1QGZA

Ferredoxin:nadp+ reductase mutant with leu 78 replaced by asp (l78d)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRDYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ REDUCTASE)
publication title Role of a cluster of hydrophobic residues near the FAD cofactor in Anabaena PCC 7119 ferredoxin-NADP+ reductase for optimal complex formation and electron transfer to ferredoxin.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qgzA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qgzA02
1Q81D 1VQKB 2GPJA 2XNCA 4J0QA 3AVXA 2QTZA 3PENA 4M2LA 4K1XA 2BV3A 3QFCA 2BMWA 1NJID 1TUIA 1IB0A 4RJLA 2YWFA 2YWEA 4PGOA 1EXMA 1YI2B 3E1YE 1UMKA 1QUFA 4QHYA 3CD6B 1AIPA 1BX0A 3AGPA 4UAJA 3OZUA 1M90D 1VQ8B 1DARA 3OZWA 1GAQA 4H9GA 4RCYA 1K8AD 3AVWA 1G7CA 3I1FA 1YJNB 1G7RA 4QFMA 4DQKA 1S72B 2DETA 1N0UA 1QGYA 1KK1A 3W5VA 1OGIA 4YAOA 3ZZUA 2ZITA 1QVGB 2QTLA 3W2EA 4B44A 1EFCA 4LBYA 1D1NA 3W2FA 3ZBUA 4NBSA 3VO2A 3WY9A 1YIJB 2QDXA 4C0SA 3AVUA 2DCUA 3G6EB 3E20A 3OJXA 1AMOA 3G71B 4AF7A 4RD1A 2QA4B 4RD6A 3CCSB 4ACAA 1QG0A 4F7DA 1FNBA 1VQ4B 1E63A 3B8HA 2BGIA 2RC6A 4MYUA 1N8RD 2GQFA 2B7BA 4ZGNB 1QFZA 5HXBA 1S0UA 4TMZA 3ZBTA 1Q86D 1YJWB 1KK0A 2BSAA 1KK2A 1QX4A 5TY0A 1DG1G 5KSWB 5DSZA 4PC7A 3CCMB 1ELOA 3CCUB 1VQOB 2D74A 2NPFA 2VZLA 4IW3B 4B43A 1FNMA 4HE5A 5TR9A 1OB5A 3CRZA 1DDGA 2RC5A 4P6VF 2EIXA 3AVYA 2EFGA 1QVFB 3CCVB 3VNVA 1Q82D 1J9ZA 3W2GA 2OTLB 4FWTA 1R5BA 2PMDA 3J81k 1CQXA 1OGJA 3WBKA 1Q7YD 4YAUA 3MCAA 4RD0A 3VO1A 3G4SB 4R71A 1KRHA 1VQPB 4TMWA 4TMXA 4M0LA 2YWHA 1YITB 3CCLB 3JQPA 3W2HA 4AF6A 3CMAB 3CXCB 4LBWA 1ZM4A 1NDHA 1XE1A 1ZM2A 2AHOA 3I56B 4ZGQB 1VQNB 3WYAA 2J7KA 3FPKA 5EMNA 3ZZ0A 1GO2A 4G1BA 3QFTA 1OB2A 1I7PA 1M1KD 4M53A 1YJ9B 3WXMA 3CW2A 3LVBA 1B2RA 3W5UA 2OTJB 2CNDA 1B23P 3U2QA 2C78A 2VNKA 3AVTA 1CNEA 3B82A 2BGJA 4YAWA 5JBQA 4ZCLA 1KTVA 1VQMB 3LRXA 5H59A 2E1RA 1VQ9B 1F60A 1KK3A 4RD4A 1FNCA 1GR1A 1QUEA 2PIAA 3CCRB 2BPOA 4PC6A 4ZCMA 5FA6A 5H5JA 1H85A 1U2RA 3QFSA 4U9UA 3OW2B 1IJFA 3FJOA 3W2IA 4B48A 1DDIA 3A1FA 3U6KA 3P27A 3JQQA 2OK7A 3QFRA 1XB2A 1TVCA 1G7TA 1KQSB 3VNUA 1EP1B 3CPWB 2B5OA 1FNDA 5TV2A 3CCQB 2FX3A 2VYQA 4M4SA 3V76A 3VMFA 1ZM9A 2PLFA 1VQ5B 4Y9UA 2VNIA 1D8TA 1JB9A 3CC2B 2VNJA 3CCJB 4YAFA 2B7CA 4AC9A 3U6BA 1QGZA 4Y7CA 4ZCIA 2QN6A 1ZUNB 5GV8A 2R6HA 2YWGA 1FRNA 1KD1D 2HDNB 1R5NA 4B3XA 4P3YA 1EP3B 1N0VC 4RD3A 2QMUA 4M1KA 3CMEB 1KJZA 1HA3A 4TMVA 2BN4A 1W34A 3CB4A 4YALA 3CCEB 4FN5A 1F20A 3ES9A 2CRVA 3MHPA 1TLLA 3QSYA 1VQ7B 3B78A 5THXA 1SKQA 3OZVA 2DY1A 2BVNA 3ZZTA 1E64A 1SM4A 3I55B 3P26A 3WNCA 1K9MD 1JJ2B 1BQEA 4HE6A 1GJRA 1D2EA 2X3UA 1YHQB 4G1VA 4LBVA 3AVVA 4PC2A 4N3GA 3WNDA 2OK8A 1ZM3A 4N3NA 4RCZA 4BPRA 4TN1A 3LO8A 2BF4A 2DEUA 3OJWA 1KC8D 4LBZA 4Y9RA 1GVHA 4LC0A 2HCJB 1IJEA 1W2BB 1R5OA 1WDTA 4RD2A 3SJZA 2HMAA 4EH1A 4WQMA 3WBJA 3LYUA 1JA1A 2C77A 4ZV4A 4TMTA 3ZC3A 2XNJA 4NCNA 1A8PA 1QFJA 4B47A 5GV7A 1VQLB 2BM0A 2BM1A 1EWYA 3AGQA 2QEXB 1K73D 4C43A 1FRQA 1JNYA 4Q7JB 4YHBA 1JA0A 4G5GA 3JQRA 1QFYA 1TTTA 1VQ6B 1W35A 3CC4B 4B4DA 3CC7B 1H42A 3WNBA 1QH0A 1EFUA 5AN9A 1W87A 1EFTA 3QE2A 4ACBA 4PC1A 3MMPA 1G7SA 1FDRA 1BJKA 1BX1A 1GAWA 1CNFA 2DERA 4FK8A 1EP2B 2VNHA 4DQLA 1E62A 3W5HA 2XEXA 1QGAA 4MYTA 4PC3A
chains in the Genus database with same CATH superfamily
1AGRA 4EW3A 4XUCA 3RRZA 5L40A 2AN4A 2DHRA 1F0NA 2GPJA 4WNCA 1ZAYA 4J90A 3KXDA 2VP2A 5IRCD 2HCBA 2BMVA 5JRDS 1QP0A 2HX1A 1Y98A 2QTZA 5F4ZA 3PENA 2GK4A 4QQRA 3FOCA 5CDFA 2ZZEA 4B8WA 4A2PA 3KT0A 4RANA 3ROXA 1QIJA 4FFNA 3ANNA 3PF8A 1FEZA 1NUPA 3FI0A 3D43A 3L5KA 4PGOA 5EA2A 1ZITA 4Q00A 1EXMA 3SS8A 3N07A 1PEKE 4NK5A 3ZE6A 1SCQA 3IVGA 2JD1A 5JJLA 4PZAA 1SEPA 2UUOA 5BN4B 4B76A 4BN5A 3WRVA 3K0FB 5JJCA 1AIPA 4OAPA 2WHRA 4XJXA 2H1LA 2GARA 2PRKA 5ER6A 3TZCA 3LFHA 1V9SA 4OP7A 4J16C 1JI3A 4KX5A 1ZN8A 2V6JA 5HMLA 4YXWD 3P2JA 1I1OA 4NCJA 1KEWA 4JVOA 1FYXA 3TBHA 2WW8A 3P20A 2B36A 3A2NA 2K5UA 5HZAA 1MX1A 3DOFA 4QD3A 5GAJA 3A58B 1R2QA 2RH9B 3S5JA 4XX1A 4UUQA 4E7PA 1A88A 4BB5A 4PGAA 3FPAA 3ELUA 1AUPA 1K0UA 3DBIA 4I66A 3EXEB 2ZB7A 4UM7A 3O3OB 2W0SA 4YLEA 5I8ZA 1PWZA 1IK6A 2IYLD 4G36A 4MQ5A 2UUBB 1L2TA 4RTKA 3FW1A 4Z1MA 2G5TA 3IQXA 3KT3A 3L8CA 5E8JA 2I55A 5B37A 3ZGZA 1AKNA 2ONJA 3SQLA 1IQUA 4GOJA 2BFFB 4EPVA 1Y7TA 1U02A 1UJ4A 1KYWA 1WOMA 1MC8A 1E9CA 1NL3A 1PZEA 1SKUA 1Y48E 2ZB3A 3QE4A 4U2EA 4XEUA 3WTBA 4CN9A 3M4NA 1RXYA 1JUDA 2P6RA 1LPOA 1YJ8A 2GJPA 4NMXB 2HMTA 2GZAA 1HKHA 1Z06A 3IPAA 3H2JA 5G4KB 4BNDA 4EATA 5B6JA 4CEHB 2ZWAA 4DABA 1B0PA 3GBSA 3RI3A 1NZFA 4EFLA 3G8YA 4REMA 4Z0NA 1AMOA 2P3MA 1OPRA 1SWVA 4O1IA 5E95A 4HNVA 4A0QA 3KKQA 3QU2A 7REQB 4PYKA 1LS1A 3JVDA 4PG6A 4JI7B 3K9QO 4PO1A 1F9AA 1UPTA 3L7DA 4CLOA 5I9BA 2B35A 1PV1A 3L2OB 3KB1A 3LW7A 3LIPA 1IY8A 1Y3CE 2PJZA 3B8HA 2YOHA 1C7EA 1BCRA 1N07A 1ECCA 1ETHA 3MINA 4RIHA 4C2BA 4BEBA 1N8RD 2J3MA 3FX2A 5HF9A 3SKVA 3I5XA 2V4DA 1LQTA 3G79A 4C6HA 1WTAA 3NRCA 1YUNA 2C2MA 5HKKA 3K8ZA 1SN7A 2N0SA 2IU6A 1JAYA 3O4HA 3QTLA 3KX2A 1J4AA 4JBWA 3EEFA 3TAHA 5JC8A 1A1SA 1HQKA 2P40A 1WLSA 2P90A 4IRXA 4C78A 2P2GA 4J1NA 5E7QA 1ZJYA 1GWNA 4ROTA 4DE5A 3WVNA 4FGLA 1JN0A 2XYPA 