4G7XA

Crystal structure of a complex between the ctxphi piii n-terminal domain and the vibrio cholerae tola c-terminal domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
b'INCDPNTTTSHQLLFGFGSPIVQSVLFDGCMLDIEKDDYGFVWSCLSNENGDYCKGLYKPRFTQGVSPNWPMCDLSGASAERCIYPYCPEGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal Structures of a CTX{varphi} pIII Domain Unbound and in Complex with a Vibrio cholerae TolA Domain Reveal Novel Interaction Interfaces.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Protein binding/protein binding
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2012-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.280 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4g7xA00
4G7XA 4G7WA
chains in the Genus database with same CATH superfamily
2JDIA 2DEUA 2AHOA 1D2EA 1HVXA 1KC8D 4AVZA 4PC7A 3CP2A 2QEXB 2QMUA 2WYRA 2ZZGA 3FJOA 1EP3B 3A35A 4YAWA 4XOPA 1JA1A 3BCFA 4B43A 3Q38A 1ZM2A 2C4TA 2D74A 2W6IA 2WZPP 3LVBA 2QE7A 1QG0A 1WORA 3OP1A 4RDKA 4QFMA 3OJWA 1R5NA 1W35A 1T5EA 1WOSA 1SKYB 1VLOA 4XR6A 5IYWA 3OEHA 4YALA 2B5OA 1COWA 2PE3A 2GJPA 3NE5B 3WNDA 2F1MA 4LBWA 1Q86D 1FDRA 1QUFA 2OTLB 4G7XA 4N3GA 3KL9A 2Q6KA 4G1VA 2FVGA 2CK3A 2V7WA 2BVNA 3CRZA 4OOXA 3B82A 3AVTA 1H42A 1PJ7A 1VJSA 1QFJA 2YWFA 2ZL6A 4UZFA 3GVJA 5BSYA 3ISXA 4H9GA 3A3BA 2CRVA 2VNKA 2F1LA 1V5VA 3ONUA 2QDXA 3U6KA 2DOGA 4YELA 1UMKA 2X6WA 1Y0RA 1KMHA 4XLCA 3CCQB 4E0FA 3CW2A 2XZPA 2BSAA 4XONA 3CC2B 1T6YA 5BSXA 2BGIA 1H8HA 4KKTA 2NV4A 2ZZEA 3CCVB 3JQQA 2WR8A 4Z4VA 4OOSA 4DK1A 1DARA 2ZL5A 4WZEA 4OOVA 2ZBUA 5CDFA 4OPVA 5E6TA 3OZUA 1TTTA 4ZCMA 3CTAA 3QFRA 3W5UA 4PAAA 4DQLA 2WZNA 4WWVA 2GREA 4MYTA 3LQEA 4B4DA 4Z1MA 4XMYA 3D26A 3V7AA 1JJ2B 4XQFA 3WYAA 3OW2B 2DY1A 1DDIA 2B7CA 2F43A 3QFCA 3Q3AA 1HA3A 1WP6A 2CF4A 2OTJB 3FPKA 4WZLA 3OW7A 3SEJA 1W0JA 4RD0A 1PJ6A 4Y9UA 4AC9A 2D3NA 2XZOA 4P22A 2X85A 2BGJA 4HIZA 3ZZ0A 3G05A 4RJLA 4Z4TA 1VQ9B 4X06A 1FNMA 2RC6A 1BMFA 5H5JA 1I7PA 2D3LA 1CQXA 1OB2A 1KQSB 4FXUA 1CNFA 4XKWA 1ZM9A 4TKOB 4UAJA 2V4DA 1YJWB 1IHMA 1RQRA 3WNBA 1GAQA 4ZGQB 2C77A 4YXWA 2VNIA 2C5HA 2VYQA 1NB0A 3ZIAA 3WQZA 3ZC3A 1TVCA 2BM0A 3VNUA 4B3GA 1GJRA 