0ZA 4TYNA 1LV7A 2JLZA 2ZRBA 3DZDA 4HB2A 2YOGA 5H70A 5F3WB 3QFSA 4QBFA 3VR1A 1RZ3A 4P6VF 4G1UC 4D2IA 1T6NA 3A8TA 3NWJA 4DIEA 2AFHE 1DAGA 1QHYA 1IAQA 2GHIA 4X8HA 3QF4A 3KJIA 1NIJA 2G9NA 3BFXA 2GESA 1W7AA 3FMPB 2CEAA 2QAGC 2HV8A 1P2SA 2ZS7A 3OJXA 3IIMA 1VQPB 1A8PA 2HDNB 4IKEA 3O8BA 4TL6A 4TT3A 1CNEA 3W6PA 2DEUA 2IT1A 5JWHA 4WQMA 2DFLA 3TUIC 3QKTA 1OGIA 1HEIA 4C43A 2YOHA 4FW9A 1AM4D 5JCPA 2R6DA 2GRJA 1QVAA 4N1AA 3RRYA 4NONA 2ZJOA 3TSOA 3QKRA 5IDVA 3H2YA 4GZMA 1E79D 5EUQB 1AK2A 3QPWA 1UBCA 1JEDA 2WWIA 2OXRA 4HDCA 4PANA 4K1XA 1Q81D 3B85A 4G3XA 5FA6A 1P9RA 1J8MF 2AX4A 1US8B 4D4MA 2YKGA 2B6HA 3F8TA 5FI0B 2DHRA 1GOTA 1YJWB 1E96A 2GWHA 2WWFA 4QGGA 2QENA 3OIVA 1KIMA 1UF9A 4NH0A 4PR0A 5LB2A 3W3AA 3TAHA 3TK1A 4DC9A 4G5RA 2FV8A 2ERXA 1ZAKA 2JDIA 4UJ5A 1SXJA 2EFDB 2FJUA 1DS6A 3PR1A 1HE1C 3UWOA 2UKDA 3BD9A 4G5GA 2VHQA 3C4JA 4JKIA 4LHZA 1GL6A 2QP9X 4NKRA 2RGNC 3RVBA 3FKSA 1L2TA 1W46A 3RRNA 1W4AA 1E2EA 1MO4A 2GF9A 3KZ1E 5JS8A 3SR0A 2JJ1D 3NDBB 1FQJA 4Q9JA 1KI6B 1SQ5A 1FMLA 3CX6A 3PXGA 1E9EA 1E4VA 4JT2A 4YMUA 2QT0A 4QNMA 2WWWA 4HI0E 4UNRA 4DCTA 3BH7A 3SBDA 5EP3A 1S3SA 4HZUB 1SVMA 2FEOA 3R8CA 4PXAA 4TMXA 2QBYB 3BJIC 1O3YA 1E2JA 1W1WA 3WP0A 2G77B 4FMBB 4B3FX 4AYTA 1UADA 3FB4A 3AF1A 2BBWA 4JT4A 2C99A 3CBQA 4TMKA 2BJWA 4OJQA 1XZPA 3K8YA 5CJPA 1QFJA 1TQ2A 2F9LA 3EA5A 521PA 1KAOA 2PMDA 3EW9A 1ZM2A 1QHXA 3L82B 5DE3A 1UJ2A 5HZKA 5L3SA 1PLLA 4DEYA 3MRSA 3QXCA 5EXTA 5EE0A 2GVDC 1XJ0A 4AWXA 1G17A 4IVPA 2QZ4A 4A0HA 5KSWB 5AN9A 3NBZC 3PUYA 4Q7LA 4A8JA 4EKDA 4OQLA 5AWFC 1XTSA 5KNBA 1QHGA 1KO1A 3FPKA 2G83A 4KFRA 2HMAA 4Q1AA 2OILA 2ZVPX 2GXQA 4HAWA 3ZZUA 4XH9B 4LBVA 2ZQ5A 2W2TA 5K8LA 5KNCA 3SDZA 3N2EA 3K53A 3N2IA 4JVMA 2R6HA 1U9IA 3MJHA 3DOEA 3SFZA 1N6KA 1ESNA 3CLVA 1I2DA 2I1QA 4KV9A 3RS0A 5A0FA 1BX1A 2ZI7A 1UEJA 3R7WB 4MRNA 2VSOA 4EJSB 1H65A 3AF0A 4DKXA 3OAAA 3UIEA 1GL9B 5L3VA 3PENA 1CJVC 3AF3A 3Q7PA 2BM0A 2MMGA 3NC1C 2XEXA 4TQUS 2BJVA 2QY9A 3FHTA 2XZLA 2AD5A 1G3QA 1P4SA 2J45A 1ETUA 4X8MA 1RW4A 3A36A 5CB6A 3MWKA 3KKMA 2QTZA 2PX0A 2GXAA 1N6OA 1QX4A 1E4YA 1EFCA 1XD2A 1KDOA 5CM8B 2ZS9A 1ZCBA 5DSZA 2DYKA 2OO7A 2GDJA 4OJKA 3O47A 3Q7QA 4JKYA 4C2TA 1IN7A 3AVTA 5BW8A 3WMFA 2WAXA 3AP2A 2IS1A 1UAAA 3CCJB 4PSVA 1KI9A 5JECA 3DKPA 3W2IA 3CCMB 1DG3A 3GJXC 4RD4A 2ZAOA 4LC0A 5JI2E 2REBA 2RHMA 4ON9A 3FYHA 3IDQA 2FFAA 1XP8A 4PAOA 4D4KA 1D8TA 5EP2A 3TIFA 5FPKA 4Z54A 4BZXA 3UMFA 3ADKA 2FU5C 3HYRA 1G5RA 2REOA 2IYRA 3BGWA 3U3JA 4LK2A 1Z47A 5ANRB 2ZYWX 3EXAA 2WPDD 1XPOA 3K70C 1TX4B 1W34A 1BS1A 1YR9A 3DEFA 3LQQA 4FWIB 5DHFA 1YITB 3AVXA 1B2RA 3NHAA 3Q85A 4NCKA 3W2FA 1U90A 2R44A 3CC7B 4AK9A 4NCNA 3P4YA 4DCNA 2A3RA 4CEHA 2AKAB 2GJ9A 1JXMA 2OEPA 4URXR 3O8RA 1E3MA 2K5UA 3TW8B 4HE6A 1LW7A 2P5TB 5E7JA 1E94E 2CK3D 5EZ6B 2PJRA 1KHTA 2Q3FA 1OF1A 2F9MA 3ZYCA 1XXHB 3DMNA 2BN4A 1YZGA 4KU4A 3GJ5A 2Q21A 1Z6AA 2CRVA 1XMVA 4DLWA 3FPAA 4A0FA 2IYYA 4NYIQ 4PZYA 1R5OA 3CR8A 2WSSD 1SULA 4IOMA 2Z5FA 3NXSA 4HATA 3RAPR 3T35A 3W34A 4CEJB 4M1TA 2YNMA 4LWZA 2QORA 1XB2A 4D0GA 1NL3A 1A5TA 4M9XA 4BFUA 1CKEA 1GR1A 2QA5A 1Q3HA 1WCV1 2EYUA 3WXMA 3UWKA 3LVBA 3TQCA 2AXNA 3QFRA 3AUXA 4C9BA 4DLTA 1XD2B 3CC2B 2C04A 2G6BA 2YVUA 2YZ2A 1XMJA 2R6CA 4IDQA 3FVQA 2GCPA 4QBHA 1KY3A 4JLVA 5TB5A 3UKDA 3AUYA 3U3MA 2IYWA 1DELA 1W87A 4OI4A 5BN5A 1KDPA 1TF7A 1ZD8A 4F4CA 2BC9A 3LBIA 3EZ6A 1Z22A 4GP7A 3GQBA 3KXLA 3QEJA 3SS8A 1G6HA 1XTIA 3O8DA 3MG9A 2ZROA 2IK8A 2GEUA 1SKQA 4QM6A 1KC8D 3KDSE 3P26A 2WM9B 4GRAA 4Q4LA 2KWIA 3TR5A 4AY2A 4XD7A 5FPTA 3LO5A 2FZLA 5P21A 4HEJA 1OIXA 2GEDA 1RRFA 2AR7A 3JVUA 4URWR 4ZO4A 4Q1EA 3BS4A 2G0NA 3I56B 2I4IA 3EC2A 4LRWA 2CLDX 1UFQA 1S2MA 1IJEA 1DDGA 1OLOA 4TLAA 1EX6A 3MHPA 