4M53A

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in complex with gdpcp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
403
structure length
403
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
total genus 104
structure length 403
sequence length 403
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m53A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m53A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m53A01
5JEEA 1Q82D 1SHZA 1XMJA 1W36D 1FUUA 1P61B 3I56B 2XTNA 2L0XA 5AUNB 1RW4A 4Q9IA 2OK7A 2A5JA 4HZUA 1CBUA 4P4SA 2QMUA 2JASA 1NIJA 1GNPA 5C2JB 4PHGA 2WKRA 3GLIE 2X3UA 1NMYA 2GDJA 3LW7A 4TLDA 4WIAA 4TT3D 2ZSAA 2OHFA 1NN1A 5HTKA 4PFSA 4GFDA 3CPWB 2OESA 1OW3B 1S96A 4DIDA 4QBFA 1IB0A 1OGIA 1LF0A 2XTMA 2ZUBA 4B3CA 1FW6A 2F43A 3PR1A 2PZFA 2QAGB 1OGJA 1U98A 1VHLA 2E87A 3PUWA 5JRZA 2IA5A 1XTKA 2VP0A 3E5HA 3E70C 4YQFA 5EUQB 4LX0A 4OI4A 3B82A 5EP3A 3NBYC 3T06B 3W90A 1T0JB 4K81B 4D25A 2BEKA 1KO8A 4JBYA 2QU8A 3VR3A 2QGZA 3NEJA 1CLUA 4M1YA 4G5SA 5JEDA 4FK8A 2YKGA 1KOFA 4Z1MD 4QBHA 2QBYA 1G20E 4PZLA 6Q21A 2EFHB 2FOLA 1XTRA 1CNFA 1OB5A 3HJNA 3T15A 1T91A 3PXGA 1P9RA 3FB4A 3I8XA 4YC7A 1G5PA 3QXJA 2VSXA 1EXMA 1VHTA 2ZRKA 1XDBA 4QHSA 5JRJA 5JCPA 1OXTA 2W6IA 3SOPA 1TF5A 1U8YA 2F1JA 3EG5A 3W2EA 3I5XA 3UANA 3LRPA 5FOTA 4XVRA 1BO6A 3A37A 5KNDA 3NWJA 1VYUA 1EGAA 3EPLA 1YZQA 3IILA 1Z0IA 3TSWA 3ZD7A 1CR4A 2X8AA 4C4PA 3SJBA 5CIQA 5BN3A 4B43A 4YLGA 3SBEA 1DG3A 3AVYA 1F3OA 3CCUB 5G3YA 3SN6A 2WZQA 4Q18A 2X19A 1GAJA 3TSZA 4CYMA 2V8OA 1G17A 3NBXX 3RS0A 4D0LB 4B74A 3B7GA 2G3YA 2IYVA 3GJ6A 3KKPA 5LD2C 3FMOB 1P9NA 1V43A 3VKWA 2I4IA 4RSGA 1YR9A 1AQYA 1GZSA 2ZRHA 2LWIA 1E64A 5FOXA 1IN6A 4Q21A 2QEQA 1E96A 1ZD8A 2AK2A 3GLHE 4Q9HA 4KXFB 2Q3MA 3GLHA 3R8CA 4UNPA 4FMDB 1NVVR 1SKQA 4TMKA 