2KVOA

Solution nmr structure of photosystem ii reaction center psb28 protein from synechocystis sp.(strain pcc 6803), northeast structural genomics consortium target sgr171
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
120
structure length
120
Chain Sequence
b'MAEIQFSKGVAETVVPEVRLSKSKNGQSGMAKFYFLEPTILAKESTDDITGMYLIDDEGEIITREVKGKFINGRPTAIEATVILNSQPEWDRFMRFMERYGAENGLGFSKSELEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II reaction center psb28 protein
molecule tags Photosynthesis
source organism Synechocystis sp.
publication title Solution NMR structure of photosystem II reaction center protein Psb28 from Synechocystis sp. Strain PCC 6803.
pubmed doi rcsb
total genus 16
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03912 Psb28 Psb28 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.220 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2kvoA01
3ZPNA 2KVOA
chains in the Genus database with same CATH superfamily
4YAUA 3A3BA 3CB4A 4ZCLA 4XN0A 1KZLA 1S4MA 1YJ9B 1VQ5B 3MCAA 4OP7A 3CCJB 3KL9A 1Q7YD 2VBVA 2BF4A 2HLDA 4M0LA 3PENA 1GAQA 1TUIA 3AVXA 1RQPA 1DARA 1FNDA 1NRKA 3FPKA 4YHBA 3Q38A 4YXWA 4XKVA 3QFRA 1GJRA 3CESA 2BV3A 1OB5A 1FNCA 1GO2A 3CP8A 4XN3A 1I8DA 2ZL5A 3B82A 1SKYB 2GK6A 4RLZA 5H5JA 1D2EA 5TR9A 3CCMB 4JMQA 1SM4A 5FNZA 1QFYA 1WOOA 4G6IA 2XGJA 1ZM4A 4IW3B 3WNDA 1QFJA 3CCUB 5J35A 1HA3A 4DNRB 4WZLA 2HCJB 3SLDA 2F43A 5FA6A 1WU8A 5KNLA 1BLIA 3ONUA 3OKXA 4NBSA 2GJPA 2J7KA 2ZBVA 3BC9A 2OBSA 2LZJA 3ZBTA 4TMWA 1K8AD 1JA1A 3VO1A 3OAAA 2ZL7A 3CPXA 3ZZTA 1E43A 4UZFA 3ASRA 1Q81D 1UD8A 1FNBA 4ZGQB 2Q6IA 2C2WA 2BN4A 3OE7A 4RCZA 1YLOA 2CK3A 2D3NA 4E0FA 2X8KA 1ZUNB 3GQBA 5A8AA 1M1KD 2OBTA 1BJKA 3QFCA 4YAFA 2D9RA 2CF4A 3LO8A 5HXBA 2XZLA 1F60A 4Q7JB 1JJ2B 2OTJB 1QGYA 2WPDA 5IK2A 1G7RA 5L46A 1PJ6A 3P27A 2VNKA 3U6BA 4BPRA 3Q39A 3ZZ0A 5A88A 1XB2A 2ZTNA 3VNUA 3OEEA 4Z4SA 1RQRA 1I7PA 2DY1A 1N06A 1T6ZA 3I56B 1JA0A 1WSVA 1WTHD 2Z6BD 3ASSA 4ZCMA 2QTLA 4P6YA 4XOTA 4XD7A 2WYRA 2D74A 3Q6QA 1OGIA 3WQZA 3W2EA 4K1XA 4PC1A 1FRNA 1JNYA 5IYPA 3OZVA 4N3GA 3HAGA 1VHEA 1WORA 4AVZA 4B4DA 4X0CA 1EXMA 5KW9A 1K73D 1F20A 3BCDA 1P4MA 3A8IA 2QEXB 2YWEA 4ZGNB 1H85A 