4M53A

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in complex with gdpcp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
403
structure length
403
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 104
structure length 403
sequence length 403
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m53A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m53A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m53A01
1NG9A 2BGJA 5H1YA 1E2HA 1NMYA 4ZI2A 1NRJB 1IY0A 1XTRA 5GJVC 1DAMA 4MH0R 3VR4A 4P4TA 5JRZA 4TYYA 1QX4A 5K8LA 2DEUA 1X8LA 4GRAA 4FW9A 3SNHA 3KFVA 1N6PA 2FN4A 1YR9A 4BFUA 2VP0A 2XEXA 3LXRA 4GT1A 4RFSB 2O8FB 4PC7A 1A4RA 4CEIA 2WJYA 3K9GA 3U44A 3MWLA 3TRFA 3MFYA 1GFIA 4G1UC 2P65A 2QEXB 4QGGA 4S2EA 2CNDA 2JCSA 5FOVA 4RD6A 1Q86D 1P5ZB 2R6HA 4WOPA 1H8HD 3KKOA 1HE8B 4JKYA 1Z5ZA 1AS2A 4D81A 4LOAA 2IA5A 1ZIPA 3CH5A 4MQBA 3WMEA 1VMAA 3C16C 5LD2B 2W0MA 1GR1A 3OEED 5G3YA 5GVSA 5C1BA 3U7FB 4V0KA 2PCJA 4KU4A 1Z0KA 3AKEA 3HU2A 3PEVA 2XNDD 2AD5A 4JSTA 2CHGA 1NLZA 4B43A 3GJ7A 2N42A 4BZXA 2JLZA 1IY1A 2ZSDA 4PHTA 2D4HA 4TYQA 3B8HA 1QHNA 3IGFA 3C14C 2HF8A 4LHXA 4DHEA 1AKEA 5SZIA 5UKDA 3RS2A 4UNPA 2AN9A 3QUSA 5DHAA 3V76A 1SVMA 3RAPR 3LLUA 4LGMA 2JAQA 4IXMA 3VQTA 5CIQA 3T34A 1LB1B 1VECA 4U9UA 4URWR 3IDQA 3CRW1 3BFVA 4GSYA 4BUJA 621PA 2Q9AA 2IEZA 2E9SA 2EFDB 3WMGA 3K70D 4LV6A 4PC1A 3KJEA 2FFBA 1A1VA 3LXXA 1UAAA 2QTHA 2F9MA 2J7KA 4LHYA 1NLFA 2JLSA 4LJ6A 1II0A 5FR1A 2FPLA 4M2LA 2R6GA 5B30A 4L9SA 3RLFA 5B64A 2G83A 3X1WA 5FUWA 2IUUA 3CZQA 5CYPA 3W5JA 1GRNA 2VBCA 4GPTA 1BMFD 1Z6XA 3FKSA 1CIPA 1YZQA 4HDCA 1XD2B 4DJTA 3IIMA 3P20A 3RYTC 2O8BB 2NO6A 1QHHA 5KU1A 4I1SA 2HEIA 1QHSA 2OHFA 1F2UB 4G1BA 3SDZA 2WKRA 3ZJYA 3TH5A 2QMEA 3AVUA 4LBYA 2J5XA 4EAQA 5JHGB 1LS6A 1VQNB 3QF4A 1F60A 2ZSAA 3L8ZA 1GKIA 5LBIA 2H8KA 1P62B 4MGYR 2ZRCA 5TXGA 4HAXA 1RRGA 1SXJC 3Q72A 1GIAA 3GLFA 3RC3A 5CYOA 5IDVA 1GITA 2Q9CA 2RGNA 2NO9A 4W5JA 1EP3B 3T1QA 1AMOA 5B58C 2RGDA 1EK0A 1A5TA 2ZVQX 3X1XA 5AJWA 5EXTA 4Q9JA 4DRZA 1NL3A 1VCOA 4YMWA 1JXMA 2J0UA 5L3VA 2ODBA 3NTUA 2PZFA 4AY2A 1XJ0A 2BM0A 2YHSA 3TVDA 3U3OA 2HCJB 4KYIB 4RJLA 2XB4A 4II7A 2FSFA 3UK6A 4PHHA 2G77B 2XGJA 5EMNA 2X2EA 1QG0A 4Q19A 3OESA 1GVHA 2GAAA 2ZU0C 3ADKA 4FXPA 2WMOB 2FSGA 3AKDA 1F3OA 1MO6A 3OE7A 1JR3A 2QAGB 2R6AA 3K53A 4ZDIA 1RYFA 1G7RA 4OHZA 3K0FB 5FBWB 2VP2A 1Z6AA 3U4QB 3GEIA 1K5DA 1Z22A 4QKQA 1BJKA 2V8OA 3OF5A 4KFRA 4LCBA 4RZXA 1IBRA 3QFTA 3BFKA 4P4UA 2WPDA 3HR7A 1NN3A 1U90A 3DZ8A 4XH9B 3CD6B 3DPUA 1AQYA 1RE0A 2IYXA 2QE7D 3A37A 3AF2A 1BO6A 1U98A 2RGCA 3N2EA 1IN8A 1OHHD 4XD7A 3A1TA 3A1VA 4H1VA 1L7VC 3QOFA 3JVVA 3VR2A 2GXAA 1JQJC 2H5EA 4IKEA 5L8VA 1LF5A 1N25A 4Q4HB 1N5KA 2ZJOA 4MKHA 3K0EA 2WAXA 1BH2A 4NYMQ 3UG7A 3QY0A 1TAGA 5HTKA 4DCUA 3BERA 4NCKA 2RHDA 4S35A 1VKJA 5JECA 1CQXA 4M1OA 2WM9B 3KL4A 3ONWA 4JLVA 2O8EB 1VQPB 2DYKA 2J0VA 3AV0B 3CR8A 1ZCBA 2ZE8A 3GLHA 3I5YA 1P72A 2REOA 1CRPA 1B2RA 2BKUA 1W2BB 3B60A 3FB4A 1KO1A 1A8PA 2Q3HA 3I92A 1PUJA 5J5CA 3ASZA 4NYJQ 3EA0A 2IYSA 4LSGA 1S96A 1TF2A 4EPYA 4V0MA 4URYR 2QNRA 2Q0HA 3CUEF 1N6NA 2J87A 2ONKA 2QAGC 821PA 3PITA 3ICQB 1WP9A 2FA9A 3Q85A 4ARZA 4MYCA 1X8JA 1IAQA 3S1AB 3LVQE 3GQBA 2PL3A 5JSZB 4Q03A 1OPXA 1G8GA 4LI0A 2Z5FA 2QA5A 3WRYC 4DQLA 1IN7A 4J0QA 1E1RA 2CK3D 2IK8A 3DMNA 3TR0A 2OCYC 1BKDR 3KJGA 1W4AA 1Z0IA 2BMWA 4B6FA 5DYIA 4R7ZA 1JB9A 3DVLA 2FEMA 4HUQB 3LRPA 4JLMA 4NMMA 4BRUA 4KFUA 1DS6A 1XP8A 3D7MA 4CF7A 5EP4A 2FOLA 1D9XA 4YMSA 1DPFA 1ZUNB 1EWQA 5F9FA 1H65A 3LX5A 1RRCA 3IEUA 1NNEA 4X8HA 4DUGD 4IRUB 4YAWA 2VP9A 4JLNA 3RSOA 1G5TA 3LW8A 4B3XA 2FFAA 3Q5EA 3T35A 2ZIAA 3EIHA 1J8MF 1NBME 2FMXA 1PV4A 2JJ8A 4TT3D 2AWNA 1CF4A 5DLQC 3ND9A 1Q0UA 2F3TA 1S1MA 1QDEA 4XVUA 3KUDA 1G7CA 1EWRA 1LV7A 4JZKA 4L5BA 1Q7YD 4D4LA 1Z83A 1C9KA 1I4LD 2V55B 3PR1A 4I1VA 1JBKA 2VIIA 2O0HA 3GLIB 3MGCA 1W36B 2NPFA 3PUZA 3CNOA 5G40A 2WWYA 4XSHA 3JVUA 1EFCA 2A5YB 4C2UA 2QENA 5KPJA 4A1FA 4HUTA 3E5HA 4ABYA 4QM6A 4N3GA 1W34A 2R65A 1KMHA 2ORWA 4DC9A 4NBSA 2X2FA 4B3DA 1WA5A 2B21A 2DR3A 1UKVY 1LS1A 1N6LA 4AD8A 3FFAA 4C4PA 1X3SA 1G3IA 4WBSA 5J4KA 2NZ8A 2UZ3A 5L3QA 221PA 2W58A 4CEJB 3AF0A 2ZRFA 2R6FA 2YZ2A 3KTAB 4IVRA 2CJWB 4L8GA 1ZUHA 3D3QA 1HYQA 2YWFA 1GKYA 1O87A 4IOJA 4Z1MA 2QMOA 2VL7A 2QBYB 2WAYA 3HU1A 1CJVC 4UKDA 1M34E 1E1QD 2WJGA 1II8A 1PLJA 3T5GA 1KSHA 4A2PA 4DCNA 4N1AA 2ZUDA 3FPAA 2PJRA 1NI3A 4D0NA 1XZPA 3ZZUA 1IHUA 4PC6A 3IBYA 4PC2A 1AM4D 2NO7A 3UMSA 2R8RA 2OLKA 3PEYA 2NO1A 1D8TA 4IDNA 2GVDC 4FMDF 2ZI9A 2RC6A 2ATVA 2WJVA 3CRZA 3GJ5A 2BM1A 1HEIA 1KK3A 3CF6R 3BOSA 3AVPA 3NKVA 1GRRA 4JL5A 1CS4C 2ZU6A 5BQ5A 1CJMA 3BE4A 4O25A 4CRWB 2RGEA 4ZPXA 2OESA 2QTVB 3W34A 4M1KA 2GQFA 5HCNA 5LB4A 4FCVA 1AZTA 2CRVA 5JJKA 3QPVA 1G8FA 2QL6A 1TUIA 3AGPA 3BB1A 3GEHA 4AWXA 4Q66C 2YC4C 2YINC 5B2ZA 2W6IA 3T12A 1QGZA 3C15C 4MRRA 5DSZA 1KIMA 2CXXA 3OHMA 4PZLA 4CIDA 5BXQC 4TL9A 4FN5A 5CJ2A 5CLLA 2VSFA 5CJPA 3ZQ6A 3LX8A 4KSCA 3OEHA 8OHMA 2XOKD 1S72B 4G3XA 5F2EA 3G4SB 3JQPA 1AKYA 2WWWA 3THXB 3QE0A 3K9LA 2PMKA 4LJ7A 4GMDA 4Y7CA 4QL3A 1R0ZA 3BD9A 1UKYA 4IOLA 4EPRA 3Q7PA 2J1LA 3IQXA 3PENA 3ZLJA 