1E62A

Ferredoxin:nadp+ reductase mutant with lys 75 replaced by arg (k75r)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPERLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP+ REDUCTASE
publication title Structural Analysis of Interactions for Complex Formation between Ferredoxin-Nadp+ Reductase and its Protein Partners.
pubmed doi rcsb
source organism Nostoc sp. pcc 7119
molecule tags Oxidoreductase
total genus 83
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2000-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1e62A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1e62A02
1BX1A 4RD2A 3I55B 1EFTA 1IJFA 2VNKA 2HCJB 4M4SA 1M90D 4IW3B 3WY9A 3AVTA 4C43A 3E20A 1B2RA 1FRNA 1TVCA 3JQQA 4B48A 4LBYA 2B7BA 1OGJA 1KD1D 1EFUA 3W2IA 3QFSA 4P6VF 2RC6A 1YI2B 1ZM2A 1G7TA 3AVVA 1VQPB 2VYQA 1EP1B 4QHYA 1DARA 4B43A 2QTZA 2R6HA 3U6KA 1JNYA 2BV3A 1CNFA 4DQKA 4TMXA 5GV7A 3VMFA 4FN5A 1W2BB 1KK2A 2BM0A 3A1FA 2C78A 1VQ6B 3JQRA 1UMKA 1KK0A 3LYUA 1FNBA 1Q81D 1G7RA 1M1KD 1KK3A 3PENA 1VQOB 3CXCB 3JQPA 1YJNB 5EMNA 4ZCMA 3WNCA 2VNHA 5JBQA 1KRHA 1KK1A 3ES9A 4TMZA 1EP3B 3ZBTA 3CCQB 1JA1A 4YAWA 1VQ8B 2QTLA 3FPKA 3AVYA 3CCMB 4LBVA 1QVGB 3OZVA 1S0UA 2YWHA 1TUIA 4HE5A 1QGAA 2BVNA 3I1FA 1Q7YD 2XEXA 2OTLB 1DDIA 4ZV4A 1QGYA 2VZLA 4G5GA 3G71B 1QG0A 1FNDA 2GPJA 2YWFA 1D2EA 2VNIA 4F7DA 4J0QA 3J81k 1OB2A 1YITB 4YHBA 1YJ9B 5GV8A 1TLLA 2BGJA 4FK8A 4RCYA 3VO2A 3MMPA 3P27A 3ZZUA 1QUFA 1F60A 4TN1A 1GVHA 3CCSB 4U9UA 3CCEB 3MCAA 3W5VA 1FRQA 1DDGA 1B23P 1VQ4B 4YAOA 3CCRB 1YJWB 1YIJB 1VQ5B 1W87A 1QX4A 1BQEA 2BF4A 1IB0A 3ZZ0A 3VNVA 1ELOA 1FNCA 3AGQA 4RD6A 1XB2A 3ZC3A 3WNDA 4RD1A 3I56B 4WQMA 3CMEB 3B78A 3OZWA 1VQMB 1YHQB 2BMWA 3WBKA 4ZGQB 1QUEA 3VO1A 1GR1A 1FDRA 1G7CA 2DERA 1QVFB 2HMAA 3V76A 5DSZA 2BGIA 4P3YA 1QFJA 1E64A 4AC9A 4LBWA 4LC0A 3ZBUA 1N0UA 1W35A 2X3UA 2EIXA 3P26A 2NPFA 4PC3A 4B3XA 1JJ2B 3B82A 1EWYA 2PLFA 3AGPA 2ZITA 4B47A 2BM1A 2OK8A 1QFZA 4LBZA 3SJZA 1R5NA 4EH1A 1OB5A 3U6BA 2QA4B 2J7KA 4AF7A 1J9ZA 4K1XA 3CCVB 2E1RA 2RC5A 1NJID 1ZM9A 1QH0A 2HDNB 3AVUA 4TMVA 2DY1A 4PGOA 4PC6A 1K73D 1ZM3A 5H59A 1H85A 4TMTA 1N0VC 4DQLA 4YALA 3CC2B 1QGZA 1KQSB 3CW2A 3WNBA 2CRVA 3CRZA 4RD3A 2PMDA 2DETA 3AVWA 1H42A 3ZZTA 2BPOA 4H9GA 1S72B 1E62A 1AMOA 5AN9A 3WBJA 2QN6A 4HE6A 1VQKB 1XE1A 3CCJB 1ZM4A 4RCZA 1K8AD 1R5BA 3VNUA 2DEUA 4NCNA 3QSYA 1NDHA 2YWEA 4G1BA 3CMAB 5HXBA 1VQ9B 1OGIA 4PC2A 1R5OA 2VNJA 2QEXB 4Y9RA 1IJEA 2B5OA 1D8TA 5TR9A 3OW2B 1Q86D 3QFRA 4MYUA 4YAFA 2D74A 2XNJA 3B8HA 3LRXA 2AHOA 4Y7CA 3W2HA 4BPRA 4RJLA 2BN4A 4ZGNB 4N3NA 1Q82D 2GQFA 3QE2A 3CC7B 4Q7JB 4M53A 3QFCA 1JA0A 2XNCA 3E1YE 3OJWA 4M1KA 2OTJB 4AF6A 1DG1G 1GO2A 5KSWB 1QFYA 4PC7A 4Y9UA 1KTVA 3U2QA 3CD6B 3W2GA 1K9MD 3FJOA 3MHPA 3W2FA 3AVXA 1KJZA 4B4DA 2C77A 1VQLB 1HA3A 3LVBA 1GAQA 4ACAA 3W5UA 4TMWA 1VQNB 1CNEA 2EFGA 4RD0A 4ZCIA 1ZUNB 2CNDA 1GAWA 1SKQA 1G7SA 3CB4A 1D1NA 4UAJA 1F20A 3WXMA 2PIAA 3QFTA 1FNMA 3OZUA 4QFMA 5THXA 3G6EB 3OJXA 4MYTA 1EP2B 1EXMA 1CQXA 3WYAA 1JB9A 5H5JA 4ACBA 1W34A 1TTTA 4RD4A 4ZCLA 3W5HA 4YAUA 4C0SA 4M0LA 3CCLB 4M2LA 1AIPA 1KC8D 1BX0A 3LO8A 1I7PA 1U2RA 5FA6A 4R71A 1N8RD 4FWTA 1EFCA 3CPWB 2QDXA 1BJKA 1A8PA 1E63A 1WDTA 2DCUA 2YWGA 1VQ7B 4G1VA 4NBSA 3W2EA 5TY0A 2OK7A 4N3GA 5TV2A 4PC1A 1SM4A 2BSAA 3CC4B 2B7CA 4B44A 2QMUA 1GJRA 3CCUB 3G4SB 2FX3A
chains in the Genus database with same CATH superfamily
5FT9A 4CIBA 2GOYA 3E4CA 2QNIA 4M9QA 1SG6A 3QIVA 4BQOA 5EJ6A 5DDIP 2CVQA 2PU5A 4YCJA 3GY0A 4M0KA 1IZ9A 4ZTUB 4ZYLA 1DRVA 4NR0A 1L1QA 1SHTX 1U5AA 2HEIA 2J3KA 1U6JA 2E55A 5DHRA 3WZMA 1MBZA 1YRAA 2HMWA 3TQQA 3QKWA 4W5HA 1DNPA 1KDOA 1Z13A 2OMKA 3VAZA 3WB2A 3V4OA 4RHXA 3KWJA 1U90A 4N4AA 3ELBA 1WEHA 3CF0A 1ZM7A 3O3OB 4RL6A 5DYGA 4YJ2F 2NV6A 2J3IA 2RGRA 4C43A 1XOIA 4WZ6A 5CB4F 4JEMA 2JLZA 1FRNA 4BGUA 2RKBA 4MRMB 4XYGA 3HXPA 3S2IA 1I94B 4ZRNA 3OY7A 3OIFA 4KNVA 1YR2A 1EZ1A 2J4DA 4DK1A 2C0PA 2X6TA 3HU3A 4C03A 1DKRA 1YUBA 2OFPA 1KPGA 5G1NA 1OMOA 2OMEA 2V6MA 4ZVQA 1YZYA 3D0OA 2Y67A 3I6MA 1YVPA 2JASA 1N8TA 2IPNA 2FN4A 2HIHA 1LI5A 4MI6A 2G25A 3RKUA 1OA1A 4FHDA 4IKOA 1DEKA 3BC1A 1YNOA 1XDUA 4FINA 4YAJA 3RYCB 4Z3OA 1L8XA 2DX7A 3FTQA 1EP1B 3O2NA 4H3VA 4J0FA 3FOZA 3PFBA 4MS3A 4Y6OA 4O5OA 5AW7A 5BPFA 3V2IA 3M0EA 5LR6A 3J81A 1M6WA 2P11A 4TTIA 4AJPA 4IIDA 5BSHA 2OXCA 4XGRA 1VLOA 1R8XA 4DSNA 3V4LA 5A9SB 1JIKA 4UM5A 4A0QA 4B4KA 3NVKI 1KKLA 4E2XA 3HEAA 4YI5A 1Y8RA 3QVGA 1UDCA 4WFJA 3CTPA 4NBRA 1WHSA 3SP1A 2GD2A 3U7QA 5KYYA 4QASA 2B20A 3C39A 1FFBA 4AY3A 4DA9A 2C3PA 3KTOA 4QOSA 4ZTBA 4LV8B 5LP6B 1OZFA 1RBQA 3PENA 2I4NA 3OMLA 3VDMA 5JATA 2UZIR 1JF8A 2GZMA 1TYCA 1MAHA 3L6EA 4R2WA 5AW2A 4XOIA 2ZI6A 4FYYA 2I3BA 1E7MA 1GAXA 5JAPA 1VE1A 1UMDA 2VK2A 3IBFA 1FP6A 3SBEA 3WNCA 4ZJZA 3FYUC 1WZEA 1KC1A 2ARKA 1OGYA 2BFCA 2RGNC 4HPWA 3R5HA 4LRWA 1Y5MA 3TE6A 4B83A 3U39A 5KAMA 3N7AA 3MLAA 4X9XA 2AZDA 1YTLA 3G5AA 3HBAA 5FO0A 2WWRA 3FTEA 3ZBTA 5L4LA 1Y3IA 1U0NA 4R6WA 2IS2A 4K5QA 4QPJC 2O8FA 3BYZA 2H4XA 4XWKA 1PL8A 5H81A 1WZ2A 3JQ7B 1WU7A 2CNWA 3B7GA 4P4SA 1QHSA 1EUCA 1M1UA 2QIPA 1Z75A 1JR3D 1E2FA 3BUSA 3SR4A 2ZTHA 4PSKA 3TQIA 2ZXFA 1X1RA 