1QGZA

Ferredoxin:nadp+ reductase mutant with leu 78 replaced by asp (l78d)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRDYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ REDUCTASE)
molecule tags Oxidoreductase
source organism Nostoc sp.
publication title Role of a cluster of hydrophobic residues near the FAD cofactor in Anabaena PCC 7119 ferredoxin-NADP+ reductase for optimal complex formation and electron transfer to ferredoxin.
pubmed doi rcsb
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qgzA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qgzA02
2ZITA 4M1KA 3QFSA 2B7BA 4UAJA 1QH0A 1TLLA 2J7KA 3PENA 4LBYA 4TMTA 4ZGNB 3JQPA 1DG1G 4TMXA 4YAWA 3JQRA 5TV2A 3CCRB 4J0QA 1Q81D 1W87A 4NBSA 3W2GA 3MHPA 2BMWA 2D74A 3SJZA 1GO2A 1BX0A 1EFTA 1G7SA 3P27A 4RD0A 3VMFA 4LBVA 2QTZA 1VQPB 3LYUA 3OW2B 1B23P 1YJNB 4B48A 3FPKA 4ZGQB 1W2BB 1F60A 4PC6A 1H42A 5EMNA 1J9ZA 1KTVA 3J81k 1GVHA 3ES9A 3CMEB 2YWEA 2PLFA 1VQNB 4TN1A 3QFRA 3V76A 3VO1A 4FK8A 4ZCMA 3WNDA 1K9MD 2XNCA 3WXMA 3LRXA 4P6VF 2OK8A 5H5JA 1R5OA 4H9GA 1N8RD 3CC7B 5DSZA 3AVXA 2X3UA 2OTJB 4HE5A 2PMDA 3MCAA 1EP1B 4PC1A 2QDXA 1KD1D 2BVNA 5GV8A 2OTLB 3P26A 3CC2B 3E20A 1FNCA 4PC3A 1TTTA 4ZV4A 1YITB 3AVTA 3AVVA 4MYTA 1OB2A 3AGQA 4FN5A 3VNUA 1KK0A 3CCUB 3FJOA 1VQ5B 1CNEA 2EFGA 1BQEA 3WBKA 1YJWB 4RD3A 3OZVA 2BPOA 1VQ6B 3W2IA 1JB9A 1TVCA 3W2HA 1VQMB 3B78A 1ZM2A 4PC7A 1JNYA 1YJ9B 1M90D 3B8HA 4N3GA 3I56B 2FX3A 1VQ7B 1VQKB 1HA3A 1R5NA 2VNJA 2HCJB 3VNVA 2VNHA 4FWTA 1EXMA 3CXCB 5THXA 4B3XA 2DY1A 1VQ4B 5TY0A 1H85A 1ELOA 2B5OA 1Q86D 2QTLA 1KK1A 1YIJB 3WNCA 1D2EA 1ZM9A 1F20A 3E1YE 1KQSB 2QN6A 1VQLB 4YAOA 4LC0A 3QFTA 3CCQB 1B2RA 1E62A 1FRQA 1OGJA 3ZZUA 3CW2A 1YHQB 3A1FA 4DQLA 1Q7YD 2VNKA 1K8AD 4TMZA 3CB4A 1BJKA 3AVYA 4M2LA 3QE2A 1JJ2B 4AC9A 2CNDA 5TR9A 2BGIA 1CNFA 3U6BA 3AGPA 4HE6A 4P3YA 3W2FA 1GR1A 2VNIA 3ZBTA 5GV7A 3WNBA 1D8TA 4YAFA 1KJZA 1XB2A 4QFMA 1QFYA 2OK7A 1KC8D 4MYUA 3CC4B 1A8PA 2QA4B 1ZUNB 2XNJA 1I7PA 1R5BA 5FA6A 1VQ9B 4RD4A 1K73D 1IJEA 2YWGA 2BF4A 4G1BA 4EH1A 1OB5A 4N3NA 3G4SB 3MMPA 4ACBA 4RD6A 1VQOB 1KRHA 1YI2B 2R6HA 1OGIA 3WBJA 1BX1A 3I55B 1QUEA 4RCZA 4B4DA 1IJFA 3VO2A 4TMVA 1DARA 2PIAA 1NJID 1ZM4A 1U2RA 3CCMB 4Q7JB 4Y9UA 4LBZA 4PC2A 1JA0A 1SM4A 3CCLB 3ZBUA 1EFUA 1M1KD 4M53A 2NPFA 2DEUA 3CCEB 4LBWA 1QUFA 3CCVB 3CD6B 2YWHA 4TMWA 1FNMA 1DDGA 3QFCA 2HMAA 1QFJA 4G1VA 3OJXA 2QEXB 3I1FA 1XE1A 2BV3A 4U9UA 1NDHA 1WDTA 2CRVA 4WQMA 1N0VC 1JA1A 3CMAB 2QMUA 1G7TA 1S0UA 3ZZ0A 1FNDA 1D1NA 3CRZA 5AN9A 1EWYA 1QG0A 4ACAA 1UMKA 1IB0A 4ZCLA 4F7DA 1QFZA 3AVWA 3G6EB 2BSAA 4B47A 1VQ8B 4DQKA 2E1RA 1FRNA 1QGZA 4YHBA 2GQFA 1EFCA 4YAUA 3LVBA 1E63A 4R71A 1ZM3A 1FDRA 1EP2B 1AIPA 2DERA 3CCSB 4K1XA 1GJRA 1W34A 1CQXA 3W5UA 3G71B 4AF7A 1GAWA 5HXBA 2C77A 1QVFB 2DCUA 5H59A 2VZLA 2RC5A 2BM0A 4Y9RA 4YALA 3U2QA 1QVGB 1TUIA 2HDNB 2RC6A 5JBQA 3OZWA 2XEXA 1KK3A 2BN4A 5KSWB 3OZUA 3JQQA 4M4SA 2C78A 3W2EA 4BPRA 3W5VA 1QX4A 4RD2A 3CPWB 4IW3B 1W35A 1G7RA 4RD1A 4NCNA 4ZCIA 3ZZTA 4M0LA 1KK2A 4B44A 1EP3B 1SKQA 3OJWA 4G5GA 3WY9A 1AMOA 1E64A 2BGJA 4C0SA 3AVUA 1G7CA 1FNBA 2EIXA 4C43A 1QGAA 1S72B 2AHOA 2GPJA 3LO8A 3WYAA 4PGOA 1N0UA 3B82A 3CCJB 2BM1A 4QHYA 4RCYA 3U6KA 3QSYA 1QGYA 2VYQA 2YWFA 4RJLA 1Q82D 3W5HA 1DDIA 3ZC3A 4AF6A 4B43A 2DETA 1GAQA 2B7CA 4Y7CA
chains in the Genus database with same CATH superfamily
2I34A 2IHVA 5FBVB 3FPHA 5BRJA 2RK6A 4A5SA 4Q3NA 4FNOA 4IJKA 1Z8NA 2IVFA 2AFHE 4OSPA 2B7BA 1XZBA 4P4LA 4PGAA 3LBHA 3RHZA 4AZVA 1NVTA 2WVGA 3GFGA 3QEMB 4US0R 3KKQA 2JDIA 3OQ6A 4JZKA 5F76A 2P4UA 4B83A 2V1XA 3EVBA 3OBBA 4L15A 2HRQA 3ELBA 5HKKA 1QZ3A 1LK0A 4Q1BA 3ML1A 1PL8A 1PJZA 2GD6A 5CBPB 2IH2A 1VE5A 1GVNB 3M70A 1HZEA 1P4HA 5FHQA 3M5WA 4FFNA 4Z1OA 4UZUA 3PC7A 3UMYA 3I9LA 1TKCA 1P1JA 4HUTA 4CU2A 2PJUA 2HO4A 1RWWA 3SJZA 4O4LA 1BX0A 4J9UE 4L8YA 5H9WA 5GZ3A 1EFTA 3LJKA 3N0VA 4R2JA 3WWYA 5B4VA 4H08A 2NNWB 4KPYA 1HEUA 2W43A 2AWNA 4YMTA 4XW2A 1AZWA 3R9IA 4XVRA 4OJTA 2CV2A 3T06B 1AKNA 3FDZA 1E6CA 1TW3A 3B1FA 4HZUB 2X3YA 3NHSA 4M6WA 1B26A 1L5SA 2RBEA 4JIMA 4TQGA 3MOGA 1BLIA 4DNTB 3C85A 4GO1A 4GRDA 3SIXA 1S7CA 3ONEA 1QE5A 2QMEA 2GD2A 4H0FA 1Y9AA 1QO7A 4PO1A 2X9VA 1UOQA 3TYXA 4IGEA 1QF9A 2RAVA 4BCBA 2D7CA 2VT6A 4DKXA 3IVCA 4K86A 4ZZ0A 1NLYA 4F5DA 1K86A 1Q1NA 1RM5A 1K89A 2BMEA 2JHFA 4V2IA 4UXIA 1Z06A 3FTCA 4IIBA 4DC9A 4NOLA 3RRFA 4GKJB 5CB4B 3DWGA 4COKA 2CDAA 2FLVA 4JVNA 4DYHA 4FQ7A 5CA1F 3CO0S 4TWBA 4EI7A 5TMEA 1WSAA 3RTDA 4RDLA 1H65A 1PGJA 2NU9A 3B6JA 4RJIA 1YQEA 1EE1A 1HYHA 5I5EA 4HE5A 1Y63A 4OIFA 1XLWA 1N2SA 1JHYA 1JDTA 1AS0A 1CKEA 4GMFA 1E1KA 4XVHA 4DE5A 1HBJA 3FA2A 3C48A 1KFJB 5BQFA 4Q9AA 5E0OA 2QX4A 2I4NA 3CR3C 3D4BA 1SWVA 2GF2A 3EOAI 4MZXA 2HI0A 1EXNA 1Z7BA 4F11A 2LUOA 3H11B 4M6WB 2CCKA 1GGMA 1SG6A 4O2BF 4TTSA 3NNNA 2B8WA 5L3SA 5ECDA 1RP7A 3HG7A 1AMUA 3Q0IA 4NBTA 2WFLB 4UUBA 1GV0A 3CLKA 1TMGE 2IHBA 1ITZA 4AZ3B 1YI1A 1W8IA 3LWZA 1CQJA 2JVKA 2VUHB 3UEOA 4C76A 5ISMA 3I6BA 3FKSA 2HU2A 2I6UA 3FYCA 3V8PA 1ONOA 1M34A 3EVZA 4INZA 1CZHA 3I39X 4LXXA 1RYNA 2ZJ3A 3SI7A 3UAVA 2QTHA 2IBMA 4KRGA 1U28A 4OJMX 5IXSA 2GS9A 3NFRA 2B83A 3HVUA 