4M53A

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in complex with gdpcp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
403
structure length
403
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 104
structure length 403
sequence length 403
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m53A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m53A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m53A01
2PMDA 1YR8A 2FSHA 4F38A 2C04A 3CCUB 4PQFA 5G3ZA 2NO1A 2X8AA 3CNLA 2R6DA 5D3MB 1JQLB 2CHVA 2O0KA 4I99A 3KKNA 2A30A 4L8GA 4URYR 2O0JA 4Q9JA 1OW3B 1UKVY 3ICQB 4PO9A 3M4YA 5JLJA 2ZPTX 1H85A 3LLUA 1GKYA 1LS6A 1MH1A 4BFTA 2IS6A 1RRGA 1UKZA 1F48A 4UNSA 2QMEA 1PLLA 5E95A 3LBNA 4UXHA 4A2QA 5GVSA 1W4RA 1AZTA 2KI5A 4KVGA 2OHFA 5FOVA 2CEAA 3ES9A 5IHPA 2WZQA 2NGRA 2OLKA 4YXWD 2GAOA 2GJSA 5CIQA 2WVJA 3Q7PA 4CDGA 4LJAA 3TSZA 4B2PA 1IXSB 2B6HA 1IAQA 1P4SA 1GKUB 4NP6A 2Z83A 3C41J 4QBGB 3IUYA 4OL0A 4D4KA 4MRRA 3E5HA 5FOUA 3X2SA 2XTNA 5J4VA 4JL5A 1NN1A 1TEXA 3I92A 2WTUA 2GXQA 4JYCA 2GKSA 2A5DA 1Q21A 2OFXA 1WCV1 4TL8A 2AXNA 1P5ZB 3S1AB 1OIVA 3OZUA 5BN4A 1LW7A 1KMHB 1H8HA 5DI3B 1P9RA 4Z1MD 3IILA 4LBYA 4DDTA 4LGMA 4TTQA 3QSYA 3QF4B 1YVDA 3A1UA 5AJXA 4OQLA 4E5UA 3W3ZB 3P32A 1Z6YA 3AUYA 4YALA 4TT3D 3ZVRA 2A5GA 3L43A 2VRWA 2IYRA 1I7PA 3DZDA 3QI2A 1E0JA 1AIPA 1OXSC 2FPLA 2QT1A 4HYYA 1ESMA 3U3OA 4DSUA 5TMPA 2QZ4A 3HU3A 3RWOA 5D3MA 3QXJA 4BLSA 4Q9IA 5EE3A 1VYUA 1MT0A 2A5JA 2A78A 4TYWA 2HMAA 2VZLA 1CRPA 4YMVA 5JZVA 4JLBA 4YXWA 2V8OA 5JBQA 4NCKA 1UF9A 2QL6A 2WJJA 2VNHA 2PJRA 5CB6A 4FXPA 3W6OA 3T5DA 3AGPA 1RKBA 2G6BA 3G82C 1RYHA 3QBTA 4NKRA 2QP4A 3UMSA 4EPTA 3WP0A 2W83A 4DWJA 3GFPA 4V0MA 4XH9B 4Q7LA 2GDJA 5C46F 1ZM3A 1NKTA 1HA3A 1HYQA 1XNJA 3LD9A 1G3RA 4Y0AA 3VR4A 4F92B 3HDTA 1QF9A 5FOSA 2RGGA 4TYPA 1SVIA 3IBGA 3W8RA 1OGJA 2QMHA 5FTKA 2RGXA 4M4SA 3EPJA 4Z1MA 5G3YA 2FGKA 4DUGA 3IIMA 3OE7A 3ZVLA 3WNBA 2FSFA 3UWOA 3CIOA 3UWKA 4B6FA 1NI3A 4OHZA 4GSYA 4Q5IA 1PLJA 621PA 4RD1A 2PLFA 1V5WA 5B64A 3RABA 5C4GB 1PVOA 2QMOA 1AJEA 1OFUX 3SOPA 1Q12A 2CLCX 1CTQA 4LBZA 4JL6A 2QRZA 121PA 2E9SA 1I2DA 4MKIA 5EZ5A 4BLQA 2RHMA 3AKYA 3U60B 2XEXA 4PFSA 5H1YA 3CNNA 1VCMA 2HLDD 4HI0E 5E4FA 1CJKC 1JA0A 2MSDB 2R44A 4UAJA 4G1VA 1U99A 1N6RA 3VR6A 1AGPA 1P3JA 3HU2A 4FWIB 3TMKA 2DY1A 3ZLJA 1OHHA 3LQQA 5FOXA 3CRW1 3NEYA 1XE1A 1G291 1T3HA 2YINC 1J9ZA 3DL0A 2J0QA 4US1R 1FFHA 2ZQ5A 1IBRA 2V1XA 2QP9X 2ZS9A 2D06A 4GNKA 1CS4C 3K0FA 4Z8XA 4QC2A 3PIRA 3GLIE 3NVAA 4PHTA 3W6PA 3AVWA 4EFLA 1NG9A 1YJ9B 3KTAA 2F1IA 2H17A 2WJIA 4GZLA 2R8RA 1QG0A 2GBLC 3K9NA 2JLQA 2XNJA 4H9GA 2OXCA 4POAA 1Z83A 1E2PA 1SGWA 4Q7KA 2JLUA 4OQNA 3GFTA 3DM9B 3ZGXA 4Y9RA 1LV7A 1JR3D 2AWNA 2CRVA 4RD3A 4U02A 3WBJA 4ZCMA 5FOTA 2IYXA 4A92A 5CDFA 2J0SA 1G18A 2JJ1D 4NYIQ 3JQPA 4TMZA 1VG9B 1KNQA 2BKUA 1QHXA 3G6EB 4ZIRB 3QFCA 1G8HA 4DT1B 1AA9A 1KK1A 2HYDA 4EFNA 1N2CE 5LD2B 1PJRA 2XJ4A 1XD9A 4KAXA 2N46A 4DLSA 2LKDA 4QKQA 4N3NA 3PUWA 1XP8A 2RGDA 1UM8A 4LDJA 3QKUA 3T1QA 2P0EA 3THXA 2QQEA 3BFVA 3MAAC 3GLFB 2F3RA 3OFNA 4JL8A 1WBBA 1XTIA 1G17A 1DVRA 3JVVA 3MWLA 4I1UA 4L4UA 2PIAA 4NYIR 1TUIA 4BLTA 4Q18A 2PZFA 1BYUA 1GVNB 4D4JA 1KI2A 1X8JA 2ZS7A 1TQ4A 3JQQA 5A5GA 1FW6A 3PITA 1ZD1A 4LZZA 1NJFA 3QFTA 3B2EA 3CH5A 4UNNA 4B6EA 2QTLA 3PUYA 2ZRLA 3TNFA 3DKPA 2Q9AA 1GOTA 1SULA 1RJ9B 2CVHA 1Z6XA 2CVFA 1TL7C 2VSOA 4TN1A 4A82A 1ZNWA 2VBCA 2ZREA 5CM8B 3CD6B 1J8YF 1H8EA 5EXSA 5FPSA 5KSPA 4DCVA 1ZAKA 2GEUA 4LJ6A 2J9RA 2O5VA 2OESA 3AH8A 2HYIC 4TTPA 1XXHB 2FX3A 2D62A 1EFCA 4HUTA 1K73D 1QGZA 3OEHD 4PPFA 2WBLC 4EPWA 1DO2A 2ZJAA 4TLAA 1FX0A 2WAXA 2BM1A 3W2IA 1IQPA 3ZS8A 2NTYC 4D25A 5GADl 2VHQA 2XTMA 1OH6A 2VSFA 5L3RA 2DETA 3LX8A 4AKEA 4CEHB 1KKLA 1US8A 3NBYC 1IHUA 2R6CA 4JBYA 4DEXA 1S3SA 5HKKD 1H42A 3IBYA 4Y0VA 2O8BB 1KSFX 1PLKA 4HLDA 4FWTA 1FX0B 2XOKD 3RANA 4DC9A 2I4IA 3GJ6A 1CR4A 2VP0A 4QBFA 5JCPA 1SM4A 5JWOA 3RRYA 3ZQ6A 1J7KA 4PZYA 2WSSD 4LYJA 3I5XA 1CEEA 2F6RA 1XCGB 1S72B 1VECA 2JGNA 2AKYA 4TTRA 2ZRDA 3RSOA 2ZI4A 1U94A 4RD2A 3AVUA 3RSLA 1KO8A 1HE8B 1MV5A 2OBMA 2ZROA 4OYHA 1G21E 2Q9BA 3BBPA 4UXJA 3WYFA 3KUCA 1QRAA 3MWYW 4J0QA 2OLJA 1ZD8A 1NN5A 3L0PA 1GIAA 2YJTD 4OKSA 4A4DA 2B7CA 1W1WA 2HEIA 4IOJA 4S35A 3WMEA 1FMJA 4FINA 1E2KA 4ZDIA 3SHFA 4DLRA 1KNXA 2D2FA 5BN3A 5IK2D 3FFBA 3ADKA 2FWRA 2FEMA 1YIJB 1QHGA 1CR0A 3LNCA 4HAXA 3DM5A 4N0EA 4G01B 4PPNA 4C0LA 2VHUA 1VKJA 1T5IA 4G3XA 3SDZA 3FHTA 3MWKA 3T1OA 3QKSB 4XTCS 3SC3A 4CEIA 3ONWA 1XD2A 1G7SA 1NMYA 1SKYE 5B57C 4RFSB 4JT4A 5H70A 4TQ9A 5JJIA 2XOKA 2GTPA 1GRNA 2HJVA 2IW3A 2QPAA 5FL7A 2JASA 2MSCB 3QPUA 4LYFA 3BB4A 4EKDA 3I72A 2GILA 2UKDA 1MR3F 1M8PA 1WXQA 1SHZA 2H8KA 4LJ7A 1KO5A 1IY1A 3OZXA 3FPKA 2QAGA 1GITA 5LB2A 2QT0A 4BPRA 2A3RA 5LDDC 4C2TA 2J41A 1SVKA 4HAZA 2Q3MA 5FBQB 3SI7A 3TR5A 4DDWA 4PPGA 5JCZA 2WWWA 1SZPA 5J4HA 3W5UA 4TLBA 3O8CA 2G88A 2NZJA 2FFQA 4DEYA 1E96A 2GEDA 2V6IA 5FR1A 3THOA 3WMGA 4LI0A 1P6XA 1TQ2A 2F1RA 1G20E 1CXZA 2F1JA 4YMUA 2PL3A 3L8ZA 2AFHE 5IK2A 1VQOB 3FWYA 4NYJR 1GWNA 5GJBA 2P65A 5CJPA 2OE2A 2ZTSA 3C5CA 1K5GA 4AF7A 3SNHA 4AG5A 4OI4A 1HE1C 4ZV4A 2QA4B 