4G7XA

Crystal structure of a complex between the ctxphi piii n-terminal domain and the vibrio cholerae tola c-terminal domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
INCDPNTTTSHQLLFGFGSPIVQSVLFDGCMLDIEKDDYGFVWSCLSNENGDYCKGLYKPRFTQGVSPNWPMCDLSGASAERCIYPYCPEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/protein binding
molecule keywords Putative uncharacterized protein
publication title Crystal Structures of a CTX{varphi} pIII Domain Unbound and in Complex with a Vibrio cholerae TolA Domain Reveal Novel Interaction Interfaces.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2012-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.280 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4g7xA00
4G7WA 4G7XA
chains in the Genus database with same CATH superfamily
1NBMA 3Q38A 3GVJA 4Z4RA 5L46A 5B6IA 1GJRA 1EWYA 2ZZEA 3SJZA 1QG0A 4LBYA 1G7CA 1ZM4A 2GPJA 5KW9A 4OPSA 3CCJB 3QFSA 2HDNB 4PC3A 1FX0A 5JBQA 2DIEA 4TMXA 3H9NA 4XR6A 3CD6B 2CNDA 4TMZA 5DN6A 3NE5B 3ONUA 1W0KA 2BM0A 4RDJA 4YAOA 3JU4A 3U6KA 2C77A 4RD4A 4NBSA 1VJSA 3OEEA 2WJYA 3V76A 2KVOA 1BPLA 1QFJA 4X7EA 4MYUA 1DARA 2C4TA 1WORA 2V31A 5HKKA 1FNBA 2VBSA 4DQLA 4G6IA 4ZGQB 1YJ9B 4Z4VA 4XORA 4G7WA 2WZNA 3I1FA 4M2LA 2QEXB 4RDLA 1QVFB 1S0UA 4G1BA 4B44A 3WYAA 1H42A 1JA0A 2HMAA 4YAUA 2XGJA 3WY9A 1XFOA 1I8DA 2XZOA 2X6YA 1QGYA 1W35A 1WOOA 2GJPA 4TMWA 4YAFA 1DDIA 1EP2B 1BQEA 1RQRA 1WP6A 2W6IA 4XOTA 1IJEA 4P6VF 1NRKA 1WPCA 3PVDA 1YITB 2CW5A 4LBVA 1ZM2A 3R6JA 3U2QA 2V7XA 3AVYA 2QMUA 4P9SA 4EH1A 3PA1A 3J81k 3CMEB 2JJ2A 4X8IA 1VQLB 5H59A 1V0FA 4QVAA 4ASUA 1NB9A 1WSRA 4WZEA 3CP2A 1YI2B 1BLIA 1TVCA 2XZLA 1JNYA 2FVGA 4YHBA 1BJKA 4P1VA 4Z4UA 3W2HA 5IYWA 3CESA 5KNLA 5BSXA 4Z4YA 1VQNB 5IYPA 3E1YE 4ZCIA 3SJPA 4YAWA 1KK1A 3CPXA 4E0FA 1HA3A 1EFUA 5FIUA 3ASTA 5A88A 2D9RA 2VNJA 2VYQA 1Q7YD 1BMFA 4P3YA 1OB2A 1KK0A 4M1KA 1KD1D 1H8EA 4B3XA 4RM0A 4RCZA 4ACBA 4MYTA 1QH0A 3WNBA 1YJNB 4YEJA 4OOVA 3KL9A 3CCRB 3DDYA 2F43A 3OW2B 5FL7A 5AN9A 3CTAA 1N05A 2CC2A 4X0CA 4OPOA 4BPRA 4XLEA 4PC7A 4DK1A 4AVZA 1E62A 3CC7B 1NJID 3AVTA 1B23P 1SKQA 2PE3A 2QGGA 3PUNA 4B4DA 1FNDA 4UAJA 2R9VA 4ROXA 1W0JA 4XMYA 