1QGZA

Ferredoxin:nadp+ reductase mutant with leu 78 replaced by asp (l78d)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRDYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ REDUCTASE)
publication title Role of a cluster of hydrophobic residues near the FAD cofactor in Anabaena PCC 7119 ferredoxin-NADP+ reductase for optimal complex formation and electron transfer to ferredoxin.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qgzA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qgzA02
4MYUA 3FJOA 4RD1A 3VNUA 1D8TA 5TR9A 3I55B 4LC0A 2PLFA 1E64A 3AGPA 3W2EA 1CQXA 1JB9A 1FDRA 1ZM9A 2YWFA 2YWGA 1R5OA 1N0UA 4FN5A 2BV3A 3U2QA 1DDIA 4C0SA 1OGIA 4B48A 4YAUA 1VQ8B 3AVTA 1KK1A 1QH0A 1GAWA 1BX0A 2XNCA 2HMAA 2DETA 2C77A 4B47A 4ZGQB 4DQLA 4C43A 3WNCA 3OZUA 2AHOA 4HE6A 3WNBA 1YJNB 4EH1A 3P27A 1J9ZA 1DDGA 1FNMA 3ZC3A 4YHBA 2VYQA 3CCEB 1Q7YD 3CCUB 1QGYA 1ELOA 1G7SA 1FRQA 1CNEA 3J81k 4G1VA 1EFUA 3SJZA 2EIXA 3CMEB 3QFRA 1YJ9B 1VQMB 2VNIA 1AMOA 4TN1A 3A1FA 4YAFA 4TMWA 4IW3B 3CCQB 5H5JA 4F7DA 2C78A 5JBQA 1ZM4A 5FA6A 5THXA 1GR1A 4UAJA 5TV2A 4RD3A 4LBVA 2PMDA 4P6VF 1VQOB 4ACBA 4YAWA 4N3NA 4FK8A 3W5VA 3VNVA 1QUFA 1KD1D 2BSAA 1R5NA 1QFYA 4ZGNB 2BMWA 1KTVA 2VZLA 3E1YE 4TMVA 4NBSA 1D2EA 1QX4A 4LBZA 4HE5A 1M90D 1OGJA 3B8HA 1VQ5B 4TMXA 4Y9RA 1UMKA 3I1FA 4H9GA 4BPRA 1S72B 4ACAA 1GO2A 2EFGA 1Q82D 1QFJA 1M1KD 2HDNB 3WYAA 1U2RA 2B7BA 5GV7A 3W5UA 3VO2A 1W35A 3CC7B 4YALA 1IJFA 1Q86D 3ZZTA 4B4DA 1QG0A 3MHPA 3LO8A 3W2HA 2VNKA 1ZM2A 4WQMA 1VQ7B 1EP3B 3CC2B 1YJWB 1W34A 3B82A 1KJZA 1W87A 3CPWB 1KRHA 5AN9A 5HXBA 3OZVA 2NPFA 1I7PA 5H59A 1YI2B 4AC9A 4ZCLA 1K9MD 3CB4A 3CCJB 4M53A 3ZZUA 2B7CA 2QN6A 1QVFB 3AGQA 1FRNA 2D74A 4TMTA 3VMFA 1QGZA 3WBKA 1BQEA 1FNCA 3CW2A 3LYUA 4FWTA 1R5BA 3E20A 1VQ9B 1JJ2B 4RCYA 3JQQA 2QDXA 4PC7A 3V76A 2BGJA 5KSWB 2VNHA 1DARA 1BJKA 1EFTA 1AIPA 3CD6B 3CMAB 4Y7CA 4ZCIA 5EMNA 1EFCA 4PC3A 1KK3A 1S0UA 2DEUA 1KK0A 4G5GA 1SKQA 3CXCB 4J0QA 1GAQA 3VO1A 2BF4A 1JA1A 1KC8D 3B78A 4PGOA 4QHYA 1SM4A 3AVVA 2BN4A 2BGIA 2DCUA 2OTJB 2GQFA 4Y9UA 3CC4B 2DERA 3W2IA 1G7CA 1NDHA 1F60A 3U6KA 1WDTA 3OZWA 4B43A 3P26A 4G1BA 1JNYA 1TLLA 2QMUA 4YAOA 3MMPA 1VQPB 4M0LA 1E62A 3AVXA 1EP1B 3ES9A 1TVCA 3U6BA 1N0VC 3WY9A 3G4SB 4R71A 3CCVB 3W2GA 1VQNB 1VQKB 1QGAA 1VQ6B 5TY0A 1IB0A 3W2FA 1ZM3A 2DY1A 4M4SA 4NCNA 2GPJA 1K8AD 3CCLB 3PENA 3QSYA 3ZZ0A 4RCZA 4RD2A 1XB2A 1QUEA 1VQ4B 3CCRB 4U9UA 1DG1G 1XE1A 2R6HA 1D1NA 1EP2B 3I56B 2XNJA 3AVWA 1G7TA 4ZV4A 2BM0A 3WXMA 2CRVA 3G71B 1TUIA 4M1KA 3CCMB 1A8PA 4Q7JB 1B23P 2ZITA 3QE2A 1YITB 1GVHA 1QFZA 1IJEA 1CNFA 1H85A 1EWYA 1KK2A 2BVNA 1B2RA 5DSZA 3OJWA 2QEXB 4RJLA 4N3GA 3CCSB 2HCJB 3LRXA 2QTZA 4RD4A 4P3YA 1HA3A 1NJID 1YHQB 1TTTA 1OB2A 4PC1A 2E1RA 1K73D 3OJXA 4QFMA 1GJRA 1JA0A 3AVYA 4B3XA 2BM1A 3ZBTA 1EXMA 2BPOA 1W2BB 3FPKA 4MYTA 2OK7A 2B5OA 2YWHA 1VQLB 1Q81D 4AF6A 1ZUNB 1YIJB 2X3UA 2CNDA 3W5HA 3WBJA 2QTLA 2OTLB 2RC5A 3OW2B 1F20A 3QFTA 2QA4B 1FNDA 2YWEA 4LBYA 2XEXA 2VNJA 4PC6A 4LBWA 3JQPA 3QFCA 4ZCMA 4AF7A 3WNDA 2J7KA 4M2LA 2OK8A 2FX3A 4B44A 2RC6A 3JQRA 3LVBA 1BX1A 3G6EB 3CRZA 1OB5A 1E63A 3MCAA 5GV8A 4DQKA 4RD6A 2PIAA 1KQSB 3QFSA 1QVGB 4RD0A 3ZBUA 1FNBA 1H42A 4TMZA 1N8RD 1G7RA 3AVUA 4PC2A 4K1XA
chains in the Genus database with same CATH superfamily
1CSEE 4GR5A 1C7JA 4F1JA 1QP7A 1VE3A 4RA9A 4MYUA 3GCXA 5A5EA 3VZCA 3MBOA 4NFLA 5G0VA 5JE8A 2BISA 2QSZA 3CBQA 5CT5A 3ED5A 1KEEA 3URKA 1R4MB 1WHSA 2XKBA 4OKNA 4GM0A 2PZLA 4YRLA 5A4MS 4L0MA 4HRAA 3OQBA 4LYEA 5G0WA 4WNAA 1VRVA 2QU7A 1RCUA 5GZ6A 5HMLA 1A71A 3JQBA 4EAAA 3V8RA 2F3TA 2PYZA 2G5GX 4XYGA 1CUDA 3TH5A 3UMSA 1LPSA 4ZWNA 1E0JA 4QXAA 4A0QA 1G19A 5CFOA 2B1IA 5BSTA 1QE5A 3AH8A 4P1ZA 3TEJA 1W8IA 2FF7A 3CNEA 3OY2A 4PW0A 3B3JA 1RHQA 2OD9A 4FFLA 2P68A 4G8DA 3VI3B 1L4LA 3K9FC 2XMCA 4JVOA 3UHFA 2A3RA 3SIWA 3O7WA 2ZJZA 4DUZB 1PGJA 2HU7A 1VCOA 3I12A 2BEUA 5BVHA 3D0OA 4KU4A 2I2FA 1W0JA 1OI2A 2I67A 4L5YA 4P4UA 1ZH0A 2BCEA 5HS4A 1B00A 3V4PB 5E3HA 2DOGA 3UB2A 5T8KC 2OBTA 1VP3A 4NULA 3VHXB 2COEA 4J03A 4JU8A 3TUZC 5E9WA 2H1OA 3WGIA 2EKLA 3GA0A 3QEBZ 5F98A 1ZMXA 2ZCVA 4MR9B 2Y1CA 3TI7A 1I3KA 4EI8A 3F3KA 3VGJA 1FSSA 3BMCB 3QLUA 5FI1B 4RHYA 5HGJA 1ORWA 5IWAB 1PG0A 3JD0A 4WFQA 4E21A 1V1MA 1KS9A 4PSAA 3AR8A 3AFMA 1G38A 3CCUB 3V00A 1QGYA 1T6YA 1D2RA 1G7SA 1O97D 2QY9A 1NYLA 3GO4A 3DE2X 1PTJC 1W59A 3CJRA 4DBLE 4BEVA 1P19A 4Q37A 1XZHA 1IHPA 4JYPA 1W36B 3FDZA 3A1VA 3C3XA 3LCUA 3W78A 1X38A 5AVRA 1U4OA 3JVDA 4LOJA 621PA 3PQEA 4FHFA 1V3QE 2FN3A 2FAXA 2A1UB 1ZONA 2HR1A 3JWJA 1VQMB 5GVRA 3TB6A 4DCPA 2J46A 3G6KA 1ISIA 3T1HB 1ULUA 4MWGA 1CPYA 1ZJWA 1WKCA 4M9QA 2XUFA 3MJHA 4ILEA 2FUG6 3ZCRA 2PX0A 3F6BX 3GLSA 4Z99A 4D92A 2WYWA 1ECBA 4I50B 4TN1A 1NOIA 2FSSA 3EVFA 1MRZA 3ONNA 4UU8A 3FMIA 5A5DA 3QU2A 4YRPA 4PBRA 4XGKA 2R65A 2ZJ3A 4XOTA 4AZ3A 3CX4A 4QOHA 3UMRA 1KYYA 3INRA 1NFFA 3DNFA 4Q7LA 4CLXA 3WBBA 4UBOA 3U48A 6REQB 2GN4A 4MVJI 4OLHA 1E4EB 2A9KA 1VL6A 2DRIA 2ZUVA 1SURA 4H4CA 2GM9A 1KPGA 3GOQA 4ZCSA 1C9KA 3KR0A 4HUQB 4MWSA 3PNOA 1L2TA 2Y1KA 3H9QA 4UBLA 3UFXA 4DJJA 1PVDA 2CJFA 5B4TA 1K3UB 5CB4A 3THYB 1U0NA 4BECA 4AG5A 