1E62A

Ferredoxin:nadp+ reductase mutant with lys 75 replaced by arg (k75r)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPERLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP+ REDUCTASE
publication title Structural Analysis of Interactions for Complex Formation between Ferredoxin-Nadp+ Reductase and its Protein Partners.
pubmed doi rcsb
source organism Nostoc sp. pcc 7119
molecule tags Oxidoreductase
total genus 83
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2000-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1e62A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1e62A02
5TV2A 4J0QA 3QE2A 3LYUA 4FN5A 1ZM4A 3ZZ0A 4WQMA 3ZBTA 1EFUA 4ZCIA 4UAJA 3PENA 3CCSB 2VNHA 1TVCA 3ZZUA 1S72B 3I55B 3CCRB 4PC2A 2YWEA 1EP3B 5GV7A 3W2EA 4RD0A 5AN9A 4PC3A 3WXMA 4H9GA 1ELOA 1EWYA 1QFYA 4YHBA 1VQ9B 2DETA 3A1FA 1NJID 2VNKA 2D74A 1CNEA 1QH0A 4NCNA 3I56B 1VQNB 4RJLA 2BGJA 2B7CA 4G5GA 3QSYA 1Q7YD 3G4SB 1W35A 3P27A 1OGJA 3AGPA 3CD6B 3OJWA 2DCUA 1N0VC 1K9MD 4HE5A 1WDTA 1VQLB 4RD6A 1IB0A 2PLFA 1VQOB 4RD3A 3CC7B 1VQ6B 4LBZA 1QGAA 4Q7JB 2VNIA 3J81k 2YWFA 1BX1A 2XNCA 4M4SA 1UMKA 4RCYA 1VQ5B 3CC4B 4RD4A 3JQRA 1QUFA 1BJKA 3LO8A 1QVFB 1YJNB 1VQKB 2HDNB 1G7TA 1AIPA 1J9ZA 3WNBA 1E63A 3W5UA 3ES9A 1B2RA 1KK0A 3FJOA 1I7PA 1U2RA 4B44A 3WY9A 1OGIA 2AHOA 2CNDA 1BX0A 1E64A 2HCJB 4YAWA 4M53A 4BPRA 2B7BA 1XB2A 2QTLA 1JA1A 3OW2B 1N0UA 1EP2B 1GR1A 1R5NA 3LRXA 4U9UA 1FDRA 4YAFA 1OB5A 3B78A 4MYTA 2QDXA 1QFZA 3JQQA 2DERA 3ZBUA 1JA0A 2GPJA 1TTTA 3QFRA 3AVWA 2ZITA 3CCUB 2QA4B 4TMVA 3CB4A 1TUIA 4G1BA 1HA3A 1EP1B 3WBKA 3AVTA 3QFCA 4TMTA 1FNCA 3JQPA 1ZM9A 2BGIA 2OK7A 3B8HA 4NBSA 3E20A 2NPFA 4IW3B 2BV3A 2PIAA 3W5HA 3QFSA 4LBWA 3OZVA 1Q86D 1QVGB 1KK2A 1F60A 1D8TA 1FNBA 3AVUA 4EH1A 1IJFA 1DDIA 2E1RA 1H42A 1JJ2B 1QGZA 4LBYA 2HMAA 3CXCB 2FX3A 2CRVA 1EFTA 1BQEA 3W2GA 1CQXA 4Y9UA 1IJEA 3U6BA 2DY1A 2BSAA 2BVNA 1W87A 2RC6A 1VQPB 4RD2A 3G6EB 4M0LA 1YJ9B 4YAOA 2BM1A 1FRQA 4LBVA 1EXMA 2XNJA 1R5BA 4B43A 1ZM3A 3OZUA 1VQ4B 1GAQA 4F7DA 1ZUNB 4FK8A 1H85A 4DQKA 5KSWB 3LVBA 4Y9RA 2OK8A 4C0SA 1D2EA 4TMWA 5EMNA 1DDGA 1EFCA 3AVYA 1Q81D 1KK1A 1GVHA 1NDHA 4PC1A 4TMZA 1F20A 3U6KA 2QEXB 2RC5A 3AVVA 3OZWA 3I1FA 3CCJB 1KQSB 3U2QA 1E62A 2VYQA 1XE1A 4C43A 1B23P 4DQLA 2QMUA 1QG0A 1D1NA 2OTLB 1SKQA 4P3YA 5GV8A 1S0UA 5FA6A 4ACBA 1GJRA 3CCMB 4B4DA 1R5OA 2EFGA 4HE6A 1G7RA 1YHQB 3AGQA 3CMAB 1VQ7B 4AC9A 1FNMA 2OTJB 4YALA 1FNDA 4ZGQB 1YJWB 4ZCLA 5DSZA 3W2HA 3MMPA 1QUEA 1M1KD 1GAWA 3WNCA 4FWTA 3QFTA 3WYAA 2PMDA 2XEXA 4QFMA 1DARA 1JB9A 4LC0A 3CC2B 1YIJB 2BF4A 4PGOA 4RCZA 3WNDA 2C78A 5HXBA 4MYUA 4ZV4A 3VO2A 4B48A 1W34A 3G71B 4R71A 1OB2A 4ZCMA 4YAUA 1GO2A 1QGYA 4AF6A 3MCAA 2BPOA 2QTZA 1KTVA 2VZLA 2DEUA 1FRNA 1VQ8B 3VNVA 5H5JA 4M1KA 3CRZA 3VO1A 3V76A 4M2LA 3CCEB 2YWHA 2R6HA 3P26A 2BN4A 5TY0A 2EIXA 4ZGNB 4B47A 5JBQA 3W2FA 4Y7CA 4TMXA 3MHPA 4RD1A 3CMEB 4N3NA 1W2BB 1TLLA 3ZC3A 2B5OA 1G7CA 3VNUA 1JNYA 1ZM2A 1YI2B 1QFJA 4QHYA 1KD1D 1G7SA 1SM4A 1DG1G 2VNJA 2X3UA 3SJZA 1M90D 3FPKA 4K1XA 3ZZTA 4P6VF 1A8PA 1KRHA 2YWGA 2J7KA 5THXA 1YITB 1VQMB 2QN6A 4G1VA 5TR9A 1QX4A 4AF7A 3AVXA 4N3GA 2BM0A 3B82A 3VMFA 2BMWA 3CCVB 1KK3A 1KJZA 3CW2A 4ACAA 3WBJA 3OJXA 4TN1A 2GQFA 3CCLB 3CCQB 2C77A 5H59A 1K8AD 4PC7A 3W2IA 3W5VA 3E1YE 1N8RD 4PC6A 4B3XA 1Q82D 1K73D 1AMOA 1CNFA 1KC8D 3CPWB
chains in the Genus database with same CATH superfamily
5TV2A 1EK5A 1Q1GA 4CFSA 4CLRA 3Q7SA 1XTSA 3SX2A 1BCSB 2PBZA 5ALXA 5HE9A 2R6AA 5J4YA 1PT5A 2YYSA 3A1EA 3Q15C 4DQUA 2HQOA 2PBFA 2YMPA 4I2NA 2EC5A 5J2UA 4LQDA 2Q49A 4LDAA 4ZHQA 1EE9A 1LI5A 2PEZA 4LYDA 5DBHX 3V1KA 3U4MA 1NIJA 1RYDA 2UZIR 3VOBA 1UPBA 2ZATA 1Y8CA 2AJCA 5EI5A 1NBAA 4MKXA 5DV9A 3EHDA 1NMXA 3V8PA 1HKHA 4OAPA 4XKJA 3GAMA 2RONA 4IDEA 5CYOA 3VH3A 4A8TA 1X1TA 4DE5A 1I94B 4CEJB 4CWAA 2CD7A 1IY9A 2QUHA 2XUHA 1B1AA 4FFVA 1KDZA 4EFDA 1VBKA 2HHAA 2YZ2A 2BHNA 2A59A 3IQZA 1EP3B 3G0DA 4I8DA 1OKKD 3E48A 3HBJA 3KKPA 3AESB 2B6NA 4WLOA 3OO0A 1FLVA 2TYSB 1RZUA 2RAVA 3DYIA 3JX9A 4UHHA 2A4MA 3RVQA 3ZBQA 1XA3A 3VHQA 4CQLA 3I12A 2Y1KA 4R2MA 4X3CA 1GN8A 1ZXBA 1I7QB 5KX5A 2ZWAA 1CUDA 2DF8A 3OTQA 1F4PA 1FNNA 2HCRA 2XE6A 3HDTA 1FU8A 3IHKA 5JAMA 4EB6A 1OV4A 2Q45A 4NOKA 2O8FB 2I7XA 1VB5A 3MTAA 5LQNA 2RIRA 4HKTA 2ZBFA 3AF6A 3TTYA 4DM7A 5HQ3B 5JBNA 1Z2EA 3C87A 2A33A 4MPRA 1VJGA 3P8ZA 5A4KA 2J9FA 5BOSA 3D8TA 3GIRA 3RS9A 5D00A 3ZV6A 1A97A 3EWIA 3C3PA 5DNVA 5TE9A 1IWBB 1JFLA 3NT5A 3MJRA 3PNLA 3GJ3A 2E5WA 1R8QA 2XKBA 3CH4B 3CRRA 3S2EA 1UOQA 1X15A 1U1DA 4K40A 4ROTA 3IBFA 4K9OA 4J7UA 4NDNE 5EMJA 3UZUA 5FLXA 4UMDA 3D6HA 1Y6FA 2ODTX 3T4XA 4UCQA 2AD1A 1PJ8A 2IZ1A 2ZCVA 4CLOA 2GJPA 3P2MA 3OE7A 1I18A 4Y1FA 3DLBA 2GJKA 2ID9A 2FV8A 4G4GA 4NZZA 4Q3EA 5F5NA 2GNAA 5LQRA 3P2IA 2ZJ1A 1ZJ4A 2DPGA 4ZGBA 4H7JA 5A62A 2AV6A 3MGAA 1FP4A 5DLYA 1U28A 5HYVA 4X1IA 3JR7A 4JLWA 4KNWA 3MJDA 4FGUA 2GNOA 4JKYA 1XNHA 1E2FA 1C7QA 1CUEA 1V9CA 1U28C 1MQ8B 3SDBA 2ZRIA 1TYZA 2J4FA 4MYCA 1R9NA 4DIEA 5IKXA 2A9PA 4LIPD 8OHMA 5TVKA 1PSZA 1U90A 1XJ0A 3DNMA 4RNDB 2WJAA 5LDGA 4F85A 1AXRA 3BD9A 1LDGA 3CZ5A 4BC0A 3Q38A 2V3VA 2OA0A 1E63A 3RIHA 3ES9A 5IXYA 4JI4B 