1EXMA 4Z1MA 4CQJA 2ZL6A 4OPVA 5GV8A 1G7RA 3CCVB 1KJZA 2W6JA 4H9GA 2WYRA 1V0EA 4DK0A 1MRZA 2F1LA 3G05A 3JQRA 1F60A 4XKWA 3WNDA 4P2NA 1IHMA 4X7FA 1S4MA 3GQBA 4M0LA 3CC4B 5CDFA 1EP3B 1KMHA 5TRDA 4P25A 1I18A 1GO2A 1E1RA 2YWHA 4RPBA 4XKVA 2CF4A 2V7TA 3OJWA 2VJJA 3H94A 3A3GA 4X7CA 3WQZA 3MMPA 4HIZA 1OHHA 5GV7A 2OTJB 1N0UA 2X85A 1PJ7A 4TMTA 2OYNA 2BMWA 2QE7A 2VBUA 3Q39A 3CPWB 1JJ2B 4RD3A 4K1XA 4XM3A 1Y0RA 4DQKA 3QE2A 4B3FX 1M90D 2ZZGA 5H5JA 2D3LA 3GSIA 4PC1A 2WSSA 2B7CA 1P4MA 1E63A 3ASRA 3CMMA 1JA1A 2GK7A 1CNEA 1N07A 2E1RA 4R71A 4JMQA 1E64A 2OK7A 1N8RD 1WTHD 2EFGA 5F4MA 1H8HA 1WSVA 2VBTA 1ZM9A 1U2RA 2C4UA 2X3UA 2HCJB 2V4DA 2VJIA 3SKBA 1FNMA 4X07A 1W87A 3CCUB 2D74A 4G5GA 3ASSA 1KQSB 2ZBUA 4PC6A 4DNTB 5E6TA 1K73D 1OGIA 2I1LA 2RC6A 3OEHA 1I7PA 1Q82D 3KEWA 3VNVA 3SLDA 1W34A 3AVXA 2VNKA 1J9ZA 1GAWA 2BV3A 4XQFA 1TUIA 4KKUA 2BN4A 3ZZTA 1VQ8B 3AVVA 4UZFA 4B43A 2JDIA 4M4SA 3B8HA 2DERA 3W2GA 3ZC3A 1EP1B 3A8IA 3ISXA 2YWEA 1H85A 3OPOA 2CBXA 2V7UA 4ZCLA 1UD5A 3A3BA 3MCAA 3W2IA 3FPKA 1AIPA 4RPDA 3FKSA 3SEJA 3LQ6A 3W5VA 4AF6A 2WZPP 4G7XA 5HZBA 5DS0A 1UD3A 5DSZA 1UD4A 2VNHA 1VLYA 1YHQB 1G7TA 4XLFA 3GVKA 2HLDA 5FO0A 4M53A 3LO8A 3D26A 5IYQA 2AHOA 2OBSA 4WWVA 5TV2A 4G1VA 3E20A 1QVGB 2YWGA 3B82A 2C5HA 2JN9A 5F4OA 1V5VA 4XN0A 2WJVA 4YALA 3ZBUA 5TR9A 4II2A 2DETA 3BY1A 3U6BA 3AVUA 3CCEB 2JIZA 1QGZA 4IW3B 1XB2A 2BM1A 4P26A 1HZEA 4XL9A 3LNNA 4DNRB 1OB5A 1E43A 2XOKA 4F7DA 3BH4A 2BGIA 2E1BA 3OZWA 4L8JA 4ZCMA 2X0KA 1E79A 2Q6KA 3OJXA 4FK8A 5KSWB 2QTZA 1EFTA 1T6XA 5HZAA 5HXBA 3QFTA 3W2FA 2JJ1A 3FJOA 3I56B 1VQ9B 4XNFA 4P12A 3BQJA 4OP7A 1VQ7B 2ZTNA 3CRZA 3A8JA 2ZZQA 3BCDA 1BX0A 1VF7A 3WXMA 1VHEA 1B2RA 3QSYA 2NPFA 2M5SA 3Q6RA 4LC0A 2EIXA 4PC2A 4RDKA 2QDXA 2GQFA 3RY8A 3V7AA 2DCUA 1R5OA 3OW7A 5J3OA 3A35A 3T51B 2GJRA 4TKOB 1YJWB 1W2BB 1T5EA 2VNIA 3CCLB 4QVJA 3GIRA 1FRQA 1FRNA 4PABA 1VQ6B 4QV2A 3CXCB 3W5UA 1ZUNB 1DDGA 4RD0A 1VQPB 3QFCA 1OGJA 4Z4SA 3WBJA 3A8KA 3A1PA 3LQEA 1KRHA 4YELA 1N08A 2GJKA 3T56B 1UD6A 3JQPA 1TLLA 2XNDA 2OTLB 4QFMA 1F20A 2X6XA 3G4SB 3CW2A 4RLZA 3WBKA 2GREA 5IYNA 4QHYA 1PJ5A 1WU8A 1R5BA 2ZXIA 4AF7A 1QX4A 2BSAA 1KTVA 4KKSA 1GR1A 2J7KA 2ZITA 1XE1A 2FX3A 3MHPA 