4M53A

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in complex with gdpcp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
403
structure length
403
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 104
structure length 403
sequence length 403
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m53A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m53A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m53A01
1ZVQA 3SJZA 5AUNB 4MA4A 3OJXA 2OG2A 4MYCA 2CL7X 3OIWA 2QDXA 2QROA 1Q0UA 1IJEA 5JWOA 4GSYA 3TIFA 2ZXUA 3I5XA 2RH5A 2WKRA 2F9MA 1ZIOA 2X19A 4LGMA 1R5NA 1Z08A 1YI2B 2XNSA 3BH6A 3UMFA 5JFGA 4IXNA 1Q82D 3CR8A 1KSFX 1YU9A 1F48A 3FGNA 3K8YA 1SQ5A 2DCUA 3NH6A 4P4SA 3V4FA 2O8CB 4LC0A 3HWSA 4PC3A 2PH1A 3ZD6A 4D4LA 5EUQB 1E4YA 4QBGB 1CEEA 1P2TA 2ZYVX 4TLBA 5LPNA 2O8EA 2JLRA 4AI6A 3OZXA 1GL9B 1I4LD 4PX9A 5C1BA 3K0SA 4RFSB 1JR3A 3WMFA 1JXOA 1DE0A 2RGGA 1TADA 3GLIE 1KJZA 1O3YA 5FOSA 2O8BB 1NKSA 4YMSA 5HE8A 3W34A 3GJ4A 4FCTA 3AVWA 2FSHA 2IK8A 2PX3A 2XOKA 1XPRA 1Z0IA 4DUGA 1AQUA 5TMPA 3IIKA 4B6EA 1ZMXA 3VR6A 3TAHA 4D6PA 5DI3B 1LW7A 3NG1A 4R2HA 2ZI6A 4PHGA 1KD1D 3WNCA 1FUKA 3SS8A 4RD4A 1IAQA 2F43A 2JCSA 5L3QA 5LD2C 2A30A 2EFCB 4OHWA 1NG9A 1DVRA 4ASUA 4G5SA 4G1BA 2QP9X 5E4FA 3UMSA 4RZ3A 5J4YA 1SXJD 3C14C 1G21E 4JJKA 2YOFA 4KVGA 1JAIA 1UPTA 4HLUA 4PPNA 2ZSFA 3A1TA 2RGDA 4UXIA 1IB0A 4BLSA 3KQUA 4OQNA 3T06B 5FPKA 1T3SA 1KMHB 4Y7CA 1RVDA 1YE8A 5DNYB 3R8CA 1XXHB 1J70A 2YNMA 1II0A 1VHTA 2JGNA 1KI9A 3LQQA 1G20E 4IOKA 3FPKA 1L7VC 3I73A 1E2MA 2FN4A 3LDAA 1MO6A 2W6IA 4OJQA 2QPTA 2WV9A 4V03A 3SDZA 2BBSA 2WBLC 5SZIA 3QG1A 1GVHA 1IY1A 1MO4A 5FL7D 2D2EA 3TUJC 1ANKA 1MOZA 1GILA 4TQUS 1YJ9B 4XIGS 3VHLB 1NRJB 3FYHA 3TMKA 2JIZD 2QI9C 3A4MA 1QHYA 3CNLA 4D0LB 1KJYA 4HLUC 1OIWA 4Z54A 1CULC 3LLUA 1DBSA 4XH9B 2RKOA 4LBYA 1F2TA 1J99A 2WWFA 3I3SR 4TTRA 3DZ8A 4IVPA 3GLFB 1ZNXA 2G0NA 3GCGA 1GSIA 3Q8XB 4JLBA 4NCJA 3DMDA 3UKDA 4IDNA 1NIJA 1GJRA 5HKKD 3OZUA 2ZITA 3LO5A 2R62A 4FK8A 3FFAA 3RAPR 2A2ZA 3IEUA 2H57A 1OFIA 4OKSA 4HB0A 1F20A 2WJYA 4A1FA 3CH4B 5JS8A 1NJFA 2GVZC 1R7RA 3NIBA 2GF0A 3FMOB 3TVTA 1VKJA 2IYZA 3H2YA 4M1WA 3VKGA 3QFTA 5E7IA 2GCNA 3NHAA 4EPVA 3CCSB 5KDLA 1ZM4A 4Q48A 1W2GA 3VX3A 5IT5A 5KTYA 2ZI4A 3KXIA 1ZM2A 4IOJA 1IN7A 2B92A 1DAEA 3S1AB 2CK3A 1KDRA 2QE7A 4PQRA 4D2IA 3OHMA 2C78A 4AD8A 5LB4A 2QTHA 3VX4A 2PCJA 3F5FA 4PAMA 1E2KA 3M0EA 1H8HD 1SULA 2CHQA 2OV2A 3X1YA 4BWYA 1LF5A 3CPEA 1KNXA 2ZRCA 4KXFB 5AN9A 4QKQA 2XNDD 1P7CA 2IXGA 3K53A 3SBEA 8OHMA 3PUZA 2CJWB 4QBFA 4DLRA 4TYQA 5UKDA 4EH1A 1GNRA 2GEUA 1GDDA 1HTWA 1OE0A 2QMHA 3CLVA 4FMDB 5CYOA 4LHXA 5KOYA 2J87A 2R6GA 3QXCA 4M9ZA 1ZAKA 2PJZA 3T15A 1W44A 4MITA 1TF5A 2W6JA 3B1YA 3RYTC 2ZS7A 2OHFA 3HP1A 1XTKA 4QNMA 4UJ3A 3FFBA 5EQTA 1KAGA 1P2UA 2JDIA 1RRPA 1ZNWA 4UNSA 2YWFA 4A0GA 5JWHA 4YONB 1UBCA 5AUPB 3RS3A 2HF8A 3ETLA 1BJKA 5BN5A 1EX6A 5DO9A 2QORA 2YZ2A 5KSZA 4LC1A 4R2IA 3LVBA 4Q9LA 3L82B 1OKKD 1L8QA 5DN6D 1ZIPA 2ZANA 4US0R 4JL5A 5A0FA 2EFHB 4WBSA 3TSZA 4DDUA 1D6JA 4M9XA 3OE7A 4DSTA 1U0JA 1SVLA 5D3MA 1HYQA 1XCGB 1JNYA 1CQXA 2V1UA 4XTCS 3OZVA 3PV0A 1FOEB 1S96A 3MWLA 1NJGA 1WBBA 4C0LA 1E94E 1E96A 3I5YA 1CTQA 1P6XA 3MWKA 1OT3A 2XNCA 2C2HA 3WRYC 3K70D 5L3VA 4MKHA 2XITA 4MUAA 4WXPA 2EFGA 4GPTA 5B30A 5EZ5A 4GOJA 2QMUA 4YDSA 4QJ5A 5CIQA 1KI1A 5CM9C 1JR3E 2FPKA 3ZC3A 3LX8A 4TL7A 1UMKA 1QRAA 4JSYA 3SJAA 1Z6XA 3ASZA 3LVQE 3QKRB 3CRMA 3DEFA 4BFWA 1G6OA 4M2LA 5KNBA 4GI7A 1I4DD 2QSYA 1AKYA 1KDTA 1TEVA 4URWR 3U7EB 3SJBA 2WHXA 2R44A 2NO0A 3A4NA 2ONJA 4TYNA 2J0UB 4MKIA 2VO1A 1BH2A 3GJ8A 1X8KA 1QHGA 3EZ7A 1G6HA 2H5EA 1BYIA 3T61A 1D1NA 1XPOA 1KK2A 2ORVA 1ZCBA 1KC8D 2RCNA 3BJIC 3IIMA 3GEEA 1D8TA 1X1SA 1UKVY 1XEXB 4RZXA 2OLJA 1NSFA 2GDJA 3VTKA 4TMXA 5E3HA 2WKPA 1N6PA 2B5OA 3M1IA 3EARA 4AKHA 1Z5ZA 1OIXA 1SHZA 2DFLA 121PA 4Q03A 2VRWA 2GVDC 1P2SA 5A5GA 3GJ5A 2XZOA 3TW8B 1E2NA 3M6AA 1VIYA 2NTYC 2QA5A 2ZVPX 4GDFA 5AR1A 3NDBB 2O8CA 4Q4JB 1PLJA 2N42A 4D4JA 4LPKA 4ERNA 2DWOA 3SYNA 1VECA 4Q21A 4HB2A 2OBNA 3GEHA 1E1QA 4WOPA 1R0XA 3OFND 4LYJA 4POAA 1H65A 2N46A 4JL6A 4NYMQ 3CONA 1GVNB 2R6FA 3Q7PA 4IDOA 5DHAA 3MD0A 3RS7A 5KPJA 1KHTA 1QUEA 3KUCA 4TQ9A 1KI2A 5JEEA 3EA5A 2YJTD 4CT4B 2BSAA 1GP2A 1CBUA 1N6IA 3WHKA 4W9MC 4OQXA 1EGAA 3T1TA 4KLZA 3LH5A 1EX7A 3HJNA 4BLTA 3AVOA 1E0SA 1FW6A 2WJVA 3OW2B 1VQ9B 2C77A 1YZQA 2W0SA 3LY5A 3QF7A 2D06A 3DKVA 1KK3A 1U99A 3PUYA 4FMDF 4X8OA 3PEYA 3T35A 5KNCA 2PLRA 3M4YA 1MABA 2F9LA 2OXRA 2AR7A 2GEVA 4NE2A 2RGAA 3TNFA 2VNHA 2DYKA 3SBDA 5CYPA 3VKWA 2IA5A 3Q5EA 2VHJA 4Q1CA 1E2QA 1KMHA 4IXMA 3DL0A 3U7FB 2YV5A 1AM4D 2ZE5A 1U2RA 1XXHA 2QMOA 2HCBA 3A1VA 2JLVA 1EXMA 2C9YA 5FR2A 5FTKA 4BLRA 1VG9B 3KTAB 1IXZA 1COWD 3RSLA 2FX3A 1E69A 1E9BA 3K0FB 4GRAA 4R71A 1DG1G 2R9VA 2XXAA 5HTKA 3EIEA 4TLCA 2ZYUX 1I4TD 1CU1A 3OZWA 1KTVA 5K8UA 4JT2A 1QFYA 4TT3D 1H8EA 2V7QA 3TUZC 1QFJA 5HCIA 1E9FA 1VPLA 1E2EA 4M1OA 1DEKA 6Q21A 4LV5B 1E9AA 3WBJA 1S8FA 2CLDX 5CK5A 1NP6A 4WZBE 2R65A 1BQEA 3DM5A 4TZ6A 2AK3A 3JQRA 4WXRA 5KO2A 2X1VA 1LS6A 1GRRA 2YHSA 2WIBA 3B6EA 4H1UA 2WJIA 4OI2A 3Q72A 4TYYA 1VQPB 1SVKA 1FQJA 