2KVOA

Solution nmr structure of photosystem ii reaction center psb28 protein from synechocystis sp.(strain pcc 6803), northeast structural genomics consortium target sgr171
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
120
structure length
120
Chain Sequence
b'MAEIQFSKGVAETVVPEVRLSKSKNGQSGMAKFYFLEPTILAKESTDDITGMYLIDDEGEIITREVKGKFINGRPTAIEATVILNSQPEWDRFMRFMERYGAENGLGFSKSELEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II reaction center psb28 protein
publication title Solution NMR structure of photosystem II reaction center protein Psb28 from Synechocystis sp. Strain PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Photosynthesis
total genus 16
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03912 Psb28 Psb28 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.220 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2kvoA01
2KVOA 3ZPNA
chains in the Genus database with same CATH superfamily
2CBXA 4YALA 4G7XA 3OAAA 3W2IA 3CPWB 1KZLA 4FXUA 3G4SB 3HAGA 4YELA 1K73D 1VLOA 2NPFA 5F4JA 1JB9A 2HMAA 1Q81D 1I18A 1OGJA 4ROXA 1EP3B 4Q7JB 5TR9A 4YAWA 1VQLB 1QGYA 1KMHA 3SKBA 1OB5A 1J9ZA 3H9NA 4XL9A 2B7CA 3ZPNA 1VQ6B 2X6YA 1IJEA 3A35A 5H59A 1M90D 1D8TA 1VQ8B 3AVYA 1WSRA 4RD1A 1YIJB 1WORA 2RC6A 3ISXA 4ZCMA 1EFRA 2PLFA 1COWA 1QFYA 1VHEA 2BMWA 2R9VA 2BGJA 4M0LA 4ACBA 3QFCA 4ASUA 4XORA 3AVVA 4AC9A 4DK0A 2WR8A 5DN6A 4Z4WA 1I7PA 1UD5A 3DDYA 5IYPA 1QGZA 1N0UA 1QVFB 3W5HA 4PGOA 1BQEA 1Q82D 4PC6A 5BSXA 5EMNA 3CRZA 4X05A 1NJID 1EP1B 1EFTA 4QUZA 2PIAA 2ZXHA 3PA2A 2YWEA 3MCAA 1MABA 2R6HA 3OEEA 3V7AA 1EP2B 1U2RA 2GK7A 4G7WA 4P26A 1E3ZA 1VJSA 3JQRA 4FN5A 1Q9SA 2VNKA 2VBUA 5BSYA 1PJ7A 3CCRB 2VJJA 2DETA 1PKVA 1DG1G 3OJWA 1T5EA 2QTLA 5KNLA 1G7CA 1QUFA 2BM1A 2YWFA 3CXCB 4P3YA 2HCJB 3PUMA 4OOVA 5DSZA 1E64A 3OJXA 3CMEB 1ZM9A 1K28D 2DY1A 3A8IA 1VQMB 5A8AA 1GAWA 2ZBVA 2C5BA 1FX0A 4C43A 1VQPB 1S4MA 4AF6A 3VNUA 1JNYA 1S0UA 1KD1D 4IW3B 3B82A 4QVAA 2C77A 1SKQA 4KKSA 3Q3AA 3T51B 1EFCA 4Z4TA 4ZGNB 3CTAA 3AVWA 2F43A 3BNWA 1XE1A 4YAOA 1NB9A 1UMKA 4P1VA 4XMYA 1AMOA 2GQFA 3ZBUA 4Z4RA 1WOSA 1H85A 4RD2A 4RJLA 2OBSA 5KW9A 2FX3A 4P3IA 1BLIA 5GV7A 4II3A 4TMVA 1W0JA 4PC7A 