1XFDA 1II8B 2Q2WA 4G1FA 1Y82A 2Q27A 5SICE 3AXTA 5CEFA 2G3YA 3RYIB 4BATA 3C8DA 4YP1A 1JEEA 1Y6QA 3WMEA 3VPDA 1JKMA 1KJQA 1Z6QA 1WABA 5CLFA 3L1JA 1JFTA 4R6WA 1F7VA 2ID8A 4ECAA 4Y1RA 1VE5A 3H2GA 3UV3A 1XTZA 5EFOA 3UA4A 5BR4A 2N0SA 3H6HA 4FONA 1R16A 3RAJA 2DAPA 4OHUA 4X64B 4XKVA 3ANTA 5E38A 3RVSA 3ABQB 3WSTA 2C2HA 2C7QA 3D31A 4DDVA 3PHCA 1E1CB 5KCZA 5FTKA 4QJIA 1P2GA 4W5NA 3BFVA 1GGJA 5JNVA 5AVYA 2OCIA 4B79A 1RSZA 3DR5A 5CHEA 2E6KA 4TS3A 1T4MA 1R0LA 2DHQA 3KQTA 5GJVC 1N3BA 3ILVA 3TLCA 1T9ZA 4P86A 3TJZA 2WILA 2P4HX 3DD5A 4N3AA 4DUPA 1OWNA 3OJFA 1YULA 1CERA 4K87A 2KS6A 5DSXA 1EP2B 3WAJA 2ZRNA 4OA5A 3GJTA 5BYJA 3EDMA 5BUZA 2IS4A 5DTMA 5E7IA 3ND5A 4NYIQ 4YAFA 1NLZA 4RF4A 3UAVA 3O94A 3WI7A 4B82A 3W4KA 1HE3A 3U31A 3ELDA 3IBYA 1HZEA 3A28A 4Q0MA 5IYZA 3S2ZA 1XNRB 3SVLA 4IS3A 4I36A 1HDEA 3P9YA 4WY8A 4ETMA 3ZBUA 2I29A 1OC4A 1W4CA 2W0SA 3FPFA 4HDMB 1N0HA 2SBTA 2AOTA 2RMKA 3THRA 3O1HB 3ZHRA 3DHVA 3Q1KA 3B7PA 4QM7A 2NZWA 1Z9BA 3E9RA 2IWHA 3AHGA 4U39A 4DNTB 1KPHA 3T41A 3GUUA 3IA2A 4ILEA 4R3WA 1A9SA 3EVAA 2A1UA 4JCOA 1SWVA 4A8PA 1TK9A 1EP1B 4BLVA 1VSBA 2WTEA 5JU6A 1SVLA 3TW0A 1DC3A 5BWCA 4KR3A 1T0IA 1SN7A 2APJA 2ZTSA 2IYLD 2DFVA 3V6MA 3ZXSA 3EZFA 1MW9X 1T5HX 1JDNA 1RZVA 4WKOA 3ZLTA 3ZCPA 3AR9A 3QKRB 2DUWA 2IE0A 3AK4A 5ALYA 3TQIA 1YI1A 1XSEA 1Z0UA 3W5HA 2RFLA 1M1UA 3AU8A 4X9XA 3VU9A 3H5AA 4LF9B 1WL8A 4CN8A 3Q5GA 4IDQA 5E0KB 2WUWE 1F60A 3LOPA 4ATNA 5EMHA 5TGDA 3GLIA 3ICCA 4P32A 1TIPA 1AG9A 1N25A 3ZVRA 2EJTA 3FOWA 4GPBA 2D59A 1D2NA 3LKDA 4KR0A 3W34A 3W6UA 2IYRA 1TD9A 4V0SA 2HHJA 4U5XA 3HAGA 4CR8A 4OX9B 3AL2A 2AXEA 3G49A 1L6IA 5LZ2A 1ZEJA 1Q57A 3BA6A 3H18A 3IAFA 4PO8A 5JG7A 1MW8X 3AW8A 1I33A 1WDMA 3PGVA 1Q19A 4EGQA 3C3KA 4HPXB 1UDAA 1Z8FA 4DCGA 1EB9A 1Q74A 1ZSVA 4LDRA 3KWFA 3CMMA 1U1IA 3BRWA 1U8XX 1UT5A 1UBCA 3R5HA 4X44A 5AXAA 3UHOA 4WH0A 1QHGA 3SLKA 1N2EA 3NP9A 2P9JA 1I6LA 2RGCA 4V1CA 1WB9A 3O9VA 3R3JA 721PA 2D54A 1AHNA 1JG7A 1OW3B 3RI3A 2QAJA 2HXGA 2W6ID 5DN6A 3V8QA 4E6EA 2JNWA 4KFUA 4NMHA 1HT1E 2WPDD 4PIPA 1FRQA 1EUZA 4MQFB 4CKCA 1C4WA 5COBA 1AMNA 1CLEA 3O8RA 4TXHA 3DZCA 5DIZA 2RGAA 3V80A 3OFNA 1A9QA 2P3SA 4RF5A 1E3EA 2DC1A 2FGJA 1RU3A 1VXRA 2ANCA 3D6MA 3N70A 3O8OB 1G8HA 2ZE8A 2ZRAA 1RYNA 1E92A 4WKCA 3DKRA 4DC0A 3RYFA 5DNDA 3K92A 5DOZA 4G23A 1YI0A 4FUQA 5ERYA 1QIDA 3HXOA 1M1YA 4DEXA 3PP8A 2WF8A 5GADl 3KTAA 2SKEA 3FWYA 2A92A 2KB0A 3KDPA 2ZIXB 2GBCA 1M34A 2WWTA 1FLNA 1W52X 3L93A 3MTBA 4MAMA 1U2EA 4QUJA 5BP7A 5JR3A 2IS2A 3RC3A 3L49A 3IHWA 4QOHA 1PJCA 5K6RA 3NIFB 1S9HA 3PE6A 4Q9AA 3S29A 1PVDA 2A8YA 3U3KA 3MNFA 5A3RA 1YHNA 2HL6A 1L5FA 4TTJA 4B71A 3ANSA 4RL4A 1Z34A 1NA5A 1HTTA 3MAJA 3UPTA 1LZKA 1UDRA 2PGOA 2X23A 3VPXA 2W2NA 3IERA 4GMGA 4MUJA 4BXOB 1KI8A 2MSKA 3FJ1A 3U3JA 2OD9A 4UM5A 3X1WA 4A0FA 1C29B 2PX8A 3FMGA 1O6GA 1K66A 1W9HA 1JJVA 2VAMA 3Q3HA 3TL6A 5CFQA 5EJEA 3LVQE 4DQLA 2R62A 2QMUA 3SPXA 5K3FB 1Q0LA 3VTKA 3ZKWA 4PRKA 4TTVA 4IOMA 2JGMA 3GAFA 3HSYA 5AW4A 4DCVA 4KH0A 3HMQA 1OI7A 3KD2A 4G5YA 5JRZA 2OTLB 2CYCA 2YW2A 3FTPA 1JPJA 3M34A 2FKNA 1NY5A 3EGIA 3L0IB 3M4JA 2CFCA 5KYGA 1K9VF 4QUEA 1VRCA 3LY8A 3QF4A 1LLDA 2C7OA 4EX6A 1BHQ1 1YS9A 2OV6A 4LWZA 3LWDA 4QBGB 1R1DA 4TWBA 4LX8A 5P8WA 1RI4A 2PS0A 4PLFA 1YC5A 4C3VA 1KPIA 2QRLA 1QLWA 4EKIA 2UU9B 2X41A 4IGKA 4XRRA 2FP4B 3D81A 4CCYB 3IP5A 1WZUA 1T9GR 4UPEA 3PDWA 3GGPA 5LNK6 4ZWNA 3ZGZA 5HTKA 1XMJA 3EVBA 2C2OA 4L15A 3SR4A 4FLMA 2X4DA 4EMSA 1KMNA 1XMXA 3VDNB 1L5QA 3BL5A 4UM9D 4R05A 1IMOA 2DSNA 4CU2A 1LDEA 4C07A 4QTZA 2LKCA 3MRSA 3OEYA 2C8VA 4HRAA 2NAFA 1DRWA 5DNCA 1CJVC 3HA3A 5DSTA 2VPIA 5IAEA 5EEHA 3ZNOA 5BSVA 5JYDA 5GOTA 3R9KA 2VXBA 1SU6A 3QBJA 3RKUA 3R3HA 1RYYA 2VCHA 1C4OA 4CMEA 1RM0A 1SC3A 1ZGZA 3AF1A 4R7GA 2OUIA 1KR5A 2EBUA 1Q14A 4C0LA 1T1EA 1C9EA 5DSZA 3K1YA 4W7SA 4DIDA 2ZBRA 1CF2O 1DQRA 1N6PA 3GJXC 3OBBA 3PUZA 4CMEC 3LUAA 4YASA 5JDIC 2CXTA 2LPMA 1FW8A 2QTGA 4ME6A 4H7HA 1AU9A 4JP8A 2PUJA 2PQ2A 1ISJA 2QXUA 4URXR 3FGZA 4PS1A 2GCPA 3GFVA 4CLXA 3PDJA 1HZZA 3B9RA 1PEYA 4JLMA 5I9TA 3AKEA 4BASA 1UDWA 2WJHA 3CV3A 3CP8A 4DN6A 4DF3A 5B3AA 2EJUA 2NVUB 1AO3A 1NV9A 1YDFA 3AP2A 3STTA 5J2UF 1COWA 4FGLA 4BNMA 2BKVA 2WR8A 2ZSAA 2B4TO 1M10A 3F7TA 3NC0C 4L5BA 4UJ5A 2FRXA 2I8LA 3BSYA 2Z6VA 2OXRA 1XZMA 3UMCA 4WKBA 1GZSA 4X62B 1JTVA 2UUBB 1WHSA 2NP6A 3C6KA 3EAFA 3NOQA 2AOUA 3U7GA 1YT5A 4D4MA 4LWPA 2XKAA 2OOKA 3BTOA 4DREA 3OMXA 5COQA 3TCNA 4B48A 1Q0SA 3ZE2B 1P5FA 4FW9A 4QJ4A 2VH5R 3NAGA 3AM5A 4YGXB 1R0CA 2VP0A 4RZQA 3NTQA 3BB3A 4GM4A 3T9DA 4MVJF 4RENA 4AF6A 1XK7A 2EJWA 3V1NA 4TT3A 2CJFA 3EQZA 3FMPB 3QXGA 1FX0A 4WNYA 2ZUFA 3BH0A 2AXNA 1ULBA 4QRHA 1DTEA 3ACBA 1RRMA 5J4VA 4I1OA 4Q7LA 3SZ3A 5L46A 1SBCA 4Q3CA 5HZMA 2NLOA 4L0CA 3G79A 1YZNA 4GECA 2DTXA 3K8OE 4J7XA 4BBJA 5KNBA 5CAEA 1VLOA 1NATA 3C6QA 4M2LA 4GUAA 4MUNA 4C0QC 3UFBA 1X1BA 1H4VB 5K3BA 2IEYA 2XF8A 4HLQB 4BCBA 4C0XA 2F3UA 4H1WA 3W9UA 1JEDA 1P9LA 3P26A 5HILA 2AA3A 3DHWC 4JI0B 4YI5A 4ZQEA 5TY0A 1ZGHA 3MLBA 1LA2A 4CEIB 5AVWA 5ALPA 1TMGE 4B6FA 1Y8RB 4CQJA 4ZKDA 3VR5A 5TEVA 3VR6A 1VGQA 4UEWA 2P9CA 2ZIEA 1NBEA 5F5XA 4RD1A 2G08A 4N3NA 1ZW1A 5DT2A 2H31A 3INTA 3VDRA 3NHMA 2P11A 4GXTA 4MMZB 