3TE6A 2GRJA 3ZQ6A 4YAOA 4JZKA 4DCNA 5DHFA 3VR5A 1W34A 1TUEA 5EE5B 1H42A 1Z22A 3QENA 3QVUA 4JLNA 2OAQ1 4MQBA 3BFKA 3U2QA 4AF7A 2JLQA 4OQMA 4P4SB 4DDTA 4AK9A 5IHPA 1BO6A 1EFHA 5KYKA 1QG0A 2BKUA 4UNPA 2VNKA 1T4GA 1J8YF 4U02A 2BHRA 3REFA 5LD2B 3CX7A 1SVWA 2RC6A 4ZV4A 3BH0A 4G01B 5J40A 2G6BA 2O8EB 1FMLA 1KAOA 2ZAMA 1R2QA 1IONA 2J46A 1P5ZB 3S1AA 1PLKA 1XWIA 4PHTA 1K9MD 4ITRC 2LKCA 2XNJA 1TU4A 4WVFA 2DETA 3Q5DA 4HLCA 3LBNA 1Q1QA 4NCIA 3K0AB 4B34A 1S9HA 2XTZA 3IDQA 3MJRA 4TYPA 2RB4A 3AF3A 3P20A 4TLDA 5JJLA 3DHWC 1VQMB 4B3BA 3IGFA 2XJ9A 4PHHA 1V43A 2J7PD 4LHYA 1FNBA 2CJWA 2GXQA 2X3UA 5TB5A 4K46A 2KE5A 3PR1A 2X2EA 1SKYE 1E0KA 1E4VA 4DLVA 4A0HA 3W3ZB 1YITB 4A6XA 2VF7A 3GJXC 5JLJA 4W7SA 3SZRA 3NHBA 1R8QA 4I1SA 3THWB 4CEHA 1Z0KA 3KJGA 5JECA 1SVMA 1OGIA 4YLGA 3U3KA 1F3OA 1EWQA 2BVNA 1Z47A 4EFMA 2DFKB 3W6PA 4KI0A 2P5SA 1M1YE 3PITA 2CNDA 4OHVA 4AWXA 2OCAA 3F0TA 2V8OA 1XRJA 2ZRFA 4PC2A 4KAXA 1TL7C 3BAFA 4GMDA 4IOLA 2OCPA 4KFUA 2BJVA 4X8LA 4BFSA 1E2DA 3OJWA 1TNDA 2ODWA 2VYFA 3A37A 1E2IA 3BS4A 5HZHA 2CRVA 2OZEA 4AKIA 2VNJA 2DHRA 3IO5A 1XU4A 1W49A 1QVAA 2IWHA 3CO5A 3NTUA 2BV3A 1XD2B 2CVHA 2Z4RA 4Q66C 3I56B 3TW4A 4DWJA 2YOGA 4ZI2A 3U4QA 4L15A 2RGBA 3QKTA 4N3NA 5J47A 1L4YA 3RANA 1QH0A 1N8RD 3SYLA 1VHLA 2ODBA 4JIMA 3U61B 2AFIE 5DYIA 1QZXA 2BPOA 1G7SA 3B9PA 1E2GA 2G83A 2AXPA 2NG1A 2VSOA 3BWDD 3NC1C 3QPVA 1JR6A 1ZD9A 2GNOA 3AF1A 2V4ZA 3TJZA 2IF0A 4MRPA 3TQCA 3MWYW 1PJRA 4DCTA 5HR5A 4M4SA 3BB1A 2GK7A 3V00A 5AJWA 5TXGA 2VF8A 2XSZD 4YMWA 1FDRA 4BFZA 1S9DA 3ZD7A 3VMFA 1EFUA 3EWAA 1E2LA 4XD7D 1NKTA 4MGKR 1UEJA 5FL3A 3BBPA 4HDOB 3QKRA 1BKDR 1N6HA 1LNZA 1TX4B 2NPIA 3UK6A 4QGFA 2Q6TA 3ZIAA 1FNNA 5L8VA 2GILA 4Q4HB 1T5LA 4I1VA 5EXXA 3OEHD 3BFVA 2VHCA 3X1XA 5F9FA 2EW1A 4ILEA 4YC7A 4CZ2A 1Z0DA 2J0UA 3FMFA 2XJ4A 2AKAB 1E79A 1G19A 2BBTA 4FMBB 4TMKA 3IHWA 3QE0A 4B33A 3WMGA 4C0QC 3ES9A 2QUZA 4UNNA 1VCNA 2ZJAA 3TAUA 3UWOA 4P31A 4LJ8A 5H70A 4XTRA 1ONBA 4B44A 2CNWA 2BMFA 3KB1A 3CM0A 3TH5A 3WP0A 4B71A 1GR1A 1XXHE 2VL7A 1SXJB 2JLSA 2VSXA 3QI2A 1GKYA 4GZMA 4B3FX 3DM9B 2RAPA 3GJ7A 4KYIB 1RYHA 1D2MA 3KJHA 4Q1EA 5CLLA 3RSOA 3AQ4A 3U7GA 3AVQA 1AN0A 3IQXA 3B5JA 2C8VA 3LQRA 3LWNA 4Q4JA 2UVQA 4EQ6A 1E32A 2WWWA 1W0KD 4OI4A 1A1VA 2FF7A 3ADBA 1A7JA 3B1VA 3W2FA 1F2UA 5E7MA 1J9ZA 4Q1DA 4LYAA 1FP7A 5KDDA 4CVNA 2HLDD 1VQ8B 1M6NA 1A2KC 2OEPA 4GBMA 2CBZA 3U6BA 1NBMA 4LK2A 5EP4A 4JVSB 3VNUA 2F3TA 3E2IA 1D9XA 2AFHE 3EPJA 4AY2A 1RW4A 2YVUA 2KJQA 3ZS9A 1UDXA 4C0BA 5BYKA 3GLFE 4F4CA 3AGQA 2YC4C 1OYWA 1Z6TA 4L8GA 4RKEA 2FU5C 2JJ2A 3NBFA 4K81B 1GKIA 1OXSC 5D3MB 1ZU4A 4EPXA 1N25A 5FI0B 3CWQA 4P6VF 4MGZR 5J4LA 4F91B 2Z0MA 3KFVA 2ZE6A 4PO9A 4CEIA 1G8YA 3LA6A 3WYAA 3W2EA 3I8XA 5K8TA 5IDVA 1WBDA 2GZAA 4ESHA 1JR3D 1KI7A 521PA 2ZYWX 5TARA 3KFXA 1XFAA 4TMTA 1PLLA 5K8IA 4RD2A 4LJ7A 3KXLA 2IYWA 4BEJA 2XOKD 5C2JB 4F38A 2BGJA 4KLNA 4TQAA 3REGA 3K0FA 4BFTA 1M1KD 4BRUA 4DUGD 4QJ4A 1PUIA 3C8UA 3A1WA 1W1WA 4WIAA 2XTNA 2IXFA 2GJ9A 4R9UC 1I2MA 3T5DA 4ZKDA 3BB3A 2VP9A 2ZJOA 2C98A 1UBFA 1R8SA 1X3SA 1QX4A 4NL4H 2NPFA 3W9YA 1CR1A 4Q7LA 1W4RA 4ASUD 2UZIR 3W5UA 4HAUA 4Q7MB 4IHQA 1VQNB 3EX7C 5JCPA 3AV0B 1AK2A 1ZUIA 2QG6A 4PTLA 1VQ6B 2YWGA 3K9HA 2A7QA 5FPSA 3KQNA 1M34E 1G3IA 3DZDA 2IUSA 4QOSA 5LBIA 4Q7JB 4B43A 3PXGA 3D7MA 3CC7B 3BORA 1YRBA 2DFNA 4F92B 4QHYA 2F1HA 2IC5A 3SOPA 2W6ID 1AZTA 4FD2A 3U7HB 4HAXA 5LDDC 1RE0A 2BEJA 4JBWA 4OL0A 1Q21A 4O3MA 4FIDA 4HLQB 2A5YB 5G3ZA 1HY3A 4AKGA 1XDBA 1KYIA 3CKLA 5FTNA 3GJ3A 2BGIA 1HQYE 3UATA 3ECCA 1D9ZA 3AGPA 1FQKA 1P9WA 3EIQA 4YMUA 1VG0B 3RS4A 4KSBA 4XSHA 3BB4A 3W8RA 2YWEA 3EASA 3U5ZB 1GITA 1GM5A 4GMXA 3U3MA 1NF3A 5BXQC 5JSZB 4BFUA 3T1OA 1XMJA 2NZ8A 2R6CA 3K0AA 2XAUA 4PPGA 4TL6A 3PQCA 2WTUA 2FFHA 2ZROA 3EPHA 2DB3A 3HU1A 2FNAA 4UXHA 3WYGA 1M7HA 2FDCA 3TLXA 2PZFA 3NVAA 2GAAA 1GAQA 3EPKA 2PCLA 5GJVC 1OB5A 3SJCA 1XF9A 2HMAA 1S1CA 4MKFA 3KZ1E 4LDJA 3JQQA 1SVSA 2F1IA 1T5IA 3H4MA 1G17A 1BMFA 1MABB 1TF2A 1N5IA 2BMJA 2QSZA 4D4MA 2R6HA 3HU3A 3THWA 3VAAA 1UADA 4LHVA 3AVTA 4F7DA 2WPDA 3X1DA 5F98A 2OTLB 5J4KA 1U94A 2CK3D 4Q01A 1Z2AA 1JI0A 1WRBA 4WQMA 1I7PA 1YZUA 2A3RA 1GAWA 2IBMA 2WJJA 4DLUA 3AP1A 4BFYA 4DQLA 2OBMA 3SFVA 3U3OA 3TSWA 1UFQA 5IK2A 3B1ZA 221PA 3CRZA 3RS2A 5JEDA 1GKUB 2CEAA 2GKSA 1E0AA 4W5HA 2WVJA 4L16A 2Q3MA 4I1UA 2XXAB 1JJVA 1FP6A 2XEXA 3EZ2A 4A2PA 4DDWA 1XCPA 2WKQA 2FEOA 3MCAA 3OESA 2IHYA 1G18A 4JS0A 2QENA 2C9CA 1S3SA 1QG4A 2E1RA 1Z0JA 3A36A 3BERA 1K73D 3CC4B 1XD2A 2ZS9A 1DAKA 2P65A 5HXBA 2BIFA 2QY9A 4ZO4A 2JA1A 3SEAA 2BCJQ 4G0NA 1FRQA 4C43A 1GNQA 1KZ7B 4GP7A 4XSGA 5EJEA 3TR0A 4TN1A 1TUIA 5FPHA 3QPWA 2KI5A 1GRNA 1BX0A 2DFTA 4M1TA 1NN1A 3BK7A 2HT1A 3C7KA 1US8A 4Q9HA 1SVOA 1CR4A 2ZSEA 3P4XA 4B2LA 2AHOA 4KFSA 3FB4A 2QN6A 1YZGA 1CF4A 3A4LA 3DOEA 2GETA 4IDPA 1RPZA 2I1QA 1ZD1A 2FSFA 4HAVA 1IM2A 1HEIA 1U8YA 1NBME 1UEIA 4C0SA 2PMKA 3VU9B 4XVUA 4OHYA 1OF1A 4H1VA 3Q7QA 2EFDB 4Q4HA 3OIVA 1W87A 2BDTA 2H18A 2KBFA 2W83A 2P2LA 2OCYC 2D7DA 3U6KA 2XB4A 3QFSA 4TWZA 2IYLD 4LJ9A 2GESA 1TVCA 1P4SA 2DR3A 3AH8A 3QXHA 4BRWA 1YIJB 5GADl 2J1LA 3X1ZA 1P75A 2Q3FA 1NLYA 2DY1A 1G3UA 2ORWA 4V0MA 