2D3NA 2VBSA 1W35A 3P26A 4UZFA 3CMMA 2VNHA 2VBVA 3OKXA 2CC2A 3SJPA 5IYWA 3ZC3A 3ZBTA 4M53A 1RQRA 1WU8A 4NBSA 4MYUA 3E20A 1GR1A 5A88A 3WY9A 1D1NA 4G1BA 2C4UA 1N08A 4XNFA 4TT3A 2ZL7A 3OZVA 1QVGB 3A3BA 1W9XA 1E1QA 2XNCA 2XZLA 2OBTA 5TRDA 2BV3A 1V5VA 2GREA 1G7SA 2RC5A 3WQZA 3PVDA 5IYNA 3ONUA 1E43A 2F4NA 3AGQA 3ES9A 1TTTA 4P9SA 4C0SA 4RCZA 4L8JA 1EXMA 4Z4SA 1K9MD 1H8HA 4LBWA 4ZV4A 2WSSA 2JJ2A 3OZUA 4XLEA 4DNRB 1B23P 4XN3A 1ZUNB 4RM0A 1N05A 3RY8A 4CQJA 4ZCLA 3CP2A 1YHQB 4XOTA 1S72B 1WDTA 2JIZA 3BQJA 3JU4A 4YHBA 1T6ZA 3A8JA 3QFSA 4H9GA 1UD6A 2CNDA 3U2QA 4X7FA 2OK7A 1UD3A 4DQKA 4E0FA 1V0FA 3CCQB 1V0EA 4JMQA 3Q6QA 4Z4ZA 2CF4A 1GAQA 5J35A 1H42A 1YI2B 2V7TA 2GJRA 4B3FX 1E63A 2GK6A 4NNJA 2HDNB 2C2WA 1QX4A 4TMTA 4XLFA 4B43A 1OB2A 5CDFA 1YJ9B 2V4DA 4QFMA 2BSAA 2ZTGA 5FO1A 4HE6A 1G7RA 2YWHA 1WOPA 4P6VF 1E62A 3ASRA 4QVJA 4XKWA 4YAUA 3QSYA 1JA0A 1UD8A 2X0KA 3A8KA 4OP7A 3BCFA 3CC2B 4LC0A 2OBRA 3ASQA 5A89A 2QE7A 2V7XA 3WNCA 3AGPA 4QHYA 2OYNA 1YJWB 4WZKA 1FNCA 2W6IA 1W2BB 4OPVA 2V7VA 4XONA 2AHOA 3ZZ0A 3CCUB 2B5OA 1N0VC 4RD3A 1QH0A 2D3LA 2ZZGA 3G6EB 3MHPA 2DEUA 3ZZUA 3CCMB 4X7DA 3ASSA 3SLDA 2ZL5A 2QMUA 1QFZA 5AN9A 2JN9A 1NB0A 3B78A 2HLDA 1VQ4B 2OTLB 3LNNA 4HE5A 4WZEA 2VYQA 1PJ5A 5IK2A 4XOPA 2VZLA 4II2A 4WZTA 4TKOB 4X0CA 1BX0A 3FPKA 1Y0YA 2DERA 5J3OA 1RQPA 5HKKA 2V7WA 2ZBUA 4N3NA 2V7QA 1KQSB 2ZXIA 3PA1A 1NDHA 1HA3A 2EFGA 2CW5A 1OB0A 4KKUA 1SKYB 3W5VA 3A1PA 3OE7A 4Z1MA 1FNBA 4OOXA 4YEJA 3SJZA 4ACAA 4RPDA 4Y7CA 3B8HA 1KK1A 4DQLA 3BH4A 4PABA 4AF7A 3ASPA 3CCLB 3VO2A 2XEXA 2OK8A 2VNIA 3T56B 3CCJB 1KK0A 5L46A 5F4MA 3I56B 2PMDA 1IB0A 2X8KA 3MMPA 2WJYA 3Q39A 4RDLA 5DS0A 5HZBA 3I55B 3VO1A 1KJZA 3KEWA 3WXMA 1FNDA 4PC1A 3CESA 2ZITA 5B6IA 3W2HA 3E1YE 3CCVB 3VMFA 3GSIA 3FJOA 1WP6A 4FWTA 3ASTA 3A3GA 1IHMA 1ZM3A 5TY0A 1FRNA 4G1VA 3FPPA 2BN4A 1ZM4A 2P3MA 3JQPA 2GJKA 1QUEA 3FKSA 4RDKA 3GVJA 4G5GA 4B4DA 4XLCA 2LZJA 3SLNA 1E79A 4RPBA 4M4SA 5LMZA 4Z4UA 3BC9A 2V31A 4K1XA 4XLAA 3WBKA 4TSFA 1JA1A 1HVXA 4OPOA 2OTJB 3D26A 2CK3A 3LVBA 5IYQA 1VF7A 1N07A 1VQOB 2DYIA 4RD6A 4XR6A 1FNMA 4RD0A 4RD4A 3LQEA 2V7UA 1TUIA 1WOOA 1Q86D 1WPCA 1GJRA 1QFJA 2VBTA 3G05A 1VQ5B 4OPSA 4ZGQB 4DNTB 3CCSB 2C78A 1K8AD 1QG0A 