4DCVA 1MNAA 1JSZA 1OFTA 4K9KA 3UMFA 1FZTA 1XD8A 3KOWA 1GTSA 2WFLB 3EW9A 1I8TA 3P0FA 1V6AA 5DHUA 1L9KA 2WDPA 5CM8B 4GXQA 1CKEA 3N2KA 3K7EA 3STWA 1N78A 1W5EA 3IBCA 2PR2A 1XV5A 1X8KA 1ZISA 3EDQA 2ZQ5A 3OTIA 4YS6A 4FUQA 1YFKA 4AO7A 1F8YA 5FNZA 4ESHA 3L49A 4FJ1A 1GSAA 2VH5R 2OE2A 3DPSA 4FN4A 3IVXA 2A30A 2XKBA 3COJA 4YHHB 3R0ZA 3TXAA 1AZSC 4KGXA 3ZI7A 3VYVA 4IGAA 4CDMA 4AKTA 5BUCA 1RAEA 3F71A 1SCNE 2ZDQA 4IKEA 1J22A 1OWPA 1UXKA 4B6JA 3EARA 3KL2A 2FPGB 3LHKA 3P8ZA 4G5QA 3WLNA 1PJRA 3A3OA 2QJRA 1FVHA 4Z4YA 4JROA 5IYNA 1Q20A 4PN7A 4WJKB 4H6VA 5BN3B 1DI0A 4K9LA 1UK6A 2KS6A 3IPXA 4D9JA 4DT1A 3LHDA 1NFQA 3JQGA 4MW7A 2HH9A 4DARA 4E4YA 4EYSA 4YRNA 3U0BA 4DLLA 2ZI9A 4P12A 4YRBA 3C85A 5E6SA 3OOWA 4GX1A 2X76A 3LJKA 3SFTA 1QE0A 4KMMA 5IDVA 3KNZA 4Q4LA 4D8YA 3RC8A 3PCTA 2NU9B 2VK8A 3I72A 4DS3A 1FOEB 4O8ZA 3GOQA 4G2TA 5ALSA 4DVGA 2ZAMA 3TM5A 2A33A 2ORIA 5C4GB 4DL9A 5KNBA 3NVAA 2Q0XA 2CK3D 4CIBA 5ELMA 4OJQA 4X63A 3O83A 1U0FA 1NZDA 2FWNA 4GW3A 2JDIA 3S27A 3RARA 1PW7A 1K98A 1P9WA 3C3YA 1YL5A 3HACA 3GLIE 1YZVA 2XQGA 4BLPA 3U56A 2ZFUA 4W5HA 1SPXA 4XVQA 2OB1A 4X24A 3SKYA 4UPEA 1U8EA 4NCXA 2FWMX 3I58A 2R8EA 5EZ6B 4FXUA 5CYOA 5IKMA 2C5HA 3DBHA 3GV0A 5DBFA 5JAPA 3O82A 4NYMR 5A5DA 1OVGA 1SIUA 3L02A 4ABTA 2OG1A 5BMVA 3KVVA 3UB4A 2VHCA 2OY0A 2XIQA 3O7MA 3E2IA 1XTQA 2VWGA 4R8RA 3ZPXA 1RKBA 2PKRA 3BD9A 1FFGA 1WMBA 2D62A 2O48X 3BB1A 1U2ZA 4UMDA 2FPOA 2YXLA 3OF2A 3QV2A 3W6UA 3RYHA 1GPWB 2BLNA 3AYXB 1MF7A 2RIPA 3B2QA 3LVBA 1KZYC 1YDWA 1V6CA 1ZW1A 3DA8A 5T64A 1J00A 3MWKA 4PZEA 1M5RA 2OP1A 1IYZA 3F78A 1XZIA 2BGMA 4YXWA 3W5UA 3GQVA 4RWEA 4YJGA 4YONB 2CNDA 3UANA 4EVRA 1Z4PX 3EGXA 3EMKA 3IT2A 3VISA 1XD2A 3EYAA 2DQSA 4HDCA 3JPWA 2EL9A 2A3RA 2VNKA 1XTUA 4FB4A 1SVNA 1CZRA 1E3XA 2QLNA 4C7KA 4JENA 4KXQA 4Q47A 3H5AA 5BRAA 2B92A 5KOJB 3PTLA 5J4LA 1L8AA 2WTEA 1NX9A 4QFDA 3UXHA 1SCUB 3GLQA 5LCXA 1J2YA 1VE3A 2PVSA 3QELA 1S8FA 3TIGA 1QH1A 5KOHB 3TDMA 2GO1A 1IOVA 3BBPA 3RW9A 1U2TA 3BPSA 3K1YA 1GFIA 3OICA 1A9YA 3WWPA 1MOPA 1PCXA 2DE0X 3EVTA 3L8FA 4IO0A 1JKXA 5HA5A 4PSAA 4TPKA 5EUQB 3NOOA 3H8JA 4WZLA 1LPBB 3AU9A 1Z8DA 3LC2O 1NB0A 2ZR9A 2FF5A 3A3KA 2QD5A 1NURA 3HEAA 3OKFA 2NTEA 3HFRA 5K51A 2B37A 5JO0A 4WKPA 4C4PA 3QKUA 1OIWA 2QTMA 3G7SA 4EF5A 2IXGA 2HXGA 4UASA 2BPOA 1ARZA 1LJUA 5IYQA 4RVHA 3DYVA 1I0LA 1BKYA 2O0LA 2ZULA 1W5AA 3HVIA 4KYTA 4L7QA 4MI3A 5BRNA 2VKQA 3GC6A 4I36A 5L3VA 4Z0HO 1I24A 3PFNA 3DB2A 1YE8A 3RLIA 3D6HA 1BVYF 4OM7A 3OIUA 7AT1A 8GPBA 3A6PC 1AZTA 4YA6A 2X5XA 2OECA 4RZXA 1JIVA 3H9QA 2AQIA 2VXBA 3HG7A 2OBFA 4D3FA 4XVUA 2IF2A 3E9MA 2VJKA 4HDKA 1E6UA 3S68A 4AB1A 3NHKA 1JR3D 4CT5A 3EIEA 4YY3B 4AMGA 3H1PA 3KS9A 1W19A 3AUYA 2F17A 2AXEA 1I6KA 5BWBA 1NVVQ 2O3UA 3TQQA 2FN7A 5LMZA 2QLTA 3V46A 3T94A 1CE8A 4UHDA 2A0XA 4OLBA 1CY7A 5G40A 2FZKA 5C5EA 2RGXA 2VYNA 3TZEA 3QY0A 5COQA 2OVBA 2FX3A 2R8RA 5DNYB 3HZRA 4OLJA 1MIOB 5A3QA 4LW8A 2HK6A 5M7EA 4EJSA 2VJIA 1UINA 3VYSB 1OV4A 4UVEA 1ZUHA 4G0PA 3VKFA 1JB9A 1XTPA 2ETVA 4M1WA 4WOPA 3R7WB 4BO0A 4RTJA 4MKZA 4C76A 4JI1B 5AJHA 1PG5A 4K46A 2I8LA 4B0PA 1RBQA 2J3DA 2VAPA 4MLDA 3FROA 5K7SA 2BELA 4FTWA 1K7XB 1GYRA 1WJGA 3JD1A 1JBEA 4MUJA 1EA5A 2MINA 2B7LA 2VJQA 3GPIA 1PJ8A 1RRMA 3ITNA 1ZGZA 3MB8A 3OLQA 4N3AA 5JE8A 3B5JA 3CVVA 2Q4RA 2IE8A 3ZGVA 4LY6A 3DCJA 3KZOA 1UDXA 4LOLA 1C8BA 3FN4A 4F2WA 3U9LA 4PQRA 4JXJA 4B3XA 1T10A 4Q37A 4CKCB 1XTTA 3LWNA 5GONB 4MV4A 3SD7A 1HT2E 2A67A 2QLLA 3AB3A 2XYQA 3GT4A 1I33A 4H6XA 2CDNA 4R3WA 5L3SA 1CVRA 3CVYA 3G49A 4L07A 3CPHA 1ECPA 3HA7A 4B83A 2HU7A 4I9GA 4YUVA 2O59A 1X0VA 1SQ6A 3TJZA 4EECA 1HYHA 5CX1B 2IEDA 5COBA 2NVUA 1Q0ZA 4DNQA 1KDZA 2XWSA 4RIFA 2I1VB 1M1YE 1W5TA 5AOBA 3P9XA 4ASUD 2I8AA 4XCVA 3MHPA 3DPIA 3I32A 5HFNA 5DNCA 1EFPA 2O9JA 1TA9A 4WBNB 2PHZA 1VZ3A 3K8YA 1IHXA 3DDSA 1H9BA 2XNDD 4QLAA 1PL6A 4EHHA 4R7ZA 2AEFA 4Q9AA 4I2NA 2BKUA 3T0GA 2AJCA 4XE5A 3W1EA 1HETA 1Z0DA 2WZDA 3PNLA 4LYEA 5FEUA 3WNCA 3SBOA 1S8AA 4LVNA 1E1NA 2PKYX 1AKRA 2R8OA 4MKFA 2I0FA 4MR8B 4N8SA 2XMZA 4R1SA 4UDXX 4TTSA 2A9KA 4O4IA 4L72A 1P0IA 2J7PA 4L8FA 3RDPA 4RTQA 2OCIA 4MHOA 1PVVA 3CO5A 2FUKA 1AQUA 1CRLA 2XUKA 3PJRA 5I7RA 4D9KA 4DHEA 4N3NA 4HAYA 1P2UA 1QDEA 2O57A 3TEFA 4CIDA 2QVZX 1Z8FA 3DKVA 4EY5A 2Z2ZA 3UKJA 4B7ZA 3P97A 5LBTA 3ILVA 4XW2A 5BOSB 5I4KA 2D7DA 4X07A 1MUUA 2F67A 2GCOA 3ONNA 3F2VA 1GQYA 3OQPA 4O02B 2DEUA 3HUEA 3NC0C 2HRZA 2R97A 1CUUA 2E3JA 2YJ4A 1Z29A 3ZWVA 3AILA 3SLNA 2VPIA 2B78A 4R31A 3ZBPA 3KB2A 3C2QA 5IAEA 1Q2XA 4Q9IA 3ND5A 3R4VA 5K99A 3T9DA 4AL4A 1AJEA 2IRWA 3UEOA 1M2WA 2PS0A 3LXUX 5JCJD 1YDEA 1DJQA 2E4XA 4O2AA 4P9NA 3W5IA 1XJCA 5CBPB 3OJ0A 2VOEA 2GEJA 2ZREA 2YUTA 3K0EA 4C7XA 5IF9A 2V5UA 3QWIA 4FYVA 3RF7A 2BP7A 3OEWA 3U3XA 4E5UA 4LJ7A 1OLUB 1Z6PA 2IHTA 3W6PA 2XYHA 1R50A 1YL7A 1RJDA 3CUYA 1MD9A 4OHPA 3WYDA 3Q8MA 2BFBA 5IT5A 2VJOA 3SYNA 2UKDA 5JXHA 1EXVA 1H65A 3EDYA 3F4LA 1CDOA 3KUUA 3OLWA 1TPYA 2CMGA 4H77A 4FE7A 4YIKA 1SXJE 4RAOA 1QMGA 2B69A 1L5NA 3UQYS 3KR9A 4DNRB 2C31A 3BEOA 4HEHA 2JPDA 4HRAA 3RSOA 3BN3A 5JZMA 4OBEA 1GGVA 4V39A 1W9MA 2GX6A 1OKKA 1KY2A 2I54A 2LIVA 4KRYA 4UMVA 3ISTA 4JC4A 2XKJE 3RYIB 1ILEA 1MHTA 1Y8RB 