2KVOA

Solution nmr structure of photosystem ii reaction center psb28 protein from synechocystis sp.(strain pcc 6803), northeast structural genomics consortium target sgr171
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
120
structure length
120
Chain Sequence
MAEIQFSKGVAETVVPEVRLSKSKNGQSGMAKFYFLEPTILAKESTDDITGMYLIDDEGEIITREVKGKFINGRPTAIEATVILNSQPEWDRFMRFMERYGAENGLGFSKSELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem II reaction center psb28 protein
publication title Solution NMR structure of photosystem II reaction center protein Psb28 from Synechocystis sp. Strain PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp.
total genus 16
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03912 Psb28 Psb28 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.220 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2kvoA01
2KVOA 3ZPNA
chains in the Genus database with same CATH superfamily
4YAOA 1CQXA 2C5HA 1S4MA 1GR1A 2ZL5A 1EP1B 2OBTA 2Q6LA 4FK8A 1E64A 1JA1A 1R5OA 2JIZA 4TN1A 1N05A 4Z4YA 3DDYA 4XMYA 4RDJA 3QFSA 1OB5A 1PJ5A 1WSVA 5H5JA 4UAJA 2DEUA 1BMFA 4ZCIA 4Z4WA 4NCNA 3OJXA 2F1LA 2HCJB 2D3NA 2RC6A 1HZEA 1R5NA 2WZPP 3OZWA 3LNNA 3RY8A 1VHOA 4LBWA 3JQRA 4QUZA 3QFCA 2WJYA 1W0KA 1XQBA 3PUNA 2LZJA 4DQLA 3CCLB 1DDGA 1FRNA 1EP2B 3BY1A 3ZBUA 1Q7YD 2ZXHA 1U2RA 5A88A 2PLFA 2X6WA 2V7UA 2VBVA 1I8DA 2JJ2A 4PAAA 5LMZA 1QUEA 2OBRA 1N07A 4RM0A 4B3FX 1WOOA 1VQ4B 1VQNB 1H85A 3ISXA 4II2A 2EFGA 4R71A 3OFNA 1VQOB 1BJKA 2HDNB 2W6IA 4ZCMA 2X85A 1QVFB 1NB9A 1PJ6A 1N08A 4U9UA 1ELOA 4GQNA 4X06A 1VJSA 4RD4A 1PJ7A 3JQPA 1UD8A 3H9NA 3LVBA 1T5EA 3E20A 1FNMA 3CC4B 1RQPA 2D74A 4C0SA 1NRKA 2QGGA 4QVJA 3BQJA 4PC6A 1OGJA 1WSRA 2VJIA 2C78A 4XONA 3WQZA 3W2HA 4B4DA 3CPWB 1T6XA 4XKVA 2VYQA 3U2QA 1T6YA 3B78A 3LO8A 1VQ8B 3FPKA 2KVOA 2NPFA 3CCQB 3W2FA 1OB0A 1VQ5B 2BVNA 1N06A 1XB2A 3ASSA 1EXMA 4Z4SA 1ZM4A 3CD6B 2Q6OA 4YHBA 1E43A 1B23P 1TTTA 1SM4A 4RCYA 4XR6A 5L46A 3AGQA 5IYNA 1QGYA 2J7KA 3WBKA 1W9XA 2BV3A 4TSFA 1KZLA 5E6TA 1VLYA 1QGAA 2ZBUA 2CNDA 2R6HA 2VNIA 2WJVA 4RD2A 4YAUA 4B48A 3AVUA 2DERA 1ZM9A 1T6ZA 3OZVA 4P2NA 4PC3A 3PA1A 1YITB 5KW9A 1W0JA 2WR8A 3CESA 1HVXA 4M0LA 