4ACBA 2C5BA 4KKSA 2R6HA 3GVKA 3PA2A 5AN9A 1NB9A 1OB0A 2D9RA 2RC5A 1SKQA 4TMWA 1S0UA 1MRZA 2CNDA 5A89A 5HZAA 1UD4A 2ZXHA 2ZZQA 1QFYA 3ASTA 4HE6A 3WBJA 4PABA 4B3XA 1I8DA 3AVYA 3ASSA 2PLFA 2J7KA 4ASUA 4P3YA 4X07A 1WU8A 1AIPA 2XNCA 2OBSA 1VQ7B 3H94A 4II2A 2X8KA 1WSRA 3E1YE 4OPOA 2KVOA 2Q6LA 2XGJA 3CD6B 2X6YA 1S4MA 1EP1B 1XB2A 1GVHA 3W2IA 5DSZA 3KEWA 4XD7A 2Z6BD 1A8PA 2EIXA 3B8HA 3I1FA 4RCYA 4B44A 1E64A 3I55B 3DDYA 1W2BB 4ZV4A 1B23P 3CMEB 4XORA 5FO0A 1Q82D 4PGOA 1KK2A 1NJID 3CPXA 2OK7A 3CPWB 2GJRA 4U9UA 4R71A 1YLOA 1WOOA 3WXMA 3OJXA 1E63A 1UD2A 2X0KA 4Z4YA 4G1BA 1F60A 3SLDA 3T53B 3W2EA 4ACAA 1M1KD 4TMTA 3ZPNA 1G7SA 3WY9A 1KK0A 2V7VA 1XE1A 2BMWA 3B78A 3ZBTA 1FX0A 1E43A 4YAOA 3QFTA 1VLYA 2CC2A 3OFNA 4QV2A 4DNRB 3I56B 2V7QA 5FIUA 2HCJB 1XQBA 2OBRA 1VQPB 3ZZTA 1R5BA 2GK6A 1KZLA 1EP2B 1W34A 4LC0A 3PVDA 5GV7A 4XLFA 3OOCA 5J35A 1GR1A 3U6BA 3AVXA 4NBSA 1KK1A 2BN4A 4RPBA 3VMFA 5GV8A 2WJYA 3QSYA 2VBVA 4PC3A 2JJ1A 4UZUA 1N06A 4XM3A 1N08A 1KD1D 1M90D 4NCNA 1I18A 2WSSA 1Q9SA 1QUEA 3R6KA 3BH4A 1KK3A 2X53S 4XKVA 1UD8A 3OPOA 1N8RD 1FNCA 2WJVA 1P4MA 5DS0A 3CESA 1UD6A 4LBYA 3QFSA 2X6XA 4G5GA 3CMAB 4P12A 1QFZA 1YI2B 3T51B 1BX0A 2V7UA 3ASQA 1VQ4B 4YAUA 4C0SA 2EFGA 2I1LA 4B3FX 5J3OA 4TMXA 4X05A 4LBVA 2DETA 3WBKA 1R5OA 3HAGA 5TV2A 3ZBUA 3GQBA 4RLZA 3A3GA 5TRDA 1Q7YD 1MABA 3Q39A 3E20A 1VF7A 4QVAA 4TMZA 1CNEA 2M5SA 3WNCA 1OHHA 1YJNB 4P6YA 1NRKA 1WDTA 4WZTA 4ZGNB 4UZEA 5KW9A 1IB0A 2NPFA 4X7EA 4GQNA 4AF6A 4B47A 3CB4A 5FL7A 2HDNB 5IYQA 1W9XA 3PUMA 5B6IA 3OZWA 1QGZA 4X7CA 3CCUB 4X0CA 4Z4ZA 4X7FA 4XN3A 4PC2A 3W2HA 1UD3A 1YHQB 2DCUA 2XNJA 2GQFA 2V7XA 4WQMA 4YAFA 3ZUGA 4P2NA 2C78A 4DNTB 1IJFA 1YX2A 2LZJA 3SJZA 1BQEA 4RD3A 4Y9RA 3A8JA 1V0EA 1N05A 3GSIA 4HE5A 5HKKA 1J9ZA 4X8IA 1N0VC 1IJEA 3P27A 2ZBVA 4RCZA 3V76A 4ZCIA 4RD1A 1EFUA 3GIRA 3CCSB 1Q81D 3JQPA 1JA0A 1Y0YA 3LNNA 1JB9A 1EFTA 5HZBA 4X7DA 2HMAA 3SLNA 1E1RA 1DDGA 3VO2A 1EFRA 1WOPA 2ZZFA 3LQ6A 2HLDA 1VQNB 1WTHD 3A1PA 4RDLA 5IK2A 3CCRB 1VQ5B 3AVWA 1KTVA 3VNVA 1FRQA 4MYUA 1QVFB 2FX3A 3A8IA 2V31A 2V7TA 1ZUNB 3PENA 1VQ6B 1FNBA 4KKUA 1OB5A 2R9VA 2CBXA 4NNJA 4P26A 4G7WA 2OBTA 3H9NA 3SJPA 4TN1A 4F7DA 2VNJA 2VJJA 4M1KA 