2KVOA

Solution nmr structure of photosystem ii reaction center psb28 protein from synechocystis sp.(strain pcc 6803), northeast structural genomics consortium target sgr171
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
120
structure length
120
Chain Sequence
MAEIQFSKGVAETVVPEVRLSKSKNGQSGMAKFYFLEPTILAKESTDDITGMYLIDDEGEIITREVKGKFINGRPTAIEATVILNSQPEWDRFMRFMERYGAENGLGFSKSELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of photosystem II reaction center protein Psb28 from Synechocystis sp. Strain PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Photosynthesis
molecule keywords Photosystem II reaction center psb28 protein
total genus 16
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03912 Psb28 Psb28 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.220 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2kvoA01
2KVOA 3ZPNA
chains in the Genus database with same CATH superfamily
4UZEA 4QHYA 1E1QA 2XNJA 4YHBA 2Q6IA 4B3XA 1NB0A 4HE5A 5DSZA 5HZAA 1N06A 1VHOA 1I7PA 2XOKA 3Q3AA 4QVJA 4Y7CA 1JA1A 2R6HA 2GK7A 2DY1A 1WOOA 2VNIA 2V7TA 4DNTB 3ASSA 2XEXA 2QE7A 3ASPA 1V5VA 1E63A 2WJVA 5L46A 3G4SB 5TRDA 1NBMA 4LBYA 2J7KA 1WP6A 1YX2A 4Y9RA 2ZTGA 1TLLA 3E20A 1KZLA 2C5HA 2CRVA 1QGYA 3ISXA 4P12A 5H5JA 5HXBA 1PJ6A 1DG1G 4OP7A 4XLAA 4RM0A 1XE1A 1SKYB 3I55B 1B2RA 1H8EA 3Q39A 3P26A 1FNCA 3R6KA 4FN5A 1IHMA 4LBVA 3W2IA 2W6IA 1VQ5B 1OB2A 4RD6A 1OB0A 4IW3B 3QFRA 3CC4B 1P4MA 1NB9A 1FDRA 1VQNB 3SJPA 1ZM4A 1AMOA 3DDYA 1XFOA 2ZXIA 1N05A 5IK2A 3GVJA 3BCFA 2OBRA 2VNJA 2B7CA 1MRZA 3OW7A 4RPDA 2WZPP 3T53B 3BQJA 2ZL5A 3RY8A 1WOPA 4OPVA 1VQPB 3AGQA 2D9RA 4DK1A 2V7XA 2C4UA 1OGIA 1VQLB 4Z4RA 4YAUA 2GJKA 3FJOA 4TMWA 5GV8A 3T56B 3CCSB 1B23P 4WWVA 4DQLA 3QFSA 1VQ6B 3CP8A 4G6IA 1VF7A 5TR9A 4DNRB 5TV2A 4X8IA 5J3OA 4C0SA 3CCEB 1YHQB 3WXMA 3Q6RA 3ONUA 3BY2A 4YALA 1T6ZA 2WPDA 3OJXA 1D8TA 1E3ZA 4RPBA 1EP2B 1XB2A 4XONA 3AVXA 3E1YE 2PLFA 3MCAA 1Y0YA 4XN3A 2CBXA 1QUEA 4RCYA 1PKVA 4GQNA 4YELA 3P27A 5FO0A 1E79A 1KMHA 1S72B 1BPLA 1PJ7A 1VHEA 1WPCA 1U2RA 3CPXA 1TVCA 1D2EA 2OBSA 5FL7A 3CRZA 3GVLA 4PAAA 5IYRA 4ROXA 3G71B 3WYAA 1UD3A 1GAWA 3V76A 3A1PA 2QDXA 1UD8A 2ZZFA 4DQKA 