1E62A

Ferredoxin:nadp+ reductase mutant with lys 75 replaced by arg (k75r)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPERLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP+ REDUCTASE
publication title Structural Analysis of Interactions for Complex Formation between Ferredoxin-Nadp+ Reductase and its Protein Partners.
pubmed doi rcsb
source organism Nostoc sp. pcc 7119
molecule tags Oxidoreductase
total genus 83
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2000-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1e62A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1e62A02
3CCEB 4PC3A 4PGOA 1W2BB 2PLFA 4H9GA 3AVWA 1I7PA 3U2QA 3JQPA 2DCUA 4N3GA 5KSWB 1KC8D 4HE6A 3I1FA 1VQKB 3WNBA 1FNBA 1KJZA 1AMOA 3QSYA 4Y9UA 2XNCA 1G7RA 1ZM2A 3QFCA 1G7SA 1SM4A 4G1BA 2QA4B 4M1KA 3W5VA 4DQKA 4DQLA 3VNVA 5GV7A 1QVFB 1B23P 3G71B 1E64A 3W2IA 1FRQA 4RD3A 4M53A 3VNUA 1DG1G 2BM1A 4QHYA 1FRNA 3CCUB 1KK0A 1F60A 1FNCA 5TY0A 2BGIA 1EP1B 1VQ8B 3QFSA 1TVCA 1QGYA 2FX3A 3AVTA 2VNKA 4B47A 3CCQB 4RD1A 3V76A 4G1VA 3A1FA 3AVXA 4TMVA 1QUFA 1B2RA 4B3XA 1D2EA 4U9UA 2XEXA 5TR9A 1FNDA 4YAFA 1YJ9B 4M0LA 1EXMA 3WNCA 1IB0A 1ELOA 1W34A 3OZWA 1IJEA 1QUEA 3ZBTA 1VQPB 2VZLA 1R5BA 4TN1A 2BMWA 2CRVA 1GJRA 1VQMB 2OTLB 3WXMA 1JB9A 3I56B 3CCLB 3VO1A 1W87A 3ZZ0A 1NJID 4ZV4A 1OGIA 3ZC3A 1G7TA 4FN5A 5TV2A 1M1KD 1KTVA 2E1RA 1GO2A 1J9ZA 2DETA 3ZZTA 1VQ5B 3CCSB 1A8PA 5JBQA 1NDHA 5GV8A 3W2FA 1R5NA 4IW3B 3P27A 1VQOB 4WQMA 1K9MD 1CNFA 1GAQA 2VYQA 3MMPA 3CRZA 2BF4A 2HCJB 4BPRA 1EWYA 3FJOA 1KRHA 2AHOA 3W2EA 4B43A 4ZCMA 3CCVB 1D1NA 1YHQB 2B7BA 1KD1D 4YAUA 2BPOA 3QFTA 3CXCB 2BM0A 3P26A 1OB5A 3LYUA 2DERA 3QE2A 1VQ6B 4N3NA 3JQRA 2OTJB 2YWFA 3OJWA 1GR1A 3JQQA 1BQEA 1H85A 4FK8A 1JA0A 4AF7A 3CC4B 3G4SB 1S72B 1OGJA 4YHBA 1F20A 2XNJA 3B82A 2NPFA 3ZBUA 1QFZA 3ZZUA 2J7KA 2QTZA 3G6EB 4TMZA 2B7CA 4AF6A 2EFGA 2GQFA 1JJ2B 4LBZA 4RD0A 4C0SA 2BV3A 1TLLA 3CCJB 2RC6A 1FDRA 3CC2B 2BVNA 4ZGNB 3AGQA 2DEUA 4UAJA 4YAWA 1R5OA 4RD6A 3WNDA 1QFYA 3CC7B 1QGZA 3FPKA 1TTTA 1AIPA 4F7DA 3CB4A 1CNEA 2C77A 2VNHA 4RD2A 3MHPA 4PC1A 1EP3B 3B8HA 3VMFA 1K8AD 2ZITA 3W2GA 4M2LA 3LRXA 3OW2B 1ZM9A 1VQ7B 4ACAA 2BGJA 1EFUA 4B4DA 1VQ4B 2PMDA 4NBSA 4PC7A 4RJLA 1Q82D 1W35A 3B78A 2VNJA 1KQSB 2B5OA 3QFRA 1EP2B 1EFCA 3LO8A 3PENA 4AC9A 2RC5A 2YWGA 3AVVA 4MYUA 1N0UA 2BSAA 1YIJB 3W5HA 3U6KA 1QGAA 4RCZA 1QG0A 2HDNB 1H42A 4MYTA 1XB2A 2QTLA 1BX1A 2GPJA 2OK7A 3SJZA 4ACBA 3OZUA 1ZUNB 1SKQA 3CCMB 3CPWB 1CQXA 1DDGA 1BJKA 3CCRB 1JNYA 1KK2A 3WY9A 2QMUA 1QH0A 4TMTA 4PC6A 1E62A 3OJXA 4Y7CA 4YALA 1K73D 4B44A 3VO2A 1BX0A 1ZM3A 2VNIA 1GAWA 1QX4A 4G5GA 4QFMA 1N8RD 1YITB 2YWEA 3WBKA 2QEXB 4RCYA 4FWTA 5H5JA 2HMAA 1KK1A 4NCNA 4ZCIA 4C43A 1EFTA 2EIXA 4ZGQB 3W2HA 3WBJA 4Y9RA 1GVHA 3CD6B 3AVYA 2D74A 1UMKA 2CNDA 4YAOA 1D8TA 3ES9A 3E1YE 4Q7JB 4J0QA 1Q81D 3MCAA 3CW2A 4RD4A 1HA3A 1DARA 4B48A 1M90D 1G7CA 1YJNB 1E63A 1Q86D 1Q7YD 4LBVA 1S0UA 2R6HA 4LBWA 4R71A 2OK8A 1IJFA 5EMNA 3AVUA 3CMEB 4PC2A 5DSZA 2QDXA 4ZCLA 2C78A 1OB2A 3U6BA 4K1XA 1YI2B 4P3YA 1VQNB 4TMWA 4LC0A 3W5UA 1VQLB 1JA1A 1XE1A 1ZM4A 2X3UA 4TMXA 1N0VC 4P6VF 3LVBA 5H59A 4LBYA 5HXBA 4EH1A 5THXA 3J81k 1DDIA 1QVGB 5FA6A 4HE5A 3AGPA 3I55B 1KK3A 3WYAA 1U2RA 1TUIA 1VQ9B 4M4SA 5AN9A 1QFJA 1WDTA 3OZVA 2QN6A 2YWHA 1YJWB 1FNMA 2BN4A 3CMAB 2PIAA 2DY1A 3E20A
chains in the Genus database with same CATH superfamily
1FXWA 4KNYA 4LECA 3RVKA 1DEHA 5K3OA 4MIKA 1J0BA 4RTJA 4NRDA 3BL8A 4NMXB 4AECA 1W2BB 3SEAA 3TIVA 4K6CA 4KPUA 4MCIA 2D4AA 1CRLA 3BXXA 4GVXA 4PAWA 3VSEA 5KWVA 1HVXA 4DG8A 3CUTA 3KO8A 2HKIA 1C7QA 1JF8A 3DSRA 4Q4CA 3TB4A 4OAOA 5CA0B 2QR5A 3LHKA 1MABB 2WF5A 1PKEA 1NAHA 5TMBA 1S1MA 1A7JA 5AM2A 4LDNA 1B42A 2W6IA 1AHHA 4LV6A 5AVRA 3D31A 4C3UA 1YO6A 2IQ5A 3X1JA 4ILEA 2G28A 3QSYA 2BEKA 5DM0A 1W9HA 3OZBA 4GL4A 3BCDA 1E6WA 2YJTD 4AK9A 3AF4A 5FPTA 4YY3B 3N58A 1E9FA 1VXOA 1DBVO 2Q5JA 3AUAA 3DMTC 3QBDA 3QYJA 4KWHA 4JI1B 3S28A 2F4VB 3T7SA 2VYCA 4UC0A 4X3PA 4D3XA 3AR5A 2ERYA 2UVQA 5BN1A 6REQB 3AUXA 3HXMA 1W5FA 3T99A 3I9OA 1YRLA 2P79A 5CB4F 7YASA 3P45A 3K0AB 2X0DA 1XA0A 5JRDS 1BDIA 2AI3A 5AW9A 1HNWB 4YQFA 2WLSA 3I9JA 5UKDA 1CUIA 1UQUA 4RV5A 3RQSA 4OOFA 5IYZF 1IPHA 2ODTX 2YOHA 2G6BA 3M33A 1VKRA 3NHUA 4M7OA 1G42A 3FYDA 4MQEB 4NE2A 3HBMA 1KJ9A 3GN2A 4JGGA 1G6HA 1AKUA 1PNQA 4M53A 3GFSA 1ZM7A 2PCLA 3IBGA 3PKIA 2AZ4A 4LYDA 3SCZA 3UUWA 4DSZA 5K8VA 3RSCA 4K9NA 3BA1A 4IF6A 4MWOA 3R5FA 4U7PB 1KQ3A 3W7BA 4J94A 5LOVF 1XTJA 2FWIA 3Q12A 5JAIA 4QHYA 3SEFA 4L0CA 4G0QA 1BGXT 2QBYA 3PCXA 3TG8A 2VNAA 1FNCA 2GX6A 3R6JA 1IUKA 5EVCA 3ZXYA 2J0UB 1E0DA 3B3AA 3OZRA 5KVVA 3D4BA 1A2OA 3E7XA 4RUKA 3TVDA 1ZIDA 2X1LA 3GUHA 1CUXA 2GJ4A 2K6GA 3AU9A 1ML4A 4V38A 1KPGA 3RBAA 2R65A 5FB3A 4KPUB 4QICA 4E6EA 2H9YA 1KYTA 1RWKA 3O4FA 3E6AA 1KOLA 3T3OA 1A9PA 3WV5A 1NVFA 1F1BA 2QJWA 1TECE 1XZHA 1P0IA 3CY6A 4AO7A 4LF5B 1IHDA 1OLSB 4ER3A 4EY5A 1YB7A 1XEAA 2YUIA 2QTMA 4LYYA 4KE8A 1E1CA 4HNTA 3KUKA 4UD2A 3RS4A 5B7NA 1JHVA 2VQFB 5EI5A 5E7IA 5DTRA 5T4FA 1HLFA 3GH1A 1JSCA 2H00A 1WXGA 2Q3HA 3ASRA 3BTUA 3KPWA 3MD9A 4ETIA 2F1KA 2X58A 1IEQA 4FT4A 3CUYA 5HE9A 1MB4A 