4RLZA

Crystal structure of norovirus oif p domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
306
structure length
306
Chain Sequence
TKPFTLPILTIGELTNSRFPAPIDQLYTSPNADVVVQPQNGRCSLDGELQGTTQLLTTAICSYRGMTSNPTRDYWDGHLLHLVHPNGATYDPTEDVPAPFGTQDFRGILYGVLTQNPRASGDEAANSQGVYISSTSEKFTPKLGTIGLHQVQGNIASNQQSKFTPVGIAVNGNTPFRQWELPNYSGALTLNTNLAPAVGPNFPGEQILFFRSNVPSVQGGQPIEIDCLIPQEWVSHFYQESAPSQSDVALVRYVNPDTGRTIFEAKLHRQGFITIAATGSNPVVVPPNGYFRFDSWVNQFYALAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title A Unique Human Norovirus Lineage with a Distinct HBGA Binding Interface.
pubmed doi rcsb
source organism Norovirus nlv/if1998/2003/iraq
molecule tags Viral protein
total genus 70
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rlzA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rlzA01
4RDJA 4WZEA 4Z4SA 4RPBA 4Z4RA 2ZL5A 4Z4TA 3BQJA 1IHMA 3LQEA 3R6JA 5J35A 3Q6RA 3PVDA 5IYPA 4Z4UA 4X07A 5F4MA 5BSXA 2OBRA 2ZL6A 3Q3AA 3RY8A 4P3IA 2OBSA 3LQ6A 2OBTA 3Q38A 3Q39A 5E6TA 4X0CA 5HZAA 4Z4WA 4P1VA 3PA2A 4OPOA 3SJPA 5IYRA 4X7DA 4OOSA 4WZTA 2ZL7A 3Q6QA 4X06A 5IYWA 3V7AA 3ASPA 4RLZA 4OP7A 5IYNA 3ONYA 4RM0A 3ASRA 3ASSA 5J3OA 4P12A 4X7EA 4Z4VA 4QUZA 5F4JA 3BY1A 4ROXA 4QV2A 5IYQA 4X05A 5HZBA 4WZLA 3R6KA 4P2NA 3ONUA 4P26A 4QVJA 5BSYA 4WZKA 3PUNA 4OPVA 5F4OA 4Z4YA 3BY2A 3PUMA 3SEJA 4RPDA 4OOVA 4OOXA 3SKBA 4OPSA 3PA1A 4P25A 3ASTA 4QVAA 4X7CA 4RDKA 3SLDA 3D26A 4RDLA 3SLNA 5KW9A 4X7FA 3ASQA 4Z4ZA
chains in the Genus database with same CATH superfamily
3OZUA 3WNBA 1W87A 4AVZA 4ZV4A 4Z4SA 1XE1A 2XZLA 2GJPA 4AF6A 3LQEA 1T6YA 4M0LA 5J35A 1E3ZA 2QE7A 2D3LA 1VQLB 5FO1A 4WQMA 1QX4A 1DDIA 1EP1B 2DCUA 2WZNA 3CP8A 3W5UA 1DDGA 1R5NA 4RD0A 2V7UA 3ZPNA 1G7CA 2C5HA 2DEUA 1K8AD 1RQPA 2OTJB 3GQBA 1YX2A 3OJWA 5GV7A 3AVYA 2X6YA 4B4DA 2VBVA 2ZL6A 4HIZA 4DNTB 3CCSB 5TR9A 2E1BA 2QDXA 1VQKB 4P6VF 2WYRA 3AGPA 1W0KA 5H5JA 2FVGA 1VQMB 4TT3A 2W6JA 4K1XA 2XGJA 4YAFA 2PE3A 1WSVA 4DK0A 4RD6A 3PA2A 1GVHA 4PC1A 5EMNA 4PGOA 2GQFA 4PC3A 3OE7A 4G6IA 3H94A 5IYRA 1VF7A 4TKOB 4X7DA 4RCZA 3WNCA 4FWTA 1WOPA 3WBKA 2YWHA 3W2IA 4AF7A 2WZPP 2VBSA 5IK2A 5FO0A 3SJZA 2VYQA 5IYWA 3BC9A 3ASPA 2WSSA 4N3NA 