4M53A

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in complex with gdpcp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
403
structure length
403
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 104
structure length 403
sequence length 403
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m53A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m53A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m53A01
1GR1A 3VNUA 1OXVA 4YMTA 2BMJA 2VHJA 4II7A 5FTNA 2KSQA 3J81k 2Z4SA 1G8HA 2ZAMA 5CIWA 1N0VC 2VYFA 3LAWA 1I4LD 4LJ5A 5EE3A 2XNDD 4Q7LA 1M2OB 3CXCB 3QXHA 2F43A 2ZTSA 3CKLA 2JDID 2P3SA 5CM9C 2VLIA 4JLVA 1K5GA 2ODBA 2J87A 3BB1A 3ZDQA 2BSAA 3KQNA 4HYYA 5F9HA 2WMOB 1P9WA 1S1MA 2BC9A 1T3SA 4JLNA 4WIAA 5KTYA 2ZUCA 2WAXA 2Z5FA 5E3HA 4A4DA 3THYA 4Y9RA 2B92A 1Z29A 2QNRA 4RZ3A 3MFYA 2ZR9A 3NC1C 1RJ9B 2IW3A 4PQFA 2O8CB 1J9ZA 3ZC3A 1FMJA 2RGDA 4O2RA 1AIPA 1SXJC 2D7CA 3RWOA 1YZQA 4PC6A 3GEIA 2ZUDA 4NP6A 4N3GA 1G21E 5DI3B 2IC5A 2B21A 3UATA 2G77B 4BFZA 4LPSA 1PV4A 3I4LA 4E09A 2C5LA 5M04A 4DT1A 3EZ6A 2JLZA 4DSTA 1E2FA 1VECA 1OGJA 4WA7A 1FZQA 5ELXA 2QAGC 1QUEA 2GXQA 2FFQA 1WE2A 1E9BA 2OAP1 3GJ3A 1ESMA 2BCGY 3PIRA 2W2VA 5EP2A 1IXSB 2C9YA 4PHGA 1TQ2A 2BV3A 1ZD8A 3KX2A 2QRZA 3OIWA 4MKIA 3NH9A 4IEIA 4EFLA 4YAWA 1F2UB 2ODEA 2PLFA 2QROA 2F7SA 2JIZD 1GKIA 1K6MA 2PJRA 1DEKA 3TAHA 4OHVA 2JASA 1MO4A 3CCEB 2W0SA 2CDNA 4POAA 2DBYA 2FWRA 2ZITA 3THXB 4D4LA 4MYTA 1BIFA 1E1QD 5KDDA 1R10A 2LKCA 3EIEA 1XTQA 1N6LA 5AR1A 3ZBTA 1FP7A 2RGNC 1HE1C 3T12A 4N1AA 4HLDA 4RVCA 4HLCA 2ZJ8A 2WWIA 2PEZA 2ZSFA 2HT6A 1E9CA 2JEOA 4JKYA 1MO3A 1QF9A 1ZM7A 4UJ5A 5J5CA 3G82C 1E4YA 3IO5A 3CNNA 1Z22A 5BXQC 3CC2B 4DC9A 4XWAA 2EQBA 3AVYA 4DCVA 1GILA 1U94A 2BEJA 2CEAA 4CW7A 4TYQA 3OEED 2W6JA 3TQCA 4CIDA 2XSZD 4MQBA 1RFLA 5EXSA 1FDRA 3AVUA 2ORIA 3Q3JB 2FGKA 1XEWX 3HR8A 2ZI4A 3IHLA 2WJVA 5FUYA 2G9NA 5CITA 2CCJA 1CRQA 1NKTA 5LDDC 3EPHA 4KYIB 4XSGA 4C7OB 2JJ2D 4LZZA 3SZRA 2QL6A 1Q20A 2YC4C 2HDNB 1UKVY 1F48A 4ASUA 2H8KA 4D81A 3CC7B 4QBIA 1U0LA 4PSVA 1XB2A 4PPQA 2PLRA 5A4JA 1ZAKA 2ZIAA 1KMQA 3P20A 4LUCA 3OE7A 5CJ2A 1TPZA 3AEZA 4G3XA 4R7ZA 1UF9A 1D9XA 3BOSA 3RSOA 4YQFA 1RYHA 4D4KA 4MGIR 3DL0A 1G8PA 3PQCA 4Q4AA 1CULC 2JLRA 2RHDA 2J0UB 3QQ5A 2FZ4A 3KL4A 3U6KA 1X8KA 4TL7A 3OZUA 5HE8A 1JEEA 3RS4A 2O8BA 5KYKA 2Q6TA 1YHQB 1CJVC 4GDFA 2C9OA 1N0WA 2AN9A 3Q7PA 4EPXA 3B9QA 3C5CA 1A82A 2IYVA 1IXRC 1CXZA 1GOTA 3NTUA 2VYQA 3OIVA 2GJKA 1S2MA 1WF3A 1Q21A 2ASEA 4TMKA 5E7IA 3UG6A 4TYNA 2QPAA 4A6XA 2OFWA 2IT1A 2GEDA 1M34E 4LDJA 5H5JA 4URXR 2H7VA 2O8DB 1GTVA 1OHHA 1TVCA 4FD2A 1S3GA 3S1AB 2CL7X 3SHFA 3WBJA 4Q18A 1MO6A 3I8SA 4JZKA 4TQAA 3ZJYA 5IHPA 2FFHA 1KOFA 2XTNA 2CNDA 3GCGA 1EX7A 2ZE6A 2WM9B 4F4IA 1TL7C 1XFAA 5BYKA 2IS1A 5FTJA 3R7WA 1SVWA 4X8HA 3ZYCA 2LWIA 3QFCA 1FNDA 1LB1B 1IN4A 2EVWX 4FWIB 5DI9A 4PZLA 2F43B 2ONKA 2ZJYA 3QFTA 5LD2C 1K73D 4L16A 2Q3MA 4AIIA 2UZ3A 2X2FA 1BX0A 2B7CA 2ATXA 5G3ZA 1QGZA 3KJEA 3W3AA 1WXQA 2CE2X 2FOLA 1JEDA 1UPTA 1N6PA 2XNDA 2ZS7A 3I3SR 2JDIA 3QVUA 2ORVA 4LYFA 4RFSA 1XE1A 1YZKA 1M7HA 2FFBA 2YYZA 3THYB 1GITA 3AKYA 2Q9AA 4K8OA 3EWSA 1UBEA 1Q82D 4YONB 3G71B 4IOJA 3W5IA 1WBDA 4A6PA 1ZM3A 2ZVQX 2A5YB 1NG9A 1TX4B 3QY0A 1AS0A 2CVHA 2KI5A 1NN3A 1I2DA 1M8PA 1W4RA 4J0QA 3WMGA 2JLYA 1CEEA 2VP2A 3DHWC 3I61A 3PCRB 1ZM9A 1T91A 4OJKA 2IF2A 1VCNA 2RCNA 2BM0A 1F60A 2GEUA 1VYUA 4JBXA 4DT1B 3VR5A 4PSKA 2QM8A 3O8BA 2KB0A 4U02A 4LV8B 4PSAA 3U4QA 2Z43A 4JS0A 4WQMA 1AQUA 4JBWA 2VTKA 1NY6A 1FNBA 4AURA 2BWJA 3X1WA 3REFA 3RSLA 4C30A 4MRSA 3AVXA 2E9SA 2EFCB 3RRZA 1SHKA 3X1XA 1LS6A 1RPZA 2WJIA 3AKDA 4PO1A 1E63A 5F9FA 2GJ9A 4MRRA 2EFGA 2FMXA 3LLMA 1GNPA 2GILA 4YMWA 5F98A 5FBWB 2HMAA 1T6NA 3CC4B 2EU8A 2WKRA 4TYWA 4MUAA 1W36D 2K5UA 1J70A 4BRUA 3U61B 1G5PA 4M1YA 1GUAA 3VX4A 1U99A 1ZMXA 3HP1A 4QXAA 3TKLA 4PZZA 4DUGD 2NPFA 1TEVA 3BK7A 4TN1A 1E62A 4JLJA 4EQ6A 2FX3A 2JATA 1P2VA 3KXLA 1EK0A 4V0LA 1G17A 1QG4A 1ZIPA 2OG2A 2IYRA 2VBCA 3FDIA 3X1ZA 5J4VA 2JIZA 3GLFA 3WRYC 1NNEA 1VCMA 1I2MA 5DH9A 3RVBA 5JLJA 1M7GA 2OBLA 1UDWA 1J7KA 1IJEA 1JXOA 1YRBA 4DXAA 4KVGA 1QZXA 1E1QA 3KQKA 1KK2A 1NIPA 1TADA 4MGKR 1AZTA 1P62B 3BH7A 4GZMA 4ZCLA 1LS1A 1K5DA 1WMSA 2FNAA 3VR3A 3ADBA 1VHTA 4IOKA 3I5YA 1E1RD 1II9A 1KDRA 5EP1A 4IDOA 5EXTA 2AK2A 2BPOA 2QEXB 2OCAA 1XJCA 4E5UA 3RANA 3QKTA 4D82A 3FOZA 1TNDA 3B9PA 5FUWA 3E5HA 3MWKA 4CRWB 4IW3B 2VRWA 4BWYA 3OEEA 2ZRPA 2C78A 1E96A 2XSZA 3KJGA 5FA6A 2BMFA 4RFVA 1FNMA 2QDXA 1KDOA 3B7GA 1T0HB 2J3EA 3LXXA 5EE1A 2JJ2A 3A36A 4JLDA 1QG2A 5CDFA 2WV9A 4CEJA 3IIJA 3JZMA 3DKVA 2Q3FA 2FE4A 1E32A 4ZO4A 1HYQA 4JYBA 1VQLB 4NCIA 5FOSA 3RS2A 3MJHA 1VG8A 4Q4AB 3QEOA 4BZPA 1MH1A 1W44A 5JFGA 2HLDD 3RAPR 3U3JA 4B32A 3PR1A 4NYIQ 2ZRIA 3H2YA 1JAHA 2F1JA 1XPRA 2O8BB 1M90D 1MR3F 1VQMB 1QDEA 1KJZA 5H68A 2I1QA 1YJ9B 1GRQA 4YLGA 4PFSA 1S72B 3GPLA 1L4UA 3K0FA 2IYZA 3ZQJA 3UANA 3V9PA 3DVLA 4AYXA 4M0LA 2RGAA 3VKWA 3SJAA 3BH6A 2XNCA 1Z2CA 4Y0VA 5DGXA 3SEAA 3JZAA 3FHOA 3QSYA 4NTZA 2AD5A 5JJKA 4O0MA 4TTQA 2FZLA 3SC3A 1BKDR 1LFDB 2IEYA 2X77A 2VIIA 5TR9A 4HI0E 1GM5A 3GLIE 3B13B 3B78A 2C98A 1OFHA 