4RLZA

Crystal structure of norovirus oif p domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
306
structure length
306
Chain Sequence
b'TKPFTLPILTIGELTNSRFPAPIDQLYTSPNADVVVQPQNGRCSLDGELQGTTQLLTTAICSYRGMTSNPTRDYWDGHLLHLVHPNGATYDPTEDVPAPFGTQDFRGILYGVLTQNPRASGDEAANSQGVYISSTSEKFTPKLGTIGLHQVQGNIASNQQSKFTPVGIAVNGNTPFRQWELPNYSGALTLNTNLAPAVGPNFPGEQILFFRSNVPSVQGGQPIEIDCLIPQEWVSHFYQESAPSQSDVALVRYVNPDTGRTIFEAKLHRQGFITIAATGSNPVVVPPNGYFRFDSWVNQFYALAPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title A Unique Human Norovirus Lineage with a Distinct HBGA Binding Interface.
pubmed doi rcsb
source organism Norovirus nlv/if1998/2003/iraq
molecule tags Viral protein
total genus 70
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rlzA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rlzA01
5HZBA 4WZTA 2OBRA 4QV2A 5J3OA 4P1VA 4OPSA 4Z4WA 4X0CA 5E6TA 5BSYA 5IYQA 5IYNA 4X05A 3R6JA 4WZKA 4Z4UA 4P3IA 5J35A 5F4JA 2OBTA 4X7CA 1IHMA 4Z4YA 3Q6RA 3ASQA 3Q6QA 3ASPA 4QVJA 3D26A 5F4OA 4Z4VA 3ASTA 4OPOA 4RDJA 4OOSA 5IYRA 4Z4ZA 3R6KA 3V7AA 3PVDA 3SJPA 4QUZA 4WZLA 4RDKA 4Z4TA 3RY8A 5F4MA 4X7DA 4X7FA 3BY1A 2ZL5A 3ONUA 3ASRA 4P2NA 4Z4RA 4RPBA 3SKBA 4RLZA 4P26A 4RPDA 5IYPA 2OBSA 5HZAA 4QVAA 3PA2A 4OOVA 5BSXA 4X7EA 3BY2A 4P25A 3PUNA 4RM0A 3SEJA 4X07A 4WZEA 4P12A 5IYWA 4X06A 4OOXA 3PUMA 3ASSA 4Z4SA 3LQEA 3Q38A 3PA1A 3LQ6A 5KW9A 2ZL6A 3BQJA 3Q3AA 4OPVA 4OP7A 3ONYA 3SLDA 3Q39A 4ROXA 2ZL7A 4RDLA 3SLNA
chains in the Genus database with same CATH superfamily
4XN0A 2X85A 4G1VA 4XN3A 4B3XA 2XZOA 1D8TA 1RQRA 4QV2A 1FNDA 1W35A 3A35A 4J0QA 5J3OA 4OPSA 4H9GA 1UMKA 2C4TA 2CF4A 4PGOA 1E63A 1VQ4B 3HAGA 3VMFA 2BPOA 2PIAA 4G7XA 1VQMB 3W2GA 2PE3A 3MCAA 4B44A 4M4SA 3VR6A 2XGJA 1FNCA 4G6IA 4ACBA 2OK8A 4DK1A 5B6IA 3CCVB 3B8HA 2Q6LA 1BLIA 3U2QA 4XOPA 3CTAA 2BSAA 3D26A 3CESA 1I8DA 3ASTA 3QSYA 1PJ5A 3CC7B 3P26A 3A3BA 4LBVA 2BV3A 4TSFA 3AVXA 2E1RA 4B3GA 2WPDA 5GV7A 2DY1A 2GQFA 4OOSA 2WJVA 3H94A 2V7TA 4M0LA 2B7CA 2F1MA 3V7AA 2VYQA 3CCLB 1WU8A 3LNNA 1QG0A 1DDGA 2VBUA 3FPPA 4N3NA 4Z4TA 1AIPA 2WSSA 1VHOA 1CQXA 3CCRB 1QUEA 5HXBA 4R71A 1VQLB 1MRZA 4RD4A 3ONUA 4EH1A 3ASRA 4Z4RA 2M5SA 4Z1MA 