5TY0A 4B48A 1KK2A 2WPDA 2R6HA 5A89A 4UZUA 4X7DA 5FA6A 3CCMB 4RJLA 5IK2A 1AMOA 2DEUA 1G7SA 2Q6LA 2QN6A 3SLNA 3OE7A 4Y7CA 1N0VC 2VZLA 3ZPNA 1ZM3A 1E1QA 4WZLA 3BY2A 4AC9A 5FNZA 2C78A 3ZZ0A 2X53S 3Q6QA 1WOSA 2DY1A 4NNJA 4ACAA 3VMFA 3OAAA 4C43A 4XOPA 1COWA 3GVLA 3Q3AA 4ZGNB 4UZEA 1WDTA 3P26A 3ASPA 2QA4B 1QGAA 3G71B 3PUMA 1NB0A 3I55B 4PAAA 3WNCA 1SKYB 1VQ5B 2GK6A 4XN3A 4P3IA 1HVXA 4Q7JB 1FNCA 2YWFA 2OBTA 4P6YA 1Q81D 3CP8A 1WOPA 1D8TA 5BSYA 3CCQB 1QFZA 2QTLA 3AVWA 3OZUA 2DYIA 4B47A 1VHOA 4HE6A 4X06A 2CRVA 3PA2A 1CNFA 1XQBA 3OOCA 2C5BA 1Q86D 1UD8A 1E3XA 3PENA 4RD1A 4GQNA 3FPPA 4XLCA 2OK8A 1EFCA 2ZXHA 1ELOA 1E3ZA 4Y9RA 4FWTA 1VQOB 1QFYA 3AGPA 1TTTA 1NDHA 4U9UA 3T53B 1DG1G 1Y0YA 4LBZA 4WQMA 4YXWA 4FN5A 3ONYA 4TMVA 3G6EB 4LBWA 4FXUA 2V7QA 1KZLA 2B5OA 1S72B 1VQKB 5LMZA 3AGQA 4Y9UA 4XONA 3VO1A 5THXA 1IJFA 4N3GA 3JQQA 4PGOA 2XEXA 2XNJA 3BNWA 4TN1A 3R6KA 3ZUGA 4Z4ZA 5IYRA 1IB0A 2VBVA 2LZJA 1GAQA 3VR6A 5A8AA 1K28D 4J0QA 1K9MD 4RD6A 1CQXA 2B7BA 3BC9A 1QUFA 3P27A 3HAGA 2BVNA 3OFNA 4Z4WA 2CK3A 1KC8D 2PLFA 4B3GA 1Q9SA 1VLOA 3OZVA 2F1MA 4NCNA 1YIJB 2X6WA 4TSFA 4RD2A 3CC2B 3CB4A 1BX1A 3CCSB 4WZKA 1KK3A 2DOGA 4C0SA 2F4NA 1YX2A 3W2EA 1T6ZA 2BPOA 1EFRA 2ZL5A 3ZIAA 1VQ4B 2ZTGA 2P3MA 1N06A 3ASQA 4X05A 1FDRA 1OB0A 3LVBA 1D2EA 3OP1A 4KKTA 1UMKA 5J35A 1VQMB 3BCFA 4QUZA 1PJ6A 1GVHA 2BGJA 2X8KA 3CMAB 1YLOA 2Q6OA 2ZBVA 2XZPA 4RCYA 1T6YA 4OOXA 1QUEA 1A8PA 4II3A 2V7VA 5F4JA 4OOSA 3VO2A 1K8AD 5EMNA 1RQPA 1JB9A 2BF4A 2PIAA 4Z4TA 2OBRA 2ZL7A 3B78A 1M1KD 4XD7A 3QFRA 3OKXA 1MABA 2WR8A 4XLAA 4N3NA 3ZZUA 2NV4A 3ES9A 1SM4A 2ZZFA 4WZTA 4XLHA 1D1NA 2Z6BD 2PMDA 2C2WA 1UD2A 4HE5A 3VNUA 2XNCA 4P22A 1R5NA 2Q6IA 2RC5A 1PKVA 3ZBTA 2D3NA 4ZV4A 1W9XA 4TT3A 3W5HA 5FO1A 2V7WA
chains in the Genus database with same CATH topology
1NBMA 3GVJA 1SKYB 2R9VA 2GK6A 4XN3A 2ZZEA 1HVXA 1W0JA 4XMYA 4XN0A 2WJVA 4Z1MA 3CP8A 4II2A 1FX0A 2W6JA 2DIEA 1V0EA 4DK0A 2JIZA 4XL9A 4DNRB 3G05A 3OOCA 1HZEA 4XR6A 3LNNA 4XKWA 1E43A 2XOKA 3BH4A 5DN6A 3NE5B 1W0KA 2E1BA 4L8JA 3GQBA 1UD8A 1E3XA 1E79A 4GQNA 3FPPA 4XLCA 1KMHA 2ZXHA 3JU4A 5CDFA 1E3ZA 1I18A 1E1RA 1VJSA 3OEEA 2WJYA 4XKVA 3T53B 2KVOA 2VJJA 1BPLA 3A3GA 3H94A 