4G7XA

Crystal structure of a complex between the ctxphi piii n-terminal domain and the vibrio cholerae tola c-terminal domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
INCDPNTTTSHQLLFGFGSPIVQSVLFDGCMLDIEKDDYGFVWSCLSNENGDYCKGLYKPRFTQGVSPNWPMCDLSGASAERCIYPYCPEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of a CTX{varphi} pIII Domain Unbound and in Complex with a Vibrio cholerae TolA Domain Reveal Novel Interaction Interfaces.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Protein binding/protein binding
molecule keywords Putative uncharacterized protein
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2012-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.280 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4g7xA00
4G7WA 4G7XA
chains in the Genus database with same CATH superfamily
4TKOB 3CCRB 1U2RA 4UZEA 3VMFA 4AC9A 1TLLA 4WZKA 1R5BA 1Q86D 2CK3A 2VNKA 1IB0A 3VR6A 2DYIA 1VF7A 5THXA 2XZOA 2DY1A 1F20A 3BNWA 1VQ7B 3GIRA 1YIJB 3LNNA 5BSYA 2ZL5A 2ZTGA 3BY2A 4II3A 2QTLA 4P9SA 2QEXB 1WDTA 3T53B 4FK8A 5A89A 2Q6KA 1QUFA 2D74A 3CCLB 2YWHA 3MCAA 3AVUA 1VHOA 2KVOA 3WNDA 2XEXA 3ONYA 3OP1A 1G7CA 1W2BB 3ZBTA 4XOPA 4OPSA 2WR8A 1EFTA 2I1LA 1Q81D 4N3GA 1YHQB 1CQXA 1BMFA 4X8IA 1BJKA 1EWYA 1NB0A 4XLAA 1JNYA 1VQ4B 3ONUA 4DQKA 3BQJA 3BCDA 3U6KA 3OW2B 4OOSA 1NBMA 2RC5A 1B2RA 1UD4A 4ACBA 4KKSA 3GVJA 2QA4B 1FNMA 1GO2A 1ELOA 2RC6A 3SKBA 1K8AD 2D3LA 4YAFA 4G1BA 1W9XA 1QUEA 1PJ5A 2OK8A 1XB2A 2OK7A 2WPDA 1A8PA 2EIXA 4Z1MA 2E1RA 3LVBA 1UD8A 3SLNA 2BV3A 3OEEA 2OYNA 1WSVA 2X53S 3BH4A 1G7TA 1JJ2B 4KKTA 1W34A 1KJZA 5H5JA 4Z4YA 1VQ5B 5KSWB 2X6YA 1W0KA 1KK0A 2GJPA 1WP6A 4U9UA 5EMNA 4M0LA 2D3NA 2E1BA 3CMAB 2C4TA 1VQOB 1R5NA 2CRVA 2X0KA 1VLOA 1T6ZA 4QUZA 1PKVA 4XD7A 1M90D 3AVTA 4RD3A 3CMMA 1EP2B 1BX1A 3A8JA 3CB4A 3E1YE 1Q82D 4PC1A 1VQ8B 4B3GA 2FVGA 2HCJB 5B6IA 3PA2A 1FNCA 1HVXA 2R9VA 2M5SA 4B3FX 2GQFA 2CF4A 3RY8A 1VQ6B 3OZWA 3NE5B 2JN9A 4XORA 1G7RA 4C0SA 4X7DA 4RD4A 4L8JA 1EXMA 4XLHA 2PIAA 3OJXA 1QVGB 3OOCA 5KNLA 4ZGNB 3VNVA 2X85A 2OTLB 1EP3B 1FNDA 3Q6QA 4TMVA 3BC9A 4BPRA 3OZVA 1AIPA 2DERA 3GSIA 1G7SA 2JJ1A 1KD1D 2VJJA 4F7DA 3CPXA 1E79A 4HE6A 