3A4MA 2RMKA 3VO1A 4Q9KA 3CWZA 1N6OA 1TMKA 3CO5A 3R7WB 5K8IA 4JT4A 5GJWC 2QQEA 1MRNA 3MD0A 4UNQA 5G53C 1AS3A 2G88A 5TVKA 5GVSA 5JS8A 3IBGA 4B2LA 2WSMA 2CE7A 3G0HA 2ZRJA 4G5SA 1PUIA 2F1HA 3WHLA 1DAEA 3SJZA 1EX6A 3GLIA 2QAJA 3OZWA 3AF3A 4PO9A 4RFSB 1G41A 2OCPA 4PAOA 4UJ3A 2CL6X 3TNFA 4B3CA 3I92A 3B1YA 1KK1A 1RYFA 3HYTA 3I72A 4URYR 1RKBA 3GD7A 1IHUA 3ZD6A 4FI3C 2O0KA 5F2EA 2W58A 2ODWA 1IN8A 4FCVA 3RS5A 1E2IA 4AF6A 1DO2A 5FOUA 3AVWA 4WZAE 1Q3TA 4AYWA 4P4SA 2GQFA 1KSJA 2AXPA 2NMVA 1ZUIA 1KMHA 4PC2A 2RC6A 2BBSA 2FPMA 3IPXA 2EWWA 4FCWA 4X8LA 1A1VA 2AWNA 1J8YF 1JECA 3BS4A 6Q21A 2XB4A 2GRJA 3ZBUA 1U9IA 2ANCA 4HDQB 1G3MA 1NBMD 3HYRA 4M1WA 4KO8A 5JS7A 3U4QB 2RHMA 5FUVA 2GCOA 3SFVA 4QHYA 2J41A 4V0KA 2ZEJA 4HLQB 1AGRA 1KI3A 5JEEA 2OT3B 4UXIA 4LJ4A 2W00A 2RAPA 1VYVA 1JJ2B 2QY9A 2WBLC 4WOPA 3K70C 1GSIA 1NVVR 4Q5IA 1ZD1A 4RZ2A 1ZNYA 5ANRB 1CNEA 2QP4A 3CNLA 3WHKA 3KQUA 1G16A 1L2TA 1NSFA 2P2LA 4P33A 5HCNA 2RGBA 4DBLC 3WBKA 4DRZA 4EQ6B 4DWJA 1E2NA 3TSZA 3GLHE 1DAFA 3KFVA 4Q7MB 3GLFB 1LF0A 4DUGA 4M4SA 4JLOA 1E2QA 2P5SA 2XGJA 5JWRA 4ZGQB 1KI8A 4Z1MD 2IHYA 4CVNA 2IA5A 1UBFA 1XEXA 2ZR7A 4D2IA 4BZXA 3GEEA 2WOOA 2B5OA 4DLZA 4PPFA 1FW6A 2OCYC 2W6ID 3B2EA 4Q1BA 1VPLA 1SXJD 2RB4A 5FTKA 4DSNA 5EE5B 5FOWA 1W47A 3ECCA 3TRFA 1OF1A 2JLXA 2J59A 1II8A 2DFTA 4OHXA 4EPTA 2OBMA 3DO6A 1AK2A 1GNRA 4GI7A 1E9RA 1ZP6A 4B2PA 5J4YA 1Z47A 3WNCA 1E1RA 1CIPA 2PL3A 1FNNA 4F92B 3GJ5A 1N8RD 3OF5A 1VMAA 1CR4A 4X8OA 2OUKA 4PC3A 5CB8A 4O25A 3LA6A 4KFTA 1SKYB 3M6AA 3QNUA 2VQSA 5C46F 4TLDA 2QMHA 2O0HA 3RRYA 4DCUA 1OJLA 3FHTA 2FV8A 2YWGA 5BN5A 2ZXUA 4MYUA 2ONJA 1CJMA 2BOVA 4CEJB 1ODFA 1WBBA 1IONA 1SVLA 2ZRHA 1XRJA 5FPYA 1FOEB 2VP4A 4M1SA 4PZYA 4YC7A 2QZ4A 1NLZA 3ZIAD 4PC7A 2OEPA 4DIEA 4A2PA 1F20A 3NEJA 4Y9UA 5HZHA 2OHFA 3P32A 1HA3A 2VSFA 1W87A 4FMCB 4A8JA 3NDBB 3RYTC 2ZQ5A 1SVOA 1SVMA 3EZ9A 2N46A 3HR7A 4DDUA 3K0FB 2HLDA 3M1IA 4AY2A 2ZREA 3SDZA 2FEOA 1Q1ZA 1KKMA 3MLEA 2F1IA 2EFEB 1SKQA 5GV7A 1G3QA 2GK7A 2PCLA 3P1JA 4EJSA 5BW8A 1T5LA 2F9MA 3QXXA 4M9ZA 1DDGA 5IF9A 3CCRB 1W48A 4W5HA 1KRHA 4GZLA 1KY2A 4L15A 4TLEA 3IQXA 1P3JA 3SFZA 3VHXA 3FMIA 3TLXA 4LV6A 1DELA 1Z0DA 1CU1A 2QTVB 4DHEA 1K9MD 2A9KA 1D1NA 4ZGNB 2BKEA 4CDGA 4LCBA 4DVGA 1HQCA 1UADA 3R20A 1YZTA 3FWYA 4XSHA 2QORA 2AFHE 3DOEA 3TJZA 3CCUB 3GLIB 3CX8A 1GRNA 1FMLA 2VEDA 4NONA 1GKYA 4BFUA 2XTZA 4W5WA 3NEYA 2Q9BA 2XXAA 4B43A 2V4ZA 2R6AA 2OXCA 4G5RA 5DHAA 4MKHA 2GZDA 2OBNA 3GLGA 4C2UA 3F8TA 4GMXA 4UQOA 1A2KC 3EPJA 1JJ7A 2BMEA 3KKQA 2GXAA 5GV8A 1NL3A 1Q0UA 2GZAA 4OYHA 2HV8A 4P4SB 3T5DA 3B6EA 5GJBA 1KMHB 1WP9A 5BWMA 5KNBA 3EPKA 3LW8A 1LTQA 4NU0A 2HCBA 1FQJA 3OW2B 4KI0A 1Q12A 4ON9A 1GJRA 5SZHB 2GCOB 3SE0A 3V4FA 4M1TA 1TTTA 1EFRD 2WTUA 1IN5A 2G1KA 3CCQB 4TLCA 4EPYA 1H8ED 4DCNA 1HE8B 2MSEB 3QFSA 4PGOA 1NBMA 3K09C 2CK3D 1EESA 1F3OA 1U0HC 3UMRA 3QIAA 2QMUA 3ZVMA 1IY0A 1W34A 5LB4A 3KQLA 5FTLA 1W2HA 2V6IA 1NDHA 3UMSA 4XD7D 2XZLA 1KI1A 2WJYA 3EIHA 2R6GA 2IEZA 4EFNA 2IUTA 3FTQA 5JCPA 4A2QA 4TTPA 3C7KA 4V0ME 1N25A 1KI9A 3W9YA 5C2JB 2HYDA 3EC1A 2EIXA 1ZYUA 1ANKA 5FPSA 2FH5B 1JI0A 3WMEA 4D80A 1W36B 2R62A 3GJ6A 3ICEA 1Z0JA 5AUNB 1R0XA 2NO1A 2O5VA 4QBFA 5FBQB 2CJWA 2LKDA 2JLSA 3O8DA 3CWQA 3NIBA 1FUUA 1XZPA 1FX0A 4TLBA 3U44A 2PIAA 1XEXB 3SYLA 3LLUA 1QVRA 4CGZA 4FMCF 1IJFA 1IBRA 2Q21A 3QFRA 2ZU0C 4DLTA 2ZSAA 2W83A 3RHFA 4Z1MA 4KV9A 5A5GA 2NIPA 2IYSA 4A15A 1II8B 1NLYA 2WSSD 4ZIRA 3VKGA 2D2FA 2GCPA 3KXKA 1VHLA 2W6IA 5SZJA 1PUJA 1KSFX 1K8RA 1SXJA 3BJIC 4HB2A 3ZQ6A 4FN5A 3AVQA 1IB0A 2WJJA 1G7TA 5FBRB 4B3FX 3QUSA 4HAYA 1EP2B 3QI2A 4F93B 4B75A 3ASYA 2HF8A 1KDPA 2R6CA 4QNRA 3WNDA 4TL9A 4LJ7A 1X8LA 5LBIA 1WB9A 2QAGA 1XTIA 2DERA 2F1RA 4ABYA 4AG5A 1OIWA 2GAOA 1JA0A 2BBTA 1XCPA 3ND8A 3QBTA 2ZI3A 1G3IA 3A8TA 1E2GA 1ZINA 2X8AA 1JR3E 1LY1A 3UK6A 3P26A 1P73A 4Q4HA 5AJWA 4AI6A 1Q1QA 2IS4A 5L3VA 1Z07A 2LCFA 3BC1A 4KHZA 4PAQA 3AP1A 4AC9A 2Q9CA 4Q66C 4A8JB 1TF5A 3K0AA 3QKSA 4LJ8A 1KI2A 3EA0A 4QG7A 1VIYA 4RKFA 4S35A 3VR4A 3ZIAA 1LVGA 1FPMA 4NPHA 4NCNA 4XJXA 2IL1A 3O8RA 2WAYA 1KK3A 1ZBDA 3UWKA 5DIFA 3SJBA 1ZD9A 1C4OA 3EZ7A 3LWNA 4G1UC 2CHVA 4I81A 3CCJB 4CT4B 4ZCMA 3LX5A 2EYUA 4Q1DA 4EJSB 2Y8EA 4M8NE 5K8TA 2RGNA 2OM2A 1WRBA 1VG0B 2ECKA 4BE7B 1Q1EA 1UMKA 1BMFD 2QENA 4XWKA 5H59A 2ZE7A 3NBZC 2HYIC 1OYYA 3CRW1 3KJHA 1XX6A 2YJTD 3LBNA 4KLNA 4ZDIA 4M9XA 1KD1D 1W4CA 2V9PA 5JECA 5TMPA 1DG1G 4OHWA 2G6BA 1S8FA 5H1YA 1G18A 3QPUA 2FSIA 2VSOA 4HLUC 4WVFA 1E2PA 4ARZA 1P75A 1H65A 2PZGA 1EFCA 4FMDB 2R6FA 1S9DA 4G01B 2WHXA 5J4KA 3QENA 1ZM2A 3RABA 4PHHA 4K46A 1OIVA 2HXYA 3B82A 1LF5A 3B1XA 4BPRA 1J8MF 4U7DA 1Z5ZA 2GDJA 3MWJA 2XXAB 1T5IA 2BDTA 3U3KA 4TQ9A 5EJEA 3CNOA 3OEHD 2FA9A 2NO6A 4TMVA 4DLWA 1W0JD 4IEEA 3GLGB 2XB2A 5JWHA 3W2FA 3FE2A 721PA 1XD8A 1CBUA 2REOA 3OZXA 2XTMA 1SVSA 2NO9A 5EUQB 2ERXA 3IO3A 4DSUA 3VU9A 1W4BA 2XJ9A 2IS2A 3KXIA 4JVNA 1DAKA 2WWXA 3WP1B 1NIJA 1WQ1R 2GZHA 1DDIA 1OV4A 4ERNA 4UNRA 1JPJA 3AP2A 3P4YA 1W4AA 2IYQA 3BORA 1CKEA 1BX1A 1NG1A 3SU8A 1NRJB 2DB3A 4OHZA 5AJYA 2D74A 1AQYA 2MSDB 4ZDWA 4JBYA 3ZVRA 3X2SA 4ZKEA 4MDEA 1WA5A 2R65A 1EFRA 2ZR0A 5SZIA 1H8EA 2OAQ1 