1XFOA 3Q6RA 5TY0A 2VZLA 3OE7A 1H85A 1EFCA 3T56B 2YWHA 1FNDA 3AGPA 3BC9A 1OGIA 2PMDA 4YHBA 2E1BA 2ZXIA 1E1QA 5IYRA 1K73D 2VBUA 1VHOA 3W2FA 1QVGB 2F4NA 2BV3A 1HZEA 2Q6IA 4QUZA 1ZM4A 4XLAA 1S72B 1E62A 4LBZA 4RPDA 3W5VA 1BX1A 1W87A 4FK8A 4G6IA 5F4JA 4Z4SA 3CC7B 1U2RA 2GPJA 2ZITA 2E1RA 1UD5A 3ONYA 5H59A 2DIEA 4M4SA 3ES9A 4DK0A 4QHYA 1RQPA 3CCJB 3A8KA 1W0KA 3PUNA 2BPOA 3LO8A 4Z4RA 4XN0A 4M0LA 1T6ZA 1EWYA 3J81k 1WSVA 2C4UA 2VBTA 3OZVA 1B2RA 3CMMA 2XEXA 2QTZA 5F4MA 3JU4A 4N3NA 3GVLA 4BPRA 1F20A 1WPCA 4B48A 1KJZA 5L46A 4FWTA 4RDJA 3VR6A 2QGGA 4Q7JB 3BY1A 4TT3A 1VQLB 1N07A 1QGAA 1QGYA 5FNZA 5EMNA 4PC1A 1H8EA 2VJIA 4XLEA 1NBMA 1ZM3A 1E3XA 3R6JA 4P3IA 5THXA 2CW5A 2QA4B 4K1XA 2DYIA 1DG1G 3ASRA 4TSFA 2XOKA 2ZL7A 3ASPA 1TUIA 3PA1A 2DERA 4XNFA 2XNDA 1YJ9B 1SM4A 2ZTGA 1FRNA 1GAWA 4TMVA 4XLHA 3CC4B 2GJKA 1EXMA 4EH1A 3JQRA 4OPSA 4XOTA 5KNLA 4II3A 2ZTNA 3CP8A 4IW3B 4YEJA 3AVVA 1OGJA 2JN9A 2BF4A 3VO1A 3RY8A 1G7CA 2GK7A 3BY2A 1QH0A 1G7TA 3OAAA 1E3ZA 5FO1A 5IYPA 2BM1A 3P26A 4PC6A 3SKBA 3G71B 3BQJA 1YITB 1PJ5A 4RD4A 5KSWB 2B7BA 2W6JA 5A88A 3FPPA 1AMOA 3CCLB 5IYNA 3G6EB 4AF7A 2YWEA 3OEEA 4C43A 2JIZA 3G4SB 3MCAA 4DQKA 4L8JA 1K9MD 1NDHA 1VHEA 4WZKA 1KRHA 3MMPA 3BCDA 4JMQA 3CXCB 4M53A 3CCEB 3OKXA 1K8AD 3W2GA 5JBQA 2XZLA 3MHPA 3CCMB 1G7RA 2VNHA 3Q6QA 5HXBA 1ELOA 3W5HA 4M2LA 4ZCLA 1D8TA 4RD6A 1YIJB 1T6XA 4XL9A 4CQJA 2WPDA 2P3MA 3ZZUA 5TR9A 2QTLA 2Q6OA 3BNWA 3AGQA 4RM0A 1VQKB 4FN5A 4P25A 4P9SA 1V0FA 3FKSA 2VBSA 4Y7CA 1JNYA 4P1VA 1QX4A 4ROXA 4J0QA 4QVJA 5F4OA 2C2WA 5DN6A 1VQ8B 2OYNA 4P6VF 3U2QA 2PIAA 1GO2A 4Z4UA 2JJ2A 1VQMB 4Z4WA 1D1NA 2QN6A 3QE2A 1BLIA 5LMZA 1BJKA 1K28D 5A8AA 1N0UA 4OP7A 1BPLA 1PKVA 2OK8A 2X3UA 1E79A 1VQOB 3AVUA 5FA6A 4RD2A 2YWGA 1TLLA
chains in the Genus database with same CATH topology
4YXWA 3T51B 2JDIA 3WQZA 3ZIAA 4B3FX 4B3GA 3CMMA 3HAGA 4KKSA 1HVXA 3GVKA 3GQBA 4AVZA 3A3GA 3JU4A 1OB0A 3GVLA 3CP2A 1MABA 1VF7A 1WPCA 2ZZGA 2M5SA 1OHHA 1UD4A 1NRKA 2ZXHA 3VR6A 4TT3A 2ZZQA 3A35A 4XOPA 3BCFA 2W6IA 1H8EA 2WZPP 4GQNA 2VJIA 4XLEA 1NBMA 2QE7A 5FL7A 1T5EA 1E3XA 1I8DA 1SKYB 1W9XA 4XR6A 3OEHA 1COWA 4ASUA 2GJPA 3NE5B 2F1MA 4TSFA 4XN3A 2XOKA 4G7XA 1UD3A 3H94A 