2KVOA

Solution nmr structure of photosystem ii reaction center psb28 protein from synechocystis sp.(strain pcc 6803), northeast structural genomics consortium target sgr171
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
120
structure length
120
Chain Sequence
MAEIQFSKGVAETVVPEVRLSKSKNGQSGMAKFYFLEPTILAKESTDDITGMYLIDDEGEIITREVKGKFINGRPTAIEATVILNSQPEWDRFMRFMERYGAENGLGFSKSELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II reaction center psb28 protein
publication title Solution NMR structure of photosystem II reaction center protein Psb28 from Synechocystis sp. Strain PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Photosynthesis
total genus 16
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03912 Psb28 Psb28 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.220 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2kvoA01
2KVOA 3ZPNA
chains in the Genus database with same CATH superfamily
1F60A 4P3IA 1FRNA 4X05A 1NRKA 3CCSB 2X6YA 4M0LA 3CCRB 4HE5A 3KEWA 1VQ7B 3AVYA 3BQJA 4PC1A 5EMNA 1VQPB 3PUMA 3Q39A 1CNEA 1E1RA 3OFNA 2Q6IA 1Q81D 4RJLA 4RD0A 1VQNB 2XZLA 2Z6BD 5IYQA 4G5GA 3AVTA 1JA1A 3ZZ0A 3T53B 1EWYA 1IHMA 3GQBA 3QE2A 2FX3A 5KW9A 4J0QA 3CMAB 1KC8D 3OW7A 1YI2B 2ZZFA 2WJVA 1PKVA 1RQRA 2V7WA 4RPDA 4XN3A 3HAGA 4TKOB 4RDJA 1YJWB 2QTZA 3CCMB 1ZM4A 4XN0A 2EFGA 3SLDA 3CCQB 2BGJA 4P1VA 1OB5A 1ZM9A 3OJWA 1R5BA 3OEHA 1W0JA 3PVDA 3ZIAA 4RD6A 5FA6A 2C4UA 2ZZGA 1NB0A 1ZM2A 3I1FA 4X06A 4P3YA 4ASUA 1Q7YD 2X0KA 3CCEB 3SJZA 3Q3AA 2ZXHA 1GO2A 5TY0A 4ACBA 4PABA 3WNBA 1NB9A 2QEXB 4RD2A 4YAFA 2DYIA 3SJPA 2QGGA 2B7BA 3WY9A 1S72B 2VBUA 4HE6A 2WYRA 5TR9A 1GR1A 2JN9A 1DDIA 4TMXA 1EXMA 4XLAA 1VQ9B 4ZGQB 4PC7A 5GV7A 1OGIA 4U9UA 4C0SA 1TUIA 4P9SA 1TLLA 5A89A 4H9GA 1BQEA 1EP1B 4FK8A 5IYWA 3WQZA 3B82A 3A35A 1ZM3A 1BLIA 4P22A 4XNFA 3OW2B 1IJFA 5GV8A 3ES9A 3W5VA 2E1BA 4DQLA 2VNKA 2DIEA 1M90D 3A8IA 3CP2A 4LBVA 2F1LA 4RD3A 4GQNA 2XZPA 2EIXA 1WPCA 1WDTA 1R5NA 3MMPA 3W5HA 3WXMA 3Q38A 2VZLA 1KK0A 2ZL6A 3BY2A 4XQFA 4YAUA 4B47A 1PJ7A 4X7CA 1U2RA 3D26A 4OOXA 4Z4UA 3JQPA 4P25A 2PIAA 1I8DA 1UD5A 2D3NA 4R71A 4G6IA 2AHOA 2D74A 2GJRA 2BM1A 5F4OA 4YAOA 4WWVA 3ZZTA 4UZFA 