4B48A 2VO1A 3ETLA 3OEEA 2GZAA 3CH4B 1R0YA 1ZCAA 4IOJA 1FTSA 1CJTC 4N3GA 3GLGB 4Q1DA 2FMXA 4PSKA 5HCIA 1ZP6A 2YC2C 2WZQA 4TYQA 5KDLA 5H59A 4O25A 1E79A 1GKIA 2PH1A 4TTPA 1W36D 5HTKA 3WYGA 4TLDA 1E32A 2QEQA 2IUUA 3GLHE 2RH5A 4HSEA 4NP6A 4Y9RA 4FD2A 2NIPA 3PUWA 3SJAA 2BVNA 4UNQA 4BFYA 3OEED 2WJJA 2YOFA 1IY0A 3NEYA 4N0EA 1XFAA 4P4SA 3T5GA 3LW8A 1C4OA 4HE5A 2OXCA 4DLRA 2OK8A 4O0MA 3GEHA 2AFIE 3WBKA 1NBME 4MYCA 4AKEA 2QTLA 1GITA 3ZS8A 3TSZA 2Z83A 2ZANA 4HUQA 2V6JA 3HR8A 3Q5DA 5F9HA 1M2OB 4UNPA 2X3UA 3MCAA 2OLKA 2WKQA 1Q0UA 4KJZA 1IY1A 1J9ZA 4HLUA 3WYFA 1E62A 4B4DA 4H1VA 3A37A 5DYIA 2EQBA 2D3WA 3U7FB 2KBEA 4RCYA 2JJ1A 3IBYA 3KXKA 4QGFA 1UKYA 1KK3A 1W44A 2DCUA 1NY5A 2W2VA 5UKDA 5TXGA 3WNCA 2AHOA 1DAFA 2AD1A 2XXAA 3NH6A 1E2IA 2LKCA 2GK6A 2GBLA 2ZSAA 4ARZB 1M90D 5THXA 4I81A 2JLYA 1GDDA 3H1TA 4BLSA 3RWOA 2CLCX 1FUUA 2IWHA 1JR6A 3EZ2A 2W6IA 4CIDA 3LRPA 1ODFA 3BWDD 3K0AA 1BMFA 2H1LA 4PSAA 5A4JA 1GNPA 2RGGA 1GG2A 3RRZA 1G64A 4KLNA 2P6NA 4M53A 1QGZA 3RYTC 3LLUA 3R9XA 4PZZA 1CR0A 1U94A 4KO8A 1U99A 4GZLA 2EU8A 1E63A 1EG7A 1NJFA 2IYQA 3QPUA 4XJXA 4DDWA 3ASZA 4OQFA 4US0R 2ORVA 2A5DA 2WJGA 3G5UA 4I1UA 2BSAA 3U44A 1BMFD 1KD1D 3JVVA 4JLPA 1YZLA 5D3MA 4OHXA 4Z1MD 3IGFA 4DB2A 2QI9C 2ONKA 2VHJA 2R2AA 4C30A 2QAGB 3VR3A 4QHYA 2BMEA 4RD3A 8OHMA 4BEJA 4AKIA 1G5PA 2XB4A 4TYPA 3EA0A 4FCTA 1XMSA 2IHYA 2PJZA 3BIFA 4YDHB 4W9MC 1F2TB 3KB2A 2W58A 3SFVA 2CHVA 3CCEB 3QI2A 1P62B 5E95A 1PVOA 5CIWA 5EXSA 4GNKA 1P60A 1X1SA 3L2OB 1H8HA 3CKLA 4LGMA 2JEOA 4BECA 1BYIA 1SVOA 1R2QA 2KSQA 4OI1A 3BXZA 2ZI9A 2OFOA 1GAWA 3DPUA 4LJ8A 5EZ5A 1ELOA 1LF5A 2EYQA 3ECCA 2FFQA 3CRW1 5A5GA 3PV0A 1ZC4A 1PZNA 1XX6A 3CCUB 5J4HA 2EFGA 3TRFA 5DYGA 3TNFA 4WA7A 4A8JC 1VQ8B 2QPTA 4JLAA 4TSFA 4Q4HA 3TE6A 4IOKA 5IF9A 3CX7A 3QF4B 5BWMA 1SVWA 1JAHA 5TVKA 1II8B 4U7DA 5H8WA 2D7CA 4MA4A 3K1JA 2ZRPA 4NCHA 1KZGB 2HUPA 1TTTA 1NVUQ 1G4UR 1UKZA 3W2EA 1FPMA 1AS0A 1QG4A 1WB9A 3CF2A 1G16A 1XTJA 3N70A 4O3MA 1VYTA 5DLQC 2JLXA 4DZZA 4WOPA 3IO3A 1OGJA 2C9YA 2VYFA 2GBLC 4HUTA 4QGHA 1GNQA 4C0BA 2RC6A 2ZRGA 1YJ9B 2DFTA 2PEZA 4H1UA 2ZR0A 4R71A 4ZKEA 2H92A 1R5BA 4M9QA 4G0NA 4BPBA 1CEEA 5D3MB 3OZXA 2WHXA 1G5TA 3IUYA 1R0XA 721PA 3EAQA 4E03A 4B43A 2OBNA 3QJYA 2QAGA 1UMKA 2C9OA 1U0JA 3GLHA 5DN6A 1JR3D 3AP1A 4YMSA 5FUWA 1XE1A 2Q9CA 4AIIA 4YQFA 5JRJA 1XJQA 1P61B 1FQKA 1D5CA 4I99A 3CMEB 1IBRA 1F20A 3CM0A 5KOYA 1DPFA 1KKLA 3QVVA 4IDNA 4M9SA 3W8NA 4UQOA 3L0OA 3PUZA 3RANA 3A1VA 4OI2A 3SYLA 2EFCB 3THWA 1TQ6A 4TLEA 1VECA 3D7MA 4ERNA 1VQ6B 1OXSC 5EE3A 2IXEA 4NCJA 1L8QA 2O8DB 3GLIE 4V0MA 2ZRKA 3ZVNA 3VHXA 2PBRA 4BFTA 2XNJA 4W5HA 3A6PC 5F9FA 221PA 2VPPA 3HPQA 3GLGE 1EFRA 5LBIA 1TVCA 3DHWC 3CUEF 5J4LA 1HY3A 1FMJA 1XCMA 1NNEA 1CRPA 3TW4A 3T1VA 1ZYUA 2ZS8A 3EX7C 1XEFA 3OAAD 4RD1A 4Y0AA 2WWYA 1L4YA 1N0WA 2AXPA 4QM7A 2GVZC 4MGYR 4ZV4A 1YJ5A 1VPLA 5LDDC 3HP1A 1YHQB 4JLBA 1II8A 1Z28A 2C5LA 2RHDA 2Z6VA 2VEDA 1W35A 1XEXA 4C0KA 3LWNA 2CE7A 2J41A 2EWWA 2NGRA 4BLRA 4PZLA 1YZKA 2F43B 1SXJC 4MKIA 4MQBA 4RFVA 5F2EA 5HKKA 4EFMA 4M8NE 3ZBTA 3R20A 1M7GA 2OCYC 1JEEA 4XSHA 1WA5A 2EWVA 621PA 1Z6TA 1KZ7B 1PUJA 2OESA 4EFNA 1U8ZA 1CBUA 2FGKA 2VF8A 1E2KA 4MITA 5IT5A 2ZJ2A 3QXHA 4KBGA 3DDCA 3PITA 4ZDIA 4XIGS 1JB9A 1IXSB 3FTQA 1KAGA 4US1R 3B1ZA 1U81A 1V43A 3DVLA 3ONWA 4OI0A 2DBYA 2HXSA 1GKYA 3OF5A 5DGXA 2IW3A 4Q1CA 4GFDA 1QHHB 4I4LA 3AP3A 1D6JA 1FUKA 2OAP1 4ITRC 4US2R 1A1VA 2F1JA 1VHTA 1QHHA 4TQ9A 3I61A 1KYIA 4NDZA 1JQLB 2KE5A 4JIMA 4RZUA 2GZDA 3G6EB 3CPEA 4DDVA 4PHHA 5GJVC 4Q02A 5AJYA 3IIKA 4JLMA 2X1VA 1E2FA 2OZEA 1YR7A 4LJ4A 1VQ4B 3ADBA 5B30A 4TTRA 1P9NA 1D1NA 2ZREA 4KAXA 1SHKA 5AUPB 2HT6A 4CT4B 2O8DA 1TF5A 1WMSA 4DRZA 1U8YA 