2OYNA 5FL7A 1VQ9B 1QUEA 4G7XA 3FJOA 3A3GA 4XMYA 3W5HA 1GO2A 1VQ7B 3OZWA 4RD1A 1Q7YD 1KK2A 1OGJA 3CPWB 1KC8D 4P12A 3GVKA 4XN0A 5JBQA 2I1LA 2GREA 2D3NA 3B78A 1EP3B 4LBVA 1FRNA 4NBSA 4YHBA 5H59A 3J81k 4B48A 1B23P 1TUIA 1W9XA 3ONUA 4QVJA 1G7RA 4WZKA 1Y0RA 4LBZA 2X0KA 2CRVA 2X3UA 1EP2B 1KMHA 5TRDA 3W5VA 1YLOA 1KK1A 4RD2A 4RPDA 3CCUB 1BX0A 2F4NA 4OOXA 4B3XA 2OK8A 1Q82D 3CCLB 2J7KA 1VQNB 1EFTA 4M2LA 4UZUA 1COWA 3ZZUA 1JNYA 3OAAA 2B7BA 4PC6A 1Q86D 4XONA 4RD3A 5KW9A 2GK6A 3CD6B 1E3XA 1UD3A 2XEXA 1Q9SA 4Z4ZA 1TTTA 2B7CA 2ZZGA 2V4DA 4P22A 4JMQA 1EFUA 1FRQA 1GAQA 1N0VC 4WZEA 3W2HA 1IJEA 1PKVA 2Z6BD 2ZL5A 1KK0A 2DERA 2Q6IA 2X6WA 2HCJB 1WU8A 1VHOA 3G4SB 3FPPA 5IYPA 2VJJA 3JU4A 4TMZA 1WDTA 1RQRA 5L46A 1BPLA 1OGIA 1WOSA 3WYAA 2WR8A 3ZUGA 1UD6A 3ISXA 1KTVA 4PAAA 1XB2A 1E79A 1PJ7A 1T5EA 3CMEB 3VR6A 3OEEA 3A3BA 2OBRA 3Q3AA 4HE5A 4B3FX 1ZUNB 1R5BA 2ZXHA 1S4MA 3KL9A 2OBSA 1EXMA 2QN6A 2DY1A 1YJ9B 1G7TA 1E63A 1BMFA 4NNJA 1VQPB 1F60A 2V7XA 4X0CA 2QEXB 3CC4B 1NB9A 4FN5A 3AVVA 1UD5A 4P6YA 4Y9RA 4B43A 2CC2A 2YWFA 3OZVA 2WJYA 4OPOA 1VJSA 4YAWA 3VO1A 5B6IA 3CCEB 2Q6LA 3QFCA 1N0UA 3SJPA 1NB0A 2HDNB 1Y0YA 1DARA 2JDIA 3CCMB 5A89A 1N06A 3CW2A 1I18A 3OPOA 1QGYA 3AVTA 2ZTGA 1WTHD 3AVXA 2JJ2A 3BNWA 2C77A 3V76A 4XKWA 2NV4A 4RLZA 1NJID 4ZCIA 4UAJA 3I55B 1J9ZA 4OP7A 1VQOB 1S72B 4DQKA 4XQFA 4ACAA 2BGIA 3CB4A 1W34A 1QH0A 2BM0A 3ASRA 3ASSA 5J3OA 1ZM3A 3OP1A 4YELA 4N3GA 4QHYA 1IB0A 1YI2B 2X53S 5F4JA 1AIPA 1D1NA 3T53B 3OJXA 4Z1MA 3A35A 1XQBA 1TLLA 4QV2A 4TMVA 4U9UA 4FXUA 3FPKA 4WZLA 5FIUA 1VQ8B 1GR1A 3LO8A 3NE5B 3ZIAA 2HMAA 4P26A 1VLYA 2CK3A 4XR6A 3PUNA 4M4SA 2V7TA 4XORA 1YIJB 2PLFA 5FNZA 3SEJA 1ZM9A 2CBXA 1VQ5B 1SKQA 4LBYA 2VNKA 4P9SA 3WQZA 3SKBA 2C4UA 4OPSA 2XNJA 2E1RA 4P25A 3ASTA 5HKKA 4X7CA 4G1BA 4QFMA 1UD2A 1HZEA 4WWVA 1JJ2B 4YALA 3JQQA 3SLNA 3W2EA 3OFNA 4E0FA 5GV8A 4LC0A 1KJZA 3CESA 5HXBA 1QVFB 4RD4A 2XOKA 4KKTA 1FDRA 3CP2A 1HVXA 4PC2A 1BJKA 4RDJA 1SKYB 2ZBVA 4RPBA 1YHQB 3A1PA 1UD8A 4Z4TA 1N05A 1IHMA 4MYUA 5DSZA 1E1RA 2PMDA 1HA3A 1V5VA 3PVDA 3QSYA 3PENA 2KVOA 3T56B 2OTLB 1JA0A 3OW2B 2X85A 4KKUA 1M90D 2W6IA 5CDFA 4R71A 4X07A 4Z4UA 1CNFA 4XOTA 2GJKA 4YEJA 4X8IA 1T6ZA 3LNNA 5F4MA 