1XFDA 4OGFA 1U6KA 4YJ3A 3M7IA 3M6IA 3TRHA 4AY4A 4EKIA 3EBLA 5IVKA 4K9NA 2NO4A 3JSXA 3D6AA 3VR3A 2WTEA 3NV9A 1WSDA 1C3JA 1GCAA 1BZYA 1VG8A 4DG5A 2JN9A 4Q93A 4ZPXA 1G5PA 5AR1A 2Z83A 3LL4A 1GCIA 2FEMA 3AU9A 4I3HA 3ZZNA 3QPAA 4LDRA 2GPNA 2OZLA 4FINA 2VNJA 3EXAA 1QHEA 1MFZA 1XYVA 1J42A 3S1LA 1NKVA 2FEWB 3PDJA 4FDAA 4ZAZA 5MDHA 1ECCA 2VKQA 2CKDA 1ORWA 2WUGA 3A3PA 3RK0A 1E3EA 1RWPA 1XEAA 3NM4A 5KAMA 4BDSA 2C9ZA 3JQ7B 4DN6A 5BWLA 3KSBC 4P1ZA 5C4IA 2RG1A 1U2SA 1J23A 2QL5A 3SYRA 5HJ2A 1O95C 3WYDA 3HU3A 5BN5B 2VHTA 3CXCB 3EPHA 1ZD4A 3VYRB 3V8MA 1N1MA 2IZ6A 3OTIA 3C6ZA 1XKQA 5GTDA 1E43A 2WYOA 5CIWA 6YASA 1K6EA 2I3DA 2NP6A 2JI9A 5TY0A 1C9JA 1VHEA 2HLPA 2IUSA 4KH0A 1Z5UA 2Q6OA 1KK1A 4X05A 1YIJB 1QZUA 8ATCA 4FOSA 2QX6A 1II8A 2BHTA 2V45A 4LEIA 2BM8A 1ESDA 3QPVA 2JGDB 1JSCA 2JAHA 3D9QX 4CLHA 1XX6A 1G63A 3O74A 2ZRCA 4FE3A 3PS9A 3UV7A 2WW8A 5DM70 1R6XA 1ZUHA 3GK3A 1NAIA 2FPSA 5IYWA 2O6HA 2GJRA 5ESXA 1WPGA 5K3FB 2QZSA 3GNLA 4BX3A 1PZGA 2GPWA 1BG6A 1NULA 5F4JA 4L0QA 2GARA 3TDMA 2DUNA 3ZHVA 4XQCA 1AKQA 5JWRA 4BGUA 1M6WA 4A36A 1QQ6A 3IP8A 4Q4AA 3RRYA 4FT2A 4XYEA 4X66B 3U61B 4W1RA 2L18A 1RABA 1Z8FA 4NU6A 2A1TS 3AV0B 3GJTA 3F6PA 3CB4A 3W3AA 2KVOA 4GIBA 3WWOA 3KE8A 4YXFA 2IX9A 1X3SA 1QQ5A 5FLKA 3VPAA 5BVHB 2FOXA 1VJGA 4ZP1A 1U0RA 2QL7A 4UCQA 5LJIA 2NVUB 3CEPB 1MJGA 1MX9A 1OLSB 2PWYA 4QLOA 4ZI7B 3F49S 4ZDIA 1GGFA 4OXRA 4G0XA 3TPFA 4BNHA 3KKLA 3Q7QA 2ZYDA 4DHWA 2B2NA 3H3FA 3W2FA 4NAVA 4EQ6B 4JZYA 1GR1A 4P92A 4KKXB 1S3FA 2NSYA 1AXRA 2QGGA 1VJRA 5K8TA 2DQKA 5CK4A 1YZGA 2ZKIA 2P5YA 4NCAA 1WMEA 1EX7A 3WGLA 5I9NA 3W79A 3B8EA 3IQZA 2ETXA 2GSDA 4QU9A 1V37A 1WXGA 1KDZA 1G8YA 1T6XA 4BATA 1SO8A 3MG9A 4RXMA 3ZV6A 3H3JA 3OCWA 2OVBA 5AM3A 5GONA 1HOTA 5FOQA 4OX9B 4BASA 4BP8A 4QUIA 4QVKA 4G67A 3HZOA 3IVMA 2H7YA 3OIWA 4C0JA 4ML3A 4RTSA 2BKAA 2J7PD 1ORIA 2X0FA 3JALA 4MMZB 2H57A 3ADBA 1Z6YA 1A7KA 1EYZA 5AI6A 3ISTA 3PXDA 1V9SA 3H05A 4QYMA 3TW4A 4AY3A 4C1BA 1Z0AA 2DFPA 4G1BA 1GYRA 2YRFA 4C4YA 1L1RA 4F06A 4TOIA 1UODA 4MUYA 4FC7A 3T3GA 2R5NA 3V4FA 4WZZA 3KJGA 4C04A 3NT4A 3IA7A 1FUEA 4FHGA 2AOVA 4QASA 4URZR 3BD8A 1LZLA 5CVJA 3ZK8A 2QHXA 1P91A 3A1CA 5DLQC 2G4LA 2JEYA 4OIMA 2Q5QA 4EPVA 4F8YA 1XPRA 3AHHA 3JWIA 3SZOA 1P2VA 1Q17A 3BXHA 4QG3A 1D9XA 1CQIB 4EVRA 4ND4A 2R79A 5DNDA 3VO2A 1E7SA 4PZZA 3VHXB 5IH3A 5IM5A 3RRJA 5A3JA 3WSVA 3Q7IA 1Y6GA 1EQUA 1HNNA 2PEZA 3LQFA 3UHOA 2P27A 3AF3A 4C0HA 3LUDA 1E1QD 2CE2X 4E12A 1UBLS 2ZRLA 3CVUA 4JBLA 2ZXEA 2GAFA 3T4XA 1YS4A 3PJRA 2R1TA 4ARIA 4A23A 2YYYA 3RLFA 4QARA 1X42A 2H7VA 2WDZA 3NDJA 2Y0EA 2ZRQA 5IKOA 1NJ5A 5FADA 3LOQA 4ENSA 3S8EA 1P1BA 4ETWA 4GLJA 5CK5A 5DTQA 5FLYA 4NY1A 2VSOA 3CX3A 5H0IA 4BLUA 2D0OB 1DWPA 1O3YA 5AJVB 2XVXA 2X0IA 3L7JA 1FTYA 2A9QA 3W5IA 4BOYA 1PDOA 1AV6A 3KV1A 4IIJA 1SEVA 2UZIR 1GZSA 2EV9A 4RS3A 1E2PA 2BCGY 5B3AA 621PA 1Q2XA 2HUPA 3AUSA 4IJVA 4ENQA 1R0LA 4R6WA 4Z6KA 4ODIA 3MWDB 5FTLA 4FCCA 3CH6A 3UJDA 1L4HA 2JHAA 1PWXA 2Q3LA 2YV2A 2I7TA 1E2EA 2X13A 1Z0FA 2BBSA 4G36A 3GT7A 4CMIA 4L02A 1SC9A 2VHXA 3NM5A 3U4MA 4UFPA 3S99A 2I91A 1ODCA 1BW9A 1SD2A 1N0VC 2R751 3LWNA 2JLZA 5ALQA 1JA1A 1U1DA 1N9GA 3LKDA 3C3WA 3Q8XB 3H6GA 5EJEA 1RKXA 2FZGA 2QRPA 5L46A 3F7OA 4JHXA 3T9AA 2PRSA 4IV5A 3WGTA 3MXTA 3HEBA 5HBGA 2FFRA 2ODTX 2WIFA 4EKNB 2D2IA 4XGNA 1R2QA 1U11A 3WZMA 4GOJA 4WOKA 1TK2A 3LSYA 3L0PA 1CR0A 3A11A 3BFVA 1ZJWA 4NHEA 4OYRA 1YR6A 1J5EB 4D9GA 5KCZA 1ZK1A 1HLFA 4CQMB 3F6RA 1BJRE 1DQZA 2I78A 3GARA 5HK8A 2FFAA 3M0EA 5CB0A 1W0KD 2O8CB 5EUMA 1XVUA 4K8OA 4A2WA 3IT0A 2FG6C 4M38A 3PQDA 1LBHA 3GLHB 5JOQA 3Q3VA 3KHKA 4NC9A 3MW8A 4X1KA 3V6LA 1MCZA 4PBRA 1ZGHA 1FRNA 2LCIA 2SKEA 2QZZA 2XH8A 3H5IA 2CXQA 2IYSA 3MTGA 2C1XA 4NULA 2VJOA 1OI3A 1UKCA 5ER9A 3NBFA 4M9QA 4XOUA 4TT3A 1JFFB 2JFUA 1FLNA 1TLFA 1Y82A 1U0FA 1NUQA 4WESA 3UT6A 1CB0A 1PN3A 1GDTA 4EAAA 3HWX1 1W85A 1X80A 1V8BA 5IUJC 1Y1QA 1AQLA 3IVAA 4AL4A 4E31A 1K8QA 4Z4QA 3ZQ6A 1R8YA 1WZCA 3O7WA 2YYSA 1T9DA 3THXA 4TSFA 3X1XA 4E7OA 1JFFA 5IVDA 1P4SA 3TGWA 4X20B 1F2UB 1NP6A 1W44A 4UOQA 1A96A 3FAZA 4LC1A 3RR2A 2J6BA 3M6VA 2ZQZA 1YJQA 2H2FA 5BSRA 3PE4A 5F7XA 1YTLA 1T5DX 3O90A 3I62A 3SVTA 3D6FA 4O1HA 2Q9UA 3WLPA 1TUBA 2A5DA 3BB1A 4FR2A 4NPAA 1US8B 4Z9XA 3KVYA 1OIXA 2VHQA 1OX4B 3W9BA 3NH9A 4WD3A 3M89A 2VZLA 4RWZA 4BMVA 3AZQA 4ID9A 4H2DA 4TWIA 3P9SA 2XXAB 3D8BA 3Q5EA 5CLFA 1M1NA 3OH8A 4AAYA 4DCMA 2YMLA 3K16A 2DUUA 2C1EA 4L5IA 2O0LA 4BP9A 2CZQA 3C14C 1VSBA 3PC6A 5JCZA 1O08A 2REQB 2OD9A 1MHPA 4NCJA 4QSMA 4UHJA 3T5CA 4QXRA 1USKA 2X2PA 1TJPB 4AG5A 4BNFA 3G05A 1C2TA 2BIFA 4EFMA 3A3OA 3FR7A 1YC5A 1N6RA 2NTYC 1AHNA 1Y6QA 3SJAA 3BRSA 3NUGA 3UXYA 3U7GA 3E2IA 3NJRA 4G09A 3TZBA 3IVRA 2ZUDA 3R4CA 1TADA 3FLMA 4MLPA 4I50A 4ZO8A 3KR2A 4B3SB 4CLEA 4YV0A 4OFXA 3N5CA 4LC9A 1SIBE 2YZNA 9MHTA 4QYWA 3CLTC 1HTWA 4LWPA 4M0FA 4BVHA 3KSZO 3LVFO 2J7PA 3PVZA 4WZEA 1FK8A 3Q7PA 1D4FA 3T7SA 3WIOA 5FLXA 1Z34A 1SXJD 1FTQA 2GX6A 2R7AA 2WHYA 3JV7A 1M0TA 2ODAA 2Q2VA 5ILGA 3LMKA 2PVSA 1M2GA 1CF2O 3VPCA 3KYJB 4C0SA 3D31A 1H5QA 3AVUA 3N8KA 4MI9A 2PUTA 4P84A 4DC0A 1U04A 4MR7B 1UKEA 3OJ0A 4PO3X 5K0ZA 3E18A 3UMCA 1NW9B 1X1QA 2FE4A 1XVIA 4H16A 5HVNA 