4PC2A 3CCVB 4RJLA 3R6KA 2M5SA 1E64A 4RD6A 3OOCA 4PC6A 1OB2A 1WSRA 4QHYA 5IYNA 2GPJA 1WDTA 5F4MA 1OHHA 2EIXA 4X7FA 4XL9A 1H8HA 1W34A 1E62A 2V7WA 3SLNA 1GAWA 3GSIA 3CRZA 2JIZA 4RCYA 5DS0A 2GK7A 3VO2A 1DDGA 1COWA 1R5NA 4ZV4A 4RDKA 4Z1MA 4FWTA 1YJWB 4LBZA 2PIAA 4TSFA 1AMOA 3G4SB 1XE1A 3KEWA 3CMAB 2FVGA 3FKSA 4HE5A 3LNNA 5LMZA 4QVAA 1KMHA 3ES9A 3CCRB 4NCNA 4YEJA 1YX2A 4YELA 2WZPP 2BMWA 2VZLA 1I18A 4Y9RA 4CQJA 2VBSA 4WZKA 1W2BB 2AHOA 5IYRA 1KQSB 4X06A 4X7CA 1VQ4B 4QUZA 1N8RD 3W2FA 3GIRA 1Q86D 4B3GA 1QGZA 4LC0A 3SKBA 1NB9A 4L8JA 4QVJA 2PE3A 1BX0A 1T5EA 1ZM9A 4G5GA 4P3IA 4XORA 4B47A 1WOSA 2BVNA 2X6YA 4X07A 1VQNB 4QFMA 5THXA 2VYQA 1AIPA 4XQFA 4OPOA 2C78A 2ZTGA 1NJID 4N3NA 2RC6A 3PA1A 4ZCIA 1ZM2A 2ZZQA 1K28D 2R6HA 2WZNA 4Y7CA 1A8PA 1H42A 2OBRA 2DETA 5B6IA 1XQBA 1VQ6B 3AGQA 1H8EA 1W0JA 3VR6A 1QX4A 4LBVA 4MYTA 2QA4B 2XEXA 1B2RA 3OPOA 4NNJA 3CPWB 3T51B 2GJRA 2V7UA 2RC5A 1WOPA 2DIEA 3GVKA 1UD2A 4P12A 3W5UA 1KD1D 4X05A 3U6KA 1OB0A 3BH4A 3H94A 3ZIAA 2GJKA 4X7DA 2ZXIA 4RD1A 1MABA 2V7XA 4DQKA 1IJEA 2XNCA 4RM0A 3BQJA 5JBQA 4TN1A 4WWVA 3WXMA 1W35A 3GVJA 3CP2A 3Q6RA 4G7XA 5CDFA 1VLYA 4G7WA 2VBTA 4Z4WA 5DSZA 4RPDA 3PUMA 5FIUA 1EP1B 3BY2A 3J81k 1W9XA 1FDRA 2OK8A 2VBUA 4KKUA 4LBWA 4G1VA 3OJWA 5BSXA 1NB0A 1V0EA 2DCUA 2ZZFA 2DEUA 1J9ZA 4XR6A 4Z4ZA 4FK8A 1G7SA 4YALA 4AF7A 1VQ7B 4P2NA 3ZPNA 1B23P 4ACAA 1JB9A 3JQQA 2VJJA 2ZZGA 4TKOB 5TRDA 4P22A 2BPOA 4M2LA 4OOXA 5FO0A 1TVCA 4XLEA 1N08A 1PJ5A 3WBKA 2VNJA 2F4NA 3OJXA 4C0SA 4M4SA 4OPSA 1N05A 3FJOA 2OK7A 5A89A 4XLCA 2X0KA 3PVDA 4HIZA 1TLLA 4P9SA 1G7CA 4YAWA 4WZEA 5J3OA 1EWYA 1QFZA 4RDLA 2QMUA 1YI2B 4XONA 3E20A 1IJFA 5HZBA 3CCQB 3OZWA 4R71A 1E3ZA 3OEHA 3CC4B 1DG1G 1GVHA 2XOKA 3AVTA 3A8JA 2JJ1A 3CCEB 3CMEB 1UD6A 5HKKA 1CNEA 3A35A 4FN5A 1WP6A 3QE2A 2CBXA 1NBMA 3B78A 4RD3A 2VNHA 2GREA 1Q9SA 4II2A 3W2GA 5HZAA 4EH1A 3AVUA 3SJPA 5GV7A 1M90D 4P25A 2VNIA 2CW5A 1SKQA 2HMAA 2XZPA 4XNFA 4PC3A 2QE7A 1FNMA 4YAOA 4XM3A 4F7DA 2BM0A 4XLAA 2Q6KA 1T6YA 3BCFA 3ZUGA 3CMMA 2C4UA 4Y9UA 3FPPA 1E79A 2V4DA 2X85A 1KC8D 3LQ6A 1T6XA 4PABA 1EP2B 2DERA 3I1FA 2C5BA 3H9NA 4PAAA 2PLFA 5IYWA 4P26A 4B43A 1VQLB 2CRVA 3ZBUA 1VQ9B 1E3XA 1QGAA 3I55B 3V7AA 4G1BA 4DK0A 1BPLA 