2D4HA 2B92A 3JZAA 5FH9A 1N5KA 4V0ME 1R6BX 2ZRJA 2QMHA 4CEIB 3GMTA 1Z0FA 1QGYA 5C1BA 3SJCA 5KDDA 2QT1A 3AKYA 3KB1A 4OKSA 3MMPA 4QRHA 4A92A 2F1IA 5K8TA 4TZ6A 2OCBA 4KI0A 5GVSA 1XD8A 2GCNA 1BX0A 2HLDA 2RGAA 3REGA 4M1SA 5TMPA 2PT5A 3KJEA 4EPWA 3KL4A 2FDCA 1MOZA 1YR6A 5IK2A 4A6XA 2IXGA 2F1RA 1DG1G 2F43A 1QG0A 1E98A 3GFTA 2ODEA 4B2LA 1FRNA 2FH5B 2CNDA 1EFTA 2O8EB 4UJ3A 3RS7A 2WJIA 3QE2A 1NVXQ 1FTNA 3CF6R 4JJKA 3THXA 5CJ2A 5J4VA 2IYXA 2V4ZA 5FR1A 2OSBA 1GRRA 1CR1A 4GSYA 2CL6X 3TMKA 3TVTA 2O8EA 2C95A 5JCZA 4M22A 2E9SA 1YQTA 2NMVA 1QHSA 5SZKB 4BZQA 2V55B 3DM5A 1QZXA 1M7BA 3A4NA 1OXUA 2XNDD 1F48A 4LYHA 1NY6A 1TMKA 1OYWA 5KPDA 4KYUA 1FP7A 3LXXA 4FINA 4P4TA 1T91A 1QFZA 3KKOA 1N2CE 3RLFA 2ZE6A 4JL8A 3AVYA 3AVOA 2RKOA 2IYSA 3WP1B 3EPJA 3R7WA 1OH5A 1M74A 2G0TA 2X77A 3OZUA 4IJMA 3TR0A 2MSDB 3GJ6A 4IRUB 2BKEA 1E9DA 4A4DA 4AD8A 2G3YA 3X2SA 3KQLA 4AKGA 2J0SA 3A4MA 2GJ8A 1OKKA 3RHFA 2V1UA 1X6VA 1BKDR 1A4RA 4XWAA 3TUZC 3MLEA 4NBSA 2ANBA 4ACBA 2WIBA 6Q21A 4EJSC 3I5XA 2OHFA 3QKSA 1VQLB 3LV8A 1KI8A 4R98A 1E0AA 1IY2A 2YWFA 5TARA 4BGDA 2A5YB 4DLXA 1KO8A 2W83A 3LX8A 5DI9A 1XCGB 2WMNB 4FIDA 1G7RA 4JZKA 2J0QA 4C7OA 2RMKA 3BK7A 3CX8A 3SQWA 4BLQA 2OLJA 4B34A 4C7OB 2CVHA 1E2GA 1FOEB 1Q1BA 2XGJA 3BAFA 3P1JA 3CRVA 4LDJA 2JLRA 4Q18A 4QBIA 4W7SA 3BE4A 3OESA 1CF4A 3H84A 4MGIR 2WICA 1FX0A 4DWJA 3K70D 2P67A 2FPKA 1D2NA 3IEUA 2C96A 2CLSA 2XJ4A 4LSGA 4A2QA 1U0LA 2WJVA 3LX5A 3KUCA 4OK3A 1TAGA 3PUVA 1KOFA 3SBEA 1II9A 3THXB 2VNJA 2Q3MA 1I4DD 3WMGA 5KSZA 4KFSA 5KSOA 5TY0A 5L3RA 3IHWA 1T3LA 4BASA 3NBFA 4W5JA 2GTPA 1MABB 2J0VA 4DT1A 1MV5A 4KHZA 1F3OA 2F7SA 2WAYA 2FSHA 3TAUA 4B71A 3CR7A 4P31A 4PFSA 1FP6A 5EXXA 1RRCA 4A15A 1Z0DA 1ZRHA 3SZRA 4HDQB 4LPSA 4F91B 5JWOA 1G8YA 1R8SA 2P0EA 3LD9A 4RCZA 3IEVA 5KYKA 3HYTA 1MO6A 4GBMA 3VU9A 2XZOA 1YI2B 3BB4A 1S8FA 2LWIA 2VP5A 3ZBUA 1IN8A 2VSXA 4URYR 3WRYC 2RGEA 3C5CA 1IQPA 4Q9KA 2GXUA 3D3QA 3TH5A 4EJSA 3ZVMA 5AK0A 1KY2A 3CF0A 1AS3A 2DR3A 3RC8A 4DQKA 4MRVA 3I1FA 1ZUHA 3SHWA 1BO6A 4DLUA 5JMTA 1NRJB 4EH1A 2F3RA 2ZETA 4DJTA 1HUQA 2V9PA 1U2RA 3MWJA 1WBBA 1G19A 1L4UA 2YHSA 2VQSA 3M0EA 4DB4A 1G7CA 4XWOA 2GA8A 4B3GA 1XD9A 1QVGB 3WNBA 3BFKA 4AI6A 4EQ6A 2JIZD 3T1OA 2QUZA 1OPXA 2EVWX 3KKQA 1UM8A 2JCSA 5HE8A 3RS2A 2FEMA 1P5ZB 3R9WA 3M6AA 4MH0R 3EZ9A 2PMKA 1G1MA 3W2HA 3RS5A 2OV2A 1SM4A 1Q21A 3T1QA 1N3BA 3VX4A 1Z0AA 2HCBA 1D9XA 3AV0B 4LJ9A 3X1XA 3A58B 3K09C 4KXFB 3DM9B 4ACAA 2FOLA 1G8FA 4JBYA 4F4JA 2ZM5A 1WXQA 1CR2A 1T8UA 1YHNA 1NG1A 4IVRA 3VMFA 3FJOA 3GFPA 3QUSA 1XZQA 4B44A 4BRWA 4L8GA 4MUAA 4JVLA 1N6IA 2D7DA 2VRWA 4PC7A 3W90A 5FUXA 5L8VA 1HE8B 1KKMA 5LPNA 3HR7A 2WJYA 5D3QA 3QEOA 2WKPA 1G41A 2JA1A 2OBLA 2PIAA 4XSGA 5C4MA 1W36B 5KPJA 4LUCA 3EASA 3FMIA 3NTUA 2GETA 4PHFA 1TLLA 3RWMB 1NI3A 2Q9BA 1YU9A 2HLDD 2XOKD 1NIPA 1ZVQA 3AQ4A 2IL1A 2ZR7A 4KYIB 4MYHA 3T06B 3GD7A 2AK3A 1K8AD 4NL4H 4QHSA 1S96A 5FOTA 1VKJA 1HV8A 1P3JA 3GLFA 2H5EA 2W0MA 3EZ7A 1S4QA 1GVNB 3CRQA 2CJWB 1F5NA 2Q6TA 5CB8A 2IHBA 4ZI2A 2QEXB 2W0SA 1TPZA 3QG5A 1ZMXA 4KVGA 4C0JA 1VQ9B 1NF3A 3BERA 3GJ3A 4PQYA 4IXMA 4B74A 1RYFA 2IA5A 3FMOB 5FI1B 2VP2A 4OHWA 3K0SA 4PC1A 2FFHA 5CDFA 3EPLA 1DOAA 5DO9A 2ZSFA 1W0JA 2NO6A 3I72A 2ANCA 5L3QB 2IS2A 2VTKA 4YC7A 2WWGA 3SC3A 2QN6A 4A2PA 5J4YA 1QVRA 2ZRAA 5JI3E 1G8GA 1N5IA 2FG5A 1N6NA 1IN5A 4TT3D 1AA9A 2CXXA 1FNBA 2ZJYA 1PUIA 4TMWA 2QP4A 4ZGQB 4YXWD 1Z63A 4MRPA 3X1ZA 4HAYA 3B1VA 2ZE8A 5BXQC 2QNRA 1KJZA 4LBYA 2DWPA 2NTYC 4Q19A 2BV3A 2OFXA 3I73A 4G5SA 1G8PA 4Q9LA 4D26A 4FI3C 2BWJA 3EPHA 3A1SA 1BYUA 1WBDA 2BDTA 2YC4C 4RKFA 4FWTA 5E7MA 3FWYA 1KSFX 4UXJA 3LBNA 4JJZA 4QL3A 4D82A 2XTZA 3GEIA 2DWOA 1N0UA 1NG9A 1CRQA 3LVQE 2R62A 