4RLZA

Crystal structure of norovirus oif p domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
306
structure length
306
Chain Sequence
TKPFTLPILTIGELTNSRFPAPIDQLYTSPNADVVVQPQNGRCSLDGELQGTTQLLTTAICSYRGMTSNPTRDYWDGHLLHLVHPNGATYDPTEDVPAPFGTQDFRGILYGVLTQNPRASGDEAANSQGVYISSTSEKFTPKLGTIGLHQVQGNIASNQQSKFTPVGIAVNGNTPFRQWELPNYSGALTLNTNLAPAVGPNFPGEQILFFRSNVPSVQGGQPIEIDCLIPQEWVSHFYQESAPSQSDVALVRYVNPDTGRTIFEAKLHRQGFITIAATGSNPVVVPPNGYFRFDSWVNQFYALAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein
publication title A Unique Human Norovirus Lineage with a Distinct HBGA Binding Interface.
pubmed doi rcsb
source organism Norovirus nlv/if1998/2003/iraq
total genus 70
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rlzA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rlzA01
4WZEA 4OPSA 3Q39A 3PUMA 4ROXA 3PA2A 2ZL7A 3PA1A 4P3IA 4OOSA 4X06A 3Q6RA 4RPBA 2OBTA 4OOVA 4Z4ZA 4RLZA 4WZLA 4RPDA 4X05A 4X7CA 5F4MA 4RDLA 1IHMA 3V7AA 4RM0A 5HZBA 3PUNA 4P26A 5BSXA 3ASTA 4QVJA 2ZL5A 3LQEA 5IYQA 3SEJA 5J3OA 4P25A 3SJPA 2ZL6A 3Q38A 3R6KA 4X7FA 3ONYA 4OPVA 4Z4WA 3SKBA 5IYWA 4Z4UA 4X07A 3RY8A 5IYNA 4P12A 2OBSA 3BY2A 3SLDA 4WZKA 5IYRA 4X7DA 4RDJA 4OP7A 3ASSA 3Q6QA 2OBRA 4X0CA 4Z4VA 4OPOA 4QV2A 3ASQA 4QVAA 4WZTA 5BSYA 5IYPA 3BQJA 3ONUA 4Z4RA 4Z4YA 3LQ6A 4Z4SA 5KW9A 4QUZA 4P2NA 3Q3AA 4Z4TA 3D26A 4P1VA 5E6TA 3ASRA 3PVDA 3BY1A 3SLNA 5F4JA 4OOXA 3R6JA 4RDKA 3ASPA 5HZAA 4X7EA 5F4OA 5J35A
chains in the Genus database with same CATH superfamily
1WU8A 5H5JA 4XOPA 3B78A 3OZVA 3ISXA 1YITB 2FVGA 3AVTA 3T56B 2XNCA 3WXMA 1N08A 3PA2A 4LBZA 2GK6A 2QE7A 1VHEA 1UMKA 1S72B 1E3XA 2BF4A 3AVVA 1SKYB 1WORA 4OOSA 4X06A 4Y9RA 1K9MD 4RPBA 3QFSA 2CF4A 4Z4ZA 1OB0A 3GVJA 3A8JA 3WQZA 3HAGA 2XOKA 1V5VA 2CK3A 3ZC3A 4B3XA 5FO1A 1YIJB 1I8DA 3AGPA 2BV3A 2XNJA 1VQ8B 1S4MA 2V7VA 1E1QA 1WSVA 1XB2A 2ZZEA 2PIAA 4P26A 2VJJA 3G71B 2HCJB 2RC5A 1OGJA 4QVJA 2DETA 1BMFA 2ZL5A 5HXBA 4B3GA 4FN5A 4RD3A 2HLDA 3OOCA 3VO2A 1KMHA 1ZM9A 4P25A 1VQLB 3ZBTA 4J0QA 3R6KA 2R6HA 1WSRA 4B4DA 1DDIA 3A3BA 3NE5B 3CP8A 4X7FA 3AVXA 4YAWA 1FNMA 3LO8A 4RD0A 3G4SB 2VBUA 4EH1A 3SKBA 3JQQA 3J81k 1NB9A 3CD6B 2ZBVA 2DYIA 4PC6A 