5AW6A 3QA9A 2WD7A 1QV9A 2QD2A 1QH1A 2GEJA 2RG7A 4Y98A 4BX2A 3HXTA 1M3SA 2KB0A 3D2LA 3GJ4A 3DWIA 4LUCA 3CP8A 2O7VA 2GZ2A 3F74A 4QBGB 3H42B 1HYBA 3RAGA 4XUCA 3TIIA 4Q4DA 1X8JA 1GZ4A 1SC4A 1YJXA 4B35A 1ULSA 2PAFA 3O8LA 4KB5A 4UM5A 2JN9A 1VE5A 3IILA 2CYAA 4N49A 4D46A 5LQCA 1H4QA 2PJUA 1WF6A 2WZCA 1HX7A 4PYOA 2YWDA 2ZUSA 3LYHA 4JX9A 4WA8A 2LUOA 3ILHA 1GPDG 4AS3A 1XXHE 3O8QA 3LF1A 4MWCA 3NOXA 2PJZA 4L6CA 4OX9Y 2JGLA 2AMVA 2PQ0A 4U8GA 2H0RA 4FOLA 1OGJA 1HV8A 2Q1UA 4Q9HA 4I1PA 1VQ5B 3S8YA 1BD3A 2RHDA 1QTIA 1RPTA 1Y3CE 1H8ED 4HS9A 4BPRA 5D87A 3SFTA 4BEBA 3C45A 1I5RA 3K5PA 5CDSA 2WQ7A 4KZKA 5I4IA 5LR6A 3P2IA 3DVAB 1AKVA 2OECA 3GRUA 5DHQA 4IGAA 5FHRA 4O3MA 1N2XA 4G4IA 4UDYX 5ESDA 4MXDA 5KTRA 5JSFA 3INGA 4EKDA 4NJEA 5ALPA 5BV1A 4NABA 4X7DA 1W76A 5FD8A 1FX0B 3JQ7B 2WV7A 2J1LA 5GV7A 3HKDB 2HL6A 3E9RA 2WOOA 1IK6A 2AYZA 2E4UA 3D7SA 2FZCA 3W7VA 5IKXA 3ILSA 1KY4A 3P96A 3FXAA 1DL5A 4JBGA 2HA0A 2J08A 1GZ6A 4BVAA 4DNXA 2VF7A 2PD4A 4E2WA 1OWLA 1Q6YA 2OM6A 1KRXA 4FINA 1QCYA 3A9TA 3UYLA 4DRYA 4FSDA 2GUGA 3TRIA 1WTCA 4M7PA 1E5VA 3FMOB 1Y3AA 3WLHA 4F6RA 3OE4A 2Z6AA 5JNWA 4DIEA 2HF8A 2OXFA 3TJRA 5IT4A 4X7MA 3MSXA 4WQMA 3TW8B 1VQ7B 5B12A 3T53B 3EODA 5JROA 4GECA 3I04A 4ZEWA 1S8AA 2XUHA 1LI4A 4ZKDA 2D7JA 4L0CA 2DHCA 2EEPA 4YO7A 4ALLA 3AY7A 3R5SA 2YN4A 4GC5A 2VBFA 4NESA 5AN9A 1H3FA 3PTLA 5JD6A 5HXBA 4KR3A 4KR7A 1T26A 5TPWB 3LX4A 1MXFA 2XCLA 1T4CA 1OU4A 1N9GB 3GRFA 3HDTA 4BGUA 5ENVA 1ZVKA 2AJBA 3FZEA 5AW1A 3PNSA 1A27A 3A9RA 4KFRA 2W6OA 4UBMA 4HDMA 2WF9A 2VLIA 2F1MA 3E3NA 3KQVA 1Q1EA 1UKYA 3LUGA 1A98A 2DFNA 1EVYA 4IV5A 1VHEA 4RVDA 5HCNA 5MN6A 2VDJA 1NX6A 4PHCA 3ILXA 2AMJA 2GBLA 3AGQA 2FXVA 2R86A 2UDPA 3HUEA 2WP0A 2ZYIA 3O95A 3R6WA 4RK0A 2SCUA 3GPIA 4NCJA 1BN6A 2Y8EA 2Z2ZA 3H7AA 3E5RA 3IEUA 1VLQA 1KI3A 4ITUA 1X86B 4PZDA 2ZE6A 4PQRA 4BFUA 1ITZA 1F2VA 3C4VA 1E2QA 3K70D 1PLLA 3M9WA 3PGKA 4C6TA 5C8XA 4XUEA 4E5NA 4JI0B 4JBNA 3A7DA 1WB9A 1T36A 1J97A 2Q6VA 4UTZA 3NHZA 4NZMA 1AKTA 4WIAA 4HPWA 3A6FA 4ARUA 1GNLA 1SKYE 3BXGA 1N2JA 2EKBA 4I4CA 2JBAB 3ZNOA 3M4YA 4RFSA 1UEIA 3IBFA 1LNSA 1BD4A 2D5CA 5A03A 2P3LA 5JLAA 3O73A 2QRGA 1C1DB 3AY6A 4MTCA 4EG0A 1P0CA 1C9JA 1P5FA 1YI8A 1I0IA 7REQA 3EZ9A 3VAZA 4RGQA 5SYAA 4HJXA 5NULA 3WSTA 3COSA 1XQWA 2V96A 1E1RA 2BJVA 3GARA 2CXHA 2PUCA 4KYUA 4B6PA 4HVCA 1S0UA 1TA4A 1ZHHA 4KQ1A 2FJ0A 2DG2A 1Z68A 1PP4A 1ID8A 5DMHA 3ZLVA 2XIJA 2R8OA 4GBGA 5F1PA 4K88A 4S1WA 4UU7A 4EKNB 1W0CA 4YT2A 4Y6QA 4YYEA 4BGEA 2ZSFA 1C3XA 3LXRA 1TAGA 2PGJA 1XQ1A 2C96A 3HKCB 4GYYA 2QGGA 1RM4A 3D59A 5DS0A 3HY3A 2DFDA 4YJHA 2XZDA 5IP5A 1M34E 4IDQA 1J42A 1V41E 1SVKA 1V6AA 1DPFA 1I01A 2I87A 3A6HA 3O75A 4HXFB 1OFTA 3SKBA 4FFVA 4U9HS 3RVLA 2YFKA 3NHJA 5A3QA 2OLJA 5BSKA 2ERYA 4R83A 4U7GA 1II9A 4A03A 4YONB 2P79A 5H16A 1R66A 4UEOA 3C8DA 5IBCA 5IYZB 4MGYR 3DOFA 4U8HA 4HVAA 5EP2A 4PXSA 1U7ZA 4C4YA 1X0XA 1Q0SA 3KJNA 4UTPA 3GB9A 2IGTA 3IV7A 4F4DA 2QLMA 2D6FA 2YMMA 2KHZA 4IDHA 2Q7DA 4E3WA 1RVDA 3NWOA 3OA0A 2XB6A 3GJ7A 2D3NA 3I6IA 5JLJA 3O2QB 2BKEA 3G0GA 3K8YA 4DJAA 2W11A 5JXJA 3NGXA 2JJYA 1IBLB 1I1QB 3U6KA 2OUKA 3N8GA 4YMIA 1RHMA 2H5JA 3L0PA 1OXKB 3MQFA 3ABSB 3MTBA 4U2KA 3PLNA 4PR0A 4I8XA 3GLRA 5FR1A 5A9SB 1WBDA 3HK2A 3GYGA 1Y7PA 1TLLA 2BKXA 1H2HA 1YZFA 2GHTA 5K3DA 2YVUA 4U5QA 3CW8X 3TL6A 2KLBA 2IU3A 3ZCSA 1Q83A 5KDDA 4M0LA 1H23A 2FUKA 1KHTA 1WUIS 3OX3A 4NHEA 4ZICA 1R15A 3OZCA 2LZ0A 1XD2B 2B61A 5CVJA 3PBKA 1ZOOA 2G83A 3HU5A 3QMVA 4QFCA 1IZ9A 3TKLA 2YYZA 1W5BA 1E7RA 1D4ZA 2GJAA 1Y4AE 4EO9A 5JJ5A 3TF5A 1DEOA 4OA5A 3I5YA 1ZHOA 5A0VA 4J29A 1T0PA 5AJVB 2R4QA 4YXWA 2ONZA 3DMNA 3QW2A 4G37A 2R85A 1WUJS 4UBJA 3PF8A 5HF9A 1MNAA 1NWCA 3W2GA 3HR7A 4J0EA 2BFPA 2D54A 4JI8B 4OGFA 5IWCA 5TY0A 1YJCA 2XQFA 3D8BA 2NT3A 2J45A 1AHPA 2P6RA 2CL5A 3BE8A 4IXDA 4YIHA 2DY1A 3LLSA 4M7RA 4P7KA 2AT1A 1NI4B 1OV4A 1E2UA 1M1YA 2KM1A 2QRZA 1F8FA 3EJ6A 1CUIA 1ZIYA 3MAAC 2NYVA 3AEKA 4F38A 4JH0A 3ZQ4A 4LWPA 1OIXA 2P3MA 4U0KA 2PL3A 3M33A 1OFVA 2I6UA 2Q3DA 3PUWA 5BO5A 3UAOA 1UBMS 2Q07A 5HCIA 3ZWMA 2D3WA 3DHNA 4M9ZA 4DIMA 1D1NA 1EP2B 3W4IA 4ZAGA 1E1KA 1JS1X 1XLVA 1LWOA 3PRHA 4DCGA 5KYTA 4RVNA 4WBNF 3GCDA 5H81A 3TXYA 3O1JC 1TM3E 2YFQA 4Z7QB 3A9WA 4X61A 4RHCA 1YB5A 2Q0HA 3FNBA 3OLZA 4J0DA 5C18A 5AYVA 2XRYA 1ULAA 3W6NA 1EE2A 4PZ0A 1EA7A 1S5PA 2OBFA 2QD1A 3H17A 4UDNA 2HPZA 1QIMA 3QE2A 1H6CA 1K6JA 2RHMA 1M2NA 4OATA 1ZSVA 5D7BA 1V26A 3PU6A 1HDZA 4Q34A 1VL8A 4XKWA 1ZGHA 3PC4A 1KK2A 2ZJBA 2H08A 4HYQA 1R16A 1A7UA 1XHLA 2O48X 1N6HA 2PD6A 1KYQA 2FSHA 3OJWA 1KF0A 2DKOA 1ORTA 2ZEJA 3B60A 3DR3A 2ESRA 2IHJA 3GEDA 2RGNC 3BC1A 1U1IA 2JRLA 3OLCX 1UXIA 3GVPA 4H3SA 3F5QA 4D9HA 2CVHA 3H9BA 5C9ZA 4N3GA 3CCSB 2ECKA 1QK4A 3PXDA 2E5LB 4N9QA 3UMFA 2C83A 3WIDA 3TX2A 1AO0A 1G291 2KLHA 4F97A 3KQNA 2OHHA 3LPLA 1SXJD 4DWOA 1YB6A 3B6EA 3P71T 1NAIA 4C4PA 4IS2A 4EHKA 2HA6A 2VOEA 3AI3A 2NLOA 5KYKA 3Q9SA 4HQNA 1TTTA 2I78A 1YUNA 3IPRA 4CIYA 4TXMA 1VHOA 1GNQA 4MKGA 2C5HA 2VUHB 1N7IA 2RGEA 2X0JA 1JP7A 5HZBA 2DYKA 4S0XA 2PE5A 1V8FA 4DCSA 4OK5A 4EJ0A 3H2SA 2WD8A 3A6DA 3JZIA 3GEGA 5EHQA 3KPJA 3U7QB 3VC7A 1R4MA 2PM8A 3S7ZA 3ESZA 3HJNA 1KOFA 1MAVA 2AUMA 