3GJ8A 3TIFA 1KI1A 1NBMD 4LV8B 4URVR 2GRJA 3QY0A 2YWEA 1F60A 4QHYA 4RSGA 4WIAA 2FG5A 1OH8A 3L2OB 1X6VA 1W5TA 5CITA 2O8DB 4P3YA 1N6IA 2GQFA 3W90A 3U2QA 2KWIA 1AS2A 2BMWA 1BKDR 2HV8A 4DCTA 1IJFA 1FNNA 2K5UA 4U00A 5FUYA 3LA6A 3W5VA 1QGAA 4OJKA 3QEJA 1YQTA 3EXAA 3PUZA 3BIFA 2RHDA 3IHWA 2WOOA 4YHBA 2QEXB 4PGOA 1MRSA 2PZGA 4ZCIA 2J46A 4Q1FA 4OI0A 1OXUA 1DAHA 3W5HA 1SKQA 1XZQA 1DAFA 3RS0A 1R0XA 4DXAA 1R6BX 1YRBA 4JBWA 2GZHA 3KTAB 3CCJB 1T4GA 2VO1A 5KSYA 4JS0A 4IDQA 1C1YA 1DAKA 5M04A 2NO9A 1EWYA 3CM0A 4C43A 2OT3B 2W2TA 3LW7A 4NCHA 3AKDA 5HZHA 1GL9B 1R5OA 1EP1B 1XWIA 3AVTA 2VHJA 4LJ9A 1HUQA 4M21A 4TWZA 4DLZA 1Z63A 2YWGA 4KV9A 4GDFA 4F4JA 1WBDA 2KB0A 1COWA 3B82A 4EQ6B 5KOYA 1ZM9A 3MMPA 2OCBA 1W48A 3V4FA 2OILA 4PR0A 4JLJA 2PMKA 2W6IA 1T6NA 3CR7A 2ZR0A 1G4AE 3U6BA 2ZSEA 2ZIAA 3H0KA 4US0R 5ANRB 2XZPA 4YAFA 1NVWQ 1FRQA 2FU5C 3CCVB 1KI7A 1OYWA 1LVGA 1Q81D 4RVCA 4BFWA 4AG6A 1EFRA 3DO6A 4N3GA 1M7HA 2WIAA 2ORVA 5DE3A 4C0BA 2BM0A 3CRQA 4S2EA 4B3GA 4TMKA 5EP3A 3UANA 3N2IA 2C9OA 1C4OA 2YKGA 1I4LD 4M0LA 1KO4A 4LUCA 4MRVA 4QBIA 2ZJYA 4K81B 1S1MA 1HQYE 2RAPA 3EZ9A 4WVFA 2ERXA 1DG3A 1S1CA 3R9WA 1G7RA 4A6XA 1XPUA 1M74A 4DB2A 2H92A 2IYUA 3TVTA 1MO6A 5E7JA 3NC1C 1HY3A 1JR3E 1IN5A 4R2HA 4A0HA 2QQ0A 4TT3A 3B1VA 2A5YB 1W46A 2OTJB 5H5JA 1FP7A 2O8DA 1XMVA 2FZ4A 4NE2A 3TW4A 1COWD 5JHGB 3THYA 2XJ9A 4FI3C 4GZMA 5IDVA 3LY5A 1FPMA 2W6JD 2IYSA 4DHEA 3EZ2A 1G8FA 3SFVA 2JLXA 5F98A 3CF0A 2VNKA 1OPXA 2IWHA 3I55B 2X1VA 1W0KD 2ZU0C 5JFGA 2RGEA 1TF2A 3Q9LA 3U44B 1GP2A 3SBEA 1F5NA 4Y9UA 3VO1A 2FSGA 4MRSA 1GAJA 3FMFA 2J45A 1MABB 2YOHA 4FIDA 5GJVC 4JMPA 1ZW6A 5EQTA 4MUBA 3Q3JB 1XTRA 1A7JA 4ZCLA 1SHKA 4CEHA 3OZWA 3EZ7A 1DO0A 2D7CA 4P4TA 1CJUC 3WMFA 2BGIA 3ZC3A 3VNUA 1E0SA 2I1VB 2P67A 3EWSA 3GEHA 3V76A 4I81A 4BEJA 5TR9A 4AURA 1AK2A 2DHRA 4Q4JA 2VSXA 1X1RA 4TZ0A 2QAGB 1KDOA 1ZNZA 2R62A 4LK2A 4DUGD 2ZJ8A 2XZOA 4DDVA 1D2NA 4UNPA 2MSEB 2LKCA 2W0SA 2ZE8A 4HB0A 1RRFA 1U0LA 4ZKEA 1RVDA 1XB2A 2D74A 4EAQA 1GRRA 2CJWA 2GVDC 2ZRCA 3OIWA 2OAP1 1E2QA 1QDEA 4H1VA 4PO1A 2P5TB 4XVUA 2QP3A 5GVRA 3CRZA 1W4BA 4LHWA 2HT6A 1F3OA 4I1SA 5AJWA 4F4CA 3I56B 4HUQB 4E22A 3FE2A 3FKQA 1ELOA 2IHBA 4YMSA 2DERA 1W0KA 1DBSA 2QORA 4A9AA 4BZQA 3GLIA 1KSGA 4QXAA 3CH4B 1Z06A 4ILEA 4LSGA 2G9NA 5FA6A 2JJ2A 3PQCA 3B1ZA 2VLIA 5JRJA 1OHHD 4DRZA 4V0KA 3Q72A 4PAOA 5EP1A 1EK0A 2UZ3A 1BJKA 4Q21A 5FTJA 4V02A 1OKKA 1OT3A 5TV2A 3OAAD 3VNVA 1A2BA 3BFKA 5AJZA 1VMAA 2IEZA 1E4YA 1FUKA 1Q1QA 4IHQA 4X8LA 1N0UA 4IRUB 4BEBA 5KSOA 2DPXA 4KVAA 1W49A 4Q02A 1GZSA 2F43B 4YLGA 1YR7A 1M2OB 2OEPA 3I8XA 1KK0A 1P2SA 3I5YA 3RHFA 3K0AB 3IPYA 4NYMR 4XSGA 4ABYA 1ZBDA 1JPNA 2PX3A 1JR3A 1E64A 5FPYA 4PAQA 721PA 2V7QA 2GJKA 2I3BA 2JLSA 5DISB 2PCLA 2J59A 2QNRA 2YC4C 1XMIA 1IY2A 4DLUA 1E98A 1N5IA 3KKQA 4DIEA 2GVZC 2KE5A 1E79A 1IOZA 5KNBA 2O8BA 1HURA 3CX7A 2FGJA 1Y63A 3R7WB 1A5TA 4DB4A 3MHPA 3U7EB 5FPKA 2HJGA 3EASA 2P5SA 3ZZTA 2B8TA 2ZANA 3X1DA 1RYFA 5JI3E 1NN3A 2GXSA 4F7WA 2QUZA 4QGGA 4URZR 1G41A 1T0JB 4B3BA 3WRXC 5EUQB 4GMDA 2VP9A 3TH5A 4KBFA 5JHHB 2C78A 4LHVA 1E9SA 2CDNA 2L0XA 3L0IB 3OEED 3GLFA 4QFMA 3K70D 3TAHA 2AXPA 3U6KA 2Q21A 4MKHA 1E1RD 1G4UR 1Q86D 1NRJB 4KITB 3QVUA 2XSZD 2N42A 1E3MA 3OW2B 1E9RA 2F9MA 4B3CA 5FBVB 2F55A 1E2GA 5KU1A 3KQNA 2REBA 1KZ7B 3AUXA 3ETLA 4G1BA 4B74A 1E99A 1HT2E 1U90A 2AFIE 1GFIA 2NQ2C 2RKOA 4YDHB 4C0SA 1NG1A 3TSOA 4XWKA 4AYTA 1S96A 2XB2A 5HZKA 3ADBA 4HAYA 1FL9A 1GNPA 4TZ6A 1ESNA 4TYQA 1Q57A 3CCQB 2XNDD 3NDPA 4DCUA 1KSJA 2IBMA 4K46A 2RC5A 2WKPA 1D6JA 1KOFA 1GNRA 4PC6A 1E2HA 2PLRA 3AF4A 4B76A 5FPTA 2VHTA 1X1SA 2LCFA 3ASYA 4ON9A 1E2EA 1T3SA 3RYTC 1NVVQ 3H86A 1GAWA 1ETUA 5FFMA 1TPZA 2ZVPX 1E94E 1OXXK 2WPDA 1G8PA 2GCOB 2WMOB 4JLVA 3EPLA 4RD4A 1L4UA 1L7VC 4JT2A 3SQWA 1YZTA 3RS4A 5IT5A 3RC8A 2EQBA 1YJNB 1JAHA 1E9FA 2IUSA 5KPDA 1W2BB 2CNWD 5L8VA 1NJID 3Q7QA 1KMQA 4CIDA 4DT1A 1QBKC 1F2TA 3LXRA 3I32A 1F2UA 4A0GA 2IL1A 1NVUQ 1L4YA 1ZU4A 1TTTA 1R0YA 4F91B 2NPIA 2ZSAA 3TUIC 4LJ4A 4NCJA 3EG5A 5C1BA 1MKYA 5FUXA 2WJVA 3CCEB 4NHOA 1VQKB 2EYQA 2VP5A 4C3ZA 3KB2A 4Q1AA 1SVLA 1VCOA 2WWFA 1DTSA 3NC0C 1C9KA 4QGAA 2BIFA 4QBHA 1ODFA 1Q22A 4UQOA 4BFZA 1D2EA 3GEEA 1T8UA 1G16A 3UK6A 1J99A 3KJGA 5CIWA 5DYGA 1LFDB 3QXSA 3PENA 2GETA 1R0ZA 1KAGA 2XNDA 4O0MA 4HZUB 4LOAA 2ZJ5A 4MKGA 1KRHA 1GO2A 2R9VA 2YVUA 5FR2A 1UBGA 1YKSA 2YHSA 3CB4A 1Z0JA 1Z08A 1ZNYA 821PA 2V1UA 4JLPA 1QGYA 2EYUA 4R98A 3EA5A 4MYTA 5A4JA 2DFTA 2IA5A 1QZXA 1VCNA 3FVQA 4DIDA 1KI9A 4ZDJA 4KFTA 1YRAA 3B8HA 3GLFE 4QJ5A 3R9XA 3PR1A 3WBKA 1FUUA 3TGPA 1S2MA 4G5OA 4NMMA 2J0VA 4XIGS 1XDBA 5BQ5A 1MRNA 2EFDB 4GPTA 4B3XA 3K0CC 5GJWC 3FB4A 3CWZA 3IO5A 3QEOA 4KYIB 4P6VF 1G7CA 1G6OA 4KO8A 1IXZA 3QOFA 4EPRA 4DDUA 1OFIA 1E6CA 5FL3A 2WWXA 3VX4A 4HB4A 1DELA 2AWOA 2ZRFA 4IDHA 2GJ9A 3NH6A 1M34E 1KTVA 3DEFA 4IDNA 1YJWB 1IN8A 1TVCA 4PTLA 1LF0A 3DZ8A 3JZMA 5DGXA 1VHLA 1DOAA 5EE1A 4KLZA 4BFUA 1NSTA 4C0QC 4O2RA 1E9BA 4DLTA 1CULC 2QE7A 2FZLA 1EFUA 1IJEA 4KU4A 2IUUA 3U4QB 2Z4SA 4Q4HB 4Q03A 5L3VA 1E62A 3Q5EA 4A0RA 3IIJA 4NL4H 4R9UC 4GRAA 1VIAA 3D6TB 5KSWB 4HZIA 1N0WA 2YOFA 4FCVA 3AVOA 2X2FA 1UJ2A 2QAGC 