1QGZA

Ferredoxin:nadp+ reductase mutant with leu 78 replaced by asp (l78d)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRDYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PROTEIN (FERREDOXIN:NADP+ REDUCTASE)
publication title Role of a cluster of hydrophobic residues near the FAD cofactor in Anabaena PCC 7119 ferredoxin-NADP+ reductase for optimal complex formation and electron transfer to ferredoxin.
pubmed doi rcsb
source organism Nostoc sp.
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qgzA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qgzA02
1QUEA 4RD3A 4U9UA 2GQFA 1KJZA 1EFCA 2NPFA 2RC5A 1VQOB 1D8TA 1EP1B 3FPKA 2QTZA 4PC2A 1Q81D 2BN4A 1OB5A 4LBVA 3PENA 3U6BA 4DQKA 1QFYA 3OZVA 4TMTA 4RJLA 1QVFB 1EXMA 1VQMB 4QFMA 1DARA 1IJEA 4Y9RA 4EH1A 1KRHA 1E63A 4RCZA 4Q7JB 1GR1A 3U6KA 5TV2A 3ZBUA 1QGYA 1OB2A 1IJFA 1UMKA 1FRQA 4B47A 1TUIA 1VQNB 1FNDA 2QTLA 2VNJA 4R71A 1IB0A 1N0VC 2GPJA 1JA1A 4TMZA 2XEXA 2BM1A 3MMPA 1GAWA 1TLLA 1VQ9B 3WBJA 3P26A 4M53A 4RCYA 1FNCA 1GO2A 1KC8D 3CB4A 3G6EB 3AVVA 2CRVA 4M1KA 1VQ4B 3CC4B 3W5UA 1H42A 2AHOA 1QVGB 4N3GA 4C0SA 4ACAA 3W2IA 3QFSA 3CCQB 3AGPA 3ZZ0A 1BX1A 1YJWB 4HE5A 4YAFA 4ZCMA 1K9MD 3I55B 2FX3A 1DDGA 1BX0A 2R6HA 1G7TA 5H59A 2QMUA 4H9GA 3J81k 5JBQA 4G1VA 3ES9A 1YJ9B 2OTLB 1K73D 4NCNA 1E62A 5EMNA 3B8HA 1F20A 1JA0A 1YIJB 2PLFA 4RD1A 2B5OA 1SM4A 3WY9A 3AVXA 4M0LA 2OTJB 1CQXA 1ELOA 3VNVA 4FN5A 5HXBA 3CPWB 4LBWA 1QFZA 1SKQA 4TMXA 2DETA 3CCSB 3CCRB 1W35A 2DEUA 1W34A 1QGZA 1R5BA 3CXCB 1YHQB 2DCUA 3QFTA 2OK8A 2C78A 5FA6A 3QSYA 4UAJA 1R5OA 2HCJB 3OZWA 2BMWA 1G7CA 2DY1A 4MYUA 2EIXA 4ZV4A 1YI2B 1VQLB 2E1RA 3G4SB 4P3YA 1VQ5B 1ZUNB 1Q86D 3W2HA 1D2EA 2EFGA 4ACBA 3VMFA 3LVBA 3QFCA 4PC7A 1M1KD 3W2FA 4M2LA 3JQQA 3VO2A 4PGOA 3P27A 1EFUA 4FK8A 3JQPA 4LC0A 4Y7CA 3CMAB 1WDTA 2BF4A 4F7DA 4ZCIA 4K1XA 1I7PA 1U2RA 1EP3B 5TR9A 1GVHA 5GV7A 4ZGNB 5KSWB 3E1YE 1N0UA 2BPOA 2X3UA 1VQKB 1M90D 1N8RD 3AVUA 2YWGA 3E20A 3QE2A 2CNDA 4HE6A 4C43A 4Y9UA 4YAWA 4ZGQB 1TVCA 4WQMA 1BQEA 1VQ7B 1CNEA 4AF7A 1ZM9A 1DG1G 2QN6A 2DERA 3CCMB 2PIAA 1DDIA 3I56B 4ZCLA 2HDNB 3CW2A 1HA3A 3CC7B 4RD0A 3WBKA 1F60A 1FRNA 2RC6A 5THXA 1NDHA 1QGAA 1E64A 3CCJB 3AGQA 3AVWA 1AIPA 2VNIA 1YJNB 4TMWA 1QH0A 2HMAA 3OZUA 3U2QA 1EWYA 1VQ6B 1KK0A 4PC1A 3I1FA 1W2BB 1KTVA 1A8PA 2XNJA 4N3NA 1JJ2B 2PMDA 2OK7A 4B44A 1YITB 5DSZA 1ZM2A 4YHBA 2J7KA 1S0UA 3VNUA 1OGJA 1QFJA 3WYAA 3CD6B 1Q7YD 3ZZTA 2BVNA 1KK2A 4LBZA 3OJXA 3OJWA 3W5HA 3CRZA 1ZM4A 3LRXA 1R5NA 3W5VA 4B48A 3SJZA 1S72B 1VQPB 2B7CA 4B4DA 1D1NA 2VNHA 3W2EA 3FJOA 4BPRA 4QHYA 1OGIA 1KD1D 4DQLA 2YWHA 4M4SA 2XNCA 3W2GA 3CC2B 4AF6A 1KQSB 1GJRA 2VZLA 2QDXA 2BV3A 4RD6A 1EFTA 1ZM3A 3G71B 3OW2B 4IW3B 2VYQA 1B2RA 1XB2A 4P6VF 4NBSA 1FDRA 2B7BA 2YWFA 4FWTA 3WNCA 4PC6A 1AMOA 4G5GA 1FNMA 4RD4A 5GV8A 3MHPA 3B78A 3CCLB 3V76A 2VNKA 1XE1A 4AC9A 4TMVA 2BSAA 3ZBTA 2QA4B 1KK1A 1VQ8B 1W87A 1EP2B 1KK3A 2YWEA 1B23P 2ZITA 3ZZUA 3LYUA 1BJKA 4YAUA 4MYTA 1QG0A 3JQRA 3CCUB 1FNBA 1CNFA 3CCVB 3VO1A 3AVTA 4B3XA 1TTTA 1QX4A 2D74A 4YALA 3QFRA 1GAQA 4PC3A 4RD2A 1QUFA 5H5JA 1Q82D 3CMEB 2QEXB 4B43A 5TY0A 1G7SA 3LO8A 3MCAA 2C77A 3A1FA 3WNBA 1NJID 1K8AD 3WNDA 4G1BA 4YAOA 4J0QA 5AN9A 4TN1A 3AVYA 2BM0A 3ZC3A 1JNYA 1H85A 3B82A 1G7RA 2BGIA 4LBYA 1J9ZA 2BGJA 1JB9A 3WXMA 3CCEB
chains in the Genus database with same CATH superfamily
4CT0A 2ZYDA 3E4CA 4O4IF 3T5AA 3ZG6A 3ZDDA 2ZROA 4K7JA 5LYYA 2FEMA 4Y1GA 2X5XA 1GGJA 4BBPA 3M5CA 1W6UA 2BR3A 2ZIVB 4OMUA 8OHMA 3PS9A 3DHNA 1H8ED 1MX5A 4DXAA 1M6NA 2ZRNA 1XQXA 1MVLA 3ZGVA 5FH9A 1QE5A 3Q0EA 4OCZA 5CCEA 2HRCA 4GZMA 5I9MA 5BR1A 2IW3A 4C3UA 3AF1A 5IKOA 3X1ZA 4BQRA 3TJMA 3NDRA 2GNOA 4NZYA 5A62A 4M38A 1GZ4A 1MOPA 2PANA 3H19A 1OB5A 1N7IA 1A97A 1EVLA 1YB7A 5ICEA 4WK4B 1MXFA 4B33A 1GFIA 3BB4A 2OG1A 5HK9A 1FSZA 1H2BA 2LVBA 3H5TA 2GPSA 5DHPA 3SBOA 1PE0A 5K3FA 1KGSA 2PS1A 1J2TA 2P7IA 1EGMB 4H0FA 4D42A 1KYXA 4IIBA 5BMVA 3ANYB 4KMMA 4LYYA 3F2VA 1XA4A 4RQTA 4KU4A 4A16A 4UBJA 2ZK7A 2P75A 3NC1C 4EH1A 2VOJA 3L07A 4JT8A 1C80A 4V39A 4X8IA 1VA5A 5D51S 4MYCA 3I0NA 1EE2A 1AQLA 3O0TA 2VYCA 1OBHA 3G2QA 2Q99A 3PC8C 221PA 4KPFC 3ICEA 3QUSA 4XDYA 1EWQA 2NAPA 4L7VA 4DADA 5F9MA 3UUGA 4OHUA 4GLJA 3DEYX 1YOVB 5KSPA 4IIXA 1UMKA 2HMSA 1X92A 3KTAB 5CTJA 3QYAA 2ATCA 4MQBA 4BDTA 3FWZA 5DNYB 2VQ3A 3SXJA 4MSUA 1RZUA 1VL6A 5B6JA 4F71A 1Z16A 4CM4A 4WXHA 4A2QA 1NUUA 2W58A 3E0QA 4O1MA 2BCGY 2GCPA 2R5NA 3HKBA 3LLCA 4GP6A 1HKHA 4OOFA 3SXUA 1CTQA 3UY4A 1NM5C 3MS7A 5JSQA 5AW2A 1RXUA 3W06A 1R6XA 4CLRA 4ZYYA 3DLCA 3MMPA 1UDXA 3KEFA 3OCXA 2WIFA 2WWYA 2W6CX 4JK3A 3FA2A 4OXKA 2IYEA 3U61B 4DG5A 1THGA 5I8PA 1UEIA 4N5IX 2KB0A 3NEPX 5DKFA 5KAPA 5K8TA 1S96A 1MA3A 1XP8A 1V5IA 1G291 3AJDA 3U7JA 1C7EA 5GIPE 4MS1A 1FNCA 1GO2A 3AESA 3AFMA 2AEFA 4R0NA 1FQKA 3VNQA 3WMWA 4B9EA 3EVFA 1FYXA 1YOBA 4PPQA 4P92A 4V38A 5TE9A 3UMJA 4BQSA 4CBVA 2HWKA 2OMEA 5JZMA 2FRDC 2GKSA 1EVZA 2K5UA 1U7PA 3GP5A 1T36A 4XN0A 2C98A 3L4EA 4YCLA 4ND7A 4UC0A 2R6AA 4EY5A 2AN1A 3GMDA 1GPDG 2GHQA 2W6OA 2OBLA 2ZXEA 3GJ3A 1TM5E 3JVVA 4FUQA 1HDOA 4RLZA 1YNOA 4V2IA 1LLDA 1K8YB 2EW8A 4WAUA 4MS3A 3IEPA 1IBRA 