2OTLB 1ZM3A 2CW5A 3CCEB 1NB0A 4P3YA 1VQ9B 3SEJA 2NV4A 1GAWA 3QFTA 1YJNB 3WXMA 4WZTA 1MABA 2Q6IA 4E0FA 5BSYA 2BN4A 4WZEA 5AN9A 4G7WA 1GVHA 2OK8A 4PC7A 2VJJA 4XLAA 1J9ZA 3GVLA 4B3GA 1D8TA 1P4MA 1K73D 1NDHA 2VBTA 3HAGA 3P27A 4XL9A 3CC2B 4P1VA 3OJWA 4RDLA 3CXCB 3ZZTA 3ONYA 3ASQA 4WQMA 4YELA 1YI2B 2B7BA 3KEWA 1EFRA 5FO0A 3ZC3A 2QN6A 2OBSA 1E79A 2GPJA 1HA3A 3QFRA 4DNRB 4TMZA 3Q39A 1QFZA 2DCUA 4RD1A 4OPOA 5FL7A 3ASPA 1H42A 1QG0A 2CF4A 3ZUGA 4HE6A 5TY0A 3VMFA 3OW2B 1VQLB 2V7WA 3G6EB 1DDIA 4QFMA 2ZL7A 2C4UA 4ZCLA 4NBSA 2M5SA 1KD1D 4FWTA 2OYNA 2VNJA 4HIZA 1WOPA 1A8PA 4KKSA 4OPSA 1I7PA 3V7AA 2YWFA 2QA4B 1H8HA 1KK3A 4Z4RA 4B44A 1KK1A 1KQSB 3ASTA 5EMNA 5GV7A 4LBZA 4RPDA 3SJZA 2ZITA 4XLEA 2OK7A 1QUFA 4M4SA 4F7DA 4AVZA 3SLDA 4G1BA 1E63A 2ZXIA 3CCJB 2QDXA 4PC2A 1FX0A 3ASRA 3NE5B 2BGIA 1YJWB 2JDIA 3T53B 1VLOA 1M90D 1E3XA 4TMWA 3VR6A 3VNVA 1QFYA 3CCSB 3AVTA 2WYRA 5IYRA 1OHHA 5J35A 1AIPA 3AVVA 2BM1A 1OB2A 2BPOA 2AHOA 2YWEA 4Z4ZA 1W2BB 1KC8D 1IB0A 1EFCA 3WNDA 4HE5A 4P12A 3SJPA 3OEHA 3OP1A 2YWGA 1GO2A 1FNCA 4UZFA 3W2EA 5HXBA 3MHPA 4YAFA 1V5VA 3BY2A 3CMMA 2XNJA 3CMAB 4WZKA 1IJEA 5CDFA 1Y0RA 2CK3A 3LQ6A 4UZUA 5THXA 4P6VF 3A8KA 4C43A 2ZTNA 1G7CA 1XE1A 3OKXA 4OPVA 1S72B 2GK7A 2D9RA 3SLNA 4L8JA 4YAWA 1VQMB 1CNEA 3GQBA 1B2RA 4WWVA 5IK2A 2E1RA 4OOSA 3A8JA 3Q6RA 4MYUA 2DOGA 2W6JA 4NNJA 4LBYA 2X6YA 4ASUA 1IJFA 3PENA 1QFJA 1M1KD 2FX3A 4Y7CA 4P6YA 4K1XA 3CCVB 4X7DA 2GJPA 1SKYB 3FKSA 4QV2A 1VF7A 5KNLA 2Q6KA 4G1VA 2P3MA 5F4MA 1WOSA 4X07A 1QH0A 5HKKA 4ZV4A 3ZIAA 2QTLA 4XKWA 2C77A 4B43A 1E1RA 4X7FA 3W5VA 1WDTA 1TVCA 4P22A 4Z4TA 1UD6A 2QMUA 5FNZA 2I1LA 3FJOA 1N0UA 4XN0A 1Y0YA 4XORA 1FNDA 3BCDA 2X6XA 4P3IA 3R6KA 4XLCA 1VHEA 3PA2A 1EP3B 5IYWA 3ZBTA 2X8KA 3AVXA 4RD0A 3Q6QA 4G6IA 1JNYA 1KTVA 4Y9UA 4XOPA 2QE7A 4PGOA 4XOTA 4Z4UA 5IYQA 2XNCA 2ZBVA 3KL9A 3GIRA 4QHYA 3PVDA 1KK0A 2WSSA 4Z4VA 2XEXA 5TR9A 1JB9A 1EFTA 3PUMA 4G7XA 3A3GA 5KSWB 2ZZQA 4M2LA 2CRVA 5HZAA 3QSYA 5DSZA 4KKUA 4RD3A 1GAQA 4AF6A 2XZLA 1D2EA 2BM0A 3CRZA 2OTJB 2R9VA 1Q81D 4RDKA 1SKQA 2X53S 2VNKA 4X8IA 4M53A 3H94A 4RD6A 4CQJA 1V0EA 4XNFA 4AC9A 2DY1A 4TT3A 3VO2A 1Q86D 2XZOA 4M1KA 3CTAA 2C4TA 4B3XA 3JQQA 3BC9A 1TUIA 2BMWA 4LC0A 