1CIPA 3GJ5A 1Z8FA 3F3YA 1T9HA 1F6BA 1P2TA 1XRJA 5F9FA 3KJHA 3GEIA 1NIPA 5EXTA 1HEIA 2FF7A 2IK8A 4AKIA 4RZ3A 2FNAA 4HDCA 4PHGA 5C2JB 4TLCA 4PSAA 2GPJA 2ZE6A 1XTQA 3D31A 521PA 2CLSA 1VQNB 4B71A 2J7PD 1FNDA 3FTQA 2O52A 1ZINA 1QHHB 5AR1A 1LF5A 2ZRAA 1W87A 3N70A 3ND9A 4ZKDA 4QGFA 1BH2A 2A7QA 5DLQC 1J2JA 2CMKA 2D3WA 3KFXA 3KJIA 1U8YA 4PC7A 2CNDA 1VQ5B 3W2HA 1KI6A 2OAQ1 4MYHA 4M1OA 2NO6A 3U5ZB 3AF1A 4FW9A 1VG1A 1JJVA 1R4AA 4V0OA 5K8LA 1W36C 1KZGB 3W3AA 2GJ8A 4WBSA 5B58C 5SZKB 1W2GA 3NXSA 4BPBA 3OIYA 4LPSA 2GCNA 4WW0A 3TSWA 4EUNA 3CONA 1LNZA 2IXGA 1IXRC 4C0AC 3DHWC 1ZMXA 5AUNB 1G6HA 3BFXA 1U0JA 3B1WA 5EUMA 1R0WA 1Z6AA 2QTZA 2CE7A 2G0NA 2QN6A 1K8AD 4GP6A 4AY2A 1E1QA 2QSZA 2O8EB 1VQ6B 3IQWA 3G0HA 4ZGQB 2YWHA 3OE7D 4BECA 2EFGA 2B8WA 5SZJA 5CB8A 4Q48A 4I1OA 3K8YA 1X8KA 1OJLA 1CLUA 2BBSA 2DCUA 3ADCA 1XMSA 1CR2A 4HLUC 1K6MA 3E20A 3K70C 2AX4A 1EFRD 2OBLA 4URWR 2C2HA 1GVHA 4CEJB 3AEZA 2XITA 4ERNA 2FDCA 1GDDA 3I61A 2DFKB 2NMVA 5JSZA 3WRYC 2W2VA 1J90A 3OFND 1ZU5A 4MYUA 3J81k 4JLAA 3KDSE 3REFA 3SZRA 4D2IA 5KSZA 4Q7JB 1GSIA 4WQMA 2VP2A 3QXCA 1R8SA 4TSFD 3ZIAA 5BYKA 3HYTA 1S8FA 4W9MC 4GBMA 3FYHA 2OXRA 1VQ4B 1ZVQA 1YR9A 4IVQA 2EVWX 3A37A 4P32A 3X1YA 1YHNA 5KHOC 2QM7A 1F20A 3K0CA 3VR3A 3DMNA 1IN7A 4FMCB 4GOKA 4WA7A 3QXXA 1KQSB 3RVBA 3A1VA 3BWDD 4TMVA 2BBOA 1CJVC 3ASZA 4LPKA 2ZJZA 4HATA 3K09C 4R7ZA 5G41A 5L3SA 4JYBA 2XB4A 1AS0A 2KBEA 4HUQA 4D26A 3K1JA 2GF0A 1YZQA 1KK3A 3TJZA 4G5SA 4OQMA 2DFNA 2OZEA 1TQDA 3IEUA 2FE4A 4LBVA 3W34A 1TEVA 1OGIA 2BDTA 2JJ1A 3A4MA 3MJRA 3GJ0A 3NEJA 1Z0AA 3PVSA 4K8OA 4A6PA 3BERA 3THWB 2OG2A 5HE9A 1FRNA 3FDIA 1E32A 1SXJD 3KUDA 4RKEA 1BYIA 5CLQA 1E2NA 1OV4A 3LX5A 5KNDA 3Q85A 3K9GA 3QIAA 2BVNA 3B9QA 4XSHA 5DYIA 1I2MA 3ZJYA 3SFZA 3SE0A 2BGJA 5EMNA 5THXA 2BEKA 2RCNA 4G5QA 4LV6A 4NTZA 2JLYA 2XX3A 3ZIAD 4HEJA 4N0DA 4PZLA 1MO3A 2C8VA 3QNUA 1TU4A 5TARA 4DVGA 3EAQA 3T06B 3OESA 1NNEA 3K0AA 3VMFA 5TY0A 3F8TA 1AGRA 1RE0A 4D82A 1G3IA 3JQRA 3AF2A 2Q3HA 3AKCA 3LVRE 3LH5A 4BE7B 3VTKA 1E9AA 1GL6A 1G5RA 1ZRHA 3UIEA 4LC0A 1QH0A 1XMJA 5E3HA 2B21A 3B13B 4HB3A 5AJYA 2OM2A 3EZ6A 2QU8A 1GUAA 4UKDA 2Z4RA 1F2UB 2ECKA 2IHYA 1YZUA 2IC5A 2IYLD 4G1UC 4Q66C 1Z3IX 1XPOA 1W2HA 5AUPB 2JJ2D 5KPJA 1S3GA 4C9BA 1J8MF 2EFCB 1H8ED 3ADDA 2VL7A 2J3EA 5H8WA 1VG8A 2BWJA 3DPUA 3ZYCA 3WP1B 3ZQJA 3KQKA 3ZVMA 3AF0A 2ODNA 1IB0A 3DOEA 2PEYA 3I3SR 4XWOA 3EC2A 1KDRA 1Z29A 2G0TA 4YMWA 4YAOA 2HF9A 4W5HA 4Q9KA 3ZZ0A 3LVQE 4NPHA 1JJ7A 2AHOA 2BV3A 3EZFA 2A9KA 1FTSA 3UKDA 3R9IA 5B2ZA 4CT5A 3GP8A 1BO6A 2ZSFA 1FTNA 2VF7A 1SVOA 2RGNA 2DB3A 3SYKA 1XXHE 1FNBA 1GILA 1FNCA 1TAGA 2NO0A 2QM8A 4L5BA 4LJ8A 3X1XA 2HCBA 4GL2A 4B4DA 5HKKA 3EA0A 1QUEA 3OJWA 1N6LA 5A0FA 2D4HA 5KYKA 1EWQA 5JSZB 5LB4A 4RKFA 5K8IA 1XJ0A 1WQ1R 4PQRA 1BOFA 1KJWA 1KY2A 3E70C 4HDOB 3U3JA 4M22A 4JIMA 2ZYVX 1DAMA 5JEDA 5JWRA 1KDPA 1SXJC 1Z5ZA 2OFWA 4E03A 2ZR7A 8OHMA 3A6PC 1BMFA 2OK8A 2BMEA 1BX0A 1TX4B 4FMDB 3AVYA 3G71B 3IQXA 1E9CA 3CBQA 1DPFA 1UKEA 1TNDA 1EWRA 2DWQA 1N8RD 2JIZA 3HR8A 5F2EA 2H18A 2XAUA 1RZ3A 2HXYA 4DLYA 4MGKR 3LRPA 4C0KA 1RFLA 4CRWB 5KUTA 3QJYA 2ZAOA 3C15C 3IO3A 1FMLA 2CCGA 3I8SA 2ZUBA 5EE9A 4TL6A 1K5DA 3EIQA 2ZSDA 3SYLA 5EP4A 3HR7A 1TQ6A 2BEJA 1JPJA 5DO9A 2JLZA 1E69A 2A5FA 1OFHA 3UMRA 3TW8B 3CCSB 4EJSC 4BUJA 3ZBTA 3PEVA 4YAUA 2VF8A 3LDAA 1KJZA 1FP6A 4LC1A 1WRBA 1NDHA 4QJ4A 2EIXA 1XEWY 3A58B 4QJ3A 2EFHB 2NZ8A 4P31A 3CC2B 3KX2A 4HE6A 3A4NA 3KKMA 2P2LA 2ODWA 4ASUA 3K09A 4NH0A 3GLGB 5CYOA 3ZS9A 5DIFA 4XJXA 1PZNA 4C0JA 3SBDA 1W36D 4JVLA 1YHQB 2BCGY 2OCYC 3ZH9B 3LV8A 4Q00A 2VNIA 1XD2B 1XTKA 4H1UA 4TLDA 5DI9A 5FTNA 2BJVA 2ZAMA 3TUJC 2IYYA 4BLOA 4OI2A 1CU1A 3LLMA 1Q3TA 2ZRJA 3CRMA 5CJ2A 4ESHA 1JQJC 2P6UA 3QXHA 3SN6A 2OFOA 2F3TA 4KSCA 3OZVA 5LBIA 4A8JA 1FZQA 1R5BA 3PEYA 2ERYA 1P73A 3KXKA 1LB1B 4IVRA 3GMTA 1II8B 2D2EA 3B5JA 4D0LB 3CF2A 3LO5A 4JLMA 4BGDA 4G5RA 2RGBA 4XD7A 1GNQA 2X2EA 4JKIA 4MITA 2AD5A 1FDRA 3U3RA 1NP6A 2JDIA 1TF7A 3HP1A 3DMDA 4Z54A 3QF7A 1T3LA 1N6PA 1E2MA 1Z07A 3K9HA 3KZ1E 4AYXA 1VDZA 5JI2E 1NLZA 1G8GA 1ZC4A 1O3YA 3B78A 3ECCA 3NTUA 3CRVA 3IKJA 4LJYA 1VIYA 1PV4A 5HCIA 1VQMB 1KD1D 5FTLA 1WMSA 3IGFA 1N5JA 1OYYA 1R10A 1AM4D 3BC1A 5LD2C 3FJOA 2FSIA 3EIEA 4EJSB 2QTVB 4BZXA 2QROA 1VQ9B 3B60A 3WXMA 1B23P 2C03A 3B6EA 4C4PA 3QUSA 2YV5A 1M6NA 2ZI3A 2H5EA 2AL7A 3CPWB 6Q21A 2V3CC 1OB5A 2EW1A 1ZIOA 4LYHA 2DWOA 3WYGA 5CYPA 1VQ7B 3T15A 5FTMA 2DFLA 3RRNA 4B35A 1M1KD 1AZSC 2PX0A 1JNYA 3VR2A 1G8YA 3OIUA 3ZD6A 3EW9A 2BCJQ 3BE4A 5AUQA 1TU3A 1GM5A 4NCIA 1ZCBA 5KDLA 2ZJBA 4DQKA 2V4ZA 3THWA 3CKLA 2J0UB 4KFRA 3L0SA 2FEOA 1S0UA 2QENA 1SXJB 4L9WA 5HCNA 5P21A 5LPNA 3T61A 1A1VA 3PXGA 1IM2A 1NBME 2JAQA 3QKTA 1CRQA 5EXXA 3C7KA 5JMTA 1UAAA 1OF1A 2A2ZA 4DCNA 3WYAA 1TF5A 1UKYA 5TDHA 2JDID 4CT4B 1E2DA 1XJQA 1KGDA 3FHOA 3T1TA 2HXSA 2W6JA 3SEAA 3F0TA 3QG1A 2WV9A 3FMIA 4OJQA 1D5CA 2CHGA 2Z0MA 3LW8A 3W5IA 1EX6A 3UATA 4KBGA 4BFYA 3BH0A 4OQXA 5KO2A 1DAIA 2VQSA 3K70B 1KHTA 3D3QA 5F9HA 3CCRB 4R2IA 1WA5A 2ODBA 3X1WA 2QE7D 2QRNA 2VIIA 4JLKA 1XFAA 4OK5A 4JSTA 4HLQB 4TQAA 2EWWA 3V4RA 3U44A 2ZITA 4MGZR 2WM9B 3TQFA 2CL0X 2ODEA 