5A9RA 3PXAA 2SHKA 2PTGA 3JQGA 3IUNA 2YDXA 4HRVA 1UWVA 5I8WA 3WYAA 5LP6C 3MTBA 4PGOA 4HGNA 1P18A 1C14A 1YIOA 3WL7A 3B38A 1KP2A 2Z3WA 3K20A 2PG3A 1GZ5A 5DK6A 4EEZA 2B8TA 1XXHB 3EN0A 1QG2A 3X0DA 4FIDA 3KQPA 2XQKA 2X0RA 4UD2A 2FPGB 4V0KA 3BD9A 4YCAA 4RX1A 4QXMA 1UMCA 3UT5B 1V2HE 1WW3A 4XRRA 5DLDA 3CRMA 3AR6A 5LOVB 4JXZA 4NVRA 3TLMA 4EZEA 1GGNA 1ZW6A 1X7DA 2PH1A 3PNVA 4CMKA 1SUSA 5EERA 1OILA 1RPJA 4AP5A 5GM1A 3R7NA 3GJ8A 2XCLA 1CR1A 4G8DA 4B73A 5JCXA 3FHTA 3FDZB 3ND9A 3OF3A 3RSQA 4ZDJA 1LJLA 3CEMA 4JT9A 2C5FA 2WJJA 1UBCA 1EG2A 3T3NA 1RHUA 3UWKA 4IG9A 3WYNA 4OQDA 1AX9A 5LWHA 4DMLA 4GYJA 5HEKA 1Q92A 5AFSA 5BQ3A 4D25A 3WRVA 1RRGA 2UVDA 3NALA 3RBVA 1GD1O 1M3SA 3LBIA 1UFOA 5DM2A 2PPVA 1K28D 3RVLA 4HRAA 3HO1A 4PM4A 3DMGA 3R9KA 1T13A 1S2DA 2XNKA 2Z2KA 2ZYIA 4I9HA 4EJMA 4WSOA 3RSSA 3E3OA 3IUQA 5KQMA 3GCGA 5KSOA 3D7RA 2DOGA 4QJBA 4JJZA 1YACA 3MIIA 4CLRB 5CCXA 5AOAA 3B6EA 3OW7A 4FYJA 4G07A 4X3OA 4X6XA 2CV1A 1BU5A 1K7SN 1GDHA 4DV2B 1ZIPA 1XD2B 1OAOC 4OYHA 1NB9A 2GK7A 1UBJS 5DM60 1ZD9A 1QZTA 1Z18A 1IY0A 3HU2A 1EUCA 3JR7A 2L19A 2Q7OE 3H5OA 3LHKA 1ZH4A 3AY3A 4JCOA 2AL7A 5LP6A 4MTLA 2RGAA 4OV6B 3KVRA 3FPFA 4BZQA 3RTEA 2C3MA 3SLNA 3OW2B 2O7NA 3CZ9A 1N6LA 4NU0A 3SQWA 2WJGA 1IOVA 2HIHA 4C0XA 1SBNE 2ZFUA 3QA3E 4BBJA 5I7UA 4JUFA 5IC6A 4ESEA 5EZ5A 3N6RA 3NEPX 2QMQA 3OOSA 4UKDA 1X1SA 1DBSA 1I1OA 1IEWA 3LOUA 2FJUA 1NBOA 1Y4ZA 3C7CB 3QWAA 4Y2YA 1TF7A 1TK3A 5A05A 5KJEA 3ZHSA 2PZJA 2J0SA 4I5FA 1FX0B 4KN5A 3ZLVA 2AFIE 3R23A 1EJ0A 3ASPA 1V11B 1WP4A 3BHMA 4O4JA 4GOXA 4QAJA 3U4HA 1NYRA 4DRZA 1RLIA 2NUAA 4FTWA 4QOSA 3MWGA 5DEOA 1OTXA 1T5LA 5SYAA 4DLTA 1JR6A 1M7BA 5TS2A 1BX3A 1R0RE 1RRPA 1YMUA 2X8BA 4CM8A 4JBIA 5KQRA 2AFHB 4G85A 4G0OA 5E7MA 2Q28A 2RI6A 1RWOA 4HXGA 1GPYA 2D2VA 3ZIAA 1R5OA 4HV4A 3A28A 1KDYA 5BV7A 1I7NA 1CW2B 1TYEB 5CVEA 3P9NA 3LT1A 4X0CA 2IDJA 4IRXA 3O8NA 4IDGA 3A8KA 4N48A 2JI4A 5ENVA 3EXIA 3WK4A 2PMDA 1TKAA 1H93A 1KOFA 2QL6A 4POAA 1YMVA 1Z22A 2FPXA 2P8SA 1ESEA 2YV4A 5K0BA 3NGXA 5IJZA 4A26A 2ZATA 2JEOA 1S02A 3D5EA 4DVGA 2JKYA 1K4KA 1ODIA 2BP7A 2QLFA 2E5WA 3AUYA 1YR7A 4E2ZA 3ZDAA 2Q4BA 2IV2X 3CUWA 3A1DA 4ZV9A 4DLZA 2N0SA 1DX4A 2WQ6A 2Y1DA 2VZ8A 1R66A 3DDZX 2WWGA 2M98A 4HAYA 3PFBA 4R8KA 4AJJA 4FGUA 2AFIA 4J07A 3WKEA 4X7FA 4J1NA 2IOFK 1DFIA 3BA1A 5CAEA 2Q9BA 2O50A 1TVMA 4MS3B 5L3ZA 2ZAMA 5BSKA 4URVR 4MV1A 3ZGOA 1JL3A 3H0CA 1LPOA 1MJGM 3IAM6 1YLOA 4XLHA 3O9VA 4RA6A 4ER3A 2R62A 1PJLA 1PR0A 2HPHA 4KLZA 5DCYA 4OHYA 4F6RA 1L5YA 1POWA 2YV5A 3NM6B 2BFAA 3HYTA 4CKCA 4MOWA 4JHLA 4Q7KA 5A4AA 1ZMRA 2PO5A 4F4JA 3H5NA 3F47A 4DA9A 2F9LA 4YPOA 1DO2A 2VQ6A 1YZKA 1ZD2P 2JBHA 4ZTBA 4E30A 3CX8A 1N07A 3H2HA 1JIJA 3ETDA 1HK7A 4XAQA 3S2FA 3U80A 2VBSA 3C1TA 4FLEA 4CG2A 3VDXA 4M1WA 3H75A 1C30A 1OI7A 1VSUA 2VP6A 5LBTA 3N0WA 1Z63A 3NRJA 2NUBA 2PKEA 5JQGB 3DMRA 4O3FA 1YJ9B 5B2EA 4RKFA 4L4UA 4EENA 5KOIA 2FX3A 2NN3C 4CTKA 1W75A 3KQSA 1VQKB 1KBOA 2GK3A 3UOWA 1X92A 2AW5A 2PH3A 3MBOA 2ZYAA 1ZKMA 3NAZA 1KMHB 2VXOA 1M54A 1TCUA 2I4MA 2X4DA 2X8AA 5EVJA 5LC1A 2HZ7A 2VHJA 1FBTA 1OIWA 3A2NA 3D1VA 4ED9A 1W5EA 1W59A 4PV7A 2ST1A 1YF3A 4IJUA 1NT4A 2C4VA 3BFJA 2F48A 1KDTA 2Z0MA 4EEKA 3RYCA 1ZNYA 1GSHA 1YXMA 3MNFA 2QR3A 2VS1A 4P54A 5IUKC 1L7QA 4EHIA 3PA2A 4BGIA 4CKXA 4Z2AA 2XWSA 1JH8A 4PSUA 3T7CA 3I30X 5HZKA 5T41A 4YDQA 2Z8YM 2WOJA 3I2YX 2NYUA 4D02A 1YHYA 1H85A 1L3BA 1JG2A 2Q1WA 3MVEA 1W52X 1DIBA 1I14A 1VLZA 4MRPA 3O2NA 3P2EA 1FP2A 4OCZA 2X2FA 4PYIA 5U1PA 1ORDA 3CONA 4LECA 3L7BA 1J06A 3X1ZA 4D8UA 3UCFA 2FYTA 3C5CA 2ZPAA 3PIIA 4UW9A 2WKWA 3TOZA 3KOZA 4ZC8A 1XYYA 4FYKA 2QSZA 1U8FO 1C8BA 3QFTA 2VSQA 4OQ4A 2VYVD 4B2PA 1ZXXA 5KIAA 3PD1A 2ZUCA 4CR6A 4F45A 4M98A 3ZGXA 3BY1A 3KEWA 2H48A 2YICA 1B7GO 2CMKA 3LY5A 1O9HA 1XQ1A 1N9KA 5JLJA 3QXHA 1GPLA 4MQFB 5FUYA 4Z0TA 5JDIC 2R4UA 1FS4A 4P22A 1JHRA 2H8GA 4P2NA 4CZ2A 1FX1A 3BILA 2AC4A 1Z4JA 5DGXA 2QXTA 4JR0A 1DX6A 2YIDA 1L7MA 3BGIA 5AK0A 2ID8A 1OWLA 2Q41A 2ONJA 4NBVA 2W6OA 2X4GA 4OI2A 4YEDA 2XOXA 3GEIA 3UMGA 3X2SA 4EB8A 5B6PA 5BR7A 1LXCA 2P5SA 1NSFA 3MFQA 4L6CA 5A9SA 1E79D 2V4MA 1TECE 2AEJA 2CDCA 3AK4A 3HXKA 2BBWA 4OQPA 1D4OA 3NKLA 5EJGA 4B82A 3M8KA 7AT1A 1QPGA 2CYCA 4JJIA 2WJAA 1I2BA 1I3NA 1TM4E 2B1JA 4GZLA 3QU4A 4G25A 1SHKA 1QAQA 3I1IA 4UNIA 4X71A 5D6NA 5A0FA 4A10A 4BV3A 2QN8A 4RWEA 2Q0XA 5HR5A 4XQFA 1JXQA 4QFMA 1XYGA 5JH7F 4QREA 1JQLB 2R8EA 3E15A 1NXVA 4MGKR 3WFIA 4C78A 5E1OA 4DSNA 5FV4A 1MBZA 5B1DA 1U94A 1UPXA 2NZWA 3RQIA 5HDQA 4G81A 4NE9A 3SZGA 1LS6A 1XZIA 3JQ9A 4JGBA 2QLTA 2HXGA 3MAAC 1EFPA 1J0EA 2EGGA 4EO9A 3L93A 1WXIA 1L9KA 3U1BA 4BAUA 2YVKA 1ULZA 3IA2A 4F5EA 3R0VA 5EY5B 1J5PA 3IOYA 5K4HA 3P4UA 4YHHB 3BSSA 2XUZA 1IJEA 2WIKA 1HNXB 1X74A 3HNPA 1ZIXA 2VSYA 5G1PA 3NHRA 2BI8A 4F9EA 4PE5B 1VECA 4UZEA 2GI4A 3PX2A 3RF6A 4DEVA 4XUCA 4BVBA 5BVGA 1YJBA 1A9SA 4RD6A 1VQOB 1AZSC 2PWPA 1A71A 1JQ3A 2OPBA 3OZXA 4QU8A 4RHFA 5FTKA 2FVGA 1DLIA 1E7MA 5FTJA 3I6QA 3TAHA 2D06A 1V5WA 3ZQ4A 3ASYA 4ARVA 1EWTA 2HA2A 3DYBA 3VNQA 5CFNA 4GKVA 3T1TA 3UFBA 3DWIA 2GSWA 1VLJA 5FBZA 4J0CA 4C0QC 5AUOB 5C5EA 3AI2A 4HPXB 2C42A 3DV0A 1Y9ZA 2G77B 1B16A 2QX7A 3C98A 1SCBA 1SKBA 1JSRA 2VHYA 3P2KA 