1FRQA 1GJRA 1UD2A 2EIXA 5B6IA 3WBJA 3A3BA 3I1FA 5H59A 3AGPA 4RPBA 2V7QA 4JMQA 1YIJB 3I55B 4TMVA 1DARA 1IHMA 2B5OA 2V7VA 3CC7B 2XZPA 1YJ9B 2GJRA 4XLHA 5TRDA 1YLOA 1N8RD 4XQFA 3BNWA 3CCUB 2VBUA 1MRZA 3OAAA 4G5GA 2F4NA 4ACBA 4II3A 5JBQA 4QVAA 3CMEB 1WP6A 4IW3B 4B47A 3J81k 2VBSA 1YHQB 2D3LA 4DNTB 3QE2A 2X0KA 3WNCA 1WU8A 2V31A 3CPXA 1D1NA 1RQRA 4YEJA 1QGZA 4H9GA 4J0QA 4ROXA 3T51B 3ZZ0A 2RC5A 3LQEA 3W2IA 3B8HA 3GVKA 1UD5A 2C5BA 3G71B 1KJZA 5F4JA 4BPRA 3I56B 3Q3AA 1WPCA 1UD4A 2WZNA 4P25A 3U6KA 1KMHA 1H8EA 3W5UA 2FVGA 5TV2A 2VZLA 3OPOA 4DK1A 3WYAA 1FNBA 2V7TA 1G7TA 2DETA 1I18A 3G4SB 2WPDA 1N0VC 4FXUA 3MCAA 5DN6A 1V0FA 4XM3A 1ZM2A 2ZZEA 5A8AA 1E3ZA 5A89A 1VQPB 1F20A 2F43A 2JN9A 1KK2A 2QEXB 1F60A 4LBVA 2YWHA 2X3UA 4DQKA 1NJID 1WTHD 5FO1A 1PKVA 1Q82D 1BQEA 4N3GA 3P26A 4FN5A 1R5BA 2ZTGA 4RLZA 3W2GA 3CP8A 1BX0A 3SKBA 3BH4A 1W34A 2HMAA 5J3OA 3BCFA 3V76A 4PC1A 2E1BA 2GQFA 2GJKA 3R6JA 2PIAA 2GREA 3ZPNA 1COWA 4OP7A 3CW2A 5BSXA 1W35A 4ZGNB 2BF4A 4Q7JB 2DIEA 3GVJA 3WNBA 1VQKB 1QVGB 4X0CA 3GSIA 2B7CA 3OE7A 3CCRB 1BLIA 1E62A 4MYTA 4TKOB 5F4OA 4Z1MA 1K8AD 1UMKA 2CBXA 5DS0A 1TLLA 3CP2A 2C2WA 4KKTA 4TMTA 1EFUA 2ZZGA 1WORA 3OOCA 4XD7A 5FIUA 2F1MA 1G7SA 4AF7A 1OGIA 5HZBA 4X7CA 1K28D 3WY9A 3AVYA 3A35A 3ES9A 1UD3A 4P9SA 4X05A 2XNDA 1QX4A 4DK0A 2HLDA 1K9MD 2Z6BD 4XLFA 3W5HA 4YALA 4YXWA 4Y9RA 4N3NA 3AVWA 3A8IA 4RCZA 4X7EA 3E1YE 2ZZFA 2CC2A 3VNUA 4OOVA 4P26A 3MMPA 3CCMB 4WZLA 1BPLA 2V4DA 2JJ1A 2V7XA 4UZEA 3ONUA 3T56B 1BX1A 1ZUNB 2BGJA 1EWYA 5IYPA 2XOKA 2XGJA 4OOXA 1YX2A 3G05A 4ZGQB 1W87A 2PE3A 1JA0A 5GV8A 4EH1A 3ZZUA 3OZUA 2PMDA 4XN3A 4RJLA 1CNFA 3U6BA 1NBMA 3A1PA 5FA6A 2QTZA 3JU4A 1VQ7B 2BSAA 4TMXA 1JJ2B 1Q9SA 3OEEA 3D26A 1FDRA 3VO1A 3OW7A 4ACAA 1DG1G 1AMOA 1G7RA 1KRHA 4PABA 1E1QA 3Q38A 1VQ6B 1S0UA 3B82A 2VNHA 1XFOA 2DYIA 2GK6A 3FPPA 3CB4A 2ZL6A
chains in the Genus database with same CATH topology