1UD2A 1EFRA 1NDHA 2JDIA 2DIEA 2BMWA 3E20A 1H8EA 3GVKA 5FL7A 3CCQB 2BM1A 4TMZA 1WPCA 2PMDA 3ASTA 1VJSA 3D26A 3PUMA 3WBJA 5AN9A 4UAJA 1UD6A 4OPVA 3I56B 4KKUA 1GJRA 3OKXA 1RQPA 2VNJA 5CDFA 3ASSA 3AVVA 4QVAA 3V76A 2VBUA 4QV2A 1KZLA 3LQ6A 3W2GA 3PENA 1XFOA 4RJLA 3JQRA 4AF7A 4ASUA 1KK2A 3B8HA 3WQZA 4RPDA 2P3MA 2VBTA 2EFGA 1E64A 4X7EA 4LBVA 4P1VA 1NRKA 2F43A 4C43A 1QFJA 3ZPNA 1BX0A 2ZZFA 1XE1A 1COWA 1HA3A 2OBRA 4Z4TA 1YITB 3AVWA 1JA1A 1KRHA 1Q9SA 3PUNA 2ZZEA 2OTJB 4ZCIA 1KK1A 1YJ9B 3G05A 1E1RA 5FNZA 3ISXA 2V7QA 4X7CA 5HZBA 2X3UA 1GR1A 1K9MD 3A3BA 3G71B 1E63A 5TR9A 4M2LA 1GAQA 1Y0YA 4RD2A 4HE5A 5IYWA 4UZFA 3JU4A 4Z4ZA 2C2WA 1QGAA 2QDXA 2BF4A 1TUIA 3U2QA 4DK1A 4DQLA 4FWTA 4XONA 1VQNB 3KEWA 4AVZA 2VBVA 2R6HA 3FPPA 3A8IA 2Q6OA 3H94A 2QMUA 4GQNA 2HLDA 4YALA 1T6XA 2QGGA 2C5HA 2V4DA 2XNDA 4NCNA 3WNBA 3OW7A 1ZM4A 2VJIA 4Q7JB 4RDJA 4G5GA 2C4UA 4OPOA 2XNCA 5DSZA 2W6JA 2DETA 2ZZGA 1QGYA 1WTHD 5IYPA 4II2A 1E3XA 1MRZA 1SKYB 2B7CA 3P27A 2BSAA 4N3NA 5J35A 3ZC3A 2HMAA 2YWEA 2XOKA 3AVXA 5IK2A 2WYRA 1VQMB 5HXBA 1DG1G 1M1KD 1V0EA 3SEJA 1NJID 2X6XA 3J81k 1QX4A 1IJFA 2GPJA 5GV8A 4IW3B 1QFYA 3A35A 4YAWA 3CRZA 1OB2A 1WOPA 2GJRA 4PC7A 1PJ7A 2XZPA 3CCVB 1UMKA 2V7XA 1SKQA 2VBSA 4HIZA 4P6VF 4CQJA 3QFRA 1S72B 1T6YA 3OEHA 1E3ZA 2WJVA 4Z4SA 4B43A 2NPFA 4PC6A 1JB9A 4P3YA 3W2IA 1YJNB 1FDRA 4XKWA 4Z4RA 1D2EA 3A1PA 1TVCA 4ZGQB 1OB5A 3OJWA 3A3GA 1H42A 4YELA 1BLIA 3AGPA 3I55B 3OPOA 2OBSA 4LBWA 3PA1A 2QE7A 5A8AA 5TV2A 1QFZA 3B78A 2WZPP 4G7XA 4XMYA 2GK6A 5IYRA 1IHMA 4QFMA 4YAUA 3CESA 4OP7A 4TSFA 4ZV4A 4Z4UA 1OGIA 2YWGA 4JMQA 4E0FA 1I7PA 1EP1B 5JBQA 2QTZA 1I8DA 1N05A 1PJ6A 1FX0A 1YLOA 4MYUA 3AGQA 1VHEA 4X7FA 4PC2A 1AMOA 3MMPA 3GQBA 2BPOA 2VNHA 4XR6A 2D9RA 3QFCA 1YJWB 1HZEA 4Z4WA 3JQQA 3HAGA 4G7WA 1WOOA 1FRQA 1QGZA 2BN4A 3JQPA 1V5VA 5KW9A 2C78A 3R6JA 1NB9A 5DN6A 3QSYA 4YXWA 2YWFA 2JJ2A 3OFNA 3CC2B 3Q3AA 2V7TA 4OOVA 3CP2A 3U6BA 2CNDA 4PAAA 1JA0A 3CXCB 2WSSA 4DK0A 2JIZA 5H59A 2BGJA 2FX3A 3B82A 1OB0A 4P2NA 4P6YA 4TMTA 4LBYA 4MYTA 3W2HA 1F60A 4RPBA 2QN6A 1FNBA 2ZBVA 3QFTA 2WZNA 1ZM9A 1DDIA 3Q39A 4M4SA 1J9ZA 2CBXA 4PC3A 4RD1A 5BSXA 1ZM2A 4WQMA 1VQKB 2GK7A 2VZLA 4XN0A 3KL9A 1GAWA 3W2FA 