2KVOA

Solution nmr structure of photosystem ii reaction center psb28 protein from synechocystis sp.(strain pcc 6803), northeast structural genomics consortium target sgr171
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
120
structure length
120
Chain Sequence
MAEIQFSKGVAETVVPEVRLSKSKNGQSGMAKFYFLEPTILAKESTDDITGMYLIDDEGEIITREVKGKFINGRPTAIEATVILNSQPEWDRFMRFMERYGAENGLGFSKSELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of photosystem II reaction center protein Psb28 from Synechocystis sp. Strain PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Photosynthesis
molecule keywords Photosystem II reaction center psb28 protein
total genus 16
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03912 Psb28 Psb28 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.220 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2kvoA01
2KVOA 3ZPNA
chains in the Genus database with same CATH superfamily
2D74A 1BJKA 5LMZA 1DDIA 1OB5A 4LBYA 2BVNA 5HKKA 1YJ9B 3LNNA 5FIUA 3CXCB 4E0FA 1N0VC 1VF7A 2HCJB 2BGIA 2WJYA 1VLYA 1VJSA 3JQPA 1XB2A 3QFRA 4XR6A 4RCYA 1N06A 4LBWA 1S0UA 2F4NA 4N3GA 4RDKA 4M53A 4OPOA 1F20A 2XNJA 2F1MA 1ZM2A 1YJWB 2HMAA 5AN9A 3W2IA 3T51B 3SEJA 1E63A 3OE7A 4TT3A 3W2FA 1MRZA 4ACBA 1BQEA 4P26A 3Q6QA 1QGZA 3QSYA 3CMEB 5F4JA 1N8RD 1QUEA 3JQRA 3SKBA 3AGQA 4M0LA 3PUNA 3OW7A 1ZM3A 5IYRA 1V5VA 2BMWA 3CCQB 1QGYA 3BC9A 1A8PA 2ZXIA 3BY2A 1KJZA 5F4OA 3G05A 4L8JA 1JA1A 3KEWA 4P12A 3I56B 1VQKB 2C4TA 1M1KD 2D9RA 2F1LA 1VQMB 4QUZA 2ZL7A 4DK0A 3ZZ0A 1Q7YD 3CESA 5H5JA 3I1FA 5HZBA 3JU4A 1YX2A 3PUMA 4MYUA 2AHOA 1KRHA 2VYQA 2X6YA 4ZCIA 1QX4A 2C77A 2VNJA 1NRKA 2ZBVA 3ZBTA 3AVXA 2ZXHA 4B3FX 4RPBA 4X07A 1GO2A 3ASQA 3WXMA 3E20A 3GVKA 1E3XA 4NNJA 4ZCMA 1FNBA 1Q9SA 5TV2A 5IYNA 1YI2B 2EFGA 4PGOA 4PC7A 3AVTA 2KVOA 1WOOA 1GAQA 1JNYA 4G7XA 3WY9A 1E79A 4X7FA 1T6YA 3PA2A 2VJIA 1FX0A 4YAOA 4B47A 4B3XA 3QFCA 1GJRA 4B43A 1S4MA 1KK3A 4X05A 3P26A 4C43A 2GK6A 1TTTA 5KSWB 3CCLB 3A3GA 1EFTA 4Q7JB 1Q81D 3SJZA 1R5BA 5BSYA 5TY0A 1Q82D 1H85A 4XQFA 2BM0A 3CCSB 2WZPP 1HA3A 2FVGA 4G7WA 1SKYB 4AC9A 2Q6LA 4NCNA 4XONA 4Y9UA 5FA6A 2M5SA 2XEXA 3ZC3A 4M2LA 2WZNA 1G7RA 4CQJA 2WJVA 3CC4B 