4G7XA

Crystal structure of a complex between the ctxphi piii n-terminal domain and the vibrio cholerae tola c-terminal domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
INCDPNTTTSHQLLFGFGSPIVQSVLFDGCMLDIEKDDYGFVWSCLSNENGDYCKGLYKPRFTQGVSPNWPMCDLSGASAERCIYPYCPEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal Structures of a CTX{varphi} pIII Domain Unbound and in Complex with a Vibrio cholerae TolA Domain Reveal Novel Interaction Interfaces.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Protein binding/protein binding
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2012-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.280 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4g7xA00
4G7WA 4G7XA
chains in the Genus database with same CATH superfamily
2JJ2A 2BSAA 3CMEB 4NCNA 3CPXA 4HE6A 4PC3A 4Z4ZA 4P2NA 5FIUA 4ROXA 3CXCB 3KEWA 2QE7A 2VNJA 3CCJB 4B44A 1JJ2B 1VQ4B 3WBJA 3WY9A 1QFJA 1XQBA 3QFTA 3CCSB 3PUMA 3SJPA 3OKXA 2X3UA 5CDFA 2NPFA 1N0VC 1RQRA 3W5HA 2VBSA 2QEXB 3U6BA 1WOOA 3VNVA 2YWGA 3Q39A 4X8IA 3ZZUA 5IYWA 1UD8A 1ZM3A 2OBRA 1DG1G 3A3BA 4TT3A 4Z4UA 3QFSA 2BM1A 1NRKA 2V7WA 3ISXA 1YIJB 3OW7A 4H9GA 4M53A 1QG0A 3FKSA 4RD6A 4UZUA 5LMZA 3B82A 4RPBA 3CCEB 3AVXA 4XLHA 3GQBA 4OOXA 1VQOB 4ASUA 1ZM4A 1OB5A 1YLOA 2F4NA 4RDKA 1OB0A 4XN3A 2PIAA 1WPCA 1NBMA 4XL9A 2Q6KA 1N0UA 2HCJB 4QVJA 2B7CA 2M5SA 2ZL5A 4XKWA 4LC0A 1KJZA 4M0LA 3BCFA 4NNJA 3AVTA 3WNCA 2BGJA 4G1BA 4Z1MA 1NB0A 3SEJA 3Q38A 1VQ6B 4RDJA 1CNFA 3OPOA 4RD4A 1K73D 4L8JA 1COWA 4P9SA 1H8EA 3G4SB 3AVWA 4LBVA 4TMWA 3AGQA 2JDIA 2BM0A 4MYTA 3GVJA 3LQEA 5GV8A 5TV2A 4ZCIA 2C4TA 1MRZA 1D1NA 1JNYA 2BN4A 4CQJA 3KL9A 2OYNA 3OFNA 2QGGA 4G7XA 1DDIA 4KKSA 1XFOA 5HXBA 1FRNA 1WP6A 2V7UA 2DEUA 5TRDA 2DERA 1QFZA 5A89A 3WNBA 3BY2A 3CCUB 5A88A 3J81k 1YJNB 1VQKB 4HIZA 1FX0A 4RM0A 4WZLA 3WBKA 4DNTB 4B3FX 1BJKA 2VNHA 1WSVA 4X7FA 2WPDA 2ZZFA 2ZBUA 3CCLB 1E3XA 2GJKA 1WORA 3V76A 3AVVA 3G05A 4M1KA 4J0QA 5J3OA 1KQSB 1F20A 3CCMB 2XGJA 1ELOA 1IB0A 1TVCA 3MHPA 1D8TA 3OE7A 4II2A 3W2GA 3LNNA 2ZITA 4NBSA 1TLLA 2F1LA 2QN6A 1V0FA 2WZNA 2DETA 2GQFA 2VNIA 2X6XA 1RQPA 1KK3A 4DK0A 4F7DA 1Y0RA 3GVLA 