1P4MA 4Y9UA 4XLCA 3T51B 2ZBUA 4P26A 4P22A 1WSRA 5IYQA 5A88A 2NV4A 3R6KA 2ZTNA 1KMHA 2VNIA 4H9GA 2DCUA 2AHOA 1W87A 4P12A 4TT3A 3AVYA 3A8KA 4PABA 5TY0A 3CCMB 4XN3A 1ZM3A 2V7UA 3CD6B 1B23P 1YX2A 4XKVA 4RLZA 1R5OA 3OE7A 1N0VC 2B7BA 4P3IA 2F4NA 1QH0A 4YHBA 1SM4A 1W0JA 5FIUA 3CCEB 4X05A 4XQFA 1VQLB 2OBTA 4Y7CA 2XGJA 2BVNA 1DARA 4XM3A 1UD3A 1WU8A 4RCYA 4Z4VA 2ZXHA 4LC0A 1H85A 1QVFB 4ACAA 4NBSA 1D1NA 1CNEA 2XZLA 1N0UA 3CP8A 2B5OA 3ZIAA 1VLYA 2Z6BD 4K1XA 4DNRB 5TRDA 4XLFA 3CW2A 1T5EA 3V7AA 2ZXIA 4RM0A 1E62A 4WZTA 4X0CA 4RD0A 1E1QA 3SLDA 4WZLA 5GV7A 1E43A 1D8TA 2XNJA 5HZAA 2ZZQA 1N06A 4DNTB 4X06A 4NNJA 2WJYA 2CC2A 2ZL6A 4YAOA 3QFSA 3Q6RA 2C77A 1EFUA 5E6TA 4ZCMA 3CCSB 3ASQA 1BPLA 3ASPA 3P26A 1TTTA 3ZZ0A 1K73D 4QVJA 4TN1A 3WXMA 3PVDA 1FRNA 1KC8D 3I1FA 2DEUA 4XOTA 2BGIA 2V7VA 4B44A 2W6IA 4RCZA 1VQPB 1GVHA 1K28D 2GREA 4X07A 5F4JA 3LO8A 3VO1A 2PE3A 3ZBUA 1S4MA 3GVLA 3Q38A 4M1KA 5L46A 5F4MA 3MHPA 1N07A 3CPWB 3CCJB 4RD6A 2X6WA 4R71A 3WYAA 2DOGA 5LMZA 2F1MA 3ZUGA 5IYNA 1IJEA 4ROXA 1BQEA 2GJKA 3G4SB 1DDGA 2F1LA 1S0UA 4PGOA 4RDLA 1WOSA 2X8KA 4TMXA 4XNFA 1UD5A 4B47A 4LBZA 1Q7YD 4M53A 4EH1A 3OZUA 4WWVA 3CCUB 4OOXA 4XL9A 3VNUA 1VQ9B 1WORA 5F4OA 2Q6IA 3WY9A 5J3OA 4J0QA 2J7KA 3BCFA 4YEJA 4B3XA 3CC4B 3SJPA 4UZUA 3W5UA 5HKKA 3ZZUA 1N8RD 3ASRA 1EFCA 4WZEA 1KQSB 1OGJA 2PLFA 2HDNB 1RQRA 1I18A 1CNFA 3QE2A 2LZJA 3DDYA 3WBKA 2ZITA 3G6EB 3CMEB 2ZL7A 1OHHA 1XQBA 4B48A 1W35A 3CTAA 3FJOA 2C5BA 1QG0A 1ZUNB 3VO2A 2Q6LA 3OAAA 1H8HA 3SJZA 3T56B 2VYQA 4FN5A 1N08A 5FO0A 1YI2B 3LQEA 4AF6A 2BM0A 4FXUA 4B4DA 4TMWA 3W5HA 5FO1A 4QHYA 3BY1A 5FA6A 1KK3A 1Y0RA 4Y9RA 1V0FA 3W5VA 3WNCA 3ZZTA 3CC7B 2V7WA 4RDKA 5DS0A 3H9NA 3FPKA 3FKSA 4G6IA 4G1VA 1KTVA 3ES9A 4ZCLA 3W2EA 2V31A 4P25A 2CW5A 4XLEA 1MABA
chains in the Genus database with same CATH topology
2Z6BD 2JJ1A 4TKOB 4DNRB 4XLFA 2VJJA 2WZPP 1T5EA 4G7XA 4XMYA 1E79A 2GK6A 2ZXIA 1UD2A 1E1QA 1EFRA 2CK3A 2JDIA 2DIEA 3CESA 4TSFA 1E43A 1H8EA 3GVKA 5FL7A 3VR6A 1VF7A 4JMQA 2ZZQA 4E0FA 2XZOA 1WPCA 1VJSA 1I8DA 3LNNA 1FX0A 1UD6A 2ZTGA 4NNJA 4KKUA 4DNTB 2WJYA 5CDFA 4II3A 3GQBA 1KZLA 4XR6A 3T53B 4ASUA 1HZEA 3HAGA 4G7WA 3WQZA 1BPLA 2KVOA 1NRKA 2F43A 