4M2LA 1F20A 1EFUA 2XOKA 1A8PA 4R71A 1FRQA 3G71B 5FO0A 2XZOA 3OFNA 3KL9A 3Q6RA 4TMZA 2X53S 3VR6A 1OGIA 1JJ2B 4QV2A 1E1RA 4AVZA 1ELOA 2CRVA 4NCNA 3Q38A 4X7CA 1KK2A 2QTZA 2GPJA 4MYTA 4WQMA 1UD4A 4RDJA 4GQNA 1DARA 2D74A 4YAFA 3CC4B 3OP1A 1VLYA 2VJIA 2VNJA 2JDIA 2BF4A 2WZNA 3P27A 1VQ9B 3CP8A 4B48A 1YX2A 4ZCIA 3SEJA 3CC7B 1DDIA 5H5JA 2E1RA 4X7EA 1N06A 1SM4A 1D2EA 1XQBA 1M1KD 1TLLA 3OPOA 4P6YA 3WNBA 1QGAA 2DIEA 2J7KA 3CB4A 2QGGA 2F1MA 1G7TA 1GO2A 2XNJA 2BM0A 2BGIA 1R5OA 3PUNA 4HIZA 5IYRA 2X85A 2X3UA 1H8EA 5FA6A 3WNDA 1BPLA 5FNZA 4U9UA 3T53B 1CNEA 2B7BA 3BY2A 3GIRA 3OOCA 4FK8A 4OOSA 1BJKA 3CW2A 2C5HA 3LO8A 3U6KA 3CD6B 2M5SA 3I1FA 4B3GA 3W5UA 1VQ7B 1R5NA 4J0QA 2QEXB 4EH1A 1YLOA 1ZM2A 2Q6KA 2EIXA 2YWGA 2Z6BD 1GVHA 2W6JA 1P4MA 1WSVA 5HXBA 4UAJA 3LQ6A 3NE5B 4DK1A 3CMAB 1T6YA 4X8IA 4LBZA 5THXA 1B2RA 1DDGA 1PJ6A 3J81k 1BMFA 4N3GA 5HZAA 3GVLA 2I1LA 5JBQA 1AIPA 2XNDA 1W0KA 1Y0RA 2FVGA 2ZZEA 2XZPA 1KC8D 3OW7A 5KSWB 2ZL6A 3VNVA 4X07A 1IJFA 1R5BA 1VHOA 4TMWA 2GJPA 3JQQA 4WZLA 1FDRA 4M1KA 3GVKA 4B3XA 4YXWA 1W87A 4LBYA 1XFOA 1MRZA 4P25A 1KK3A 2JJ1A 3H94A 2PE3A 4Y9RA 4PAAA 1NBMA 1W34A 3BCDA 3ZUGA 3AVXA 3V76A 4UZUA 2QA4B 3W2FA 2WYRA 3CPXA 4PC3A 5F4OA 2C4TA 3CCEB 2F1LA 3W2GA 1KRHA 3GQBA 4Y9UA 4F7DA 2ZTNA 5E6TA 3AVTA 2WJVA 1VQNB 1Q7YD 4P22A 4XD7A 1F60A 2WZPP 3QFRA 4Z4VA 3OZWA 4XKVA 3ONYA 2DCUA 3WBJA 4TN1A 2KVOA 3OEHA 4PC2A 4LBVA 4RLZA 1UD2A 3U6BA 3ZIAA 2BVNA 1TVCA 1HZEA 3QFTA 3WYAA 4XLHA 2QN6A 1KTVA 2QDXA 2NV4A 4B44A 4P12A 3R6JA 3BY1A 1CQXA 2DOGA 3QE2A 3AVUA 2X6WA 2D9RA 1WTHD 5FIUA 1VQKB 1YJNB 1XB2A 5TV2A 2Q6OA 1N8RD 2WPDA 1CNFA 5FL7A 4XQFA 3R6KA 4TMXA 2ZZQA 1EWYA 2E1BA 4Z4YA 4XM3A 3OW2B 5GV8A 1E3XA 4P2NA 3ZZTA 1BX1A 4RCYA 4G6IA 3W2EA 4BPRA 4B47A 2Q6LA 1NRKA 2XGJA 1T6XA 2Q6IA 2ZZFA 2BPOA 4UZEA 1OHHA 3PENA 4WWVA 4KKTA 2X6XA 1YITB 4XN0A 1I8DA 4X06A
chains in the Genus database with same CATH topology