4UZUA 2DEUA 1QH0A 3BY2A 4LBYA 1PJ7A 3V76A 2VYQA 5IYRA 4RDJA 4C43A 1XE1A 3Q6QA 1ELOA 1GJRA 1JA1A 1JNYA 5EMNA 5DSZA 3U6BA 2YWGA 2OYNA 4LBWA 1A8PA 2GJKA 3OAAA 4G7WA 4QVAA 4HIZA 4Q7JB 4M2LA 4FXUA 1M90D 1N07A 2V7TA 2DCUA 1YJWB 2V7UA 5IYPA 1RQPA 2C4TA 2RC6A 1Q81D 3A3GA 1NBMA 3BQJA 3CMAB 4Y7CA 4XKVA 1BX1A 4XMYA 3ONUA 4MYTA 4PAAA 2OTLB 1SKQA 1W9XA 4PC1A 1QUEA 4XR6A 3CCJB 1ZM3A 4CQJA 4B43A 4ZCIA 1T6XA 2BVNA 3CMEB 1QVGB 2XZPA 3OJWA 3Q3AA 3AGQA 3A8KA 4XLFA 1EFUA 3PVDA 4XQFA 1E64A 1YHQB 1H85A 1EFRA 3T53B 4TMZA 1R5OA 1WP6A 2YWFA 4HE6A 4RCYA 5DS0A 4DK0A 4DQKA 4RDKA 1KK2A 5GV8A 5HZAA 3CCEB 4XD7A 2BMWA 3CRZA 4R71A 5FA6A 4WZEA 1M1KD 3VR6A 4U9UA 4XL9A 1Q7YD 1F20A 1VLOA 1W0JA 1KQSB 1J9ZA 1B23P 2ZL7A 2Q6KA 1VQ5B 1DARA 2EFGA 1UD5A 3Q6RA 1MABA 3I1FA 1VQPB 4XLEA 1UD4A 4RPDA 1FNCA 3A1PA 3OEEA 1DDGA 4RDLA 1YX2A 2W6IA 4TT3A 2QEXB 3OW7A 4RJLA 5HZBA 3QSYA 2JDIA 3ZZTA 4M0LA 1VHOA 1BX0A 3LQEA 5IYQA 1KZLA 1HVXA 1GVHA 1CQXA 1E79A 1XFOA 3OE7A 1QFZA 2BN4A 4YAFA 1NJID 1HA3A 1Y0RA 2X53S 2ZL6A 2PMDA 4ZCMA 4YXWA 2GPJA 2B5OA 3JQRA 3JU4A 3CXCB 4WQMA 2QA4B 4B48A 2VBTA 2WJYA 2X6XA 1T6ZA 1E43A 3QFCA 1JJ2B 2CW5A 5H59A 4Z4UA 1R5NA 1D2EA 1OB2A 1D1NA 4X07A 2JIZA 1EP3B 4DNRB 3AVUA 1WOSA 3ZZ0A 1QX4A 2CC2A 3SLDA 3CMMA 4G7XA 2LZJA 4WZKA 3E1YE 1BPLA 3DDYA 2OBRA 3GIRA 4Z4VA 2YWHA 2ZZFA 3H9NA 3OZWA 1UD3A 3ASQA 4B44A 4WZTA 2I1LA 3P26A 2WZPP 5BSYA 3W2IA 3CESA 3E20A 2OK8A 3WNDA 3CCMB 2C2WA 2FX3A 4M4SA 4RCZA 3CC4B 1UD8A 3W5VA 1WTHD 1TUIA 2BGIA 5FIUA 1VQMB 2XGJA 4TMXA 4G5GA 3AVYA 1FRNA 2XEXA 4Y9UA 3SJZA 3OFNA 4Z4SA 1E62A 3G05A 3CCLB 5HKKA 1QGZA 5TR9A 4NNJA 1QFYA 2ZITA 2GK7A 4P2NA 3W2GA 1EP1B 1KD1D 4Z4TA 4P22A 1UD6A 5E6TA 1JA0A 3BH4A 2Z6BD 4IW3B 1WOPA 1W0KA 4NBSA 1VQKB 5A88A 2Q6LA 2WYRA 5KNLA 2V7WA 3R6JA 1GAQA 1CNEA 1V0EA 1VQOB 2X6WA 1VQNB 4DQLA 2GQFA 4Z1MA 2JJ1A 2P3MA 3ASPA 1VQ9B 3I55B 4L8JA 1EXMA 2ZTNA 4LC0A 3WNCA 1H42A 4OPSA 1E3ZA 3ZBUA 5A8AA 4XOTA 3W2FA 2EIXA 2V31A 4PC7A 3GSIA 1VQ6B 2KVOA 1NB0A 1WDTA 3QFTA 4FK8A 2Q6OA 3WNBA 2VJIA 3PENA 3T51B 2GREA 3U6KA 2Q6IA 1VQ7B 3PA1A 4PC3A 1AMOA 3LVBA 3CPWB 2C5HA 1T5EA 3AVWA 3U2QA 4OOVA 1GO2A 2C78A 5TRDA 2DERA 1IB0A 3GVLA 4G6IA 1FDRA 4WZLA 4LBVA 4X7CA 