3JQRA 1WOOA 3WQZA 2V4DA 3CRZA 3BCFA 1MABA 4ZV4A 1VQ8B 1TUIA 1VQKB 4ZCIA 4WWVA 1BX0A 5THXA 3ZZUA 4G5GA 2V7XA 1VJSA 3OZWA 5IYPA 4XL9A 3OE7A 1ZM2A 3PA2A 4QVAA 5BSXA 3OW2B 2ZBVA 2DIEA 1EFUA 3CC2B 2D3NA 1Q86D 4X07A 4WZEA 2BM1A 4U9UA 4WQMA 4C0SA 4MYTA 1UD8A 2ZZQA 1EFRA 1BMFA 2CBXA 2ZZFA 4BPRA 4XMYA 4TN1A 2OK7A 4B48A 1FX0A 2CC2A 1G7SA 4XOTA 4E0FA 3CCJB 1V0FA 4PAAA 4ZCLA 2W6IA 1SKQA 3BQJA 1BJKA 2HMAA 3GVJA 4YAUA 2XNCA 4X8IA 3OKXA 1VQ5B 3J81k 1E62A 3CP2A 3WXMA 4QHYA 4Y9UA 1N8RD 2PLFA 3W2FA 4YAOA 1WOSA 4WZTA 1E1RA 1E64A 2OBRA 2BF4A 4XQFA 5HZBA 2QTZA 2X8KA 3OEHA 4PC6A 1AMOA 3GIRA 3CB4A 1F20A 5E6TA 1WOPA 4TMZA 4B3FX 5BSYA 3VNVA 1QGZA 4FWTA 4KKTA 3ZBTA 3P27A 1WORA 2XOKA 1S4MA 3R6JA 4QFMA 3OFNA 1KK0A 4P3IA 4YELA 4XM3A 1ELOA 1YITB 3A1PA 1ZM3A 2BVNA 2OBTA 1GVHA 2DOGA 4AF7A 4Z4YA 3BNWA 5FNZA 1Y0YA 3Q6RA 3ASQA 4M2LA 5TR9A 3LVBA 1A8PA 1QFJA 2CW5A 2X3UA 1GO2A 1QH0A 4C43A 1EP1B 4OPOA 3CCSB 1DG1G 1FRNA 1YJ9B 1OHHA 4GQNA 1KZLA 1NDHA 3OOCA 2GK6A 2WZPP 2C4UA 2V7VA 1N08A 1U2RA 4KKUA 2YWGA 5GV8A 3FKSA 2C77A 5FL7A 1R5OA 1EXMA 3BC9A 4HE5A 3CCUB 1NB0A 3T56B 3PVDA 4NCNA 3ZZ0A 1K73D 3W5UA 2QN6A 4RCYA 4QUZA 3E20A 2WYRA 3GVKA 5DSZA 2BGJA 4LBWA 2QMUA 2QGGA 4FK8A 3GVLA 2NPFA 2JJ2A 5F4MA 3ZBUA 1YJWB 4UZFA 4X7DA 1G7RA 4PC1A 3ZIAA 2ZL5A 2JN9A 2DYIA 4YXWA 3NE5B 1H8EA 2ZXHA 3WNDA 1V5VA 1OGIA 2F43A 3OW7A 1TVCA 3CC4B 4RPBA 3JQQA 1OB5A 2HLDA 1KQSB 2HCJB 1Q7YD 2JDIA 2ZTNA 5AN9A 3AVUA 1R5BA 1K8AD 2E1BA 5DS0A 1W87A 2OYNA 3BCDA 4II3A 4XR6A 3VNUA 1GAQA 4TT3A 4XNFA 2OBSA 3AVYA 1XQBA 4YHBA 4PC2A 2OTJB 5JBQA 3AGPA 2YWEA 3ISXA 3PUNA 2C5HA 4RM0A 1B23P 1N06A 2YWHA 1GR1A 5TV2A 4ZGQB 1WTHD 2F1LA 1KK3A 2D74A 3G71B 4X06A 1YIJB 2QE7A 5HKKA 1NJID 1UD4A 4MYUA 5TY0A 1FDRA 3OJXA 4LBZA 3LQEA 2X6WA 1E3ZA 3I56B 2AHOA 4UZUA 5A88A 1OB2A 1TTTA 3B78A 3OZVA 1UD3A 2ZXIA 1WP6A 2VBSA 4XKVA 1VHEA 4YEJA 3CCQB 1E3XA 4OPVA 1UD2A 4OP7A 1W9XA 3QE2A 4JMQA 4KKSA 4DNTB 2XNDA 2X6YA 3A8JA 1OGJA 3SLNA 4XLFA 2WR8A 1JA0A 3U6BA 4RD2A 1OB0A 1DDIA 1BPLA 2R6HA 2VBTA 4AVZA 4G1BA 1B2RA 3KL9A 4P1VA 4Z4WA 4RD3A 5IYQA 5IYNA 2C78A 2J7KA 4ZGNB 4YALA 1VQ7B 2QTLA 4Z4UA 1YI2B 3OAAA 3VO1A 1ZM4A 2XEXA 5F4JA 4LBYA 1I18A 4X7CA 2CK3A 1IHMA 1VQPB 