4ZGNB 4PC2A 1MABA 5IYWA 1D1NA 2BM1A 2CF4A 1VHEA 2OK8A 1TVCA 2BN4A 1D2EA 2VBTA 4XD7A 2X53S 4ASUA 4DNRB 3WQZA 4XLHA 1W34A 3WNCA 1PKVA 1R5OA 3ES9A 1QFJA 2YWGA 4ZCLA 2X0KA 2DIEA 3CW2A 3CC7B 1H8HA 1K73D 2GJKA 3WYAA 5FO1A 1BPLA 4BPRA 3B8HA 1VQ9B 3W2GA 2Z6BD 4RPDA 1Q86D 2ZZQA 3ASTA 2OBTA 2WR8A 4M4SA 2OTLB 4Z4TA 2WYRA 2YWHA 1HVXA 1PJ5A 2Q6IA 1DG1G 2ZBUA 4XNFA 2BV3A 2VZLA 3CPXA 1CNFA 1PJ7A 3JQQA 4TMTA 4Z4WA 4UZUA 3CD6B 1NB0A 2R6HA 4DQLA 5B6IA 3OPOA 4XLFA 2DETA 5BSXA 3CTAA 2EIXA 1I8DA 1G7CA 3P27A 2HLDA 1B23P 3A35A 2QGGA 1EP1B 1BMFA 2X6XA 1GAWA 1T6ZA 3CCEB 2GJPA 4TMZA 4OPVA 4YAUA 2W6JA 3CPWB 1YIJB 1UD8A 4XLAA 1G7SA 4PAAA 1KTVA 2BSAA 4RD3A 4M1KA 1WSRA 1M90D 2OBRA 3CRZA 3QFSA 3G6EB 3ONYA 3OZUA 4P3IA 2OTJB 3W5VA 3G4SB 2VNKA 2GPJA 4NBSA 4HIZA 1E1QA 2JIZA 5IYQA 3ZZUA 4FN5A 1K9MD 4OOSA 3OAAA 5DS0A 4Z4ZA 1RQPA 4RDLA 1VQLB 2XNCA 3W2EA 1QVGB 1QFYA 2QN6A 3OFNA 1KQSB 4KKTA 1KC8D 2GK7A 2ZZGA 1T6XA 3CC2B 2JJ2A 3ASSA 2DY1A 4ACAA 3U6KA 1HZEA 2DCUA 3QE2A 2E1BA 1WORA 3A8JA 3CP2A 2OYNA 4OOVA 1QH0A 3W5UA 1UD5A 1EP2B 2WSSA 4F7DA 1FNDA 2Q6KA 1E62A 2NV4A 2D3LA 1J9ZA 5FO0A 5IK2A 3PA1A 2YWEA 1COWA 3VNUA 2CBXA 2VBUA 4P2NA 2RC5A 3Q38A 4YALA 1OGJA 2BGJA 1UD2A 4LBZA 5CDFA 3A1PA 2GQFA 4Z4SA 3VO2A 5IYPA 4XLEA 4UZEA 4FK8A 3DDYA 1QGAA 4YXWA 3CCRB 2X8KA 2XNDA 5F4MA 3R6KA 3ISXA 3OKXA 5A8AA 1AIPA 3BNWA 3W5HA 1H42A 4R71A 1KK1A 3W2HA 2XZOA 1TUIA 2V7VA 1EFCA 1JB9A 1D8TA 3GIRA 3FJOA 1BX0A 1EP3B 1N08A 3OOCA 2QMUA 3GVJA 3H94A 4RJLA 2CC2A 2ZL5A 2XZLA 1N07A 4DK1A 1SKQA 1W35A 1EXMA 4YHBA 3G71B 1N05A 4WZLA 1E1RA 2QE7A 4U9UA 4WZEA 1VQ7B 1Y0YA 3AVYA 1Y0RA 3WNDA 4RD0A 5KNLA 4K1XA 2ZZEA 1VQNB 4P22A 4PABA 4X8IA 3AGPA 4C0SA 1GVHA 4GQNA 3SLDA 3CCMB 3CB4A 1YITB 1VQ5B 1E43A 2HDNB 4LC0A 2V7UA 4Z4RA 3R6JA 2GJRA 2ZZFA 4P3YA 4QHYA 1DARA 4RD4A 4TN1A 2ZL6A 1K28D 3I55B 5HXBA 1E3ZA 3PVDA 1F60A 2QDXA 3LQEA 3OJXA 2BPOA 3FKSA 4Y7CA 1YJNB 5TRDA 4RD6A 1YLOA 3LVBA 5J3OA 3Q39A 4X7EA 4ZGQB 2XOKA 1N0UA 4X0CA 4RCZA 4FWTA 2PLFA 5A89A 5JBQA 4Z4UA 1VQPB 1CNEA 4UAJA 4XLCA 1QFZA 2XGJA 4YELA 4IW3B 4YEJA 4XKWA 4TKOB 2E1RA 4B44A 3CMMA 2J7KA 4PC1A 4DQKA 2I1LA 2ZTNA 4XKVA 4KKUA 2QA4B 1IHMA 4B4DA 2R9VA 4JMQA 5DN6A 1NBMA 3OW2B 3MHPA 3OEHA 