4OHVA 4GOKA 2FX3A 1DAIA 1GZSA 3SOPA 3HPRA 1KRHA 1M1YE 1XU4A 3K0CA 1OT3A 4RFSA 4AG5A 4E5UA 4M2LA 5J4KA 3VR6A 3A1UA 2XNCA 2XNDA 1V5WA 2ODWA 4M9ZA 4ZDJA 1VQ7B 2J9RA 2XTMA 4U00A 4F4IA 4WZBE 2GEVA 1WQ1R 2FSGA 4ZCLA 4HB3A 2ZU6A 4WZAE 5J47A 1E9AA 3VX3A 5KTYA 1KMHB 3U5ZB 1BJKA 4QC2A 4JVSB 4O2RA 4LOAA 4JLNA 3QNUA 1JXOA 2QGZA 1VG8A 4HUQB 3MWYW 3AVWA 1J7KA 4JSTA 1NKSA 3OFNA 1R7RA 1OIVA 3I5YA 5AJZA 3OHMA 1IN6A 1K8RA 1FNNA 3P4XA 2BIFA 1S0UA 1PLKA 3ZZTA 4FN5A 5L3QA 1UBFA 2C77A 2HCJB 1K5GA 3TJZA 3KX2A 2XAUA 5KSPA 4LPKA 5BQ5A 1QVFB 3ZVLA 1TF2A 3KKPA 1E0KA 2H17A 2L0XA 4BLOA 4IDHA 5JJKA 2AK2A 4DQLA 4Y9UA 1IM2A 4DHEA 4DUGD 4QG7A 5E3HA 1W4RA 1E9FA 3C5HA 4NU0A 2ZR9A 5DHAA 2CCJA 3I3SR 4Z1MA 4CF7A 4PTLA 1JI0A 4HB0A 4ABYA 3UXMA 1GRNA 1CLUA 3W5UA 4UXHA 4OHYA 2ZAMA 4MGKR 1XF9A 2VYQA 1KSJA 1OFIA 4IEIA 1JAIA 1PLJA 3AVQA 1XCPA 4NPHA 3A4LA 3T15A 1XMIA 3JQQA 4JBXA 2YWEA 2HYDA 4LI0A 3I32A 2JGNA 3M1IA 2Y8EA 4C0HA 1JR3A 4LYJA 1RRPA 1D2EA 3OE7D 4B6FA 5AUQA 2ZITA 3ZGXA 1L7VC 4LJYA 1OYYA 2R8RA 2X19A 2ORWA 3ND8A 3OEHD 3BH6A 1TNDA 4POAA 4QJ4A 1SHZA 4Q01A 2ODNA 1AZSC 4GMXA 4WXPA 2JLWA 3U60B 1AGRA 5M04A 2JLQA 4URZR 5TR9A 4IFEA 3PIRA 2JJ2A 2JLSA 3QBTA 4TSFD 4Z8XA 2DFKB 4KITB 3AKEA 2IYUA 4BPRA 3OE7A 4FMDF 1AQYA 1EX7A 3AVUA 3AM1A 1EK0A 3K0CC 3OEHA 1XPRA 2QRNA 3W9YA 1VQKB 3OZVA 1K9MD 5G41A 2FN4A 2VF7A 2BEJA 2WKRA 3EIHA 2NZJA 4RD2A 4UNNA 4TYWA 3CZPA 2LKDA 2CCGA 2NPFA 4OQXA 4V03A 1DO2A 5LD2B 2QTHA 1JALA 4KFUA 1A7JA 3OIYA 1ONBA 1GP2A 1P2UA 1YRAA 1KDRA 2G88A 1W49A 2QROA 1R4AA 5DH9A 3LFUA 1Z08A 2B8TA 1JNYA 4NYMQ 4NCIA 3PJRA 3KJHA 3I92A 4CEIA 1NVWQ 4I1OA 3W5IA 1X86B 3CH5A 5E4FA 2Q0HA 1Q44A 4I1SA 5CLQA 1X8JA 4Q4AB 4LC1A 1K73D 2DERA 4ZCMA 3KJGA 4PAQA 1WDTA 2C78A 4S2EA 2O8FA 3U7EB 4N0DA 4JL5A 4V0LA 4FMDB 1E99A 2HEIA 1JQJC 1Q1EA 3QBVA 5FPSA 5C18A 3JQPA 2QDXA 3W5HA 1NN0A 1ZM7A 4B3CA 1A2KC 5FBQB 1GKUB 1T8TA 2GAOA 2I1VB 3B1XA 3WYAA 1T3HA 5H68A 1EP3B 2QAJA 3CB4A 3NBXX 1W0JD 2OBMA 4MRRA 4QBGB 4TL8A 3LXRA 1MO3A 1RYHA 2O0JA 2KBFA 1F60A
chains in the Genus database with same CATH superfamily
3A28A 1QAQA 2XJ9A 3W78A 3E8XA 2KJQA 1UT6A 2VLBA 4FFBB 3OOWA 3RS8A 4L9AA 4MB0A 1VJDA 3LQRA 2OM6A 4QD3A 3S2ZA 1EAYA 2ZZMA 1PIWA 4AY4A 4M0UA 4PM4A 3AY7A 2GO7A 2Q99A 3I28A 2JS7A 3PC3A 4WUTA 4CQMA 5B4UA 1H4QA 3ER6A 1V9CA 1BFKA 4GQIA 4KXLA 3G0HA 1JSLA 1NXPA 2CMKA 2PN1A 1Q0SA 3ABIA 3N0TA 5F98A 4EL0A 4W7HA 1AG9A 5AKEA 2UZ0A 4K6GA 3ZCSA 5K8UA 2HYIC 3PFFA 3VU9B 1KJIA 4MVJD 2OBBA 4EUHA 2R7AA 1NQXA 4XQ0A 2A7QA 2BM8A 2BGIA 1AGYA 3KOXA 5EE1A 1CHNA 5G3ZA 3DDHA 4RJLA 4R5MA 2XKBA 4KQKA 4ZIRB 3L77A 3ZD7A 4V0NA 1JT2A 1KWKA 4AN4A 1IBKB 4G1CA 4X06A 1M0WA 1ZOOA 2JKZA 1VFNA 2V1XA 5G4KA 2BHRA 3L6RA 2VP4A 2GUGA 2BEUA 4ZMBA 5EI5A 2IJGX 1CZHA 3MGAA 3U40A 3B6KA 3FFAA 3QY0A 3NE5B 3AEQA 3UAGA 4E3ZA 4G5OA 3UJHA 1JL3A 4AKHA 4RM3A 3U7GA 2X6WA 3PNLA 1E7YA 3G1WA 1OB0A 5TEWA 5TS2A 2C2KA 2BEVA 1R64A 1TA4A 1Y4AE 1RI3A 3OSZA 4GLLA 4MGZR 4NESA 5D7BA 4URVR 3K1ZA 3FRJA 1A7KA 2GAAA 3D59A 3PDUA 4BQSA 1YU6A 2Y9PB 1MHTA 4IJ5A 1L5SA 4OXIA 5FTKA 1H1TA 2OA0A 1PR5A 1W5TA 1DBQA 1RAHA 3HJNA 3JS5A 3BC1A 5LJLA 1M2GA 5TLSA 3C85A 2X0NA 3BDVA 3LIPA 1ZQ9A 2BGNA 3DP7A 3R7BA 2WYWA 1HKUA 2VNHA 1BXRA 1WE2A 2ZE7A 3OY2A 4EJFA 2H85A 3SVTA 3L8ZA 2Q4RA 3IVRA 3BL6A 1E1KA 1RPZA 1AHPA 2HIMA 1I3LA 4PS0A 4WFQA 4B6JA 1IG3A 3L06A 3BJZA 3LLCA 1C81A 3V8BA 1W2HA 4BMCA 4HDNA 5TQ2A 4UZUA 3AXTA 1FQWA 1WZIA 3AEZA 4MDFA 5MHTA 1G20E 2XUQA 2BUCA 1C5KA 3KP1A 2W2NA 5E9AA 1JDUA 3RTBA 4M21A 1NT2A 2I7TA 1TUIA 2V59A 3ESBA 1UXJA 3UANA 4BJ5A 4E3WA 3NEAA 5LB4A 5F7JA 2QV7A 3HFGA 3L9XA 2XYRA 2O06A 4ID3A 4Y6PA 2WABA 4BWYA 4JC0A 3KLNA 2TS1A 2EW1A 3KOYA 1MQSA 