1E98A 2FSIA 1RJ9B 1OSNA 2QENA 1UKZA 3W6PA 4B6EA 4LJ7A 1KI9A 2IL1A 5C18A 2AKAB 3P27A 4MYTA 3ADKA 3ADBA 3K0CA 4BZPA 4GT1A 1WB9A 2G0NA 4Q4JB 1R7RA 2IEZA 1JA0A 2BKUA 3TR0A 4BZXA 5SZJA 1E4YA 2AFIE 1QX4A 2DR3A 1PV4A 2P5TB 2B7CA 3QFRA 2O8CB 4EKDA 1VQMB 4DRZA 2PT5A 4URUR 2O8FA 1E69A 4XJXA 4TLCA 4DCVA 1W4CA 3VNUA 2VA8A 1GVHA 1OE0A 1OFUX 4Q66C 4DT1B 1EESA 4DCNA 2ZS8A 3R7WB 1K8RA 2QTLA 4DCUA 1FMLA 1N6PA 3RLFA 1BYUA 3RVBA 2WM9B 4DC9A 4URVR 1SVMA 4C0BA 5B64A 1FDRA 4A9AA 4MDFA 1OFTA 1IN8A 4W5HA 4FMBB 4AF7A 1G18A 3LV8A 4QFMA 2ZE5A 1JECA 4NYIR 5CDFA 4ACAA 2ZI4A 3JZAA 4WAUA 4B2PA 2RGXA 4PSVA 4Z51A 4IRUB 1QHGA 3ZVLA 1G8HA 3C4JA 4HAWA 4JYBA 4D2IA 4A4DA 4BQSA 2W00A 3DKVA 4Q4AA 1II8A 3OEEA 1E2MA 1SVLA 2QSYA 2DEUA 4BUJA 4OJKA 3Q5EA 4GBMA 3W3ZB 3IIMA 3DDCA 1T5LA 3GJ8A 1M90D 4ZDWA 2OBNA 1RIFA 2C99A 3TR5A 4AKEA 4QKQA 1R5BA 4AYXA 2KSQA 4DLVA 1Z47A 2HJVA 3K9HA 3RRZA 1UPTA 4Y0AA 1S3SA 1TX4B 3MSXA 4DSOA 2J1LA 1H42A 2FV8A 2QM7A 3EXAA 4B35A 1OHHD 2IYWA 3NVAA 2FFQA 1HEIA 4GZLA 3AVUA 2BGIA 2JJ8A 2Q3HA 4TL8A 3D7MA 3LH5A 5LPNA 1KK0A 3DVLA 3NC1C 1ZW6A 4M9ZA 1XBTA 2JAQA 1QG2A 5EXSA 3QJYA 1YJ9B 5G40A 3CZPA 3HWSA 4X8LA 3PUVA 4GMXA 5DI9A 4V0NA 4NZYA 3SR0A 3SU8A 4DVGA 5KYKA 1G3MA 1E9SA 4FMDF 4NCIA 3NHAA 3U3RA 3ADDA 3I1FA 3NBFA 3TQCA 3PFIA 4G5RA 4J0QA 3MWLA 3C41J 2WSMA 4M1KA 3NHBA 3QXCA 2GAOA 2JEOA 1E3MA 1OYYA 5H68A 3K0EA 4Q4HA 2IYTA 5JECA 1P60A 4JKYA 2PX0A 1BKDR 3NDBB 4JYCA 3ZGXA 3FMFA 1GM5A 3C8UA 3ZZ0A 4AY2A 1D6JA 2WJGA 3G82C 3CCVB 4MYHA 5CYOA 4Q1CA 2B8WA 4BFXA 2REOA 2ZRNA 1FNMA 2D2EA 3I73A 1LS6A 1ZJ6A 4RVCA 2GESA 1OIWA 3K70D 3G6EB 3FHOA 1OFIA 2VP5A 3KJGA 1N2CE 2RKOA 3Q9LA 3W5HA 5FL7A 4LSGA 1Q1BA 3IBYA 1F20A 1E99A 2DFLA 3ZZUA 4WZBE 3TAUA 1NDHA 1XXHA 3NBZC 5TMPA 1BMFA 4ARZB 4M2LA 1Q7YD 2D74A 5E95A 1PUIA 1TU3A 2QT1A 5EE0A 