1J7JA 3A3GA 1K3FA 4MS1A 1XZCA 3WJ2A 2UYCA 2FSFA 3CC4B 3KXIA 1CZHA 5SZKB 4D5GA 1H8EA 2XTNA 3LUCA 1MG0A 1HZJA 1QH0A 1E1KA 4Y1FA 4YQZA 3TO5A 3VPSA 3IC5A 3BDIA 3OU2A 3DKPA 5J1SB 3DOIA 5BN5A 3QMWA 5D01A 3DZCA 4Q02A 1NXPA 1UAYA 2W43A 3I2GA 4LGCA 5CX4A 9LDBA 3RJ9A 3OE5A 4KO1S 5H7XA 3W3AD 1ZK3A 3JALA 4MV6A 1T0HB 4ZXPA 1UK8A 3GEBA 1WA5A 3AZOA 2BKXA 6NULA 2I87A 3DXZA 4JQYA 5FRDA 2ORYA 3AR6A 2W4QA 1MT3A 4TYYA 1K7FB 2AK2A 5EMHA 5C8VA 3HXLA 4KBGA 3RC2A 1JVSA 1C3OA 4RPGA 5JDCA 5C53B 3I5YA 4P4UA 1C80A 1M7BA 2WSMA 4BFZA 3VHXA 4R3NA 3AUJB 2XPCA 5SZHB 3TR5A 5FTLA 2ZS9A 1BC5A 1IBSA 1XVLA 2P1RA 3R7NA 3RS9A 3RVRA 1XQ1A 2C7BA 5AW9A 3H7IA 3NXSA 4RPKA 2CXOA 5KMGA 3LCVB 2WWTA 2QROA 3OF3A 2RH4A 3R41A 4LOKA 1EE1A 1N4AA 3TR6A 2ZJ2A 4I1OA 1RLOA 2IODA 4DKXA 3RSZA 5KEIA 2Z57A 4BL5A 1ZMOA 3E8XA 3SLKA 5HJ7A 3WLEA 3CR7A 4PX3A 1X94A 4IVRA 3OP1A 1WB4A 1OX4B 4RJLA 2ECFA 4X3PA 1A98A 5BYJA 4FGZA 4ND2A 4AULA 1ISMA 2YWEA 3BMNB 3A8JA 2IY8A 1MTOA 1QPBA 2XUOA 4Z3DA 1U9JA 4G1MB 3PNVA 2VHUA 3ROTA 3E1YE 1F12A 2B6HA 2IP4A 4U2GA 2ZTSA 3CX6A 4HLNA 5AI8A 2JI6A 4NF2A 3DMTC 3RRNA 3ERCA 3T52A 5KNDH 3UG7A 1ESEA 2DHEA 1D03A 1ZNQO 4IZIA 2IHUA 2R6JA 3BC1A 4I08A 2AGVA 3CNHA 5D3QA 4K9SA 2M5SA 2PMBA 1S3IA 3IJPA 2HHLA 4X90A 4CKZA 2Q8QA 4KXMA 4XYBA 2P78A 1QH8A 4Q7KA 1QIIA 3ONFA 1M5UA 2IUYA 4AP5A 1HDOA 3B38A 3DDYA 1EDOA 2O8VA 2C7PA 3AI3A 1E4EA 4IUBS 1OGYA 3RSFA 1I9CA 1RJGA 2DH6A 5ECDA 2O2ZA 2V58A 4MDEA 3HU2A 3U7FB 1ACMA 4L5AA 1SC6A 2ACWA 3CMMA 4BKPA 5HE9A 3E5MA 4ASUA 4TSRA 3W5SA 1YAJA 1YS1X 1BDMA 5KBYA 5BNIA 3KJGA 2G83A 1X8XA 1RPJA 1DOHA 3UQZA 2FPSA 1E69A 2QTLA 3W2EA 2P6NA 2H65A 5DEIA 2XTZA 4RTNA 1JLMA 2XNDA 5E7IA 4RABA 3WO1A 1CUEA 5FNVF 1S4MA 4C0BA 5FH9A 3IKLA 4HATA 5IABA 3B5IA 3I8OA 3J80A 1G63A 2NUBA 3MQ2A 5CHYA 1VLLA 5KU7A 2X2PA 3MJVA 3NETA 5JJBA 3ECAA 3GP3A 4I55A 4CU5A 4Z7OB 4N6NA 1BGWA 1BQ3A 1R8XA 2FUG6 5DT9A 2UYGA 2PM8A 3V2GA 4H7IA 4BTVA 3HSSA 1Y80A 1YF3A 4FFBA 3THSA 2PYIA 1X9HA 1QHIA 1N08A 5K0TA 5ALQA 2DCUA 4IQFA 5IG2A 4L5YA 3KZCA 5SICE 1BU8A 3ST7A 3NB0A 2OB2A 2VP6A 3NWBA 3OCYA 1MO4A 4P38A 5C1OA 1P4RA 1YQEA 2AFIE 4QBIA 4QU0A 1KAQA 1ODJA 2M2IA 4F7DA 3NASA 1U28C 4N40A 1OI2A 1S01A 3UJ3X 1FDSA 1Y7HA 4GR9A 4E7OA 1P72A 1BOFA 1M2EA 1NOKA 4DNOA 3HN7A 3KEMA 2Y1GA 1UJBA 2YY5A 1ZNXA 4NBUA 3ZH2A 3UJBA 1CUAA 3X44A 4W82A 3RFVA 5E6UA 4P5PA 3MJ4A 1ZA2A 1NKSA 2H4YA 3PITA 4N54A 2WUEA 3UB2A 5JEEA 2O8FA 2IBTA 3TQRA 4RFLA 2DT8A 2LDXA 3EVNA 2A35A 5JCJA 4EBFA 4EG0A 3T1QA 2HZBA 1KK0A 2BSAA 1IU9A 3GFQA 3B12A 4LWOA 2FEMA 3LPNA 4IQ8A 4IJMA 4JQCA 1W0KD 1CUGA 3FHCB 3Q3AA 3HV2A 5JNRA 1FTYA 1C7FA 1XMXA 4JLSA 4RKRA 1NKTA 1PDVA 3N3BC 2VZ0A 3IBYA 4L4RA 5EQFA 2GDZA 3WS7A 4PYQA 1OH7A 3AFOA 1TF5A 4D46A 4B43A 3S2FA 1CZLA 1JDVA 1G5HA 1I18A 1R7RA 2GQ0A 1QM5A 1E9FA 3PJEA 5CGZA 1NBOA 4WK6A 3GLGB 4N5HX 4HB4A 3HJUA 2NZ2A 3D0KA 1JLLB 1QKIA 3DO6A 3NWEA 4HDOB 5B3KA 5BVGB 3FCAA 3L9WA 2JA1A 3R6JA 3RUPA 2P0AA 1Z2CA 3K9NA 2IXBA 4HBGA 4Y18A 5DGIA 1PI3A 5D6OA 5AM4A 1GZSA 6GPBA 4P3PA 1T91A 1G8KA 1DAOA 1QHXA 4HTAA 4BP3A 1M67A 2XW6A 5FR1A 3MWFA 1ZGCA 2RDMA 2AJBA 4HTFA 2ZZMA 5HTKA 5EE5B 2C5GA 2CV2A 3E58A 2B8EA 3U81A 2RHTA 1NN5A 5ER9A 1N0WA 1UXGA 2NT4A 3I04M 3LHIA 1YB1A 1Z4JA 3EIQA 4QEZA 1U8FO 4ZK2A 5LLTA 2WYOA 3H4TA 4HNAB 4MQ4A 3RCBA 3NAQA 2ZSJA 4GYWA 4QGBA 3PFWO 3FUUA 5CFOA 5C31A 5K3OA 1JDTA 4AWAA 1PJ3A 4Z9BA 1HZZC 1T6YA 3OX3A 3Q0EA 2CT8A 1DZ3A 2NUPB 2WTXA 4DIFA 5EEGA 5LQNA 1F8XA 3QXSA 3W3AA 2XH8A 4LDAA 1GRCA 2JS7A 2DYIA 3IUEA 4DNTB 2AMLA 3Q5GA 5CVVA 2Q4TA 3DVRX 2IWHA 5HM6A 1GY8A 2JGKA 1MT0A 2ZJ1A 3DLTA 4K8RB 4LNHA 5FPQA 4ANFA 1KVRA 2UXCB 4AZ0A 5IAJA 4Q4JB 3KT6A 1CJMA 4EUNA 1Q83A 4G6IA 5LXTA 2X0FA 1LQ2A 2AN1A 2GBLA 4TX1A 2QI9C 3HR8A 3SZUA 3UF0A 1ITZA 5IYZB 4AJIA 3KV1A 1DFGA 4K87A 1NW4A 3BY2A 1P0MA 2AE1A 3G8BA 4TVOA 3UWSA 2CLDX 1YR2A 5KOIA 1Q92A 2JW5A 2VSXA 5GOZA 5CB8A 3Q85A 2BJWA 4XFJA 2W2QA 2P35A 3PIRA 3VMMA 3SSMA 3CZAA 5KYGA 3PXEA 2I6GA 1ZM2A 1X7XA 1MFZA 3L77A 4Q1EA 4A36A 1VQNB 3D4NA 1M2OA 4CMEC 1NUTA 3H2IA 2OM2A 2BGGA 1NF3A 1IUKA 1NI4A 3OUTA 3AR2A 4C88A 4G09A 3CZPA 3P0JA 3V4OA 1W25A 4KO4S 3NKFA 3OJOA 5EMLA 3EFBA 5I7SA 1TM1E 1OAOC 4L16A 4JGBA 1JBQA 4N5LA 5LWHA 3GX1A 1UAGA 2ZCUA 1LK7A 4OQQA 5F4BA 4OOXA 1USGA 3FOAA 3IAM1 2VN8A 5C8DA 4FSXA 1L5QA 3BSSA 1XRMA 4RFSB 1J8FA 2NUAA 3VH2A 4BLSA 1HPLA 3K71B 4LV8B 5ICFA 2ZSBA 3JZMA 3OZIA 4F0JA 2AN5A 2XNSA 3GUHA 1NUUA 1O9GA 1KI4A 1B23P 2BEUA 2GN4A 2NVOA 2W6MA 5LOVA 4AQYB 2JG3A 1TT5B 3G0IA 4GS5A 4BMVA 4ZJYA 4RA9B 3Q2KA 5AHOA 4FGUA 2AF4C 1A82A 1BN6A 3CLUD 4XA8A 3SIXA 1EVIA 3K9LA 1JF8A 2PUHA 2WIKA 2NO1A 4KACA 5HF6A 3S55A 5DHTA 1EFVA 1H6BA 4R9RA 1T9ZA 3O4RA 3AHIA 1N9KA 2PJUA 1M8PA 2G0NA 3NVDA 1KEEA 1LLQA 1XEAA 4LRTB 4Y2SA 3MNFA 1RR6A 1SQ0A 1TM2A 4JVMA 5EZSA 4FZVA 1JFFA 2P9BA 1E3QA 1RMYA 3OAAD 1T1IA 4FCVA 1DQYA 3NALA 1SUEA 3TOXA 4B45A 1IIRA 1B8UA 1JKIA 1DBIA 3HABA 3A6FA 4Q66C 3T7JA 2HIGA 3LC7O 2DY0A 1G64A 1QUEA 5B2FA 1EGQA 3DE0X 2NG1A 3NIBA 5LBIA 1JEOA 1S7CA 1WAMA 4GKAA 4EDHA 5IX8A 4DCGA 4MSUA 2DB3A 4BVJA 2V7UA 1S9DA 2Z1DA 3A6HA 4OV6B 3DEAA 4RVUA 4W8OA 4ZARA 2JAHA 1U9ZA 3GCWA 4XDGA 1EFLA 4LDPA 1KFJB 