1VYVA 2QMUA 2BC9A 3CZQA 3FKSA 2BPOA 2GBLA 2PCJA 4E09A 3P4XA 2Q3FA 3D7MA 2BMDA 1I4DD 1LTQA 1T5LA 3IPXA 1BIFA 3SJCA 3CMAB 4HAWA 1KKMA 4GOXA 3H4MA 4Q4HA 2Z6VA 3AV0B 2FH5B 1S9HA 2N1BA 2WIBA 2F7SA 3CC7B 1KK2A 1TUEA 1X3SA 3CX6A 2OSBA 3O47A 3RS2A 3VKHA 1Q82D 2GXUA 3VFDA 4FN5A 4PO8A 5KDDA 3ZD7A 3VU9A 4QNMA 1ZUNB 1QVFB 4IOKA 5FUVA 2BJWA 4B33A 2WWIA 5KNCA 3I73A 1N6NA 1CQXA 3SJBA 4QRHA 2ZRGA 3K0EA 4KI0A 4BQSA 4M9XA 5SZIA 3TBKA 3GJ4A 4WXPA 4ZI3A 2PJZA 2WKRA 2O0HA 1T91A 3AGQA 5C4MA 1Q44A 1Y3AA 5BYJA 4A8JC 3PUVA 4MKFA 3TUZC 1Q7YD 3R20A 2WJHA 1R5NA 2VP6A 1OKKD 3OAAA 3QG5A 1Z47A 4A2PA 4AYWA 1OB2A 4OHXA 1KDTA 4BFVA 1G3QA 1U98A 2ZRKA 1JI0A 1NVXQ 3GCGA 4X8MA 4D81A 1DAGA 4EQ6A 1M7BA 4QHTA 2XZLA 2O8CB 1NY5A 2R6HA 2KSQA 3W5JA 1IN4A 4U7DA 3THXB 4ZDKA 2O8EA 1N5KA 3CC4B 1F2TB 5HE8A 1ZM7A 1OIXA 2ZI6A 1U81A 4LWZA 3GLGA 3FMPB 1NL3A 1KI3A 3NDBB 1DE0A 1KYIA 3NHBA 1DAEA 4M1KA 2YZ2A 4CGZA 4CYMA 3GPLA 2ZJ2A 1K8RA 2VYFA 3GLHB 2GCOA 1FQJA 1H8HD 3PG5A 3SHWA 4B73A 4FMCF 1W5SA 2REXB 4OK6A 4MDEA 5FH9A 3V00A 3QE2A 2ZSBA 4UNQA 4PSKA 2XGJA 4JSYA 1OIWA 2CL7X 3MJHA 4KLNA 1JA1A 4B43A 1N25A 1X86B 2RGNC 3PJRA 4MRPA 1EX7A 4TMTA 2JA1A 3O8BA 3U3KA 1JEDA 3SR0A 4B47A 3PEWA 4P33A 2MMGA 3VHXA 1EP3B 3A8TA 3RDPA 4YC7A 5DHFA 4AIIA 1DADA 4BASA 1XXHA 3CW2A 3EPKA 4TLEA 5IRCD 2PT5A 1P9NA 2FN4A 5BXQC 2QTFA 1HH4A 3Q8XB 3G5UA 1IY0A 1G3MA 5JWHA 3U7FB 2FPMA 2BBWA 2H16A 4IXNA 1D8TA 1QHHA 3BH7A 4CEJA 1SVWA 2P3SA 4Q1CA 1WF3A 1W34A 1YJ5A 3QPVA 3B85A 4BLRA 4UXIA 2XSZA 5FOWA 4A8JB 2RC6A 4X8HA 1AQYA 3GLHA 1S4QA 2BOVA 3L0OA 4LX0A 4UNRA 2AR7A 1QFYA 2CBZA 4HLUA 4C7OA 1KIMA 4BWYA 2QG6A 3V9PA 3VKWA 1EFHA 2WKQA 3CZPA 4BFXA 3CCMB 2HUPA 2V9PA 3TRFA 1WB9A 3AM1A 4ZDWA 1DARA 1MOZA 4ZO4A 2PBRA 3T1VA 3WY9A 4HB2A 1E2JA 3PCRB 4PANA 5CLLA 3TLXA 3BD9A 5TXGA 2QA5A 3KJEA 1N3BA 4L9SA 4AWXA 4LBWA 3KQUA 1NKSA 3QPWA 5GV7A 3VR1A 1XCMA 2OO7A 3MG9A 2W0MA 4MDFA 2BMFA 4B34A 1ZCAA 1JAIA 1XF9A 3E1SA 4KODA 4F93B 2ZM5A 3GLGE 2ZRPA 3B1YA 4MGIR 1Z0KA 3S1AA 4B2LA 3CF6R 2Y8EA 1RIFA 1NMZA 2R2AA 1A2KC 4AI6A 3KL4A 1E79D 1NMXA 1YZKA 4QOSA 2C96A 2BN4A 2WWGA 2AK3A 4MQBA 4B3FX 1UBCA 2Q0HA 2WJYA 2E1RA 3P20A 4BRWA 1O87A 4OK3A 1NJGA 2WICA 2CNWA 3KKOA 3EC1A 4XVRA 1KJYA 2CLDX 4A15A 1SKYB 4EIWA 5J5CA 2XTZA 4MUAA 4JLDA 1JBKA 3RC3A 1JXOA 2F43A 3MSXA 4L15A 4W5JA 3WNDA 2OV2A 3CPJB 2GWHA 1CNFA 5H68A 1GG2A 3R7WA 3A4LA 4PHFA 3A1TA 3QKSA 4D80A 1S9DA 1E4VA 1ZC3A 1OE0A 3FFAA 1W47A 1QVRA 3MFYA 1CJMA 3RLFA 1II9A 1Z0DA 3W2FA 1GKIA 4IFEA 2B5OA 4IEEA 2FFHA 4DLWA 3Q5DA 2CL6X 5HTKA 3A36A 1N6KA 3OIVA 3CLVA 3LBIA 1EFTA 4WXRA 1ZD9A 3AB3A 4P4SB 1UEIA 4B3DA 4CZ2A 3WHLA 4HAVA 4TL7A 2ZETA 2EFEB 4DLXA 1ZM2A 4RZUA 3OEHA 3I1FA 2PT7A 3EX7C 2DR3A 1A82A 1GRQA 5EZ6B 3UXMA 3FOZA 1P2UA 1DDGA 2PEZA 5GV8A 1UPTA 2DWPA 4DLVA 4D0GA 1P60A 2GA8A 1AQUA 1YZGA 1Z28A 3C14C 3CX8A 4NU0A 4QHSA 2CCKA 3EIHA 2R6FA 5UKDA 4RZXA 5JS8A 1Z6GA 2JEOA 3KB1A 2G3YA 4JJKA 1OXVA 1G1MA 2J7KA 3W8NA 5CDFE 3AF3A 3CNOA 2ANBA 3NKVA 1OLOA 2C98A 4D0NA 2WPDD 2AKAB 4RY2A 4II7A 2RH5A 4EPXA 1XBTA 2UVQA 5JS7A 1UBEA 2R65A 2JATA 2ZJOA 3ICEA 3I4LA 1M1YE 4LYAA 3QKRA 1JEEA 4PC2A 2FPKA 1M7GA 4PQYA 1Z2AA 1VHTA 1SXJE 4ZGNB 2LWIA 5TB5A 1G5TA 1U8AA 3N5CA 4WAUA 4RD6A 1KY3A 2BMJA 4IDPA 4JJZA 5BN5A 1NLYA 3SJAA 2P6RA 2CXXA 2IF2A 5E7IA 1HV8A 5FBRB 5J4LA 2GESA 2J0UA 1R2QA 4DSTA 1BMFD 5EE0A 3HYRA 1OSNA 3H2YA 1RRPA 1N5LA 1XX6A 3AVVA 2OCPA 1B0UA 1NN0A 3EWAA 5GJCA 1ZP6A 2ZVQX 4M1SA 3DOFA 3AKEA 1QX4A 2ORIA 3SJZA 4DSOA 5F3WB 1D2MA 1E2LA 3LWNA 4LCBA 2BBTA 4W7SA 3KFVA 1JR6A 2EU8A 2ZRNA 1Z2CA 5FI1B 3W9YA 3LFUA 4X8OA 4KYUA 4C30A 2KBFA 2C99A 3R8FA 4JVNA 3T35A 2ZYWX 1N6OA 2IS2A 2H1LA 4IW3B 1UADA 221PA 1QFZA 2R6AA 2RGAA 1AKEA 3A1SA 2G1KA 1VPLA 2C9CA 2QGNA 3NBXX 4LV5B 3R8CA 2B92A 4TL9A 1W7AA 3C4JA 1KO7A 2WHXA 3B7GA 4TYYA 4KSBA 3CMEB 2O8CA 1MABA 1UDWA 2ZI9A 4GI7A 3W6NA 4D4MA 2OTLB 1UDXA 1E2FA 3C5HA 4M53A 4JLOA 1ONBA 3H1TA 1E0KA 1OXTA 1QHYA 1WP9A 1X8LA 2GF9A 2IYWA 2J7PA 4HSEA 4D6PA 3GLIB 3THYB 3UPUA 2QTHA 4DJTA 4Y7CA 4Q1BA 5FBLB 4HDQB 4WZBE 3H84A 2ZYTX 4P4SA 2GK6A 3TAUA 4XVQA 4JKYA 2HDNB 4PSVA 2VYQA 3N2EA 4V03A 4JZKA 1T0HB 2IF0A 1A8PA 2VHCA 3UMFA 4GMXA 3U7HB 3CUEF 4ZI2A 5K8TA 2CJWB 4DCSA 4FMDF 3VHLB 2F1HA 5AWFC 4YONB 1U2RA 5G53C 3NWJA 2F9LA 4RJLA 1D9XA 1QG2A 5K8UA 1XCPA 4NONA 4G5GA 4Q4JB 1P7CA 4HAUA 4AC9A 3RAPR 5KDOA 2G77B 3QVVA 4Q1DA 3BH6A 4JBXA 5FUWA 2YC2C 4L16A 1NBMA 2ANCA 2W58A 4K1XA 3OHMA 4PZZA 2QPOA 4RZ2A 1ANKA 4QM7A 2RGCA 3BRWD 2QPTA 4QM6A 4Q7MB 1U9IC 2CK3D 4A1FA 3MWJA 3U4QA 3QKRB 3SYNA 3AVQA 2IX3A 2HCJB 2VA8A 3QE0A 2ZUCA 2BSAA 1W36B 3K0FB 3EPHA 5JJLA 1P72A 2X3UA 4IKEA 4PX9A 3LBHA 4YQFA 3U7GA 5HR5A 1AMOA 3KKPA 5CM9C 2GK7A 3HJNA 4BFSA 1ZYUA 1BS1A 2GHIA 2ZUDA 4NYMQ 4OQFA 3VAAA 1AS3A 2QBYB 5FL7D 4TMXA 4XWAA 4OHYA 2QDXA 2IYQA 4OHWA 1YITB 1KI6B 4IXMA 3TR0A 3NIBA 5FPHA 4AD8A 2CE2X 3O8RA 1VYTA 4F7DA 1CBUA 4B44A 3REGA 1Q3HA 2PH1A 1EXMA 4LY6A 2ORWA 1QFJA 1SQ5A 4Z51A 4IJMA 2RB4A 2PZEA 2GCPA 3CR8A 3VX3A 3L82B 3CRRA 4PC3A 2SHKA 1JXMA 1UMKA 3DVLA 2G83A 4GFDA 1E2IA 4WZAE 4LHZA 3BS4A 5DN6D 1XJCA 3O8DA 3P4YA 2QAJA 4RFVA 4HE5A 3ZDQA 2YOGA 1QHIA 