3WQZA 4YXWA 2JJ1A 4HIZA 1OHHA 5HKKA 2V31A 2X85A 4XNFA 4G6IA 4FXUA 2QE7A 2ZTNA 3BCDA 2ZZQA 4XORA 4G7WA 1VF7A 2V7QA 1KZLA 4XM3A 2M5SA 4B3FX 4XONA 2ZZGA 2D3LA 2XGJA 1I8DA 2WSSA 3OW7A 3A35A 3T51B 2XZOA 2GJRA 2X6YA 4TKOB 1T5EA 3CMMA 2GK7A 2GJPA 2LZJA 3VR6A 1WP6A 2W6IA 1K28D 4JMQA 4XOTA 1NRKA 1WPCA 3BC9A 1WTHD 3HAGA 1H8HA 3OFNA 2CK3A 4B3GA 2F1MA 2JJ2A 2X6WA 4TSFA 1V0FA 2GJKA 2V4DA 2VJIA 4YELA 4ASUA 3T56B 1UD6A 3CP2A 1BLIA 2XNDA 2XZLA 2X6XA 1EFRA 3ZIAA 4DNTB 2ZXIA 3CESA 5KNLA 2ZTGA 4KKSA 1OB0A 3OEHA 4KKTA 4E0FA 3KEWA 3BCFA 2WPDA 2X8KA 4XQFA 4UZUA 4KKUA 5IK2A 2XZPA 2JDIA 4II3A 1BMFA 3OE7A 1H8EA 3ZPNA 3OPOA 1UD5A 1E1QA 3A3BA 4XD7A 4XLAA 1MABA 3FKSA 4YEJA 3DDYA 2F43A 5FL7A 2WZPP 2ZZFA 4G7XA 4XLHA 2X53S 2Z6BD 1UD3A 4NNJA 1UD4A 1UD2A 1VLYA 3OAAA 4XLFA 4XLEA 4P22A 4XOPA 3GVKA 1COWA 2HLDA 3GVLA 4AVZA 1PKVA 4DK1A 2D3NA 1W9XA 4TT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7W A;  4G7X A; 
#chains in the Genus database with same CATH topology
 1NBM A;  3Q38 A;  3GVJ A;  4Z4R A;  5L46 A;  5B6I A;  1GJR A;  1EWY A;  2ZZE A;  3SJZ A;  1QG0 A;  4LBY A;  1G7C A;  1ZM4 A;  2GPJ A;  5KW9 A;  4OPS A;  3CCJ B;  3QFS A;  2HDN B;  4PC3 A;  1FX0 A;  5JBQ A;  2DIE A;  4TMX A;  3H9N A;  4XR6 A;  3CD6 B;  2CND A;  4TMZ A;  5DN6 A;  3NE5 B;  3ONU A;  1W0K A;  2BM0 A;  4RDJ A;  4YAO A;  3JU4 A;  3U6K A;  2C77 A;  4RD4 A;  4NBS A;  1VJS A;  3OEE A;  2WJY A;  3V76 A;  2KVO A;  1BPL A;  1QFJ A;  4X7E A;  4MYU A;  1DAR A;  2C4T A;  1WOR A;  2V31 A;  5HKK A;  1FNB A;  2VBS A;  4DQL A;  4G6I A;  4ZGQ B;  1YJ9 B;  4Z4V A;  4XOR A;  4G7W A;  2WZN A;  3I1F A;  4M2L A;  2QEX B;  4RDL A;  1QVF B;  1S0U A;  4G1B A;  4B44 A;  3WYA A;  1H42 A;  1JA0 A;  2HMA A;  4YAU A;  2XGJ A;  3WY9 A;  1XFO A;  1I8D A;  2XZO A;  2X6Y A;  1QGY A;  1W35 A;  1WOO A;  2GJP A;  4TMW A;  4YAF A;  1DDI A;  1EP2 B;  1BQE A;  1RQR A;  1WP6 A;  2W6I A;  4XOT A;  1IJE A;  4P6V F;  1NRK A;  1WPC A;  3PVD A;  1YIT B;  2CW5 A;  4LBV A;  1ZM2 A;  3R6J A;  3U2Q A;  2V7X A;  3AVY A;  2QMU A;  4P9S A;  4EH1 A;  3PA1 A;  3J81 k;  3CME B;  2JJ2 A;  4X8I A;  1VQL B;  5H59 A;  1V0F A;  4QVA A;  4ASU A;  