1A9YA 2ATEA 4NK4A 1MO3A 5H3HA 1EGAA 5TDHA 2CF4A 1OD6A 2R9VA 1Y8QB 3NB0A 4A3SA 5ITSA 2AC7A 1P62B 4LQDA 1SBQA 4OUKX 1SOWA 5KCMA 2QM8A 2DR0A 1N2HA 2EBUA 2PX2A 1SCUB 3OM9A 3EQ8A 4L0MA 4RNDB 1XE3A 2IUTA 4LXIA 3A9WA 1JA0A 5GZ6A 4QEZA 1U9YA 2GVDC 2B9VA 1M1KD 1IWPB 5JZSA 1TGVA 2J0QA 2LP4Y 4BNJA 4IQ8A 4IR7A 1L7AA 1O58A 1P2DA 3SJBA 4YXWD 1VIYA 4FFLA 1QUFA 4EY5A 3AR9A 2V9ZA 1G8FA 2A59A 3VKHA 3KYIB 1XMXA 4IIDA 5IAOA 1P33A 2F3RA 3FHOA 1CS4C 1WVGA 1PP4A 5G4LA 4ZWNA 4B81A 1J22A 4RIHA 5JVDB 4NE7A 3Q9LA 3V8VA 3QY0A 1MO4A 3OZBA 4IMPA 4MUXA 2C9CA 1BWQA 3OFKA 4CI9A 1VXRA 4YRDA 1XVLA 2PZKA 3BICA 4BPBA 1XHEA 2OA0A 5HRUA 2FN7A 4CEIB 1VZ3A 4XR9A 4E6EA 1NDHA 4P1VA 1IZ8A 3H97A 3B1XA 5GVSA 1SHJA 3LQRA 4YJHB 2QP3A 1J49A 4MCIA 4OHFA 3L8ZA 4GNKA 3H17A 4LYFA 2GUGA 2YQZA 3SQOA 4ERXA 1QDLB 3GPBA 1BPLA 3MYYA 3QGMA 3FWYA 4HWGA 3TQQA 1RKVA 3CBGA 1U7XA 2DAPA 5DGCA 5JD6A 4LG1A 3DTTA 5MN5A 3FLAA 3K72B 5LD2B 4DF3A 1O5IA 1G42A 5LBIA 3UMVA 4BZXA 2IF2A 3C6QA 3IQEA 2F1LA 3SMVA 1RLOA 4LF8B 1R9NA 1TC2A 2A0FA 2PUHA 2EP7A 3W1WA 1ZYUA 3LKZA 2CYBA 5JSQA 4EEXA 1GRQA 1T1JA 2IPNA 1RJDA 1XJQA 2C7VA 3H5AA 2WJ4A 3E03A 4I1RA 3UA3A 3B9BA 3NONA 1HNZB 3G6EB 1QP4A 4E13A 1R6TA 1TD9A 2BFWA 2BUAA 3M9LA 2D5LA 3Q5DA 3SEQA 3T7TA 3VGPA 1L5FA 1GLNA 1OFTA 3VX4A 5AW6A 3AUUA 4EBBA 2HJRA 5JAIA 4IQFA 2PXCA 5IAKA 3SC4A 1YA8A 5FTWA 4J0GA 2GQFA 3NQ41 3PR1A 4UNPA 3DMYA 5SZKB 3VC1A 1MU0A 5T67A 1RI3A 1I5RA 4RW0A 5FO0A 1CRWG 1GKUB 5EHIA 3H0EA 4FBGA 3LCVB 4DCUA 1W9XA 4FW8A 4ITRC 4EG0A 1PT5A 5GMOA 1QP0A 1DAHA 1LQ2A 2CVOA 3OHSX 4W63A 1YQQA 4J94A 2YY6A 5D7NA 2GYVA 1PIWA 2DKOA 2J09A 4E2FA 1DEAA 2RGDA 5T5QA 1Z37A 1SVUA 4PR0A 2PXHA 5DBGA 2ZBFA 2C59A 4PWZA 3TLCA 5SZIA 2Q5CA 3A27A 1M74A 2DERA 3BQNB 3I9OA 1T6YA 3AEKA 4RKYA 1ZC4A 2BI4A 4CVNA 4W5RA 1CQXA 4DPKA 2AOTB 3G5AA 2QRGA 1Z33A 3T5TA 1WO8A 3N2LA 3H94A 5DRTA 4MRRA 5I7HA 4DM3A 1Z8DA 1TYDE 3DCIA 4DV6B 3OOJA 5DT2A 4G65A 4YRGA 1KORA 5LOVF 3A6PC 3DZ8A 4F93B 2C96A 4L7VA 1E4OA 1QYWA 3NTUA 4HMQA 2G70A 4PXSA 3X2EA 5DBHX 3HCPA 3BMCB 5YASA 4RTRA 4RM2A 1L4NA 4Y18A 4ENWA 3HLYA 2XBLA 4PW0A 1QV6A 2JBAA 4ZCPA 4QTYA 2OWDA 1X7ZA 1THGA 4W7SA 3UMBA 4HDRA 1QVGB 4Z0PA 3RAEC 1PQ4A 1QIDA 3ZTWA 2GEKA 4Q7QA 1FSGA 4LFCB 1WW8A 5C9ZA 3IDSA 5FQNA 1TO2E 4B2IA 4AY2A 3EGWA 2XEXA 3KUXA 4B3TB 1DOHA 4ZOBA 1M5RA 2BZGA 1SUWA 3KV3O 4K9SA 4UHCA 3VRHA 3GIDA 1K8ZB 4S2EA 3EZ9A 4KK3A 3WAGA 3HJFA 1UPTA 3CRQA 1B4DA 2X42A 3T53B 1MVOA 1NE2A 4GX1A 4MWEA 4ALLA 1LB1B 2G5CA 3MCUA 4HY3A 2HB6A 5BN4B 2JD0A 2B82A 2W2KB 2XXJA 3PI6A 4EX6A 4OQEA 1SAYA 4IW3B 1RHRA 4CG3A 3D4PA 1W35A 2WUVA 3MJTA 2I2XB 1CQWA 2X4IA 4LZNA 3EOZA 3M2PA 4HB3A 4J2TA 3REOA 1OSNA 4D9BA 3MN1A 3WLOA 3D8UA 1XBTA 2P91A 3H8VA 1O03A 3TCXB 2XUDA 1P0QA 2QUJA 4PLWA 3AR7A 4YDSA 1J39A 1ZOLA 4WECA 3HBLA 3TNYA 3JZAA 3OX3A 4CN8A 4PYJA 1G8AA 1YS2X 3R3SA 3HPQA 4A8TA 1BEZA 2BGJA 1KVTA 1M67A 3VYSB 1XMPA 3QYFA 2AN9A 5IARA 4Y2TA 4WVLA 1D9ZA 5DMHA 4B45A 1QHYA 4OGLA 3FUVA 5F51A 3G82C 4OHVA 1RADA 4KQ1A 1G3MA 3FDIA 3ABZA 5C51B 3U4QB 4AKIA 1THMA 2O7SA 3LX8A 4OSOA 4DJAA 1OHHD 1OT5A 1N36B 5HGJA 1VGVA 5HF5A 2PYDA 1QHHA 1RKBA 1M2KA 5H4GA 2AGVA 1YKSA 2X5JO 3G88A 2XUJA 3LUPA 1MTOA 3PEFA 1QFSA 1NN0A 2Z2IA 4M1YA 4C7VA 3E3AA 3AINA 4LF4B 4RPDA 2BKLA 4NBKA 3U48A 3QZUA 4Q34A 4ENTA 5IF3A 3PHLA 1IVYA 3F5QA 3EZ7A 4L9WA 2FFJA 5KPJA 3PYMA 2YWFA 1TF5A 1RPZA 1LTHR 5CLHA 2F1KA 1GILA 2WU0A 1RWVA 1NG1A 3COYA 3DC2A 4LQ4A 1R4MA 3CKYA 4TS1A 5BUCA 4YP7A 3L8DA 3R7LA 4L72A 5K6TA 5LXTA 3OP4A 1LBIA 3EIQA 3G0BA 3PV0A 3LHFA 3PXUA 4GHWA 4MVJI 4OBXA 4TLMB 3HM9A 3CEAA 1RJWA 4ALMA 2YUIA 3AB3A 4TQ9A 3BKXA 1T2FA 3CR7A 4Q1EA 3TZEA 3GRZA 2XB2A 4GPTA 3RJMA 3HZZA 1E3TA 2R5FA 1WG8A 3KEQA 3KU1A 1Q6ZA 3LBNA 3ORQA 4IEFB 4KKVA 3RV4A 2PZMA 4O8CA 3FSGD 1CSEE 3LBYA 4DMFA 4KLRA 5EJIA 2PQ6A 4GKAA 3DTVB 2J7KA 2EXXA 4QO7A 2IIVA 4YS6A 4YQZA 3RIMA 1TOAA 5BMVF 2OQVA 1L6RA 3GJRA 5DK4A 3H2YA 1N34B 3CCRB 1M2OB 2MR6A 3FIJA 8GPBA 3UM9A 2VHEA 4OOSA 2XJ4A 1FJGB 4OFBA 1OAAA 3NGMA 4RHTA 4Y1RA 1VLQA 3PP8A 1V8DA 4RPCA 2CXPA 1EFPB 5FBRB 4EHJA 3C5EA 2DPXA 1KAGA 5C8XA 1M66A 1ZRSA 3EDRA 1V1RB 4XM3A 3NXSA 4NENB 3EEOA 1DAFA 4LJ8A 3VOBA 1G7SA 1NW7A 1MQAA 1SNYA 4KDCA 4K9LA 1N32B 3FTNA 4KIGA 3LYUA 4BTEA 3CM0A 2AVDA 5K7SA 1EUZA 5A4IS 1PD1A 5ALLA 1GUYA 1T6BY 2G1KA 1XXLA 1M5UA 1ZRHA 3GI1A 1RWKA 3NHWA 4HZIA 3KT3A 4PNHA 5IBQA 3TZKA 3WLIA 1HOXA 1USWA 2ZR9A 2Z2ZA 4ZQEA 3HXQA 1ZQ9A 5IJ9A 2PUVA 3R4VA 1CIJA 2GFHA 1P29A 5F4OA 1IWOA 2WBLC 3FF4A 4PYRA 3EF3A 3N2EA 3O5AA 3MMSA 3D0RA 4OQQA 1E9EA 3C45A 1D4AA 1VJTA 2AHRA 4M1ZA 5HJ5A 3VVCA 3AI7A 3MQFA 1QB7A 1RFGE 1QIMA 4PQFA 4QXQA 2A3NA 2PGOA 4MKXA 1L5HA 3ZI4A 4O1MA 4MI3A 1DHTA 1NAHA 1U8UA 4DA7A 3B5EA 3PC8A 5T57A 4Y2XA 1S96A 2VQFB 1N1EA 1XOIA 1LNQA 4H9GA 3BH0A 4JB2A 5BMVA 4S04A 2C0PA 3LQ4A 4N0DA 1GPDG 3MUOA 1NLFA 3PJGA 2HADA 3ZWAA 4AW9A 3ECCA 4JLUA 4BVJA 3BE8A 3JQBC 5ALDA 5HK9A 5A4DA 3ZJVA 4UOZA 1TAHA 4NCBA 4IMRA 1NF9A 3RV3A 4RL4A 2OQRA 4JKIA 4MCJA 4R1PA 1KD1D 4D4JA 4OQFA 1Z45A 1UWLA 2XMDA 3PNOA 5AW8A 3IIJA 3H04A 5ADWA 5LP6B 3IESA 2FMIA 2QN9A 3GGCA 2CJYA 3PPIA 4MH0R 4C07A 1I7QB 1OI4A 4UU7A 2QB5A 1R6AA 3BAZA 3G2QA 1KH1A 3E20A 