2X77A 5E7MA 4BRUA 2QSYA 5DSZA 1CKEA 4DSNA 4QL3A 2Z43A 3TKLA 4CEIB 3M6AA 3K9LA 3BJIC 3KXLA 5DHAA 1E9DA 1VCIA 4W5WA 2BF4A 2GNOA 5L3QB 3OF5A 4KXFB 1CJTC 2XNSA 4C0HA 2ZU6A 4D4LA 1D9ZA 2CK3A 3T34A 3NHAA 3BB1A 1K9MD 1KC8D 4PAMA 1EESA 2J5XA 2AK2A 2JCSA 4TYNA 4RD0A 3SS8A 421PA 4FCWA 2OK7A 1NY6A 1DG1G 2FMXA 4PPQA 4V0ME 3NBFA 1E1QD 3MGCA 4NBSA 3VKGA 1BX1A 3GLHE 1R7RA 4EFMA 2ATXA 4Q4LA 5ELXA 5TVKA 2FJUA 4WOPA 3EARA 4QNRA 1SXJA 3RNLA 2VTKA 3W2EA 3SU8A 3BB3A 5AK0A 3UG7A 5DH9A 2HLDA 4Q19A 1R8QA 4DQLA 3ZBUA 2FFAA 4GOJA 4LRWA 3CPEA 3TQCA 5DNYB 4Q9LA 2QEQA 2BKEA 3U3MA 4ZPXA 2W00A 1XEWX 4A0FA 4HZUA 2NPFA 3KQLA 1NLFA 1EP2B 2CHQA 3CWQA 3L8YA 1NVVR 1XTSA 3AP1A 1U8ZA 2V6JA 4DZZA 5DN6A 3RRMA 4CVNA 1JJ2B 1RW4A 2ONKA 2ZRIA 3JVUA 3FHCB 1JB9A 1UFQA 4NDZA 3PUXA 4MYCA 3RRZA 1T8TA 3FPAA 3OJXA 2UZIR 4R71A 2FFBA 2V54A 2WOJA 4TSFA 5EE5B 1Z6TA 2ZYUX 2XXAB 4IOLA 1TLLA 1KAOA 4YAWA 4EJSA 4GP7A 1AN0A 1UBFA 4FMBB 2IYTA 4PXAA 3VR5A 3IEVA 1QVGB 1Q0UA 1G9XA 2NO7A 4KCGA 4ARZB 2RMKA 5J4YA 2C5LA 1E9EA 1U0HC 4G0NA 1KI4A 2H7VA 2JLRA 4AKHA 1NF3A 3ND8A 3UG6A 5JECA 3GFOA 1P62B 4JVMA 3CXCB 3MRSA 1NSFA 2FA9A 2OBNA 4RCZA 2W6ID 4M1YA 2C77A 5EJEA 2DEUA 4ARZA 3GJXC 2B7BA 4Q47A 4MA4A 3BOSA 4LHYA 2NIPA 4EPVA 5G40A 2WWHA 1M90D 4GT1A 1Q20A 3GJ3A 3DKVA 1Z0IA 3M1IA 2J87A 1TADA 4IEIA 4M1WA 2XXAA 1HTWA 1OH5A 4OI1A 1ZUIA 3LAWA 4M9QA 4IDOA 4Q9HA 3NG1A 4CF7A 2ATVA 4O25A 4BLPA 5H59A 1VQ8B 2YNMA 3QFRA 2ZEJA 3RS7A 4C7OB 2IWRA 3ZZUA 2I1QA 2HF8A 2VP4A 3DDCA 4TMWA 4DKXA 4B48A 1EG7A 2ZRHA 4AF6A 4KJZA 1G19A 1YZNA 3F5FA 5IF9A 2VPPA 4U9UA 5L3SB 2V55B 4PHHA 3P27A 3T5GA 2IUTA 2ZRBA 3K0SA 1KMHA 5DI3A 4E07A 1HQCA 2ZE7A 2WWYA 2DYKA 2IEYA 2FV8A 1FNMA 3T12A 1N0VC 5BW8A 4QG7A 2YYZA 4FD2A 1Q1EA 2JIZD 3QENA 4AKGA 4KHZA 4LHXA 2OUKA 3HWSA 4OHVA 3GJ7A 5J40A 2TMKA 5L3QA 2FOLA 1G7TA 3MLEA 1Q1ZA 1NIJA 1XU4A 1RPZA 4DBLC 4MRNA 3HPRA 1CNEA 1GTVA 4Q1EA 2IS4A 1XEFA 1E0AA 4B2IA 2BHRA 3QQ5A 5J4KA 4NCNA 3CCLB 1MO5A 2VNJA 2AD1A 2XNCA 4RFSA 5JRZA 3SQXA 5J47A 1ZUHA 1XEXA 3D8BA 2H57A 3RWMB 1D1NA 1ZM4A 1DS6A 4UJ5A 3VQTA 5B30A 2IXEA 3PEUA 3P26A 2IXFA 2EWVA 1P75A 1W4AA 3VU9B 3LO8A 2ZS8A 4YMTA 4Q01A 1GL7A 3P1JA 4Q4AA 3E2IA 3AVPA 1YZLA 1W4CA 4M1MA 3MD0A 3WNCA 4ASUD 1GAQA 3AQ4A 2V7QD 1QHNA 1VG0B 1W0JD 2GJAA 1L8QA 1JECA 1YR6A 1QHSA 2IT1A 4U5XA 1DDIA 3U61B 2E87A 2GEVA 1I4TD 2WSSA 4MH0R 3AVXA 1YI2B 2O8FA 1HT1E 1JALA 3AP3A 2C9YA 1QG4A 2ZRMA 3M0EA 4M9ZA 4IOMA 5HPYB 4JVSB 3B1XA 4ITRC 1FOEB 3W2GA 4RCYA 4A36A 3MCAA 1V43A 4OBEA 4IVPA 4V0NA 2KJQA 3LVBA 1GJRA 3NBZC 1KI8A 2DBYA 1XD8A 3KXIA 3X1ZA 5JEEA 4NYJQ 4M1TA 4AK9A 4XTRA 4A2WA 2D7DA 1VTKA 1MO4A 3OEEA 1RJ9A 4P0TA 1RRCA 1G5PA 2JLVA 1E1RA 2Q6TA 1II0A 4P4UA 1PUIA 1ZIPA 3HPQA 1US8B 2ASEA 4BZPA 2JJ8A 3LQRA 3IHLA 3BAFA 1BQEA 1WE2A 3TE6A 2Z5FA 1J70A 2NOAA 2O8FB 1YE8A 5KTYA 1P2VA 4EDHA 1AKYA 3BORA 3QBVA 1QVAA 4B75A 1IONA 2P6NA 1CR1A 3PV0A 4URUR 1W0JA 5D3QA 1OH7A 3QFSA 3VO2A 1A4RA 4CW7A 5AUOB 4FK8A 1VQPB 5FBWB 1H65A 4IFBA 3WHKA 2REOA 5BWMA 5AN9A 1N6HA 2WSMA 3BGWA 1FQKA 1CF4A 1G64A 1W35A 1ZNXA 4TQUS 3ZVNA 1E63A 2X19A 3FGNA 1DEKA 2CCJA 2VH5R 4PC1A 1LY1A 2GAAA 2MMCA 1QUFA 1EGAA 2ZI5A 1KO1A 2YWFA 4WZ6A 5JJKA 2JLWA 3I62A 3NH9A 4V0LA 3E1YE 1Q1BA 4KFUA 4ZIRA 1U9IA 2ZE5A 4UJ3A 4QGHA 2OCAA 4XOIA 3TK1A 3IIKA 3AP2A 3K53A 4M8NE 1JB1A 5C18A 1UEJA 3IDQA 4O2LA 3FMOB 5CK5A 4HLCA 1B2RA 3RS3A 4ACAA 2QGZA 4KFSA 4Z8YA 1KSHA 2C95A 2AN9A 3TVDA 1G3UA 3GD7A 1SVMA 4Q4AB 1P9WA 4B32A 2Q9CA 2R6GA 2ZI7A 4I4LA 1TMKA 3KQHA 4XD7D 4C2UA 2ZR9A 1RC8A 1II8A 4US2R 3RS5A 1Z22A 5HXBA 1XEXB 3A1WA 1WDTA 2QI9C 3CPHA 3C16C 4N1AA 2NG1A 2ZXUA 3BXZA 4NZYA 2WMNB 2GZDA 2W2XA 1IN6A 4ACBA 3LXXA 4ESVA 2WAYA 2IYZA 5EXPA 3G4SB 4M2LA 2GZAA 1XZPA 1P61B 5EP2A 3JZAA 1YU9A 1SVSA 3FKSD 3HU1A 4I1VA 4LJ5A 4EPYA 4EH1A 2GXAA 3B9PA 2WJGA 1GR1A 1L2TA 4MGYR 1ZJ6A 1VQLB 2VEDA 5FI0B 2G1JA 1XTJA 3GQBA 4M9SA 5AJVB 1CP2A 2J1LA 3PFIA 4FCTA 5SZHB 4F4IA 1OFTA 3C8UA 2IS1A 1W44A 4URXR 2IYVA 3QF4A 4JLNA 1XPRA 4YDSA 3CO5A 2QBYA 4O3MA 1LS1A 2HT1A 5CK4A 1Z0FA 2ONJA 2QY9A 3MUFA 1PUJA 3BK7A
chains in the Genus database with same CATH superfamily
4L08A 1G6KA 3P2IA 3G9UA 1HE3A 1L5FA 3AW8A 3GFBA 3OF2A 3T3MB 5BRJA 1UH5A 1PDWA 4KR6A 2NT3A 4DM3A 4ZQGA 1VI2A 2XE6A 4FT2A 4HXFB 2QYTA 5DM0A 3T5TA 1UKVY 4PZCA 1F0KA 1OWMA 3U31A 4ER0A 4BYMA 4PO9A 3RYHA 1Y33E 2C4TA 3A6GA 5JLJA 3ETEA 1MH1A 1X0VA 3GEMA 4BFTA 4G8DA 4UNSA 1F48A 5JCJD 3L02A 1BMTA 4JEMA 2XE8A 4A2QA 3SQDA 3VAZA 1JTFA 3WNQA 5COQA 4AZ0A 2DGDA 1NJ6A 1OA1A 3OHPA 4KVGA 2PXAA 1LV8A 2CEAA 5FOVA 3TR6A 3WQSB 4B6JA 4F8YA 3SYTA 1XP5A 3O0DA 1HDRA 2VATA 3VYVA 3SAJA 5CIQA 1EWTA 2J3HA 4XN0A 4O4IA 1C0PA 5AHKA 5ERGB 2EW2A 2M6SA 3ND7A 4K87A 5F76A 2HK6A 2QLBA 3K5HA 1IAQA 5D87A 1T5SA 1YI0A 4GW3A 1BWPA 1HL7A 2D0OB 4OL0A 4M54A 3GHYA 4FJ0A 4QBGB 4QSHA 3VPAA 1C0IA 4PNZA 2OVFA 4G5HA 3X2SA 3RM3A 5HQ3A 1NN1A 4DYDA 1O0BA 1TEXA 3R2JA 1BEEA 3H6GA 4JYCA 3CLRC 2G70A 2GKSA 1RFGE 4TRMA 4F56A 3QIVA 1PV1A 2OFXA 4J8PA 5C8DA 2X8WA 5CYGA 4TL8A 2AXNA 2JIOA 2ZGVA 3RHZA 3AJRA 1LW7A 1XOIA 2BZ1A 1P9RA 3A6LA 1NXOA 4Z1MD 4HX2A 4JI2B 3MBOA 2LDXA 3SP1A 1U7TA 3IP9A 