1H85A 3P9YA 3QFSA 1A4UA 4IV0A 1T8YA 4JYBA 1XJ0A 3AK4A 3TJMA 1RFLA 3TFOA 1WPXA 2ZVJA 5CFNA 3W2IA 3EC2A 4E1AA 4UARA 3MRXA 3SDBA 3WICA 3TDKA 3EXG2 5F23A 4ID3A 1E0AA 1ZUIA 5TLSA 3T1HB 2FMHA 3A1FA 3NORA 2OCGA 1Q1NA 4ZDIA 5HRUA 2FZGA 1T24A 2OV8A 2OK7A 2VTKA 2YBEA 4HPJB 4I6EA 4P2BA 3U31A 1FTSA 1TCAA 3TZHA 1Z26A 2TECE 3FDZB 1KQSB 1XN1A 2OL4A 3EIOA 2OZKA 1G55A 3I45A 3IKJA 4JAVC 3A10A 4KAXA 4UXJA 3D64A 2CF4A 4TYNA 3VAZA 1KQFA 4BNZA 3MGCA 1OU4A 1UUFA 2BGUA 3B2NA 5F64A 3U13A 4K40A 3BMCB 1W0KA 1XA0A 1PD0A 2WM9B 3KKEA 4PWYA 4ARUA 4WV3A 4LJAA 2IUEA 3CBGA 3T5AA 4BRUA 4XCXA 4JOBA 2AT1A 1E98A 2YV4A 1DCFA 1UKZA 2D7CA 3ETCA 3NBUA 3WGZA 2P5TB 4DMCA 3MM4A 1RCUA 2XECA 4DMUB 3KVRA 3H84A 1GPLA 5FWXA 4HEQA 4WIAA 4TYWA 1MKYA 1ZH4A 2FPIA 1F7VA 4N4AA 1UEJA 5AD1A 4BKOA 5C5DA 1RLUA 3IUJA 3HEMA 3ZU4A 1NVEA 4AJNA 5JCOC 4PN3A 1CUZA 3KSMA 1P6XA 3WZMA 1UKYA 1ZLXA 1FRZA 2B7CA 1A9PA 2CLEB 1D7AA 3O2NA 3RVPA 4B8ZA 4COKA 1YHZA 2JFOA 4R0MA 5LQRA 3LIIA 5KPJA 1DIOB 2BE9A 2ODNA 4K7JA 4OOEA 4DLKA 4IF6A 1MO5A 1JHDA 2J4FA 3QI2A 1AK2A 1BDJA 1N6LA 3AUKA 4I9FA 2NO7A 3DEHA 4Z4WA 4PYRA 3MUEA 4U0JA 4KPYA 4QXAA 1U9IA 4KQMA 4TMVA 5JW6A 3OECA 3JS5A 2O3SA 3GRPA 4QBHA 3R7FA 1EHYA 1JLKA 4DPMA 1FX0A 1GZ5A 2D3LA 1FZQA 4FFWA 4ONEA 2YXDA 1C9YA 1LH0A 2HKIA 2Q2VA 4RULA 2NN3C 4ARSA 1WETA 1R6VA 1J1UA 4QRDA 3KQTA 3KJXA 1T43A 1VQ7B 4CM8A 1UXIA 1IEXA 1SD2A 3ESQA 4Q9LA 3TRKA 3VGPA 4E5PA 3WWZA 2ZZQA 5EQJB 3TB6A 4KR2A 1IMJA 4WOKA 1G41A 3VPCA 4TWZA 1Y8ZA 3EIHA 2PWBA 1YULA 2J30A 1AO3A 4FI3C 2GK3A 3T99A 1VJTA 3ZDFA 1JJ2B 2C5FA 3IEVA 3A26A 1R0YA 3OEYA 3DYBA 4K3UA 2YIMA 5B1EA 3X1XA 5B6IA 3QA9A 1UBTS 2WJGA 3FJYA 1NW6A 2L19A 2LR0A 3BMOB 1MABB 4LYFA 4OCZA 1XLTA 1RQRA 4RDHA 4E12A 1L4UA 3V8QA 2L18A 1RWBA 2O8NA 4X7MA 3SF0A 3ZCUA 3EEOA 4TS1A 1ZVVA 2VDQB 4L76A 4B3RB 1SZCA 2I66A 2NXEA 3NFRA 4IDPA 4UVGA 4OJYA 5GJWC 2WY2D 1NQ5A 5L3ZA 1RBZA 4XIJA 3TSYA 4E4RA 4OFZA 1P1BA 1W75A 4H4EA 1DGQA 3TCNA 2GJSA 4E2FA 2XV1A 5IJ9B 1GLVA 3MGAA 4P83A 3UMMA 1U8YA 4Y9RA 1N9GA 1H69A 3GLHA 4ZOBA 2X0EA 4URHA 2G1JA 4P4NA 4BEVA 3CLVA 4AS2A 2GCNA 4DLNA 3KFXA 3N8IA 3RRYA 3BXFA 4LRUA 2VDPB 1VB3A 1USKA 4TGLA 3DDHA 5F21A 3WA6A 3MN1A 2IS1A 4JP8A 1OVMA 1K5PA 4TV8F 3SNKA 1ZN9A 4S3MA 1IL0A 4PAAA 1KAGA 3F8WA 4FKMA 4RD2A 2GVZC 2Q46A 4NECA 1FIUA 4PZDA 1Z2NX 4TRMA 3F7TA 1WOYA 2DULA 2W90A 1EUCB 3I9KA 3E1GA 4BQRA 3JXEA 3CKKA 1G3QA 2Z95A 3L40A 3LHFA 3F9RA 3PL1A 4OSOA 4TMTA 3DV0A 2UYOA 4YLYA 1DRKA 2NU7A 3LWBA 2XNJA 3UV7A 1RC1A 1TW3A 1TQDA 2HR1A 3FYDA 1XHEA 4CLRB 3I42A 3A6ZA 1XN4A 3O03A 3O6VA 3Q3VA 3UT6A 4OHOA 2H63A 4IIVA 4EW2A 1TYEB 4KB5A 2G04A 3OAAA 3U4CA 2O2GA 5CD1A 4D9HA 3MBIA 1Y9JA 4EK9A 3MOIA 4L2IA 2PGAA 1RWWA 4Q7EA 1GNVA 3D1VA 4W5WA 5JSYA 4E5YA 1VG8A 2O1XA 1KBOA 2AOUB 1RLJA 4D0NA 4Q7JB 4JHLA 2DOGA 2YMLA 2W11A 3SXUB 3JWIA 3NV9A 2IITA 4G5GA 5G2OA 5F35A 1Y9ZA 5G4LA 3SMVA 4JD5A 2VQEB 1U0EA 2QAGB 2GGSA 3TKAA 1RHQA 5JG7A 1W35A 4NU8X 4PE5B 4OHYA 3MTJA 3Q88A 2PS1A 1M83A 5FYDA 2BFCB 2POCA 2WP8J 1JDUA 1K4MA 1ZESA 2AJTA 1UBGA 2BZSA 2P91A 2XWBF 3AR5A 4RY8A 5IKPA 3IQFA 1T9DA 4FJ0A 2OFOA 3L3BA 1IXKA 2C1ZA 1OFUA 4GGOA 2I3BA 2Q1SA 4OGFA 4LE2A 2GNAA 3EA0A 2WDZA 4P0QB 4XPIA 2EGGA 1ZGGA 1F2TA 2EU8A 2FSVA 2RGCA 3Q2OA 3KEFA 1U0NA 2QV7A 3ZHVA 3QEBZ 4ZANA 4H27A 5HIAA 1DMRA 2XDAA 1EP2B 3MFYA 4YX9A 1IQRA 1ZR4A 4HVLA 4M88A 5T3YA 4CETA 1LFDB 2BEWB 1W1WA 3JQAD 3ET4A 1UD6A 4J3JA 4QX6A 5G0WA 3BS4A 3UC5A 2KI5A 4J6EA 3X1MA 4EP1A 1NBME 4JN6B 1VJGA 3AKEA 3OLYA 3OLVA 2JFYA 1VHJA 3WGLA 3ZJVA 2CLSA 1M54A 4Z0PA 3TIFA 4GHWA 4XORA 4JLJA 2AIRA 4X1IB 4WASA 3DMYA 3GUVA 2DVMA 4G56A 4RLFA 1IEVA 1A8SA 1KQPA 1M1YA 2JAWA 3OM0A 1Y6RA 1CK4A 1VBKA 2C7GA 2R44A 1OBFO 2WIAA 4I3HA 1KJ8A 4LF4B 1W88B 3PDCA 4LMPA 3VR0A 4DN6A 1TUIA 4LTMA 2YWFA 3D2AA 3EBLA 5KNCD 4P7FA 3PBKA 3VC1A 5ITZA 4YXFA 1RYNA 3HKBA 1C9JA 2ZQYA 1YB5A 2DBYA 2VEDA 1Z0UA 4IOLA 4JEHA 4KQFA 4ZA2A 4WESA 1Z68A 3SEZA 1N25A 3FA2A 5AHKA 4AMUA 4ZYWA 5CB0A 5IF3A 1EVEA 4K6FA 3B7GA 4FZRA 2JANA 1KPIA 1J09A 4FS8A 1E8DA 2EFJA 1PGNA 1LLFA 1VL6A 3LQ6A 2H3EA 2J33A 2WKQA 1M75A 2RGWA 3DNPA 2VT3A 3G88A 3KTOA 3LQRA 4HLQB 4M0MA 4R81A 5ALZA 3VBCA 4F7WA 3C87A 2QV0A 1DT5A 2HDHA 1W52X 2H8GA 2Y0BA 3E84A 5BOVA 1C8LA 2I33A 3FNQA 3VC2A 1ES9A 3ZJ4A 1UKVY 1MJHA 3E8MA 1PWEA 1GAQA 3ECSA 1HEYA 1P3Y1 1I3KA 3L1KA 4OJTA 4R9SA 3IPCA 3T5PA 3U7HB 3JQ8A 3L05A 2HT6A 3TMYA 3OURA 4E2WA 4EJFA 2C4NA 2AW5A 4M7WA 3QTTA 1XR3A 3JQBA 4YRKA 2HF9A 4LAFA 4Y2HA 4EF4A 1I13A 1ZMBA 4G7WA 3RS2A 2SICE 4QTYA 1CUYA 1VYHA 2P77A 3E7FA 3ZE7A 3K73O 3S2UA 5FFMA 4QQ8A 1Z0AA 2QK4A 2BZ1A 2J6CA 4DK0A 1QRRA 3W2FA 2JI7A 3DDCA 1NP3A 1ODCA 2CFIA 2G72A 3FGNA 1VJ0A 2P4HX 3H8SA 3AV0B 1JFRA 3PE3A 4IDQA 3U26A 8OHMA 4QE3A 1ID1A 3NRBA 4NWIA 3R8FA 3DHWC 1USUA 4MP6A 2MSLA 1Y3BE 3SR0A 1XPUA 3NIDB 4ZHQB 1ZU5A 4JNCA 1WKBA 4RPLA 3VH4A 2BMFA 1UODA 3E2PA 4MVWA 2X85A 4MVJF 4J8PA 2CFRA 4JB8A 3DLCA 2IIVA 4FZ5A 4R1LA 5KNBH 2YCLA 1UP6A 1L9XA 1ZK0A 4QNMA 2WK1A 1K8QA 4HEJA 2FWAA 3Q38A 2LUOA 5HIMA 1GTL1 4QATA 2PRSA 2VPPA 5LZ5A 3ZGYA 3HA3A 4MLCA 5DXJA 5AW7A 2QX9A 3G6KA 4RO0A 3GP5A 3LXXA 5JY1A 3ZX4A 5GINE 4Y1RB 2PLNA 1ID8A 2X0IA 2EF1A 1RD4A 4OOVA 3R7SA 3C3KA 1HT3A 1USVA 1Y0YA 2IOQA 3H4MA 2GFIA 3KCNA 5CH3A 3KVNA 4N82A 3P5SA 1FUKA 5J4HA 1G4HA 3AVPA 5KYUB 1QX4A 3K6JA 4HB0A 1KY4A 4KQ9A 5TY0A 2GF9A 2X8JB 5T8KA 1JLSA 5LKRA 4IAOA 4MWBA 3X1WA 5DSZA 1PZXA 1GRQA 1ELOA 1YRHA 2GZ1A 4RA6A 5FHRA 3FZQA 2VP9A 1RYZA 2QZ4A 3FVTA 5K03A 5LIPA 1OLXA 4KI7A 2XB2A 2C0PA 1P74A 1NVVR 1HR0B 4HE5A 1D6MA 1NBWB 4H1UA 3PL5A 3I4FA 3TI7A 1RQPA 2QORA 1ZICA 2CJWB 4XDHA 4X8IA 3GO4A 4B82A 1QVFB 4F86A 1DKUA 5DP2A 4BJ3A 1N5KA 1OPXA 3ZVMA 3LYLA 5L7TA 4AO6A 1QTIA 2GD1O 2PKQP 3MWEA 2W2MA 4MUEA 3W5DA 1U63A 4D3DA 2OGTA 2CL0X 3LQKA 3HB9A 5KQGA 4JBLA 5E9AA 1J9ZA 3TMAA 3ZV7A 5A5FA 3OCCA 2OTLB 3ZGXA 4HAIA 1L4FA 1FVXA 1GAEO 4PLZA 4ME6A 5BUQA 3KSRA 1ZX1A 4EAAA 1JEYA 2Q7OE 1KF0A 4G41A 4GOND 3RBXA 3PX3A 3IA2A 3OTQA 3W1WA 3WZLA 1OGJA 1MLDA 1GEEA 2WWFA 4EBBA 3PI6A 3E48A 2O50A 3ADBA 4BGVA 4OYRA 3LH5A 5FPTA 4RD0A 1EAYA 4A16A 4YDRA 5JSZA 3KT8A 3A1SA 5BYAA 3SVLA 4NJEA 4ENPA 4GMDA 1N0HA 4G8JA 4K1LA 5KDDA 1SOVA 3PF9A 4TV9F 1FMCA 3QVTA 2ZZNA 2EZUA 4I9HA 2ADOA 1E2GA 1Y3IA 2VDJA 2PGOA 1O6CA 2B0CA 2QPLA 3EDRA 3FPGA 3N5CA 3Q3GE 1L7EA 4HQRA 2CCJA 4LJ4A 2KLBA 4OGWA 4OL9A 5ILQA 5JMPA 1FFSA 3GAFA 3ZK8A 1GPJA 1KP2A 1T8SA 3DDZX 1UKBA 2A9VA 5E6RA 3WLAA 1L7AA 2NIPA 2FSGA 3MMNA 3CCLB 1AHIA 2JC3A 3JQPA 3LPMA 2HL6A 3JQAA 3W2HA 2C92A 1DTSA 4OUDB 4OTZA 4J7CA 1QZTA 5LZ2A 4KFUA 3W77A 2QUHA 1SCAA 2Y66A 2PU5A 3D8SA 3FGPA 3L4SO 1OTYA 2CL7X 3O0DA 5EL0A 5LYYA 4YYEA 4BNIA 1QTRA 3SLDA 1ATIA 4ITRC 4OHRA 4OJNA 4BPBA 2GREA 1YWGO 5K8LA 1RVV1 1CEEA 5LQAA 1G6OA 2W2KB 4KC0A 3D7MA 1SBTA 1OH8A 1W6UA 1S8OA 1WMSA 4C9BA 4DAOA 2IH5A 3EA4A 3K8OE 3KPWA 4MPDA 1E8NA 3HU5A 4YBZA 4C0KA 4I14A 1WF6A 4G1BA 5NULA 1E5VA 3BJZA 2G82A 3DL4A 4B9EA 4BN0A 4C0XA 5ITVA 2XXAB 2NADA 3IRVA 3ZWOA 4OXIA 4J0KA 1W5FA 3CYFA 1Y7IA 1JEQB 1O95A 5HQ3A 2UZ1A 5THQA 3PC2A 1KH2A 4I4TF 4FCCA 3DKKA 2QAGC 2HJGA 2ZETA 1XMSA 2WI8A 1RMQA 1IN7A 2WP0A 4GGPA 2AFRA 4GI3A 4J03A 2H4WA 3T95A 5AVVA 1QRUA 5J59A 4LV6A 3RSCA 3MG9A 1ENYA 1NR7A 1YMUA 2FGJA 2CUNA 2PQ0A 3DD5A 3VU9A 1UAAA 1UBLS 2R3SA 2WJ4A 1JPJA 3EUWA 4Q3LA 2R5WA 1U65A 3F8TA 4BRSA 3OTWA 4GP9A 4CDGA 1RACA 1Y3AA 5F4JA 1T2UA 2IPXA 5K4HA 4KAJA 1X3SA 2GI4A 3TS1A 1IZ9A 1DRVA 3JR7A 3UOAB 2FSUA 1E60A 3O1HB 5G0UA 1BWSA 2FU5C 1WD5A 3CLSC 1GZVA 4B3HA 3WO0A 3IE1A 3SC6A 1AD2A 5KVCA 5IM4F 4DLYA 3AZQA 1SCIA 2ZSDA 2VDWB 4QVAA 3IE2A 4PNPA 4H1VA 2GUGA 1OY1A 1PEAA 2C7VA 2YICA 3OW7A 3SKXA 3WOHA 4EB0A 4NR0A 2SCUB 4FOSA 5JTTA 1WULS 1GZ3A 1TYZA 3BRSA 5CHEA 3ROQA 3LRXA 2XBLA 3AY6A 5D3ZA 3T41A 4CTOA 3KYJB 4BP8A 4PPQA 3IL2A 1GTVA 4H6PA 4J1TC 3A1WA 2HCRA 4ZO9A 3REOA 1W6RA 1FBTA 3JTEA 3QWBA 4XI9A 1Z7WA 1BE1A 5EIWA 1KY5A 4MI9A 2B1GA 5ITWA 3VUEA 2FETA 1XNGA 2WG0A 3KFVA 1LTHR 1P81A 5DWDA 3ISXA 2PXHA 2J6BA 3A11A 1X1EA 2B3TA 4FQ5A 2PKCA 1BU5A 5F1PA 3K9FC 3H9GA 3I30X 4MP8A 3NIWA 4PC6A 3P1JA 4MI1A 1TM7E 3SBDA 3OFJA 2FPWA 4IMRA 3FJOA 1YS6A 4ZQGA 4A2CA 5H0IA 4F3YA 5JAZA 2VFAA 3A9WA 4INPA 5DGTA 4K2AA 3TW4A 3VVBA 4QGFA 2ZQZA 1L5FA 1CWUA 2VA9A 5K2MA 3ZIAD 3DL7A 1CEYA 3VNBA 3U6KA 3GXBA 3K20A 3R5KA 5K0FA 4KN9S 3V4VB 3PD1A 3GPCA 1JI0A 3WHLA 1X7WB 2KJQA 3MPOA 4LJ8A 4RDIA 3IAAA 4L85A 5E6TA 1XE3A 1P77A 3LV8A 3C6QA 5H9VA 2Y3IA 4KX3A 4EA7A 5FIUA 3D8NA 3GZTB 4JI5B 1S2GA 2AYYA 2QD4A 2JLRA 1CV2A 1ZUWA 2PZAA 1CBUA 3ASQA 1GLGA 1XZPA 5FPPA 5B64A 1LW7A 4Y6OA 4R1PA 2B5OA 1FNDA 2AI2A 2FYTA 3M4YA 4CTNA 3OZEA 4WY8A 1A4RA 4MR9A 4FJ2A 4BAZA 1JHVA 3LX4A 4BVGA 3NKLA 2C97A 4YEDA 1KJQA 4OH7A 3V76A 1QG6A 5A89A 2D06A 3K9BA 4HJXA 4HK4A 3KL9A 5I9SA 3BE4A 1PV4A 1U8TA 1OHHD 1I7SB 2X40A 3LW8A 2EW2A 1EBUA 4QICA 3A6JA 1OZHA 3FVRA 4MKIA 3RUFA 2RAPA 3V6LA 1F4LA 3R5FA 1L8QA 1Q15A 1AX9A 1XZNA 3KOXA 2G7ZA 4LI3X 2F1IA 1RXEA 1QHHB 4QSMA 1M1XB 4ND3A 5IT9A 2G9UA 2YC4C 4G4GA 1I2MA 1K8XB 4GZ6A 2ADMA 3N8DA 1J90A 5SZIA 4JEIA 3T54A 1CUDA 1VHTA 4ZV9A 1J5XA 3KG2A 3TNJA 4N9QA 4C4YA 5KTYA 5GV8A 1RQXA 2RHDA 4MW9A 2CLMB 3A14A 4P4LA 2W9XA 1PJ4A 1U2QA 1U8UA 3Q72A 4MAFA 2NU8A 5C7IO 3DCIA 4I19A 2ZM5A 1K9SA 4F5DA 2YASA 5C4IA 3LL7A 2H2GA 1NVGA 3PT9A 4WE3A 3IOYA 2IS4A 4JKIA 5BT9A 5HF8A 1EP3B 1EVKA 3V7NA 1V9CA 1UBMS 1YBFA 3G9QA 4C4XA 4ZCRA 1G20A 2NV2B 1Y89A 1H1LA 1KJZA 1QB7A 3D4PA 4M8LA 2GHIA 2HUNA 3VU3A 1T8RA 3DCYA 4ER5A 1W34A 2JLSA 4YV1A 5A5GA 5HRAA 1AV6A 3TLKA 1DKLA 5K2OA 4QTUB 4NZOA 1DIRA 5DGHA 2XE7A 4ZI7F 3BOSA 4DK1A 3CCEB 4BLUA 3NTQA 1CZOA 1OLSB 1K63A 1JH8A 1C29B 1O8CA 1Z56C 2AVDA 4KGZA 3EIXA 1VFNA 1WP9A 4LRQA 5CCDA 3VC7A 2ECPA 4GU5A 4XIFA 4DYDA 4I1RA 4R2MA 4NESA 2Q41A 2IDJA 2JFNA 4CM7A 3CKLA 6ADHA 3FMFA 4WCFB 3RVBA 5DIZA 2BSQA 3VNAA 2NYAA 4O2BB 1MW9X 2O8CB 3SYMA 1UBOS 4JOCA 1E64A 1P2BA 1ORTA 1HFJA 2AKYA 2ONZA 2D54A 1OFVA 1ZN7A 2QMQA 3ND7A 4WY5A 1UC9A 4AURA 5L6MB 4WZAA 5D5PA 3WYCA 2RGBA 2N1MA 3T3OA 1U1EA 2Y1EA 3WQZA 2OQ2A 4IQGA 1UBRS 3EC7A 2EX0A 3AFIA 2OMEA 3IDAA 3IP9A 2D5BA 4H0CA 4LIPD 5F2NA 5DNAA 2VTBB 1E2KA 3QBJA 3QX9A 4B3JA 4DLZA 1VG9B 1ZKDA 3GGOA 2CUZA 3MT9A 4LXGA 1C8KA 4PHFA 4ZVOA 3RS4A 1N5JA 3WIDA 1ODKA 2Z30A 3WGGA 4OLAA 2JHPA 2YHAA 4K03A 1NIPA 2XHEA 4PRLA 5JBNA 1YS7A 3FCYA 4I99A 4DSOA 1JX6A 4W8HA 1US8A 3RVOA 3F3MA 2IK8A 4LKRA 