5TRDA 4RCZA 1KMHA 1WU8A 2V7XA 2F4NA 3LO8A 3ASSA 2CBXA 2OTLB 1WORA 2VBVA 1GVHA 4PC3A 4FN5A 1BPLA 1TVCA 1Y0RA 4M53A 4TSFA 2BMWA 1Q9SA 3Q6QA 5L46A 1QVFB 3CD6B 2RC5A 4XMYA 3LQ6A 2R9VA 4TMVA 1E62A 4XORA 1AIPA 5A8AA 1N0VC 1QUFA 3SEJA 4DNRB 3A3BA 3CESA 2ZITA 5HKKA 1Q82D 1H8EA 1MRZA 1N07A 1YX2A 5BSYA 4YEJA 1QUEA 3QFRA 5H59A 3CXCB 3VNUA 3AGQA 1VQOB 2C2WA 2C78A 2DEUA 2CC2A 4TN1A 1HVXA 4RM0A 1D2EA 3P26A 2V7VA 3CMMA 1FNDA 4XL9A 2BSAA 1G7SA 1XFOA 2ZBUA 4Q7JB 1QH0A 3PA1A 2M5SA 3W2HA 1KJZA 1W87A 4IW3B 4B48A 4OPVA 4XR6A 1BX1A 2GJKA 1EFCA 3B78A 1HA3A 4NNJA 1WSRA 5IYRA 1NJID 5KNLA 1NDHA 5DSZA 3B8HA 2VNJA 2BPOA 3AVVA 2NV4A 1T6ZA 2DCUA 1G7RA 1ELOA 3CC7B 3PA2A 1WTHD 1YLOA 5E6TA 1JJ2B 1YJ9B 1W9XA 1N0UA 1HZEA 1WSVA 2R6HA 4HIZA 4P2NA 1DARA 4YHBA 1E64A 2XOKA 1GAQA 4OPSA 5A88A 2WSSA 3ZBTA 3CTAA 4RDKA 1E79A 3FPKA 2QE7A 3MHPA 2NPFA 4XLCA 5DN6A 3OPOA 3V76A 1KZLA 5F4JA 2VJJA 4Y7CA 2OBTA 1SM4A 3GVLA 1TTTA 2CRVA 4FWTA 3FPPA 2YWEA 3GSIA 2X85A 4Z4RA 2I1LA 3ZBUA 2PMDA 4G7WA 4ZGNB 1YHQB 1KQSB 4XLFA 5IK2A 3WBJA 1K73D 2WR8A 3R6JA 3T56B 4WZLA 1VLYA 4AF7A 1D8TA 1WOSA 2BGIA 1QFJA 2OBSA 3U6BA 4N3NA 1VLOA 3CP8A 3ISXA 2OK8A 4LBZA 1VQLB 1E3XA 4X07A 1COWA 2F43A 3OEEA 4UAJA 3H94A 2D9RA 2C4TA 1H42A 1H85A 1MABA 2VNIA 1VHEA 1QX4A 3CCLB 4AC9A 3CRZA 4RLZA 1D1NA 1K28D 1XB2A 5IYNA 1V5VA 4OPOA 3VR6A 4Y9RA 4ZCMA 3G4SB 1BX0A 1QFYA 4QVAA 2YWFA 2QN6A 3T51B 4RDLA 3AVWA 4BPRA 2VBTA 4DQKA 1CNFA 3GVKA 4XKWA 5HXBA 4M4SA 4DNTB 3PUNA 1Y0YA 4AF6A 2GREA 4B43A 1PJ5A 1VHOA 4TT3A 1BMFA 3CCUB 1VJSA 4II3A 1UD2A 1UD4A 2HCJB 4OOSA 4QV2A 1KK1A 3LVBA 3ONUA 3ONYA 3RY8A 2GK6A 3LQEA 5KSWB 2FVGA 3BCFA 4RPBA 1SKQA 3JQQA 2CK3A 1EFUA 4P6YA 4EH1A 3I56B 1EP3B 1VQ8B 4OOVA 3BY1A 3U2QA 4Z4YA 4LC0A 3SKBA 3FKSA 4X7EA 2HDNB 3QFCA 5LMZA 1I18A 4B4DA 3KL9A 1WP6A 3R6KA 3NE5B 2PE3A 3OZUA 2W6IA 4KKSA 5FO0A 4LBWA 3CCJB 2LZJA 1JB9A 3ASPA 4AVZA 2QA4B 1P4MA 4OP7A 3A8KA 4P6VF 3OZVA 3W2IA 4G1BA 2VJIA 4YAWA 4B44A 4F7DA 2X3UA 4YALA 5CDFA 3G6EB 3BNWA 2OTJB 4TMWA 4Z1MA 1K9MD 3WNCA 1E3ZA 4XOPA 1VQMB 4Z4ZA 4TMTA 3MCAA 3ZPNA 3BH4A 2JIZA 3Q6RA 4B3FX 1OB2A 4TMZA 1EFTA 1V0FA 4MYUA 1W35A 3GVJA 2BN4A 4X7FA 1GJRA 1KTVA 1WOPA 4P26A 4PGOA 2ZTGA 1R5OA 1KK2A 3VNVA 