2Y4OA 4HPWA 1Z12A 4L0CA 1JG2A 4OQLA 5CLFA 3W3ZB 1Z6YA 3AUYA 3ZK7A 3PF9A 2EJWA 2YJ4A 4ZHQA 3PGMA 1SUFA 2NVUA 3JQAA 3ZDEA 2C54A 1OT5A 3FUCA 1OXSC 3OZEA 2K2QB 3A2LA 4EP1A 2GEJA 4EQZA 2QZ4A 1RNLA 1J6UA 4RPDA 1K7XB 3L0DA 4MHOA 3PFBA 4Q9IA 3TS1A 5EE3A 1CNMA 1O95D 1MJHA 5BSEA 3U17A 4AN1A 2CD9A 2J6HA 4TYWA 2HMAA 2VZLA 4YIHA 1CRPA 1FZTA 3MXOA 2HCFA 2CYBA 5JBQA 3GMIA 4LSZA 4IILA 5LDHA 3LK6A 5LZ4A 5IBPA 3A8KA 2ETVA 1WDMA 4W9RA 5BQ3A 1KQGA 3T5DA 3LL7A 4C6HA 2EG5A 5HBRA 1RKBA 4NKRA 3G82C 2D2VA 2AKEA 3UMSA 3R6JA 1UMBA 2GLXA 4TLMB 3WI7A 1JHOA 3EXHA 1OZHA 4E11A 2QMYA 3GGJA 1L5VA 3BTUA 4XH9B 4MCHA 4Q7LA 1NKTA 1VE3A 1HYQA 1UP7A 4HAIA 4R2MA 4Y0AA 1KAQA 3VR4A 3HDTA 1QF9A 1IBKB 3NNNA 2BGRA 4HDSA 1NMQA 4AROA 3IBGA 1T8PA 5FTKA 1QO9A 4CI9A 3EPJA 1SBIA 3OE7A 4OXYA 1W30A 2VDKB 3WNBA 3CIOA 5ITZB 4NOJA 3L3BA 3T4EA 2W6MA 2Y3IA 2REQA 4OHZA 2QLTA 4CE6A 2O2SA 5AI6A 1KP9A 2FWAA 1ECLA 3JR7A 3RABA 3Q4GA 1OFUX 4RJKA 4HQKA 3KU4A 1CTQA 1NDUA 3HCBA 5KJEA 1KY4A 4C21A 3QVOA 1I2DA 2YDXA 1V1RB 1CY4A 1E9VA 6CHYA 4DV4B 5K0BA 2J9FA 3AKYA 3UBMA 3UT6A 4HK4A 3MRTA 1T0UA 1VCMA 4WRRA 5BN3B 3HNOA 1CJKC 2QVYX 2R44A 3A9RA 4G1VA 1U99A 4A6DA 3ILXA 1LDEA 4G2TA 2QU7A 4FWIB 2PUTA 1C0KA 1GRVA 4LWPA 2DY1A 5ALEA 3LQQA 3ZLJA 3CRW1 5HJ5A 2H7XA 5KYUB 3UO8B 1T3HA 3B2NA 4F2WA 1YFJA 3E0XA 4RXMA 5LD2C 4X07A 4CMIA 2XQFA 4F9TA 2ZBDA 3NVAA 2GAFA 1NG9A 1I2ZA 2ZOSA 3FCSB 3G17A 3QEKA 1HTTA 1WPRA 1KKUA 2WJIA 1Z18A 3FAKA 3LPLA 3NOXA 8GPBA 2R8RA 4TV8B 1ZI6A 1QG0A 2A5LA 2GBLC 1PVDA 2ABWA 1MEEA 1N2EA 1QR2A 2X1HA 5E2IA 5ITZA 1P4HA 2FW8A 2C3MA 2JARA 3DM9B 3WFZA 1E3LA 4UM9D 1LV7A 3O83A 2X15A 4HQFA 2CRVA 3BE8A 3H65A 5J58A 3AI2A 4XWWA 2CVOA 1E3TA 1QGUA 4ZZ2A 2WYUA 2BHNA 5CDFA 3VU0A 1OILA 2QYSA 4MWOA 1UOEA 2P68A 2EF1A 3L8EA 3U26A 3EN0A 2EFYA 1KNQA 1TIPA 2BKUA 4CTNA 5GZ1A 3G6EB 3LQKA 4ZP1A 4KXUA 5BSTA 3CTAA 3QFCA 1G8HA 3NC4A 4ZCSA 3JYHA 3GEGA 1FUEA 1V11A 1Q11A 2WJZB 4MARA 4WNYA 1KK1A 2NXNA 4TKUB 1N2CE 1VPEA 2XJ4A 4NQRA 2X76A 3ZWCA 1JFSA 4PABA 4DLSA 1T25A 2PAAA 5D6OA 2LKDA 3TQHA 3PUWA 4JQSA 1GTL1 1XP8A 4LDJA 2AXQA 3F2IA 4QQRA 3U40A 5CA1F 3D8HA 2W42A 4ARAA 4EHDA 3IT0A 3MAAC 4FKBA 1XYYA 4JL8A 4ZC8A 2G82A 5CA1A 4FEYA 4QGBA 1Y80A 1DBQA 1KFJB 1O0SA 1UWLA 3S70A 4ARVA 3MWLA 1L5ZA 3P9XA 2VOJA 2E6KA 2QF7A 4Q18A 1BYUA 4QLAA 5DBFA 1SY7A 3VDXA 5JALA 2JI9A 3GZJA 3ZWWA 3WIVA 1AQJA 4ZVUA 4X64B 1E6KA 1PJLA 1Y4ZA 1U7XA 4KAJA 4XR4A 2WLTA 1FW6A 3IUJA 4ZOQI 1LBSA 2VUHB 3GELA 5T3UA 2YNMC 4LZZA 4YGYA 4UFNA 5BOVA 5B4VA 3E4DA 2QTLA 3PHIA 5CFMA 5AVQA 3B70A 2Z2KA 3EZYA 5C37A 1PJCA 1GCUA 1GOTA 3PIDA 1RJ9B 5AW5A 4UHDA 2CVHA 4I9GA 1Z6XA 1T29A 2VSOA 3EDMA 1M1NB 5BSXA 2ZREA 3PGLA 4J2TA 1H8EA 4QDZA 5CNJA 5KSPA 5LYJA 4DCVA 1ZAKA 2GEUA 2VAXA 3FX2A 4GBGA 4LJ6A 2HYIC 1N2OA 4UVHA 4YR9A 4MEAA 1K88A 1XXHB 5JNSA 3DF9A 5TRTA 1JILA 1EFCA 5EMLA 5DYTA 4A3SA 1QGZA 4YV1A 2VHWA 3IURA 3I01A 3OZRA 1DO2A 2M2IA 1X7YA 1ECBA 4TTVA 4F5YA 2BM1A 3W2IA 1LJLA 3BMOA 3ZS8A 4H6VA 5GIPE 1D2RA 5GADl 3IEKA 4HP8A 3LX8A 2A92A 4BXOB 1WM1A 2O23A 1X15A 2H1FA 2JBWA 3DDSA 1T9ZA 1TAUA 4QRDA 1CZLA 4MIYA 3ENWA 1U7DA 2R6CA 5AQ1A 1KZ6A 2O1SA 1XKLA 4WPGA 4DEXA 3NVKI 1H42A 1WSBA 1EVYA 1KSFX 1YJBA 3CJRA 4FWTA 4HLDA 1J9EA 1FX0B 4JOBA 3SDSA 1J07A 2I4IA 4DC9A 1YV9A 3T51B 4WCFA 3ZNNA 3OTOB 4URFA 3S0JA 4YCNA 3ZQ6A 4CKEA 5A9RA 2F8TA 3F96A 1UP4A 4QYIA 1CEEA 2F6RA 3N07A 2PPVA 2K6GA 2P9ZA 1ISSA 3JQFA 3OECA 5E0OA 1ZD3A 3KHUA 2JEYA 2H4YA 3PGJA 5HF8A 2VBVA 4EUEA 2X6WA 4R3WA 3UNXA 3FAZA 5DT9A 1NAHA 2OP0A 3KAQA 3WK5A 2OQVA 3L5OA 4B84A 2NV6A 2W2QA 3L05A 4K5QA 1MV5A 2OBMA 2W71A 4OYHA 1DBWA 2HA0A 1WXDA 2V97A 3WYFA 3FCEA 2G7ZA 1EK5A 2ZUVA 1T1IA 1YVEI 2GLUA 2OLJA 4FQ7A 5AW6A 5CH3A 1GIAA 3AEKA 3EG9B 3I42A 4RF5A 3UW3A 3PQ5A 3L46A 1X7YB 1XZJA 1W1WA 2HK8A 3DG9A 2DFPA 4XRRA 4NFHA 3WMEA 1Z4IA 3C70A 4UU7A 3FZGA 4OB7A 4MS3B 1P45A 3LIIA 3NO4A 4JJGA 1KNXA 2D2FA 3NP7A 3SHFA 3ZCXA 2EL7A 4A10A 2Y2VA 2BELA 5IK2D 2H59A 3ADKA 3LLVA 5JY1A 2AI3A 1QHGA 1CR0A 3GA5A 2ONZA 4DLKA 4C0LA 1UZUA 4G25A 1G0NA 1EM8B 1SNYA 1YL7A 2WFAA 1Y42X 2XGOA 4HWKA 4PCLA 3F74A 4RESA 5IDYA 4ZZ3A 5IYNA 1WOOA 4BTLA 3SDZA 3GYGA 2XWJI 3PPYA 5AJHA 3TL2A 4AUMA 4MVCA 5E6RA 2XUPA 5BVHB 1VE1A 4GC5A 1NVKA 1WUKS 1O96B 1NATA 2AW3A 2YHIB 3K6JA 1G7SA 4LIPD 1SKYE 1M6YA 1N4DA 2Y27A 3P9SA 4YJGA 4NARA 5JJIA 2XOKA 4EGCB 1FMTA 2GTPA 3DB2A 4MQ4A 3H9JA 2QPAA 2XODA 4RQTA 2I7CA 3NBQA 2WAOA 3TOZA 2JHAA 1EBBA 3I72A 1U8CB 2PSFA 1MR3F 3R5JA 4ES6A 1XZ8A 721PA 2C88A 3M9LA 2DULA 5JD3A 1U31A 4FNGA 5I9NA 3WC4A 3C7AA 5LB2A 3TLMA 4BPRA 4C2TA 2BGMA 3N6VA 3DE5X 1FVOA 2I2BA 1OBFO 3UK2A 2EGUA 4J9UE 1M6HA 1QIIA 2JCYA 4TRJA 2V0CA 1XTVA 5TQVA 1L9XA 3U9SA 2OTCA 3QMWA 2UXCB 4MKRA 4TV8F 4Z2AA 2FZCA 3OY2A 4TLBA 1UD4A 4D9GA 3G5MA 2GEDA 4LKRA 3COYA 1T9CA 4MQFB 4D92A 4YFYA 2E2WA 1P6XA 1C7RA 5T4HA 4CUKA 1YT5A 3DXFA 4IQ0A 2QVLA 3IBCA 4YMUA 2R1VA 1CUBA 1L0BA 1VQOB 3C6XA 1T4CA 2Z9DA 2D2XA 2XUZA 2P65A 5CJPA 3UAZA 2BH2A 1BDBA 2OE2A 4IAOA 1FFBA 2O8NA 4CLOA 4AF7A 4NDAA 3T38A 2GUGA 2PDAA 2HGZA 1HE1C 5K20A 2HFJA 1DU4A 4HRXA 3QBJA 4LV8B 5C80A 2QOEA 4KQXA 1YZFA 4BAUA 2QUBA 4R9NA 1N3IA 2BZSA 2FG5A 