2ZS8A 3C24A 5KAPA 4NOKA 721PA 2IU4A 1YB6A 2OQIA 3HZOA 3J7TA 3OFSA 5IWCA 5CPBA 2CLCX 1GLGA 1QRDA 2RJNA 1XZ8A 1BE8A 3VZQA 5KOHA 3I2GA 3IAEA 2NPOA 3FROA 5BWNA 3QHQA 1YULA 4CMCA 1ARZA 1U0LA 3ANLA 1ZJJA 4Z1OA 2F55A 3VX3A 3JD3A 4ARVA 4L8GA 1ZEMA 4G1FA 1X7GA 3OQ1A 4FOSA 3ETEA 1PWZA 4BFSA 5ITZA 2EKQA 1TTPB 4B85A 4BHTA 5D51S 4BDSA 5BYJA 2ZROA 4MDHA 2IQIA 3LT5A 3LLCA 1LFDB 5JCZA 3GELA 4JJGA 4KR9A 2QTNA 3R9WA 1OXKB 5D01A 4BO2A 2V7XA 3IP9A 3DL2A 3OIVA 3W8FA 2AOVA 5C7IO 2GWHA 1E3WA 4QNRA 1K8YB 2YKGA 3RFCA 4PZLA 2QBYB 2QLFA 1H2HA 4D4LA 5FTJA 3D7RA 2WE7A 2JIMA 5H9WA 4RKRA 1E4OA 3D7MA 4NNOA 2ZM5A 3HZHA 5JWHA 4V1CI 5K0TA 3WK9A 2C9ZA 2RGRA 2I71A 5BSXA 1D2RA 2GEBA 2I67A 2P27A 4KE7A 4KDFA 5ALGA 2ODWA 5ECGC 1T1EA 3OOJA 3P4XA 3DMTA 3CH6A 3DEZA 4P22A 2JD0A 1QC5A 1NDHA 2XQKA 2H92A 3D6TB 2RHDA 2CB0A 2CFRA 2O5EA 4J1NA 1VPLA 3DTVA 4CUKA 3QX3A 1E1CB 5JZMA 3RF7A 2C9YA 3CVJA 1B8VA 3IBTA 5TNXA 4EF4A 4RTNA 4O08A 1VQOB 3AKZA 4U2GA 4E14A 4RPCA 2PZAA 3PYXA 3BMXA 3OH8A 4G26A 4AS1A 4EG5A 1K7FB 5IFLA 4X90A 1Z38A 2EQ5A 4NF2A 4CR6A 1H94A 4X8HA 2P9TA 3SD7A 4BU0A 2Y1EA 3FZEA 3AIMA 2VYQA 5JANA 1Z4OA 1YC2A 3KB6A 2ROQA 3PHHA 1NVVR 5KOHB 1BQ3A 1TMYA 4FZ3A 4P7KA 1KOFA 3L82B 1YR6A 4OOSA 1CE8A 2VP0A 3KJFA 4RBNA 1MA3A 1DUSA 1VJ0A 2OAQ1 3GGJA 3V80A 5LL6P 2IP1A 4WK6A 4A8HA 1KJ8A 4D0GA 2Z8YM 4C4OA 2VDMB 5FOQA 5ITZB 1IVYA 3L01A 2NQ2C 3E84A 4QEDA 3DMHA 2X41A 1XZAA 1CEQA 1TAQA 1WXXA 4HWRA 3FKQA 4J0IA 1ADJA 4K9LA 1C7ZA 3VVCA 5JNSA 3LYUA 3JCZA 1NL3A 3L79A 1AGYA 3KT0A 3E0QA 3R41A 2HF2A 3U60B 4FYJA 3CINA 4N3NA 3BKXA 1NU6A 4I4TF 3TQFA 1E3WB 3NBQA 4KVFA 4AN0A 4IRMA 5EZSA 2Q1YA 3JQCA 1NR7A 5SYAA 4ZJUA 1LGYA 3SHWA 1ZVQA 5GJVC 4ENWA 1Z5OA 5C80A 3CN9A 1XGKA 3U4QA 2FPMA 3AKYA 1VPVA 5A4FS 4O59O 2QP9X 3MJFA 1J0XO 1G6Q1 2YMQA 3PYLA 2BJHA 3CA8A 2B21A 5BR7A 4RVCA 1OU4A 2ZSDA 5JTTA 1VJRA 4JLOA 4WKPA 5DBEX 1QC5B 5KIAA 1A5BB 5F51A 4RM3A 1VMEA 1JRLA 4CMAA 4MYHA 3H2JA 3TD2A 3DTVB 2AE1A 3QEMA 4J1TC 2PA0A 3RKSA 4F96A 2QTCA 3AK4A 1EKXA 2CNNA 1K6IA 3MTBA 4Q3DA 1FUKA 4BVLA 2H08A 4X64B 1XVAA 4FP9A 2OYCA 1LDYA 1EHIA 3LP6A 2E4WA 4QELA 2ZZGA 2ASEA 4C7OA 4B71A 1SIBE 3U7HB 2OFOA 1P6XA 3WZLA 1FDVA 1JR3A 1J49A 2BFBA 3RIYA 4Y2RA 4ZN6A 3ERCA 2B5WA 3LGSA 2VTEA 3FTQA 1GG9A 1RFGE 2ZRAA 5AXBA 1RYBA 1QG4A 2RC6A 1O8BA 2FQXA 1XUOA 3G82C 2JFPA 3C39A 5THQA 1QBGA 4D8UA 1M5RA 1CE8B 1V96A 3GOHA 3UMJA 3PVDA 3CC2B 3H2IA 3P9QA 4BVAA 5ALSA 5A4MS 1XRRA 1J8DA 5LDDC 4YMHA 3QEBZ 3MSCA 2Z6BD 4U7FA 1NPDA 2Y6VA 3F4BA 1O9HA 2ZU0C 3PEYA 4DMHA 1SQ0A 2O7SA 1PNRA 3MGGA 4WVFA 5FR2A 2DB3A 1OSNA 4O2BF 5C3MA 5KTPA 4R8VA 3AV0B 3D3KA 1QGZA 3K31A 1P4MA 4MO9A 5BSUA 5DN6A 3FPKA 1NYQA 1R9JA 3BRSA 3D1JA 2C9MA 3HYRA 2JFUA 1FW8A 3WLOA 3CEPB 2C03A 3D5QA 5DMXA 5EP2A 2IV2X 5AM3A 5JTUA 4Z51A 5MN4A 2DBVO 2JI9A 2OO5C 1N3LA 1AGNA 4P08A 1E9SA 2POCA 2CVHA 2VHJA 1RQRA 3QWIA 4GUDA 4IJUA 5JAHA 3K0FA 3P2EA 1HETA 3IELA 3MJSA 4UW9A 5JU6A 2J3DA 3R0XA 1PKXA 4QNMA 4YTEA 5EHIA 1UAYA 1ODLA 3O03A 1N6IA 4OO3A 1YB4A 3VVBA 1U1GA 2WHPB 3UJAA 5BSFA 1FTSA 3QJYA 5SICE 2AUTA 3M6UA 4JUDX 4B4VA 2UYHA 2W5UA 4XWTA 3C6QA 2WD8A 3RYFA 1IBLB 5E4YA 3L9WA 3G85A 4LPKA 4W4TA 1FLNA 1R9NA 4PC7A 1CCWA 2V31A 1PLJA 2VHWA 2Z0MA 3QEMB 1VJSA 4AULA 4E21A 3VR4H 5A04A 5KSZA 4C5CA 1NBAA 3JSXA 1ULZA 1XD2A 4C29A 5HF5A 2Z3WA 4G7XA 3SQMA 1UD2A 1SA0A 3PX2A 3RAGA 4UCQA 1I32A 1PFWA 3FJ1A 3HBNA 4HFMA 2OYNA 4LK3A 2BFMA 4AWXA 4C7OB 2G1KA 2IWHA 3BRWA 4BMOB 2BFBB 3JQGA 2GA8A 4KGXA 4HIZA 5JPCA 3E7WA 5F4JA 3I5MA 4U6NA 5IABA 3GJ8A 4YO7A 3N70A 1HYEA 4FGLA 3ZE8A 3E4CA 4HEA1 3SZUA 5U9CA 1XNRB 2B2CA 1HTWA 5KNCH 1ZHOA 5C8ZA 5CHYA 2XDQA 3GP3A 1L7RA 4FYVA 5AVVA 2C7RA 4MYTA 5BYAA 4H1HA 3G02A 1NSTA 1KNXA 2GR9A 3W2TA 1FYFA 8OHMA 1CDZA 1ZBQA 4DKXA 1N5JA 2ZSBA 4FZVA 5IUNC 1CQXA 4KLAA 4Q9IA 3VTKA 1LSUA 5JQWA 1Y6QA 1T3TA 3PNBA 4P80A 1R12A 3VPFA 3CCRB 3WI7A 1JH9A 2X6QA 5ESXA 4TMTA 3N86A 4I08A 4YXWD 2CLHB 4J1TA 3HJCA 3A1DA 4EGJA 1WMAA 1RWWA 2B69A 2GEUA 3K0FB 5KYXA 1AO0A 4WI1A 1V7CA 4R6XA 3RLFA 1DG3A 4AD8A 1A8QA 2GRUA 4L9RA 1XHFA 1BX0A 3ZHOA 1QHEA 4DUPA 2NXWA 1GAWA 3INTA 3U3RA 3V00A 4L8FA 3HL0A 3PPIA 4M0UA 4W7HA 1NF2A 1FE8A 1PI3A 1OFIA 2X15A 4YREA 1U90A 2VHYA 5TMDA 2O2CA 3NBKA 1MJHA 4X7MA 2DFKB 4IG9A 2SKEA 4YAGA 2PUBA 1NF3A 1XZFA 2WFZA 1ABBA 1DZIA 1XD2B 2GM5A 1IQ0A 1SUCA 1SA0B 5KTRA 1D6SA 2P2CA 4U7TB 2XCSB 1T2UA 4CGYA 2YJNA 5HTKA 1Y1PA 4MDEA 4Z5XA 5EXDA 3X2SA 4XRRA 5A05A 1P18A 3JQGB 4Z7JA 3PPXA 3U7GA 1UPFA 4LOKA 4UHBA 2CNWD 3DO8A 4CXMA 1U2SA 3IB6A 2QT0A 5E7QA 1Q0SA 3OP4A 4Q6WA 4IMIB 2C7OA 4NE9A 1V3TA 3W9SA 2ZRIA 4XVCA 1W52X 3RSFA 4FBGA 5DJ5A 4ESVA 3E1YE 3HA3A 1K9VF 3ZV7A 1L4YA 3IEKA 4MB2A 2XXAA 5CVJA 3BWVA 4YV2A 2XDQB 4BCBA 2QJRA 4C5AA 2HI0A 2EYUA 2OO5A 3D6AA 3PR3A 4NZMA 3KYIB 3NHMA 1SNYA 1DBIA 1GA1A 3OFNA 4N7JA 1XLTA 5HILA 2FQ1A 3QLVC 1FDTA 2GAOA 3IQXA 4G25A 2NU6A 3V7UA 1L8LA 4RHFA 3URMA 4RTKA 4UREA 5LDGA 5B6IA 4JQOA 5L45A 1PSZA 2JLXA 4X3CA 4XUDA 1L5OA 13PKA 1CRWG 1JKXA 4AWAA 4MX8A 1YFJA 4N3CA 2E4AA 2IP4A 4CQJA 3GGOA 5SY6A 3UT6A 3CPEA 4TWZA 4Y1EA 4YDRA 2J4FA 2FWMX 1KARA 1MEEA 4LYAA 3KQVA 3RVMA 2Y3IA 3TSAA 3NMUF 5KYXB 3TAHA 1AV6A 1B6SA 2CJPA 3STWA 