2VNHA 3OEEA 4P25A 1VQ6B 1WP6A 2V7XA 5E6TA 3VO1A 3GVLA 4XN0A 3A8KA 4Z4VA 3J81k 5TR9A 3U2QA 2CK3A 4Y9RA 3AVWA 3OZWA 3Q6RA 4AF6A 2VNIA 1IJEA 2D3NA 1UD6A 1E64A 4XMYA 4X7CA 3WBJA 1VHOA 3BY1A 4HE5A 2GREA 1V0EA 2B7BA 5GV7A 3AVUA 2C78A 1FNMA 3LO8A 3T56B 2B7CA 1IB0A 5J35A 2ZTGA 4TMXA 1BX1A 1JJ2B 1OGIA 2DYIA 3D26A 1T5EA 1VQ4B 1IJFA 3OZVA 2CW5A 2V7WA 4XN3A 4RDJA 2LZJA 1W0JA 1H8EA 4YAFA 2JDIA 3H9NA 1VQ8B 3SJPA 1EWYA 1JA0A 4AVZA 4B3GA 1OHHA 2V7QA 2F43A 2JJ1A 3FPKA 4N3NA 1DDGA 3ASRA 3BCFA 5HZAA 4RM0A 1RQRA 3V7AA 1XFOA 2P3MA 4II3A 1OB2A 3E1YE 4YAWA 1W9XA 2C2WA 1WOSA 1KMHA 2X85A 2BF4A 3LQ6A 3OP1A 4B48A 1NJID 1EFRA 4OPSA 1WDTA 4QFMA 4QV2A 2CNDA 1WPCA 3CCVB 4QVJA 3CMAB 4OOXA 2DERA 1FNCA 1K8AD 3BQJA 4KKSA 1UD4A 1XQBA 1KK2A 4XL9A 1KZLA 3ZBUA 1QG0A 4P1VA 3RY8A 5THXA 1FRNA 4WWVA 1SM4A 4X06A 4RLZA 3WBKA 3U6BA 1AMOA 3GQBA 2Q6OA 1R5NA 1NB9A 1U2RA 1TLLA 4G1BA 4Z4YA 3CCUB 4DNTB 3ZUGA 2RC6A 1FRQA 3BCDA 4G1VA 5FNZA 1QVFB 3A3BA 1WSVA 2VJJA 2XZPA 1UD3A 2C5HA 4Z1MA 3B82A 4XORA 3VNVA 2VBVA 4ROXA 5KW9A 1YHQB 4TSFA 3WNBA 3BH4A 3T53B 2QEXB 4G6IA 1GR1A 1ZM4A 4XM3A 4J0QA 2V4DA 2NPFA 2PIAA 3ZIAA 1I18A 2YWFA 3A8IA 5H59A 2ZITA 1CQXA 4LBVA 4RD2A 3ONUA 3PENA 3QFTA 1WU8A 4P6VF 4WZKA 1B2RA 1S72B 2JN9A 3NE5B 2OBSA 4P9SA 2C4UA 1WOPA 1ZUNB 1W0KA 2W6IA 3HAGA 4X7DA 2VBSA 1OB0A 3MCAA 1KK0A 4TMVA 1FDRA 4PC6A 3B78A 2PE3A 1QUFA 3GSIA 4P6YA 4TMWA 4PC3A 4RD1A 3Q3AA 1W2BB 4H9GA 1W87A 1BLIA 2OK7A 3OJWA 2PMDA 3V76A 1G7TA 1VLOA 3ZZTA 2QTZA 4AF7A 1I7PA 4QVAA 2CRVA 1ELOA 1P4MA 1PJ6A 4ZV4A 1KD1D 5A88A 4EH1A 4FXUA 3SLNA 4WQMA 3AVVA 4OP7A 4XOTA 2C5BA 1EFUA 5EMNA 4UZFA 4G5GA 3CCJB 1VQOB 2X6WA 1V0FA 2FX3A 4WZTA 5FL7A 2QTLA 4XOPA 1WTHD 5L46A 2WPDA 2X3UA 2DOGA 3KL9A 4II2A 3CP8A 1UMKA 4MYTA 4HE6A 5DSZA 3ZPNA 2B5OA 3MMPA 1NDHA 3VR6A 3FPPA 3ASPA 3VMFA 2V31A 2V7TA 2DEUA 5GV8A 1XE1A 1ZM9A
chains in the Genus database with same CATH topology