3UWPA 1QCDA 3VU9B 4F4CA 3STYA 2HDWA 3IUMA 5B4VA 2HU7A 3BPSA 4BUJA 5CGQB 3LA6A 4RF3A 1FW6A 2GRUA 4EHLA 1MC5A 2Q0SA 4YLGA 4G4GA 2WU4A 5B53A 3SR0A 2C07A 2GWRA 3N3AC 4Z4EA 3F8WA 3I4FA 3O75A 1DS6A 2YFKA 1MABB 1FFSA 5I8ZA 3J81k 1M8PA 2FZ4A 3A1NA 3V7WA 2I2FA 5IN5A 2GN8A 3CLHA 3BULA 2OTLB 4ZRMA 3IJPA 5HCIA 2BW0A 1GL7A 5THQA 4DA8A 5AK3A 4FS3A 1IWBB 1YHNA 1E62A 3BSSA 1HFJA 2VK1A 4G5FA 5DM1A 3C3CA 3N2GA 5BN4B 3UT6A 1NJFA 1W76A 2V6GA 3I6MA 5T6MA 1TO6A 3MCZA 3HI6A 1NTOA 1Z0SA 3OF2A 2UVQA 1G2PA 2JLUA 2ZR9A 5IC5A 1NSFA 3EC7A 3LLVA 1U11A 3V55A 1YL5A 3ZQUA 2XW6A 3RH0A 5SICE 1GYQA 1Z0IA 1EK5A 4Q1AA 3SZGA 3WIUA 5JSFA 5CNJA 5AK6A 5H82A 3JZFA 1FX0B 1JBEA 1VHDA 3WX0A 4BECA 3VTFA 2FR0A 1AJEA 2PD4A 3D7MA 3NM5A 5FJIA 2CF5A 3QKSB 3PGLA 4AURA 1NPTO 2FMHA 2DYIA 2IPOA 1EE9A 1VSQA 2B8EA 1E89A 2GEDA 2NLOA 3MCVA 1ZOIA 4E4YA 1XYYA 3NVDA 2I62A 4L4SA 4DG8A 3AFNA 3HO8A 1OZ0A 1JDUA 1UQTA 4AS3A 5L40A 2NM0A 1U3WA 2XADA 3DDNA 1U2DA 3ZIDA 3AFHA 3NJ4A 4F6CA 5IUJC 4H1VA 3B60A 2X0KA 2NW6A 3DHEA 4Z7JA 3C6MA 1LPOA 3OKAA 2DU8A 1GVNB 2WNSA 1NF2A 4KXXA 4M1QA 3M1IA 1MPTA 2EKBA 2CUTA 3FPSA 4A5SA 3SLDA 4D3ZA 1TAUA 2B78A 3M83A 1XCOA 4Q34A 4CE6A 2EBHX 3UWDA 2Z3VA 3KBBA 2EL7A 3OZFA 4ZC1A 1X1EA 1YI2B 2R4UA 3HKEB 3DWIA 3M2PA 3M9XA 4YMIA 1X6VA 3JRXA 3QZUA 1AQUA 4ETIA 2TMDA 3MYYA 1A9XA 3PE6A 3BRSA 4Q9AA 3V8VA 2B3TA 4M1SA 1JHXA 1GGMA 1NVUQ 4L4XA 2CBZA 5JIBA 1JX6A 2P91A 1NE7A 1BE8A 3VSDA 4QUIA 2V4MA 3DMHA 3AO0B 3VH2A 3WGGA 4K0KB 1FLNA 2H54A 3JWGA 2OMKA 3T06B 4QASA 2RB5A 1W94A 1JG4A 2UXCB 3E35A 3UJNA 3SN6A 3AF5A 5FBZA 1R0RE 2UKDA 3D59A 2ROQA 1U0BB 4BB5A 1N05A 2X0JA 2OQ2A 3OJ0A 4JCOA 4HGZA 4MQFA 4DIOA 4TRRA 5F7ZA 4IHJF 2PRKA 4NS1A 3MILA 2ZSAA 4LC0A 1OZAA 4Q1DA 4RWZA 3K70D 4N7BA 1OAAA 2OVFA 2YMLA 4JIMA 1E99A 3A05A 2IP2A 4G1FA 1FP6A 2ASVA 4J75A 3OUTA 4U2BA 2EJCA 3A3YA 3EXHB 1NFFA 3RUAA 4UMFA 3ZDEA 1XFAA 4YDSA 5HUJA 3UJ3X 3GYGA 3BB1A 2BFDB 1YDWA 1WP9A 1GVHA 1PT5A 5H1YA 3AF4A 3GZJA 3QV2A 4XQCA 2PGXA 2LDBA 3DMDA 4FFVA 1G8JA 2HF7A 1GV1A 2D1SA 3CRVA 3F2IA 3GH3A 4FYWA 4LY9A 4XI9A 4D79A 1TXGA 1YS2X 4BZPA 5IYZA 4O4LB 4DABA 1X1CA 4TKOB 5HMMA 5GWXA 4ZCTA 1OH7A 2EKDA 4E09A 2P8JA 3IELA 1X7GA 3GGGA 5BPFA 4F6RA 2Q5JA 2F8SA 2PQ0A 1I30A 1IQUA 2IXGA 2QY9A 2RGGA 3NH6A 5F3WB 1A9RA 2Z1MA 4MGIR 4ZVRA 1RJ9A 4IGEA 4MP8A 2WKQA 4TV9B 1FMFA 1ZUIA 2G4VA 2GN2A 1QORA 1A04A 2VP2A 1ZITA 2C1EA 4GSLA 2Q2QA 1YGYA 4M9UA 1VPDA 2YW9A 2AJDA 5I48A 3TGPA 2X2EA 4OI0A 3FROA 1U0RA 2EJTA 5KMGB 1PJZA 5HIKA 2D3WA 3G79A 3I4LA 1TZJA 2PM8A 4EMTA 1IC6A 1RTTA 2VQ6A 3D5EA 3SKYA 2DUWA 4K0RA 5KDLA 4CR6A 1K7FB 4NENA 5M34A 5DNCA 3D2AA 4JKOA 1OH6A 5DNUA 1E2NA 1GZHB 1V5WA 3GZNA 2C29D 5J35A 4O4IB 4S1OA 1G66A 3ZGOA 1DXOA 1SBZA 5ESWA 4RDJA 4HXYA 4BOYA 1YKFA 1NVBA 3LPNA 1AHIA 1ML3A 1FP7A 1C1XB 4JSYA 4OGWA 4OXIA 1B16A 4P54A 1L7RA 1VKHA 5FUWA 3VUEA 1E3XA 1E9CA 1RRPA 1XVIA 2VP0A 2EKZA 4CT5A 1UD4A 4ZPXA 3KE8A 4WZTA 4OSEA 2AR9A 3ACBA 1QG2A 1UFRA 5KIAA 4BO8A 5A7GA 2IT1A 2FQ1A 3B1JA 4LOKA 4KH1A 4KXFB 5FWYB 1BGWA 2IZZA 1R0SA 2H52A 4Q7QA 1C0EA 2ZYTX 3CCJB 4RL4A 4DLNA 1OTHA 1WMFA 1OA1A 1XZCA 1Y81A 5ETJA 3VZCA 4OQDA 1KO4A 2ST1A 3GJRA 3QY0A 4MLCA 1RHUA 1A8IA 3A6ZA 1AUXA 2F3RA 1T5IA 1AN0A 2G6TA 1AB6A 2F4NA 4YB8A 5DYWA 5GONA 4DJJA 4B6EA 2A1IA 4C7OB 1L6IA 3GPDG 3X1DA 1WXQA 1WHTB 3HDYA 2QWXA 1WZ2A 4CM5A 4JJ4A 2X86A 1XRQA 2JRLA 1H69A 4M1ZA 4L5YA 1YT5A 4JLUA 2H4YA 1ZNWA 4ZAVA 1KO5A 5BSMA 3PRYA 3KJXA 2ZS7A 1Z68A 5MFPA 3LZDA 3QLVA 4HB4A 4Q21A 2QE7D 4LWZA 4AYXA 3OJCA 2JCXA 3V1KA 4BU1A 4NNJA 1VG0B 3O21A 4BV8A 1L7PA 4X1KB 3OM0A 1BGVA 2FRVA 2DOGA 2JEZA 1MJ5A 1P74A 4W6QA 3STUA 4ZYTA 1RJFA 4KE9A 2OKCA 3VTZA 2TMKA 3ANMA 1FFBA 1T4DA 1FDUA 2W2MA 1OZHA 2D7CA 3AJAA 1QLHA 4D1YA 3U4QB 4GW3A 1CUYA 2R8BA 4TQAA 4BX8A 3E9RA 5B3JC 5GVRA 3GJ8A 5B1HA 2WMYA 2NTEA 4HPXB 3VYSB 2XOXA 4NPCA 4WINA 1USGA 4HUTA 1JFVA 2ET6A 4M1MA 4FLMA 1PVDA 4YC7A 2QI9C 3ZE1B 3L7MA 3ASYA 3AV3A 1T8TA 3D9QX 1S72B 3OTGA 4K6FA 2BGKA 3FSGD 4M6WB 2WJYA 3ETDA 2G71A 1ZBQA 1ID1A 4FYPA 4LNUB 4RDXA 4MR7A 2ZRJA 4EECA 3HVRA 1AQIA 1RSZA 2YJ6A 2ZBRA 3DO8A 3WWYA 5IJZA 2QTWB 1X9GA 3EGDA 2PZGA 1C30B 5EE9A 1Z7WA 2JCBA 5FL3A 4BPRA 4QHYA 2ORVA 3JZAA 4XM2A 4LV6A 3PD1A 4JP1A 1ULTA 1WA5A 2QD4A 3PITA 4K9OA 1PS9A 2RAPA 5PGMA 4AMBA 5KS2A 4R9SA 5FCDA 4LJ4A 1IDN1 5IABA 5K6AC 1A5AB 1X7YA 1BDMA 5KJFA 4OQZA 1I2DA 1NBWB 4P3XA 3T9AA 4IJ5A 3ZY3A 4QUDA 5M2QA 1NQXA 3DFZA 2X40A 1RI3A 3W7BA 3W5BA 1RJGA 5ELXA 3AM4A 3GO4A 1QO0D 3AV0B 3I2IA 5CHEA 5DBFA 5BOSB 3DZBA 4FFDA 3U3JA 3TG2A 3FFAA 5CU7A 2FP3A 1P4GA 3EISA 3JQ9A 4L76A 3HUDA 2J67A 3SIWA 3UVEA 5BWMA 1R18A 2OQRA 3RRZA 1U0OC 3ZW9A 1E8DA 1A5ZA 3KXDA 4KYUA 1CF4A 1JPNA 4KQIA 4M0MA 1U1EA 4KIGA 3BIJA 4KLCA 4TS9A 2QVYX 1BYIA 1DAIA 4Q18A 2PZEA 3BY1A 1CNMA 3OX3A 1Q9SA 2HMVA 1M54A 1JHRA 1P9LA 2VJCA 1NGSA 1SZDA 2C54A 2IGBA 2I65A 3DD1A 4OEHA 2FPWA 4TPKA 4WEQA 1GQSA 4IWYA 5AJHA 3WISA 3BUSA 1DRWA 4TMVA 4GGOA 4H17A 5LP6C 5CK5A 2WJIA 4CKBA 2I9KA 1VQ8B 2ZUCA 1I8TA 3X1KA 3KVRA 1COWA 1RRKA 2IHTA 2BELA 1J24A 4D4IA 4N7RA 4ER6A 1B15A 5KINB 1LBIA 3ZXYA 1L7XA 4OH7A 2E1PA 3FTPA 4W8HA 2C2BA 4B40A 3DA8A 2GCOA 4V1CB 3SZUA 4D8WA 4EZBA 