4ARUA 4C2UA 1P72A 3WMXA 3NR2A 2F3TA 1MC5A 4FS8A 4WSOA 4LXXA 2IIVA 1FMFA 1HRDA 4A92A 3DE4X 3D0QA 3OIFA 1G38A 3UJ6A 3EVDA 2AR7A 3NOQA 1UK7A 1R9MA 1BYIA 2Q3JA 2WT8A 4L8YA 4WKBA 4PNHA 3U0VA 5DT2A 2QVCA 4CM8A 5FAKA 2PUCA 4R1MA 4G0WA 4G65A 5JROA 1F38A 3WJAA 1GFIA 1GNLA 2O20A 1Z36A 2H8KA 3V8QA 4F2DA 4TS3A 1GZHB 4CDRA 3W5BA 3DL0A 1DKPA 4EZIA 2J1LA 4KXYA 3L40A 2A1TS 3LQQA 2XUIA 4W5RA 5AN9A 5AFSA 3EGCA 1QFJA 3T1TA 2HA6A 3FPAA 1NQ5A 5KJFA 3UJNA 4UVIA 4N49A 1QZZA 2DR0A 1R8JA 3NDIA 1RT9A 4Q9KA 2XXAB 2CVZA 4F3NA 2YN0A 1CJVC 3EK2A 2EDAA 2XKBA 1QM5A 5CT5A 5AKYA 4Q1EA 5E9QA 3U3OA 3HLYA 3GVLA 1O1YA 2FFAA 3EGDA 3LF2A 2Q3FA 1R0LA 3PXGA 1PR6A 1Z0FA 3KWLA 4LW8A 4R1SA 4N12A 4D7AA 3Q40A 4LRXA 5TXGA 1CZOA 4IFTA 1QYIA 3FZGA 1SK9A 2GFQA 4GBGA 1EX6A 2GSWA 4XX1A 4FC6A 4BZXA 2F6RA 4PIVA 4OJYA 4EHKA 4NMMA 1L6IA 2GYYA 4LSMA 4MW6A 5AW2A 5FPQA 4EAAA 4MKFA 5TPZA 3M5CA 1CY7A 1JVBA 1VE1A 1B15A 2E48A 4AUKA 2DCUA 3DMFA 4DWVA 1GRRA 5CB0A 5K4GA 1CR1A 3WC4A 1D4OA 1E2KA 2B82A 5K8CA 2PSEA 1EX9A 3HUFA 1UFOA 3LC1O 3ER9A 1HURA 2CDRA 1QO0D 4ZT5A 1DVRA 1NRIA 3U7JA 2Q6LA 1G7RA 1U5CA 5FUYA 3NAMA 5BV0A 4I9NA 4MVJH 3KJHA 2P6OA 3GT3A 1UC9A 3KZ1E 3QVXA 4O5AA 4UNIA 2G9VA 3Q3EA 5JNVA 2B25A 5I45A 2AJCA 2I9PA 4M86A 3V2HA 1Q83A 4CM8B 5J4LA 4DGSA 2BM8A 4BWYA 1GQSA 3LYLA 3G9QA 4LN1A 2VCEA 3FMOB 2OCDA 2A4MA 2PL9A 1CUFA 5H80A 3GWGA 1W5BA 4GOLD 1Q92A 4C7MA 1GARA 4WEQA 1Y9AA 1OWOA 1T8RA 2QF7A 5IC6A 1YXMA 5F1PA 2V9PA 2H07A 1NC1A 4OHUA 5E2AA 3GAZA 3I83A 1LPMA 1NNLA 4YJ3F 2UZIR 3BCUA 2R9VA 4NSNA 4RANA 2RARA 3W9YA 4F3CA 5CCXA 4QEKA 1J8VA 4B6QA 1BFDA 3S29A 1EE2A 3NG1A 4FTWA 5KHAA 4EKEA 5HF9A 2FRDC 1R4MA 1U8YA 3HUTA 3KS9A 4FX2A 2BD0A 4NNJA 1UBGA 1BHO1 3EGDB 3Q41A 4RXTA 5AI0A 4AIIA 2JZNA 1IAQA 1U0RA 1TU3A 2JJQA 3IODA 1DRJA 1JKMA 3B3JA 3GAFA 2ZTMA 3KX2A 5A1JA 1UC5B 3CJTA 4DUYB 1CFJA 5L53A 4B4KA 4PE5B 1R6AA 3KKEA 3FPCA 1Y4AE 3TBFA 5C52B 3JY6A 5LFAA 2NZVG 4KAJA 4UHEA 3M49A 1VLZA 3JTEA 2PMBA 5C5IA 5KHOC 4DCMA 1QRTA 1D6NA 3RVRA 3L1JA 3DV0A 1Y3DE 4B74A 1A7KA 3P9XA 2FEWB 3ZH9B 3DZFA 4D8XA 5JCOC 5F4OA 4QUKA 1KO1A 4JYCA 1QUFA 3KKPA 4G5SA 3EFEA 3VJRA 1KZ1A 2IE0A 3QU5A 2QRGA 2R8PA 2JGDA 3Q3VA 3WIVA 5HVNA 1VC2A 4Y2SA 3R7NA 4OI4A 5LYJF 2WAXA 2VF5X 4K6HA 2V3VA 4BWFB 2QD5A 3UTDA 1IN4A 1A0OA 5HDQA 1D1PA 1JYEA 1NBWB 1UMBA 4FHEA 4I9HA 4INOA 2V0NA 3ANTA 4C0WA 3C5VA 4TVSA 4CF7A 5DOZA 1WB9A 3O0TA 1PSWA 5E9WA 1ACJA 1PNTA 4TRNA 2AMJA 1BU5A 2QORA 4PW0A 2IUTA 3I61A 3LXMA 4YRGA 1P19A 5B7PA 2G9ZA 2PT7A 2BF7A 2ZRHA 2VZLA 1YNOA 2YIDA 3GO4A 4K9MA 3RTDA 1R5BA 4BNLA 3IPCA 1Y6FA 4QJ5A 3KQHA 2CRVA 3QNWA 4U02A 4YCSA 1E2QA 4Z4VA 1CQJB 2ZRNA 1T3HA 1PVDA 3FVTA 1U9CA 3VR6D 3ZHCA 3CURA 3I9MA 4FONA 4UQLA 2ZYUX 4DHWA 2FJUA 3WYEA 2Q2VA 2YYSA 3F9RA 1E0KA 2ZUWA 3EVAA 5AOCA 1KI2A 2I4TA 2PBFA 3BMQA 3KDSE 1R4MB 3W9BA 1NJID 1DFIA 521PA 4RVGA 4R8RA 5FBRB 5IKPA 4G0OA 1X39A 3OPOA 1CV2A 4Z0HO 4OJNA 5FPPA 3OPXA 5KNDH 2IK8A 1OI7A 5H02A 1LRLA 1BCSA 2O2HA 3L7AA 3ZLTA 3MMXA 4Y1GA 3V4OA 2WP8J 3Q6QA 5BMVF 3PUVA 3O91A 3ZE0B 1JT2A 3A10A 2HM7A 3AKCA 4CFZA 3ZWBA 1CR6A 1ESZA 2FEAA 3S70A 1U04A 3DAOA 1KP3A 4M60A 4OP2A 4W1SA 1JWAB 1W59A 2C5FA 3OPMA 1E3ZA 4E5PA 1KIAA 2O2ZA 4HN9A 3WYBA 4N65A 4DDVA 1ZJ5A 1S1CA 2G8NA 3AO0B 4OQDA 2FZWA 1TIKA 4UDOA 2XMGA 1VI5A 3FWNA 5DHSA 3U48A 3VNRA 2AVNA 4OMUA 3D6UA 4L4ZA 1DJPA 2Y1FA 4CM9D 4JGIA 4IZ6A 4O29A 1GITA 1SB8A 3JWGA 3VOTA 3E81A 4UFOA 2BF4A 1DX4A 2O2IA 3RC3A 5JHHB 2F8SA 2A3RA 3WMWA 3WDMA 3B9QA 1EHYA 3JZMA 4ZVQA 4ZCMA 3OHMA 5D5HA 5KMGA 4MXDA 3EUFA 1HFJA 3DVSX 3WK7A 4BVGA 3GFPA 1KD1D 3REFA 4BP3A 1M66A 2HDWA 2CC2A 1Z07A 5LWQA 2I4LA 2C5HA 4N9QA 1OB5A 1ENZA 2XR1A 3CONA 2HIMA 5DK6A 4LDPA 4H6WA 4J0GA 4BFCA 3K20A 2L2QA 5KYNA 3BMQB 1RZ3A 3OM8A 2G40A 3NWEA 3WRVA 5CB4B 3FNIA 3UK7A 3WOHA 3RVPA 3VOSA 2CFSA 5JCOA 3V2IA 5FDFA 3RVNA 2PX6A 3AP1A 5IS2A 1WUYA 3FIUA 4P7JA 4CCAA 2A0KA 1VP9A 4NYIR 3T1YB 2XWSA 3REOA 1ULAA 1E9DA 2AJLI 4GGOA 1QK5A 1RADA 3WLQA 2YFYA 4GVPA 5HSGA 2ZSIA 4D3DA 3FUCA 3S8MA 3ETDA 4IDFA 2YWJA 1R4NA 3ILXA 5DNCA 3ZY2A 3PFWO 4Z6KA 5FWNA 3EDRA 4DT1A 5I7EA 2BTQA 3F1LA 4XD2A 5FI3A 2II6A 1QHSA 3QV1A 4JC8A 4A6XA 4DLYA 3AEZA 1S3FA 4HBZA 4BVJA 3NZEA 4FHZA 4XUGB 3RK1A 4EI9A 3PFIA 5LC1A 2WZNA 1HG1A 2VF4X 2QTZA 3G6EB 2ZB2A 4OHMA 3LUHA 5AW1A 3VH2A 1OZGA 4AKSA 2SKCA 1G20E 1SUEA 4WGFA 1E4YA 2FHPA 1S8OA 1DTWA 3EE6A 3TBHA 4RY2A 3ZWOA 1HKUA 5HIJA 3K15A 1JG1A 3IP7A 3MTEA 1KQFA 1LW7A 3DOJA 3CEJA 2C3UA 4NU0A 4W5OA 1GT91 4I5DA 1US8A 4EB6A 1EUYA 1ONSA 4BNJA 6PFKA 1VPEA 5CLHA 2LW7A 2OCPA 4KQ2A 1NTRA 2VZEA 1U8FO 4N40A 3WLKX 3EPKA 4A6EA 5KMGB 2QW1A 4QQRA 3C0KA 2DEUA 5D2CA 4B6SA 4EG1A 2W43A 4QOSA 1XTRA 3V7AA 1ML3A 1BIFA 2V0CA 5EMKA 4DNXA 1X7WA 2NSJA 3AKDA 3QK7A 3EEBA 5IKEA 1AN9A 2I1QA 5GMOA 3L0CA 4DR5B 4LGCA 1RQ2A 3NALA 4XQ9A 1NI5A 3AHEA 5KVCA 4F7DA 2G7MC 5B1YA 1NQTA 1ONPA 1JIIA 4HWOA 2QG6A 4GI5A 4I19A 3W6UA 1EE1A 3H11A 1KJYA 1JTVA 2VG8A 3HYSA 3A70A 1C9KA 1EP3B 4J2HA 4GQNA 1Z7GA 5HM8A 1F2VA 5FOWA 3VMFA 1BWPA 1OH6A 4KLNA 2B4AA 1JHDA 2O57A 5AHOA 4NQZA 3J80A 2TRSB 2N0SA 3EXHA 1XZCA 2OAEA 2Z43A 1R4NB 3OW2B 3D9QX 2ZETA 3F78A 4I8IA 5ITVA 4DT1B 3H4VA 1F14A 2BTQB 2RIPA 