5CLQA 1N6KA 2A9KA 3O8BA 1GG2A 1Z6GA 2QTLA 5EQTA 2JIZD 4XVRA 4EKDA 1L2TA 1Z06A 2AWOA 2C8VA 4N3NA 5AJXA 1UFQA 2ZYUX 3QKTA 2MSDB 4GFDA 3FHCB 4JKIA 1KD1D 2CNWD 3P27A 2VZLA 3SJZA 1KI6B 3GJ6A 4MRVA 2JLYA 2V54A 5DNYB 4LWZA 1DEKA 1E9AA 1GO2A 1HA3A 4RD0A 5D3MB 5KTYA 4POAA 3ZBUA 5JI2E 3CPEA 2GILA 3HYTA 1ZC3A 3T61A 3C5CA 4ASUD 2HYIC 1N5LA 1E94E 3CX6A 4Y0AA 1KDRA 2IW3A 4OHVA 1NVXQ 4OI0A 1LNZA 4NP6A 4B76A 2YV5A 1M7HA 3IO5A 3KXIA 1VQ8B 2PIAA 2GDJA 3CWZA 2AK2A 4D82A 3EWAA 5L3RA 2YWEA 1S1CA 3RWMB 1UJ2A 5C18A 2C04A 1QZXA 2JJ1D 1Q21A 4JL6A 2EFHB 4M1MA 721PA 1TADA 1Z0FA 2Z43A 2FPMA 1OGIA 2WIBA 5DH9A 5JCZA 5H8WA 1EESA 1HQCA 2WWFA 3WHKA 2UZIR 4LPSA 3EXAA 1B23P 4XWOA 1WCV1 3OZVA 2P67A 2O8FA 2CMKA 1Z2CA 3A4MA 3CCQB 4X8MA 4XTCS 1R8SA 3MWKA 2ERXA 3ZC3A 5SZJA 2P5TB 2VF7A 4BZQA 2DWOA 4C0LA 1COWD 1P9NA 2V7QD 1OXUA 1IONA 4M1TA 4I4LA 2EFGA 4LJAA 4L9WA 2P6UA 5JJLA 3Q7QA 1NJID 2AX4A 1GWNA 1MRNA 1T91A 1G64A 5FOTA 1W7AA 4RSGA 1G17A 2GJ9A 1E79A 3R9WA 4JLDA 2XZPA 421PA 1QHGA 4DEXA 3CXCB 4B47A 1Z2AA 1DE0A 1BIFA 1U8ZA 4DVGA 3KUCA 4YONB 4AKIA 4M9SA 3NDBB 2ZRGA 2PEZA 4UXHA 1TVCA 2FV8A 2MMGA 1QUFA 4PAMA 1WQ1R 1NMZA 3O47A 4LBWA 3ZDQA 3H1TA 1XEFA 1FX0B 2F1HA 4PZZA 3REFA 3ZVRA 4AYWA 4M0LA 5EZ6B 3CX7A 5TARA 4B73A 5FUVA 3AVTA 4AIIA 1FQKA 4PPNA 1NVVR 3OZUA 3KKNA 1JJ2B 4TSFA 1ZU5A 3I32A 3WY9A 4QNRA 4YXWD 4DIDA 2RGBA 1QHIA 4B3GA 3CH4B 1M8PA 3SFZA 3RC8A 4B4DA 3QBVA 3QG1A 2D06A 2B92A 4A0GA 5CITA 5HE8A 3BH0A 3AVVA 2P3SA 2QTFA 2QY9A 3LBHA 2QP3A 1QFYA 1GSIA 1M1KD 1S4QA 1TPZA 1XMIA 3FDIA 4M1WA 3SR0A 1G18A 2VYQA 2JDIA 4X8LA 2OK7A 2HLDA 4LBVA 2ZSBA 1LW7A 4JLAA 2BV3A 1F2TB 3U2QA 3QQ5A 1OH5A 3FGNA 3MRSA 3K9NA 1NDHA 3O8CA 5JZVA 2P0EA 121PA 4P4SB 1LVGA 3NG1A 1KAGA 3T1VA 4TMZA 3OW2B 3RRNA 3TR5A 2QMHA 2XTMA 3TSOA 5DIFA 3ZH9B 4MITA 1ZBDA 2QN6A 1VQKB 2A5DA 3U6KA 2RCNA 3LY5A 2O8BA 3CB4A 1OFUX 3KXLA 1Z47A 2Q21A 1TQ6A 2DFLA 3O8RA 1DDIA 2ZRKA 3K70B 2V1UA 4PTLA 4PANA 1E62A 1F2UA 1PLLA 2VYFA 4JLKA 4A6XA 1AN0A 2OSBA 2ZI6A 4MKFA 3V9PA 4DLRA 1FW6A 4IJMA 1SXJE 3FKSD 4TL8A 2WMNB 3ZQJA 1ETUA 1NN0A 1TTTA 2YC2C 3GEEA 3IILA 3UXMA 3Q9LA 1OYYA 4BFXA 4BEBA 3FMFA 2W83A 5LDDC 2ZS8A 4IEIA 4LV5B 1KI8A 2EWWA 2GNOA 5KSPA 1PUIA 1JECA 3KQHA 4ZKEA 3C41J 2IL1A 2ZRMA 2ZYWX 4KYUA 3JZAA 2P6RA 4UNNA 3OAAD 1OXVA 5DISB 3THWA 2GZHA 1N8RD 3U3JA 4AYTA 4AI6A 1JPNA 2QPAA 3AF3A 3SFVA 1LFDB 4QG7A 1T0JB 4ZDWA 1SVOA 3H0KA 4WW0A 1G3RA 4US0R 1G5PA 5CM9C 4F7WA 2OCAA 4FMBB 1ZNZA 3SZRA 5JJIA 4TYWA 4PO1A 4GOXA 3LVRE 3NVAA 4PC3A 3CRRA 3KJIA 4HLCA 1FMLA 2AFIE 3RNLA 2GCOB 1AQUA 3I56B 2BMDA 3GLGA 5JI3E 2QAGA 2DERA 2QT1A 5HCIA 4Y9UA 1GAWA 4UJ3A 4HATA 4DSNA 4MGKR 2FDCA 3K0FA 2H17A 3U4QA 5F9HA 4PX9A 2NQ2C 1W2GA 2EU8A 1KKMA 4DT1A 2O8DB 4BASA 2WSSD 1JR3D 1QVRA 2QU8A 3C4JA 2C99A 3HWSA 2AK3A 3QEOA 3VAAA 1P2UA 2CEAA 3BXZA 5HXBA 1W48A 2ZSEA 3VMFA 1GILA 4UNRA 5FOSA 1PLKA 4BLQA 1R5OA 3NBFA 1R0YA 1TL7C 3QKRB 4MYHA 4A82A 4HB2A 3WP1B 3W6OA 1KI2A 1H8EA 3E70C 1U0LA 3I3SR 4TMVA 1T8TA 5L3SB 2GWHA 3GFPA 3FJOA 1Q1QA 3PV0A 3NBXX 3WP0A 2BMFA 4KFSA 3MHPA 3WXMA 1D2MA 2QI9C 4NTZA 1DVRA 2FZLA 3M0EA 4WZ6A 2RB4A 4CZ2A 2G1JA 2C9CA 2FZ4A 2GBLC 1E96A 3PUVA 3ADDA 3HDTA 3B6EA 3U7EB 2ZM5A 3QG5A 4NHOA 4B48A 3BWDD 3FE2A 2YKGA 4MA4A 4KITB 3MWYW 1W46A 1AIPA 3MAAC 2I4IA 4PPFA 4O3MA 3QFCA 1ZM4A 4KVGA 2GJ8A 2ZRJA 1CBUA 5E7JA 3GJ4A 4FMDB 4BPRA 3CCUB 3QPUA 4BFSA 3IEVA 1NBMD 1AGPA 4Q02A 1PVOA 1SKYB 1VYUA 5JSZA 5AJVB 3AVXA 2RHMA 4JYCA 4DSUA 5EUMA 2KI5A 2B7CA 3W6NA 4FI3C 1X6VA 2IYZA 4TLEA 3R9IA 2YNMA 4EH1A 1Z3IX 3T06B 4HUQA 4NU0A 3ZBTA 1XZQA 5IHPA 2JLUA 3LD9A 4HZUA 3TSZA 4Q9KA 2IWHA 1Z0JA 3VR6A 2NPIA 3DDCA 2OBMA 1ZU4A 1TU4A 1T9HA 2DFTA 1IM2A 2ZRDA 4JS0A 3GJ8A 1I2MA 3VHLB 4TN1A 1OB5A 2G3YA 3OFNA 4RD2A 2CBZA 1NKSA 2ZRHA 3U3MA 3CF2A 4PQYA 4A2QA 4DBLC 1FNMA 1JR6A 1DAGA 4DSTA 2R6CA 3DHWC 2OK8A 3PG5A 1QHYA 2ZPTX 1IXZA 2C9OA 2ZREA 5FBLB 2Z4SA 4EQ6B 1WE2A 2DY1A 1VTKA 2HT6A 1KO7A 2WIAA 3WBKA 2BF4A 4NH0A 3B7GA 2OFXA 1ZMXA 1G3QA 2ZUBA 4U5XA 2W2VA 1D9ZA 3NIBA 1GNPA 1CP2A 3OIWA 4AG6A 3GLIA 4Q4JB 1A7JA 4B2LA 3I62A 4F7DA 3CIOA 4B74A 3OZWA 4XWKA 5J4HA 5KSYA 2ODEA 4IDHA 4QJ5A 4AKEA 5AK0A 1VIYA 3QKSB 3ES9A 2FJUA 3B9PA 3THYA 2PJZA 2FNAA 2IBMA 1BX1A 4Q7JB 2NIPA 4M4SA 3E1YE 1IQPA 2VSXA 4KVAA 1G20E 4LZZA 3FYHA 1IXSB 4TWZA 3TKLA 1W44A 3PVSA 5E4FA 2GF9A 3I61A 2UKDA 2XITA 4GOKA 3CR7A 1XU4A 1XB2A 4P0TA 3TSWA 2GVZC 2OE2A 4CEJA 1ESMA 1MO3A 2C96A 2RKOA 2CJWA 4R98A 4OJQA 2ZQ5A 5JS7A 5CK5A 3W2FA 1JEDA 2Q9BA 2QBYA 1KO4A 5KYKA 2ZXUA 1P9RA 1S8FA 4DCTA 1UM8A 4OQFA 5BN3A 3WYGA 3KXKA 4FMCF 2YYZA 1HTWA 1FP6A 3M6AA 4RKFA 5EJEA 4E07A 1BQEA 1SVKA 3P4XA 3IPYA 5SZKB 2OG2A 4NYIR 3UWKA 4ZGNB 2FSIA 5LD2C 2PMDA 2ORVA 5JFGA 1AS3A 1EX7A 1E2KA 2QRZA 4CGZA 3GJ3A 2ZEJA 1G9XA 3G5UA 4Q9LA 1HH4A 2L0XA 2B5OA 1XXHB 4ITRC 3L43A 2GJKA 3X1ZA 1EGAA 1KI7A 5B57C 2IHYA 3WHLA 1L4YA 2GCNA 4B3BA 1DG1G 2F9LA 4JL8A 4QGAA 1U0HC 3TQCA 1CLUA 4YMVA 2IYQA 3TUZC 3C7KA 1KZ7B 3O8DA 1DDGA 3DEFA 1KK2A 4BGDA 1XPRA 3EA5A 3B85A 3CLVA 1E0SA 2JA1A 2GRJA 3B1WA 1VCNA 5EXXA 1E2EA 1D1NA 1FDRA 4G5OA 3CC2B 3EW9A 1Z6YA 1AZSC 1XTQA 2YOGA 4TZ6A 1Q82D 3CNNA 4KI0A 