4XKVA 3WNDA 1VQ9B 2WSSA 3PVDA 1ELOA 1DDIA 2FX3A 3BC9A 4G5GA 4RDJA 2XGJA 4XOTA 3OZVA 5HZBA 1OHHA 3CB4A 1WSVA 4OPOA 3VR6A 4B4DA 1KK3A 3A3GA 4L8JA 1VJSA 3A8KA 4ZGQB 3ZBTA 1VLOA 1ZM3A 4YAOA 2C4TA 4ACAA 3ASQA 1KC8D 1QGZA 2BF4A 4P3IA 4B48A 4XR6A 2CW5A 3PA2A 4TKOB 2X6YA 3B82A 2ZZQA 4X0CA 3Q38A 1YJWB 1VQMB 1GO2A 3J81k 3G6EB 2BM0A 1G7TA 1Y0RA 1H42A 5A89A 3QSYA 2ZBUA 3CCQB 3CPWB 1W35A 1EFUA 2ZTNA 3G05A 1BQEA 1RQRA 1QX4A 3JU4A 4TT3A 2JJ2A 3CMMA 2C77A 3AVUA 2QA4B 2ZXHA 4AC9A 3CCRB 2ZZGA 2BN4A 1QUFA 4P6VF 2VBVA 2EIXA 2VYQA 4F7DA 2XZLA 1WOSA 1YIJB 2V31A 4AF7A 1YITB 1CNFA 4LC0A 2RC5A 4QV2A 1DDGA 2XNCA 1ZUNB 3GSIA 2GPJA 5J35A 1N8RD 1UD5A 3GQBA 5F4MA 3W2HA 1BX1A 1XQBA 2HMAA 1YJNB 5F4JA 1F20A 1SM4A 4MYTA 1YLOA 2QTLA 2HDNB 4TMZA 4Z4YA 2Q6KA 3R6JA 4YAFA 3CCJB 4N3NA 4WZTA 1KD1D 1JB9A 3SJZA 4FK8A 3MHPA 1VLYA 1VQOB 1N07A 4P2NA 1QVGB 4UZUA 2YWFA 2Q6OA 3LNNA 3CCVB 1HVXA 3SEJA 2JDIA 2GJRA 2VBUA 1G7SA 4C43A 3ZZTA 1TUIA 4OOVA 4J0QA 1OGJA 5IYPA 2XZOA 1QG0A 3LO8A 1BJKA 1K9MD 1EFTA 2JIZA 4K1XA 2E1BA 3OOCA 3JQPA 1Q86D 1MABA 4XLFA 2DEUA 4Q7JB 3OE7A 2V7QA 4X05A 1N0UA 2BGIA 3ZPNA 3A8IA 3KEWA 2OYNA 4JMQA 1W9XA 3AGPA 1I8DA 1G7RA 4XQFA 4P22A 3U6BA 4X7DA 5F4OA 2VBSA 1YI2B 4RD2A 4PC3A 4Z4TA 1COWA 4U9UA 2OK7A 3NE5B 4G1VA 3ZBUA 2W6JA 4AF6A 3W5HA 3CCUB 1H8HA 3WY9A 1IB0A 4FXUA 2Q6LA 2WYRA 1UD4A 2OBTA 2BMWA 2XNDA 4N3GA 5FNZA 5GV7A 5KW9A 3CP2A 4WZLA 2D3LA 1Q9SA 1UD2A 5CDFA 1ZM9A 3QFTA 3BCDA 1H85A 5THXA 3GIRA 1UMKA 3OEEA 1J9ZA 1F60A 3WBJA 2CK3A 3WNBA 1T6YA 4P6YA 3W2GA 3OW2B 3FPKA 4M53A 1WU8A 4P26A 3ZZ0A 3PENA 3LVBA 4P1VA 2JJ1A 1QGAA 1N08A 3ZUGA 5AN9A 2X3UA 2XZPA 1WSRA 3OP1A 2YWGA 3HAGA 4P9SA 2AHOA 4X7EA 4XLEA 4RJLA 4RD3A 3BH4A 1NJID 4G1BA 4ZCLA 3OFNA 4PC1A 3FKSA 5B6IA 2GREA 2EFGA 2QMUA 3Q6QA 2F1MA 5EMNA 3JQQA 2WJYA 1A8PA 2I1LA 1EWYA 2X53S 4ZCIA 5KNLA 2OTJB 3SKBA 4B47A 3WQZA 3CMEB 3I1FA 4ACBA 4XMYA 3PUNA 3H94A 4ZV4A 1FRNA 3B8HA 2BVNA 5IYWA 2YWHA 2PE3A 1E43A 2CF4A 3CCMB 2HLDA 2V7WA 1WDTA 4AVZA 2VJIA 4DK0A 4Z4ZA 2BSAA 4PC6A 4X7FA 1K8AD 5IYNA 1JNYA 1NRKA 1BLIA 2BM1A 2V7VA 2VNHA 4M4SA 2VZLA 4RCZA 1DARA 2NV4A 4OOSA 4XNFA 2ZZEA 4RDLA 4X7CA 4YEJA 1W2BB 4M2LA 3LQEA 2M5SA 2C78A 4G7WA 3OEHA 4LBZA 2WR8A 