2Q6OA 4B43A 3W2FA 1KK0A 5FO0A 3VO1A 2XZOA 2R9VA 4XONA 3LO8A 4Z4RA 3ZUGA 3CD6B 4DK1A 4DQLA 5IYQA 2WSSA 1FDRA 2GK7A 1V0EA 3CCVB 1V5VA 2OBTA 3ONYA 1H85A 2YWEA 2ZBVA 4RD3A 1R5OA 1W35A 1G7SA 1I7PA 3CMAB 1CNEA 3JQRA 3CTAA 4LBZA 2XNCA 1H8HA 5TR9A 3AVYA 2VBTA 4TN1A 2ZXHA 2R6HA 1N07A 4G7WA 2ZZGA 3CP2A 4YAFA 5KSWB 1BX1A 1M1KD 3ES9A 4OOVA 4M2LA 2WZPP 1XB2A 1GAQA 2BGIA 3U6KA 1Q81D 3Q3AA 2GPJA 2DIEA 2E1RA 2X53S 4BPRA 3W2EA 1KC8D 2ZZQA 3CW2A 1VQ7B 4TKOB 1WDTA 5HKKA 4OOSA 2DY1A 3A8JA 4JMQA 2QTZA 1FNBA 5BSYA 2CC2A 3JQPA 4ZV4A 2C4UA 2VJJA 2CBXA 1YJWB 2QDXA 2LZJA 3QE2A 3GVKA 1QH0A 2XZLA 2X0KA 2CW5A 2PMDA 1J9ZA 5HZBA 3BY1A 4WQMA 1R5NA 2OK8A 4RD0A 3WYAA 5F4MA 2OTLB 4AC9A 2V31A 3BH4A 3P27A 1Q7YD 3OW2B 1VF7A 5GV7A 2CRVA 1UD5A 5DS0A 2ZL7A 4X7CA 2XNJA 4XKVA 1ZM9A 3A1PA 4DQKA 3OAAA 4P6VF 5H59A 4AF6A 4G5GA 4XN0A 1JB9A 1VHEA 4XORA 5KW9A 2OTJB 2AHOA 3G6EB 1AIPA 4Z4SA 2YWFA 3WXMA 1S72B 3W5VA 4G1VA 5KNLA 3CC7B 1PJ7A 1M90D 1YI2B 1SKQA 1E79A 3ASQA 1T6XA 2CNDA 3E1YE 4II3A 4YAWA 4XD7A 1TUIA 1GJRA 1FRQA 1N06A 3R6JA 3ZZTA 1FNDA 3Q6QA 4YALA 1G7TA 2KVOA 3T53B 2XNDA 4WWVA 1NDHA 2WJVA 4YAOA 1E43A 4YELA 3VNUA 4U9UA 4KKUA 1S4MA 5L46A 1QVGB 2V7TA 1YX2A 4QUZA 1BPLA 5TY0A 2CF4A 2CK3A 4Y9UA 1W0JA 2DCUA 4XLEA 3T56B 4B4DA 4PGOA 3PENA 4QHYA 3FPKA 2D3LA 2DYIA 1T6YA 2VZLA 2GREA 4RJLA 3SLDA 1BMFA 3OZVA 3CESA 4LBYA 1VQ8B 1QGAA 2P3MA 1P4MA 2JJ1A 1OGJA 3ASPA 4Y7CA 3R6KA 2QA4B 4X0CA 2JIZA 1WOPA 2HMAA 3ZPNA 1OHHA 3B8HA 5FNZA 1EXMA 3MMPA 2ZZEA 4WZKA 4X06A 1QVFB 4P25A 1FNMA 2C78A 2RC5A 4XLCA 1MABA 1UD4A 1K8AD 1WSRA 2BF4A 2XEXA 1YJ9B 1W9XA 4PAAA 5B6IA 5E6TA 2V7VA 1CQXA 2D74A 3W2IA 3ZBUA 1GAWA 3A35A 1N8RD 1G7RA 1EP2B 2B5OA 3CPWB 3AVUA 2ZXIA 1K9MD 3ZC3A 5IYNA 4TMTA 1GR1A 2B7BA 2J7KA 3OJWA 4P22A 4QVAA 4RLZA 4Z4YA 2Z6BD 1Y0YA 4UZFA 2FVGA 1HVXA 5BSXA 4XNFA 3ZBTA 1Q9SA 2X8KA 1FNCA 1EFRA 1A8PA 2Q6IA 3OZUA 4P26A 3OOCA 4HE5A 3I56B 1I8DA 2C5BA 4B3GA 3ZIAA 1Q86D 3CC2B 2JN9A 1Q82D 3GSIA 2XOKA 2Q6LA 1E3ZA 2X85A 2C2WA 5F4JA 3OEHA 4AF7A 1QGZA 4ACAA 1HZEA 3SJZA 1YHQB 5HZAA 1JA1A 4RD1A 1JA0A 1G7CA 4N3GA 3D26A 1E64A 2VBVA 1TTTA 5FA6A 1W34A 3JQQA 1YITB 4OPSA 4ACBA 3BC9A 1EP3B 1UMKA 1VLOA 2V7QA 3CB4A 1EFUA 3AGPA 