4M1KA 1CNEA 3Q6QA 1IJEA 2Q6KA 2Z6BD 3ASPA 3V76A 4Y9RA 3CP8A 4B4DA 4Q7JB 1FNBA 4Z4VA 2JJ1A 2P3MA 5H59A 4YAWA 3CW2A 2NV4A 1HA3A 1UD6A 1G7CA 1XE1A 1KRHA 2X53S 2KVOA 1E43A 3WNCA 1WDTA 1CNFA 4II2A 2XZLA 1HVXA 1NB9A 2ZITA 1KK1A 4Z4ZA 1W34A 3R6KA 4P9SA 3ES9A 1D2EA 1BQEA 1R5NA 1PJ6A 1EFTA 4YAFA 3CCMB 3PENA 1S72B 2CNDA 3MHPA 4P6YA 1QVFB 4RDKA 1KMHA 1WSRA 4FXUA 3T51B 2B5OA 2GJRA 2ZBUA 2FVGA 3GSIA 3CCEB 3A8IA 3DDYA 1VQNB 5H5JA 4IW3B 3G05A 5TRDA 1ZM9A 3FJOA 4XLCA 2C5BA 1KTVA 3SKBA 2EIXA 3W5VA 3VO2A 1T5EA 1QVGB 1VQ9B 3ZPNA 4UZEA 4P26A 5KNLA 4RPDA 1IJFA 3W5HA 1FNMA 3LO8A 5FIUA 3B82A 3JU4A 3BY2A 4XLAA 1Q81D 4XORA 4XKWA 2ZZGA 3ZUGA 2GPJA 5IYWA 4FN5A 4P12A 3CD6B 1XB2A 2VNJA 1UD5A 3QFTA 1VQOB 5IK2A 2BMWA 4ASUA 1YHQB 1F60A 3PUMA 1KJZA 3ASSA 3G6EB 1H42A 2D3LA 4UAJA 4ACAA 2LZJA 2VJIA 3AVTA 3KEWA 2XNJA 4P3YA 3OP1A 2GK7A 4P22A 2C2WA 1JJ2B 4TKOB 1P4MA 4PABA 3WNBA 3E1YE 3LQ6A 5FA6A 5KW9A 1YLOA 1H85A 3Q3AA 1WSVA 1VLOA 2BM0A 1S0UA 2YWFA 3ONYA 1EP3B 2VZLA 3SLDA 5KSWB 2DERA 4L8JA 2ZL7A 4RDLA 1VF7A 2RC6A 3OPOA 1N0UA 3WBJA 1GAWA 1G7TA 1ZUNB 1T6XA 3G4SB 1N05A 3H9NA 2F4NA 2BN4A 4HE6A 2XZPA 4CQJA 1EWYA 1PKVA 4X0CA 1XFOA 1D1NA 3WY9A 3AVWA 2BGIA 1TLLA 2B7BA 2GREA 2QEXB 3FPKA 2WZNA 4X05A 4LC0A 4TMTA 4HIZA 1K28D 4TMXA 2I1LA 2VNHA 4B43A 2V7QA 4WZKA 3SJZA 3QFSA 4RD0A 5A8AA 1M1KD 1IB0A 4M53A 2GJPA 5J35A 3ZZTA 1FRQA 3T53B 1BX1A 4DK0A 5FO1A 3JQPA 4TMVA 1YX2A 4XLEA 1SM4A 2FX3A 1QGYA 2OTLB 4QVJA 4RCZA 2EFGA 3CPXA 1H8HA 3GQBA 4Y7CA 2Q6OA 2VNKA 2CRVA 5F4OA 1EP2B 3MMPA 2VJJA 3OJWA 4AF6A 2DETA 1E1QA 5EMNA 3U6KA 2V7UA 3WBKA 4RDJA 1J9ZA 5IYRA 1W0KA 4RD6A 2RC5A 4DQLA 3CMMA 1VLYA 1PJ7A 3I1FA 3SJPA 1I7PA 1KK2A 4XD7A 2R9VA 5A89A 1JNYA 4WZLA 2X0KA 3CPWB 3RY8A 2GJKA 4DQKA 1KD1D 1Q9SA 4K1XA 5FO0A 3OEEA 4X7FA 3BY1A 2Q6IA 1V0EA 4NNJA 1T6ZA 2DCUA 4PC3A 4P2NA 4DNRB 4P6VF 4ZCMA 1QX4A 1GJRA 1W2BB 1YJNB 4F7DA 1NRKA 2QA4B 4N3GA 5LMZA 1COWA 4RLZA 3W2HA 1QFYA 2W6JA 1JA1A 1WPCA 1SKYB 5CDFA 4XLHA 1Q82D 2ZZEA 5HZAA 1HZEA 5L46A 1VQ6B 3CMAB 4OOVA 1QGAA 1EFCA 1N0VC 4X7EA 2PMDA 3W2EA 2V7WA 4P25A 1NBMA 4G7WA 2VNIA 3QFCA 3SEJA 1DARA 1K9MD 4PC7A 3ZC3A 1T6YA 4XONA 4OOXA 3AGQA 2D9RA 2ZTGA 2JIZA 3BH4A 4TMWA 2V31A 3OZUA 1Y0RA 4Z4SA 2WJYA 5DN6A 3AVVA 2HDNB 2DEUA 1N07A 3I55B 3Q38A 2QDXA 2X6XA 3PA1A 4AC9A 3A3GA 1QUFA 4RJLA 1E79A 1KC8D 3CMEB 2ZL6A 3A8KA 3CXCB 1RQPA 1QFZA 1M90D 4RD1A 4NBSA 3WYAA 3W2IA 4B47A 1JB9A 3Q39A 4ROXA 3QFRA 1W0JA 2VBVA