3ASUA 4YACA 3UAZA 2P5UA 2WA1A 1A9RA 1OFHA 4PR3A 4MUMA 5L6LB 1EWRA 1HE3A 2MOKA 1TU0A 1NXPA 2PSFA 2VR1A 1TTTA 1MB9A 3RIEA 3DONA 3LYHA 5BV2P 1EVZA 2XCTB 3ZNNA 4GX2A 3AVVA 3H2BA 4UEJA 2HHJA 3W04A 2D6FA 1II8B 4FN5A 1JFRA 4N18A 4NJEA 1YMQA 3I76A 4B87A 1PW7A 5CDGA 4JI5B 1JHUA 3WQHA 2AS0A 4RQTA 2C8KA 3B2QA 4AJIA 4G41A 1J07A 1ZCJA 1T4DA 2Q6VA 3EG5A 3Q9NA 3C3BA 4F9TA 1YJWB 2QPLA 4Y2HA 3BRWA 4RD3A 2XKAA 3L01A 5AXAA 5JAHA 4S24A 8AT1A 1ZD3A 3B78A 3J7TA 3CPSA 4RY0A 4URFA 3DE6X 2FF5A 4WNIA 1P6UA 1N8KA 4MLZA 4HQFA 2QD1A 2WZCA 1APBA 4BO7A 4E51A 3T34A 1VRWA 3OZAA 3GDFA 5IZCC 3QEAZ 5MFZA 3OF5A 1R5NA 4M8LA 5AVTA 2BFBB 3SFTA 2FXIA 3NEJA 3WL3A 1XVVA 3PA1A 4UUAA 5K3DA 2Z4RA 4G5OA 1FFAA 4WA8A 2IS1A 3ZDBA 3A26A 1JEJA 2WYUA 4BMDA 3UAGA 3ZGNA 3PFNA 3FSEA 4U2DA 4Y2JA 4FWTA 2AF4C 2FQXA 3EQ9A 4MB2A 4QQKA 1K6XA 1PR4A 1QCYA 4QUAA 2BISA 4QJIA 4TL6A 3U3XA 4Q9DA 5KSYA 2VDWB 4HUJA 4AS2A 4YAIA 2PGXA 2VQ3A 4N3AA 1ENYA 1GGVA 2O3UA 1AKMA 4ZZ3A 2AB0A 5P8WA 1H23A 3BJIC 3E27A 3L1VA 1OXTA 1RVDA 1UUFA 1YZ3A 2PLWA 3D2CA 3KLOA 1DXHA 1IN5A 3H18A 2OC4A 5ALNA 2B5WA 4CIDA 1E9DA 2B7LA 3F6CA 2QE7A 1PQWA 1OUMA 2VPYA 3GJQA 4HWOA 2WVJA 2ALJA 3MB8A 4RPGA 4EI8A 3W2TA 4IIXA 1XRRA 1S2MA 1JGTA 2ECQA 2O3JA 1JAIA 2YY5A 3DDHA 3DLCA 3R09A 1H5NA 1SH7A 5E38A 4XDHA 1WWKA 1JJ7A 2OR3A 3LV8A 4G24A 4IIGA 4CTJA 1DDOA 1LLQA 4Q16A 5A62A 2XUAA 1VQLB 1OB0A 2IYPA 5GM2A 5J63A 3VKVA 2QP9X 5EQFA 5LLTA 4RULA 2FN3A 4RIFA 1GNQA 1JB1A 3PFCA 3DEAA 3ENVA 2QJRA 1NVKA 2QZ9A 4K2AA 3JCZA 4MV0A 4NZPA 1CP3A 3NVKI 2C3PA 3RUFA 1FMTA 5JJCA 1JBQA 4DLRA 3T5DA 3MM4A 1DEXA 1QJ4A 5AJTA 1S8AA 1JT2A 1T3LA 3UVEA 5CH3A 3ZBQA 1WVMA 3OLXA 2FRDC 2ZT5A 2HJ9A 1IXRC 4BN5A 2FX5A 1WOMA 4TMZA 1P7CA 2PIDA 4KUHA 5DKFA 4YAGA 6REQA 1GXSB 3A70A 1GTG1 3O3OB 3RC3A 1KO5A 3NHUA 2OOSA 3OPMA 1QNFA 5HMLA 3GRCA 5EQJB 4CHTA 2C4TA 3LZCA 1OXXK 1XRMA 3FFWA 1YB5A 1DIOB 3NLLA 4CWAA 4IO1A 2GYYA 1FFDA 3A6HA 1ID1A 2J4FA 1N2BA 4N41A 2IU6A 4NK5A 4BNUA 1MLDA 3TNJA 3EIHA 1C2YA 1L1FA 5K9ZA 1XN4A 5K0FA 4BNMA 4KFCA 3KQLA 1THZA 1H6BA 2NO9A 5JD3A 3S2EA 4ISBA 2VLBA 4Q9KA 5I7AA 3VHRA 3LC7O 2EKDA 1E9AA 1P6XA 4Q12A 5CH8A 2CE7A 2H2HA 3UKJA 4CIYA 5E9QA 2UZAA 1XJ5A 2D7JA 3IB6A 1A77A 1R6UA 3RAFC 4MB0A 3C15C 4M7WA 4IF6A 4AS1A 1JDJA 1EX1A 1O96B 2DBVO 1TYCA 2GO1A 2IF0A 2YINC 3GGPA 4P38A 1EUCB 4YCDA 5JAQA 4ND3A 1RIIA 4M9SA 1CY1A 1I7PA 4CODB 3CKLA 1K6IA 1XC7A 4I19A 4MWZA 1QR2A 3KB2A 3IJEB 2DFTA 1G21E 2JGKA 3OCZA 2OYNA 4AO6A 2HMVA 2H17A 3LOPA 4CKEB 5K6AC 3KFVA 4RPKA 3FPPA 4HVCA 1VPWA 3L8HA 4AP9A 1A5AB 2FUCA 3STWA 4IGIA 5BNWA 3HHEA 4YT2A 3L18A 4JUDX 1HM5A 1E4EA 1U5AA 2O20A 2Q29A 3GFOA 4N5MA 1ORHA 4UUPA 4DILA 3GY0A 5HTOA 1WP6A 2A1UA 3DO5A 3DZBA 2MCFA 1K5HA 4CEJB 4BJHB 3NJ8A 4MJ7A 3T3IA 5D1HA 1KRHA 4OP3A 3T1OA 4DIBA 5BUZA 4HTFB 1Y6FA 5LA6A 3KBBA 4YJ3B 3WLFA 1NMQA 2LWIA 4MVCA 1Z5NA 1ZR4A 1RIFA 3O2SB 4Z7JA 2PD3A 4G1FA 1IN4A 2D59A 4AMZA 4GBMA 2DP4E 3SNHA 5JQWA 3ICQB 5BPHA 4IWXA 3I8XA 3SY8A 1YOVB 1AOXA 1ZUWA 3L6BA 4LPKA 4PCVA 5IJXA 4ER7A 1NJID 1GPUA 4X92A 1U6IA 1NJSA 3FNHA 1HI9A 1U2RA 1D2MA 1PR6A 5CNMA 1UC9A 3LBAA 1X1BA 3C70A 4Q7JB 4G0ZA 3V7AA 1GUBA 2ATVA 1RXWA 1EUDB 3ZG6A 3R9XA 3QFHA 1Q7BA 4CIVA 2YKGA 2E5FA 1LX7A 2ADFA 1GPKA 2FSIA 4MNTA 4Q15A 4DR2B 2V1UA 3PEYA 2CKMA 5ES3A 4CL8A 1MF7A 3QBVA 5ITVA 2H85A 3OQMA 1Y48E 4D41A 4Y9SA 3CCVB 1LFDB 1KZ4A 1VIMA 2OESA 1OH7A 1PR5A 4LPSA 3DFFA 1E3LA 1W1IA 2I8LA 5CJJA 4EUEA 4V1CB 2P77A 2IYLD 3OOCA 2OGUA 2QPOA 2W6ID 3PFIA 2BMJA 1T9KA 4NAUA 3IE1A 4FMCB 4NI5A 1JJIA 2FJ0A 4UQPA 1UM9A 3ZVMA 2PRYA 1RJ9B 4MIKA 2WTAA 4PVDA 2FNAA 2YVLA 4RZHA 4AFNA 4A2CA 3GXOA 3ANNA 2PBFA 3RC7A 1IJKA 2CLCX 1HMYA 3OCYA 1GEEA 4UFOA 2K6GA 2JFWA 3EYWA 3OMLA 2ZTNA 2C92A 4QBTA 1DGQA 1P2FA 1FVFA 3G1TA 3A2LA 2VYND 3FPJA 2G08A 1ES9A 3TDNA 5A5GA 4J03A 4REMA 1QWOA 5ICGA 5FIUA 4MS1B 4DY4A 4O29A 4X7DA 1XEFA 3FTFA 4I4LA 3HQ4O 2O8FB 1T6NA 3FCYA 1C7RA 4XE5A 1FFEA 3N3AC 4X1IA 5A6SA 1YAJA 3G89A 3S7ZA 2YWCA 1XTQA 4EKYA 2Z3ZA 4L8GA 1F4LA 1T1GA 1NQUA 2G9VA 4FWIB 2ZJ4A 5L7YA 4EJ0A 4MRMA 4DWJA 3NI2A 4DMUB 1XRPA 5CT9A 5CG2A 2A8YA 1XEXA 1XK7A 2QTFA 2MSDB 3DTVD 2Z4TA 2WYVA 3KELA 3PFFA 4WOJA 5FEUA 2TMGA 3JYLA 4F3TA 1ENOA 5D5PA 1NQXA 3U7FB 1WEKA 4WZBE 4WZKA 4I3FA 1FTGA 2VF2A 1IG0A 4Y6OA 2FW7A 2ZRKA 4ZAVA 3T15A 4HXYA 1KPGA 3RUHA 4MITA 4V0QA 4CM8B 4DQKA 3C8UA 3KPVA 4LHSA 4P0TA 5C3UA 5T4EA 3NYWA 3ORSA 1L5VA 3EGDA 1GUFA 2E4UA 3LCRA 5HRCA 2O59A 4ZO6A 3BIJA 3ASRA 4Z4RA 1H2WA 2AMVA 1HURA 2PSEA 2VSXA 4FD3A 3K1AA 4OD0A 4YRJA 2IVZA 3RW9A 4AURA 1RC8A 3GEMA 3D3NA 2RHOA 2JJ8A 3AI3A 4D79A 2J9RA 4AWXA 3ZXSA 2G4VA 2HJVA 4OHMA 4YLGA 3A4NA 1ULHA 2V6FA 4OOXA 1Q12A 1TI7A 1PS0A 3ZKAA 3AYXB 3L9XA 3K0KA 3THRA 1L5GB 1XLTC 4OGKA 4UUNA 5ESWA 1AIPA 1KGSA 4ME6A 3W78A 1P9NA 4RU1A 2XUHA 3IBYA 3K1AB 4Y0NA 4K1XA 2D3LA 2V3CC 2GPAA 4LVOA 5E7QA 1IUPA 1E3SA 4LDJA 1YWGO 1F9EA 3AETB 2H07A 2HGZA 3BGWA 4O4IF 6Q21A 2HQBA 3LLUA 1VXOA 4LYHA 1OZFA 2QRLA 4JDUA 2HWYA 2QM0A 4KHZA 3UXEA 2E4WA 4QGHA 1JHQA 4LFAB 3AONB 2ASVA 4KGXA 1LLDA 4Z4TA 1AC5A 2C57A 2W2XA 3FG9A 4FDLA 5HCIA 4BEWA 2RIRA 3PWZA 4JJ8A 3MJSA 4LGMA 2ORWA 4HWKA 5ABPA 1D4ZA 3A9RA 5JI3E 2BEJA 2WKRA 