5ADUS 4QUHA 5IJWA 3ELUA 2J6BA 3A8TA 2XUFA 3B20A 1N7GA 2HSDA 3ZNQA 4EQZA 2QIOA 5F2NA 3I5AA 4MV4A 2P3MA 4MVJF 1N9GA 4GMDA 1JSRA 1T4GA 1VG8A 1D5CA 1YBHA 2LXNA 2Z09A 3KKZA 5DV9A 3MJCA 4AQ7A 3PENA 1TT5A 4WKNA 3N7AA 1DTWB 1Z13A 3T3HA 3W3ZB 3UGJA 1L7QA 1L5NA 1BD3A 2X85A 1QKIA 1YIJB 3OUUA 2Z2IA 3ZQJA 4MMYB 1SD2A 1US8B 4BUCA 1QGAA 2I8CA 2X2FA 1XQVA 4A7PA 4WJZA 2IX9A 1KS2A 3UCXA 3UAYA 1QG0A 3RANA 1KA9H 2CVOA 3SHVA 2FK7A 2XE6A 4OQMA 2VJLA 3M2TA 2YZ2A 1U8TA 4K6OA 4YB8A 2JEYA 1XRMA 1BX1A 2Q41A 3P0EA 3P4YA 4CNBA 1X7WB 1ZCZA 1YRAA 1NJSA 1E2MA 3DDCA 4IUBS 4MQMA 2DQKA 2I66A 3BTSA 4H7DA 4L5BA 2PJZA 1KORA 1TUEA 3T9EA 1U1EA 1E0AA 3TQIA 2JFWA 5AMXA 1TZBA 2JHCA 1OKKD 3PL5A 1PEAA 3UHPA 3JQDA 2QM3A 3TVTA 3Q6RA 4IIDA 4MH0R 1TZCA 1XEWX 1XELA 5TQVA 1WPRA 1UT8A 1P4HA 4CG1A 2G9UA 3A27A 3H11B 5EG5A 4QYTA 1Q11A 1JTEA 3AV3A 4A9AA 1KC3A 2ZSAA 2E4ZA 2ID9A 1I4TD 4J91A 5HCUA 4FILA 4EQ6A 4HXEB 4NPAA 2DH5A 1JDVA 1SHUX 4ZFNA 1I2BA 1X9HA 1ORVA 2PSSA 5E3IA 4C0BA 4X05A 1YFZA 3EYAA 5EN4A 5IX8A 1XKLA 2BI7A 2QQ0A 4N9WA 1FIUA 3MN1A 2KPOA 3EXHB 3AJ9A 4RK0A 4EVQA 2FR8C 1LX6A 1L4LA 2PY6A 1GG8A 3AFGA 3QVOA 4H16A 4Y2GA 3SSAA 3C3CA 5CGZA 1Y3IA 2QT9A 1GG5A 3W5IA 1J4AA 1C7EA 4ALIA 1KS9A 5BSVA 3GNQA 2G5CA 1HDZA 2WDZA 1N9GB 2VDOB 1NWCA 1MKYA 3P19A 3U4GA 3ZPXA 1V0FA 2HF7A 4ZCIA 1KDYA 1H23A 3NDPA 1P31A 3MJDA 4JMLA 1A9TA 1TT5B 1DB3A 4ITUA 2JHGA 4GEGA 3IOCA 5IG2A 1GVHA 1WR8A 1YOBA 3GLIA 4NAVA 1UMKA 2H0QA 1CVIA 2BIFA 1R37A 1VE5A 2PL3A 3OIWA 3Q9NA 3U37A 3X44A 1GTJ1 5EJ6A 1EG2A 2NV6A 4AZ0A 4J0QA 3U31A 5TJ9A 3ZU5A 1XCGB 1EIWA 4ZYVA 2V4UA 4HQLA 4JJKA 3NLLA 2GHTA 4ZT4A 1ZL2A 2PS3A 3L0OA 4MR8A 2DFDA 5C8DA 1QVRA 3DVQX 1LF5A 2Z30A 1JECA 4YXWA 3V8NA 1P17A 4IGEA 5ALQA 3KZOA 5L46A 1SZCA 4R71A 1T3ZA 2YH2A 3LHSA 1OXUA 4INJA 4JT9A 4M0PA 5CM8B 5E6RA 4CKXA 1ZSYA 4FYKA 2CD9A 3NT4A 3EUEA 5FAXA 2BBTA 1SCUA 4FKMA 2C1XA 4OGWA 2BGMA 2JEZA 5DSZA 2XITA 3FUUA 4HSGA 4BO9A 3L8YA 1UZNA 4CT4B 2IEZA 2HQBA 2HSWA 2WIDA 1MHPA 3FYUC 4M22A 4ZDIA 4QPZA 4F06A 1O6BA 2XWJI 3V7NA 4JD5A 2DYIA 3KQTA 4G8JA 2XEDA 4EMTA 4P58A 4IDCA 2FVGA 1GUBA 4HH1A 3NHLA 1E18A 3TZBA 5H59A 2XLBA 3C8ZA 3I01M 1IFXA 2H7YA 4DIFA 4ZCRA 5IH7A 5K45A 5LIRA 1ISIA 3J81k 2OLEA 2QB5A 4FR5A 1T10A 1T36A 4RHUA 3RC8A 2FP3A 1JXQA 3I55B 3PXEA 2XCQA 3BERA 4QLAA 2A35A 3HEMA 9MHTA 5IARA 3P0JA 5C4MA 5JAMA 3E9DA 4X62B 2TS1A 2PNJA 1OILA 5LQCA 1SRQA 2ONYA 1M34E 4IWXA 5AJUA 5IAEA 4ETNA 3TQOA 3GLIB 2A9PA 4F11A 4LYJA 2AJTA 2P6UA 3L0IB 2UU9B 2Q9CA 5EIWA 1MX1A 2PUWA 1CSEE 2OGUA 3MELA 4MRPA 1SKYB 4D80A 1O6FA 1SVWA 1ZIOA 3USZA 3SXJA 4AZ0B 1GM5A 5DO9A 3N0TA 4IQ4A 3SZLA 2JZCA 2YWHA 4PAAA 3GEMA 4HDQB 1GAEO 4LJAA 3CNOA 2CZQA 3CMAB 2A5JA 4MR8B 4GXQA 1VI2A 2B9VA 1G3UA 4LGVA 3VO8A 3OKPA 4HH0A 3IR6A 3DEFA 1U8XX 4HQ6A 1GYQA 1E9RA 2JFFA 5IEJA 5EHZA 1Y8ZA 1Y82A 3WLAA 3ZQUA 4AO6A 1NDUA 1LV7A 1IN6A 1OBVA 1IK4A 2AL7A 2FR8A 3THOA 1ZI9A 1HYGA 4OQXA 4UHFA 2I2XB 1SCUB 1Z2DA 4QQKA 1JAXA 1Q14A 1WZEA 2C54A 1RNLA 1I30A 6ADHA 4TLMB 1XQBA 4WCVA 1SVIA 1EIZA 3IKMB 2BFFA 5J47A 3GI1A 1XLWA 1V11A 2ZXUA 3FNBA 3WNBA 1C9EA 3HSYA 4ZVTA 2RGBA 2G9QA 1C29B 1RABA 1UJ2A 1IUNA 3TLXA 2Y99A 4JROA 1F5SA 4V3BA 4UTZA 1GGVA 4WLUA 3O5AA 3HWWA 3FY4A 4B3GA 4KQMA 3RUPA 3U4HA 1ESCA 2NAFA 3JV7A 4FEYA 1OC4A 1CZUA 4LAFA 5IANA 5ICSA 1TYAE 2LDXA 4DW8A 3OEYA 1K66A 3UOWA 3DKKA 4FB4A 5JECA 2HTEA 3I76A 4O2AA 3QG5A 3JVIA 1JFRA 4D8VA 1T36B 3ILYA 1YUNA 1ZJ4A 4KFUA 3QYFA 4ZYLA 1WTAA 1E3TA 3V1LA 3AW9A 1RPZA 1RVV1 2PK3A 3OBIA 3UW1A 4BNKA 4DUZB 1P80A 2ZRCA 5TGDA 4BV9A 1GP2A 2VBGA 1X6VA 3G8BA 1L5HA 3V55A 1E9AA 5BMVA 4RE5A 4EDHA 5AUNB 4XUCA 2N75A 1UZLA 1N5MA 3DCYA 1GGHA 2IITA 1JG6A 2FPPA 4WKGA 2P2YA 1E3SA 3CT4A 3KSDO 5ITSA 2QKYA 5MFZA 3RE1A 1KKUA 2F1MA 1TE2A 2H4WA 2PBZA 5EHQA 5BQFA 2J3EA 1O54A 5J4YA 1QYDA 1J56A 2GCOA 4LZNA 2G3YA 4J43A 3UAOA 2HRBA 4DNTB 2FOIA 2PX4A 2QQGA 1FFWA 1N6OA 3FYUA 4FHFA 4TT8A 4JBXA 4PX2A 4OBEA 4ETMA 1USVA 2C5SA 4GMXA 1HDGO 3HY6A 1VQ8B 2YNMD 4R2HA 4V0OA 3PK0A 1UIMA 4BLQA 2YS6A 1AT1A 4P0TA 4MVJI 2FX3A 1X1EA 1DBQA 2GH1A 1L5GB 3UHJA 1B2LA 3GVJA 2BGLA 4UDYX 4P1VA 4ND3A 3TQQA 1QO0A 1Q7CA 4XQCA 5BRNA 1YMUA 2OENG 4M88A 4K9SA 3GJQA 4M38A 3W4KA 4XM3A 3EISA 1YA4A 3PR1A 4F0JA 2BFFB 5C32A 5HZAA 3H4MA 3U1VA 4DMKA 4DNFA 2HW8A 2P5SA 4H6VA 3LH5A 1LI4A 1U5AA 2ATIA 2D7JA 1H2FA 3A3YA 3WGGA 1XVUA 3Q9UA 3QEOA 3NH6A 1ZFNA 2WK1A 2XYHA 3K6JA 3URKA 4QT4A 2WWYA 5KQRA 3RR2A 1IBRA 4F8JA 4QWMA 5HS4A 4PZDA 4QOGA 3J81A 4QTZA 1LUAA 1YJ8A 3M4XA 2R1UA 4LX0A 2BZGA 3G88A 2GJ8A 3MNFA 1KI3A 4GPTA 3T6KA 4BO3A 4Y9DA 4UMEA 1RCTE 3LK6A 3IOMA 1I2AA 4O2AB 3NAQA 2Z83A 4MRAA 4Q3CA 3HNRA 7ABPA 1ORTA 1RJDA 4FUQA 4Y8VA 1ZA1A 3QIAA 1NI3A 3G5UA 5DIFA 1AQ6A 1IOZA 4YWJA 3VU9A 4U8HA 3TMYA 3W9UA 3NVAA 1QFSA 1SQGA 3LXXA 4AFNA 4BFLA 4ZOCA 4JLVA 1GJRA 4HFJA 5JIBA 1AB6A 1L5HB 4GM0A 4P7GA 4YUZA 3L02A 4ES6A 3UK6A 3ZDBA 5KINB 4E2YA 1Y0YA 2YTZA 3L8EA 1X1DA 4LXQA 2NN3C 2H1SA 4L8JA 5FLYA 2FPPB 2PKQO 3U3JA 1T0JB 3K8QA 2DX7A 5F73A 4JEMA 4QXAA 3ITEA 1WQ4A 2GCOB 2YL2A 3WNQA 4BLUA 3AOEC 3PV0A 1OGIA 4YXFA 3SM9A 3W6PA 3ZZNA 1M1UA 2RKWA 3ELWA 3FYUB 3GGSA 4OATA 4EG8A 2PV7A 1M1KD 5A9SB 5BOVA 2BW0A 5A9SA 