3AKCA 2O52A 4WXRA 4DLYA 1G4AE 4DDWA 1KO5A 2CK3A 5B58C 1M6NA 2NG1A 4TQUS 1UEJA 1NJFA 3IEVA 4XD7A 1W5SA 2J7KA 1LNZA 4RD3A 1Q3HA 5J47A 2WIAA 4QJ3A 1MRSA 1JAIA 5HPYB 2IXEA 4N3NA 1QHHA 4PPGA 1JQJC 4BLQA 2BM1A 3DZ8A 5J4HA 1EWRA 4V02A 2CJWB 3FPKA 3AF0A 2F9LA 3SYKA 4Y7CA 1JJVA 1NVVQ 4IXMA 1FX0B 4JL5A 1Q81D 1YE8A 3U44B 2V1XA 2V8OA 4AK9A 3R9WA 1R0ZA 4LYAA 4US1R 3QXCA 1GVHA 2X2EA 4LBYA 1JBKA 1XTSA 5FBLB 1DVRA 4DIDA 2QP9X 4HE6A 3KZ1E 4WAUA 4A36A 2ORWA 1J99A 2H1LA 3RS7A 4ZIRB 3THWA 1SVKA 1QX4A 1HY3A 1GAWA 1U90A 1Q1BA 1SXJB 5B2ZA 3F0TA 5DHFA 4DLXA 3PJRA 3SBEA 3W2EA 2WSSA 4UNPA 2J5XA 5FR2A 1PZNA 1E98A 1M1KD 4KBGA 3B60A 1DAGA 1XMVA 1CJTC 5DE3A 2ZYTX 3KKOA 3GJXC 2QAGB 3DOFA 3QF7A 4TL8A 2OZEA 4QGFA 1P5ZB 1HUQA 5KSOA 3RDPA 3K70D 2CRVA 4IDPA 4JL8A 4Q4HB 1U8AA 2BMWA 2C8VA 1BOFA 1IXZA 1G6HA 3CX7A 4FMDF 4D6PA 2PX3A 2IWHA 3ADDA 3RRNA 1GL7A 1P2UA 1GNQA 2BIFA 3W5UA 3K0AB 3LO5A 3G5UA 3QKSB 2W0MA 1NVWQ 2PZFA 3QPWA 1OXUA 2TMKA 1TQ4A 5TY0A 1YU9A 2A78A 2X1VA 4KSBA 1S1CA 2DFLA 2PEYA 4NH0A 3KKMA 1OFUX 4UNSA 4BLOA 4W5JA 2H18A 3N5CA 5BQ5A 5B64A 3MHPA 1GL6A 3MCAA 4UNNA 2G3YA 4Q9LA 5EXXA 2YZ2A 1E3MA 2A5DA 1HQYE 1MABA 2PZEA 3FKSD 4HAWA 3C41J 4H9GA 5K8LA 4O3MA 4Z8XA 2YVUA 5AN9A 3BXZA 2H16A 3B8HA 1TF2A 3L0SA 4KVAA 2IUSA 5GJCA 1G7SA 4E07A 3CH4B 5FL7D 2JJ8A 5KSPA 4LJAA 2DY1A 2XZOA 4OQMA 2XITA 3CM0A 1NMYA 1NY5A 1E2MA 1JALA 3NBFA 3PUYA 4JLBA 2HT1A 1E0SA 4FXPA 1XPUA 1GDDA 4Q9IA 5KU1A 2RC5A 3CD6B 1BMFA 3K9GA 3EW9A 3NHBA 1NMZA 3T1OA 5AJVB 5GADl 4R2IA 1E9EA 1GO2A 4B74A 5F3WB 2FF7A 2ZSBA 4ARZB 1XMSA 3GFTA 4L4UA 1Z6XA 4LBZA 4Z8YA 1EGAA 4I1SA 2WWFA 4FW9A 4TWZA 2QGNA 2CLCX 4MGZR 2JLWA 1G8FA 4M9QA 4AWXA 2QG6A 2X19A 2JGNA 1A8PA 2ZU6A 3B1ZA 4L5BA 4TSFD 2NO7A 3NDPA 5HKKD 1EFTA 2NTYC 2O8EA 2G0TA 4KFRA 4QHTA 4BGDA 1A7JA 2AK3A 2IYLD 5IK2D 1NN0A 1VG9B 1VDZA 3EWAA 1K8AD 1KJYA 2I3BA 3D3QA 3D8BA 4A0GA 1VQOB 1G64A 1DPFA 2WZQA 1IN6A 2WWHA 3B85A 2FSHA 4EKDA 3N70A 3OIUA 2GXSA 3OEHA 1SQ5A 3K1JA 3K53A 3QVVA 1W0JA 4D4JA 3SS8A 3FFAA 2R9VA 1KO7A 4XTCS 2ZRBA 2IF0A 3VU9B 1ZCAA 2Q3HA 3IILA 2ZRDA 3W6NA 3Q72A 3JQQA 1ZVQA 3PXGA 4JMPA 2FSFA 3CUEF 3CMEB 2GJ8A 4GT1A 2DR3A 4N0DA 5L8VA 3R8FA 1PLLA 2XAUA 1FFHA 4UXJA 3K0CC 4DDVA 3CLVA 3L2OB 4LY6A 4NKRA 1XXHE 2KBFA 3NKVA 3I8XA 5FPKA 2XX3A 5AUQA 3UIEA 1P2SA 1KO4A 4I99A 5EZ6B 1SGWA 2HJVA 4PAMA 2ZI6A 4ILEA 1I7PA 1AM4D 1R0WA 4L8GA 4NZYA 4US0R 4OL0A 4IVQA 1D2NA 3ASZA 2PT7A 1CR2A 1D6JA 1XU4A 1E2LA 1OH6A 1F2TA 1Y3AA 4QJ5A 2VPPA 4R71A 1YJ5A 4G5GA 2P67A 2ZM5A 1QHHB 4EPWA 4YAFA 3K0EA 1XZQA 3V76A 5LD2B 4QGGA 1EP1B 2F6RA 4LHWA 5HCIA 3U60B 3LVRE 2DFNA 2GETA 2OO7A 2FJUA 4DJTA 3E1YE 4DLUA 2C96A 8OHMA 1ZM4A 4O2LA 5EP4A 2MMCA 2VF8A 3FGNA 2ATVA 2C95A 1G3RA 1NI3A 1XTJA 4HB0A 4NYJR 1GZSA 1CJUC 3TAUA 4MYCA 4BZQA 4D0GA 4P3YA 4JJKA 1R2QA 4C9BA 3THWB 4B44A 2WPDD 1KO8A 1R7RA 4HDOB 3WYAA 2VHUA 3SQXA 2ZJAA 4XVQA 3FJOA 3C14C 3CRQA 1N6NA 2WKQA 2J1LA 1VQ9B 2OCBA 1AKEA 4F7WA 5FH9A 3VMFA 2H5EA 1KC8D 3E1SA 3W5HA 1OXSC 3JQRA 3KFXA 4NMMA 4EFMA 4P0TA 2QT1A 5DNYB 1E9SA 4Q4JA 3IHWA 1BS1A 1RRGA 4M22A 4QM6A 3BFVA 2AD1A 1ZNWA 2HF9A 1G291 5FI0B 1OXXK 3WNBA 1V43A 4PHTA 4Q00A 4A9AA 5UKDA 4D0LB 1TUEA 4WZ6A 3TR0A 3U3RA 2GNOA 2SHKA 3WMFA 2OXRA 3IPYA 1XD9A 2Z83A 3KDSE 4IJMA 1COWD 2P6NA 3KJIA 1AS2A 4AKHA 1CQXA 4DQKA 3U7EB 3OAAD 2P6RA 1XMIA 4CT5A 2ZI9A 2BBOA 2QT0A 3FMPB 1VYTA 4HB4A 4KXFB 3R9IA 3SHWA 2J0QA 4IHQA 3NH6A 5BN3A 3CF0A 4XWOA 3AUXA 4LHZA 5KO2A 1Z6TA 2CL0X 4IVPA 4U9UA 1UKEA 3VHLB 2OK7A 1TUIA 1OSNA 1MABB 1ZU5A 3NBXX 4JLMA 3X1YA 5JJLA 2ERYA 1W5TA 3WRXC 3PUWA 2CNWD 5KSZA 4HAXA 3CRRA 5KHOC 3AF1A 3OFND 3EXAA 4G0NA 4MDFA 3FKSA 4MRNA 1DAIA 1X1SA 3CIOA 3GEHA 4OQNA 4BUJA 3E2IA 3TVDA 1P9NA 2WWYA 3CX6A 3AH8A 3RC3A 1H8HD 5FL7A 1S3SA 2P5TB 5IDVA 1L7VC 2IXFA 1OH5A 2JJ1D 3C15C 3IIMA 2YOGA 1GIAA 2VF7A 3AB3A 4RZXA 4JLKA 5CIQA 1NP6A 4IDNA 5CYPA 3U5ZB 3BFXA 5TXGA 1CLUA 4BFVA 2C03A 1QVGB 2WMNB 2QI9C 2IBMA 1G8GA 3T15A 4W7SA 1GAJA 2N1BA 4M1OA 3WP0A 3B1VA 3VR2A 1VQ4B 3EZFA 2O8EB 4PC1A 1OB2A 1KY3A 3GLHA 4Q9HA 1D8TA 1CS4C 4ZDKA 2RGCA 5JI3E 1OFTA 3SR0A 2YC2C 1E4VA 4TSFA 3X1DA 1PLJA 5HKKA 4RD0A 3Q7QA 1UAAA 1NKSA 1Z3IX 3CBQA 3L43A 1SZPA 1QGYA 1U8ZA 4R2HA 5IK2A 2VP5A 5KPDA 2J0SA 4Q02A 1EXMA 3W2GA 5SZKB 4KLZA 4HAUA 1BJKA 1X86B 1KI4A 2DCUA 4YHBA 2OESA 4DLRA 2GTPA 5JZVA 4C4PA 1XJ0A 3H4MA 2B6HA 4HUTA 1DO0A 1NVXQ 3K8YA 1ZC4A 221PA 2Z6VA 3AP3A 5B30A 4LBWA 1YQTA 3DPUA 2O8FA 1E94E 4BLTA 2A7QA 4OK3A 1OGIA 1NN1A 2ZVPX 2QTZA 2ZANA 521PA 3L8YA 3LQQA 1NVUQ 1G8YA 5KOYA 5FTMA 4KODA 4QFMA 1T4GA 1NF3A 3VAAA 1JR3D 4KU4A 1R5NA 1H85A 1KI7A 1W35A 4IFEA 1G20E 1UFQA 3DEFA 3SJCA 3BE4A 3PG5A 5AWFC 4OK5A 3REGA 3EC2A 4DDTA 1NN5A 3IKJA 1KJWA 4YMSA 3SOPA 2HCJB 1YJNB 1F2TB 5CM8B 2WJGA 1DADA 2GK6A 3CR7A 1VQNB 3BBPA 5P21A 2QE7D 5FOXA 3CPWB 3HWSA 5J40A 3DM5A 2VNJA 1OT3A 1I4TD 5AJZA 3GFOA 3L0PA 4DCTA 3A6PC 3TVTA 3V4RA 1X1RA 1KZ7B 1QHXA 2D2EA 3CB4A 2GBLC 2GCNA 2NO0A 1Z0FA 4LRWA 4OHYA 4BFWA 2F55A 2EW1A 2FFAA 5DN6D 2B8TA 2PBRA 3AM1A 3TW8B 2VSXA 4KAXA 4XH9B 1J90A 1Z63A 1Q44A 1OKKD 1SVIA 4K1XA 4Z51A 3ZZ0A 3TR5A 3M0EA 3I56B 2P65A 2WPDA 4LSGA 5G3YA 