chains in the Genus database with same CATH topology
5HZBA 4WZTA 2OBRA 4QV2A 5J3OA 4P1VA 4OPSA 4Z4WA 4X0CA 5E6TA 5BSYA 5IYQA 5IYNA 4X05A 3R6JA 4WZKA 4Z4UA 4P3IA 5J35A 5F4JA 2OBTA 4X7CA 1IHMA 4Z4YA 3Q6RA 3ASQA 3Q6QA 3ASPA 4QVJA 3D26A 5F4OA 4Z4VA 3ASTA 4OPOA 4RDJA 4OOSA 5IYRA 4Z4ZA 3R6KA 3V7AA 3PVDA 3SJPA 4QUZA 4WZLA 4RDKA 4Z4TA 3RY8A 5F4MA 4X7DA 4X7FA 3BY1A 2ZL5A 3ONUA 3ASRA 4P2NA 4Z4RA 4RPBA 3SKBA 4RLZA 4P26A 4RPDA 5IYPA 2OBSA 5HZAA 4QVAA 3PA2A 4OOVA 5BSXA 4X7EA 3BY2A 4P25A 3PUNA 4RM0A 3SEJA 4X07A 4WZEA 4P12A 5IYWA 4X06A 4OOXA 3PUMA 3ASSA 4Z4SA 3LQEA 3Q38A 3PA1A 3LQ6A 5KW9A 2ZL6A 3BQJA 3Q3AA 4OPVA 4OP7A 3ONYA 3SLDA 3Q39A 4ROXA 2ZL7A 4RDLA 3SLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HZB A;  4WZT A;  2OBR A;  4QV2 A;  5J3O A;  4P1V A;  4OPS A;  4Z4W A;  4X0C A;  5E6T A;  5BSY A;  5IYQ A;  5IYN A;  4X05 A;  3R6J A;  4WZK A;  4Z4U A;  4P3I A;  5J35 A;  5F4J A;  2OBT A;  4X7C A;  1IHM A;  4Z4Y A;  3Q6R A;  3ASQ A;  3Q6Q A;  3ASP A;  4QVJ A;  3D26 A;  5F4O A;  4Z4V A;  3AST A;  4OPO A;  4RDJ A;  4OOS A;  5IYR A;  4Z4Z A;  3R6K A;  3V7A A;  3PVD A;  3SJP A;  4QUZ A;  4WZL A;  4RDK A;  4Z4T A;  3RY8 A;  5F4M A;  4X7D A;  4X7F A;  3BY1 A;  2ZL5 A;  3ONU A;  3ASR A;  4P2N A;  4Z4R A;  4RPB A;  3SKB A;  4RLZ A;  4P26 A;  4RPD A;  5IYP A;  2OBS A;  5HZA A;  4QVA A;  3PA2 A;  4OOV A;  5BSX A;  4X7E A;  3BY2 A;  4P25 A;  3PUN A;  4RM0 A;  3SEJ A;  4X07 A;  4WZE A;  4P12 A;  5IYW A;  4X06 A;  4OOX A;  3PUM A;  3ASS A;  4Z4S A;  3LQE A;  3Q38 A;  3PA1 A;  3LQ6 A;  5KW9 A;  2ZL6 A;  3BQJ A;  3Q3A A;  4OPV A;  4OP7 A;  3ONY A;  3SLD A;  3Q39 A;  4ROX A;  2ZL7 A;  4RDL A;  3SLN A; 
#chains in the Genus database with same CATH topology