3CNLA 2EJCA 1ISMA 4PZZA 3TRJA 1SURA 2C4WA 2EHDA 4KKVA 4W9NA 3KJFA 2SICE 3RS4A 4YS6A 1DBRA 3JWEA 3GT3A 4AG6A 4Z1MA 2NU9B 1FSGA 4PRZA 4O4JB 1G98A 3M1YA 3D1JA 1ZZGA 3VYTB 1Q7YD 2R6AA 3R3SA 5IFKA 2UU9B 1KZ1A 3QVXA 4W5JA 2A9VA 2LIPA 4E70A 1ZN8A 4QFCA 2GS9A 4H3KB 4BO5A 3BWYA 4ENWA 4WGGA 2EOAA 4M55A 3UIEA 2ZWIA 5TQ2A 4MO9A 1HE3A 1I5RA 4B8YA 4OREX 2EBUA 3U26A 4ENRA 2NLOA 4PCLA 3FLBA 4BASA 3WA6A 3ETDA 1R6XA 4XN3A 1CLUA 4F92B 3TXAA 3WJAA 3ORYA 5F3RA 4YREA 1H8ED 4P2BA 1CUCA 5CAEB 4H7HA 4NESA 3VSEA 4E2YA 5K0TA 4WD3A 2JLVA 1U0OC 3T5CA 2M32A 3PLRA 3RB8A 4EYSA 3ILXA 3OCVA 1JL3A 2D1SA 5E7IA 4TKOB 4JLPA 2X86A 2ANBA 3ZK7A 3OG9A 1IDOA 4Y6PA 1TLLA 1SA0B 3R5KA 4RA9B 2D2FA 4FFOA 5CDGA 3ZCRA 5E6SB 4Q15A 1KJJA 8LDHA 2XUIA 3PITA 5EP2A 4D0GA 4EATA 3QMMA 2IXEA 3EAGA 4EYQA 5KOHA 3EDYA 3KX2A 3G1WA 1OBOA 1Z4LA 2J9YB 2XCIA 2ASEA 2HO4A 3C4QA 1EHCA 1NP3A 3BXPA 3IUPA 3PGMA 5EJFA 1EXVA 2ACEA 2C5AA 3N9IA 4IDNA 2B82A 3V34A 3R6DA 3RDPA 3TXXA 3IDFA 1R0RE 3M6MD 1EK1A 1XU9A 1J0CA 4ALIA 4DW8A 1MO4A 4C1NA 3HL4A 1TM2A 3R3HA 4LF4B 1YI0A 4RIFA 4ZP1A 5P21A 3GJ4A 1YJWB 1YDFA 2R5FA 3KSBC 2OV8A 3F5SA 4QOEA 1MRNA 4AXXA 4QPDA 1W52X 1HOTA 2PCJA 2QLBA 2FRXA 3ILYA 4R68A 3TDNA 3LY8A 3ZDYB 2BC9A 2G0AA 1W47A 4M0CA 4Y1RA 4EPWA 3N28A 4WLVA 1LPPA 2FWPA 4I1IA 2GJPA 2Y4NA 1YA8A 3K0CA 1ZCZA 1YHYA 3Q5GA 4G5RA 4JEUA 1TKRA 3K30A 5IAJA 3LC1O 3GLFB 2WZDA 3LGAA 4HSEA 1F2DA 4U7TB 1JDTA 3KJIA 3OPYA 3REOA 2LGJA 4EGAA 1I2ZA 3PQ3A 2WUGA 3SHOA 2CMKA 3H5VA 5TVGA 2Z6AA 1M76A 4OJTA 2PBRA 5FB3A 2Y3IA 3L7AA 1ZH0A 2QUIA 1CUFA 3QEMA 3T3MB 2P2SA 3IVCA 3JSAA 3QVKA 3EXG1 1J2YA 1RLUA 3MJDA 5DYNA 5DWVA 1TF5A 2ZTVA 3IP6A 4C0HA 1E9FA 3MJCA 4OYHA 3G0HA 4MDEA 5IAOA 5H70A 1AGYA 1RAEA 3H2JA 5IJ0B 1GRRA 3L1KA 3RY8A 3GBVA 2HWXA 4I50F 2I1QA 2Q6LA 1ETUA 1ONBA 1X1DA 2C5GA 3GUYA 3FPCA 1IOLA 4XLTA 4E09A 3DM5A 1F8GA 2I6QA 1G4AE 2NU7A 2XLBA 1FIUA 2CBGA 2WUWE 2NMVA 3B82A 2QZPA 3OHMA 3L77A 3LS2A 4NDZA 5B1IA 1YQDA 4L0CA 4WK0B 1NHGA 2PUVA 3LL4A 2ZK7A 5SZKB 1W5EA 5BNZA 2O14A 2V8OA 4C20A 3KSDO 5ABPA 3HCPA 3A8TA 3T5MA 4AZWA 1E3WB 1MAVA 1E60A 1QC5B 2YV3A 4H7EA 4JNKA 4HDMB 1XTVA 2DFTA 2P77A 4HGOA 1IG0A 1RFLA 5KYGA 2ZVJA 1UBJS 3KT8A 3QU5A 5JY1A 2JRLA 3H1AA 1QIJA 4OXIA 2QA4B 3KYDA 3T61A 1Z8NA 2E3JA 1GTZA 3EQZA 4IXWA 2JLBA 3N07A 4P3PA 1ZNQO 5JTTA 1K7SN 1NU8A 1YRYE 2MR6A 3RUAA 2CHGA 4ZT2A 3NMUF 4JLSA 1JP7A 1XTTA 2XT9A 1EWTA 3BQ9A 1BKSB 1V1RB 3NUQA 4LXQA 5JTUA 4X7EA 2O8VA 1OYVA 2WB4A 1U99A 3INNA 4HX5A 1TA9A 1X1EA 1LJLA 1HT0A 4I1YA 2O9JA 3AI3A 3IBSA 2B1RA 3LUHA 4KQ9A 3F7MA 2DTEA 4EPXA 4QXMA 4I1OA 4HWRA 4H35A 2QRHA 3L0DA 4E5MA 2PBFA 2HM7A 2V74B 3SYNA 2O7QA 1RI2A 2AKEA 4O2AB 3DOCA 1YNSA 2QW0X 2JFBA 1P0MA 3BTSA 3ELWA 2BR5A 4IHJA 3ZZNA 2HCTA 3U62A 4S35A 3WLFA 3CRZA 3NOQA 3VC7A 3WX0A 2YMPA 4YP9A 1MZVA 5AVSA 3H17A 3AVWA 4NOMA 1BDMA 3QWAA 2G17A 2BHNA 1MTZA 5AW1A 4MR9A 2FR8C 3WLQA 2VF8A 3B53X 4GLOA 5AN9A 3FVVA 4LJ8A 1SWWA 1FFXA 4E5YA 2FP4B 2X0DA 1MU0A 3ONNA 2YY6A 4IFTA 4IMPA 1LH0A 5IZCC 4YV2A 3T1OA 4HBZA 1A8QA 1Q3TA 4MUNA 5IAGA 1Y5IA 1GNQA 3FDZA 1Y8CA 3N2IA 2PZMA 3OCCA 3T3PB 5A5DA 2V3VA 1R7RA 3PGVA 4M54A 5JYDA 1CQZA 2EL9A 2YS7A 4FE4A 4YCBA 5CBPB 2GLTA 4WESA 4O6VA 4KPUA 3QH4A 4MJ3A 5I9SA 4DIOA 3CGGA 4D57A 2OEPA 4V2UA 3UF0A 1KSGA 1YOBA 4A0SA 4DCOA 4EPVA 3CF2A 1E2MA 3GRCA 5K2OA 1DIBA 2ILVA 3CMAB 3GRZA 1CQJA 1FOEB 3M5PA 1AUQA 4A8TA 2H52A 3JWJA 1Y1LA 4YI3A 1PLLA 3GR6A 3JAMA 4OCZA 3S2GA 1IVNA 1OAAA 3EIOA 3FSEA 3QVUA 4PAMA 5LYYA 3RH0A 4PC2A 1UWVA 3SHWA 1C9JA 2QEXB 3GRPA 4UUOA 3CZRA 4J0GA 4RLFA 3P0HA 4URFA 4CF3A 2BR4A 3OQIB 1PEKE 3SYRA 1P8AA 3NTXA 3T9BA 4NV3A 5GPBA 5IKPA 5KVCA 1VJ1A 4R4JA 1KEKA 4ESVA 2P40A 2Z1MA 3UAYA 1Z5VA 1N6LA 2BHTA 2GO7A 1Z6YA 1ORWA 1ZCBA 2GZHA 2HV9A 4ILEA 3HVIA 3ZKWA 2FSUA 2GN8A 3GX1A 4HYEA 4L85A 1Y1QA 5AYVA 4CFSA 1WRBA 4JLKA 5TRTA 1XKXA 4ZICA 4UTZA 3VMMA 2ACKA 3UB2A 1SKYB 1SUBA 4RKWA 2HADA 5HRAA 1Q82D 1V48A 3BK1A 4H4EA 1N9GB 1G5QA 2E4WA 4MLPA 1Q7CA 2HU8A 4RQUA 4KXQA 1P3DA 1MV5A 3EDRA 3UNXA 4Z1MD 5KDDA 2O1EA 3KZKA 2QHXA 3RQIA 1J24A 1K63A 1XRMA 4F2GA 4LF8B 3PL5A 1WTAA 3C14C 3L0OA 5K5EA 2VSXA 2YJTD 1U9IC 4XR6A 1T8TA 2PKQP 1DEHA 2XUJA 5BRNA 4LSMA 1V5WA 4Y9UA 1BDJA 1J8YF 1TJPB 2AOTA 1L7MA 2LZ0A 5T41A 5JVDF 2Q5JA 3AESA 2Y71A 3IUYA 1UBGA 3NT5A 4JI0B 4NCXA 1UM8A 2NTYC 5DT9A 3HCOA 4LWPA 1UD5A 2WF9A 4MHTA 2RK4A 3RSQA 2M5SA 3ZUPA 4CT4B 1E9CA 2IOYA 1GGFA 4KQWA 5CLQA 3EBOA 5I7OA 3FLMA 4PNPA 2BEKA 5A1JA 2D1FA 3UWDA 3L8EA 4F04A 1J0AA 4URXR 2I6GA 1PR1A 1SEVA 3REFA 4FHGA 3VH1A 2RK3A 5F3DA 1MGOA 3WTBA 2EF1A 1GUYA 1A8HA 1SOVA 3H2HA 4QLAA 2GNAA 2OCYC 3PVSA 4DFDA 4DKXA 2OPHA 4RULA 2RBGA 1NG9A 3ET5A 1BE8A 4JR2A 3TOCA 1YR7A 2IGBA 5K0BA 4PGFA 3NWEA 1I0LA 1TIBA 4MDFA 3FH0A 4BKPA 5FRDA 2NIPA 5JECA 4JLAA 5DNDA 1IZ7A 1VLJA 4DMFA 4AG5A 1W85B 1Y6RA 2X1HA 4BDSA 5BW8A 1LBSA 1H05A 2QPTA 4DWWA 4ITUA 2CXUA 5AVKA 3RVLA 4DNRB 4B2YA 1M2OA 2PGNA 3GZTB 3RRJA 1TEZA 4J6EA 5BQPA 1U3DA 1IBLB 2HCBA 5L3SB 1NB9A 3AJ8A 2G1PA 1WW3A 4WBXC 5F9MA 3DDYA 1EEXB 1G20A 1RXEA 3ZXUB 4Q3KA 5AICA 5B2FA 4HDQB 3CMCO 1V16B 2P3LA 5E3JA 1YS4A 3I37X 3FOFC 2AL7A 2W2XA 4GICA 3HDYA 3A37A 3UXHA 1AQUA 2CYBA 3VX3A 