4WKCA 1ADJA 1SUSA 1TUBB 2CMDA 3HKEB 1E92A 3K1TA 4OHBA 3QLUC 4EUKA 4R9VA 1C0LA 1SXGA 3QVUA 3G85A 3MTBA 3GRVA 4XLCA 4OHUA 1PF7E 2Z5LA 4G9BA 4OQNA 3KQNA 2V31A 3R74A 1F06A 1R16A 2V6FA 2W4IA 5AYVA 4N7MA 1WB9A 2CXHA 4CQMD 3OFKA 2H2WA 4AMBA 3IXQA 5JECA 1R18A 4KYUA 2C77A 5DX1A 1FJHA 3E9DA 1E94E 2OYNA 4MQUA 4DV0B 3GRRA 3ZU6A 3C97A 1SBIA 1THGA 2C98A 2ZTNA 3H1FA 3QLVC 3BHMA 2OCAA 3HY4A 2XCOA 1A2QA 4RACA 3RUIA 4AX8A 5J2TB 4I50B 3JU4A 2GZMA 4XB2A 3ICOA 4YRZA 2JH8A 3L07A 2WT9A 3OZBA 2XGMA 5F3RA 1IBMB 1KDPA 1OZFA 3LE8A 1PZMA 1AUXA 4YGYA 5I5GA 3RSSA 4IX9A 4XWAA 4L8GA 2BR5A 3RWOA 4BV3A 5C7YA 1XLWA 5EIBC 2R65A 4KLRA 4D4MA 3SWWA 1PVDA 1Z6AA 3OEED 3TCXB 4AJKA 5FLXA 2Y1FA 1L5OA 4YMTA 3TGLA 2OLJA 2J9RA 5T6BA 2ZI6A 4XSGA 4JMQA 2ECKA 1QCDA 4QHSA 3W06A 2UYQA 3RF6A 1OXVA 1G1MA 1SVMA 3CEHA 3MCWA 2OVFA 1VQ6B 3G5MA 2HMVA 1EVZA 3ZWYA 2EF0A 5CB4B 3IEXA 4JELA 3OZXA 1FFXB 1DUSA 2WQZA 3EWSA 3MMZA 3ND6A 1QGUB 3DWEX 4CLXA 4DLBA 2GZ3A 1KHHA 3QE2A 2REQB 4R2LA 3OSZA 4X91A 1XPRA 1X6VA 1TIBA 1FDRA 4J7AA 3ZIAA 3N2GB 4LJSA 1EZZA 1FTWA 5HKLA 2WYWA 3Q10A 5HS6A 1WDWB 1X38A 3II6X 4JLMA 2EFYA 5BSFA 2GJ4A 4C0LA 3FWKA 2R1ZA 1CNFA 1N4DA 3FWPA 5EHNA 4FYMA 1SC9A 4B3CA 5I3CA 5IH3A 5A6SA 3SS7X 1M72A 3ONUA 3AB7A 1DKRA 3Q8LA 1QPZA 2Q9CA 2R6FA 1V5IA 4ZODA 4BIIA 3HQ4O 3H3JA 5EGNA 2OQRA 4QU5A 1EUYA 4M0UA 1C14A 2XEXA 3TW6A 3LT5A 1NMXA 4MVCA 4KMOA 3BFVA 2IXFA 2Q5OA 1U6JA 4GBMA 5DCYA 1NRIA 3ASYA 1PR0A 4MJ3A 5IBQA 2O19A 1I4TD 4E2ZA 1QIFA 3LNCA 3A4NA 1J70A 3IVMA 3NU1A 2E7ZA 2I4LA 4MS3A 1OHHA 3DZKA 3SC2B 4D9BA 2Q3BA 4FDAA 3AY0A 1QG2A 1AHNA 1A9SA 1TM3E 1TQHA 1A5SB 1AN9A 1XTJA 1IOZA 1ZJJA 3ENQA 3LTEA 4KZKA 5AM1A 5JSUA 3SSOA 2NLOA 2WE7A 2WMDA 3QE9Y 4C3UA 3WB9A 4YYZA 1NJID 2PVPA 1AGNA 1EFRD 1Q0SA 1IHOA 3MWDB 4IIHA 4LRYA 3NS7A 5DI3B 5DYYA 5JS1A 2I3ZA 4NDZA 1U7HA 2OENG 2ZSUA 5DHFA 1TQ2A 3GFGA 3HNPA 3WOVA 3T0IA 4F60A 4RDLA 5JXWA 1Z83A 5FBQB 1G9XA 4MUYA 5DX0A 5ETJA 5KU1A 5FCDA 2D5IA 3V8NA 3WL6A 1XCBA 1KWGA 2RI6A 5EFZA 3KZMA 4WUTA 3VKHA 2D0IA 3O4VA 3QEMB 2E85A 3IAEA 2W00A 1X74A 1XKLA 2OBXA 5GZ6A 1WOOA 4HYQA 4D8VA 5IXYA 5DM2A 3QW4B 4DTCA 2R7KA 4BNJA 2OZVA 1KMHB 4E0BA 1I1NA 2QMOA 1WKVA 2DETA 4CM9A 3NWJA 1DKMA 4X60A 3S3TA 4EG3A 1HK7A 3KAJA 3BTVA 1RI3A 1ULBA 4ZPXA 3OBBA 5U4QA 3WG9A 3ZY5A 2WNHA 2WG1A 4MQEB 3G0GA 2FZEA 5GM2A 3LQQA 2Q5QA 3OO1A 4ODIA 4GR4A 3R7BA 4CL0A 4XLEA 4LX8A 2WFAA 1JJVA 1YI0A 1PJ7A 3V8VA 4TVSA 3KVOA 4RGYA 1XWIA 4TLLB 4R51A 4RKQA 3KALA 5IARA 2Q7XA 4LFAB 2QRNA 2JZNA 1E1LA 3H5OA 3L18A 1P5JA 4DQVA 3W3AH 4BNLA 1P39A 3FPSA 3H5RA 4ZZIA 3SEJA 3HXQA 1VP9A 5IW8A 3SIRA 5LN1A 3H1BA 2E0IA 4Q1CA 5K0NA 1T1RA 2V97A 1WXIA 4MV5A 4TUYA 1IBKB 4ZIRB 2DECA 4YCCA 3ZHQA 3NBYC 3V4FA 3B60A 3LF2A 2AD5A 3BDAA 1HQDA 4KIFA 5DLPA 3VR5H 5MGBA 3OJXA 2VYVD 2XQVA 1QLWA 4BECA 2XZPA 1F14A 1WXDA 5CBKA 2DU8A 3E3AA 3ZDXB 5IAAA 3ICWA 3L0YA 1HSZA 3KYCA 3ZWQA 5E1MA 1Z2AA 1B6GA 2TSYB 2JGDB 2RARA 3ZHBA 4QT0A 3EVAA 2WKSA 1PQPA 3F7OA 4C5BA 3EYWA 1E89A 4QPNA 5F7XA 4AKHA 5BXQC 2BF7A 3FFXA 2A9OA 3GLIB 1GNTA 4RADA 1QRDA 1JU9A 4WN3A 4C4AA 5EWLA 2GZ2A 2C7OA 4ZGNB 4EG8A 2WF8A 3K0CC 1P4SA 2VZEA 1KMCA 1PR2A 2WILA 3ESBA 3MUOA 1L4NA 1BXRA 4ZOLA 3WLRA 3L0OA 4I1UA 4KHPB 1K3UB 2H4HA 1DBQA 4UNPA 4NFLA 4OBBA 2ZT7A 3DVAA 5FTKA 1TEHA 3WL5A 3BCFA 1RAFA 1ICIA 3IBGA 4NCIA 4CQMA 3AOGA 1Z6YA 3AEQB 3BGVA 3HCCA 4GLBA 2VF7A 4NMHA 4ZT7A 2XMCA 3OLXA 3EUAA 2XRYA 3SZMA 2I7CA 4FMBB 2FPMA 3UXYA 2ID4A 2R8BA 2VJNA 5TR9A 4YJFB 4ZRDA 4WCFC 2Y05A 5DM1A 3TNDA 1A8QA 3A27A 5ECYA 1PJ2A 1ZCAA 5BSXA 1TJPB 4I9UA 2UXDB 3KQWA 1G5TA 1XTVA 4IJ6A 3H99A 3B3AA 2Q6OA 2UVQA 3ZLBA 4AYTA 5KPDA 2JN9A 1WV1A 3L0PA 5EIOA 5DM60 2NZ8A 4MVJE 1SUIA 2BL4A 4RIIA 3TW8A 1OWMA 1VKNA 4NQZA 4OFXA 2Z6BD 1TUGA 2FKAA 2VRWA 5AXDA 3OEEA 1PJLA 2GZRA 4WJLA 3HGMA 5B7GA 1WQ3A 2GD6A 2QTFA 4RF5A 3HP4A 3RH0A 4CMBA 1W2WB 3PGLA 4YPOA 2GK7A 1NB9A 3J81k 2GERA 3KBOA 3QVSA 4R1OA 2CYCA 3SC3A 3A37A 3FETA 3WBKA 3PTZA 5FOXA 3UT5B 4D4GA 5A1JA 4C7VA 2IPLA 1TJYA 1IRXA 2FMIA 3UPTA 3AUSA 3OTOB 4DCSA 4B81A 3L1IA 2R7AA 1GARA 2WBLC 5EFOA 1G8MA 3NLLA 1L4YA 2ZRCA 5H80A 4DJTA 1N5DA 1ZVKA 2RG7A 4MKHA 1G38A 3NBXX 3UHAA 4JYZA 2F2TA 4LQ4A 4ECAA 5BO5A 1ISFA 3T7AA 4KFRA 4OK5A 1KRHA 1NMSA 1EWTA 3L9XA 3HP1A 4A15A 1SVWA 3T7IA 1J5EB 2ORED 4BAGA 1Y8AA 2PLAA 4DOMA 3U4DA 2B8TA 2P75A 4HMPA 1GDDA 4R9UC 3ZHXA 5JALA 4XUEA 1NWCA 3I37X 4JT8A 1K08A 3LG2A 1L3IA 4C3OB 2VG8A 3F2IA 1FYWA 4HDSA 1UCFA 3TTVA 2PV7A 3G05A 4EG4A 4QG3A 3IBTA 2C94A 1GPAA 1P5ZB 1R88A 3GFRA 2FK8A 2ZJ3A 4X00A 2B25A 4NV0A 1GPH1 3FE2A 3TRFA 1F2UB 4DADA 4FMCB 1WDKA 5DE3A 4FP9A 1O97D 4IQ4A 5G0TA 1ZPDA 4QDZA 3IQZA 2ZI3A 1T1EA 2G36A 4GMXA 1XROA 2W48A 4FC6A 4KUHA 2HMUA 4NYIQ 1ZCJA 4PAMA 1OXXK 3GLTA 3Q3EA 1BD4A 3S1AB 3FYTA 1V47A 1NQTA 3EMDA 1WCYA 1N1EA 1OE0A 2Q1WA 2XLBA 2XUHA 2W70A 5JZSA 2BJVA 3H94A 5GONF 4PYMA 5EUMA 2Z9BA 3WXMA 2QE7D 2IUTA 5TARA 5D3KA 4C3ZA 2FV8A 1E2QA 1DWOA 2WD9A 3G6WA 3UY4A 1J7KA 1F17A 1CR0A 3DUFB 3Q40A 4B4UA 1JILA 2XDYA 5JH7A 3D31A 1D2RA 3FMGA 4E22A 4NLLA 4WX2B 1Y42X 4OXXA 3BNWA 2IXDA 3F96A 4HWOA 4R4JA 1BXGA 1UH5A 2HA5A 2YDYA 1I7LA 3EWIA 2V7PA 4JA0A 4YJ2A 1FSPA 