1VLOA 3AVWA 2X6WA 4C43A 1S72B 1FX0A 3A1PA 5FO1A 1UD3A 3AVVA 1YHQB 5BSYA 2BSAA 2C4TA 2JDIA 5KSWB 2XNDA 2P3MA 1UMKA 1V0FA 3ASTA 1KJZA 4XKWA 1EFCA 5F4JA 4B44A 1VQOB 3AVYA 2YWGA 1CQXA 4PGOA 5DN6A 3ONYA 1E1RA 2R9VA 4X7EA 4AF6A 3CCLB 4KKTA 1YIJB 3QFSA 1UD4A 3CC7B 4U9UA 2OTLB 3MHPA 3ZC3A 4AC9A 1QG0A 4XMYA 2PMDA 2X3UA 3A3GA 3WBJA 4DQLA 4P3YA 5F4OA 3T56B 1EP3B 1BX1A 3R6JA 1VJSA 1N0UA 1UD5A 4TMVA 3PUNA 4B3FX 1QVGB 1PJ7A 1N0VC 1QVFB 4X8IA 5TY0A 3PA2A 4Z4VA 4ACBA 3WYAA 1G7TA 3OW7A 1VQMB 1HZEA 2X53S 4RDJA 3RY8A 4RPBA 3WNBA 2C5HA 2QN6A 2V7TA 2Q6LA 1KRHA 4Z4UA 2E1RA 2F1MA 4GQNA 3T53B 1N07A 2WJYA 4TMTA 2XNJA 2DYIA 2QGGA 2EFGA 1EFTA 4FXUA 2FX3A 1VF7A 4ROXA 4P6VF 2B7CA 2V31A 3NE5B 3CTAA 2ZITA 3SJZA 3OFNA 2JN9A 1MRZA 1IHMA 3ASPA 4MYUA 4OOVA 1E1QA 4OPVA 3W5HA 3ZZUA 4J0QA 4M1KA 4UZUA 1PKVA 3JQRA 1VQPB 2WJVA 1XFOA 4RD0A 1Y0YA 2BGJA 2D3LA 2NPFA 4UAJA 4ASUA 3CCSB 1KK3A 2W6JA 3G6EB 3QSYA 1D1NA 4DNTB 3JU4A 4WQMA 2DOGA 2W6IA 1EFUA 2WSSA 3DDYA 2F1LA 1YJNB 2B7BA 3WNCA 2X6XA 2KVOA 4II3A 2ZXHA 4B48A 1TTTA 5GV8A 3CD6B 3D26A 4WZTA 1GR1A 3VMFA 1BQEA 1S0UA 1QUFA 2C77A 2WR8A 5FL7A 3G71B 4P1VA 3A8KA 3ISXA 1W0KA 3BY1A 4M53A 3MMPA 2YWFA 1HVXA 1EFRA 1U2RA 3G05A 1CNFA 2E1BA 3CC2B 3VNVA 1R5BA 3B8HA 1ELOA 3OP1A 1KK1A 1K9MD 4B3XA 4KKSA 4Z4YA 1OGJA 4HE6A 4RD4A 4UZEA 3V76A 1VHOA 5E6TA 4XOPA 3U2QA 4DK1A 1E63A 1V5VA 2BM1A 3LVBA 5H59A 4Z4RA 5IYQA 3GVLA 3W5VA 2ZZEA 5EMNA 2NV4A 1YITB 3SEJA 3W2HA 5AN9A 1Y0RA 1W87A 2V7VA 3QFTA 1R5OA 4PC7A 3CXCB 1IB0A 3WY9A 2ZBUA 3W2IA 4LBYA 4XLHA 3E1YE 1VQ8B 2CC2A 2XZOA 1QH0A 3OZUA 2V7QA 5TV2A 1D8TA 2QDXA 3OW2B 1VQKB 1WPCA 2GQFA 2BGIA 4TMXA 4Z4TA 1Q82D 1ZM3A 3LQEA 4RD2A 4TMZA 2Q6OA 4OOSA 1BMFA 4TT3A 1KK2A 2OYNA 1QUEA 3JQPA 1NDHA 2I1LA 2QTZA 4H9GA 1KTVA 3P26A 3BNWA 3CW2A 1KK0A 1DDIA 2JJ2A 3ASQA 2YWHA 4XLFA 1FRQA 2B5OA 2HDNB 2VJIA 3AGPA 2CNDA 2ZL6A 3Q3AA 4QV2A
chains in the Genus database with same CATH topology