2IF2A 4HI0E 1W4CA 2JJ2A 3DMDA 3IIJA 3NBYC 1FTNA 5IK2A 3U3KA 3R8FA 2FEOA 4QFMA 1XTSA 2ZAOA 1R6BX 4JBXA 2OAP1 1DAEA 4EPWA 5DN6A 1E9BA 1TF5A 2OT3B 3QF7A 3A1UA 1OFHA 4KFTA 5AUNB 2XXAB 1VPLA 1VG0B 1HUQA 2W6JA 2AFHE 4GZLA 1M7BA 4RZ2A 5JEEA 5J47A 5H68A 4YALA 3UPUA 5FBVB 1P2SA 4HZIA 4U02A 4O2RA 1KI6A 1HT1E 1SVLA 3BAFA 1PZNA 2C98A 1GM5A 2BSAA 1MABB 3VR5A 2ZRLA 3NH6A 2DB3A 1XD8A 4KLNA 5D3MA 4A4DA 1HURA 4GI7A 3TIFA 3GLFE 1XCGB 4QOSA 2ZI3A 4QBFA 3SYNA 1KTVA 4KO8A 1XE1A 4AF6A 3E2IA 3AVQA 5C4GB 4OQXA 4QXAA 4AURA 2Y8EA 1GZSA 4TLAA 3EC2A 2KB0A 1K8AD 1KNXA 3CRMA 2AKAB 1FOEB 1X1SA 4BFWA 5FUYA 4D0GA 5JWRA 5EE3A 2RGGA 1W0JD 3V00A 1OJLA 2C03A 1II9A 5GJBA 1N6HA 4I1OA 1MKYA 4ZDKA 2BBTA 1E2FA 3AVWA 2OUKA 1G1MA 4Q47A 1JR3E 1NSFA 5FOWA 2DHRA 2CL6X 3WYFA 4HSEA 1IXRC 1YRAA 3CZPA 3SYLA 3N2IA 1JI0A 1G5RA 3ZIAA 2V6JA 2QDXA 2F1RA 2EYQA 3N70A 5G53C 4D25A 1P73A 1R5BA 2C5LA 4HAYA 3ZVLA 2X19A 1E2LA 3SEAA 4BE7B 1RVDA 3L8YA 2XNSA 4LJ4A 4MRNA 1XEXB 3SN6A 1XMJA 3TE6A 5HKKD 3FWYA 3HP1A 2GCPA 4M21A 3L0SA 2P5SA 4LYFA 1GRQA 5FH9A 1KI4A 2KWIA 2LCFA 1DOAA 3WNCA 1P75A 5KDOA 4ACAA 5AUOB 5J4VA 2FE4A 1D6JA 3UG6A 5AR1A 1CNFA 3UMFA 5HZHA 1KJZA 1E9FA 4NDZA 1W2HA 1TEXA 3TW4A 4IOMA 4QBHA 5BN5A 2PT7A 4WZBE 3SBDA 1NVUQ 4WXPA 4BEJA 1OV4A 2Z6VA 1J90A 1YJWB 1JAIA 3LDAA 1GL9B 2VHUA 3K9HA 2ONJA 3P4YA 2DWQA 5P21A 4LY6A 4PPGA 2A5FA 2VEDA 2ZTSA 3GLHE 2ZYTX 3I72A 4DLYA 3U7GA 3ETLA 3L0IB 2A78A 5J4LA 2VLIA 2FFQA 1VQ5B 3OEEA 1SXJD 2ECKA 5G3ZA 5J40A 2OFOA 4NONA 4DDVA 3KB1A 4ZIRB 4PAQA 4OJKA 4V0ME 3VX3A 5GV7A 2EFCB 3LLMA 3AKYA 5THXA 3W8RA 5AN9A 1G6HA 1CR1A 1GUAA 1Z29A 2J7PD 3Q8XB 2CE7A 2W2XA 5K8IA 2FH5B 4Y9RA 4TYNA 1F2TA 3DZDA 2IXGA 1JAHA 4JLOA 4CT4B 3NHBA 1Q3TA 4TQAA 3IIKA 4RD3A 4DLSA 5HR5A 3VO1A 1CJUC 2CLSA 2QPTA 3AEZA 4OI1A 1YZNA 5EZ5A 3PUYA 2JDID 1JXOA 4HLUC 4D4MA 3KQNA 5AJZA 1Q3HA 2BN4A 1TQ4A 4AC9A 3ASYA 2Q6TA 3CKLA 1OH8A 4HB4A 4BQSA 3ND8A 2WBLC 4DLUA 2OTLB 2P6NA 1SVWA 2ATXA 1F20A 3L0OA 4UQOA 5TVKA 2D2FA 2RGXA 1FFHA 4EPTA 5HE9A 4JLJA 3TNFA 1E9DA 4TZ0A 1L8QA 3VKGA 1E0AA 1E69A 1EFHA 1EFRD 4I81A 1BMFA 2A5GA 2ZJYA 3BJIC 1GJRA 1VCMA 4TMKA 5DI3B 4CEHA 2A5JA 2IS1A 4C0SA 3W2GA 3OIYA 1ZD8A 4LV8B 4DIEA 3AVOA 4URXR 4E09A 1S9HA 2VNHA 3ZS9A 1R0XA 1NVWQ 1S3GA 1UDWA 3QEJA 3P26A 1UKZA 4HDQB 1YVDA 1KDOA 1B0UA 2JGNA 2GBLA 2X8AA 3E1SA 1IJFA 5JLJA 2IUTA 4D26A 4V0OA 1E63A 2D2EA 1W36C 2X1VA 3PFIA 2WWGA 3DO6A 1K6MA 3FKQA 4GP7A 1QHHB 2BMEA 4JVLA 1WDTA 3BH6A 3QNUA 3SQWA 2XSZA 1KO5A 1OIXA 2OEPA 5KPDA 3UATA 2ZSFA 2DCUA 4YMUA 1S9DA 4F91B 3RRZA 1Z6TA 1KDTA 3W5IA 2ZE5A 4WQMA 2BBSA 1LF0A 1U2RA 4V0LA 2XNCA 1EFTA 2C95A 1BOFA 4FWTA 1JPJA 1OIWA 2ZE7A 3GCGA 1FRQA 1Q1EA 2ZITA 3VX4A 2O8DA 4TMXA 1M74A 2WWXA 3GLFB 3LBIA 5FI0B 4QGFA 4Q4LA 1T4GA 4Q7KA 4X8OA 1H85A 3IHWA 1U0JA 1W0KD 3EZ9A 1W5TA 1L4UA 3BB4A 5JMTA 1ZAKA 1W35A 1O3YA 1FTSA 5AUQA 1YR7A 1OFIA 4GDFA 1GTVA 2J0UB 4EUNA 1J2JA 2H7VA 4DLXA 3QKRA 1VQLB 2OXRA 3EZ7A 1N6IA 2XTZA 1KK0A 3FMPB 2A30A 3LH5A 2G9NA 4F4CA 3QFSA 4LC1A 1Z0AA 4ESHA 2OLJA 5L3SA 2VPPA 2ODWA 5HZKA 2F6RA 2BBWA 2J45A 3IPXA 5IF9A 3LBNA 1GNRA 1HQYE 5FL7A 1Z07A 1VQ4B 2QE7A 5CK4A 2QSYA 2GK6A 2IXFA 4JLPA 4WAUA 4EJSB 5DI9A 2ZJZA 4FMCB 4MKIA 4LJ8A 1VQ7B 3U7HB 2PZEA 4HEJA 4NYMR 1UBFA 3AF1A 3MMPA 1ZM2A 2CLDX 2GESA 4R71A 3ECCA 4KXFB 3P32A 3AP3A 5GV8A 3FHTA 1J7KA 1SHZA 1Y3AA 3EPJA 2IYTA 1DBSA 1TEVA 4UXJA 1XDBA 3DM5A 2V1XA 4YDHB 4EPXA 6Q21A 3BFXA 4NCIA 4NCNA 2F43B 1YZLA 3PUXA 4JVSB 4HAUA 3M1IA 1KI1A 4IDQA 2NO0A 2GXSA 1KK1A 2AKYA 2OAQ1 4Q18A 3UWOA 1OH6A 3W2EA 4ACBA 4RFSA 5AJYA 4NYJR 1XTKA 2X77A 3TLXA 3PJRA 1HV8A 2ZI4A 4PXAA 4Q1AA 4ZDJA 1N5IA 1UEJA 4OI4A 2BGIA 3N5CA 5FPYA 5A4JA 3ZVMA 2W0SA 1OSNA 5JEDA 2XJ4A 3CC4B 1UF9A 4M1SA 5ELXA 4PGOA 3E20A 2G0NA 1FMJA 4QHSA 3QKUA 4M22A 4TTPA 2QZ4A 3RS3A 4D6PA 2HJVA 3GLHB 2OFWA 1IJEA 4RZ3A 5E95A 2RC5A 1NY5A 2VSOA 2ZRPA 1DARA 4K8OA 1M90D 4YHBA 2AL7A 1XBTA 4B6EA 1FNCA 3VKWA 4Q00A 3LO8A 4OK3A 5FBQB 4EQ6A 3NDPA 4KSBA 2NG1A 4QNMA 3RANA 4V02A 1R5NA 3JZMA 3AGQA 4W5HA 1D2NA 2IS4A 4ARZB 2Q3MA 3CCLB 1CJTC 4IOKA 1KMQA 2ZJBA 1U99A 4EJSC 4DEYA 5EP2A 1YKSA 4UAJA 4A8JB 3UMRA 1FZQA 1V43A 5FUXA 5IRCD 3EZ2A 1KHTA 3CRVA 4F4JA 4PSVA 2GEUA 1ZCAA 3KB2A 1CJKC 2F1JA 1E2QA 1RZ3A 3WBJA 2RMKA 3QKSA 4FCWA 4DUGA 5H5JA 2I1QA 4PFSA 1G8PA 1GVNB 4URUR 1RRPA 1MO4A 5EXPA 4W7SA 5TR9A 1XWIA 4CW7A 3THOA 2BJVA 2W00A 5EE1A 3MD0A 4D4JA 4HLDA 1P4SA 1MV5A 1YITB 2QP4A 2QPOA 2GHIA 5BYKA 4I1UA 3A1SA 4F92B 1LTQA 2J46A 3TQFA 5BN4A 3WRXC 3IHLA 4F93B 1FP7A 2BIFA 4KV9A 2RH5A 4OQMA 1XFAA 4QJ3A 5C2JB 3FFBA 1XD2A 1ZRHA 2GZAA 2H92A 3QXSA 1EG7A 1ZINA 3U6BA 2AXPA 3B1YA 4NZYA 1QRAA 1K73D 1KSJA 5FPSA 2QM7A 4Q1DA 3MJRA 1N0WA 3BK7A 1E4VA 1XEWX 4RKEA 4R2IA 2PX0A 2IYRA 2PLRA 5CDFA 3EZFA 2XZOA 4Z8XA 4B3CA 1QBKC 2CE2X 3A36A 1JALA 3MJHA 1J9ZA 5TB5A 1KMHB 4C7OB 3OJXA 2ZI5A 4WZAE 3TMKA 2D62A 3W5HA 1XXHA 3EPLA 1QH0A 2WWHA 3KDSE 1T0HB 3I1FA 1DTSA 5KSOA 3SJAA 3G71B 3VKHA 3NXSA 5TDHA 4HYYA 5L3QB 1FRNA 2H57A 1X86B 4HDOB 3BGWA 4IEEA 1E2MA 2HF9A 1P2VA 4BWYA 1Y63A 1UKEA 2VHTA 4PHGA 4ZI3A 3LNCA 1II8B 3I4LA 4A0RA 3ZD7A 2OV2A 2AD1A 3V4FA 1TQ2A 2KBEA 