5FL7A 1H42A 4XLAA 1VQNB 3WQZA 1ZM2A 3MCAA 4LBWA 2WJYA 1BLIA 3QFRA 2NV4A 4ZGQB 5F4OA 2WR8A 4P12A 1HA3A 4IW3B 4M4SA 5DSZA 1XE1A 4RD2A 2W6IA 4TSFA 3A3GA 3ONUA 1S0UA 1KZLA 1UD6A 4XOPA 2VNKA 1F60A 1N05A 4PC2A 4UZEA 1T6ZA 2VJIA 2BV3A 1E62A 3ZZ0A 4TMXA 3P26A 1PJ5A 2RC6A 1GO2A 3H94A 2GK6A 3BQJA 4FXUA 4P1VA 4AVZA 1E1RA 4C43A 2EFGA 3QFCA 2OK7A 4B48A 3QSYA 3GIRA 3T51B 4PC6A 4XMYA 4RDLA 2W6JA 4PC7A 2HLDA 5H5JA 4FWTA 1VQPB 1W0KA 1OB2A 3CC4B 1VQMB 3V7AA 3PA1A 1QX4A 2X6WA 1E63A 4YAUA 2PE3A 3SLNA 4RCZA 1AMOA 2XZPA 4PABA 2EIXA 1E1QA 1ZUNB 4P3IA 3FPPA 2V7XA 4FN5A 2C5HA 5FO1A 5JBQA 4X7DA 2ZL6A 1QUFA 2I1LA 3B78A 4ZCLA 1EWYA 3H9NA 2BMWA 4WZTA 4YEJA 2QMUA 1DDGA 3WNDA 1VJSA 2F43A 3A8KA 1WU8A 3ASTA 1VHOA 4YXWA 1SKYB 4XM3A 1QGYA 1UD3A 3CRZA 1VQ5B 3HAGA 4OPVA 1IJEA 3PVDA 1W2BB 1PKVA 1GVHA 1VQ9B 4X7EA 2ZTGA 2D9RA 5IK2A 3BCDA 4Z4TA 1R5BA 3BNWA 4XLFA 4MYUA 2E1BA 2VYQA 3OJXA 4K1XA 3NE5B 4OPOA 4UAJA 5IYPA 1QUEA 4X07A 1B23P 3RY8A 2BVNA 1T5EA 2OBSA 2QTLA 3CMMA 4G6IA 1B2RA 1VQLB 1KK2A 2BPOA 1UD2A 3CCQB 4P3YA 1KD1D 2WYRA 4YHBA 2F1MA 4DNRB 3Q6RA 4QV2A 1OGIA 1EP1B 1VLYA 4OP7A 5EMNA 4E0FA 2VBUA 4XOTA 1BX0A 1EFTA 4ZGNB 3I1FA 1I18A 3SKBA 2D3NA 2DOGA 4QFMA 3FJOA 4XR6A 1KRHA 4R71A 1D2EA 1WOSA 1EFCA 3W2HA 2GJPA 1DARA 3JU4A 3OEEA 4PC1A 3VMFA 4Z4WA 1U2RA 5J35A 3VO2A 5IYRA 2PLFA 3DDYA 3CCRB 5DN6A 2X6YA 4TMVA 3VR6A 3CP8A 4Q7JB 3I55B 4XQFA 3LVBA 1KTVA 4B3XA 1WTHD 4N3NA 1NJID 4RCYA 1SM4A 4TMZA 2YWHA 3OZWA 4P6YA 5AN9A 2V4DA 2FX3A 1QFYA 4EH1A 5A8AA 3G71B 5THXA 3W5UA 1PJ6A 4B47A 3PUNA 1IHMA 1IJFA 1N08A 1BQEA 3A8IA 3ASSA 4Y9RA 3U2QA 4Z4VA 1KMHA 2ZTNA 2C77A 1KK1A 1W87A 3OP1A 4KKTA 2HDNB 4ZCMA 4GQNA 2GJRA 4WZEA 4FK8A 3LQ6A 4RPDA 1NB9A 3ASRA 1K28D 4X05A 3E20A 3PA2A 4C0SA
chains in the Genus database with same CATH topology
3GVLA 2GK6A 3H94A 1BMFA 4FXUA 3CESA 2JJ2A 1E1RA 4AVZA 2XZOA 2JJ1A 2R9VA 4XONA 4DK1A 2WSSA 3T51B 3KEWA 2QE7A 2GK7A 1V0EA 2W6JA 2JIZA 2HLDA 3ZPNA 1W0KA 1OHHA 2ZZEA 4XLCA 2X6WA 1H8HA 1MABA 1UD4A 2XZPA 2ZXHA 1E1QA 5CDFA 3FPPA 4G7WA 2ZZGA 3CP2A 1W9XA 4YEJA 2WZPP 1UD8A 3A3BA 4TT3A 1VJSA 2F43A 1NRKA 2DIEA 2X53S 3A35A 2ZZQA 3OW7A 4UZUA 2ZXIA 3FKSA 4YXWA 1SKYB 4XM3A 1UD3A 