4G7XA 3OAAA 1BPLA 5HKKA 1KZLA 3T53B 1BLIA 2V7QA 2ZXIA 3OOCA 4FXUA 4II3A 3HAGA 1W0JA 4YELA 2D3NA 1OB0A 4KKUA 1SKYB 2M5SA 3CMMA 3OE7A 4Z1MA 1I18A 4B3GA 4YEJA 3BH4A 2Z6BD 2W6JA 1KMHA 3T56B 4XL9A 4XNFA 3NE5B 4TT3A 3ZPNA 2X6YA 2X8KA 3A3BA 2WJYA 3A35A 4DK1A 1W9XA 3KEWA 1E1QA 2XZLA 1BMFA 3CESA 3GVLA 2ZZEA 2XNDA 1W0KA 2XZPA 3WQZA 1WP6A 3OW7A 3A3GA 1EFRA 1E43A 1COWA 2R9VA 4ASUA 3FPPA 4L8JA 1H8HA 2GJPA 2GJKA 3FKSA 4XORA 3GVKA 3GVJA 2WSSA 2JJ2A 4XLCA 4XLEA 5DN6A 4YXWA 4DK0A 4DNRB 2LZJA 4XN3A 1E79A 3H94A 1UD5A 2JJ1A 3DDYA 1NBMA 3BCDA 3CP2A 4XOTA 3BC9A 2V31A 4XLAA 4UZUA 4TSFA 2JIZA 3JU4A 1HVXA 2CK3A 1VF7A 3GQBA 2ZXHA 1UD6A 2ZTNA 1MABA 2WJVA 3OEEA 4XR6A 1UD3A 4E0FA 4P22A 1V0FA 1V0EA 4XD7A 4JMQA 4G7WA 2GK7A 1WPCA 1E3ZA 1VJSA 2WZPP 3G05A 4XKVA 2GJRA 4DNTB 4B3FX 2KVOA 2GK6A 3OEHA 4NNJA 4XLFA 2XOKA 1UD2A 5CDFA 2VJJA 3ZIAA 1PKVA 2V4DA 1HZEA 5KNLA 1T5EA 2ZTGA 3OFNA 4TKOB 2XZOA 4XLHA 2X53S 3VR6A 1E1RA 4XKWA 4AVZA 1UD8A 1K28D 3BCFA 2X6WA 1UD4A 1FX0A 1WTHD 2QE7A 4GQNA 2W6IA 4XONA 2WPDA 5FL7A 4XQFA 2VJIA 1VLYA 2ZZQA 2D3LA 2JDIA 2ZZGA 3CP8A 2E1BA 4KKSA 4XM3A 1E3XA 3T51B 4G6IA 1NRKA 2XGJA 2HLDA 2F43A 2ZZFA 3OPOA 3LNNA 2DIEA 2F1MA 1OHHA 4XMYA 5IK2A 4XOPA 4KKTA 2X6XA 4HIZA 4II2A 4XN0A 2X85A 1I8DA 1H8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVO A;  3ZPN A; 
#chains in the Genus database with same CATH topology
 2CBX A;  4YAL A;  4G7X A;  3OAA A;  3W2I A;  3CPW B;  1KZL A;  4FXU A;  3G4S B;  3HAG A;  4YEL A;  1K73 D;  1VLO A;  2NPF A;  5F4J A;  1JB9 A;  2HMA A;  1Q81 D;  1I18 A;  1OGJ A;  4ROX A;  1EP3 B;  4Q7J B;  5TR9 A;  4YAW A;  1VQL B;  1QGY A;  1KMH A;  3SKB A;  1OB5 A;  1J9Z A;  3H9N A;  4XL9 A;  2B7C A;  3ZPN A;  1VQ6 B;  2X6Y A;  1IJE A;  3A35 A;  5H59 A;  1M90 D;  1D8T A;  1VQ8 B;  3AVY A;  1WSR A;  4RD1 A;  1YIJ B;  1WOR A;  2RC6 A;  3ISX A;  4ZCM A;  1EFR A;  2PLF A;  1COW A;  1QFY A;  1VHE A;  2BMW A;  2R9V A;  2BGJ A;  4M0L A;  4ACB A;  3QFC A;  4ASU A;  4XOR A;  3AVV A;  4AC9 A;  4DK0 A;  2WR8 A;  5DN6 A;  4Z4W A;  1I7P A;  1UD5 A;  3DDY A;  5IYP A;  1QGZ A;  1N0U A;  1QVF B;  3W5H A;  4PGO A;  1BQE A;  1Q82 D;  4PC6 A;  5BSX A;  5EMN A;  3CRZ A;  4X05 A;  1NJI D;  1EP1 B;  1EFT A;  4QUZ A;  2PIA A;  2ZXH A;  3PA2 A;  2YWE A;  3MCA A;  1MAB A;  2R6H A;  3OEE A;  3V7A A;  1EP2 B;  1U2R A;  2GK7 A;  4G7W A;  4P26 A;  1E3Z A;  1VJS A;  3JQR A;  4FN5 A;  1Q9S A;  2VNK A;  2VBU A;  5BSY A;  1PJ7 A;  3CCR B;  2VJJ A;  2DET A;  