2VQSA 3WNDA 1VG8A 5DYGA 1RIFA 1U8YA 4JJKA 3RS5A 1NN5A 4BLRA 3EWSA 2XAUA 3B13B 3AQ4A 1XPOA 3Q5DA 5CB8A 4MGZR 4G5QA 1XJCA 2ZS9A 1J8YF 1DAHA 1HE1C 1I4DD 2OILA 1ZIOA 5KHOC 1W87A 2JLVA 1FUUA 1P6XA 4YQFA 3TK1A 2R9VA 3H2YA 4MRSA 4PZYA 3G6EB 1OF1A 3SU8A 3EIQA 4LUCA 5JCPA 4I99A 1OGJA 4C0BA 1WRBA 3A6PC 1VQ6B 1MRSA 4OHYA 1YHQB 3GJ0A 3OE7D 1DO2A 2JATA 2WV9A 3HPQA 3TVTA 3K70C 2JJ2D 4LHVA 3FMIA 2GKSA 5JBQA 5FR2A 2R62A 2XOKA 1MABA 1P3JA 2WTUA 4ZV4A 3BH7A 2BKEA 2QTZA 1ZJ6A 4BRWA 1UBCA 5DN6D 4ESVA 3W2IA 1QVGB 2W6JD 5KDLA 4B35A 4TQ9A 4Q4HA 1JB1A 2WPDD 3VO2A 3CRQA 3DOFA 4IHQA 4TLBA 1G291 3NC0C 1G3UA 2O8CB 4D4KA 5CM8B 5H70A 1N0UA 2FGKA 2GTPA 2PBRA 1R7RA 2N46A 2ORIA 1X8KA 4BECA 4LPKA 4KBGA 1J99A 3X1DA 4XD7D 2F55A 1GDDA 3BIFA 3LV8A 3K0CC 3TAUA 4JLBA 1CRQA 1OH7A 2O8EA 3CPWB 4BFYA 2BOVA 4EFNA 3VU9B 1K8RA 4L4UA 4URVR 1JNYA 3FOZA 3U61B 1DG3A 4QBIA 1KQSB 4JIMA 1U81A 3GLGE 4LJ9A 2HMAA 2ANCA 2XJ9A 4EDHA 1OT3A 2V9PA 1R0WA 3LFUA 1W49A 3CWQA 1ESNA 5FTLA 4LC0A 1CTQA 1VG1A 1NIPA 2IC5A 2OTJB 4XJXA 1RFLA 1MO5A 2N1BA 4ASUA 3NC1C 1SGWA 1VCIA 1E2GA 3FTQA 3HR8A 4LYHA 521PA 4HE5A 3DKPA 2VHQA 3BBPA 2PH1A 3S1AA 2B6HA 1BYIA 2YOFA 4XVQA 4QC2A 1G3MA 4ERNA 4YAUA 1OFTA 2BCGY 4HE6A 2ZJ5A 4JJZA 5FFMA 3TAHA 3U60B 1N0VC 3OIUA 2CCGA 4N0DA 4C43A 1YZUA 3CF0A 1G16A 3DKVA 2JJ1A 3ZIAD 2HJGA 4MYTA 5TV2A 4HLUA 3EX7C 2LWIA 3WNBA 1G19A 1RPZA 4Q9HA 2ANBA 1SM4A 2ZR9A 3KKMA 4DXAA 3ZD6A 2PEYA 2NOAA 3NBZC 4Q21A 4IXNA 2Z83A 2JLXA 1S0UA 5DHFA 1X1RA 4HAVA 1OE0A 1P9WA 1EFUA 2OO7A 4AG5A 1VIAA 1E9CA 4P33A 4DB4A 3NEYA 1FNDA 4GMXA 4GNKA 1E1RD 1YR8A 2LKCA 1A82A 4ZGQB 4M53A 1GL7A 1COWA 2V7QA 4XIGS 1E9EA 1P61B 2WJIA 2PLFA 3AUYA 4IDPA 1JEEA 2E87A 4KLZA 3KQLA 5EE5B 2X3UA 4M8NE 4DKXA 4G5SA 1P7CA 4FCTA 1EP2B 1CU1A 2QQEA 2K5UA 1EWYA 3PIRA 3QVVA 4Q4AB 3D31A 3KFXA 4US1R 3W2HA 1N2CE 2TMKA 3EG5A 4WXRA 4LHZA 4YC7A 1RJ9B 4ZIRA 2IYYA 2IEYA 1P60A 3K0AB 1VDZA 2YWGA 1J70A 1OIVA 5EE0A 1N5JA 2ZVPX 5JHHB 1I2DA 5J4YA 1F5NA 1KSGA 4LDJA 2BMJA 1XRJA 1ZM7A 4WA7A 4Q7MB 2FPKA 3W3ZB 4TL6A 4PQRA 5A5GA 2V6IA 4KCGA 2BJWA 3RS7A 1G8YA 3R9XA 4BFTA 1JJ7A 4L15A 4B2PA 5GADl 4HB3A 4YXWA 4DDUA 1SXJB 2XTNA 4IVQA 4C2TA 2WKPA 3KTAA 4LX0A 3KQUA 5KO2A 3EPKA 2WJJA 2ZYVX 1F48A 3F0TA 2QM8A 1ZNXA 3HYRA 4NPHA 4XSGA 3RDPA 1E32A 3SYKA 3CM0A 1MOZA 4N0EA 4RD1A 1MR3F 1KOFA 2XX3A 2YVUA 1TLLA 1VQMB 2HYDA 3CW2A 1F6BA 2CVHA 3KZ1E 3I5XA 1KNQA 1SQ5A 2DPXA 2B7BA 4C0HA 3W9YA 2ZJAA 1TMKA 1Z63A 5DI3A 2VH5R 4Z1MD 3QXCA 4LBZA 4JT4A 5JS8A 1YU9A 2CHVA 1WB9A 4MUAA 1YI2B 2W2TA 2GPJA 2R2AA 3ZGXA 1QUEA 3GLIE 1NLYA 3RVBA 4GP6A 1SULA 4HAWA 2GXUA 2NZJA 1M7GA 4R9UC 4UNSA 2F3RA 4Q48A 3HJNA 1TQDA 2XNJA 1T6NA 2IS6A 2VP5A 1OXTA 4E5UA 2EQBA 4A0HA 4NKRA 2QGNA 1T5LA 3OAAA 2A3RA 4K1XA 2EYUA 1KO8A 1XF9A 4UJ5A 4CYMA 2BDTA 1N3BA 2BEJA 3FHOA 2W6ID 3K09C 3THXA 1PJRA 3AUXA 3EPHA 4BZPA 2XSZD 2EWVA 1ZM9A 1US8B 2A2ZA 2REXB 1E0JA 2CDNA 3QXXA 3THWB 2GF0A 1TU3A 1ZD9A 4NE2A 5GVRA 3OEHD 4IFEA 4ILEA 1Q1BA 4O2LA 2GK7A 2HT1A 2CVFA 4WIAA 4BFVA 4QBGB 1E98A 3VFDA 4O0MA 1QFZA 4RY2A 2R6DA 4DZZA 1ZM3A 3GLGB 1CR2A 1TUEA 1YRBA 1I7PA 2P2LA 2WSSA 3L2OB 1KDPA 5EXSA 2ZRAA 5AWFC 4JYBA 4EJSA 2YWHA 3I55B 4P3YA 5GJWC 5JWHA 2AHOA 5KNDA 3PEWA 3QFRA 3B1ZA 1BX0A 4DT1B 1WMSA 3CCSB 2EVWX 3CMAB 1E2PA 4NL4H 3IO3A 5FL7D 1ZP6A 3QENA 4NCJA 4B2IA 4LYAA 1TF7A 1W47A 1U94A 1VG9B 4KAXA 4U00A 4TLCA 4JT2A 3R7WB 3I73A 3LO5A 1AA9A 2F43A 4B3FX 4AKHA 1KC8D 1A2BA 4YDSA 4CT5A 1NN1A 3ZYCA 2CCJA 2KSQA 1FL9A 4BFZA 3SJBA 4RFVA 4E22A 1CNEA 1SVIA 3CNLA 3OZXA 5IT5A 1OXSC 5BWMA 2XZLA 2GXQA 1SHKA 1OKKA 5E7MA 1DAFA 4C0KA 4FIDA 4PO9A 5TY0A 4W9MC 1P2TA 1YE8A 3U5ZB 1E6CA 1CR0A 4TTQA 3UKDA 2ZJ8A 4DDTA 1ZNWA 2JASA 1XCPA 3VHXA 1SVSA 2UVQA 4PPQA 5FOUA 1H42A 1NBMA 4FWIB 3M4YA 4D2IA 4MGIR 4FK8A 5AUPB 4TMTA 4KODA 4OQNA 5D3QA 1KKLA 2WJHA 2BPOA 4OI2A 2D7CA 1E99A 3ADBA 3QE2A 4B32A 2OCPA 5KNCA 1E2IA 4YAFA 4DWJA 3BB3A 2C78A 4V03A 1VQOB 5KDDA 4LK2A 2PT5A 2VTKA 1M1YE 1YZGA 4IFBA 1QG4A 4OBEA 3UIEA 4AYXA 3CCRB 4B71A 1RC8A 4A8JA 2NGRA 2ASEA 4KHZA 3BC1A 1E79D 4JVMA 1FX0A 1H8HA 2D74A 1KZGB 1QGAA 2BC9A 2CL7X 4GZMA 1Q12A 4PHFA 3SC3A 4CEIB 4B44A 1C1YA 2VHCA 3BS4A 3PCRB 3U44B 4HZUB 4LYJA 3HU3A 3W5VA 1K5GA 2YOHA 1G7SA 3FPKA 1YR6A 3CC7B 3F8TA 4Q7LA 1IY2A 2XNDA 2HDNB 4TTRA 2BVNA 4EFLA 3C8UA 4IVPA 1E0KA 1KGDA 4TSFD 4DB2A 1UPTA 1NVVQ 5CIWA 3AH8A 1YHNA 4LJYA 3K0SA 5FPTA 2ZROA 1AK2A 1W4RA 2IT1A 1KY2A 5BYJA 1DO0A 2FGJA 3KQKA 2ZR7A 1KY3A 3CCVB 4P4SA 1TX4B 4DCVA 2MMCA 4IW3B 2Z0MA 4G01B 4Q5IA 3B1XA 5EP3A 3W6PA 1GAQA 1BYUA 4ZCMA 2REBA 3CX8A 5FI1B 3RHFA 2J3EA 1OB2A 2VA8A 3QPWA 1U9IC 2WKQA 4PSAA 3DOEA 1G6OA 2HLDD 3QJYA 1AS0A 5FTJA 2G1KA 4EIWA 4E03A 3VNUA 4A92A 1ZC4A 2D3WA 1GOTA 3IBGA 4B33A 4GL2A 4OYHA 4PQFA 3THYB 1VHTA 1M6NA 3OIVA 1Q22A 3VR3A 1E4YA 4C7OA 4Z54A 2FWRA 1T3LA 3ZVNA 2PX3A 1JJVA 2GA8A 5KOYA 2WOJA 2G88A 3SBEA 3G0HA 1MH1A 3CPJB 5BW8A 2NTYC 3TGPA 2G6BA 1RRFA 2F7SA 3P1JA 1YZKA 1NJGA 3B2EA 3K0CA 2VNJA 2VHJA 1XMVA 3R20A 4HLQB 5FTKA 4DCSA 1VYTA 2DFKB 1UBEA 1E2NA 3GJXC 4A0FA 4TLDA 1ZYUA 5LPNA 4BPBA 2GEDA 4Q1CA 4R2HA 4C3ZA 1G8HA 4OK5A 2C9YA 1CR4A 3HPRA 1YJNB 4DQKA 4K81B 