4AC9A 2WSSA 5F4MA 4KKSA 4TMTA 3OZUA 4XORA 1IHMA 1UD2A 2VNKA 3A8IA 1JB9A 1W2BB 4RM0A 2C4UA 3PUNA 2GJPA 1YJNB 4AF6A 1H8EA 3W2HA 1G7RA 1RQRA 5BSXA 2PLFA 3ES9A 3ASTA 1KTVA 1XQBA 3OKXA 4K1XA 3CCQB 2VBVA 1D8TA 1K73D 4II3A 1G7CA 1PJ5A 2WR8A 1V0FA 3SJPA 3WBJA 2ZXHA 4N3NA 2WPDA 4C0SA 3ZPNA 2VNHA 3I56B 2CBXA 3ZZUA 2VNJA 1W87A 4PGOA 4OPVA 1H8HA 1FNBA 1U2RA 1EFCA 4Z4WA 5IYWA 4TKOB 1YLOA 1VJSA 5B6IA 3RY8A 4ZCLA 1W34A 2X8KA 1N06A 2YWEA 4QFMA 1P4MA 2WZNA 2M5SA 4X7DA 1BJKA 4XM3A 1YJ9B 4B3FX 4X0CA 1Q82D 1VQ4B 4FWTA 4OPOA 4QV2A 3OP1A 2V7QA 2DIEA 1YI2B 1I18A 1KK3A 2PE3A 4PC2A 3H94A 5LMZA 1EWYA 5FNZA 2ZXIA 4NCNA 1BQEA 1TLLA 3CP2A 2F43A 5DN6A 4Z4RA 2BGJA 1QGYA 4Z4YA 3LQ6A 4XLCA 1N8RD 2QTLA 5KW9A 2NV4A 4QUZA 2J7KA 2BSAA 4ZGQB 4H9GA 1TTTA 4PABA 4KKTA 3ZIAA 1QVFB 1N0UA 2DY1A 3D26A 4RD6A 1KK0A 4P1VA 2X0KA 2DOGA 3ASRA 2D3LA 3BC9A 1WPCA 3BY1A 3VNUA 3FPPA 3OJXA 4E0FA 3W2EA 4OOXA 1IJEA 2BPOA 4GQNA 2AHOA 3B8HA 4RD1A 2JN9A 2CNDA 2C5BA 1NRKA 5FO0A 1KJZA 2D3NA 4X7EA 2X85A 5F4OA 2VZLA 3KL9A 3CCSB 4YAUA 1I7PA 4BPRA 4TSFA 1Q86D 3FJOA 3B82A 3MCAA 3Q39A 2B7BA 3PUMA 4KKUA 4ROXA 4HE5A 1PJ6A 1GR1A 2BM1A 1VF7A 4N3GA 2X3UA 1GAWA 1QUFA 4JMQA 2F1MA 1NDHA 1PKVA 2OK7A 3QFRA 4UZEA 4P3IA 3CC7B 2OBTA 3MMPA 4AVZA 4P6VF 2R9VA 3G6EB 4RLZA 4X05A 2ZZQA 4TN1A 4XLHA 2WJVA 2VNIA 1DG1G 1K28D 3CTAA 3V7AA 1KC8D 1BLIA 1QFJA 4ASUA 3CCVB 1K8AD 2OTJB 3BCFA 2ZBUA 1Y0YA 1VLYA 3CCUB 2E1RA 4P6YA 2BM0A 4G1BA 4F7DA 1IJFA 2NPFA 2X6YA 3QE2A 4II2A 2JJ2A 3SEJA 3WY9A 5J3OA 1F60A 1OGIA 1W35A 2QTZA 1HZEA 2ZTGA 4WWVA 2XZOA 3WBKA 1ZM2A 4X8IA 5JBQA 3Q38A 2D9RA 2W6JA 5FL7A 4ZGNB 3VMFA 1G7SA 1S0UA 3ONYA 1G7TA 3BCDA 1ZM4A 1CNFA 2F4NA 3OEHA 4XNFA 2XZLA 4M53A 2XNDA 1FNDA 1WOOA 3BNWA 4ACBA 5THXA 3CB4A 5IYNA 1FRQA 4P12A 2QGGA 5KSWB 4ZV4A 2OBSA 5IK2A 3ZUGA 3FKSA 4XN3A 4TMWA 1FX0A 1SM4A 4OP7A 2V4DA 3ASSA 4YELA 1MRZA 2GJRA 5L46A 4XONA 4P3YA 1EP2B 3VNVA 1COWA 2CRVA 2C77A 4TMVA 1QG0A 1TVCA 2E1BA 1B2RA 4QHYA 1KRHA 2D74A 4XLAA 5TY0A 5A89A 1E1RA 1N05A 5AN9A 1T6YA 4YEJA 5GV7A 2V7XA 4G1VA 4RD4A 3CCRB 1R5BA 3JQPA 3CPXA 3CW2A 4DNTB 3GVKA 3VO1A 4UAJA 1ZUNB 2HDNB 4MYUA 3GQBA 3OW2B 2F1LA 4XKWA 3W5UA 2QMUA 4B47A 3KEWA 2B7CA 3P27A 3W5HA 3WYAA 1KK1A 1AIPA 2HMAA 1EFTA 3OPOA 4ACAA 2QDXA 3CC2B 1OB5A 4YAOA 1QGAA 4UZFA 3SLNA 4AF7A 2QN6A 3FPKA 4YALA 3LNNA 5F4JA 2VBSA 4YHBA 2ZZGA 4DK1A 1E63A 3A35A 5TV2A 4RD2A 4P9SA 4XN0A 1N0VC 1OHHA 1Q9SA 5J35A 4M1KA 5CDFA 3MHPA