4R2XA 4N0EA 2IV3A 4RJ2A 3CZCA 2X9VA 1NN1A 1Q22A 2Q4TA 3G0DA 3C3YA 1E94E 2GF2A 4PO1A 4DQDA 2V9ZA 3OHMA 1CV2A 3D5TA 4NV1A 2YJGA 4PHFA 2GK3A 1KAQA 3UHPA 3EC7A 4L8VA 5E1OA 2YQ4A 3NDBB 6GPBA 5B7NA 2HJRA 3A3OA 2WJJA 4BV2A 4DSUA 2OV4A 1OUMA 2BUBA 3U62A 4BVFA 4N47A 1VQ1A 3IIMA 4ON9A 4WKOA 4CLOB 4LRSB 1BMTA 1BJRE 1ZL0A 3DW3X 4K9SA 4XCQA 1JR6A 2C9ZA 3MUNA 3IIKA 3A70A 2AUTA 4D42A 3FCYA 2NTNA 4AJOA 4X3OA 2VDUE 4F4CA 1YR9A 1E61A 3CUSA 4L4UA 4LRYA 4GPEA 5EVCA 3VHXA 2VSFA 3DE6X 4DMLA 5KYGA 4EF6A 1JSCA 4XLEA 3H9GA 3T7CA 3H9EO 2C5BA 5DLYA 5DTJA 2Q6OA 4MR9A 2DU8A 3QMWA 4PAMA 3QI2A 3TZKA 5K8VA 1QJCA 2RKWA 3U3DA 2A1TS 2JFFA 4UEJA 5EIEA 4AQDA 4QOSA 1DJQA 3STYA 1U0EA 1IK4A 1SG9A 2F6RA 4DMFA 5BSHA 2I0FA 2YBDA 5LLDA 1Z8DA 3E15A 4Y2SA 1DJOA 3ZCXA 4FN4A 2WU4A 4WY5A 2D1RA 1L7NA 1XCBA 4XXHA 1IUNA 1H94A 3LKBA 4NXNB 3F6RA 3A25A 4DEXA 1DJNA 4Q39A 3SZUA 3Q8LA 2QP4A 2I33A 3TK1A 4JWTA 1JI3A 3G6EB 4AU1A 3S8EA 2A1UA 2ZYAA 5AK3A 1K7FB 5DHAA 4B40A 1NW7A 1N2EA 1YASA 2YY7A 3Q8WA 2XHEA 2LW7A 3FG9A 2OO5A 5K0GA 3ZHXA 3QFSA 1GTJ1 1C9MA 2F48A 4I50A 4M0DA 3FR8A 5D01A 2VO1A 4ZOEA 3UOAB 4D9FA 4WW0A 3PA1A 2V3VA 1CY1A 1YQDA 1P29A 3A6EA 3GRCA 4CM7A 4QJ4A 2QQEA 1BCSB 5FNZA 3GJTA 4O1IA 2EF1A 4LSMA 2O8BB 2WUGA 3OT5A 4IH1A 6REQA 1E4EA 4I3FA 4QOEA 3CF4A 3TZHA 4QA9A 2CGEA 1WY5A 1U8FO 2NV6A 3DOOA 2BLNA 4UOEA 1TKBA 3QEKA 4HUQA 2V45A 1N5OX 2EX1A 4FDUA 1K89A 1EGHA 4IQ0A 3THYA 1LRKA 3DTVB 4F9TA 2AOUB 1XT6A 1A50B 4LF8B 4FOTA 1VYUA 3E2MA 2XUGA 2A2ZA 4YLEA 3A1EA 4S24A 1JVBA 5E7MA 1VMAA 4HD8A 3DEYX 3L05A 4R31A 3R7NA 3SMQA 2C9YA 2FKAA 3DR5A 3OD5A 2AFIE 3B36A 1R5OA 1VE7A 2XUDA 3AJEA 3OIFA 1T0JB 4LQ4A 4EP1A 1B8VA 4H60A 2DQSA 1C1YA 1U0GA 3AZOA 3GGSA 3IVXA 1K5HA 3CZ9A 3TXAA 1YNSA 4MROA 3VVBA 2G3YA 3PDCA 2IZ6A 3BZWA 3MRSA 4JUDX 5DZSA 1D0IA 3I6ZA 4DC9A 3N2KB 4TWZA 2X6XA 2IYVA 1GGKA 3QUTA 1EVIA 3BWMA 4MDEA 5H83A 3ONDA 4ALMA 1ZICA 5BURA 2PGDA 4DTIA 4RF5A 2FPPA 4M9RA 2H4XA 3SQOA 2GILA 3RUFA 2J9YB 1KDOA 3L2OB 3HVHA 1YRAA 2OSVA 4O2BB 3G49A 5EP4A 1RQPA 4NE2A 1KDVA 2C07A 4EVSA 1XUOA 1TCBA 3BFXA 4C0XA 3EH1A 1YJNB 3QBVA 4G9GA 3TLGB 4A16A 3P27A 1XTTA 3AR6A 5LQUA 4BMSA 2P5TB 1EE9A 4MUNA 3IUYA 3DVAA 4HR7A 2NXEA 2PD3A 4MO9A 1LF0A 2R00C 3BUSA 4HNQA 3F5MA 4JT2A 2G1JA 1W0JD 3KPUA 2FCAA 3DM5A 2HIHA 3M2TA 4Z4QA 3NFRA 2JLVA 2VPPA 3CE6A 4DR6B 3DBIA 2N47A 1SU4A 3ZWVA 4CIBA 4NMHA 4TZTA 3K8QA 1FX0A 3OJLA 4XOUA 3JQ7A 3HKDA 2H59A 5K0FA 3L1KA 1JHRA 1NBMA 2G0NA 1IZZA 2NW6A 5J2UB 4ISBA 3S0JA 1VZ2A 3HRHA 2XA2A 5BYBA 2X8KA 3CMEB 3A6PC 5A6SB 4E07A 3DZBA 3FZYA 1VLHA 1GNRA 3O31A 5GZ1A 5C31A 1C0IA 2R7LA 1AB6A 4PLPA 3ZYCA 1LS6A 3KJFA 4FEAA 5K8UA 4R9NA 4TXHA 3Q7QA 4PYKA 2Z57A 3KQPA 2Q2OA 1NZJA 1UMBB 1ZMRA 3LZ6A 4J2TA 2IITA 2H17A 3ELUA 3KUKA 5FOSA 4XTCS 3CSUA 4YT8A 3V1MA 4Q1BA 2SKDA 3ZK7A 1X3SA 3TQIA 5JVDB 1G1MA 3WWPA 1TA0A 3VZBA 4I6GA 4TLEA 5JDIC 5JYBA 1Q2XA 3VOAA 1VRWA 1BS9A 1UK8A 1WU7A 1FDIA 4UZUA 4W6ZA 3PA6A 1U0SY 1TE2A 4IL5A 4IF4A 1EWQA 1OCEA 2E3JA 4C9BA 1QIKA 1DIHA 5TPWA 3ACDA 3OFVA 4IGFA 4P6VF 1N9GA 2W8BB 4YRRA 4QXMA 2ACWA 2DUUA 4J0GA 4TZKA 5KQGA 4Z5XA 1AV6A 4B3CA 4D9CA 3L3BA 4S3MA 5FBLB 2PANA 4FFOA 1BCRB 1DKMA 4ER5A 3O82A 1SUBA 2PUWA 4FBMA 1N4DA 3F6SA 1LF5A 4Q05A 3LVRE 5AI4A 4TMKA 3DOUA 3ZK9A 3AL2A 2DC1A 2ODEA 5SZIA 5TQVA 1L5MA 1B6TA 3MXOA 2UYCA 2QRLA 1C81A 3BF7A 1Y3HA 3DZGA 4QODA 3CSDA 1DINA 1R6UA 1EYZA 3I52A 3KV1A 2J4CA 1SZCA 3EQ7A 2BMWA 1G3RA 5BR7A 2DVMA 2ZTMA 1PJLA 3AXTA 5JATA 1J5EB 1GCAA 1QX3A 4XQCA 4Y0AA 4TMVA 3F9RA 1GRRA 4JCCA 4EY6A 4F4HA 1Z5WA 3WLLA 3ZGLA 1VI6A 5F4JA 2A5GA 4NPAA 4ZCPA 2BI4A 1JU9A 1XFDA 3RJ5A 3ZQUA 2JBAA 5IRCD 4MV7A 4MQ4A 1IPHA 1CZHA 1ZZEA 3DO6A 2B92A 2YJZA 1HFKA 1M7BA 3HCOA 3L6UA 1QOQB 3RARA 4H9GA 4OH1A 1O8CA 2VDMB 2GTPA 3H2GA 3WLPA 4EJSB 1C1DA 2WMOB 3R24A 4H17A 4BLSA 1P9WA 2OCPA 3A8KA 3IMFA 4INAA 1U1DA 2CV1A 4R6XA 2EBWA 1X8LA 2RAUA 1MA0A 2Z9DA 1EK5A 1HDCA 2RSLA 3FYUB 2R8PA 3GHHA 3BRSA 2CXRA 4PGAA 1QHEA 4HVLA 2WZNA 2OHGA 3GLFB 3GUZA 4BNGA 4QRHA 2CL7X 1O08A 1YRWA 2HDOA 1SCNE 2HBQA 5GGXA 3PC6A 3P9QA 2EGHA 2HF9A 3KJXA 2CMHA 1ISHA 1KDTA 4JLOA 3BIWA 1W4BA 3DBRB 3QELB 1LK0A 4ISCA 1A9QA 1ENYA 4DBZA 2XECA 3HKCA 5JYDA 3IVRA 4CTNA 3GDGA 1IYZA 3RIMA 4B82A 3FDIA 2WUDA 3DQQA 4BQQA 1UWVA 2AK3A 1Y4ZA 4XDZA 3ZZTA 1SG6A 4MRAA 1W1WA 3OT1B 3PRKE 4H0CA 3ZLBA 5DT9A 1PJQA 4QLOA 4XGNA 4B6GA 4AYWA 3T4XA 1AG9A 1VE9A 1HETA 1U1FA 2ODPA 2A58A 3WYNA 3ZCUA 1G42A 3D6FA 4Y8VA 2OQIA 5IYZA 3LCRA 4G4GA 3KSAC 1GKYA 4YDQA 2D1FA 4YBRA 1VJGA 3TMYA 4GWGA 5SY9A 5KWSA 3RRMA 2O23A 1W87A 3VDXA 2HSDA 5CT9A 3SKXA 1NXVA 2DLNA 1A82A 2RFLA 2JASA 3EWIA 3UUFA 2F2TA 3ZYZA 5JNTA 5KPJA 4FWBA 3JVEA 5BSWA 2WTMA 4EY4A 3L7AA 2H9AA 3OOWA 1QYCA 3CCJB 2APJA 4K6MA 2D62A 5G1NA 3WIOA 5CB8A 3DM9B 2HPVA 1C9DB 4PX2A 3QX7A 4RK7A 3B7GA 3GLTA 5JSQA 5A9SA 3FLBA 3WLAA 2B7CA 1P3JA 3F97A 2ZWVA 3NBAA 1TKCA 3H5NA 1RKVA 2VWPA 2Y2VA 3K4HA 1RJGA 5A62A 1JFVA 3BG5A 2JH9A 2FFQA 3BD9A 5FO0A 3E48A 3AP3A 3GFSA 3OFJA 1MC4A 5D85A 1Z34A 5EI5A 3GLIB 1EU1A 4ND1A 4TMTA 2OQ2A 3WRXA 3VMFA 4BAGA 4LF4B 4U2GA 4YDSA 1XD2A 3AWDA 4NV0A 4URYR 1OI3A 2ZJ2A 4U7PB 3L6BA 1ZOIA 4YUWA 4FWTA 1NY6A 1Z0ZA 