4XLHA 3GQBA 4TKOB 3HAGA 4P22A 5HKKA 2Z6BD 4ASUA 4JMQA 1PKVA 1HVXA 4XNFA 2ZTGA 1OB0A 4XN3A 2VJJA 5IK2A 1WPCA 1NBMA 2X8KA 2LZJA 3BCDA 4XL9A 1EFRA 4XLFA 2E1BA 3GVKA 3OOCA 2XZLA 3NE5B 1I8DA 2M5SA 4XKWA 4G6IA 1T5EA 4B3GA 3CMMA 3ZIAA 2V31A 3BH4A 3BCFA 1UD2A 1VF7A 1UD5A 4NNJA 2XOKA 1E3ZA 2F1MA 2X85A 4DNRB 4XKVA 3OEHA 4Z1MA 1VLYA 3OPOA 1HZEA 4E0FA 3OAAA 4L8JA 4XOTA 1COWA 1H8EA 1I18A 4XN0A 4DK0A 2JDIA 4XORA 3GVJA 2D3NA 4XR6A 3OFNA 2GJPA 3JU4A 4G7XA 3OEEA 5KNLA 3BC9A 4KKSA 2V7QA 1WP6A 5FL7A 1E79A 3DDYA 4XLAA 4HIZA 1FX0A 4II3A 5DN6A 2X6YA 4XD7A 3WQZA 3VR6A 2WJYA 1BLIA 3CP8A 4XQFA 2KVOA 4DNTB 4B3FX 1WTHD 2XNDA 3T53B 2WJVA 4YELA 1E43A 2WPDA 2ZZFA 1E3XA 2GJKA 2V4DA 2W6IA 3G05A 4KKUA 4TSFA 3A3GA 1BPLA 2XGJA 1KZLA 2CK3A 3T56B 1W0JA 1KMHA 1UD6A 2ZTNA 3OE7A 4II2A 4XLEA 4XOPA 3LNNA 4KKTA 4GQNA 2GJRA 1V0FA 2VJIA 2D3LA 1K28D 4XMYA 2X6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7W A;  4G7X A; 
#chains in the Genus database with same CATH topology
 2JJ2 A;  2BSA A;  3CME B;  4NCN A;  3CPX A;  4HE6 A;  4PC3 A;  4Z4Z A;  4P2N A;  5FIU A;  4ROX A;  3CXC B;  3KEW A;  2QE7 A;  2VNJ A;  3CCJ B;  4B44 A;  1JJ2 B;  1VQ4 B;  3WBJ A;  3WY9 A;  1QFJ A;  1XQB A;  3QFT A;  3CCS B;  3PUM A;  3SJP A;  3OKX A;  2X3U A;  5CDF A;  2NPF A;  1N0V C;  1RQR A;  3W5H A;  2VBS A;  2QEX B;  3U6B A;  1WOO A;  3VNV A;  2YWG A;  3Q39 A;  4X8I A;  3ZZU A;  5IYW A;  1UD8 A;  1ZM3 A;  2OBR A;  1DG1 G;  3A3B A;  4TT3 A;  4Z4U A;  3QFS A;  2BM1 A;  1NRK A;  2V7W A;  3ISX A;  1YIJ B;  3OW7 A;  4H9G A;  4M53 A;  1QG0 A;  3FKS A;  4RD6 A;  4UZU A;  5LMZ A;  3B82 A;  4RPB A;  3CCE B;  3AVX A;  4XLH A;  3GQB A;  4OOX A;  1VQO B;  4ASU A;  1ZM4 A;  1OB5 A;  1YLO A;  2F4N A;  4RDK A;  1OB0 A;  4XN3 A;  2PIA A;  1WPC A;  1NBM A;  4XL9 A;  2Q6K A;  1N0U A;  2HCJ B;  4QVJ A;  2B7C A;  2M5S A;  2ZL5 A;  4XKW A;  4LC0 A;  1KJZ A;  4M0L A;  3BCF A;  4NNJ A;  3AVT A;  3WNC A;  2BGJ A;  4G1B A;  4Z1M A;  1NB0 A;  3SEJ A;  3Q38 A;  1VQ6 B;  4RDJ A;  1CNF A;  3OPO A;  4RD4 A;  1K73 D;  4L8J A;  1COW A;  4P9S A;  1H8E A;  3G4S B;  3AVW A;  4LBV A;  4TMW A;  3AGQ A;  2JDI A;  2BM0 A;  4MYT A;  