2Z6BD 2ZZQA 2XZLA 4DK1A 1EFRA 5HKKA 1HVXA 1WPCA 3LNNA 4XNFA 4E0FA 1VF7A 4KKSA 1UD4A 1E1RA 2QE7A 2WJYA 1VLYA 1VJSA 4XL9A 1KZLA 4XR6A 4UZUA 5KNLA 2ZZEA 3OPOA 4XLFA 3GQBA 1I8DA 4P22A 2HLDA 2F1MA 3A35A 1BMFA 4GQNA 2X6XA 3T51B 4DNTB 1E43A 2GJPA 3OE7A 4TT3A 2W6JA 3BCDA 1UD8A 4XLAA 2GJRA 2ZZFA 3A3BA 1K28D 2VJJA 2XZPA 1E3ZA 1UD3A 3OW7A 4Z1MA 3BC9A 3FKSA 4XORA 2ZXIA 4HIZA 1E1QA 2JIZA 4TSFA 3G05A 3BH4A 4L8JA 3KEWA 3T53B 4G6IA 2XOKA 3OAAA 4XM3A 4DK0A 2V4DA 3CESA 3ZIAA 1I18A 3JU4A 4XLCA 2X6YA 3OFNA 2XGJA 4YELA 4YEJA 1NRKA 4XKWA 4KKTA 4TKOB 2ZXHA 3NE5B 3CMMA 4B3FX 2GK7A 1W0KA 2ZTNA 2ZZGA 3GVKA 4XKVA 3GVJA 2W6IA 1E3XA 3HAGA 3H94A 4KKUA 4NNJA 2JJ2A 2R9VA 4JMQA 1OB0A 5DN6A 1NBMA 1HZEA 2E1BA 3OEHA 3OEEA 2KVOA 1WP6A 3CP2A 3GVLA 4XN0A 1UD5A 2CK3A 4G7XA 2WSSA 1E79A 1BLIA 2VJIA 1FX0A 2D3LA 2D3NA 5IK2A 1UD6A 2GK6A 4XMYA 1COWA 3A3GA 4XQFA 1V0EA 4FXUA 2WZPP 4G7WA 1SKYB 1UD2A 4XONA 2M5SA 4XOTA 5CDFA 3T56B 2WJVA 1V0FA 2X6WA 2ZTGA 4XLEA 5FL7A 1T5EA 1MABA 4XN3A 3DDYA 4XOPA 1WTHD 2LZJA 4YXWA 1W0JA 2X8KA 2XNDA 1H8EA 2WPDA 2JDIA 4XD7A 2X53S 4ASUA 4DNRB 3WQZA 4XLHA 4II2A 3CP8A 4AVZA 4B3GA 1OHHA 1PKVA 2V7QA 2XZOA 2F43A 2JJ1A 3ZPNA 3BCFA 3VR6A 3FPPA 2DIEA 2V31A 1H8HA 4II3A 2GJKA 1BPLA 1W9XA 3OOCA 1KMHA 2X85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVO A;  3ZPN A; 
#chains in the Genus database with same CATH topology
 2D74 A;  1BJK A;  5LMZ A;  1DDI A;  1OB5 A;  4LBY A;  2BVN A;  5HKK A;  1YJ9 B;  3LNN A;  5FIU A;  3CXC B;  4E0F A;  1N0V C;  1VF7 A;  2HCJ B;  2BGI A;  2WJY A;  1VLY A;  1VJS A;  3JQP A;  1XB2 A;  3QFR A;  4XR6 A;  4RCY A;  1N06 A;  4LBW A;  1S0U A;  2F4N A;  4N3G A;  4RDK A;  4M53 A;  4OPO A;  1F20 A;  2XNJ A;  2F1M A;  1ZM2 A;  1YJW B;  2HMA A;  5AN9 A;  3W2I A;  3T51 B;  3SEJ A;  1E63 A;  3OE7 A;  4TT3 A;  3W2F A;  1MRZ A;  4ACB A;  1BQE A;  4P26 A;  3Q6Q A;  1QGZ A;  3QSY A;  3CME B;  5F4J A;  1N8R D;  1QUE A;  3JQR A;  3SKB A;  3AGQ A;  4M0L A;  3PUN A;  3OW7 A;  1ZM3 A;  5IYR A;  1V5V A;  2BMW A;  3CCQ B;  1QGY A;  3BC9 A;  1A8P A;  2ZXI A;  3BY2 A;  1KJZ A;  5F4O A;  3G05 A;  4L8J A;  1JA1 A;  3KEW A;  4P12 A;  3I56 B;  1VQK B;  2C4T A;  1M1K D;  2D9R A;  2F1L A;  1VQM B;  4QUZ A;  2ZL7 A;  4DK0 A;  3ZZ0 A;  1Q7Y D;  3CES A;  5H5J A;  3I1F A;  5HZB A;  3JU4 A;  1YX2 A;  3PUM A;  4MYU A;  2AHO A;  1KRH A;  2VYQ A;  2X6Y A;  4ZCI A;  1QX4 A;  2C77 A;  2VNJ A;  1NRK A;  2ZBV A;  3ZBT A;  3AVX A;  2ZXH A;  4B3F X;  4RPB A;  4X07 A;  