5CCXA 3L2OB 4G0WA 1X6VA 1V4BA 3KAJA 1W5TA 4AAYA 5CITA 1UBMS 4BLUA 1RVV1 3FYCA 1O94C 1NC3A 1JBQA 2FG7C 2A57A 2YZMA 4FIZA 5TVGA 3U2QA 1WSRA 3ZCUA 1MG0A 4KSYA 2YW9A 4ATNA 4JXZA 2HSJA 1HORA 5LNK6 1QFMA 2CDBA 3PHGA 4HVTA 5KJFA 5LU9A 1ZFNA 3K3PA 3LA6A 4RC9A 1H4SA 1Y37A 3H1GA 4WERA 1LSOA 2A84A 3EXAA 4D1YA 4C7VA 3BIFA 8MHTA 1YCGA 3H4VA 1N1GA 1DQRA 2QEXB 3WIOA 4IQ4A 4S1NA 4X62B 1UAGA 3OI7A 3RU7A 1H2HA 4OI0A 4ZZIA 1R0XA 2D3LA 2X0JA 2EV9A 1JW9B 5FQNA 1M73E 3DDZX 5G02A 1R6BX 3V1YA 1AMUA 2EARA 1V95A 1B14A 2JPDA 1ZNQO 3H18A 3S27A 1T4GA 1CQZA 3K5PA 2CXRA 3AJEA 1Z5UA 2G5GX 5KX5F 3FB1A 4MW6A 5HK8A 1B8PA 1E59A 4D46A 5IVPA 2OHHA 1S8NA 3RLIA 1Y34E 3LW7A 1DMRA 3AKDA 2WYOA 1WXXA 4QECA 1R5OA 2ZIEA 4DLZA 3CR3C 3IQHX 1ZPDA 2YWGA 1UJMA 4KV9A 1KQFA 4F4JA 1CHDA 3AHFA 4EB8A 4Z9BA 3ESRA 2H4XA 3HO6A 6REQA 1QIJA 3RADC 2PS3A 2AJDA 3Q6MA 1DAOA 3D2AA 4PR0A 4IZ6A 3A3GA 1F8XA 4BXOA 2HWXA 4JBGA 1UZMA 3D81A 3EXHB 4Q6WA 5EIXA 1T2CA 4CGYA 1OAOA 1UD5A 1BWRA 2ZIAA 2QTRA 2XZPA 3UW1A 3UOGA 3L6CA 1FW8A 3TPCA 3FTFA 4YAFA 3D0QA 2C57A 1SU7A 3ZJ4A 4XMYA 2R87A 4A8HA 1QFXA 3HMKA 2GVNA 1KI7A 4F0JA 1LVGA 4RETA 4C7XA 3PUKA 4DIBA 4W7IA 4DDHA 2WIAA 2ORVA 2BM0A 3CRQA 4X0EA 2YV4A 4ALLA 5EP3A 3UANA 4DMUB 4IIHA 4RHEA 1YRQA 2YKGA 3A9SA 1WPGA 4M0LA 1KO4A 1IK4A 1Q2UA 1W581 1RP1A 1UOPA 2YASA 2RAPA 4K81B 4QBIA 1Q0ZA 3BXHA 3HBFA 2DG2A 4L8WB 3WIUA 2QRQA 1SXGA 2BUAA 3PVDA 1DG3A 3F90A 3HCFA 4KO4S 4R3NA 4TTAA 4K0RA 1ZL2A 1SC6A 1G7RA 4WBNB 3R9WA 1M74A 3HCWA 5MHTA 1PD1A 2QK4A 1EGMB 3D4OA 1MO6A 3BD8A 3FLEA 1J00A 3NIGB 1NUQA 2QQ0A 1M34B 2XUAA 4CV3A 4AWBA 3B1VA 1W46A 4DC1A 5BSHA 4XIJA 2B37A 3PYXA 1F2VA 3SCZA 3MS2A 4FM9A 1FP7A 1P8JA 1L4BA 2XEDA 1PEDA 3QFHA 5GINE 4I08A 4YREA 1XMVA 1M76A 5CDYA 2CL5A 1COWD 4A03A 4OLJA 4GZMA 1M1UA 4L2IB 3THYA 5L95A 4BLVA 3ZHRA 4EZBA 2TSYB 1TXGA 1VGQA 4RH3A 2O57A 2ZU0C 4WLNA 2RGEA 3Q9LA 3KLMX 5HQ3B 4H27A 2ECPA 1GP2A 2BKVA 3GAAA 1F5NA 5B6IA 4Y9UA 3EY4A 3H1EA 3MMSA 4N5LA 4MLZA 2LP4Y 3EVCA 4KGVA 4O2BB 4RPJA 4C7BA 2YOHA 1MABB 1KDZA 4Z3OA 3SIPA 1ACMA 1ZW6A 2V3VA 4MUBA 1CDOA 1LPAB 2P9GA 1XTRA 3Q3JB 1A7JA 4N5HX 4NJOA 1SHKA 2P3OA 5JTTA 1DO0A 2W37A 5AM0A 3GXBA 4RPCA 2BGIA 1N8TA 1PK8A 2I1VB 3KLOA 3QPBA 3EWSA 4LGYA 1M5TA 1AK1A 5LZ2A 4X85A 3FUUA 3GJRA 4QG7A 3MLBA 4I81A 5LIPA 5TR9A 1CUUA 1AK2A 1E3DA 3PL1A 4NK4A 2F1LA 2GD2A 2QAGB 4LK2A 3G2IA 4DUGD 1OUMA 3DO5A 2H1IA 2X8LA 4HH4A 4IUYA 1TTQB 4J0GA 5LCXA 3ESQA 4M99A 1M2VB 3T56B 1XB2A 1RVDA 3UICA 3P0RA 1H2BA 3KS9A 4R8LA 3A05A 3NW9A 5KTOA 1GRRA 2AI2A 2CJWA 2GVDC 4HVCA 3KZVA 1TMOA 2V4DA 4XASA 4O5OA 3OCCA 3QELA 2CSXA 4YTEA 3RVSA 3T8YA 1G21A 3CW8X 5H82A 5I7UA 4LDNA 3A31A 1U2PA 3I56B 1MPXA 4BCCA 3FE2A 3FKQA 3BY2A 1EDEA 4ITUA 2IFTA 3K92A 4ZJUA 4ZEVA 2H0RA 3KWMA 1W0KA 2DERA 1DBSA 3L6RA 4YUVA 3I52A 4A9AA 4EB3A 3KL9A 3I05A 3MELA 3W0LB 2ZIWB 2FPSA 2C0PA 3A0RB 4ILEA 4X7MA 2G9NA 2PVPA 2VLIA 3G79A 5JRJA 1OHHD 1STOA 1UK7A 3A4VA 3LG2A 4V0KA 2ZG6A 5EP1A 3TZHA 5BMVF 5ALYA 1YFLA 3EBOA 5DFAA 3K7EA 2IOFA 1OKKA 2YJ6A 1P3DA 1A2BA 2GZ2A 3DNFA 3K8ZA 3BFKA 1LLQA 3AU9A 2Y1FA 1SUPA 1JLLB 2HA3A 2XQGA 1SEVA 4IIGA 2PNJA 4D9FA 1RP7A 2IEZA 4YAGA 1FFYA 1EH5A 2AZXA 4BEBA 1N0UA 3E81A 1H4VB 4IRUB 2I3ZA 4Y18A 2PRZA 3JVDA 2DHEA 3C1UA 5AD1A 1R5JA 1XTZA 1XQ6A 2QX4A 4Q02A 2I6UA 1C8BA 2E4YA 1LJUA 1M2OB 1OFVA 3JWPA 3Q6RA 5I7HA 2EP7A 4FE3A 4NYMR 4XM3A 4RNDB 1PR2A 1YKGA 4E32A 1NZDA 1V37A 3I53A 4CTJA 1VXRA 3CXUA 2BRUA 4UVIA 1J1ZA 1EB8A 1XZKA 1YB2A 4L0QA 2V98A 3FTQA 1N2CA 4PAQA 2AFIB 2LXNA 5DISB 3PPXA 2I2WA 2YC4C 4JXJA 1XMIA 2YFQA 3HCOA 4GPD1 4RSMA 1IPEA 1ZLYA 2KLBA 3IA2A 3A04A 4PRLA 5DWQA 1IOZA 1P0PA 3Q39A 2H63A 2PMEA 4IIBA 1Q7GA 5BVGB 1IUPA 2IPNA 1IN1A 4PG6A 1XN1A 4HMPA 4QIHA 3I09A 4C6RA 1Y63A 4OFXA 1A5TA 1JDJA 3IE0A 4MAFA 3MHPA 3U7EB 2H2GA 5FPKA 5FLYA 2HJGA 2P5SA 1ORWA 3X1DA 4EVIA 1XZLA 4H3KB 4U9HS 5BWLA 1GA1A 3DMFA 4OOSA 1J0DA 4QGGA 1JLRA 3WRXC 4GMDA 4B3IA 4D9CA 4LF8B 4IUBS 1YHYA 4KBFA 4RVHA 3DTVB 1ZMTA 1Z7BA 2BGNA 2YHUA 5T67A 3T1HB 4LHVA 1YUMA 1E9SA 3L0IB 5EIHA 4TV9F 2AG1A 2QRMA 1HYGA 2XA9A 1AHPA 1ZK2A 4JCCA 4OPMA 4W6QA 4M3NA 1CT9A 1T2EA 3E22B 3HSSA 3WJ1A 3ZCPA 5ICMA 4MVJD 1PWXA 1QGOA 3FFXA 3ZWOA 4DV5B 2F9MA 1GZ7A 4MR7B 4U2KA 4LNAA 4B3CA 4HNVA 5KU1A 1WORA 3FNBA 1UK6A 1I1HA 5JC8A 1KXJA 1ULTA 2XVYA 5K0NA 1L3IA 3FI9A 3E8XA 2RKOA 4EB0A 4C0SA 1NR5A 2VBIA 5I9LA 2XZDA 4I19A 3LC7O 3MBIA 3W05A 3M1LA 5KX5A 3KOMA 4L9RA 3EPRA 4OU5A 5AOVA 4IH1A 3OE5A 1MIOB 4B0PA 4DQVA 2XNDD 4DCUA 1I4EB 2TS1A 1KSJA 3FYDA 3NDPA 1BA3A 1HF3A 2IBMA 2RC5A 4S04A 1GNRA 3NEAA 1S01A 4B76A 4EGSA 5FHRA 4M1EA 4DV3B 2LRHA 2RG1A 3OIGA 2ENUA 4ON9A 1JSXA 1E2EA 2XMPA 5CLGA 1IJKA 5EZQA 1YNSA 1VI6A 2OXEA 1H2ZA 2ZVPX 2D1YA 5MF6A 1G9TA 1RMQA 1E94E 1OXXK 3PNVA 3RG2A 1YF3A 2WPDA 1G8PA 2HXGA 2XYGA 4NQZA 4AMZA 4DZRA 1JQBA 3IV7A 1L4UA 3GO4A 3SQOA 1C1DA 1WXWA 4MWSA 4S1PA 1YJNB 2A0KA 5C7LO 1E9FA 1VJCA 3HDVA 4I55A 5H3CA 3H94A 3NRJA 3M3PA 3D59A 3UB3A 1XQXA 3Q7QA 1UPBA 4KQ2A 4FS8A 2AXEA 3GVPA 5LA6B 5HA5A 1L4YA 1ZU4A 1TTTA 5CNKA 4W5QA 1SC9A 3L1KA 4WDRA 4CMBA 5A4MS 1X7XB 4CM8B 3OM0A 5ITWA 3STUA 5HW0A 4N5IX 3IKVA 1ZMOA 4CIAA 