2F1MA 4GQNA 3A3BA 3T53B 2WJYA 1KZLA 4XN0A 1OHHA 4FXUA 2HLDA 1H8HA 4XL9A 1VF7A 2V31A 4XLCA 2JIZA 3NE5B 4HIZA 2GK7A 1NRKA 1COWA 3OFNA 4XONA 4YXWA 4XKVA 4Z1MA 3CESA 4TSFA 1E1QA 3KEWA 1E3ZA 3CP8A 3FKSA 3OEHA 1I8DA 4XN3A 3LNNA 2XOKA 1PKVA 1SKYB 2GK6A 4UZUA 2WJVA 2JJ1A 4JMQA 1KMHA 4G6IA 2XGJA 1UD6A 5HKKA 2D3LA 3A35A 4ASUA 1WP6A 4YELA 2WZPP 2W6JA 1NBMA 4DNRB 1I18A 4DNTB 3JU4A 4II2A 2F43A 2W6IA 2WSSA 3DDYA 5KNLA 1BLIA 2X6XA 2KVOA 4II3A 2ZXHA 2XZPA 4XNFA 2GJPA 4B3GA 3BC9A 2QE7A 2LZJA 4L8JA 5FL7A 1T5EA 3OAAA 4XM3A 4XORA 1E43A 4XLAA 2X6YA 1W0KA 3BCFA 1UD8A 3CMMA 1HVXA 1EFRA 3G05A 4XQFA 2E1BA 3FPPA 1E79A 2V4DA 2X85A 2ZTGA 3OE7A 4E0FA 2CK3A 2D3NA 4KKSA 2X8KA 2ZZQA 1K28D 3GQBA 1E3XA 4XOPA 4DK1A 2XZLA 1H8EA 1W0JA 3VR6A 4DK0A 1BPLA 2WPDA 3GVLA 5IK2A 2X6WA 2ZZEA 1FX0A 1UD3A 4NNJA 3OPOA 3T51B 2GJRA 2DIEA 3GVKA 2JDIA 1UD2A 2XNDA 1V0FA 4XKWA 1OB0A 3BH4A 3H94A 3ZIAA 4XLHA 2ZTNA 2GJKA 2ZXIA 1MABA 5DN6A 1E1RA 2R9VA 3OEEA 2XZOA 2V7QA 4KKTA 1UD4A 2Z6BD 1WTHD 4XMYA 3GVJA 3CP2A 1WPCA 4G7XA 5CDFA 1VLYA 3A3GA 4XOTA 4G7WA 4XD7A 3T56B 4B3FX 1VJSA 1UD5A 3WQZA 1W9XA 1BMFA 4KKUA 4TT3A 3HAGA 4AVZA 1V0EA 2ZZFA 4XLFA 2JJ2A 4XR6A 3BCDA 3OW7A 2VJIA 3ZPNA 1HZEA 2X53S 4TKOB 2VJJA 2ZZGA 4P22A 2M5SA 3OOCA 4XLEA 4YEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZPN A;  2KVO A; 
#chains in the Genus database with same CATH topology
 4YAU A;  3A3B A;  3CB4 A;  4ZCL A;  4XN0 A;  1KZL A;  1S4M A;  1YJ9 B;  1VQ5 B;  3MCA A;  4OP7 A;  3CCJ B;  3KL9 A;  1Q7Y D;  2VBV A;  2BF4 A;  2HLD A;  4M0L A;  3PEN A;  1GAQ A;  1TUI A;  3AVX A;  1RQP A;  1DAR A;  1FND A;  1NRK A;  3FPK A;  4YHB A;  3Q38 A;  4YXW A;  4XKV A;  3QFR A;  1GJR A;  3CES A;  2BV3 A;  1OB5 A;  1FNC A;  1GO2 A;  3CP8 A;  4XN3 A;  1I8D A;  2ZL5 A;  3B82 A;  1SKY B;  2GK6 A;  4RLZ A;  5H5J A;  1D2E A;  5TR9 A;  3CCM B;  4JMQ A;  1SM4 A;  5FNZ A;  1QFY A;  1WOO A;  4G6I A;  2XGJ A;  1ZM4 A;  4IW3 B;  3WND A;  1QFJ A;  3CCU B;  5J35 A;  1HA3 A;  4DNR B;  4WZL A;  2HCJ B;  3SLD A;  2F43 A;  5FA6 A;  1WU8 A;  5KNL A;  1BLI A;  3ONU A;  3OKX A;  4NBS A;  2GJP A;  2J7K A;  2ZBV A;  3BC9 A;  2OBS A;  2LZJ A;  3ZBT A;  4TMW A;  1K8A D;  1JA1 A;  3VO1 A;  3OAA A;  2ZL7 A;  3CPX A;  3ZZT A;  1E43 A;  4UZF A;  3ASR A;  1Q81 D;  1UD8 A;  1FNB A;  4ZGQ B;  2Q6I A;  2C2W A;  2BN4 A;  3OE7 A;  4RCZ A;  1YLO A;  2CK3 A;  2D3N A;  4E0F A;  2X8K A;  1ZUN B;  3GQB A;  5A8A A;  1M1K D;  2OBT A;  1BJK A;  3QFC A;  