1VF7A 5KNLA 5DN6A 1V0FA 2VJJA 4XM3A 2ZZEA 4XLAA 3GVLA 4B3GA 5HKKA 1E3ZA 3ZIAA 2JIZA 2F43A 3HAGA 4XKWA 4XL9A 3DDYA 1E1RA 4XMYA 4P22A 4YELA 1UD6A 1WTHD 3KEWA 1BMFA 1PKVA 1EFRA 4XN0A 4XORA 1E79A 3BCDA 2X6XA 2D3NA 2ZTGA 1HZEA 4XLCA 2WZPP 2X8KA 3LNNA 3CP8A 4G6IA 4DNRB 4XOPA 2QE7A 4XOTA 3BH4A 2WJYA 1W0KA 5FL7A 3BCFA 2LZJA 2E1BA 2WSSA 2GJKA 4G7XA 3ZPNA 1COWA 3A3GA 2ZZQA 2ZXHA 1SKYB 2M5SA 2X6WA 4KKUA 1I8DA 2JJ2A 4HIZA 2DIEA 4KKSA 3GVJA 2XZLA 4B3FX 1H8HA 3OE7A 1BLIA 4TKOB 2R9VA 4II2A 4Z1MA 2X53S 3OFNA 2W6IA 2X85A 3CP2A 4XLEA 4KKTA 3H94A 2ZZGA 3OOCA 4GQNA 4XD7A 1V0EA 2F1MA 4XNFA 1VJSA 4AVZA 4TT3A 1UD8A 2ZXIA 1K28D 2XZOA 3A35A 1T5EA 1UD3A 1FX0A 3BC9A 3NE5B 2JDIA 3T53B 2XNDA 1E3XA 1UD2A 3VR6A 4DK0A 1NRKA 2HLDA 3A3BA 2VJIA 4XONA 3WQZA 2Z6BD 4XLFA 1OHHA 2V7QA 4JMQA 4XKVA 4YXWA 2XZPA 2KVOA 3OEHA 2GJRA 4XLHA 1OB0A 2ZZFA 4XQFA 1BPLA 2V4DA 2JJ1A 3OAAA 3T56B 1E43A 4II3A 3CMMA 1WP6A 5CDFA 2D3LA 4DNTB 4XR6A 2CK3A 2XOKA 2XGJA 3G05A 4UZUA 1W9XA 2V31A 4TSFA 1KZLA 1VLYA 3FKSA 4YEJA 2WJVA 2ZTNA 4XN3A 2GK7A 1NBMA 4L8JA 3T51B 1W0JA 3GVKA 1UD5A 3GQBA 3JU4A 3CESA 1HVXA 5IK2A 4G7WA 3OEEA 2W6JA 3OW7A 4NNJA 1WPCA 1UD4A 2X6YA 4ASUA 1E1QA 1KMHA 1H8EA 1MABA 4E0FA 3OPOA 4DK1A 1I18A 2GK6A 2WPDA 3FPPA 2GJPA 4FXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVO A;  3ZPN A; 
#chains in the Genus database with same CATH topology
 4YAO A;  1CQX A;  2C5H A;  1S4M A;  1GR1 A;  2ZL5 A;  1EP1 B;  2OBT A;  2Q6L A;  4FK8 A;  1E64 A;  1JA1 A;  1R5O A;  2JIZ A;  4TN1 A;  1N05 A;  4Z4Y A;  3DDY A;  4XMY A;  4RDJ A;  3QFS A;  1OB5 A;  1PJ5 A;  1WSV A;  5H5J A;  4UAJ A;  2DEU A;  1BMF A;  4ZCI A;  4Z4W A;  4NCN A;  3OJX A;  2F1L A;  2HCJ B;  2D3N A;  2RC6 A;  1HZE A;  1R5N A;  2WZP P;  3OZW A;  3LNN A;  3RY8 A;  1VHO A;  4LBW A;  3JQR A;  4QUZ A;  3QFC A;  2WJY A;  1W0K A;  1XQB A;  3PUN A;  2LZJ A;  4DQL A;  3CCL B;  1DDG A;  1FRN A;  1EP2 B;  3BY1 A;  3ZBU A;  1Q7Y D;  2ZXH A;  1U2R A;  5A88 A;  2PLF A;  2X6W A;  2V7U A;  2VBV A;  1I8D A;  2JJ2 A;  4PAA A;  5LMZ A;  1QUE A;  2OBR A;  1N07 A;  4RM0 A;  4B3F X;  1WOO A;  1VQ4 B;  1VQN B;  1H85 A;  3ISX A;  4II2 A;  2EFG A;  4R71 A;  3OFN A;  1VQO B;  1BJK A;  2HDN B;  2W6I A;  4ZCM A;  2X85 A;  1QVF B;  1NB9 A;  1PJ6 A;  1N08 A;  4U9U A;  1ELO A;  4GQN A;  4X06 A;  1VJS A;  4RD4 A;  1PJ7 A;  3JQP A;  1UD8 A;  3H9N A;  3LVB A;  1T5E A;  3E20 A;  1FNM A;  3CC4 B;  1RQP A;  2D74 A;  4C0S A;  1NRK A;  2QGG A;  4QVJ A;  3BQJ A;  