3BNWA 3VO2A 2F1LA 4XOPA 3JQRA 1ZM2A 4II2A 1GR1A 1KJZA 3SLDA 1FNDA 3U2QA 5BSYA 3AVWA 1QFZA 4XKWA 3ZIAA 1KQSB 4YAWA 1E64A 2C5BA 1VQKB 3AVTA 2OTLB 1EP3B 1FNMA 1KK0A 5FO1A 4Z1MA 4XN0A 1FX0A 1W34A 3D26A 2DETA 3U6KA 2CNDA 5KSWB 1GVHA 4H9GA 1CQXA 1G7CA 4B3GA 1I18A 1VQ4B 3B78A 2HCJB 3CD6B 1KK1A 4OOXA 2VBTA 3VMFA 4ZCMA 1HA3A 5FIUA 3WNCA 4TMXA 2F4NA 2D74A 4TSFA 4FWTA 1Q82D 1T6XA 1JJ2B 2BV3A 2ZL6A 1KTVA 2OK8A 2JN9A 4P3YA 1N0VC 5FA6A 4TMVA 3CW2A 5H59A 1HZEA 3H9NA 2NPFA 5E6TA 1M1KD 3CCLB 1FRQA 1E62A 2KVOA 1EFRA 2ZITA 5A8AA 2P3MA 3W5UA 2YWEA 4G7XA 1QFYA 3ZZUA 4RDKA 1V0EA 2RC6A 1S0UA 3BY1A 1YJ9B 1BX0A 3SLNA 3OJWA 2GK6A 4TMTA 3OAAA 1IJEA 2F43A 2QGGA 2ZBVA 4Z4SA 1RQPA 2X6WA 3PA1A 4ASUA 3CXCB 4Y9UA 3CTAA 1Q7YD 1BMFA 1D1NA 1FNBA 3KL9A 1E3XA 2PIAA 4X06A 3A35A 4QFMA 4PC2A 3QFCA 5HKKA 4WZEA 4Z4VA 4XLHA 3VO1A 3VNUA 3V7AA 2QTZA 3AVYA 4KKUA 1GJRA 3OPOA 1QFJA 2QN6A 4XD7A 4M1KA 3ZC3A 2C2WA 4UAJA 1QVFB 1W0KA 3PUMA 4XLCA 3CMAB 1R5NA 3A8JA 2X8KA 3ASRA 4PABA 3A3BA 4RD1A 4QVAA 2BGJA 1IJFA 2DIEA 5TY0A 1W0JA 2BPOA 4OPSA 5A88A 3OKXA 5BSXA 2DOGA 4HIZA 2DCUA 2E1RA 3T51B 1V0FA 2DERA 3AVVA 3OZWA 4YXWA 1WORA 1WTHD 1AIPA 4P25A 4CQJA 3MMPA 2V7UA 4HE6A 3CC2B 1CNEA 2CC2A 4Z4WA 2D3NA 4RLZA 2R9VA 4R71A 4Z4UA 4RD4A 3QE2A 2V4DA 3CESA 4B43A 2DYIA 3OZUA 1K73D 1R5OA 1K28D 1QH0A 4MYUA 1JA0A 2ZL7A 4XL9A 4X07A 4XM3A 3W5VA 4PC7A 1GAQA 4LBWA 1EFCA 4KKSA 4WQMA 4BPRA 4II3A 2X0KA 4RD0A 4NNJA 1W87A 4E0FA 1TTTA 1KK2A 4ZGNB 1EP1B 1OB5A 3W2FA 1KRHA 1VQ8B 3ONYA 2X6XA 2LZJA 2WZNA 2FVGA 4NBSA 1E1RA 5DN6A 4XORA 1NDHA 4WZKA 4UZFA 1UD6A 4M0LA 2B7BA 2GQFA 1M90D 5DS0A 5IYQA 4B3FX 2VJJA 1EXMA 4QUZA 1VQ7B 1T5EA 3LQ6A 1SKQA 2X85A 2GJPA 2Z6BD 2VNKA 1R5BA 4KKTA 1S4MA 3FPPA 3GVKA 4B44A 3CC7B 3VNVA 3I56B 2PMDA 4EH1A 4NCNA 3ASTA 2QEXB 5LMZA 3W2EA 1Q81D 4PGOA 3WBKA 4TN1A 5JBQA 1PJ5A 3ES9A 2B5OA
chains in the Genus database with same CATH topology