4YAF A;  2D9R A;  2CF4 A;  3LO8 A;  5HXB A;  2XZL A;  1F60 A;  4Q7J B;  1JJ2 B;  2OTJ B;  1QGY A;  2WPD A;  5IK2 A;  1G7R A;  5L46 A;  1PJ6 A;  3P27 A;  2VNK A;  3U6B A;  4BPR A;  3Q39 A;  3ZZ0 A;  5A88 A;  1XB2 A;  2ZTN A;  3VNU A;  3OEE A;  4Z4S A;  1RQR A;  1I7P A;  2DY1 A;  1N06 A;  1T6Z A;  3I56 B;  1JA0 A;  1WSV A;  1WTH D;  2Z6B D;  3ASS A;  4ZCM A;  2QTL A;  4P6Y A;  4XOT A;  4XD7 A;  2WYR A;  2D74 A;  3Q6Q A;  1OGI A;  3WQZ A;  3W2E A;  4K1X A;  4PC1 A;  1FRN A;  1JNY A;  5IYP A;  3OZV A;  4N3G A;  3HAG A;  1VHE A;  1WOR A;  4AVZ A;  4B4D A;  4X0C A;  1EXM A;  5KW9 A;  1K73 D;  1F20 A;  3BCD A;  1P4M A;  3A8I A;  2QEX B;  2YWE A;  4ZGN B;  1H85 A;  4PC2 A;  3CCV B;  4RJL A;  3R6K A;  2M5S A;  1E64 A;  4RD6 A;  3OOC A;  4PC6 A;  1OB2 A;  1WSR A;  4QHY A;  5IYN A;  2GPJ A;  1WDT A;  5F4M A;  1OHH A;  2EIX A;  4X7F A;  4XL9 A;  1H8H A;  1W34 A;  1E62 A;  2V7W A;  3SLN A;  1GAW A;  3GSI A;  3CRZ A;  2JIZ A;  4RCY A;  5DS0 A;  2GK7 A;  3VO2 A;  1DDG A;  1COW A;  1R5N A;  4ZV4 A;  4RDK A;  4Z1M A;  4FWT A;  1YJW B;  4LBZ A;  2PIA A;  4TSF A;  1AMO A;  3G4S B;  1XE1 A;  3KEW A;  3CMA B;  2FVG A;  3FKS A;  4HE5 A;  3LNN A;  5LMZ A;  4QVA A;  1KMH A;  3ES9 A;  3CCR B;  4NCN A;  4YEJ A;  1YX2 A;  4YEL A;  2WZP P;  2BMW A;  2VZL A;  1I18 A;  4Y9R A;  4CQJ A;  2VBS A;  4WZK A;  1W2B B;  2AHO A;  5IYR A;  1KQS B;  4X06 A;  4X7C A;  1VQ4 B;  4QUZ A;  1N8R D;  3W2F A;  3GIR A;  1Q86 D;  4B3G A;  1QGZ A;  4LC0 A;  3SKB A;  1NB9 A;  4L8J A;  4QVJ A;  2PE3 A;  1BX0 A;  1T5E A;  1ZM9 A;  4G5G A;  4P3I A;  4XOR A;  4B47 A;  1WOS A;  2BVN A;  2X6Y A;  4X07 A;  1VQN B;  4QFM A;  5THX A;  2VYQ A;  1AIP A;  4XQF A;  4OPO A;  2C78 A;  2ZTG A;  1NJI D;  4N3N A;  2RC6 A;  3PA1 A;  4ZCI A;  1ZM2 A;  2ZZQ A;  1K28 D;  2R6H A;  2WZN A;  4Y7C A;  1A8P A;  1H42 A;  2OBR A;  2DET A;  5B6I A;  1XQB A;  1VQ6 B;  3AGQ A;  1H8E A;  1W0J A;  3VR6 A;  1QX4 A;  4LBV A;  4MYT A;  2QA4 B;  2XEX A;  1B2R A;  3OPO A;  4NNJ A;  3CPW B;  3T51 B;  2GJR A;  2V7U A;  2RC5 A;  1WOP A;  2DIE A;  3GVK A;  1UD2 A;  4P12 A;  3W5U A;  1KD1 D;  4X05 A;  3U6K A;  1OB0 A;  3BH4 A;  3H94 A;  3ZIA A;  