2J0QA 4YAOA 4IDOA 4QHTA 4F4IA 3B5JA 2I3BA 4FD2A 2GCOA 4C9BA 2XB2A 4Q1EA 5HPYB 3GFOA 4CVNA 2VO1A 2ZS7A 4PSKA 3TJZA 2IUSA 3LQQA 1JA1A 4DLZA 2ZR0A 5FPHA 1Z28A 3ZS8A 1OXXK 1VYVA 3EC1A 2OM2A 5ANRB 1VQ9B 2QG6A 3W8NA 3QF4B 2HXYA 2E1RA 3A4NA 4BLSA 4MRPA 2C77A 3EIEA 3AF4A 1EP1B 1JQLB 1C4OA 4XWAA 2WZQA 1XEWY 1GNQA 3GFTA 3PUWA 1UMKA 4HAZA 4JBWA 1GKUB 2GJSA 4QGHA 2IX3A 3NWJA 5CB6A 1NSTA 3QI2A 1U8AA 4G0NA 4A9AA 1EXMA 2B8TA 4Q1FA 1KRHA 5DE3A 1IB0A 2JLRA 2WWIA 1ZVQA 1HT2E 1XNJA 2O8CA 1CEEA 1R8QA 2G0TA 4MKGA 5EP1A 2QRNA 5A0FA 2ZRIA 4QRHA 5JRJA 1CXZA 1RKBA 1QF9A 2KE5A 4A15A 2O0KA 1Q1ZA 3B78A 5KSZA 2VP4A 3VU9A 1Q57A 1N6OA 3CMEB 2ERYA 1QHXA 1OHHA 1Q20A 4PO8A 1H8ED 1ANKA 5C46F 4P32A 3JQRA 2HUPA 4KBFA 1KAOA 2AR7A 2B8WA 2WICA 4BLPA 2J59A 2IYVA 3ICEA 3GP8A 3K1JA 3SS8A 2MSEB 1Z08A 1NMXA 1K9MD 2A7QA 1E3MA 1N6RA 1NIJA 2FFHA 3VTKA 4QM7A 1ELOA 2CHQA 3G82C 2HCBA 2QMUA 1QVFB 2ZANA 2IS2A 1W4BA 1D2EA 1E2DA 1R4AA 3F5FA 1W0JA 2C2HA 4JBYA 3TUJC 1LY1A 1EX6A 3IUYA 4F38A 2RGNC 1RYHA 1QG2A 2DWPA 4Q1BA 4BLTA 4JSYA 2OCBA 2RAPA 2EW1A 2FSHA 3KJHA 5K8UA 1R10A 1DADA 3GD7A 3VNVA 2IXEA 4TQUS 3RSLA 4URZR 4D0LB 4QHYA 3MCAA 5FTNA 4P6VF 2WSMA 3SI7A 2QEQA 4D80A 4OQLA 2J0SA 2GAOA 4ON9A 4ZCIA 2QSZA 3CCJB 1FPMA 4LJ5A 4DDWA 5HKKA 2YJTD 5FBRB 2CK3A 4Q9IA 4MYUA 4UXIA 2BBOA 3LVBA 3DM9B 4Q4AA 4YMTA 1KJYA 4TL7A 3X1YA 4ZO4A 2FF7A 3LWNA 2ODNA 1RJ9A 3IKJA 2DBYA 2KBFA 4V0NA 4H9GA 3K0AA 3OFND 1QVAA 2GETA 4Q4JA 4EPVA 1WBBA 1NY6A 3T1TA 1T3HA 1OLOA 4MDEA 4RCZA 4GBMA 1V5WA 2CL0X 4C0QC 2HV8A 4YLGA 4Z51A 2CCKA 3RWOA 2OBLA 3R8CA 2V3CC 3CCMB 3EARA 1G7TA 4U7DA 1SKYE 3MUFA 5E3HA 3C5HA 2QUZA 3F3YA 1XD9A 4M1YA 5FPKA 1QFJA 2NMVA 2R44A 5FOXA 3SQXA 3H84A 1E2JA 3B9QA 3BORA 1W36D 1IN6A 4TT3A 4AK9A 5H59A 4LRWA 3T5DA 5KUTA 3NH9A 4P31A 1DELA 1SXJA 2FG5A 2QROA 5JWOA 1FQJA 4M9XA 1ZUIA 3K09A 4MUBA 1ZNYA 1NF3A 5KSWB 1T5IA 2VNIA 2SHKA 1FNBA 3VR1A 2OXCA 3QIAA 5FA6A 2QA4B 2IF0A 2LKDA 3LW7A 4C0JA 1YJ5A 2J7PA 3T1OA 1UBGA 1DAIA 3L82B 1UDXA 1QGYA 2EIXA 2Z4RA 2ZE6A 3BRWD 2VF8A 3A58B 1Q44A 3MSXA 1ZD1A 4HB0A 1E9SA 4OK6A 2J9RA 3AB3A 2O5VA 1XMSA 3OJWA 5C4MA 4B34A 3I8SA 5E7IA 3B82A 2O0JA 2H1LA 1XCMA 2GJAA 4A2WA 3ZZTA 2WVJA 3D6TB 3SHWA 2OZEA 4L16A 1E9RA 2ZAMA 4B75A 1TNDA 1G21E 3RRMA 2FX3A 1KI9A 4RZUA 4OL0A 3J81k 2IYLD 5TMPA 5EUQB 1XX6A 3T15A 1IOZA 4PAOA 3L0PA 1W1WA 4OHXA 3PXGA 2JLWA 1JA0A 3AM1A 1S3SA 2QAJA 1AJEA 2MSCB 1ZW6A 4W5WA 2H18A 1E1QA 2I1VB 2BEKA 2JEOA 4OHWA 3AP1A 4A8JC 1FUKA 1S2MA 1CKEA 3H86A 4NYIQ 3A4LA 3QVUA 4A36A 1Q81D 4JMPA 3FVQA 3W3AA 4JVNA 5M04A 2IWRA 1EFRA 1VHLA 4DLWA 1KYIA 1GAJA 1BS1A 1XTJA 2H16A 2AXNA 4ZKDA 4G1VA 2QT0A 4C30A 3SOPA 3LAWA 5GJCA 3I8XA 1XPUA 1NJFA 3LA6A 3TBKA 1T8UA 4M9ZA 3RRYA 3Q3JB 2OBNA 5FTMA 1E64A 3IQWA 1GL6A 3MWJA 1NKTA 2ZJ2A 3EZ6A 5EE9A 4CEHB 1IN5A 1US8A 3PQCA 1KJWA 1YIJB 2EFEB 1D5CA 4DLTA 3KKPA 2QQ0A 3MLEA 4A6PA 4M9QA 3WMFA 2KJQA 3CO5A 1KSFX 1KI3A 1M2OB 2XXAA 3FMOB 1OW3B 5CDFE 2BCJQ 2QGZA 2WHXA 2F1IA 3AVYA 4G5RA 1SZPA 2FU5C 1GP2A 4CDGA 3QXJA 1G41A 2ZRNA 2DFNA 1W5SA 1XJQA 3A1WA 5IK2D 2IHBA 1G4AE 2WOOA 1MT0A 2J41A 2PCLA 4AKGA 1XXHE 3REGA 3V4RA 2Q3FA 1R2QA 4RCYA 1I4TD 1W0KA 4NCHA 3SHFA 3CCEB 3D8BA 4DSOA 1Z8FA 2GZDA 1T3SA 3EAQA 2VP6A 2O52A 2ZRBA 4OKSA 3AP2A 2JIZA 4XTRA 2CLCX 4BLOA 3W5UA 1NP6A 3AKCA 1YQTA 5DO9A 4RVCA 4UNQA 1WXQA 2ZI7A 3RABA 4MDFA 2CNWA 2IYUA 4WVFA 4AF7A 3SE0A 1OYWA 3GMTA 3R7WA 3MG9A 5FL3A 3RS0A 3SJCA 3K8YA 3NHAA 1UADA 5DGXA 5K8TA 2GEVA 4RD4A 2ZETA 3JQQA 4ZCLA 1ODFA 3CPHA 3B1VA 3H4MA 2ZUCA 3PEUA 1WBDA 2QP9X 4C0AC 3DL0A 4DLVA 4QJ4A 4EFMA 1CULC 4FINA 1ONBA 1YJ9B 2BHRA 1YZTA 4Z8YA 4Y0VA 2DETA 2IYWA 2PZGA 3EASA 3X2SA 3CONA 1NG1A 3NEJA 1G4UR 1HY3A 4H1UA 3U3RA 5KNBA 1XEXA 1A2KC 2HXSA 3TUIC 3KKQA 4KJZA 3ADCA 4K46A 1AGRA 4TMWA 4TYPA 1RW4A 4LHWA 3GPLA 1U9IA 4Q01A 1IN4A 3QBTA 3QXHA 2RGAA 3TW8B 1OKKD 1WF3A 1XTIA 3WYAA 2VRWA 2BWJA 4XOIA 5SZHB 3ZZ0A 4GOJA 1UEIA 3W90A 2QORA 2VNKA 3QSYA 3A8TA 3RS4A 3KX2A 2JLQA 1FNNA 3LQRA 5F98A 3CBQA 1SKQA 5LB2A 5G41A 2V4ZA 5F3WB 3UANA 2D7DA 1Z0DA 4G5GA 4US2R 4PR0A 1DAKA
chains in the Genus database with same CATH superfamily
3EAGA 5H1YA 3TNJA 1BE8A 2IEBA 3EOBI 1IY0A 1Q0SA 3C39A 3CQ9A 4JU9A 4E70A 5A4IS 1Y1KE 2H2HA 4TYYA 2X9GA 1JZQA 5TMDA 2ZSUA 1G20A 3CUWA 4FW9A 4I8IA 4ROSA 2NXCA 4N3CA 2H6EA 2YW9A 2FMTA 3W0LB 4YUXA 5HW0A 2VP0A 5IP5A 1R00A 4CLRB 4MAAA 1E5QA 2JNWA 5CXXA 1VFPA 4CEIA 3U44A 2WVHA 3D54D 2WJ3A 3UCXA 3MFYA 3VR5H 1GFIA 1V6AA 3MIIA 2P65A 4PO3X 5IT9A 5E6UA 1A2QA 1P5ZB 2I4LA 5EWJB 1H8HD 4R4JA 3TSCA 3WICA 3E9RA 1AS2A 4RS4A 2IA5A 4ND6A 1P33A 3H3JA 2JD0A 3VH4A 3WMEA 4FX2A 1MPXA 5GVSA 1IC6A 4PYKA 3ABIA 1RM3A 4HEQA 3HU2A 2I80A 2VYNA 2MIIA 5JE8A 3MLAA 3ASTA 2XNDD 3RC9A 4XX0A 4V1CA 4OUKX 2HZBA 4B43A 2C2YA 1ZAYA 1HMYA 2UZAA 4LW8A 3W6UA 3Q3HA 4AY4A 2D4HA 2QN8A 4UM7A 1RP7A 2QXYA 3IAFA 1C0LA 3ABSB 5IYRA 3BMOA 3C14C 2D5AA 3T5PA 5SZIA 4NFLA 3ZBQA 3E0XA 5EVJA 2QRPA 3WRVA 3A32A 4NE9A 1ZNQO 1ODCA 1L5MA 2GZ2A 1PTJC 4EHDA 2JAQA 1SC3A 1VECA 4HR7A 1OWLA 3TIXB 3IDQA 1EXVA 4OGWA 2AMLA 2I3DA 3JY6A 2P40A 3QJGA 4QO7A 3VDQA 2OAGA 2GYWA 4BUJA 621PA 1DGQA 2O59A 3RNOA 