chains in the Genus database with same CATH topology
4WZEA 4OPSA 3Q39A 3PUMA 4ROXA 3PA2A 2ZL7A 3PA1A 4P3IA 4OOSA 4X06A 3Q6RA 4RPBA 2OBTA 4OOVA 4Z4ZA 4RLZA 4WZLA 4RPDA 4X05A 4X7CA 5F4MA 4RDLA 1IHMA 3V7AA 4RM0A 5HZBA 3PUNA 4P26A 5BSXA 3ASTA 4QVJA 2ZL5A 3LQEA 5IYQA 3SEJA 5J3OA 4P25A 3SJPA 2ZL6A 3Q38A 3R6KA 4X7FA 3ONYA 4OPVA 4Z4WA 3SKBA 5IYWA 4Z4UA 4X07A 3RY8A 5IYNA 4P12A 2OBSA 3BY2A 3SLDA 4WZKA 5IYRA 4X7DA 4RDJA 4OP7A 3ASSA 3Q6QA 2OBRA 4X0CA 4Z4VA 4OPOA 4QV2A 3ASQA 4QVAA 4WZTA 5BSYA 5IYPA 3BQJA 3ONUA 4Z4RA 4Z4YA 3LQ6A 4Z4SA 5KW9A 4QUZA 4P2NA 3Q3AA 4Z4TA 3D26A 4P1VA 5E6TA 3ASRA 3PVDA 3BY1A 3SLNA 5F4JA 4OOXA 3R6JA 4RDKA 3ASPA 5HZAA 4X7EA 5F4OA 5J35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZE A;  4OPS A;  3Q39 A;  3PUM A;  4ROX A;  3PA2 A;  2ZL7 A;  3PA1 A;  4P3I A;  4OOS A;  4X06 A;  3Q6R A;  4RPB A;  2OBT A;  4OOV A;  4Z4Z A;  4RLZ A;  4WZL A;  4RPD A;  4X05 A;  4X7C A;  5F4M A;  4RDL A;  1IHM A;  3V7A A;  4RM0 A;  5HZB A;  3PUN A;  4P26 A;  5BSX A;  3AST A;  4QVJ A;  2ZL5 A;  3LQE A;  5IYQ A;  3SEJ A;  5J3O A;  4P25 A;  3SJP A;  2ZL6 A;  3Q38 A;  3R6K A;  4X7F A;  3ONY A;  4OPV A;  4Z4W A;  3SKB A;  5IYW A;  4Z4U A;  4X07 A;  3RY8 A;  5IYN A;  4P12 A;  2OBS A;  3BY2 A;  3SLD A;  4WZK A;  5IYR A;  4X7D A;  4RDJ A;  4OP7 A;  3ASS A;  3Q6Q A;  2OBR A;  4X0C A;  4Z4V A;  4OPO A;  4QV2 A;  3ASQ A;  4QVA A;  4WZT A;  5BSY A;  5IYP A;  3BQJ A;  3ONU A;  4Z4R A;  4Z4Y A;  3LQ6 A;  4Z4S A;  5KW9 A;  4QUZ A;  4P2N A;  3Q3A A;  4Z4T A;  3D26 A;  4P1V A;  5E6T A;  3ASR A;  3PVD A;  3BY1 A;  3SLN A;  5F4J A;  4OOX A;  3R6J A;  4RDK A;  3ASP A;  5HZA A;  4X7E A;  5F4O A;  5J35 A; 
#chains in the Genus database with same CATH topology