3MWYW 4C3ZA 3IBYA 3A1TA 2FPKA 2JLVA 1ZIOA 1MT0A 3SBDA 3H84A 4FK8A 2RGGA 2BN4A 3QJYA 4E03A 3KQHA 3VNVA 5FOTA 2CLSA 2O0JA 3HU3A 4JYCA 1E2HA 1JNYA 1BH2A 4GOXA 1BQEA 2HXSA 3BB3A 1XCGB 4Q4JB 4C0KA 3PUVA 2FSGA 1KI6A 2NZJA 2GPJA 3ETLA 3K09A 3K9HA 2PJZA 1KNXA 2ZI5A 2YNMA 3F5FA 4RKEA 3VTKA 4ZDJA 4B3GA 1N5KA 1U0JA 2BJVA 3PUZA 3ZGXA 1KTVA 3U2QA 1QGAA 2F3TA 4OI4A 3K70B 3FPAA 5HXBA 3UG7A 4LI0A 3RS3A 1Z6GA 3AF4A 2BKUA 2QM7A 2FG5A 4U00A 4HEJA 3FVQA 4B6FA 1IAQA 3MUFA 4LJYA 2WVJA 2GF0A 4LOAA 3TW4A 2W2TA 1COWA 3KTAA 3LQRA 5CJPA 4CZ2A 2OK8A 4US2R 4GPTA 2X3UA 1QFZA 1D2EA 1E99A 2ZYUX 2GKSA 1CTQA 3FB4A 3N2EA 3OAAA 3Q8XB 1YZNA 4P31A 1XD2A 5JRJA 1OH8A 1Y63A 3Q5EA 4PR0A 2YWHA 1QVFB 3L0OA 1KSGA 3UXMA 1JR6A 3CCSB 5IRCD 1DG3A 4A1FA 4U5XA 4LJ9A 2V3CC 3MSXA 3KB1A 1CJKC 3HPRA 1C9KA 5L3RA 5GJVC 1E2KA 2CNWA 4XVRA 3A4LA 4G1VA 3HJNA 4QRHA 4TLAA 3M4YA 3OFNA 4MKFA 1FNCA 3ADCA 3ZD7A 4L9WA 4M21A 3UPUA 1XPOA 1P4SA 4R98A 5THXA 2GF9A 5FUXA 3TGPA 4YMUA 5BYJA 5G41A 1GFIA 1H8HA 1SULA 4LWZA 5AK0A 2JJ1A 4B47A 2V6JA 4V0MA 5C1BA 1XBTA 1VKJA 4YMVA 3AVOA 4OQFA 4JVMA 3RC8A 1E0AA 4P4TA 3GLHB 1M74A 1QHGA 2EFDB 3DMDA 3IUYA 5HE9A 4LHYA 3ZVLA 4PQRA 1R8QA 3ONWA 3TK1A 5AUPB 2FN4A 2RKOA 4IOMA 4P6VF 4MITA 1EP3B 1JB1A 1YKSA 2WWGA 1HEIA 2OLKA 2HEIA 2I4IA 5C4GB 2OILA 2ZYVX 1TF7A 2OTLB 3A4NA 5EE0A 4MRVA 2DYKA 4RCZA 1XWIA 2GEVA 4KFSA 5LB2A 3QKRA 2N42A 1ZUNB 3LFUA 1C1YA 2ZYWX 5FI1B 3ADKA 4BECA 4M2LA 1VQ8B 1VQ7B 2WJHA 4ESHA 2ODNA 2BMDA 2IYXA 2QRNA 1PJRA 3W6PA 3ZH9B 2O8FB 1CRPA 3LO8A 2VHQA 4DZZA 1E9AA 1R8SA 2R6HA 4TMTA 3QXSA 2YHSA 4D0NA 1HTWA 1FTSA 4JSTA 1ZUHA 1U2RA 2H92A 1NMXA 3CF2A 1A5TA 3BAFA 4V0OA 3LXRA 3T1VA 1V5WA 2QPOA 1T3LA 3W2IA 3CW2A 3LH5A 4F38A 4QKQA 3LDAA 3WXMA 1G5TA 1II0A 1XP8A 4D4MA 1GRRA 5J4LA 4LJ6A 1Z28A 2KBEA 4H1VA 4MRPA 1JR3A 1ONBA 2A3RA 4JL6A 2ZJ5A 2CHQA 4IFBA 3TE6A 3WYFA 5D3MA 4AKIA 1E64A 2H17A 4HLUA 4MH0R 1D2MA 3GJ0A 1FRQA 1JB9A 1E2JA 3U3OA 2XJ4A 3VQTA 1CF4A 3H1TA 4RY2A 2PMDA 2QE7A 5C18A 4JVSB 5GVRA 3JQPA 1Z6AA 3C8UA 1MV5A 1T3HA 1XF9A 2YV5A 4KBFA 4KSCA 3BD9A 4OQLA 4BFSA 5JRZA 4OI2A 2XNJA 1MO5A 3Q5DA 3QKUA 5H70A 1FRNA 4RD4A 1E2EA 1QBKC 3VR6A 3SI7A 1KHTA 1E69A 2GHIA 4LHVA 2G0NA 1N6RA 1GVNB 1Z2AA 3MGCA 3EA5A 5DN6A 3HU2A 3G6EB 1FP6A 2BCJQ 4CEIA 2BEKA 1RE0A 3JVUA 3TUIC 1OKKA 2FU5C 1KZGB 2OV2A 4NYJQ 3U6BA 3CZQA 3UKDA 3SN6A 4MYHA 4R9UC 2D7DA 2NOAA 4LC1A 4TYPA 4IDHA 4ZCIA 3T61A 4Q9JA 1QG0A 1DE0A 4PO8A 3K0SA 2BVNA 3QF4A 4I1VA 5EE9A 4B3BA 4G1BA 1N5JA 4HDCA 2R6DA 3LD9A 3PENA 1T8UA 4F4JA 3VX3A 1KI6B 3KUDA 3NXSA 4M53A 2J7PD 2ZJOA 4NDZA 5HTKA 4B3DA 1CR0A 2JLUA 4QGAA 3T35A 4A0RA 1JXMA 3CCVB 2IYTA 3LW7A 4B71A 5EP3A 1M7BA 2UVQA 5IT5A 5KNDA 2D4HA 2BHRA 5DSZA 2V7QD 4EIWA 1ZW6A 1DS6A 3VO2A 1IQPA 1KGDA 1A4RA 3KTAB 2IYYA 4M1KA 3FFBA 3AVTA 3LV8A 4C0BA 4IVRA 3N2IA 4YAOA 5JI2E 3PV0A 4NHOA 1XD2B 1M1YE 1ESNA 5FL3A 4CEHA 4GFDA 2OLJA 2WIBA 1FQKA 5G40A 5DYGA 2JA1A 1R5OA 4GRAA 1HH4A 3CCMB 2A30A 3RNLA 3LNCA 4ACAA 1T0JB 5JJIA 3LBIA 4DB4A 3I62A 2CLDX 3TBKA 2XOKD 3EARA 3NC0C 4JKIA 4YALA 4DEYA 3G4SB 3WY9A 1Z0IA 3MAAC 1W1WA 4Q21A 4OJQA 5KSYA 1QHIA 1X8JA 2GA8A 4YXWD 2NGRA 1W0KD 3Q9LA 3EAQA 1NSTA 3EZ2A 3CCLB 4PTLA 4I4LA 5TDHA 4DEXA 2QTLA 1Z08A 3KB2A 2DHRA 1Z6YA 3T1QA 2HJGA 3SYNA 3K9NA 1KQSB 1F6BA 3QEJA 3THOA 3QPVA 5KUTA 2EFHB 1I4DD 2VNIA 2D62A 2AHOA 4B34A 4CYMA 3U7FB 1US8A 3CZPA 4QJ4A 4PXAA 2R2AA 1ELOA 3H86A 2VP9A 2QN6A 1BO6A 3UMFA 1KKLA 2D06A 3ND9A 3IEUA 4FMBB 5DO9A 4URWR 3T06B 3C5HA 3MG9A 3E70C 3NG1A 1N5LA 4M9SA 4RD6A 4IKEA 2ZAOA 5FPTA 1RZ3A 2ZSEA 4NBSA 5JEDA 1W2GA 2KJQA 4B48A 4C0HA 3QG5A 3C4JA 1E2DA 4F91B 2A5GA 121PA 2CHGA 3TSWA 4BASA 2ZJZA 4GP6A 3QKRB 1XTRA 2EWVA 1XTKA 3OJWA 2PMKA 4C0JA 2DEUA 3BFKA 1VTKA 1E0JA 2WOJA 5EQTA 2ZRMA 1G4UR 3K9LA 3AV0B 1OFIA 1N6KA 5JMTA 1XDBA 4KCGA 1AN0A 2D3WA 2OFOA 3HDTA 5KNCA 1UEIA 2PX0A 3CR8A 3NHAA 3LBHA 3W5JA 5TB5A 1DTSA 4NL4H 1UKZA 1BYIA 2J0VA 4JIMA 4NYMR 3B5JA 4ITRC 1EG7A 3DKPA 1RRFA 3OESA 2ZRCA 3QE0A 3PEWA 3LRPA 3IGFA 4D26A 1U81A 1X6VA 5FBVB 2F3RA 3BB4A 4QNMA 4JLPA 1ZC3A 4LHXA 5D3MB 1QUFA 2B7BA 1YIJB 4P32A 2UKDA 2VO1A 5EUMA 3ES9A 1EFHA 1ZCBA 3VFDA 3ZS8A 4MKGA 1A2BA 1UM8A 1B2RA 1YR6A 3TIFA 2PT5A 4FIDA 3CRZA 821PA 3GLFE 2C04A 4TZ0A 3I5XA 2OTJB 4EDHA 3MMPA 2WWWA 1KDTA 3O47A 4GOKA 4C0QC 4EPVA 1KAGA 3A1WA 4B3XA 1Z8FA 2ANBA 4KYUA 4PPNA 1S0UA 4QL3A 1QHYA 2ZPTX 3KKPA 1VQ6B 4M1MA 4BLSA 4TT3D 4BEJA 1PLKA 2PH1A 2FEMA 2IWRA 2P0EA 3Q85A 4AKGA 4BFXA 1Q22A 4CEIB 3PVSA 1HURA 2AFIE 4Q7JB 2Q0HA 2VL7A 2AL7A 2WKPA 3AVPA 4EUNA 5HR5A 4FCTA 1XEFA 2QPTA 3JVVA 4HUQA 3VR1A 5DISB 1FUKA 4Q03A 4X8MA 1D9ZA 1N6HA 1FL9A 3K0CA 4HZUA 4I1UA 3QF4B 4OQXA 2XZPA 3GP8A 4KITB 5AUOB 4LBVA 1RW4A 1SKYE 2H57A 1XMJA 1G6OA 5LPNA 1GG2A 1EWQA 4EAQA 4DCSA 5L3SA 4ESVA 2C77A 3W3ZB 2GJSA 2RH5A 4Y0AA 4FWTA 1TU4A 4BLPA 5CDFE 3CPHA 1ZRHA 2G1JA 3SQWA 2BF4A 3KKNA 3BRWD 1SM4A 1P6XA 1E0KA 1XCMA 3CMAB 1VG1A 2J7PA 1FTNA 4JVLA 1AMOA 2YWEA 1W49A 1S96A 3AGQA 4XIGS 4HZIA 4WXPA 4LC0A 3W34A 3TH5A 1Q86D 4B33A 4B76A 3L0IB 4QBHA 3MWLA 4F7DA 1N5IA 2IK8A 5KPJA 2V7QA 4TMXA 4B4DA 3LX8A 2QMEA 2CCKA 2VNKA 1OW3B 1CNFA 4CEHB 2C99A 2BJWA 