2I4LA 2XCIA 3R7DA 3REFA 2KBFA 1G18A 3CEMA 4HQFA 4LMBA 2H4JA 3IDQA 1FE8A 1KDOA 1TDJA 3A4MA 1DTWB 1BMDA 3GA5A 1U4NA 2H06A 5LOVA 4P3PA 1H2XA 1JPVA 4V3BA 4JP8A 2CVHA 5EPOA 3P32A 3QA3E 5FV7A 4TZ6A 2MDTA 1PNVA 2GILA 2VT6A 2HU8A 4ZVKA 4EGJA 2VS1A 1K06A 5LUAA 2UAGA 3QFRA 3KPJA 2GD6A 1P5HA 2FEAA 2CW5A 1XQYA 1AA6A 3NVAA 4W1QA 3OOCA 1JEQB 3DHYA 1CUXA 4BYGA 4OJQA 3PQ6A 4D9CA 3GRCA 4QNMA 1ICEA 4GMKA 5IXYA 3N8IA 2C7BA 3FY4A 1Q82D 4KN8A 3V1TC 4X84A 1U7WA 2MSKA 4OHFA 4Q9JA 2D9RA 2CXQA 1WPRA 3LO8A 2E87A 4E0BA 5A7FA 2QK4A 2OHJA 5KJ1A 1ICIA 1M33A 1FSPA 3A1FA 3FGPA 4ZO4A 1TM3E 3NAMA 3NDPA 3DT6A 4FB4A 4RS3A 2J9FA 4AVZA 1J9GA 1VCIA 2IP4A 2IP1A 4I1UA 3R7LA 3SVLA 1SU8A 2R86A 4TVBA 4YV7A 5KYYB 4M1OA 5KNBA 4MGHA 4RDKA 5KNDA 3PEEA 1JDBC 1A2KC 3LHFA 3GLUA 1G7RA 4DM7A 3I58A 3JD2A 4NIMA 1X86B 4RK0A 1OPRA 4I0WB 2JFHA 3NUZA 4YLEA 1BMFA 1Y3CE 5K0NA 4XN3A 4RMHA 2ZJ8A 1HFEL 2WQZA 4ZAYA 3VSBA 4L50A 4HDSB 3UB4A 2OBXA 4H27A 2J3DA 2QRMA 2GN4A 4L9SA 3AI3A 1COWD 1H0KA 1M8GA 3I2JA 3CZAA 4V0ME 3AEQA 3WGVA 2IXBA 3MBKA 1OYWA 3EGIA 3ET4A 3V6LA 4MV1A 1LK0A 4LXQA 2WD7B 3W9YA 3GP8A 1JDNA 1BIFA 3ZWYA 1ND5A 1OFUA 3IVGA 5AUPB 4Q1EA 1B7GO 2NX2A 3E18A 2P62A 2IX3A 1GPWB 4BZZA 5KC8A 1F2TA 5K09A 2BN4A 2Q49A 3C5CA 2VTBA 4Y6QA 5DWDA 3DOOA 3ZUGA 2O23A 1AVTA 1K4YA 4LHYA 1GL3A 4JB8A 2ODWA 5HRUA 1B4DA 2AX4A 3M4JA 3OQ1A 4NBRA 3ZBQA 3KYDB 2B2XA 4RHUA 2PJUA 4R2KA 3MLAA 3NIWA 2VRBA 3K0SA 3HRIA 5DIFA 5HILA 4WUTA 4M36A 1P4AA 3SZMA 2AUMA 3Q6RA 1XTRA 1WETA 1P6QA 1U02A 3C5WP 5TV2A 3FZYA 4GR4A 1L7NA 4NXMB 4G23A 3SMQA 5MFZA 1EUCB 4I9GA 3REGA 3V4LA 4BGEA 1UPUA 2CL6X 1OX4B 3F71A 5FKJA 3U09A 2C5AA 1QFMA 2X1VA 3KJNA 3BXGA 3P7MA 1J00A 2JKYA 4FX5A 3L7NA 4KXWA 5BW6B 5U1PA 3U0VA 4CM7A 3EVBA 4IXWA 721PA 4B74A 1VQNB 3CB2A 4UU8A 5CT4A 4NESA 4UTRA 2AG0A 4XWWA 3C0KA 4PYJA 1A27A 1DC3A 2MSCB 5FRDA 5KNDD 3L4JA 2GDJA 4KDRA 4ESOA 1EQAA 5JWHA 1Q0TA 5JNLA 1VMIA 4TTQA 3L6RA 1BMFD 2WUFA 3G23A 4YWJA 3D6HA 4C88A 1Q12A 1T9CA 3M6UA 4D56A 5KZMB 3OIDA 4NCIA 3VPSA 4YCCA 1UZAA 3GLKA 4U6NA 3DH0A 3H1TA 3R0XA 5JVDF 4Y1RB 1Q0HA 1I36A 2RI0A 3R5JA 1R6VA 2HLDA 1ZUWA 1OILA 2PQMA 3WLKX 2YHUA 2ZE7A 4XKWA 1ONPA 3ID6C 1GZSA 1KBOA 1QRTA 3D2BA 1J5EB 1Q84A 4RPJA 4TLEA 5FOXA 3RNOA 3ETCA 5K0CA 3H2BA 3O4IA 3PEVA 1T2NA 1LWOA 4HZIA 5JZ9A 1PRYA 1C7JA 1PIWA 4RDCA 1P0QA 1FSGA 2OCPA 1L4UA 3GLIB 1Z2CA 4J0CA 2ZCVA 2ODAA 1X8JA 2FPGB 4D46A 4KFUA 2QT1A 3TBKA 3WI7A 3WYFA 3QEMA 4LKOA 2ZSEA 4D8YA 3B53X 3C6XA 1PEDA 1P19A 4J4TA 3WLEA 4A8HA 4KXYA 2PE3A 2O7NA 2PX3A 3H9CA 4URUR 1QG6A 3JPWA 3Q15C 3H4IA 1CQIB 4RKEA 3KWJA 1JEYB 3OBBA 4GT1A 2V7PA 4B4WA 3GEBA 2QPTA 1F8UA 3A4LA 4I55B 1DWOA 3TLGB 3ZD6A 5LBUA 4YAFA 1OA0A 1K9MD 2ODBA 1ISFA 4HX5A 4DWVA 2ESRA 5BSWA 3SLGA 3U4DA 5CH3A 3ZHXA 1CUHA 3UXEA 4GMXA 2CK3A 1PJSA 2QUIA 5CP8A 4KDFA 3QP9A 3IOMA 7REQB 4EGQA 1A8SA 4FILA 3PIDA 3TB4A 2EWVA 4CW7A 4MROA 3AK4A 1ZISA 3K5HA 3ZWBA 1DIGA 4J0DA 1OT5A 1N7GA 1XKTA 2P0AA 4MW2A 4X3OA 4G8DA 4TROA 1Y7TA 5EZYB 3GCWA 4XQ0A 4FVTA 3ADDA 1YONA 5ADHA 1Q19A 4O2BA 1KZ1A 2JVKA 3T52A 2AOTB 5GINE 3ZJVA 3D4LA 1KI8A 1VLLA 3VC2A 3LF2A 3ZTTA 3W7VA 1AGRA 3WA7A 5EMNA 3N8GA 4ZGWA 4M0EA 4NU8X 1SM4A 2DX7A 5EPUA 5IVDA 2I7CA 2ONYA 3S7TA 3KYCB 4LV5B 1XALA 4MVJF 5AVVA 3OMXA 3DYIA 1ZXXA 4J4BA 1U0GA 3EIHA 2ZWVA 3GT4A 3WP1B 3FWPA 3LPAA 3LUPA 2HJ9A 2OE2A 4LYHA 2OSBA 4IXDA 3WSTA 2JCYA 4YYEA 4ESHA 1K5HA 1J2YA 4D0GA 2HLDD 5JBIA 2YIDA 3VR4A 1E2BA 1VL0A 1JQEA 2AV6A 2WAOA 4G4SP 3FUCA 3IBTA 4BV3A 5BW5A 5T41A 1N8KA 2Q5LA 3RS9A 4AMGA 3B1VA 2ZT8A 3JWPA 4RK7A 3S68A 3KKZA 2G5CA 5DN9A 1HDEA 4RQAA 3T5GA 1E2MA 1VPLA 4AJ1A 4CMIA 1ZN9A 2PWPA 3T1NA 1T9GS 4ON9A 4F7WA 1PZHA 2Q6KA 1KVRA 3IKVA 4FFBB 4QNRA 5K2OA 2A5DA 1JKJB 1LNQA 2YWBA 5JDCA 2QMHA 2OO5C 3P97A 3DSRA 4HAVA 5EERA 1R3UA 3QBJA 5GJCA 3T0FA 2V4ZA 5F2KA 2HNKA 1KJYA 1RW4A 2PWYA 3OU2A 2OG2A 4GMGA 4ZHQB 4G2NA 3DULA 2OR3A 2ZWMA 4IGKA 1G59A 1ONNA 2DJ5A 1KKMA 1HWYA 2BJWA 3OLQA 3QMMA 4L9WA 4B1FA 2EHJA 4EGSA 2CK3D 2O2ZA 1BFUA 1FVHA 4R8VA 4Z3KA 1ZLXA 3ZX5A 1EWKA 4P3YA 2P77A 3LE8A 3LT1A 3T5MA 4C4XA 2CVOA 2IIVA 1RZ3A 3LO5A 5GZ3A 1L5OA 1YIAA 2DHQA 2JPDA 2AG5A 2CDNA 5FADA 5C8DA 4LOHA 3HPQA 4KR3A 1USIA 3FGOA 3K20A 5BYKA 2HPVA 2FVGA 5B5SA 3T9CA 2VL7A 4BTLA 2ALJA 2BFOA 1Z4NA 3VZBA 3H9JA 1M2OB 1XMXA 2VTVA 3BHNA 5DO9A 1SIUA 2NADA 1M1YA 3F3YA 1NQAO 1X87A 4F9FA 3UTDA 3GVLA 3R6KA 3C5VA 4B3BA 2IEZA 3MQ4A 4IKEA 3C1UA 3RFXA 1XNRB 3BH4A 1GZUA 1O5OA 1ADCA 2HK8A 4BNLA 4K3UA 4ZCIA 4K1XA 4B5KA 5LP6B 4DV6B 4Y0NA 1B41A 1O9BA 1CE8A 2FFHA 3PR3A 1BH6A 2PWBA 2V3WA 4I4TA 1R4NA 4WLFA 2Q4EA 3L8ZA 1G5HA 2ILVA 1V4NA 3OY2A 3KZKA 3VR4D 2VDUE 4OHWA 1OAOA 3E23A 1XMOB 1JB1A 1K5PA 5F23A 2YVQA 3AHJA 1CDEA 1DNPA 3V7AA 1Z36A 2G1UA 3COVA 3H0KA 4HDNA 4RZIA 5DHAA 3FFTA 3O74A 3FZGA 5C46F 4DV3B 3EW9A 2CWDA 1I5RA 3SNKA 4FNOA 2IOQA 1DKUA 5FD8A 3ZWQA 3N8HA 3MUEA 1X7ZA 3H75A 2P78A 2PUGA 3DLTA 2O2JA 1EM8A 2IPAB 4M55A 4CEHA 2X4IA 4ITVA 2QUAA 4V0NA 4MW7A 4CFYA 3GW8A 5JY1A 2PXAA 4U0KA 4PS1A 1ISIA 3OKCA 2PUAA 1MRSA 2P4QA 4K6MA 3HG7A 3NDJA 1SGWA 2QQ0A 1OBOA 2PMBA 4OI1A 2C2MA 2V7WA 4ZQCB 4ZZ2A 2LBPA 1PGPA 3PQEA 3R3HA 1MQSA 2JL1A 4XRGA 4F46A 1MX9A 