1GO2 A;  3ASQ A;  3WXM A;  3E20 A;  3GVK A;  1E3X A;  4NNJ A;  4ZCM A;  1FNB A;  1Q9S A;  5TV2 A;  5IYN A;  1YI2 B;  2EFG A;  4PGO A;  4PC7 A;  3AVT A;  2KVO A;  1WOO A;  1GAQ A;  1JNY A;  4G7X A;  3WY9 A;  1E79 A;  4X7F A;  1T6Y A;  3PA2 A;  2VJI A;  1FX0 A;  4YAO A;  4B47 A;  4B3X A;  3QFC A;  1GJR A;  4B43 A;  1S4M A;  1KK3 A;  4X05 A;  3P26 A;  4C43 A;  2GK6 A;  1TTT A;  5KSW B;  3CCL B;  3A3G A;  1EFT A;  4Q7J B;  1Q81 D;  3SJZ A;  1R5B A;  5BSY A;  5TY0 A;  1Q82 D;  1H85 A;  4XQF A;  2BM0 A;  3CCS B;  2WZP P;  1HA3 A;  2FVG A;  4G7W A;  1SKY B;  4AC9 A;  2Q6L A;  4NCN A;  4XON A;  4Y9U A;  5FA6 A;  2M5S A;  2XEX A;  3ZC3 A;  4M2L A;  2WZN A;  1G7R A;  4CQJ A;  2WJV A;  3CC4 B;  4ZGN B;  4PC2 A;  1MAB A;  5IYW A;  1D1N A;  2BM1 A;  2CF4 A;  1VHE A;  2OK8 A;  1TVC A;  2BN4 A;  1D2E A;  2VBT A;  4XD7 A;  2X53 S;  4ASU A;  4DNR B;  3WQZ A;  4XLH A;  1W34 A;  3WNC A;  1PKV A;  1R5O A;  3ES9 A;  1QFJ A;  2YWG A;  4ZCL A;  2X0K A;  2DIE A;  3CW2 A;  3CC7 B;  1H8H A;  1K73 D;  2GJK A;  3WYA A;  5FO1 A;  1BPL A;  4BPR A;  3B8H A;  1VQ9 B;  3W2G A;  2Z6B D;  4RPD A;  1Q86 D;  2ZZQ A;  3AST A;  2OBT A;  2WR8 A;  4M4S A;  2OTL B;  4Z4T A;  2WYR A;  2YWH A;  1HVX A;  1PJ5 A;  2Q6I A;  1DG1 G;  2ZBU A;  4XNF A;  2BV3 A;  2VZL A;  3CPX A;  1CNF A;  1PJ7 A;  3JQQ A;  4TMT A;  4Z4W A;  4UZU A;  3CD6 B;  1NB0 A;  2R6H A;  4DQL A;  5B6I A;  3OPO A;  4XLF A;  2DET A;  5BSX A;  3CTA A;  2EIX A;  1I8D A;  1G7C A;  3P27 A;  2HLD A;  1B23 P;  3A35 A;  2QGG A;  1EP1 B;  1BMF A;  2X6X A;  1GAW A;  1T6Z A;  3CCE B;  2GJP A;  4TMZ A;  4OPV A;  4YAU A;  2W6J A;  3CPW B;  1YIJ B;  1UD8 A;  4XLA A;  1G7S A;  4PAA A;  1KTV A;  2BSA A;  4RD3 A;  4M1K A;  1WSR A;  1M90 D;  2OBR A;  3CRZ A;  3QFS A;  3G6E B;  3ONY A;  3OZU A;  4P3I A;  2OTJ B;  3W5V A;  3G4S B;  2VNK A;  2GPJ A;  4NBS A;  4HIZ A;  1E1Q A;  2JIZ A;  5IYQ A;  3ZZU A;  4FN5 A;  1K9M D;  4OOS A;  3OAA A;  5DS0 A;  4Z4Z A;  1RQP A;  4RDL A;  1VQL B;  2XNC A;  3W2E A;  1QVG B;  1QFY A;  2QN6 A;  3OFN A;  1KQS B;  4KKT A;  1KC8 D;  2GK7 A;  2ZZG A;  1T6X A;  3CC2 B;  2JJ2 A;  3ASS A;  2DY1 A;  4ACA A;  3U6K A;  1HZE