2CK3A 2XNDA 4II2A 4XNFA 2ZTGA 2X8KA 4XLHA 4DNTB 2GJKA 1VJSA 5KNLA 2KVOA 4XOTA 4II3A 2LZJA 2ZTNA 3CP8A 4YEJA 3GVJA 1V0EA 5HKKA 2XGJA 2X6YA 3A3BA 3KEWA 2GK7A 4XD7A 2Z6BD 4YELA 2X6WA 3OAAA 1KMHA 1E3ZA 4XLCA 4E0FA 3DDYA 3LNNA 2XZPA 4XONA 4XORA 1H8HA 2W6JA 1E1RA 3FPPA 4KKTA 2ZZEA 1EFRA 2ZZFA 2HLDA 1WTHD 4DK1A 3OEEA 5IK2A 2JIZA 5CDFA 2GJRA 4L8JA 2V31A 3BCDA 4KKUA 1UD2A 2R9VA 4JMQA 4NNJA 3T53B 4Z1MA 4G7WA 4XMYA 2XZLA 3ZPNA 4XQFA 2VJJA 1FX0A 1E43A 2F43A 1VLYA 3OFNA 4DNRB 2V7QA 3OE7A 4XL9A 2WPDA 1WP6A 3T56B 3BC9A 3OW7A 2GK6A 1KZLA 2E1BA 1W0JA 2ZXIA 1E1QA 1V0FA 3FKSA 3OOCA 4XLFA 2D3NA 2XZOA 4P22A 2X85A 4HIZA 4XLAA 1HZEA 3G05A 5DN6A 2WJYA 2JJ1A 4UZUA 1BMFA 2JJ2A 4G6IA 4XM3A 2D3LA 1I18A 2WSSA 3BH4A 4FXUA 1UD5A 4XKWA 1BLIA 2X53S 1UD8A 2DIEA 3OPOA 4XKVA 1K28D 2WJVA 4TKOB 4DK0A 2V4DA 1BPLA 3CESA 1PKVA 1UD6A 1W0KA 1E79A 2X6XA 4XN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7X A;  4G7W A; 
#chains in the Genus database with same CATH topology
 2JDI A;  2DEU A;  2AHO A;  1D2E A;  1HVX A;  1KC8 D;  4AVZ A;  4PC7 A;  3CP2 A;  2QEX B;  2QMU A;  2WYR A;  2ZZG A;  3FJO A;  1EP3 B;  3A35 A;  4YAW A;  4XOP A;  1JA1 A;  3BCF A;  4B43 A;  3Q38 A;  1ZM2 A;  2C4T A;  2D74 A;  2W6I A;  2WZP P;  3LVB A;  2QE7 A;  1QG0 A;  1WOR A;  3OP1 A;  4RDK A;  4QFM A;  3OJW A;  1R5N A;  1W35 A;  1T5E A;  1WOS A;  1SKY B;  1VLO A;  4XR6 A;  5IYW A;  3OEH A;  4YAL A;  2B5O A;  1COW A;  2PE3 A;  2GJP A;  3NE5 B;  3WND A;  2F1M A;  4LBW A;  1Q86 D;  1FDR A;  1QUF A;  2OTL B;  4G7X A;  4N3G A;  3KL9 A;  2Q6K A;  4G1V A;  2FVG A;  2CK3 A;  2V7W A;  2BVN A;  3CRZ A;  4OOX A;  3B82 A;  3AVT A;  1H42 A;  1PJ7 A;  1VJS A;  1QFJ A;  2YWF A;  2ZL6 A;  4UZF A;  3GVJ A;  5BSY A;  3ISX A;  4H9G A;  3A3B A;  2CRV A;  2VNK A;  2F1L A;  1V5V A;  3ONU A;  2QDX A;  3U6K A;  2DOG A;  4YEL A;  1UMK A;  2X6W A;  1Y0R A;  1KMH A;  4XLC A;  3CCQ B;  4E0F A;  3CW2 A;  2XZP A;  2BSA A;  4XON A;  3CC2 B;  1T6Y A;  5BSX A;  2BGI A;  1H8H A;  4KKT A;  2NV4 A;  2ZZE A;  3CCV B;  3JQQ A;  2WR8 A;  4Z4V A;  4OOS A;  4DK1 A;  1DAR A;  2ZL5 A;  4WZE A;  4OOV A;  2ZBU A;  5CDF A;  4OPV A;  5E6T A;  