4WSOA 3IBCA 3TCKA 3N8KA 1KGSA 1M5RA 5ALXA 3OP4A 3L7KA 4BCBA 5AUPB 1B0AA 1T3TA 1V1RB 2REBA 2J67A 3WHKA 1NPTO 5CVTA 5F73A 3AOEC 1V48A 2UXBB 1JKIA 3ENKA 3UGJA 2W2QA 1S3SA 3RS7A 3I1JA 4LNAA 3TQOA 4PC7A 2VJIA 2C98A 4ER7A 2WPNA 5CCXA 3QBDA 2XT0A 2VNHA 1R0XA 1UJ6A 2B5VA 2DBRA 5ARCA 3IJPA 4ZT7A 2V5UA 3ZV6A 1BJKA 2VF4X 3LC1O 5KPDA 1JKMA 2ECPA 2XMSA 3RRJA 1NI4A 3NAMA 1W94A 2W6QA 3OG9A 3P5SA 4BIMA 2XZPA 4TYQA 3SBEA 4ERXA 5IK2D 4AJ4A 3V1NA 2JJQA 4WFJA 4P3KA 5AKYA 2PWBA 2ZVJA 4C4SA 1Z5VA 1SQSA 1YL6A 1LC0A 2CEAA 2QVGA 2NO6A 2VP3A 1GXSB 2VS1A 3GZTB 3KD2A 3L6DA 2RGYA 1YFZA 3LDUA 3CVJA 1L5FA 2NZYA 2ZVDA 3PQ4A 3ZVNA 1GNTA 1V5FA 3P0HA 4M8LA 2WC1A 1SKQA 4KQEA 4KCGA 4MYDA 4GU5A 4Q5IA 3RNOA 4UD2A 4AY5A 3QX3A 3VO1A 1BWSA 1E1RD 3CUKA 1GKIA 1XU9A 3CWZA 1V37A 5SICE 2IZ1A 3DMFA 5JV5A 3HADA 1LC3A 1F8XA 1XEWY 5CGZA 5EUMA 3X2SA 5K20A 1E1YA 1GN9A 5G53C 3THXB 2UZ4A 1IM2A 1MJ5A 1W75A 1WSBA 2QXYA 1M2HA 3OLVA 4WWHA 2ZB2A 4XVHA 5BNTA 2HQRA 3HJHA 5CFQA 3STXA 2IHNA 4MJ7A 2PX8A 1JBQA 2QLTA 2JB9A 3A1DA 4G0XA 1DEKA 3WDLA 3HVRA 2B5WA 3PGJA 1ENPA 3KJIA 4QC2A 5HRCA 4EA9A 4ARIA 4F2PA 1CY0A 1XMVA 2R25B 2ENUA 1EX6A 3OKCA 4R5HA 4IIJF 5CA1F 2P2GA 3I72A 1F60A 2ZT5A 1KZ4A 1OPRA 2EARA 2HK7A 1QE0A 2JKZA 3AJAA 5DTEA 1GPH1 4QFDA 3C7KA 5ESWA 1RJWA 2ZYSA 3LKVA 2GASA 1TO2E 1GYPA 1HOTA 3EOZA 3DE5X 3I30X 3P9CA 4Y2QA 3HXKA 4X41A 1A69A 4A8HA 2I54A 2B8NA 4O6VA 1GL6A 4YMUA 5KWEA 1MBZA 2FUG1 4LN1A 4MWBA 1OW3B 4RSMA 2GOYA 2NG1A 4FOOA 5CPBA 3I5UA 5DNWA 1YFLA 3P2EA 4DK1A 3JYHA 3P19A 4PSCA 4S1TA 5BN3B 5KNCH 1HT0A 1YU9A 1N75A 5B1EA 3GA5A 2FP4B 4ZHQF 2FMFA 3OO1A 1Q0TA 3BA1A 1O97C 4J1SA 5ELMA 5KREA 3PEVA 2GLTA 2NU9B 4B4UA 3WY9A 4H6XA 2ZZEA 4UCXA 3HFRA 3ZWQA 1E9EA 3NTQA 3AKZA 3CCVB 5TF0A 5CDFE 1W2GA 5DHFA 1T5HX 4WJLA 4G5RA 4IDFA 1M6YA 3VZDA 4AVYA 2DQZA 4WVLA 3IQGX 4DNFA 1FMLA 2Z6BD 4WXEA 3RIEA 3X3HA 1JALA 3WGQA 3KYCB 4FNAA 3D81A 1E6KA 3FUTA 4JXJA 1GLGA 4GKKB 4RF4A 1FP7A 2UV8A 3L8DA 4NY1A 3ZXSA 4F8JA 4CLOA 4YXWD 3SNKA 3ZZ0A 4AZVA 1N8KA 3ZN2A 3AB8A 1YMUA 3GCWA 3NXKA 3ZCQA 2ZZGA 1M1NB 2WG1A 3GN1A 5HJ5A 1G1AA 5ICCA 3ZWNA 1OBVA 5C1BA 5AI5A 2M9MA 1VKRA 3UJNA 2CCJA 2NO4A 3B9RA 3CS3A 3ROFA 2LZJA 1E77A 4YAJA 1G8AA 4UW9A 1E99A 3IV9A 3VPHA 4BLQA 1YQEA 1JG6A 2RHTA 3PE4A 3ZHTA 1X19A 4GOMD 2DWOA 1ZH8A 3FVWA 4OL0A 5FOUA 4C4RA 5JR3A 4KRXA 5JSZB 3SE0A 1BWQA 1Z18A 4MUFA 1EGQA 1P8AA 3GROA 4P38A 1JXQA 3H9UA 1D5WA 2DMRA 2AQ8A 3F6YA 2PFGA 3QLEA 4J07A 4JJ7A 3N8DA 2V31A 3S1AB 1L7RA 1CHDA 2QGFA 3ID6C 5KC8A 1Z6QA 4F86A 3HDVA 3FX2A 3VNSA 2KMLA 5HBRA 1R64A 2HLHA 3I39X 1ZXXA 4P35A 2JD0A 2Q5OA 2DGDA 1B2RA 3O3OB 3JQAB 4IOJA 3N9IA 5DSZA 1NMZA 3QWIA 5IULC 1FRFS 4CMCA 2Q1YA 3HYRA 3URMA 3MIIA 3BY2A 2FR0A 1DC3A 4AMGA 3MS2A 4GXQA 3KQUA 1QB8A 4NDAA 1TL7C 3KDPA 1NJFA 1UC8A 3OZBA 3H84A 4BZQA 5LZ2A 2CHGA 1PEAA 5CIWA 2VJNA 3HZOA 2BGLA 3Q40A 2ZVPX 4NAUA 3TLKA 5C4GB 3U44B 3ADCA 1C8VB 3HACA 1G21B 1V3VA 1TJPB 2BI7A 2P5SA 1BCSA 3D7KA 3K31A 4OJQA 1VF7A 4UM9B 1ZD9A 2O8BA 1OYWA 2WHQA 1N1DA 1G0OA 3PNVA 4RLQA 5AK0A 5IUJC 1ACJA 1EJ2A 3LYLA 2VDVE 2H4ZA 4QUZA 3AVYA 1RBYA 1WD7A 1WXHA 1VYVA 2AI1A 2K2QB 2J3MA 4KRFA 4PQEA 1ODIA 1C3JA 1JPUA 2H18A 2B94A 2AOUA 2UUPA 1WVGA 3DTVA 3KZKA 4H7JA 4LZZA 4U39A 5CT6A 2LIPA 2X4DA 3RVRA 1HE8B 2YV2A 4ARAA 1H9CA 3CH4B 2FYTA 3V4RA 3MBKA 3CSSA 4G0QA 5ILOA 3CZ5A 3G9XA 3N8HA 3PUVA 3A27A 3ONUA 1LKZA 4D96A 2OFWA 2PG3A 1G41A 4ECEA 1XGKA 5ALQA 3TR6A 2Y4OA 4FI3C 3B9PA 3MHTA 2NGRA 2NU7B 2TMDA 1CQIB 3ECAA 3N2KA 1P77A 2IXTA 4GPIB 3G5AA 1KEPA 1YB2A 4P4NA 3EE6A 1QAQA 3LK7A 5HILA 2IIPA 5DDIP 1DT3A 1UQUA 1CU1A 3NUGA 4GZ3A 2P8SA 4LNHA 3OQIB 1FYDA 3SOZA 2YOFA 3FFWA 2Z2IA 1LWNA 2BGMA 2FCRA 1AXGA 4O2BA 3IC5A 5TJ9A 4LX0A 4AN4A 2B9EA 4JJZA 5LIRA 3GELA 4JP8A 2MYTA 4YV0A 5AW2A 3TLGA 4MP3A 1W7AA 4I4TF 5KUTA 4LBYA 2CFCA 1JR3A 4CEHB 4W7IA 3ITNA 4O59O 1GIAA 4CE6A 2FFBA 2QD3A 1PN3A 5JMTA 3HLTA 4E09A 2Q8PA 3FSEA 1LVHA 3KJHA 4R8MA 3V2IA 2QL5A 1WO8A 4P98A 4YASA 3OU6A 2JDIA 1PX2A 2W0SA 1U9IC 1QR6A 2FX3A 2VHXA 1E4OA 2ZTLA 4ZPJA 5DNEA 2GHRA 1KO7A 1CETA 4IAOA 1BE1A 3SIRA 2HC9A 3BN3A 2Q0XA 3I92A 2ECFA 2GJ4A 4NNPA 3WNQA 5J2UA 3CRZA 1R9JA 5T67A 5A6SA 3UMBA 1UADA 1R8QA 2PV7A 1W5AA 4M76B 4YMGA 1L5WA 3NMUF 3LPMA 4NZZA 3K70C 4CUZA 1WZNA 4GBED 2CMFA 2V3WA 2RGAA 3VI4B 3I1YA 1UMBA 2JGNA 3KE8A 1TW3A 1OYOA 4YMHA 5JSKA 2P27A 1W36D 1DS6A 4B3MB 4I2VA 1RWKA 3SEQA 3MCTA 4N41A 4IDPA 4K1XA 4YP9A 5JVDA 5CB6A 5D1HA 3DG9A 4YRSA 3TNLA 1XL0A 3HEMA 1Z7YA 1XR3A 2E89A 3AR9A 3HCDA 3EG9B 3SDBA 3WP1B 1C4XA 1R0YA 1Z0DA 2C2XA 4GAEA 1RE0A 1AJEA 1TU0A 2DFVA 3N2GA 3HBFA 4AKHA 2H4FA 4E5UA 1CYEA 2JJ1A 1G16A 2XXJA 1YJAA 1U7HA 5JW6A 1A4XA 1EG2A 1G5RA 4TRRA 4YEDA 1U9CA 4ECAA 4DLLA 5BMOA 1BCRA 2Y77A 3OCYA 3AV3A 2GLXA 3OTHA 3V6MA 4BO5A 1TDJA 2C7BA 4X0CA 1QGED 1CY8A 2JHGA 1ATZA 2OC4A 3HB5X 3HWX1 3B5IA 3REGA 2V98A 3TZ6A 3HH8A 4MB0A 2WKPA 4JL8A 1QS0B 2DPMA 2BF7A 3WIUA 1PQPA 1WOMA 3W04A 2WFMA 1XP8A 1MQAA 2REQB 1K0FA 2VR1A 3E7XA 4W4TA 1AS3A 2F9MA 3WKDA 2I1LA 5HP4A 4H27A 3O8BA 5C8ZA 1BKYA 4QO7A 1ZVVA 1LW6E 2W2VA 4TWRA 5GONF 5FO1A 2BELA 2HTEA 2YV3A 5B1DA 3U3JA 3DFKA 3GFGA 3KPWA 1L4MA 1N7JA 1ZU4A 2ZRHA 