3LCVB 2GB4A 2O5VA 1TVMA 1X80B 1T15A 2VK4A 3KB6A 3O4RA 3P9XA 3PQDA 3TKLA 4UE2A 1H3NA 1WCIB 5IUNC 1Y1RA 1H0RA 4K81B 1JP7A 1M34B 2IUSA 1H9BA 2KVOA 1HFKA 2HBYA 1BDMA 4J76A 4Q3NA 5DIZA 1O4WA 1R5JA 1IHXA 1T2CA 1XRRA 4CUZA 1PL6A 1Z83A 5IKMA 2GEFA 4REQB 3C3AA 1E6CA 4A6PA 5L40A 3M6XA 3JVDA 4IEEA 4AECA 1ZONA 2D0PB 4MS3B 4BNYA 1SXHA 3QVUA 4BFZA 4H7FA 5E1DA 5JJLA 5F4ZA 4KPUA 1QIHA 4BX9A 1W5EA 4K6HA 4PAWA 1GPUA 2NQ8A 4FJ0A 4ENTA 3GUHA 3PEYA 1XXHA 4J8PA 4XM2A 4L15A 4I5FA 2CCKA 4O1MA 3VPGA 1UDCA 5EP1A 4AF6A 3QPDA 4IWXA 2J7PA 4QZVA 4HY3A 4KREA 1J5EB 1X8LA 2H4FA 3ONVA 1AKNA 4S35A 4DEXA 2VTBA 2YVQA 3NXKA 2ZLBA 1JYEA 3EGVA 3NTLA 2DBQA 5KNCH 1IE3A 1GAQA 2XZPA 2JGKA 3DBOB 3CZCA 2J5KA 1FNMA 1MIHA 1LB1B 3JYPA 4AROA 4RETA 1Q92A 1LS1A 3DBRA 3HGMA 3AX6A 3QNMA 4FQ7A 1E9RA 1NMXA 1ZRMA 2EX0A 1HQKA 3TNDA 4D7AA 4DV2B 4GL2A 2I1LA 2BHLA 4MAFA 2YMQA 3DSRA 2HRCA 3EUEA 5AHOA 1XALA 3ORRA 1M6VB 3A32A 2VHCA 2Z3ZA 3B9QA 4K7JA 1CQJB 5T3UA 4IIXA 2X5NA 1N25A 4O4IB 2PS0A 2G5GX 1ZK4A 3R0JA 3MAGA 3PKZA 4RZSA 3USCS 4Q7JB 1NW8A 2DKNA 3GNLA 1ML4A 3OIUA 1RVDA 2QHXA 3OPQA 4MV0A 4XQCA 1WMEA 2X5OA 1ZL2A 4R1QA 1ACMA 1UJMA 4P0TA 3IB6A 3OOEA 3A70A 3VKUA 2H3EA 3SF8A 3OJLA 2Y0DA 2YICA 2X8AA 2H4YA 5BN3A 2W6ID 3B2EA 1EVKA 1YJXA 1C3OA 1TPYA 1ULAA 2JPDA 1PG5A 2G80A 1COZA 4QDKA 4WADA 3YASA 1NKTA 3KSDO 2BFEB 3QBEA 4QODA 1DAOA 3HC7A 5COQA 1N0IA 2WWHA 3SJZA 3WLSA 2FLKA 4NH4A 1XRNA 4UBJA 3ROGA 4BBAA 1T9AA 4O4JA 4B2IA 5C7IO 9MHTA 1XEWY 3JQDA 1DC5A 1Q82D 5CVTA 1KJ9A 2OORC 3FCAA 3IOEA 1TD9A 3JWJA 3W5SA 2Q5LA 3AZQA 1S2IA 4XLZA 5FTNA 4U9IS 5HZGA 2CDNA 3FPBA 4B3SB 2DCMA 2G04A 4DV7B 4FYKA 4BKUA 1NVEA 3HQ4O 3LIIA 1Y42X 3CISA 4LYFA 4XTRA 4MVYA 3FCSB 1FRQA 1KI2A 3IOYA 2C4WA 4K6KA 3DE7X 5BVGB 2V54A 4QPNA 2E4WA 1GUBA 2PANA 4P32A 1L8XA 4F93B 5FI5A 1MFPA 4QGAA 4QVKA 1Y6FA 1SCJA 2I66A 4JQYA 1ODJA 2UUCB 1JKIA 3DEIA 4MYTA 3QUTA 4AZWA 3RSCA 2FPXA 3HABA 2HA3A 4QGBA 1CQWA 4Q4CA 1WCXA 3CNBA 2PXHA 2D2XA 1JFTA 2ZIAA 4KXNA 2ARKA 5JNVA 1S72B 3B78A 3O92A 2PQ0A 4TV9B 2OECA 3O8NA 3JZMA 4PCUA 4YX9A 1Q0HA 2RKWA 1M75A 2XSZA 2W48A 5AVSA 3U61B 1JHMA 3IBFA 2CC2A 1EVQA 3OBIA 2NZ2A 5AKYA 4D99A 2C7QA 1KZ6A 3KFXA 4YAOA 4PGMA 3WS7A 2JVKA 3O74A 4RHTA 4W5OA 2IHVA 2YMPA 1ATIA 4YV7A 4MMYB 5L7YA 1IMJA 3HCNA 5FTMA 1OV4A 3ZE7A 2I76A 3QG1A 2XXAB 4ARCA 1X8KA 1F4VA 2WLTA 2N1BA 1Q95A 3AI1A 1X7WA 2IVFA 3I1YA 4GMGA 4I4CA 1V16B 3DZ8A 1DXOA 1FFWA 4PO9A 4I1VA 5TF4A 1FUEA 2DULA 3SFTA 5A3QA 1PYGA 5AQ1A 1U8UA 2ZUDA 3IULA 4A1OA 4B46A 4BNUA 4CIAA 1H0KA 1KR5A 4OQNA 4Q4HB 4C6RA 4C5AA 1B8VA 4XR4A 1W59A 1DKUA 4PC3A 2HSGA 4ZVTA 1QE5A 3IEPA 3NGLA 3ZN2A 2P5SA 5CX1A 4QXAA 1HOXA 1VYVA 2QMOA 3HVKA 3ED1A 2W2OA 3DL0A 4FGUA 4FT4A 1GJRA 1JEAA 2JFBA 5JVDB 1NMZA 1ORHA 3CT4A 1RLMA 4QYTA 4B4WA 2FR1A 2DOGA 1B8NA 5LA6B 3FPEA 3DQQA 3NHWA 4AZVA 4RSMA 1Y5IA 3D43A 5CK5A 1X42A 4RZXA 4QDUA 3HDGA 1CRWG 1VLZA 4MQEB 4P3IA 1PJSA 4AJJA 1WPCA 1DADA 2EJVA 4PXYA 4RLFA 5SY9A 3S5JA 1LJUA 1MVNA 5A1JA 4EZBA 2GCOA 3VPBA 4OFZA 2DY0A 4ICIA 1CS0A 3IJPA 5PGMA 4P0PB 2O7QA 2IOYA 4S05A 1ZW6A 4ZGGA 5KYYA 4J1NA 2BEWB 4GBJA 4HQKA 2XMQA 4B7CA 4PVCA 5EMNA 4M3NA 1GTRA 4D4HA 3EBPA 1SVUA 2PLFA 5ARDA 1HQCA 1X9GA 3W5VA 3T5CA 2C92A 3V34A 2O52A 421PA 3O1HB 1BAPA 4EDHA 4YT8A 1MPTA 5EKSA 5JQGF 3DVQX 1C3JA 1XFOA 4EY8A 1EM8B 1WU7A 4OREX 1EXVA 4FYPA 5EQTA 1S9HA 1YVEI 3ZTWA 2ERYA 1UXGA 2WTNA 3ACDA 3MJSA 3OO1A 4EJ6A 2P4HX 4G1VA 3SJBA 1NUHA 4XVQA 1FP4B 1F17A 5IAAA 3IP9A 1VTKA 2RHRA 4RHYA 5E38A 1IYZA 4GKKB 2PEYA 1T4GA 1L6RA 2Y05A 5JHGB 5LQJA 1Q86D 1PJRA 3TFQA 3WNDA 3PVDA 3I6IA 3KR9A 3QPCA 1R18A 3BQMB 3EVEA 3LXUX 3UMGA 5J1SB 3BWYA 4FKMA 1SC6A 3WK5A 4CI9A 3E4CA 5TPWB 2TMKA 2FQXA 2NG1A 