1E1QA 3A3GA 2KVOA 4L8JA 1EFRA 1H8HA 1VJSA 4FXUA 1UD4A 2XNDA 3CP2A 4G7XA 2D3LA 5CDFA 1UD2A 2XOKA 4XR6A 2GK7A 3BCDA 1V0EA 3OEEA 4TKOB 2X6YA 4DNTB 2GK6A 2CK3A 2F43A 3OAAA 2QE7A 2X6WA 2ZZQA 4ASUA 1BMFA 2WJVA 1NBMA 1E3XA 2JJ1A 1WP6A 3A35A 5HKKA 2XZPA 2ZTGA 4XLHA 3HAGA 4KKUA 1KZLA 4XLEA 3OPOA 4XLAA 2ZTNA 4XD7A 3BH4A 3G05A 1SKYB 1W0KA 4XLCA 3JU4A 4TT3A 2JJ2A 3CMMA 1H8EA 2X8KA 3OFNA 2ZXHA 3FKSA 3A3BA 2ZZGA 2DIEA 2F1MA 1W0JA 2W6IA 2WJYA 2X53S 1OB0A 5KNLA 3WQZA 4HIZA 3T51B 2XZLA 1V0FA 4YXWA 2V31A 4XMYA 1WTHD 3H94A 3DDYA 2ZXIA 1E43A 5IK2A 3GVJA 3BCFA 2D3NA 2HLDA 3OW7A 2R9VA 2WZPP 3T53B 4AVZA 2VJIA 4DK0A 2V4DA 1UD5A 3CESA 3GQBA 1K28D 1NRKA 4DK1A 1BLIA 4XNFA 2GJKA 3T56B 2ZZEA 4YEJA 4XL9A 4XM3A 2M5SA 3CP8A 4G6IA 4G7WA 1VF7A 3OEHA 4KKSA 4DNRB 4II3A 4XOPA 1VLYA 4NNJA 4E0FA 4UZUA 2WPDA 4II2A 3LNNA 1E3ZA 1HVXA 4XKWA 3ZIAA 2JDIA 2GJRA 4XONA 4XN3A 2X6XA 2LZJA 1PKVA 4XN0A 4Z1MA 1E1RA 1FX0A 4GQNA 4YELA 4XORA 5DN6A 2XZOA 1E79A 1KMHA 1BPLA 2JIZA 1WPCA 2E1BA 1UD6A 3OOCA 4B3GA 1I18A 5FL7A 1MABA 4XLFA 4B3FX 3GVLA 2VJJA 3OE7A 1T5EA 2X85A 2V7QA 2GJPA 2Z6BD 1UD3A 4KKTA 3GVKA 3FPPA 3ZPNA 1UD8A 2ZZFA 3KEWA 4JMQA 1W9XA 4XKVA 4TSFA 1I8DA 2WSSA 3BC9A 4XQFA 4P22A 2XGJA 4XOTA 1OHHA 1COWA 3NE5B 1HZEA 3VR6A 2W6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVO A;  3ZPN A; 
#chains in the Genus database with same CATH topology
 4UZE A;  4QHY A;  1E1Q A;  2XNJ A;  4YHB A;  2Q6I A;  4B3X A;  1NB0 A;  4HE5 A;  5DSZ A;  5HZA A;  1N06 A;  1VHO A;  1I7P A;  2XOK A;  3Q3A A;  4QVJ A;  4Y7C A;  1JA1 A;  2R6H A;  2GK7 A;  2DY1 A;  1WOO A;  2VNI A;  2V7T A;  4DNT B;  3ASS A;  2XEX A;  2QE7 A;  3ASP A;  1V5V A;  1E63 A;  2WJV A;  5L46 A;  3G4S B;  5TRD A;  1NBM A;  4LBY A;  2J7K A;  1WP6 A;  1YX2 A;  4Y9R A;  2ZTG A;  1TLL A;  3E20 A;  1KZL A;  2C5H A;  2CRV A;  1QGY A;  3ISX A;  4P12 A;  5H5J A;  5HXB A;  1PJ6 A;  1DG1 G;  4OP7 A;  4XLA A;  4RM0 A;  1XE1 A;  1SKY B;  3I55 B;  1B2R A;  1H8E A;  3Q39 A;  3P26 A;  1FNC A;  3R6K A;  4FN5 A;  1IHM A;  4LBV A;  3W2I A;  2W6I A;  1VQ5 B;  1OB2 A;  4RD6 A;  1OB0 A;  4IW3 B;  3QFR A;  3CC4 B;  1P4M A;  1NB9 A;  1FDR A;  1VQN B;  3SJP A;  1ZM4 A;  1AMO A;  3DDY A;  1XFO A;  2ZXI A;  1N05 A;  5IK2 A;  3GVJ A;  3BCF A;  2OBR A;  2VNJ A;  2B7C A;  1MRZ A;  3OW7 A;  4RPD A;  2WZP P;  3T53 B;  3BQJ A;  2ZL5 A;  3RY8 A;  1WOP A;  4OPV A;  1VQP B;  3AGQ A;  2D9R A;  4DK1 A;  2V7X A;  2C4U A;  1OGI A;  1VQL B;  4Z4R A;  4YAU A;  2GJK A;  