3V9PA 1SZPA 4YALA 4OYHA 2XTMA 4PSVA 5B2ZA 1Z29A 1JB1A 2H17A 1GRQA 3HYTA 4FXPA 4I4LA 2ZAOA 1R0YA 4LI0A 1XTSA 4ARZB 3LBIA 3CPHA 3LNCA 1SXJA 2JJ1D 3CH5A 4B6FA 2ZS8A 2HJVA 5P21A 4TZ0A 3KDSE 2XX3A 3NC0C 2ZSAA 2R6AA 1Y3AA 4TLAA 4K8OA 3AF0A 3CRRA 4EDHA 4RCZA 5DH9A 3T5GA 3FE2A 1ZP6A 2EWWA 4CEHB 3P1JA 3ND8A 4JLMA 3TSOA 3FDIA 2Z83A 4ZCLA 2FGKA 1RZ3A 3A1SA 1E9RA 1I2DA 1N6KA 1UM8A 5THXA 2I3BA 1GAJA 4Q18A 3ZVNA 3SE0A 5FL7A 3WNBA 3VKHA 2QRZA 2GCPA 1KI4A 2V1XA 4M9QA 3ZDQA 3FHTA 1AGPA 4IRUB 4ON9A 4EPYA 4GL2A 2JIZA 1QDEA 1SXJC 2DBYA 4BASA 3AEZA 3C4JA 1YJNB 3V76A 1YZTA 3GJ0A 2EQBA 4DLSA 3EZ9A 2YOHA 1SVIA 2B6HA 4IKEA 4AURA 5G40A 2W00A 1AGRA 1Q20A 1VG1A 2DEUA 2MSCB 2PT7A 4BLQA 4I99A 4HB4A 1JA0A 3U4QB 2ZJZA 2F55A 2QP4A 1X86B 5C18A 1Y63A 3CUEF 5HKKA 2P0EA 5BN4A 2OO7A 5GV8A 4A0FA 4KBFA 5BWMA 3WHLA 1J8MF 1XJ0A 2JLUA 2OK7A 3IPYA 4WA7A 3C41J 4AF6A 1TMKA 4Y0AA 4EAQA 1W4AA 1YHNA 3Q85A 2XB2A 2WAXA 5FOWA 4A2QA 2OM2A 1VQKB 4G3XA 3RRMA 1EP1B 4PAQA 2ZTSA 2ZM5A 1S0UA 3NKVA 4NCKA 4TTQA 5JS7A 2MSEB 1QG2A 1N0VC 2QPOA 1T8TA 4JLVA 3LW7A 5E95A 2JEOA 3JQPA 1KO1A 2RGNA 4Q4LA 2QTLA 1VG8A 2AKYA 3L2OB 4RY2A 2BBWA 4D26A 1Z6GA 4LJ6A 5DE3A 5FOTA 1G16A 3B85A 1YKSA 1Z83A 3GP8A 4UQOA 3VR2A 3FOZA 4LJYA 2GQFA 1IN6A 3I8SA 2RGCA 4C30A 4JSTA 2GJAA 1IHUA 3BH7A 1FX0B 4NYIR 2BMEA 3PENA 1EFRD 2J59A 2QRNA 2ZRMA 4BGDA 2ZR9A 4PZYA 1KSJA 1L4UA 4O2LA 3AKDA 3KJEA 1WQ1R 4HZIA 4PFSA 3L8ZA 3VO2A 4IVQA 2P6NA 4TL9A 1AZSC 2WOJA 4NONA 4BUJA 4I81A 1CP2A 3CMEB 1GIAA 4HB3A 1QHHB 1U81A 1WE2A 2GHIA 2W2XA 3D8BA 3I4LA 3MUFA 4DSUA 2RGNC 1X8JA 4DBLC 3VR1A 2ODEA 2VP5A 4A82A 2IEYA 3P4YA 4NCNA 2PT5A 4D0NA 4MYHA 1N5KA 2GCOB 3KXKA 4MRRA 2O5VA 1KNQA 4UKDA 3QXJA 4TSFA 4DJTA 1JQLB 4PSKA 1N6RA 1Q1BA 4ZDKA 2N1BA 1NVXQ 5EZ6B 4Q7KA 1QUFA 1UBGA 4EQ6B 2CHVA 3CIOA 4WAUA 2Z5FA 1RKBA 1NVVR 5FPTA 1F2UB 3FHOA 3SHWA 4D80A 3RS5A 2J41A 3IPXA 1J2JA 1OKKA 1OXXK 4DQKA 2C03A 4BLPA 4P4UA 1VCMA 5JSZA 1A82A 1R5BA 4MRNA 4LY6A 1W0JD 4QHTA 2QM7A 4LYFA 1W36B 4TMWA 4NMMA 2REXB 4BZQA 2YYZA 4P32A 2O0HA 2OAP1 2VTKA 3K9NA 3OIYA 1PV4A 5ELXA 1S72B 4JBYA 2NO7A 2G88A 3IBYA 2WWXA 3R9WA 1WDTA 1KDOA 2PZGA 1OFUX 2IX3A 1E62A 2L0XA 3KKQA 4P33A 1YZLA 1YZNA 2F6RA 1T0JB 4FW9A 4P0TA 3SQXA 3CX8A 4YXWD 1N5JA 1XZQA 4CEIB 3KKNA 2GXAA 4H9GA 1N2CE 3I1FA 3W5VA 3EXAA 5JJIA 3EZFA 3SC3A 4C0HA 4DSNA 1D2NA 1E1RD 3W6OA 2IYQA 1Z0FA 1QHIA 4EPTA 2AD1A 4PC7A 4DEYA 3CCVB 3QEJA 5J4VA 2AK2A 3THXB 1R0ZA 2NO1A 4N1AA 3U60B 2R6DA 1GFIA 1FTSA 1ZM9A 1A8PA 4MYUA 1X6VA 3ADKA 4CDGA 4F4IA 421PA 3CCMB 2G3YA 4DRZA 2D4HA 1OLOA 1JA1A 1CJVC 3QXXA 3ZYCA 3R8FA 1E64A 2I4IA 3BC1A 1G9XA 1IQPA 3DKPA 3L0IB 3NBZC 1W2BB 3W3AA 3K70C 1PVOA 2VP0A 3IILA 4YHBA 4II7A 4JMPA 2V54A 5JI3E 2ZSDA 1OH5A 3N2EA 1GG2A 4NKRA 4LJ5A 1G291 1J90A 2D3WA 4NYJR 1PZNA 4BECA 1EWYA 2CXXA 4LHZA 2ZU6A 2O8FB 1Q22A 2FPMA 2JLZA 4HZUB 4FMCB 2BC9A 4KODA 3AF2A 1LTQA 3AVVA 4NDZA 1FPMA 3FMPB 1NDHA 4KHZA 3QBVA 1XMIA 2W58A 3BFXA 3RC8A 4C3ZA 1OHHD 5KSOA 2VZLA 3OEEA 5GJWC 4G5GA 2IUUA 1HQCA 2GAOA 1EP2B 4Q1AA 1CKEA 3ZVMA 2QL6A 3OFNA 3VU9A 5FTLA 3AVPA 1CS4C 3MFYA 4B4DA 1YVDA 1P73A 2RC5A 1CJTC 4IFEA 1RRGA 3KL4A 3DO6A 4Z1MD 1T3LA 1RIFA 1XNJA 1VQ4B 3RDPA 3VFDA 2WWHA 4QM6A 4OJKA 4MYTA 3QY0A 2EYQA 4LRWA 1EESA 1IJFA 3U44B 5GV7A 3ZVLA 4BLOA 2EVWX 3SNHA 5AJZA 3B7GA 1DPFA 3A58B 3NBXX 5JJKA 1OB2A 4YMTA 5CITA 5EE0A 1KSGA 3PEUA 4C0AC 5C4MA 2BM0A 2GF9A 3MMPA 1II8A 3NEYA 3Q9LA 4A36A 4E09A 4AIIA 1KKMA 1NG1A 5DGXA 4ARZA 1Z07A 4FINA 5H59A 3DOFA 4DCVA 1YQTA 2OESA 4B3GA 2P5TB 3ZIAD 1OH8A 2GPJA 4RVCA 2QAGB 4OK5A 2D74A 3E5HA 4N0EA 3W2IA 4IFBA 1TLLA 2FSGA 1H85A 4LBWA 1XD9A 4A9AA 3N5CA 2GJSA 3IHLA 4LJ4A 3FTQA 4TLEA 2ZUCA 1VYTA 4EKDA 1FL9A 1QFZA 3WP1B 1EP3B 1VCOA 4Q4AB 4TT3A 3W2HA 4BZPA 2A5DA 4S35A 2IYXA 4Q9JA 2BCGY 3LLMA 3VR3A 2BOVA 2IUTA 3KQHA 4FWTA 4DLZA 1RJ9B 2CNWD 4B47A 2LWIA 4D0GA 1YZKA 5B57C 5FTJA 4ZDWA 2CDNA 2ONKA 3D3QA 4OK3A 4IEEA 2ZE7A 2D62A 3C5CA 3RWOA 4N0DA 3E1YE 4NHOA 2C9OA 1W48A 1GZSA 4C4PA 1FTNA 3MJHA 3CWZA 3AVUA 1XEWY 3TUIC 3CNOA 5JMTA 5L3SA 2Q0HA 5DSZA 3KQKA 4RD3A 1AA9A 4M21A 1VDZA 2ZRPA 5AJXA 1US8B 3LAWA 4A0RA 2QT1A 2ZIAA 4XVRA 1GO2A 4E07A 1OH7A 3T34A 1NBMD 5H8WA 2Q3HA 3WMEA 1QVFB 3H84A 2AXNA 4KO8A 4HAZA 2ZU0C 4A92A 2QTZA 4YMVA 1RFLA 2VBCA 2VA8A 1IN8A 4PC6A 1YR7A 2B7BA 5JBQA 1W47A 3I92A 1GOTA 3KX2A 1KY3A 3IUYA 1M2OB 5FPYA 3CRQA 3ADCA 3CCEB 1KI8A 1JB9A 1ZRHA 2ZJBA 3K9LA 2DWQA 3QIAA 3TQFA 3EIHA 1JXMA 2NMVA 1Z6YA 2HJGA 1K5GA 1FX0A 2V6IA 4OQLA 1KIMA 1YR9A 3HR7A 3X1WA 4UXJA 1FZQA 2YWHA 4DB2A 4LYHA 2Q9AA 3IBGA 4GOKA 5K8LA 5F2EA 2QQ0A 4M1KA 4Q9KA 4FMCF 1W4CA 2P67A 3LBHA 3ZBUA 1G64A 1VYVA 1G4UR 1ELOA 1QHHA 2RMKA 1YJWB 2WJHA 4NZYA 5CK4A 2NO6A 5BYJA 5SZHB 5J4HA 1W7AA 1YHQB 3ASYA 3EWSA 1CR2A 3FKSA 4LZZA 3GFOA 4JVLA 5KU1A 1QGYA 1KO5A 3GLHB 2FOLA 4CEJA 3QFCA 4ZKEA 2GCOA 3QG5A 1F5NA 2I1VB 1TTTA 1W4BA 1N6LA 2CCKA 4IVRA 5EXSA 3H1TA 2VNIA 1KRHA 4URYR 5KSPA 4B3CA 1KSHA 1OV4A 3MHPA 3K09A 1VQ7B 2F7SA 2WSSA 3CPWB 1GTVA 1T9HA 2FFBA 3LX5A 1G3MA 2VP4A 2ZRHA 3OAAD 4DCSA 1UKEA 4QM7A 4HLDA 5KHOC 4ZCMA 4B2PA 1NSTA 1JEEA 4RD6A 4HUQB 1ZCAA 4QGHA 3NDPA 2IWRA 