4C9BA 4PCLA 1SQ5A 2FOLA 3L43A 1VJSA 5FXMA 2QAIA 2WRZA 3N2GA 1TXGA 2EC5A 3ZCUA 1VHOA 2W90A 3HDVA 1ML3A 4HDOB 1WUYA 4JH0A 2JZNA 3L7OA 4URHA 4E5MA 4ZYVA 2AG5A 1C7IA 4G0MA 1U0TA 2WHXA 2IYTA 3ZWPA 1L7EA 5K3EA 1GPJA 3O82A 4W1QA 1CJKC 5CX1B 5AUQA 5JIBA 4UDOA 1ZFNA 1SY7A 2OOKA 2ZQ5A 4Z86A 4Q5IA 1W4BA 2B9EA 4HO1X 3UHFA 3PQCA 1NV8A 2I7DA 3GJ7A 4XFJA 3WLLA 6LDHA 4F21A 3RAJA 3DZGA 4M86A 1T2NA 4E1BA 1SA0B 1Y5RA 2IC5A 4Y6GB 2UVQA 3OJWA 4B5LA 4RJ2A 3BERA 2AD5A 3MS2A 2PUWA 3D7NA 4MYSA 2IZ0A 2H0AA 2ZANA 3AEYA 3QRWA 1FTSA 1TYAE 3OUUA 2D5IA 3NH6A 3NHKA 4LE2A 3WNZA 4DIFA 3JYQA 4DRXA 4PONA 1VQ1A 2JKVA 5BVHA 4US2R 3UMMA 1VJDA 3R0ZA 4XNFA 1IULA 4P4NA 3SYMA 1BN6A 3VR6D 1NXQA 4ZFNA 1A0OA 5LQCA 5COBA 1S72B 1BE6A 1RYBA 1N7IA 1XMQB 10MHA 3DHNA 2C1ZA 4KZKA 2CVHA 4QPDA 3TTVA 5KREA 3TRKA 2GA8A 3DQZA 3X1DA 5DW3A 3JARB 5FBKA 3B5IA 2E0IA 2IXEA 1DIRA 1X1DA 5J4YA 1Y34E 4QPPA 3QMPA 2H4HA 3QSYA 1M7GA 2H4WA 2Y1XA 3B3FA 4RCVA 3VYWA 3VZQA 1NRKA 1Z16A 4ZCTA 1EH5A 2IU3A 1O89A 4AX8A 5DP2A 2GTIA 3V97A 4CCYA 3NG1A 5K3AA 3UPUA 1NJ2A 5FBHA 1UL1X 5EP1A 1WOOA 1JN0A 4DEYA 3SMQA 1RLTA 1RXEA 4U7TB 4ZMBA 1JIKA 4UHHA 1IIBA 3OJOA 1H9AA 4LNAA 4QQNA 4MPDA 4F0JA 3FB1A 1J24A 2BR4A 1AS2A 3MBKA 2YMMA 4M1KA 3RD5A 1F48A 2WA2A 1HORA 2HIGA 2PMEA 3E7PA 3SJPA 1NBIA 4MK4A 4DNQA 3N7AA 2YYAA 4F5ZA 1DADA 1FFCA 1UKYA 3NMUF 5JV5A 1Q0LA 4OREX 3KZMA 3AHGA 4LXUA 3VR2D 4C2BA 3S6JA 1QG4A 5LM3A 1AMNA 5B2FA 1IN8A 3DPSA 2ZTUA 2I6SA 4M8NE 3ORFA 2MINA 3PKIA 4MICA 1UDCA 2B69A 2Z5GA 3C7KA 3PQ5A 4M46A 5A2QA 2JLRA 1W87A 2OSVA 3BXEA 1X1TA 5EP4A 5C4MA 2I9PA 3EDMA 3AM1A 1ACLA 2DBYA 5E6SA 5I48A 3PFHA 5F1YA 3HU5A 3B5JA 3NBMA 1BWRA 3HKCB 4LK3A 4M0PA 2VUUA 2HUNA 5E95A 1U0LA 3U13A 4YUYA 2H4YA 2OXFA 4ZT6A 3K6JA 3CUEF 3WICA 1PV4A 1A98A 3C3DA 2OMEA 4XLZA 3AJ9A 2JFGA 1YQWA 4LY3A 4QYIA 4S0XA 1O0CA 1AQIA 1GDDA 3CJTA 3GLKA 4HQRA 3BULA 3WLAA 1F60A 1NF3A 2ES4A 2HBQA 4TYMA 4B6FA 5CXQA 1H42A 1JWBB 2G9UA 2R2GA 1R4MB 4F85A 4XGKA 4UEWA 2AMJA 3KIPA 1M2HA 1IK4A 2IXDA 4NBUA 1QRSA 2HOQA 1L4LA 4HXFB 1MO6A 4ZGBA 2CB9A 3QJ5A 4KG7A 2YWDA 3KC2A 2PD6A 1WV1A 1F2VA 3GJZA 3IEUA 4LS3A 2IWHA 3WBBA 3G23A 2CD7A 4O4IB 4Q3OA 3ZHCA 5TEVA 4CCSA 4M1TA 2WR8A 4ZU1X 2VJMA 2WT8A 3KQOA 1VCIA 1AUPA 3W1EA 2FP4B 5EL0A 3ZU3A 1ISIA 1R9MA 1FXWA 4NMXB 2CXTA 3WNDA 3QNWA 2FW1A 4I55F 1K9MD 1MIOA 4LW8A 4XDZA 1F8XA 3WXMA 5AVZA 3K70D 3DTNA 2IEDA 1RJGA 2J41A 2WV9A 3DMHA 5ALHA 2C94A 4AMVA 4UZFA 1RXVA 3GGGA 1N8RD 2DFNA 2HBZA 4FS3A 1YU9A 3VAYA 5IHPA 5IKPA 3I9JA 5AKXA 5CDSA 4LSWA 3MPUA 4QTTB 1U8CB 3X2FA 3A35A 4J4HA 3WQQA 1UFKA 2FDRA 3WGOA 4CM7A 3MHTA 1L4KA 2NSJA 4L6IA 1N05A 3U0BA 2REQA 3UW3A 5LBUA 2WG1A 2DE0X 2OBRA 1W6RA 2R6DA 2QX9A 3LGAA 4I7EA 2WLTA 4RF4A 2NLOA 3HFRA 4YRZA 1U2GC 5JQGF 3PPXA 4IKOA 2WT9A 2OP0A 2JGEA 1LI4A 4KR9A 3HNOA 4G5XA 4K6FA 1S1MA 4PZAA 5DW0A 4YYEA 1S6YA 2AG8A 4IMIB 4IFIA 1QZXA 3HY4A 1VPTA 4Q3EA 1I8TA 1OFUA 1Y3BE 2QV7A 5NULA 2G0NA 3D02A 4GR4A 3V4VB 1AN0A 3DKKA 3IUYA 3SWWA 2HJHA 1W9MA 1XLUA 1LDBA 1RQ7A 5DH9A 1TUBB 5HOEA 2I03A 4PS0A 1T2AA 4L4YA 4QATA 4X7PA 2JARA 4XLCA 3VNUA 1Z4MA 1I1QB 1UWKA 1X7YA 4NEHB 1ZA1A 2P4QA 1L7DA 1VDZA 1I0LA 3M6AA 4QRDA 1KQPA 4RFLA 3H9EO 1PO7A 2AN3A 1XD2A 4RHEA 3E23A 2OENG 2JFVA 1UT5A 1VJ1A 4LDQA 2JFNA 4CLOB 1N0HA 2I3ZA 3LYAA 3KQKA 5IVHA 2J30A 4KPGA 4BQSA 3LTNC 4O0MA 3OQOA 1EDBA 2OZLB 1VQ6B 1J0BA 1RQRA 1NZDA 3I01M 2ZIAA 3IPCA 3PL1A 4GH5A 4PAWA 1Y42X 2PFGA 1A27A 1VHQA 3K6RA 1X86B 2JJMA 4QDUA 4RVFA 2UXBB 4P2BA 4CYMA 2AIRA 1EVLA 2SBTA 3A1TA 5M5BA 4GQBA 3CZPA 4N3GA 3D59A 5HBRA 3W7AA 5HUQA 1YOVA 3D6NB 3CF4G 4LN1A 2VIIA 5KTPA 2FN9A 1UOPA 3RYFB 1U3TA 1OV4A 2Z43A 3H84A 1WXXA 4NJEB 5E9AA 3TSCA 1NNEA 3O03A 1GIAA 2O1EA 4N7RA 4B3MB 2I4IA 3IE0A 4WIAA 5B58T 4WNAB 5C5IA 5DPMA 1GZ6A 1HVXA 2YX1A 3KZ1E 4WW0A 1CS0A 3ZWYA 1IVSA 2C2XA 1WKBA 4MDYA 4PLYA 3H4MA 4U3JB 2IT1A 4KXNA 2XAAA 4A8JB 2YNMD 1H4QA 1VZ2A 4PAGA 4GZ5A 1LPMA 1M2OA 3E8SA 2OM6A 3LWBA 4FFVA 4I5IA 4ZOAA 2VTKA 2JLAA 4L5AA 5BUSA 3VTAA 4XARA 3BXGA 2OV1A 5D00A 2CNWD 3SSAA 2I65A 2P7HA 1HGXA 4KXYA 3R2JA 1CUZA 3A6DA 1YS7A 2EFEB 2YXDA 2VF7A 3HA5A 3LWDA 4FE4A 4N5NA 4TWRA 5KQPA 4MVWA 1PG2A 2YC2C 4DOMA 4HIZA 5J3OA 3OQ1A 1I1NA 4R1TA 2Y76A 3ETHA 4RPJA 5HF8A 3ZDQA 1Z2OX 5JWOA 3U60B 4YH1A 3ITNA 1S5PA 4KVAA 2Z5VA 5LYYA 1KEKA 3ESCA 4Z99A 3BEOA 1QFXA 4X6UA 3JWGA 3SF8A 1FFYA 1CUBA 2HDHA 4QYXA 3JQGB 1IUOA 3ROXA 3GMIA 2HSDA 3IO3A 4C4RA 4UCWA 2IXTA 4DNOA 1U02A 4EATA 4G9EA 3GG2A 2QG4A 1T5TA 3RJ9A 4YUAA 4YAOA 3EVTA 1ODFA 4PYLA 4B8ZA 4CRWB 4I1YA 3CCQB 1D8AA 1ZGBA 1B2RA 1QB8A 1U80A 1ZP6A 4L8WB 1XRJA 4FNAA 5BV1A 3EY4A 1VIAA 3NORA 5M04A 1T4CB 1FFSA 1KPHA 4MQLA 2OUKA 1ZZEA 4G8JA 5F9HA 3QKRB 1EGVB 4NZMA 4QYSA 3ZU4A 4ZMRA 5FWXB 5LLDA 5EXEA 3ROQA 3C3CA 1XQBA 3RKUA 3T5BA 2C4NA 1NRJB 4RF5A 5HCNA 4LOHA 3TSWA 3VYUB 1T2EA 3OD1A 1MX1A 4Z9BA 3WOVA 3RM3A 4AM8A 4FM9A 3DWFA 4QTUB 2ATIA 3QFFA 4GSLA 5GONF 2P0EA 5EFOA 1GQ2A 1JIUA 1EVIA 4Z4WA 2ZS7A 3IAEA 3T95A 3T52A 2BFDB 1PL6A 4L78A 2R84A 3UAYA 1UT8A 3M4XA 1KEPA 2YFHA 1CNFA 3KUUA 2HXYA 4R8LA 4A5OA 4F4FA 3G0HA 1CXZA 2IYAA 4YJGB 5LMZA 4KSBA 1X2EA 1RZUA 3R0IA 3O1HB 5BUQA 4WKGA 4CG0A 2WWHA 3CF2A 