5FFMA 3FW1A 1T6BY 4YP7A 1CE8B 1RR6A 4IKEA 1VFPA 4OB8A 4D4IA 2IODA 5J3OA 4EJSA 5I7SA 4YHBA 2X0RA 3HU3A 4BX0A 4IILA 1XQ6A 3FYUA 3WLRA 1P62B 3GL9A 3ZW8A 3BIOA 4K6CA 4CN8A 3GT3A 3G5UA 2QUHA 1CUVA 2ZPUA 3GLFA 2GFIA 1JDTA 3Q7SA 2WIBA 2YXDA 2Z30A 4O1HA 3KXPA 3OZIA 1OT3A 4L3WA 2JFNA 4QZVA 1ZXLA 4CF3A 3DBRA 1I2ZA 2XVZA 3LQ2A 3QELA 3QFRA 1YJ9B 2A5DA 1PT7A 1S2DA 1Z4PX 2WU3A 4IJWA 4MJXA 1B1CA 4Q4CA 2QORA 4HT3B 2X2OA 1PZGA 1PBNA 3H0EA 3LQQA 2FSIA 3T35A 3OPXA 1X7HA 4M0CA 4QOJA 3OT1A 1VLMA 3GMDA 1DAHA 1FBNA 5GAJA 3EISA 1AKRA 5AHOA 1TJ4A 1QLHA 4HK4A 5IN5A 2VBSA 5H5JA 1NBMD 1GM5A 3PYLA 1DTEA 4OTZA 4YUZA 5BQOA 2B4AA 2RBGA 1BHQ1 2CFIA 2ABWA 1OWNA 2HZBA 4YJ2B 2I91A 5EHIA 1XV5A 2JLXA 3FWHA 3IHLA 4C1BA 2PMDA 1A2QA 3GLVA 3JASB 4EGJA 1JF8A 4Q47A 2WTBA 3QU4A 3F4LA 3OIYA 4D41A 1UOQA 2JZOA 1DEHA 1KJ8A 2Q3HA 1Y1SA 2R1VB 1Q7TA 4MW9A 1VA4A 4K0KB 4L73A 3PRJA 2WI8A 3CZRA 1D7OA 2WTNA 2X0FA 4HAXA 3TEFA 4QELA 3ZE7A 5F4MA 4UNIA 3M82A 4L74A 1ISPA 4BXOA 2IV2X 4ZGNB 4KXLA 2P9BA 1YRLA 4OP7A 2FRDC 5AT1A 5FNVF 1P7YA 5B58C 3COJA 3QHAA 3MJVA 4DR1B 3GLIA 2B4RO 2YV5A 4BVGA 4PS0A 1PQUA 2QRNA 1P5RA 4H2DA 4P7FA 4WJZA 1WXEA 4XQ9A 1OZHA 3KDAA 4K87A 2ETXA 2GEKA 1J6UA 2X5KO 1CIJA 2WZDA 2TRSB 2IYRA 1IXSB 1M90D 1M1YE 1UJBA 4I9GA 3ZH2A 1G5TA 1K98A 5EZQA 1F4LA 5HMMA 3PUMA 1IB6A 4N48A 4OA8A 1AC5A 3CTPA 4Y2PA 1M6HA 1ID1A 1YH3A 3OIGA 3UAVA 4Q4JB 1SMKA 1OQAA 4BJ6A 4F6LA 5J1TB 3ER8A 1YBAA 2EFGA 1DXHA 2B4KA 4YRGA 3GVIA 1PR3A 4ZC8A 5BOVA 3WGGA 4QEDA 2HDNB 3BC9A 1KNQA 2P9CA 1H69A 3ADPA 4CETA 2I6TA 4IVPA 1SXJC 2D06A 4ZU3A 3HQ4O 3FROA 3TQCA 1XZGA 2HQ1A 2VPYA 4HAUA 2C59A 3AP2A 4I5IA 4LMRA 3GFFA 4XDGA 1YUMA 1GXSA 3ORQA 5FWDA 3K0EA 4F9GA 1BE0A 3BH4A 4GQAA 2CDRA 4JJ4A 2XGSA 4P4GA 1RWPA 2PWYA 4ZQIA 2GI4A 3BIXA 1ISRA 1NP7A 1X1RA 3D0RA 3K20A 3EZ7A 3L49A 3A0RB 5ED0A 5SY4A 3H13A 3TIGA 2G1KA 2J0UA 3DMPA 1FVHA 1SXIA 4XM2A 4ZXPA 1H0HA 1CDOA 1MOQA 1A0OA 2CB0A 4ZQGA 2JCVA 3THXA 5DGDA 3AZQA 2ZSUA 3QVXA 5EQFA 5CA0F 1VJ5A 4WNYA 3RU3A 2F3SA 3P9XA 4MPDA 1ENOA 2X8AA 4S2EA 5BV7A 2D9RA 2RGCA 5U9CA 4D97A 3LQ6A 5F1OA 1GUFA 3RTDA 2HSGA 2ODQA 3I28A 1EDOA 2VRBA 4Q48A 3MGBA 3BFPA 3UT5B 2DQ4A 3TUIC 4TV8B 1J99A 1POWA 4RTNA 1H2EA 1M1ZA 1DQNA 1IMJA 3H9JA 3SQWA 4Y2TA 2AQKA 5ALYA 1NBWB 4YAGA 2IH2A 5JRZA 2ZS7A 3UNXA 3C97A 3LT5A 1XTIA 2JCGA 2OV3A 4KTVE 4MUIA 1TF5A 2YWCA 3WIBA 1HOXA 2NU8B 1CG6A 3EGCA 3WGVA 1KGDA 4CQNA 4NR0A 5BN3A 2HEGA 2ERCA 4CN9A 1R5BA 2HH9A 2VJMB 3QOXA 2FP4A 1Y1RA 5CAEB 2WWXA 1NN0A 1W29A 2JH3A 1R18A 3CNOA 5HTKA 2NU9A 3LUJA 4NOLA 1RHKA 3USES 5DULA 2IW3A 3MSCA 2ZSAA 4DKJA 4YCSA 1YF3A 2DLCX 3DFIA 1NG1A 5LPNA 1QRUA 4BGVA 3UO8B 1PFVA 1T4DA 1L9KA 3ORHA 3EDQA 3G9ZA 5AICA 2PRSA 4EOGA 5AJYA 5KSWB 4KC0A 3EFOB 3NX4A 3I01A 1O8BA 3K96A 2PT7A 3H4TA 3KYCA 4BB6A 4CI9A 3IPXA 2ZRNA 3TN7A 3UMCA 5BUZA 2QW0X 2IEIA 1NB0A 2LWIA 4I7EA 4LSZA 4NS1A 1VL2A 4L3VA 3G1WA 3K30A 5B58T 3KVRA 4B5KA 3P4UA 4S12A 5D5PA 3CN9A 4UUAA 1M1NA 3F47A 1E0KA 1FEZA 1XE3A 2XLCA 3JARB 4GRAA 3IP1A 1R6BX 4TL9A 3THWB 3IHKA 5KOJB 3DBLB 1RHUA 2BFWA 3VYSB 2O19A 1O96B 4N0PA 3MRVA 1UC9A 4DMCA 1P4HA 4ZT2A 3FNQA 3DMTA 4XX0B 1D1SA 4J0QA 5LU9A 4ZI5A 4WCDA 1FFAA 1E3ZA 1ZOSA 2J6IA 5JSZA 5LJIA 3CURA 3R76A 3LFHA 1FFYA 4JVSB 2CNNA 1XAHA 4QHYA 1F9AA 1Y5NA 1O6FA 3OHPA 3ADKA 3Q6NA 1W44A 4G23A 4J7AA 3S1AA 4R7TA 1G3IA 1PNVA 1GTRA 4KFSA 3TNDA 1Z33A 2BGIA 1N6OA 3D6UA 3NKVA 4RE6A 4DG8A 4ZYVA 3SQMA 3GN2A 5DCUA 2OGSA 3JW8A 3OF3A 3OUZA 3QMMA 3JD2A 2B98A 3ZVKA 1JEYB 3UJAA 3I2HA 4X71A 2AI3A 2X6YA 2PKYX 1QO9A 1NKSA 4ITRC 1DO2A 3U4DA 3KHSA 1Q20A 1XZNA 2G28A 2NOAA 4G24A 1KEVA 2HQSA 3JQBC 1MB4A 5AMXA 3HRKA 1IL0A 1CJBA 3NOOA 5HR5A 3OZWA 2O06A 2AW5A 4QVAA 2WYIA 4QGGA 1U0FA 5MF6A 4G1BA 2LD4A 4XI9A 4GYJA 2QMUA 3L8FA 5TF4A 3U44A 1CDDA 4YAOA 1AY0A 1G21A 1U0HC 4FFDA 4J91A 4LFCB 1RWOA 5BUSA 4HLUA 3NDRA 4LGVA 2VJCA 4DK0A 5ADUS 2A6PA 2MMGA 2CXXA 2W70A 5DI9A 4MCHA 4EG8A 1F48A 3I9OA 5BV2P 4AAYA 2G6BA 5G0UA 5IBPA 1P1FA 5P8WA 2EEZA 1E3DA 1U04A 1TVCA 4XWKA 3MLBA 5D00A 3G4SB 5TGDA 3AEUB 4R71A 4AKGA 4WN3A 1RYMA 4NU6A 5KDOA 1VQKB 1K63A 3AZPA 1T9KA 4UVGA 4C3UA 1NG9A 1RCTE 2JAHA 3QLUC 2E18A 3R6DA 4YRDA 3P0RA 4QUDA 1O9BA 5JCZA 3DBOB 3FYHA 3P52A 1XCJA 1J8FA 2PZBA 1MX1A 2EJCA 3GVCA 3NM6B 2I4MA 3OM9A 3R5XA 5EP1A 5G3YA 4DV2B 3AM5A 2B83A 1WQ3A 4N4AA 2IHZA 4OHXA 2NU7A 2WJHA 1NSFA 1Q7CA 3IGFA 1FMCA 1DKOA 2H2GA 3SQXA 3OQIA 4IJVA 4PG5A 5IKEA 4D0SA 2PLWA 2AOXA 1X7GA 2EF0A 2OKCA 1P1IA 4QUKA 3FI9A 4AYXA 3CPHA 1NL3A 4XVCA 3MT9A 4CEHA 1XI2A 2DTXA 1NP3A 2GXQA 2XRFA 4JEUA 4UNQA 4ZMSA 2OORA 2ZYWX 2WA2A 2D8MA 4MYSA 4RPGA 3WNZA 1I0LA 4KRGA 1Y3DE 2H4YA 3PNLA 3ZCVA 1BH6A 2OCLA 3VYVA 1TMYA 4ZJUA 3CX8A 4MPPA 2LTAA 3LFUA 3D3KA 3LNCA 4JSTA 1KJ9A 1PWHA 2RKBA 2GM5A 3KQKA 1JZSA 2VP6A 3EXAA 3IBTA 3TZCA 2AX4A 3JWEA 2UZ0A 3SHWA 2XUOA 3EIHA 1JHZA 2G1UA 3I6MA 1Z4JA 4KWEA 3UIEA 1DBIA 2NM0A 1HDIA 1OXUA 1T3LA 2WFAA 2QRJA 3AKDA 5ALOA 1DCTA 1E7QA 4EJFA 1OU0A 1Z2OX 2Y1XA 1YTLA 1NBIA 1RC0A 4CIWA 1DG3A 5FH9A 1ODJA 1TD1A 4H08A 4I55B 4EA6A 2F4VB 5DM1A 2HCJB 1AXEA 5EAIA 3HEAA 3TB4A 5HE9A 4HQFA 2WLSA 3T3EA 4JI4B 4YQFA 5IASA 3VH2A 5KYUB 1MR3F 3R9KA 1DIGA 