3OZU A;  1TTT A;  4ZCM A;  3CTA A;  3QFR A;  3W5U A;  4PAA A;  4DQL A;  2WZN A;  4WWV A;  2GRE A;  4MYT A;  3LQE A;  4B4D A;  4Z1M A;  4XMY A;  3D26 A;  3V7A A;  1JJ2 B;  4XQF A;  3WYA A;  3OW2 B;  2DY1 A;  1DDI A;  2B7C A;  2F43 A;  3QFC A;  3Q3A A;  1HA3 A;  1WP6 A;  2CF4 A;  2OTJ B;  3FPK A;  4WZL A;  3OW7 A;  3SEJ A;  1W0J A;  4RD0 A;  1PJ6 A;  4Y9U A;  4AC9 A;  2D3N A;  2XZO A;  4P22 A;  2X85 A;  2BGJ A;  4HIZ A;  3ZZ0 A;  3G05 A;  4RJL A;  4Z4T A;  1VQ9 B;  4X06 A;  1FNM A;  2RC6 A;  1BMF A;  5H5J A;  1I7P A;  2D3L A;  1CQX A;  1OB2 A;  1KQS B;  4FXU A;  1CNF A;  4XKW A;  1ZM9 A;  4TKO B;  4UAJ A;  2V4D A;  1YJW B;  1IHM A;  1RQR A;  3WNB A;  1GAQ A;  4ZGQ B;  2C77 A;  4YXW A;  2VNI A;  2C5H A;  2VYQ A;  1NB0 A;  3ZIA A;  3WQZ A;  3ZC3 A;  1TVC A;  2BM0 A;  3VNU A;  4B3G A;  1GJR A;  4ACB A;  2C5B A;  4KKS A;  2R6H A;  3GVK A;  3PA2 A;  5AN9 A;  1NB9 A;  1OB0 A;  2D9R A;  2RC5 A;  1SKQ A;  4TMW A;  1S0U A;  1MRZ A;  2CND A;  5A89 A;  5HZA A;  1UD4 A;  2ZXH A;  2ZZQ A;  1QFY A;  3AST A;  4HE6 A;  3WBJ A;  4PAB A;  4B3X A;  1I8D A;  3AVY A;  3ASS A;  2PLF A;  2J7K A;  4ASU A;  4P3Y A;  4X07 A;  1WU8 A;  1AIP A;  2XNC A;  2OBS A;  1VQ7 B;  3H94 A;  4II2 A;  2X8K A;  1WSR A;  3E1Y E;  4OPO A;  2KVO A;  2Q6L A;  2XGJ A;  3CD6 B;  2X6Y A;  1S4M A;  1EP1 B;  1XB2 A;  1GVH A;  3W2I A;  5DSZ A;  3KEW A;  4XD7 A;  2Z6B D;  1A8P A;  2EIX A;  3B8H A;  3I1F A;  4RCY A;  4B44 A;  1E64 A;  3I55 B;  3DDY A;  1W2B B;  4ZV4 A;  1B23 P;  3CME B;  4XOR A;  5FO0 A;  1Q82 D;  4PGO A;  1KK2 A;  1NJI D;  3CPX A;  2OK7 A;  3CPW B;  2GJR A;  4U9U A;  4R71 A;  1YLO A;  1WOO A;  3WXM A;  3OJX A;  1E63 A;  1UD2 A;  2X0K A;  4Z4Y A;  4G1B A;  1F60 A;  3SLD A;  3T53 B;  3W2E A;  4ACA A;  1M1K D;  4TMT A;  3ZPN A;  1G7S A;  3WY9 A;  1KK0 A;  2V7V A;  1XE1 A;  2BMW A;  3B78 A;  3ZBT A;  1FX0 A;  1E43 A;  4YAO A;  3QFT A;  1VLY A;  2CC2 A;  3OFN A;  4QV2 A;  4DNR B;  3I56 B;  2V7Q A;  5FIU A;  2HCJ B;  1XQB A;  2OBR A;  1VQP B;  3ZZT A;  1R5B A;  2GK6 A;  1KZL A;  1EP2 B;  1W34 A;  4LC0 A;  3PVD A;  5GV7 A;  4XLF A;  3OOC A;  5J35 A;  1GR1 A;  3U6B A;  3AVX