5DN6A 4YXWA 2JJ2A 3ZPNA 3OFNA 2ZZFA 1COWA 3CP2A 4XOTA 4XOPA 2W6IA 1K28D 2ZZEA 2WSSA 4DK0A 2JIZA 1BMFA 3G05A 1E1RA 3GVLA 4XLAA 2V7QA 1OB0A 3BCDA 3A3BA 2X6WA 1NBMA 1UD4A 4KKSA 2F1MA 3GVJA 3JU4A 2GJKA 2D3LA 2X8KA 1W9XA 4XNFA 1UD5A 2WPDA 4DK1A 2GK7A 4Z1MA 4XN0A 1UD8A 4XONA 3KEWA 4XL9A 4AVZA 3OEEA 3BH4A 2X53S 3FPPA 3H94A 4GQNA 4KKTA 4XLCA 2HLDA 2V4DA 2XNDA 3T51B 3OW7A 2VJIA 2X6YA 3BCFA 1W0KA 4YEJA 2GJPA 1WP6A 4P22A 2W6JA 2ZZGA 1WTHD 2D3NA 2E1BA 4II2A 1E3XA 1SKYB 4UZUA 2ZTNA 1KMHA 5HKKA 2XOKA 5IK2A 1PKVA 4TT3A 4XD7A 1V0EA 1I18A 2LZJA 2X6XA 3DDYA 4XN3A 3CMMA 1OHHA 4B3GA 3A35A 2GJRA 4XKVA 3OE7A 2XZPA 1HVXA 2R9VA 2M5SA 1H8HA 3OAAA 3T56B 4B3FX 4HIZA 3NE5B 1W0JA 3OEHA 4FXUA 4XORA 4XQFA 1E3ZA 2WJVA 4L8JA 2XGJA 1V0FA 4XLHA 4XM3A 1UD3A 4XKWA 3OOCA 5KNLA 3ZIAA 2ZXHA 2X85A 3FKSA 4G6IA 3A3GA 4YELA 1BLIA 3BC9A 3OPOA 2XZLA 2V31A 2QE7A 4XLEA 3CP8A 1MABA 1VLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7W A;  4G7X A; 
#chains in the Genus database with same CATH topology
 4TKO B;  3CCR B;  1U2R A;  4UZE A;  3VMF A;  4AC9 A;  1TLL A;  4WZK A;  1R5B A;  1Q86 D;  2CK3 A;  2VNK A;  1IB0 A;  3VR6 A;  2DYI A;  1VF7 A;  5THX A;  2XZO A;  2DY1 A;  1F20 A;  3BNW A;  1VQ7 B;  3GIR A;  1YIJ B;  3LNN A;  5BSY A;  2ZL5 A;  2ZTG A;  3BY2 A;  4II3 A;  2QTL A;  4P9S A;  2QEX B;  1WDT A;  3T53 B;  4FK8 A;  5A89 A;  2Q6K A;  1QUF A;  2D74 A;  3CCL B;  2YWH A;  3MCA A;  3AVU A;  1VHO A;  2KVO A;  3WND A;  2XEX A;  3ONY A;  3OP1 A;  1G7C A;  1W2B B;  3ZBT A;  4XOP A;  4OPS A;  2WR8 A;  1EFT A;  2I1L A;  1Q81 D;  4N3G A;  1YHQ B;  1CQX A;  1BMF A;  4X8I A;  1BJK A;  1EWY A;  1NB0 A;  4XLA A;  1JNY A;  1VQ4 B;  3ONU A;  4DQK A;  3BQJ A;  3BCD A;  3U6K A;  3OW2 B;  4OOS A;  1NBM A;  2RC5 A;  1B2R A;  1UD4 A;  4ACB A;  4KKS A;  3GVJ A;  2QA4 B;  1FNM A;  1GO2 A;  1ELO A;  2RC6 A;  3SKB A;  1K8A D;  2D3L A;  4YAF A;  4G1B A;  1W9X A;  1QUE A;  1PJ5 A;  2OK8 A;  1XB2 A;  2OK7 A;  2WPD A;  1A8P A;  2EIX A;  4Z1M A;  2E1R A;  3LVB A;  1UD8 A;  3SLN A;  2BV3 A;  3OEE A;  2OYN A;  1WSV A;  2X53 S;  3BH4 A;  1G7T A;  1JJ2 B;  4KKT A;  1W34 A;  1KJZ A;  5H5J A;  4Z4Y A;  1VQ5 B;  