3OW7A 1OB2A 3A8KA 1EFCA 3G6EB 3ZZTA 2R9VA 5KSWB 1Q81D 5BSXA 4XLAA 4AC9A 2GK7A 1W35A 1VQ6B 5AN9A 2M5SA 5A88A 3LQ6A 2C5BA 2OBTA 1H42A 1YJNB 4PC7A 2F1MA 5E6TA 4II3A 4KKSA 1CQXA 2RC5A 1VLOA 5HZAA 2BM1A 2JIZA 2BV3A 4TMWA 2JJ1A 1E64A 2C4TA 4UZFA 3I56B 2XNDA 4CQJA 1MRZA 1D8TA 2VZLA 1WOOA 4XOPA 1BQEA 5LMZA 3U6BA 3AVUA 2ZL7A 2XZPA 2ZZQA 1FNDA 3QFRA 2EFGA 3Q6QA 4X06A 4XLEA 3V7AA 3DDYA 3WNDA 1VHEA 1BLIA 1FNMA 1EFRA 2BGJA 2GPJA 2BN4A 1H8HA 1N08A 2BSAA 3G05A 2V7QA 1IJFA 2V7VA 3E20A 3ONYA 4Q7JB 2LZJA 5IYNA 3CMAB 1XFOA 3VNVA 3BCFA 3BCDA 3CCQB 2Q6OA 1E1QA 4XLCA 3W2FA 1U2RA 4BPRA 2C2WA 4QUZA 4B47A 3AVWA 3BY1A 1G7SA 2B5OA 4ROXA 1JB9A 1OB0A 3A8JA 3CPXA 2NPFA 4PABA 5IYQA 4X05A 1T6XA 2VNIA 1QG0A 4M1KA 1KK3A 3OKXA 2V31A 3R6KA 2V7WA 5BSYA 1KRHA 4P3YA 4OPVA 3GVJA 5F4OA 2CF4A 3A8IA 2ZITA 2HLDA 2BPOA 5FA6A 4TMXA 4XM3A 3MHPA 2ZXIA 3U6KA 4ZGQB 3FKSA 3PUMA 3CC2B 1N8RD 1QGZA 2QGGA 2ZZFA 3KEWA 1QFJA 1KD1D 2YWEA 5TV2A 3PA1A 4ZCMA 3MCAA 3CMMA 4M53A 3HAGA 2C78A 2CNDA 2AHOA 4RDKA 4RDLA 2QA4B 4XN3A 1A8PA 4II2A 3JQPA 3MMPA 4X7FA 1K73D 2QTLA 1M1KD 3ASQA 4XLFA 2JN9A 1K9MD 4XL9A 3ES9A 3U2QA 4YAOA 3JQRA 2P3MA 1ELOA 5A8AA 1WSRA 4Z4RA 2DIEA 2VJIA 4XD7A 1FNCA 3BQJA 3R6JA 1QFYA 1QVGB 3Q6RA 4C43A 4H9GA 1QUFA 1V0FA 4GQNA 1E43A 3BH4A 1VQ4B 4IW3B 3GSIA 2D9RA 3ZZ0A 1B2RA 1BX1A 5TY0A 3ZBTA 1P4MA 2WJVA 1PJ5A 1WORA 3QFSA 3CCJB 4HE6A 1W0JA 3CCRB 1R5OA 3QE2A 3RY8A 5KNLA 4P3IA 2XNCA 4G1VA 1WPCA 3Q38A 3Q39A 3T51B 1TVCA 4DK1A 3E1YE 2ZTNA 4XKVA 1JA1A 1UD4A 1F20A 3GIRA 4Z4WA 2F43A 2RC6A 2YWGA 4P1VA 5DN6A 4G5GA 1OB5A 4C0SA 1OHHA 2DETA 2XZOA 1FX0A 2QMUA 4DQLA 4B3GA 4OOSA 2BVNA 1E62A 2GJRA 1WP6A 1NBMA 4WZTA 4Y9UA 1N07A 1S0UA 3H9NA 1H8EA 1NDHA 1SM4A 3P26A 3W2GA 2FX3A 4EH1A 2DYIA 1H85A 4LBWA 4L8JA 4DNRB 1GJRA 4RCYA 4YXWA 2QTZA 1EWYA 4ACBA 2DOGA 1KQSB 4RM0A 2EIXA 4YAUA 3CC7B 2X6XA 2ZZEA 1DG1G 3OEHA 2OK7A 2X8KA 4RJLA 2ZBUA 3GVLA 1AMOA 1NRKA 4F7DA 1YITB 5THXA 4TMTA 4X7EA 3WBJA 3ZC3A 4Z4VA 2VBTA 3CXCB 4UZEA 2D74A 4MYTA 2R6HA 1QGAA 3I1FA 3ZBUA 2VNHA 4FK8A 4XNFA 5HZBA 2CW5A 4XLHA 1FNBA 4TSFA 3B8HA 3VNUA 3WY9A 3B82A 4P2NA 4ZCLA 2F1LA 1MABA 2Q6KA 1I8DA 1W2BB 1V0EA 1PJ6A 1ZM2A 1UMKA 3P27A 2PIAA 3VO2A 4Z4YA 3BY2A 4Y7CA 3OOCA 5DS0A 3CCVB 3CRZA 4ASUA 2VNJA 4G7WA 4OOVA 3G71B 2BF4A 4ZGNB 1KZLA 1D2EA 4QVAA 1GAWA 4NCNA 3SLDA 1I7PA 1CNEA 3D26A 3WXMA 1YJWB 1QFZA 3QFTA 4B44A 3LVBA 1ZM4A 3AGQA 2WPDA 4J0QA 4TN1A 3VMFA 1K28D 2VBUA 3CTAA 2BMWA