4GDMA 3CCEB 4BRSA 3GMDA 1TK9A 4NHOA 1Y7HA 2EYQA 2O2YA 2BEWA 4Q1AA 4RKWA 3DD1A 1Y8AA 3LNTA 1VCOA 1ONSA 1DTSA 2WWFA 2Q41A 1NWCA 3NC0C 4QGAA 1Q22A 1RYZA 3HRIA 5ELLA 4DBLE 5CEJA 2JAXA 5C31A 4YRLA 1P77A 3QHAA 4JI7B 4MS4B 3QKIA 1Z56C 3KTDA 1AD2A 5F2NA 2APJA 3LT5A 1DKQA 1I3KA 1EQAA 3PXEA 1U7UA 1X7XA 4G81A 4CM8A 4WE3A 2IP4A 4CKBA 3AOEA 1MOPA 4TKLA 4UASA 1L4LA 2VDLB 5DW0A 2R9VA 5EMHA 5JC1A 4FR2A 1TKCA 3ZDYB 5FB3A 4UD2A 2YHSA 3CB4A 1F12A 3D2LA 5KYGA 1Z08A 821PA 5ER6A 4HVAA 3AHJA 3K2QA 3AEUA 4JLPA 1QGYA 2CC2A 3W04A 4EUSA 3REQA 4MYTA 1GZ6A 1N75A 1Z17A 2ZBEA 5H9WA 3QW2A 4LE0A 1QE3A 4WZBA 1KR2A 1YRAA 1UWKA 1NQAO 2RGUA 1NI4B 4Y2QA 4D3YA 3COZA 1FUUA 4NDNE 1PJBA 1MFZA 1S2MA 1UKCA 3P9PA 4XIGS 3ROPA 4CL3A 2NSYA 2H06A 5GJWC 3DULA 5A02A 3IO5A 3KLNA 1AUXA 4P6VF 1HPLA 1MO2A 3EFEA 3KJXA 1USIA 3OLCX 1QZUA 4K1LA 3JQEA 3ISVA 1Y1SA 4HX5A 4ZAFA 3QWFA 2IV7A 3IP8A 2DQYA 3K72B 3VX4A 2OL4A 3T7TA 3WGNA 1S3IA 3GRYA 4ZQCB 3ETJA 1CWUA 1M34E 2DBRA 4IDNA 4QDKA 3FPCA 1PZMA 4X05A 1AQLA 2BLLA 2YIJA 4DV2B 3V8RA 4ZQEA 2WMDA 2OD7A 1MB9A 2IGTA 3K1AB 4KZKA 1O94D 3OD5A 2AE2A 4O2RA 4J03A 2DWUA 4R84A 1SHJA 3SHVA 1HLFA 3HXLA 4C89A 4TM8A 5EQJB 1GFWA 3WX0A 1OYVA 2NV4A 2VH2A 1ULAA 2Z4SA 5HEKA 1XLVA 2G63A 4NY1A 3W6ZA 4Q03A 1IL0A 4OHBA 4PV7A 5F7XA 1I01A 4OH1A 4JYAB 3V80A 1EFKA 1D4FA 2NU7B 4GRAA 3AR7A 1ORRA 1VIAA 2HU7A 4XWTA 1R64A 5ED4A 1PQWA 3A1FA 2OCKA 3AG6A 1NRKA 1UC9A 2X2FA 4KB5A 3WS7A 1FYFA 1NVBA 2QRUA 3IRUA 2C4VA 3DE3X 2R5WA 4PNHA 3AESA 2JGKA 2X8BA 3QFFA 3S5UA 1F6BA 1TZKA 4FFLA 5JV5A 4IPTA 2POCA 4GXQA 4WKGA 5F9FA 4IIJF 5LKRA 2IK8A 4IDEA 1J0XO 4TSRA 4C0WA 1VE7A 1ONOA 4HYTA 4PGMA 4WV3A 4NV0A 3HVIA 3RJZA 2CJYA 3BA1A 4YP5A 4BNYA 4PHGA 3UJ3X 4BE9A 1OBVA 2HO5A 4PSAA 1AUPA 1QB8A 4TVOA 2L82A 5CA0A 1K8QA 3C2QA 3FZYA 2NU6A 3TZKA 3NR2A 3NAMA 2VTVA 2WUWE 1B76A 4JJAA 4OHRA 4AG3A 1JA9A 2A33A 3C3XA 3IPCA 4IMJB 1U8FO 2HUNA 4MMXB 2XWSA 5IEJA 1Q0HA 1WSDA 1ZVMA 1GT91 2WG1A 3C6QA 3ND9A 3O7WA 3OO1A 4J6EA 1RAFA 4MUYA 4PU0A 4XIFA 3V8MA 2EJBA 4E7OA 1IHMA 3P4UA 2CMKA 4BIMA 2PH3A 1J39A 2C82A 2QL7A 2FR0A 2ZBPA 4PINA 3EAGA 1PBNA 3CN9A 5CW1A 1KI6A 2OAQ1 4MYHA 4M1OA 4W5OA 5LYYA 4RTQA 4IXTA 3KOYA 1QTIA 3FUVA 4OUDB 1XQBA 1MAHA 3HV2A 3IUMA 3KQPA 3KUKA 2A9FA 4BQOA 5AXBA 2CLOB 3RU9A 1MENA 3W3AA 3WV5A 1H6BA 1UBKS 1HOXA 3W8EA 2PPLA 1PFWA 1XT6A 5SZKB 3ZBQA 3F49S 1N77A 1JIVA 1UT8A 4GHWA 1KH3A 1RXSA 1LNZA 3Q2KA 4ICIA 2ZIXA 1LD3A 1X9HA 2BFDA 3DHWC 4Z4ZA 1G6HA 3E9QA 1NPTO 5DM70 1NVTA 3B1WA 1Z6AA 1JIKA 1V16B 5TS3A 1PFUA 2LUOA 4A26A 4EG4A 2QN6A 4AY2A 4WCFC 2VDVE 2QSZA 1WHSB 1J42A 2O8EB 1GQSA 1FU4A 2A59A 1FDSA 3IQWA 4PBRA 1I1NA 3HNRA 1DP4A 2Q1YA 3F4LA 4ZGQB 1UMDB 1OB0A 3ILHA 4B4VA 4CMGA 5J2UB 1ODIA 2B8WA 2LZ0A 4YASA 5SZJA 3ER6A 4UPVA 3BQJA 2EJTA 4XEUA 2EX1A 5CJJA 1EDBA 2KHZA 3K8YA 3N75A 2BBSA 1XHLA 1BU5A 2P4EA 4ZAVA 3L8HA 3ADCA 5ER9A 2HL6A 1W76A 1QONA 2CMHA 3K70C 4URWR 1EFRD 2XOEA 1Y82A 4O4JB 3SX4A 5AM4A 4LNUB 1TO1E 5ICEA 1TW3A 1DHTA 5TF0A 4CEJB 1QX3A 2G67A 2RONA 2XITA 5E1MA 1FFGA 1L5YA 3GNLA 1CFJA 1NASA 2PL9A 3ELUA 4HOYA 5EJAA 3VKUA 4ER5A 2FPXA 3FM9A 3P0IA 4P86A 4KXXA 4OHMA 5AICA 1J90A 3OFND 1ZU5A 3J81k 2FWPA 1XMPA 2UYYA 3HYNA 4P0QB 3TZEA 1U7OA 4FJ2A 1R8SA 3A6DA 1N1DA 3B36A 3H7AA 3OQHA 1T9KA 3HYTA 1IIBA 3TRHA 1AXGA 4BNXA 4CETA 2G4CA 1E20A 3AHGA 4GBMA 4KN9S 4L75A 1VQ4B 5DTEA 2FMIA 8AT1A 4P32A 3ZUGA 2GBPA 3URMA 1YHNA 2GN4A 3X1YA 3O73A 4FGSA 1AX9A 3K0CA 2FPIB 3F9CA 4ROXA 3C8HA 4A27A 1H0SA 4FMCB 4GOKA 3RU3A 2WC1A 1M2JA 1PTJC 3MUOA 2QN9A 1Y4SA 1SPXA 3KPWA 4Y2HA 3RVBA 5JDIC 2FQQA 3ZE8A 3CP8A 2GPNA 3T3PB 1PCXA 1G20A 1G2OA 1LCIA 1YDHA 2FUEA 2P9YA 2ZJZA 3FWZA 4G0XA 4BB6A 1L5GB 3ITDA 3IJ5A 3JWHA 1L7MA 2KBEA 3OSZA 4HUQA 2WJ3A 4JJ8A 4D26A 3GPCA 5HHTA 4PSDA 3TJZA 4XB2A 5DLDA 2WINI 4LWOA 2DFNA 2P9QA 3IEUA 2IYEA 3F5MA 4RJJA 2VDQB 3DQZA 2QRVA 4Y2XA 3W34A 2AFHB 4LXIA 3A4MA 2BDTA 4GP9A 4KFCA 3PDHA 4EW6A 2VNSA 3MJRA 3GJ0A 3QMMA 4DHWA 3AZQA 4Z9FA 1ZD5A 1PQ4A 1SUBA 5E6UB 5ICFA 1KJNA 5IWAB 3KWJA 5EQFA 4UAVA 4K8OA 1FFSA 1P9OA 3FDIA 1E32A 1SXJD 3SLNA 5EIOA 3SXPA 1BYIA 4FFNA 3WLTA 4O6VA 3QX3A 4R2KA 4EI7A 4X0CA 5K3OA 3FMVA 1MJGA 1RWMA 2NV0A 3UVEA 5J3OA 1I2MA 3R6DA 3M6VA 2BEKA 5EMNA 5THXA 1RPNA 2HREA 2VA9A 2JGDA 1NQXA 4BQRA 4MB0A 1FFXA 4HEJA 2V9CA 3H2KA 3R0ZA 4O29A 1TU4A 1TO2E 3RVDA 4DVGA 2ROQA 2VWPA 1YA8A 1Z38A 3NHMA 3JZDA 1LPNA 3ZDXB 2VN8A 3I1JA 4Z0NA 3F8TA 3MW8A 3GCZA 3R9XB 4NMLA 4D82A 1G3IA 4JLSA 2XUFA 3AF2A 4E6PA 1BVHA 3GIRA 2AZDA 3LH5A 3ZDZB 4FZ5A 5A8AA 3VTKA 5ALIA 2B21A 4EYKA 3ERCA 3EMVA 2OM2A 5KREA 3VR5D 5EFZA 2QU8A 5CCBA 5FWAA 2W6ZA 4DMHA 1YZUA 3N0XA 4G1UC 2J9FB 2TYSB 4ZGWA 5IRCD 4MV6A 1W2HA 3TG8A 1EUDB 5BN5B 4PLFA 4ZT3A 5AUPB 5KPJA 1GPKA 1J8MF 4L4XA 4QT0A 3ZHXA 2A8YA 2VL7A 2EKPA 3E9EA 4E3WA 5H8WA 1VG8A 2VDPB 4ZYUA 4CPDA 2BWJA 2IHUA 5B7QA 4XIIA 3ZVMA 3F47A 4OYYA 5EJIA 1G8MA 3HY4A 2BFEA 4QGSA 1R0RE 5JYEA 4P2GA 4GKAA 1Z29A 1L4NA 2AMYA 3A35A 4N3AA 4DQXA 2HF9A 3H9UA 4IX9A 4Q9KA 4XPIA 5EMMA 2Q4RA 1XZMA 3LT1A 3UF0A 1B16A 4NPHA 4AY4A 4OA5A 1RJFA 3EZFA 4R2JA 3UKDA 5KNLA 2YJ3A 3PXBA 4N12A 5LU8A 2OPHA 5L40A 2IYOA 4CT5A 4AJJA 4GI1A