4PC6 A;  1OGJ A;  1WSR A;  2VJI A;  2C78 A;  4XON A;  3WQZ A;  3W2H A;  4B4D A;  3CPW B;  1T6X A;  4XKV A;  2VYQ A;  3U2Q A;  1T6Y A;  3B78 A;  3LO8 A;  1VQ8 B;  3FPK A;  2KVO A;  2NPF A;  3CCQ B;  3W2F A;  1OB0 A;  1VQ5 B;  2BVN A;  1N06 A;  1XB2 A;  3ASS A;  1EXM A;  4Z4S A;  1ZM4 A;  3CD6 B;  2Q6O A;  4YHB A;  1E43 A;  1B23 P;  1TTT A;  1SM4 A;  4RCY A;  4XR6 A;  5L46 A;  3AGQ A;  5IYN A;  1QGY A;  2J7K A;  3WBK A;  1W9X A;  2BV3 A;  4TSF A;  1KZL A;  5E6T A;  1VLY A;  1QGA A;  2ZBU A;  2CND A;  2R6H A;  2VNI A;  2WJV A;  4RD2 A;  4YAU A;  4B48 A;  3AVU A;  2DER A;  1ZM9 A;  1T6Z A;  3OZV A;  4P2N A;  4PC3 A;  3PA1 A;  1YIT B;  5KW9 A;  1W0J A;  2WR8 A;  3CES A;  1HVX A;  4M0L A;  2OTL B;  1ZM3 A;  2CW5 A;  3CCE B;  1NB0 A;  4P3Y A;  1VQ9 B;  3SEJ A;  2NV4 A;  1GAW A;  3QFT A;  1YJN B;  3WXM A;  4WZT A;  1MAB A;  2Q6I A;  4E0F A;  5BSY A;  2BN4 A;  4WZE A;  5AN9 A;  4G7W A;  1GVH A;  2OK8 A;  4PC7 A;  2VJJ A;  4XLA A;  1J9Z A;  3GVL A;  4B3G A;  1D8T A;  1P4M A;  1K73 D;  1NDH A;  2VBT A;  3HAG A;  3P27 A;  4XL9 A;  3CC2 B;  4P1V A;  3OJW A;  4RDL A;  3CXC B;  3ZZT A;  3ONY A;  3ASQ A;  4WQM A;  4YEL A;  1YI2 B;  2B7B A;  3KEW A;  1EFR A;  5FO0 A;  3ZC3 A;  2QN6 A;  2OBS A;  1E79 A;  2GPJ A;  1HA3 A;  3QFR A;  4DNR B;  4TMZ A;  3Q39 A;  1QFZ A;  2DCU A;  4RD1 A;  4OPO A;  5FL7 A;  3ASP A;  1H42 A;  1QG0 A;  2CF4 A;  3ZUG A;  4HE6 A;  5TY0 A;  3VMF A;  3OW2 B;  1VQL B;  2V7W A;  3G6E B;  1DDI A;  4QFM A;  2ZL7 A;  2C4U A;  4ZCL A;  4NBS A;  2M5S A;  1KD1 D;  4FWT A;  2OYN A;  2VNJ A;  4HIZ A;  1WOP A;  1A8P A;  4KKS A;  4OPS A;  1I7P A;  3V7A A;  2YWF A;  2QA4 B;  1H8H A;  1KK3 A;  4Z4R A;  4B44 A;  1KK1 A;  1KQS B;  3AST A;  5EMN A;  5GV7 A;  4LBZ A;  4RPD A;  3SJZ A;  2ZIT A;  4XLE A;  2OK7 A;  1QUF A;  4M4S A;  4F7D A;  4AVZ A;  3SLD A;  4G1B A;  1E63 A;  2ZXI A;  3CCJ B;  2QDX A;  4PC2 A;  1FX0 A;  3ASR A;  3NE5 B;  2BGI A;  1YJW B;  2JDI A;  3T53 B;  1VLO A;  1M90 D;  1E3X A;  4TMW A;  3VR6 A;  3VNV A;  1QFY A;  3CCS B;  3AVT A;  2WYR A;  5IYR A;  1OHH A;  5J35 A;  1AIP A;  3AVV A;  2BM1 A;  1OB2 A;  2BPO A;  2AHO A;  2YWE A;  4Z4Z A;  1W2B