2R8RA 1VCOA 3GJ8A 1P7CA 4GL2A 1ZNXA 1Z0AA 2BBWA 3DM9B 2AKAB 2JCSA 1YJWB 4BRWA 2IYWA 5FR1A 5CLLA 1XXHA 4B6EA 4KFUA 3CPEA 1KNQA 4G5OA 3W8NA 2VHTA 1QFYA 3IQWA 3OZVA 3QOFA 3FMOB 3BGWA 4NCJA 1U8YA 4TTRA 1ZNZA 2GVZC 2XOKA 3A58B 3EG5A 4GOJA 4IXNA 4LX0A 3WYGA 1LV7A 3R9XA 1G19A 4URZR 5C4MA 1KK0A 2CXXA 2YKGA 4YXWA 1W0KA 3H0KA 1P72A 4RD1A 2ZETA 4ZPXA 1TQ6A 4EPRA 1LW7A 1NLFA 2VHCA 1EWYA 4XOIA 2IUUA 4Z54A 2ZE8A 2REBA 1JPNA 1US8B 5E4FA 1VCIA 4C43A 1MKYA 2QUZA 3D7MA 2AXNA 4FINA 3RRMA 4QBGB 3P4XA 2EYQA 3AQ4A 3FKQA 4PHFA 4N0EA 1YR9A 4Q1CA 5JHHB 3ZZUA 3BIFA 5BN4A 4XVUA 5CK4A 2FPLA 4AYTA 2IHBA 1AGPA 4MGYR 2ZI7A 1UDXA 1YR8A 1OXTA 4CF7A 4BPBA 5E95A 2QSZA 1N2CE 2ZJ2A 5B57C 1WCV1 5JSZA 4WZBE 1GP2A 2NPIA 1KIMA 1QFJA 1TAGA 3AKEA 4AF7A 4AKEA 5CB6A 1IY1A 3TUZC 2QSYA 3ZVNA 3I1FA 1HT1E 2QMOA 3ZS9A 4ZI3A 1WDTA 1E6CA 4PX9A 4QGHA 2QBYA 1YITB 4MUBA 2VZLA 1E79D 2BGIA 2J45A 3LVBA 3GJ7A 3VKHA 1R5BA 4Q1AA 1VQ5B 1F5NA 4QOSA 1N3BA 5FOVA 3OHMA 3MRSA 1P2TA 4LGMA 4Q1FA 3PITA 3TQFA 1YI2B 3W90A 2VP6A 3ZZTA 3RWMB 5JCZA 5E7JA 3NBYC 1DOAA 2QQ0A 3A37A 5L3QA 1KYIA 3LY5A 1S4QA 1E9DA 1DARA 4C0AC 4LYHA 3IDQA 4L9SA 5HZKA 1TLLA 2Z4RA 5AJXA 1MOZA 4C0SA 2E87A 2J9RA 3PFIA 3DZDA 1QHSA 1H42A 1G3UA 2GJAA 1OIXA 2V55B 3U7GA 3TSOA 3TUJC 2VP0A 3U3MA 3D6TB 1CR1A 5EMNA 1R4AA 2GVDC 2P6UA 2REXB 4QC2A 5FFMA 1KO1A 4A0FA 4URVR 4B35A 4MA4A 2QTFA 1UJ2A 2CCGA 2ZE5A 3L8ZA 1AJEA 3RS0A 3BWDD 2YOHA 2ZS8A 2MSCB 1RC8A 2HUPA 2OSBA 2QA4B 1HV8A 4A2WA 1U9IC 4AD8A 4BQSA 2IX3A 3KUCA 3L82B 4LPKA 4Q01A 4QHSA 4UXHA 4NCHA 1W7AA 1TU3A 4RJLA 3P27A 3GJ4A 1CP2A 4ZI2A 1YR7A 4P4UA 1O87A 4Q47A 1RIFA 3CRVA 4HSEA 4OK6A 4Q4LA 2GAAA 3TMKA 3FMFA 1G1MA 3PEVA 3A1UA 4H1UA 1OE0A 3GFPA 2VNHA 1QRAA 4TT3A 1YHNA 3QE2A 4YDHB 621PA 3QG1A 3AF2A 2Z0MA 2ZRLA 4HUQB 2DPXA 4A92A 2IS6A 4TL6A 4OI0A 2GESA 5JHGB 1GWNA 1VQKB 1DAHA 4HZUB 4DSOA 2VA8A 3BH0A 4ACBA 1OB5A 4V0NA 3AGPA 2AKYA 1EFUA 4IOLA 1XEWY 1W36C 2FDCA 3CRMA 3F3YA 3T1TA 3LVQE 4JJZA 5L3SB 5KDOA 3FHCB 1L8QA 1OLOA 2R44A 3QBVA 3I32A 4HAVA 3W6OA 4BEBA 2CVFA 2KE5A 2JLQA 2DWPA 1QH0A 4ZKDA 3D31A 3BERA 4LYJA 2GXUA 4YDSA 2A5JA 4PANA 3EPLA 3T34A 4DQLA 3CONA 3W8RA 1KSHA 2W2XA 2AX4A 2ZRKA 5H8WA 3A1SA 2DWQA 3EASA 4IDQA 4BFTA 2ZROA 4BLRA 1TEXA 4W9MC 1W2BB 5K8UA 1DBSA 1UBGA 1RJ9A 4BFYA 2O8CA 4HAZA 2A2ZA 5KDLA 2ZRAA 5CLQA 2MMGA 4C0LA 1UKYA 1QHNA 1Z83A 3CH5A 5EXPA 5EZ5A 5E7MA 2G83A 2XNSA 1IOZA 1IM2A 2GWHA 4TMWA 4JLAA 4B73A 1GKUB 5DI3A 2DWOA 3R8CA 3NWJA 4OKSA 4URUR 1L4YA 1JA1A 1AKYA 1T8TA 4WW0A 4E22A 1XXHB 2GBLA 4TZ6A 4RZUA 4XTRA 2ZRNA 3I73A 2WICA 1YZGA 4UAJA 1B0UA 2OE2A 421PA 4F4CA 2ZSDA 3CF6R 4Q48A 3OIYA 3GQBA 1XJQA 3FYHA 1Z0KA 2ZUBA 1AA9A 3MJRA 2C2HA 2I1VB 1S9HA 3U7HB 4RD2A 2ZRFA 3AVVA 2AWOA 1NJID 4DKXA 2AR7A 1OPXA 1U98A 3PUXA 1OH7A 2IYUA 3EX7C 4A8JC 1J2JA 1HT2E 1R0YA 3EIQA 1P9RA 1F2UA 2DFKB 5FPHA 2ZS9A 4LK2A 3T5GA 1P60A 2ZJBA 3HU1A 1G7RA 2QU8A 2XEXA 2FGJA 2NQ2C 4JT2A 4NCKA 1YZLA 1DAMA 3A1VA 2L0XA 3GMTA 3QXJA 1SHZA 5A0FA 3THXA 3O8CA 1GL9B 4Q7KA 1Q7YD 2B8WA 4A82A 4DLSA 5JSZB 2JAQA 3GLGE 4DB2A 4EJSC 3HPQA 4D25A 2QP3A 5CK5A 2IXGA 2QBYB 1ZU4A 4GBMA 1D5CA 3B1WA 2V1UA 3SNHA 4JSYA 4V03A 2W6JD 4NE2A 2BGJA 1GAQA 1YZUA 5JWOA 2YWFA 1O3YA 1VQPB 1TQDA 1N6IA 4AG6A 3OJXA 3UWOA 5DYIA 3AUYA 1E79A 1PVOA 4RSGA 1AZSC 1X3SA 1Q57A 2QA5A 2DETA 1N0UA 4KJZA 2E1RA 5L3QB 3ICQB 4HB3A 4ASUD 1NBME 1ZJ6A 1RRPA 2QGZA 1BYUA 4ZV4A 2YOFA 4GSYA 4C7OA 1YVDA 2A5FA 4GP7A 4OBEA 3OE7D 2KWIA 2YINC 5KSWB 2RGEA 4NYIR 2UZIR 5D3QA 3RLFA 4TMZA 2QTHA 4EH1A 5CYOA 2ZRGA 2C9CA 4C2TA 2CMKA 2OFXA 3DMNA 4LV5B 3PEUA 1G7CA 1B23P 1IN7A 3IIKA 4GNKA 5TV2A 3C16C 4YAUA 4G5QA 4K81B 4NYMQ 4OI1A 4I1OA 1ETUA 1Z06A 1OYWA 4GMDA 1RVDA 1XNJA 1QVAA 4IRUB 4RCYA 2NZ8A 2J0UA 2J46A 4HATA 3CPJB 4DLVA 3W2HA 1NJGA 3E20A 2QEQA 2VH5R 1G5RA 5TARA 4QM7A 1T9HA 1YRAA 4PQYA 3W5VA 1R6BX 4Q1EA 1UBCA 4B2IA 1OHHD 3ZLJA 4WBSA 3V00A 1KAOA 2CBZA 2V54A 4Q19A 3PEYA 1W46A 4TYYA 1JQLB 3DDCA 5JBQA 5DLQC 4HE5A 3NVAA 4S2EA 1P61B 2PCJA 2O8DA 3I55B 1IY2A 2RGXA 1E9FA 3S1AA 1VIAA 1SXJE 1RRCA 4UKDA 4A0HA 1G9XA
chains in the Genus database with same CATH superfamily
3VNUA 3TW0A 4FHDA 1YBMA 2VHJA 2ZQZA 3T53B 1YCHA 5C5CA 2DPLA 4O1IA 4Y0NA 2UU9B 4Y7DA 2ZAMA 4JJFA 3S2EA 3VYSB 5TPWB 4P9SA 2ZG6A 1DNPA 2DBVO 3ZXSA 1PL6A 2RARA 4W1PA 5TE9A 2XNDD 3TL3A 1W6UA 3NBKA 4QNNA 4ZI7F 1EPUA 4MR8B 4L3OA 5CM9C 2VLIA 4JLVA 3DGEC 1B0PA 2ODBA 3NT2A 3AX6A 2J87A 3GD5A 4LRYA 5IASA 4MUMA 4COKA 3LY8A 3D2CA 2M32A 3K5IA 4AF8A 2ZKLA 4DQ0A 5KVCA 2XKBA 2BM8A 1GV0A 2F3SA 2PX2A 3E8MA 4H4EA 4ER6A 3RADC 3ZH2A 2B4YA 1THTA 2CXUA 2MSKA 5HMLA 4OOVA 1TTHA 3OZTA 3K5HA 1Z29A 1UFKA 4JC4A 2XQIA 3WOHA 3E6AA 3DQPA 1A04A 1B16A 1RJ9B 3BN3A 3NC1C 2A9PA 3ASPA 2QM0A 3MS4A 1FMJA 4IHKA 2A1UB 3G8YA 3HCDA 4DR2B 1W581 1SXJC 3TL6A 1YZQA 1OFUA 1QYDA 4FR2A 3VYRB 5EVCA 1CQWA 4KWTA 3CZRA 2NXEA 1O89A 5AXDA 2MT9A 4IDCA 1EXVA 1G9SA 1G21E 4EG5A 1YRYE 5DI3B 3C6BA 2GNAA 2B21A 3H1FA 3MLBA 2G77B 4QSHA 3UATA 5AW0A 5L53A 2HA7A 2J08A 2FSVC 4E09A 1CUUA 4ZOLB 1RWXA 2ZJ6A 1E4EA 1BH6A 1I2ZA 2Q1YA 1N2HA 1VECA 4W9NA 4MWZA 3B38A 1N2OA 3VI4B 2Q8NA 3WXBA 2JFQA 2QAGC 