1NB9 A;  1WSR A;  4WZE A;  3CP2 A;  1YI2 B;  1BLI A;  1TVC A;  2XZL A;  1JNY A;  2FVG A;  4YHB A;  1BJK A;  4P1V A;  4Z4U A;  3W2H A;  5IYW A;  3CES A;  5KNL A;  5BSX A;  4Z4Y A;  1VQN B;  5IYP A;  3E1Y E;  4ZCI A;  3SJP A;  4YAW A;  1KK1 A;  3CPX A;  4E0F A;  1HA3 A;  1EFU A;  5FIU A;  3AST A;  5A88 A;  2D9R A;  2VNJ A;  2VYQ A;  1Q7Y D;  1BMF A;  4P3Y A;  1OB2 A;  1KK0 A;  4M1K A;  1KD1 D;  1H8E A;  4B3X A;  4RM0 A;  4RCZ A;  4ACB A;  4MYT A;  1QH0 A;  3WNB A;  1YJN B;  4YEJ A;  4OOV A;  3KL9 A;  3CCR B;  3DDY A;  2F43 A;  3OW2 B;  5FL7 A;  5AN9 A;  3CTA A;  1N05 A;  2CC2 A;  4X0C A;  4OPO A;  4BPR A;  4XLE A;  4PC7 A;  4DK1 A;  4AVZ A;  1E62 A;  3CC7 B;  1NJI D;  3AVT A;  1B23 P;  1SKQ A;  2PE3 A;  2QGG A;  3PUN A;  4B4D A;  1FND A;  4UAJ A;  2R9V A;  4ROX A;  1W0J A;  4XMY A;  1EXM A;  4Z1M A;  4CQJ A;  2ZL6 A;  4OPV A;  5GV8 A;  1G7R A;  3CCV B;  1KJZ A;  2W6J A;  4H9G A;  2WYR A;  1V0E A;  4DK0 A;  1MRZ A;  2F1L A;  3G05 A;  3JQR A;  1F60 A;  4XKW A;  3WND A;  4P2N A;  1IHM A;  4X7F A;  1S4M A;  3GQB A;  4M0L A;  3CC4 B;  5CDF A;  1EP3 B;  1KMH A;  5TRD A;  4P25 A;  1I18 A;  1GO2 A;  1E1R A;  2YWH A;  4RPB A;  4XKV A;  2CF4 A;  2V7T A;  3OJW A;  2VJJ A;  3H94 A;  3A3G A;  4X7C A;  3WQZ A;  3MMP A;  4HIZ A;  1OHH A;  5GV7 A;  2OTJ B;  1N0U A;  2X85 A;  1PJ7 A;  4TMT A;  2OYN A;  2BMW A;  2QE7 A;  2VBU A;  3Q39 A;  3CPW B;  1JJ2 B;  4RD3 A;  4K1X A;  4XM3 A;  1Y0R A;  4DQK A;  3QE2 A;  4B3F X;  1M90 D;  2ZZG A;  5H5J A;  2D3L A;  3GSI A;  4PC1 A;  2WSS A;  2B7C A;  1P4M A;  1E63 A;  3ASR A;  3CMM A;  1JA1 A;  2GK7 A;  1CNE A;  1N07 A;  2E1R A;  4R71 A;  4JMQ A;  1E64 A;  2OK7 A;  1N8R D;  1WTH D;  2EFG A;  5F4M A;  1H8H A;  1WSV A;  2VBT A;  1ZM9 A;  1U2R A;  2C4U A;  2X3U A;  2HCJ B;  2V4D A;  2VJI A;  3SKB A;  1FNM A;  4X07 A;  1W87 A;  3CCU B;  2D74 A;  4G5G A;  3ASS A;  1KQS B;  2ZBU A;  4PC6 A;  4DNT B;  5E6T A;  1K73 D;  1OGI A;  2I1L A;  2RC6 A;  3OEH A;  1I7P A;  1Q82 D;  3KEW A;  3VNV A;  3SLD A;  1W34 A;  3AVX A;  2VNK A;  1J9Z A;  1GAW A;  2BV3 A;  4XQF A;  1TUI A;  4KKU A;  2BN4 A;  3ZZT A;  1VQ8 B;  3AVV A;  4UZF