B;  1KC8 D;  1IB0 A;  1EFC A;  3WND A;  4HE5 A;  4P12 A;  3SJP A;  3OEH A;  3OP1 A;  2YWG A;  1GO2 A;  1FNC A;  4UZF A;  3W2E A;  5HXB A;  3MHP A;  4YAF A;  1V5V A;  3BY2 A;  3CMM A;  2XNJ A;  3CMA B;  4WZK A;  1IJE A;  5CDF A;  1Y0R A;  2CK3 A;  3LQ6 A;  4UZU A;  5THX A;  4P6V F;  3A8K A;  4C43 A;  2ZTN A;  1G7C A;  1XE1 A;  3OKX A;  4OPV A;  1S72 B;  2GK7 A;  2D9R A;  3SLN A;  4L8J A;  4YAW A;  1VQM B;  1CNE A;  3GQB A;  1B2R A;  4WWV A;  5IK2 A;  2E1R A;  4OOS A;  3A8J A;  3Q6R A;  4MYU A;  2DOG A;  2W6J A;  4NNJ A;  4LBY A;  2X6Y A;  4ASU A;  1IJF A;  3PEN A;  1QFJ A;  1M1K D;  2FX3 A;  4Y7C A;  4P6Y A;  4K1X A;  3CCV B;  4X7D A;  2GJP A;  1SKY B;  3FKS A;  4QV2 A;  1VF7 A;  5KNL A;  2Q6K A;  4G1V A;  2P3M A;  5F4M A;  1WOS A;  4X07 A;  1QH0 A;  5HKK A;  4ZV4 A;  3ZIA A;  2QTL A;  4XKW A;  2C77 A;  4B43 A;  1E1R A;  4X7F A;  3W5V A;  1WDT A;  1TVC A;  4P22 A;  4Z4T A;  1UD6 A;  2QMU A;  5FNZ A;  2I1L A;  3FJO A;  1N0U A;  4XN0 A;  1Y0Y A;  4XOR A;  1FND A;  3BCD A;  2X6X A;  4P3I A;  3R6K A;  4XLC A;  1VHE A;  3PA2 A;  1EP3 B;  5IYW A;  3ZBT A;  2X8K A;  3AVX A;  4RD0 A;  3Q6Q A;  4G6I A;  1JNY A;  1KTV A;  4Y9U A;  4XOP A;  2QE7 A;  4PGO A;  4XOT A;  4Z4U A;  5IYQ A;  2XNC A;  2ZBV A;  3KL9 A;  3GIR A;  4QHY A;  3PVD A;  1KK0 A;  2WSS A;  4Z4V A;  2XEX A;  5TR9 A;  1JB9 A;  1EFT A;  3PUM A;  4G7X A;  3A3G A;  5KSW B;  2ZZQ A;  4M2L A;  2CRV A;  5HZA A;  3QSY A;  5DSZ A;  4KKU A;  4RD3 A;  1GAQ A;  4AF6 A;  2XZL A;  1D2E A;  2BM0 A;  3CRZ A;  2OTJ B;  2R9V A;  1Q81 D;  4RDK A;  1SKQ A;  2X53 S;  2VNK A;  4X8I A;  4M53 A;  3H94 A;  4RD6 A;  4CQJ A;  1V0E A;  4XNF A;  4AC9 A;  2DY1 A;  4TT3 A;  3VO2 A;  1Q86 D;  2XZO A;  4M1K A;  3CTA A;  2C4T A;  4B3X A;  3JQQ A;  3BC9 A;  1TUI A;  2BMW A;  4LC0 A;  1FRQ A;  1GJR A;  1UD2 A;  2EIX A;  5B6I A;  3WBJ A;  3A3B A;  3I1F A;  5H59 A;  3AGP A;  4RPB A;  2V7Q A;  4JMQ A;  1YIJ B;  3I55 B;  4TMV A;  1DAR A;  1IHM A;  2B5O A;  2V7V A;  3CC7 B;  2XZP A;  1YJ9 B;  2GJR A;  4XLH A;  5TRD A;  1YLO A;  1N8R D;  4XQF A;  3BNW A;  3CCU B;  2VBU A;  1MRZ A;  3OAA A;  4G5G A;  2F4N A;  4ACB A;  4II3 A;  5JBQ A;  