1PKV A;  1DG1 G;  3OJW A;  1T5E A;  2QTL A;  5KNL A;  1G7C A;  1QUF A;  2BM1 A;  2YWF A;  3CXC B;  4P3Y A;  2HCJ B;  3PUM A;  4OOV A;  5DSZ A;  1E64 A;  3OJX A;  3CME B;  1ZM9 A;  1K28 D;  2DY1 A;  3A8I A;  1VQM B;  5A8A A;  1GAW A;  2ZBV A;  2C5B A;  1FX0 A;  4C43 A;  1VQP B;  1S4M A;  4AF6 A;  3VNU A;  1JNY A;  1S0U A;  1KD1 D;  4IW3 B;  3B82 A;  4QVA A;  2C77 A;  1SKQ A;  4KKS A;  3Q3A A;  3T51 B;  1EFC A;  4Z4T A;  4ZGN B;  3CTA A;  3AVW A;  2F43 A;  3BNW A;  1XE1 A;  4YAO A;  1NB9 A;  1UMK A;  4P1V A;  4XMY A;  1AMO A;  2GQF A;  3ZBU A;  4Z4R A;  1WOS A;  1H85 A;  4RD2 A;  4RJL A;  2OBS A;  5KW9 A;  2FX3 A;  4P3I A;  1BLI A;  5GV7 A;  4II3 A;  4TMV A;  1W0J A;  4PC7 A;  2D3N A;  2VBS A;  1W35 A;  3P26 A;  4UZF A;  3CMM A;  2VNH A;  2VBV A;  3OKX A;  2CC2 A;  3SJP A;  5IYW A;  3ZC3 A;  3ZBT A;  4M53 A;  1RQR A;  1WU8 A;  4NBS A;  4MYU A;  3E20 A;  1GR1 A;  5A88 A;  3WY9 A;  1D1N A;  4G1B A;  2C4U A;  1N08 A;  4XNF A;  4TT3 A;  2ZL7 A;  3OZV A;  1QVG B;  3A3B A;  1W9X A;  1E1Q A;  2XNC A;  2XZL A;  2OBT A;  5TRD A;  2BV3 A;  1V5V A;  2GRE A;  1G7S A;  2RC5 A;  3WQZ A;  3PVD A;  5IYN A;  3ONU A;  1E43 A;  2F4N A;  3AGQ A;  3ES9 A;  1TTT A;  4P9S A;  4C0S A;  4RCZ A;  4L8J A;  1EXM A;  4Z4S A;  1K9M D;  1H8H A;  4LBW A;  4ZV4 A;  2WSS A;  2JJ2 A;  3OZU A;  4XLE A;  4DNR B;  1B23 P;  4XN3 A;  1ZUN B;  4RM0 A;  1N05 A;  3RY8 A;  4CQJ A;  4ZCL A;  3CP2 A;  1YHQ B;  4XOT A;  1S72 B;  1WDT A;  2JIZ A;  3BQJ A;  3JU4 A;  4YHB A;  1T6Z A;  3A8J A;  3QFS A;  4H9G A;  1UD6 A;  2CND A;  3U2Q A;  4X7F A;  2OK7 A;  1UD3 A;  4DQK A;  4E0F A;  1V0F A;  3CCQ B;  1V0E A;  4JMQ A;  3Q6Q A;  4Z4Z A;  2CF4 A;  1GAQ A;  5J35 A;  1H42 A;  1YI2 B;  2V7T A;  2GJR A;  4B3F X;  1E63 A;  2GK6 A;  4NNJ A;  2HDN B;  2C2W A;  1QX4 A;  4TMT A;  4XLF A;  4B43 A;  1OB2 A;  5CDF A;  1YJ9 B;  2V4D A;  4QFM A;  2BSA A;  2ZTG A;  5FO1 A;  4HE6 A;  1G7R A;  2YWH A;  1WOP A;  4P6V F;  1E62 A;  3ASR A;  4QVJ A;  4XKW A;  4YAU A;  3QSY A;  1JA0 A;  1UD8 A;  2X0K A;  3A8K A;  4OP7 A;  3BCF A;  3CC2 B;  4LC0 A;  2OBR A;  3ASQ A;  5A89 A;  2QE7 A;  2V7X A;  3WNC A;  3AGP A;  4QHY A;  2OYN A;  