2IHUA 2WAOA 1P2SA 3VZRA 2Y6VA 1NUSA 4P3KA 5L3VA 4BZWA 3KXDA 4MSUA 3IMFA 1ZM2A 4F2PA 3U4QB 4CM4A 1W7AA 2GD1O 1D4FA 3T38A 1VPLA 3FYDA 3H8VA 3NU1A 4EUHA 4X85A 2OZLB 3EF3A 3UF0A 3O6VA 3I6YA 3NJRA 4LZWA 4Q4CA 2YJTD 3U3RA 4K1XA 1M72A 2M98A 3BZUA 4RIHA 2OYRA 2QX7A 5K8LA 1A8PA 3U37A 4JVNA 5BNFA 2AR0A 1P31A 2CF5A 1XMSA 3NOXA 4IDPA 4LYFA 4X6UA 4XGQA 1QQ5A 2O3TA 4EG7A 4XRGA 4DNFA 5A9SA 3FY4A 3R9WA 1SUBA 4DDMA 2JH3A 4PIMA 4DEVA 5JTUA 1MKYA 1P1JA 2JLRA 2PUHA 3AVXA 2DT5A 2FF7A 3FTCA 1EX1A 1SD2A 5DGXA 2VHCA 1HE2A 3UUFA 5A5VA 3ZJTA 2G0NA 3G05A 4HZUB 3TZEA 5C46F 1KJZA 3PQ8A 1KZLA 4HXFB 2GK3A 4QFDA 4BE9A 2V6GA 2V1XA 3BULA 2CGEA 3NWBA 3ND8A 2VJLA 2XF2A 3NHUA 3I04M 4G0ZA 3K20A 1EFHA 2GQFA 2OHFA 3NT2A 4L5JA 4OSPA 1EIWA 3GNQA 3NNDA 1J7JA 4IX1A 3GY0A 5AP9A 3T9BA 2LKDA 3TIXB 1KJIA 1IZZA 3H13A 3H8JA 2P6UA 3L6OO 3AYZB 1JR4A 1UZMA 5DCLA 2PFSA 3EWAA 4PHHA 4XFKA 4YV2A 3FNEA 4PC6A 2PSEA 4G6ZA 4RESA 1SVNA 1WMFA 4IYRA 4JYCA 4JUCA 1SOVA 3GHHA 2F1OA 1C41A 3CPWB 1G63A 1LLCA 2IPLA 3PGLA 1F0NA 4Z1MA 3A8KA 4UULA 5IH3A 1L5GB 4TTAA 1LVUA 3UCFA 3HUFA 4BLTA 4HXEB 1WAMA 4AMVA 2OPBA 3UG7A 3B9BA 4V3CA 1R6XA 1EFPA 3H2JA 1ATIA 3AV0B 1E2UA 4QGGA 1YVPA 3NKFA 2JGDA 3H94A 1V3UA 1TKCA 4KPUA 3VH1A 1M74A 4KWTA 1WX1A 4CRWB 3QEBZ 1FS4A 3V4ZA 1HDYA 5E3HA 2GXUA 1DUVG 1E2DA 2EZTA 2R1ZA 3QPVA 4HEHA 1NP7A 3I9JA 4JUAA 3R5TA 1L5KA 2Y1CA 3UOAB 1MX1A 1F1JA 4XVHA 2OSBA 3F9IA 3UXHA 1F2UA 3ETNA 2WOJA 5EJ2A 2UVDA 4JBYA 4REOA 5JMOA 1RYMA 3FSGD 4RDXA 1QU2A 4HFJA 4MVJM 1WXWA 3HZZA 3D7MA 1HETA 4RKYA 2GH1A 5FEUA 3RSGA 1FU7A 2C2WA 3K3PA 2YKGA 2XMZA 1GTG1 3OZIA 4JQCA 1TW2A 1GCUA 1K2VN 1N2XA 1QS0A 2HREA 5K8IA 2HIAA 3U4IA 1CRQA 3O8DA 3QLVA 1NJID 1I5RA 4M1SA 5TPWB 3SBEA 2WYOA 3TX2A 5C8DA 3Q12A 3MCWA 2ZB8A 2J08A 4YJ3B 4OQDA 2PXXA 3C3YA 1JG3A 1QH0A 5AJYA 5T3YA 4ARAA 4CV3A 4ZDJA 1BE0A 2JJ2A 3FPPA 1VHEA 2FSIA 2Q5EA 3EW7A 3QLVC 2QQGA 4KQJA 4YECA 2W43A 4IJ6A 1JH9A 3ED1A 4ALJA 3L0SA 3VYUB 1WDKA 2C0CA 2ODAA 3T61A 1G3UA 4KMMA 1ZA1A 4ZGWA 1ZVMA 1DAKA 4UOZA 5IPFA 1KO1A 4HN9A 1AV7A 4A6XA 1VHTA 4WBNB 1E0KA 1U0TA 4G9EA 4A0SA 1PI3A 4P6YA 2BCJQ 1AKUA 1PJQA 1QTIA 2CCGA 3DOOA 3CD6B 3PITA 2CJYA 1L9XA 2RI0A 3CLRC 2Y0DA 3BIXA 1PG5A 3EW9A 1MAHA 4X41A 3EXHA 3DDYA 4DPLA 4IICA 4OGWA 5IDWA 1ZOPA 4TVBA 5FUBA 4KR6A 3GOQA 2VH1A 4AMYA 2V03A 1DKQA 5IP5A 1YBAA 5CFLA 4G0WA 3OEHD 4RPCA 3UOWA 1TLFA 1QZZA 4NC9A 2J0QA 4OBXA 3AJEA 2H63A 4OYLA 4X1YA 3LY5A 2AOWA 2DYIA 2ZDHA 1N75A 3NHSA 3W5SA 1ZD4A 3I3SR 3EMBA 1JLSA 1R0XA 3GF4A 4I8XA 4QNNA 1FA9A 3GVJA 1XDGA 3AHEA 2XMRA 4HYEA 1Q3TA 3OLXA 2C8KA 2IZ6A 2G88A 3DZIA 4OPMA 1VHQA 2QN2A 3PJDA 5EJGA 2NGRA 3JALB 1X1QA 2C7BA 1U4NA 4PU0A 2NU9A 3EEYA 4O0MA 2J48A 1T8SA 3VNSA 4XVUA 1YJNB 1SR8A 2Z1DA 4QQ8A 5KYXA 5EZYB 3J81A 3DAPA 5T4FA 4CDMA 1FCJA 4UBNA 3IS3A 1ECCA 2YWDA 1RWVA 1MRSA 2CNNA 1OFVA 3FFBA 5F4ZA 5FNVF 2A0YA 3VZPA 2IHNA 3OZFA 3RYHB 4HGNA 1P39A 5ALDA 1PZNA 3BWEA 2PZBA 3PDUA 3G85A 4COOA 3LF1A 3V1YA 3PHBE 1TYDE 3QK7A 4D9EA 1I2AA 5JCXA 5M04A 2ZEJA 2CVZA 4V39A 3WLSA 4AJ1A 1UEXC 3L06A 1JWAB 4LRTB 3V7WA 4DMKA 4KKVA 3P52A 3A4LA 3TAXA 3I28A 3BQJA 3ITDA 1YLOA 3SHVA 1NGSA 4BOYA 4HH3C 3RSZA 2JAOA 1SOMA 4GDMA 4LVUA 4RZXA 2W2LD 3ROFA 2GFHA 3I8SA 5CDGA 4UUBA 2R97A 2G1PA 2XTAA 3QH4A 1L0BA 5CH8A 4AVZA 2GN1A 2R6R1 3I3OA 1XHFA 1LC0A 4BNTA 4EMTA 1A50B 2QAGA 3N0TA 1SD5A 2XBLA 3T06B 4UM9B 5GIPE 4PQGA 3JQCA 5CK5A 1DZIA 4XLLA 3F5SA 4GI5A 4O33A 3DH0A 5K3EA 1N9ZA 1W0KA 1FQJA 1K3TA 2D2IA 3B1XA 5KJEA 3F6BX 4EP1A 4DR1B 2GYYA 4XORA 1WG8A 4RC9A 1OB5A 4G0XA 5C5EA 1FTSA 3N6XA 2WM3A 3ANYB 4WOPA 3N2KA 5JNLA 4IJ5A 1HE8B 4JQYA 4HFRA 4BECA 4EOGA 4YRMA 5BV8A 4KR7A 2X6RA 3JQQA 1QZUA 2L0XA 5EVCA 2A2ZA 1JJ7A 4Q7EA 2PAFA 3PKZA 1EWTA 2NNLD 3RUDA 4BZZA 3THWB 3TD2A 4RQBA 3WDSA 3DEZA 5EP1A 4KXLA 5T5QA 4BRUA 2QRVA 4AX4A 5HJ7A 1KETA 4YAGA 2QN8A 5C18A 2QX8A 3HWRA 1OPXA 3K70D 2RHCA 3QHQA 1COZA 1HA3A 2VVTA 5JWRA 5F4OA 1IN4A 3WBKA 1HYBA 2BI4A 3I0ZA 1L2TA 3IVXA 3IT1A 1FNCA 2HPHA 4MH0R 3VSAA 4GR4A 2QN3A 2F3RA 3DBRA 2VK2A 3KQPA 4XUEA 2SKDA 1NPTO 2Y68A 4WADA 4DABA 1FPMA 5B1HA 4PYLA 1CUFA 1MAWA 1DOZA 1O6BA 2HSGA 3ABOB 3HFSA 4HR7A 3UY4A 2C5SA 1J2TA 1W4BA 2AFVA 3MILA 3QFSA 4R2JA 4S3MA 3WLRA 3GHYA 4C29A 1T24A 2QV0A 4AP5A 2GZRA 5IKEA 3GRPA 4IS2A 1RZRD 4NZMA 2PD6A 3HPRA 5DYGA 3FUUA 2PGDA 1OLUA 3OHPA 1AS0A 5IFKA 1PAUA 2YXPX 5IYWA 2E1RA 1LVGA 5AM3A 4Z2YA 1R6AA 3PI7A 1DT5A 3RC2A 3BMOB 4DV2B 5A7GA 2ZYIA 1GKKA 1PDWA 4ZPXA 2G6TA 2XUZA 2QVGA 4PZUA 2ZETA 3W06A 4CMIA 4CQMB 3TEMA 4QD3A 4WVFA 1ZJJA 3P0RA 3VPAA 2GPSA 4F6RA 4HDRA 1JJFA 1NZDA 3BD7A 2AFHE 4N0DA 1ODLA 1ST3A 4P0QB 1N8NA 4NEGA 1KZHA 5JYBA 1KVSA 4CM3A 2A9RA 4AAYA 5DBEX 2H1IA 4Z4VA 1EEXB 4Z4YA 2KSQA 2J41A 2I2BA 4CM8A 5C9ZA 3PXBA 2Q1TA 3A6KA 3P4YA 4UPDA 1I2ZA 2LCIA 4BMVA 3LYAA 4F6LA 4Z4QA 4OFWA 2GEUA 1MEEA 1ML3A 1I3LA 2YVAA 3CCFA 3MBIA 2VOEA 3AX6A 2I2XB 4X7DA 3T15A 3TWOA 4BRSA 3IELA 4RE5A 2Q8NA 3FMIA 3IRVA 5AOVA 1Y1PA 4FHEA 2AQ8A 3QTLA 4HLCA 1Z2PX 4UNQA 1U7UA 5A4JA 1N78A 1VSQA 1X1DA 3E3LA 3LVBA 1YH3A 2Z6AA 1TDJA 4XN3A 2HBRA 5DW0A 1V35A 2CL6X 3LUCA 1FXSA 1LPAB 2GPYA 1BO6A 4BX9A 2EWWA 2EATA 3IBSA 3ROQA 4BB6A 1PZHA 4UZFA 5LN1A 