3W6NA 4B76A 4NP6A 1YJ5A 4AYXA 2XZLA 4AG5A 3ICEA 4Z51A 1WMSA 4HEJA 2J45A 4ACBA 5H68A 1ETUA 4G5QA 2A5GA 2GXSA 3J81k 3MG9A 3PVSA 3CCUB 1XP8A 2TMKA 4G5OA 1KY2A 3LVRE 2EFEB 3PCRB 2C95A 2EU8A 1IY0A 4O25A 4CIDA 1T6NA 1G5RA 1MV5A 3EC2A 3SHFA 1MKYA 2WWIA 3O8RA 3SYKA 1G8FA 3QXSA 1ZINA 3K0EA 3K09C 3TVDA 2CVFA 1OPXA 4CT5A 5JRJA 4PO8A 5FOXA 4YDHB 1DAMA 1UDWA 3PEVA 1MRNA 4NH0A 5F9HA 4XWOA 3KUDA 1QHSA 1VCIA 2C04A 1IOZA 1NY6A 2XSZA 1ESMA 2Z4SA 3AUYA 1A4RA 2JLYA 1P9RA 5JHGB 1IN4A 4XD7A 5SZJA 4EPRA 3AKEA 1W36C 2C96A 1VTKA 5FFMA 3THXA 2P3SA 4KFTA 2VP6A 2GZHA 1WXQA 2GA8A 1JPJA 4L5BA 2V55B 3RS0A 1Q7YD 4TMVA 4MDEA 2ZYTX 4PHFA 2NOAA 4R7ZA 1Z0AA 5CB8A 3SQWA 1XEWX 2AL7A 2HEIA 3QKUA 1HUQA 2OFWA 3OF5A 2B21A 1J7KA 3C5HA 3EG5A 4BEBA 3LXRA 3NBYC 2ZE8A 1KKLA 4RJLA 4FWIB 2OK8A 4TTPA 1OH6A 3CB4A 2CL0X 3CXCB 3UPUA 4J0QA 2ZRNA 3FJOA 2NQ2C 3H0KA 3GLGB 2O8FA 1K8RA 3WXMA 1KO7A 5FUXA 4HZUA 1SKYB 2DERA 2QPAA 5IF9A 4MUBA 2DWPA 1VQOB 2ZRLA 2GWHA 4Q9IA 3EA0A 5AUQA 3CZQA 4KSCA 2Q21A 1E9EA 2BKEA 2QTFA 1OFHA 4ABYA 1BYUA 2RHDA 1XTQA 3G4SB 5D3QA 1AS2A 5FBWB 1U9IC 2J9RA 4URUR 5EXTA 4HDCA 4X8HA 1IBRA 1RC8A 3PUVA 3FVQA 2KWIA 2FJUA 1QVGB 3I55B 1XJQA 1QHNA 3IIJA 2IW3A 5FUYA 1KGDA 1XEFA 1OIVA 1CJUC 2HLDA 1S4QA 2E9SA 1IXRC 2JAQA 2VPPA 4HUTA 3ZS8A 4B32A 2ZUBA 4A4DA 2GK6A 5CLQA 2Z43A 4QL3A 4RD1A 3DPUA 3R20A 2ZRJA 1QGZA 1XX6A 2ZRAA 2PIAA 1BX1A 2VEDA 1SGWA 1NMYA 5KSWB 3L0SA 3MLEA 3B8HA 4U9UA 1R10A 1B0UA 3BXZA 3U44A 3WY9A 1R4AA 3QFRA 5JCZA 1IXSB 2G1KA 4IJMA 5HPYB 5FOVA 5HE9A 1B23P 2OBLA 2R2AA 2J7KA 1W35A 1E9DA 3LFUA 3L0OA 4V0KA 5AJVB 4V0LA 5JHHB 4M1YA 2OLKA 1Z2CA 1X8LA 1P9NA 1Q1EA 2REBA 1E63A 2EIXA 2FZLA 4V0ME 5HZKA 1WP9A 1EWRA 2FEMA 3NEJA 2PJRA 1YR6A 4GP6A 4MGYR 4MKGA 1DO0A 1MR3F 3HPRA 3K70B 2QAGA 4ACAA 2VLIA 1DAIA 5M04A 1ZUHA 1CJKC 2Q9CA 5KDOA 1DAGA 2Y8EA 5FBQB 1Q12A 2EYUA 1AKEA 5TY0A 5EP2A 4A2WA 3I72A 1BS1A 1DDIA 3RVBA 2QE7D 4BQSA 3A6PC 3ZBTA 4IDQA 4CW7A 1FNCA 1DAHA 3OIUA 4Q4AA 5TR9A 1M7GA 1M74A 1U90A 2HUPA 1D2EA 4M22A 3ZQJA 4EUNA 1AIPA 1OJLA 4URXR 3QNUA 3B13B 1RJ9A 3CRW1 3FWYA 4M8NE 2OUKA 3B2EA 2QAGC 5FBLB 1HH4A 3U3JA 4JLKA 4OHZA 5EE9A 3U3RA 2ZREA 5H1YA 1DG3A 1HURA 5B64A 2ATVA 2W6JD 5IRCD 1DELA 4MGIR 1UKZA 4FCVA 2JDID 4PQFA 2H92A 2QA4B 4JKIA 1NLFA 2ZRGA 5DLQC 1ZUNB 1SHKA 1LV7A 1XB2A 1P2VA 3QF4A 4LV8B 4NTZA 4DLYA 4MDFA 2HDNB 4DC9A 3NH9A 4Q1BA 1MH1A 2PBRA 1C9KA 3ZVRA 4HAYA 4Y9UA 2JASA 1DADA 3HR8A 3PUXA 1QGAA 4JLAA 1FFHA 5EE3A 1U8ZA 2OT3B 4JVNA 4O2RA 4EFNA 3MAAC 1C4OA 4LUCA 4OI0A 1HE1C 4NBSA 2ORIA 3CRVA 3OE7D 5FR1A 2OCBA 2W2VA 4E5UA 4JLPA 5BW8A 1FNDA 4QRHA 4LV6A 5LB2A 1LFDB 4BFXA 3F3YA 3UXMA 3WYFA 2MMCA 1DAFA 2QMEA 2QGNA 2V6JA 2ZETA 2D7CA 5FUVA 3AKCA 1CJMA 1M7BA 4GZLA 3NXSA 1QHXA 4C7OA 3W5JA 3B9QA 3ZGXA 4B73A 2IL1A 1JALA 5G41A 4BE7B 3BGWA 3AP2A 1II9A 3WBKA 1Z63A 4XOIA 3EPLA 3AKYA 3UG7A 3CCJB 2ZVQX 1N6NA 4B74A 3I61A 1KQSB 5G53C 3TGPA 1II8B 1P60A 3D6TB 2JLWA 3B60A 4HAWA 1KZGB 3GLHA 3ZZUA 2WJGA 3UMRA 1AMOA 4NU0A 2PL3A 2QTVB 3CD6B 1P62B 2F1JA 4L4UA 3JZAA 2FSIA 1F60A 1E2FA 4M1SA 4PAOA 2UZ3A 4DKXA 3AM1A 1KO8A 2BEKA 3TRFA 1Z3IX 2E87A 4IW3B 2LKDA 3H86A 2X77A 3KKPA 3QOFA 4HUQA 4KFRA 4OQFA 4DT1B 1TEXA 5FBRB 4M1MA 5ANRB 4US2R 3QSYA 1D5CA 1JJ2B 3E70C 3LD9A 5KNDA 4ZIRB 3CC2B 3AP3A 2VP2A 1E2HA 4QGGA 1XJCA 4KVAA 5CM8B 1SM4A 1G1MA 1XTJA 4DIDA 2HV8A 5E7JA 3IKJA 3SU8A 4YAFA 4Z8XA 4MH0R 1GL7A 2CHGA 2F1RA 4S2EA 4Q02A 4LX0A 2GXUA 4TSFD 2O8DA 5JRZA 2VHUA 1FUUA 1ZU5A 2QM8A 1KI6B 2OSBA 2CE2X 2RGXA 3HDTA 1RRCA 1TPZA 2X2FA 1YR8A 1GWNA 1ZM7A 2A78A 1AQYA 4V0OA 1MO5A 5L3SB 2P6RA 2IS4A 3CNNA 1E1QD 3UWKA 4DLWA 4KU4A 2OXCA 1M8PA 4PC1A 4L9WA 2JLXA 5HCNA 1MRSA 4JL8A 3TKLA 1EFCA 4Q1FA 3FPAA 3JVVA 2HT6A 2CE7A 1R5OA 3QPUA 2QAJA 1T8UA 2IT1A 4X8MA 3QKSB 4RSGA 4LJAA 4P4TA 4DZZA 2JJ8A 2VQSA 2ZI9A 1ZNZA 2HYDA 3UG6A 3GLIB 4B35A 3BRWD 3V4RA 3K1JA 2ASEA 1V5WA 1G3QA 3G5UA 4HE5A 2O52A 2KB0A 4PGOA 2PLFA 1T91A 3R9XA 3QEOA 4OI1A 2A9KA 5G3YA 2ZRDA 4A8JA 2Z6VA 4DXAA 1GL6A 3RC3A 3ZH9B 3AVYA 4U7DA 1XTRA 3CBQA 3GLGA 1N0WA 2ZPTX 3AVXA 1H8HA 1NLZA 1XMSA 3IO3A 1ESNA 2WIAA 4URVR 5C4GB 1G7RA 2XNDA 1EFTA 3ZZTA 4LPSA 5EP1A 3D31A 2JJ1A 1YRAA 2F3RA 3JZMA 3K0CA 3RWMB 1AJEA 1CIPA 3O8CA 1E0JA 5GJCA 4EJSB 3KQLA 1XE1A 1NN5A 1RRFA 1CRPA 4LWZA 4AG6A 4CGZA 3CR7A 4QNRA 4CEJB 2VIIA 3GJ6A 1Z8FA 3SN6A 1H8ED 3UANA 4NYIQ 2V7QD 2ODNA 1NIPA 4A8JC 1VIAA 1P61B 2MMGA 3L43A 5BQ5A 3EZ6A 3CPJB 3B82A 2BF4A 2FG5A 3PIRA 2K5UA 1G8GA 4LCBA 3CCRB 4G1VA 4GFDA 4LBZA 2A5JA 4US1R 1JPNA 1QF9A 2KSQA 1NVWQ 1P72A 2W0MA 2ZI7A 4NYMR 5AK0A 3RHFA 3WRXC 3WNDA 2BMDA 5DN6A 4PR0A 3CF2A 4JLJA 5JZVA 2OILA 1LY1A 3FHCB 1G5PA 1HT2E 3K0CC 1W46A 1UAAA 1ZBDA 5AUOB 1JECA 3VO1A 3G82C 3GQBA 4OHXA 1ZYUA 5DISB 5J5CA 1BIFA 4O0MA 3W5IA 1E99A 1HV8A 3GFTA 4Q19A 1TQDA 4HYYA 4TL8A 1NL3A 3OEED 3CCQB 4PPQA 1Z28A 3EW9A 2XGJA 3CF6R 4HSEA 4G1UC 2VHQA 1W2HA 4XWKA 2CLCX 621PA 2A5FA 3W2GA 4ZCIA 2W2TA 1NVVQ 1NN3A 1OSNA 1WF3A 4KBGA 5FH9A 4RFSA 4GT1A 2V3CC 2FE4A 1Q3HA 4PSAA 3CMAB 1RYFA 2WMNB 4E22A 4GOXA 4XWAA 3P32A 3BE4A 2LCFA 4UNRA 3O8BA 2O8BA 3AB3A 1TF7A 4JYBA 4QG7A 3R7WB 3QE2A 4HATA 4Q47A 1T3HA 2IYTA 