1VBFA 2Q1SA 3IXLA 4O0LA 2BHRA 4BKOA 2OUKA 4G9BA 1UMDA 4PRLA 4E13A 1UBFA 4QUDA 3ABIA 2X3FA 4RKWA 1ZSVA 4TTAA 5LU8A 4AMGA 5HM6A 1PQ4A 2FMIA 1CUUA 3C6MA 1JZSA 3ZHXA 5AXDA 4AJEA 4E31A 1SU6A 1GKUB 2EF0A 1P7YA 2C29D 2UYQA 3TLAA 1QGUA 3DOIA 2IGTA 5I4KA 2DHEA 3ZXSA 1ZMTA 3VOBA 1WUIS 3A0UA 5EUBA 1M7HA 1IEWA 2IFTA 1K75A 3PD1A 4J9UE 3LZ6A 5D87A 3P27A 1L0BA 2CY0A 3HBAA 5I8ZA 3T5TA 5LOVA 3VA7A 2OD9A 3WSVA 1WSRA 4XKWA 4B87A 4JIMA 4IRXA 4Q03A 2VHUA 4AVZA 1RRPA 2FSGA 2W90A 3UMSA 1TZKA 1IBKB 3LXRA 3C1TA 3W1EA 4D3ZA 1ZMXA 4L0MA 4FQ8A 2C0PA 1WV1A 2IV3A 4CTNA 4ZJZA 3ROQA 1P1CA 2JAUA 5DP2A 3HVKA 3VR6A 1AUVA 2Q4RA 4O02B 3QVTA 4P3KA 3VU9B 4OGFA 1CJCA 2YCBA 1HDRA 2B98A 2D2EA 3C4JA 5CJPA 5D00A 5ECDA 2I7DA 4O0MA 4LVOA 5DTQA 5CNKA 4RGBA 4ZO4A 2QPAA 1Q16A 1A8IA 3U61B 3NHJA 4FFPA 1G17A 3A6PC 4QHSA 4DV1B 5HTOA 2E7ZA 4H6PA 4CHTA 2IBSA 1JI3A 4BFYA 1E5TA 4PWYA 3CH5A 3O2NA 1KH3A 2ADOA 4Q48A 2UV8A 1U4OA 5AUPB 1LLQA 4BX3A 5KNDD 4F2PA 2O0LA 3RVLA 3GRAA 4CKCA 5KEIA 2WW8A 1WBBA 2GN0A 3R24A 1PKVA 3SBDA 3E7FA 3MD0A 4MA5A 3KCNA 2OD2A 3V1UA 1J21A 2VTVA 1KMNA 2W37A 3HBLA 3OJWA 1GR1A 5BR1A 2CJXA 3JQQA 4ZGBA 4MULA 5K3FA 1BQEA 1YIOA 5JLJA 4OHXA 4QGGA 2NYAA 1UOQA 3PGMA 2IZ6A 3OT5A 1Q1GA 5FQOA 1BHJA 1JIXA 1NWHA 1Z39A 1VL8A 1QHIA 3HGMA 4NULA 3T52A 4XXHA 1Y7PA 4QTYA 4RDXA 2CV2A 1TM5E 5J40A 1PYOA 2XNJA 1V1RA 2ZI7A 1BPLA 3VJLA 4C4YA 3LOPA 1CEEA 3D2LA 1RCFA 1CPYA 1QGUB 3TO5A 4CM9A 4ZMRA 2WV9A 4J29A 4QV2A 4A0RA 3KL9A 1JDBB 2O06A 3DCJA 3ISTA 4U2KA 4UBIA 4IVRA 3ICWA 2WY2D 2NZ2A 2EHDA 1RRFA 2JD1A 3PEEA 4F2WA 4LOJA 4TQAA 1KEKA 1CTQA 3TTSA 4NL4H 1UDAA 2B4KA 4UNQA 5KO2A 1T2FA 2VJAA 4EJ6A 3ZX5A 1MR3F 2Q2QA 4JEHA 2GQFA 4NH0A 1GCGA 3AR4A 4TLBA 1H22A 3DBOB 1UD8A 2VT6A 4XJVA 4AT1A 821PA 4CNQA 3ZK8A 5E3JA 4D41A 4CTMA 2HEGA 4PO3X 4CI0B 1KZ7B 4A0HA 1QSGA 1DQRA 2OQ2A 5JS7A 1FRVA 3E61A 5ER6A 4L2IB 3DE0X 5EE5B 4XIGS 3B51X 5LYYA 5K0ZA 3AOEA 1WW8A 4CE6A 3EF0A 2QQFA 1KVRA 1X7DA 1YE8A 1UFRA 1VCNA 2ODPA 1KU0A 4AKGA 1EFKA 4XQFA 1A04A 3HU1A 3M34A 4JBHA 2OZVA 3CVYA 3RIEA 1V3VA 4DLNA 1SIUA 4MEJA 4A8TA 2UKDA 4EJMA 1TCUA 1U0TA 2QRVA 5KQLA 4OOVA 2OMKA 3F8WA 4WOPA 1Z2CA 1MMFB 4ERXA 3OLZA 3ZE2B 1Q15A 3B7GA 5CT4A 4KDEA 3L0ZA 1NMEA 3LCMA 4YEDA 4CKCB 3QKUA 4G07A 2NYRA 3AY3A 2FXIA 1J1ZA 1V41E 3I09A 4QL3A 4A5OA 2W0MA 3CB4A 3GJTA 2N42A 3OCWA 2C77A 3BH4A 3DQQA 3E1GA 1QB8A 3E4DA 2HXGA 3Q11A 1PX2A 3A4TA 4A8JC 1EM8A 1ETHA 2GNPA 5K3FB 3BD9A 3QJ5A 4OBBA 4YCNA 3ISJA 4MSUA 4I1OA 3EW9A 1ZO8A 2ZIWB 2F3RA 4MQUA 4KPFC 3CB2A 1M3SA 3SYMA 5LWHA 2EXXA 2OB1A 2OV8A 2RDMA 1FP4A 3O9VA 3O95A 1JVNA 3VR5D 4DSAA 1FVXA 2F8TA 4DJDC 1HQCA 4EB3A 2HK9A 4UEOA 1C3LA 3CMCO 5GGXA 4KUHA 4L51A 4XDYA 3QUAA 4J3NA 1PVVA 1V1RB 2V6MA 1KI4A 1RQNA 5ALUA 1IPEA 2BGJA 2E82A 4DNOA 5F98A 4GGPA 3MLEA 1N25A 2QE6A 1M1YA 4DIKA 5KYWA 4MPJA 1B8UA 1YS6A 1YZGA 3EZFA 1CC1S 4OQPA 3MOGA 1V5GA 4TZKA 3UNXA 4FNGA 1H1TA 3C3PA 7GPBA 3GDGA 1JPVA 1V71A 1XE3A 4QOFA 5JSKA 4G8DA 3ZV6A 1C9YA 2E18A 2Q5IA 2YV1A 1PP4A 3DYIA 4MHOA 2G6TA 1KQSB 5EIFA 3S2EA 1AKWA 4L22A 4DSUA 2C59A 1G19A 1RM5A 3INRA 2WTBA 3MIIA 3Q1KA 3IALA 3IT0A 1JEOA 5BMVB 2B36A 4XWWA 4NDNE 2Z6UA 1QDUA 3HO1A 3SICE 5FX2A 4FZJA 1N57A 2CLSA 2I78A 1XVLA 1OQAA 3CLVA 3X1MA 4DWJA 2ASVA 1SBCA 3F2VA 2GFIA 2Z98A 2OKCA 2A5YB 2WHEA 3HB0A 4C7JA 3UK0A 5HRCA 5J3JA 3GMIA 3N6RA 4G5QA 5D1NA 4QFDA 2OCXA 4HC4A 2EL9A 9GPBA 5G2OA 2QJOA 2Z3VA 3U3XA 4EFLA 4DLZA 1F2UA 3N6VA 4PYOA 2ATEA 3LX6A 4P38A 2V7VA 2EZ8A 4OHRA 3I4FA 2QTLA 1QQ5A 1EVZA 2QRVB 1KO8A 3CUVA 3NTVA 3IDQA 2XAUA 1L1FA 2VRWA 2YJZA 3B1JA 3PQ8A 3DNMA 3F4LA 3GROA 5ALRA 1A9ZA 1EWRA 2EJCA 4TWBA 3T8YA 3WQHA 1E9VA 2VPZA 3TECE 3ZLUA 5IMBA 1A9SA 2EGGA 2GK6A 4IKPA 2PSFA 5DHUA 4ZVVA 4X8LA 3SC3A 4DLWA 1NW7A 5C34B 4MUBA 1EM8B 3OCCA 1E62A 2ZZQA 4BLTA 2WJ3A 4QRDA 1KTIA 1LPNA 4TRJA 2PE3A 1ZWLA 1E2NA 1VZ3A 1Z2PX 3D3WA 2CYAA 2PQ6A 2V1XA 3H84A 4HG2A 5CRIA 4RHEA 3NJRA 3HU2A 3MUOA 1FP4B 4J8PA 5E0OA 2RK3A 5EXTA 4N1AA 5IASA 1WPXA 1DL5A 3K3PA 5CVVA 1TK2A 5A4JA 5IKXA 1CEYA 3TZLA 2AYYA 1UDXA 1P39A 3AX6A 2YWEA 3BH0A 5E1MA 1HF3A 1M1YB 1SQ5A 3FMGA 5KYWB 3KSBC 2Q1WA 4FMDF 1WXIA 3GZNA 1BEUB 1X3SA 1MN6A 2PTGA 5DGXA 4BKRA 5LR6A 1U0EA 4F9TA 1LI5A 3DDUA 2HO5A 3GH3A 2O50A 1M73E 3ESRA 4IOLA 4YACA 3I5XA 3K4PA 2CV0A 1BXGA 2WM8A 3GW8A 2ZTGA 5M34A 2AQ8A 3A1WA 1ZX1A 3M6WA 3ZWDA 1RYHA 3LPMA 1VSUA 1UM8A 4ZVMA 2R8OA 3SVTA 4EW3A 4K0KB 4Q12A 2WSMA 3K0BA 2BFCA 3RG8A 3WYCA 1DO0A 1REQA 2O2SA 2W71A 2OFWA 4PS1A 2W6OA 4WPGA 2HA5A 1VLJA 2XYRA 2ZYVX 2IBMA 4JOQA 3ZTWA 5H70A 1HA3A 3LAWA 1F2UB 1OKKA 3JQEA 2YMMA 3PUKA 3QQ5A 3L06A 4GBJA 3R7WA 1M90D 3QE4A 3UXYA 2BEUB 3BGDA 1P74A 3LBFA 1U7TA 1YI8A 3GPBA 3BXPA 4I1PA 3JAWA 1X7XA 1QH1A 4PAGA 2G1PA 5CDHA 1GPYA 3EOZA 4C6HA 5BWOA 3PDWA 4WNCA 1Q0RA 1E61A 4KYUA 1FPMA 2HRRA 3MC1A 2CUZA 5ALOA 1I36A 3OSZA 1LPBB 4HNHA 5K2MA 1VIAA 1QR2A 3JQ7A 4JBIA 4OM8A 1EUQA 3QIVA 3QVKA 4YIHA 2Z1DA 5SZIA 4GMFA 5EJFA 1T4BA 4HWPA 4MV3A 4Z53A 1Q57A 1CB0A 2VUIB 2YHAA 4PICA 2B92A 2BCEA 4R54A 2NNLD 5L6MB 4ZTZB 1VQNB 3D3WB 2VWHA 1G8MA 1PJTA 4LC0A 1OGYA 2QVZX 2XYQA 1MRSA 4IIJA 1NKTA 2ZRPA 1W9XA 3TIGA 4OHWA 5CTJA 1L4HA 1RC0A 1DAOA 5ICMA 2B8NA 