3FJO A;  4TMW A;  5GV8 A;  3T56 B;  3CCS B;  1B23 P;  4WWV A;  4DQL A;  3QFS A;  1VQ6 B;  3CP8 A;  4G6I A;  1VF7 A;  5TR9 A;  4DNR B;  5TV2 A;  4X8I A;  5J3O A;  4C0S A;  3CCE B;  1YHQ B;  3WXM A;  3Q6R A;  3ONU A;  3BY2 A;  4YAL A;  1T6Z A;  2WPD A;  3OJX A;  1D8T A;  1E3Z A;  4RPB A;  1EP2 B;  1XB2 A;  4XON A;  3AVX A;  3E1Y E;  2PLF A;  3MCA A;  1Y0Y A;  4XN3 A;  2CBX A;  1QUE A;  4RCY A;  1PKV A;  4GQN A;  4YEL A;  3P27 A;  5FO0 A;  1E79 A;  1KMH A;  1S72 B;  1BPL A;  1PJ7 A;  1VHE A;  1WPC A;  1U2R A;  3CPX A;  1TVC A;  1D2E A;  2OBS A;  5FL7 A;  3CRZ A;  3GVL A;  4PAA A;  5IYR A;  4ROX A;  3G71 B;  3WYA A;  1UD3 A;  1GAW A;  3V76 A;  3A1P A;  2QDX A;  1UD8 A;  2ZZF A;  4DQK A;  4XKV A;  3WND A;  1VQ9 B;  2WSS A;  3PVD A;  1ELO A;  1DDI A;  2FX3 A;  3BC9 A;  4G5G A;  4RDJ A;  2XGJ A;  4XOT A;  3OZV A;  5HZB A;  1OHH A;  3CB4 A;  1WSV A;  4OPO A;  3VR6 A;  4B4D A;  1KK3 A;  3A3G A;  4L8J A;  1VJS A;  3A8K A;  4ZGQ B;  3ZBT A;  1VLO A;  1ZM3 A;  4YAO A;  2C4T A;  4ACA A;  3ASQ A;  1KC8 D;  1QGZ A;  2BF4 A;  4P3I A;  4B48 A;  4XR6 A;  2CW5 A;  3PA2 A;  4TKO B;  2X6Y A;  3B82 A;  2ZZQ A;  4X0C A;  3Q38 A;  1YJW B;  1VQM B;  1GO2 A;  3J81 k;  3G6E B;  2BM0 A;  1G7T A;  1Y0R A;  1H42 A;  5A89 A;  3QSY A;  2ZBU A;  3CCQ B;  3CPW B;  1W35 A;  1EFU A;  2ZTN A;  3G05 A;  1BQE A;  1RQR A;  1QX4 A;  3JU4 A;  4TT3 A;  2JJ2 A;  3CMM A;  2C77 A;  3AVU A;  2QA4 B;  2ZXH A;  4AC9 A;  3CCR B;  2ZZG A;  2BN4 A;  1QUF A;  4P6V F;  2VBV A;  2EIX A;  2VYQ A;  4F7D A;  2XZL A;  1WOS A;  1YIJ B;  2V31 A;  4AF7 A;  1YIT B;  1CNF A;  4LC0 A;  2RC5 A;  4QV2 A;  1DDG A;  2XNC A;  1ZUN B;  3GSI A;  2GPJ A;  5J35 A;  1N8R D;  1UD5 A;  3GQB A;  5F4M A;  3W2H A;  1BX1 A;  1XQB A;  2HMA A;  1YJN B;  5F4J A;  1F20 A;  1SM4 A;  4MYT A;  1YLO A;  2QTL A;  2HDN B;  4TMZ A;  4Z4Y A;  2Q6K A;  3R6J A;  4YAF A;  3CCJ B;  4N3N A;  4WZT A;  1KD1 D;  1JB9 A;  3SJZ A;  4FK8 A;  3MHP A;  1VLY A;  1VQO B;  1N07 A;  4P2N A;  1QVG B;  4UZU A;  2YWF A;  2Q6O A;  3LNN A;  3CCV B;  1HVX A;  3SEJ A;  2JDI A;  2GJR A;  2VBU A;  1G7S A;  4C43 A;  3ZZT A;  1TUI A;  4OOV A;  4J0Q A;  1OGJ A;  5IYP