1CXZA 2VYQA 1G4AE 4DEXA 1NN0A 1PUJA 3IEVA 2FPLA 4B3DA 1IY2A 4QBHA 3LRPA 3RRZA 2WMOB 1TQ2A 2NIPA 4PZZA 5DI3A 4M53A 3HU2A 3RABA 3KKOA 3THYB 2H1LA 4JLOA 4V0NA 4LBVA 2PEZA 1VQLB 4Q5IA 3LV8A 4BPRA 4B75A 3EAQA 1A2BA 2G9NA 2HYIC 2J3EA 1W5SA 3GFPA 1EFRA 3A1UA 2OTJB 1DS6A 3BOSA 2YINC 1X1RA 4EIWA 3ADDA 4G5RA 4DLTA 4B48A 4FN5A 2RGEA 4AKEA 2IS6A 2IYVA 3BIFA 2OFOA 4QJ3A 2NZJA 2DPXA 2PX0A 3GLHE 4HI0E 1DDGA 1SXJE 4QFMA 4FCWA 3CW2A 1EK0A 4JLDA 1NJID 2FZ4A 3FKQA 1VYUA 4OK6A 5DI9A 3SR0A 5GVSA 4EFLA 3MGCA 4DB4A 4UNQA 1JQJC 1SKQA 2G77B 2WSMA 1B2RA 1OXTA 1U0LA 2HXSA 2J5XA 3CX6A 4Y0VA 1TQ6A 4JBXA 4L9SA 4A15A 2QBYB 2ZJYA 3RRNA 3PJRA 4RCYA 4PQYA 3HYRA 3AF4A 3I62A 4YAUA 1G5TA 3T12A 4I1OA 4NPHA 4D25A 3F8TA 3JVUA 4D81A 4ZI3A 2R8RA 1KI3A 1KOFA 3ND9A 4NYJQ 3EC1A 2D2FA 2BMWA 3GLFA 3IQWA 2J0SA 1ZW6A 3TR5A 1AS0A 1HT1E 4LHWA 5SZKB 4C0JA 3O47A 3RRYA 1MO3A 2YC2C 5CDFE 1Q81D 4BPBA 1W0JA 1NY5A 1U98A 5FI1B 1GNPA 2FA9A 1M90D 1OXUA 2GZDA 1Q44A 4KITB 1FMJA 4C2TA 5EMNA 1NVUQ 5FA6A 1W5TA 1N3BA 1A5TA 4UJ5A 2GBLA 2REOA 5CJPA 4HDQB 2IHBA 4YXWA 4D4KA 4XJXA 3G0HA 5EXPA 1E3MA 4AYTA 2BN4A 3L8YA 2EWVA 3SFZA 2ZEJA 721PA 3W5HA 4U5XA 1E1RA 2CMKA 2QU8A 3TBKA 1S2MA 4LSGA 2H8KA 1KJWA 1OGJA 5KPDA 2WWYA 1JJ7A 3E20A 1XCMA 1NMZA 3UIEA 4AYWA 2UKDA 1LF0A 4MRSA 1COWA 1E79D 2PZEA 2PEYA 3ZJYA 3TK1A 4QHSA 1N5LA 2B8WA 4DT1A 5JI2E 1U0HC 4U00A 2ZSBA 5CDFA 2ZQ5A 4BFVA 4QBIA 4W5JA 2CCGA 2H16A 2O0JA 2OE2A 3MSXA 4V02A 4ZIRA 2IF2A 3GLGE 1R6BX 2RHMA 2GBLC 5L3QB 1C1YA 2F43B 5CB6A 1Q57A 1XZPA 4QC2A 4M9SA 4RD0A 3FKSD 4Q00A 1ZC3A 3MRSA 4PANA 1G7TA 2ZRBA 3LO8A 1WA5A 3NWJA 2ZI3A 1KO4A 1Q1ZA 3T1QA 1DARA 4DVGA 4JJZA 1ODFA 1R0WA 3MWJA 3ICQB 3CCLB 4RKFA 1KI6A 1QBKC 1JEDA 2WSSD 1UKYA 1Z6AA 3RLFA 3LXXA 1T0HB 4W5WA 1OW3B 4Z8YA 5TVKA 4ZDJA 1Z06A 2AX4A 4Y9RA 2IXEA 2FFAA 3P26A 1CNFA 2MSDB 4LOAA 1XMVA 4B3XA 3E1SA 2NGRA 1VMAA 1ZJ6A 1OHHA 1S1MA 3KJIA 2VH5R 1L2TA 4OBEA 4B2IA 1TU3A 3P27A 1XTIA 1DOAA 1K5DA 4IEIA 1F6BA 4WZAE 1E2JA 3QF4B 4JYCA 2ANBA 1WCV1 4RZUA 2ERYA 2GTPA 4NCHA 5DIFA 2YKGA 4FI3C 3ONWA 2IYYA 3SI7A 1W36D 4CRWB 3B1WA 1E98A 5EP3A 2ZJ2A 3QKSA 2ERXA 3B1XA 1P3JA 1QVRA 2H7VA 1XPUA 3GLIA 4ESVA 3B78A 3G71B 5EE1A 4Z1MA 1LS1A 3W90A 2JJ2D 1F2TB 4BZXA 4TMZA 4KCGA 821PA 3L0PA 3QJYA 4WZ6A 4HE6A 5FOUA 3PUWA 4KV9A 2AWNA 4C9BA 4F7WA 2ATXA 4DHEA 3GMTA 5A4JA 2J0VA 2IYRA 1XD8A 2WICA 5EUMA 1K6MA 5B58C 4ZDIA 5H5JA 4PZLA 1BOFA 2CCJA 3ZLJA 2QQEA 5TDHA 4M0LA 4F93B 1Q3TA 3AUXA 1DO2A 4N3GA 4ZPXA 2QNRA 4C7OB 4JKYA 2ZRIA 2BWJA 3LW8A 2J7PA 1LVGA 4DIEA 1UBEA 2BM1A 4DLXA 2AD5A 2ECKA 1EG7A 1OYYA 3GPLA 5CIWA 3N70A 4EJSA 4URZR 4KJZA 2WWGA 2OFXA 2FH5B 2ZR0A 1N6OA 1NI3A 2WOOA 3CF0A 2AN9A 3DVLA 3PG5A 4CF7A 2IS2A 1G8HA 2QEXB 5AWFC 4QGAA 3RNLA 4F4JA 1LB1B 1ZD8A 4DCUA 2VSFA 1S3GA 4RZ2A 2ANCA 3T1VA 2CL6X 3C15C 1WB9A 1UF9A 3KKMA 2QEQA 3N2IA 1VQ5B 1E9SA 1KK1A 1OXVA 1TAGA 3GEIA 4KYUA 4ZGQB 1UJ2A 1XEXA 3THOA 1O87A 2JATA 4PXAA 4A6PA 3QUSA 5TV2A 4C0KA 1HA3A 2AWOA 2IYSA 2Q9BA 4EJSC 2QGZA 3PFIA 3QBTA 1G7CA 4YAWA 1G8PA 5KUTA 5F3WB 1ZNYA 4PPFA 3QVVA 3O8DA 5AJYA 3VR4A 3VHXA 5L3RA 3I32A 5FTMA 2GEDA 3ZZ0A 2HCJB 1G3RA 4R98A 2ZR7A 4RFVA 1NNEA 1IN5A 2GJ8A 2VHTA 3C16C 4CYMA 2O8DB 5GVRA 1HE8B 4GNKA 3QQ5A 2IYUA 1CRQA 3GD7A 4DDVA 2FFQA 1E2PA 4TYWA 2PMDA 4AC9A 1JBKA 2P6UA 1JAHA 3W8NA 2CLSA 2WM9B 2C5LA 2G0TA 1E6CA 1E9CA 3R7WA 1KDPA 3X2SA 1FRNA 3DMNA 3Q3JB 2WAYA 2FGJA 2NO9A 2X8AA 4PO1A 2HXYA 2J0QA 4XVQA 2IS1A 5JWRA 2FMXA 3A8TA 2KBEA 2B8TA 5FBVB 2QP3A 1N0UA 3THYA 2HF9A 1ZM3A 1FNMA 4K1XA 4JT4A 4IDHA 1U8AA 2QT0A 1U9IA 3OEHA 4YQFA 1TQ4A 2V9PA 5BN3A 3K9GA 2ZUDA 2ZJ8A 1NMXA 1CLUA 4IOMA 1G41A 4MRVA 2BJWA 1CNEA 3KB2A 4UAJA 2FV8A 5GJBA 1KK0A 1XBTA 4E03A 1AS3A 2O0KA 4A8JB 4P3YA 1BMFD 4ZGNB 4WW0A 2C99A 1DTSA 2BBOA 2ZI5A 3G6EB 2WPDD 3KTAA 5DYGA 1OFTA 1KMQA 3HPQA 5C46F 3VNVA 1MT0A 2WZQA 4C2UA 3DDCA 2ZJ5A 2FWRA 3VQTA 2GJKA 2XZPA 4QXAA 4EPWA 4JVMA 1Q86D 2QZ4A 3FMIA 5KSYA 5IK2D 2QBYA 3PEWA 5CJ2A 2B7CA 2ZRKA 1GUAA 3CZPA 4D82A 1CR0A 2SHKA 1K8AD 1ZC4A 2G1JA 3OAAA 4DSOA 3R9IA 1W0KA 3BD9A 2IEZA 5FUWA
chains in the Genus database with same CATH superfamily
3IEKA 2WF7A 4BMNA 3A28A 1ODLA 3ASQA 3LPLA 4MA4A 1OLSB 3UXEA 3ZWOA 4Q6BA 1KQNA 3ZBPA 5AD1A 2P9JA 3CMCO 3OIWA 3C97A 1J8DA 1P5FA 2AYYA 1EK6A 3FUXA 1PKXA 2V4UA 3V2UA 4R9VA 4G4SO 2ZXUA 3I5XA 2RH5A 1XLUA 1S2NA 2X19A 4CMIB 1I6LA 1AKVA 1QONA 4D9EA 2PMCA 1LI4A 3P94A 4UBIA 3SCZA 1I7SB 4R2MA 3SDBA 4EKNB 1LQTA 1UIRA 4IXNA 1IFXA 1SU7A 1YU9A 4R8VA 4Y2JA 2PX6A 1HDYA 3A1PA 1SQ5A 1XVTA 3NH6A 3OC0A 3BC9A 5EJFA 2NXNA 2HA0A 2NNLD 5DPMA 3V4FA 1IUNA 4G0VA 4YDQA 1RXEA 2DUJA 2QUHA 3F5QA 4CJXA 4RENA 1O7JA 1TVKA 2PH1A 1BDMA 1DEOA 4J9VA 3SF8A 1TCAA 1ICIA 3OICA 1P2TA 2R00C 4AI6A 2PKQO 2XYRA 5LXTA 1N2IA 3DB2A 3VISA 1GL9B 4H08A 2BISA 4OHUA 5AKEA 3ZGOA 3N1UA 3QBDA 2Q6IA 1GZ4A 2P27A 3Q9SA 4C7KA 1MQ8B 1TADA 3JQFC 4L1KA 3KELA 1MZPA 5E6TA 1O3YA 3BTVA 3OWOA 2F4NA 2ZXHA 1NKSA 2R6JA 5HE8A 1XL0A 1X8XA 1O0SA 3GJ4A 1W9XA 3WZ2A 2A9QA 1T35A 2XOKA 2FSHA 1XPRA 1ULSA 3NFYA 1H1DA 4XWYA 1N8NA 4DUGA 2QL5A 4EVIA 1I94B 4A6DA 1A4UA 3IIKA 4B6EA 5TMPA 4HBGA 1LW7A 4I6EA 1TZCA 