1GGVA 2AR9A 4HAZA 4MRRA 4MEJA 4PAWA 5H9WA 3IAUA 2QW1A 3WAKA 1CUGA 4CGYA 5FXMA 1XMSA 1XDZA 2IVZA 1EDZA 4O4LB 5B2EA 2YZGA 3HYCA 3T7TA 3EG9A 2FSPA 2R6FA 3QEMB 2XXAB 3D6NB 4AJLA 4R6WA 3WGKA 4OH7A 4U2EA 5CLIA 1DLIA 1G3MA 2UZ3A 4LISA 3RPEA 3QYFA 4QDKA 5LMNB 3AKYA 2QL9A 1ND5A 1Z8NA 3IAS6 3MGAA 1VSVA 3OSUA 3BHNA 4AJNA 3KB2A 6Q21A 1WA5A 5KO2A 3JZMA 4RZQA 4OOXA 4R68A 5AHRA 1KY5A 3A2LA 3BXOA 3PX2A 2ZBVA 3RWBA 5EJ2A 4AIRA 1Z0FA 1BQ3A 3I5XA 1I10A 1MENA 5KNLA 1KSHA 4U00A 2ZAMA 2HN9A 3TSAA 4ZTBA 4E5KA 4RZUA 3PPIA 2IXAA 3C0KA 3NKLA 5DNDA 1QS0A 4QAJA 4CMBA 5LQKA 2ZU0C 1ML3A 3DTVD 3WLFA 4EHLA 1TJ3A 3HMKA 2N46A 2REQA 3L04A 3CKLA 2DUNA 3PHBE 1BVUA 4IXWA 1QLWA 1JU3A 4K86A 5ECGC 5EIWA 3S99A 3UJ3X 4BAZA 4LI0A 5F1KA 3A11A 3A8TA 4RAQA 4XGQA 1PD1A 4GZ6A 2XYGA 2J4FA 2YJ3A 4GOXA 1OWMA 4KOAA 3TLEA 1F20A 2WSYB 5FPPA 4II3A 3ZOKA 4LXTA 1TO1E 3I2JA 4ZT3A 4ZV9A 1CUFA 1K2VN 4GR9A 2GWHA 4GNRA 2MSEB 1CE8A 4Q15A 4UJ3A 2VI5A 3D4NA 3NRBA 5CM2Z 3ZE1B 4UHCA 1FK8A 5K8CA 2GDJA 4PYIA 1FFXB 1PR1A 2GZ1A 2WFLB 5LP6B 3CPSA 3O3NB 4KQHA 1JMVA 5DNAA 1TKAA 3KKQA 4W8GA 3B3FA 4F5YA 4IQGA 4IV0A 5AVUA 4YV1A 3WHPA 1YK0A 2CK3A 2P2SA 3CX7A 3KL4A 3WNDA 2ZUUA 5GOZA 2A8YA 4EPXA 2Z58A 2RH9B 4YDHB 3A9VA 5HS6A 3GVHA 3U80A 6ABPA 2WMDA 3JQRA 2FFRA 2I2CA 5AJHA 3ZTWA 2VYNA 3K92A 4BGIA 1JR3D 2NUTB 4C30A 2WUWE 1E7SA 4LEIA 1PJ7A 1W4AA 3TRDA 1I94B 2ZRIA 1QKIA 5LWHA 1JVSA 4AX4A 1HORA 5AW9A 5IJ9B 4BLRA 1C0PA 1JJFA 1YU6A 2Z3WA 3NT2A 1Z8HA 4XONA 4ED9A 3H6GA 1QZUA 1R0WA 3QV1A 4WZTA 3SJBA 4TKOB 1KE2A 5AVXA 2JDID 3GC6A 3R7WB 2JFOA 4RD0A 4R8SA 1T4BA 2B3DA 2B4YA 5REQB 2GBLC 4PZ9A 1LFAA 3GJRA 3PC3A 4TM7A 2EJVA 3V34A 3HXLA 1CF9A 1GCOA 4FZ5A 4I9FA 3ZV3A 4ZJZA 2EYQA 2ZL7A 3ZE2B 4LGCA 1ODTC 5B3KA 4YJ2A 5GADl 5AJXA 4ZI7B 5L3SB 2YKGA 3KEWA 1ZK2A 2VF5X 3KJZA 4PQGA 4YAIA 2Q8QA 3JASA 3PE6A 5I9NA 5JFGA 2O7NA 3ROTA 3UPDA 2WSBA 4FHZA 4DCCA 1TU4A 3PQ8A 2R1VA 3P9PA 3P94A 1Z16A 4NZYA 3O3MB 1V5IA 1PQ4A 5E1DA 1KVRA 3DHVA 2V7TA 3GXBA 1ZN8A 4PZEA 4ZU6X 5K3SA 3TCNA 3TM4A 4IHJF 4L78A 5GP1A 4B32A 1YI1A 4DJ5X 3JTMA 2Q8NA 5JXGA 3R0VA 2IE8A 3A31A 1NXOA 1M2FA 3IMCA 1XC7A 4B48A 1B15A 1VKZA 4KLCA 4NCIA 2I55A 4R41A 1PJ8A 1G9TA 2XW6A 2ZJ1A 3V7WA 2JJ1D 1HG1A 2EJUA 3W2TA 2PUEA 2F8TA 2H2HA 3D6TB 1B41A 1EFKA 3SJ7A 2VBCA 4NU5A 4YRZA 1BX0A 3JWIA 1M5TA 2VCEA 4L9WA 3PDJA 2VBTA 1Z74A 3TGPA 5EE3A 1U3VA 5A71A 3UV6A 5IVPA 2OKGA 5CX4A 4G7XA 1AA9A 2Z56A 3QXJA 4G81A 2HWUA 1L7EA 5HKBA 1H2ZA 4LZWA 4Q21A 4DIBA 2OTCA 1FP6A 2QT1A 1AN9A 3GK3A 4Q4JA 4R2JA 5HIMA 3TLBA 3NGLA 5JZ9A 2E6UX 3G89A 3ORRA 3S2UA 3G2HA 3PQ3A 5J5VA 3EEYA 4UMEA 4DZZA 3AEXA 5BT9A 4DABA 1T2EA 1NASA 5L7TA 1ADGA 3UJHA 3OPQA 1RZUA 2Q3FA 3VM6A 3ADBA 3R6JA 1USIA 2SECE 4A2WA 1V6SA 4HBZA 4EENA 2HU8A 4ZAXA 2DTEA 2OO3A 4KUHA 3K9BA 2XJ9A 1FSZA 5IVHA 2JGMA 1EFUA 4MV6A 4BN5A 3QU5A 3D2CA 3IULA 3MF4A 3TZLA 4JKYA 1JIVA 1W5TA 1SFRA 1VMDA 2YINC 4MWOA 2OHXA 1LDBA 4LRWA 4R8LA 1GZ5A 3VISA 2KX7A 4QUJA 5CDYA 3CYFA 2A4KA 1L4UA 4H4DA 4CUJA 2ORIA 2V1UA 1Y3BE 5CK4A 5TLSA 2VHCA 5ADWA 3EAGA 4IIXA 1RE1A 1YULA 4PXYA 3H94A 1OREA 4WKBA 4ASUA 2L82A 3VAYA 4LOHA 3OP1A 1BX3A 4CMIB 3NVMB 5KNCA 5KWVA 4JXZA 5JC1A 2CD7A 1S02A 2CFOA 4C5CA 5DCWA 1MC5A 1E2BA 3VX4A 5DBHX 1LJLA 4D56A 3ZKWB 1RD4A 4UAJA 2Q41A 5I6DA 3VFDA 3ZGXA 5THKA 4F45A 4LBVA 1IXKA 2Q6TA 2XMRA 1ABFA 4WAUA 2UVDA 2XGJA 1Q92A 2LNDA 3S27A 3KFLA 3EEFA 3DDOA 3DZ8A 4B85A 2GX6A 3ASPA 2OC9A 2PY6A 2X0NA 3NRCA 4XWGA 1FQOA 5ERXA 3KKOA 3PA2A 4FK8A 4WD3A 3UT5A 1BIFA 3VNVA 1UBCA 2ATCA 1KD1D 2EIHA 3ED1A 4R8VA 2WG0A 4TV8A 1BDHA 1JAIA 3D3EA 4MULA 1RAGA 1JPNA 1P0FA 4OUKX 1JI0A 1TEVA 4BQEA 1EVJA 1T8YA 1SIUA 4KKTA 2FSVC 2W2PA 1MC8A 1JAXA 2CMKA 3DZIA 3I6QA 1WX1A 5ICMA 2C0QA 3EZ6A 1XAGA 4Y3UA 3OHSX 4L9AA 4RX1A 4QU5A 1L7QA 2FMUA 4JNCA 2NU8A 3W0LB 2IVFA 3ZU2A 2FW8A 4ZKEA 3OECA 2OXTA 2G36A 2X77A 3BXPA 4OLFA 2GEVA 2V7GA 3X1YA 3BXEA 2GM4A 2VJMA 4N76A 4Q66C 1TZ2A 1VL5A 5CAEA 1KYVA 2B6NA 1GLNA 3I0MA 4IQFA 5HE8A 2HRDA 2X5JO 2I6SA 4RIEA 4X92A 4CT4B 4WK6A 3GGOA 4D57A 4URVR 4ETIA 1S3IA 4GE3A 1KEKA 2A33A 3DFUA 3DAFA 4GHWA 1DPGA 3TTSA 3FRHA 1JJIA 3EFOA 2YNMA 4LJ6A 2B8JA 2P11A 1D5CA 2FEPA 1C5KA 3IOBA 1JLSA 4F1KA 5FADA 1Z4LA 2OFXA 5AI0A 5FOVA 3WLSA 5KWJA 4P3IA 4HAYA 2BFFB 4RY8A 4NVRA 2VA9A 4I5DA 3FNHA 4KBYA 5A06A 3K9LA 4LOIA 4G4JA 3JARA 3O2JA 2JD2A 3THWA 1GAEO 3QY9A 5ALJA 5EJMA 3MFQA 1WCWA 3DBLA 5KOJA 1G17A 1HURA 1O96A 4JZKA 1QFSA 2AKAB 1MO5A 2HCBA 4R84A 5BW4A 1UZNA 4N5NA 3EZFA 4XX0A 1F6DA 9ATCA 4JJ8A 1UPAA 1YCGA 3AIKA 2G0AA 5D2CA 4Z4HA 5FPHA 5HWSA 2IF2A 3DTTA 4BVBA 4JUIA 3LY7A 4FNGA 2CVOA 4PX5A 3U9SA 4Z4ZA 3AF0A 3KM0A 5EJAA 4E46A 3B82A 1QKJA 5HCUA 1J56A 3CZAA 3Q7TA 4DGSA 3G2JA 3CPWB 3M83A 4DDMA 3IELA 4HUJA 4MVJH 3OWOA 2ZANA 4FFSA 4M54A 5IS2A 3RIGA 4OYHA 4QLBA 1L3BA 1QRAA 4AC9A 2GZAA 4G1FA 3GJSA 1UOPA 3DXYA 2X4GA 1IWBB 2OGWA 3LCMA 1NF9A 3VDNB 4MRSA 3ROKA 2X1HA 1YVDA 2J3JA 3E03A 4BMPB 4JLDA 4QEKA 4D9GA 4F04A 1DZIA 4UFNA 1WU8A 2FV8A 3CWCA 3OM1A 3AMVA 1I80A 1FRNA 1OD6A 2Y4NA 1O3YA 3T1VA 1H93A 2ZJ6A 2B20A 3W1WA 4OSPA 1VLJA 3HBNA 1HI9A 3HXPA 3OCVA 1HDXA 1PZXA 1V8ZA 4AULA 2QI9C 4Z54A 3NP7A 3AB7A 3LQEA 