A;  2XZO A;  1QG0 A;  3LO8 A;  1BJK A;  1K9M D;  1EFT A;  2JIZ A;  4K1X A;  2E1B A;  3OOC A;  3JQP A;  1Q86 D;  1MAB A;  4XLF A;  2DEU A;  4Q7J B;  3OE7 A;  2V7Q A;  4X05 A;  1N0U A;  2BGI A;  3ZPN A;  3A8I A;  3KEW A;  2OYN A;  4JMQ A;  1W9X A;  3AGP A;  1I8D A;  1G7R A;  4XQF A;  4P22 A;  3U6B A;  4X7D A;  5F4O A;  2VBS A;  1YI2 B;  4RD2 A;  4PC3 A;  4Z4T A;  1COW A;  4U9U A;  2OK7 A;  3NE5 B;  4G1V A;  3ZBU A;  2W6J A;  4AF6 A;  3W5H A;  3CCU B;  1H8H A;  3WY9 A;  1IB0 A;  4FXU A;  2Q6L A;  2WYR A;  1UD4 A;  2OBT A;  2BMW A;  2XND A;  4N3G A;  5FNZ A;  5GV7 A;  5KW9 A;  3CP2 A;  4WZL A;  2D3L A;  1Q9S A;  1UD2 A;  5CDF A;  1ZM9 A;  3QFT A;  3BCD A;  1H85 A;  5THX A;  3GIR A;  1UMK A;  3OEE A;  1J9Z A;  1F60 A;  3WBJ A;  2CK3 A;  3WNB A;  1T6Y A;  4P6Y A;  3W2G A;  3OW2 B;  3FPK A;  4M53 A;  1WU8 A;  4P26 A;  3ZZ0 A;  3PEN A;  3LVB A;  4P1V A;  2JJ1 A;  1QGA A;  1N08 A;  3ZUG A;  5AN9 A;  2X3U A;  2XZP A;  1WSR A;  3OP1 A;  2YWG A;  3HAG A;  4P9S A;  2AHO A;  4X7E A;  4XLE A;  4RJL A;  4RD3 A;  3BH4 A;  1NJI D;  4G1B A;  4ZCL A;  3OFN A;  4PC1 A;  3FKS A;  5B6I A;  2GRE A;  2EFG A;  2QMU A;  3Q6Q A;  2F1M A;  5EMN A;  3JQQ A;  2WJY A;  1A8P A;  2I1L A;  1EWY A;  2X53 S;  4ZCI A;  5KNL A;  2OTJ B;  3SKB A;  4B47 A;  3WQZ A;  3CME B;  3I1F A;  4ACB A;  4XMY A;  3PUN A;  3H94 A;  4ZV4 A;  1FRN A;  3B8H A;  2BVN A;  5IYW A;  2YWH A;  2PE3 A;  1E43 A;  2CF4 A;  3CCM B;  2HLD A;  2V7W A;  1WDT A;  4AVZ A;  2VJI A;  4DK0 A;  4Z4Z A;  2BSA A;  4PC6 A;  4X7F A;  1K8A D;  5IYN A;  1JNY A;  1NRK A;  1BLI A;  2BM1 A;  2V7V A;  2VNH A;  4M4S A;  2VZL A;  4RCZ A;  1DAR A;  2NV4 A;  4OOS A;  4XNF A;  2ZZE A;  4RDL A;  4X7C A;  4YEJ A;  1W2B B;  4M2L A;  3LQE A;  2M5S A;  2C78 A;  4G7W A;  3OEH A;  4LBZ A;  2WR8 A;  3BNW A;  3VO2 A;  2F1L A;  4XOP A;  3JQR A;  1ZM2 A;  4II2 A;  1GR1 A;  1KJZ A;  3SLD A;  1FND A;  3U2Q A;  5BSY A;  3AVW A;  1QFZ A;  4XKW A;  3ZIA A;  1KQS B;  4YAW A;  1E64 A;  2C5B A;  1VQK B;  3AVT A;  2OTL B;  1EP3 B;  1FNM A;  1KK0 A;  5FO1 A;  4Z1M A;  4XN0 A;  1FX0 A;  1W34 A;  3D26 A;  2DET A;  3U6K A;  2CND A;  5KSW B;  1GVH A;  4H9G A;  