4R2HA 2GX6A 4HTFB 3G1WA 3O26A 3B20A 3SS8A 4RD4A 1IAQA 2PD3A 5COAA 4YP9A 5ERGB 2EFCB 3E15A 4D3YA 2Y3IA 3BXFA 4ASUA 3I42A 4MEBA 4G1BA 2WUEA 2Y1XA 3LOPA 3OE1A 5E4FA 3UMSA 5IS2A 3C14C 1G21E 1JTFA 1JAIA 1UPTA 3K96A 2ZLBA 1JPVA 3A1TA 1JAYA 1B0PA 1IB0A 3OQ6A 3PNQA 4UTZA 1HKUA 1F0PA 2V8BA 3RTEA 1RVDA 4WDRA 4DPKA 1XXHB 4AJ4A 1K7CA 1T9CA 1UZMA 3ISJA 3NYQA 4INPA 4Y67A 1PNRA 2YNMA 1II0A 1VHTA 4IOKA 3TTWA 2WIKA 1ZSNA 4G56A 3FPKA 2FZGA 3I73A 1E2MA 1REQB 4X6XA 2ZUFA 1NQUA 3ROTA 4V03A 2PTHA 3M70A 3SDZA 1WORA 2BBSA 5SZIA 3NJ8A 3TUJC 1Z38A 4IM7A 1N1DA 2D2EA 5FL7D 1VJ1A 1ANKA 1MOZA 1E5XA 1JQBA 1K6EA 1ZVMA 3BAZA 3DJFA 3PFNA 3D4LA 4J7CA 4TQUS 1YJ9B 4XIGS 3UMJA 2FZEA 3VHLB 3CE6A 3I09A 3LPMA 1SCIA 1B1AA 3Q6QA 1PJ2A 2Q4OA 2D0PB 2WJ6A 3FLBA 1ES9A 3K1AB 3HL0A 3A4MA 4WTOA 4BCBA 1U7DA 1JSZA 3DLIA 4JC8A 1KJYA 1SCAA 1E6LA 1ENYA 3TOCA 4Z54A 3MQ2A 2C1ZA 3LLUA 1COZA 2AXEA 2SECE 4RKYA 1DBSA 1HMPA 3OLWA 3BQNB 5COBA 2C7PA 3I1JA 1J99A 2WWFA 3I3SR 3KO8A 2A1IA 2X86A 4LCEA 4QUJA 1KH2A 1SC6A 1Q7BA 1ZNXA 3GCGA 1GSIA 3MFQA 4X6YA 2WA2A 1R74A 3D7RA 4Q15A 3EIWA 3ZHVA 3PXUA 2FE1A 3EGXB 3IEUA 1IPEA 2H57A 5M7EA 1KVRA 1OFIA 5KKAA 1T9ZA 2PSJA 3V34A 2XUQA 3ASPA 1F20A 2WJYA 4B3MB 1NVMB 4A1FA 3ZNOA 1R7RA 3ASVA 4PVCA 5J2UA 2GF0A 3KB8A 1FFCA 1VKJA 3WB2A 1H0RA 2PXCA 2VJMB 2XBLA 3PDUA 4FNOA 1HG0A 2YHBA 4QT0A 3QFTA 5E7IA 2GCNA 5CVUA 1GNVA 1ZM4A 3FAZA 4MUKA 3VX3A 1L7AA 1MQAA 1QIIA 1A96A 3CEJA 5ALQA 3RSGA 4P22A 3KXIA 4I8IA 4TRNA 4C07A 6ADHA 1GPKA 1IWOA 1IN7A 4KDEA 1W88B 2IEIA 4H7HA 4X1YB 3S1AB 1HFJA 4RSHA 3H1BA 4PQRA 3OHMA 3OQ1A 5TEWA 1P4RA 5DM60 1YVRA 2QTHA 4KXXA 4MQFB 1EA5A 2BI8A 1XL1A 1KZ1A 1VLOA 2QTCA 4ZMBA 2PCJA 1M3SA 1L9KA 3H9GA 1KDYA 4F3KA 5FAKA 3QHAA 1H8HD 2OV2A 1MX3A 3DWIA 3HXQA 3FIJA 3V1UA 3ZGZA 4KXFB 4TOIA 1U04A 4DXDA 4QKQA 1C4XA 2A9JA 3K53A 2B82A 4A91A 1XHEA 3QW4B 1RAIA 3L8HA 4TYQA 5UKDA 3RTAA 2GEUA 3NYIA 5H3LA 4BGUA 3WYEA 3QXCA 2CHEA 1VLZA 1P9OA 2WT8A 4J0EA 3UJ6A 4MITA 2W6JA 4NEQA 5H81A 2YHIA 2RE8A 5A03A 2JHPA 4X6UA 3FTPA 4Y9TA 4QNMA 5KC9A 4H7FA 2J9XB 2DPGA 4MUIA 3KOMA 1EUCA 2Y05A 1RRPA 2PY6A 5TPZA 4UNSA 3MZ0A 1PYDA 4NQRA 3V48A 3I9OA 3RS3A 5IH7A 1TCCA 3ETLA 4AMVA 2R97A 3WYBA 5AOBA 1DIGA 2D3TA 3CKKA 5DO9A 4BAGA 1WCWA 4LC1A 1X1EA 5KSZA 3LK7A 1AG9A 1WB5A 4BJ1A 5DN6D 1GV1A 3RFCA 1UXHA 3TQRA 5F4BA 3M6FA 2JCYA 2JH3A 4WBSA 1D6JA 2GN6A 3CNQS 3MQFA 3NQ41 4M9XA 2FEKA 3OE7A 5EZYA 2I4MA 4JV5B 2QSJA 4MMZB 4DSTA 2QUAA 5TMDA 2C7RA 1PNQA 3RUFA 1CQXA 1T2UA 4CUZA 3EF3A 3G02A 1MJHA 1XZNA 2FR8A 3JQDA 1FOEB 4Z99A 1RC0A 4KW7A 2JIMA 4NBKA 1PJZA 4C0LA 2WF8A 3CLTC 3O2QB 1IZ8A 1Q5PA 1P6XA 3QLUC 1JIXA 2XNCA 1P3DA 5DMHA 3K70D 1XLVA 4KGDA 1Y5NA 1M2GA 4MKHA 3RK1A 3ZV5A 1DRJA 1EYZA 1PFGA 2EFGA 4GPTA 4WXPA 4B40A 5ICFA 1IH8A 3HBLA 3RYHA 5EZ5A 4CFSA 2B4TO 2CF6A 2RFLA 1AA6A 1LDYA 4BNDA 4QJ5A 4LRTB 1JR3E 3SKVA 3LX8A 3ZC3A 2G71A 4O5OA 5DCWA 3SJAA 3N2GB 1Z6XA 3LVQE 1UANA 3QKRB 4HRAA 5B5SA 2K7ZA 4FEAA 2GKOA 4BFWA 2WKWA 4M2LA 2QW1A 4GI7A 5I5EA 2XB9A 1I32A 3AJEA 4FDLA 5JU6A 3U7GA 1GTL1 4NJOA 1BDIA 3FDFA 1KDTA 4Z53A 1RE1A 3U7EB 1RWNA 3KC2A 3SJBA 3W5CA 2HWYA 5G0WA 1ESEA 4WNAB 2ONJA 3QYJA 5EL0A 4TYNA 1UXOA 2D0DA 4RGVA 5D1HA 4MKIA 1YL6A 2DFPA 3W3AD 2VO1A 1BH2A 1RPJA 3F47A 4U7WA 3K1TA 2O5EA 1QMPA 2H59A 3D8TA 1G6HA 3RVDA 2YVQA 3TMYA 4PRZA 1KK2A 1FNSA 2ORVA 2IDJA 1KC8D 1MNAA 4NOJA 3IIMA 4ZTBA 3GEEA 2IOFA 4K9PA 1IOWA 1TQ8A 1UKVY 1Y8RB 4RJKA 4RZXA 2OLJA 1NSFA 3EXHB 4LG1A 2AXQA 3WDLA 5C8XA 2ZB8A 1T1GA 1N6PA 1KJ8A 4OUKX 5FULA 4AKHA 4LRUA 1OIXA 1SHZA 2JKZA 2IP4A 2UVDA 3OLQA 4MLCA 3ZWVA 3CJRA 2GVDC 1P2SA 5A5GA 4UD6A 2Z3ZA 4ZVMA 1GU7A 1E2NA 4D4GA 3VDMA 1RJEA 3N74A 4QUEA 4QWWA 1I1QB 1XK7A 2EG9A 3ESDA 3PJFA 1R3DA 2AFIA 4ZVRA 5IWCA 5K6AC 3HDVA 3NDBB 3DT8A 5AR1A 4D4JA 3AHJA 4LPKA 5DNEA 4MV8A 1PG5A 2FQQA 3AF5A 4P5DA 4R8MA 1USWA 3ORRA 3VBEA 2HPHA 3T4UA 4DR3B 3LIPA 1A9OA 1QYVA 1JU4A 1XMXA 2OBNA 1RYBA 1YA4A 2R96A 2C5AA 3BMQB 4K87A 4BMYA 3OMWA 1U1GA 2YJ5A 4ZT3A 1GD1O 4BNVA 4EBBA 5E0OA 1H65A 1GZUA 5IVIA 4DAEA 5BNIA 4RJIA 1H2RS 4QRDA 3CONA 5C5DA 3U19A 2SCUA 1DWOA 1OPRA 1SA0A 3IUJA 3JW8A 3D26A 2R6FA 3T99A 3ZNNA 2X15A 5K3BA 2YZNA 2AI3A 4CLEA 2VK1A 3RS7A 2RGRA 2J5RA 2YHUA 1VFNA 3A1FA 4HDNA 1J8VA 5JEEA 3GELA 5TPWB 1NQAO 1P0IA 3C3DA 1CBUA 4UZSA 4ZANA 1EZ4A 4X3OA 4W9MC 3SZGA 4MTCA 1T0PA 2W0SA 3KT6A 2ZIXA 4G5FA 2AMLA 2D06A 3DKVA 3IRVA 1KK3A 3RV4A 3H16A 1J06A 4X8OA 4P8RA 4MWGA 2C2WA 5KNCA 4UASA 4D9CA 2PLRA 3IE1A 2GZ3A 4FMPA 2OXRA 3T1NA 1QVZA 2GEVA 2Q7OE 3RU2A 3S2YA 3TNFA 4KR2A 3NORA 1RQGA 1XZDA 5CB0A 1RI4A 3R40A 3V9AA 3FDXA 2HBZA 3D64A 3AYZB 3F46A 1NVAA 3KDAA 1LBHA 3O9VA 1KMHA 2ZDGA 3Q5EA 4Q1CA 1Z7GA 3F74A 4FFMA 3REQA 1OTXA 2YV5A 2QMOA 4AJPA 1EXMA 2C9YA 4H1HA 4MIOA 4L0MA 1EZ1A 1IXZA 3RSLA 3X44A 1IBCA 3IVMA 4EITA 2Z8YA 3K0FB 1IJBA 1DG1G 2VJIA 3DKKA 2HTEA 3OJLA 1LK7A 4DRXB 1AGYA 2ZYUX 1CU1A 1SUWA 4OJNA 4PS1A 4JQSA 2FDCA 1I2CA 4JT2A 3KEMA 1W52X 3TRHA 4EX7A 2BGNA 2JCVA 2OO3A 3CP2A 1V11A 5F5LA 3RKSA 5A62A 3IP8A 1DTEA 4UVGA 1E9FA 1PGPA 3P96A 2A84A 2ODPA 2C20A 5YASA 2DF8A 3HN7A 1DEKA 1E9AA 1S8FA 3B9BA 4EI9A 3JRWA 4HH3C 4F9TA 3A2KA 1D7OA 