1Y9JA 3CUWA 1DC5A 3RVPA 1G64A 1VCMA 1KAGA 4E08A 2R1ZA 4GYYA 3AHIA 3L4BC 1E3WB 2HF8A 3ZWKA 1IDOA 4XM1A 3KSDO 1NQWA 1AMNA 2YJTD 1H65A 2DVMA 1M34E 3GFPA 2H7VA 5JHGB 3I62A 5JS7A 1Z2OX 4JI5B 3LQ2A 3FHTA 2X4LA 1PQ4A 1TVEA 4RIGA 2AZXA 1DDIA 2FSPA 2HD4A 1NHWA 4OL9A 4CLXA 4JB3A 2OCBA 2YXNA 2HDNB 4ZTBA 3SKXA 3CC7B 3WL7A 3V7FA 3LGAA 3KJGA 3DPUA 2WTUA 3L0SA 4JEUA 2A14A 2PTGA 1Q3KA 2Q5IA 2BCJQ 1EEXB 2Y4OA 3DLPX 3KUCA 2JB9A 3OQHA 3L9XA 3A3OA 3BMOA 1FRNA 3CKMA 4J16C 5B3KA 1BRMA 4OOVA 1HDYA 1NUTA 2ZRAA 3K2EA 3VAZA 2QNRA 1HL7A 2GUWA 3L0CA 3OCJA 4UHBA 4ER5A 1J2UA 4HN2A 3UYLA 1F6WA 2VDRB 4LJ7A 3BORA 3T34A 5CXSA 3O9ZA 1KEUA 2DR3A 3OZDA 1IOWA 3WRYA 2I2XB 3FF1A 1SEPA 1WSBA 4I5EA 4OJMX 4TL6A 3ZE7A 3ZKAA 4Z4UA 5DP2A 3V4RA 3KUXA 4LDJA 3WIVA 2EAUA 4R3WA 1H1LB 3QTTA 3GHYA 3LK6A 4UPDA 1W2BB 1QNLA 2CCJA 1P5JA 3B1WA 3IOYA 4XYMA 3EASA 3FIJA 1W36B 1K4KA 1U1FA 5D86A 5L45A 2ZP1A 4L0CA 1Z8NA 1CUWA 2NQ8A 4J7CA 2W6MA 3RUFA 3PPYA 2HA6A 1ZD9A 4B7CA 3OJOA 5TMPA 3OOJA 2QXTA 4DV1B 2IOFA 4MKIA 1IY2A 1UBEA 2I9PA 5E1MA 4UU0A 3BCDA 5DT9A 1VJCA 1F17A 2A2ZA 5CYGA 3WYAA 1QFJA 3CD6B 1Z12A 1TJ3A 5FOUA 3BWCA 3NJ8A 3DF7A 2HCFA 3ZK9A 1SVOA 2O5VA 4IH1A 2BVNA 2XMQA 2ZFUA 4IIEA 1VBNA 3MWEA 5A89A 2IY7A 3I73A 4MHSA 1F9AA 2IOHA 4PYNA 4G4IA 4YVFA 2Q5FA 1PGOA 2JLXA 2D13A 3WO1A 1NVVR 4JJEA 2YJZA 3EJ6A 3W1WA 4PLCA 3T3OA 3TEJA 1WM1A 1Q1ZA 5EWLA 1SELA 1A76A 2A9FA 2O54A 1MR3F 2HSDA 2DFTA 3P9IA 3ZBPA 3NCHA 5HKOA 2RI1A 3TW6A 4JI4B 4UXHA 1XZMA 1YR8A 1T5EA 1Q1GA 1RE0A 3N2KA 2F4VB 4A8TA 4Y2TA 2RHLA 1YUMA 2YJ4A 3SEAA 5ALDA 1T5LA 2PLRA 4NAUA 2NXCA 1GUDA 1T4CA 4HO1X 2DG2A 1JZSA 5HKBA 1E1RA 1G4HA 1TX4B 4JBIA 4QHSA 5JISA 1JAZA 2W6PA 4QUGA 4FXUA 4D3YA 1IQRA 2QVGA 3W6UA 1Z0AA 2RGDA 1XZGA 2XRMA 5TEVA 1JHZA 5K0GA 1N75A 4JITA 3AXTA 4MVXA 1Z08A 5FNVB 5I5EA 4G86A 5HE9A 5I6DA 3CGWA 4R2MA 4LDNA 4YCNA 3IDFA 3MT7A 4M9CA 3DMPA 2HFJA 1U9CA 3F5FA 3OPNA 2ZL6A 4A6XA 1LW6E 1VPTA 1M34B 1U98A 4B7ZA 3UHFA 1VLYA 4O2LA 3AQ4A 4ZOLB 3ZCSA 5K0BA 1PWHA 4M8IA 1QG4A 1Z6XA 1HZJA 2A5FA 2NV2B 2O3UA 3EEBA 3GG2A 3H84A 1O57A 3NBXX 5F35A 3ZJTA 5DEOA 1HQDA 4M8LA 4CQNA 2AD5A 2CWWA 2P6PA 5FOSA 4F3TA 5E6RB 2XNSA 4N8SA 3DBVO 5DSXA 1QHHA 2VWPA 2WSSA 2BFFA 5ALWA 3TCXB 4EX7A 3HXMA 4X0CA 3IMCA 2GCEA 3W9BA 4GWLA 3QJYA 1DCTA 1GPKA 4QQKA 4PC6A 1R12A 1IBLB 3PWKA 1J1IA 2VBCA 4JB2A 4PV7A 4UULA 5D3MB 1V3UA 3DEIA 2PAFA 1V41E 3K5IA 1WCXA 5CAEB 4DC1A 3C7CB 3PXUA 4RK4A 4YQEA 1MIOB 1V6CA 4F96A 4JYZA 3V76A 3ZU5A 4DYVA 5EZQA 2PJZA 5HK8A 3A32A 5AVJA 2NVUB 4UDOA 2BDUA 4OH1A 2REXB 4XTCS 4BVEA 1T8UA 1QH9A 3MRTA 4ZRNA 4YMTA 1YQGA 1A4RA 3MJRA 1AQJA 3AEKA 3BMQA 4NPAA 3U9TA 2I4RA 4DUGD 3FOCA 3KR1A 3JXEA 2BUCA 1D4ZA 1K1EA 1NR7A 3QI2A 1X7XA 4HEQA 4W4TA 1U2ZA 3ETHA 1Q1QA 3L06A 3A35A 2RHHA 5LNK1 2AF4C 4QLBA 1B0AA 1Q11A 4FYXA 4QQFA 2P6NA 2REQA 3QYJA 3T61A 3BH0A 4IAOA 4RUKA 4X60A 3EPKA 1XA0A 1YDEA 2PJRA 3TSCA 4YYZA 4BNUA 1PFWA 1IM8A 1HLDA 1E2EA 2A0WA 5CVUA 1FYFA 3JTEA 1RWXA 1E1RD 3EE6A 2YRXA 3ABOB 3JQFC 4RA6B 3TR0A 2PIDA 2BGMA 2D2FA 3EPJA 2VPWA 1XZQA 4QX6A 2QYHA 4CM8B 3LUDA 4ZQIA 4JVMA 4NE2A 3MBIA 4YCDA 2NP7A 4YRZA 2HHCA 1QK5A 3QOYA 4HZUA 3V1YA 5I7EA 4LSGA 1Y9ZA 1Z2DA 5IAEA 3S1AA 2DPHA 5A9RA 2RGRA 1RMTA 1T1EA 4BNXA 1UC5B 4D6PA 1VHTA 5BUZA 3I04M 2F3TA 4CTMA 1WY7A 2W7TA 1DTEA 2VDWA 1TMGE 3O1HB 1FOEB 2P6UA 3WNBA 2MINA 3R0QA 5EZ5A 3WNDA 2H1HA 5H70A 3RYIA 3RSZA 3I8SA 1GPMA 1KY2A 2WSSD 2GK3A 2QENA 2ZYSA 3IUBA 3WQBA 4F3NA 1RJDA 3GOHA 4LUCA 1UAYA 2ORIA 4U0JA 5C7YA 5GY7A 3FR8A 1RQXA 3Q3EA 4JXZA 2VDKB 2WF8A 3BAZA 3ITDA 2YCBA 3MWDA 4XOTA 4MMXB 4DWWA 4WA7A 1XXHB 2ACEA 2BSXA 2GETA 4IO1A 5EFOA 3WXMA 1QAMA 1SZPA 2B4QA 2G40A 4YTEA 4C7MA 4E2YA 4URVR 4O8ZA 1N08A 3EK2A 1RXEA 3AB3A 5F64A 1EJ2A 3GT3A 2DC1A 2QZ4A 1EZ4A 3SP1A 5IN4A 4PZZA 4N4AA 1YZQA 4BMXA 1ABBA 4MO9A 1W96A 1MO4A 4QELA 2IDZA 2RAVA 3CEHA 4WDQA 1EFCA 3C98A 1Y48E 4XGKA 3V8NA 2A58A 1RKXA 4JSTA 1WXHA 5K7SA 3TQTA 1GT6A 4KR0A 5E38A 3V5NA 3D64A 4U2EA 4D0NA 5DB4A 1ITZA 3D4IA 5GOZA 3IAAA 1JDSA 1BVRA 1ZN8A 4B2YA 2QRVB 3QHAA 1VBFA 3CUEF 4UOZA 4TKUB 4IMRA 1XEWX 3QOFA 2CL5A 1A98A 4AUNA 4PC2A 2UZ4A 2O8DA 2BKVA 3FCOA 4I4NA 1MV8A 3S5UA 2BOVA 2QYSA 2F7SA 3AHDA 4HTFB 4EPRA 1G63A 2IYQA 4LHXA 5G1OA 4ROTA 2UUOA 3I6IA 4GBMA 4IEEA 4G0UA 2GRAA 4JI6B 4OK3A 3WWEA 5DTQA 4UVHA 2FSGA 3PA2A 3GFRA 3LX6A 1QVFB 2GZ1A 3ETJA 3MGKA 2PL1A 3OMLA 4DLAA 3PHIA 4X54A 1F1JA 1P5RA 1DRVA 2XITA 2BLNA 3EMDA 2B9VA 4KE7A 4WESA 5LZ4A 4Z53A 4ZANA 4NJEA 3RFCA 2CFOA 1HI9A 4YDHB 4LTMA 2E5LB 4W7SA 2X53S 1FIUA 4YBZA 3OQBA 3HB7A 4I1OA 1QGYA 3WZ2A 1NN5A 1VPVA 1PZFA 2X9VA 5B2EA 1QK3A 5IYQA 3AP1A 4JEMA 3ORHA 3WQZA 1KAMA 3H0EA 1G20E 1IH8A 2PU7A 5T4BA 1N2CB 2RH9B 2E0IA 4CGZA 1RIFA 3UW1A 3DXFA 4LHSA 3DAPA 1DJMA 5HXAA 3MMXA 4YX9A 2NO0A 2Q8NA 4HQKA 4K46A 1Y37A 4HMPA 1QGOA 1Q6ZA 3DO6A 1UT5A 3ELWA 2ODQA 2Z8YM 2NZVG 3IHWA 1J1ZA 4QD3A 1S1CA 1CJCA 2AMYA 3AR8A 2VPPA 4Q24A 5TXGA 4K6CA 3WIOA 5ER9A 1XWFA 5EKSA 1E9RA 5IAAA 5L4SA 1U7XA 3PGMA 4X41A 2O48X 3O4JA 1EH5A 1Y42X 3LCRA 4P81A 3G7NA 1SUAA 3AL0C 4OPMA 2YV5A 3ZIAD 3MAJA 1KXZA 3L0DA 4FZ3A 3QF4B 3JQ7B 2OCGA 4KW7A 1IMJA 1M2KA 1S3SA 1AV6A 4RHCA 1ES9A 2X6RA 