2F59A 2R5WA 3WFJA 4PC1A 3RAGA 1P29A 1QVWA 3ACDA 3N76A 4Y2QA 3JWJA 3AT1A 3HCWA 1FIUA 3IOBA 4F4CA 1LXCA 2XMSA 3D59A 3QHPA 1A98A 5TNXA 3VPFA 3B1YA 2YYYA 1A27A 5J2TB 2JFFA 3PYXA 4GWKA 5AM1A 3CCJB 2C9ZA 2H2FA 2IX3A 2B92A 3BFPA 3OCYA 4CIWA 1MH1A 2NX2A 2P6MA 4R1QA 1HT2E 3UGQA 1Y1SA 3VSBA 5IYQA 5D2CA 4ZYWA 4CNQA 4TKLA 1CR1A 4G5HA 1O97C 2EHJA 4LXXA 4RGQA 4DG5A 3O7MA 3NBKA 1I3CA 3AUTA 3AEXA 2XMPA 2XYVA 4L4UA 3CPXA 1PUIA 4FMDF 4NIMA 1SBIA 1Z6TA 4Q24A 3LQEA 2OFPA 5DHAA 1HOXA 4ZYXA 2PKRA 1K86A 1BGVA 4GPTA 5AI0A 2PWAA 2FCAA 3VKGA 5CW2A 1NXXA 3H0CA 4OQXA 3TOXA 3HVUA 4G1MB 4IMJB 5BN5B 3WYCA 1R5OA 3MCVA 4Z4TA 1UBRS 4HE6A 4PYQA 2IRWA 4DBLE 3BXOA 3TO5A 4IGAA 3C8UA 4ES6A 4AULA 1MC1A 2PY6A 1TCBA 3SLDA 1B15A 1OFIA 2VJBA 2YHIB 3E9EA 4MV0A 2FR1A 4DMGA 1FNDA 3IP1A 3E61A 2FJ0A 3RVKA 3NGMA 3PCRB 3OJEA 3QTTA 4DCCA 4UD2A 5F1KA 1VRWA 1W88A 3G5UA 4ZCQA 3KUUA 3BGOS 1QHEA 3E58A 2OQVA 3RUPA 3SG0A 3EH2A 1UINA 3L3BA 3P71T 2C4TA 4ZCLA 3PJRA 4KKXB 4C5BA 2O5VA 3BL6A 5ICEA 3CCCA 4OQEA 1QDLB 4B40A 3PNPA 4CV1A 4B6QA 5FUXA 1D3AA 2ZRMA 1N2CB 4P1VA 1Q20A 1Z7EA 1GNSA 1TPYA 4A6EA 4IV0A 3WDMA 3EG9A 1XTTA 3T7RA 2E2WA 3OA2A 1IOLA 5DW3A 1N5IA 1PQ4A 2ZB7A 1KZ4A 2ARKA 5KDOA 5FV7A 1ZMXA 5F1YA 2FPGA 1Z17A 3WOVA 7ADHA 2ZAOA 2CDCA 3L84A 5ILQA 4A2PA 4PGOA 3BFJA 1QIMA 2ZTUA 2PGNA 3BCSA 4QRDA 2IXGA 3WP0A 1AN9A 5ICMA 1ZAYA 2NSDA 4RFSB 3KM0A 1XZBA 2C5GA 1G8PA 2XXJA 3PF8A 1KHHA 1A9TA 4H3KB 1XVLA 3TQQA 4E15A 3TW8A 1E2EA 2PTHA 4O3FA 5IXJA 2ZRDA 4RKWA 1PEAA 5JEDA 2BGGA 3DTYA 3K16A 4R1OA 3M89A 4NBWA 5NLLA 2V3CC 2B3DA 4URWR 4G0VA 4KE8A 4MVWA 3CR8A 1YK1A 1Q2UA 2R11A 1L5OA 4IMRA 3UAYA 4EA7A 2W42A 3SF8B 4XWAA 1T3GA 4WN9A 1UK9A 3O0TA 1GTJ1 1GZ3A 1PJ3A 2ZJAA 1TEHA 4JT8A 3W7AA 2DEUA 5LMZA 2R5NA 3HJAA 4RIIA 4X95A 4JBNA 1U9CA 3FLEA 2KQUA 5CTAA 3ADKA 4DLYA 1SCBA 4FFBB 2JJQA 3SS7X 2WOOA 4ZAWA 4EVIA 2PSHA 5AW5A 3GVPA 2NVWA 5EGNA 4DTIA 2NQ2C 2Q41A 4RJ2A 4E5PA 3U5ZB 1SCAA 3OUTA 2CL7X 5CH3A 3UENA 4MS3B 1E3MA 3AR2A 4YRNA 4UEQA 2O0JA 2J67A 1A7KA 1U8UA 3KLOA 4W7HA 1AKMA 3QJ5A 3V4RA 1DKMA 1GRNA 1VJSA 4MVJD 4X84A 2BFCB 5BYAA 4J4TA 2HADA 2GRUA 3W2FA 1JJBA 2P0EA 3OPVA 3ZS8A 5BWBA 4JITA 2FDCA 7ABPA 3LW7A 2E89A 4JX9A 3LDUA 4DV1B 5LJLA 5ARCA 3ZWDA 4FT2A 1NMQA 3ORHA 5BNTA 3N0VA 3RSQA 1QRDA 5FLEX 1QQBA 3RJ5A 4NESA 1LRLA 1JDBB 1ZUD1 5C0OE 2I9KA 2EBWA 3I01A 4Z4IA 1P6XA 3AHIA 3QWAA 1MTZA 4N6NA 4RZUA 4AJ2A 2QTVB 4Q1AA 2QZZA 4TLLB 4ARSA 2CL5A 4JDPA 1IPHA 1QVVA 4TM7A 3RW9A 1Z5ZA 4O08A 4CBVA 3PTAA 1R15A 1RT9A 2ZW9A 4D4LA 3TIIA 5TR9A 3HDJA 4BFVA 2JI6A 3GQBB 3WWCA 4AF7A 4HFNA 3ONFA 4BJ5A 4KKUA 3BCUA 3U7IA 4RDLA 2QZ4A 3JZIA 3IA7A 1C7FA 1FFDA 1RCUA 1DPFA 1UJ5A 1IN8A 2PEYA 3P1JA 3Q8MA 4ACAA 4HXGA 5KSOA 2WLTA 1Y1LA 2INGX 2FN7A 4RV5A 3OT1B 4E5MA 1XZNA 1AZLA 1TUBB 1KVTA 3U61B 1AGYA 1Q11A 1JRLA 2HDHA 2QVYX 4IOJA 4JJZA 4MAFA 5IBQA 3THOA 3FPAA 2Q2NA 1SQGA 3SVZA 2ZBVA 3CLUD 3HA2A 3OTGA 1RBYA 1WSDA 1IUPA 3RWOA 4BY9E 1E18A 2GBFA 2W2QA 2YXEA 4DYHA 5JVDA 4EABA 4HMOA 5H9WA 2BEUA 5JRDS 1B16A 4Q4AB 3F8TA 2CW5A 3K71B 2AKEA 3VGPA 5IBPA 5A9TA 3SM9A 3DWIA 2NN3C 3H2BA 4IZIA 1YQWA 5AHKA 2P0YA 3BF8A 3GWGA 5E1BA 5C5DA 5IDXA 1BFUA 2Q1SA 4NCHA 4CKBB 1TJYA 3K70B 3DCNA 3VNQA 3N2EA 3PHIA 3ZXXA 3W7BA 2CLHB 3EGDB 2FRDA 1Z2AA 3MEQA 3GLHA 1YQTA 1U0OC 3QOXA 2R8ZA 2WZNA 3DE6X 4MJLA 2P5TB 4MGYR 3COZA 2F3PA 2FRDC 1RVDA 2HXSA 4Q82A 1WB6A 4P54A 3P0JA 1E1DA 1X87A 2FQ1A 1T6NA 4GYWA 2FETA 4C4ZA 5HRAA 4X7RA 2A86A 3L07A 3GO4A 1A8IA 3N7AA 4Q9NA 3TLEA 3T5PA 3CCRB 2QSZA 2ZQ5A 4YMGA 3VU3A 1OX6A 1SCQA 1RJGA 1J70A 3AZOA 3GSIA 1XZDA 3NIWA 4FSXA 4X8MA 4EZEA 1SUAA 3T7SA 4BMYA 5C8YB 2EWMA 2O19A 1XP8A 3R7BA 2XW6A 2EFEB 3R5SA 4C14A 1CZRA 2AGVA 2GO1A 3CW9A 2FPPB 2P77A 2XGGA 3NKVA 2PXCA 2QK4A 4GZ5A 4E5VA 2XXAA 5E9WA 3S2IA 3ZWXA 1TK3A 1R8YA 4FFPA 2XD4A 5HUQA 2FPUA 1IWOA 5FOXA 1V47A 1GKLA 4N01A 1EVZA 2FEXA 4QUHA 2NUTB 3QOYA 3JQGA 2ZTVA 4QBHA 1VQNB 2DOGA 1PNTA 3SJCA 3WB0A 4EA6A 1YU6A 4A1FA 2GUGA 1Z16A 5F7ZA 3FF1A 5AKLA 1L7MA 4F5WA 3NDJA 1J8QA 3RJZA 4OHRA 4CKEB 2VJMA 1NI4A 3F78A 3HE3A 3TZLA 3KHTA 1I3OA 3KQKA 4WZBB 2W2XA 4KO8A 3NBQA 1DEXA 3SX0A 1RWBA 2IYFA 2QSYA 3GPBA 4F8YA 3LWBA 5EHNA 1TYBE 1U0HC 2A1TR 1N5JA 4EI9A 1ZIPA 5PGMA 2ZIZA 4Q3LA 3WRVA 5JXIA 3QA3E 2DMRA 4MJ3A 5JMWA 1EDDA 5FPKA 1BDIA 2IXBA 4UHKA 4OYYA 1WDTA 1EK1A 1CP3A 2FWIA 4BDTA 1JAXA 4L16A 2PH3A 3TZQA 1L4BA 1E9VA 2Z95A 1PW5A 4TLAA 3GR6A 5FA8A 3DBLA 2M32A 3IUQA 4HJRA 5TC4A 2QE7A 2P9EA 3IHLA 3HXLA 3IO5A 4UE3S 3CC7B 2ON6A 2PZKA 1PT7A 5CVJA 3B3GA 4G01B 3UANA 1JLMA 2R7MA 2W6PA 3A8TA 3L7YA 4NYJR 3UXYA 2D2XA 2OHVA 5HDQA 4AJIA 4LNUB 2WBLC 1JR3A 3FNGA 1EIZA 3IVAA 4B6RA 4Z8YA 2NW6A 1KH3A 4G24A 4I1IA 5T57A 3G2MA 3UWKA 2QY6A 5CXQA 7MDHA 1VE9A 2BEVA 2RK6A 3QE3A 3OICA 3ZIUA 4H77A 3UWOA 1B8VA 3CINA 5D87A 1GG8A 5JARA 2J0UB 1CUWA 4DNPA 1ZM7A 1WLYA 2XTJA 5EHXA 2AX3A 1AB6A 2X8JA 3DZHA 4PLTA 2OQRA 4PZAA 3SBOA 4D3YA 4J49A 5ADWA 2GN8A 2IPOA 2ECKA 4CR6A 1XQYA 2ZR8A 4JB2A 1A4UA 4Q1DA 1EGQA 3WHLA 2YWJA 4XLHA 2VKQA 1VFNA 3HWWA 3PUXA 4M9UA 5ENZA 4F04A 3QEMA 5E6SB 4Z7JA 1NVGA 2X5OA 2H92A 1E5LA 3OIVA 5CH5A 1Z0SA 2VA8A 2BGWA 2IQIA 5FL7D 1NN3A 2D06A 4G5RA 4HTAA 4UFNA 