5KC8A 5ELXA 1HKUA 1MIHA 2IP2A 2AZDA 3EXG1 3M9XA 3PGXA 4HH1A 4AZ0A 3GQBB 3M9LA 5IC5A 3WNQA 3GJ3A 5ELMA 3KTDA 1ESMA 3NOXA 1G20B 4F3KA 2IJGX 4FPXA 4G26A 4GC5A 1A97A 2QU7A 4HVTA 4X85A 3U7QA 5A3QA 2C9YA 4YRPA 1YVPA 1L1QA 3CUSA 3H1AA 4RJTA 5C31A 4C08A 1QYXA 3NH9A 3LKVA 4IEIA 2IEBA 1GGJA 3F1LA 4GE3A 3WO1A 2PLFA 1T2AA 2C83A 2F7SA 3ZU2A 3ZWMA 2BGRA 1K88A 3JU4A 1X0XA 1QNFA 2CDNA 1YQWA 3BF7A 3FN4A 2D6FA 4WLNA 2RKBA 2FE1A 4RAQA 3AY6A 2PG3A 4LGVA 4EABA 1BQ3A 2DECA 4EVQA 3KUUA 5KDDA 1R10A 3BY2A 2LKCA 3BULA 4L76A 1J8QA 3OHSX 2JG3A 2VZ0A 1RQ7A 3W4JA 4HDNB 1FP7A 2RGNC 1HE1C 4TX1A 3QVGB 4GLLA 1RMTA 2EFJA 3RYCB 3C6MA 1SELA 4HLDA 1YF3A 3TI7A 1UQTA 4MCIA 3HNOA 8MHTA 3S7TA 3A6ZA 4BVFA 3NHUA 3NHRA 3YASA 2NUBA 3L5KA 4HADA 2WF9A 2V9ZA 4H6WA 4N5LA 3IO5A 3KSDO 3L93A 4WK0B 4AVYA 1W29A 2CB9A 3AJEA 1NAIA 1MEEA 4DCVA 2V7XA 3LT0A 1LDNA 4I36A 4CIDA 1U5CA 2XSZD 1RFLA 1N2EA 4R2JA 1ZEJA 5HRCA 2FGKA 1Z4LA 2UZ4A 2YZNA 5CITA 3EPHA 3V4SA 1EFKA 1X7YB 3D7LA 5CA0B 1WW2A 4KYIB 1E5XA 2MSNA 2JJ2D 4LZZA 5LDDC 4C7OB 1JDNA 2R4UA 3MN1A 1Q20A 4YO8A 4X1OA 3WJ2A 5L40A 2HDNB 1NT4A 1AF4A 4ECEA 4ASUA 3EZNA 5DK4A 3CC7B 1U0LA 1H0SA 1KAMA 4PSVA 5B5SA 1I9GA 2ZIAA 1Y8QA 1ZK3A 2LE0A 3AUKA 4B4WA 4F8YA 4G3XA 4R7ZA 1OCEA 2QM3A 3M82A 4EKYA 2V8BA 3VSEA 4YQFA 1RYHA 2GFHA 1GAXA 2HQBA 5BO5A 4Z53A 1P7VA 1VL2A 3DL0A 3PQCA 2IHUA 4FR0A 4KE6A 3EVZA 2JLRA 4AJ2A 4Q9DA 2RHDA 3QQ5A 4RLQA 4RNCA 3KL4A 1X8KA 5HE8A 3RS4A 3FDJA 2FSSA 4WLUA 1L5HA 3UWSA 4DILA 5YASA 1YHQB 3PQFA 1RAHA 4OV6B 3EEOA 2F8TA 2AN9A 1OU4A 3I42A 4UE2A 2HJHA 1NMEA 4RABA 1EFDN 2HM7A 3OY7A 2ICAA 4HQ0A 3I5MA 4N5MA 1IM8A 1Z82A 3KEMA 2ASEA 4TYNA 2QPAA 3HB4X 4WOCA 4TLMB 4MWSA 5CNJA 4H6PA 4A6XA 4BKQA 4BB6A 2GEDA 3ZJ4A 4LDJA 4AECA 2A1TS 3TTWA 3KSAC 2PMCA 2VUIB 2Q3CA 4BNWA 1C7FA 1MVLA 3PC6A 2C0PA 4FD2A 4N03A 2CL7X 3BC9A 5ELLA 2E82A 4G4SP 3KLBA 3MD9A 1M9NA 4LEIA 4RDCA 1CWUA 3SHFA 3VYUB 3OA2A 4LDZA 3ZJYA 3BCFA 4BQFA 3UVEA 2D9RA 3GWGA 2F4NA 3TI9A 3ONDA 1EGVB 1C8KA 1PGPA 1EX7A 1P3DA 1LPOA 1L5SA 1ENZA 2WM9B 3KPUA 1TL7C 4B3IA 1SHJA 3JAKA 3M7IA 4YCDA 4JJ7A 4X8HA 3ZYCA 2Y93A 2FUNB 1JBEA 2LWIA 2P75A 5AHOA 4FWIB 4IINA 1LB1B 2EVWX 2BFNA 4PZLA 4C06A 2JFWA 2HW8A 2H1WA 2YN0A 5GZ6A 5LD2C 2IYFA 2Q3MA 1W9HA 1ZSVA 2WW8A 1PQYA 2X2FA 3GFSA 4YGXB 3Q8MA 2HPAA 1OC2A 2YIJA 1IG0A 2B7CA 2ATXA 3H97A 1QGZA 1L4HA 1UPTA 1YBFA 5F1OA 3Q41A 3I3SR 1UWKA 4IQGA 5JSYA 3QVUA 2DPYA 4RFSA 5F4BA 1XE1A 1TZBA 1YZKA 2FFBA 4Q3CA 3H3FA 1HSZA 3G8AA 3QJGA 4BMCA 5BWLA 3AKYA 2K6GA 3K73O 3OOCA 2VPXA 3PFCA 1V7PC 1NW6A 3IAUA 4WECA 5ARCA 3IE1A 2BKLA 1XYVA 2FLVA 1ZCFA 4RULA 4ZOBA 1A4IA 1WBDA 3QE9Y 4B8YA 5LJLA 1MF7A 4OLBA 5ESWA 3QY0A 1D8AA 2KI5A 5AVOA 4DUPA 1GTSA 1I2DA 1W4RA 2A67A 4HN2A 4DDKA 2P1DA 1B8UA 1ULTA 3HL0A 4RV9A 3WMGA 1CEEA 4K1LA 3C87A 3DHWC 1RLMA 4KLCA 3I61A 1ZM9A 3CJQA 4LI3X 4BVAA 1T91A 3E84A 3MTQA 4FOLA 4OJKA 2RCNA 2BM0A 1F60A 4C5AA 4JBXA 3ECSA 1JMYA 5ICGA 1E4EB 2YY7A 4DNRB 1U4SA 5LVAA 1NB9A 1E8NA 4BMNA 1WXXA 2KB0A 3D4NA 1DLIA 1VLMA 4J3FA 4FGKA 4LV8B 4PVDA 4E7OA 1K3UB 5JC1A 1YSCA 4AZ0B 4WQMA 1J0CA 1GGVA 5K1ZA 4OO3A 4OSEA 2QWXA 4HPJB 1P19A 3QFFA 1TYDE 2CUNA 4AMYA 2QQGA 5LZ2A 1V35A 3OTHA 3PPXA 1GZUA 3U7QB 3L8MA 3B3QA 3ZLBA 2FZWA 2C2XA 4LY3A 5FAKA 1DC4A 2FMXA 4IO0A 2PAAA 2IXDA 2GILA 3LLMA 5F98A 5FBWB 3FDZA 1T6NA 2WT8A 2W2QA 4ARUA 3SJPA 4J9UE 4IO1A 3DBLA 4BRUA 1PG2A 1U99A 1OAKA 2WU8A 3HP1A 5JV5A 1OU0A 5MDHA 4JKOA 2ZXIA 4UVHA 1GNLA 2FX3A 2X0NA 3KXLA 4ZVOA 4EQ6A 2XMCA 5IT9A 1EK0A 4CBVA 2OG2A 3A3BA 1MDBA 2VBCA 1M75A 2XMRA 2JIZA 3PCTA 3UWPA 2OYNA 2HD4A 3HV0A 3TLYA 4K9SA 5JLJA 2OBLA 2Z8YA 3PRJA 1J7KA 1SQFA 1B3BA 3FHLA 2I3ZA 2OV3A 2WSIA 2QK4A 5TGTA 4TUYA 1QZXA 3DC2A 4MGEA 1LRJA 3UUEA 1T29A 4AJKA 1P62B 3J7AC 3IELA 2QV7A 1K5DA 1SCIA 3LXMA 4P3IA 3I5YA 1II9A 4WK2B 4AWBA 4BMDA 4YV7A 4IDOA 3GDGA 4HG2A 5EXTA 1TC1A 1UC5B 2OCAA 2G72A 3DFMA 4I1PA 4E5UA 4LISA 4R8VA 3L8CA 5FA8A 2ST1A 4ZHSA 1TOAA 3QKTA 1HDYA 4NBLA 3I3OA 3VV3A 1U2DA 3MWKA 2GK4A 1C41A 2ZRPA 2C78A 1WUYA 2PXCA 3QTBA 5CUQA 4XLAA 4RDKA 5FA6A 2PU7A 3H9UA 1K7YA 1FNMA 1E6KA 3HN6A 4K26A 2PT6A 5LQRA 1EVEA 5K99A 3MIIA 5DX0A 4WASA 4QVGA 1YB6A 3KV1A 1JZTA 3L9XA 2CF6A 4JLDA 1QG2A 1Y8QB 2PTHA 3OLZA 4ALMA 3EWIA 2WV9A 2BL4A 2O20A 3JZMA 4J3JA 1M2NA 3JARA 2BAGA 4ZO4A 2UXBB 2CFIA 1CUYA 3ELUA 1PRYA 4FBGA 2ZWOA 3RS2A 3ZQUA 4EGJA 2M1XA 4BZPA 1K6IA 5JFGA 1W44A 2GN2A 2HLDD 4DJFC 4OYYA 2W2NA 3U3JA 4B32A 2CFOA 1FVHA 3PR1A 5CCEA 2ZRIA 4WKOA 1XPRA 1R9NA 1L5HB 1D07A 1VQMB 3HN7A 2XDWA 3PR2B 2L69A 2PL9A 1YJ9B 4YLGA 1L4UA 1EZ4A 3OX1A 2RGAA 3GLSA 1QHFA 3BH6A 4QVKA 3RGWS 4GS5A 9ATCA 3RTGA 1YB5A 4GBGA 4HF7A 4JB3A 4GOND 3MQFA 3OT4A 4NTZA 3VZCA 3UJ9A 2FZLA 4PS1A 1BKDR 4JGGA 3B3AA 3ZBQA 4XCXA 5BSGA 3PR3A 2WTBA 1XDWA 3FGPA 1KYQA 2YL2A 5K6AC 1PBTA 2V96A 1EBBA 2RH9B 3SX4A 2C98A 4HNSA 4DF3A 1AUPA 4HN9A 3RC9A 3GLIE 1FS5A 3W7VA 4LQDA 4K9LA 2PLNA 4NBUA 3CWZA 4EJ2A 5BMVF 1J1UA 3RRXA 4I55A 4KQHA 3JAKB 5TC4A 1ISIA 4DMLA 1B6TA 4RIEA 1WXFA 3LGSA 2PIDA 4RIIA 4JT4A 4TTVA 2YZKA 4P3XA 3W6ZA 4TKLA 1ZIYA 1O9BA 1PL8A 5GM1A 5TVKA 4A6EA 3OJFA 2Z04A 5JC8A 3E1KA 3HN2A 3W2TA 4B2LA 2VOJA 2ZRJA 