2YVUA 3EUFA 2Y6UA 3R6WA 4A3SA 4B76A 3GJZA 3AHDA 1S01A 4BNGA 2FLVA 1C9DB 4AJNA 2OZVA 3CRRA 4Q4DA 5T57A 2IYOA 1IN6A 2BWJA 3HBNA 4B40A 4CQMB 1YB5A 3TUZC 1RPJA 3GXOA 3GBSA 1NYLA 5JPCA 3RSZA 2JFFA 4TTVA 2C57A 2IL1A 2C9MA 2CLMB 3D31A 3NS7A 4ZVNA 4JI6B 3TAXA 1SN7A 2BFPA 4AJKA 4H7DA 4JUBA 4DIDA 4EJ0A 2X0NA 4MR7B 1YIOA 1HFKA 1LTKA 2WW8A 4K6KA 3RCBA 2TMDA 3VV3A 1NVBA 4ARVA 3BE4A 5FOSA 3EVTA 3ZLUA 4JLJA 3MB5A 1PR6A 1TPYA 4Z4VA 5HS6A 4D9MA 5AW0A 1WMSA 1UBCA 2IHZA 1I2CA 2AI3A 4G63A 5JXJA 2QLFA 2ZRDA 5TV2A 2ZBPA 3ANMA 4HEA1 4G86A 3W9BA 1PNTA 1VSTA 1OC4A 2ZUCA 1K8RA 4DB4A 5TX7A 5JCXA 2FMUA 4NCKA 5F2EA 1F2TB 5F7ZA 4YT2A 5FAKA 5F3WB 1SC3A 4PU0A 3DTYA 2E1PA 5K8TA 3OU2A 1B76A 4Y0VA 1DADA 2O2ZA 3EEYA 3G4SB 3RK4A 4B80A 4EFKA 3HWSA 2FVGA 2WUVA 1S2GA 2IU3A 3WBBA 1U0SY 4O4IB 3T06B 1A7KA 1S8OA 3IR6A 1OA0A 4WNIA 1R6AA 4TZKA 2XA9A 2C1EA 5TARA 3RFXA 3KYBA 1W93A 4HZGA 3IKJA 3OZ7A 4ZZ2A 1Z0SA 4INPA 5CCBA 1TFRA 1SIBE 1TA0A 1W76A 1MP0A 3G2MA 3PF9A 1ZVKA 3D6FA 4JUFA 3ZJTA 3FPHA 5EQDA 1K8XB 1L5OA 3NC1C 4OHOA 4A0FA 4B3CA 3BXOA 1YZHA 2BHLA 2ZREA 4KV7A 4TTPA 6CHYA 4DS3A 1SVNA 3DMFA 1C3OA 1RPAA 2O2YA 4EG7A 2NUAB 2WKPA 1ND6A 4RPLA 1ZXXA 2DF8A 3IAHA 4JMPA 1B2RA 4IR7A 1N0WA 4I9NA 3SVZA 3LLUA 1SXJE 4JT4A 4OQDA 1JTFA 4CEIB 1YVEI 2J45A 1P2TA 4FNGA 4ODIA 4TL7A 3RFFA 3OPYI 3SYTA 2JA2A 1J99A 3KWLA 3HZZA 1O1YA 2W8BA 4KBGA 1ZMBA 1BXRA 3I1IA 4H6WA 1QYDA 5DXFA 4E13A 3OZXA 4PPYA 1LX6A 1VM6A 2VF7A 3N0VA 4WZAE 5AI0A 2WUDA 3QFSA 4P6VF 1Z36A 1DINA 2H1LA 4HAZA 4CBVA 5BMVB 3B2QA 3B6MA 1WX1A 4X1IA 1A04A 4HLUA 2G1AA 3F67A 1EGVB 3EEFA 3COSA 4TYPA 4DAOA 2XCSB 5JI3E 3QEBZ 3H18A 5LZ8A 4CM8B 5DLEA 2QORA 1PGNA 3MS7A 1TD9A 5FCDA 3ANSA 3TLZA 1D9ZA 5ALRA 4RESA 4YONB 4B43A 3BMOB 4D46A 5B4TA 2FEKA 4ARCA 4EFLA 2Y99A 3EBPA 5IHPA 4F71A 3OKPA 3O8OB 2W6IA 1PJ8A 3QBTA 4Z53A 5DT2A 4MDYA 1PK8A 4YASA 1MRSA 3G2PA 3DV0B 4C7XA 5ELLA 3I42A 2EERA 4C87A 1ZG3A 1P1FA 2P91A 5ELXA 1HEIA 1KVSA 5LZ9A 1E6LA 5COAA 2BFFA 1QV6A 3QVVA 3VGJA 2DBYA 3PICA 5B7PA 4DC9A 1WPQA 2PGLA 1NDUA 2UZ3A 3TTXA 4YPVA 1Q3KA 1IYZA 4OVKA 2HPZA 2RGDA 1KEEB 1MQ9A 3E22B 2O2CA 1M7BA 1Q12A 2IYPA 2Z9CA 4WMLA 1SHLA 1WMAA 2V7PA 1VQOB 1ZR4A 3CXCB 4EO4A 3ZGNA 3N2GA 1NUQA 3SMQA 3PVZA 3WG9A 1JLKA 3IEKA 4YMLA 1YJNB 2JEZA 5JMPA 3HEMA 5IZ4A 1OX6A 4DKJA 1NQWA 4BLWA 3FOBA 1I9CA 2FNAA 3LK6A 4MWSA 3DD5A 4CKWB 3MGCA 5AW9A 3ME5A 1YRQA 4Y1GA 5NLLA 1OV6A 3L1JA 2XMDA 5HBRA 2QJTA 3H1EA 2UVPB 4GPAA 4EAAA 5B12A 1U7HA 1D04A 2IZOA 1SIOA 3NM5A 1P2GA 4Q9DA 3RT7A 1JHPA 2O7SA 2X4IA 3QMWA 1G17A 1GVNB 3ROTA 1JDBB 2EARA 2WZCA 121PA 3A1SA 4OI2A 3FPKA 3DVSX 3QNWA 1WOSA 2J33A 1V7QA 4DCVA 5J59A 1J20A 2IYWA 4EI9A 3OE7A 4LRXA 4MW7A 1X1BA 5P8WA 4KLCA 2BFDB 1AZSC 4EG1A 1DZ3A 2D06A 2CVZA 1CS0A 1XHFA 5EPEA 4M7PA 3D7RA 3FF4A 4Z9XA 4YACA 4A1OA 1Z2OX 4KQMA 3K5PA 4JJ7A 2I4RA 2H1OA 1FW8A 4EF5A 3KQVA 1SD2A 1CUWA 3E03A 3MILA 4OHXA 5K8LA 1ICIA 3PUYA 1N7IA 3F6SA 4FQ5A 4LSGA 4DPMA 1DB3A 4B3SB 3NC4A 1DUVG 1VZ2A 2Z09A 3OEWA 3QPWA 4IY1A 4DQ0A 3G71B 1QG0A 3K0FB 1CUVA 4J0CA 2V4MA 4LMAA 2HA3A 3PIDA 4OU4A 3HJUA 4JWTA 1MAAA 2XD4A 2AQ8A 4JQZA 5B53A 3TTVA 4NMMA 2J9FA 2EATA 4BKRA 3B3AA 4B4WA 1S2MA 1UEXC 3K6KA 3RVQA 4A2WA 4D6XA 1VHOA 5ITZB 2W71A 4UDOA 5HZGA 1K6MA 1RTKA 5THKA 1HFEL 2P5SA 3H9GA 4E46A 1PRYA 4E1VA 1L6RA 2CYAA 2JHGA 3I01M 2WJYA 3MUOA 4IMIB 4LKOA 3M6VA 2OHIA 1ZIXA 3DEYX 5CW1A 4JGGA 3W1WA 4BKOA 3HVHA 4E30A 4CCWA 5A4KA 3TECE 4BC1A 1QAMA 4HQFA 4XSVA 2IH4A 1E1LA 4B3DA 1O4VA 2WZQA 1RI1A 2E5WA 3K0AA 1U2PA 4NYIQ 4N5HX 3DOJA 3D26A 1I3LA 1WW8A 3MCAA 2YNMA 3R7DA 3T7EA 4FXOA 1NT2A 1EHYA 4FHCA 5D1NA 3ROFA 4E94A 2XVYA 4QOIA 3SSOA 3HBJA 4N0EA 1PJAA 5IKEA 2FPLA 1QG4A 3OY2A 4OUDA 3S44A 1VLHA 2QEQA 1VQ4B 3CLSD 2F3UA 3FYSA 4DV0B 1GGKA 4WDRA 3NX4A 5JSFA 1MF7A 2WSLA 1YZVA 3TTUA 2J3QA 2JGIA 2KBFA 5HQ3B 4RXUA 4O4LB 1M2KA 4DLNA 4M1MA 4DNPA 1N2CA 1QDLB 5HVNA 2PUFA 2DG2A 4Z4HA 2MSLA 1NNUA 4TZTA 3LZ6A 5CRIA 1WB6A 4WHMA 3V4PB 4IWXA 1Z7WA 5AHKA 1UJ6A 5A7FA 1HLFA 2HA0A 5DLQC 4D9JA 2UZ4A 4AX8A 1L4NA 4KQHA 5DGXA 5FV7A 5LUAA 2XE8A 1YB2A 1NURA 3VO1A 4G5XA 4X24A 1L1RA 1PEYA 1YHNA 2B1JA 1PR9A 4K6GA 1NVWQ 2KBEA 1T6XA 2QUHA 4PX2A 4MWTA 1RMQA 3TB4A 2R86A 3TQFA 1C9EA 1TU0A 3SX0A 2AYYA 5EPOA 1DXYA 3D6MA 4GSLA 1BLIA 3NHKA 1QLJA 4Z8XA 1T9ZA 1NWCA 3QX7A 3GEGA 2OHVA 5I4KA 5J4LA 4OV6B 1JHDA 5LZ7A 3RC9A 1BU8A 2ONCA 5K3CA 3EGDB 5ES4B 3F5FA 2QUJA 1KDVA 2GBFA 1RHKA 4JVLA 3N8HA 3GLGA 1Z4PX 1BYIA 1E0SA 1THGA 1YVUA 3JQFC 1HKUA 3LT2A 4DB2A 3WIVA 5AK5A 5ALOA 3UMSA 3QBEA 1L7EA 4AWXA 3ABSB 3KJHA 4RZ3A 3AQ4A 5BQFA 2Q45A 3KT0A 3BPSA 4WLFA 3AR4A 4OJYA 1GZ3A 3EGCA 3EODA 3TSWA 4KXLA 1G19A 1CR6A 1WQ3A 3H2BA 4RDCA 1F1JA 4I0WB 2HQBA 2Z2IA 4IIHA 5IM4F 3B7PA 4AMUA 2OE2A 2XGSA 4LBZA 1SRRA 3NHFA 3P0RA 4P53A 4X44A 1R8SA 2LV8A 1OB5A 3WP0A 5HXAA 9MHTA 3LUDA 1BNCA 2BFAA 2VH2A 3LLSA 1QGED 3AY0A 4FT2A 4IZ6A 4LDAA 1QVWA 4MA5A 4RGBA 5ADWA 2XTJA 4FGWA 1CUDA 1FU8A 2I8LA 2VOEA 2QJRA 4UTVA 4Q1CA 5CD9A 2YV5A 3WNQA 2LXNA 2VNSA 5GVSA 1SXPA 1QS0B 1R0BA 1TQHA 2O8CB 3T0IA 4YR7A 2CXTA 4DUZB 2O2SA 2Q3JA 1VHWA 1XF9A 2Z9BA 3CG4A 5I5EA 4L2IB 3LLCA 1ISJA 4DANA 2ZP1A 5B3KA 2FOXA 4LVOA 1Y6GA 3IUMA 