A;  4B43 A;  2JDI A;  4M4S A;  3B8H A;  2DER A;  3W2G A;  3ZC3 A;  1EP1 B;  3A8I A;  3ISX A;  2YWE A;  1H85 A;  3OPO A;  2CBX A;  2V7U A;  4ZCL A;  1UD5 A;  3A3B A;  3MCA A;  3W2I A;  3FPK A;  1AIP A;  4RPD A;  3FKS A;  3SEJ A;  3LQ6 A;  3W5V A;  4AF6 A;  2WZP P;  4G7X A;  5HZB A;  5DS0 A;  1UD3 A;  5DSZ A;  1UD4 A;  2VNH A;  1VLY A;  1YHQ B;  1G7T A;  4XLF A;  3GVK A;  2HLD A;  5FO0 A;  4M53 A;  3LO8 A;  3D26 A;  5IYQ A;  2AHO A;  2OBS A;  4WWV A;  5TV2 A;  4G1V A;  3E20 A;  1QVG B;  2YWG A;  3B82 A;  2C5H A;  2JN9 A;  5F4O A;  1V5V A;  4XN0 A;  2WJV A;  4YAL A;  3ZBU A;  5TR9 A;  4II2 A;  2DET A;  3BY1 A;  3U6B A;  3AVU A;  3CCE B;  2JIZ A;  1QGZ A;  4IW3 B;  1XB2 A;  2BM1 A;  4P26 A;  1HZE A;  4XL9 A;  3LNN A;  4DNR B;  1OB5 A;  1E43 A;  2XOK A;  4F7D A;  3BH4 A;  2BGI A;  2E1B A;  3OZW A;  4L8J A;  4ZCM A;  2X0K A;  1E79 A;  2Q6K A;  3OJX A;  4FK8 A;  5KSW B;  2QTZ A;  1EFT A;  1T6X A;  5HZA A;  5HXB A;  3QFT A;  3W2F A;  2JJ1 A;  3FJO A;  3I56 B;  1VQ9 B;  4XNF A;  4P12 A;  3BQJ A;  4OP7 A;  1VQ7 B;  2ZTN A;  3CRZ A;  3A8J A;  2ZZQ A;  3BCD A;  1BX0 A;  1VF7 A;  3WXM A;  1VHE A;  1B2R A;  3QSY A;  2NPF A;  2M5S A;  3Q6R A;  4LC0 A;  2EIX A;  4PC2 A;  4RDK A;  2QDX A;  2GQF A;  3RY8 A;  3V7A A;  2DCU A;  1R5O A;  3OW7 A;  5J3O A;  3A35 A;  3T51 B;  2GJR A;  4TKO B;  1YJW B;  1W2B B;  1T5E A;  2VNI A;  3CCL B;  4QVJ A;  3GIR A;  1FRQ A;  1FRN A;  4PAB A;  1VQ6 B;  4QV2 A;  3CXC B;  3W5U A;  1ZUN B;  1DDG A;  4RD0 A;  1VQP B;  3QFC A;  1OGJ A;  4Z4S A;  3WBJ A;  3A8K A;  3A1P A;  3LQE A;  1KRH A;  4YEL A;  1N08 A;  2GJK A;  3T56 B;  1UD6 A;  3JQP A;  1TLL A;  2XND A;  2OTL B;  4QFM A;  1F20 A;  2X6X A;  3G4S B;  3CW2 A;  4RLZ A;  3WBK A;  2GRE A;  5IYN A;  4QHY A;  1PJ5 A;  1WU8 A;  1R5B A;  2ZXI A;  4AF7 A;  1QX4 A;  2BSA A;  1KTV A;  4KKS A;  1GR1 A;  2J7K A;  2ZIT A;  1XE1 A;  2FX3 A;  3MHP A;  5TY0 A;  4B48 A;  1KK2 A;  2WPD A;  2R6H A;  5A89 A;  4UZU A;  4X7D A;  5FA6 A;  3CCM B;  4RJL A;  5IK2 A;  1AMO A;  2DEU A;  1G7S A;  2Q6L A;  2QN6 A;  3SLN A;  3OE7 A;  4Y7C A;  1N0V C;  2VZL A;  3ZPN A;  1ZM3 A;  1E1Q A;  4WZL A;  3BY2 