2GJK A;  4X7D A;  2ZXI A;  4RD1 A;  1MAB A;  2V7X A;  4DQK A;  1IJE A;  2XNC A;  4RM0 A;  3BQJ A;  5JBQ A;  4TN1 A;  4WWV A;  3WXM A;  1W35 A;  3GVJ A;  3CP2 A;  3Q6R A;  4G7X A;  5CDF A;  1VLY A;  4G7W A;  2VBT A;  4Z4W A;  5DSZ A;  4RPD A;  3PUM A;  5FIU A;  1EP1 B;  3BY2 A;  3J81 k;  1W9X A;  1FDR A;  2OK8 A;  2VBU A;  4KKU A;  4LBW A;  4G1V A;  3OJW A;  5BSX A;  1NB0 A;  1V0E A;  2DCU A;  2ZZF A;  2DEU A;  1J9Z A;  4XR6 A;  4Z4Z A;  4FK8 A;  1G7S A;  4YAL A;  4AF7 A;  1VQ7 B;  4P2N A;  3ZPN A;  1B23 P;  4ACA A;  1JB9 A;  3JQQ A;  2VJJ A;  2ZZG A;  4TKO B;  5TRD A;  4P22 A;  2BPO A;  4M2L A;  4OOX A;  5FO0 A;  1TVC A;  4XLE A;  1N08 A;  1PJ5 A;  3WBK A;  2VNJ A;  2F4N A;  3OJX A;  4C0S A;  4M4S A;  4OPS A;  1N05 A;  3FJO A;  2OK7 A;  5A89 A;  4XLC A;  2X0K A;  3PVD A;  4HIZ A;  1TLL A;  4P9S A;  1G7C A;  4YAW A;  4WZE A;  5J3O A;  1EWY A;  1QFZ A;  4RDL A;  2QMU A;  1YI2 B;  4XON A;  3E20 A;  1IJF A;  5HZB A;  3CCQ B;  3OZW A;  4R71 A;  1E3Z A;  3OEH A;  3CC4 B;  1DG1 G;  1GVH A;  2XOK A;  3AVT A;  3A8J A;  2JJ1 A;  3CCE B;  3CME B;  1UD6 A;  5HKK A;  1CNE A;  3A35 A;  4FN5 A;  1WP6 A;  3QE2 A;  2CBX A;  1NBM A;  3B78 A;  4RD3 A;  2VNH A;  2GRE A;  1Q9S A;  4II2 A;  3W2G A;  5HZA A;  4EH1 A;  3AVU A;  3SJP A;  5GV7 A;  1M90 D;  4P25 A;  2VNI A;  2CW5 A;  1SKQ A;  2HMA A;  2XZP A;  4XNF A;  4PC3 A;  2QE7 A;  1FNM A;  4YAO A;  4XM3 A;  4F7D A;  2BM0 A;  4XLA A;  2Q6K A;  1T6Y A;  3BCF A;  3ZUG A;  3CMM A;  2C4U A;  4Y9U A;  3FPP A;  1E79 A;  2V4D A;  2X85 A;  1KC8 D;  3LQ6 A;  1T6X A;  4PAB A;  1EP2 B;  2DER A;  3I1F A;  2C5B A;  3H9N A;  4PAA A;  2PLF A;  5IYW A;  4P26 A;  4B43 A;  1VQL B;  2CRV A;  3ZBU A;  1VQ9 B;  1E3X A;  1QGA A;  3I55 B;  3V7A A;  4G1B A;  4DK0 A;  1BPL A;  1VLO A;  3AVW A;  2X6W A;  4C43 A;  1S72 B;  1FX0 A;  3A1P A;  5FO1 A;  1UD3 A;  3AVV A;  1YHQ B;  5BSY A;  2BSA A;  2C4T A;  2JDI A;  5KSW B;  2XND A;  2P3M A;  1UMK A;  1V0F A;  3AST A;  1KJZ A;  4XKW A;  1EFC A;  5F4J A;  4B44 A;  1VQO B;  3AVY A;  2YWG A;  1CQX A;  4PGO A;  5DN6 A;  3ONY A;  1E1R A;  2R9V A;  4X7E A;  4AF6 A;  3CCL B;  4KKT A;  1YIJ B;  3QFS A;  1UD4 A;  