 1WU8 A;  5H5J A;  4XOP A;  3B78 A;  3OZV A;  3ISX A;  1YIT B;  2FVG A;  3AVT A;  3T56 B;  2XNC A;  3WXM A;  1N08 A;  3PA2 A;  4LBZ A;  2GK6 A;  2QE7 A;  1VHE A;  1UMK A;  1S72 B;  1E3X A;  2BF4 A;  3AVV A;  1SKY B;  1WOR A;  4OOS A;  4X06 A;  4Y9R A;  1K9M D;  4RPB A;  3QFS A;  2CF4 A;  4Z4Z A;  1OB0 A;  3GVJ A;  3A8J A;  3WQZ A;  3HAG A;  2XOK A;  1V5V A;  2CK3 A;  3ZC3 A;  4B3X A;  5FO1 A;  1YIJ B;  1I8D A;  3AGP A;  2BV3 A;  2XNJ A;  1VQ8 B;  1S4M A;  2V7V A;  1E1Q A;  1WSV A;  1XB2 A;  2ZZE A;  2PIA A;  4P26 A;  2VJJ A;  3G71 B;  2HCJ B;  2RC5 A;  1OGJ A;  4QVJ A;  2DET A;  1BMF A;  2ZL5 A;  5HXB A;  4B3G A;  4FN5 A;  4RD3 A;  2HLD A;  3OOC A;  3VO2 A;  1KMH A;  1ZM9 A;  4P25 A;  1VQL B;  3ZBT A;  4J0Q A;  3R6K A;  2R6H A;  1WSR A;  4B4D A;  1DDI A;  3A3B A;  3NE5 B;  3CP8 A;  4X7F A;  3AVX A;  4YAW A;  1FNM A;  3LO8 A;  4RD0 A;  3G4S B;  2VBU A;  4EH1 A;  3SKB A;  3JQQ A;  3J81 k;  1NB9 A;  3CD6 B;  2ZBV A;  2DYI A;  4PC6 A;  4UZU A;  2DEU A;  1QH0 A;  3BY2 A;  4LBY A;  1PJ7 A;  3V76 A;  2VYQ A;  5IYR A;  4RDJ A;  4C43 A;  1XE1 A;  3Q6Q A;  1ELO A;  1GJR A;  1JA1 A;  1JNY A;  5EMN A;  5DSZ A;  3U6B A;  2YWG A;  2OYN A;  4LBW A;  1A8P A;  2GJK A;  3OAA A;  4G7W A;  4QVA A;  4HIZ A;  4Q7J B;  4M2L A;  4FXU A;  1M90 D;  1N07 A;  2V7T A;  2DCU A;  1YJW B;  2V7U A;  5IYP A;  1RQP A;  2C4T A;  2RC6 A;  1Q81 D;  3A3G A;  1NBM A;  3BQJ A;  3CMA B;  4Y7C A;  4XKV A;  1BX1 A;  4XMY A;  3ONU A;  4MYT A;  4PAA A;  2OTL B;  1SKQ A;  1W9X A;  4PC1 A;  1QUE A;  4XR6 A;  3CCJ B;  1ZM3 A;  4CQJ A;  4B43 A;  4ZCI A;  1T6X A;  2BVN A;  3CME B;  1QVG B;  2XZP A;  3OJW A;  3Q3A A;  3AGQ A;  3A8K A;  4XLF A;  1EFU A;  3PVD A;  4XQF A;  1E64 A;  1YHQ B;  1H85 A;  1EFR A;  3T53 B;  4TMZ A;  1R5O A;  1WP6 A;  2YWF A;  4HE6 A;  4RCY A;  5DS0 A;  4DK0 A;  4DQK A;  4RDK A;  1KK2 A;  5GV8 A;  5HZA A;  3CCE B;  4XD7 A;  2BMW A;  3CRZ A;  4R71 A;  5FA6 A;  4WZE A;  1M1K D;  3VR6 A;  4U9U A;  4XL9 A;  1Q7Y D;  1F20 A;  1VLO A;  1W0J A;  1KQS B;  1J9Z A;  1B23 P;  2ZL7 A;  2Q6K A;  1VQ5 B;  1DAR A;  2EFG A;  1UD5 A;  3Q6R A;  1MAB A;  3I1F A;  1VQP B;  4XLE A;  1UD4 A;  4RPD A;  1FNC A;  3A1P A;  3OEE A;  1DDG A;  4RDL A;  1YX2 A;  2W6I A;  4TT3 A;  2QEX B;  3OW7 A;  4RJL A;  5HZB A;  3QSY A;  2JDI A;  3ZZT A;  4M0L A;  1VHO A;  1BX0 A;  3LQE A;  5IYQ A;  1KZL