1N06A 3ZUGA 5B6IA 2BV3A 2D3LA 2E1RA 2F1MA 4LBYA 4Z4SA 1QGAA 2DOGA 1BJKA 3PENA 2P3MA 1YJNB 3QFSA 4PC2A 4ROXA 4Y9UA 1F20A 1VQKB 1W0KA 3BCDA 2CNDA 4YELA 2XNJA 4Z4VA 1UD3A 2HMAA 3J81k 2JDIA 2DERA 1OB0A 3E20A 1J9ZA 2OYNA 3WBKA 3E1YE 2J7KA 1YIJB 2B7CA 2X6WA 2XZOA 3VO2A 3OJXA 2ZBVA 3OKXA 3FJOA 5HZBA 2BM0A 2YWHA 1Q86D 2WJYA 2X8KA 3ZZUA 4WQMA 4QUZA 1E63A 5HZAA 3OE7A 4QHYA 1FX0A 2CW5A 3OZWA 5DS0A 3QSYA 2ZXIA 2V31A 2KVOA 1W2BB 3CPXA 3CPWB 4JMQA 3U6KA 4RD4A 3BC9A 2QDXA 2BF4A 4DK0A 3G05A 4WZEA 1B23P 2B5OA 4XOTA 3VO1A 1IB0A 2JJ1A 4NBSA 4XONA 1VQ6B 1N05A 1M1KD 1QGZA 1VQ4B 1H8HA 1S4MA 2OK7A 2HLDA 1AMOA 4X8IA 1K8AD 2C77A 4C43A 1B2RA 2VBSA 1VF7A 2BVNA 3LNNA 4E0FA 2JJ2A 3CMEB 3CC4B 4ZCIA 1T6YA 3SLNA 2Q6OA 1GAWA 1QFZA 1DG1G 2DY1A 3JU4A 5AN9A 4DK1A 4M1KA 2CF4A 5BSXA 2ZL7A 1OGJA 3QFTA 2VYQA 2W6JA 3AVXA 2ZZQA 2C5HA 1XQBA 4G1VA 2WZPP 4K1XA 1UMKA 1ZUNB 3OAAA 1UD6A 3VMFA 4II2A 3A8JA 1A8PA 2GJPA 3ZC3A 1W34A 2X53S 3ASQA 4RD1A 2Q6KA 5THXA 2QMUA 2XNCA 4M2LA 2XGJA 2ZZEA 4XLHA 3G71B 1KRHA 1FNCA 1FNBA 4MYTA 3W2GA 2QTLA 4XD7A 1NBMA 3A1PA 2V7UA 5FNZA 5FO1A 2XNDA 1I7PA 4Z4WA 2RC6A 1UD8A 4RCYA 1KD1D 1N8RD 2VNHA 4KKTA 1S0UA 1XE1A 4Z4TA 2PLFA 2V7TA 3ASTA 1WOOA 2DETA 3W5UA 1T6XA 4G7XA 3CC2B 5IYPA 1VQ5B 1G7CA 4L8JA 3AGPA 5JBQA 1EP2B 1FDRA 4NCNA 4PC6A 2X6XA 2ZTNA 3OP1A 4WZTA 2YWGA 1DDGA 4CQJA 3CB4A 4KKUA 3CW2A 1RQPA 4ZCLA 3ASRA 1FNMA 5J3OA 4P12A 2XEXA 4UZUA 2GK7A 1KK3A 3H9NA 1OHHA 4XLEA 3I55B 4QFMA 4B3GA 1JNYA 4ZV4A 4XM3A 1T5EA 1FRQA 2V7QA 4PAAA 4YXWA 4ACAA 1SKYB 5H5JA 4X0CA 2V4DA 1QG0A 3W2FA 5FIUA 3CCVB 1YITB 1E43A 3WNDA 3P27A 1PJ6A 4B3XA 4UZEA 5J35A 3WYAA 3AVUA 2C5BA 5TV2A 1N08A 2WZNA 4X7DA 3OOCA 4QVJA 1QGYA 5F4MA 1CQXA 2WPDA 1JA0A 1EFRA 3GIRA 2GPJA 4WZKA 1E1QA 5FL7A 3DDYA 1IJEA 2ZL5A 4XKVA 1G7TA 1V0EA 4FXUA 3W2EA 2GQFA 2OBRA 3A3GA 1QVGB 3JQRA 2Q6LA 3V7AA 4N3GA
chains in the Genus database with same CATH topology