1SCKA 2Q1YA 4OLHA 3GLFA 4OB8A 1BD3A 4X6YA 3B52X 3QMMA 4WBNF 4GD3Q 3BD6A 3HUFA 2CKMA 4OX9Y 3STUA 2O8BA 1IIBA 1IZ7A 1NUQA 2VAXA 4JLNA 5FV4A 4DRXA 1E5QA 3LSTA 1QP4A 1MIHA 4WKOA 4HRXA 4ZT2A 3P2OA 3ND8A 4LA4A 1X92A 2RSLA 1HMPA 1II8B 3TTYA 2C83A 5BNZA 1QHEA 4QUZA 4MH0R 2E1RA 2PO7A 4UUMA 2PZEA 4ZVKA 3WKAA 3CLRC 3UOWA 4O4JB 3HU3A 4QC2A 1UXOA 1TO2E 1WP4A 4JBGA 5E4TA 4YV0A 3B3QA 3AESB 3HUUA 2EZ4A 4HQ0A 4X1KB 2H07A 2HLDD 4GQAA 1GA1A 5J47A 5D85A 3AQIA 3U4IA 2ZRAA 1DAIA 2QP3A 4PLCA 4F8EA 3DE2X 4HDAA 7ADHA 1YUBA 2ODQA 3TZ6A 3S5UA 1GN8A 1M6VA 3QVWA 1C1YA 1QRTA 4RORA 2H0QA 1VCMA 2VYVA 3E3MA 5FA6A 1UPCA 4BNKA 3DD1A 1G8JA 2ROQA 2O0KA 3PC8C 5A4FS 1H2AS 1O54A 3L6UA 1SRQA 4C0WA 1GP2A 4D41A 2D00A 1SC4A 1VDZA 2A86A 2EDCA 4HNHA 2M6LA 4F92B 4W5OA 5DCWA 4WK2B 2UYHA 1Z88A 3AR9A 1NR5A 2ZUDA 1V8ZA 3MCZA 5CM9C 4GT1A 2XY4A 5I7OA 1SXIA 4BP1A 4WLEA 1TVCA 4G5FA 5EE3A 2QI9F 1Z39A 2ACKA 1I80A 2ZAIA 1EDZA 1ANKA 2PAFA 3K1AB 1NMEA 1X2BA 4FOOA 1CIVA 2Z2YA 3RAEC 2E87A 1FW6A 1BLIA 4UFPA 2H54A 1TFUA 3UXMA 3TLGA 1ZGAA 3NHAA 2QXYA 5K5EA 3ZDDA 2YFYA 4FFOA 1L5WA 5AVWA 4Q4HB 3S2EA 3OTHA 2XKAA 4HNQA 3WRYC 2AZTA 4KXLA 4RL4A 3UC9A 5IUJC 1J2UA 3RC9A 1E6EA 2FUCA 2H0AA 2IYZA 3PCRB 2Q21A 4ILKA 4DSAA 4F5EA 1OWNA 2GHTA 3ZWPA 3IB6A 1CUFA 4MWDA 1SNYA 3T9AA 3SSNA 3TN7A 1O94C 2PTHA 1FX1A 5C52B 4CNQA 4PLHA 3TOVA 5B4VA 2B4AA 2WJHA 4UCWA 1YJXA 4P4SB 3AHHA 4Y2VA 2XGJA 5KWVA 4PM4A 3A8IA 4AC9A 4OSEA 4LHYA 4QPDA 2HB6A 5AKZA 5K45A 1MRNA 3QPWA 4S0ZA 3WMGA 1FRNA 1SY7A 2BEVA 2HJRA 1PTJA 3IAUA 5TX7A 1QCZA 2WZBA 4HN9A 2VF5X 3H9UA 3UA3A 4PCAA 1NXXA 2I76A 1DIHA 3BYZA 2ANCA 4P3YA 3L7OA 1O8BA 1V1MB 3FVVA 1YZNA 4FGWA 4DV5B 2P9HA 2BD0A 3BK1A 5A0FA 4LHWA 1PT8A 3VOTA 2VNSA 3JQ7A 3Q8XB 3R3SA 4TSKA 4B6FA 1RM4A 1AM4D 5HQJA 3CVXA 3T3NA 3R77A 2XGGA 1FMTA 3C8UA 3B6JA 3V5NA 3IKVA 1H94A 3V7AA 1KDVA 2G7MC 2CLHB 1SXJB 1LSOA 5BSHA 4G0MA 1UPBA 2IYWA 1T0PA 4FXPA 1R6BX 5D7BA 5CLQA 1JDJA 2YCBA 2ZLBA 3JQFA 1E59A 3LMKA 1SOWA 3DLBA 3DOJA 3TRDA 1E2NA 4ND8B 1KYXA 4JP1A 4Z7QB 1OR8A 1CR4A 1JXQA 1SM4A 1H2HA 2XCQA 3CRW1 4NENB 3CUKA 2QD2A 4R16A 3WGHA 2QUAA 5K6RA 4HYTA 4ZYVA 3EQ8A 3FFAA 1BQEA 4GE3A 2QL5A 1LRLA 5TPZA 4F84A 2J48A 1V41E 1D2EA 3BXZA 3T8YA 1LEHA 3R3YA 5B3LA 4JI0B 1QO7A 3KZNA 1VLQA 2O5CA 3L6CA 2ZB4A 4LZZA 3K70B 1G291 1UP7A 4QXPA 4P36A 3L8ZA 4QREA 3U48A 4RF2A 3RRXA 2GN0A 4TN1A 2DOKA 1C7RA 4NEGA 1XTZA 1N5IA 3OPXA 3WL3A 2CNNA 3COVA 1ODFA 4JJ7A 4KRXA 3PICA 1N3YA 4KQWA 2JLZA 1SCJA 4UZFA 2B4TO 2QL6A 3HCBA 5ALVA 5C3MA 1AO0A 1L7QA 2O0JA 2ZUWA 2DCMA 1PKVA 1HE4A 4XLTA 2BEKA 4IKOA 3T7TA 3L1UA 4IIGA 1QHGA 1NY6A 3ZWDA 4UD6A 4A3SA 1ZZEA 2IEZA 3GT7A 3KJIA 2ZTHA 1V1RA 1XQYA 5BR4A 1F8UA 1VSBA 3HVJA 3HXPA 2IXAA 3FAZA 4K6GA 2E1PA 3EG5A 3LBIA 2W2XA 4AJJA 4H17A 1YI8A 3DL2A 4EGJA 1J2TA 4YB8A 2H18A 1VJSA 2OFPA 5EPUA 3EC1A 2EZ9A 2H59A 3LYUA 5LB2A 3PG5A 4CHGA 3R9XB 2ODTX 2BGKA 5B58C 5KTRA 4QRIA 3TI9A 4EHBA 3IPRA 4OQZA 3G2JA 2VHXA 1C9NA 4ENUA 1WU7A 5E2BA 1WZNA 2QNIA 1BIFA 1V8PA 4BY9E 3WLJA 4BHTA 2CXUA 1BWRA 4BO8A 1PZGA 1V45E 1Z73A 5AKIA 3V8PA 4NK4A 1IAVA 1Q0RA 4WWHA 3ZHCA 2CV0A 2XE4A 4IJQA 1NG1A 4AMVA 3EPRA 1OXBB 2AZDA 3MZ0A 3NM5A 3AGQA 1KEKA 4GPD1 4ND7A 3B7PA 2ATVA 4D3ZA 4D43A 1EK1A 1D9XA 4X92A 2FY8A 1TE2A 2BHNA 4X20B 4CL3A 2YVLA 5ED0A 5H68A 1I7QB 4PF1A 4YRJA 5T3UA 4C89A 3PSHA 1WHSB 4H0FA 1XCMA 2DR0A 4PQYA 4BVBA 3LM8A 3QP9A 1GFZA 4DSUA 4B3TB 4J1QA 4H31A 5REQA 4XD2A 1UKCA 1GG9A 1CF2O 5TRTA 1TZCA 2O2DA 1C3EA 5FI1B 1C1XB 5AN9A 1LD3A 4HQOA 4PS1A 1AU9A 4AJPA 4B84A 1EFTA 2G76A 5FKJA 1M2FA 1SUPA 4MW1A 1XQBA 3LT2A 2BZ0A 4BTEA 2AG5A 3NHLA 1GAWA 2YZMA 2ZS8A 3KEOA 3PIIA 3UK1A 1LBSA 2WIGA 1FL9A 2AN9A 2Z4TA 3QVMA 4R8LA 1O1YA 3HMKA 5SYMA 1GNSA 1UD4A 2HWWA 4PICA 4KQXA 5J5VA 5CFPA 3TGPA 4AY2A 3FRJA 4DR2B 1C50A 1YONA 4HH1A 5K05A 4FXOA 4MO2A 3AHDA 1VPTA 2WB4A 3M70A 2QHXA 1IBRA 1KZHA 1QYRA 4A0GA 4F9TA 2QTGA 3RGGA 1P3DA 4FI3F 4QSHA 2VF4X 4TN5A 5DBOA 1V9LA 4C22A 4K81B 3O7WA 2CSXA 3THRA 4GL4A 3UZUA 5EP2A 3R6KA 1GL7A 2GJRA 2I99A 2X4GA 1NJFA 1QGYA 2EKQA 3L6RA 3M0EA 3MXTA 3PXUA 3GQBA 2PZJA 4OBXA 4W7SA 3ZCSA 1Y1RA 5IZ4A 3E5NA 1NLFA 1VQKB 3KE8A 4G5YA 2VWPA 1J8VA 3NJRA 4ZYUA 2XNCA 2HSEA 2V54A 3LTNC 4WDQA 2BFNA 2B3DA 2GCPA 2ZUVA 2QT9A 3CG4A 1KMNA 4N8DA 2O3RA 4D4KA 2OGUA 1EB8A 2HCTA 3NBFA 3D6MA 3ORRA 1CJTC 1IJBA 3HM2A 5DM0A 2JGFA 4NKRA 4YMUA 3D5QA 4YUAA 5A4IS 3B6IA 5A2QA 2R0QC 4ND5A 2OCKA 3V80A 1J8YF 3C1TA 3LD9A 2NQTA 5EXEA 3W6NA 2GDJA 2O23A 4ZEWA 2PV0A 1JMVA 3I2KA 3N0RA 4TKVB 3L0IB 3WGNA 3HHPA 3S8YA 4OHXA 4ES6A 2J3JA 2X4LA 4QHYA 4BB6A 3I9MA 1U90A 4EMSA 4Z4QA 1Z5VA 3C3PA 3D6FA 2BE7A 4WXMA 3RADC 2JI4A 3RREA 3EQZA 4JITA 1VRCA 1XRLA 4EZBA 4G4IA 2A5JA 4BVEA 1JDBB 1Z0ZA 3CXUA 4K9QA 1OBHA 3EPJA 1DHTA 3WZ2A 4X0CA 5IEBA 1ZYUA 1P4HA 2B1JA 3SE0A 1LDBA 2MIIA 4NULA 3QPAA 2A1UA 1U2DC 3GEHA 1D07A 1P17A 2CWDA 4QYIB 5FQNA 1VRVA 2X1VA 3CTMA 4FIZA 1ZOOA 3TZBA 1G6Q1 3LPLA 1C1DA 3VYWA 3ZYZA 1NBIA 2J9FA 2A3NA 1PL7A 2QEQA 3U7QB 2XMRA 3HWSA 2ZJYA 1CF9A 1AQLA 2JJMA 1X9GA 4MP3A 2JAOA 3I4LA 3LRTA 3AR8A 3MBKA 4R54A 1N32B 2XRZA 1BXKA 5IYZF 5FULA 2Q4DA 1NE7A 1AKQA 4DW8A 2JIZD 3F5DA 1CVLA 4QJ5A 4UJ5A 