3I04A 4RX1A 3WMGA 4LV6A 4PC1A 1NW8A 3A9CA 3UA3A 3KJEA 2FFBA 2Z98A 1JG7A 1WJGA 4GVXA 4PZDA 3WIVA 4CV3A 1A98A 2PQMA 5IC4A 1ZA1A 5AI9A 2J7KA 5FUMA 1NLFA 2JLSA 5TPZA 1II0A 4I55F 5E38A 2CNNA 3WGIA 4L72A 4EVQA 3SOZA 2R25B 2XYVA 5B30A 4RQBA 4TV8B 1QONA 2P3QA 3BXOA 3BZUA 4X91A 1SUIA 5LMUB 1CQZA 2ZJ3A 3DE0X 3NCTA 2FCRA 4HQFA 4LQDA 4QPJC 5FUWA 2QMYA 1NRXA 1ZSVA 2VBCA 3C87A 3PI6A 4NV1A 3WB2A 3TG8A 3FKSA 1CIPA 2JI9A 3OJOA 1H2EA 3P20A 1T5SA 4IO1A 3RYTC 4KEAA 3O4JA 2GASA 4DQDA 4MW0A 4MCHA 3A26A 4NAVA 2JCGA 3MA0A 3T9DA 2HDOA 4CKCA 2DZDA 5KU1A 1I3OA 2OHFA 3I09A 2AFHA 1L7DA 4V3BA 4N5IX 1NB0A 3SDZA 5IVKA 1GGMA 2QMEA 4LBYA 1Y9ZA 4E11A 4EAQA 1LS6A 4RK7A 2ZW9A 3IAXA 3L8ZA 3LI2A 1UZNA 2E4XA 2NV0A 2D7JA 5LBIA 5JY1A 4I9NA 5TXGA 1M2NA 4W5QA 5KQSA 2HR1A 3ROZA 4CM8B 5LP6F 3Q72A 2C4VA 3DKRA 4CKWA 2A1TR 1CC1S 1N2JA 1ZOPA 4JNCA 2RGNA 4II3A 1EWVA 5BT9A 2C4NA 4PZCA 5B58C 2NTEA 3NKFA 1EK0A 2Q2OA 2QYTA 3X1XA 1W5BA 5EJ7A 4DRZA 3LP5A 4LE0A 1NL3A 3QBJA 4DHWA 1W19A 4ENQA 1BGVA 3DTTA 3BGVA 3NTUA 4U2BA 4AY2A 3SVZA 1DIAA 3TVDA 5T4FA 2G70A 1XGKA 5HXAA 3OCVA 4BWGA 1E59A 5JS1A 1C81A 3EOAI 3B2NA 2XB4A 3ZDZB 4QUJA 3HDYA 1OLSA 2JZNA 3PT5A 3Q7TA 4ID3A 1T3TA 1GCUA 2XGJA 4WXEA 5EMNA 2EGGA 3MWEB 1QG0A 2J6HA 5AXCA 4IHJA 1QK4A 5BV7A 2I7DA 1Z0ZA 3BWCA 4ZZIA 4N12A 1JDTA 4A91A 2R6AA 4ZDIA 3AXSA 3R0IA 1GFSA 2C2MA 4G0YA 1I7NA 1RYFA 2VP2A 2E55A 3GEIA 3ASVA 3NEAA 5CNMA 4A8PA 5B4TA 2Z3ZA 4TKVB 2Y05A 2PMEA 2RHBA 2XKKA 3CY6A 1G38A 2WPDA 4OMUA 5DTJA 4A5SA 3HR7A 3WADA 1NN3A 4XH9B 3CD6B 2H63A 2IYXA 3ZWNA 2WTEA 3EYWA 3KJQA 3ACBA 2VSQA 3AQIA 3H8WA 4EUHA 5KOHA 1YRQA 3HWX1 2IDZA 4XD7A 1USGA 4Q3NA 1WKBA 3A1VA 3OWXA 1L7VC 3F4LA 3K8OE 1H2XA 1KR2A 4PGFA 4A0QA 2XCSB 1AKMA 1OJ7A 4ZVLA 5J3OA 1LW6E 3JYLA 4YUYA 4LZAA 4UVEA 2QJOA 5F4ZA 5L8VA 1LF5A 5I9LA 3P2OA 4ZOAA 2GN2A 3KSAC 4R2WA 1X1DA 3K0EA 4NYMQ 3UHJA 2W43A 2UZ1B 3NJRA 4WZBA 1D5WA 3F1LA 3GIDA 4XIFA 4L3OA 4BNMA 3UMCA 1ISFA 2V5AA 3F1KA 1P6QA 2XW6A 4CMEC 1EAMA 3G2OA 3K1ZA 4JBHA 1U1EA 3AZOA 1K2WA 1VKJA 1CQXA 2RHGB 2OQVA 2WM9B 3KL4A 4H4EA 3NBQA 2W4MA 3NRBA 4AFNA 3U56A 1E7SA 3ZYZA 4X7CA 2REOA 5BQOA 3B60A 3UBMA 3T1NA 2HHCA 2YCLA 3PEFA 5HFJA 4TOIA 3SDSA 1TK3A 3BGIA 1PJ4A 3BMNB 3I92A 3K1YA 1N8NA 5JADA 2RFLA 4BC0A 4NYJQ 3IKMB 4ISBA 5J35A 4B5KA 2PUFA 3AONB 4TXHA 5AKEA 4GBJA 5H4HA 4URYR 2P7IA 4OF4A 2Q0HA 5EZSA 5BY2A 3BBLA 4KGDA 3D3KA 1EWTA 3ER8A 3FYDA 3DTVA 5SY4A 1JSCA 4RQTA 3IKLA 5CPBA 2YDYA 3D3WB 6ADHA 3PGKA 3KYDB 1N5RA 3GQBA 5TEVA 4LXIA 4XD2A 5E6SB 3JQAD 4IG4A 1JZTA 4L9RA 2UUBB 4PZ0A 1YO6A 3WRYC 4PLZA 4J0QA 4OMFG 5AOVA 1M2GA 1ECJA 4BKMA 2OCYC 4Z4TA 1JG3A 1RM0A 3OX1A 3Q3GE 4B6FA 1HBJA 4MK4A 2H3EA 2C0CA 4RHUA 1JB9A 3INYA 3CZ4A 2QI9F 2Y67A 3ABRB 4DMFA 4WKBA 3M4NA 5EJ2A 3D7MA 3EBOA 5DBEX 5DNCA 1Z75A 3F49S 3G7NA 2O3TA 3LDGA 1NHGA 3RRBA 5EVCA 3R3XA 2B3TA 2FB9A 5LQMA 1ZUNB 1SCIA 2XF8A 2PUHA 2IH4A 2FTKE 3AJ9A 4JB3A 1LTHR 8GPBA 1COZA 3T56B 1UM9B 5KX5A 5CTAA 2VR1A 4IWNA 1FRFS 1GPUA 4JLNA 2PK3A 3IE1A 1ONOA 2FFAA 2QZSA 1CB7A 3EXIA 2VBUA 3ZGOA 1KMMA 1PJAA 1R0CA 3ND9A 1U5BB 1VSUA 3N2NA 2A58A 3IV6A 3EUWA 1G7CA 3KUDA 1EWRA 1CQIA 1LV7A 2V6BA 4GQNA 3OUZA 4HDSB 4EW2A 4Z5XA 2V55B 3HFGA 4EFKA 3N86A 1VLYA 1HEUA 1XP5A 4I8DA 5LJLA 1BEEA 3C3MA 2VXCA 3CNOA 2FWMX 3AETB 3DPIA 3FD8A 3KJNA 3NWOA 2MSNA 5KPJA 3FOFC 2GM3A 1NV9A 2QRLA 1GPBA 3WSTA 4UHEA 1FYWA 3E5HA 3NNNA 4G65A 4ZRMA 3ZWCA 2OHVA 1IQUA 1NUSA 4QM6A 2BD0A 3MS2A 1CYDA 4L8LA 4LF5B 4G8BA 4MUGA 4B3DA 3SZLA 1Z56C 2I0FA 1WA5A 5LLDA 4QUGA 3R5SA 2DR3A 1Y81A 4G41A 4P7GA 3DT9A 3KD2A 3H17A 2JZOA 4MUMA 5EZQA 1WSAA 4XA8A 5L3QA 2W58A 2FR1A 2VKQA 4HN9A 4QVAA 2R6FA 2YZ2A 3BTOA 3KTAB 4K9DA 2WFLB 4ZAWA 4B3RB 4KKXB 2OCDA 4FFDA 3HVRA 3C3AA 3VTZA 4ZEOA 3TNYA 2PPVA 4EI9A 4UZUA 1EXNA 4M7WA 3RG8A 3PQ8A 3EUEA 1J39A 5J2UA 1PR5A 4D56A 4ZI7A 1BVYF 3FH0A 3I45A 4N1AA 2HFKA 2QM3A 2ZUDA 1A72A 5A0VA 3NGLA 3FPAA 1NI3A 2P9HA 1XZPA 3ZZUA 3URKA 3IP1A 2BKLA 3HXKA 5IZCA 1I33A 5I9IA 1FFAA 2Q3EA 1AM4D 3TCKA 1VSBA 1WOPA 2XA2A 3CLUD 1U5CA 4BMCA 3O3MB 2ZI9A 1V1JA 3HUUA 1SCNE 4H15A 5CB4B 1HDIA 2JFHA 1HEIA 5FWXA 4Z7JA 3NKVA 3ZE1B 1CS4C 1QP8A 3HP7A 5BQ5A 1MHPA 3BE4A 2Z56A 2Z8ZA 4GM4A 1J56A 4O25A 1DG9A 2H2AA 5AICA 1GUYA 2ZAYA 1NI5A 3OPVA 1OBCA 2GQFA 3EIFA 3N0WA 3PNKA 5LB4A 4Q3KA 4MRMA 4EZEA 2EAUA 2Y9MB 1PJ6A 3QH4A 3ZWPA 2CRVA 1RQRA 4OUDA 5JJKA 4KGXA 3P2EA 5CT6A 4L2IB 3WB0A 4AWXA 4P25A 3MWDB 2W6IA 2Q4EA 1KH1A 2JFVA 3I5MA 1EJ2A 3LK7A 5KYWA 2ADMA 2Y6VA 2VZ8A 1Z2EA 3QK7A 4U2FA 4AJEA 5I8ZA 3NZEA 1KIMA 5ITWA 4FOPA 4PZLA 1L6RA 3AL3A 1UJBA 3O8QA 3TRKA 3WQRA 2EZ8A 2Q2WA 4HGOA 5AO9A 4D4IA 2L2QA 5BQ3A 4O1IA 1M2JA 1IATA 3G49A 1X7DA 3VDMA 5GAJA 2UYHA 3DDNA 3N2GA 4WLVA 2PL1A 3QVKA 3KIPA 4F3TA 3PNSA 5HQTA 1NXTA 2WWWA 3THXB 2H4ZA 1EK5A 4AVYA 4GRDA 1MENA 5B3JC 4LJ7A 1K4YA 4UZFA 4Y7CA 3FHLA 3KE9A 4XWYA 2JGDB 4IOLA 3A6LA 3JASA 4EPRA 3Q7PA 2J1LA 4AULA 1BS9A 5HWSA 1TUBA 3PENA 1UZLA 3GAZA 1YGYA 5CDUA 3K94A 2A9KA 2XA9A 1GG2A 5DEIA 1O8BA 2A8YA 1HYHA 1X8XA 3FX2A 5EQTA 1MZVA 4G9EA 2ZTHA 3BFPA 1Y5IA 4N3NA 2Q3DA 4W7HA 5AJXA 3IX7A 2Y76A 3QKTA 3NM5A 3TOVA 1YS9A 3CVUA 4RTQA 2VDWB 2XQGA 3KQWA 