3VPHA 5GV7A 3GFTA 1BOFA 1HDRA 2G67A 3GUCA 1ZAKA 3N7UA 4REOA 4NV0A 2ZZQA 1S8NA 1N6PA 3IP3A 4GXRA 1HT1E 1O87A 2PTHA 3GBVA 3OQIB 3OOYA 2H1VA 1Q21A 2WM9B 3KTAA 4TM7A 2ZBUA 4D6PA 3HVRA 1MNAA 1HL7A 2UVPB 1UXOA 4MYUA 3AKDA 4LKOA 3CJRA 1QS0B 2QA4B 4UQOA 5CVTA 1V11A 3CXRA 1XROA 2IIPA 3ZWKA 4ROTA 3EIOA 2CWWA 3SQDA 5HA5A 5E6TA 1JDNA 1FUIA 4J0FA 3GVKA 1GR0A 3AQ4A 4NECA 3K6SB 4LFBB 1MRNA 1ZDMA 2B30A 3V1UA 1GYQA 3RGWS 2C4KA 3E82A 2FMTA 1J2YA 2RB4A 1NW5A 2FPMA 3IELA 3DBLA 2EBFX 4W8OA 4BYMA 1VBFA 3IPLA 4C4TA 4L8JA 2PZFA 3BIWA 1GSIA 2Z95A 2ZDHA 1ND5A 1OB5A 4A0SA 2P9HA 4AXBA 4TZ6A 1ST3A 4P53A 3L4KA 3KHUA 1CY4A 2MSCB 4M83A 5JNSA 2UYYA 4H18A 4B79A 4Q1DA 2ZZMA 5KHLB 2KMLA 2ZI3A 1U9IA 1NBHA 3B12A 4IHJB 5A71A 4A0GA 5C80A 3VMMA 1JMYA 2HGSA 3RVOA 1T25A 2VTVA 4Y8VA 1ISHA 2VK8A 1CZRA 3IAAA 1PYOA 1HY3A 1Q7TA 2KLBA 3IBGA 4MW6A 4RZXA 3EPKA 2E48A 3G6WA 1DAKA 1SU7A 1FYDA 5CAEB 1J0CA 1DNPA 2FW9A 3UK7A 1C1XA 2NU8A 1IY9A 2Z9DA 2XDQB 2DPGA 3DMNA 2B6NA 4JYPA 4OB6A 3EQ6A 3F67A 5HDBB 3G9XA 5FQOA 3UUEA 3T3EA 4Y9UA 4BBZA 4CUZA 1NVGA 3T9CA 2NU6A 4NEGA 2MYUA 5CA0F 2CYAA 1GEGA 2HQOA 2QSYA 1RDFA 3OY2A 4OJKA 1SM4A 3OZRA 3CCLB 1EFUA 2XKBA 1JKFA 1N5DA 3IIKA 4LE1A 5KNCA 4TV9F 3FYUC 3S2GA 4LBWA 2AI3A 3BDVA 3IHWA 3BG5A 1NA5A 3GQVA 3HNRA 1FNMA 2OZPA 3RBAA 3SX0A 3QG5A 4B31A 5HPYB 1I3OA 3NIGB 8MHTA 3EGCA 1L9XA 1O94D 1XGKA 1PGNA 2IZ7A 2O07A 4QO8A 5JMOA 3STHA 4DLUA 1ETUA 4CMEC 1UFVA 4O0LA 3SHFA 3TFWA 1MHTA 1HG0A 3UJAA 5ALEA 5P21A 5JD4A 1ZICA 1JP7A 4D26A 5KHAA 1XZ8A 3DXFA 4UMFA 2RGGA 3N8GA 2BV3A 1KFEB 2HWKA 4JC8A 1GAEO 4DLWA 2G6BA 3KDAA 4D44A 1WBDA 2VUTA 4LGYA 3QW4B 4EQZA 4HI0E 4DBLC 3DZCA 1XVAA 1JTVA 2X0JA 4DHEA 4E09A 2NXJA 4NARA 1X39A 1YNSA 2P9FA 3HUDA 1V25A 2NVBA 4W9RA 1WB9A 2EYQA 2AC2A 2Q27A 1RSZA 3TLBA 2HLNA 2I67A 4N8EA 5EE9A 3OI7A 2C8LA 4PINA 3SR3A 4I1SA 4F4UA 2D5AA 2YN2A 2O8BB 3HMKA 1CCWA 4QZVA 2O0MA 1OU0A 3OPNA 1P2BA 1YX2A 2JBAB 3PNBA 3L82B 3Q3GE 4JL5A 1TUEA 1N7HA 3WMFA 4DXAA 5JPCA 5DHQA 3JATA 3GLVA 1XTJA 4HDMA 4MI6A 3N8DA 1ZRMA 5AK3A 2TRSB 2AJ8A 4UXJA 5C1DA 1RAHA 3K9BA 3MT7A 2QZPA 5B36A 2E1RA 2O8DA 1EWKA 4BKQA 1XDUA 3I58A 5GGXA 1RTKA 3A4MA 4QELA 3C74A 4F4DA 4ZDKA 2M6SA 4MGEA 1DB3A 4X65B 3T1QA 2CNOA 4JLJA 2R11A 3BKWA 3R76A 3O92A 3DMTC 4FHFA 4D9JA 4LX0A 1MX5A 3CRVA 4DDHA 1UBUS 2YZ2A 3VGJA 1OWMA 2H06A 2WSIA 1N5KA 3LI2A 3G7NA 4NZOA 5EUQB 1F8FA 1ZM3A 3FY4A 1IAVA 4LHZA 2A78A 1JIIA 4PICA 5C5CA 4TXLA 2FMFA 3CZ5A 4Q18A 4EABA 1FW8A 1YSCA 2OCAA 2OV8A 4IY1A 3RRMA 3G8BA 3IQIX 3ZE1B 1ZW1A 2J3HA 3TPCA 1ONBA 3OQJA 1FIUA 4GM1A 3OQVA 2ILTA 2HSJA 3ND8A 3QELA 3GRFA 4YLEA 1E4VA 2D1FA 3DP7A 4UNNA 3ZVKA 3SKXA 1CJTC 4R9UC 5JTTA 1T2UA 1P7VA 3QF4B 3G2NA 2EGUA 3M6WA 4GC5A 1NW4A 1QVZA 1CJUC 2GPTA 5IX8A 3KL2A 2PS0A 4GYYA 2A9JA 1BKDR 1JHMA 4X20A 4GMDA 2F00A 1N2CE 2OEPA 4L07A 4UNQA 4CM6A 1TUIA 1QSGA 1S1CA 1SKYE 1MW9X 3GNQA 4JA2A 4X9XA 3JZIA 3CGWA 4E22A 4YP0A 3CX6A 3FWNA 3A6LA 4X85A 2IOHA 3R40A 4KZPA 3EGDB 5NLLA 4O6VA 5BN3B 2HREA 5L7WA 3D0KA 3GN2A 3JQAD 2JH8A 4KV7A 1GL3A 5EFZA 4G8BA 5G0WA 5U4QA 3DUFB 2WQZA 1PEDA 1EJBA 1U7PA 1M0SA 3GLUA 5CDUA 2RGNA 5B6IA 4HQNA 1A7JA 4PQEA 2YDYA 3CPWB 1CHNA 4MIYA 3Q0EA 1UBGA 2BGTA 3IR5A 1USVA 1VKJA 1LH0A 1M2NA 4L2IB 1NN1A 2QAGA 4OMDA 4JQCA 5AIBA 4YFYA 3WGMA 2Q3JA 3OC0A 1ABBA 1Q1AA 3EUEA 3JVUA 3HYSA 4DUYB 7MHTA 2M5SA 1C50A 1QV9A 1T8TA 1QE3A 2D7DA 5DGTA 3A7EA 3SVZA 5GINE 1U8ZA 3LT4A 1YU6A 1XJ0A 2OT3B 3GEGA 4R31A 2X7JA 2EJBA 2APJA 1FZQA 5K8UA 1KR5A 2NTJA 3U3ZA 1U1CA 2HLHA 5ARCA 4RTKA 1Y89A 4TSKA 1NB0A 1F0PA 1N6OA 4U6SA 4AUKA 3S8YA 2A5YB 2JJ2A 2XW6A 3V1MA 2F59A 1FNBA 5J4LA 1Z2AA 4ZOEA 5FBWB 2NTNA 1J9GA 5L95A 1W6UA 1QGAA 4FOOA 1E7QA 1VMIA 3JAKB 2O3SA 3H2GA 2VRCA 5DNCA 2XZDA 3AUAA 3EXHA 3GJYA 4WLVA 2UUOA 4X8MA 3ZJ4A 2HMWA 1Y5NA 5KYNA 3S5JA 5IAGA 1DPFA 4KH1A 3U17A 3CCJB 1R7RA 3OT4A 1XZDA 2FZCA 1S4MA 4O4LB 4OP7A 1NT2A 4U6QA 4DK0A 4BS9A 4A0RA 3HY6A 1G6Q1 4PFQA 2Y93A 2XCRB 3AEUA 2GMWA 1R8XA 1N6NA 5DN6D 1N2GA 3U3RA 1QGYA 3V48A 4RJLA 4V38A 2R8PA 3IDQA 4YLYA 1V7PC 2QAGB 5F7ZA 1ZEJA 3DS8A 1KYYA 5AP9A 5CNIA 2JGRA 4Q1CA 5CPBA 3HKBB 4HQOA 4TTAA 5HZBA 4WJLA 1UAYA 2DETA 2QROA 3ZHOA 4KYIB 2OAQ1 2W7TA 3EVFA 4HAZA 2FN4A 3QKSA 2WWRA 3K7EA 4GZMA 4CDMA 4OAOA 2ODPA 5IC5A 4DIMA 3GRUA 3ER6A 3EFBA 3SZRA 3E2PA 2M6KA 3LE8A 1H0SA 2A0UA 2H4JA 2Q3DA 3V8EA 3VR1A 1T1RA 2GCPA 3PA8A 4ADSG 2ROQA 3DP9A 2SKDA 3I9V1 4DMCA 1CYEA 1ZR2A 3IQGX 2HRCA 1TMYA 2HK8A 2JK0A 2ZIGA 3H2IA 3SLRA 2WAAA 3FDFA 3QVXA 4DLSA 4K1LA 1T0BA 4LOLA 4LBYA 3HKBA 4M7RA 1B8OA 4I36A 2PSJA 4DR1B 3G8YA 5TQ0A 1P19A 3KYDB 4OLJA 3W6OA 2NOAA 4W82A 3WLHA 3NTXA 3MCTA 2V7BA 3T3PB 1TMKA 1KJYA 1NVEA 4MV6A 1GO2A 4WZ6A 2P9JA 5CFZA 2UVPA 1A1VA 4US1R 3U49A 4YQFA 1J2EA 4V39A 3NHPA 4JLWA 4WDQA 1V8PA 5DRYA 1W4CA 2CXRA 3RO7A 5K8CA 3L7CA 1B00A 2IHTA 3TLEA 1YJNB 2IHJA 4QXOA 4FCTA 5DNUA 1XQ6A 4RDIA 2HF7A 5ANRB 1JW9B 4M8IA 2QE6A 4RXUA 3DLBA 5EQDA 3Q41A 3MJ4A 1G98A 1HC7A 2P2ZA 3HN6A 1ZM7A 3MINA 1J9ZA 5TLSA 4W6QA 1T9GR 1KHTA 2A4MA 3FCSB 3SCZA 3FOZA 2ZAIA 2D2EA 2P3QA 3FR8A 1UZUA 5IFLA 4F1KA 2PLFA 5JNVA 4CKCB 3K0FA 1QCCA 2F7SA 2GCOA 5F4BA 2WUFA 1YDMA 1EE2A 2I1WA 3DTYA 3K9NA 3UC5A 