5FBKA 2AQKA 4P93A 1EBUA 1K7YA 4UDYX 3QLJA 2Y3IA 2JN9A 3D7NA 1LSJA 3RE1A 5JZOA 4PR0A 3NTXA 121PA 3FPJA 2NP7A 5CDFE 1S3IA 1T3ZA 1WF6A 1Z18A 4GLFA 4J91A 2HSDA 5EA2A 2I62A 5ADVA 2FHPA 1F0PA 4W5WA 3AEUA 3ZJVA 1IBSA 3C98A 1Y8ZA 3DF7A 2NYUA 3UQZA 4JX8A 4BPRA 3P4UA 1K7XB 4RH1A 1U4OA 3CLKA 4XGKA 1H2AS 1M6WA 1RWQA 3A14A 3IUNA 1YX2A 3FLAA 1QQ7A 2A6PA 3IJEB 5B7PA 5FTLA 5JTTA 2IUYA 2REQA 2QORA 1R18A 2I87A 3ROGA 4EI2A 4YV1A 2O50A 3EN0A 2JAHA 4KXMA 3CNEA 1EEHA 3WK5A 4HT3B 1PLKA 4H7IA 5AIAA 4ALIA 3G0HA 1XJ5A 1M7BA 2PS1A 1RHQA 4Y1EA 4E1BA 1PCXA 1G60A 4H6VA 1DQSA 3B2QA 1PFVA 5F9FA 3REOA 3L8DA 2DB3A 1JAIA 4FR5A 1EFVB 4H4DA 4F5YA 1USWA 3ETGA 3ZE9A 4YCLA 3PC8C 4L1KA 5JQGF 4C2UA 3LQYA 4KKTA 1Z15A 2O23A 3CRQA 4QODA 1BMFD 4R1MA 3RYCB 4ZC1A 2C92A 4QFBA 3R20A 4M1EA 1T0JB 1NLFA 2VK8A 4WMLA 2QI9F 1PWHA 1E3JA 2RGEA 3AR5A 2YV5A 2CZCA 2G5GX 2C5HA 4TMTA 3HG7A 4FE7A 2GXQA 1ZM9A 3ZNQA 3JZAA 3CF4A 221PA 3KG2A 2ZXEA 3HYTA 3KB6A 4NBSA 2NTNA 2H7CA 4UTVA 3ONWA 3AF4A 3O90A 4D4HA 1BMDA 2ATXA 1W85B 3EG5A 4J8PA 2PGXA 1SXJA 3CF6R 1FLAA 1N6LA 3LCCA 4JP1A 4B81A 1P2UA 5EJIA 4MS4B 1QVGB 2BBSA 3ET4A 4GMDA 1LPBB 1GQQA 2EL7A 4QGHA 1JMVA 5CAEB 4AQ7A 1Q1EA 3LM8A 5GOZA 4GI1A 2Q1UA 1SXJC 1P9NA 4TXNA 2HSZA 4I50F 1N2GA 1VPTA 3MS4A 4HMQA 1EPUA 3CSDA 3L7AA 1DDIA 4NBKA 4V0QA 4NXNB 4PONA 2I4OA 5CA1A 3FVRA 2IX9A 1IN7A 3CXCB 2FW0A 2FX3A 2JIBA 1REQB 4XN0A 3B12A 3MYYA 1H1LB 2WIDA 1H8EA 1D2HA 2X1VA 1B3RA 5CVUA 5HM6A 3DE1X 4LA4A 4DZRA 3V8NA 1VB3A 4HL6A 1PQPA 1DSSG 1ORWA 1C1XB 2QPOA 2LCQA 1F2VA 4GXRA 3TQTA 2GR9A 4LXYA 1T5LA 2KJQA 4RS3A 2I2DA 4PQYA 4F2GA 2RC6A 4GLOA 1OLSA 2X4LA 3FHTA 1R9GA 3AW9A 3KSRA 4M0LA 1LPOA 3AFNA 5CM8B 1EVEA 5LM3A 5BVHB 3EVTA 2X0RA 1Z29A 4B2PA 2ZYWX 4XYLA 1NBMA 2IFTA 4E2XA 2ICAA 1J21A 2EKZA 1CEQA 3OIGA 4EUFA 3JQAA 3Q6QA 3GVCA 2B1GA 1IPFA 2EFJA 1BSVA 3D8BA 3OZUA 3PUJA 2B8TA 4LTMA 2HLDA 2ZSUA 1MG0A 4PLVA 4A2CA 3Q3GE 4IIVA 3U3OA 3FZNA 2H1LA 1P7PA 1ZUNB 4O2AA 1GRCA 2WHYA 1YOVB 3CX8A 2ISQA 4DADA 4PPYA 1KSFX 3F6EX 4Y2VA 1FBNA 2BP7B 2XCTB 4BO2A 3FVQA 5CFPA 1OFGA 4IO0A 3QX3A 2BELA 3H9NA 4MX8A 1B76A 3NTRA 4LJRA 5EMNA 4QYTA 5JZMA 1L7XA 1VHWA 1XU7A 3OY7A 1W4ZA 4PBSA 4YP6A 4GOKA 2AZDA 1T5IA 4PG4A 1GU1A 5DFAA 1JG2A 1Q22A 3AMVA 3ESDA 1AKNA 3JQBA 5LOVF 2EZ9A 3WMGA 4HN4B 2CT8A 4Z6KA 3GH3A 3OP1A 1VI5A 2CLLB 4BO8A 1B0ZA 3JRWA 1P4GA 3KKLA 3KQOA 3ROMA 3KAJA 3R74A 2UAGA 4URHA 5B1SA 4II7A 4HHEA 3CM0A 3K5IA 5EKTA 4P83A 5D3KA 3OIWA 2FEAA 2ZZMA 4C43A 4F71A 5CA0A 1KKMA 3T9FA 2QJRA 3JPYA 4REMA 2WJ3A 1GNLA 4TLMB 4DIBA 1RXCA 4BKMA 1ZD5A 1SKYB 1KF0A 1Y63A 3S55A 3NM6B 4CGZA 1RC8A 1W1UA 1Z7YA 5DLQC 5DXAA 5ALMA 4H17A 2ZSHA 3QJYA 4HNAA 2DJIA 5IK2A 5JYEA 2VZ0A 3VGJA 4QVIA 3QPAA 1IK4A 2Q0SA 5LIPA 2HWUA 3HXMA 5K4GA 2D1TA 3UXEA 1SEVA 1QTRA 2FP3A 2G1KA 3EA4A 2ODQA 3OP4A 2BKEA 1EWRA 3GRFA 1SWWA 1Q7GA 4LZAA 4BB9A 2X7XA 1ECJA 4EGCB 1PK8A 1WSAA 3UOGA 3W9BA 5L7TA 3GXOA 1Y42X 4Q1FA 1EZ1A 3ONYA 3CG0A 2Q9BA 4NK4A 4D8YA 2XGMA 3NCHA 3WK9A 4U0JA 5ED0A 1SXIA 2KMLA 3D7SA 3WMWA 3SYRA 1MOZA 2C4WA 4RGBA 2AK3A 2Y1OA 3Q9LA 4BBPA 3L46A 1GL3A 3ZS9A 1FYXA 4UUAA 1G8GA 2X8WA 3AKZA 3MA0A 1FDVA 1YB1A 1JWBB 2Q2VA 4G2NA 1CUIA 4RVHA 5H3HA 1GPYA 5GZ6A 4J2HA 4EUKA 3PWSA 2D4HA 2V6IA 1B6RA 3PQEA 5AI8A 2PE3A 6GPBA 2O3QA 2WJPA 3R7LA 2ZE6A 4WXPA 3SI7A 4PANA 4IUBS 4AKGA 1Z8DA 1P1KA 3S81A 5E95A 3PFFA 4X0CA 4O3MA 2UUOA 3GPIA 1ZL2A 1HI9A 5KREA 4DV4B 1K0FA 5K3DA 4U1RA 5F33A 5AHRA 2WYWA 1C1HA 1VCHA 3E5HA 2PO7A 4G7XA 3II6X 4L9WA 4JLUA 3MK31 3DVLA 3OEEA 2M6RA 5FWNA 4JFAA 1T43A 2PWBA 3WNCA 1PX0A 3H42B 4HSGA 2QPAA 2ZS8A 3H7AA 4A0QA 3I23A 2G06A 1SKMA 1X7GA 4OQYA 1EJBA 1Y4DE 4QFMA 1XEXB 1DARA 1MPTA 3CURA 4PAAA 3OF5A 4NZPA 2RK4A 4BN5A 2XUKA 4BP8A 5JCJA 4TWIA 2X14A 3KUXA 4OJNA 4JJIA 3SC3A 5FI1B 3OA0A 3LWNA 3AEYA 1CXZA 4GOXA 4BQOA 3CONA 2C78A 1LH0A 3FRJA 3K4HA 4D41A 1SBZA 5CP8A 2VDJA 5DMHA 4EY3A 3K94A 3GCDA 4OQMA 3NBZC 4R1NA 5FUWA 3TRDA 1FFWA 1DJNA 2YW9A 4Z0HO 4AUMA 1ZI8A 2K7ZA 5DRYA 1N2CE 3L1UA 2HH9A 4V0NA 4YAJA 1EE2A 3BN3A 2XWQA 4R71A 1OB2A 4C1BA 1DIOB 1QVZA 3RQIA 4FX2A 5L53A 5HQTA 3A05A 2XUGA 3LGSA 3O4IA 4IUCS 1GY8A 2F3QA 1VOTA 4XDGA 1QGYA 4DJJA 3KO8A 3O1JC 1JA9A 2V7GA 3G7UA 4JAVC 3ZIAA 1KGDA 1SHLA 3IJ5A 5H7XA 2ZJ4A 3FFTA 3N86A 3OWOA 3UTCA 5DM70 5C1PA 3PK0A 4WY2A 1SK9A 3PNMA 5EZSA 1CPYA 3IXQA 2H0RA 4GOND 1WP6A 1V0JA 2WM2A 5KIAA 4PZ9A 3CIOA 1CD5A 2JATA 3JAWB 3PC7A 2LV8A 5A4AA 1CKEA 3EVDA 1P72A 3CWZA 3DFZA 2BR4A 5B1YA 4R1PA 1JZSA 4EJ2A 1H2WA 3ECCA 2CXHA 2HNAA 2N1MA 1MT0A 3K9CA 2R6HA 4RZ3A 3IKTA 3RVNA 2G9UA 4JI5B 1YDHA 1VG0B 3L1KA 1UOOA 4FW8A 2R86A 4JZKA 2W6NA 5I7AA 4G8CA 5B58T 2YXLA 1P73A 3RVRA 4OQFA 3WGLA 1Y3FE 2ECPA 4N5NA 2CUZA 4NZNA 3A3PA 3F2VA 3TXYA 1EDEA 3LPMA 2DKFA 1A04A 1P33A 5IEJA 1DCMA 2PMFA 4D9JA 4U2GA 4E0FA 4JQOA 5D6OA 3PUVA 2ZZEA 1P1RA 4L07A 1Y8QA 3L43A 3ADDA 4M0CA 5EHGA 1J33A 2F8LA 1L8QA 2Q5IA 5AJTA 5IWCA 3D8NA 1YE3A 4KBGA 2QD3A 1V9LA 2KI5A 2PUCA 3K4QA 1KD1D 1G7SA 4JK3A 3WDKA 1V0FA 3FVWA 5EUCA 5ICGA 4DR3B 1K4YA 4X20A 1C1DB 2C96A 4G4SP 4N41A 1BW9B 1W19A 1M0TA 1T9CA 2IUSA 5U1PA 2C9CA 3SIWA 4DJDC 4D0NA 5MGNA 1EU1A 1DOAA 3FPKA 2YVUA 3BK2A 4L9RA 1HE4A 3F9RA 