1YJW B;  4WZK A;  1FNC A;  2W6I A;  1W2B B;  4OPV A;  2V7V A;  4XON A;  2AHO A;  3ZZ0 A;  3CCU B;  2B5O A;  1N0V C;  4RD3 A;  1QH0 A;  2D3L A;  2ZZG A;  3G6E B;  3MHP A;  2DEU A;  3ZZU A;  3CCM B;  4X7D A;  3ASS A;  3SLD A;  2ZL5 A;  2QMU A;  1QFZ A;  5AN9 A;  2JN9 A;  1NB0 A;  3B78 A;  2HLD A;  1VQ4 B;  2OTL B;  3LNN A;  4HE5 A;  4WZE A;  2VYQ A;  1PJ5 A;  5IK2 A;  4XOP A;  2VZL A;  4II2 A;  4WZT A;  4TKO B;  4X0C A;  1BX0 A;  3FPK A;  1Y0Y A;  2DER A;  5J3O A;  1RQP A;  5HKK A;  2V7W A;  2ZBU A;  4N3N A;  2V7Q A;  1KQS B;  2ZXI A;  3PA1 A;  1NDH A;  1HA3 A;  2EFG A;  2CW5 A;  1OB0 A;  4KKU A;  1SKY B;  3W5V A;  3A1P A;  3OE7 A;  4Z1M A;  1FNB A;  4OOX A;  4YEJ A;  3SJZ A;  4ACA A;  4RPD A;  4Y7C A;  3B8H A;  1KK1 A;  4DQL A;  3BH4 A;  4PAB A;  4AF7 A;  3ASP A;  3CCL B;  3VO2 A;  2XEX A;  2OK8 A;  2VNI A;  3T56 B;  3CCJ B;  1KK0 A;  5L46 A;  5F4M A;  3I56 B;  2PMD A;  1IB0 A;  2X8K A;  3MMP A;  2WJY A;  3Q39 A;  4RDL A;  5DS0 A;  5HZB A;  3I55 B;  3VO1 A;  1KJZ A;  3KEW A;  3WXM A;  1FND A;  4PC1 A;  3CES A;  2ZIT A;  5B6I A;  3W2H A;  3E1Y E;  3CCV B;  3VMF A;  3GSI A;  3FJO A;  1WP6 A;  4FWT A;  3AST A;  3A3G A;  1IHM A;  1ZM3 A;  5TY0 A;  1FRN A;  4G1V A;  3FPP A;  2BN4 A;  1ZM4 A;  2P3M A;  3JQP A;  2GJK A;  1QUE A;  3FKS A;  4RDK A;  3GVJ A;  4G5G A;  4B4D A;  4XLC A;  2LZJ A;  3SLN A;  1E79 A;  4RPB A;  4M4S A;  5LMZ A;  4Z4U A;  3BC9 A;  2V31 A;  4K1X A;  4XLA A;  3WBK A;  4TSF A;  1JA1 A;  1HVX A;  4OPO A;  2OTJ B;  3D26 A;  2CK3 A;  3LVB A;  5IYQ A;  1VF7 A;  1N07 A;  1VQO B;  2DYI A;  4RD6 A;  4XR6 A;  1FNM A;  4RD0 A;  4RD4 A;  3LQE A;  2V7U A;  1TUI A;  1WOO A;  1Q86 D;  1WPC A;  1GJR A;  1QFJ A;  2VBT A;  3G05 A;  1VQ5 B;  4OPS A;  4ZGQ B;  4DNT B;  3CCS B;  2C78 A;  1K8A D;  1QG0 A;  4M2L A;  1F20 A;  1EFU A;  2XOK A;  1A8P A;  4R71 A;  1FRQ A;  3G71 B;  5FO0 A;  2XZO A;  3OFN A;  3KL9 A;  3Q6R A;  4TMZ A;  2X53 S;  3VR6 A;  1OGI A;  1JJ2 B;  4QV2 A;  1E1R A;  4AVZ A;  1ELO A;  2CRV A;  4NCN A;  3Q38 A;  4X7C A;  1KK2 A;  2QTZ A;  2GPJ A;  4MYT A;  4WQM A;  1UD4 A;  4RDJ A;  4GQN A;  1DAR A;  2D74 A;  4YAF A;  3CC4 B;  3OP1 A;  1VLY