 4XN0 A;  2X85 A;  4G1V A;  4XN3 A;  4B3X A;  2XZO A;  1D8T A;  1RQR A;  4QV2 A;  1FND A;  1W35 A;  3A35 A;  4J0Q A;  5J3O A;  4OPS A;  4H9G A;  1UMK A;  2C4T A;  2CF4 A;  4PGO A;  1E63 A;  1VQ4 B;  3HAG A;  3VMF A;  2BPO A;  2PIA A;  4G7X A;  1VQM B;  3W2G A;  2PE3 A;  3MCA A;  4B44 A;  4M4S A;  3VR6 A;  2XGJ A;  1FNC A;  4G6I A;  4ACB A;  2OK8 A;  4DK1 A;  5B6I A;  3CCV B;  3B8H A;  2Q6L A;  1BLI A;  3U2Q A;  4XOP A;  3CTA A;  2BSA A;  3D26 A;  3CES A;  1I8D A;  3AST A;  3QSY A;  1PJ5 A;  3CC7 B;  3P26 A;  3A3B A;  4LBV A;  2BV3 A;  4TSF A;  3AVX A;  2E1R A;  4B3G A;  2WPD A;  5GV7 A;  2DY1 A;  2GQF A;  4OOS A;  2WJV A;  3H94 A;  2V7T A;  4M0L A;  2B7C A;  2F1M A;  3V7A A;  2VYQ A;  3CCL B;  1WU8 A;  3LNN A;  1QG0 A;  1DDG A;  2VBU A;  3FPP A;  4N3N A;  4Z4T A;  1AIP A;  2WSS A;  1VHO A;  1CQX A;  3CCR B;  1QUE A;  5HXB A;  4R71 A;  1VQL B;  1MRZ A;  4RD4 A;  3ONU A;  4EH1 A;  3ASR A;  4Z4R A;  2M5S A;  4Z1M A;  3JQR A;  1WOO A;  3WQZ A;  2V4D A;  3CRZ A;  3BCF A;  1MAB A;  4ZV4 A;  1VQ8 B;  1TUI A;  1VQK B;  4ZCI A;  4WWV A;  1BX0 A;  5THX A;  3ZZU A;  4G5G A;  2V7X A;  1VJS A;  3OZW A;  5IYP A;  4XL9 A;  3OE7 A;  1ZM2 A;  3PA2 A;  4QVA A;  5BSX A;  3OW2 B;  2ZBV A;  2DIE A;  1EFU A;  3CC2 B;  2D3N A;  1Q86 D;  4X07 A;  4WZE A;  2BM1 A;  4U9U A;  4WQM A;  4C0S A;  4MYT A;  1UD8 A;  2ZZQ A;  1EFR A;  1BMF A;  2CBX A;  2ZZF A;  4BPR A;  4XMY A;  4TN1 A;  2OK7 A;  4B48 A;  1FX0 A;  2CC2 A;  1G7S A;  4XOT A;  4E0F A;  3CCJ B;  1V0F A;  4PAA A;  4ZCL A;  2W6I A;  1SKQ A;  3BQJ A;  1BJK A;  2HMA A;  3GVJ A;  4YAU A;  2XNC A;  4X8I A;  3OKX A;  1VQ5 B;  3J81 k;  1E62 A;  3CP2 A;  3WXM A;  4QHY A;  4Y9U A;  1N8R D;  2PLF A;  3W2F A;  4YAO A;  1WOS A;  4WZT A;  1E1R A;  1E64 A;  2OBR A;  2BF4 A;  4XQF A;  5HZB A;  2QTZ A;  2X8K A;  3OEH A;  4PC6 A;  1AMO A;  3GIR A;  3CB4 A;  1F20 A;  5E6T A;  1WOP A;  4TMZ A;  4B3F X;  5BSY A;  3VNV A;  1QGZ A;  4FWT A;  4KKT A;  3ZBT A;  3P27 A;  1WOR A;  2XOK A;  1S4M A;  3R6J A;  4QFM A;  3OFN A;  1KK0 A;  4P3I A;  4YEL A;  4XM3 A;  1ELO A;  1YIT B;  3A1P A;  1ZM3 A;  2BVN A;  2OBT A;  1GVH A;  2DOG A;  4AF7 A;  4Z4Y A;  3BNW A;  5FNZ A;  1Y0Y A;  3Q6R A;  3ASQ A;  4M2L A;  5TR9 A;  3LVB A;  1A8P A;  1QFJ A;  2CW5 A;  2X3U A;  1GO2 A;  1QH0 A;  4C43 A;  1EP1 B;  4OPO A;  3CCS B;  1DG1 G;  1FRN A;  