2MSCB 4I9FA 3ENWA 1ZXXA 5KVSA 2C0QA 4OI2A 1MABB 1ZIOA 3S5JA 3NUZA 1WKVA 3E53A 3CEHA 4OHXA 2B94A 3MSCA 3SIXA 4L85A 4KXUA 2Q7XA 3MOSA 1JAZA 2PE5A 4GI2A 5A7HA 4N3GA 4F2WA 3PTZA 4XLAA 1ESMA 5BNZA 5L3ZA 4PYNA 2D2FA 2D8AA 2Q4BA 5EINA 3LQKA 5FNVB 2GAFA 2YFHA 2IIQA 4P4GA 3VTFA 4OLBA 3RK1A 4KN9S 2H6EA 2CNOA 5L6LB 3HK2A 1RXUA 2LXNA 5EE0A 1MIOA 1UD2A 1SC9A 1E3ZA 1N0WA 3KKNA 4MLDA 1AS2A 2EYQA 4OBWA 4P4SA 4F3NA 1CF9A 2XT0A 2PZEA 3N3AC 3E22B 1G21B 2O05A 1SBYA 1T26A 3A2MA 1YTLA 5KTSA 3FI9A 2XCSB 3KALA 5DGIA 1Y6GA 1XELA 3VVMA 3P45A 3PFNA 4TZTA 2NT4A 3ROPA 1QNLA 1Q82D 1TZCA 1Z0KA 2HYDA 3AUAA 4TL6A 3AERA 3NS7A 3ZWCA 4B7XA 3VI4B 1L7PA 3U4DA 3OFJA 4PBRA 3JQEA 4J0QA 3L6UA 2RE8A 4NQRA 5D1NA 3NDPA 2H59A 4BMDA 2PM8A 1H2HA 4YUAA 3UJ6A 4B2LA 2Q0QA 4ZTUB 3LBIA 3NC1C 5JFGA 4FUTA 4LOAA 1D1PA 5K6AC 4DUGA 5FOVA 1NJ8A 1LPNA 1XLUA 1XDBA 5HZKA 1EFUA 2GF0A 2YUTA 3L5OA 1ATZA 3NHAA 1RMQA 5DHQA 2RHLA 1A77A 1H2BA 4KQWA 3G02A 1OHHD 1KL7A 4Y30A 3LO5A 4Z4RA 3AUKA 5EUQB 3W8DA 5HIKA 4P7FA 3EPLA 1TADA 4DNRB 1L3CA 2V74B 5FUQA 3BD8A 1TVCA 4KVAA 3O47A 1I2MA 1N1EA 1HOTA 1ADCA 4XOPA 2GAAA 6REQB 2C4HA 2VYVA 5A3QA 4E88A 3EHEA 4OHBA 1UD6A 3BC1A 1Z88A 3QNUA 5ALGA 3VHRA 2ZWPA 4AXBA 1NBHA 1Z39A 3VM6A 4S05A 1P75A 4OUKX 1R4MA 3ZY6A 1JJIA 2G80A 5I7VA 2EFHB 2WJYA 2FSPA 3AJAA 1ZRHA 3K9QO 3E1KA 5TMEA 2F00A 4EB0A 3T5BA 4Q93A 4ENVA 1WXIA 4P81A 1WKCA 2QA5A 5JY6A 2ZANA 1CEYA 1R4NA 4KAJA 1X94A 1RR6A 4GEKA 4BZXA 1KEWA 2FUG6 2HF8A 1Q17A 1X13A 5EMKA 1BU8A 4BZPA 4LVCA 1J99A 1E6KA 5DI3B 2QRMA 3B60A 1AA6A 3LVFO 4TKUB 3EVZA 1J2UA 5H1YA 2AB0A 3OFVA 4V0ME 2ODEA 4P7JA 4BLOA 3EAQA 1PWEA 3GZJA 1CR2A 2P6OA 3LDFA 3TQRA 3DBIA 1QM5A 2JFGA 1W5FA 1RS0A 4INPA 4NAUA 3AJ8A 4AJEA 1UK7A 2O8CB 3TL2A 1FTWA 4HDOB 5EQTA 4LHEA 1CWUA 1GA4A 3HBMA 3M6UA 3P9CA 2P41A 2PVSA 2YN2A 3FBTA 4QVJA 3AF5A 4HE5A 2RAPA 3ZHYA 3LAWA 3PHJA 4CL0A 5JH7A 1Q95A 2PMEA 4D4IA 2XMGA 5IUNC 1VQLB 4LWOA 1HGXA 2PHZA 4OFXA 4DY6A 1MMFB 2YVKA 2PL5A 1IB0A 1MDBA 2NO6A 3L9WA 2R9VA 1D4AA 2PLFA 1M1NB 5DLDA 1VQOB 1LNSA 5BSEA 1VQ6B 4UMFA 3ASSA 2XUPA 3PRKE 4Z0NA 4C9BA 1QGAA 1HKUA 1Q0UA 2AKYA 3LQ4A 4FC6A 4JBXA 4MWZA 1GFIA 3H2HA 2ZRFA 1XJWA 2VYFA 3K0BA 4NJMB 3RRBA 2JJ8A 4OI4A 1DUSA 1E98A 1RI5A 3AKCA 3X1MA 4MOWA 4A23A 1EJ2A 3C8MA 2B1RA 5GVRA 3WRWA 4WZBE 1K97A 3SSOA 4POOA 2FQQA 3GT0A 4PAMA 2V0GA 2H4WA 2BFDA 5C31A 3PUWA 4ETNA 2O2IA 2VAXA 2VZ9A 3DLCA 3ODPA 2AR9A 1QVFB 1BJKA 2R44A 4KK3A 2A7XA 4J1NA 1BOFA 2A5LA 2DFTA 2O48X 4Z0PA 3Q8KA 4I5IA 4PHFA 4JVOA 4NL4H 1P2BA 1P3DA 2AWOA 1J5PA 3KB1A 2JCVA 4Q47A 3U1BA 3RR2A 3HDGA 5AYVA 1DMSA 1YO6A 4GL4A 1Z5OA 3HB9A 4ZO8A 3K2IA 1Q7EA 2EDCA 5EHZA 1KK0A 3WICA 4RWEA 5CNJA 2RH8A 2X8AA 1YU9A 2IL1A 3R3SA 2ZBGA 1T1IA 4HG2A 2JLSA 4LQLA 3TCKA 3F98A 2G67A 2NV6A 2V7VA 3B9PA 3Q3JB 4HGRA 4IIBA 4LYAA 4TRNA 2H00A 4Z7OB 1I7PA 4R2WA 3ZU3A 3WY9A 4PXSA 2D7CA 4HTFB 3V34A 3FVVA 3OPNA 3PCTA 4B3MB 4JMLA 2HK9A 3PHLA 1KORA 1DTWB 5JAHA 1MAAA 5C81A 2R6CA 4J1TA 4EFMA 5LBUA 3PVSA 2C8LA 1GNRA 1U81A 1LD3A 4IM7A 4RA9A 4MA5A 3K31A 4XPZA 1DO8A 4NULA 2ZI5A 3OZBA 4IIJA 4LRQA 3ZHOA 3DAYA 4CCAA 4J1TC 3ETLA 3T52A 1B42A 2DFNA 4QASA 2EHDA 2AJTA 2EQBA 1KI3A 2UZ4A 3EDRA 3NDRA 1AUVA 1C8VB 1NTOA 5ELXA 2V9PA 1LBQA 2CNKA 4JU9A 4DLBA 5EJ7A 5K01A 2X9QA 3A9SA 4IUYA 2IYSA 3DO8A 3BILA 1XCGB 1LFAA 1W8DA 2GK4A 3VR4H 5L8VA 5JJLA 1ZNYA 1U2DA 1P7VA 3T7CA 1IBKB 1BA2A 3DXXA 5HMLA 4FMDB 4B85A 1KJ9A 4NX2A 5LP6C 5DK4A 1C3LA 1U2DC 4DV3B 2VN8A 5FI0B 4JBHA 1Y0YA 2FG7C 2DR2A 3PQFA 5E6UB 5LU8A 2XKJE 2YBDA 5THQA 1QH8A 4M54A 4PPFA 1MRZA 1RWXA 2R5FA 5KB3A 1TMKA 1L8AA 1YJXA 1UBNA 1NYTA 4Z1OA 1LLUA 2X86A 4PWYA 2FOXA 2CFSA 2OHGA 1IEQA 1OV6A 1ZA2A 2OG1A 2P8JA 2IYNA 2QA4B 4RXUA 4JGBA 2E6UX 3MRXA 3CB4A 1LZLA 1VC2A 3EPPA 1WETA 2OG2A 3DNFA 1JHZA 4H31A 4KEAA 4F2HA 2WVAA 1U0SY 1CR0A 1ZRSA 4IXWA 4MRVA 2I91A 2K2QB 5CIWA 3IPRA 1E1KA 3JTEA 3O2SB 4G0QA 3LDAA 3HVIA 3AZPA 3P9KA 3H8WA 2YOGA 4MINA 3DPIA 2OK7A 3E20A 4ND8A 4J03A 5IANA 1NQ5A 2H3HA 2GD2A 4QJ3A 4LSGA 1JHUA 4IYJA 2OCGA 2HQSA 3A4IA 4RDIA 1IM2A 1QB8A 1XEWX 2GRJA 1WD7A 4FPXA 1WSRA 4D42A 1P4JA 2J3HA 2PZFA 3IAS6 4IIHA 1V5GA 4RSRA 4BQRA 1UXIA 1VMEA 1QO9A 1SQ6A 1CY1A 3ENVA 4WBXC 1IJFA 1Y1KE 3K1AA 4QBTA 1P1FA 3E3AA 1YAHA 3BMNB 2JFQA 3WO1A 2YXDA 4NABA 1L5WA 1YNSA 1RC1A 2O3JA 2YNMA 2A35A 2YXBA 3KB2A 4MQLA 2AE1A 2WJ6A 1MJHA 3P9IA 4RQUA 5H3CA 3D26A 3DDCA 3X2SA 1JSZA 4FOSA 5CDUA 2A0WA 2YNMC 3CUWA 3DTTA 1R9JA 4J0FA 1A96A 1QR6A 1XHEA 3STHA 1IHDA 3S0JA 2ASVA 1U1GA 3CXUA 3D4BA 2G09A 2WNSA 3H9EO 4YVFA 1FUIA 3EQ2A 4BV8A 2NG1A 4QAJA 4HAZA 4TT8A 5DYIA 3HCOA 3QQPA 2HN9A 2J31A 2XNJA 2HJ9A 4FR2A 5LC1A 4QXQA 1KQ3A 4HH0A 1XWIA 5AVRA 5F9HA 3N8GA 1FUUA 4RXMA 1GAQA 4AZSA 4F7DA 3G5AA 2I34A 2Y66A 3ESYA 1N3IA 4G1EB 3E23A 5FHQA 3UHAA 4CJXA 4FI3F 4JXXA 2Q6LA 1UBTS 1XVUA 1PKXA 5IAKA 1JF8A 3DVAB 3HC7A 1Q91A 5AQEA 1F48A 1ZZGA 2FWPA 2RB4A 3H84A 4TZKA 5FPPA 3OZRA 4CMAA 2AH5A 3CLTC 4EGJA 5BN3B 1IRIA 4IXMA 4EHIA 4C0SA 1D2EA 3MC1A 2J46A 4GXNA 1M76A 1S8OA 3C45A 1FYEA 2D2EA 2DLDA 4UQOA 2GK6A 1PD1A 3T56B 1AKTA 1DWPA 3G9QA 4MUXA 3AOEC 4RDCA 2UYCA 4ENWA 4K9QA 4J0CA 3AVVA 2EGUA 2EVWX 5GQSA 1VL8A 3SX4A 3TZHA 2WAXA 5IKPA 4RYLA 5JFTA 3IMCA 4QV2A 3R5KA 4MVJE 1M2OA 2JGAA 4JKIA 4LXGA 1KQOA 3ZH9B 5L7WA 1X19A 5CBKA 1Y3AA 1OE0A 3Q40A 4I55F 3KKZA 4NFHA 1UZAA 1CUSA 4JT9A 2WHEA 1I4LD 3GMDA 3HRKA 1ODIA 2A4KA 2Q4RA 3P9RA 5FFNA 3RRMA 3GXBA 3UHJA 4EHFA 3BMQB 2YY7A 4LFBB 3N39C 1NOJA 1QYIA 1Z4LA 4QGAA 1IAQA 1TQ2A 5E7JA 2QTHA 2N1BA 2OBSA 4HIZA 1RLOA 1S0UA 3FROA 4Y9SA 3ONVA 4Q4HB 3B13B 3LE8A 4CM1A 2VTBA 4BJ6A 4HC4A 4TQ9A 4BEBA 1WV1A 1EBBA 1OZGA 4I1RA 4K6FA 5TS2A 1WNTA 1YMUA 4Q6BA 4JOCA 2ZYVX 3N9IA 4Q3NA 1QKJA 4A91A 1M8PA 1UBOS 4XR4A 4AURA 2PVPA 3LX6A 1C9NA 3BY2A 3WIOA 2EG5A 4BCCA 2VL7A 4PX9A 1E0AA 4LY0A 1CUZA 4AC9A 4FJ2A 1R0RE 1SKYE 5AK6A 2J5XA 1T9AA 2ZI9A 4I5GA 4C6HA 1SU7A 4LRUA 5J40A 5GMOA 5K8VA 2FPSA 2W22A 2VQ6A 4B73A 1GNPA 1UFQA 1XRNA 3C5VA 3KQVA 4RHUA 5REQA 1CE8B 1ZMOA 5EQDA 1RLIA 2F3TA 4JLSA 4DANA 3EA0A 3ZI4A 3LK7A 4M21A 1UUFA 3OM0A 5ITVA 1K9SA 4P53A 4PAOA 2RHMA 5IBCA 1BCRA 4DQDA 3LUGA 3AEZA 5DTQA 5GZ1A 1QO0D 2NU6A 1TJ4A 4H16A 2ZQYA 1APBA 2GJSA 2KBEA 2P2GA 2JHCA 4MGZR 3ZV3A 4DPMA 5IJ0B 4AS2A 2RGWA 5IKMA 4B3DA 2WG0A 2Z6BD 4L57A 1X9HA 2BH9A 3MTEA 2ZJZA 2RAUA 4KX5A 5IVKA 1UEJA 2VH2A 3WSWA 1NZJA 2JZNA 4J1QA 4C76A 3OQPA 4AI6A 5KYYA 4KE7A 3EFBA 5K0NA 5JC1A 3ZUPA 5G1PA 3WBFA 3BX1A 5AUOB 1KZ1A 4PYJA 4LFCB 2OCDA 1GRQA 2H16A 2AXQA 2X15A 3H7IA 2DRIA 3DCJA 4FSDA 1XKQA 2B8JA 3IAXA 4D5GA 3HYCA 4U2CA 1P7WA 1SXGA 4R9VA 5EERA 1QKIA 3TR6A 3W04A 2QMOA 4A1OA 4MV6A 2DBYA 5EZQA 3GG9A 1WW3A 3EOAI 3CH6A 2BFEB 3E3MA 4NG5A 2E55A 5JO0A 3VKWA 2NO0A 1EXNA 5D51S 1E5TA 2P5UA 4XM2A 1DX6A 2JC3A 3SHQA 1NASA 3TNLA 1II9A 1LQUA 2G6BA 1PZXA 2H1SA 4OU4A 5DTEA 2QTZA 1NXQA 1Y1QA 2OGZA 2PX6A 3C3XA 4S0XA 4WESB 1XQ6A 2CDBA 2X5KO 2I9PA 3TE6A 1DBWA 4W9MC 3IUYA 3NE5B 3AEQA 3AOGA 3FWPA 3COPA 2ERYA 3ORYA 4PCVA 3CRZA 1XXHB 4A27A 3DD1A 3V76A 3J7TA 2PA0A 1HDOA 3I2GA 3V48A 1O95D 1IWPB 2XVZA 4BX0A 2WQ6A 3N87A 3GELA 421PA 5H4HA 5B6IA 2JK0A 1CS4C 2PKQP 3JY6A 3KZOA 4MGKR 1VL1A 5JCOC 3WKAA 1XDUA 3F7NA 3TH5A 3G2HA 4MV3A 3H11A 4F11A 3S2YA 2HCTA 4Y0VA 2AK2A 3OE1A 2GB4A 4D44A 1HL7A 2E4XA 3NANA 5LWHA 3ZHQA 2P2ZA 5C37A 3KVNA 5L6MB 4G9GA 1WEHA 2XMDA 1ZC3A 4AG5A 1NIPA 2IPNA 2CLFB 5BQXA 1SPXA 4D0RA 2IWRA 1X8XA 1OCEA 1IK6A 2W8BA 1I5EA 3LUBA 3VNUA 5LXTA 1YACA 2YV4A 2X2EA 4HYYA 2PX0A 5AOCA 4B7UA 4P1ZA 3DEAA 2RHDA 3PL1A 4MIOA 2V8OA 1NHWA 1CP2A 1QGUB 5DM60 1PJ4A 3LPDA 4G84A 5L45A 1AHPA 2ZPAA 2X3UA 4PNZA 1EJ0A 1RE0A 2WYHA 2RBKA 1XMOB 1L4EA 2RI6A 3NLLA 4C7XA 4BKUA 1W76A 4HLUA 5KNLA 1VKOA 2QSJA 4LY3A 4BTVA 5EMLA 3AF3A 3BJIC 3R24A 5K7SA 1RWOA 2XYPA 3C1OA 3HDVA 4DLSA 5KNCD 4O8ZA 3CEPB 3NETA 2XYQA 1UKBA 4OKSA 2R6ZA 2P90A 4HLUC 3T53B 1X7ZB 5EGSA 3N07A 3HP4A 2VXYA 1MTOA 4JR2A 1J1UA 3O82A 1USVA 1Q83A 1U5BB 4I4LA 4QFCA 3ICQB 3UK1A 2IIBA 2BTQA 1DADA 1JIXA 2P4SA 5AVKA 3DW1X 4AJPA 1AH2A 2C5LA 2AJ8A 2Q5JA 1M6NA 1K8RA 2HMTA 2HZBA 3IVRA 3L1HA 4MLZA 1KE1A 2VAPA 2YJ5A 5JS8A 2QW1A 2VSOA 5BN1A 4ZQGA 4CMCA 3FCXA 4UUNA 3FI0A 1IQPA 3ASYA 3OJXA 3O9ZA 3PC3A 5IUKC 1L4NA 3CCLB 1XCBA 3SC6A 3W2IA 5DCYA 2AYXA 4L5AA 5HFJA 1XRLA 1BXGB 4X7EA 2GCOA 5ES3A 1DBRA 3NV7A 3GCZA 1I01A 1LW7A 3ILYA 3URMA 5BY2A 1XMQB 1AGXA 2DULA 1C8LA 2XNHA 5F2OA 2ZSJA 4B3XA 1HYGA 1QORA 2VSNA 4FD2A 3TBFA 2UZ0A 4Y2TA 5JPIA 2AVDA 4Q9IA 5BPHA 1BYUA 1YZHA 3KSZO 4JELA 1E2BA 4BGEA 3AM1A 1XZQA 2D5AA 1KY5A 1NXOA 2C82A 2Q3FA 2D2VA 3KSUA 4IG9A 4TV8A 3VVBA 3WTCA 4C78A 1KP2A 3DGFC 4RMJA 3IXMA 4DRXB 3OCZA 1ENZA 2XDAA 3EXG2 1F9EA 5BQOA 3MWKA 1HFEL 1M6YA 3BCHA 3U7QA 1P1HA 3DMDA 3OLZA 4S12A 3C48A 3GT7A 4AECA 1GYQA 4JLJA 1G21E 3KS9A 1T1GA 4QSHA 1THTA 1XRSB 4R68A 2J3QA 3HB1A 3QUCA 4J3NA 3PENA 2ZE5A 4U2FA 4EQZA 1YASA 1GTVA 4I7EA 4KB5A 1FJXA 1NXTA 5ALOA 3Q7QA 1FRVA 3IJRA 2X3YA 4QUKA 3LWZA 1U63A 2WMOB 4O63O 1QP4A 4F2DA 1FJHA 1OFHA 5GGXA 4ZK2A 3PVZA 3CY6A 4MR7B 4UFPA 4PC2A 3KOXA 1KQFA 2KVOA 4M9XA 2ISCA 4EK9A 1T9HA 4ZVTA 2J6CA 3PGJA 2B7LA 3NEAA 4QHSA 5J47A 4KV9A 5I5EA 1JHMA 3CUTA 5JQGB 4I4IA 4D82A 4OB6A 1Q77A 4B31A 3IOMA 1M6VB 1NL3A 3E7DA 1MHPA 4LECA 4G6IA 4BB0A 3GT4A 4CR7A 4I1PA 4X8OA 4Y2UA 1U2ZA 3Q9UA 4NCNA 3P2EA 1U2SA 3RFTA 4E4YA 3DHNA 2ZIVB 4U9HS 1Q1AA 3SF0A 3W7VA 2AEMA 2P4EA 3SU8A 1TVKB 4WZEA 2OXFA 1V95A 2ZBEA 3O21A 1PS8A 2DM6A 3G4SB 3G0GA 1C80A 3GVIA 4LYEA 4RVCA 4XB6B 4LK3A 4ZQFA 1VF7A 3Q9SA 3N0XA 5LYJA 3MCUA 4WGFA 2B8NA 1UDXA 4LSZA 2VHJA 4O4LA 2VBSA 1BIFA 4G4JA 3I1JA 4DLKA 2OQ2A 1YZFA 3VKFA 1G8JA 4C0WA 2GHQA 2MJLA 4OGFA 4CUKA 4CIAA 2ZVDA 2VTDA 4J9UE 4I50B 4PVCA 1N0VC 2OCAA 3QLUC 1JILA 1PL7A 4RK6A 4BMXA 1HG1A 3D3EA 3GDFA 2W2VA 3LGXA 5DF1A 2FEPA 2IXEA 4XWTA 2O2DA 5H68A 1QAQA 4D7AA 4OL9A 5E6RA 4EVSA 5HKKD 1NW8A 2D1RA 4IMIB 3H3XA 4AWXA 5HZHA 1VP9A 4QGFA 1YDEA 3UGKA 3NASA 3WGMA 5B3KA 1XZAA 4F84A 1D2AA 4HDNA 4A03A 2O4CA 1YL7A 4Y98A 3IP9A 3NW9A 5CVVA 3NHZA 3AR6A 5PNTA 3EFOB 5AKJA 4EY8A 2Q2OA 1ZUIA 3JD2A 5DT9A 5FORA 4DUYB 3WWDA 1WCWA 4CL3A 2C3OA 3T9CA 4AMUA 3P97A 1CT9A 4KXVA 4UHFA 4US0R 3CWQA 2GN9A 3EDQA 2WEKA 1QRTA 4N7JA 3T7TA 1L5LA 4HNUA 2AFIB 3GLFA 1YS2X 1VQKB 1G4AE 1ZOLA 2HJWA 2DHDA 1E7SA 2VDWA 4XLTA 2PUEA 3L40A 2O2XA 2I3GA 5KNDA 2RGDA 2OZEA 3ZWPA 1XPUA 1P91A 3UH0A 3MN1A 3DEKA 5ALEA 4U8HA 1QKKA 3Q4GA 