5KSW B;  2X6Y A;  1W0K A;  1KK0 A;  2GJP A;  1WP6 A;  4U9U A;  5EMN A;  4M0L A;  2D3N A;  2E1B A;  3CMA B;  2C4T A;  1VQO B;  1R5N A;  2CRV A;  2X0K A;  1VLO A;  1T6Z A;  4QUZ A;  1PKV A;  4XD7 A;  1M90 D;  3AVT A;  4RD3 A;  3CMM A;  1EP2 B;  1BX1 A;  3A8J A;  3CB4 A;  3E1Y E;  1Q82 D;  4PC1 A;  1VQ8 B;  4B3G A;  2FVG A;  2HCJ B;  5B6I A;  3PA2 A;  1FNC A;  1HVX A;  2R9V A;  2M5S A;  4B3F X;  2GQF A;  2CF4 A;  3RY8 A;  1VQ6 B;  3OZW A;  3NE5 B;  2JN9 A;  4XOR A;  1G7R A;  4C0S A;  4X7D A;  4RD4 A;  4L8J A;  1EXM A;  4XLH A;  2PIA A;  3OJX A;  1QVG B;  3OOC A;  5KNL A;  4ZGN B;  3VNV A;  2X85 A;  2OTL B;  1EP3 B;  1FND A;  3Q6Q A;  4TMV A;  3BC9 A;  4BPR A;  3OZV A;  1AIP A;  2DER A;  3GSI A;  1G7S A;  2JJ1 A;  1KD1 D;  2VJJ A;  4F7D A;  3CPX A;  1E79 A;  4HE6 A;  1UD2 A;  1EFR A;  1NDH A;  2JDI A;  2DIE A;  2BMW A;  3E20 A;  1H8E A;  3GVK A;  5FL7 A;  3CCQ B;  2BM1 A;  4TMZ A;  1WPC A;  2PMD A;  3AST A;  1VJS A;  3D26 A;  3PUM A;  3WBJ A;  5AN9 A;  4UAJ A;  1UD6 A;  4OPV A;  3I56 B;  4KKU A;  1GJR A;  3OKX A;  1RQP A;  2VNJ A;  5CDF A;  3ASS A;  3AVV A;  4QVA A;  3V76 A;  2VBU A;  4QV2 A;  1KZL A;  3LQ6 A;  3W2G A;  3PEN A;  1XFO A;  4RJL A;  3JQR A;  4AF7 A;  4ASU A;  1KK2 A;  3B8H A;  3WQZ A;  4RPD A;  2P3M A;  2VBT A;  2EFG A;  1E64 A;  4X7E A;  4LBV A;  4P1V A;  1NRK A;  2F43 A;  4C43 A;  1QFJ A;  3ZPN A;  1BX0 A;  2ZZF A;  1XE1 A;  1COW A;  1HA3 A;  2OBR A;  4Z4T A;  1YIT B;  3AVW A;  1JA1 A;  1KRH A;  1Q9S A;  3PUN A;  2ZZE A;  2OTJ B;  4ZCI A;  1KK1 A;  1YJ9 B;  3G05 A;  1E1R A;  5FNZ A;  3ISX A;  2V7Q A;  4X7C A;  5HZB A;  2X3U A;  1GR1 A;  1K9M D;  3A3B A;  3G71 B;  1E63 A;  5TR9 A;  4M2L A;  1GAQ A;  1Y0Y A;  4RD2 A;  4HE5 A;  5IYW A;  4UZF A;  3JU4 A;  4Z4Z A;  2C2W A;  1QGA A;  2QDX A;  2BF4 A;  1TUI A;  3U2Q A;  4DK1 A;  4DQL A;  4FWT A;  4XON A;  1VQN B;  3KEW A;  4AVZ A;  2VBV A;  2R6H A;  3FPP A;  3A8I A;  2Q6O A;  3H94 A;  2QMU A;  4GQN A;  2HLD A;  4YAL A;  1T6X A;  2QGG A;  2C5H A;  2V4D A;  2XND A;  4NCN A;  3WNB A;  3OW7 A;  1ZM4 A;  2VJI A;  4Q7J B;  4RDJ A;  4G5G A;  2C4U A;  4OPO A;  2XNC A;  5DSZ A;  2W6J A;  2DET