3PDUA 1XMXA 1U5BA 3JQ9C 3A6ZA 1MC4A 3TIIA 4EI8A 4R1MA 4MMZB 4MUMA 5KUTA 1NY5A 3SF0A 3T15A 1H85A 5TGZA 2ZUWA 2V7QA 2XQKA 1WXQA 3LQFA 4FDUA 1AB5A 3EGIA 2RGBA 5KPJA 3Q11A 4AUKA 1Z45A 2Q0QA 5LZ2A 2AEEA 2YBDA 1DX9A 3E84A 4QXAA 4CYMA 2PLRA 4UHEA 3O4HA 5JISA 2E5LB 1R2QA 3EDCA 1HQCA 3KAJA 1WWKA 4NEGA 5KNCA 1CY2A 2OYSA 3MRXA 4D4LA 3GA7A 5TEWA 3GYBA 3B1YA 4JHXA 3RJTA 4EKIA 4RJTA 3RYCA 2EEZA 4YA6A 3C5HA 4MI1A 4BY9E 1YZKA 2QYTA 2AR0A 2PG3A 1CE8B 3FBTA 3G23A 1D4AA 1GARA 2BPOA 1Q92A 2CLCX 2R7NA 3CKYA 2W6MA 3NKLA 4I4TA 4K7JA 1GUDA 3TEJA 2GTPA 4ABYA 4AK9A 2EHJA 2R4TA 1AGNA 5HW0A 1RMYA 2W6ID 1A1VA 1JECA 1Z83A 2QN6A 1QBKC 1CSEE 4G0OA 2BGLA 1N92A 3ET4A 4KI0A 1YS6A 2HL6A 3PQ7A 4HFJA 1OYOA 3F97A 4BNMA 4ZOBA 4PQRA 5EKXA 1B6RA 4QQ8A 2FGJA 5EERA 1RBMA 3ZCUA 2AMYA 4DF3A 4MEBA 1HQYE 1UBUS 4AMBA 1Y9EA 2I2AA 3OECA 3AF5A 3EBLA 3H3XA 4LXHA 4LZJA 2HSGA 4G89A 2HD4A 3CUUA 2VAWA 4U5XA 5FO1A 1QSGA 5CCXA 3QSYA 1NUUA 1XRLA 3BTUA 4G8JA 2Q99A 3DXXA 2AKAB 1WSVA 1O5OA 2R6FA 3LNNA 4FC6A 4H0CA 4PXSA 4G0WA 3CZPA 2Q7OE 4UPEA 1BEZA 2H1SA 5EKTA 4ZMSA 1LBIA 3L7LA 4ZVLA 1XZPA 1AM4D 4URWR 4M98A 3T4EA 4D3XA 4PR0A 4CL8A 3IVXA 1XP8A 2IEYA 1FDUA 3IEPA 2ODAA 3UH0A 3U7FB 4YAIA 2FPOA 2R2GA 3COWA 5FA5A 2D54A 5HKLA 2O3QA 1Y6FA 4RDLA 1FXWF 3HXMA 1I7QB 2IK8A 1YTUA 1M6VB 1BS2A 4DMUB 2JAWA 1BA3A 2IW3A 2YN4A 3QBJA 3SQDA 3JQ7A 1FX1A 2W98A 5IDWA 2B83A 1XO1A 1SEPA 1U9YA 2Z5VA 1PD0A 5J2UB 5L8VA 2IPOA 2HFKA 3OE7D 4A1FA 3A4MA 1J33A 1JMVA 1NVKA 1LSJA 1IIRA 1H2ZA 2DUUA 2I76A 4JBIA 3RSFA 4ZREA 3QFCA 4FXUA 2B1IA 3L2OB 3PQ2A 3VOTA 5K6AA 4XFKA 4DR4B 1F9EA 1V4VA 2NU9A 4O4JA 3T51B 2YZNA 3K9GA 2W4IA 5DBIA 2O6HA 1E3JA 1GKLA 1WTCA 4V2IA 1ZHHA 2HF2A 2XMRA 1JHUA 1EE1A 3IVAA 4WINA 1QPGA 5KW9A 1E79D 1WKVA 2YXNA 3Q1LA 4RH0A 1KFKB 2OQRA 2DHQA 2X8WA 3FVQA 4ZCTA 5J4VA 4O25A 5IJ9B 5K9ZA 5E4TA 4ZAZA 8GPBA 1NW9B 4QUBA 1ZXLA 3K9NA 5JO9A 2CLIB 2CWDA 2OFWA 1RS0A 5JZ9A 2DHCA 5IYQA 5BXYA 4YNBA 1RSZA 3K1AB 4RBNA 4B9EA 2YOGA 2R5NA 3A1VA 4JOCA 1IC6A 4B6QA 4JP1A 1V4BA 2CLDX 1PT9A 1SA0A 1A9QA 2VNAA 4EUHA 3C48A 5E6SA 4TTTS 3KKZA 4C3VA 1I01A 1V6CA 2GRJA 1U5CA 1N77A 2C9ZA 2CV1A 2WVJA 2PSFA 4XUCA 3PCRB 1X7YA 4BV2A 4R3UC 4RD0A 3F5MA 3NV7A 2YNMD 1SG0A 3P52A 4MRVA 2G67A 3KWMA 4MW5A 1GFIA 1SUSA 2GEDA 1B14A 1Y0BA 4UVDA 3E3AA 3GVCA 4DNQA 1Z33A 3LNTA 1HFWA 2JDIA 2BI7A 3C87A 1D1NA 1XJQA 3MELA 4XWGA 1QU2A 1IUPA 3O83A 1JZQA 4MP3A 4GLBA 1OBFO 5KNLA 1II8A 2AYZA 1NTOA 1Y9ZA 3MC1A 3LAWA 4L4UA 4EEKA 3ASRA 1T15A 3KJZA 4QFMA 1S89A 2ZBUA 3OE4A 5KWSA 3JV7A 3Q3HA 4TV8A 3DT6A 2XCRB 3SOPA 2XR1A 3OJXA 3AKYA 3ECSA 3F6RA 4UTXA 4JI3B 1YRLA 2AB0A 2GX6A 1FDSA 1N6NA 2JH9A 2CBXA 2VHXA 3CCBA 3H19A 3NBUA 1MVLA 3OZEA 1QF6A 2AC7A 4V1CB 4CEJB 5GTDA 1QOPB 1ACMA 1E2HA 2OAEA 4N40A 4ACBA 1N5RA 2G88A 3B6JA 3VNQA 4RD4A 1POWA 4Y1EA 3P19A 1XTSA 4LJKA 4UBLA 4YCSA 1X7GA 2O2IA 1MNQA 4BIMA 1UT6A 2FN8A 2XQFA 4RY2A 2YW9A 4QNMA 4C0SA 1C3JA 4ZU6X 3TW8B 3HB9A 1PR5A 2QTCA 5M7EA 1KC8D 1F6DA 4XVCA 5AD1A 4PFKA 1GFSA 5E2AA 4X66B 3NEJA 4CM4B 2VDKB 3ZV5A 5KSZA 1N8RD 2DBVO 4AQ7A 4CZ2A 4AKHA 4MQBA 1BU5A 1QV9A 1RPNA 1NIPA 2ZJ3A 3E58A 4HEQA 1WPRA 4MARA 1AKVA 3NNSA 1ZGHA 4DLVA 1N5JA 4CM6A 2I2DA 4HMOA 3CESA 1WDTA 4TQUS 3TLJA 1B8VA 2WKWA 1Y3FE 4GPZA 2W48A 1JKXA 3EQ7A 2XNHA 2ZB2A 1HT2E 3CIOA 4LOKA 4NBSA 5IJ0A 4G0UA 3DULA 3EXHC 3MFYA 5ALMA 4EA8A 1KYZA 1Z4KA 1V45E 4LGMA 2A5LA 1M5UA 2KS6A 1G3QA 3GLRA 4G4GA 5LBTA 4IL5A 4ALNA 2B4YA 1KAOA 4DEXA 1JSRA 4JP5A 1NVGA 1HFJA 1UK7A 3R24A 1YGPA 3VZCA 2I4IA 3LE8A 5FTMA 1U31A 2GCOB 5GY7A 3PJRA 3DMYA 3NFYA 2VAVA 2WDZA 3BZBA 5TIIA 5HX7A 2HMVA 1VG8A 1T8YA 2I4OA 3GRUA 4FYMA 3G2HA 3B1ZA 2NAPA 4FZRA 1FVXA 4G9BA 4KMMA 1E3WA 1QC5A 3CCUB 4UZFA 1X1CA 5J58A 3RS0A 2IIQA 1KPIA 2C3YA 3D3WB 3EQ9A 2FQYA 4Y2UA 3IL2A 4K6MA 5BWMA 4RFLA 4U2CA 3EVBA 4JJIA 1QWOA 5HZMA 2CJWB 4KGXA 4N76A 1IJFA 1TVEA 5GWXA 3P0JA 3RNLA 3O84A 2J3DA 1PV2A 3BWBA 1X2BA 4E03A 1NONA 2BRUA 3RBZA 3K1ZA 2GD1O 3QOXA 4IW3B 5CJJA 3SICE 3M1LA 1X86B 3HA7A 3T1NA 1V6AA 4Q9KA 3DWEX 4YR9A 4J1QA 5I7WA 4NHEA 2H2WA 2O2GA 1AD2A 4OYLA 4WGFA 2XAUA 3QA3E 4B3GA 2XMGA 3T1HB 1GADO 1W4BA 1DJNA 4L28A 4D9BA 3TFOA 4KP7A 3DT8A 5BQ5A 1VE5A 2UYYA 2XTNA 3KLPX 2BW0A 5LCXA 4FC7A 4ILKA 4O2AA 2J46A 4OK5A 4BWFB 3EF0A 4ZO6A 1A3CA 3RHTA 4GZLA 5AVXA 4ZARA 4WXHA 4TS1A 2GLUA 1OT5A 4IIJA 1D0IA 1VMKA 4XGQA 2F3QA 1PYGA 4ENPA 1KH3A 4YLYA 3C97A 1I6WA 2MIIA 2JIDA 4ERXA 2BM9A 2X6RA 3QLVA 4Q93A 3U81A 2FP4A 5CBKA 4HDNB 1QHFA 1P2UA 1KORA 1O4WA 3AF0A 5EP3A 3VNAA 2EBWA 3FZGA 3GFFA 2IVZA 2P4QA 2NZVG 2X6QA 3ISTA 3OIWA 4J1TC 2QBYB 5DB4A 3GFGA 4NOKA 3OEYA 4WA7A 2V7WA 2PN1A 2LVBA 5C8YA 1AQLA 4JLWA 2C9DA 1MB4A 3KXIA 2ZWOA 1H2XA 2WOJA 3PS9A 4LPSA 2VR1A 1NKVA 1DG3A 1ESDA 2F67A 2XZPA 3OFJA 1PS9A 2J6IA 3E7XA 4OTZA 1S3GA 2AJ8A 3ASZA 3I9KA 1E9RA 3QEKA 2DWQA 1FJ2A 1EVJA 3HEBA 1H23A 3G02A 1P1JA 2E82A 4DWJA 1Z25A 3SYKA 4JZYA 3C7KA 3JR3A 3DM9B 2XLCA 5G2OA 4UKDA 2FF5A 2F8LA 2V9ZA 3SD7A 5CLLA 1G8PA 2V65A 4F3KA 1K86A 1MO2A 5HMLA 3KQTA 4BVJA 4EABA 5KTKA 3EX7C 4W5OA 3PTAA 4NZOA 3VBCA 1K7YA 2X9GA 1GCGA 1V4NA 1Z7YA 3NWPA 3OQIA 2DUJA 4TUYF 1HH4A 3ZHZA 4DV4B 3BAFA 2ORVA 5BV8A 2PH3A 4KLAA 1XT6A 