5DNVA 2BUAA 4E13A 3DBRA 1F8FA 2O8FA 2PFKA 2XBMA 1PHRA 2FWJA 1HZEA 4RCYA 1O89A 5LKRA 1AE1A 1O6BA 4U4AA 2NPOA 3ZWDA 1KC8D 5DM2A 2ZKLA 3D0KA 1JLKA 1RHJA 4HNAA 3CPEA 2G0NA 3RBVA 2IYNA 1BO6A 2CF6A 3KKMA 3GDHA 2DFPA 3VVCA 1JIQA 1YJXA 1ZD8A 3GUHA 4AN4A 5GZ1A 4FR2A 3WYNA 2NYUA 16PKA 3MYRA 5DYIA 5EHIA 3VAAA 3I9KA 4PNHA 4BNYA 2EYQA 4N3CA 5ER6A 2NZWA 3QXGA 1KWKA 1SKMA 1UXKA 4C2UA 4FOLA 5IANA 1OLSA 4OI4A 2C94A 3D2LA 3FYUA 3CCBA 3NUGA 1QAOA 1C41A 4NOKA 4HIZA 2GMWA 5TRDA 3CY6A 5JZSA 3U7HB 3NHLA 1KZGB 4X91A 4BBJA 1L5RA 2H1LA 2QD3A 3QGMA 5TQ0A 1DT5A 1PFKA 2QMUA 1WB6A 3HKDB 2DWOA 1I18A 3GV0A 4FFPA 4Q3LA 2NUAA 4Z8YA 2VEOA 1Q0UA 3ZR4B 3CTPA 4EB8A 3FBGA 3FWNA 2HK9A 4D41A 1ZN2A 4NCNA 1T3LA 5KI6A 1Z56C 1NJ5A 3A1EA 4QYMA 1GPUA 3DBHA 2PZAA 3CCCA 4JBNA 1Z06A 4E7OA 1WZCA 1ZNYA 1XKXA 1PX2A 1G2IA 1WVGA 2H4ZA 5FA5A 1ZMRA 3OY7A 3TUIC 1ZR4A 1IHOA 1CZNA 7GPBA 2J5KA 1SH7A 5FPTA 3FCEA 3LDUA 1J8FA 2R8XA 3M1YA 3BHIA 3I01A 4PICA 4S35A 3RJZA 1VHWA 1DOZA 4YJDA 2C8KA 2SKDA 2PSSA 1W88B 3N28A 3WK4A 3L7YA 1D03A 2W6NA 1PWXA 3LDFA 1Z47A 2Z5GA 4JENA 1K7SN 3AUJB 3BFXA 2HBQA 4NY1A 1S7CA 5GIOE 1ESMA 5BYBA 4Y2XA 3RSHA 4CIWA 1TCAA 2EKLA 1L5HB 3C48A 1WUYA 4NJMB 5D1NA 3VPAA 4BX3A 4BYMA 3TB6A 4NV3A 4MJ3A 1LLFA 3K2QA 3MINA 3NXSA 4H35A 3RK1A 4CM1A 4PGMA 1QOZA 3NAQA 4MUIA 2RHGB 4HVTA 4QIHA 4B4OA 3OE7D 3QPDA 4QYWA 2Q3MA 2FPIA 4EVIA 1WQ4A 3UFXA 5JRDS 3O38A 5HDBB 4ENUA 2DSNA 1TLTA 1M2JA 2Z08A 2VBSA 4ALNA 4Q3AA 1KYIA 3ZGYA 2P9YA 3Q6NA 3WDKA 4BRUA 2DLDA 2WHYA 1Y6JA 3SD7A 3SU8A 1WMEA 5AIAA 4TN5A 4J0HA 3ELUA 3TZLA 3C3AA 3W2HA 1CQPA 2REOA 5T4HA 1CR4A 1GUAA 4J9VA 1ZC3A 2QORA 4ONEA 5CNIA 1IVSA 2EFGA 4IUCS 2CV2A 3IH5A 3KUKA 3NMUF 1NLYA 4UJ3A 3R76A 1M1KD 4CF7A 5EMMA 2QA5A 3PBKA 2V4UA 3FUWA 1MQAA 2ECOA 2YUIA 2JIBA 2XT6A 3AI1A 4GOMD 4HI0E 4MKFA 1WPGA 2P35A 2YASA 1JUDA 1KEZA 1ONSA 3AIOA 3G0DA 4IY1A 4MWDA 4IOLA 2FQYA 2FN4A 5FWDA 4EI9A 4ZCRA 5AM3A 1MMFB 4RNDB 1CJSA 1SCJA 3GD7A 1TUBA 4KWTA 3ZS8A 3VDMA 2R1TA 3RC9A 1U0FA 2VCHA 4W5JA 4JJ6A 1T24A 3E3AA 3ZWNA 1QVVA 3IV7A 1U2RA 3BFPA 3DOFA 1EP3B 1GA6A 3FFWA 2XMGA 5FTJA 3H6GA 1B6GA 4U00A 5F21A 3GRYA 4EENA 1GT91 1OIVA 2BE7A 1O97C 4FYKA 4UTZA 4EMSA 3DZHA 5L6LB 2C5BA 1KJ8A 4CF6A 1XU7A 1NSTA 2Q8QA 1WCYA 1LBTA 3JWHA 4JLKA 2ZDGA 4RLSA 3QQ5A 2QAGB 5BSTA 1F6DA 1WMAA 4I36A 4IJUA 4DUPA 3UZUA 1N0UA 2UV8A 4ZOEA 3UK6A 1OV6A 2AG6A 2PYDA 3PHJA 4L28A 3UJBA 3BBPA 1FDSA 2NT3A 1VLQA 3TAXA 4CKWA 3THWA 3VR0A 1CERA 3MXTA 1SVSA 2CHGA 2N47A 4WPGA 6Q21A 1SA0A 2VXBA 3R7WB 4FDVA 1GNQA 3ZYCA 4URXR 1VKJA 3ILYA 3JQCA 1ODSA 1AQ6A 1Y5NA 2FLVA 3LT0A 3ONDA 4YMWA 1XQ6A 3G2HA 4UZEA 3CBQA 5FULA 4EL0A 2V1UA 4DIFA 1N0WA 2OTCA 4UNPA 2XKJE 3DZJA 2Y0EA 3L7DA 3NHWA 1DUIA 4HAWA 3VTKA 3DV0A 3W8EA 3QE2A 2GTHA 2P9HA 2WNIA 2YBDA 1PJ7A 2CNDA 3OZBA 3IIIA 1BCSB 1PL6A 1KS9A 3O83A 3RBZA 5ARCA 1L7EA 3K8YA 1W9XA 2XB9A 4OF4A 4YP7A 2X0DA 1H0SA 4RHTA 4C0HA 1B1CA 5ARDA 1RZRA 1T5BA 2FZWA 2C5SA 3CRMA 4U9HS 2A59A 4LX8A 2WJPA 4QTZA 4GSYA 4QRIA 2AX3A 5HGXA 4NCAA 1NW3A 1ZNXA 1ZRNA 2V03A 1NW9B 2VFAA 3AWIA 3A4VA 1JSXA 2DGDA 1CD5A 2WF9A 2VBIA 2Y1DA 4LW8A 4CQJA 1IOLA 4BVHA 4UUQA 3V8QA 3NORA 3CCMB 3OIFA 4Q37A 3KQUA 3NHYA 3U16A 2AW3A 4HGQA 1DKLA 3I56B 2YCLA 1PT6A 2BFAA 3DYVA 5AOAA 3KPUA 1J25A 4ZCSA 3SQWA 5H80A 2FWIA 3Q38A 3V8EA 4NXNB 1XDZA 5ALOA 2R8RA 3CMMA 4ZDJA 1PSZA 2WA1A 4D5GA 1RQLA 3T56B 5AKJA 2G9QA 3PKZA 3WRWA 1IB6A 1J42A 3RNLA 4EI7A 1VYHA 4TZKA 5KKAA 2GK6A 2UYCA 1MC8A 4L8JA 1JP7A 1QH1A 2YJ5A 3ESYA 2HCRA 3EIEA 3N5CA 3Q3IA 3L4KA 1GDTA 3HK2A 1D2AA 3K6KA 4IJWA 2G28A 4GLLA 5FO0A 4EGFA 1QH0A 3WIEA 3QX3A 1JE1A 4XB1A 1JWAB 5J2UA 3UQYS 3WADA 4DSZA 4H6WA 2JFVA 4HEJA 2J6IA 4JMQA 4IDGA 5HA5A 4CNBA 3EH1A 3ETGA 3V7YA 2HFKA 2ZB8A 2JIZA 3A06A 3DLAA 3LFTA 3LUBA 4JOCA 3L7JA 3OIYA 4RENA 3QLUA 1C1YA 2PKCA 4OA8A 3K09C 5CTAA 3ZCQA 5JJBA 2PWAA 1M0EA 1JIUA 1NJSA 1XZPA 4EA7A 1T5SA 1IY8A 2BZ0A 3KBOA 1ATZA 4JEHA 2J7KA 3ZNOA 3ER6A 2BKLA 1E1NA 3RVSA 5JCOC 2DTDA 5L9AA 2JI7A 4HDKA 3FOWA 4B3CA 3V8BA 3ASSA 1AKMA 1RZRD 2WZPP 1EWRA 4A73A 1RQPA 2WWFA 1DI0A 1Y82A 2WJ4A 3EOAI 3S2EA 4HGRA 3V97A 3FTFA 1M0TA 2XTAA 2QLTA 3PXEA 3EZNA 2JRCA 1PSWA 4L4UA 5FBVB 2R1VA 2LZJA 3ER9A 3H8VA 1TMYA 1T6ZA 1IJKA 2JZNA 4R4JA 3LC0A 4L51A 3KSUA 3H94A 1GGHA 3FFXA 2VHZA 2ZSHA 4OHPA 3MLBA 2BGWA 3EXFB 1Y0YA 1GTL1 1E1MA 1PFYA 3KKKA 3P2JA 5HFAA 2RH4A 4A0HA 4ENRA 5IMBA 1JSLA 1KSHA 3H9EO 4EHIA 4V0QA 1YDMA 2DQZA 1VKZA 3DT8A 1BX3A 1VMDA 1D2MA 1KNXA 3HV0A 5CR9A 2M1ZA 4ZVTA 2WB2A 2W90A 1OGIA 1EHCA 4RVFA 1B8UA 3RU2A 5IXJA 3PEYA 3I9MA 2ADOA 3CF6R 2YWHA 1RM5A 4GE0A 2JANA 1IQ0A 5ECDA 3HSSA 1RBMA 4PPFA 4E94A 2HJHA 3IHTA 3IIJA 3EY9A 4PHFA 4BUZA 1EA5A 1GJRA 5K8CA 3JAWA 1JLMA 3RR2A 1V1RA 2C82A 4RD6A 2XA1A 3K1ZA 3CH5A 3ENKA 1RFLA 1FDWA 3RCBA 2NMVA 3EGCA 4LDZA 3G71B 4UTVA 1G5QA 2W2KA 1SUEA 5AW3A 3TR5A 1BKDR 1KC1A 5BVGA 2YHIA 2W37A 2HIAA 3H3XA 4YP9A 5M7EA 4MVJH 2E18A 1OLUB 3TD9A 1AUPA 3FN4A 1FDRA 2JI6A 4PBRA 2ZZFA 1WHSA 2FSVC 4OREX 1DIBA 1G5PA 2ZRQA 2JIZD 3IPLA 2DWCA 2HJGA 4JLWA 3K71B 3CQ9A 2PZFA 4Q82A 2BYTA 1G41A 1NKTA 1OBFO 2QNIA 3W05A 3WFZA 4X66B 4ASUA 1OI3A 4G24A 4LRQA 3WYDA 1UK9A 2AWOA 2WE7A 3BTUA 