4XJVA 4MRVA 1Q19A 4LVOA 2H2FA 2ZT8A 3DZFA 3EGIA 3V4SA 1J6UA 1TB4A 3WG9A 4CFSA 5K3SA 5DGCA 5TGDA 5EIXA 3ESYA 4RD0A 5D3MB 4K40A 1RWPA 1XRRA 1PVDA 2NVOA 3DC2A 1I0ZA 2PAAA 2YZKA 4G09A 5JPDA 1YR1A 3CPEA 3HYTA 2L42A 5LZ8A 2X0EA 3T61A 1SUDA 2X2OA 4J49A 4EB3A 3C5CA 2B4TO 1P74A 1ENZA 1AH2A 1IH8A 3Q7RA 2A9VA 3AUTA 5FKJA 2NVUB 1O5IA 1ZL0A 1M76A 1C8VB 4OHVA 2G9QA 1EQ2A 2GM9A 4NP6A 1RDFA 4B76A 2YV5A 2HSDA 3IO5A 3KXIA 3ILVA 2P27A 2G9UA 2P9QA 5BSEA 4MNTA 5E1DA 1L4BA 3WV4A 1KQFA 1UJ2A 4R2LA 2OYNA 3U4HA 4YT5A 1QZXA 4JL6A 4C5CA 1TYDE 1HEYA 2JGEA 4M1MA 5FLKA 721PA 1Z0FA 2FPMA 1OGIA 1VPVA 2PBZA 2PUEA 1THTA 2WW8A 1WCV1 1UT6A 2P67A 2ISCA 3HCNA 3VU1A 1HGXA 5KYNA 4CLRA 2CMKA 3MGGA 3SXJA 3S2YA 3I42A 4XTCS 2R86A 5BVGA 1FB5A 3TOSA 1W73A 1FDOA 1D4ZA 3HM2A 1QGED 1SXQA 1MB3A 3PKJA 3C8HA 1ZR4A 4U1RA 1COWD 1G6KA 5CAEA 5L4LA 3ODGA 2E1PA 2GO7A 3WNQA 4II2A 1BHQ1 1P2BA 5EWJA 3ECSA 1QRSA 4KREA 2I4NA 5EGNA 3S70A 3T9CA 3U7RA 3VHXB 4RMNA 3ZHYA 4YT8A 1LRLA 4L9WA 5JJLA 2FPSA 3Q7QA 1AMUA 1NJID 3A1PA 1A1SA 1MRNA 1W7AA 3G6WA 1TKAA 3GVHA 1HTBA 4QWWA 4WASA 1F4LA 1FQOA 1ONSA 3K30A 1AOXA 3I9V1 4HADA 3ZN2A 2JI8A 5TVGA 1Q2UA 1ZG3A 1H69A 3MTGA 4BO3A 421PA 3WA7A 3R9WA 3LHFA 3C6KA 2A1TS 3C3CA 4UBLA 1BIFA 3EUAA 4GM0A 1V8FA 2PS9A 2PQ0A 3MS7A 4BV9A 1VI2A 2ZRGA 5K0CA 3NDBB 1RT9A 4L5IA 4NABA 2D3TA 2WZBA 1WQ1R 1DWPA 1U7XA 2IRWA 3KS9A 4I46A 1VZ3A 3RSGA 1RQ2A 4D8UA 3EEOA 2AF3C 2NACA 4Y2YA 4BNJA 4FFMA 4EJ0A 1QQAA 4M0LA 1U7OA 4UMVA 3DZKA 1CHNA 1H4TA 1A50B 3Q8WA 3EULA 3L0DA 3EVFA 4H0FA 4MUKA 4QX6A 1FQKA 3FSGD 1AUOA 1HE4A 4K28A 3UAYA 2VYND 1JJ2B 2GS9A 1ZU5A 3I32A 4N3BA 4BBPA 1I80A 1QHIA 2G1PA 4RZHA 5F4OA 1DKQA 3K9CA 4K9MA 4ZRNA 3SFZA 3RADC 4MTLA 2EWMA 4UATA 3BM5A 3WRWA 1AKWA 3FAKA 5CITA 4PAAA 4HXEB 4C05A 2P3SA 2QTFA 4CQLB 4KUEA 1GSIA 2ZATA 4CG2A 1S4QA 1ADYA 1M1XB 1TPZA 1WDKA 2QG9A 5JO9A 1G18A 5KOIA 2JDIA 5KU7A 1HLGA 1Z8NA 2XOXA 1VGRA 2D00A 5CJJA 4TV8A 4YJ2B 3FGNA 4W63A 4X9XA 1M2FA 2WINI 2ZCVA 4MQMA 1NDHA 2RAUA 4QGBA 5DCWA 5DIZA 5IKMA 2QUKA 4DV5B 3HMQA 2CKDA 1GUBA 2NU7B 4RM3A 3OW2B 1FFCA 3TR5A 1ODKA 4YR9A 2GR9A 2QN6A 1VQKB 2XMBA 3GOQA 5TPZD 1KL7A 4F5YA 3NX4A 4LRUA 2VTEA 1OVMA 2YIJA 1R6XA 3A7DA 1RQGA 3K70B 4GPEA 2XY4A 1E62A 1PLLA 2JAWA 3DLPX 4I1IA 4JLKA 1GTMA 2HU8A 5ALQA 2ZI6A 4XLFA 3KJXA 4A6XA 1FS5A 3ZI0A 1FW6A 1JU9A 5JFTA 3FKSD 3ROXA 1L5WA 2XXBA 1H1LA 4R1LA 4OXQA 2YC2C 4YRJA 3UXMA 1YL6A 2JRLA 3Q9LA 1OYYA 3R9KA 7MDHA 2G63A 3FMFA 1R9MA 3SLRA 1M8JA 1CR6A 2X5XA 1PFQA 4DMMA 2GNOA 4X7PA 1JECA 2N0SA 4Y2UA 1QV9A 4K87A 3TKAA 5BO5A 2PSEA 3ET5A 4Z7OB 2P6RA 2PZKA 4JN6B 4MGHA 3OAAD 1OXVA 2XD4A 3FETA 4IDAA 5DISB 3GR6A 4DE5A 1U2GC 4UOEA 3THWA 3AHFA 3VZQA 2GZHA 3FLEA 3QZUA 4RPGA 5CUQA 1JPNA 1BN6A 1GAXA 3GRCA 1FVXA 1QQ6A 1OWPA 4EG6A 1SVOA 3GC6A 3H0KA 4WW0A 3VI4B 4US0R 5AM2A 2JLCA 1I3NA 3FYSA 2OCAA 4X8IA 1LA2A 3GA5A 4DREA 3SZRA 1ZK1A 1NYLA 4GMGA 4PQEA 3LVRE 4PC3A 3DV2A 3KJIA 4ZEWA 3DAGA 1CDOA 1AQUA 1ILEA 3V32A 3UOWA 1H6DA 3RR2A 3D9QX 3G7SA 4HPJB 4YFYA 4OYYA 1RXCA 4HATA 4DSNA 3QVJA 3K20A 2GPAA 1D4FA 3OLQA 2H17A 1V35A 3BCFA 1EQAA 2G04A 2JIRA 3PP8A 4OJMX 2SKDA 5F9HA 4RVUA 1UJ5A 2NQ2C 2K7FA 4PN3A 4ALIA 1V8ZA 1KFCB 3MVEA 4M37A 1NFRA 2EU8A 3Q6IA 4DNOA 4E5DA 5JNSA 3PNOA 4CV2A 1EDDA 1PW5A 5FJIA 3GAMA 3C4JA 3LIIA 4QATA 5TF0A 3PUHA 4YN3A 2FFJA 4OOXA 1UDAA 2CEAA 1GHTA 3BXZA 3OKPA 2R4UA 2ADOA 1SBQA 1W48A 2Q3BA 1IY8A 2ZSEA 5IBCA 1T2DA 1GILA 3RFVA 3HB7A 1OZ0A 3CJRA 4PBSA 3M1YA 5T7BA 1ZJZA 5ALTA 4OGKA 1Q7RA 2O2JA 4MYHA 5EWMB 1ZGZA 5MN4A 2O8NA 1KI2A 4CIWA 2Z04A 2ZPUA 2UZ1A 3E70C 1JYFA 3H6GA 3K5IA 4J3NA 5LKRA 2I7XA 1HNXB 1UKAA 4OM7A 4WRRA 1UPAA 4HDMB 3FVTA 3P9IA 3GFPA 3Q1LA 5JYEA 3PV0A 4DMCA 2FUKA 1MAVA 3NBXX 3WP0A 3ETNA 3QMWA 5F7OA 4KFSA 1AB5A 3Q88A 4JA0A 1D2MA 4NTZA 4OL9A 2FZLA 4YREA 2G1JA 4TVKA 3TXYA 2O8VA 3PUVA 1LBEA 3ZXYA 1JXQA 2M6RA 5A8AA 1RAEA 3DNFA 2ZM5A 4DWOA 3BWDD 3E9CA 3FE2A 5C5DA 4KITB 4LA4A 4MR7B 3ZHZA 1PZGA 4MQ6A 3CR3C 3MJSA 1QWOA 4IX9A 1R8YA 2Z30A 3TZBA 2GJ8A 2PRKA 1CBUA 1JPVA 4BPRA 2JGFA 3IEVA 1JDBC 1JAZA 4LCEA 3GXOA 1D03A 3G7UA 1AGPA 4Q02A 7REQA 2G36A 1QO7A 2BKVA 1PVOA 1SKYB 5AK4A 4X05A 4YCDA 1MEOA 1ZGCA 1MQ9A 4KQWA 1TFUA 5AJVB 5ARDA 2EBUA 2Z5LA 5H82A 4RTNA 2CBXA 1WNTA 3W6NA 1Y9DA 5KNCD 3H99A 1KDZA 2VBVA 2D3LA 4KKSA 2OBFA 4RK6A 5JVDF 5K0NA 4ZJUA 1N9GB 2VT6A 3T06B 3H19A 3PR3A 4NU0A 1M1UA 1YCGA 1HQKA 1XZQA 3DAFA 1JQAA 4HZUA 3EMDA 3E27A 1EZZA 2IWHA 3V4VB 3T5TA 1Z0JA 2MDTA 2PTHA 4W1SA 1JP7A 5KVCA 3OZAA 2OBMA 4ZOLB 1MA3A 3Q9SA 3Q3EA 5JALA 1ZUNA 1IM2A 2QG4A 2PYDA 5KNDH 3JQ7B 3L8HA 3QW4B 3RIGA 1UM9A 5AW5A 2XQKA 1T4DA 4FLMA 3L6UA 5IHXA 1MX1A 3U3MA 3FZNA 1RD4A 1HMPA 1ZH6A 2O2GA 4C5AA 2R6CA 4RPLA 4KLRA 3E1KA 5IBQA 5IJ9A 1QHYA 2ZPTX 1ESEA 5FBLB 4CCSA 1N7GA 2Z4SA 4YCSA 4AAYA 2DY1A 1VTKA 3OKAA 2WIAA 4WVLA 2VDQB 2G0AA 2VZ9A 1J0XO 4XUCA 5GOZA 4DR2B 5A5EA 3HHEA 1HFEL 1HSOA 5IUJC 1IY9A 4Q4DA 4HDSA 1D9ZA 1EHYA 4L4YA 3HZHA 3RFUA 2G9VA 3QOYA 3KO8A 1ZVKA 3OIWA 4AG6A 5IYNA 4ANFA 2OBTA 3I62A 3AETA 4F7DA 4AY6A 1PL7A 1BLIA 3ZY5A 1PGJA 3OZWA 2Q4OA 2GRAA 4HX9A 4PYMA 5ALPA 5IVDA 5JCXA 3WGVA 3H6HA 3BIOA 3D4PA 5KS2A 