3INGA 1ZH2A 3PDIA 3TAHA 1QV7A 5JBQA 4D9CA 3KT3A 2FWRA 5FR1A 1SZPA 2JKYA 2R1TB 4YUZA 5JEEA 5CDFA 4MW1A 5DX1A 3OAAA 1U7DA 1VMEA 3PC2A 3Q3VA 1I0IA 3HY4A 2PKEA 1NR1A 3JWGA 4NV0A 3U80A 3IV6A 2P9BA 3K09A 4PCAA 5EMJA 5JALA 3QE9Y 4POAA 2IYAA 3ICQB 4P7FA 4OSOA 4DJTA 2PUAA 1WUYA 2IZ5A 1Z38A 2SECE 1N9GA 3I52A 1XNRB 1J23A 1LPBB 1OROA 1T6BY 4FIZA 3KQMA 4H1HA 3CZMA 1CNMA 3MAGA 1T0IA 1Y48E 1ZP6A 2QG9A 3P2JA 4LYGA 4CJXA 4ETWA 5BSTA 1XPOA 1VCHA 2FQXA 1OLSB 2H2HA 5FOXA 4LBVA 2C7OA 1X7XB 3I9MA 4BYGA 3O94A 1QVGB 2ZSAA 4GP7A 1SUIA 5CDUA 1CY0A 2YWHA 3G9QA 4II7A 3CSUA 1X14A 2NUBA 1FP1D 3ICPA 1WB4A 1PL0A 4IOMA 5EJGA 1ORIA 4WXMA 2BVNA 4CCSA 2ZPUA 2ZJAA 1WV1A 4FB5A 3QWHA 2EL7A 4HLQB 1EJ6A 3HP1A 5HFAA 2P9YA 1R64A 3D81A 3E9CA 3EGXA 4RA6B 2H1RA 4MUKA 2UZAA 1LA2A 1OFIA 3E9EA 4EY6A 1ZJ6A 4DBLE 1YR3A 3SEFA 2O05A 5CVUA 2GEUA 5B6JA 1WDWB 4E4RA 1Z5ZA 3DA8A 3ORSA 2Z4RA 2Q4RA 4MTLA 5E8JA 2J6HA 3W8RA 3WWYA 2PZ8A 3FI0A 2LCFA 2F90A 2ODTX 5A0TA 5L3QB 4F7DA 4YCNA 3THXB 2NADA 2ZCUA 1UP6A 3CURA 4NNJA 4DUGA 4FEGA 1G55A 3RODA 2A6PA 3GDWA 3RRFA 5I6DA 1O9GA 3H84A 2BGJA 3QELB 1CXZA 1X70A 3W6NA 4XQEA 2D0PB 1JHZA 3EGEA 3LF1A 1GRCA 2PFGA 3KOWA 5D6NA 5DTJA 5CA0B 3OIVA 4DNXA 2JDID 4KR0A 4MCJA 2YIDA 3FY4A 3W8EA 1D03A 4A2PA 4PGAA 3CTMA 1M2NA 2O1XA 4UTRA 4CL3A 5AIAA 1A9XB 4CM1A 5KJFA 1E7SA 4CHTA 4F21A 4YPOA 2FY8A 1JR4A 1LBQA 1V71A 2HNBA 4LMBA 4WDQA 5C7YA 4KODA 3HLTA 1RZRD 1RZ3A 1LVUA 2ZROA 5LDGA 1W85A 5LB2A 1KJ9A 2DBQA 4IFIA 4OK6A 4A2QA 2VN8A 4X00A 1MA3A 3LVQE 3ZYCA 1W29A 4NFHA 5ADHA 1FSFA 2JB9A 3OTOB 4RTSA 2INGX 4X85A 3VU0A 5L3SA 2CKDA 1FLAA 4RACA 4RO0A 4Z7QB 2R00C 2QV7A 3RRBA 3VNVA 4QVIA 2DKFA 5HIJA 3UWMA 3PPWA 2Q07A 3LRPA 1V16A 4G84A 3AJ9A 3V9AA 3WGLA 3DQQA 4F1WA 2JGFA 2P79A 3FUXA 4ZWNA 1CS4C 4NCHA 1IN8A 2HEGA 3R0JA 4HV4A 4RD1A 3OJFA 3GN2A 5IYPA 3E8MA 4NJMB 4PGGA 4QE3A 3FCCA 1XZCA 3BSWA 4F3TA 3E8XA 2ZM6B 4J94A 1QTRA 2QENA 4MPJA 4RK4A 4TLDA 5D51S 1QP4A 2P6RA 3DE3X 1YQTA 4HB4A 4CQNA 3LHKA 1BZYA 4JP8A 4G0ZA 2I3GA 4HFNA 1QDUA 1SBHA 2OAQ1 4RPKA 5DU2A 2IYUA 4ZA2A 1W2GA 5BQXA 3SZOA 2FJUA 4BBJA 1HDCA 1DIHA 3EMBA 3HJTA 3KOZA 4MR7A 4XD2A 5GIOE 2ZSEA 1QIGA 3JD2A 4KO3S 4NTZA 5B6IA 1KY2A 1BOFA 3F0TA 3K7EA 5JAIA 4N0MA 2DFKB 1M0EA 3Q41A 3V6MA 3HN7A 4J16C 4KFTA 5A3JA 4PX5A 5DKFA 4ZOEA 4UZSA 1NGSA 1I51A 8OHMA 1MOZA 1QHGA 4EA9A 4IIYA 1FLNA 2Q6OA 1F2TA 1R6VA 1XROA 1Y82A 2G7ZA 2VHEA 1E18A 1GPMA 2CHUA 3AUYA 1G5IA 2GVNA 4BE9A 4CDMA 2ESRA 4IZOA 1KERA 2G5TA 2JCGA 2Y92A 3RV4A 5E3IA 4EB0A 1TZ2A 1N5LA 1MIOB 4D74A 4FLFA 1MT3A 4QBIA 3PIIA 2W83A 2ZTMA 4M22A 4AIRA 1PQWA 3D02A 2HB6A 4O4IA 3KZ1E 3UH1A 2XT6A 4F6CA 3L07A 1EFPB 3EB9A 1UJ2A 3P7MA 4MVJP 3F7NA 5IC4A 2ZCVA 4PO9A 4QEZA 3WL8A 2VH5R 4PLTA 1RQRA 4XYMA 3F98A 4B3FX 1T4CB 2C58A 2VAPA 1P31A 2ZSBA 4OJKA 2FPGB 3MCUA 4E5UA 1F6BA 3GPDG 1IU9A 2YHAA 1XZKA 3HPRA 3M4YA 3JWHA 5E1MA 3SS7X 4X65B 3KJGA 5F76A 3WGUA 4AZ3B 3PWSA 3CCVB 2NUAA 2O0MA 1OLOA 3GAAA 2FZEA 2HU5A 4HZIA 3VPSA 3SBXA 4AZ0A 3AVPA 1ESEA 3NBFA 1G9TA 2Q50A 3KHSA 3F3MA 3QPAA 3TLBA 1R4AA 3QOFA 4X54A 3CX4A 3D8HA 3TUJC 2IJGX 1RQLA 2ZJBA 4G36A 3Q8MA 3H8VA 5AM1A 5HR5A 4WECA 5B30A 2HHHB 1G8HA 1ZWKA 1N0VC 1RAGA 1ZNWA 2WFZA 4JBGA 5JD6A 1VKNA 1DWQA 3HRIA 3NIBA 3IERA 2CCKA 5D7BA 1Z8FA 1DRKA 2Q2VA 1RFGE 3S1AB 3COJA 4BNLA 2GZRA 1NLFA 1JUDA 2P9QA 4MUEA 4ZAXA 2QM3A 1U2TA 3B1KA 1MEOA 1V26A 2VDUE 3N2NA 2ZRBA 4O33A 5G0TA 2KMLA 1ZU5A 2QSYA 1SAYA 4ZVPA 5C7IO 4ZGGA 2PAAA 4YJFB 2PUEA 3P9PA 1SBCA 3KZVA 5IC6A 3NHRA 4ZVSA 3BMOA 3ZDDA 1CD5A 1D2MA 4REQA 1QKJA 4GD3Q 1YQGA 2Y8EA 4H0FA 2WU4A 3O8OA 4JC4A 2QAIA 3H1BA 3SNHA 5A3VA 1E2BA 3QRWA 5DE3A 4DG8A 3H9CA 2XJ9A 3GO4A 1TU3A 2APJA 3TH5A 1T3HA 5EE9A 2A86A 3S99A 3TO5A 3OZBA 3KQLA 1M75A 1UPXA 2FX2A 1UQTA 2IDMA 2Q8NA 3AJRA 3LXXA 4NCNA 4FKBA 4QU9A 3RRXA 4OL9A 1KEEA 1EFVB 4D8YA 3A27A 1DO0A 3DJYA 4PFSA 4Q03A 2YWEA 4BTLA 4BNNA 1XRRA 2PMKA 5ICFA 5IF9A 3ZWXA 3PNPA 2NVWA 1RYNA 2WRZA 5CVJA 4YY3B 4AFNA 2IP4A 2RD2A 2BMFA 1JDUA 2I2FA 4IWNA 1G5PA 1ORTA 3NW9A 2CZQA 3COYA 4KDRA 4L7QA 4EVRA 4Z4YA 5JCOA 1VKZA 1Y9JA 2VT2A 5ALLA 5AKGA 1QP8A 3QF4B 2Z6BD 4MUAA 4R0VA 4XI9A 1UOOA 4JJKA 3MWFA 3DVAA 4RZQA 3OAAD 3UJAA 3VA7A 2JZOA 5TR9A 1NR7A 2UVPA 4XDGA 3OFSA 4BP3A 1GPKA 5CA1F 4A27A 3RASA 4LDZA 3GLVA 3A3KA 1XMIA 4G4SP 5AKKA 2PPLA 3L8MA 3UO8B 3PLAE 4JSTA 5E9JA 2AMVA 3P0IA 4BIIA 3N2KB 2A9QA 4D0LB 4RZUA 1VZ3A 2CXOA 3GMDA 3IELA 2VSQA 4PX3A 1Y1KE 3CPHA 1N9ZA 3L8FA 4YHHB 2YKGA 2GWRA 1OHHA 3DHYA 4RVSA 4HRYA 1ES9A 1IZ0A 3H13A 1O58A 2JZCA 3ETHA 1GA6A 3FGPA 5I9MA 3UAOA 5T5QA 3OLZA 5I9BA 2G07A 5AVZA 2XIJA 2HJRA 1T2UA 2H5JA 2QLMA 4L74A 2CF4A 2NV0A 4BQRA 4S24A 1KHHA 4JVMA 3NIWA 2ZS7A 5FI5A 3T4UA 3ZE6A 2GK4A 2PQ2A 4BN0A 5M29A 1K6XA 5F4BA 4ARZB 4YMHA 2XOKD 2GFHA 3RPEA 4LDPA 4N5MA 3MXOA 4XSHA 3EPJA 1B3RA 2MYTA 1KI6B 5JG7A 4J49A 4P0PB 2A35A 1T5DX 2H7VA 4BEWA 3FLEA 1T36A 2FZGA 4LVCA 1HDGO 4BU0A 2VPXA 1WORA 1I6LA 4O5AA 1LPMA 1EM6A 1EM8B 1Z15A 3R09A 4YUVA 2BI8A 3C3YA 3DHWC 4AO7A 1LJ8A 4PLYA 2IH5A 3QPCA 1EDBA 2AQIA 3PXCX 3T34A 4DUGD 3TGLA 5H16A 2A0FA 2HY7A 2AZTA 1AQ6A 2ZFUA 3NCHA 1ZD2P 2GCPA 3C7DB 4N7JA 2ORIA 5EKDA 2IQIA 4RTJA 2FX5A 3BAZA 