4QARA 4HDMA 2JNWA 2FJ0A 5CLLA 1RBZA 2VBVA 2QMEA 2ZRIA 4RH3A 3CVJA 1EKXA 2C57A 4Z0PA 5JJLA 3KXKA 2Y0DA 3IXQA 3AR5A 3GGCA 1MLDA 2C4HA 2B4TO 3I2GA 4PLVA 4KO2S 1AUQA 4G5SA 4O1IA 4WKOA 2ZYVX 3WVNA 1K66A 2HHJA 2HQOA 2RARA 4KI7A 4NSNA 1UM9B 4WLOA 4YJ3B 5CT8A 3D3WB 3RJ9A 1PGNA 3VAYA 1S4MA 2WYRA 1FXWA 2VUUA 4HY3A 5DSTA 1T5TA 1ESZA 2IGTA 2ZXIA 3LWNA 4URWR 4DVGA 1PVOA 1FZTA 5ADUS 3UKOA 1OT3A 1JXMA 3I32A 4JU9A 2D5IA 1LC0A 3Q8XB 4Q4HA 3ZWWA 4BE9A 3WGMA 2D7JA 1CNFA 5B58T 4QGSA 2ZR0A 3PNOA 1V16A 3G9TA 4YJKA 1HBJA 3RSQA 2F3SA 4MDEA 1HUQA 1XELA 4QRHA 1Y1TA 3RK0A 1SCDA 4NCJA 4YMVA 1F0KA 1FMJA 2HZ7A 1PR6A 4AUEA 1W30A 3HNPA 2JFWA 2XQJA 2XE7A 4LEIA 1Y6ZA 2IHZA 4QJBA 1VQ1A 3VKHA 1DB3A 2Q1UA 3BSYA 1LPNA 3L3BA 3VISA 1VIAA 2Z0MA 4FZRA 1Q7RA 2G4CA 2PNJA 4WWVA 1T9GR 1NC3A 3GLQA 2OXIA 2Q7DA 2A0XA 2BH9A 2ZAIA 4OLFA 2QEXB 1WCV1 2NGRA 4UW9A 4Y98A 5EJGA 4F4UA 1QRDA 2IY8A 4JP3A 2I71A 2XBUA 3NT2A 3MCAA 2QD2A 3OZAA 5DW0A 4P83A 4AROA 5JW6A 5DHTA 3PZRA 4MCHA 3A2KA 2QB5A 2QN8A 4LGVA 4NMLA 2V7QA 2Z6AA 1J0CA 2ZIGA 3DMNA 2ZULA 1E6UA 2WTMA 1YS1X 2CUNA 2OAGA 1KO7A 2AQIA 2BTOA 4LHZA 5REQB 3S8EA 2UXBB 1GGKA 2WUVA 1CB0A 4MICA 3M9LA 4ASUD 5C8YB 1NVDA 2OV3A 3G49A 3B82A 1D2NA 1KEEA 1UANA 3E22B 1GZDA 4QOGA 4ZT4A 1IWOA 5I7RA 2FQWA 3TVTA 4XVCA 5AVTA 1NIPA 1QMGA 1FK8A 1LI4A 3L7BA 1Z33A 1FSSA 1XD9A 1PWYE 2O50A 1QUEA 4FZVA 4ZC8A 2OT3B 3WGUA 3GA7A 1D9XA 4RD3A 1NUQA 5CM8B 4C7KA 3S44A 1PG5A 5CG2A 4YP5A 3AJRA 1Z6YA 3HB4X 1Y7HA 1JR3A 5LXTA 2JLVA 1FA9A 4KR2A 4FQ8A 4GC5A 4ZCQA 2DRIA 3NHSA 4EG1A 4GI5A 3NG1A 2R62A 3P71T 5KJCA 1N6LA 4LYDA 5LWHA 1YA6A 3H2IA 2ERYA 3OAAA 4M0UA 4OG2A 3G8AA 4FOOA 1ZSNA 4Y9SA 5BSUA 4CDNA 3HR4A 1I6LA 1J23A 1RBYA 2ZYIA 1WABA 3RGWS 2J4DA 2FA9A 3WYEA 3PENA 5FWNA 4DQKA 2FGKA 1IK4A 1CUGA 4C3VA 5A4MS 2WF5A 2WP8J 4MRNA 3OMWA 3SBXA 3RTBA 5DTIA 2P6OA 3BTOA 2YXDA 4G5HA 1R2QA 3ZWCA 121PA 5F9FA 4D4KA 1NVVQ 4MA4A 5FHRA 2P2DA 1EUDA 2LNDA 4B5LA 3CNLA 3D3KA 2IJGX 2V54A 4MV0A 4OX9B 1MO2A 2Q1WA 2HMUA 1I6WA 1QJ4A 1VJ5A 4JLPA 4CN9A 1PLKA 4L95C 5E7MA 2V7QD 4AUKA 4FU0A 4YQYA 1Z4JA 5F7XA 2BGGA 4B47A 4IQ4A 3SXPA 5KPDA 3EWSA 3QG1A 3R0IA 2LDXA 1ZMTA 2RCNA 1BC5A 1MHTA 5HF6A 1FNDA 3CV3A 2Z5LA 4EHHA 1UJ6A 4ZQEA 4K3VA 3E81A 5CUQA 3D6FA 4QDZA 2GTIA 3U3XA 3M5WA 3WNZA 4GQIA 3ME5A 4J03A 1B73A 1YOVA 1PJAA 2FPXA 4H7HA 5I4KA 4D4MA 3U1VA 2Q45A 1K2VN 2XQVA 4DDWA 2JA1A 2WUWE 3QK7A 3C8UA 2EGGA 2V98A 2AL7A 1KSGA 1U94A 1QHXA 3BVPA 4AJPA 4G25A 3OQJA 5M5BA 4YJ2A 3WOHA 3R7FA 3AC0A 4CG2A 4I6JA 2R3SA 4ESEA 1KMNA 5CIYA 3GDGA 3CLVA 5JADA 2JKZA 1QTIA 4KYTA 3Q6IA 1R0CA 1IATA 4OUDA 4YQZA 1YB5A 3CB4A 1ZK1A 2AS0A 4FHDA 4BVJA 4E14A 5IDQA 5JS2A 2Q8PA 3KHUA 4NVRA 4ZOAA 3OAAD 2AE2A 2PMWB 3AVVA 2V6JA 3ZV3A 4JSRA 1CLUA 1O7JA 1NUAA 3CC4B 1UZNA 1Z18A 4EUFA 2QGGA 2QUHA 1B3RA 3PI6A 3R9KA 3VPBA 2UDPA 1V6AA 3C3JA 1ZRMA 2G5TA 4W7IA 4DNTB 2IS4A 5E4FA 3IQZA 3NAGA 4PLZA 2IL1A 1QBGA 2IYFA 2QJWA 3EB9A 1LY1A 3DEFA 4QEDA 3GJXC 3V7UA 1X14A 4RVNA 3DVAB 2GBCA 3LBHA 3M1LA 4S04A 3MA0A 3SY8A 4AG5A 1QO9A 4B09A 4YT4A 3VKFA 4Z9XA 4F1KA 2IUEA 3RC8A 3R3WA 2ZE6A 4GAEA 2FRXA 4RZ3A 2X0IA 2XMDA 4LMPA 2CDRA 3K0BA 1P75A 4MUHA 1U7UA 1EP9A 3PC3A 3AUTA 3DPIA 3ANSA 4XWYA 4CHTA 2CYBA 2ZPTX 4IQFA 2E4AA 2JHAA 2KHZA 3Q7SA 1TTPB 3BILA 3LL4A 3MJHA 1QR6A 3HBFA 3WAGA 2GPTA 4BGVA 1YIJB 1UQRA 1ZCJA 2Q5OA 1ODFA 1XUOA 2WICA 1KSFX 2G08A 2CFRA 1AB5A 3OICA 4P1ZA 4AJOA 1JPUA 3KJQA 2H7CA 2I1QA 4UUNA 5C37A 4BJHB 1WDLA 2ZYHA 2XUPA 5BN4A 2IQIA 1ZC4A 2ZVQX 4RPHA 1NW7A 4EKEA 3JRNA 2HA4A 2HWUA 3TF5A 3L1VA 1GXSB 4EY8A 1XTVA 2A4MA 3CW9A 2IYZA 3NONA 5G2OA 1CY8A 1LJUA 2OC9A 1MO6A 3HYLA 4ZO9A 1GQOA 4F4HA 1ZFNA 3SLKA 3EPHA 4WY5A 2NUPB 3QELA 4C0LA 2P2ZA 3B3JA 3A6GA 3N6RA 4JYMA 1Q14A 1Z5WA 2NUTB 2V6BA 4MUEA 3R9XA 3C7KA 3QKSA 4GOXA 4M7PA 1R5OA 5J40A 2YV2A 3ZU4A 4MO2A 3ROXA 5C32A 1UK8A 3U4AA 4C6RA 4BPBA 3OZWA 5CCBA 2TSYB 5E6UB 2BH2A 1E0KA 1UBOS 1OWOA 4S0XA 4UBNA 4J1TA 4OGKA 3STVA 3E9ZA 4CDRA 4M9ZA 4DJTA 3BB3A 5LLTA 3BJRA 4Y9TA 4MWOA 4D3DA 4DWOA 1UMBB 1SBQA 4MITA 4YRSA 4QO7A 3M5DA 1BCRB 1RQ2A 2PX5A 1ZP6A 3P2MA 1SUDA 3LU1A 2O7SA 2QI9F 1U2DC 1DHTA 2ZCJA 3DVRX 2JCSA 3QW4B 4RMJA 2CXNA 2LP4Y 2A9PA 2Q07A 4F56A 4RZHA 4KBYA 1MGOA 2HF9A 2VYFA 2UZ1B 3HKEA 5AT1A 5G1PA 1SIBE 4BKRA 1EJBA 3VJRA 2GVZC 1JA9A 2ZUBA 4ROSA 3REQB 2JEOA 3S2IA 3SC3A 2AA3A 2X8BA 4DR1B 4CLOA 1RC1A 5CBPA 4PONA 2EX4A 1KO8A 2QN2A 4W7HA 3F3KA 3HMQA 4P58A 4ZYXA 5EJ7A 3PPIA 1TK9A 4G37A 4LZOA 4NFSA 1K4MA 4X8LA 1ODTC 2QLMA 2WLTA 5KYGA 3JATA 4MS4B 3V34A 4Y7CA 2F9LA 2RDMA 1NVFA 3WL8A 1DFHA 5DNWA 4JASB 4J0JA 3IP7A 3A27A 4OYYA 2CNLA 1I7PA 3MTDA 3R5HA 3E3LA 1Y8AA 1W5EA 2GEBA 5L95A 3FMOB 1OI2A 2IVZA 4L7QA 2O2IA 4QU9A 1TA0A 3RS7A 4R8SA 1DX6A 1MX1A 5ERGB 3AF0A 4ARCA 1F8XA 1WPQA 1LX7A 1C9DB 2JBAA 3E84A 1JFTA 1TA9A 3AB8A 2B8JA 2JHPA 4RLQA 4EFNA 1J4AA 1VI5A 3C3DA 1FJHA 2XSZA 3EXHA 3Q0TA 1MNQA 4NAVA 2OZKA 2NTVA 4JXJA 4QUEA 1ZD1A 1XCLA 3ZY6A 1FP4B 2LD4A 3K0KA 1DBQA 1G2QA 2BFDA 1XI2A 1W48A 2FMXA 4B6QA 2BPOA 3HVUA 4NMHA 4H3KB 4H1TA 3BZWA 2EWWA 5DGTA 4I3GA 2ZVJA 3GLSA 3QEBZ 2ODPA 3C7TA 1JG7A 3DKKA 4JJ7A 3LBIA 4DXHA 2J08A 4O4LA 5IT9A 3SSOA 2GFIA 1P9WA 5DXAA 