A;  4NBS A;  1KK1 A;  2BN4 A;  4RPB A;  3VMF A;  5GV8 A;  2WJY A;  3QSY A;  2VBV A;  4PC3 A;  2JJ1 A;  4UZU A;  1N06 A;  4XM3 A;  1N08 A;  1KD1 D;  1M90 D;  4NCN A;  1I18 A;  2WSS A;  1Q9S A;  1QUE A;  3R6K A;  3BH4 A;  1KK3 A;  2X53 S;  4XKV A;  1UD8 A;  3OPO A;  1N8R D;  1FNC A;  2WJV A;  1P4M A;  5DS0 A;  3CES A;  1UD6 A;  4LBY A;  3QFS A;  2X6X A;  4G5G A;  3CMA B;  4P12 A;  1QFZ A;  1YI2 B;  3T51 B;  1BX0 A;  2V7U A;  3ASQ A;  1VQ4 B;  4YAU A;  4C0S A;  2EFG A;  2I1L A;  4B3F X;  5J3O A;  4TMX A;  4X05 A;  4LBV A;  2DET A;  3WBK A;  1R5O A;  3HAG A;  5TV2 A;  3ZBU A;  3GQB A;  4RLZ A;  3A3G A;  5TRD A;  1Q7Y D;  1MAB A;  3Q39 A;  3E20 A;  1VF7 A;  4QVA A;  4TMZ A;  1CNE A;  2M5S A;  3WNC A;  1OHH A;  1YJN B;  4P6Y A;  1NRK A;  1WDT A;  4WZT A;  4ZGN B;  4UZE A;  5KW9 A;  1IB0 A;  2NPF A;  4X7E A;  4GQN A;  4AF6 A;  4B47 A;  3CB4 A;  5FL7 A;  2HDN B;  5IYQ A;  1W9X A;  3PUM A;  5B6I A;  3OZW A;  1QGZ A;  4X7C A;  3CCU B;  4X0C A;  4Z4Z A;  4X7F A;  4XN3 A;  4PC2 A;  3W2H A;  1UD3 A;  1YHQ B;  2DCU A;  2XNJ A;  2GQF A;  2V7X A;  4WQM A;  4YAF A;  3ZUG A;  4P2N A;  2C78 A;  4DNT B;  1IJF A;  1YX2 A;  2LZJ A;  3SJZ A;  1BQE A;  4RD3 A;  4Y9R A;  3A8J A;  1V0E A;  1N05 A;  3GSI A;  4HE5 A;  5HKK A;  1J9Z A;  4X8I A;  1N0V C;  1IJE A;  3P27 A;  2ZBV A;  4RCZ A;  3V76 A;  4ZCI A;  4RD1 A;  1EFU A;  3GIR A;  3CCS B;  1Q81 D;  3JQP A;  1JA0 A;  1Y0Y A;  3LNN A;  1JB9 A;  1EFT A;  5HZB A;  4X7D A;  2HMA A;  3SLN A;  1E1R A;  1DDG A;  3VO2 A;  1EFR A;  1WOP A;  2ZZF A;  3LQ6 A;  2HLD A;  1VQN B;  1WTH D;  3A1P A;  4RDL A;  5IK2 A;  3CCR B;  1VQ5 B;  3AVW A;  1KTV A;  3VNV A;  1FRQ A;  4MYU A;  1QVF B;  2FX3 A;  3A8I A;  2V31 A;  2V7T A;  1ZUN B;  3PEN A;  1VQ6 B;  1FNB A;  4KKU A;  1OB5 A;  2R9V A;  2CBX A;  4NNJ A;  4P26 A;  4G7W A;  2OBT A;  3H9N A;  3SJP A;  4TN1 A;  4F7D A;  2VNJ A;  2VJJ A;  4M1K A;  1XFO A;  3Q6R A;  5TY0 A;  2VZL A;  3OE7 A;  1H85 A;  1EFC A;  3T56 B;  2YWH A;  1FND A;  3AGP A;  3BC9 A;  1OGI A;  2PMD A;  4YHB A;  2E1B A;  2ZXI A;  1E1Q A;  5IYR A;  1K73 D;  2VBU A;  1VHO A;  3W2F A;  1QVG B;  2F4N A;  2BV3 A;  1HZE A;  2Q6I A;  4QUZ A;  1ZM4 A;  4XLA A;  1S72 B;  1E62 A;  4LBZ A;  4RPD A;  3W5V A;  1BX1 A;  1W87 A;  4FK8 A;  4G6I A;  5F4J A;  4Z4S A;  3CC7 B;  1U2R A;  2GPJ A;  2ZIT A;  2E1R A;  1UD5 A;  3ONY A;  5H59 A;  2DIE A;  4M4S A;  3ES9 A;  4DK0 A;  4QHY A;  1RQP A;  3CCJ B;  3A8K A;  1W0K A;  3PUN A;  2BPO A;  3LO8 A;  4Z4R A;  4XN0 A;  4M0L A;  1T6Z A;  1EWY A;  3J81 k;  1WSV A;  2C4U A;  2VBT A;  3OZV A;  1B2R A;  3CMM A;  2XEX A;  2QTZ A;  5F4M A;  3JU4 A;  4N3N A;  3GVL A;  4BPR A;  1F20 A;  1WPC A;  4B48 A;  1KJZ A;  5L46 A;  4FWT A;  4RDJ A;  3VR6 A;  2QGG A;  4Q7J B;  3BY1 A;  4TT3 A;  1VQL B;  1N07 A;  1QGA A;  1QGY A;  5FNZ A;  5EMN A;  4PC1 A;  1H8E A;  2VJI A;  4XLE A;  1NBM A;  1ZM3 A;  1E3X A;  3R6J A;  4P3I A;  5THX A;  2CW5 A;  2QA4 B;  4K1X A;  2DYI A;  1DG1 G;  3ASR A;  4TSF A;  2XOK A;  2ZL7 A;  3ASP A;  1TUI A;  3PA1 A;  2DER A;  4XNF A;  2XND A;  1YJ9 B;  1SM4 A;  2ZTG A;  1FRN A;  1GAW A;  4TMV A;  4XLH A;  3CC4 B;  2GJK A;  1EXM A;  4EH1 A;  3JQR A;  4OPS A;  4XOT A;  5KNL A;  4II3 A;  2ZTN A;  3CP8 A;  4IW3 B;  4YEJ A;  3AVV A;  1OGJ A;  2JN9 A;  2BF4 A;  3VO1 A;  3RY8 A;  1G7C A;  2GK7 A;  3BY2 A;  1QH0 A;  1G7T A;  3OAA A;  1E3Z A;  5FO1 A;  5IYP A;  2BM1 A;  3P26 A;  4PC6 A;  3SKB A;  3G71 B;  3BQJ A;  1YIT B;  1PJ5 A;  4RD4 A;  5KSW B;  2B7B A;  2W6J A;  5A88 A;  3FPP A;  1AMO A;  3CCL B;  5IYN A;  3G6E B;  4AF7 A;  2YWE A;  3OEE A;  4C43 A;  2JIZ A;  3G4S B;  3MCA A;  4DQK A;  4L8J A;  1K9M D;  1NDH A;  1VHE A;  4WZK A;  1KRH A;  3MMP A;  3BCD A;  4JMQ A;  3CXC B;  4M53 A;  3CCE B;  3OKX A;  1K8A D;  3W2G A;  5JBQ A;  2XZL A;  3MHP A;  3CCM B;  1G7R A;  2VNH A;  3Q6Q A;  5HXB A;  1ELO A;  3W5H A;  4M2L A;  4ZCL A;  1D8T A;  4RD6 A;  1YIJ B;  1T6X A;  4XL9 A;  4CQJ A;  2WPD A;  2P3M A;  3ZZU A;  5TR9 A;  2QTL A;  2Q6O A;  3BNW A;  3AGQ A;  4RM0 A;  1VQK B;  4FN5 A;  4P25 A;  4P9S A;  1V0F A;  3FKS A;  2VBS A;  4Y7C A;  1JNY A;  4P1V A;  1QX4 A;  4ROX A;  4J0Q A;  4QVJ A;  5F4O A;  2C2W A;  5DN6 A;  1VQ8 B;  2OYN A;  4P6V F;  3U2Q A;  2PIA A;  1GO2 A;  4Z4U A;  2JJ2 A;  1VQM B;  4Z4W A;  1D1N A;  2QN6 A;  3QE2 A;  1BLI A;  5LMZ A;  1BJK A;  1K28 D;  5A8A A;  1N0U A;  4OP7 A;  1BPL A;  1PKV A;  2OK8 A;  2X3U A;  1E79 A;  1VQO B;  3AVU A;  5FA6 A;  4RD2 A;  2YWG A;  1TLL A; 