A;  2DCU A;  3QE2 A;  2E1B A;  1WOR A;  3A8J A;  3CP2 A;  2OYN A;  4OOV A;  1QH0 A;  3W5U A;  1UD5 A;  1EP2 B;  2WSS A;  4F7D A;  1FND A;  2Q6K A;  1E62 A;  2NV4 A;  2D3L A;  1J9Z A;  5FO0 A;  5IK2 A;  3PA1 A;  2YWE A;  1COW A;  3VNU A;  2CBX A;  2VBU A;  4P2N A;  2RC5 A;  3Q38 A;  4YAL A;  1OGJ A;  2BGJ A;  1UD2 A;  4LBZ A;  5CDF A;  3A1P A;  2GQF A;  4Z4S A;  3VO2 A;  5IYP A;  4XLE A;  4UZE A;  4FK8 A;  3DDY A;  1QGA A;  4YXW A;  3CCR B;  2X8K A;  2XND A;  5F4M A;  3R6K A;  3ISX A;  3OKX A;  5A8A A;  1AIP A;  3BNW A;  3W5H A;  1H42 A;  4R71 A;  1KK1 A;  3W2H A;  2XZO A;  1TUI A;  2V7V A;  1EFC A;  1JB9 A;  1D8T A;  3GIR A;  3FJO A;  1BX0 A;  1EP3 B;  1N08 A;  3OOC A;  2QMU A;  3GVJ A;  3H94 A;  4RJL A;  2CC2 A;  2ZL5 A;  2XZL A;  1N07 A;  4DK1 A;  1SKQ A;  1W35 A;  1EXM A;  4YHB A;  3G71 B;  1N05 A;  4WZL A;  1E1R A;  2QE7 A;  4U9U A;  4WZE A;  1VQ7 B;  1Y0Y A;  3AVY A;  1Y0R A;  3WND A;  4RD0 A;  5KNL A;  4K1X A;  2ZZE A;  1VQN B;  4P22 A;  4PAB A;  4X8I A;  3AGP A;  4C0S A;  1GVH A;  4GQN A;  3SLD A;  3CCM B;  3CB4 A;  1YIT B;  1VQ5 B;  1E43 A;  2HDN B;  4LC0 A;  2V7U A;  4Z4R A;  3R6J A;  2GJR A;  2ZZF A;  4P3Y A;  4QHY A;  1DAR A;  4RD4 A;  4TN1 A;  2ZL6 A;  1K28 D;  3I55 B;  5HXB A;  1E3Z A;  3PVD A;  1F60 A;  2QDX A;  3LQE A;  3OJX A;  2BPO A;  3FKS A;  4Y7C A;  1YJN B;  5TRD A;  4RD6 A;  1YLO A;  3LVB A;  5J3O A;  3Q39 A;  4X7E A;  4ZGQ B;  2XOK A;  1N0U A;  4X0C A;  4RCZ A;  4FWT A;  2PLF A;  5A89 A;  5JBQ A;  4Z4U A;  1VQP B;  1CNE A;  4UAJ A;  4XLC A;  1QFZ A;  2XGJ A;  4YEL A;  4IW3 B;  4YEJ A;  4XKW A;  4TKO B;  2E1R A;  4B44 A;  3CMM A;  2J7K A;  4PC1 A;  4DQK A;  2I1L A;  2ZTN A;  4XKV A;  4KKU A;  2QA4 B;  1IHM A;  4B4D A;  2R9V A;  4JMQ A;  5DN6 A;  1NBM A;  3OW2 B;  3MHP A;  3OEH A;  2VNH A;  3OEE A;  4P25 A;  1VQ6 B;  1WP6 A;  2V7X A;  5E6T A;  3VO1 A;  3GVL A;  4XN0 A;  3A8K A;  4Z4V A;  3J81 k;  5TR9 A;  3U2Q A;  2CK3 A;  4Y9R A;  3AVW A;  3OZW A;  3Q6R A;  4AF6 A;  2VNI A;  1IJE A;  2D3N A;  1UD6 A;  1E64 A;  4XMY A;  4X7C A;  3WBJ A;  1VHO A;  3BY1 A;  4HE5 A;  2GRE A;  1V0E A;  2B7B A;  5GV7 A;  3AVU A;  2C78 A;  1FNM A;  