A;  2ZZG A;  1QGY A;  1WTH D;  5IYP A;  4II2 A;  1E3X A;  1MRZ A;  1SKY B;  2B7C A;  3P27 A;  2BSA A;  4N3N A;  5J35 A;  3ZC3 A;  2HMA A;  2YWE A;  2XOK A;  3AVX A;  5IK2 A;  2WYR A;  1VQM B;  5HXB A;  1DG1 G;  1M1K D;  1V0E A;  3SEJ A;  1NJI D;  2X6X A;  3J81 k;  1QX4 A;  1IJF A;  2GPJ A;  5GV8 A;  4IW3 B;  1QFY A;  3A35 A;  4YAW A;  3CRZ A;  1OB2 A;  1WOP A;  2GJR A;  4PC7 A;  1PJ7 A;  2XZP A;  3CCV B;  1UMK A;  2V7X A;  1SKQ A;  2VBS A;  4HIZ A;  4P6V F;  4CQJ A;  3QFR A;  1S72 B;  1T6Y A;  3OEH A;  1E3Z A;  2WJV A;  4Z4S A;  4B43 A;  2NPF A;  4PC6 A;  1JB9 A;  4P3Y A;  3W2I A;  1YJN B;  1FDR A;  4XKW A;  4Z4R A;  1D2E A;  3A1P A;  1TVC A;  4ZGQ B;  1OB5 A;  3OJW A;  3A3G A;  1H42 A;  4YEL A;  1BLI A;  3AGP A;  3I55 B;  3OPO A;  2OBS A;  4LBW A;  3PA1 A;  2QE7 A;  5A8A A;  5TV2 A;  1QFZ A;  3B78 A;  2WZP P;  4G7X A;  4XMY A;  2GK6 A;  5IYR A;  1IHM A;  4QFM A;  4YAU A;  3CES A;  4OP7 A;  4TSF A;  4ZV4 A;  4Z4U A;  1OGI A;  2YWG A;  4JMQ A;  4E0F A;  1I7P A;  1EP1 B;  5JBQ A;  2QTZ A;  1I8D A;  1N05 A;  1PJ6 A;  1FX0 A;  1YLO A;  4MYU A;  3AGQ A;  1VHE A;  4X7F A;  4PC2 A;  1AMO A;  3MMP A;  3GQB A;  2BPO A;  2VNH A;  4XR6 A;  2D9R A;  3QFC A;  1YJW B;  1HZE A;  4Z4W A;  3JQQ A;  3HAG A;  4G7W A;  1WOO A;  1FRQ A;  1QGZ A;  2BN4 A;  3JQP A;  1V5V A;  5KW9 A;  2C78 A;  3R6J A;  1NB9 A;  5DN6 A;  3QSY A;  4YXW A;  2YWF A;  2JJ2 A;  3OFN A;  3CC2 B;  3Q3A A;  2V7T A;  4OOV A;  3CP2 A;  3U6B A;  2CND A;  4PAA A;  1JA0 A;  3CXC B;  2WSS A;  4DK0 A;  2JIZ A;  5H59 A;  2BGJ A;  2FX3 A;  3B82 A;  1OB0 A;  4P2N A;  4P6Y A;  4TMT A;  4LBY A;  4MYT A;  3W2H A;  1F60 A;  4RPB A;  2QN6 A;  1FNB A;  2ZBV A;  3QFT A;  2WZN A;  1ZM9 A;  1DDI A;  3Q39 A;  4M4S A;  1J9Z A;  2CBX A;  4PC3 A;  4RD1 A;  5BSX A;  1ZM2 A;  4WQM A;  1VQK B;  2GK7 A;  2VZL A;  4XN0 A;  3KL9 A;  1GAW A;  3W2F A;  1P4M A;  4Y9U A;  4XLC A;  3T51 B;  2ZBU A;  4P26 A;  4P22 A;  1WSR A;  5IYQ A;  5A88 A;  2NV4 A;  3R6K A;  2ZTN A;  1KMH A;  2VNI A;  4H9G A;  2DCU A;  2AHO A;  1W87 A;  4P12 A;  4TT3 A;  3AVY A;  3A8K A;  4PAB A;  5TY0 A;  3CCM B;  4XN3 A;  1ZM3 A;  2V7U A;  3CD6 