1YJ9 B;  1OHH A;  4GQN A;  1KZL A;  1NDH A;  3OOC A;  2GK6 A;  2WZP P;  2C4U A;  2V7V A;  1N08 A;  1U2R A;  4KKU A;  2YWG A;  5GV8 A;  3FKS A;  2C77 A;  5FL7 A;  1R5O A;  1EXM A;  3BC9 A;  4HE5 A;  3CCU B;  1NB0 A;  3T56 B;  3PVD A;  4NCN A;  3ZZ0 A;  1K73 D;  3W5U A;  2QN6 A;  4RCY A;  4QUZ A;  3E20 A;  2WYR A;  3GVK A;  5DSZ A;  2BGJ A;  4LBW A;  2QMU A;  2QGG A;  4FK8 A;  3GVL A;  2NPF A;  2JJ2 A;  5F4M A;  3ZBU A;  1YJW B;  4UZF A;  4X7D A;  1G7R A;  4PC1 A;  3ZIA A;  2ZL5 A;  2JN9 A;  2DYI A;  4YXW A;  3NE5 B;  1H8E A;  2ZXH A;  3WND A;  1V5V A;  1OGI A;  2F43 A;  3OW7 A;  1TVC A;  3CC4 B;  4RPB A;  3JQQ A;  1OB5 A;  2HLD A;  1KQS B;  2HCJ B;  1Q7Y D;  2JDI A;  2ZTN A;  5AN9 A;  3AVU A;  1R5B A;  1K8A D;  2E1B A;  5DS0 A;  1W87 A;  2OYN A;  3BCD A;  4II3 A;  4XR6 A;  3VNU A;  1GAQ A;  4TT3 A;  4XNF A;  2OBS A;  3AVY A;  1XQB A;  4YHB A;  4PC2 A;  2OTJ B;  5JBQ A;  3AGP A;  2YWE A;  3ISX A;  3PUN A;  2C5H A;  4RM0 A;  1B23 P;  1N06 A;  2YWH A;  1GR1 A;  5TV2 A;  4ZGQ B;  1WTH D;  2F1L A;  1KK3 A;  2D74 A;  3G71 B;  4X06 A;  1YIJ B;  2QE7 A;  5HKK A;  1NJI D;  1UD4 A;  4MYU A;  5TY0 A;  1FDR A;  3OJX A;  4LBZ A;  3LQE A;  2X6W A;  1E3Z A;  3I56 B;  2AHO A;  4UZU A;  5A88 A;  1OB2 A;  1TTT A;  3B78 A;  3OZV A;  1UD3 A;  2ZXI A;  1WP6 A;  2VBS A;  4XKV A;  1VHE A;  4YEJ A;  3CCQ B;  1E3X A;  4OPV A;  1UD2 A;  4OP7 A;  1W9X A;  3QE2 A;  4JMQ A;  4KKS A;  4DNT B;  2XND A;  2X6Y A;  3A8J A;  1OGJ A;  3SLN A;  4XLF A;  2WR8 A;  1JA0 A;  3U6B A;  4RD2 A;  1OB0 A;  1DDI A;  1BPL A;  2R6H A;  2VBT A;  4AVZ A;  4G1B A;  1B2R A;  3KL9 A;  4P1V A;  4Z4W A;  4RD3 A;  5IYQ A;  5IYN A;  2C78 A;  2J7K A;  4ZGN B;  4YAL A;  1VQ7 B;  2QTL A;  4Z4U A;  1YI2 B;  3OAA A;  3VO1 A;  1ZM4 A;  2XEX A;  5F4J A;  4LBY A;  1I18 A;  4X7C A;  2CK3 A;  1IHM A;  1VQP B;  4M1K A;  1CNE A;  3Q6Q A;  1IJE A;  2Q6K A;  2Z6B D;  3ASP A;  3V76 A;  4Y9R A;  3CP8 A;  4B4D A;  4Q7J B;  1FNB A;  4Z4V A;  2JJ1 A;  2P3M A;  5H59 A;  4YAW A;  3CW2 A;  2NV4 A;  1HA3 A;  1UD6 A;  1G7C A;  1XE1 A;  1KRH A;  2X53 S;  2KVO A;  1E43 A;  3WNC A;  1WDT A;  1CNF A;  4II2 A;  2XZL A;  1HVX