3OE7A 1BPLA 1FX0A 1NRKA 1K28D 2ZXIA 4TSFA 2V31A 2KVOA 2X6YA 3VR6A 4JMQA 3KEWA 3BC9A 4DK0A 3G05A 4XMYA 4XOTA 2JJ1A 1E1RA 2R9VA 3OFNA 3T51B 4XONA 4XORA 2XZLA 1H8HA 2Z6BD 4XKWA 3GVKA 4DNTB 3T53B 2HLDA 4DNRB 3A3BA 3CESA 3GQBA 5HKKA 3OW7A 1H8EA 4TT3A 1BMFA 4YEJA 2ZZFA 2WJVA 1PKVA 1VJSA 4II3A 1UD2A 1UD4A 4XN3A 3HAGA 1VF7A 4TKOB 3LNNA 4E0FA 2JJ2A 4XN0A 2GK6A 1HVXA 3OEHA 3BCFA 1W0JA 3JU4A 3ZIAA 4DK1A 3CMMA 2CK3A 4XL9A 2ZZGA 4ASUA 2W6JA 2ZZQA 2M5SA 2WZPP 3FKSA 2ZXHA 3OAAA 1UD6A 4II2A 4XR6A 1I18A 2GJKA 1WP6A 2GJPA 3NE5B 2X53S 2W6IA 4KKSA 2XGJA 4NNJA 2LZJA 2ZZEA 4XLHA 5KNLA 4AVZA 4XD7A 1NBMA 2XNDA 4XLAA 1WTHD 2VJIA 1UD8A 1W9XA 5CDFA 4KKTA 1HZEA 4HIZA 4Z1MA 1E3ZA 4XOPA 3WQZA 3A35A 4P22A 1BLIA 4G7XA 4XNFA 3ZPNA 2XOKA 4L8JA 2E1BA 3BH4A 2JIZA 2DIEA 4B3FX 2WSSA 2X6XA 2ZTNA 3CP2A 1E79A 1V0FA 3GVJA 2QE7A 4GQNA 4KKUA 2XZPA 4XLCA 5DN6A 1WPCA 3OPOA 1KZLA 2VJJA 4UZUA 2GK7A 2ZTGA 3GVLA 1OHHA 4XLEA 3FPPA 4B3GA 4XM3A 1T5EA 4XQFA 2V7QA 2X85A 2D3LA 2F1MA 1SKYB 4YXWA 2V4DA 4G7WA 1E43A 1I8DA 1UD5A 4XLFA 2D3NA 5IK2A 4G6IA 3T56B 1VLYA 2GJRA 1W0KA 3BCDA 3OOCA 4YELA 1UD3A 3CP8A 2JDIA 2WPDA 1OB0A 1E3XA 1COWA 1EFRA 2F43A 3OEEA 3H94A 1E1QA 2X6WA 3DDYA 5FL7A 2XZOA 4XKVA 1KMHA 1MABA 1V0EA 4FXUA 3A3GA 2WJYA 2X8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVO A;  3ZPN A; 
#chains in the Genus database with same CATH topology
 1F60 A;  4P3I A;  1FRN A;  4X05 A;  1NRK A;  3CCS B;  2X6Y A;  4M0L A;  3CCR B;  4HE5 A;  3KEW A;  1VQ7 B;  3AVY A;  3BQJ A;  4PC1 A;  5EMN A;  1VQP B;  3PUM A;  3Q39 A;  1CNE A;  1E1R A;  3OFN A;  2Q6I A;  1Q81 D;  4RJL A;  4RD0 A;  1VQN B;  2XZL A;  2Z6B D;  5IYQ A;  4G5G A;  3AVT A;  1JA1 A;  3ZZ0 A;  3T53 B;  1EWY A;  1IHM A;  3GQB A;  3QE2 A;  2FX3 A;  5KW9 A;  4J0Q A;  3CMA B;  1KC8 D;  3OW7 A;  1YI2 B;  2ZZF A;  2WJV A;  1PKV A;  1RQR A;  2V7W A;  4RPD A;  4XN3 A;  3HAG A;  4TKO B;  4RDJ A;  1YJW B;  2QTZ A;  3CCM B;  1ZM4 A;  4XN0 A;  2EFG A;  3SLD A;  3CCQ B;  2BGJ A;  4P1V A;  1OB5 A;  1ZM9 A;  3OJW A;  1R5B A;  3OEH A;  1W0J A;  3PVD A;  3ZIA A;  4RD6 A;  5FA6 A;  2C4U A;  2ZZG A;  1NB0 A;  1ZM2 A;  3I1F A;  4X06 A;  4P3Y A;  4ASU A;  1Q7Y D;  2X0K A;  3CCE B;  3SJZ A;  3Q3A A;  2ZXH A;  1GO2 A;  5TY0 A;  4ACB A;  4PAB A;  3WNB A;  1NB9 A;  2QEX B;  4RD2 A;  4YAF A;  2DYI A;  3SJP A;  2QGG A;  2B7B A;  3WY9 A;  1S72 B;  2VBU A;  4HE6 A;  2WYR A;  5TR9 A;  1GR1 A;  2JN9 A;  1DDI A;  4TMX A;  1EXM A;  4XLA A;  1VQ9 B;  4ZGQ B;  4PC7 A;  5GV7 A;  1OGI A;  4U9U A;  4C0S A;  1TUI A;  4P9S A;  1TLL A;  5A89 A;  4H9G A;  1BQE A;  1EP1 B;  4FK8 A;  5IYW A;  3WQZ A;  3B82 A;  3A35 A;  1ZM3 A;  1BLI A;  4P22 A;  4XNF A;  3OW2 B;  1IJF A;  5GV8 A;  3ES9 A;  3W5V A;  2E1B A;  4DQL A;  2VNK A;  2DIE A;  1M90 D;  3A8I A;  3CP2 A;  4LBV A;  2F1L A;  4RD3 A;  4GQN A;  2XZP A;  2EIX A;  1WPC A;  1WDT A;  1R5N A;  3MMP A;  3W5H A;  3WXM A;  3Q38 A;  2VZL A;  1KK0 A;  2ZL6 A;  3BY2 A;  4XQF A;  4YAU A;  4B47 A;  1PJ7 A;  4X7C A;  1U2R A;  3D26 A;  4OOX A;  4Z4U A;  3JQP A;  4P25 A;  2PIA A;  1I8D A;  1UD5 A;  2D3N A;  4R71 A;  4G6I A;  2AHO A;  2D74 A;  2GJR A;  2BM1 A;  5F4O A;  4YAO A;  4WWV A;  3ZZT A;  4UZF A;  5TRD A;  4RCZ A;  1KMH A;  1WU8 A;  2V7X A;  2F4N A;  3LO8 A;  3ASS A;  2CBX A;  2OTL B;  1WOR A;  2VBV A;  1GVH A;  4PC3 A;  4FN5 A;  1BPL A;  1TVC A;  1Y0R A;  4M53 A;  4TSF A;  2BMW A;  1Q9S A;  3Q6Q A;  5L46 A;  1QVF B;  3CD6 B;  2RC5 A;  4XMY A;  3LQ6 A;  2R9V A;  4TMV A;  1E62 A;  4XOR A;  1AIP A;  5A8A A;  1N0V C;  1QUF A;  3SEJ A;  4DNR B;  3A3B A;  3CES A;  2ZIT A;  5HKK A;  1Q82 D;  1H8E A;  1MRZ A;  1N07 A;  1YX2 A;  5BSY A;  4YEJ A;  1QUE A;  3QFR A;  5H59 A;  3CXC B;  3VNU A;  3AGQ A;  1VQO B;  2C2W A;  2C78 A;  2DEU A;  2CC2 A;  4TN1 A;  1HVX A;  4RM0 A;  1D2E A;  3P26 A;  2V7V A;  3CMM A;  1FND A;  4XL9 A;  2BSA A;  1G7S A;  1XFO A;  2ZBU A;  4Q7J B;  1QH0 A;  3PA1 A;  2M5S A;  3W2H A;  1KJZ A;  1W87 A;  4IW3 B;  4B48 A;  4OPV A;  4XR6 A;  1BX1 A;  2GJK A;  1EFC A;  3B78 A;  1HA3 A;  4NNJ A;  1WSR A;  5IYR A;  1NJI D;  5KNL A;  1NDH A;  5DSZ A;  3B8H A;  2VNJ A;  2BPO A;  3AVV A;  2NV4 A;  1T6Z A;  2DCU A;  1G7R A;  1ELO A;  3CC7 B;  3PA2 A;  1WTH D;  1YLO A;  5E6T A;  1JJ2 B;  1YJ9 B;  1W9X A;  1N0U A;  1HZE A;  1WSV A;  2R6H A;  4HIZ A;  4P2N A;  1DAR A;  4YHB A;  1E64 A;  2XOK A;  1GAQ A;  4OPS A;  5A88 A;  2WSS A;  3ZBT A;  3CTA A;  4RDK A;  1E79 A;  3FPK A;  2QE7 A;  3MHP A;  2NPF A;  4XLC A;  5DN6 A;  3OPO A;  3V76 A;  1KZL A;  5F4J A;  2VJJ A;  4Y7C A;  2OBT A;  1SM4 A;  3GVL A;  1TTT A;  2CRV A;  4FWT A;  3FPP A;  2YWE A;  3GSI A;  2X85 A;  4Z4R A;  