1YBAA 2C31A 2WTBA 2ZBQA 4JYBA 4JUAA 2QZZA 1J06A 1KAHA 4BVJA 1EIZA 3CPJB 3GROA 3H6HA 5FOVA 5IMSA 4J0EA 1I33A 3PT5A 1B0ZA 3CC4B 1OPRA 2QYTA 1O87A 1P80A 2BFCA 2HPAA 3D2AA 4GRDA 4V3BA 1JAYA 3OZEA 4ZV9A 4ECEA 1BNCA 3RIHA 1UL1X 1BXKA 1Z0IA 2V45A 3A1FA 4GUAA 2GZ1A 1A76A 4MW5A 5E2BA 5EHNA 4BUZA 4PCAA 1YZVA 1W2BB 1L5OA 4Q1BA 5ELXA 3JAKB 1VQMB 3LUCA 3G5AA 3I05A 5KAPA 3BY1A 4H7JA 4RTJA 1COWA 1GVHA 1PJCA 3D2BA 3AF5A 1U9CA 1UJ4A 1CIVA 2F1HA 2FW8A 3ZQJA 4DUPA 1VSQA 3LWZA 1W29A 1NR1A 2JIBA 4QEKA 4A9AA 3ZEAA 4H1WA 3M6WA 2QF7A 2YWHA 4KEAA 5L3SB 3B1WA 3ORFA 1XDWA 4XVUA 3Q3HA 4JI8B 3EXEB 1VXOA 2HDHA 2YY6A 4PYJA 1P7WA 4JB3A 3TIGA 3FUWA 4G8DA 5D86A 4YRDA 4Z2YA 2C5BA 1WOMA 4ER7A 3H86A 4Q47A 1CV2A 1RAIA 2I8AA 3KE9A 3RDPA 4E0FA 4ZI7A 1T6ZA 1J90A 5AVWA 2ZGVA 1UD3A 1AKYA 4YTEA 5IMBA 2X8JB 4K3VA 3TDMA 4UOZA 9ATCA 1CP3A 3ITDA 3QSYA 1HEUA 3HZOA 4AYWA 4H6VA 3GMIA 2E87A 1JKFA 4A8PA 1JIJA 3QEMB 1CJMA 3AHHA 4DSNA 4DDTA 4AYXA 5BYKA 3CUVA 4JP5A 1N3LA 1UBNA 4BMVA 5JZMA 1OX4A 5IJ0A 4Q7QA 1CZNA 4EPYA 2RJ3A 1AH2A 2AQIA 2CHQA 3PWZA 4NOJA 2VDVE 4XB6B 3TVDA 5T57A 1NRIA 2WIAA 5K99A 5GGYA 4M4SA 1E3EA 1SXGA 4Q82A 3GLHB 4MPPA 5FBRB 1WP9A 3QWHA 4N39A 1A2BA 3DUWA 2IP4A 1OXVA 3ZZ0A 2QMEA 1R8JA 2YW9A 4JSYA 2RIRA 1YRQA 1Y9AA 2PYDA 3MEQA 4YONB 3GLUA 4E2WA 3FUVA 3H0KA 1TU3A 1XAGA 3I6BA 1KDVA 3FOZA 1Z0JA 2R8XA 4U2BA 1PZEA 2GK7A 3JYOA 2GYUA 3PQ8A 5AI4A 4CGYA 1VG1A 3QVGA 4QU5A 3INTA 3LPAA 1YS1X 1CQPA 5M2QA 2A1IA 4HAUA 4HLCA 3V4PB 5EIAA 4R2IA 4UEJA 4Z9XA 2QSZA 2JAHA 4ALLA 1VDMA 2IEYA 1TEXA 5B57C 2WJPA 3SQNA 2IS6A 3DAYA 3REFA 4RPDA 3FYTA 1VMDA 3EVDA 1NW4A 2D06A 3NDPA 1Z6YA 3TSAA 5F7XA 1X7ZB 2FK7A 2XGOA 4HFMA 4UMVA 4LKRA 4N3CA 3H5IA 4AO7A 2JI7A 3EIQA 2P2GA 5BV2P 2YNMC 4DMGA 3A35A 4TXMA 1KVRA 2FUNB 1OXXK 1QLHA 1ORWA 4LXYA 1WTHD 1BVYF 3PQ3A 2XKJE 3AB8A 1PFGA 2J6HA 1ZJZA 1OUMA 2GH1A 2XUZA 3I45A 3DA8A 3H4VA 4MKGA 3O8CA 2O8BB 1PJAA 4AS1A 4V24A 4X91A 1RCFA 1FL9A 2PHZA 3OWOA 3UJDA 3ZY6A 4XI9A 5JAUA 4R2WA 4WFJA 4ZZ0A 2XADA 1BCRA 1HPLA 4BDSA 2AEJA 1CR6A 1X80A 3V8EA 3TCNA 4NZZA 3K9QO 4HGZA 4K2AA 5L95A 2XWQA 2VOEA 3HO8A 2IPOA 3VU3A 2ID4A 1W8IA 2XMCA 3V00A 3N6RA 5DLPA 1RI2A 4HK4A 1SIBE 3BYZA 2IFTA 1JBKA 1W93A 2C98A 4KVAA 5AM0A 5B2FA 4LJAA 3KDAA 5IX8A 2QPOA 1PQUA 4OL0A 1J23A 5FL3A 1QJCA 2DPXA 3GT4A 1LJ8A 2PFSA 3O82A 5CDUA 2ZXIA 4MS3A 4HYYA 3SHOA 4DDUA 1E9CA 2C4TA 1G7TA 5EKDA 3FYUB 4RM0A 3WBJA 1RKBA 1H69A 3IAFA 3TOCA 3GEGA 3QLTA 4KKSA 1DCMA 1Y7HA 3AKDA 3RU2A 1G7SA 3QE3A 4TV9F 2LPMA 4DBLC 5TE9A 4OFXA 2VHTA 4MDEA 1G21E 2VAPA 3PUXA 4OM8A 2I6UA 3CSSA 3HNOA 4ZO9A 5HMLA 2H1WA 2BP7B 2WIKA 4F71A 2Q1SA 2E1RA 2WBLC 5HE9A 4KACA 3WLHA 3C8DA 3GMDA 1D1SA 2W8BB 5MN4A 3K2BA 3PEWA 5BW6B 3LYLA 5ESXA 1H2FA 2ZYUX 1MGOA 5CFQA 4OQMA 1Y3AA 2FSUA 2VS1A 4RZ3A 3NWEA 1KPIA 2YRWA 3MWEA 3ELYA 4EB0A 4FM9A 1FW6A 3W1EA 2FN3A 4K9PA 1OHHA 1XWIA 2O2ZA 1Z2EA 4I8XA 5F5LA 4MV4A 1M1YA 4YJ2F 1UPBA 1BXGA 3SI7A 3VR5A 4D6XA 4PX2A 2D2IA 2EC5A 1E5QA 3A7EA 5JYEA 4B47A 5FTJA 3NC0C 5KO2A 3H42B 5F52A 1LRKA 4FGJA 3KEMA 4GM1A 2ODBA 4II7A 4D9CA 3P9QA 3CUKA 1B4DA 1CUYA 1FX0B 1KJWA 1BEEA 4U7PB 2XI4A 4J03A 4JLJA 3T3PB 1DCFA 3HA3A 3DDSA 1DU4A 1K6MA 4L6IA 4CR7A 5LSAA 1ZMOA 2DETA 4QJ3A 1O9GA 3A8KA 3HB7A 4QARA 2IH5A 5H80A 3GLKA 2V6FA 3CVUA 1YJCA 3N8KA 4E1BA 3U6BA 3AHCA 4KE9A 1I2MA 5K0ZA 4JR1A 1HDXA 2JH8A 4P4UA 5J2TF 2P4EA 3KZNA 1YVPA 3E9ZA 2QL6A 4FXUA 4GX5A 1BGWA 1AN0A 3T0GA 3DEJA 4CG2A 5KVQA 4LRTB 1ZUNA 4TL9A 2VJDA 4GI2A 2H2HA 4DR7B 4Q3DA 3SEQA 2Z9CA 3IKJA 4I8IA 5ECDA 3AMVA 1MNAA 2Z5VA 3GUYA 5FTWA 1PW5A 2FSVC 3H5VA 4IDOA 2INGX 5HCUA 1WR8A 2AOXA 5F4JA 4P1VA 3AR5A 2VWPA 4EAQA 1KTVA 1O4VA 3M5PA 4YFVA 3HKBA 3ROQA 2OBFA 2EKBA 