4QVA A;  3CME B;  1WP6 A;  4IW3 B;  4B47 A;  3J81 k;  2VBS A;  1YHQ B;  2D3L A;  4DNT B;  3QE2 A;  2X0K A;  3WNC A;  1WU8 A;  2V31 A;  3CPX A;  1D1N A;  1RQR A;  4YEJ A;  1QGZ A;  4H9G A;  4J0Q A;  4ROX A;  3T51 B;  3ZZ0 A;  2RC5 A;  3LQE A;  3W2I A;  3B8H A;  3GVK A;  1UD5 A;  2C5B A;  3G71 B;  1KJZ A;  5F4J A;  4BPR A;  3I56 B;  3Q3A A;  1WPC A;  1UD4 A;  2WZN A;  4P25 A;  3U6K A;  1KMH A;  1H8E A;  3W5U A;  2FVG A;  5TV2 A;  2VZL A;  3OPO A;  4DK1 A;  3WYA A;  1FNB A;  2V7T A;  1G7T A;  2DET A;  1I18 A;  3G4S B;  2WPD A;  1N0V C;  4FXU A;  3MCA A;  5DN6 A;  1V0F A;  4XM3 A;  1ZM2 A;  2ZZE A;  5A8A A;  1E3Z A;  5A89 A;  1VQP B;  1F20 A;  2F43 A;  2JN9 A;  1KK2 A;  2QEX B;  1F60 A;  4LBV A;  2YWH A;  2X3U A;  4DQK A;  1NJI D;  1WTH D;  5FO1 A;  1PKV A;  1Q82 D;  1BQE A;  4N3G A;  3P26 A;  4FN5 A;  1R5B A;  2ZTG A;  4RLZ A;  3W2G A;  3CP8 A;  1BX0 A;  3SKB A;  3BH4 A;  1W34 A;  2HMA A;  5J3O A;  3BCF A;  3V76 A;  4PC1 A;  2E1B A;  2GQF A;  2GJK A;  3R6J A;  2PIA A;  2GRE A;  3ZPN A;  1COW A;  4OP7 A;  3CW2 A;  5BSX A;  1W35 A;  4ZGN B;  2BF4 A;  4Q7J B;  2DIE A;  3GVJ A;  3WNB A;  1VQK B;  1QVG B;  4X0C A;  3GSI A;  2B7C A;  3OE7 A;  3CCR B;  1BLI A;  1E62 A;  4MYT A;  4TKO B;  5F4O A;  4Z1M A;  1K8A D;  1UMK A;  2CBX A;  5DS0 A;  1TLL A;  3CP2 A;  2C2W A;  4KKT A;  4TMT A;  1EFU A;  2ZZG A;  1WOR A;  3OOC A;  4XD7 A;  5FIU A;  2F1M A;  1G7S A;  4AF7 A;  1OGI A;  5HZB A;  4X7C A;  1K28 D;  3WY9 A;  3AVY A;  3A35 A;  3ES9 A;  1UD3 A;  4P9S A;  4X05 A;  2XND A;  1QX4 A;  4DK0 A;  2HLD A;  1K9M D;  2Z6B D;  4XLF A;  3W5H A;  4YAL A;  4YXW A;  4Y9R A;  4N3N A;  3AVW A;  3A8I A;  4RCZ A;  4X7E A;  3E1Y E;  2ZZF A;  2CC2 A;  3VNU A;  4OOV A;  4P26 A;  3MMP A;  3CCM B;  4WZL A;  1BPL A;  2V4D A;  2JJ1 A;  2V7X A;  4UZE A;  3ONU A;  3T56 B;  1BX1 A;  1ZUN B;  2BGJ A;  1EWY A;  5IYP A;  2XOK A;  2XGJ A;  4OOX A;  1YX2 A;  3G05 A;  4ZGQ B;  1W87 A;  2PE3 A;  1JA0 A;  5GV8 A;  4EH1 A;  3ZZU A;  3OZU A;  2PMD A;  4XN3 A;  4RJL A;  1CNF A;  3U6B A;  1NBM A;  3A1P A;  5FA6 A;  2QTZ A;  3JU4 A;  1VQ7 B;  2BSA A;  4TMX A;  1JJ2 B;  1Q9S A;  3OEE A;  3D26 A;  1FDR A;  3VO1 A;  3OW7 A;  4ACA A;  1DG1 G;  1AMO A;  1G7R A;  1KRH A;  4PAB A;  1E1Q A;  3Q38 A;  1VQ6 B;  1S0U A;  3B82 A;  2VNH A;  1XFO A;  2DYI A;  2GK6 A;  3FPP A;  3CB4 A;  2ZL6 A; 