A;  2VJI A;  2VNJ A;  2JDI A;  2BF4 A;  2WZN A;  3P27 A;  1VQ9 B;  3CP8 A;  4B48 A;  1YX2 A;  4ZCI A;  3SEJ A;  3CC7 B;  1DDI A;  5H5J A;  2E1R A;  4X7E A;  1N06 A;  1SM4 A;  1D2E A;  1XQB A;  1M1K D;  1TLL A;  3OPO A;  4P6Y A;  3WNB A;  1QGA A;  2DIE A;  2J7K A;  3CB4 A;  2QGG A;  2F1M A;  1G7T A;  1GO2 A;  2XNJ A;  2BM0 A;  2BGI A;  1R5O A;  3PUN A;  4HIZ A;  5IYR A;  2X85 A;  2X3U A;  1H8E A;  5FA6 A;  3WND A;  1BPL A;  5FNZ A;  4U9U A;  3T53 B;  1CNE A;  2B7B A;  3BY2 A;  3GIR A;  3OOC A;  4FK8 A;  4OOS A;  1BJK A;  3CW2 A;  2C5H A;  3LO8 A;  3U6K A;  3CD6 B;  2M5S A;  3I1F A;  4B3G A;  3W5U A;  1VQ7 B;  1R5N A;  4J0Q A;  2QEX B;  4EH1 A;  1YLO A;  1ZM2 A;  2Q6K A;  2EIX A;  2YWG A;  2Z6B D;  1GVH A;  2W6J A;  1P4M A;  1WSV A;  5HXB A;  4UAJ A;  3LQ6 A;  3NE5 B;  4DK1 A;  3CMA B;  1T6Y A;  4X8I A;  4LBZ A;  5THX A;  1B2R A;  1DDG A;  1PJ6 A;  3J81 k;  1BMF A;  4N3G A;  5HZA A;  3GVL A;  2I1L A;  5JBQ A;  1AIP A;  2XND A;  1W0K A;  1Y0R A;  2FVG A;  2ZZE A;  2XZP A;  1KC8 D;  3OW7 A;  5KSW B;  2ZL6 A;  3VNV A;  4X07 A;  1IJF A;  1R5B A;  1VHO A;  4TMW A;  2GJP A;  3JQQ A;  4WZL A;  1FDR A;  4M1K A;  3GVK A;  4B3X A;  4YXW A;  1W87 A;  4LBY A;  1XFO A;  1MRZ A;  4P25 A;  1KK3 A;  2JJ1 A;  3H94 A;  2PE3 A;  4Y9R A;  4PAA A;  1NBM A;  1W34 A;  3BCD A;  3ZUG A;  3AVX A;  3V76 A;  4UZU A;  2QA4 B;  3W2F A;  2WYR A;  3CPX A;  4PC3 A;  5F4O A;  2C4T A;  3CCE B;  2F1L A;  3W2G A;  1KRH A;  3GQB A;  4Y9U A;  4F7D A;  2ZTN A;  5E6T A;  3AVT A;  2WJV A;  1VQN B;  1Q7Y D;  4P22 A;  4XD7 A;  1F60 A;  2WZP P;  3QFR A;  4Z4V A;  3OZW A;  4XKV A;  3ONY A;  2DCU A;  3WBJ A;  4TN1 A;  2KVO A;  3OEH A;  4PC2 A;  4LBV A;  4RLZ A;  1UD2 A;  3U6B A;  3ZIA A;  2BVN A;  1TVC A;  1HZE A;  3QFT A;  3WYA A;  4XLH A;  2QN6 A;  1KTV A;  2QDX A;  2NV4 A;  4B44 A;  4P12 A;  3R6J A;  3BY1 A;  1CQX A;  2DOG A;  3QE2 A;  3AVU A;  2X6W A;  2D9R A;  1WTH D;  5FIU A;  1VQK B;  1YJN B;  1XB2 A;  5TV2 A;  2Q6O A;  1N8R D;  2WPD A;  1CNF A;  5FL7 A;  4XQF A;  3R6K A;  4TMX A;  2ZZQ A;  1EWY A;  2E1B A;  4Z4Y A;  4XM3 A;  3OW2 B;  5GV8 A;  1E3X A;  4P2N A;  3ZZT A;  1BX1 A;  4RCY A;  4G6I A;  3W2E A;  4BPR A;  4B47 A;  2Q6L A;  1NRK A;  2XGJ A;  1T6X A;  2Q6I A;  2ZZF A;  2BPO A;  4UZE A;  1OHH A;  3PEN A;  4WWV A;  4KKT A;  2X6X A;  1YIT B;  4XN0 A;  1I8D A;  4X06 A; 