4F12A 1U2QA 4F97A 2BFFA 4ZI2A 2OLKA 1YB6A 3DE0X 3NXKA 4NU6A 5J4KA 2N47A 3L0DA 3OC6A 5GP1A 1OGIA 2OCYC 3D7RA 2J3EA 2PMBA 3C6BA 3HVKA 3R4VA 4PO9A 4C6TA 5AHWA 4DAOA 2DYKA 2E37A 4HAUA 4DQVA 2EKDA 3B3FA 2AXPA 1T3TA 4B09A 3OEWA 5DMXA 5KMGB 5LOVB 3GLQA 2J4CA 1YCDA 4K6GA 3M5WA 3UK7A 3TTUA 2GA8A 1S2OA 2JCXA 5FOQA 1GRRA 1KYYA 1RWMA 3JYOA 1NYRA 2V8BA 1V4NA 3L6DA 3NAQA 1ZHOA 3VPHA 3DTVA 4QU8A 2IV2X 5AXDA 4E30A 1ZIDA 2I8CA 2J3KA 3G5MA 1LRKA 3I61A 2Q8PA 2P2SA 3R7WB 2NSJA 4RM0A 4QTXA 3QX7A 4BDSA 2ZSFA 5LD2C 4ENSA 4R84A 4RU1A 4TZ0A 1O3YA 4ENRA 3TI9A 5D5PA 4RE6A 4KN6A 4UNPA 5LZ5A 4PSCA 4UW9A 4H7EA 1JAYA 2I03A 3CUKA 4MW6A 1HNNA 1NMSA 1Z68A 3G8AA 1YB7A 1AZSC 1NI5A 1JALA 3LECA 1S2NA 4FYMA 1DOHA 2ZUUA 3O3MB 2DBQA 2ZR0A 4FMPA 5FT9A 2Z57A 3CVVA 1VHDA 4DIFA 4RAQA 1V8BA 1RM4A 3CESA 3I09A 4EHHA 3PT5A 3IRUA 4CEJA 1UC4B 3ZDCA 1H5NA 1HUQA 1WSWA 3AY7A 3IQFA 4MYSA 3RC8A 4D5EA 2XZPA 5EE5B 2ZDGA 3TECE 2FJUA 3QU2A 3PUIA 4K9KA 4YAKA 3HA7A 3SQDA 1N6NA 1UBHS 3Q5DA 4DWJA 3A2KA 1V8PA 1NVEA 2OZVA 1WZCA 2AJLI 4KO2S 3IESA 3EOZA 3GJ7A 4GMFA 1AQJA 1ZGBA 4K2AA 1HURA 2GS9A 1ZNWA 3DE5X 4WWHA 4UPVA 4DQ0A 3AESA 3O03A 5F7JA 4ZZ2A 2H2DA 2PIAA 1DL5A 4C21A 4YRPA 1GNTA 3LFUA 3LT2A 3WLLA 3WDLA 1OAKA 1JBEA 1XMIA 3GZNB 1K5HA 4RNCA 4C4YA 4ZT7A 2ZBQA 2QVXX 5TJ9A 2R0QC 2IW1A 4YJHB 4E6PA 3STVA 2WG2A 2O8FA 4GZ6A 1N57A 2CF4A 2HQ1A 3ELUA 1ZRMA 5IAOA 3LK6A 4LDPA 4P0PB 4AJOA 1Y5RA 3BTSA 3PPXA 5HQ3A 3Q8XB 2GAJA 4BNDB 3A26A 4AKHA 3QEOA 2GPNA 2LZJA 1USGA 5ALVA 5ED4A 4MDEA 2R66A 3C3DA 2BEJA 2VDVE 5CG2A 4J90A 3TPZA 2MSNA 4B4VA 1E6EA 1P0QA 1PGPA 3D3QA 4KPGA 5LLTA 4CMHA 3KL9A 1K6IA 2NPIA 3RASA 3U3XA 3QBTA 4B3TB 3M81A 1GPWB 1MDFA 1CQZA 2J9GA 4YPFA 2QG9A 3ZJYA 2FY8A 2I1WA 2A5GA 2ZRGA 3ER6A 4TTSA 3RRZA 4DDKA 3LYHA 4D0SA 3HYLA 3PVCA 4B80A 3E27A 3ECSA 4UNNA 4B3RB 2RHJA 1Z0ZA 1N8SA 1ZH4A 4EHAA 4LMBA 1OWOA 2OC9A 3HVRA 4PTZA 2Y1FA 3Q5EA 1T0PA 2R7LA 1UBFA 1JQLB 2HPVA 2QRGA 4NH0A 3EULA 4OKNA 1U8YA 1YUBA 1NMEA 3ED5A 4E3ZA 1E0SA 3KPUA 4FOTA 2QUBA 5EE3A 3K0CA 3N0WA 3JASB 5K0BA 2WTMA 5JSUA 1PR3A 3C14C 1UBKS 1TM2A 1ID1A 1UF9A 4Y6PA 1A5TA 1LDMA 2R6JA 4DQKA 3K0CC 4JB8A 4MK4A 4NPHA 4BVGA 4CM9D 3B2EA 3GEHA 1JKJB 2Q3MA 3QUBA 1GL9B 5BR7A 3TQFA 1J00A 1P5JA 2CVQA 1UWLA 4KU4A 3DAGA 1A5SB 4R40A 4XCXA 2GZAA 3MMNA 1HVXA 4JODA 4F96A 4JASB 1KK1A 1QIJA 4TS9A 2BFBA 1II8A 4G36A 3T9AA 4R5MA 4WERA 2FE4A 2WU1A 3DGEC 3KEQA 4N54A 4M9ZA 4QYIB 3T9EA 3RYIA 2ZRJA 3OAAD 1XDDA 3DP9A 2XB8A 4G09A 5LKRA 3T0GA 4UREA 4HRXA 2IYPA 4M0MA 1QO7A 4ZARA 1GSIA 3HCBA 1CQJA 1T36B 3FCUB 5AW9A 1TIKA 5KTRA 1H2XA 1UM8A 2B4YA 2AJBA 2Z83A 4R16A 1B23P 1CNMA 2VHUA 4C4AA 4YXWD 4QVAA 3ZQ6A 4R9RA 2FWBA 3K30A 3LUPA 3HM9A 1Y0BA 1E1CA 2D5CA 4P0TA 2HRQA 4GYJA 4CG0A 2PKYX 1SKQA 4B4UA 3LSTA 4EZBA 4WZKA 2VT3A 4PPQA 1K63A 5I9MA 2ZAYA 3H3JA 3DV2A 1ULZA 3JYHA 3K5PA 4EARA 3RKRA 1SHZA 4RYDA 4XOTA 2WNIA 1A4XA 2IYVA 4F8JA 5C53B 4DQXA 3L0OA 3QELB 4X60A 1I2BA 1MB4A 4IKEA 2HF2A 4KVZA 4XX1A 3A9CA 4F56A 1C8BA 2EFGA 1BXRA 1JW9B 4M9QA 1PF7E 2YIVX 3G23A 3GLGB 2WZCA 1MB0A 4HDMA 1RXIA 4B6OA 2OECA 1LTQA 1E96A 1NNUA 1XU9A 2FQYA 3CR3C 4LNHA 5TPZA 3I39X 3V2UA 2BEWB 3GA0A 5AW0A 1PK7A 1U7HA 1VTKA 4EA8A 2A5DA 5LR6A 2IT1A 4FHDA 3WMXA 1L5RA 3D6UA 3JZFA 3KV3O 3MWLA 4P2GA 5SZKB 2JIOA 3K5WA 3NJ4A 2AYZA 2HA0A 4R31A 5ALLA 3SHTA 3JYPA 2WSSA 3LT1A 2IEBA 1X38A 4LPKA 4KQFA 1YQEA 3P94A 2WT8A 3PXCX 2SCUB 3AKYA 2ZUWA 3I0MA 3MQ4A 3AI1A 4WDRA 2O0MA 3PLNA 1RLTA 1H5UA 1UBGA 2F9LA 1Y4ZA 2H5JA 1QFMA 2HAEA 1F8XA 4PSKA 2QGZA 1OWLA 3HKCB 4RHFA 1BDMA 2O8BB 4OJKA 1EWKA 1UZUA 5JROA 4YCBA 4B7AA 2QG6A 4BLRA 4JUBA 1EH5A 3AXSA 2ZZKA 1FVOA 5EMMA 1EK2A 1DP4A 4RPDA 3JSAA 2W98A 3AB3A 4JI1B 2C9DA 1YUNA 3OZCA 3ST7A 2GLTA 1J39A 5HDBB 4EI8A 3KXKA 4F6CA 3X1YA 1IONA 1SOWA 3JQ7B 4MGIR 4MWTA 3D3NA 5CBPB 4L8VA 5DHTA 1ULTA 3IV7A 2QOEA 3G71B 3FAZA 3D8SA 3GLUA 1XRJA 3MMSA 2GM3A 4RY9A 4GVLA 5ESRA 3TPCA 2ZVPX 1NFRA 3NIGB 1BZYA 2YN4A 3BCFA 3ZPXA 4MQFA 1JMKC 2GPWA 1IZYA 1BKSB 2AN5A 2M1ZA 1T2UA 1DB3A 2OGTA 1JIJA 3JCZA 3X2EA 1ZDMA 3P4XA 1WXDA 2BGLA 5L3RA 3VR4A 2PJRA 1PSDA 3DBOB 5I7RA 1R8JA 1S4MA 1B41A 1V71A 1VQ8B 2QROA 3G2LA 4ITUA 1Y9EA 4CMJA 3I6ZA 2EXXA 3DWFA 3FGPA 3BY1A 5H5JA 4M1KA 2CFOA 3BM5A 5FHRA 3TLGB 1AA9A 3ZDXB 4E46A 1H69A 5BSYA 2ZYAA 3IT2A 2P4QA 2XE7A 4ZOQI 1RAEA 4DKJA 4NENB 4P08A 1RYFA 5CTJA 5KYUB 4IDGA 2HF7A 5A89A 4JYZA 4UQLA 4LISA 1Y5LA 3WV5A 1GVNB 3E2PA 2CXOA 2Q7OE 1VJCA 3U39A 5K0CA 3FRHA 1W75A 4G0MA 4MJ7A 1V6SA 4TSFA 1P19A 2VJDA 1E79A 1GZ7A 4GRDA 4P26A 1YAJA 2Q6KA 4GYYA 3VJLA 3BEDA 3E8MA 3D1LA 4YS6A 3JAMA 2YJ3A 2R85A 1IH8A 1X6VA 5CLQA 3BWBA 1S6YA 3HDQA 1RHJA 4M1WA 4PTLA 3VHLB 2YIDA 4YCMA 4BXOA 4DL9A 1K98A 2P6NA 2W70A 4R8SA 3A1VA 4KDCA 4XZ3A 4BLWA 1CLUA 1ZVKA 3G68A 4AN1A 3Q41A 3DKKA 4H60A 1M8GA 2HBQA 1QFJA 1SVSA 5FTNA 4OK3A 5K3FA 3UVEA 1H3FA 3FPSA 1A1VA 2PKWA 4DBLC 1PV4A 3QU7A 4QTUB 1DXHA 3HR7A 3ZDDA 5F21A 3ZGYA 4FNGA 1XQXA 3F6RA 1O77A 3V6LA 1G16A 2GARA 3BF7A 3VR3D 2PUGA 4U00A 3FWKA 3ZV7A 3B89A 3LZCA 1AE1A 1UPAA 1OIWA 1NW5A 1Q7BA 1PG2A 4Q16A 5H0IA 1Q7CA 4YDHB 2PZMA 2FP4A 3OWHA 4YEJA 4JDUA 3SZGA 2OXCA 4CCYA 1N33B 1CFJA 1W2WB 2V45A 2VYCA 4QXRA 2