A;  1HVX A;  1GVH A;  1CQX A;  1E79 A;  1XFO A;  3OE7 A;  1QFZ A;  2BN4 A;  4YAF A;  1NJI D;  1HA3 A;  1Y0R A;  2X53 S;  2ZL6 A;  2PMD A;  4ZCM A;  4YXW A;  2GPJ A;  2B5O A;  3JQR A;  3JU4 A;  3CXC B;  4WQM A;  2QA4 B;  4B48 A;  2VBT A;  2WJY A;  2X6X A;  1T6Z A;  1E43 A;  3QFC A;  1JJ2 B;  2CW5 A;  5H59 A;  4Z4U A;  1R5N A;  1D2E A;  1OB2 A;  1D1N A;  4X07 A;  2JIZ A;  1EP3 B;  4DNR B;  3AVU A;  1WOS A;  3ZZ0 A;  1QX4 A;  2CC2 A;  3SLD A;  3CMM A;  4G7X A;  2LZJ A;  4WZK A;  3E1Y E;  1BPL A;  3DDY A;  2OBR A;  3GIR A;  4Z4V A;  2YWH A;  2ZZF A;  3H9N A;  3OZW A;  1UD3 A;  3ASQ A;  4B44 A;  4WZT A;  2I1L A;  3P26 A;  2WZP P;  5BSY A;  3W2I A;  3CES A;  3E20 A;  2OK8 A;  3WND A;  3CCM B;  2C2W A;  2FX3 A;  4M4S A;  4RCZ A;  3CC4 B;  1UD8 A;  3W5V A;  1WTH D;  1TUI A;  2BGI A;  5FIU A;  1VQM B;  2XGJ A;  4TMX A;  4G5G A;  3AVY A;  1FRN A;  2XEX A;  4Y9U A;  3SJZ A;  3OFN A;  4Z4S A;  1E62 A;  3G05 A;  3CCL B;  5HKK A;  1QGZ A;  5TR9 A;  4NNJ A;  1QFY A;  2ZIT A;  2GK7 A;  4P2N A;  3W2G A;  1EP1 B;  1KD1 D;  4Z4T A;  4P22 A;  1UD6 A;  5E6T A;  1JA0 A;  3BH4 A;  2Z6B D;  4IW3 B;  1WOP A;  1W0K A;  4NBS A;  1VQK B;  5A88 A;  2Q6L A;  2WYR A;  5KNL A;  2V7W A;  3R6J A;  1GAQ A;  1CNE A;  1V0E A;  1VQO B;  2X6W A;  1VQN B;  4DQL A;  2GQF A;  4Z1M A;  2JJ1 A;  2P3M A;  3ASP A;  1VQ9 B;  3I55 B;  4L8J A;  1EXM A;  2ZTN A;  4LC0 A;  3WNC A;  1H42 A;  4OPS A;  1E3Z A;  3ZBU A;  5A8A A;  4XOT A;  3W2F A;  2EIX A;  2V31 A;  4PC7 A;  3GSI A;  1VQ6 B;  2KVO A;  1NB0 A;  1WDT A;  3QFT A;  4FK8 A;  2Q6O A;  3WNB A;  2VJI A;  3PEN A;  3T51 B;  2GRE A;  3U6K A;  2Q6I A;  1VQ7 B;  3PA1 A;  4PC3 A;  1AMO A;  3LVB A;  3CPW B;  2C5H A;  1T5E A;  3AVW A;  3U2Q A;  4OOV A;  1GO2 A;  2C78 A;  5TRD A;  2DER A;  1IB0 A;  3GVL A;  4G6I A;  1FDR A;  4WZL A;  4LBV A;  4X7C A;  4AC9 A;  2WSS A;  5F4M A;  4KKS A;  4TMT A;  3OZU A;  4XOR A;  1IHM A;  1UD2 A;  2VNK A;  3A8I A;  1JB9 A;  1W2B B;  4RM0 A;  2C4U A;  3PUN A;  2GJP A;  1YJN B;  4AF6 A;  1H8E A;  3W2H A;  1G7R A;  1RQR A;  5BSX A;  2PLF A;  3ES9 A;  3AST A;  1KTV A;  1XQB A;  3OKX A;  4K1X A;  3CCQ B;  2VBV A;  