3LO8 A;  3T56 B;  2B7C A;  1IB0 A;  5J35 A;  2ZTG A;  4TMX A;  1BX1 A;  1JJ2 B;  1OGI A;  2DYI A;  3D26 A;  1T5E A;  1VQ4 B;  1IJF A;  3OZV A;  2CW5 A;  2V7W A;  4XN3 A;  4RDJ A;  2LZJ A;  1W0J A;  1H8E A;  4YAF A;  2JDI A;  3H9N A;  1VQ8 B;  3SJP A;  1EWY A;  1JA0 A;  4AVZ A;  4B3G A;  1OHH A;  2V7Q A;  2F43 A;  2JJ1 A;  3FPK A;  4N3N A;  1DDG A;  3ASR A;  3BCF A;  5HZA A;  4RM0 A;  1RQR A;  3V7A A;  1XFO A;  2P3M A;  4II3 A;  1OB2 A;  3E1Y E;  4YAW A;  1W9X A;  2C2W A;  1WOS A;  1KMH A;  2X85 A;  2BF4 A;  3LQ6 A;  3OP1 A;  4B48 A;  1NJI D;  1EFR A;  4OPS A;  1WDT A;  4QFM A;  4QV2 A;  2CND A;  1WPC A;  3CCV B;  4QVJ A;  3CMA B;  4OOX A;  2DER A;  1FNC A;  1K8A D;  3BQJ A;  4KKS A;  1UD4 A;  1XQB A;  1KK2 A;  4XL9 A;  1KZL A;  3ZBU A;  1QG0 A;  4P1V A;  3RY8 A;  5THX A;  1FRN A;  4WWV A;  1SM4 A;  4X06 A;  4RLZ A;  3WBK A;  3U6B A;  1AMO A;  3GQB A;  2Q6O A;  1R5N A;  1NB9 A;  1U2R A;  1TLL A;  4G1B A;  4Z4Y A;  3CCU B;  4DNT B;  3ZUG A;  2RC6 A;  1FRQ A;  3BCD A;  4G1V A;  5FNZ A;  1QVF B;  3A3B A;  1WSV A;  2VJJ A;  2XZP A;  1UD3 A;  2C5H A;  4Z1M A;  3B82 A;  4XOR A;  3VNV A;  2VBV A;  4ROX A;  5KW9 A;  1YHQ B;  4TSF A;  3WNB A;  3BH4 A;  3T53 B;  2QEX B;  4G6I A;  1GR1 A;  1ZM4 A;  4XM3 A;  4J0Q A;  2V4D A;  2NPF A;  2PIA A;  3ZIA A;  1I18 A;  2YWF A;  3A8I A;  5H59 A;  2ZIT A;  1CQX A;  4LBV A;  4RD2 A;  3ONU A;  3PEN A;  3QFT A;  1WU8 A;  4P6V F;  4WZK A;  1B2R A;  1S72 B;  2JN9 A;  3NE5 B;  2OBS A;  4P9S A;  2C4U A;  1WOP A;  1ZUN B;  1W0K A;  2W6I A;  3HAG A;  4X7D A;  2VBS A;  1OB0 A;  3MCA A;  1KK0 A;  4TMV A;  1FDR A;  4PC6 A;  3B78 A;  2PE3 A;  1QUF A;  3GSI A;  4P6Y A;  4TMW A;  4PC3 A;  4RD1 A;  3Q3A A;  1W2B B;  4H9G A;  1W87 A;  1BLI A;  2OK7 A;  3OJW A;  2PMD A;  3V76 A;  1G7T A;  1VLO A;  3ZZT A;  2QTZ A;  4AF7 A;  1I7P A;  4QVA A;  2CRV A;  1ELO A;  1P4M A;  1PJ6 A;  4ZV4 A;  1KD1 D;  5A88 A;  4EH1 A;  4FXU A;  3SLN A;  4WQM A;  3AVV A;  4OP7 A;  4XOT A;  2C5B A;  1EFU A;  5EMN A;  4UZF A;  4G5G A;  3CCJ B;  1VQO B;  2X6W A;  1V0F A;  2FX3 A;  4WZT A;  5FL7 A;  2QTL A;  4XOP A;  1WTH D;  5L46 A;  2WPD A;  2X3U A;  2DOG A;  3KL9 A;  4II2 A;  3CP8 A;  1UMK A;  4MYT A;  4HE6 A;  5DSZ A;  3ZPN A;  2B5O A;  3MMP A;  1NDH A;  3VR6 A;  3FPP A;  3ASP A;  3VMF A;  2V31 A;  2V7T A;  2DEU A;  5GV8 A;  1XE1 A;  1ZM9 A; 