3GVJ A;  3LQE A;  5GV8 A;  5TV2 A;  4ZCI A;  2C4T A;  1MRZ A;  1D1N A;  1JNY A;  2BN4 A;  4CQJ A;  3KL9 A;  2OYN A;  3OFN A;  2QGG A;  4G7X A;  1DDI A;  4KKS A;  1XFO A;  5HXB A;  1FRN A;  1WP6 A;  2V7U A;  2DEU A;  5TRD A;  2DER A;  1QFZ A;  5A89 A;  3WNB A;  3BY2 A;  3CCU B;  5A88 A;  3J81 k;  1YJN B;  1VQK B;  4HIZ A;  1FX0 A;  4RM0 A;  4WZL A;  3WBK A;  4DNT B;  4B3F X;  1BJK A;  2VNH A;  1WSV A;  4X7F A;  2WPD A;  2ZZF A;  2ZBU A;  3CCL B;  1E3X A;  2GJK A;  1WOR A;  3V76 A;  3AVV A;  3G05 A;  4M1K A;  4J0Q A;  5J3O A;  1KQS B;  1F20 A;  3CCM B;  2XGJ A;  1ELO A;  1IB0 A;  1TVC A;  3MHP A;  1D8T A;  3OE7 A;  4II2 A;  3W2G A;  3LNN A;  2ZIT A;  4NBS A;  1TLL A;  2F1L A;  2QN6 A;  1V0F A;  2WZN A;  2DET A;  2GQF A;  2VNI A;  2X6X A;  1RQP A;  1KK3 A;  4DK0 A;  4F7D A;  1Y0R A;  3GVL A;  2Q6O A;  4B43 A;  3W2F A;  1KK0 A;  5FO0 A;  3VO1 A;  2XZO A;  2R9V A;  4XON A;  3LO8 A;  4Z4R A;  3ZUG A;  3CD6 B;  4DK1 A;  4DQL A;  5IYQ A;  2WSS A;  1FDR A;  2GK7 A;  1V0E A;  3CCV B;  1V5V A;  2OBT A;  3ONY A;  1H85 A;  2YWE A;  2ZBV A;  4RD3 A;  1R5O A;  1W35 A;  1G7S A;  1I7P A;  3CMA B;  1CNE A;  3JQR A;  3CTA A;  4LBZ A;  2XNC A;  1H8H A;  5TR9 A;  3AVY A;  2VBT A;  4TN1 A;  2ZXH A;  2R6H A;  1N07 A;  4G7W A;  2ZZG A;  3CP2 A;  4YAF A;  5KSW B;  1BX1 A;  1M1K D;  3ES9 A;  4OOV A;  4M2L A;  2WZP P;  1XB2 A;  1GAQ A;  2BGI A;  3U6K A;  1Q81 D;  3Q3A A;  2GPJ A;  2DIE A;  2E1R A;  2X53 S;  4BPR A;  3W2E A;  1KC8 D;  2ZZQ A;  3CW2 A;  1VQ7 B;  4TKO B;  1WDT A;  5HKK A;  4OOS A;  2DY1 A;  3A8J A;  4JMQ A;  2QTZ A;  1FNB A;  5BSY A;  2CC2 A;  3JQP A;  4ZV4 A;  2C4U A;  2VJJ A;  2CBX A;  1YJW B;  2QDX A;  2LZJ A;  3QE2 A;  3GVK A;  1QH0 A;  2XZL A;  2X0K A;  2CW5 A;  2PMD A;  1J9Z A;  5HZB A;  3BY1 A;  4WQM A;  1R5N A;  2OK8 A;  4RD0 A;  3WYA A;  5F4M A;  2OTL B;  4AC9 A;  2V31 A;  3BH4 A;  3P27 A;  1Q7Y D;  3OW2 B;  1VF7 A;  5GV7 A;  2CRV A;  1UD5 A;  5DS0 A;  2ZL7 A;  4X7C A;  2XNJ A;  4XKV A;  1ZM9 A;  3A1P A;  4DQK A;  3OAA A;  4P6V F;  5H59 A;  4AF6 A;  4G5G A;  4XN0 A;  1JB9 A;  1VHE A;  4XOR A;  5KW9 A;  2OTJ B;  2AHO A;  3G6E B;  1AIP A;  