3CC7 B;  4U9U A;  2OTL B;  3MHP A;  3ZC3 A;  4AC9 A;  1QG0 A;  4XMY A;  2PMD A;  2X3U A;  3A3G A;  3WBJ A;  4DQL A;  4P3Y A;  5F4O A;  3T56 B;  1EP3 B;  1BX1 A;  3R6J A;  1VJS A;  1N0U A;  1UD5 A;  4TMV A;  3PUN A;  4B3F X;  1QVG B;  1PJ7 A;  1N0V C;  1QVF B;  4X8I A;  5TY0 A;  3PA2 A;  4Z4V A;  4ACB A;  3WYA A;  1G7T A;  3OW7 A;  1VQM B;  1HZE A;  2X53 S;  4RDJ A;  3RY8 A;  4RPB A;  3WNB A;  2C5H A;  2QN6 A;  2V7T A;  2Q6L A;  1KRH A;  4Z4U A;  2E1R A;  2F1M A;  4GQN A;  3T53 B;  1N07 A;  2WJY A;  4TMT A;  2XNJ A;  2DYI A;  2QGG A;  2EFG A;  1EFT A;  4FXU A;  2FX3 A;  1VF7 A;  4ROX A;  4P6V F;  2B7C A;  2V31 A;  3NE5 B;  3CTA A;  2ZIT A;  3SJZ A;  3OFN A;  2JN9 A;  1MRZ A;  1IHM A;  3ASP A;  4MYU A;  4OOV A;  1E1Q A;  4OPV A;  3W5H A;  3ZZU A;  4J0Q A;  4M1K A;  4UZU A;  1PKV A;  3JQR A;  1VQP B;  2WJV A;  1XFO A;  4RD0 A;  1Y0Y A;  2BGJ A;  2D3L A;  2NPF A;  4UAJ A;  4ASU A;  3CCS B;  1KK3 A;  2W6J A;  3G6E B;  3QSY A;  1D1N A;  4DNT B;  3JU4 A;  4WQM A;  2DOG A;  2W6I A;  1EFU A;  2WSS A;  3DDY A;  2F1L A;  1YJN B;  2B7B A;  3WNC A;  2X6X A;  2KVO A;  4II3 A;  2ZXH A;  4B48 A;  1TTT A;  5GV8 A;  3CD6 B;  3D26 A;  4WZT A;  1GR1 A;  3VMF A;  1BQE A;  1S0U A;  1QUF A;  2C77 A;  2WR8 A;  5FL7 A;  3G71 B;  4P1V A;  3A8K A;  3ISX A;  1W0K A;  3BY1 A;  4M53 A;  3MMP A;  2YWF A;  1HVX A;  1EFR A;  1U2R A;  3G05 A;  1CNF A;  2E1B A;  3CC2 B;  3VNV A;  1R5B A;  3B8H A;  1ELO A;  3OP1 A;  1KK1 A;  1K9M D;  4B3X A;  4KKS A;  4Z4Y A;  1OGJ A;  4HE6 A;  4RD4 A;  4UZE A;  3V76 A;  1VHO A;  5E6T A;  4XOP A;  3U2Q A;  4DK1 A;  1E63 A;  1V5V A;  2BM1 A;  3LVB A;  5H59 A;  4Z4R A;  5IYQ A;  3GVL A;  3W5V A;  2ZZE A;  5EMN A;  2NV4 A;  1YIT B;  3SEJ A;  3W2H A;  5AN9 A;  1Y0R A;  1W87 A;  2V7V A;  3QFT A;  1R5O A;  4PC7 A;  3CXC B;  1IB0 A;  3WY9 A;  2ZBU A;  3W2I A;  4LBY A;  4XLH A;  3E1Y E;  1VQ8 B;  2CC2 A;  2XZO A;  1QH0 A;  3OZU A;  2V7Q A;  5TV2 A;  1D8T A;  2QDX A;  3OW2 B;  1VQK B;  1WPC A;  2GQF A;  2BGI A;  4TMX A;  4Z4T A;  1Q82 D;  1ZM3 A;  3LQE A;  4RD2 A;  4TMZ A;  2Q6O A;  4OOS A;  1BMF A;  4TT3 A;  1KK2 A;  2OYN A;  1QUE A;  3JQP A;  1NDH A;  2I1L A;  2QTZ A;  4H9G A;  1KTV A;  3P26 A;  3BNW A;  3CW2 A;  1KK0 A;  1DDI A;  2JJ2 A;  3ASQ A;  2YWH A;  4XLF A;  1FRQ A;  2B5O A;  2HDN B;  2VJI A;  3AGP A;  2CND A;  2ZL6 A;  3Q3A A;  4QV2 A; 