2I1L A;  3ZBU A;  2PMD A;  4G7W A;  4ZGN B;  1YHQ B;  1KQS B;  4XLF A;  5IK2 A;  3WBJ A;  1K73 D;  2WR8 A;  3R6J A;  3T56 B;  4WZL A;  1VLY A;  4AF7 A;  1D8T A;  1WOS A;  2BGI A;  1QFJ A;  2OBS A;  3U6B A;  4N3N A;  1VLO A;  3CP8 A;  3ISX A;  2OK8 A;  4LBZ A;  1VQL B;  1E3X A;  4X07 A;  1COW A;  2F43 A;  3OEE A;  4UAJ A;  3H94 A;  2D9R A;  2C4T A;  1H42 A;  1H85 A;  1MAB A;  2VNI A;  1VHE A;  1QX4 A;  3CCL B;  4AC9 A;  3CRZ A;  4RLZ A;  1D1N A;  1K28 D;  1XB2 A;  5IYN A;  1V5V A;  4OPO A;  3VR6 A;  4Y9R A;  4ZCM A;  3G4S B;  1BX0 A;  1QFY A;  4QVA A;  2YWF A;  2QN6 A;  3T51 B;  4RDL A;  3AVW A;  4BPR A;  2VBT A;  4DQK A;  1CNF A;  3GVK A;  4XKW A;  5HXB A;  4M4S A;  4DNT B;  3PUN A;  1Y0Y A;  4AF6 A;  2GRE A;  4B43 A;  1PJ5 A;  1VHO A;  4TT3 A;  1BMF A;  3CCU B;  1VJS A;  4II3 A;  1UD2 A;  1UD4 A;  2HCJ B;  4OOS A;  4QV2 A;  1KK1 A;  3LVB A;  3ONU A;  3ONY A;  3RY8 A;  2GK6 A;  3LQE A;  5KSW B;  2FVG A;  3BCF A;  4RPB A;  1SKQ A;  3JQQ A;  2CK3 A;  1EFU A;  4P6Y A;  4EH1 A;  3I56 B;  1EP3 B;  1VQ8 B;  4OOV A;  3BY1 A;  3U2Q A;  4Z4Y A;  4LC0 A;  3SKB A;  3FKS A;  4X7E A;  2HDN B;  3QFC A;  5LMZ A;  1I18 A;  4B4D A;  3KL9 A;  1WP6 A;  3R6K A;  3NE5 B;  2PE3 A;  3OZU A;  2W6I A;  4KKS A;  5FO0 A;  4LBW A;  3CCJ B;  2LZJ A;  1JB9 A;  3ASP A;  4AVZ A;  2QA4 B;  1P4M A;  4OP7 A;  3A8K A;  4P6V F;  3OZV A;  3W2I A;  4G1B A;  2VJI A;  4YAW A;  4B44 A;  4F7D A;  2X3U A;  4YAL A;  5CDF A;  3G6E B;  3BNW A;  2OTJ B;  4TMW A;  4Z1M A;  1K9M D;  3WNC A;  1E3Z A;  4XOP A;  1VQM B;  4Z4Z A;  4TMT A;  3MCA A;  3ZPN A;  3BH4 A;  2JIZ A;  3Q6R A;  4B3F X;  1OB2 A;  4TMZ A;  1EFT A;  1V0F A;  4MYU A;  1W35 A;  3GVJ A;  2BN4 A;  4X7F A;  1GJR A;  1KTV A;  1WOP A;  4P26 A;  4PGO A;  2ZTG A;  1R5O A;  1KK2 A;  3VNV A;  1N06 A;  3ZUG A;  5B6I A;  2BV3 A;  2D3L A;  2E1R A;  2F1M A;  4LBY A;  4Z4S A;  1QGA A;  2DOG A;  1BJK A;  3PEN A;  2P3M A;  1YJN B;  3QFS A;  4PC2 A;  4ROX A;  4Y9U A;  1F20 A;  1VQK B;  1W0K A;  3BCD A;  2CND A;  4YEL A;  2XNJ A;  4Z4V A;  1UD3 A;  2HMA A;  3J81 k;  2JDI A;  2DER A;  1OB0 A;  3E20 A;  1J9Z A;  2OYN A;  3WBK A;  3E1Y E;  2J7K A;  1YIJ B;  2B7C A;  2X6W A;  2XZO A;  3VO2 A;  3OJX A;  2ZBV A;  3OKX A;  3FJO A;  5HZB A;  2BM0 A;  2YWH A;  1Q86 D;  2WJY A;  2X8K A;  3ZZU A;  4WQM A;  4QUZ A;  1E63 A;  5HZA A;  3OE7 A;  4QHY A;  1FX0 A;  2CW5 A;  3OZW A;  5DS0 A;  3QSY A;  2ZXI A;  2V31 A;  2KVO A;  1W2B B;  3CPX A;  3CPW B;  4JMQ A;  3U6K A;  4RD4 A;  3BC9 A;  2QDX A;  2BF4 A;  4DK0 A;  3G05 A;  4WZE A;  1B23 P;  2B5O A;  4XOT A;  3VO1 A;  1IB0 A;  2JJ1 A;  4NBS A;  4XON A;  1VQ6 B;  1N05 A;  1M1K D;  1QGZ A;  1VQ4 B;  1H8H A;  1S4M A;  2OK7 A;  2HLD A;  1AMO A;  4X8I A;  1K8A D;  2C77 A;  4C43 A;  1B2R A;  2VBS A;  1VF7 A;  2BVN A;  3LNN A;  4E0F A;  2JJ2 A;  3CME B;  3CC4 B;  4ZCI A;  1T6Y A;  3SLN A;  2Q6O A;  1GAW A;  1QFZ A;  1DG1 G;  2DY1 A;  3JU4 A;  5AN9 A;  4DK1 A;  4M1K A;  2CF4 A;  5BSX A;  2ZL7 A;  1OGJ A;  3QFT A;  2VYQ A;  2W6J A;  3AVX A;  2ZZQ A;  2C5H A;  1XQB A;  4G1V A;  2WZP P;  4K1X A;  1UMK A;  1ZUN B;  3OAA A;  1UD6 A;  3VMF A;  4II2 A;  3A8J A;  1A8P A;  2GJP A;  3ZC3 A;  1W34 A;  2X53 S;  3ASQ A;  4RD1 A;  2Q6K A;  5THX A;  2QMU A;  2XNC A;  4M2L A;  2XGJ A;  2ZZE A;  4XLH A;  3G71 B;  1KRH A;  1FNC A;  1FNB A;  4MYT A;  3W2G A;  2QTL A;  4XD7 A;  1NBM A;  3A1P A;  2V7U A;  5FNZ A;  5FO1 A;  2XND A;  1I7P A;  4Z4W A;  2RC6 A;  1UD8 A;  4RCY A;  1KD1 D;  1N8R D;  2VNH A;  4KKT A;  1S0U A;  1XE1 A;  4Z4T A;  2PLF A;  2V7T A;  3AST A;  1WOO A;  2DET A;  3W5U A;  1T6X A;  4G7X A;  3CC2 B;  5IYP A;  1VQ5 B;  1G7C A;  4L8J A;  3AGP A;  5JBQ A;  1EP2 B;  1FDR A;  4NCN A;  4PC6 A;  2X6X A;  2ZTN A;  3OP1 A;  4WZT A;  2YWG A;  1DDG A;  4CQJ A;  3CB4 A;  4KKU A;  3CW2 A;  1RQP A;  4ZCL A;  3ASR A;  1FNM A;  5J3O A;  4P12 A;  2XEX A;  4UZU A;  2GK7 A;  1KK3 A;  3H9N A;  1OHH A;  4XLE A;  3I55 B;  4QFM A;  4B3G A;  1JNY A;  4ZV4 A;  4XM3 A;  1T5E A;  1FRQ A;  2V7Q A;  4PAA A;  4YXW A;  4ACA A;  1SKY B;  5H5J A;  4X0C A;  2V4D A;  1QG0 A;  3W2F A;  5FIU A;  3CCV B;  1YIT B;  1E43 A;  3WND A;  3P27 A;  1PJ6 A;  4B3X A;  4UZE A;  5J35 A;  3WYA A;  3AVU A;  2C5B A;  5TV2 A;  1N08 A;  2WZN A;  4X7D A;  3OOC A;  4QVJ A;  1QGY A;  5F4M A;  1CQX A;  2WPD A;  1JA0 A;  1EFR A;  3GIR A;  2GPJ A;  4WZK A;  1E1Q A;  5FL7 A;  3DDY A;  1IJE A;  2ZL5 A;  4XKV A;  1G7T A;  1V0E A;  4FXU A;  3W2E A;  2GQF A;  2OBR A;  3A3G A;  1QVG B;  3JQR A;  2Q6L A;  3V7A A;  4N3G A; 