4PHFA 1FS6A 3T61A 1C3OA 3HC7A 1OCEA 1KEZA 3H9JA 4IDAA 4R31A 4TMXA 1E8DA 1AY0A 2C4VA 2DWQA 2V6GA 3O4IA 1RFLA 3KLMX 3GZNB 4B5LA 2J3IA 4KQEA 4EH1A 3PHLA 3GY0A 4H3KB 1YS4A 2QGNA 4MKRA 5DX0A 4ZAVA 1RR6A 1GKLA 5DHRA 5AI5A 3MCVA 4KXNA 4ARAA 5T3YA 2ZI6A 1BXGB 4AJOA 1S8NA 4D42A 4MI6A 3WAGA 1NXTA 3LGAA 4GX0A 2QUJA 4WLVA 4G0XA 3PYMA 4TXJA 3T1QA 2CWWA 1LDNA 3CX8A 4BFUA 1X8JA 1TCVA 5IXYA 3BBLA 3KHKA 4ER6A 4B45A 3A14A 4WADA 2CLOB 1MD9A 2AR0A 1QRRA 2CL6X 1TQ8A 4EF5A 5IVKA 4A8JB 2V6IA 5BN5A 2BN4A 1FMCA 2O19A 4HNUA 1P91A 3RTEA 5C5DA 1P5HA 4Z0TA 1XDDA 4FMCF 3NYWA 2HPZA 3IQHX 4M0DA 1WCWA 3TNYA 1NQVA 1BNCA 1SHJA 3JAWB 1X7XB 1JYFA 1QH1B 4TSFD 3ZCPA 9LDTA 4HATA 2R8XA 1P3DA 2WJ6A 4KCGA 1LKZA 3LL4A 5KSYA 3GPLA 3ASTA 4CM4A 4D0RA 5AI6A 1ANKA 1YJCA 2EFEB 3DONA 2XCIA 4N8EA 3V3TA 3JQ7B 2JLZA 2ZJBA 2CNOA 5JYDA 2YNMC 4L27A 4AX4A 5ARBA 5LQSA 2QZ4A 4RIGA 2B99A 2JA2A 3U80A 4F97A 5JR3A 1C7RA 1I1QB 2AN1A 3LQ4A 1Y0RA 1Z83A 5EQTA 4XONA 4PFQA 4A5SA 1Q19A 1YDGA 3L41A 3HLTA 3SYTA 1SG9A 1KJZA 3ZDDA 1WZIA 3LM8A 4IIJB 4RZ3A 3RC7A 4I50A 1FP1D 4ENSA 5A3RA 3THYA 3ASSA 3MXTA 5I7HA 1Y5LA 2REQA 1C3OB 4HEJA 4B2PA 3K0HA 3PGVA 3AHGA 4OK6A 1DCTA 3RJTA 1TL7C 4HXFB 1E5XA 3MSXA 3PA6A 4E46A 1RQLA 1RJ9A 3PFCA 4RLSA 1BWQA 3IAHA 3MHTA 1WE2A 2H52A 4JP1A 3GXBA 2FEPA 2IYLD 1V47A 2JEOA 2JDID 4GX2A 5DHTA 4N0EA 2JGMA 1E5DA 1GZUA 3ADCA 1LB1B 2QUHA 1D1TA 2JHPA 3G9TA 1DWUA 1R0RE 5IDQA 5HHTA 3ZDAA 3EXFB 3FVVA 5J1SB 4ZEMA 4GRDA 4WRRA 5ALXA 3AQ4A 4FOTA 3R3SA 1B26A 2HHJA 4K8OA 3FYTA 4P7FA 3OEHD 1RI2A 4S3MA 4ARZA 4EBFA 2RAFA 1K3FA 2ZWAA 4AJJA 1QHGA 4FX5A 3NKLA 4RZXA 3RFUA 5IVPA 2MYPA 2EFYA 1Z4QA 3JXEA 3RRYA 1CKEA 3GGGA 1M6HA 2D3NA 4JI4B 3MMSA 4R1PA 4FS3A 1Z5WA 1DE0A 3DFMA 2VAWA 3IBYA 3P9NA 5BN5B 4YT8A 3A4VA 5MGNA 2V65A 5FXMA 3MG9A 3GIRA 1I2CA 5AT1A 2P9HA 4DLBA 3HXQA 3GZJA 3LWZA 1SXJD 4IRUB 2ZUTA 5CDFA 1LTKA 3DVAA 1IHMA 2IOHA 2ZJOA 4EYQA 1VMIA 2H1WA 3NYQA 1UBCA 3RRJA 2NQ8A 3LA6A 4RWEA 1QGYA 621PA 2O1WA 3DWGA 4CM4B 4LXYA 5I9BA 3TLEA 3V2GA 3BTVA 4H59A 1Q0QA 3CCQB 1DOAA 3NI2A 2YW2A 1YB2A 2F43A 4NS1A 2EERA 1T0BA 3SZRA 1H6AA 2IS4A 1CP3A 3HKDA 2QMZA 2PFGA 4G1VA 2NUPA 3FCEA 2HSZA 3ECCA 1XTUA 1JNXX 1WWKA 1ECFA 5TQ0A 4ND8A 4PCVA 3UJPA 2G83A 2D8AA 3MFQA 4FYXA 4I50B 4Z0NA 1AGPA 1ZNYA 4ND2A 3QUCA 2REQB 5IJ0A 4YCDA 4UCFA 1JU4A 2P7HA 1WDKA 2EBFX 5BY2A 3PUWA 4UTXA 4I0WB 4NAUA 3BUSA 2DUWA 4PGMA 1RJ9B 4YK7A 4E5KA 2B6HA 3A6ZA 1SURA 1LBTA 4NU6A 4RORA 3RFVA 2M6LA 4BQOA 4QU9A 4B3DA 3ZCSA 3MUNA 4K3VA 3UN1A 4YUAA 4Q66C 3CF0A 4XLFA 2D1YA 4O4IF 5LQNA 3ER6A 4QXRA 5EJIA 3SYLA 3DB2A 4K05A 5JJ5A 1M0EA 1GILA 2FEKA 3ID6C 2G63A 1V7QA 5AM4A 2YXLA 3ZCVA 5DYTA 4GI3A 5TVKA 2E4VA 1J25A 1LNQA 2V7GA 4ARZB 1WW3A 5AHKA 4YYZA 1NB9A 4KVAA 4RSMA 2GK7A 1UUFA 3C5CA 2VDPB 4I14A 4KIUA 2XGJA 2YNMA 4GMHA 4NEQA 4B4WA 2WAYA 2XUHA 5FRDA 3SBXA 3VV2A 1DDOA 3R4CA 3C3EA 3FKSA 4ZV4A 3LYAA 1YWGO 5SY9A 2JCXA 3BK1A 2E9SA 3AVQA 3H97A 3JZAA 4CM5A 3EWAA 4L72A 1NNSA 2XTAA 1BFKA 2SCUA 3DVAB 1BS1A 2XKKA 1KEUA 2GN6A 3HCEA 4WECA 2Z5LA 3PWSA 3RFFA 3SQOA 1J9ZA 3VSAA 4EHHA 1T9AA 3EYWA 3JYQA 4DANA 2WI8A 5BWLA 4YN3A 1ZAYA 1RZUA 1VQ5B 4MRVA 4QJ3A 3TFQA 4AYXA 3JW8A 1Z29A 4U7JA 1CY2A 1X2BA 4AMUA 1HRKA 1KEWA 3FPHA 4GR4A 4Z4FA 3F67A 2JARA 3QVUA 1Z2EA 2Q6IA 2NUPB 1AA9A 1SK8A 2XUDA 5DW0A 1TJNA 2DBYA 2GOYA 2HIGA 1Z5NA 3TLCA 5TQ0B 4ND8B 5H3CA 1T5TA 4PO8A 1O7JA 3VHRA 1NBMA 3DBLB 4BECA 5DWQA 3WWEA 4RZ2A 3KKOA 1YFLA 1YRHA 1ISSA 1GZ6A 1KZYC 2NU9A 1MEOA 3H1PA 3H5VA 4I55F 5B37A 4AL4A 3NVKI 1P7WA 3KLPX 5ITWA 2PJUA 3B13B 3SQWA 1KF0A 2M6KA 1YHZA 4RV9A 3FNGA 3BY2A 4J6FA 1NZJA 5LZ7A 1ECJA 5CG1A 3WWZA 4QVKA 3MMPA 2V6FA 4Q7KA 2IYVA 1PK7A 4NEHB 5CK4A 3ZLBA 2QAGA 3ZN2A 2O3UA 4EGSA 1NUTA 1MDBA 3T3MB 2SECE 1JG3A 1C41A 3A06A 1NW5A 1JEJA 1BXRA 3NV7A 4E2WA 3HKEA 4Z4SA 3RSHA 3OW7A 1KERA 4DJTA 2B7BA 1SOWA 2HPAA 4PFKA 4JC4A 3GJYA 3W4JA 3ZDXB 3CLSD 1Z74A 1SCJA 1VHDA 4HNSA 3CXCB 3AFHA 4Z8YA 1GQRA 3ABOB 3CO5A 3KHSA 1YDWA 4FYYA 4LYGA 4NG5A 4RGVA 2WAOA 2NZJA 3IULA 5CLGA 1B0AA 1E1MA 4XUEA 3NFYA 2IH2A 5KC9A 1N0WA 1VLVA 3QE2A 2PRJA 5E2IA 3BE4A 1BSVA 4BQPA 2JJ1D 2JBHA 1NOIA 4ZCSA 2RHHA 5I6DA 5LQKA 1UBKS 4BRUA 1OD6A 1EZZA 1GGFA 2HT6A 2KYRA 2SCUB 4HQFA 4ZYXA 4PVDA 3LRTA 3DTNA 1JDNA 4KHPB 3EDYA 5DNUA 3IMGA 4BY9E 3R3VA 3OCXA 2QYTA 2WTUA 1FMTA 2X2OA 3HSSA 4HT3B 3KB2A 4TKLA 1FTQA 2BJVA 1DHRA 2A5DA 2GM4A 3H3FA 4JENA 1X92A 1LW6E 4BVBA 3LTNC 2ZTHA 3F96A 3P9IA 4WNAA 4X24A 4G1MB 2C84A 1QYXA 1UQRA 2AMFA 3IHKA 4A10A 4BB5A 4K9OA 2XVZA 2ZUUA 3WL6A 2NU9B 2J46A 4L76A 2HNBA 4JBWA 2HJ9A 3RSSA 3ZU6A 4L4RA 4DVGA 1PJ5A 3EIQA 2AC2A 4EB0A 1JJ2B 2VTBA 1MT0A 1EJ0A 4A2WA 3NDBB 2C5BA 2Q6OA 2DHDA 2X8BA 4NZOA 5BVGA 1WULS 3KB1A 2REXB 4QYXA 4F3KA 1T25A 3CNHA 3JQBC 2H5IA 5B3JC 5LB4A 3N2EA 5K0JA 2C0QA 3IAXA 4HB2A 4KN5A 4MYCA 4E5VA 4GZLA 2WUVA 5CMLA 1XU4A 2GBCA 2NTJA 3HKEB 3MS7A 2EVWX 4PQRA 4EHDA 5FBVB 4PABA 2NZXA 1H6CA 1B8OA 2ZSUA 3C43A 1F8YA 4EG6A 4F60A 3B85A 3QVVA 1MB9A 1ADGA 2QZPA 2C7GA 4DR3B 2ZJ1A 5ADHA 1N5RA 1KETA 4RDLA 2IRWA 5FUXA 2ACEA 4G5FA 2BH2A 2TMKA 4DMUB 3A6FA 3EBOA 2FPWA 5FOXA 3QQPA 2PD6A 1Z33A 2H0RA 4LI3X 1RWBA 3DYVA 1AGXA 1WXHA 3G6WA 