1CQX A;  1G7C A;  4B3G A;  1I18 A;  1VQ4 B;  3B78 A;  2HCJ B;  3CD6 B;  1KK1 A;  4OOX A;  2VBT A;  3VMF A;  4ZCM A;  1HA3 A;  5FIU A;  3WNC A;  4TMX A;  2F4N A;  2D74 A;  4TSF A;  4FWT A;  1Q82 D;  1T6X A;  1JJ2 B;  2BV3 A;  2ZL6 A;  1KTV A;  2OK8 A;  2JN9 A;  4P3Y A;  1N0V C;  5FA6 A;  4TMV A;  3CW2 A;  5H59 A;  1HZE A;  3H9N A;  2NPF A;  5E6T A;  1M1K D;  3CCL B;  1FRQ A;  1E62 A;  2KVO A;  1EFR A;  2ZIT A;  5A8A A;  2P3M A;  3W5U A;  2YWE A;  4G7X A;  1QFY A;  3ZZU A;  4RDK A;  1V0E A;  2RC6 A;  1S0U A;  3BY1 A;  1YJ9 B;  1BX0 A;  3SLN A;  3OJW A;  2GK6 A;  4TMT A;  3OAA A;  1IJE A;  2F43 A;  2QGG A;  2ZBV A;  4Z4S A;  1RQP A;  2X6W A;  3PA1 A;  4ASU A;  3CXC B;  4Y9U A;  3CTA A;  1Q7Y D;  1BMF A;  1D1N A;  1FNB A;  3KL9 A;  1E3X A;  2PIA A;  4X06 A;  3A35 A;  4QFM A;  4PC2 A;  3QFC A;  5HKK A;  4WZE A;  4Z4V A;  4XLH A;  3VO1 A;  3VNU A;  3V7A A;  2QTZ A;  3AVY A;  4KKU A;  1GJR A;  3OPO A;  1QFJ A;  2QN6 A;  4XD7 A;  4M1K A;  3ZC3 A;  2C2W A;  4UAJ A;  1QVF B;  1W0K A;  3PUM A;  4XLC A;  3CMA B;  1R5N A;  3A8J A;  2X8K A;  3ASR A;  4PAB A;  3A3B A;  4RD1 A;  4QVA A;  2BGJ A;  1IJF A;  2DIE A;  5TY0 A;  1W0J A;  2BPO A;  4OPS A;  5A88 A;  3OKX A;  5BSX A;  2DOG A;  4HIZ A;  2DCU A;  2E1R A;  3T51 B;  1V0F A;  2DER A;  3AVV A;  3OZW A;  4YXW A;  1WOR A;  1WTH D;  1AIP A;  4P25 A;  4CQJ A;  3MMP A;  2V7U A;  4HE6 A;  3CC2 B;  1CNE A;  2CC2 A;  4Z4W A;  2D3N A;  4RLZ A;  2R9V A;  4R71 A;  4Z4U A;  4RD4 A;  3QE2 A;  2V4D A;  3CES A;  4B43 A;  2DYI A;  3OZU A;  1K73 D;  1R5O A;  1K28 D;  1QH0 A;  4MYU A;  1JA0 A;  2ZL7 A;  4XL9 A;  4X07 A;  4XM3 A;  3W5V A;  4PC7 A;  1GAQ A;  4LBW A;  1EFC A;  4KKS A;  4WQM A;  4BPR A;  4II3 A;  2X0K A;  4RD0 A;  4NNJ A;  1W87 A;  4E0F A;  1TTT A;  1KK2 A;  4ZGN B;  1EP1 B;  1OB5 A;  3W2F A;  1KRH A;  1VQ8 B;  3ONY A;  2X6X A;  2LZJ A;  2WZN A;  2FVG A;  4NBS A;  1E1R A;  5DN6 A;  4XOR A;  1NDH A;  4WZK A;  4UZF A;  1UD6 A;  4M0L A;  2B7B A;  2GQF A;  1M90 D;  5DS0 A;  5IYQ A;  4B3F X;  2VJJ A;  1EXM A;  4QUZ A;  1VQ7 B;  1T5E A;  3LQ6 A;  1SKQ A;  2X85 A;  2GJP A;  2Z6B D;  2VNK A;  1R5B A;  4KKT A;  1S4M A;  3FPP A;  3GVK A;  4B44 A;  3CC7 B;  3VNV A;  3I56 B;  2PMD A;  4EH1 A;  4NCN A;  3AST A;  2QEX B;  5LMZ A;  3W2E A;  1Q81 D;  4PGO A;  3WBK A;  4TN1 A;  5JBQ A;  1PJ5 A;  3ES9 A;  2B5O A; 