chains in the Genus database with same CATH topology
4RDJA 4WZEA 4Z4SA 4RPBA 4Z4RA 2ZL5A 4Z4TA 3BQJA 1IHMA 3LQEA 3R6JA 5J35A 3Q6RA 3PVDA 5IYPA 4Z4UA 4X07A 5F4MA 5BSXA 2OBRA 2ZL6A 3Q3AA 3RY8A 4P3IA 2OBSA 3LQ6A 2OBTA 3Q38A 3Q39A 5E6TA 4X0CA 5HZAA 4Z4WA 4P1VA 3PA2A 4OPOA 3SJPA 5IYRA 4X7DA 4OOSA 4WZTA 2ZL7A 3Q6QA 4X06A 5IYWA 3V7AA 3ASPA 4RLZA 4OP7A 5IYNA 3ONYA 4RM0A 3ASRA 3ASSA 5J3OA 4P12A 4X7EA 4Z4VA 4QUZA 5F4JA 3BY1A 4ROXA 4QV2A 5IYQA 4X05A 5HZBA 4WZLA 3R6KA 4P2NA 3ONUA 4P26A 4QVJA 5BSYA 4WZKA 3PUNA 4OPVA 5F4OA 4Z4YA 3BY2A 3PUMA 3SEJA 4RPDA 4OOVA 4OOXA 3SKBA 4OPSA 3PA1A 4P25A 3ASTA 4QVAA 4X7CA 4RDKA 3SLDA 3D26A 4RDLA 3SLNA 5KW9A 4X7FA 3ASQA 4Z4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RDJ A;  4WZE A;  4Z4S A;  4RPB A;  4Z4R A;  2ZL5 A;  4Z4T A;  3BQJ A;  1IHM A;  3LQE A;  3R6J A;  5J35 A;  3Q6R A;  3PVD A;  5IYP A;  4Z4U A;  4X07 A;  5F4M A;  5BSX A;  2OBR A;  2ZL6 A;  3Q3A A;  3RY8 A;  4P3I A;  2OBS A;  3LQ6 A;  2OBT A;  3Q38 A;  3Q39 A;  5E6T A;  4X0C A;  5HZA A;  4Z4W A;  4P1V A;  3PA2 A;  4OPO A;  3SJP A;  5IYR A;  4X7D A;  4OOS A;  4WZT A;  2ZL7 A;  3Q6Q A;  4X06 A;  5IYW A;  3V7A A;  3ASP A;  4RLZ A;  4OP7 A;  5IYN A;  3ONY A;  4RM0 A;  3ASR A;  3ASS A;  5J3O A;  4P12 A;  4X7E A;  4Z4V A;  4QUZ A;  5F4J A;  3BY1 A;  4ROX A;  4QV2 A;  5IYQ A;  4X05 A;  5HZB A;  4WZL A;  3R6K A;  4P2N A;  3ONU A;  4P26 A;  4QVJ A;  5BSY A;  4WZK A;  3PUN A;  4OPV A;  5F4O A;  4Z4Y A;  3BY2 A;  3PUM A;  3SEJ A;  4RPD A;  4OOV A;  4OOX A;  3SKB A;  4OPS A;  3PA1 A;  4P25 A;  3AST A;  4QVA A;  4X7C A;  4RDK A;  3SLD A;  3D26 A;  4RDL A;  3SLN A;  5KW9 A;  4X7F A;  3ASQ A;  4Z4Z A; 
#chains in the Genus database with same CATH topology