4LRTB 5GONA 4D9CA 3G2HA 2PLAA 4QYWA 2CCKA 4CM7A 1HUQA 3HB5X 4XQ0A 4BYMA 5I7UA 4MS3A 3I42A 1KBZA 4RD2A 3O3OB 3R3YA 4QJ4A 3BB4A 3ZK9A 4Z7OB 1SOAA 5F77A 1IHPA 3QWFA 1NF8A 4ZI5A 4B6PA 2VBCA 3B8HA 1K8AD 3CLRD 3ED1A 2WU1A 1J97A 1SCQA 3FCYA 3O4VA 2H59A 3PGLA 4HFRA 1YQEA 4WCFC 5D6OA 4CWAA 2RBGA 1RWMA 2HRZA 1DFGA 1Y5NA 3EXG2 2XWPA 4AI6A 3E3MA 3NHRA 2MR6A 1FK8A 1HOTA 3KOMA 3AI7A 1LWOA 1Y1TA 3UCEA 1XVVA 2O7QA 3EQ2A 4KR0A 3Q5DA 2LUOA 4RJLA 4KMRA 1RU3A 4C6SA 3RTCA 3VUEA 4I4LA 4EFMA 3AHHA 4W8OA 1R8QA 4X7DA 5F64A 2A78A 3B53X 4BBZA 4K9RA 1B6GA 4TKVA 3EZ7A 3PG5A 1NYLA 1V7ZA 1RAAA 2IOFA 5D84A 1TNDA 3RRFA 4C2AA 1NQOA 5HMLA 4FE7A 4TLLB 3OAAD 3ZY6A 4EPVA 2VTBB 3VKGA 2DFVA 4Z3DA 2YWGA 1T8PA 4BO6A 4DJJA 1N0UA 2WJYA 2HA4A 3PUJA 1QANA 3AUKA 3GT4A 4YMVA 3L1VA 1YRQA 4NHEA 2ZYWX 5BVGB 4GOKA 1RSZA 4PZ0A 3SC4A 3SMVA 2YRFA 3C3XA 5AKLA 2CGEA 4CV2A 1DWOA 4MUYA 4ZCQA 3RHZA 1N32B 3MM4A 5DCUA 5EA2A 4DY4A 2N9UA 3DXFA 5EZQA 5JNUA 1V5FA 2QTRA 4MROA 3TD9A 3M4JA 4PBRA 1T2AA 4CKBA 3VR2D 3FBTA 3OO0A 2RHCA 4ZXFA 5C1IA 1UFKA 4ACBA 2CXNA 2VF7A 3IE2A 4MRSA 2PN1A 1E1QD 4RL6A 4KKXB 2H1VA 1QO9A 5DM70 1JHYA 3TQTA 3FFAA 1Y37A 2XF2A 2YXBA 3DZGA 1PL6A 2G09A 5FA5A 5I7OA 1N2SA 2A9FA 3VR5A 5EMHA 1N9ZA 2XVAA 2HZBA 4GE0A 1CS4C 3PHJA 4RMGA 3VKUA 4L5AA 1Z4IA 5IYRA 1B16A 2XF8A 3BMOA 1PJ2A 3EOAI 3RT9A 1J8FA 1O6GA 3M6LA 1VCHA 2RK6A 1TQDA 3GYGA 2VWGA 2H5EA 5JALA 4B44A 4JUCA 4NHOA 4UZSA 5CYPA 2RB5A 1HLPA 3WZMA 3VO2A 1WMDA 1JPUA 1KMCA 1PT5A 3A4IA 1Q77A 5SZHB 4Q4LA 1MOQA 4MB0A 3K9BA 3PA1A 1JDTA 5ERGB 3ROZA 3CNBA 1MVNA 3CRRA 1UEIA 2GT1A 2HRQA 4QFMA 2V9CA 1YB5A 3JQ9C 1J0CA 1YITB 3BCSA 1ST3A 5KU7A 4MEAA 1L8XA 5JDIC 2RIRA 3JQBA 5B3JA 5DYNA 5EVJA 4LWQA 4YQZA 1P7PA 4JQCA 3I05A 4B9EA 3EH1A 3COJA 5KOYA 4BP9A 4W5NA 4TKVB 1VSVA 2RHMA 4E33A 1AXEA 3ZI4A 1JE0A 1PUIA 1E99A 1ZSNA 2XMDA 4OQ4A 3QYPA 4HUTA 3QITA 3VV3A 4RMNA 1CR4A 2X6XA 2EF1A 4IOKA 1LFAA 5FBQB 4JKOA 4Y9RA 1DG9A 1Z4NA 5JWRA 2Q0QA 3ENKA 3D4IA 2F64A 4CKZA 1ZD4A 3LJKA 1R0BA 3FFTA 1C4OA 5DYYA 4BKMA 4CZ2A 2XVMA 4BFTA 4FZRA 3V8MA 3UAGA 5KYYB 3JTMA 3CKKA 3JYHA 3LY8A 3C3AA 4J1QA 1CIJA 4PR0A 5EYPB 2VWQA 4CKBB 1E69A 3GFOA 3MVEA 3IBCA 3MWEA 1R6DA 1JVSA 5IVHA 2JIBA 1TQ6A 1E6CA 1Q86D 3E9QA 3NVMB 4TGLA 3GRPA 2N3ZA 3VU0A 3VVLA 2VR1A 3ZHVA 3PQFA 1ZL0A 2ETXA 2EWVA 2AR9A 4BIMA 1A7AA 1DEKA 3CH4B 1EWTA 2C4HA 4ESOA 4QVJA 3O74A 1VJGA 2QDXA 3PFBA 1EX1A 2X5NA 4X44A 4E94A 4DR7B 3BMOB 2IVZA 4K1XA 1YI2B 2AH5A 1M6VB 2BDTA 1L9KA 2MMGA 3HHPA 3NUZA 2A88A 1T5LA 4AX8A 2GASA 5JD5A 4PBSA 2J6HA 4IIYA 3SNHA 5G1PA 1XDGA 3SIRA 5DXAA 3PQ6A 4NFSA 5LZ4A 3LX5A 2AC7A 2I87A 3PXBA 3RS3A 3L4JA 1FQJA 4XR4A 4DDTA 1T8YA 1E6UA 1ILWA 1H2XA 2RGAA 3M1IA 1LQ2A 4NBTA 3VMMA 3O84A 2CHEA 3PRKE 1MUUA 3D6HA 3I2IA 4M21A 4L9SA 5E9JA 3LVRE 4KQJA 1M5UA 4YV7A 5ENZA 3K8OE 1QXSA 1XKXA 1V8OA 2BKAA 3MEQA 1CJBA 3IQWA 5A89A 3DOFA 5CBPA 5CDUA 3VR0A 2C2KA 1GSAA 1CUGA 1NVEA 2C96A 1DCKA 3L6OO 1ORWA 2QV0A 4TWAA 4Y1RA 5CLLA 2XIJA 3C3JA 3TN7A 4BAZA 3HJTA 3IQFA 4A36A 3OT4A 1U2RA 3AIIA 3DEJA 2Y2UA 2K7FA 1FUYB 4DCCA 3LOUA 5JC1A 2YMLA 2A30A 3FDZA 4R8KA 1KAMA 5DNWA 1XHEA 4NATA 2OC4A 2IEYA 2JKZA 1SG6A 3L8MA 1DV2A 2XCLA 5AXAA 5IDYA 4B0PA 1K8QA 4XM0A 4IQGA 4WZAA 3VAYA 1ACMA 4WV3A 4GSKA 1KSFX 1WCYA 1WHSA 1DAIA 3HU3A 3NPMA 3ASZA 2O6HA 4YAJA 3MWEB 3T3IA 5IC4A 3IGFA 3P97A 3EC7A 4OQYA 2Q5HA 5H0IA 1XD8A 4OHOA 1XRLA 1LPOA 4XDZA 1WD5A 3S2YA 4L5JA 1Z0SA 3WIOA 5F23A 4ZQHA 4KQHA 3W6OA 1SXJC 3BYZA 1U2QA 4F12A 1QU2A 2VZ8A 2HCBA 2VCHA 4I9FA 3H1EA 5BPFA 3OQPA 1DGQA 3JQPA 2XNDD 4ZODA 1J0AA 3CM0A 3ZWAA 2IF2A 4YX9A 3P9CA 1DOZA 1A3CA 3I1FA 2WP0A 5T8KA 4PIMA 1KJIA 3LQ2A 5C35A 5C7LO 4X7CA 1FOEB 1N2OA 4P6YA 2LGJA 1A4IA 2V8BA 3L3BA 4KMMA 4ZOEA 1U3FA 2YY7A 4PZUA 2PMEA 4Z7NB 5HFNA 2OPBA 3QW4B 3RYCB 4IJ5A 1QIHA 2ENUA 3FDJA 1ZM2A 4WZTA 3Q0EA 4I5GA 3WGQA 3SMQA 4X7BA 3KE9A 1B8NA 5DEOA 1GQFA 2YQ5A 2HCRA 3K16A 3V4LA 2QA4B 3GPIA 2Y67A 3PE6A 3ZBQA 4BN5A 1EZ4A 3GVHA 3P32A 3FOFC 2B94A 5DLYA 2JHAA 5FORA 4DIUA 1DNPA 1BOFA 4IFBA 4LJSA 4WZ6A 4CDNA 5CBPB 5HIAA 1KR5A 4U8GA 3RJZA 3TXXA 1C4WA 1O5OA 3UH1A 4AJ1A 1GPH1 1RJFA 1N5LA 4Y1RB 5J9FA 2BCJQ 4YR7A 3A36A 1OI2A 2DPLA 2XPCA 3UB4A 5JYBA 1JE1A 2OV4A 2NADA 2XWBF 3LHFA 3OE7D 5KB3A 4RM0A 5JNRA 1X13A 1UZMA 1K6MA 2J67A 3FDZB 3T95A 3KWMA 3L1IA 3LNTA 3DGEC 3W05A 4U9IS 4JLWA 1BS2A 1M54A 4BASA 4TSFA 1SQ6A 4FMDB 3MIZA 1U28A 2QW0X 2V59A 9LDBA 3DXXA 1PF7E 2FW6A 1LBQA 2XH8A 4I6EA 4NU5A 4WZAB 3QJGA 2ZIUB 4LF8B 2NPIA 5L7TA 1TEZA 1BDJA 1XMQB 1WHSB 4DUGD 1E2GA 3TPZA 2I6FA 2XNKA 1YQQA 2PMWB 4QPNA 1LWNA 1L2TA 4RNDB 4V3CA 3T15A 3V8BA 5IFKA 2WYRA 1SC4A 2OGTA 4MB6A 4MUEA 4F9FA 4CM1A 4DQXA 2WFAA 1C8KA 2C2HA 2WU3A 2FN8A 3WQZA 2WUDA 3BFXA 4HGNA 6YASA 2YW9A 1GCUA 4BJ6A 4KNVA 3EG9A 5SZJA 2RE8A 4N47A 1HYHA 2BKEA 2DWOA 2F3QA 2I2CA 3AI2A 4WXMA 2KLHA 5GZ3A 3GZ4A 2F3SA 4EBBA 1H4TA 1Y9ZA 3SU8A 1OMOA 3IUPA 2QW8A 3LMKA 3E5RA 3JWHA 1XK6A 4CF4A 5BT8A 1AV7A 3MT9A 2WJZB 1ZLYA 1RAHA 2OBBA 4OB7A 2HYDA 4LC9A 4FIZA 4I99A 4X9XA 2HV8A 2WWTA 5EZYF 2PUJA 2B0CA 1DUVG 2A9OA 1U3VA 4JA0A 3TQRA 2JDIA 3WRXC 5TR9A 4P36A 2HCTA 2VDUE 3FTFA 1RWNA 1PGOA 4CL2A 2YHIA 1ZI8A 3R6LA 4P9NA 3EFOA 