1OA1A 2XPCA 3AQIA 1YQQA 3IP7A 2O0KA 3EXG1 1COWA 4NJMB 3C7DB 3UK1A 2CF4A 4DYDA 3IEXA 4DIFA 1JJVA 1MB2A 2FJPA 3LP6A 3DAGA 3ASRA 1ZW1A 2WB4A 3AEUA 3KZNA 1TTQB 2IWHA 3U3OA 1EUDB 4AJ2A 4D0RA 4DDTA 4GLBA 4O33A 2EG5A 1A5BB 4HEA1 4LHSA 5D1NA 4ZAFA 3DC2A 3SYMA 2HSZA 2ZPAA 4EVIA 3ND5A 2NZJA 4OK3A 4KMRA 2YHSA 4EA7A 1K2WA 1KMHB 1Z2EA 2XWBF 3AUJB 3TMAA 2P9EA 5C80A 1J9GA 1X2BA 3QQ5A 2IJGX 5EMNA 3TTWA 4BRZA 3I9JA 3HWRA 3DZFA 3TW6A 1XOIA 4EFMA 2W90A 1SBHA 3PPVA 5C3UA 5KWIA 2DIEA 5CH5A 4GSYA 5H4GA 4X45A 5LOVB 4H6VA 2B30A 3EIQA 3LUBA 1C8LA 1FUEA 2EZ4A 4V0SA 5JO9A 1W36C 4G0YA 1Y9AA 2GJ8A 2JHFA 3LHKA 3M6WA 1P44A 3UWDA 3DV2A 2PHZA 1RWMA 3I9NA 1T3GA 3MM4A 3PJEA 2OXIA 2P69A 1SUSA 3FRJA 4KE8A 4AMVA 5F77A 1MO3A 1X9GA 4P5EA 3D5EA 1DVRA 2XVXA 2OO5C 3GUYA 3TLCA 4CIXA 1NJ8A 3JATB 1E9RA 5TEVA 1N2CB 4G0VA 2YCBA 3H18A 5GJCA 1BDMA 2PEZA 3FBGA 3PEEA 5ALHA 3UOGA 3TXXA 1T0HB 1TIKA 2QX7A 2IY9A 5A5GA 4JB0A 4ZEXA 1NQVA 1M2KA 4QQ8A 1ZD5A 4QDZA 2GVZC 5A02A 3GJXC 4REMA 5LYJB 2J5XA 5TMBA 1JECA 1P1KA 2ZRQA 2R1UA 3FTCA 1JFTA 2WIDA 4JJFA 4AT1A 5AXAA 4ZCQA 3QWFA 3IEMA 4C3ZA 4UNSA 4GOND 1LUAA 1S1CA 2YZ2A 4FDVA 5DGTA 4YWJA 2IYXA 3N0RA 3O92A 2ROQA 1EIZA 1GQFA 4MB6A 1Z15A 2EZ9A 1V1JA 2VHTA 4I55A 4XYBA 2VEOA 5B5SA 1EM8B 2FW7A 4BUJA 5LXTB 1BFDA 4B3GA 1PGPA 3OFKA 1XN1A 4R2LA 1DRKA 1TW2A 4OLJA 5KYUA 3JQAD 3ZE8A 4AMUA 2QVLA 1MABB 1MN6A 3OLYA 1XKQA 3LUPA 1EBFA 1I13A 1AGRA 2KVOA 3BB3A 2ZGVA 4MQUA 3B53X 4UZFA 1TLFA 2V0NA 4O4LA 4RHFA 3M1LA 1UBLS 3L7IA 5IAKA 2WEKA 4BRWA 1IHOA 1ACMA 3QEMA 1NDQA 4B6EA 2XXAA 4LXIA 1CF4A 1WDLA 3SP1A 5FBVB 3PCRB 4FQ8A 1SH7A 1ZGGA 2WKWA 3IESA 4ZV7A 2G9QA 3N8IA 4R2KA 2V7WA 1UJ2A 4NEHB 5H68A 1K06A 5TSDA 3JYNA 5I9LA 3BKWA 1FQWA 2H0QA 4XW2A 5DCYA 2G9RA 2Z2JA 3OPYB 4QXPA 4UM9D 1A9ZA 4X6UA 3H2BA 4C6HA 2PKEA 2OE2A 3AJ8A 3T8YA 4Q7QA 5BWLA 2FJUA 3ZD7A 1KOGA 2QVYX 1B2LA 3H7IA 3OZGA 3RK1A 3H1GA 1FZQA 3JWGA 1UQRA 1UZLA 3K0AB 4O4IF 1A5ZA 3HHPA 2G08A 1C14A 2W2OA 4Y18A 2V7VA 1C4KA 3L0BA 1ZI9A 3MOSA 1AQIA 1ZISA 3VGPA 5K0EA 1D1PA 2WABA 2ORVA 2G09A 1U0RA 3UHOA 1XE1A 1I4TD 2HW8A 3N59A 4JUBA 1XRLA 3K5HA 3GLFE 3RV3A 3P2YA 4DDHA 4UQLA 5A8AA 2XNJA 1K7SN 4RESA 1WE2A 1G7TA 2WWFA 4JL6A 4P2GA 1GDHA 4G97A 1ENZA 3RAEC 4JKOA 1QIHA 2VNAA 3OETA 3E1SA 3KLNA 4PABA 1FDTA 2ECOA 2JC3A 4QYMA 1WCIB 1RQNA 5BWMA 3UMYA 2WFLA 3RT1A 5F7XA 1P74A 4Q7JB 4FKMA 4P0PB 5JZVA 3C4JA 4Q1AA 1FP2A 4QU8A 2XY4A 1ANKA 2ZJOA 4CG1A 3TPCA 5AKKA 1E69A 3RS8A 2WNHA 5BSFA 2OCGA 5LP6F 1WY7A 1B16A 1XRSB 2FWAA 2GEFA 1ECPA 4UMDA 5AI6A 1QM5A 2CLFB 1T9ZA 3UN1A 1DKNA 1Z3CA 1QPBA 3B20A 1I7NA 4M8IA 1KDZA 3RWOA 2CXSA 3U17A 2Q99A 1AQNA 3AR4A 5IJ9A 1KKLA 1CY4A 4AO8A 4E2ZA 1QG6A 2YMPA 3PLRA 4MTLA 4EFKA 2Z5LA 3AFHA 4Z4WA 2Z83A 2C1EA 1BLIA 3MOIA 1HEUA 1SULA 4M98A 4KXQA 2AJ8A 3BL5A 3R7WA 1C2TA 4BWYA 1J7JA 1DRUA 1VDMA 3IO3A 4UC0A 1VC2A 3LG2A 3ZGNA 3ZW9A 3P0FA 4RD4A 5EE1A 5REQA 1YMVA 4N40A 4RTPA 2ID4A 1C3EA 4XIFA 1GZDA 1KYIA 2NUPB 4GMDA 5M3BA 4Z2YA 3A6JA 2JBHA 4R9RA 16PKA 3K09A 4IOKA 4NFYA 2C0PA 4ZI7A 5PNTA 5L3SA 3FPBA 2G1PA 5DP1A 1EGMB 3ONYA 3SM9A 5EKXA 4B09A 4KXUA 2P1DA 2ZRLA 3S8MA 2A9VA 3L77A 2QTHA 1NULA 3C3AA 4AXBA 2V9PA 5IAEA 3NW9A 4Z3OA 1RYEA 3H5TA 4GUAA 3VTFA 2QTBA 3CC8A 3DDZX 2D4AA 5DTQA 3MMZA 2OK7A 5WRFA 4EA8A 3D4IA 2G82A 2CBZA 3K9GA 3OLQA 2XYQA 4IRXA 3PUHA 3WLKX 1JX6A 1HC7A 4S35A 4PHTA 4AF6A 5DM70 2VZ8A 3UQZA 3FGNA 4UUOA 4D0GA 2CT8A 3O7MA 3IQHX 3MTGA 2ZWOA 3NLLA 2RHLA 2OY0A 4HI0E 3BTUA 3DMDA 3KB6A 4QBFA 3B1WA 4Y6LA 1NRWA 4IDGA 3V97A 5I7OA 2OBSA 4JKIA 2FEXA 4Q1VA 2FE1A 2GUWA 4PANA 4GDFA 2PVPA 1RHRA 1RJEA 2IOYA 1B3RA 2X85A 2Y92A 5EJGA 4YRNA 2BMVA 1PV2A 3D02A 1Y7IA 1PJBA 1YZLA 1DRVA 4P2NA 2YXNA 3NHYA 2EAUA 1UC4B 4K6KA 4RLFA 3WMWA 3QFTA 4D4MA 2YWEA 1PK9A 4AKTA 4E4YA 1XNJA 1ORHA 2UYQA 4BCCA 2YRXA 1XMPA 1ESCA 4GICA 4NL4H 4CIAA 5HPYB 2PKQP 5CM8B 2C7RA 2I2AA 4C3OB 1RQRA 3CT6A 4N5LA 5IM4F 3HR4A 2HLDA 5T5QA 4AZSA 4AYTA 3TI9A 2W48A 4KSYA 1NQXA 3T7AA 1S2NA 3GFPA 5K03A 4UARA 1GOTA 2OP1A 3DMHA 4YO8A 3MPUA 3ZLTA 4MGIR 2VHVA 4AX8A 5IJZA 3I4LA 4PCUA 4YRAA 4I0WB 1Z25A 4C4AA 1SVIA 5JEDA 1LPBB 3NPAA 2Y05A 2WT4A 4KVGA 2IV7A 3VOBA 3EZNA 2PMEA 4CU2A 2PQ2A 1XDDA 2VPIA 2CK3D 4G5SA 1MOZA 1OC4A 2P0YA 3WK7A 4YUAA 1F0KA 1UBGA 1RKQA 3PFNA 4R1MA 5JCOA 3VKHA 4S04A 3TLJA 1S9HA 2MDTA 4JBWA 3JALB 4CMIA 2IYQA 1KDPA 2VYND 4KAJA 4RKWA 1L3CA 4FB4A 1E6UA 3UTCA 2J3EA 4YV2A 821PA 3WRXC 3BZUA 2HMUA 5E2IA 3ZKWA 4WUTA 3PFBA 2QZSA 3G17A 2ZROA 3I1IA 5TQ0B 4NX2A 4LJAA 1Q7GA 2H2AA 5HFAA 3ZUGA 4PZUA 3K6JA 4DUYB 3UVEA 2A14A 3AUAA 3CU5A 3HJRA 3IRVA 1TMOA 4I4IA 3A05A 3M89A 3ETLA 5FL3A 4DIKA 1HEIA 3KEOA 2WJVA 2HA7A 5FLYA 2IYSA 4QJ5A 1SUDA 4GMFA 1U94A 1SQ6A 4L5CA 5KOIA 5FYDA 4NOJA 1L5NA 4FN5A 1R3DA 3FZQA 2V59A 4F11A 4BJ3A 4EHNA 4BWGA 4JROA 4ZO9A 4O0MA 4QT4A 3W06A 2HADA 1VQ8B 1H0KA 3AVTA 2JJ8A 2RI0A 3LW7A 2RJOA 2VK1A 3ZIDA 4DTCA 5CXQA 4MIOA 2BKUA 2GD0A 2NWQA 2D3TA 2QROA 2WSLA 2X4IA 3KVVA 4A8TA 4A0FA 2C77A 3U4IA 1XTJA 2IY7A 2BHRA 4LQCA 4QDUA 4URHA 1JVNA 3ZWOA 3OZUA 1NA5A 1QDUA 3VVCA 3L1VA 4YMVA 3QA3E 4RETA 3L82B 1KI9A 2IYZA 1YHZA 2R60A 1HFJA 3L18A 3QSGA 4J4TA 2UUCB 3EFEA 3TFQA 1TFUA 