#chains in the Genus database with same CATH homology
 2Z6B D;  2ZZQ A;  2XZL A;  4DK1 A;  1EFR A;  5HKK A;  1HVX A;  1WPC A;  3LNN A;  4XNF A;  4E0F A;  1VF7 A;  4KKS A;  1UD4 A;  1E1R A;  2QE7 A;  2WJY A;  1VLY A;  1VJS A;  4XL9 A;  1KZL A;  4XR6 A;  4UZU A;  5KNL A;  2ZZE A;  3OPO A;  4XLF A;  3GQB A;  1I8D A;  4P22 A;  2HLD A;  2F1M A;  3A35 A;  1BMF A;  4GQN A;  2X6X A;  3T51 B;  4DNT B;  1E43 A;  2GJP A;  3OE7 A;  4TT3 A;  2W6J A;  3BCD A;  1UD8 A;  4XLA A;  2GJR A;  2ZZF A;  3A3B A;  1K28 D;  2VJJ A;  2XZP A;  1E3Z A;  1UD3 A;  3OW7 A;  4Z1M A;  3BC9 A;  3FKS A;  4XOR A;  2ZXI A;  4HIZ A;  1E1Q A;  2JIZ A;  4TSF A;  3G05 A;  3BH4 A;  4L8J A;  3KEW A;  3T53 B;  4G6I A;  2XOK A;  3OAA A;  4XM3 A;  4DK0 A;  2V4D A;  3CES A;  3ZIA A;  1I18 A;  3JU4 A;  4XLC A;  2X6Y A;  3OFN A;  2XGJ A;  4YEL A;  4YEJ A;  1NRK A;  4XKW A;  4KKT A;  4TKO B;  2ZXH A;  3NE5 B;  3CMM A;  4B3F X;  2GK7 A;  1W0K A;  2ZTN A;  2ZZG A;  3GVK A;  4XKV A;  3GVJ A;  2W6I A;  1E3X A;  3HAG A;  3H94 A;  4KKU A;  4NNJ A;  2JJ2 A;  2R9V A;  4JMQ A;  1OB0 A;  5DN6 A;  1NBM A;  1HZE A;  2E1B A;  3OEH A;  3OEE A;  2KVO A;  1WP6 A;  3CP2 A;  3GVL A;  4XN0 A;  1UD5 A;  2CK3 A;  4G7X A;  2WSS A;  1E79 A;  1BLI A;  2VJI A;  1FX0 A;  2D3L A;  2D3N A;  5IK2 A;  1UD6 A;  2GK6 A;  4XMY A;  1COW A;  3A3G A;  4XQF A;  1V0E A;  4FXU A;  2WZP P;  4G7W A;  1SKY B;  1UD2 A;  4XON A;  2M5S A;  4XOT A;  5CDF A;  3T56 B;  2WJV A;  1V0F A;  2X6W A;  2ZTG A;  4XLE A;  5FL7 A;  1T5E A;  1MAB A;  4XN3 A;  3DDY A;  4XOP A;  1WTH D;  2LZJ A;  4YXW A;  1W0J A;  2X8K A;  2XND A;  1H8E A;  2WPD A;  2JDI A;  4XD7 A;  2X53 S;  4ASU A;  4DNR B;  3WQZ A;  4XLH A;  4II2 A;  3CP8 A;  4AVZ A;  4B3G A;  1OHH A;  1PKV A;  2V7Q A;  2XZO A;  2F43 A;  2JJ1 A;  3ZPN A;  3BCF A;  3VR6 A;  3FPP A;  2DIE A;  2V31 A;  1H8H A;  4II3 A;  2GJK A;  1BPL A;  1W9X A;  3OOC A;  1KMH A;  2X85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...