1KDRA 1P6QA 1RWVA 3IELA 5EHXA 2G88A 4AY4A 4EOGA 3K5WA 5CFLA 1V37A 2YWXA 3D3KA 3HDVA 3JSXA 3LRPA 1RI1A 4BATA 1Z13A 4DQUA 2QSYA 4WXPA 1HBJA 1Y8QB 1PZHA 2HWUA 4DUPA 1JEEA 4D9IA 1ONSA 2J3EA 3WY9A 1KJWA 3BH4A 2UZAA 2SNIE 3QYPA 3EY9A 3KLMX 1EGHA 4K0RA 4LGVA 2JLYA 5KWJA 4ZVRA 3CA8A 1KC1A 3KJHA 2VO1A 4GM1A 4O63O 1W9XA 1QZ3A 1X1QA 4Q9KA 1J2RA 2AWNA 2QDKA 3VTKA 3ME5A 4IM7A 1ZXLA 4OXNA 1PJBA 5EIHA 3LNTA 5JROA 4Y6PA 4LOJA 3W8DA 1NIJA 1X39A 2CFSA 4J43A 2JH9A 4LYAA 5C9ZA 3T6KA 1VJCA 5IJAA 1GGEA 1KI3A 3IT3A 2G9VA 5EZYB 5CGQB 3R0VA 1F0KA 4LRXA 3PC4A 3UJPA 3AL2A 3EXHA 5ESRA 1EEXB 1NVKA 1OXKB 2ZIXA 3JAKB 4MVJD 2YS7A 5DCUA 4MRRA 4ZVLA 1QVVA 4DV7B 3NH6A 5HXBA 1MORA 3AMVA 3HN2A 5F78A 4DDUA 4ROSA 5K6TA 1IVNA 4ERNA 3ZD7A 3COSA 5IN4A 5KNCH 5MGNA 3E23A 1KJNA 4EMTA 3HXTA 4TTRA 1ZOLA 3A70A 4E2YA 2FX5A 2FUNB 3TZLA 2AKAB 1GILA 2Q99A 3CONA 2RHWA 1SXJC 2QT1A 4XSHA 4YJKA 3SQOA 1DUIA 3BJMA 5MDHA 3M8KA 1Q1QA 3AF2A 5CLLA 3SAJA 3FG9A 5K6AA 2NPFA 2WQ7A 4MIEA 3UWDA 5HX7A 5AVZA 1VMDA 1CEQA 2OUKA 5FR2A 3D8BA 1U2GC 4MQFB 4U7FA 1OB5A 5M3BA 4CKEB 5CXUA 1SKMA 4ZAWA 4HH4A 1XQVA 4ZYYA 2V1XA 3TOCA 3JATB 2NNWB 3IAS6 3VKVA 6CHYA 3PLAE 3ONWA 2F1HA 4QUDA 2XZLA 2NUTB 2YIVX 4Q1AA 4N1AA 4BVHA 4TT3D 5ALHA 3HJGA 1Y3DE 4CG1A 1S3FA 3GGPA 2N42A 1Q9SA 4LQDA 1MAAA 4C7BA 4DUZB 2ZPUA 1PHRA 1VHWA 3CH6A 3D59A 2LRHA 1MC4A 2OFWA 2QQGA 3NBQA 4M87A 2G9NA 4BNDB 5MN4A 3GNLA 2CVFA 4GO1A 2QN8A 2OHOA 4HLUA 4WOCA 4BMCA 3MOSA 4E5DA 1BXZA 2ATIA 3QU9A 4IWXA 2M9MA 1RQLA 4AP9A 3VO1A 3TWOA 1BKSB 2BH9A 1I01A 2HHHB 1BN7A 3EQ7A 5JNTA 4X5OA 2C9OA 1GYQA 4CUZA 4CLOB 4ZQBA 4KVAA 4LSMA 4DKJA 3RHTA 1UBSB 2CLLB 4REQA 3IOCA 1YB6A 3FWNA 3A1PA 3D9QX 3PQCA 5DM70 3MINB 2GD0A 4HLCA 3KZXA 5EE9A 5DO9A 4QOHA 5ALUA 3F5MA 4IDBA 1MRZA 1PJ5A 4EB3A 5IBRA 2YHSA 2ZRQA 1YJQA 3SJCA 2YWHA 4NXMB 3G5UA 4C0HA 4IJUA 1Z4LA 4DTIA 5BW4A 1HL3A 3ZEIA 5J2UB 1QHYA 3ASUA 4GRIA 4IHJB 2ZJFA 4HDMA 2V7QD 4S2EA 2Y93A 5ENVA 4BZXA 2ES4A 3JRXA 4FBGA 4AZWA 5BR8B 1NW9B 3RHZA 3W8EA 1CRQA 2BGLA 2EBHX 4YCJA 3WAGA 1KE2A 1ZM4A 3PUHA 1BWPA 5HYVA 2BH2A 3AO0B 1N57A 1YDMA 1YC2A 1KYTA 1ZNZA 3PSAA 2QIPA 4XL9A 2ERXA 4KIJA 3UJ6A 1NSTA 4G24A 3ORQA 3RVDA 2I4RA 3N2KB 5CT8A 3AZPA 3IERA 4U5QA 4LWQA 4ZO8A 3I9OA 3P9SA 3DAYA 3I64A 3MK31 1XUOA 1W94A 3OIGA 4H3VA 4L6AA 1I7PA 1Q0PA 4G37A 4U8HA 5HJEA 5EP4A 4MDFA 1N8KA 3QWAA 1B42A 2R68A 3KUCA 2Y0PA 1YRBA 1CC1S 4XQGA 3ZQKA 4IEEA 1P1RA 3W7AA 3OIWA 3A8TA 4A8HA 1E1DA 1M2VA 2X13A 5B5SA 3MWGA 2VXYA 5JXIA 5I9NA 1JVBA 1NP6A 1Y5MA 3QTBA 4G0QA 1JG6A 3J7TA 1DJLA 2WU4A 2ZJAA 3EG9B 2AEJA 4DMMA 3U2QA 3F9CA 3DTTA 4GNKA 4N5MA 4YAJA 2P5UA 3TG8A 4DR5B 2H06A 5BSTA 1LPAB 3CB2A 3B82A 1E2IA 3SI7A 1YKGA 2IYXA 4DT1B 4PS0A 3ZZMA 2EP7A 2Y6VA 3F5QA 3IB3A 3JQGB 3PUXA 4NCAA 1LUAA 3V97A 1RFGE 1N5OX 2RBEA 1QTQA 4MKGA 1E0JA 2XCIA 3DL0A 3K94A 4JV5B 2JIZA 1GR0A 3BILA 3VOBA 4GI5A 2IYTA 4DZTA 2VP3A 4PFJA 1WM1A 3JYNA 1SMKA 1ISHA 4X65B 2AR7A 2Z5GA 3H3FA 1GAJA 1L4HA 2RJ3A 3FTPA 3HC7A 3BQNB 4JSYA 1S3SA 3QLTA 1Z4KA 4X93A 4ZVUA 4A8JA 4PG8A 5C8ZA 4CIAA 4ZREA 4LXYA 3WC4A 1XG5A 2PRJA 2E49A 2PIAA 3W4JA 2W5UA 4FONA 4QXMA 4OAQA 1HO3A 4JJIA 3CCRB 1O0CA 2NP7A 1FCJA 1MOZA 1ZH8A 2F9LA 4G07A 2IBMA 4UEJA 4RTSA 4PZYA 3Q7RA 4BASA 2VSYA 2G06A 3ILYA 1EMDA 5FO1A 4PEVA 5AI9A 2OV2A 2ZAOA 2HFJA 4XIGS 3SEAA 3L7CA 3H5WA 1JE0A 3BXEA 3ANMA 3FHOA 4KXFB 3QXXA 5CRIA 5EPEA 2WIJA 1T1SA 1EUDB 3HN6A 4KDEA 1W29A 1LK0A 2WTNA 1Z2DA 4B48A 3DBRA 2G0AA 4F2HA 5BMVB 3SDSA 2DKNA 3CF2A 2VHZA 3COZA 4UD2A 3NTLA 4XYMA 4BMOB 3D4IA 1K2WA 1YIAA 4EHAA 1M6EX 3N0WA 1WCIA 2HBRA 1KU6A 3IA7A 3URKA 1UBJS 2GK6A 3H11A 3IULA 4LG1A 1M76A 2FFAA 3ABOB 4RYDA 4WLUA 5I45A 4U0KA 2ZL5A 5AJUA 4HNUA 2DR2A 1B8PA 1ONNA 4AKEA 2J3QA 4D57A 1N3LA 1ILWA 1GDTA 2MSKA 3V1LA 3N74A 4RCVA 3W6ZA 5DHRA 4XJSA 4AY6A 2NPIA 4EMBA 1V4VA 4RW0A 5AR1A 1K4YA 4FFDA 4QFCA 1YH3A 3WSTA 4QZVA 3QJGA 4DJAA 4XOTA 2XTMA 1GT6A 5TF0A 3JVIA 2Z2XA 2Y1XA 3T5TA 2WAYA 5F4MA 1VQ5B 2YJ6A 3QVKA 4S04A 4KCGA 4D0SA 1AKWA 1QAOA 1GDHA 1K28D 2FPLA 3RJTA 4NU0A 3CC2B 2VNJA 1VMEA 2VBFA 3ORYA 4RTMA 3CCJB 2CWWA 4K6KA 3K70C 5IS2A 2QL7A 2J4DA 4EENA 4WACA 2QRPA 3FCSB 3R2JA 3SR4A 4F8YA 4TT3A 4LJ9A 3U6BA 1E0KA 1EJ2A 4CGYA 2DFVA 4UTPA 3FUTA 2C3YA 2I71A 5F3WB 2FPXA 3PX7A 2QVCA 3IQHX 1M34E 5JAOA 1Z37A 4BWGA 3C41J 3EZ9A 3WNVA 1DIBA 1N5RA 2B83A 4G1FA 2IXEA 3CLTC 4MUAA 3ZU2A 1WUHS 3CMEB 4JLUA 1Q14A 3D6UA 4E0FA 2Y68A 3VJLA 3RYFA 3WLHA 3ZI0A 4CLEA 4DF3A 3V1YA 4PG4A 1XVVA 3F7NA 3LLCA 4D0LB 3TLCA 2X6XA 3ET5A 2HRCA 3M33A 4I81A 1ZONA 4FT4A 5C2JB 2VJAA 2Y99A 5DLYA 5JZ9A 4HBZA 4HCJA 2W93A 1R8JA 2A84A 4Z4UA 1NXWA 2P9FA 2GVDC 1IVYA 3EMBA 3MVEA 3NYRA 2FJ0A 1GYPA 1QOZA 3SOPA 4B8YA 3NHUA 3QQPA 2J08A 1H6DA 2XQJA 3H6KA 3I61A 1UBFA 3ZLJA 4HB2A 1CUXA 4YCSA 3LDFA 1EINA 3B78A 3PR2B 1GGHA 2FG5A 3ILXA 3NIFB 4JJGA 4P7JA 2DY1A 5CIQA 5AK3A 2P9QA 3TBFA 4DM7A 1CT9A 5EJ4A 1LPMA 1T36A 4HG2A 2FSIA 1Q3TA 2XVXA 4YWJA 1JP7A 4ND6A 2V7QA 3IMEA 3R20A 5F73A 3VZBA 4CV0A 3V3KA 5LP6B 4QTXA 1PJAA 1VIMA 4JSRA 3SX2A 3PPIA 1GJRA 3K09C 1NQAO 1U04A 3D4BA 3IDSA 4M98A 5DOZA 3VZQA 2X3UA 3L7AA 2PMFA 3RTAA 4AJ1A 5AVYA 3QW2A 3OPQA 1GA4A 1L8OA 3GWGA