9LDTA 4D4MA 3TL2A 2FW0A 4GRAA 3CN9A 4OOEA 3FCUB 3DBRA 1S8OA 3ACDA 4FK8A 4DXDA 1L4YA 2IH5A 2PL9A 4KYTA 1UK6A 2HEIA 4OI4A 4RE6A 5IMSA 1M1YA 3Q0TA 3FOCA 1VKZA 4MGZR 3IEMA 1SR8A 4F8EA 2C8VA 1W581 1GSOA 1UPUA 1Y8RA 5ED0A 1UQRA 4DV1B 1F9AA 2BJWA 4YP1A 3AVXA 3PUYA 4MUEA 4TM8A 3S0JA 1TEVA 1T3SA 2J1LA 4CM9D 2GJ9A 3CWZA 4I46A 4PANA 4U7JA 5CMLA 5TPWB 1C8KA 2PKQP 4ETIA 4QFDA 2P62A 5B5SA 2FSVA 1GSAA 1H2ZA 3DEYX 4JS0A 1SQ0A 1C3EA 4X62B 2C54A 1ZS9A 4PZEA 5EE3A 1J00A 1WNTA 3F1KA 3UQZA 1PJCA 1S3SA 4RMIA 5BSFA 1YC2A 1DAPA 1DIAA 3KR1A 4OGWA 3DE4X 3QEKA 4RIEA 3DF9A 5IKEA 3WWDA 2B61A 1JLRA 1TMOA 3MLEA 3UIEA 2AXPA 3V6MA 9GPBA 4C88A 1A4IA 3EFHA 1ZXBA 4U39A 1YZYA 2OXIA 4KREA 3NWJA 1XTVA 2QQEA 3BCSA 4EITA 1L4MA 5EG5A 3VPBA 1UP4A 3OCCA 5BSYA 2C9OA 2GZSA 1H4VB 3OOWA 3VH4A 5KW9A 5DTIA 3B1JA 3CNLA 4KGZA 3IP7A 1DUSA 5JS6A 5KC8A 3Q10A 1K63A 1UBFA 1WTCA 4E88A 4YRBA 2AQ8A 1ZG3A 1KI6A 4BO2A 1S7GA 4G6ZA 3CISA 1KP3A 1X7GA 2Q45A 2RGEA 2QT0A 3BWDD 4D6XA 3QSGA 1EXWA 2ZVJA 4DJFC 1R6DA 2RDMA 3B6ZA 4YCSA 2XLCA 1B3BA 4ASUD 2PGNA 4GL2A 3E3MA 4W8HA 1L5RA 3A6ZA 1PG0A 5ALFA 4EF5A 3PX3A 1WE2A 3NV7A 4G2NA 5AVOA 2DHDA 5T7BA 3JTMA 3LUGA 1NFFA 5K0JA 2I6QA 2BMDA 5FNVA 2DM6A 3MUFA 4PLPA 1EFAA 3I73A 13PKA 2VT3A 4GI7A 1G8MA 2HA5A 3KXPA 1KF0A 5CYFA 3MWKA 1TO1E 2BGMA 2NG1A 4WASA 4IVRA 4BFTA 2P9GA 4EI2A 1SVIA 3P9PA 3BIOA 4I50F 3OECA 4YMLA 4FUQA 1HZZC 3INTA 1MT0A 2W37A 2YS6A 4B7CA 2ZXFA 3RHFA 3RGGA 3ULKA 5CM2Z 2LE0A 1C41A 1PZMA 1U98A 3RYTC 2GJAA 1D0IA 1VJCA 1ZSNA 4QL3A 1ONNA 4U7DA 2EWVA 4WXMA 3AG5A 1DMRA 2VVTA 4HMOA 3ICWA 3PGXA 4I5DA 5JAZA 2V55B 4I4IA 3T54A 4MR9A 3AZOA 2DWOA 1LWOA 4JT2A 3W5JA 4M36A 1MEOA 3WL6A 5JUWA 1F14A 4CMHA 1X77A 5KNBH 3ITKA 5LJLA 1RBYA 4LRYA 1T5IA 5IYPA 1KI4A 5TX7A 4EYOA 4AQYB 2WF5A 3K92A 2G9RA 2QBYA 4F91B 1P45A 2D8MA 1V41E 3FSRA 3ZZUA 2FVYA 4H35A 1OJ7A 2ERCA 2VF5X 3A1FA 4UZSA 3RT7A 3VSEA 3JU4A 2FPGA 2Q8NA 2WFLA 3KKEA 5HNKA 2C9MA 4O4HF 2I6FA 3IAHA 3IEKA 2FWJA 5CNKA 1UAGA 4R8SA 1GPBA 4QUHA 1G21A 4ZYLA 2VDOB 5FI1B 3FBTA 1RR6A 1E2QA 2XE8A 3HB0A 5IANA 2IY9A 3AJAA 3UICA 3B89A 3GP5A 1I0ZA 3MJCA 2AZXA 1MABB 1Y4DE 2EZ9A 2V3VA 4ZAWA 1R4AA 1WLSA 3AIOA 3WLQA 1Z36A 2ACVA 3VOTA 1RE1A 1B8VA 2VKTA 4LSMA 5JECA 5J5CA 2I4LA 5AW4A 2COEA 4YRQA 2O54A 2VNIA 1IM8A 3OM1A 3WIVA 4JFRA 1PG5A 1Q1ZA 2P35A 2V4ZA 2ZWIA 1HF3A 1BQ3A 1WTHD 1T9ZA 5DMXA 1NUUA 2RIPA 3UW1A 2HPAA 3PRYA 2J5XA 3ED5A 5KINB 2VAVA 1A5BB 2H1FA 3ZI0A 3BIXA 3BN3A 2HNAA 3BJZA 4N40A 5LDHA 1A8PA 3RQSA 3CNHA 3RU2A 3VC7A 3L0YA 3TX6A 1V5FA 3EBOA 4FNGA 4OFWA 2ZTSA 5ILQA 1R5BA 1QIJA 3CURA 5KSZA 3BBPA 2FWIA 2XMZA 4S1PA 2GZ3A 1DBVO 5FA8A 4JOBA 1LVUA 1JLHA 1DWQA 1F2TA 3PKZA 4B85A 1K73D 2FLWA 3QVVA 4F71A 4P80A 4J0IA 3QELB 2YWGA 1PJ4A 1ZJZA 4DYDA 1VGRA 1QV7A 1SHUX 4UBOA 3F2VA 4ACBA 3S55A 4NPHA 5CBPA 4B32A 1VIVA 1KL7A 3JQAB 4U1RA 4WI1A 1K97A 1YI2B 1I2MA 2G36A 2ZAOA 4IQ0A 4NZNA 4LRUA 5GY7A 4L7QA 3N28A 3V7YA 4M76B 4P3OA 4NLLA 2LXNA 5LOVA 3EEFA 5HSGA 5KO2A 1XMOB 1XCPA 3BUSA 2QJTA 3MMNA 4Q4DA 4HAWA 4ZHQA 2DPMA 4BFXA 4ZO4A 2FAXA 5ED4A 3F7TA 3K5WA 3L8EA 1CVLA 2RAUA 4LAFA 4YJKA 1WHSA 1N5IA 2RGXA 1NPYA 4HLUA 4UM7A 2GOYA 2X53S 1IIRA 4QUKA 4YA6A 1V96A 2GJPA 2F8MA 4PFSA 1VA5A 2PCLA 3IAM1 1N8TA 3R0QA 3DL7A 4BE7B 1VHDA 4M53A 3BS4A 3LC1O 3O4VA 4BO4A 3NWPA 4WBSA 4KR3A 4HT3B 5FP0A 3P8ZA 1RM4A 3TJMA 5LZ8A 1Z7GA 2A5JA 4C4AA 1DS6A 3NCTA 5B30A 4MTCA 4MULA 5CDTA 1UP7A 4C4ZA 1P4JA 2ACKA 3M5DA 5CTAA 5FX2A 3DEZA 3JXEA 3K1TA 5IVIA 2BFNA 4MVJA 1YB6A 3QFCA 1NRWA 1PD0A 2PGJA 1S4QA 4EYGA 1E18A 1AB6A 1QHSA 4QOIA 1YIDA 1AXGA 1GKKA 1CBUA 4E2YA 4E07A 3C4JA 3LUHA 1BFKA 1QGUA 3ZW8A 5ECWA 2CSXA 2BEKA 4KXXA 2PBZA 4Q21A 2PBLA 1I4OA 2MJLA 2VDKB 1VC2A 2GWHA 1FCJA 3DE3X 3G13A 3QVJA 4OA5A 5EKSA 2AI1A 2YWJA 1Q7GA 5JYDA 2GN6A 2VP3A 4CMJA 2VJAA 2IYWA 4AROA 3LQ2A 1DCKA 1G21B 4CM3A 3TSYA 3FI9A 5HYVA 4LNHA 1NJFA 1U2QA 3KG2A 3TMKA 3I64A 4P5DA 5EE0A 2JI7A 4AZ0A 2XA9A 2IY7A 4JLNA 4C87A 5J4KA 4U00A 1WXEA 3E1SA 4PVCA 4Z3KA 3SQMA 1VBMA 2I2DA 4R54A 1EDDA 1ZH0A 4XJSA 2IEZA 1Z5GA 4AIRA 5AVQA 1W76A 2C83A 3SHWA 2WSBA 4PG6A 2OTCA 5SV2A 3PJEA 1RI1A 2NU6B 3E3LA 3B60A 2I1QA 4OM8A 3ZKWB 4EBFA 4ZI7F 4LX8A 3BL5A 3RSCA 4N8SA 2BSAA 1AGPA 1XMJA 2H00A 2FP4A 1XG5A 2H4FA 3BGOS 3OIUA 4MUFA 4MWBA 5FWDA 1X38A 2J48A 2SKCA 3HFJA 3MQ2A 3PWSA 2JGNA 4WFJA 3EGOA 1L5LA 4GI1A 1SBTA 3R8CA 4BMZA 3KP1A 1QQ7A 4Z0HO 4W7HA 3AFGA 3BD6A 2X8JA 1BMFA 1XCOA 5K0GA 3I12A 4IPTA 3VU0A 4JEUA 4ZEWA 4I4TA 3COVA 2ZXUA 1ZVMA 2QDKA 2AV6A 3DM5A 3JRWA 4HDQB 4HYEA 1PI3A 2CLHB 4NH4A 5EP2A 2ZYGA 4N12A 1U7DA 5PNTA 1MOQA 5WRFA 4EHFA 5HIKA 5JDIA 3MSXA 4B0PA 4KRFA 1E9VA 1ZONA 4RVCA 4D45A 3KQNA 1G20B 1HSOA 4EA6A 3M2TA 3CCSB 1DU4A 2PWZA 2Y0PA 3MJHA 3OO1A 2VUIB 4JB0A 1W34A 1J9EA 3I23A 4IS2A 3RH0A 4QOFA 5BSXA 4QC2A 4OXKA 4EG8A 2UZ4A 4JLVA 4B6JA 1W5TA 2I6XA 3DEKA 1NU6A 2P30A 3OIYA 4RPHA 5E6SB 1QX3A 2WSMA 4Z4HA 1IHUA 3U7RA 4OJQA 4F4CA 3A2MA 1U0GA 5LDGA 1N8SA 5KAPA 1I32A 5T4FA 5CPFA 3BDIA 4B1FA 2PJDA 5H59A 2Q50A 1DE0A 2HXSA 5HXAA 1A8HA 3AIKA 4A6PA 1BDHA 1KEUA 1XTPA 3CUTA 5F7JA 3C1OA 2PE3A 5FTNA 2GVZC 1U9IC 3RFXA 3TTTA 1EQAA 3KD2A 1J8MF 4ROXA 2IP1A 1CUXA 3KJZA