 3OZU A;  3WNB A;  1W87 A;  4AVZ A;  4ZV4 A;  4Z4S A;  1XE1 A;  2XZL A;  2GJP A;  4AF6 A;  3LQE A;  1T6Y A;  4M0L A;  5J35 A;  1E3Z A;  2QE7 A;  2D3L A;  1VQL B;  5FO1 A;  4WQM A;  1QX4 A;  1DDI A;  1EP1 B;  2DCU A;  2WZN A;  3CP8 A;  3W5U A;  1DDG A;  1R5N A;  4RD0 A;  2V7U A;  3ZPN A;  1G7C A;  2C5H A;  2DEU A;  1K8A D;  1RQP A;  2OTJ B;  3GQB A;  1YX2 A;  3OJW A;  5GV7 A;  3AVY A;  2X6Y A;  4B4D A;  2VBV A;  2ZL6 A;  4HIZ A;  4DNT B;  3CCS B;  5TR9 A;  2E1B A;  2QDX A;  1VQK B;  4P6V F;  2WYR A;  3AGP A;  1W0K A;  5H5J A;  2FVG A;  1VQM B;  4TT3 A;  2W6J A;  4K1X A;  2XGJ A;  4YAF A;  2PE3 A;  1WSV A;  4DK0 A;  4RD6 A;  3PA2 A;  1GVH A;  4PC1 A;  5EMN A;  4PGO A;  2GQF A;  4PC3 A;  3OE7 A;  4G6I A;  3H94 A;  5IYR A;  1VF7 A;  4TKO B;  4X7D A;  4RCZ A;  3WNC A;  4FWT A;  1WOP A;  3WBK A;  2YWH A;  3W2I A;  4AF7 A;  2WZP P;  2VBS A;  5IK2 A;  5FO0 A;  3SJZ A;  2VYQ A;  5IYW A;  3BC9 A;  3ASP A;  2WSS A;  4N3N A;  2OYN A;  5FL7 A;  1VQ9 B;  1QUE A;  4G7X A;  3FJO A;  3A3G A;  4XMY A;  3W5H A;  1GO2 A;  1VQ7 B;  3OZW A;  4RD1 A;  1Q7Y D;  1KK2 A;  1OGJ A;  3CPW B;  1KC8 D;  4P12 A;  3GVK A;  4XN0 A;  5JBQ A;  2I1L A;  2GRE A;  2D3N A;  3B78 A;  1EP3 B;  4LBV A;  1FRN A;  4NBS A;  4YHB A;  5H59 A;  3J81 k;  4B48 A;  1B23 P;  1TUI A;  1W9X A;  3ONU A;  4QVJ A;  1G7R A;  4WZK A;  1Y0R A;  4LBZ A;  2X0K A;  2CRV A;  2X3U A;  1EP2 B;  1KMH A;  5TRD A;  3W5V A;  1YLO A;  1KK1 A;  4RD2 A;  4RPD A;  3CCU B;  1BX0 A;  2F4N A;  4OOX A;  4B3X A;  2OK8 A;  1Q82 D;  3CCL B;  2J7K A;  1VQN B;  1EFT A;  4M2L A;  4UZU A;  1COW A;  3ZZU A;  1JNY A;  3OAA A;  2B7B A;  4PC6 A;  1Q86 D;  4XON A;  4RD3 A;  5KW9 A;  2GK6 A;  3CD6 B;  1E3X A;  1UD3 A;  2XEX A;  1Q9S A;  4Z4Z A;  1TTT A;  2B7C A;  2ZZG A;  2V4D A;  4P22 A;  4JMQ A;  1EFU A;  1FRQ A;  1GAQ A;  1N0V C;  4WZE A;  3W2H A;  1IJE A;  1PKV A;  2Z6B D;  2ZL5 A;  1KK0 A;  2DER A;  2Q6I A;  2X6W A;  2HCJ B;  1WU8 A;  1VHO A;  3G4S B;  3FPP A;  5IYP A;  2VJJ A;  3JU4 A;  4TMZ A;  1WDT A;  1RQR A;  5L46 A;  1BPL A;  1OGI A;  1WOS A;  3WYA A;  2WR8 A;  3ZUG A;  1UD6 A;  3ISX A;  1KTV A;  4PAA A;  1XB2 A;  1E79 A;  1PJ7 A;  1T5E A;  3CME B;  3VR6 A;  3OEE A;  3A3B A;  2OBR A;  3Q3A A;  4HE5 A;  4B3F X;  1ZUN B;  1R5B A;  2ZXH A;  1S4M A;  3KL9 A;  2OBS A;  1EXM A;  2QN6 A;  2DY1 A;  1YJ9 B;  1G7T A;  