4Z4S A;  2YWF A;  3WXM A;  1S72 B;  3W5V A;  4G1V A;  5KNL A;  3CC7 B;  1PJ7 A;  1M90 D;  1YI2 B;  1SKQ A;  1E79 A;  3ASQ A;  1T6X A;  2CND A;  3E1Y E;  4II3 A;  4YAW A;  4XD7 A;  1TUI A;  1GJR A;  1FRQ A;  1N06 A;  3R6J A;  3ZZT A;  1FND A;  3Q6Q A;  4YAL A;  1G7T A;  2KVO A;  3T53 B;  2XND A;  4WWV A;  1NDH A;  2WJV A;  4YAO A;  1E43 A;  4YEL A;  3VNU A;  4U9U A;  4KKU A;  1S4M A;  5L46 A;  1QVG B;  2V7T A;  1YX2 A;  4QUZ A;  1BPL A;  5TY0 A;  2CF4 A;  2CK3 A;  4Y9U A;  1W0J A;  2DCU A;  4XLE A;  3T56 B;  4B4D A;  4PGO A;  3PEN A;  4QHY A;  3FPK A;  2D3L A;  2DYI A;  1T6Y A;  2VZL A;  2GRE A;  4RJL A;  3SLD A;  1BMF A;  3OZV A;  3CES A;  4LBY A;  1VQ8 B;  1QGA A;  2P3M A;  1P4M A;  2JJ1 A;  1OGJ A;  3ASP A;  4Y7C A;  3R6K A;  2QA4 B;  4X0C A;  2JIZ A;  1WOP A;  2HMA A;  3ZPN A;  1OHH A;  3B8H A;  5FNZ A;  1EXM A;  3MMP A;  2ZZE A;  4WZK A;  4X06 A;  1QVF B;  4P25 A;  1FNM A;  2C78 A;  2RC5 A;  4XLC A;  1MAB A;  1UD4 A;  1K8A D;  1WSR A;  2BF4 A;  2XEX A;  1YJ9 B;  1W9X A;  4PAA A;  5B6I A;  5E6T A;  2V7V A;  1CQX A;  2D74 A;  3W2I A;  3ZBU A;  1GAW A;  3A35 A;  1N8R D;  1G7R A;  1EP2 B;  2B5O A;  3CPW B;  3AVU A;  2ZXI A;  1K9M D;  3ZC3 A;  5IYN A;  4TMT A;  1GR1 A;  2B7B A;  2J7K A;  3OJW A;  4P22 A;  4QVA A;  4RLZ A;  4Z4Y A;  2Z6B D;  1Y0Y A;  4UZF A;  2FVG A;  1HVX A;  5BSX A;  4XNF A;  3ZBT A;  1Q9S A;  2X8K A;  1FNC A;  1EFR A;  1A8P A;  2Q6I A;  3OZU A;  4P26 A;  3OOC A;  4HE5 A;  3I56 B;  1I8D A;  2C5B A;  4B3G A;  3ZIA A;  1Q86 D;  3CC2 B;  2JN9 A;  1Q82 D;  3GSI A;  2XOK A;  2Q6L A;  1E3Z A;  2X85 A;  2C2W A;  5F4J A;  3OEH A;  4AF7 A;  1QGZ A;  4ACA A;  1HZE A;  3SJZ A;  1YHQ B;  5HZA A;  1JA1 A;  4RD1 A;  1JA0 A;  1G7C A;  4N3G A;  3D26 A;  1E64 A;  2VBV A;  1TTT A;  5FA6 A;  1W34 A;  3JQQ A;  1YIT B;  4OPS A;  4ACB A;  3BC9 A;  1EP3 B;  1UMK A;  1VLO A;  2V7Q A;  3CB4 A;  1EFU A;  3AGP A;  5FL7 A;  1H42 A;  4XLA A;  1VQN B;  3WQZ A;  1ZM2 A;  3MCA A;  4LBW A;  2WJY A;  1BLI A;  3QFR A;  2NV4 A;  4ZGQ B;  5F4O A;  2WR8 A;  4P12 A;  1HA3 A;  4IW3 B;  4M4S A;  5DSZ A;  1XE1 A;  4RD2 A;  2W6I A;  4TSF A;  3A3G A;  3ONU