2Y92A 1XQBA 3FDIA 3H9GA 3C45A 1DT3A 3ZY4A 2BZ1A 1GU1A 5JCJA 2P90A 3WLPA 3JQDA 3B3GA 2PS9A 4GL2A 2EEPA 2YWRA 2WW8A 3ABQB 2IH4A 2IU3A 4FFMA 1KEVA 4TV9A 1WD5A 1G8GA 1XD8A 5A3QA 1B14A 3N6XA 2GYVA 3TQIA 5DISB 3RTEA 3KQLA 1IU9A 3NUQA 4BLQA 3G02A 1DLIA 3RV3A 4Q7EA 3T1VA 1NE2A 2DERA 1V96A 2JFPA 3F6BX 1Z88A 2NU7A 2ZSJA 3C1OA 4PGGA 4XCXA 4E31A 2J45A 1EVKA 4FSHA 4QT4A 4ZCLA 1JH8A 5FBQB 1K7CA 4RH1A 3ZVNA 2DBZA 3IA7A 1C7QA 4IYRA 3UWSA 2AFIE 3VZPA 1HA3A 4OX9Y 3KAJA 3GU3A 4X6UA 5JH7B 2BBTA 4O4IA 4WTOA 5J5CA 2C1XA 2FR8A 1LTHR 3ZE9A 2OKGA 1Z26A 3UK2A 3B20A 1R50A 1IZZA 1V2GA 3ESAA 3A1SA 3LKBA 2WSIA 4Q9IA 5GM1A 1NDHA 1IIRA 2Q5EA 2PH1A 1E64A 2SNIE 3VZDA 4B3GA 3WL6A 4AF8A 3Q7PA 4IH4A 1FS6A 2COUA 3AL3A 1LF5A 4TV8F 3UAYA 1VSBA 4CKYA 2ORED 3Q40A 4Z0TA 4KQ2A 4N41A 2VNIA 2NSLA 2X0RA 2ES4A 2X4DA 4GOLD 5JAOA 2P5UA 4I6EA 3E82A 3ROTA 3TW4A 4G07A 3CZ5A 4PABA 3SDZA 4DEVA 3Q5GA 1KK0A 2WJJA 4QAQA 3M6FA 3UA4A 3CFYA 1WB9A 3CUKA 2GD0A 1NB0A 5FLEX 1SXJC 1ISRA 3FHLA 3I5UA 5HTOA 2JN9A 3IHKA 4MAFA 2K87A 1KO1A 3EXAA 4WCFA 3X1JA 4LA4A 4P1VA 1JT2A 1TLFA 2OBFA 4U39A 5L4NA 3P9SA 4DMHA 2D0OB 2E48A 2PRZA 1WHTA 2AKYA 1SCIA 3MOIA 4QXPA 5F3DA 4AZ3B 2B61A 1BAPA 3MHTA 2QPLA 2GFQA 5C18A 1BEEA 1ZXBA 2H7XA 1T8SA 1O6CA 1AHNA 2J0UB 2W5UA 2F8LA 1KPHA 2YR0A 3IX7A 4HXGA 4L15A 4WEOA 3ZTYA 3ESQA 2PLWA 3ILSA 1UH5A 3LYHA 4OAOA 1LDMA 2XGGA 4BTEA 3N1UA 3C39A 1KK2A 4Y0VA 4QGAA 4PU0A 1DCFA 4MUYA 4OGLA 1IPHA 3L05A 1H4TA 5GJVC 3HABA 4MV8A 1J2RA 3O2NA 3OTQA 3U3DA 2QM3A 3QTBA 3IT1A 4X1KA 5DBHX 3K6SA 4F9EA 5CVEA 3K1YA 1E2FA 3FNGA 3ODGA 3ORSA 1DWPA 4LV8B 4U7FA 3TRJA 3SC2A 2E4VA 5K3FB 1CQWA 2PGOA 2PS3A 3O4VA 4PN7A 4YRIA 3QLVC 2PU5A 1HQKA 3JQBA 3GFSA 1N8SA 1KDTA 2GT1A 5LCXA 2X6QA 2ZZEA 3W2EA 4JBHA 3WBBA 5F4JA 4ARIA 1YJBA 3Q7RA 3KQPA 3QQPA 4LZPA 1WU7A 3D1VA 4PVDA 4ZYUA 2BSQA 1YR2A 4M6WA 5LA6A 3CNHA 4G7XA 2V7EA 3B48A 4LNUA 3ZXUB 1UPAA 2G72A 3H2HA 4AJHA 4CIXA 1PV4A 4F38A 1MH9A 4GDFA 1QZ3A 1BXZA 2RGWA 4U6SA 1EB9A 2FYTA 4RHXA 3TRKA 1C30A 1LKZA 1BEZA 1Z37A 5BQ5A 3LVRE 3HEAA 4RMGA 3GDOA 1P2UA 3FDFA 3WQRA 3G8CA 1N9GA 3WLQA 2QYTA 2ADMA 1U0EA 3Q87B 4CM4B 4E51A 5JZVA 4ALMA 1XL1A 3I01M 1M2VA 5CDUA 4K2HA 4RPGA 3HKBB 5FYDA 4TTIA 2EV9A 2TECE 5DV9A 3ZZMA 9LDTA 3LT5A 2FAXA 1MCZA 4R7GA 3SKVA 5D5QA 5CIWA 3ZDXB 3QYPA 3TX6A 5IS2A 3PFIA 4QDKA 1QS0B 4KR7A 4J3JA 1XKQA 3EFOB 1A8QA 1IZ0A 1NIJA 1AXEA 4PQYA 1AC5A 4ND4A 3HVJA 3QKRA 3FRIA 3K5WA 1PQUA 3V9AA 1Z29A 4HATA 4LJ9A 4OQQA 1X7DA 1EVYA 3N2LA 2V1XA 1PEKE 1NYRA 2ZAMA 4KH0A 3RADC 4MS1B 2R5FA 3AESB 3MWYW 2H8KA 4IIFA 1TVMA 4CU2A 2R6GA 5C53B 4CQLA 5MN5A 3ONFA 5DIZA 2ECQA 1S8FA 3PFGA 1T36B 3LX8A 4JL8A 1R0ZA 1ZU5A 4OLJA 3JQ9C 4XDZA 4AY4A 2VO1A 5LMNB 1W87A 1XCPA 1KS2A 3ACCA 4V03A 1EZZA 3DPSA 4KMRA 5EJ8A 4ENPA 4ATNA 3T95A 2J9YB 3CH7A 2JFUA 4QV2A 1YB6A 4MR9B 3A6LA 3B2NA 2HSZA 3EGXB 3ASUA 1XCBA 1Q1AA 1NP3A 2X77A 2XCLA 3HCPA 3NRCA 4MYTA 1PWEA 1YQWA 1HT1E 3L5OA 4BQNA 3SHQA 3JQRA 1KF0A 5KKNB 2L19A 5KJEA 4AG6A 2CVPA 4IWXA 4KYIB 4X85A 1BFKA 3PHBE 4G0NA 2GAJA 4QDOA 1TTTA 3QW2A 5EVCA 5C1DA 2Z09A 4BGIA 1JQLB 4IV5A 3C2QA 4A0FA 1UBJS 2QV7A 1N5DA 1DL5A 4TLMB 1V1JA 4XA8A 4EY7A 1P7PA 1ST3A 4HDCA 2Q9AA 4JUIA 1DTWA 4QUBA 4XXHA 5IH7A 5AXBA 4G0WA 2DXIA 1BLIA 4BNDB 4IL5A 4Y2GA 3ENNA 1GNPA 4ZT7A 3PGVA 2HYIC 1EJ0A 3N2GB 1WUJS 3NTVA 4X7RA 4QDXA 2XZTA 1ODLA 5BSYA 3PWZA 4HEHA 3CMEB 3T15A 1QTRA 4WY2A 3F4BA 4KK4A 1IOZA 1ZD2P 1SHZA 4TXLA 2Z1NA 3K70B 3H1GA 4QQRA 1JEQA 4IVNA 4LQCA 4PWYA 1V7PC 4ENVA 2DCMA 4G1BA 1E94E 4NI5A 3H13A 5ALYA 1PU2A 1EJ6A 1SCAA 1NFRA 3JALA 2I87A 3U37A 3HU2A 3UC9A 1C9EA 3C6KA 1DQYA 2NSHA 4DBVO 5CB8A 1HG1A 4ES6A 3BGIA 4F04A 4ZRDA 1DDOA 2H1SA 2PUHA 3AMVA 3W4IA 4FNMA 4BIIA 1DXQA 2E21A 1D2RA 3OD1A 3UQZA 4Z3OA 4QOEA 3JQAD 2FF5A 1TJ5A 4GUAA 5EZSA 5LKAA 1A95A 4QODA 4H3VA 1QYIA 1IBSA 5JAIA 2OGZA 1JG3A 2B36A 1PYDA 3R3XA 4OQPA 5MDHA 3KEOA 1FFGA 1ZVMA 2DP4E 5FI3A 4BVKA 1L5WA 2PSJA 2V6MA 3BIOA 4GRDA 5C4MA 4RPDA 4ZIRB 2OLEA 1J9EA 1K88A 3MRSA 1YVDA 3EQ7A 3MUNA 4WNAA 5AD1A 2RD2A 1O2DA 3IPAA 3HGQA 4IHJA 4AP6A 1TCVA 2PUEA 4ITRC 2O4CA 1NYQA 1YR3A 3RRYA 1A9XB 4UEWA 3VSCA 3G2LA 2XECA 2HSWA 1ZH2A 2DPLA 3BFJA 3Q6QA 3WJ2A 1ECLA 5BN5A 2WIGA 3NBFA 1JQ3A 2QZSA 3CCFA 3D8TA 4RORA 1OVMA 2FEKA 1NULA 2G63A 3JCZA 3FWKA 3F6EX 1G8KA 3M34A 5E2IA 4LRXA 4IOMA 4JI7B 4ZQGA 4YR9A 2R65A 4D02A 2JHFA 2OL4A 4B83A 1F51E 1XTKA 1UPXA 4IIJF 4M9RA 4XR9A 3CX8A 3NKFA 4Y9RA 5EIWA 4F8EA 4QG3A 1JKFA 1E3ZA 3DMTA 1YXMA 3BK7A 4MQFB 4UU7A 5EGSA 4RTJA 1D4OA 2VUIB 4C78A 1Y9AA 5JXIA 1L9XA 2JK0A 3C15C 4QHTA 5LZ8A 1RPZA 1V5FA 3BOSA 4XIYA 3KZCA 3U5TA 2WD8A 2YOGA 1KEPA 3O47A 4OL0A 2O3SA 4LXGA 3EEQA 4KVZA 3CRQA 3CP2A 4OFZA 4RABA 2QSYA 2V6IA 4PAQA 1EUCA 3NIGB 3FTDA 3KD2A 5EHXA 1CUIA 1U8CB 4LRWA 2Q1TA 2WA2A 3KL4A 3NU1A 4QUJA 4F0JA 4BXOA 1HX7A 3UAVA 3OF5A 4CL0A 3CWCA 1JA1A 1G9XA 2H18A 1PUIA 2QRZA 3LQ1A 4FCTA 2O2XA 1BS9A 3OFSA 3JZIA 3R5KA 3C24A 2NZJA 2P3MA 2QV0A 3B3QA 4F6RB 5T64A 5EUBA 2CXPA 5EP1A 1RJ9B 4RK1A 1UWLA 2VK8A 4TMFA 2J4FA 1QB8A 4CIBA 3FDZA 4YIHA 1TO1E 4YCSA 4I50F 4XYGA 4HSGA 3I5MA 3VUFA 4Y1RA 5KPJA 1QZTA 4LOJA 2UYGA 4TV8B 1RKQA 1Z45A 3N5KA 4GPBA 1IBKB 1RAAA 