#chains in the Genus database with same CATH homology
 1VF7 A;  5KNL A;  5DN6 A;  1V0F A;  2VJJ A;  4XM3 A;  2ZZE A;  4XLA A;  3GVL A;  4B3G A;  5HKK A;  1E3Z A;  3ZIA A;  2JIZ A;  2F43 A;  3HAG A;  4XKW A;  4XL9 A;  3DDY A;  1E1R A;  4XMY A;  4P22 A;  4YEL A;  1UD6 A;  1WTH D;  3KEW A;  1BMF A;  1PKV A;  1EFR A;  4XN0 A;  4XOR A;  1E79 A;  3BCD A;  2X6X A;  2D3N A;  2ZTG A;  1HZE A;  4XLC A;  2WZP P;  2X8K A;  3LNN A;  3CP8 A;  4G6I A;  4DNR B;  4XOP A;  2QE7 A;  4XOT A;  3BH4 A;  2WJY A;  1W0K A;  5FL7 A;  3BCF A;  2LZJ A;  2E1B A;  2WSS A;  2GJK A;  4G7X A;  3ZPN A;  1COW A;  3A3G A;  2ZZQ A;  2ZXH A;  1SKY B;  2M5S A;  2X6W A;  4KKU A;  1I8D A;  2JJ2 A;  4HIZ A;  2DIE A;  4KKS A;  3GVJ A;  2XZL A;  4B3F X;  1H8H A;  3OE7 A;  1BLI A;  4TKO B;  2R9V A;  4II2 A;  4Z1M A;  2X53 S;  3OFN A;  2W6I A;  2X85 A;  3CP2 A;  4XLE A;  4KKT A;  3H94 A;  2ZZG A;  3OOC A;  4GQN A;  4XD7 A;  1V0E A;  2F1M A;  4XNF A;  1VJS A;  4AVZ A;  4TT3 A;  1UD8 A;  2ZXI A;  1K28 D;  2XZO A;  3A35 A;  1T5E A;  1UD3 A;  1FX0 A;  3BC9 A;  3NE5 B;  2JDI A;  3T53 B;  2XND A;  1E3X A;  1UD2 A;  3VR6 A;  4DK0 A;  1NRK A;  2HLD A;  3A3B A;  2VJI A;  4XON A;  3WQZ A;  2Z6B D;  4XLF A;  1OHH A;  2V7Q A;  4JMQ A;  4XKV A;  4YXW A;  2XZP A;  2KVO A;  3OEH A;  2GJR A;  4XLH A;  1OB0 A;  2ZZF A;  4XQF A;  1BPL A;  2V4D A;  2JJ1 A;  3OAA A;  3T56 B;  1E43 A;  4II3 A;  3CMM A;  1WP6 A;  5CDF A;  2D3L A;  4DNT B;  4XR6 A;  2CK3 A;  2XOK A;  2XGJ A;  3G05 A;  4UZU A;  1W9X A;  2V31 A;  4TSF A;  1KZL A;  1VLY A;  3FKS A;  4YEJ A;  2WJV A;  2ZTN A;  4XN3 A;  2GK7 A;  1NBM A;  4L8J A;  3T51 B;  1W0J A;  3GVK A;  1UD5 A;  3GQB A;  3JU4 A;  3CES A;  1HVX A;  5IK2 A;  4G7W A;  3OEE A;  2W6J A;  3OW7 A;  4NNJ A;  1WPC A;  1UD4 A;  2X6Y A;  4ASU A;  1E1Q A;  1KMH A;  1H8E A;  1MAB A;  4E0F A;  3OPO A;  4DK1 A;  1I18 A;  2GK6 A;  2WPD A;  3FPP A;  2GJP A;  4FXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...