A;  4AC9 A;  5FNZ A;  2C78 A;  3ZZ0 A;  2X53 S;  3Q6Q A;  1WOS A;  2DY1 A;  4NNJ A;  4ACA A;  3VMF A;  3OAA A;  4C43 A;  4XOP A;  1COW A;  3GVL A;  3Q3A A;  4ZGN B;  4UZE A;  1WDT A;  3P26 A;  3ASP A;  2QA4 B;  1QGA A;  3G71 B;  3PUM A;  1NB0 A;  3I55 B;  4PAA A;  3WNC A;  1SKY B;  1VQ5 B;  2GK6 A;  4XN3 A;  4P3I A;  1HVX A;  4Q7J B;  1FNC A;  2YWF A;  2OBT A;  4P6Y A;  1Q81 D;  3CP8 A;  1WOP A;  1D8T A;  5BSY A;  3CCQ B;  1QFZ A;  2QTL A;  3AVW A;  3OZU A;  2DYI A;  4B47 A;  1VHO A;  4HE6 A;  4X06 A;  2CRV A;  3PA2 A;  1CNF A;  1XQB A;  3OOC A;  2C5B A;  1Q86 D;  1UD8 A;  1E3X A;  3PEN A;  4RD1 A;  4GQN A;  3FPP A;  4XLC A;  2OK8 A;  1EFC A;  2ZXH A;  1ELO A;  1E3Z A;  4Y9R A;  4FWT A;  1VQO B;  1QFY A;  3AGP A;  1TTT A;  1NDH A;  4U9U A;  3T53 B;  1DG1 G;  1Y0Y A;  4LBZ A;  4WQM A;  4YXW A;  4FN5 A;  3ONY A;  4TMV A;  3G6E B;  4LBW A;  4FXU A;  2V7Q A;  1KZL A;  2B5O A;  1S72 B;  1VQK B;  5LMZ A;  3AGQ A;  4Y9U A;  4XON A;  3VO1 A;  5THX A;  1IJF A;  4N3G A;  3JQQ A;  4PGO A;  2XEX A;  2XNJ A;  3BNW A;  4TN1 A;  3R6K A;  3ZUG A;  4Z4Z A;  5IYR A;  1IB0 A;  2VBV A;  2LZJ A;  1GAQ A;  3VR6 A;  5A8A A;  1K28 D;  4J0Q A;  1K9M D;  4RD6 A;  1CQX A;  2B7B A;  3BC9 A;  1QUF A;  3P27 A;  3HAG A;  2BVN A;  3OFN A;  4Z4W A;  2CK3 A;  1KC8 D;  2PLF A;  4B3G A;  1Q9S A;  1VLO A;  3OZV A;  2F1M A;  4NCN A;  1YIJ B;  2X6W A;  4TSF A;  4RD2 A;  3CC2 B;  3CB4 A;  1BX1 A;  3CCS B;  4WZK A;  1KK3 A;  2DOG A;  4C0S A;  2F4N A;  1YX2 A;  3W2E A;  1T6Z A;  2BPO A;  1EFR A;  2ZL5 A;  3ZIA A;  1VQ4 B;  2ZTG A;  2P3M A;  1N06 A;  3ASQ A;  4X05 A;  1FDR A;  1OB0 A;  3LVB A;  1D2E A;  3OP1 A;  4KKT A;  1UMK A;  5J35 A;  1VQM B;  3BCF A;  4QUZ A;  1PJ6 A;  1GVH A;  2BGJ A;  2X8K A;  3CMA B;  1YLO A;  2Q6O A;  2ZBV A;  2XZP A;  4RCY A;  1T6Y A;  4OOX A;  1QUE A;  1A8P A;  4II3 A;  2V7V A;  5F4J A;  4OOS A;  3VO2 A;  1K8A D;  5EMN A;  1RQP A;  1JB9 A;  2BF4 A;  2PIA A;  4Z4T A;  2OBR A;  2ZL7 A;  3B78 A;  1M1K D;  4XD7 A;  3QFR A;  3OKX A;  1MAB A;  2WR8 A;  4XLA A;  4N3N A;  3ZZU A;  2NV4 A;  3ES9 A;  1SM4 A;  2ZZF A;  4WZT A;  4XLH A;  1D1N A;  2Z6B D;  2PMD A;  2C2W A;  1UD2 A;  4HE5 A;  3VNU A;  2XNC A;  4P22 A;  1R5N A;  2Q6I A;  2RC5 A;  1PKV A;  3ZBT A;  2D3N A;  4ZV4 A;  1W9X A;  4TT3 A;  3W5H A;  5FO1 A;  2V7W A; 