4DCMA 2DQKA 1AQ6A 1J0AA 1WABA 4L4ZA 4RPLA 1WDWB 1XBTA 4M1YA 2FRVA 3H0KA 5DSXA 3X1ZA 4B76A 4WFKA 1P18A 1L8LA 1SJ9A 2CLLB 1H0SA 4FHDA 3H2HA 1Y33E 4BYMA 3VYRB 3WLNA 3V1YA 3G8YA 3MWEB 2VPTA 1YQTA 1WPXA 2E4XA 1ZHFA 3IHWA 2HF7A 1M0EA 1EESA 1PW7A 3NC4A 4C7JA 3Q7PA 1SG0A 2A84A 2XVMA 4M9UA 2VAXA 5J3JA 1HNZB 2II6A 1O54A 1V7ZA 2IZ7A 2Q3JA 5I7FA 3R0QA 1WUYA 2X76A 3A4MA 1WV0A 1R0LA 2XI4A 3D1LA 2YZ7A 3EYAA 3FPAA 3MQ4A 1I5OA 4J1NA 1O6GA 3FMPB 1WZIA 1IAQA 4KQ6A 4Q3DA 3SFVA 3W3AH 1VCIA 1UPBA 2YMQA 3CUVA 3RSCA 4EMTA 5J5CA 4B6FA 5B1SA 1QVVA 1SIOA 3KQQA 4NV3A 1FFBA 4XCXA 4N5IX 3L8HA 3VH1A 2KPOA 4JVNA 4M0UA 4RWEA 5TT0A 4E70A 4LK3A 4ESVA 1XCMA 4GLOA 3OBIA 4EUHA 3MBIA 5FA6A 2REOA 4HNVA 4Y2RA 1ST2A 4HKTA 5A7FA 3EPKA 1RKUA 3C5EA 3QKWA 3T94A 1G21E 4YJFA 2WHRA 1N5DA 4RS4A 4X0EA 4RADA 4RK6A 2FWBA 4FQ5A 5A4AA 1WTHD 1DLJA 2JCBA 4OGWA 1JFRA 4TUYF 4L28A 3B38A 2FDXA 4O2RA 4ACBA 5F5NA 4KQ9A 4PG4A 5KNCD 3DQZA 4P25A 3QLVA 2IK8A 4EL0A 2VUIB 2QAIA 4QV2A 4JA0A 3KOWA 5ANRB 3BGVA 5C8DA 3P32A 2YVKA 1QHXA 4GX2A 1R5NA 2W6JA 5JY1A 3AG5A 3TUJC 3TX6A 5FI3A 4X8OA 3RQIA 4Q3LA 1BHO1 4MEAA 4L8WB 1K3FA 2H2WA 4L51A 1LXCA 2CYCA 2R1ZA 1FJ2A 2DP4E 5FUVA 1FBTA 1OI7A 2MOKA 5EPOA 1PBTA 4GS5A 4NBVA 1D07A 1QE3A 2QG6A 2Z4RA 3A28A 3EEIA 4U6NA 2QM3A 5FRDA 3GNSA 1BFUA 5B36A 4RTMA 5DF1A 1W6RA 1FXWF 4TMXA 1EUDA 3F9CA 4QBHA 4WY2A 1Q74A 2N0SA 1CX9B 3T5AA 3NKFA 1W48A 1GV0A 1NU6A 1QYRA 2VHEA 4HLNA 1KMHA 2W6NA 2RCYA 1RXYA 1GRCA 5LCXA 1M1KD 3WYDA 1SA0B 1I6LA 3OZTA 3NG1A 2GM3A 3HA2A 2F3QA 4JY7A 1KJWA 3HWWA 3JD4A 3HLKA 4TMYA 3NHBA 2AXQA 5EE9A 5JDCA 5LOVA 4JUCA 5LMZA 1I0ZA 4NYJR 1ZN7A 2ZZQA 2PS1A 3DZDA 3AONB 4FPXA 2OOSA 3F71A 2H11A 4UEQA 3WJ2A 4H7EA 1KO1A 2FFJA 2PXXA 2RGBA 5IMSA 4MGHA 4CM9A 2YNMD 4BFCA 1B0UA 1MB3A 3K1JA 3OQMA 4G56A 4RU1A 4L76A 1THGA 5M7EA 4YA6A 5AM5A 1OY1A 3QUQA 3ZW7A 2F64A 3JATA 1NMYA 1N2CA 1XZCA 5TRTA 1HK7A 2O3JA 4Y9TA 2VNKA 4X3PA 4Y1RA 1D8AA 1Z82A 2XMDA 3N07A 4HHEA 4POAA 2A30A 2FTKE 1W9MA 1B1AA 2J3KA 2XADA 3DP7A 4OFZA 5C1OA 1KJZA 4GPTA 2VQEB 1ECLA 1KSJA 4JJIA 4P36A 4P7JA 3CR7A 4WZAB 5A3JA 3WGJA 5JAIA 1DDOA 1RI4A 1FYXA 2AR0A 2PS9A 4FYHA 5CXXA 1CD5A 4JBIA 4KIGA 4QWMA 5JH7B 5A5FA 2HLNA 4RJKA 5LYJF 1WNFA 8ATCA 1QGOA 4PTLA 1TX4B 2C4UA 1G55A 4FT2A 1I36A 5DFAA 5AKLA 3DVLA 4GYWA 3CZMA 4FZJA 4D4HA 5K0SA 4YCAA 5FBZA 1IG3A 2W4IA 3GJ8A 1H8HA 4N6GA 4PPQA 1EM8A 1QOPB 5LXTA 2E4AA 2N75A 1WF3A 2FHSA 4XFKA 2CF5A 1Z6GA 3SGLA 1A8HA 4MUXA 2AGVA 2VUSA 2XKJE 3IRUA 4WGGA 2ZB4A 5AKHA 3E22B 5DX1A 4LMBA 3R7AA 4MCAA 1MABA 4JP5A 2A7XA 3QVOA 4NHOA 5GOTA 1BU5A 1ZLXA 5TPZA 1Z7WA 2XXBA 1UXJA 1UIMA 5F51A 1E6WA 4O4HB 1L4YA 3HJBA 3PGLA 3N76A 4LYHA 4HWOA 1QHFA 1QHHB 4RCVA 4XTRA 3K2QA 3MD9A 2GKSA 2HQOA 1E9DA 2P35A 4JOQA 4IMRA 5J4HA 4ZRDA 5GM2A 3V7NA 1RJDA 2OBYA 1U8EA 2YWRA 4DMUB 3LQFA 4A15A 2I4RA 4UNPA 4MUGA 1N9ZA 1ZBDA 1EVZA 3LBAA 3OPYA 3PR3A 1LB1B 5ES3A 4V0QA 3SQLA 3V8NA 3WSWA 3EIXA 4DV7B 1K5DA 2PRZA 1XTRA 3K0AA 3USZA 3CF4G 1L4HA 1O6BA 3R4CA 1XU4A 4XUGB 5F9FA 4HDRB 5AIAA 3LA6A 2EFEB 3KR2A 2Q9UA 1N5LA 2VZ9A 1CBUA 4BB0A 1COWD 3A4IA 1JXOA 4PC3A 2BGKA 3JAKB 5LDDC 2AJCA 3F4BA 4WZLA 3ELDA 3T9EA 2J5KA 2IYOA 3JZFA 1NNSA 2GPWA 1CR6A 1W5FA 1TRHA 2PR2A 1A88A 4MI9A 1V95A 4CV1A 2GN1A 3ER6A 3KVNA 4E08A 5AKXA 1RAIA 2PLAA 1WVMA 4ENTA 4DNRB 1E2EA 2IHBA 1US8B 2VBGA 4JOCA 3V1TC 4RPDA 3Q11A 5JQGB 3L7YA 4AMYA 3JV7A 1Y9ZA 1WKVA 3MWDB 3T61A 3B78A 1QP8A 1YR6A 1WCIA 3WWCA 2C4TA 1O7JA 1XXHB 4G1EB 4TT3A 5EWMB 1XCLA 1IUKA 2QP3A 2GXUA 3E0XA 1Q5PA 3Q1KA 4IJMA 1K9SA 1E2GA 1QV6A 2V6GA 3OU2A 4K9NA 4JC8A 2V4ZA 1U9YA 1C1HA 1NE7A 2Y0DA 3EQZA 1IN4A 4C6SA 3RS3A 3VQTA 2B82A 2VK8A 4GSLA 4RIGA 3I2YX 5KNDH 2DERA 3W2IA 4TTJA 2NTYC 4ZRMA 1X9IA 1AKUA 3N70A 2FKNA 1PR6A 1U3WA 4F6CA 2PTGA 1EZ1A 1VL1A 1BVHA 3AK4A 5HIAA 2I6GA 3E61A 1OBCA 3O8NA 4ZVOA 4ZI2A 2C2WA 2ZI4A 4A36A 4LV5B 1DC6A 1QOZA 1YB7A 3IKMB 4HBGA 2G5TA 3A10A 5IYPA 1YVPA 3MMPA 1WV1A 3BD8A 4MYCA 4GUDA 4BZWA 1UWKA 2NUPA 4QQNA 1M8GA 4E4TA 2B69A 3EEOA 1Y63A 4QGHA 4IJ6A 4OIMA 2AF3C 4DZTA 3C5VA 1TPYA 2FSFA 2C0CA 2Q29A 2ZT8A 3QU9A 4JJAA 1DTSA 2ZZMA 3VBCA 1RU3A 1QTRA 4AJHA 4JI2B 2C00A 4BKQA 3R77A 5EOVA 4IKOA 3ESQA 5FBHA 1FTGA 3OQ1A 1Z6XA 1XK7A 2NPOA 4E88A 3V9PA 1PL8A 1VQ6B 3DDUA 2WD9A 4BQOA 3KT3A 1SN7A 4PZCA 3HCBA 4EJSC 2PX3A 2RGUA 4L15A 5KTYA 5JNUA 1QJ4A 5AKZA 4HNHA 1PNRA 3B52X 4URFA 1DBQA 3FYUC 4I1OA 4C07A 5C4MA 1E9CA 1ABEA 5KSOA 4MCJA 2ADFA 1UJ5A 2YIMA 1YHNA 5D3ZA 2I8LA 3SF0A 2CKMA 1M2OB 1Q0QA 4K9QA 4QUGA 4EARA 3BT7A 2H4WA 4QPPA 3BCSA 4INJA 3LPNA 3LT1A 1O6ZA 3JVVA 1KJIA 1CIPA 1XJQA 2CWWA 4XM3A 4WEOA 4YXFA 2V7XA 3MT8A 3LK6A 3G7UA 5AK6A 3PV0A 3AOGA 4QPNA 3T9DA 4DSTA 5CLHA 1P0IA 3FPGA 4WE3A 4DMGA 2ONYA 4ZYWA 1ZVJA 3CH5A 2F1IA 3LVFO 1XQBA 1ESDA 1BEUB 4Z0HO 3UWPA 3WI7A 1T4MA 2ZJ4A 3QUAA 3S2FA 5IDXA 2QUAA 1GL3A 1H1LB 1FW8A 4IG4A 2ECQA 2WF7A 4LZPA 2P5YA 3QIAA 4NYIR 3TW4A 3UT0A 3W34A 5LL6P 1XYVA 2C2YA 1GFSA 2BAGA 2E4ZA 1GPNA 1KVSA 5EZSA 1U5CA 3B3AA 2HA2A 2XUAA 4GI2A 4HB3A 4YMTA 2W6IA 2ZIUB 3BXFA 1L6RA 1A5TA 4OOEA 1VMEA 2CV0A 2JL1A 3WR5A 3VTZA 1U1CA 2VXOA 3LUAA 3FFAA 4PX9A 4R40A 4BN4A 2R6AA 3DS8A 2AOWA 3LXMA 2ZWPA