B;  1B23 P;  1YX2 A;  4XKV A;  4RLZ A;  1R5O A;  3OE7 A;  1N0V C;  2B7B A;  4P3I A;  2F4N A;  1QH0 A;  4YHB A;  1SM4 A;  1W0J A;  5FIU A;  3CCE B;  4X05 A;  4XQF A;  1VQL B;  2OBT A;  4Y7C A;  2XGJ A;  2BVN A;  1DAR A;  4XM3 A;  1UD3 A;  1WU8 A;  4RCY A;  4Z4V A;  2ZXH A;  4LC0 A;  1H85 A;  1QVF B;  4ACA A;  4NBS A;  1D1N A;  1CNE A;  2XZL A;  1N0U A;  3CP8 A;  2B5O A;  3ZIA A;  1VLY A;  2Z6B D;  4K1X A;  4DNR B;  5TRD A;  4XLF A;  3CW2 A;  1T5E A;  3V7A A;  2ZXI A;  4RM0 A;  1E62 A;  4WZT A;  4X0C A;  4RD0 A;  1E1Q A;  3SLD A;  4WZL A;  5GV7 A;  1E43 A;  1D8T A;  2XNJ A;  5HZA A;  2ZZQ A;  1N06 A;  4DNT B;  4X06 A;  4NNJ A;  2WJY A;  2CC2 A;  2ZL6 A;  4YAO A;  3QFS A;  3Q6R A;  2C77 A;  1EFU A;  5E6T A;  4ZCM A;  3CCS B;  3ASQ A;  1BPL A;  3ASP A;  3P26 A;  1TTT A;  3ZZ0 A;  1K73 D;  4QVJ A;  4TN1 A;  3WXM A;  3PVD A;  1FRN A;  1KC8 D;  3I1F A;  2DEU A;  4XOT A;  2BGI A;  2V7V A;  4B44 A;  2W6I A;  4RCZ A;  1VQP B;  1GVH A;  1K28 D;  2GRE A;  4X07 A;  5F4J A;  3LO8 A;  3VO1 A;  2PE3 A;  3ZBU A;  1S4M A;  3GVL A;  3Q38 A;  4M1K A;  5L46 A;  5F4M A;  3MHP A;  1N07 A;  3CPW B;  3CCJ B;  4RD6 A;  2X6W A;  4R71 A;  3WYA A;  2DOG A;  5LMZ A;  2F1M A;  3ZUG A;  5IYN A;  1IJE A;  4ROX A;  1BQE A;  2GJK A;  3G4S B;  1DDG A;  2F1L A;  1S0U A;  4PGO A;  4RDL A;  1WOS A;  2X8K A;  4TMX A;  4XNF A;  1UD5 A;  4B47 A;  4LBZ A;  1Q7Y D;  4M53 A;  4EH1 A;  3OZU A;  4WWV A;  3CCU B;  4OOX A;  4XL9 A;  3VNU A;  1VQ9 B;  1WOR A;  5F4O A;  2Q6I A;  3WY9 A;  5J3O A;  4J0Q A;  2J7K A;  3BCF A;  4YEJ A;  4B3X A;  3CC4 B;  3SJP A;  4UZU A;  3W5U A;  5HKK A;  3ZZU A;  1N8R D;  3ASR A;  1EFC A;  4WZE A;  1KQS B;  1OGJ A;  2PLF A;  2HDN B;  1RQR A;  1I18 A;  1CNF A;  3QE2 A;  2LZJ A;  3DDY A;  3WBK A;  2ZIT A;  3G6E B;  3CME B;  2ZL7 A;  1OHH A;  1XQB A;  4B48 A;  1W35 A;  3CTA A;  3FJO A;  2C5B A;  1QG0 A;  1ZUN B;  3VO2 A;  2Q6L A;  3OAA A;  1H8H A;  3SJZ A;  3T56 B;  2VYQ A;  4FN5 A;  1N08 A;  5FO0 A;  1YI2 B;  3LQE A;  4AF6 A;  2BM0 A;  4FXU A;  4B4D A;  4TMW A;  3W5H A;  5FO1 A;  4QHY A;  3BY1 A;  5FA6 A;  1KK3 A;  1Y0R A;  4Y9R A;  1V0F A;  3W5V A;  3WNC A;  3ZZT A;  3CC7 B;  2V7W A;  4RDK A;  5DS0 A;  3H9N A;  3FPK A;  3FKS A;  4G6I A;  4G1V A;  1KTV A;  3ES9 A;  4ZCL A;  3W2E A;  2V31 A;  4P25 A;  2CW5 A;  4XLE A;  1MAB A; 