4XIYA 4IQFA 1TMGE 2DGDA 1GZ3A 4RHYA 2I33A 5ECYA 3VHXB 2Y1OA 3I37X 4ZI7A 4ENQA 2G5PA 2FZVA 1L4NA 3CEMA 1XT6A 2WKQA 4B6RA 2H1HA 4GI7A 4HGOA 3OEHA 2R00C 4HLCA 4RENA 4IDGA 3ENZA 3AF6A 3FWZA 1OROA 3GNLA 3N2IA 3PGXA 5CBKA 3LSYA 2O5VA 3OZTA 1ZIPA 4DABA 4V2IA 1ZXXA 2PYZA 4QU5A 1P8AA 4RLZA 3ILHA 4DDUA 2GB4A 3AR8A 4HTAA 2H11A 4LV8B 5H83A 3S81A 1FU4A 4GD3Q 3A2MA 5F76A 3BSWA 4YJHB 3EX7C 1XKQA 1DCFA 4A1OA 3ONYA 4WW0A 4BVEA 4GRIA 4B32A 4LY0A 2PGNA 3PA8A 1SXJA 4E2ZA 2FY8A 4JOSA 3GB9A 4X41A 3MWYW 1YZQA 2D54A 1QJCA 4KXQA 5LD2C 1TK3A 4P3PA 1OF1A 2VRBA 3L8HA 4CLRA 2ZYDA 3ZDCA 4JI7B 1NLUA 3MUEA 1L5SA 4G01B 2ISCA 1NKSA 3OFJA 2PVPA 1RXVA 4PNPA 1DTSA 2Q07A 3DMGA 2LVBA 4TMFA 4XSHA 2E1RA 3PQ3A 4MRMA 2V9ZA 1G59A 5HUJA 2FF7A 4NICA 1Z8DA 4QYSA 1KSGA 3EG9B 3GEEA 3L6DA 2UZ4A 1GDHA 1V8PA 1E2HA 4RF5A 1D03A 5F2EA 1YA6A 1X7YA 1V9SA 2VBVA 5HS6A 3REGA 3JR7A 3R5KA 4U00A 5AUQA 1K6JA 2WJWA 3IQIX 2ZYHA 1W75A 3DNPA 1QKKA 3WGIA 4IY1A 2ZIVB 1XQ6A 3U40A 1S96A 3RUAA 4FMCB 4A03A 4DDWA 1PUXA 4MWZA 1L8OA 1Z7EA 3CLUD 4KACA 4PYLA 3ZBPA 3HA2A 1I9GA 1PD0A 2PZMA 4LOHA 3IURA 1Y8RA 4AICA 4N5DA 3RROA 3I01A 3T41A 4Z7QB 4NYMR 2D4HA 2B4YA 3DNFA 2JVKA 4TS9A 3ZCTA 4EHFA 2YHIB 2CXRA 4CIBA 3TRKA 2I62A 3EFOB 1G41A 1GAQA 1HSOA 3P7MA 4LYEA 2O1SA 4MI1A 4A2QA 2IEIA 1TIPA 2KQUA 3R3JA 4ZI7B 5ALWA 4B31A 4MUXA 4YMTA 3G7NA 4BMSA 4MRRA 2QMQA 2I6UA 2PEZA 3RH0A 4UEWA 1SWWA 2BEWA 4CLEA 3NKFA 4TZ0A 4B43A 5CPFA 2E55A 3STXA 2Y66A 4ZCTA 2ZXIA 2BBSA 1DAFA 2IYOA 3H8SA 3SFTA 2ARKA 1YHQB 4Q0MA 4PLTA 3V3KA 3OOWA 1P2UA 1V2HE 3P0HA 5KYUA 4BDTA 5L7WA 1KQGA 3RAEC 1PW7A 1QP8A 2MYTA 5CFPA 3FPLA 3O4GA 1S9HA 3GLHA 2VXYA 3OQJA 5C51B 4NBKA 2ZJ6A 3I5UA 4FSHA 3FHTA 2QUKA 4NJEA 1YL7A 1SXJB 3NOOA 4Q93A 3EXEA 2A7QA 3LCVB 1T6BY 1IZYA 5HRUA 3HK2A 4LRYA 1VQ6B 2QSYA 4M46A 2ZRLA 3CKLA 5F4BA 4CLRB 2OMEA 4W5HA 4XCXA 4RM2A 1NBHA 3S2UA 2D62A 4D98A 2HFKA 1DAMA 1RYYA 3CGWA 2YV4A 3WDSA 4BFVA 1P5FA 3JWPA 4L9AA 3ECAA 4M37A 4OMFG 4MRMB 4NI5A 4S2EA 3SXPA 3WRXA 2HA3A 4R2LA 4ZVSA 2AOUA 5ANRB 4AF7A 3SX2A 4XARA 2AXNA 2Y92A 4D6PA 1XRPA 1HDEA 1EJBA 4TTJA 1BH6A 1K4MA 3ED5A 5DNVA 5CAEA 4OEHA 1X7YB 4E1VA 4DQ0A 2ZAMA 3KYBA 4ZVPA 3VNBA 5HF8A 2E4XA 3F4KA 3F98A 3LDAA 4E3ZA 3CLRC 1NZDA 1Y89A 3OM0A 1YDFA 2HPHA 3DB1A 5A6VA 1P9RA 4RDKA 1SO8A 1BXZA 2RBKA 3GEGA 4FI3C 4DDHA 4G4IA 2J7KA 1GYPA 2QYHA 1EDOA 3VHLB 1XWIA 3LWNA 4KITB 5HR5A 1B0ZA 1DU4A 1Y8RB 2DYKA 2ERCA 3VXKA 4DIEA 4CR8A 2RI1A 1R8SA 3WKCA 1ULHA 2IZZA 3OLCX 1VLOA 4MVJG 4DG5A 3T0IA 1O8CA 3JALA 3LFTA 3TKYA 1O5IA 3CWCA 2J9GA 4K6KA 4RGQA 4TWIA 1AVTA 2NUAA 2ZAGA 2BEWB 2JJ2D 3GHHA 1QZTA 1UKCA 3HLKA 3ROPA 2QN1A 2PSJA 4S2UA 2VWPA 2FZ5A 4WBNF 2QN7A 5AQ1A 8ADHA 4I55A 2VJQA 4OPSA 1A4RA 4RD6A 1YZYA 3NORA 5KYUB 3A1SA 1W73A 4PG7A 3A3GA 1CIPA 3SZOA 3U9TA 1MH1A 2ZT6A 1HXHA 4DK1A 3GLHB 3QHPA 3V33A 4OF4A 4Z4QA 1WETA 4NJEB 1IONA 1QPBA 1C14A 3EXEB 2BEJA 2BR5A 3KSAC 4FDAA 1V35A 5LLSA 2DAPA 1SFRA 5IAAA 1DEOA 2AXPA 1RLMA 2YIMA 2HT1A 4M7PA 3D8UA 4G4JA 4DCNA 1GQ2A 4GLFA 1UODA 1N2XA 1R6UA 1E58A 3JD0A 2LNDA 4RC9A 1USKA 3OJCA 1G0NA 3U44A 1U1IA 1ZNQO 3D2AA 5DI9A 2WU8A 2XBMA 5B57C 4Q82A 2OR3A 2AOUB 3ISXA 1G3RA 4MWDA 4QG7A 4P4LA 4ABTA 1WVGA 3COYA 5CAEB 4IX9A 1H3NA 2JCSA 4ZEWA 4KO2S 2Q2WA 1LZLA 3A6DA 1QV7A 3E70C 2HWWA 1L8QA 1MPXA 3IDFA 5I5GA 1NLYA 4UQOA 3R7SA 2XRMA 4X65B 1WPGA 3HUEA 1FFSA 4NBUA 2GZSA 4NBSA 1MF7A 4W8HA 1HZZA 3HJHA 4KIJA 3SS7X 1NW3A 3TOSA 1XD9A 3H0EA 2V7QD 1M2OA 4QU8A 2QL9A 2OAP1 3VNSA 3FPFA 1Y4DE 3KZNA 4OAPA 4UXHA 2DY0A 5DX8A 4DB4A 5M04A 2YHSA 4U2EA 1YJXA 2NXJA 5EXEA 3RIHA 4AQDA 3TEJA 3T3EA 1C4XA 1DQYA 1FDWA 1DFHA 2RC5A 2DLNA 2KBFA 3E9MA 4U7GA 3FMFA 1E0SA 2X6RA 1UKZA 2Z2KA 1QRSA 3L0YA 3PWZA 3QVMA 4RZIA 1WZCA 2E1PA 2Q21A 3DE1X 2QE7D 4NY1A 5T4HA 1PWXA 1SHTX 3PXAA 1Y3FE 3U3KA 2NUAB 2Q4EA 4B80A 3AI1A 5F1KA 5LD2B 1KRWA 1H2BA 2EG9A 3BJRA 3M5DA 2Z9CA 1H42A 1U8ZA 2CNBA 1JXAA 1IHYA 4KK4A 3WL8A 2P9GA 2HQRA 2CF5A 4I55B 3IOYA 2IDZA 4ENPA 1XB2A 2IXBA 4GWGA 4V02A 3BZUA 5EWMA 1OPXA 5DIZA 1IXSB 4O3FA 3OZUA 1B00A 1I01A 1ZMOA 1NYTA 1PR1A 2C3PA 2VPQA 2YJ5A 4ZTBA 1EXVA 2CBZA 1I3KA 4YJKA 1PQUA 3EGVA 4S1VA 5F5LA 2NUTA 4JJ8A 2QJTA 2GZDA 3X0DA 1X8KA 4P5EA 4J4HA 4ZAGA 5K8JB 2K5UA 4L5CA 3S40A 4ZDJA 4EJ2A 3A6JA 2IUEA 4LDAA 3U16A 1EJ2A 4ZOLF 2Y1WA 3D4LA 1FZTA 4I4NA 3U44B 4CODB 5EHXA 2JIPA 4WGGA 3D6FA 5AVJA 1AK1A 3BHMA 3LSTA 3IEUA 4KZKA 5KNBD 2K2QB 1LBSA 1S8FA 2FX5A 2OP1A 5AOAA 3V1KA 2VZ9A 4ESEA 1V2GA 4PANA 1JQKA 1QE0A 4Q18A 1UFQA 3W34A 4DGQA 3E3LA 3TB6A 3WB2A 1RAFA 3MAAC 3KDAA 2WKPA 4EITA 5AR1A 3CPSA 2C5LA 3ZDRA 5KTMA 3PUNA 2BMVA 2C2MA 1UBHS 2QQEA 3CPHA 3CU5A 5B1SA 3UXMA 5IF9A 3OAAA 1NBEA 3GRVA 3MRVA 4X06A 3G1UA 2X5JO 5MF6A 1M2OB 5A6SA 3OQNA 4UTVA 2AJ8A 1YS2X 3LX4A 2PH3A 3EQZA 4NMLA 5G4KA 3PWTA 1JB1A 1KY3A 5F1YA 1FFCA 2P0EA 3KJXA 3ICOA 5IULC 1W30A 1LXCA 3K5HA 1M7BA 2PRZA 1XALA 3WHLA 2B8TA 2G5GX 4OJTA 1VGVA 3PUZA 5HQ3A 3T3GA 2D74A 1BGVA 2WJ4A 4D79A 3VR2A 3X1WA 2AQIA 1G21A 5EKTA 4FYPA 5CXUA 4HXGA 4Q16A 2B1QA 4D0SA 1RTTA 4L85A 2GBGA 4E88A 5DCYA 1VRWA 1J5EB 1E1QA 1QVZA 3LFHA 3ZNPA 1SCKA 3O0DA 3PU6A 2ONZA 2O59A 4YELA 1FNSA 1L5WA 1Q0PA 3VZDA 5FADA 1P9OA 3VGJA 1