3IEIA 2O20A 5DBOA 4AKEA 4RF3A 5EGSA 3B9PA 3OLWA 2F62A 1VI6A 3IEPA 2FNAA 3M1LA 4Y2VA 2GNPA 1BX1A 4Q7JB 2NIPA 1ZJJA 4LZZA 5HJ5A 2GVNA 4W1PA 4MS4A 3HVIA 3PGA1 3PVSA 4PSDA 2IUYA 1K0FA 2H7XA 1T9AA 2UKDA 4MWTA 1OYOA 4IQ0A 1PBNA 3UK2A 1K4MA 2I3GA 5FV4A 4P0TA 3ZK7A 2B2NA 4JCOA 1AY0A 1EFKA 1R6AA 2FKNA 2NW6A 1GCOA 2QLMA 3ORRA 2WFLA 4RVNA 1RJEA 5EZYB 1GRVA 5JS7A 1WV0A 5HM8A 3VR3D 3RBXA 4PTZA 5IW8A 3M4XA 3RVNA 2II6A 4TROA 1C7QA 1UD5A 3TI9A 4D45A 3QHAA 2ZXUA 3R3WA 3BHJA 3GJTA 1MC4A 2GTIA 2X0RA 4R8LA 1Z4NA 4OQFA 3KSMA 1KXZA 3N2LA 2LDXA 2PDAA 5E8RA 3WYGA 3F47A 4BNIA 1GGFA 2OB2A 2IVZA 4WOKA 4U6NA 1U5AA 3PL5A 4E07A 4AQDA 4NEGA 2ID7A 3O91A 1URPA 2VK1A 3HZZA 2YFHA 3G8CA 3QA3E 5SZKB 1BDIA 3SLDA 4MVCA 4QSHA 4HNHA 4NYIR 2VHYA 2RCYA 4PCAA 1XRLA 2YDXA 3STYA 3NKLA 3H7IA 5CB4A 5FT9A 4RPJA 4RY8A 1H6CA 3OCZA 1EX7A 4RF2A 4Z0NA 3DLBA 1I18A 5FJJA 2Q6LA 1U1DA 4AIRA 4D4HA 4LMBA 3VZPA 4FC7A 3OC6A 1PT9A 1JYSA 3G5UA 4X1IB 2L0XA 3COYA 4FDLA 1OX5A 2B5OA 1XXHB 2C5SA 3C1TA 3FPSA 4ITRC 4OSPA 1W5AA 2QSJA 4TV9B 5CT8A 5ALNA 2OVFA 5I45A 5B57C 4I1YA 3WHLA 1NZFA 2GLXA 4KZPA 1NBHA 3OPYI 3OZDA 3DBOB 4B3BA 1QHEA 4JL8A 3VZRA 4P4GA 3W5CA 1CLUA 4EA9A 3RS9A 4DBZA 4UHKA 5F5XA 1KZ7B 1VJGA 1U1FA 4M7OA 4FQ8A 1E92A 1V2GA 2Z9BA 1Z2NX 3EXHC 4QBKA 1KK2A 3SEJA 1FYFA 3I34X 4ZTBA 1C1XB 1NU8A 4QLAA 3L4KA 5MGNA 1ZESA 1J24A 1B6SA 1NNLA 2ET6A 3G5AA 1E2EA 1WDWB 1Q1GA 1PFKA 1XO1A 2QX7A 1FDRA 3DFIA 3K32A 4JJ7A 4DV2B 2BYTA 2B20A 3PLRA 1FDWA 2EIHA 1Z6YA 5CDYA 5FULA 4CIXA 1O96B 1XTQA 4MPJA 1PFWA 4F12A 2D5CA 2QD3A 4KK4A 4TZ6A 3CNNA 3WISA 4JITA 1XDSA 2JGDA 1F4VA 1SZJG 2PGOA 1JWAB 1CVIA 1UODA 3B6JA 3HVKA 2FEOA 4Q3OA 1XTSA 4RV5A 4ZEXA 2VH1A 5IC5A 1F2DA 4UUMA 5C8DA 4MVWA 1W96A 3HKCB 2SECE 2ZTVA 1ISHA 5AUNB 1VG0B 3EBPA 3F5SA 3HBFA 3ZWOA 1LWNA 3KCQA 4U02A 4FMPA 3CLSC 4O2RA 2IUFA 3UGKA 4YRSA 1XQ9A 3N3BC 2NSLA 2ZWVA 3RUEA 4Y6LA 2BSAA 2V65A 4KRYA 5ELMA 4UPVA 4NI5A 2DB3A 5ALKA 1VMIA 4ZT6A 2VDLB 5D3MA 2JKVA 2H7CA 3QP9A 3TIFA 1K97A 4HDKB 1M66A 1L7EA 1XZMA 1W76A 2PMWB 4KQGA 3GMIA 4OAOA 3ETGA 1V0EA 1NQTA 2PTGA 4ETIA 1MEJA 1H2FA 1XE1A 1JLHA 4AF6A 1KBQA 5C4GB 1USUA 2NVUA 3PZRA 4OQXA 1L5LA 4AUNA 4GI2A 1XVIA 1WZEA 1H5UA 3TYXA 4AURA 1T3ZA 4EL5A 3H1BA 4HDNA 1ULTA 2ZB2A 5LWHA 3FGOA 1OV6A 2B34A 4GPD1 4CIVA 4D0GA 5DCLA 1F8GA 1JVNA 1RJGA 4YV1A 3P9KA 2RGGA 3V2IA 3SLGA 1II9A 4DLAA 2XF2A 1VLQA 1NP7A 2BBTA 4X7BA 4E5MA 5K1ZA 4B7UA 3STUA 1HE3A 3VAYA 3B7PA 2B61A 2ABWA 4KXXA 4Q47A 5FOWA 2DHRA 3OKCA 3OZCA 1ND5A 1IXRC 3CZPA 4RCVA 1BXRB 3AJEA 1G5RA 2A86A 4BB6A 1VIVA 4OHMA 5DT9A 4DV0B 1CG6A 1XDGA 3WRXA 2R79A 4HAYA 4D25A 1SG9A 2YHAA 2X19A 3ENVA 5EJMA 3EOZA 4DA7A 1A9YA 1XEAA 3L8YA 5BV0A 1N7IA 3T7DA 2XUOA 2CFOA 3FWYA 3HP1A 5LN1A 2J07A 2GCPA 3WIOA 1BD4A 2AG5A 2OC9A 3L0SA 4M21A 4H1WA 2OXIA 3OZIA 3WNCA 1P75A 1PJ2A 2BHTA 1EE2A 3SYTA 1DOZA 4L8WB 5AR1A 1CNFA 1KBZA 2X15A 1E7QA 3QTBA 2QVBA 3EZGA 3RAEC 3SHOA 2G40A 2LIVA 1UPCA 1V71A 3FWHA 3ZJ4A 4BYMA 2XUPA 5BQXA 1IIBA 4IOMA 4UTNA 5DCYA 1RYZA 1C80A 2B82A 3AHJA 1NVUQ 1W6UA 1ID1A 1OV4A 1J90A 2CKMA 2CBGA 4HOYA 1DRUA 4BFLA 1P44A 3JQGA 3K9HA 3USZA 3HADA 3P4YA 1QTNA 3HBJA 1T9DA 2DWQA 3F96A 4PPGA 4RK1A 2A5FA 3GLHE 5IASA 2JFBA 3ETLA 5CCXA 1U8UA 5EIWA 2PYIA 4RPDA 1G2PA 3JRXA 4EB6B 1E1MA 2JFZA 1VQ5B 3OEEA 1WCXA 2WC1A 5J40A 4D7AA 1E6MA 3A2NA 1CZHA 4NONA 4DDVA 5JS6A 3VYUB 1MW8X 2AOWA 5GV7A 1NBOA 4GF5A 3VTFA 5HCUA 4M6WA 4CQLA 5TRTA 3W8RA 5JANA 5AN9A 1G6HA 3TD2A 4Z1OA 1ZN9A 2W2XA 1SHUX 3LU1A 3JQEA 2FN8A 1VL6A 4RK4A 1MQSA 3UC5A 3TO5A 4YJ2A 1FF9A 4OPMA 3MBOA 5LUBA 3K05A 2RG7A 3KHKA 5G0WA 1Q3TA 4KQIA 3IIKA 4GO1A 3DUWA 4P5PA 4DNQA 5HR5A 1CX9B 2NU7A 2ZLBA 2AXEA 2BHNA 4N5MA 4ZQHA 4BO0A 4RSMA 5KWIA 3R9XB 2PUGA 5DXAA 2CLSA 3MC1A 4YRTA 4HNVA 3TGLA 1YZNA 3V6LA 1BC5A 2JDID 5J3JA 1P0PA 4RHTA 4Z86A 3OICA 1E60A 4HLUC 3KQNA 1T8YA 1Y80A 3GLTA 1JG2A 3BD7A 2YNMC 1JYEA 3O5AA 4AC9A 2BH9A 2RAFA 4WA8A 1XAGA 2H59A 1Z4LA 2Q6TA 4KWEA 4PG6A 4XFKA 5HG0A 4CM7A 3HXOA 1WP6A 4H7PA 5JASA 2VQ3A 2P6NA 3JZIA 4V0SA 3S7ZA 3VDXA 3LCMA 1VB3A 1VXRA 3PXAA 2D2FA 2RGXA 4EPTA 4I50B 3W3AD 1E9DA 4GYYA 1L8QA 2CWWA 3NB0A 4EHJA 1E3EA 4IMJB 4CMKA 3NJ8A 5JSQA 2W98A 2IU6A 2PU7A 1FX1A 2ZJYA 3HKBB 1GJRA 1DC4A 5DI3B 3WL4A 5BVHB 1Y8CA 3KEGA 4C0SA 1WZIA 4GAEA 3MERA 3OIYA 4LV8B 4WOCA 2QTAA 2C5FA 4MHOA 5I7FA 2O2IA 3LPCA 4J1TC 2AYXA 4J7CA 2VNHA 2W2LA 5BR1A 4HT3B 1R0XA 3I9MA 2HA0A 2PKYX 3T4EA 2WFAA 2FQQA 4YS6A 2Y1EA 5LVAA 4G6IA 4HDQB 2NV2B 3UH1A 4KIFA 2JGNA 2X8AA 3E1SA 2P9TA 1ZVMA 4ND1A 3O2NA 5JLJA 2CV2A 5HUJA 3LUPA 1TZJA 1J4AA 2FUCA 4ZU6X 1W36C 3PFFA 1VJ0A 3A9UA 4ARBA 3PFIA 3PB3A 1OILA 5KEIA 3DO6A 3FKQA 3BDIA 4X1OA 3URMA 2AMYA 2O7VA 2WMDA 2XMZA 1FDSA 2Y27A 3MUNA 1JHQA 2XSZA 1KO5A 3IBTA 3N8IA 2OEPA 5JD4A 1PJLA 5KPDA 2DIEA 2IXDA 5HSGA 4EG7A 4YMUA 3DJFA 3RYIB 1CD5A 1YE3A 5DTMA 4HVCA 1KDTA 4HCJA 3V8RA 4EMUA 5IXSA 1QH8A 2ZSKA 2ZE5A 1ZH4A 1LF0A 1U2RA 2BBSA 2XNCA 1YU6A 3UHPA 3WDLA 1Q1EA 4QTZA 2ZITA 1YX2A 2C2GA 3T9EA 2CLFB 4P12A 1M74A 2C8KA 2HRQA 4ZALA 3S2EA 1JWBB 4Q7KA 1HRDA 3ND7A 3CIFA 3GUUA 1EDBA 3IHWA 4AQYB 2CLLB 4TUYA 3BB4A 3KHUA 1W35A 2OMKA 3IMFA 3AG5A 1KC1A