#chains in the Genus database with same CATH homology
 2Z6B D;  2JJ1 A;  4TKO B;  4DNR B;  4XLF A;  2VJJ A;  2WZP P;  1T5E A;  4G7X A;  4XMY A;  1E79 A;  2GK6 A;  2ZXI A;  1UD2 A;  1E1Q A;  1EFR A;  2CK3 A;  2JDI A;  2DIE A;  3CES A;  4TSF A;  1E43 A;  1H8E A;  3GVK A;  5FL7 A;  3VR6 A;  1VF7 A;  4JMQ A;  2ZZQ A;  4E0F A;  2XZO A;  1WPC A;  1VJS A;  1I8D A;  3LNN A;  1FX0 A;  1UD6 A;  2ZTG A;  4NNJ A;  4KKU A;  4DNT B;  2WJY A;  5CDF A;  4II3 A;  3GQB A;  1KZL A;  4XR6 A;  3T53 B;  4ASU A;  1HZE A;  3HAG A;  4G7W A;  3WQZ A;  1BPL A;  2KVO A;  1NRK A;  2F43 A;  5DN6 A;  4YXW A;  2JJ2 A;  3ZPN A;  3OFN A;  2ZZF A;  1COW A;  3CP2 A;  4XOT A;  4XOP A;  2W6I A;  1K28 D;  2ZZE A;  2WSS A;  4DK0 A;  2JIZ A;  1BMF A;  3G05 A;  1E1R A;  3GVL A;  4XLA A;  2V7Q A;  1OB0 A;  3BCD A;  3A3B A;  2X6W A;  1NBM A;  1UD4 A;  4KKS A;  2F1M A;  3GVJ A;  3JU4 A;  2GJK A;  2D3L A;  2X8K A;  1W9X A;  4XNF A;  1UD5 A;  2WPD A;  4DK1 A;  2GK7 A;  4Z1M A;  4XN0 A;  1UD8 A;  4XON A;  3KEW A;  4XL9 A;  4AVZ A;  3OEE A;  3BH4 A;  2X53 S;  3FPP A;  3H94 A;  4GQN A;  4KKT A;  4XLC A;  2HLD A;  2V4D A;  2XND A;  3T51 B;  3OW7 A;  2VJI A;  2X6Y A;  3BCF A;  1W0K A;  4YEJ A;  2GJP A;  1WP6 A;  4P22 A;  2W6J A;  2ZZG A;  1WTH D;  2D3N A;  2E1B A;  4II2 A;  1E3X A;  1SKY B;  4UZU A;  2ZTN A;  1KMH A;  5HKK A;  2XOK A;  5IK2 A;  1PKV A;  4TT3 A;  4XD7 A;  1V0E A;  1I18 A;  2LZJ A;  2X6X A;  3DDY A;  4XN3 A;  3CMM A;  1OHH A;  4B3G A;  3A35 A;  2GJR A;  4XKV A;  3OE7 A;  2XZP A;  1HVX A;  2R9V A;  2M5S A;  1H8H A;  3OAA A;  3T56 B;  4B3F X;  4HIZ A;  3NE5 B;  1W0J A;  3OEH A;  4FXU A;  4XOR A;  4XQF A;  1E3Z A;  2WJV A;  4L8J A;  2XGJ A;  1V0F A;  4XLH A;  4XM3 A;  1UD3 A;  4XKW A;  3OOC A;  5KNL A;  3ZIA A;  2ZXH A;  2X85 A;  3FKS A;  4G6I A;  3A3G A;  4YEL A;  1BLI A;  3BC9 A;  3OPO A;  2XZL A;  2V31 A;  2QE7 A;  4XLE A;  3CP8 A;  1MAB A;  1VLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...