1D8T A;  1K73 D;  4II3 A;  1G7C A;  1PJ5 A;  2WR8 A;  1V0F A;  3SJP A;  3WBJ A;  2ZXH A;  4N3N A;  2WPD A;  4C0S A;  3ZPN A;  2VNH A;  3I56 B;  2CBX A;  3ZZU A;  2VNJ A;  1W87 A;  4PGO A;  4OPV A;  1H8H A;  1FNB A;  1U2R A;  1EFC A;  4Z4W A;  5IYW A;  4TKO B;  1YLO A;  1VJS A;  5B6I A;  3RY8 A;  4ZCL A;  1W34 A;  2X8K A;  1N06 A;  2YWE A;  4QFM A;  1P4M A;  2WZN A;  2M5S A;  4X7D A;  1BJK A;  4XM3 A;  1YJ9 B;  4B3F X;  4X0C A;  1Q82 D;  1VQ4 B;  4FWT A;  4OPO A;  4QV2 A;  3OP1 A;  2V7Q A;  2DIE A;  1YI2 B;  1I18 A;  1KK3 A;  2PE3 A;  4PC2 A;  3H94 A;  5LMZ A;  1EWY A;  5FNZ A;  2ZXI A;  4NCN A;  1BQE A;  1TLL A;  3CP2 A;  2F43 A;  5DN6 A;  4Z4R A;  2BGJ A;  1QGY A;  4Z4Y A;  3LQ6 A;  4XLC A;  1N8R D;  2QTL A;  5KW9 A;  2NV4 A;  4QUZ A;  2J7K A;  2BSA A;  4ZGQ B;  4H9G A;  1TTT A;  4PAB A;  4KKT A;  3ZIA A;  1QVF B;  1N0U A;  2DY1 A;  3D26 A;  4RD6 A;  1KK0 A;  4P1V A;  2X0K A;  2DOG A;  3ASR A;  2D3L A;  3BC9 A;  1WPC A;  3BY1 A;  3VNU A;  3FPP A;  3OJX A;  4E0F A;  3W2E A;  4OOX A;  1IJE A;  2BPO A;  4GQN A;  2AHO A;  3B8H A;  4RD1 A;  2JN9 A;  2CND A;  2C5B A;  1NRK A;  5FO0 A;  1KJZ A;  2D3N A;  4X7E A;  2X85 A;  5F4O A;  2VZL A;  3KL9 A;  3CCS B;  4YAU A;  1I7P A;  4BPR A;  4TSF A;  1Q86 D;  3FJO A;  3B82 A;  3MCA A;  3Q39 A;  2B7B A;  3PUM A;  4KKU A;  4ROX A;  4HE5 A;  1PJ6 A;  1GR1 A;  2BM1 A;  1VF7 A;  4N3G A;  2X3U A;  1GAW A;  1QUF A;  4JMQ A;  2F1M A;  1NDH A;  1PKV A;  2OK7 A;  3QFR A;  4UZE A;  4P3I A;  3CC7 B;  2OBT A;  3MMP A;  4AVZ A;  4P6V F;  2R9V A;  3G6E B;  4RLZ A;  4X05 A;  2ZZQ A;  4TN1 A;  4XLH A;  2WJV A;  2VNI A;  1DG1 G;  1K28 D;  3CTA A;  3V7A A;  1KC8 D;  1BLI A;  1QFJ A;  4ASU A;  3CCV B;  1K8A D;  2OTJ B;  3BCF A;  2ZBU A;  1Y0Y A;  1VLY A;  3CCU B;  2E1R A;  4P6Y A;  2BM0 A;  4G1B A;  4F7D A;  1IJF A;  2NPF A;  2X6Y A;  3QE2 A;  4II2 A;  2JJ2 A;  3SEJ A;  3WY9 A;  5J3O A;  1F60 A;  1OGI A;  1W35 A;  2QTZ A;  1HZE A;  2ZTG A;  4WWV A;  2XZO A;  3WBK A;  1ZM2 A;  4X8I A;  5JBQ A;  3Q38 A;  2D9R A;  2W6J A;  5FL7 A;  4ZGN B;  3VMF A;  1G7S A;  1S0U A;  3ONY A;  1G7T A;  3BCD A;  1ZM4 A;  1CNF A;  2F4N A;  3OEH