#chains in the Genus database with same CATH homology
 2F1M A;  4GQN A;  3A3B A;  3T53 B;  2WJY A;  1KZL A;  4XN0 A;  1OHH A;  4FXU A;  2HLD A;  1H8H A;  4XL9 A;  1VF7 A;  2V31 A;  4XLC A;  2JIZ A;  3NE5 B;  4HIZ A;  2GK7 A;  1NRK A;  1COW A;  3OFN A;  4XON A;  4YXW A;  4XKV A;  4Z1M A;  3CES A;  4TSF A;  1E1Q A;  3KEW A;  1E3Z A;  3CP8 A;  3FKS A;  3OEH A;  1I8D A;  4XN3 A;  3LNN A;  2XOK A;  1PKV A;  1SKY B;  2GK6 A;  4UZU A;  2WJV A;  2JJ1 A;  4JMQ A;  1KMH A;  4G6I A;  2XGJ A;  1UD6 A;  5HKK A;  2D3L A;  3A35 A;  4ASU A;  1WP6 A;  4YEL A;  2WZP P;  2W6J A;  1NBM A;  4DNR B;  1I18 A;  4DNT B;  3JU4 A;  4II2 A;  2F43 A;  2W6I A;  2WSS A;  3DDY A;  5KNL A;  1BLI A;  2X6X A;  2KVO A;  4II3 A;  2ZXH A;  2XZP A;  4XNF A;  2GJP A;  4B3G A;  3BC9 A;  2QE7 A;  2LZJ A;  4L8J A;  5FL7 A;  1T5E A;  3OAA A;  4XM3 A;  4XOR A;  1E43 A;  4XLA A;  2X6Y A;  1W0K A;  3BCF A;  1UD8 A;  3CMM A;  1HVX A;  1EFR A;  3G05 A;  4XQF A;  2E1B A;  3FPP A;  1E79 A;  2V4D A;  2X85 A;  2ZTG A;  3OE7 A;  4E0F A;  2CK3 A;  2D3N A;  4KKS A;  2X8K A;  2ZZQ A;  1K28 D;  3GQB A;  1E3X A;  4XOP A;  4DK1 A;  2XZL A;  1H8E A;  1W0J A;  3VR6 A;  4DK0 A;  1BPL A;  2WPD A;  3GVL A;  5IK2 A;  2X6W A;  2ZZE A;  1FX0 A;  1UD3 A;  4NNJ A;  3OPO A;  3T51 B;  2GJR A;  2DIE A;  3GVK A;  2JDI A;  1UD2 A;  2XND A;  1V0F A;  4XKW A;  1OB0 A;  3BH4 A;  3H94 A;  3ZIA A;  4XLH A;  2ZTN A;  2GJK A;  2ZXI A;  1MAB A;  5DN6 A;  1E1R A;  2R9V A;  3OEE A;  2XZO A;  2V7Q A;  4KKT A;  1UD4 A;  2Z6B D;  1WTH D;  4XMY A;  3GVJ A;  3CP2 A;  1WPC A;  4G7X A;  5CDF A;  1VLY A;  3A3G A;  4XOT A;  4G7W A;  4XD7 A;  3T56 B;  4B3F X;  1VJS A;  1UD5 A;  3WQZ A;  1W9X A;  1BMF A;  4KKU A;  4TT3 A;  3HAG A;  4AVZ A;  1V0E A;  2ZZF A;  4XLF A;  2JJ2 A;  4XR6 A;  3BCD A;  3OW7 A;  2VJI A;  3ZPN A;  1HZE A;  2X53 S;  4TKO B;  2VJJ A;  2ZZG A;  4P22 A;  2M5S A;  3OOC A;  4XLE A;  4YEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...