A;  1S0U A;  1KZL A;  1UD6 A;  4XOP A;  2VNK A;  1F60 A;  1N05 A;  4PC2 A;  4UZE A;  1T6Z A;  2VJI A;  2BV3 A;  1E62 A;  3ZZ0 A;  4TMX A;  3P26 A;  1PJ5 A;  2RC6 A;  1GO2 A;  3H94 A;  2GK6 A;  3BQJ A;  4FXU A;  4P1V A;  4AVZ A;  1E1R A;  4C43 A;  2EFG A;  3QFC A;  2OK7 A;  4B48 A;  3QSY A;  3GIR A;  3T51 B;  4PC6 A;  4XMY A;  4RDL A;  2W6J A;  4PC7 A;  2HLD A;  5H5J A;  4FWT A;  1VQP B;  1W0K A;  1OB2 A;  3CC4 B;  1VQM B;  3V7A A;  3PA1 A;  1QX4 A;  2X6W A;  1E63 A;  4YAU A;  2PE3 A;  3SLN A;  4RCZ A;  1AMO A;  2XZP A;  4PAB A;  2EIX A;  1E1Q A;  1ZUN B;  4P3I A;  3FPP A;  2V7X A;  4FN5 A;  2C5H A;  5FO1 A;  5JBQ A;  4X7D A;  2ZL6 A;  1QUF A;  2I1L A;  3B78 A;  4ZCL A;  1EWY A;  3H9N A;  2BMW A;  4WZT A;  4YEJ A;  2QMU A;  1DDG A;  3WND A;  1VJS A;  2F43 A;  3A8K A;  1WU8 A;  3AST A;  1VHO A;  4YXW A;  1SKY B;  4XM3 A;  1QGY A;  1UD3 A;  3CRZ A;  1VQ5 B;  3HAG A;  4OPV A;  1IJE A;  3PVD A;  1W2B B;  1PKV A;  1GVH A;  1VQ9 B;  4X7E A;  2ZTG A;  2D9R A;  5IK2 A;  3BCD A;  4Z4T A;  1R5B A;  3BNW A;  4XLF A;  4MYU A;  2E1B A;  2VYQ A;  3OJX A;  4K1X A;  3NE5 B;  4OPO A;  4UAJ A;  5IYP A;  1QUE A;  4X07 A;  1B23 P;  3RY8 A;  2BVN A;  1T5E A;  2OBS A;  2QTL A;  3CMM A;  4G6I A;  1B2R A;  1VQL B;  1KK2 A;  2BPO A;  1UD2 A;  3CCQ B;  4P3Y A;  1KD1 D;  2WYR A;  4YHB A;  2F1M A;  4DNR B;  3Q6R A;  4QV2 A;  1OGI A;  1EP1 B;  1VLY A;  4OP7 A;  5EMN A;  4E0F A;  2VBU A;  4XOT A;  1BX0 A;  1EFT A;  4ZGN B;  3I1F A;  1I18 A;  3SKB A;  2D3N A;  2DOG A;  4QFM A;  3FJO A;  4XR6 A;  1KRH A;  4R71 A;  1D2E A;  1WOS A;  1EFC A;  3W2H A;  2GJP A;  1DAR A;  3JU4 A;  3OEE A;  4PC1 A;  3VMF A;  4Z4W A;  1U2R A;  5J35 A;  3VO2 A;  5IYR A;  2PLF A;  3DDY A;  3CCR B;  5DN6 A;  2X6Y A;  4TMV A;  3VR6 A;  3CP8 A;  4Q7J B;  3I55 B;  4XQF A;  3LVB A;  1KTV A;  4B3X A;  1WTH D;  4N3N A;  1NJI D;  4RCY A;  1SM4 A;  4TMZ A;  2YWH A;  3OZW A;  4P6Y A;  5AN9 A;  2V4D A;  2FX3 A;  1QFY A;  4EH1 A;  5A8A A;  3G71 B;  5THX A;  3W5U A;  1PJ6 A;  4B47 A;  3PUN A;  1IHM A;  1IJF A;  1N08 A;  1BQE A;  3A8I A;  3ASS A;  4Y9R A;  3U2Q A;  4Z4V A;  1KMH A;  2ZTN A;  2C77 A;  1KK1 A;  1W87 A;  3OP1 A;  4KKT A;  2HDN B;  4ZCM A;  4GQN A;  2GJR A;  4WZE A;  4FK8 A;  3LQ6 A;  4RPD A;  1NB9 A;  3ASR A;  1K28 D;  4X05 A;  3E20 A;  3PA2 A;  4C0S A; 