3ZOZA 3EGEA 4MRAA 3TG2A 4TZ6A 4JYMA 1YHYA 5KO2A 1VIVA 1AK1A 2BGMA 2IEDA 1GRRA 2G08A 2P2SA 3G8AA 2NUBA 4OI2A 1QQBA 1QIEA 2ZFUA 3PWSA 4S1WA 5GM1A 3GRRA 1G38A 5JT1A 2ZL6A 2WFMA 5A4DA 4LF7B 3JD0A 4DC1A 4LIPD 1HDCA 4JQCA 1CDEA 3GDGA 2LBPA 3H19A 4GEKA 5FNVA 2OBXA 1XLWA 3R74A 3ZQKA 1JG4A 1HWYA 2IIQA 4ZOBA 3TLBA 2P91A 5B6JA 3MXTA 2WG0A 2AR9A 1RYYA 3WGIA 4P4SB 4DDTA 4OCZA 5HM8A 2WSIA 2DLDA 1X7WA 4DFDA 1EFHA 4U2FA 1E1LA 4FONA 4UNPA 2VNKA 1T4GA 1T9AA 4XFJA 2WRZA 1L7BA 1EFVB 4B80A 5F9MA 4DLBA 2TYSB 1GCAA 1QAQA 1UD4A 4ZV4A 1QIMA 3BH0A 3BK1A 1NUHA 4G01B 1FSSA 2P62A 4O4LF 5ECYA 3TLGB 3DF9A 4NH4A 4G2NA 4PZEA 2J46A 1IONA 3GJSA 3C3MA 1XWIA 3Q3VA 5I9TA 1VE9A 2DXIA 5KHLB 1TU4A 3D4NA 4WVFA 3U3DA 3Q5DA 3LBNA 4X20A 4EKGA 2DVMA 1MV8A 5AM1A 2HRRA 2XTZA 3L7AA 2P5UA 3IDQA 3MJRA 3NHSA 3Q12A 2RB4A 3AF3A 1N7GA 2J33A 4KQ2A 4BQFA 5ER9A 2PGLA 4YRZA 4ZGGA 3TZEA 5LU9A 3L1KA 4E2YA 2ZJFA 4Y6QA 2GEKA 4PHHA 2COKA 2VDRB 1SRQA 2J7PD 4CM8B 4PFJA 5C8DA 3NHRA 3UM9A 3QM1A 5FYQA 1CS0B 3UV7A 4BATA 1JHZA 1U0EA 4L8JA 2FEPA 5IM5A 2X4DA 5TB5A 3K4HA 2JA2A 1ZNQO 2ZYSA 3PR1A 1SKYE 2C4HA 2JD1A 2XVXA 3VHQA 3W3ZB 3IP6A 2WM2A 4MVJF 3AR5A 3IFSA 2JVJA 4RE6A 4I1SA 4CEHA 1L3BA 3KJGA 1Z15A 1VKHA 5JECA 4IV5A 1PKEA 4FHGA 4J8PA 3A6ZA 2Q7XA 2W2OA 4OVKA 4EFMA 5KMGA 1FLVA 4CMEC 2O23A 5JY6A 1M1YE 2CNDA 3ICPA 4N6OA 4TV9F 1U0NA 1UBTS 1Y7LA 3F0TA 1UQTA 3IEMA 4BXOB 1E58A 4X93A 3DNFA 3GO4A 3H9QA 5H80A 2FPOA 3FXAA 1BA2A 4BCCA 5CA1A 2R60A 4Z4RA 1S4MA 3COSA 2XD9A 4ZCSA 5CEFA 5KJFA 2XT6A 3NHLA 5AXDA 4ZZIA 5A6SA 1SKMA 1DRKA 5DBEX 5DWVA 5HF6A 5AKIA 4JIGA 4PHCA 3OOEA 3OQIA 4BO8A 3N7TA 5K3FA 1V8ZA 4N48A 2CDRA 1E2IA 1X0VA 3BS4A 2WE7A 4NRDA 1S2GA 4CV1A 2DHRA 2IU0A 5BWBA 4AKIA 4X85A 2IWHA 3NTUA 2H8GA 2BV3A 2CVHA 2ZVJA 3TW4A 2QR3A 5BOSB 4BMPB 1MB0A 3QLJA 3V7YA 2HO5A 4DPLA 4KKVA 1I18A 3OFKA 1C30B 4KQ9A 4UULA 3ZDAA 4N3NA 3X1ZA 3RAFC 5J47A 4XQ9A 3Q2KA 4QEZA 4Y2PA 1U0SY 3GT3A 4MV1A 3SYLA 2WUGA 2XE7A 3M5PA 1ZMRA 1P1FA 4DSZA 3MA0A 3NOOA 2JANA 2PGNA 5DCUA 4YQEA 1GNLA 5T64A 3W04A 2BPOA 3IELA 1G7SA 4MKXA 4QODA 3B9PA 2XGOA 2G83A 3BWDD 3C3JA 3BJZA 1Z13A 4D79A 1ZD9A 3LLVA 4L73A 1L7OA 4MRPA 1MIHA 1D1SA 1PJRA 3PNPA 3BB1A 4IDFA 4XUCA 4NEHB 3V00A 1U1FA 3F2VA 1M5UA 3DMHA 2RAVA 4J75A 2VBVA 2XSZD 1YULA 4JP2A 3FVTA 4UEWA 2O3QA 3T7SA 3ZTTA 4BFZA 4BOYA 1E2LA 4I5IA 4KE6A 2V7VA 3NPAA 4WLEA 4MW6A 2QRUA 3L93A 3M5WA 1UEJA 2JIDA 4HDOB 5BMOA 1N6HA 1TX4B 3FZGA 2NPIA 3W0LB 4L08A 1S89A 1XRPA 1YIOA 2Q6TA 2OBFA 4NCAA 3NOVA 4G8CA 3FPHA 4DQXA 3T7TA 2GILA 5L8VA 1QCDA 1LEHA 5H0IA 3GI1A 4I1VA 3HYNA 3R09A 3OEHD 3GUYA 2GJRA 1O5OA 2AN3A 1I8DA 1DG9A 3MINB 1Y9JA 2F48A 1JLLA 1THGA 5J2TF 2YVAA 1TKRA 1PFYA 3SLNA 3ZH2A 1M5RA 4NBLA 2OM6A 2HPAA 1VCNA 1B1CA 2ZJAA 1MPXA 4DOMA 4YCBA 2OA0A 3SQOA 3UWOA 3DULA 4LJ8A 5H70A 4B3IA 4B3SB 3C6BA 1RQPA 2JGMA 3OEYA 1KWGA 2IH4A 1IDOA 3EVTA 3IDZA 3I0NA 4MHSA 5CX4A 4BKPA 4PFKA 5F4JA 2BMFA 1Q2UA 2PL5A 4FE3A 4CIXA 3T6KA 3WP0A 4B71A 2VL7A 3WLIA 4LCJA 3OX1A 3TW8A 3GN1A 2JLSA 2VSXA 1GKYA 4GZMA 4XI9A 2PUGA 3C4VA 1SG0A 4KN9S 4H4CA 1RYHA 3RSOA 5CLLA 5KC8A 1FDIA 1RI2A 3AQ4A 4FZRA 1XJ5A 3IQXA 3EBLA 3LQRA 3G2OA 5IJ9A 3BQMB 1OAOC 1Z82A 1TI7A 3V7FA 1TTHA 3EEBA 4OI4A 3DP7A 4F85A 2ORYA 4F8JA 3ADBA 1UODA 2Y1FA 1J07A 1M6EX 1W75A 5E7MA 3T4PA 4Q1DA 3WK7A 1FP7A 4JC4A 4K6CA 3AG5A 1O95A 2OEPA 3H87A 3IP7A 4U9IS 3VJRA 4ZQGA 3C0KA 4CTJA 2IITA 3DWEX 1WUKS 3KVNA 2Z6QA 3U6BA 2E18A 1JG2A 5IJAA 1C7EA 5A1JA 3KAJA 4UVEA 5TRDA 3EQZA 2F3TA 2O07A 3LUCA 3E2IA 2AFHE 1Q84A 3D4BA 4AY2A 1RW4A 4JJ4A 3A8JA 2HNBA 1XNHA 2I8AA 2Z9BA 1ORVA 3S3TA 3AGQA 4HQKA 4NR0A 5AW8A 1Z6TA 3GC6A 3WV4A 5FWYB 3SIPA 2JJ2A 1BX3A 1LJLA 1PF7E 1R16A 1Y33E 3LGAA 2VT2A 3NBFA 5EQJB 1ZU4A 1YMVA 4M98A 3RRBA 5LKAA 1Z7YA 1N25A 1FSZA 2ZULA 3CWQA 5FI0B 1KETA 2FY8A 2OYCA 5KTRA 5EIOA 2AFRA 1N06A 2P30A 2PBFA 3ANYB 4EW2A 3KFVA 3J80A 2OO5A 3VNQA 1SQFA 3FZNA 2V7UA 3OIFA 1BU8A 3T0IA 3SEJA 3WYAA 1FVHA 4O5AA 2OQIA 4NCBA 2IVFA 2I2BA 2QI9F 1DDOA 3UZUA 4GGOA 4ESHA 5KQGA 1JR3D 1KI7A 4CL2A 5D7NA 2HU5A 4KK4A 3LF1A 3N8NA 2I80A 3UH1A 4C1NA 2IOFK 2JFGA 2XUJA 3D6FA 3L8MA 4AJ2A 5K8IA 3NP7A 4LJ7A 3KOOA 5C2JB 4XJVA 3FPGA 2OBBA 3HL4A 4KLNA 3PP8A 3BZBA 3REGA 4F38A 3EQ6A 1M1KD 2WT9A 3DLAA 6AT1A 1RHKA 2R5WA 1J0EA 2H0RA 5ESRA 1CUHA 1D2RA 4WIAA 1RTTA 2JFXA 3LLSA 4ZOEA 4FYXA 2GJ9A 1CFZA 4OA8A 4L2IA 3TQOA 4ZKDA 4B6PA 2ZJOA 4WY8A 4BJ5A 3D6MA 1X3SA 1QX4A 2NPFA 1FFXB 4IZIA 1CR1A 4HDRA 2Q4DA 4M55A 4Q7LA 3RC2A 3RTGA 3BE8A 2UZIR 4HNQA 1BU5A 1GQ2A 3N2KA 4JAVC 1SBQA 4Q7MB 3IEIA 4IHQA 2OP1A 3MTIA 2H51A 4B7CA 4P2GA 2DH6A 3ZD8A 1MO2A 2NX2A 1WOOA 4PTLA 2H07A 3STHA 4FKMA 2A7QA 2BDUA 5FPSA 5K3SA 2RI6A 2CF5A 5D5HA 1M34E 1G3IA 3ASTA 3QOYA 5LBIA 1CSEE 2YQZA 3UJCA 5BT9A 5A2QA 4HWKA 1OFGA 1C5KA 1M6VA 4F92B 1T2NA 3VSCA 2NSLA 4HAXA 5LDDC 3S2IA 4PF1A 5CIYA 1RE0A 2I1WA 1DHRA 1NW6A 1Q21A 2O7RA 1XZAA 2XVYA 3ADOA 3HB9A 2YMMA 2CFRA 4MULA 4MVJP 4O33A 2B25A 3TW6A 2A0KA 1YMQA 5BVHA 1F7VA 2C00A 1CX9B 1Q7GA 2BFFA 5FTNA 3TBHA 1ADFA 2BUBA 1C3EA 1KMMA 3WOHA 2VUHB 3ECCA 2CMDA 3AGPA 1FQKA 3AIKA 3AFIA 4J3JA 3UENA 5AI8A 4QU0A 4QO8A 4ZFNA 3TYXA 3NIWA 