3OF5A 4CG3A 1ECBA 3OJOA 3L9WA 2WYOA 2HGZA 1NVXQ 1X1QA 4H7PA 4E12A 1AXRA 3HCEA 3GMTA 4LUCA 4BX2A 4NE2A 4MA4A 2Q3HA 3O92A 5JZSA 2X4GA 4EG4A 1XD9A 3QJ5A 3S28A 3PCTA 3TW0A 5K0CA 2WJIA 3P8ZA 4H4CA 4HATA 4OHCA 4JL6A 5DFAA 4ND6A 3TW6A 5G0WA 2FUG1 4S0ZA 3A6GA 3BL5A 5B1EA 1VG9B 3OZSA 3REQB 1XQBA 3WJ2A 1QANA 3ZE2B 2QU7A 5B7NA 5CIWA 1O6ZA 2FSVA 3P4XA 3SC2B 2Q3FA 2ZIZA 1JU4A 2XQIA 3M3PA 3WK9A 1ZQ9A 2H7YA 2HQ1A 2Q1YA 3VOAA 4WOPA 5HTKA 2HH9A 4XGNA 5ENDA 4IDCA 4LZOA 3MT7A 4IO1A 3EGWA 4F7WA 5HQ3A 4QQFA 2Z8YA 4FKZA 1B0UA 2YDXA 3FPBA 4IGFA 4ZYZA 3V4SA 3NTRA 4YRNA 5E6RB 1W34A 4NPAA 1R5JA 2QJOA 3AJAA 3LT4A 1C1HA 3NRJA 2MT9A 4XAQA 5JDIA 2IYFA 4B3MB 3U61B 3A6KA 1M34B 2I9KA 4X6XA 2KB0A 4MVJE 1UJBA 3X2EA 4N18A 4DJ5X 2ZRMA 1AXEA 5A05A 4GVLA 1CJUC 4YJGA 3I04M 4RDIA 1NJ1A 1FTWA 2BDUA 5BW6B 2EKZA 1V2HE 3L8ZA 1BX0A 3LZDA 4MQFA 4DTCA 2XRYA 2X42A 2OFFA 1P1IA 2GEKA 5I4IA 4R2IA 3WFJA 1B2LA 4BO6A 3W04A 2DUWA 3W5JA 5LXTF 4CW7A 4JT9A 4L78A 1COZA 2W5UA 3DWGA 6ADHA 2O8DB 1AKTA 3OT1B 3VC2A 4BLOA 1K8YB 5DI3A 1YBMA 1GA1A 4QQKA 6ABPA 4EWLA 2Z30A 2WNHA 1YR1A 3PF8A 3QYPA 3R9WA 2MWMA 4H4DA 4JITA 3E61A 5EUMA 3MCVA 1JHMA 2B4QA 2OGTA 5E1BA 3EUWA 1N1MA 1FMJA 4KFRA 4ML3A 4YJ2A 4FR0A 5K8VA 1Y80A 1C2TA 4ND7A 1D5WA 2XKAA 4UU0A 4KH1A 1A76A 3R2JA 1XTRA 4ZVMA 3RS3A 3D3QA 4IIVA 4M7WA 4TQ9A 4G4JA 3C1TA 4QM6A 4PYJA 1QYXA 2X2FA 3S2YA 1GSHA 1HXHA 3GNQA 1GSOA 4MWZA 4YRDA 2FQQA 4QPPA 4I1PA 1IEVA 4P33A 3VFDA 5GONB 2IV2X 3TR6A 4B73A 4AJ2A 1SCIA 3NCTA 4NX2A 3PWKA 2WTXA 1K8ZB 2ATVA 4U02A 4XJXA 4X63A 3V7FA 2L2QA 1JDNA 2YRWA 3I6QA 4KQXA 3WGQA 1RC8A 1M6YA 2O8CA 1SVIA 2RGAA 2WHXA 3DOIA 4NMXB 2EP8A 4I81A 1XYGA 4IUDS 3D2CA 5JT1A 1VBFA 1KEUA 2CLEB 2ISSD 4NEHB 2VJCA 1U7OA 2PM8A 3HZRA 4JQOA 2WJ3A 3ESZA 3E20A 1FVFA 1P5FA 1IPEA 1PDVA 1YQ9A 1RHUA 5E4JA 4C2TA 4KGDA 3N6VA 1QGOA 1UZNA 3KAKA 4N5NA 4GBJA 1Q91A 2YRFA 1NBHA 3TMKA 3NOOA 3QK7A 2AN3A 2IY8A 3K0KA 2ONZA 4HRXA 3H5NA 1NV8A 2FHPA 1QH8B 4MUIA 2VTDA 1VQPB 1MH9A 2I3ZA 1B42A 1CE8A 1H0KA 4NU0A 1EBFA 2Y76A 5BR1A 1ULTA 1XTJA 2QSJA 3UN1A 1WCIB 5B3AA 1B8NA 3ELYA 1TQ8A 2WWFA 3LWZA 3QJYA 3PU6A 3W9YA 3T94A 4E5SA 5LLTA 3RADC 3O5AA 1VSBA 2XDQB 1EXWA 4CEHB 1H6AA 2QTZA 2CZCA 2RHWA 3L4BC 3NEAA 3ZCXA 1QFXA 3ANYB 2DMRA 1SZCA 4R1OA 3AETB 1VMIA 1X94A 1JQBA 3AC0A 4QBKA 2ZSUA 2I6SA 3LKVA 1SQ5A 1U81A 2B36A 4RPJA 3R9IA 1LQUA 5AHWA 5LVAA 3HY3A 3VMFA 2V6FA 3V1MA 4NG5A 2HTEA 4DT1B 4UOQA 3U7IA 1IXSB 4NNOA 3W6ZA 5FP0A 1YCDA 5AHOA 5HZKA 4BKUA 2BM0A 3S27A 2PT9A 2C78A 3ASYA 3AR9A 3ESCA 1FC0A 3Q6MA 4Q39A 1E1QA 3WK4A 1G5RA 1UBTS 1CV2A 2W4MA 3IOCA 3ONEA 3L46A 3WSVA 3WYGA 1N5DA 4D97A 1TM3E 2JLYA 4B31A 1IHYA 3FKSA 2CMHA 4QRDA 3A1TA 5C1DA 1V0EA 1F3LA 3UHPA 4J9VA 4PVCA 3ITEA 2ERYA 5EJ8A 2JAXA 3Q7EA 2EGGA 3EMDA 3TKAA 3U4DA 2CKMA 1JLLB 2WTAA 5SICE 3T5BA 4QSHA 4YT5A 1E9AA 1C0IA 2Q8QA 2C7GA 1MMFB 1XCOA 3DO6A 3GT4A 3NT2A 1X1AA 1G60A 4OHRA 5F1KA 2ZIUB 3VYUB 1RM5A 1OILA 1SCBA 4HZUA 4OH7A 3E35A 4PZPA 1FRVA 4A0HA 2BGTA 4TMZA 3H75A 4H77A 4WBNF 1MB0A 1OHHD 2NT3A 3IXMA 4JMQA 4MP6A 1UDWA 1Y37A 3KKKA 2OLJA 5J2UA 1GTSA 3KE8A 4M76B 2Z2ZA 4XCQA 1N2BA 3EIFA 3PIRA 3LF2A 3KM0A 3CS3A 4FE7A 1JXMA 3TQTA 4IRXA 2J48A 2O2EA 3JARB 1T25A 5BVHB 1CY8A 3MQ4A 4OHUA 1DPFA 1K7FB 1UDAA 1Y6ZA 4I5DA 4US0R 3ZHBA 1P9WA 1YS7A 4KVAA 3VNSA 4D8WA 2UXBB 4J75A 4TLMB 4KITB 4WTOA 1GRVA 3IIKA 2P2ZA 3ZWQA 3C16C 3M1IA 4MWGA 3JU3A 1E6KA 3O47A 4UZEA 1T1RA 5IN4A 3M6LA 1DJOA 2XOEA 2XEXA 1VRCA 5DASA 5CFPA 4G9EA 2XXAB 2A33A 2QTAA 2VP5A 5IJ9A 1EXDA 1K89A 4MUBA 4U3JB 1ADBA 4RORA 5K0LA 1UPUA 3AVQA 3EOBI 3NG1A 5EZ6B 3ZVLA 4BVHA 3FFXA 2VZLA 1H6DA 1T3TA 3COZA 3ZXYA 3LT0A 1CHNA 5CNMA 1KIMA 2VRWA 3K1AA 5SY4A 4G0MA 1P62B 4RM3A 5F5LA 1AHIA 2XKJE 4WKPA 1TJNA 1ULZA 5SYNA 3GFPA 2VNIA 2QT1A 4K88A 4YUXA 4GBED 5DGCA 4BVGA 5BYKA 4L6IA 4C76A 3PE3A 3V55A 2RBKA 3A58B 1IN1A 1BIFA 2XYHA 4WK6A 2PWPA 4X60A 3IPRA 4EPYA 1IUNA 1S3SA 1YJ9B 2FR8A 3FFWA 3A9VA 1YC2A 1EZ4A 3B1WA 1I4LD 4MQLA 5D1HA 1K7XB 4L0DA 1T4GA 2BTQB 3FNHA 4L5YA 5TS2A 2R8EA 2N42A 3A4IA 4OYRA 3OPNA 4K9KA 4HFMA 4O2BF 3H0CA 3PQDA 4H18A 3FXAA 2G0NA 4ZVRA 4RK1A 2P2YA 1JHRA 3IIJA 2YZ7A 4DDTA 1EJBA 1XBTA 2ZUSA 3ZNNA 3W5VA 1X1TA 3TRHA 5C35A 2QTHA 2I6TA 2BYTA 3JQBA 4AZTA 3O8RA 2WJ6A 3RQSA 1H1LB 1DDGA 2ZIWB 3T3IA 3AL0C 4INOA 3HWWA 2JCBA 1Z12A 3C74A 3NGXA 2VPTA 2JFNA 1ZUIA 3NI2A 4TKLA 4IH1A 3UM9A 3K8YA 3VR6D 5JUWA 2UUCB 1JKFA 4RL4A 1UXJA 1NVMB 3DZBA 2DKNA 3FWZA 4R84A 3USCS 1G21A 1JR3E 3F9RA 3CLHA 4KKUA 2VZ0A 5F1OA 3ZQ4A 3H6GA 1IB0A 5E7QA 3ICEA 3M4XA 2B35A 2NYUA 1CY6A 1T4MA 3H5WA 3UA4A 1FSPA 4PZAA 4RW0A 3E4DA 4GEGA 3SC6A 3SE7A 2QW8A 1OTXA 3BQJA 1T2AA 3CW9A 3K4HA 3OFVA 4FU0A 4B46A 4BFCA 3ESYA 3TTWA 4MV0A 4DDHA 1R27A 3OT5A 1L4KA 4JJ4A 1KJNA 5AO9A 5LOVF 1Z2CA 1R4NB 1YDWA 4FN4A 2NO1A 4XJTA 5H83A 3PRKE 1WVMA 3NBZC 3B1FA 3BRWA 1S8AA 1BDIA 2ZULA 3SFTA 2WABA 3IO3A 4BXOB 3K9BA 3PGA1 2HXSA 4QJ5A 3AL2A 3V76A 1A9OA 1PSWA 1AS0A 3M6AA 3RVKA 1CVLA 3NDIA 3AR5A 5FL7A 4A73A 4EY4A 1NXOA 2OENG 4XWAA 2WVGA 4P3YA 1VIMA 2CFTA 2GPNA 1AK9A 2NTJA 3OM0A 3V46A 3Q8LA 3A1DA 4UHFA 1CUAA 5EQJB 1YFKA 4RJIA 2QP9X 3K1YA 1K4YA 4CU5A 5MHTA 3RSLA 2X3UA 3TQHA 2VAXA 