A;  1NB9 A;  2ZIT A;  1KK1 A;  4Z4Z A;  1W34 A;  3R6K A;  4P9S A;  3ES9 A;  1D2E A;  1BQE A;  1R5N A;  1PJ6 A;  1EFT A;  4YAF A;  3CCM B;  3PEN A;  1S72 B;  2CND A;  3MHP A;  4P6Y A;  1QVF B;  4RDK A;  1KMH A;  1WSR A;  4FXU A;  3T51 B;  2B5O A;  2GJR A;  2ZBU A;  2FVG A;  3GSI A;  3CCE B;  3A8I A;  3DDY A;  1VQN B;  5H5J A;  4IW3 B;  3G05 A;  5TRD A;  1ZM9 A;  3FJO A;  4XLC A;  2C5B A;  1KTV A;  3SKB A;  2EIX A;  3W5V A;  3VO2 A;  1T5E A;  1QVG B;  1VQ9 B;  3ZPN A;  4UZE A;  4P26 A;  5KNL A;  4RPD A;  1IJF A;  3W5H A;  1FNM A;  3LO8 A;  5FIU A;  3B82 A;  3JU4 A;  3BY2 A;  4XLA A;  1Q81 D;  4XOR A;  4XKW A;  2ZZG A;  3ZUG A;  2GPJ A;  5IYW A;  4FN5 A;  4P12 A;  3CD6 B;  1XB2 A;  2VNJ A;  1UD5 A;  3QFT A;  1VQO B;  5IK2 A;  2BMW A;  4ASU A;  1YHQ B;  1F60 A;  3PUM A;  1KJZ A;  3ASS A;  3G6E B;  1H42 A;  2D3L A;  4UAJ A;  4ACA A;  2LZJ A;  2VJI A;  3AVT A;  3KEW A;  2XNJ A;  4P3Y A;  3OP1 A;  2GK7 A;  4P22 A;  2C2W A;  1JJ2 B;  4TKO B;  1P4M A;  4PAB A;  3WNB A;  3E1Y E;  3LQ6 A;  5FA6 A;  5KW9 A;  1YLO A;  1H85 A;  3Q3A A;  1WSV A;  1VLO A;  2BM0 A;  1S0U A;  2YWF A;  3ONY A;  1EP3 B;  2VZL A;  3SLD A;  5KSW B;  2DER A;  4L8J A;  2ZL7 A;  4RDL A;  1VF7 A;  2RC6 A;  3OPO A;  1N0U A;  3WBJ A;  1GAW A;  1G7T A;  1ZUN B;  1T6X A;  3G4S B;  1N05 A;  3H9N A;  2F4N A;  2BN4 A;  4HE6 A;  2XZP A;  4CQJ A;  1EWY A;  1PKV A;  4X0C A;  1XFO A;  1D1N A;  3WY9 A;  3AVW A;  2BGI A;  1TLL A;  2B7B A;  2GRE A;  2QEX B;  3FPK A;  2WZN A;  4X05 A;  4LC0 A;  4TMT A;  4HIZ A;  1K28 D;  4TMX A;  2I1L A;  2VNH A;  4B43 A;  2V7Q A;  4WZK A;  3SJZ A;  3QFS A;  4RD0 A;  5A8A A;  1M1K D;  1IB0 A;  4M53 A;  2GJP A;  5J35 A;  3ZZT A;  1FRQ A;  3T53 B;  1BX1 A;  4DK0 A;  5FO1 A;  3JQP A;  4TMV A;  1YX2 A;  4XLE A;  1SM4 A;  2FX3 A;  1QGY A;  2OTL B;  4QVJ A;  4RCZ A;  2EFG A;  3CPX A;  1H8H A;  3GQB A;  4Y7C A;  2Q6O A;  2VNK A;  2CRV A;  5F4O A;  1EP2 B;  3MMP A;  2VJJ A;  3OJW A;  4AF6 A;  2DET A;  1E1Q A;  5EMN A;  3U6K A;  2V7U A;  3WBK A;  4RDJ A;  1J9Z A;  5IYR A;  1W0K A;  4RD6 A;  2RC5 A;  4DQL A;  3CMM A;  1VLY A;  1PJ7 A;  3I1F A;  3SJP A;  1I7P A;  1KK2 A;  