4G5SA 4D9MA 1GYPA 4RZHA 3AF3A 2UUPA 4RFSB 1G41A 4PAOA 4UJ3A 3TNFA 1J2RA 3I92A 5KTKA 1KK1A 3I72A 3HYTA 5HG0A 2J6HA 4FGJA 4LRUA 4DIMA 3BNWA 3MCWA 1R15A 1V48A 3NPMA 1NJ6A 4IIYA 3T3OA 3DOUA 5HQTA 2ODWA 4AMGA 3CUWA 1Q0PA 1XUOA 1QP7A 4AF6A 3QP9A 1ZIDA 5LP6C 4F3YA 1FP4A 1ZOOA 3A27A 4M8LA 2NMVA 1ZUIA 1KMHA 3IPXA 4MW2A 2BBSA 1E3JA 3UAWA 1A1VA 2R97A 4E12A 2LBPA 2Q1SA 5CTAA 4ZYYA 4Y2HA 5CPBA 3HB9A 4ZU1X 5KU7A 4HNRA 1B0ZA 4HDQB 1DC5A 1QIMA 4EF6A 1G3MA 1NBMD 2NUPA 2AB0A 3NWPA 4M0KA 1XZHA 4HQKA 2RHMA 3VR6D 1FYVA 1Q11A 2I1WA 2HU2A 3SFVA 3DZFA 3IKLA 3FYUA 5CW2A 3A11A 2ZR8A 1ZMRA 1Y0RA 3QLEA 2EBFX 4HLQB 1RBQA 1V4VA 4V0KA 2ORED 4DKJA 5JZBA 1LKZA 1VA4A 3N2KA 4WZAA 3G0CA 2AUMA 1SOMA 4LJ4A 1ONSA 2WSYB 3EZLA 2OWEA 1E77A 5M2QA 1CFZA 1PNOA 2OKCA 3JD2A 4WOPA 3F6YA 4EI8A 3FDZB 3NTXA 2VJJA 3OPXA 3UEOA 3KAKA 1ZD1A 3DBLB 4UZFA 1P7WA 5HIJA 1BVHA 1B2LA 2RHRA 1FU8A 2EJBA 1SUCA 2LD4A 1G16A 2ESRA 3F47A 1BXZA 2BKAA 2RGBA 2XWQA 4EQ6B 5A4FS 2AXQA 2A58A 2DKOA 2PFKA 2QW0X 1D0IA 3GLHE 3H5OA 4YY3B 1GTRA 1LF0A 2JGKA 4JC0A 2OORC 5L4SA 1CUJA 5G4LA 1T5EA 2G06A 1T3TA 2P5SA 3MF4A 1TM2A 2CNLA 3I9MA 2IHYA 1ORIA 1C2YA 4V3BA 1GCUA 3CZMA 1R9JA 2I71A 2IA5A 2OGZA 5KQPA 2G82A 4TUYB 3OZEA 2WOOA 3ZE0B 2X0IA 1WMEA 4PPFA 2D3TA 1NWHA 2W6ID 4KTTE 3LCUA 3B2EA 4XLLA 3DO8A 3K8ZA 1GQOA 2X9LA 5FOWA 4HQRA 2PRSA 5ETJA 2OBMA 2DH6A 1FYWA 1GNRA 3GUVA 3PWZA 4H7FA 1W59A 3DCIA 3TTSA 1T9GS 3LQ2A 4GI7A 2VQFB 3G2IA 1Z47A 2R6R1 1HF3A 1QGOA 5JATA 1P77A 2PL3A 2YJ6A 3EEQA 5CYGA 4EGQA 1BGVA 4MYSA 4XYGA 2OHHA 4QG3A 2AR9A 3ZWBA 1CR4A 4GXNA 2OUKA 5BSHA 2VT6A 3LA6A 3V2IA 5ER6A 3QNUA 2Q62A 3P2JA 3BTSA 1TO2E 1JLMA 1XDGA 2OR3A 5FO0A 2O0HA 3H5WA 4ND5A 5AOAA 2Z2IA 2EW2A 2FV8A 4I8DA 2INGX 3ZCRA 4DARA 4UFPA 2KHZA 4CDRA 3FPJA 1BS2A 1CJMA 3E58A 4B9AA 3FB1A 1ES9A 3EGOA 3UTDA 3JARB 4PIPA 1WBBA 2A9VA 3GGGA 1IONA 4O4HA 1W73A 2XUQA 2G70A 3DBHA 2ACVA 4BQQA 2ZZQA 5FPYA 1IIBA 4KQ2A 3DAOA 4M1SA 3ZIAD 3FRJA 3HVIA 3MCVA 2OEPA 3GNSA 3NHZA 4GKJB 4NNPA 4P0PB 3TEFA 2R85A 4JBIA 3NEJA 4Y9UA 3W3AH 3FWHA 3SZMA 5F78A 4A8JA 5K09A 1YJXA 4Y1RA 5CBPA 1PZMA 3TWOA 4JSRA 3WIEA 3ONFA 1SVMA 2N46A 4DK1A 5T3YA 4DDUA 2ZTHA 4KI7A 4AY2A 4L74A 1QHEA 1SUAA 2GJRA 1W5EA 2P6OA 2WTEA 4MUXA 2O19A 2P6MA 2JF0A 2VHVA 4JZYA 4PIMA 1IHXA 4F1KA 2EFEB 4NK4A 2CZGA 5IH7A 2AZ4A 5GV7A 4HWRA 1TJ3A 5FXMA 4ZO8A 1NXWA 1NW9B 2C3YA 1T4CA 4M9ZA 3S1SA 1DDGA 5C8XA 5EZYA 2H65A 2VQDA 2YJZA 1F17A 3OD1A 1UZAA 5I9LA 1N77A 2CMGA 4EX7A 1Z9BA 4QFCA 1KY2A 4L15A 5EOVA 3ZEIA 1MFPA 3LWZA 3OQ6A 4HX2A 3VR5H 4K6MA 4I55B 2YQ5A 1I7DA 1ARZA 3PLNA 2B1JA 1XNRB 1L6IA 4E5YA 1RKUA 1N32B 4A5OA 1FUEA 2O2IA 3PGVA 4JQOA 1FSSA 5KQLA 3IMCA 1YONA 4TXMA 2P9QA 5CDHA 1H1TA 5MF6A 3RS9A 6ABPA 1UADA 3FWYA 4Y6LA 1KU0A 1DEXA 1Y5RA 3C3JA 1JTEA 3DDZX 2AFHE 3DOEA 4J0KA 4N8DA 1RU3A 2BZ0A 2D0PB 5AM2A 1VLJA 4J4TA 3RSQA 2EX4A 1HLFA 1GRNA 1FMLA 2IIVA 4JBHA 4M98A 1YFLA 3E03A 3RR2A 4U7GA 3OTWA 4P81A 2QMYA 4PRKA 3RT1A 2V4ZA 5A4MS 4X64B 1IC6A 2NAFA 3F2VA 4MKHA 4UM5A 4AUNA 2B30A 3PNPA 4HC4A 3FBTA 4MYDA 4PN3A 1JJ7A 3KKQA 4ETNA 2OBSA 1VGRA 1Q0UA 2A1IA 1FP4B 1U4NA 2HV8A 3DQQA 2A92A 3FETA 2XDYA 3UKJA 5FUBA 1KMHB 2WRZA 3U3DA 5KNBA 3LOPA 3FR8A 1ODJA 4MIOA 2Z2JA 5IDYA 4NU0A 3ZE6A 1WXHA 1DLJA 1M6WA 4DWWA 4TUYF 1XNQB 3BG5A 1SCDA 1FK8A 3L02A 3R40A 2NUPB 1Y0YA 4ON9A 3H8VA 4H35A 1OI3A 2R68A 3U4HA 3SE0A 5IBRA 3GUHA 1RRMA 9ABPA 3ACBA 3SS7X 3FYUB 2GZRA 3MCTA 3N1UA 5K3BA 1HE8B 1NQWA 1PU2A 2MSEB 3QFSA 4PGOA 3K09C 3N2KB 2CK3D 1TM3E 4FU0A 4HGNA 4WZAB 3TQHA 3VH3A 1PX2A 3KCQA 1U7TA 3UMRA 3ZVMA 2G71A 1W34A 1E9VA 1W2HA 3RT9A 1NDHA 5L6MB 5CNIA 3UMSA 3MT8A 2XZLA 5THKA 3S28A 1DJQA 2R6GA 3BX1A 3CLSC 3M89A 4UPEA 1OVGA 1U7ZA 3FTQA 3VR0A 3I1JA 1SHTX 4V0ME 3E9ZA 1N25A 2BGTA 4TSRA 4KXQA 2Q07A 3RFVA 3ZDEA 1JG6A 2N9UA 5C2JB 3C5VA 5CEFA 3A1PA 1X1EA 2JH9A 3GW8A 1AXEA 2R62A 4FYVA 5ICMA 3R0XA 4V24A 1Z0JA 1T43A 1PEKE 3QPCA 4QBFA 1VHDA 5KVVA 5GMOA 3CWQA 1PN3A 2BW0A 4Q24A 4FDLA 3QBEA 3I6MA 1NULA 4GSKA 1S3IA 2PIAA 2JFVA 1QFSA 2BD0A 4I3FA 4XX1A 3SYLA 2CDBA 3MBKA 1HPLA 5JO9A 4CL3A 4DLTA 2ZSAA 4RXUA 5AK6A 1KVQA 3OECA 4XZ3A 4KV9A 3EVTA 5KWIA 1KDVA 5TSDA 3SEJA 3LUCA 4I3HA 2GFIA 1UK8A 3KXKA 3R7DA 1NUHA 3PE3A 4OFBA 3GJZA 4MZXA 3BJIC 1CUHA 1A95A 3N6VA 3C3YA 4FN5A 5JMWA 2PKYX 3SDSA 2GSDA 1G7TA 1YZVA 2YV3A 3QUSA 4RQTA 4FYJA 1XIVA 3QI2A 4CCWA 4ZJPA 1RP7A 1XAHA 4AB1A 2YMMA 1P7PA 5CX1A 4FVTA 1KDPA 4FHCA 1Z0ZA 4C0XA 1TUGA 2R6CA 3LGAA 2QD4A 3WNDA 4TL9A 4LJ7A 4YCAA 5A2QA 3NWOA 3L41A 5LBIA 3UJ8A 5TS3A 1XMPA 4I55F 2GAOA 4LOJA 4RL4A 1PYOA 1XCPA 1LK0A 4Q39A 2DX7A 3A8TA 1IUPA 3K20A 5F51A 1U63A 4CQMA 1MJ5A 3UJAA 4O4HB 2FSPA 3WLRA 3P26A 1GFWA 3DBHB 1Z4QA 4ZZIA 1QDLB 1Q1QA 1VE5A 1BMQA 5L3VA 1YRQA 3GMIA 5H82A 4UHKA 2H4YA 3AP1A 4AC9A 1XRLA 2FJPA 1U0TA 3DQZA 3HBNA 2XQFA 3MTDA 4Q66C 5LP6F 3VVMA 3K0AA 4LJ8A 4A8JB 3VR4A 2FUG1 3EA0A 4Y1RB 4S35A 1AGXA 4YQEA 1C0EA 4B8ZA 5CBPB 2ZL7A 4Z4QA 3ZG6A 1U7UA 4LTDA 4OVKA 2YFQA 1J97A 4FILA 4NPHA 4JD5A 3L7YA 1BHJA 1GKKA 4HNAA 2VHYA 2WAYA 5M3BA 1WOYA 3U1BA 4LTNA 3GCXA 3UWKA 4FKMA 2NADA 2JFGA 4UBKA 2GPBA 1B8VA 1ZD9A 2L18A 2PGOA 2D1SA 3LX5A 2EYUA 