#chains in the Genus database with same CATH homology
 1NBM A;  3GVJ A;  1SKY B;  2R9V A;  2GK6 A;  4XN3 A;  2ZZE A;  1HVX A;  1W0J A;  4XMY A;  4XN0 A;  2WJV A;  4Z1M A;  3CP8 A;  4II2 A;  1FX0 A;  2W6J A;  2DIE A;  1V0E A;  4DK0 A;  2JIZ A;  4XL9 A;  4DNR B;  3G05 A;  3OOC A;  1HZE A;  4XR6 A;  3LNN A;  4XKW A;  1E43 A;  2XOK A;  3BH4 A;  5DN6 A;  3NE5 B;  1W0K A;  2E1B A;  4L8J A;  3GQB A;  1UD8 A;  1E3X A;  1E79 A;  4GQN A;  3FPP A;  4XLC A;  1KMH A;  2ZXH A;  3JU4 A;  5CDF A;  1E3Z A;  1I18 A;  1E1R A;  1VJS A;  3OEE A;  2WJY A;  4XKV A;  3T53 B;  2KVO A;  2VJJ A;  1BPL A;  3A3G A;  3H94 A;  3WQZ A;  4YXW A;  2JJ1 A;  4HIZ A;  1OHH A;  5HKK A;  2V31 A;  2X85 A;  4XNF A;  4G6I A;  4FXU A;  2QE7 A;  2ZTN A;  3BCD A;  2ZZQ A;  4XOR A;  4G7W A;  1VF7 A;  2V7Q A;  1KZL A;  4XM3 A;  2M5S A;  4B3F X;  4XON A;  2ZZG A;  2D3L A;  2XGJ A;  1I8D A;  2WSS A;  3OW7 A;  3A35 A;  3T51 B;  2XZO A;  2GJR A;  2X6Y A;  4TKO B;  1T5E A;  3CMM A;  2GK7 A;  2GJP A;  2LZJ A;  3VR6 A;  1WP6 A;  2W6I A;  1K28 D;  4JMQ A;  4XOT A;  1NRK A;  1WPC A;  3BC9 A;  1WTH D;  3HAG A;  1H8H A;  3OFN A;  2CK3 A;  4B3G A;  2F1M A;  2JJ2 A;  2X6W A;  4TSF A;  1V0F A;  2GJK A;  2V4D A;  2VJI A;  4YEL A;  4ASU A;  3T56 B;  1UD6 A;  3CP2 A;  1BLI A;  2XND A;  2XZL A;  2X6X A;  1EFR A;  3ZIA A;  4DNT B;  2ZXI A;  3CES A;  5KNL A;  2ZTG A;  4KKS A;  1OB0 A;  3OEH A;  4KKT A;  4E0F A;  3KEW A;  3BCF A;  2WPD A;  2X8K A;  4XQF A;  4UZU A;  4KKU A;  5IK2 A;  2XZP A;  2JDI A;  4II3 A;  1BMF A;  3OE7 A;  1H8E A;  3ZPN A;  3OPO A;  1UD5 A;  1E1Q A;  3A3B A;  4XD7 A;  4XLA A;  1MAB A;  3FKS A;  4YEJ A;  3DDY A;  2F43 A;  5FL7 A;  2WZP P;  2ZZF A;  4G7X A;  4XLH A;  2X53 S;  2Z6B D;  1UD3 A;  4NNJ A;  1UD4 A;  1UD2 A;  1VLY A;  3OAA A;  4XLF A;  4XLE A;  4P22 A;  4XOP A;  3GVK A;  1COW A;  2HLD A;  3GVL A;  4AVZ A;  1PKV A;  4DK1 A;  2D3N A;  1W9X A;  4TT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...