1E63 A;  1BMF A;  4NNJ A;  1VQP B;  1F60 A;  2V7X A;  4X0C A;  2QEX B;  3CC4 B;  1NB9 A;  4FN5 A;  3AVV A;  1UD5 A;  4P6Y A;  4Y9R A;  4B43 A;  2CC2 A;  2YWF A;  3OZV A;  2WJY A;  4OPO A;  1VJS A;  4YAW A;  3VO1 A;  5B6I A;  3CCE B;  2Q6L A;  3QFC A;  1N0U A;  3SJP A;  1NB0 A;  2HDN B;  1Y0Y A;  1DAR A;  2JDI A;  3CCM B;  5A89 A;  1N06 A;  3CW2 A;  1I18 A;  3OPO A;  1QGY A;  3AVT A;  2ZTG A;  1WTH D;  3AVX A;  2JJ2 A;  3BNW A;  2C77 A;  3V76 A;  4XKW A;  2NV4 A;  4RLZ A;  1NJI D;  4ZCI A;  4UAJ A;  3I55 B;  1J9Z A;  4OP7 A;  1VQO B;  1S72 B;  4DQK A;  4XQF A;  4ACA A;  2BGI A;  3CB4 A;  1W34 A;  1QH0 A;  2BM0 A;  3ASR A;  3ASS A;  5J3O A;  1ZM3 A;  3OP1 A;  4YEL A;  4N3G A;  4QHY A;  1IB0 A;  1YI2 B;  2X53 S;  5F4J A;  1AIP A;  1D1N A;  3T53 B;  3OJX A;  4Z1M A;  3A35 A;  1XQB A;  1TLL A;  4QV2 A;  4TMV A;  4U9U A;  4FXU A;  3FPK A;  4WZL A;  5FIU A;  1VQ8 B;  1GR1 A;  3LO8 A;  3NE5 B;  3ZIA A;  2HMA A;  4P26 A;  1VLY A;  2CK3 A;  4XR6 A;  3PUN A;  4M4S A;  2V7T A;  4XOR A;  1YIJ B;  2PLF A;  5FNZ A;  3SEJ A;  1ZM9 A;  2CBX A;  1VQ5 B;  1SKQ A;  4LBY A;  2VNK A;  4P9S A;  3WQZ A;  3SKB A;  2C4U A;  4OPS A;  2XNJ A;  2E1R A;  4P25 A;  3AST A;  5HKK A;  4X7C A;  4G1B A;  4QFM A;  1UD2 A;  1HZE A;  4WWV A;  1JJ2 B;  4YAL A;  3JQQ A;  3SLN A;  3W2E A;  3OFN A;  4E0F A;  5GV8 A;  4LC0 A;  1KJZ A;  3CES A;  5HXB A;  1QVF B;  4RD4 A;  2XOK A;  4KKT A;  1FDR A;  3CP2 A;  1HVX A;  4PC2 A;  1BJK A;  4RDJ A;  1SKY B;  2ZBV A;  4RPB A;  1YHQ B;  3A1P A;  1UD8 A;  4Z4T A;  1N05 A;  1IHM A;  4MYU A;  5DSZ A;  1E1R A;  2PMD A;  1HA3 A;  1V5V A;  3PVD A;  3QSY A;  3PEN A;  2KVO A;  3T56 B;  2OTL B;  1JA0 A;  3OW2 B;  2X85 A;  4KKU A;  1M90 D;  2W6I A;  5CDF A;  4R71 A;  4X07 A;  4Z4U A;  1CNF A;  4XOT A;  2GJK A;  4YEJ A;  4X8I A;  1T6Z A;  3LNN A;  5F4M A;  3OW7 A;  1OB2 A;  3A8K A;  1EFC A;  3G6E B;  3ZZT A;  2R9V A;  5KSW B;  1Q81 D;  5BSX A;  4XLA A;  4AC9 A;  2GK7 A;  1W35 A;  1VQ6 B;  5AN9 A;  2M5S A;  5A88 A;  3LQ6 A;  2C5B A;  2OBT A;  1H42 A;  1YJN B;  4PC7 A;  2F1M A;  5E6T A;  4II3 A;  4KKS A;  1CQX A;  2RC5 A;  1VLO A;  5HZA A;  2BM1 A;  2JIZ A;  2BV3 A;  4TMW A;  2JJ1 A;  1E64 A;  2C4T A;  4UZF A;  3I56 B;  2XND A;  4CQJ A;  1MRZ A;  1D8T A;  2VZL A;  1WOO A;  4XOP A;  1BQE A;  5LMZ A;  3U6B A;  3AVU A;  2ZL7 A;  2XZP A;  2ZZQ A;  1FND A;  3QFR A;  2EFG A;  3Q6Q A;  4X06 A;  4XLE A;  3V7A A;  3DDY A;  3WND A;  1VHE A;  1BLI A;  1FNM A;  1EFR A;  2BGJ A;  2GPJ A;  2BN4 A;  1H8H A;  1N08 A;  2BSA A;  3G05 A;  2V7Q A;  1IJF A;  2V7V A;  3E20 A;  3ONY A;  4Q7J B;  2LZJ A;  5IYN A;  3CMA B;  1XFO A;  3VNV A;  3BCF A;  3BCD A;  3CCQ B;  2Q6O A;  1E1Q A;  4XLC A;  3W2F A;  1U2R A;  4BPR A;  2C2W A;  4QUZ A;  4B47 A;  3AVW A;  3BY1 A;  1G7S A;  2B5O A;  4ROX A;  1JB9 A;  1OB0 A;  3A8J A;  3CPX A;  2NPF A;  4PAB A;  5IYQ A;  4X05 A;  1T6X A;  2VNI A;  1QG0 A;  4M1K A;  1KK3 A;  3OKX A;  2V31 A;  3R6K A;  2V7W A;  5BSY A;  1KRH A;  4P3Y A;  4OPV A;  3GVJ A;  5F4O A;  2CF4 A;  3A8I A;  2ZIT A;  2HLD A;  2BPO A;  5FA6 A;  4TMX A;  4XM3 A;  3MHP A;  2ZXI A;  3U6K A;  4ZGQ B;  3FKS A;  3PUM A;  3CC2 B;  1N8R D;  1QGZ A;  2QGG A;  2ZZF A;  3KEW A;  1QFJ A;  1KD1 D;  2YWE A;  5TV2 A;  3PA1 A;  4ZCM A;  3MCA A;  3CMM A;  4M53 A;  3HAG A;  2C78 A;  2CND A;  2AHO A;  4RDK A;  4RDL A;  2QA4 B;  4XN3 A;  1A8P A;  4II2 A;  3JQP A;  3MMP A;  4X7F A;  1K73 D;  2QTL A;  1M1K D;  3ASQ A;  4XLF A;  2JN9 A;  1K9M D;  4XL9 A;  3ES9 A;  3U2Q A;  4YAO A;  3JQR A;  2P3M A;  1ELO A;  5A8A A;  1WSR A;  4Z4R A;  2DIE A;  2VJI A;  4XD7 A;  1FNC A;  3BQJ A;  3R6J A;  1QFY A;  1QVG B;  3Q6R A;  4C43 A;  4H9G A;  1QUF A;  1V0F A;  4GQN A;  1E43 A;  3BH4 A;  1VQ4 B;  4IW3 B;  3GSI A;  2D9R A;  3ZZ0 A;  1B2R A;  1BX1 A;  5TY0 A;  3ZBT A;  1P4M A;  2WJV A;  1PJ5 A;  1WOR A;  3QFS A;  3CCJ B;  4HE6 A;  1W0J A;  3CCR B;  1R5O A;  3QE2 A;  3RY8 A;  5KNL A;  4P3I A;  2XNC A;  4G1V A;  1WPC A;  3Q38 A;  3Q39 A;  3T51 B;  1TVC A;  4DK1 A;  3E1Y E;  2ZTN A;  4XKV A;  1JA1 A;  1UD4 A;  1F20 A;  3GIR A;  4Z4W A;  2F43 A;  2RC6 A;  2YWG A;  4P1V A;  5DN6 A;  4G5G A;  1OB5 A;  4C0S A;  1OHH A;  2DET A;  2XZO A;  1FX0 A;  2QMU A;  4DQL A;  4B3G A;  4OOS A;  2BVN A;  1E62 A;  2GJR A;  1WP6 A;  1NBM A;  4WZT A;  4Y9U A;  1N07 A;  