3BB4A 4CIBA 2CXQA 5CDTA 3W8RA 2YWEA 1UC4B 3U5ZB 3FB1A 3GP3A 2NADA 4YUWA 5D8DA 1QRRA 5BXQC 1NJ6A 2A1TR 4RTLA 3MTQA 4YO7A 3HKEB 2NZ8A 2BHTA 3JQ9A 5JH7A 4Z4WA 4PPGA 3PQCA 2FFHA 1YACA 4BO3A 6GPBA 3VU3A 2PMBA 4ENVA 1O58A 1RWKA 2VPXA 2Y99A 4U0KA 1PFWA 1CD5A 1SU8A 3HU1A 3NOXA 2DB3A 1U0TA 1OWPA 3ROEA 3DHYA 4EW3A 5U1PA 4K6FA 4MPPA 4DCPA 2H4WA 4KQIA 4EJ2A 1C3OB 1Q2XA 2VF4X 3GT4A 2RGYA 2GAAA 4GKVA 1KJNA 4NFSA 2O1XA 3GDHA 5GJVC 4XCXA 4JBGA 2C54A 4PYRA 4QIHA 3VJKA 4TKUA 3PC7A 4M1ZA 3U1BA 1CY4A 3KZ1E 4BNZA 5D87A 3KWMA 4MIYA 4ZTUB 1BMFA 4EENA 2B4KA 1YRHA 1MGPA 4ZOCA 2R6HA 1PAUA 1PZEA 3HU3A 3OE4A 3THWA 2EQ5A 4LYYA 3VAAA 4F7DA 2XQKA 3DZGA 5JQGF 5AI4A 3C6YA 2OTLB 2FPPB 4LKRA 1U94A 1F9AA 2O9JA 1Z2AA 5J4KA 5A88A 1Q3KA 1I7PA 3IS3A 4DQLA 2OBMA 4WCDA 3U3OA 3L8GA 5IK2A 1UFQA 3FTCA 1QS0A 4S1OA 1S7CA 4PICA 2VDWB 4TVKA 4OHRA 4A5SA 5KS2A 2HCFA 1FP6A 1T8RA 2XEXA 4GKAA 1IEVA 2BFCA 5INTA 2XUOA 2FEOA 1HETA 5DNCA 5KNDD 1D4OA 2FQXA 2QENA 3OH8A 2IKSA 2E1RA 1WB6A 3A36A 4IO0A 1Y1KE 4MS4A 1PZHA 2I2CA 5EJ8A 1XALA 2ZS9A 4ZO4A 2NVBA 4HF7A 4WJZA 1P18A 2ZUSA 3SEAA 3COYA 1M67A 4OHOA 4GZ6A 1I3CA 1GNQA 4PNHA 1CLEA 4Q34A 3AM4A 4HQFA 1AVTA 4TN1A 5KAMA 2QMZA 3PF8A 3R3WA 1Y6QA 3UB2A 3CG0A 2DFTA 2H5JA 4M1TA 3VOAA 2JHCA 5FO1A 3C7KA 5F4ZA 3ZU3A 2F4VB 1CR4A 5J9FA 5I4CA 4HNUA 3PXEA 3P4XA 2WM3A 3ZHCA 4EATA 4EFKA 4J0HA 3NDJA 3ISXA 1PP4A 2VH2A 3CA8A 4IQ0A 4LTDA 1UKBA 2FOIA 4JU8A 4I4TF 1ZD1A 2FSFA 4HAVA 1IM2A 3AT1A 1BD3A 2DOKA 3E8MA 1NBME 4WXHA 3VSDA 3FBWA 5K3CA 5KTTA 3GVIA 3Q87B 4J7XA 4GZ3A 4XVUA 4DA9A 1XRRA 3H2JA 1OF1A 4ED9A 2WIJA 1FRVA 4OHYA 1H2WA 3FHJA 2QX4A 2PU7A 3MCTA 2PWBA 1HL7A 2P2LA 3AI7A 3ELWA 3PFWO 1TXGA 5HKOA 4FW8A 5IUNC 2AOUA 3CJTA 4ZOLF 5HILA 2IYLD 4CKXA 2GESA 3IJ5A 2V98A 1IHDA 3HAGA 3AEKB 3D8HA 4BRWA 5D5QA 3VNBA 1JIIA 5GADl 4HYTA 3FOBA 1RRVA 1P75A 2E1PA 1NLYA 3DZFA 1G3UA 3E2MA 4V0MA 3LUHA 4YI5A 1FB5A 1SZPA 3EJ6A 4Q9NA 4A73A 4RPGA 4TTIA 2R6R1 2XTMA 1NXTA 4B8ZA 1IOVA 4N6NA 1CDZA 3PKZA 3FDJA 3HYTA 4JH0A 4V0QA 1RAFA 2G82A 1HDXA 1JDTA 2ZAOA 1MBZA 1Q1GA 1J25A 4JX8A 3A2NA 3SY8A 2B5WA 2VYVA 3GUZA 1SXJA 2B4AA 5E9AA 2ZJ4A 4KO2S 3TX2A 1CB0A 2DKFA 5P21A 4K9RA 1I51A 1CUVA 2XX3A 1QMGA 1OREA 1VB3A 2MOKA 2YZKA 3KYCA 4YAJA 4DIMA 4QELA 1E3IA 3DT9A 3ZQ4A 5C3MA 4EVRA 4EDHA 1ORTA 3IUMA 4L7QA 5DH9A 2X5XA 2H1OA 3CN9A 3ZN2A 4KWEA 3E9CA 3ND8A 2FQ1A 4I0WB 1L8OA 4M1QA 4RDHA 3O91A 3TSOA 1GAEO 1W9MA 3AL2A 2FPGA 3F4KA 3DXFA 1PZGA 4ZCLA 2FGKA 3FDIA 4Z49A 3GEMA 3U09A 3Q0EA 1ZCZA 1I2DA 3SLDA 2I3BA 5THXA 3SHOA 4E88A 3V80A 4PXSA 2Q07A 1WCYA 2GBPA 3DZJA 2GZMA 2QRZA 1XU7A 2GCPA 3KVVA 1KI4A 2V1XA 3MGKA 4ZK2A 1PYGA 4IHAA 4ON9A 2ZDQA 2E4XA 3QX7A 3STYA 4JJGA 1AQLA 1YB2A 2DBYA 3COVA 4NATA 4XGQA 2J9FA 3RGGA 2DHDA 5AI0A 3D2CA 2J3QA 4BASA 1YJNB 3V76A 2ECOA 3AEQA 4N5IX 4YWHA 3E9YA 3TOSA 1TGVA 3EZ9A 3G85A 3IB6A 3CMMA 2L69A 1SVIA 4V1CA 2IHNA 1XYYA 1BS9A 1GG8A 1RBYA 1RM0A 1SHJA 5G40A 2W00A 1Q20A 5ILGA 4RTRA 3DDYA 2XMGA 3PPIA 4C6TA 2XKAA 4KNVA 2C31A 3KEOA 4KACA 2NVUA 3L8EA 6REQB 3E9ZA 3KRTA 7REQA 3CUEF 3NBMA 4F45A 5G1PA 1UBSB 1YI1A 3GH3A 4DYVA 1J00A 5JY1A 4LF6B 2GN0A 1VL1A 2OK7A 3ZY4A 1VGQA 5KW9A 2FUEA 3C41J 3FCXA 3MSCA 1DX9A 2WAXA 3WA6A 5IF3A 2OM2A 2PGXA 4PAGA 1UJ4A 1DC4A 4HFMA 4MSUA 5KEIA 2CZCA 4IMIB 1E5VA 3THWB 1JG3A 2B2NA 3DMTC 4JLVA 2DYIA 1E0AA 3PEEA 3HU5A 1Q15A 2JEOA 4MUGA 1VG8A 3L6BA 1Y4DE 1A0OA 1WZUA 5D86A 4D26A 2YS7A 2X1MA 5AM0A 5FOTA 3ENNA 5BUZA 1YKSA 1Z83A 4XAQA 4PEVA 3VR2A 3DS8A 4EMTA 5G0UA 4LJYA 3FOZA 3QUQA 4G1EB 2GQFA 1IN6A 3BQJA 1TYDE 5JAOA 2QX7A 3LKVA 2OAEA 2XR1A 3BL6A 3QA9A 1FDUA 3PENA 1EFRD 2YRFA 4GBJA 3SR4A 5F33A 2ZR9A 4PZYA 3ZKAA 1L4UA 3NALA 1CT9A 1WQ1R 3L4BC 4MS1B 4PFSA 4XOUA 3VO2A 1SB8A 3HMQA 4IVQA 2MJLA 4TL9A 3RVKA 4LGYA 1VJTA 2WTAA 4BMCA 1QKKA 1SURA 4NONA 3T5BA 1A97A 3CMEB 4HB3A 9MHTA 2P1ZA 3EXG2 1SBNE 2GHIA 2AMJA 3SHTA 4ENTA 4MI6A 4DSUA 1GTZA 2ODEA 4XR6A 4FCCA 4DV4B 4NZPA 1WUIS 4QLOA 2Q3LA 3INTA 4C0WA 3GVHA 3BN3A 1Z4NA 4FYJA 5AHOA 2JIOA 4LE2A 4QQRA 4XDGA 1N5KA 4Y7DA 4IHKA 4ZA2A 4EJ0A 4L0CA 4CL8A 3EF0A 3EVAA 4V39A 3LTNC 4PSKA 2Q4RA 4BNMA 4OQ4A 1N6RA 1Q1BA 3CLSD 4LXIA 5EZ6B 1DP4A 4Q7KA 4EQ6B 2D1YA 5KKNB 1KERA 4O4IB 4WZAA 5K0EA 1IDN1 2IQ5A 1NVVR 3JARA 4E08A 3FHOA 4NG5A 5LLTA 3FN4A 4D80A 2Y9PB 4ZHQB 3A4IA 1J2JA 3HO1A 3HRHA 2C03A 5FPQA 1UPAA 3GPDG 4JCOA 2DFDA 1R50A 5I3CA 1VCMA 1KAEA 1A82A 3HO6A 4CLOA 1R5BA 1HDOA 3QP9A 4W1SA 5CVDA 3UHFA 3B1JA 1K86A 2H4XA 2ZXFA 4AFNA 4NMMA 3ZU4A 4C4TA 3LUAA 2FWBA 1M54A 5DBFA 5IZCA 4HK4A 1ZIDA 5JNUA 2HEGA 4AP9A 3EQ2A 1EK1A 3IURA 3OMXA 5CDHA 2NO7A 5KOHB 5DFAA 3ZE6A 2NUAA 1V9LA 1WDTA 2BFBB 2WWXA 4D9NA 4Q4CA 4J3NA 4BN5A 2CNOA 2WD7A 4XNFA 2CDBA 3RS8A 3AUJB 3KKQA 2WWRA 4P33A 2AVDA 1E3JA 3HWX1 5ENVA 4EUHA 2VWGA 2V5VA 2IPOA 4P0TA 4B1FA 3CX8A 3IAS1 4YXWD 3P97A 4U39A 1TA0A 2YWDA 2WT4A 2C59A 3EXEB 4B3RB 2JRCA 3I37X 1N2CE 1DO8A 3SC3A 4NK4A 4C88A 1UBOS 1Z0FA 2AR0A 2VF2A 4P12A 3B51X 2P9YA 1P3Y1 3BSSA 2AK2A 2O3RA 4RVDA 4CM3A 1YS2X 4OG2A 3THXB 2IIPA 4N1AA 4OSEA 2CMFA 5I3ZA 1NJ8A 4DIKA 1A8PA 4F4IA 421PA 1YRQA 4AWBA 4PLGA 1P1JA 2G3YA 3T3DA 3KAPA 3J7AC 3QJ5A 1OLOA 3FZQA