#chains in the Genus database with same CATH homology
 3GVL A;  2GK6 A;  3H94 A;  1BMF A;  4FXU A;  3CES A;  2JJ2 A;  1E1R A;  4AVZ A;  2XZO A;  2JJ1 A;  2R9V A;  4XON A;  4DK1 A;  2WSS A;  3T51 B;  3KEW A;  2QE7 A;  2GK7 A;  1V0E A;  2W6J A;  2JIZ A;  2HLD A;  3ZPN A;  1W0K A;  1OHH A;  2ZZE A;  4XLC A;  2X6W A;  1H8H A;  1MAB A;  1UD4 A;  2XZP A;  2ZXH A;  1E1Q A;  5CDF A;  3FPP A;  4G7W A;  2ZZG A;  3CP2 A;  1W9X A;  4YEJ A;  2WZP P;  1UD8 A;  3A3B A;  4TT3 A;  1VJS A;  2F43 A;  1NRK A;  2DIE A;  2X53 S;  3A35 A;  2ZZQ A;  3OW7 A;  4UZU A;  2ZXI A;  3FKS A;  4YXW A;  1SKY B;  4XM3 A;  1UD3 A;  4XLH A;  3GQB A;  4TKO B;  3HAG A;  4P22 A;  5HKK A;  2Z6B D;  4ASU A;  4JMQ A;  1PKV A;  1HVX A;  4XNF A;  2ZTG A;  1OB0 A;  4XN3 A;  2VJJ A;  5IK2 A;  1WPC A;  1NBM A;  2X8K A;  2LZJ A;  3BCD A;  4XL9 A;  1EFR A;  4XLF A;  2E1B A;  3GVK A;  3OOC A;  2XZL A;  3NE5 B;  1I8D A;  2M5S A;  4XKW A;  4G6I A;  1T5E A;  4B3G A;  3CMM A;  3ZIA A;  2V31 A;  3BH4 A;  3BCF A;  1UD2 A;  1VF7 A;  1UD5 A;  4NNJ A;  2XOK A;  1E3Z A;  2F1M A;  2X85 A;  4DNR B;  4XKV A;  3OEH A;  4Z1M A;  1VLY A;  3OPO A;  1HZE A;  4E0F A;  3OAA A;  4L8J A;  4XOT A;  1COW A;  1H8E A;  1I18 A;  4XN0 A;  4DK0 A;  2JDI A;  4XOR A;  3GVJ A;  2D3N A;  4XR6 A;  3OFN A;  2GJP A;  3JU4 A;  4G7X A;  3OEE A;  5KNL A;  3BC9 A;  4KKS A;  2V7Q A;  1WP6 A;  5FL7 A;  1E79 A;  3DDY A;  4XLA A;  4HIZ A;  1FX0 A;  4II3 A;  5DN6 A;  2X6Y A;  4XD7 A;  3WQZ A;  3VR6 A;  2WJY A;  1BLI A;  3CP8 A;  4XQF A;  2KVO A;  4DNT B;  4B3F X;  1WTH D;  2XND A;  3T53 B;  2WJV A;  4YEL A;  1E43 A;  2WPD A;  2ZZF A;  1E3X A;  2GJK A;  2V4D A;  2W6I A;  3G05 A;  4KKU A;  4TSF A;  3A3G A;  1BPL A;  2XGJ A;  1KZL A;  2CK3 A;  3T56 B;  1W0J A;  1KMH A;  1UD6 A;  2ZTN A;  3OE7 A;  4II2 A;  4XLE A;  4XOP A;  3LNN A;  4KKT A;  4GQN A;  2GJR A;  1V0F A;  2VJI A;  2D3L A;  1K28 D;  4XMY A;  2X6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...