4Q1DA 5I7EA 5K8TA 4YRJA 3PTLA 1T4CB 1AHNA 3Q9NA 1WRBA 1VG0B 5EZYB 2ZAYA 3BXEA 3BL8A 4OMFG 4XDZA 1KEUA 2UYOA 5IBQA 5I3ZA 4ZAZA 2HYIC 3LP8A 3KJHA 1RZRA 1L7EA 2ZWVA 2HHHB 1TU0A 4QTTB 2YJTD 4LOKA 1OTYA 4KV7A 1VLZA 4WJZA 5HJEA 2N1MA 4M9XA 1L4NA 1ULHA 1KD1D 1T2NA 2DR0A 5SY4A 1GUZA 4OHWA 1ZESA 4LTMA 1S8FA 1AURA 3NAGA 1G18A 4Z51A 4WVFA 1O6FA 1PJZA 1NF9A 2QLFA 4HLUC 1BG6A 2PYDA 3ESYA 3V34A 1VKRA 4KPYA 2D3LA 2QXUA 4ZAFA 1S9DA 3QWIA 4G01B 3QENA 3HJRA 4V0QA 3RABA 2H7XA 5GTDA 4K46A 5JAZA 2EX0A 3DFKA 5TT0A 1XALA 4INPA 2A0FA 4ND3A 4X66B 3LT1A 1CUAA 1Y9DA 2BZ1A 3R5FA 4OX9Y 4A10A 5HGJA 3I6IA 1J56A 4G09A 1W0JD 1E58A 2QJOA 4RHCA 1J9EA 3NIDB 1M5UA 4GI2A 2JGDA 2O5CA 1VMDA 2QVLA 3CVYA 2XTMA 4HGOA 3ZWVA 3F7NA 3HABA 3JQCA 3NHKA 2ERXA 5EUQB 2A7XA 4W5QA 3IO3A 3OM8A 1UZUA 1MAUA 2XJ9A 3K2BA 1FFAA 3A6JA 3LPCA 2FRDA 1DAKA 2O2CA 3HAGA 2GZHA 2ZJ4A 4OQ4A 4JMLA 2ZULA 4RZQA 5AIAA 1EXDA 3K2IA 2RIPA 2E0IA 2F1KA 1CKEA 1Z0SA 3I6YA 2DB3A 5AJYA 1AQYA 4HEA6 2H1OA 1WOPA 1ETHA 3VDRA 4RSMA 5ALQA 5TMEA 2EIHA 1KYYA 3X2SA 2VDOB 3PNLA 2HQ1A 3CLHA 4YI5A 5ESXA 1H6DA 2ZR0A 1RI4A 5SZIA 2FWJA 1KZ6A 3BBLA 1H8EA 2P4HX 1TRKA 4OJYA 4HNVA 1ZX1A 2H2DA 1PFWA 3DTVD 1KO5A 3GDHA 5B58C 1HE5A 4LKOA 4UFOA 3RUDA 1XLTA 1UEJA 1NJFA 2C31A 3AWDA 3IEVA 4O2AA 5ES3A 1VLLA 2PNJA 4BN5A 1W5SA 4GO1A 4RD3A 1RTKA 2DF8A 4OUDA 5EIOA 2NZXA 5K0GA 1NBHA 1ZN7A 3PQ8A 1AH2A 3R76A 3EG9A 4B6RA 3FZQA 2IXEA 3ZHUA 4N3NA 3JSAA 1Z88A 3VKUA 5A4IS 4HQNA 5DBGA 3S55A 2JVIA 4O4HF 2HMWA 5J4HA 4RLZA 4V02A 4ZA2A 4PXSA 3HMQA 3AF0A 5JVDA 5EHNA 2F9LA 1V8ZA 1DHTA 3AUJB 4Z4EA 3W1EA 4F6RA 1XTTA 4MPRA 4RLHA 3VMMA 3HXPA 2X0KA 5TNXA 5HIAA 4YELA 1JBKA 2JD1A 3CG0A 4MW7A 1WO8A 1DVRA 4DIDA 1EEXB 2FLKA 2QP9X 3KZ1E 3UJBA 5EIXA 3AYXB 2GPNA 3ISJA 2Z8XA 2YH2A 1J99A 2H1LA 4B17A 1PX0A 4UTNA 1SVKA 1T8SA 1HY3A 3THWA 5T4EA 3UK2A 3QM1A 5LKRA 2AOTA 3I64A 4B9EA 2JI8A 2P62A 5TEVA 1V7QA 1XVLA 2Q45A 3GUCA 4RKWA 4ZZ2A 1KY4A 3HZZA 1DBRA 1EINA 5FR2A 4Q3EA 5COQA 1PQPA 1NZJA 2CJFA 3GHHA 1YZHA 4L8WB 2O8NA 1XMVA 3AEKA 5CX1B 1NI5A 3K9WA 2H4JA 3JYHA 1ABFA 4MA0A 2A94A 4YI3A 3AY7A 4ZVTA 1GT91 1ESEA 1WDMA 1XQ9A 4TL8A 1LGYA 2OZEA 2F00A 2Y6VA 5D8DA 1W94A 2G67A 3ZTYA 2DU8A 3RDPA 3IBCA 4Y2UA 4IDPA 4JL8A 4CQMB 4DUYB 3KT0A 3FYSA 1TXGA 4PZEA 5DOZA 2I7XA 1E7RA 2I7TA 5HZAA 1EVKA 3BE5A 2JLCA 3W9SA 5C5EA 4L5YA 4ALLA 2FPWA 3GYBA 5LXTA 1J0XO 2PX3A 2QZZA 3DXZA 1HMYA 1N5OX 4JU8A 4KQCA 1XRRA 5ERXA 3IPRA 2BIFA 3W5UA 1UMDA 1XCBA 3EXHC 3A2NA 2V7UA 3EULA 3K0AB 2W0MA 2Z95A 3OIDA 3EIFA 5CFPA 3HJCA 2Y4OA 5BRAA 4QZVA 1TQ4A 5TY0A 4KSBA 1WEKA 3PC2A 4M7RA 4WEOA 4ZOCA 1P5RA 1YJ8A 3WC4A 5IN4A 3SGLA 5JBNA 1EX9A 4HNAB 1MAHA 3UFBA 4DREA 1OFUX 4QUKA 4F5DA 4DCJA 1UFOA 3S40A 4IIJF 5BV1A 1QH9A 3AFMA 4JGBA 4QDTA 1JDTA 3MHPA 1L5NA 1CEYA 3LSTA 5B2FA 2YZ2A 5FNVA 2VBGA 1X80A 1HQYE 3C41J 3ZJVA 5K8LA 4O3MA 4Z8XA 4RANA 4RVUA 1SWWA 2FJ0A 2AN5A 1P4AA 2GAFA 2IUSA 1R9GA 2IYOA 2JFFA 3CH4B 3VH1A 4D43A 5BR1A 7GPBA 5L95A 2DY1A 2XZOA 2OYSA 2XITA 3GEGA 4H16A 4R01A 4AXXA 2B5VA 2CB0A 1NY5A 2V7EA 4NIMA 5SY6A 3T54A 1E2MA 2JFPA 3NBFA 3X0DA 1ZR2A 2HT1A 5FWAA 4W99A 1IRXA 1YAJA 4X92A 2C2KA 4XUDA 2RC5A 2OSVA 3NHBA 2PUAA 1KOGA 3E81A 1GO2A 3GQVA 1QFMA 2FF7A 4ZGGA 4NI5A 3I9V1 2I4NA 4GQAA 3B1FA 3HJGA 2I6SA 4I1SA 1P5JA 2OXIA 3BPSA 4FW9A 2JLWA 3CXUA 3BKWA 1H2RS 3L6UA 3A25A 4MB0A 2G5TA 1LFAA 1JAZA 5HX7A 5I7SA 4TSFD 1MOSA 3NDPA 2IPNA 2DWUA 2BSXA 2JEZA 1GYQA 1E7SA 2G0TA 5JPIA 4QHTA 4EI2A 2AK3A 1IB6A 5IK2D 5KQRA 4PQGA 1VG9B 4MWCA 1XTPA 3TBHA 3TG2A 1KJYA 4P6YA 2QJFA 4DAOA 1Z15A 1I1QB 3RWBA 1DJNA 1XZEA 5T8KC 4EKDA 4RVFA 2JGDB 1MG5A 3A32A 3N70A 3OIUA 2FP4A 2J9ZB 3KEGA 4LRSB 3OEHA 5FWDA 2X7JA 4YT8A 1SQ5A 3B2QA 1DCMA 4D4JA 4MB6A 5C81A 4XTCS 1ZCAA 1W1UA 3IILA 3JQQA 3O82A 2BTQA 3PXGA 4JMPA 1U1DA 1VIMA 3CUEF 2Q5EA 4Y30A 4ENPA 4Z6KA 2O06A 1GUFA 2E3JA 4UXJA 2IODA 4EO4A 4RVHA 1S5PA 2PQ0A 2CUKA 2ZGVA 2JFOA 3AM3A 5EIAA 3RUCA 3AG6A 5KNCA 1FFYA 2N0SA 3CLRC 3NKVA 2RK6A 3I8XA 3LA8A 5FPKA 2C61A 2CV2A 2PMEA 4R68A 2QTGA 3ZNQA 5MHTA 2DLDA 3T41A 1L8XA 1HTTA 1KZ1A 5CFZA 2WYOA 5EZ6B 1SGWA 1HI9A 1LPNA 1GADO 1NP7A 1X7DA 2WYWA 3LMKA 4NZYA 4US0R 5F2KA 3FBGA 5KWJA 1D2NA 1EB9A 3ASZA 3Q9SA 4W82A 4XASA 2I55A 4KIJA 5JY1A 1P17A 5J3JA 3NNDA 1CIJA 1A72A 3I0NA 4O2AB 3PGJA 4N6NA 4AQ7A 1E2LA 1OH6A 4OUDB 1XNGA 2ZCJA 3EG9B 3QQPA 3TR6A 2P67A 3CNEA 3IALA 4Q15A 3WIOA 2ZM5A 3MB8A 2JFZA 3EEFA 3V76A 2H1HA 1GG5A 4FT2A 4K03A 2VCHA 3TZHA 5LLTA 5HCIA 1AG9A 4DJTA 5JVDB 5AJHA 1SXIA 1UINA 4F6RB 1T3ZA 4EO9A 4O2LA 2FN3A 2ATVA 3BH4A 2FLWA 5F7ZA 2W2LA 3EMKA 3MK31 4NYJR 4K9DA 4C4TA 1M6EX 1ZA1A 2JCBA 3E9CA 3WIVA 1SC1A 3FUCA 5IN5A 4BVJA 2Y1LA 1ZWKA 3V9AA 1ORHA 3THWB 1EI9A 4B44A 1X7WA 1OBCA 3R7AA 2D5BA 1PWXA 2PE3A 3MAJA 4W1QA 2AOTB 1PFKA 3LT2A 1IZ8A 4UUPA 1HC7A 1YU6A 2XUIA 4E2YA 3Q10A 5JS1A 3DMTA 5TQ0A 3FJOA 4N5DA 3C7DB 4CMEC 3CJRA 1H1DA 4H0CA 1MX9A 3ACDA 2NXNA 3ROTA 3STTA 1RYBA 4GVXA 5FH9A 3AEKB 3NNNA 4TYMA 4YUYA 2GLTA 4DG9A 4GUAA 3MERA 3HKBA 2YNMD 2NTVA 3PKJA 4QUGA 1TCBA 4YGYA 5HEKA 3RRYA 2V3VA 3TECE 1FS4A 4LDRA 1BS1A 2O57A 4UE6A 2BHLA 3AI3A 4D3SA 3ZYZA 4JJAA 2OMEA 1FSFA 1G291 1K8YB