2J3HA 1BHSA 3QU4A 4Y9DA 3WZLA 2AJ8A 3R44A 4BB0A 1U0NA 1RAEA 2P62A 4N49A 2JIDA 3DD5A 4BO0A 3EIUA 1CQXA 4XQGA 4EPXA 1DRJA 4JC4A 1YIJB 3RIGA 1V2HE 5C4IA 1FFBA 1RI1A 1QQ6A 4V0QA 1DRUA 2OZPA 5ALLA 2B8NA 4LE1A 4M55A 3A1TA 1VMAA 5KX5A 4MW7A 5HG0A 1GZVA 5CBPA 3AVVA 1YS4A 3T5DA 1BH2A 1EP2B 2AF4C 1KK2A 3HACA 4H17A 4EB6B 1ZR4A 4YT2A 3E2IA 2YFKA 1YBMA 4MW4A 4RV9A 1QOZA 2R5WA 5G53C 3JQ7A 1PQWA 4GR9A 1NVVQ 2B8WA 2PE5A 5DCYA 3N2KA 5IYZA 4KDFA 1F3LA 5JT1A 1YZUA 3VR2D 1PR3A 3HN7A 3G2PA 4L2IA 4F7DA 2RGBA 1ULSA 3GGCA 3ISVA 4L8FA 4TKUB 3VI3B 1SPBS 3KT3A 3ICQB 1I4TD 4D3YA 2WA2A 2NT3A 3WA6A 2B1GA 3U4QA 1W4LA 1SVLA 2Q28A 4YRNA 4G1BA 3ZGYA 1T3SA 3Q2OA 1ISPA 4N03A 1QH9A 4FXPA 2IOFA 3S27A 2PUEA 4NXNB 3A1WA 2F1LA 1MLDA 3B1KA 1TJNA 4WZKA 2J6CA 1C7EA 2DZDA 2CLMB 2FHSA 1VPDA 1VL1A 4JQZA 2OUKA 4JXJA 3D54D 3T38A 4X64B 4N01A 2Q3HA 1IXRC 3HM2A 4JI4B 1DBVO 4QYSA 3F47A 1PGOA 2AOTB 4I19A 8ADHA 1I1HA 4HWRA 4QPZA 3TX6A 1H1DA 5EPUA 3VNQA 5I7WA 1DINA 4GDMA 4XXHA 4ZCQA 4ARZA 4ZVNA 4CIYA 4BZPA 3HEMA 3FMFA 3VHLB 4D80A 3STVA 4YRLA 1JJVA 2VDNB 3A9VA 3NBYC 2IGTA 4ZOLF 4DADA 2MYTA 1POXA 1U0GA 5KUTA 3D8SA 2P41A 3I9KA 4AJKA 4YS6A 5BP7A 4TMVA 4V0SA 2JGLA 3IR7A 5AJXA 2OCAA 1OI4A 2AQ8A 3C87A 3OT4A 4JCCA 2BTQA 3Q10A 1DC8A 3CMAB 2ZRMA 4TZTA 3RG8A 2G1PA 2AG5A 4CMKA 1FU4A 3EMKA 4IFTA 1Z6XA 3MUOA 1UUFA 3C8ZA 4NZYA 3WQQA 1NW7A 5K45A 2BZ1A 3CLUC 2X0IA 4L5BA 4MRMB 1PD0A 1NI5A 2PMFA 4DSTA 3ZJYA 3QXGA 3GLGA 4Q9IA 2P2LA 3F90A 1K6XA 4FSXA 5AVZA 5KYYB 2J6IA 4FMCB 4U7HA 2GNOA 4Z3DA 5HOQA 3PL5A 4YV1A 1R5NA 4CEJA 3FBTA 4Y7DA 3WIVA 5IKEA 3HBNA 2HWKA 1HL7A 1C3EA 1B8OA 3EVAA 1GPYA 1AKEA 1YXMA 3OQIA 1JDSA 3ZLBA 3HJTA 4NEGA 4DV1B 2UXDB 1RJ9A 2QGFA 5BWNA 1PJ5A 5CT4A 3V9PA 2QRJA 3VJKA 5LXTA 3E9QA 2PZFA 4NS1A 1P6XA 1UKBA 4EQ6B 4FI3F 1L5VA 1WUTA 1SOMA 4M1OA 1TIKA 1TZKA 4L0DA 4X1IA 3ZDYB 2AOUB 3W8RA 3EGWA 1ULZA 3BH0A 4OATA 4R83A 4JU9A 5J1TB 2A9OA 5K6AA 1F2TA 3EPRA 1N07A 1U7OA 3AFNA 2I1WA 2NV4A 4XR9A 3IV9A 2NXWA 2MSWA 4HDMA 4YO7A 5JEDA 3VUFA 1J70A 1DHTA 4BVEA 1D0IA 1P5FA 4NK5A 4R1TA 4ZVQA 3SE7A 5LP6F 2F17A 2XE7A 4XGRA 1K86A 2YIMA 2DMRA 3IRUA 4QRIA 2GSWA 1QOQB 1XCLA 4WZEA 5IFLA 4UHBA 3SZOA 3X3HA 1P0MA 5ALSA 3DPSA 4U2EA 3LDHA 4LY3A 2PKYX 4FNMA 4D02A 3BXPA 821PA 2PTGA 3HCOA 4EO9A 3WLKX 3KOZA 2CK3A 1QBKC 4BU0A 3WKCA 4OX9Y 4UUPA 2HHCA 2ZZNA 1OROA 4JYAB 2FE4A 2ONYA 3ZTTA 4F6LA 3JV7A 3SPXA 1FDWA 2XD9A 4OP2A 4HZIA 3W5DA 4FZ3A 1GNRA 2V96A 3GLIB 2J7KA 1YI0A 2P30A 3C97A 3VQTA 3V5NA 1FZTA 1Q7BA 1DL5A 3ENKA 2IYNA 4F9FA 3CVYA 2VJQA 3CONA 3Q41A 1DEXA 1Z2CA 1Z6GA 1QFSA 1OB2A 3MK31 3PEUA 2L69A 3PPIA 4IIEA 2PVSA 4PGOA 2PL3A 1D9ZA 1PJ2A 3P0HA 4O8ZA 2Q6IA 5ECWA 5DISB 3K0EA 1P2VA 1IBMB 3ICEA 1AQUA 1X38A 2X2EA 1HQDA 4X7RA 1G8HA 3N8NA 2D2EA 2OCPA 4ZQBA 1FZQA 5EE9A 4ENUA 4ZICA 4OHCA 2EOAA 3PCTA 2Z4RA 3PDIA 5JH7B 3K70B 1VQOB 3ZW7A 3C5EA 1JS1X 2HO5A 1P3DA 2V7WA 1ZNZA 2XQGA 2AN9A 3GU3A 1YZNA 1X94A 3IXMA 3MPOA 1NW3A 4I9UA 4WKPA 3VDRA 5FUMA 4B7UA 4Y7CA 4R5HA 2XB2A 3T9FA 3ZIAD 2ZJZA 3ANNA 5GAJA 4HT3B 2WSMA 5FNVF 1I0LA 3AQIA 1C29B 2FFJA 3UKJA 4ZMRA 3V2UA 4JUCA 1SBCA 1T24A 1A82A 3CURA 1NR5A 5DGTA 1BGVA 1GUZA 4HHEA 2DXIA 2WHPA 3H9CA 3EWNA 4Q0MA 4JJGA 2FPGA 1BWRA 4ESHA 5K8JB 1N2GA 2GO1A 2YJTD 1H0SA 2WEKA 3BZUA 4V0OA 1TCCA 2CFSA 1G18A 4YAUA 1V7CA 4DY4A 4TTVA 3X1JA 4GS5A 1D4ZA 1XVAA 1ZD2P 1Q7CA 4EFKA 5U9CA 2H4JA 1DLIA 1E2PA 3SJUA 2RB4A 3HWSA 2GARA 1AZWA 1S3FA 4TL7A 4E2YA 3THWB 4HTFA 3T51B 1YRBA 2ZQZA 1GUFA 3Q3IA 4BNMA 5TMPA 4B84A 2VSFA 5K0GA 1ISHA 4KMOA 1TZCA 4YELA 2FWJA 1YOVB 1Y3CE 4PHGA 4RFLA 2J59A 1Z37A 4EI7A 1FFXA 5AOVA 2WMOB 3F7TA 2F90A 4KO1S 4TV8B 3F5QA 1N2CB 2NU6A 2H7XA 2I7XA 5EWLB 5GQSA 3RTDA 