#chains in the Genus database with same CATH homology
 4YXW A;  3T51 B;  2JDI A;  3WQZ A;  3ZIA A;  4B3F X;  4B3G A;  3CMM A;  3HAG A;  4KKS A;  1HVX A;  3GVK A;  3GQB A;  4AVZ A;  3A3G A;  3JU4 A;  1OB0 A;  3GVL A;  3CP2 A;  1MAB A;  1VF7 A;  1WPC A;  2ZZG A;  2M5S A;  1OHH A;  1UD4 A;  1NRK A;  2ZXH A;  3VR6 A;  4TT3 A;  2ZZQ A;  3A35 A;  4XOP A;  3BCF A;  2W6I A;  1H8E A;  2WZP P;  4GQN A;  2VJI A;  4XLE A;  1NBM A;  2QE7 A;  5FL7 A;  1T5E A;  1E3X A;  1I8D A;  1SKY B;  1W9X A;  4XR6 A;  3OEH A;  1COW A;  4ASU A;  2GJP A;  3NE5 B;  2F1M A;  4TSF A;  4XN3 A;  2XOK A;  4G7X A;  1UD3 A;  3H94 A;  2CK3 A;  2XND A;  4II2 A;  4XNF A;  2ZTG A;  2X8K A;  4XLH A;  4DNT B;  2GJK A;  1VJS A;  5KNL A;  2KVO A;  4XOT A;  4II3 A;  2LZJ A;  2ZTN A;  3CP8 A;  4YEJ A;  3GVJ A;  1V0E A;  5HKK A;  2XGJ A;  2X6Y A;  3A3B A;  3KEW A;  2GK7 A;  4XD7 A;  2Z6B D;  4YEL A;  2X6W A;  3OAA A;  1KMH A;  1E3Z A;  4XLC A;  4E0F A;  3DDY A;  3LNN A;  2XZP A;  4XON A;  4XOR A;  1H8H A;  2W6J A;  1E1R A;  3FPP A;  4KKT A;  2ZZE A;  1EFR A;  2ZZF A;  2HLD A;  1WTH D;  4DK1 A;  3OEE A;  5IK2 A;  2JIZ A;  5CDF A;  2GJR A;  4L8J A;  2V31 A;  3BCD A;  4KKU A;  1UD2 A;  2R9V A;  4JMQ A;  4NNJ A;  3T53 B;  4Z1M A;  4G7W A;  4XMY A;  2XZL A;  3ZPN A;  4XQF A;  2VJJ A;  1FX0 A;  1E43 A;  2F43 A;  1VLY A;  3OFN A;  4DNR B;  2V7Q A;  3OE7 A;  4XL9 A;  2WPD A;  1WP6 A;  3T56 B;  3BC9 A;  3OW7 A;  2GK6 A;  1KZL A;  2E1B A;  1W0J A;  2ZXI A;  1E1Q A;  1V0F A;  3FKS A;  3OOC A;  4XLF A;  2D3N A;  2XZO A;  4P22 A;  2X85 A;  4HIZ A;  4XLA A;  1HZE A;  3G05 A;  5DN6 A;  2WJY A;  2JJ1 A;  4UZU A;  1BMF A;  2JJ2 A;  4G6I A;  4XM3 A;  2D3L A;  1I18 A;  2WSS A;  3BH4 A;  4FXU A;  1UD5 A;  4XKW A;  1BLI A;  2X53 S;  1UD8 A;  2DIE A;  3OPO A;  4XKV A;  1K28 D;  2WJV A;  4TKO B;  4DK0 A;  2V4D A;  1BPL A;  3CES A;  1PKV A;  1UD6 A;  1W0K A;  1E79 A;  2X6X A;  4XN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...