#chains in the Genus database with same CATH homology
 4G7X A;  3OAA A;  1BPL A;  5HKK A;  1KZL A;  3T53 B;  1BLI A;  2V7Q A;  2ZXI A;  3OOC A;  4FXU A;  4II3 A;  3HAG A;  1W0J A;  4YEL A;  2D3N A;  1OB0 A;  4KKU A;  1SKY B;  2M5S A;  3CMM A;  3OE7 A;  4Z1M A;  1I18 A;  4B3G A;  4YEJ A;  3BH4 A;  2Z6B D;  2W6J A;  1KMH A;  3T56 B;  4XL9 A;  4XNF A;  3NE5 B;  4TT3 A;  3ZPN A;  2X6Y A;  2X8K A;  3A3B A;  2WJY A;  3A35 A;  4DK1 A;  1W9X A;  3KEW A;  1E1Q A;  2XZL A;  1BMF A;  3CES A;  3GVL A;  2ZZE A;  2XND A;  1W0K A;  2XZP A;  3WQZ A;  1WP6 A;  3OW7 A;  3A3G A;  1EFR A;  1E43 A;  1COW A;  2R9V A;  4ASU A;  3FPP A;  4L8J A;  1H8H A;  2GJP A;  2GJK A;  3FKS A;  4XOR A;  3GVK A;  3GVJ A;  2WSS A;  2JJ2 A;  4XLC A;  4XLE A;  5DN6 A;  4YXW A;  4DK0 A;  4DNR B;  2LZJ A;  4XN3 A;  1E79 A;  3H94 A;  1UD5 A;  2JJ1 A;  3DDY A;  1NBM A;  3BCD A;  3CP2 A;  4XOT A;  3BC9 A;  2V31 A;  4XLA A;  4UZU A;  4TSF A;  2JIZ A;  3JU4 A;  1HVX A;  2CK3 A;  1VF7 A;  3GQB A;  2ZXH A;  1UD6 A;  2ZTN A;  1MAB A;  2WJV A;  3OEE A;  4XR6 A;  1UD3 A;  4E0F A;  4P22 A;  1V0F A;  1V0E A;  4XD7 A;  4JMQ A;  4G7W A;  2GK7 A;  1WPC A;  1E3Z A;  1VJS A;  2WZP P;  3G05 A;  4XKV A;  2GJR A;  4DNT B;  4B3F X;  2KVO A;  2GK6 A;  3OEH A;  4NNJ A;  4XLF A;  2XOK A;  1UD2 A;  5CDF A;  2VJJ A;  3ZIA A;  1PKV A;  2V4D A;  1HZE A;  5KNL A;  1T5E A;  2ZTG A;  3OFN A;  4TKO B;  2XZO A;  4XLH A;  2X53 S;  3VR6 A;  1E1R A;  4XKW A;  4AVZ A;  1UD8 A;  1K28 D;  3BCF A;  2X6W A;  1UD4 A;  1FX0 A;  1WTH D;  2QE7 A;  4GQN A;  2W6I A;  4XON A;  2WPD A;  5FL7 A;  4XQF A;  2VJI A;  1VLY A;  2ZZQ A;  2D3L A;  2JDI A;  2ZZG A;  3CP8 A;  2E1B A;  4KKS A;  4XM3 A;  1E3X A;  3T51 B;  4G6I A;  1NRK A;  2XGJ A;  2HLD A;  2F43 A;  2ZZF A;  3OPO A;  3LNN A;  2DIE A;  2F1M A;  1OHH A;  4XMY A;  5IK2 A;  4XOP A;  4KKT A;  2X6X A;  4HIZ A;  4II2 A;  4XN0 A;  2X85 A;  1I8D A;  1H8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...