1U2PA 1HT2E 2BR4A 2Q29A 3TOXA 2K4MA 3QPAA 2C00A 3RIGA 4BFUA 1Z0FA 3WDMA 2Q4RA 3P5BA 3TNYA 1Q6YA 2J9GA 2VDVE 1GCAA 3GLIA 2K6GA 3W2IA 4GZLA 3VH3A 3ON5A 1E2HA 2PRYA 4HQRA 2VP4A 2FPGA 3PDUA 421PA 3OM1A 1MORA 2QG4A 3EZXA 4BO6A 5FYQA 3LHSA 1OFHA 4IHQA 4CTKA 2X15A 3GZNB 2QP4A 3PQDA 1CQIA 1ZNQO 4YA6A 3U0BA 1U9IA 3WO0A 3AW8A 2ENWA 2PA0A 4Q3KA 1II9A 4CM3A 5A4FS 2WFMA 4CFSA 4ILKA 3ZKWA 3KC2A 4GVPA 1X1SA 2OCYC 4GRIA 2EP5A 1GAXA 1UP4A 1SC6A 1TEHA 2P4SA 5TNXA 1QBKC 7REQA 1K73D 2KVOA 1D4FA 1IHPA 2J59A 3D02A 3LRTA 1YK1A 4GLOA 4WHMA 3GAAA 2B98A 1YCGA 1U3DA 1Z7BA 5IJ0A 3T35A 1CZKA 3P52A 2CMDA 4INJA 4F85A 2B5OA 1A9ZA 4LVOA 3QLEA 4P3KA 2R85A 3W4JA 3BA6A 1QVZA 2ONJA 2PT5A 5CCDA 1AKUA 1KORA 1YB4A 1QGDA 1YJ8A 4EHFA 2IZ7A 1UBNA 4P6YA 1IZ7A 4G2TA 3T4UA 1U90A 4E0FA 4QU0A 1THTA 2JI8A 1MB3A 5AHRA 3KOUA 4Z54A 2O57A 3VYWA 1TRKA 2H0AA 2O1EA 3ADKA 1UJNA 3KYCA 4DMUB 2G0TA 1RU3A 1XIVA 3L93A 5G02A 2DEUA 4ZCPA 4YUWA 3HTXA 1HYHA 2V96A 3VNSA 1IUPA 2PH3A 4GKKB 2JGDA 1CR1A 1KYZA 2OCXA 3CE9A 1A72A 3EZYA 2YRFA 3OEWA 1LPPA 1RDFA 4OGGA 1AOXA 2XXBA 4GMHA 4K9SA 2LRHA 3OLVA 3V8MA 3VM6A 1B6SA 1K9SA 4O2RA 2RBEA 3DDSA 3PUHA 4GYKA 2BMWA 3RARA 4E4RA 2PE5A 4A9AA 3C6ZA 5JLJA 4KO3S 2C7QA 4Q1BA 5A02A 3PFWO 4JL6A 5A1TA 5IT4A 2Z98A 1JAHA 4V0SA 1XWWA 4GXQA 2A1UA 4NAHA 5DHQA 4ZV4A 3F7TA 2OV6A 3MT0A 4QXMA 3RRJA 4EOGA 1PK8A 2VPXA 3HY3A 3U62A 3CVWA 3IESA 2Y93A 3CC8A 3IJRA 5EJMA 4DV2B 1HO3A 4GPAA 3G88A 5EIHA 4NNOA 1IZYA 5LB4A 2ZTVA 1YR6A 2CVFA 3FLAA 4MR7B 1WPXA 1CW2B 3AIKA 3IOCA 3DAOA 1WP4A 1DOHA 4N49A 5EXXA 5JDCC 3PXAA 3LL7A 4HADA 3RS3A 2ID7A 4AJNA 5LJLA 3K9FC 2YL2A 2XE6A 2VJNA 4IDPA 3FCCA 3P2EA 4NRDA 3VO2A 4AK9A 5LM3A 1T8WA 2FXVA 1LSSA 4IHKA 3M2TA 3GJ0A 4FMCF 4PHCA 4TYMA 3WLLA 3RW9A 3JQPA 3CMAB 1NAHA 4IOJA 3ZK7A 3RFUA 2ILTA 4IFEA 3CJTA 3VXKA 1M2OA 4QJIA 2JLZA 2XYQA 1W7AA 2WWVD 3DWGA 5CFOA 4Z3DA 2VJOA 4PZUA 5A4DA 4QREA 3FIUA 3KXLA 5FORA 4H0CA 1RWBA 2H85A 2RGYA 3IERA 3CKLA 5TDHA 6REQA 1M72A 4PAOA 3A70A 5KWIA 1RAHA 2Q4DA 1RNLA 3IR7A 3KQSA 3EF3A 3F9RA 1Z5UA 1QYXA 4RX1A 3GUZA 1T4MA 5AXAA 1P1FA 5EUMA 3T7RA 3T1TA 2M5SA 1FJ2A 5U4XA 4D3XA 1A8UA 4JYAB 3EZFA 3IUJA 3JZMA 2ZE8A 5I7OA 2D06A 2RGEA 2FEWB 2CEAA 3A04A 4N6NA 3T4EA 4CT4B 3IQXA 3D7SA 3IEKA 2ZRMA 4IXMA 3LXXA 1GLNA 5K3OA 3F0TA 5AJZA 3UPTA 5EP2A 4EJSA 1OAOC 3H8WA 1D09A 2C9YA 3EVAA 4XZ3A 4M9QA 2H1OA 1BN7A 3DMGA 3X2SA 5B58C 2IWHA 1JIJA 4HXFB 1ESCA 2ANCA 3FWYA 2ODEA 2R2GA 1WWKA 1KQOA 4F5EA 5DZSA 5KYKA 2GF9A 2C42A 1PBNA 2XB8A 2ZYGA 3EXG1 1TJNA 2G1KA 1SBCA 5C4IA 1PS8A 4H7IA 1G5RA 3I39X 4L5CA 4OFWA 5GOTA 5LOVB 1CNEA 1Q3TA 5F33A 1GQYA 5IJXA 4EPVA 3GUCA 3OKFA 5EIFA 1KETA 2QN6A 4Z1OA 1R8JA 4F60A 2IE8A 1CZOA 3SX2A 3DQZA 2EG9A 3FTCA 3MUOA 4RIIA 3QNMA 3BQJA 1NXTA 2D1FA 5FBLB 1VSUA 4F1JA 2TS1A 2ZSKA 1E8MA 2NPIA 4GG1A 1L1RA 4B79A 4CEJB 4A15A 1RHQA 5LDGA 5T8KA 3CT6A 3HACA 1LD3A 1NATA 4MHOA 2RJOA 3GNLA 1C9YA 1AURA 2GN9A 2IYSA 4A23A 3AONB 5K3EA 5LFAA 4FFSA 2EZUA 4YMHA 4HEA6 1BMTA 2Q7OE 4NONA 1Z6AA 1NMXA 3GFVA 2VG8A 1AGPA 3O1JC 1FJGB 5BN1A 5THXA 4ABYA 1S2IA 4R1NA 5ALFA 2VJAA 2WWHA 3WL3A 2XYHA 5D1HA 2W83A 2JFFA 4GBJA 2AH5A 2J9FB 3LUFA 4EKDA 2OLKA 4GHWA 1MEJA 2K2QB 3S2GA 1BVUA 4TMWA 4PQRA 5L51A 5JJCA 1IN6A 1L6RA 4EEZA 2YJ3A 1E1CA 5FPYA 3T3HA 5K01A 1EWYA 1G4AE 1UBLS 3HBAA 3KOWA 2IU0A 3JVDA 4Y6LA 4YV0A 5JSKA 1L7QA 2DUNA 2JGKA 1ZCBA 1AX9A 2C99A 3FWHA 3NEJA 3I1FA 2V5AA 1NMQA 1PL7A 2XI4A 3BWYA 1UZLA 4AMVA 1L4MA 2O2YA 5J2TF 3IILA 4P3NA 4L9AA 3KJZA 3O6VA 4R31A 1VYTA 4EYKA 2GCIA 2X23A 3QU4A 2BEWA 4BEWA 2OK7A 2Z2IA 4HWOA 2FY8A 2AMVA 4OY3A 5TQJA 3UOGA 3VX3A 4D97A 4IUBS 4KXQA 2Z43A 5JS6A 5IK2D 2Y6VA 2X2FA 2X1HA 3KOZA 3OPOA 3SBDA 3WRYC 1VLVA 2OUKA 3ZY5A 4WMLA 1Q7YD 2HBRA 2W00A 4HBGA 5JZOA 3MW8A 2FFQA 2SKEA 1XZKA 3DZCA 4LJKA 4PAWA 2WU0A 3PE4A 3R6JA 4OK5A 5F1PA 4DY6A 5BWBA 2IIPA 1UD6A 3OJWA 2VTBB 1WF3A 3K0EA 1ZW1A 1N5JA 4U2DA 3IUPA 5A6VA 4AFNA 2BGTA 3GUYA 3A1PA 1WOPA 2HBZA 4QPDA 4BO2A 1GAJA 3IAM6 4HDRB 3UGQA 3RVDA 1S8OA 3N0VA 4WOCA 4BIMA 5JS1A 1E2DA 3KIPA 3S4YA 3VQTA 2W6JA 1VQPB 3SEJA 2I4OA 1R8XA 3PUVA 2ZI4A 1J8YF 3G5TA 3TFQA 4QPJC 1O9HA 4GOJA 5SY4A 3CM0A 1H8HA 2I2WA 4A0GA 1G3RA 1YBAA 5CD9A 5FLYA 5JVDA 1SHUX 1ZKMA 4NYJR 1NUHA 3D3EA 5D7NA 5B1SA 2IV2X 4EJ6A 3O2SB 5A5GA 3K0HA 3V9PA 4UAVA 2R84A 2GS9A 4PE5B 3E61A 2XUAA 5KCMA 1POWA 4P93A 4AF6A 1KBZA 3HCFA 4JLVA 4QDJA 3FOZA 3GZ4A 2CUKA 2FZLA 5A05A 1A5BB 3MOGA 1RQNA 5TS3A 4G8BA 2WHPB 2WTAA 3MUFA 5G40A 3N58A 4KACA 4TMYA 4X90A 3KZOA 2PCLA 3I83A 3V1NA 3RF7A 5HHTA 1JZQA 4QFDA 4IX1A 1DFGA 1E3QA 3D0RA 1B2RA 5FNVA 1NQTA 1HNZB 4U3JB 3KEWA 1RHKA 2D2VA 4GYJA 3CN7A 3ZI7A 4E5SA 2WU8A 4QTUB 3X2FA 3RIMA 2W2PA 4GX5A 3UXHA 3AJEA 3KHSA 4B80A 4BP3A 4LF4B 5HIAA 5BV8A 2V5VA 3LNCA 2EW2A 1ZGAA 3I72A 1TYBE 3DB2A 1EDEA 3LG2A 2ZSUA 5KTTA 3G7UA 2VBFA 5ALPA 1II8B 3OEHA 3EHEA 1L4NA 4HX2A 4O0MA 4PXSA 3SYLA 3TZCA 3UATA 2HA7A 2PGIA 3GY0A 5E6RA 1ZIOA 3KV3O 1CRZA 3EIFA 2ZETA 4DMFA 1EIZA 4FCCA 4GC9A 3R8XA 1UPCA 3EVCA 5FL7A 4F3RA 2CHVA 5JXGA 3UPUA 4NTZA 2HIMA 5D3MA 4UU1A 4ZVSA 2CLMB 2YHAA 2VWGA 3VBCA 3ANLA 1ZG3A 5CAEA 3L7CA 1PF7E 4FMPA 3RYCB 1FQOA 1M1YE 1FBTA 1MIOA 3IB6A