1S0U A;  3H9N A;  1H8E A;  1NDH A;  1SM4 A;  3P26 A;  3W2G A;  2FX3 A;  4EH1 A;  2DYI A;  1H85 A;  4LBW A;  4L8J A;  4DNR B;  1GJR A;  4RCY A;  4YXW A;  2QTZ A;  1EWY A;  4ACB A;  2DOG A;  1KQS B;  4RM0 A;  2EIX A;  4YAU A;  3CC7 B;  2X6X A;  2ZZE A;  1DG1 G;  3OEH A;  2OK7 A;  2X8K A;  4RJL A;  2ZBU A;  3GVL A;  1AMO A;  1NRK A;  4F7D A;  1YIT B;  5THX A;  4TMT A;  4X7E A;  3WBJ A;  3ZC3 A;  4Z4V A;  2VBT A;  3CXC B;  4UZE A;  2D74 A;  4MYT A;  2R6H A;  1QGA A;  3I1F A;  3ZBU A;  2VNH A;  4FK8 A;  4XNF A;  5HZB A;  2CW5 A;  4XLH A;  1FNB A;  4TSF A;  3B8H A;  3VNU A;  3WY9 A;  3B82 A;  4P2N A;  4ZCL A;  2F1L A;  1MAB A;  2Q6K A;  1I8D A;  1W2B B;  1V0E A;  1PJ6 A;  1ZM2 A;  1UMK A;  3P27 A;  2PIA A;  3VO2 A;  4Z4Y A;  3BY2 A;  4Y7C A;  3OOC A;  5DS0 A;  3CCV B;  3CRZ A;  4ASU A;  2VNJ A;  4G7W A;  4OOV A;  3G71 B;  2BF4 A;  4ZGN B;  1KZL A;  1D2E A;  4QVA A;  1GAW A;  4NCN A;  3SLD A;  1I7P A;  1CNE A;  3D26 A;  3WXM A;  1YJW B;  1QFZ A;  3QFT A;  4B44 A;  3LVB A;  1ZM4 A;  3AGQ A;  2WPD A;  4J0Q A;  4TN1 A;  3VMF A;  1K28 D;  2VBU A;  3CTA A;  2BMW A; 
#chains in the Genus database with same CATH homology
 4RDJ A;  4WZE A;  4Z4S A;  4RPB A;  4Z4R A;  2ZL5 A;  4Z4T A;  3BQJ A;  1IHM A;  3LQE A;  3R6J A;  5J35 A;  3Q6R A;  3PVD A;  5IYP A;  4Z4U A;  4X07 A;  5F4M A;  5BSX A;  2OBR A;  2ZL6 A;  3Q3A A;  3RY8 A;  4P3I A;  2OBS A;  3LQ6 A;  2OBT A;  3Q38 A;  3Q39 A;  5E6T A;  4X0C A;  5HZA A;  4Z4W A;  4P1V A;  3PA2 A;  4OPO A;  3SJP A;  5IYR A;  4X7D A;  4OOS A;  4WZT A;  2ZL7 A;  3Q6Q A;  4X06 A;  5IYW A;  3V7A A;  3ASP A;  4RLZ A;  4OP7 A;  5IYN A;  3ONY A;  4RM0 A;  3ASR A;  3ASS A;  5J3O A;  4P12 A;  4X7E A;  4Z4V A;  4QUZ A;  5F4J A;  3BY1 A;  4ROX A;  4QV2 A;  5IYQ A;  4X05 A;  5HZB A;  4WZL A;  3R6K A;  4P2N A;  3ONU A;  4P26 A;  4QVJ A;  5BSY A;  4WZK A;  3PUN A;  4OPV A;  5F4O A;  4Z4Y A;  3BY2 A;  3PUM A;  3SEJ A;  4RPD A;  4OOV A;  4OOX A;  3SKB A;  4OPS A;  3PA1 A;  4P25 A;  3AST A;  4QVA A;  4X7C A;  4RDK A;  3SLD A;  3D26 A;  4RDL A;  3SLN A;  5KW9 A;  4X7F A;  3ASQ A;  4Z4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...