3ROPA 2H3EA 4M8IA 2C03A 1BN6A 1AX9A 1I1NA 1P81A 1I4EB 1RCTE 2XGMA 3HB5X 4RQAA 4G8DA 2CC2A 4ZEVA 3U3DA 4MPRA 5JH7B 4IYRA 1N0IA 4JC8A 1CEXA 3EK2A 4CMCA 1Y7TA 2C7RA 1RQGA 2QTTA 4P4GA 1ODJA 3V48A 1PJ2A 3CLRC 4TXMA 4I1RA 2CGEA 4NG4A 3IQIX 1LK5A 1SCQA 2I71A 2XF8A 2XUQA 5TSDA 1BWSA 1KDPA 2GHQA 2CB0A 4JYPA 3B8EA 5MN4A 3KLOA 1W5BA 1REQA 3T7JA 1GG9A 3PJEA 3ZWCA 3DOOA 4HNSA 3TZKA 1R00A 4RFSB 3VHXB 1EVIA 4MWOA 2O3SA 1RYDA 1RAAA 2AR7A 4QOGA 4PZCA 2Q5HA 2JLWA 4U7WA 4YH1A 4BNWA 2BKVA 2ZEJA 4N7RA 5FUVA 3RAPR 4RABA 4ASUD 4PC6A 1J39A 2BBSA 2ZRQA 3L43A 3UEOA 1U2QA 2F00A 1Q0PA 5AUQA 1A98A 1Y8QB 1XMOB 1YS1X 3A11A 4ZU3A 1XEXB 1T0JB 1EDZA 2GTIA 2Z5LA 2O23A 2CF5A 1JR2A 1T26A 5KNCH 3RNOA 5DBFA 3OX4A 2ATXA 3VJKA 4IP0A 4HAVA 4TM8A 1W8IA 3PUIA 1UDRA 4MJLA 4P2GA 2IV7A 5KQGA 1CUXA 5FLXA 3UUFA 2VK8A 3AIOA 3H87A 5FLKA 1KQFA 4OM7A 1XTPA 1C1XB 1YQXA 1L8OA 2EFEB 3VVLA 4QVJA 3FYHA 1KYXA 3RIMA 4C1BA 1ZGJA 3TLMA 3VZRA 4ZTZB 3MYYA 2LPMA 4OQZA 4WIAA 2ZUBA 1XALA 1Y5NA 2BEVB 4LWQA 4UVIA 4WZBE 5GGXA 1CDDA 1KS2A 2JIBA 2YDYA 1VJSA 2ODQA 3F46A 3JVEA 4HXYA 3ZWAA 4C07A 4RQTA 1BW9B 3MXTA 4X97A 3ZQKA 5ESDA 5CEFA 5HHTA 2AN4A 2WBLC 4L3WA 4LHYA 3ZVRA 3PEVA 4KMSA 1A5SB 3BICA 1L4YA 4JBLA 3RO7A 2OOKA 4P36A 2YVAA 2Z3ZA 3OO1A 3BK2A 4LY6A 3SVTA 1GFZA 1Z5PA 1ECLA 4BV3A 4EUFA 1QQ5A 1UP7A 2PKRA 4XIJA 5A03A 3TOZA 1JG1A 3BDIA 5CNKA 4LS3A 4B09A 3E2MA 3U56A 4QU8A 2XZDA 4TZ0A 1V7PC 2ERCA 3FKSD 3T54A 4CL0A 2GAOA 2OXEA 1XKTA 3AG6A 3H5RA 3BH6A 4GGPA 3ZDCA 2OECA 3TM4A 4LJYA 4C04A 3ZBPA 3PNSA 2GEFA 3OM8A 4HGNA 5CG1A 4M1OA 1NF8A 3C6XA 2QR5A 2IYLD 4BEBA 4PYRA 3MAAC 1GL7A 4NH0A 1CY1A 2R1TA 5KX5B 1C8BA 1VE6A 3OW2B 3P2YA 5JZMA 4UCXA 4BJ3A 3L6BA 3TX6A 5KOYA 1V25A 2IEDA 5JJKA 3MD0A 4B7XA 1R6BX 2JGEA 2NQ8A 1NYRA 3EA4A 3R3ZA 3BWEA 4I2VA 5DW0A 3B8HA 4EMSA 4LK2A 1J1ZA 4M0UA 3BIWA 3L79A 2AHOA 1O94C 4E15A 5DZSA 3ZCVA 3ASSA 3A4NA 2DUMA 2X53S 1KJIA 1QE0A 2WIJA 2ZIFA 3KHTA 1I18A 2ZBVA 4TS4A 2YXEA 4MVYA 1F1BA 2ZSJA 3GLKA 1W4AA 4KUHA 2ZETA 4QBHA 3ZS9A 4UTPA 1BFUA 1F8UA 1HF3A 2D8MA 2BLLA 1VFPA 2FRDC 1XV5A 1D2NA 2WT8A 4AXBA 1GTL1 2QNBA 3HDGA 4P3NA 4EY5A 1ZNXA 4ENQA 3BRCA 4ZIRA 2XJ4A 4ZO8A 2VWGA 3TLAA 3PT9A 5FR2A 1BMFA 2XB4A 1Z8HA 5BUCA 3LC7O 3ROMA 4CLDA 1ONPA 3BQNB 4RA6A 4J2TA 4AB1A 4DLSA 4PLFA 3H9EO 2VKQA 3E9MA 1NM5C 2ZI3A 1K9MD 2WKSA 3R40A 3EZ9A 4Q9AA 1MJGM 2B78A 4CV1A 5HTOA 2JBWA 2VG8A 5JC1A 2PL3A 1GZ6A 4ETNA 5L3QA 2O2DA 3WGKA 4GPTA 4E22A 4I3FA 4MKFA 5IJZA 4CDNA 3BHNA 3PC8C 1NVTA 4G09A 3C3XA 3QELA 4AL4A 1DQYA 4G1EB 2OGSA 4LSWA 2QY9A 4GP6A 5CA0A 1IJKA 1GP2A 1Z3CA 1L2TA 2BE7A 1KZGB 4QC2A 3ZTYA 2OB2A 1A69A 3SK0A 4HDKB 3GCXA 3W78A 1T10A 4DJDC 3A2KA 4YWHA 2HQRA 2AMFA 3I0ZA 1A9XA 3AF6A 1ZOLA 1USKA 1ZZEA 4P7KA 4X20B 2A92A 2GAJA 5D5HA 5I9TA 4JY7A 2G9ZA 3VAAA 2VA8A 5CFLA 2KYRA 1F48A 3KU1A 4EG5A 1GTG1 1ITZA 1JWAB 1C4KA 1KXJA 1PNQA 5DNUA 5DHQA 1IHPA 2JLXA 3NHMA 2H8GA 4RZXA 3WYEA 3I8OA 5EG5A 2CFCA 3PYLA 4R1PA 3H5TA 4CPDA 4U2FA 1DWUA 4B45A 4DLZA 3AXTA 5JJ5A 3WYAA 1YQUA 3AINA 2ZR0A 1Y9DA 2CFRA 2O07A 1TC1A 3I76A 3MGKA 3B13B 4I1VA 1NUHA 3ZJYA 4EJMA 1B8OA 1I3CA 3IILA 3DE0X 2IHNA 3DV9A 1II9A 3E1GA 4HF7A 4OGWA 5EJ2A 4UVEA 3V4ZA 3ZW7A 2W6OA 2H16A 1DMRA 4JB0A 3FOAA 3REGA 3UY4A 3UVEA 1QIKA 4FZ3A 4NJMA 5G3ZA 3NTOA 5CVTA 4FX2A 2GREA 2JBAB 3EC1A 2PH7A 4OHFA 3AM4A 3Q3AA 2D7CA 3IGFA 1UBRS 4CIAA 3LI2A 1QM5A 2HK9A 3UZUA 3WMEA 3O0TA 1TTPB 1FMCA 3LW8A 3BMNB 2QGGA 1JKJA 3PFKA 4NKRA 3SE0A 3TMAA 4TLEA 5FL7D 5HILA 3RAEC 4Y1RB 5J43A 1A8PA 3X1ZA 4L6AA 4NI5A 2I7TA 3OLVA 3QA9A 2AS0A 2J3HA 1TT5B 4I4CA 4MYHA 3GZNA 3ONVA 2B2NA 4NBWA 4AO8A 4CTNA 1N3IA 5AUPB 3KQKA 2Z58A 4KE7A 3EPPA 1B43A 5CFNA 2P9EA 3PFNA 5I4BA 4NXMB 1ZMRA 3OFKA 3KIPA 2XB2A 4JR0A 4TRJA 2Q3DA 3ZGYA 5MDHA 4XORA 5HBGA 2M6SA 2J0QA 2P27A 3UV7A 1JSXA 4QOJA 4N3GA 4FYXA 3CW8X 2DOKA 5IAKA 1GPH1 3T7RA 4DCNA 4MQ5A 5ARDA 3A1NA 3WWDA 4RK6A 2ZIGA 1ABFA 2BFWA 3DNFA 2VA9A 5B58T 3SQOA 4DBVO 1R3UA 1T9GS 4CODB 5BQ3A 4PC1A 3OEHA 1VG1A 3OUUA 2FPPB 3PPVA 1MFZA 1O54A 3A6JA 1EX9A 3GGPA 3PBKA 2BL4A 1YU6A 2G63A 4LDRA 1EFPA 2RGEA 4OY3A 3ORHA 4UW9A 2PRZA 4QBTA 5ANRB 3A9WA 3R44A 4B33A 2ZJ7A 1VYHA 3HJFA 2WQ7A 3ZUGA 3L18A 4TWRA 1S5PA 4DM4A 4KOEC 2DAPA 3SSNA 2FPGA 1X9HA 2QL9A 2YCLA 4IVRA 4TLLB 3CLTC 4B3BA 4XWWA 2CV2A 2CFIA 3CR3C 3MWYW 4Z51A 2BI4A 2NU6B 3Q5DA 2H7CA 4FWBA 1JEDA 2HRCA 2V7BA 3H1PA 4HNAA 4DDWA 4YXFA 2CFSA 2GPAA 2R8PA 3I9V1 4CLRB 4QGSA 1R74A 4AS1A 3SLNA 1H93A 1MAWA 3GLSA 3DCIA 1UQUA 1BXGB 4OSEA 2ZANA 1EJ2A 3R9XB 1TVCA 3MBIA 3Q5EA 2QL5A 4NAVA 3FZNA 5FTNA 3D43A 4B35A 1Z37A 1TJ5A 4LBYA 4DMRA 1C7QA 4IDDA 4AYWA 1O6FA 1DT3A 2C0QA 4UNIA 3EQ2A 3ROZA 5MF6A 3S1AA 2WD7B 3OWHA 1URPA 1OFUA 3SU8A 1KETA 1IY8A 1EFUA 2ICAA 3HNOA 1YH3A 4QD3A 3H0EA 4ESHA 4ZDIA 4EYOA 4MH0R 2AEJA 4QFBA 4OHZA 4OXXA 4BAGA 1HTTA 1AGXA 4YJFA 5KJ6A 5KTPA 4PLPA 5G4KB 3JQ8B 3PFGA 5CJPA 4DJAA 8ATCA 1SC1A 4K87A 2VPIA 5DN9A 1RAFA 3AERB 4AQYB 2V4DA 3JAKB 2CL5A 2PQ6A 3EEQA 3PRYA 4QHYA 1ML4A 1N3YA 1VMAA 3OZGA 4RGYA 5HCNA 5E6TA 3W5IA 5LQKA 2F4VB 3U13A 1M9NA 4WKOA 1SUWA 3U6KA 2A1TS 3SFZA 1TAUA 1T6NA 1NA5A 1AUXA 4Y0AA 4MMYB 3DT9A 2PZJA 1OX5A 1PQYA 4G0QA 4KUGA 5AXBA 2HK8A 