A;  4XNF A;  2XZL A;  4M53 A;  2XND A;  1FND A;  1WOO A;  3BNW A;  4ACB A;  5THX A;  3CB4 A;  5IYN A;  1FRQ A;  4P12 A;  2QGG A;  5KSW B;  4ZV4 A;  2OBS A;  5IK2 A;  3ZUG A;  3FKS A;  4XN3 A;  4TMW A;  1FX0 A;  1SM4 A;  4OP7 A;  2V4D A;  3ASS A;  4YEL A;  1MRZ A;  2GJR A;  5L46 A;  4XON A;  4P3Y A;  1EP2 B;  3VNV A;  1COW A;  2CRV A;  2C77 A;  4TMV A;  1QG0 A;  1TVC A;  2E1B A;  1B2R A;  4QHY A;  1KRH A;  2D74 A;  4XLA A;  5TY0 A;  5A89 A;  1E1R A;  1N05 A;  5AN9 A;  1T6Y A;  4YEJ A;  5GV7 A;  2V7X A;  4G1V A;  4RD4 A;  3CCR B;  1R5B A;  3JQP A;  3CPX A;  3CW2 A;  4DNT B;  3GVK A;  3VO1 A;  4UAJ A;  1ZUN B;  2HDN B;  4MYU A;  3GQB A;  3OW2 B;  2F1L A;  4XKW A;  3W5U A;  2QMU A;  4B47 A;  3KEW A;  2B7C A;  3P27 A;  3W5H A;  3WYA A;  1KK1 A;  1AIP A;  2HMA A;  1EFT A;  3OPO A;  4ACA A;  2QDX A;  3CC2 B;  1OB5 A;  4YAO A;  1QGA A;  4UZF A;  3SLN A;  4AF7 A;  2QN6 A;  3FPK A;  4YAL A;  3LNN A;  5F4J A;  2VBS A;  4YHB A;  2ZZG A;  4DK1 A;  1E63 A;  3A35 A;  5TV2 A;  4RD2 A;  4P9S A;  4XN0 A;  1N0V C;  1OHH A;  1Q9S A;  5J35 A;  4M1K A;  5CDF A;  3MHP A; 
#chains in the Genus database with same CATH homology
 4WZE A;  4OPS A;  3Q39 A;  3PUM A;  4ROX A;  3PA2 A;  2ZL7 A;  3PA1 A;  4P3I A;  4OOS A;  4X06 A;  3Q6R A;  4RPB A;  2OBT A;  4OOV A;  4Z4Z A;  4RLZ A;  4WZL A;  4RPD A;  4X05 A;  4X7C A;  5F4M A;  4RDL A;  1IHM A;  3V7A A;  4RM0 A;  5HZB A;  3PUN A;  4P26 A;  5BSX A;  3AST A;  4QVJ A;  2ZL5 A;  3LQE A;  5IYQ A;  3SEJ A;  5J3O A;  4P25 A;  3SJP A;  2ZL6 A;  3Q38 A;  3R6K A;  4X7F A;  3ONY A;  4OPV A;  4Z4W A;  3SKB A;  5IYW A;  4Z4U A;  4X07 A;  3RY8 A;  5IYN A;  4P12 A;  2OBS A;  3BY2 A;  3SLD A;  4WZK A;  5IYR A;  4X7D A;  4RDJ A;  4OP7 A;  3ASS A;  3Q6Q A;  2OBR A;  4X0C A;  4Z4V A;  4OPO A;  4QV2 A;  3ASQ A;  4QVA A;  4WZT A;  5BSY A;  5IYP A;  3BQJ A;  3ONU A;  4Z4R A;  4Z4Y A;  3LQ6 A;  4Z4S A;  5KW9 A;  4QUZ A;  4P2N A;  3Q3A A;  4Z4T A;  3D26 A;  4P1V A;  5E6T A;  3ASR A;  3PVD A;  3BY1 A;  3SLN A;  5F4J A;  4OOX A;  3R6J A;  4RDK A;  3ASP A;  5HZA A;  4X7E A;  5F4O A;  5J35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...