#chains in the Genus database with same CATH homology
 3OE7 A;  1BPL A;  1FX0 A;  1NRK A;  1K28 D;  2ZXI A;  4TSF A;  2V31 A;  2KVO A;  2X6Y A;  3VR6 A;  4JMQ A;  3KEW A;  3BC9 A;  4DK0 A;  3G05 A;  4XMY A;  4XOT A;  2JJ1 A;  1E1R A;  2R9V A;  3OFN A;  3T51 B;  4XON A;  4XOR A;  2XZL A;  1H8H A;  2Z6B D;  4XKW A;  3GVK A;  4DNT B;  3T53 B;  2HLD A;  4DNR B;  3A3B A;  3CES A;  3GQB A;  5HKK A;  3OW7 A;  1H8E A;  4TT3 A;  1BMF A;  4YEJ A;  2ZZF A;  2WJV A;  1PKV A;  1VJS A;  4II3 A;  1UD2 A;  1UD4 A;  4XN3 A;  3HAG A;  1VF7 A;  4TKO B;  3LNN A;  4E0F A;  2JJ2 A;  4XN0 A;  2GK6 A;  1HVX A;  3OEH A;  3BCF A;  1W0J A;  3JU4 A;  3ZIA A;  4DK1 A;  3CMM A;  2CK3 A;  4XL9 A;  2ZZG A;  4ASU A;  2W6J A;  2ZZQ A;  2M5S A;  2WZP P;  3FKS A;  2ZXH A;  3OAA A;  1UD6 A;  4II2 A;  4XR6 A;  1I18 A;  2GJK A;  1WP6 A;  2GJP A;  3NE5 B;  2X53 S;  2W6I A;  4KKS A;  2XGJ A;  4NNJ A;  2LZJ A;  2ZZE A;  4XLH A;  5KNL A;  4AVZ A;  4XD7 A;  1NBM A;  2XND A;  4XLA A;  1WTH D;  2VJI A;  1UD8 A;  1W9X A;  5CDF A;  4KKT A;  1HZE A;  4HIZ A;  4Z1M A;  1E3Z A;  4XOP A;  3WQZ A;  3A35 A;  4P22 A;  1BLI A;  4G7X A;  4XNF A;  3ZPN A;  2XOK A;  4L8J A;  2E1B A;  3BH4 A;  2JIZ A;  2DIE A;  4B3F X;  2WSS A;  2X6X A;  2ZTN A;  3CP2 A;  1E79 A;  1V0F A;  3GVJ A;  2QE7 A;  4GQN A;  4KKU A;  2XZP A;  4XLC A;  5DN6 A;  1WPC A;  3OPO A;  1KZL A;  2VJJ A;  4UZU A;  2GK7 A;  2ZTG A;  3GVL A;  1OHH A;  4XLE A;  3FPP A;  4B3G A;  4XM3 A;  1T5E A;  4XQF A;  2V7Q A;  2X85 A;  2D3L A;  2F1M A;  1SKY B;  4YXW A;  2V4D A;  4G7W A;  1E43 A;  1I8D A;  1UD5 A;  4XLF A;  2D3N A;  5IK2 A;  4G6I A;  3T56 B;  1VLY A;  2GJR A;  1W0K A;  3BCD A;  3OOC A;  4YEL A;  1UD3 A;  3CP8 A;  2JDI A;  2WPD A;  1OB0 A;  1E3X A;  1COW A;  1EFR A;  2F43 A;  3OEE A;  3H94 A;  1E1Q A;  2X6W A;  3DDY A;  5FL7 A;  2XZO A;  4XKV A;  1KMH A;  1MAB A;  1V0E A;  4FXU A;  3A3G A;  2WJY A;  2X8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...