3L0PA 3U3XA 3VPDA 5JZOA 3IP1A 1MJGM 3L1JA 4DIDA 4N3AA 2Y9MB 1LI5A 3A6HA 2HTFA 3FE2A 2QQ0A 3H99A 4C2AA 2QVCA 1M2VA 1YV9A 4K86A 3GEPA 4TMYA 4BMDA 4ODIA 4GOND 1DWUA 1W0KD 3LQ4A 1QQBA 4XCVA 5I7OA 4MYUA 3FPJA 4J9VA 1L5GB 1RPNA 4HAZA 1QFYA 4M37A 5A2GA 3FTNA 3LNCA 1Z0SA 2JRLA 1Z3IX 1G2QA 1W30A 3I55B 1YK1A 4M7PA 3F5SA 4JLKA 1NPYA 3HUEA 3RHTA 1ZWKA 3RSSA 3AIKA 3VSAA 1ADCA 2BPOA 3ELBA 3K9LA 4PBRA 3E1YE 4H2DA 3TLXA 5LOVA 5F2NA 2ZDHA 2N0SA 3N7UA 4BN4A 2F6RA 3NZEA 1ILEA 1QO9A 3TGLA 3FTDA 1L7QA 3IQEA 3WIOA 1NHGA 4MULA 2FA9A 3T8YA 1RWQA 4BRUA 3OP1A 1XZ8A 3EARA 3GCGA 2C88A 3UFXA 3WYBA 4HNTA 4G4JA 5CA0A 5JQWA 5BSEA 2PUHA 2QLMA 4I3FA 2BCGY 2DSTA 4HYQA 2R6FA 2C00A 4WLOA 1VQNB 3BCSA 3B48A 1B0UA 3TQIA 3UAXA 1BW9A 1UC8A 3EZLA 2R1VB 4JUFA 3VKWA 2XOKA 3P2MA 1RXCA 4HDKB 5MGNA 3ADCA 2R6AA 1Q7RA 3K16A 4M1ZA 2HREA 4BLPA 1CC1S 4CV3A 2UYGA 3RVRA 4Q4JA 4CI0B 3KYJB 5KVSA 1R8XA 1S2LA 4C20A 2WKWA 2Z6BD 5MDHA 1QVWA 1KBQA 2HA7A 1J25A 3KLMX 3DMDA 5IEJA 5K6RA 2W6JA 1JE0A 1DOZA 1HDZA 3AONB 4B40A 5AW6A 3KQUA 4XLHA 1FJHA 1NSTA 1QSGA 1XC7A 2A0XA 2EFEB 2FZ4A 2QLTA 3FI0A 4K40A 3EN0A 4FHZA 1H2YA 2GKSA 4GO1A 4HEQA 1Q16A 4ZCIA 4TM7A 1I9CA 4B80A 3MLAA 3W2GA 1NVBA 2DH5A 4GAEA 3PDWA 2J67A 4HVAA 2W8BA 4MS4A 4G1MB 4WY2A 1CUXA 3SG0A 5LR6A 2CKDA 1AT1A 3B6EA 4M1KA 3QYPA 1GT6A 1V41E 1TE2A 2GLXA 1UXKA 3FKQA 4A8HA 1R0ZA 2WAOA 1DMSA 5CA1A 4OPMA 2W43A 3TG2A 1LV7A 5F3WB 4HB2A 3NNNA 1N2IA 1VLMA 1ZN2A 2FZCA 2VPWA 1KZHA 1F0KA 4EMUA 5CTAA 1QRSA 2XCUA 4P6VF 4C4SA 3NWJA 2JK1A 2AFHE 1ZGHA 2DPYA 1DSSG 3IOCA 3T3HA 1X9IA 1IAQA 4U8GA 4XZ3A 4X00A 2JG3A 4BNTA 4NZNA 3TRJA 2O7RA 1BEUB 3I34X 3JVIA 4DA4A 3RVJA 3LQ6A 4KV7A 3T7IA 3OJXA 3IIMA 4MIOA 2C1XA 4IMIB 2HDNB 1U1DA 4TL6A 2QL9A 4FOPA 1A3CA 2JZNA 2EAUA 2AOWA 3BBLA 2JIRA 3HV2A 4NDNE 5JMWA 1W5AA 3QKTA 1OGIA 1HEIA 2DFVA 2YOHA 5KC9A 3H65A 3FYDA 2PK3A 4JJEA 3ZD9A 4CQMD 1QVAA 1YS6A 3DVSX 4MS1A 2NUTA 1VJ0A 3MLBA 2VHYA 4NQZA 4RKQA 3RRYA 3RK0A 1U1GA 1Y9JA 2VJBA 5ELMA 3EEBA 4S1OA 1RYDA 4JEUA 4Z4ZA 4TS4A 5KU1A 2VHVA 5EUQB 3HK2A 3T3OA 4MVCA 2OXRA 4HDCA 1L7NA 2WYOA 1Q81D 4X7DA 2LP4Y 3B85A 3S70A 3ZDXB 5FA6A 2AX4A 3TPZA 3AEKB 4D4MA 2FWNA 2X0RA 3FG9A 1URPA 4NECA 2ECOA 5REQA 4JBGA 3MOGA 3PA6A 3EZXA 2G25A 1EKXA 2QJRA 3ILSA 3KC2A 3OIVA 4MUKA 3TK1A 4RVFA 4PTZA 2XRZA 2FV8A 4B09A 1WU8A 4G67A 1ZAKA 3SVZA 2JH3A 3ETJA 3IAS1 5F51A 4RHXA 3RYFB 5JCJA 2QNIA 3G9XA 2VC2B 4RYLA 3UWOA 1PR9A 4G5GA 1E60A 2AB0A 2VHQA 2ZYAA 4X9XA 2HXGA 4JKIA 3DLHA 3ZHBA 4NKRA 3MCZA 1P1CA 4IWYA 4W9NA 3DFIA 1PE0A 3RRNA 5AI9A 1W4AA 1E2EA 1MO4A 2XQVA 5FRDA 1FBTA 3TSCA 2JJ1D 5ALUA 2DP4E 2W4MA 3GZ4A 4L2IB 3K71B 1FMLA 3CX6A 1E9EA 4JT2A 5ALXA 4FCCA 4FZRA 1QZZA 1QMGA 2YRFA 4DFDA 2TYSB 3P9KA 1JAXA 1U1IA 3OKCA 1SVMA 4OU4A 1GZHB 3R8CA 1GYRA 3L7OA 3VNSA 3IDFA 3WP0A 2PUBA 3K72B 3T0IA 3Q40A 4F3CA 1YDMA 2PGNA 1UADA 3AF1A 3DLTA 4JT4A 3HEBA 2BJWA 3EDMA 1PSWA 1WMFA 4OJQA 5CJPA 2P78A 4LA4A 1TQ2A 4E70A 1KAOA 3EOBI 2PMDA 3EW9A 1P8AA 4GPIB 1ZM2A 3MTEA 4J1SA 4KQWA 4R3NA 1QHXA 1E7RA 4X6YA 4DQDA 3IKTA 2B78A 2LUOA 2X1HA 1UJ2A 5HZKA 5LBUA 1PLLA 4IDBA 5EXTA 4D3XA 4GXRA 1N9GB 1XJ0A 2JHAA 1G8AA 1G17A 3GJQA 4AWXA 3DKRA 4JU8A 4P82A 5AN9A 5JPDA 1UQUA 4EKDA 4ZOLA 1LDBA 2XUDA 2Z04A 2I22A 3VU8A 2KLBA 4XN0A 1Z74A 5I4BA 2EZUA 4P7BA 2L18A 4DAEA 2HMAA 3M6MD 5I01A 4Q1AA 2OILA 4O4IF 4PRZA 4XH9B 5EL0A 3EULA 2W6PA 2J6BA 2AZMA 4A2CA 4YXFA 5KNCA 4BTVA 4HNAB 3R3UA 1C0LA 3L7CA 4RJ2A 2R6HA 3D6NB 5B2EA 4XGNA 1IXYA 4ZEXA 1OJ7A 2QSUA 3SFZA 4LVCA 1ESNA 1G98A 2I1QA 3DWEX 3PGJA 3RS0A 2DC1A 2GASA 3BRCA 1GCGA 3K1AB 5A0FA 1UEJA 3HI4A 1LC0A 2LCIA 3WG9A 3UIEA 4BV9A 1RMYA 5CB4A 4MV8A 3EF0A 2XEXA 4G9EA 2B0CA 4WJZA 3E5RA 3G8CA 2BJVA