4XD7 A;  2R9V A;  5A89 A;  1JNY A;  4WZL A;  2X0K A;  3CPW B;  3RY8 A;  2GJK A;  4DQK A;  1KD1 D;  1Q9S A;  4K1X A;  5FO0 A;  3OEE A;  4X7F A;  3BY1 A;  2Q6I A;  1V0E A;  4NNJ A;  1T6Z A;  2DCU A;  4PC3 A;  4P2N A;  4DNR B;  4P6V F;  4ZCM A;  1QX4 A;  1GJR A;  1W2B B;  1YJN B;  4F7D A;  1NRK A;  2QA4 B;  4N3G A;  5LMZ A;  1COW A;  4RLZ A;  3W2H A;  1QFY A;  2W6J A;  1JA1 A;  1WPC A;  1SKY B;  5CDF A;  4XLH A;  1Q82 D;  2ZZE A;  5HZA A;  1HZE A;  5L46 A;  1VQ6 B;  3CMA B;  4OOV A;  1QGA A;  1EFC A;  1N0V C;  4X7E A;  2PMD A;  3W2E A;  2V7W A;  4P25 A;  1NBM A;  4G7W A;  2VNI A;  3QFC A;  3SEJ A;  1DAR A;  1K9M D;  4PC7 A;  3ZC3 A;  1T6Y A;  4XON A;  4OOX A;  3AGQ A;  2D9R A;  2ZTG A;  2JIZ A;  3BH4 A;  4TMW A;  2V31 A;  3OZU A;  1Y0R A;  4Z4S A;  2WJY A;  5DN6 A;  3AVV A;  2HDN B;  2DEU A;  1N07 A;  3I55 B;  3Q38 A;  2QDX A;  2X6X A;  3PA1 A;  4AC9 A;  3A3G A;  1QUF A;  4RJL A;  1E79 A;  1KC8 D;  3CME B;  2ZL6 A;  3A8K A;  3CXC B;  1RQP A;  1QFZ A;  1M90 D;  4RD1 A;  4NBS A;  3WYA A;  3W2I A;  4B47 A;  1JB9 A;  3Q39 A;  4ROX A;  3QFR A;  1W0J A;  2VBV A; 
#chains in the Genus database with same CATH homology
 5HZB A;  4WZT A;  2OBR A;  4QV2 A;  5J3O A;  4P1V A;  4OPS A;  4Z4W A;  4X0C A;  5E6T A;  5BSY A;  5IYQ A;  5IYN A;  4X05 A;  3R6J A;  4WZK A;  4Z4U A;  4P3I A;  5J35 A;  5F4J A;  2OBT A;  4X7C A;  1IHM A;  4Z4Y A;  3Q6R A;  3ASQ A;  3Q6Q A;  3ASP A;  4QVJ A;  3D26 A;  5F4O A;  4Z4V A;  3AST A;  4OPO A;  4RDJ A;  4OOS A;  5IYR A;  4Z4Z A;  3R6K A;  3V7A A;  3PVD A;  3SJP A;  4QUZ A;  4WZL A;  4RDK A;  4Z4T A;  3RY8 A;  5F4M A;  4X7D A;  4X7F A;  3BY1 A;  2ZL5 A;  3ONU A;  3ASR A;  4P2N A;  4Z4R A;  4RPB A;  3SKB A;  4RLZ A;  4P26 A;  4RPD A;  5IYP A;  2OBS A;  5HZA A;  4QVA A;  3PA2 A;  4OOV A;  5BSX A;  4X7E A;  3BY2 A;  4P25 A;  3PUN A;  4RM0 A;  3SEJ A;  4X07 A;  4WZE A;  4P12 A;  5IYW A;  4X06 A;  4OOX A;  3PUM A;  3ASS A;  4Z4S A;  3LQE A;  3Q38 A;  3PA1 A;  3LQ6 A;  5KW9 A;  2ZL6 A;  3BQJ A;  3Q3A A;  4OPV A;  4OP7 A;  3ONY A;  3SLD A;  3Q39 A;  4ROX A;  2ZL7 A;  4RDL A;  3SLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...