#chains in the Genus database with same CATH homology
 1E1Q A;  3A3G A;  2KVO A;  4L8J A;  1EFR A;  1H8H A;  1VJS A;  4FXU A;  1UD4 A;  2XND A;  3CP2 A;  4G7X A;  2D3L A;  5CDF A;  1UD2 A;  2XOK A;  4XR6 A;  2GK7 A;  3BCD A;  1V0E A;  3OEE A;  4TKO B;  2X6Y A;  4DNT B;  2GK6 A;  2CK3 A;  2F43 A;  3OAA A;  2QE7 A;  2X6W A;  2ZZQ A;  4ASU A;  1BMF A;  2WJV A;  1NBM A;  1E3X A;  2JJ1 A;  1WP6 A;  3A35 A;  5HKK A;  2XZP A;  2ZTG A;  4XLH A;  3HAG A;  4KKU A;  1KZL A;  4XLE A;  3OPO A;  4XLA A;  2ZTN A;  4XD7 A;  3BH4 A;  3G05 A;  1SKY B;  1W0K A;  4XLC A;  3JU4 A;  4TT3 A;  2JJ2 A;  3CMM A;  1H8E A;  2X8K A;  3OFN A;  2ZXH A;  3FKS A;  3A3B A;  2ZZG A;  2DIE A;  2F1M A;  1W0J A;  2W6I A;  2WJY A;  2X53 S;  1OB0 A;  5KNL A;  3WQZ A;  4HIZ A;  3T51 B;  2XZL A;  1V0F A;  4YXW A;  2V31 A;  4XMY A;  1WTH D;  3H94 A;  3DDY A;  2ZXI A;  1E43 A;  5IK2 A;  3GVJ A;  3BCF A;  2D3N A;  2HLD A;  3OW7 A;  2R9V A;  2WZP P;  3T53 B;  4AVZ A;  2VJI A;  4DK0 A;  2V4D A;  1UD5 A;  3CES A;  3GQB A;  1K28 D;  1NRK A;  4DK1 A;  1BLI A;  4XNF A;  2GJK A;  3T56 B;  2ZZE A;  4YEJ A;  4XL9 A;  4XM3 A;  2M5S A;  3CP8 A;  4G6I A;  4G7W A;  1VF7 A;  3OEH A;  4KKS A;  4DNR B;  4II3 A;  4XOP A;  1VLY A;  4NNJ A;  4E0F A;  4UZU A;  2WPD A;  4II2 A;  3LNN A;  1E3Z A;  1HVX A;  4XKW A;  3ZIA A;  2JDI A;  2GJR A;  4XON A;  4XN3 A;  2X6X A;  2LZJ A;  1PKV A;  4XN0 A;  4Z1M A;  1E1R A;  1FX0 A;  4GQN A;  4YEL A;  4XOR A;  5DN6 A;  2XZO A;  1E79 A;  1KMH A;  1BPL A;  2JIZ A;  1WPC A;  2E1B A;  1UD6 A;  3OOC A;  4B3G A;  1I18 A;  5FL7 A;  1MAB A;  4XLF A;  4B3F X;  3GVL A;  2VJJ A;  3OE7 A;  1T5E A;  2X85 A;  2V7Q A;  2GJP A;  2Z6B D;  1UD3 A;  4KKT A;  3GVK A;  3FPP A;  3ZPN A;  1UD8 A;  2ZZF A;  3KEW A;  4JMQ A;  1W9X A;  4XKV A;  4TSF A;  1I8D A;  2WSS A;  3BC9 A;  4XQF A;  4P22 A;  2XGJ A;  4XOT A;  1OHH A;  1COW A;  3NE5 B;  1HZE A;  3VR6 A;  2W6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...