3LXRA 4FCCA 1L7NA 3K8ZA 5JO0A 5CB8A 4C7OA 1HRDA 4KKXB 5C7OO 2C1XA 3MIIA 2REXB 3MINB 4QG7A 2CHVA 5HK9A 5DNWA 1EFVA 5CHYA 2ZXEA 2VJLA 4XWOA 1NWHA 3ZDAA 1CK4A 1U65A 1GZVA 1FQOA 3PLNA 4NDAA 4MS1B 4OHBA 3FTDA 3HBMA 2ZZGA 4M36A 4B4VA 5LDHA 3M49A 3JQRA 4QTUB 3WDLA 1QFMA 2A5DA 4O3FA 3U49A 2G36A 1G7RA 2BUBA 4KDFA 1OD6A 1C0LA 4W6ZA 3TQRA 4DCGA 3UXMA 3F8TA 1G9SA 1PZEA 1GUAA 5A89A 3GW8A 3L04A 4NBUA 3KZMA 1NPDA 2IEBA 4WOBA 3RTEA 1K92A 3SS8A 3GCWA 4DYDA 4ZCMA 1ZUHA 1SBQA 3GGDA 3RVRA 3NPAA 3AJEA 2DTDA 1WKCA 1BH6A 1ZISA 3OX1A 3U4MA 1OI2A 1PLKA 2GM9A 2Q6TA 5CH8A 1D1SA 2X85A 4C06A 1M2VB 1KK1A 5KOJB 3DAOA 4LC1A 3IT0A 1FB5A 2FMIA 4MQEB 4J0JA 4UNNA 3HN2A 4YAWA 1Q1GA 4W9NC 2AX3A 2QE7D 1EUZA 2WIFA 1C14A 2R1UA 5BSMA 3Q6RA 2AT1A 3D6JA 3SN6A 3CLVA 1IZZA 1P44A 3R5JA 4BB6A 1O6CA 3MMXA 2COUA 3AVYA 2BZSA 1CFJA 3JZFA 3CCMB 1TO1E 2PKQO 1PFYA 4BO4A 1E2JA 3D6NB 1Y34E 2ECPA 1BMFD 1SD5A 5HJEA 3TAUA 3VJLA 1F0KA 3AKDA 3AEUA 1NBEA 4ARZA 5FUMA 2RHLA 3P2IA 5IVHA 4HE5A 2G70A 3A1UA 1YAJA 1QGAA 3I1FA 2RHDA 3ETNA 4PYOA 2WVAA 3N5CA 3RIGA 1ZIYA 5AKHA 1HORA 4WZEA 1QGYA 3TNDA 3MT0A 5JS6A 1EM8A 1X8LA 4TVOA 5E6UB 3UATA 3TSAA 1F12A 3PFHA 3N8NA 4RC9A 1IXRC 2ZUEA 1WBBA 1RPZA 4R8VA 3PUNA 1A9TA 2WWVD 3OX3A 2GEJA 1FFDA 3AFHA 5IF3A 4Q18A 3DUFB 5KNBD 1LVHA 2DPXA 2JCYA 4P7JA 3K35A 1XNJA 5BUQA 1OLUA 2FB9A 3L0PA 4AURA 4BCCA 4RMHA 4Z4EA 2A9JA 5I7AA 2O57A 1KP2A 3WL6A 5MGBA 4H60A 3ADOA 1GUZA 3O38A 3ESXA 3BGSA 4LA4A 3HCFA 4ZKEA 5T67A 3FPPA 2NVUB 1OFUX 1UKEA 1F60A 3REQA 5K0NA 1OFVA 3QWFA 4BVLA 1AQNA 1CZRA 2PZGA 5BNFA 1H4QA 5ALIA 3SC2A 4IHJF 2IW1A 3VYVA 1DJPA 2GYVA 4Y6QA 3GDFA 5LB4A 2VYVA 5LWHA 4DEVA 1UBHS 5KQLA 2CK3D 1QMGA 1TZMA 3OWOA 2GBLA 4N6GA 1ZNYA 2TECE 3BE8A 3STHA 4MGKR 1M10A 3HDHA 5ALDA 3K0CC 5K4GA 1J49A 4IQ4A 3HFSA 3FVWA 1VHQA 3IPYA 5SY6A 1E5DA 3G2IA 4LY9A 4AUMA 2Z04A 2EFDB 1BQEA 1VA4A 1M34A 4EFMA 5B4VA 5KB3A 2HWYA 5IC5A 3AM3A 5AESA 4DEYA 3ZU5A 3NDJA 4YV7A 2OYCA 4IDOA 4QU0A 2AJCA 1E3XA 4EB6B 3GNLA 2GQ0A 2W42A 3MJ4A 3LJKA 5DRYA 3LCRA 3EZFA 3TNLA 5A9TA 2P69A 5TPZA 1N08A 4LJ9A 5EOVA 4WQMA 1KYTA 1GU1A 2FE4A 5CEJA 1Y4AE 3K6SB 4IIEA 3CCCA 3WV5A 4CMKA 3NO4A 9LDBA 1RD4A 2VEDA 4M9SA 3VPHA 2IWHA 2JH8A 1F5NA 2HMTA 5T4FA 4LOHA 4YQFA 4Q19A 1K6EA 1US8B 2RARA 2RBEA 2XF2A 1TI7A 1XEWX 2MTBA 2PXAA 1R66A 3DVRX 3RKRA 2AMLA 1PW5A 2XVAA 3BIJA 2VZ9A 3H83A 3LUJA 1AQYA 1D4FA 3PD1A 1KMHB 4Q6BA 4HNUA 4ZK2A 4ZQHA 4C6RA 4RANA 2Z8YM 5EXSA 4IDEA 3PUZA 3L0CA 3ITKA 1XGKA 4I4LA 2Q3MA 3Q9NA 1IN5A 1JJ2B 4MAAA 1I3MA 2Q3CA 4KYTA 3VYWA 3WK6A 4DR7B 3KXDA 1CPYA 3CR7A 2IDZA 3MN1A 1TTQB 1WDLA 4G0NA 4BLVA 2CBZA 4Z4IA 3UMFA 3VOSA 1YSCA 1J8MF 1SZJG 2WHPA 3AR7A 3FCAA 4P8RA 1XNQB 4YYEA 1U9ZA 4AKGA 1RQNA 3O0DA 4X71A 5I7FA 3ABIA 3O26A 2GI4A 1Z4JA 4JVOA 4E5PA 3UT6A 4JROA 2R8YA 4DA0A 3U6BA 3OBIA 3N1UA 2M98A 4ROTA 1XZLA 4KFUA 1G20E 1SR8A 4L95C 4N5DA 3F6EX 2HPVA 3KLMX 3UTCA 4RM2A 3DEJA 3WQQA 1I13A 1UD3A 2R68A 5K8IA 2GERA 1WUTA 3QVMA 4R9VA 2VBUA 3GEEA 4MYRA 5CX1B 2E1RA 4MP8A 2B8JA 4X91A 5AI5A 2WAXA 1V6SA 3EFHA 2POCA 3AVUA 3MUEA 3HGTA 1OXBB 1UD8A 3WQBA 4E4YA 2YMMA 1L4FA 1Z26A 1ZM3A 3EDQA 3NRBA 4HG2A 5FYQA 4HWOA 1WS6A 5BQOA 3VZSA 4DZZA 3PC4A 4KQ2A 2PFSA 7ADHA 5H59A 2PYDA 2WFLA 3OURA 4RKEA 2IHYA 1Q0LA 5E9WA 3ZDEA 4R6XA 5FWNA 2FEMA 4MZDA 2ZE7A 3DEHA 1P4GA 3QLEA 3AY7A 1XJCA 2NPOA 5EJEA 1QH8A 5F35A 3ZU3A 3DP9A 3L06A 1A2KC 4YT8A 3OSUA 1D3AA 2X15A 1A7JA 1OZGA 1ODFA 2C8KA 4MKZA 4UE6A 1SMKA 1YL7A 4XL9A 3FNGA 2IXDA 1THTA 3BEDA 4OIMA 1DQNA 5T4EA 3R8XA 2XDQA 3A3NA 5B57C 1G8YA 1L8LA 3N5KA 1E3EA 4N03A 1E62A 4BFSA 5BWNA 4CEHA 1WP4A 3KV1A 4Q7MB 3TOXA 5J3JA 4G56A 2JJ1A 1RBYA 4D56A 3AETA 1P5JA 2B4KA 2WC1A 5E8RA 3SOZA 4B6OA 4DGSA 2P1RA 1W1IA 3L5KA 4CF7A 5JD5A 2WD9A 3IB3A 5F9HA 1B74A 4RKQA 2JFYA 1EQUA 3DF9A 4FJ2A 4QYIB 2GBCA 3SKYA 3MCZA 1LLCA 5KTMA 3FSGA 5F98A 4Q4HA 1XCGB 2Z56A 2P6NA 3A6PC 4XPZA 1GN9A 1V7ZA 2XPCA 3WVNA 2YHSA 3BILA 2VJQA 4LRUA 4OFXA 3HS3A 4UM7A 4HNTA 5EZYB 3L7YA 5HXBA 2ZATA 2XRZA 4CTOA 2I62A 3G6WA 1NOIA 2DWUA 2DR0A 3BSSA 1JLLA 3DNPA 5BV7A 1CUJA 4X7FA 2DPHA 3B3GA 4AZ3A 2ZUFA 3FGNA 1PT7A 3OLQA 3G8DA 3LSYA 2HRDA 3WDKA 5F5XA 1A77A 3D6AA 3A7EA 1QKKA 3C6MA 4MJXA 2VQFB 3QHAA 4YAFA 2OC9A 4I8XA 2D74A 2XNJA 3BC9A 2IBMA 3FCYA 3JQAB 4ZT5A 1Z0ZA 2CXXA 2OO7A 4LCBA 1IVSA 1JGTA 3ASVA 5LQUA 1EWQA 4CTMA 3JARA 4IZHA 1DIAA 2WV7A 4XLFA 4P83A 2GPTA 2W4QA 2XRMA 1BG6A 3P5SA 3EPRA 5ALXA 5FV4A 3DFMA 4ZGNB 3THYB 3RJMA 2AOUB 3PPXA 3S2SA 1GU0A 1CCWA 1XDBA 3RAJA 5I47A 4MGEA 5HG0A 4M53A 1JH8A 2W43A 2DPLA 2P65A 3R6TA 1Z56C 1QHHB 2OQVA 3EVEA 3VPGA 3WGJA 4UOZA 1N34B 5JAQA 3JTMA 3MPOA 4G5FA 4ISCA 2C92A 5KKNB 3BN3A 3NIFB 5DK6A 3HCAA 1U2GC 3UV6A 3ZU2A 1MENA 2SHKA 4S3MA 1AA9A 1FUKA 1HL3A 1XVIA 2ZUDA 3RYHB 2XXAA 4G1UC 3K9CA 4U3JA 3UTDA 1QHEA 5GINE 1NB0A 3QV1A 5K3EA 3TIVA 4DV2B 3UWKA 3CCFA 4HXGA 3O91A 1EA5A 3J7TA 4N49A 1BWPA 1LI4A 2UV8A 3SZLA 3MHPA 1H4VB 1U8XX 1Z2NX 2ZXHA 3W2FA 2C3UA 2QNRA 1W4RA 1W5SA 1L1EA 3AF3A 3VVCA 1T5EA 3HBFA 4F1JA 1EB9A 2G06A 2VJKA 3WYCA 3N2LA 1MB2A 4OK3A 1J4AA 2N47A 1Z2AA 3R5TA 4ES6A 2F9FA 3AW8A 2X8KA 4HL6A 4LQLA 3FHTA 4DCMA 4N6NA 1HZEA 1XZBA 2ZAYA 3IP9A 3K32A 4TV9B