1Z29A 4AYWA 5KOYA 3PEWA 4EQ6B 4C7OB 1T8TA 4KFUA 3B85A 4LV5B 2XZPA 1QFZA 1Q44A 2ORIA 4OI1A 3MJHA 3P26A 4QBIA 4EPWA 4JL6A 2WAYA 4YMWA 1KMQA 1HV8A 1OFHA 2C98A 3THXB 1TEXA 4HLCA 2FPKA 4CEIB 1G3IA 4D0NA 3KKOA 1ZC3A 1MO6A 2GK6A 5CLQA 2GJ9A 3X1DA 5KNBA 2JA1A 1TU4A 3WXMA 2XXAB 1R2QA 1XPUA 2OLJA 4G5OA 1Q1QA 4BE7B 3BXZA 2QP3A 5CB6A 4OHXA 1E63A 4DKXA 1AS3A 3B1YA 4B76A 4AYTA 1NN3A 1W5TA 1F6BA 3AP3A 4C3ZA 1DE0A 3NIBA 4XTRA 4KHZA 2DFNA 3KJEA 4D4MA 2VO1A 2PJRA 1R5OA 2NMVA 4ZO4A 1RZ3A 2VLIA 2XJ4A 4UKDA 4A1FA 2FX3A 4MRVA 2IYYA 721PA 3DZ8A 1E79A 2CEAA 4MKFA 2EFDB 4JSYA 1TQ2A 2HUPA 4CT4B 2GCPA 1ODFA 1T6NA 3TIFA 2JLSA 4DLXA 5FTLA 3V9PA 4DUGD 3FKSA 2GJKA 3Q3JB 4F38A 2GVDC 2OE2A 4KU4A 4CEJA 5FPYA 4XOIA 3ECCA 1Z22A 2ZE6A 4M1SA 5LBIA 2D2FA 4OHZA 3A1UA 1AQUA 4PAOA 5FI1B 1W2GA 4KYUA 3SEAA 4ASUA 1Z63A 4ZIRA 3O8CA 3CNLA 4Q7MB 3EZFA 1VQ5B 2XSZD 2BCGY 3AF1A 2V6JA 4OQLA 5LB4A 3THYA 4IDOA 4EJSC 3U7FB 3B1VA 1QHSA 3R8FA 1ESMA 4GDFA 1H65A 1FUKA 2XEXA 1W47A 5DI3B 1ZYUA 4IXMA 1BJKA 3KJHA 1G3UA 3T35A 2GILA 2HEIA 3B1ZA 3W6NA 2BCJQ 2HLDD 2Q9BA 2OXRA 4P6VF 4V0ME 1H85A 4WQMA 1HE8B 2ZPTX 4V0MA 3CO5A 3KKQA 4WW0A 2O0HA 1W1WA 1KK1A 2ZJZA 1W46A 4OHYA 3L82B 4HLQB 1RFLA 4NYMR 5UKDA 4BFWA 2VPPA 5KDOA 1GAQA 3KKMA 1JR3D 3TUIC 2CHGA 2WWXA 4QGFA 4BGDA 4DB4A 3HR7A 5J4LA 2ZRGA 1OH7A 4F4JA 2FNAA 1AN0A 2IXGA 4DLWA 4EH1A 1XTIA 8OHMA 4C0AC 4BECA 3H2YA 2PL3A 3L0IB 2NG1A 4GZMA 4A0FA 1J8MF 1E9EA 4A0HA 3TMKA 1U99A 3WYFA 1S4QA 4HSEA 1CQXA 2B21A 4YXWA 2VHTA 1MO4A 2VF7A 4OHWA 2J9RA 4JZKA 1KNXA 3CCSB 3TW4A 2ZE7A 4U02A 1G291 1R8QA 3PUXA 4WXRA 2V1UA 2XB2A 1SXJB 4KVAA 1IBRA 3VNVA 1X1SA 3X1ZA 3W5IA 3K70B 5DN6D 1ZBDA 4NBSA 4P0TA 1E2KA 3CB4A 5SZHB 4F7WA 1DO0A 5F2EA 1EP3B 1TEVA 2GAAA 3UATA 1YZKA 4YAWA 1ZIPA 1M7HA 1EP1B 1NSFA 2XNDD 3OIWA 4NPHA 2XNJA 1Z0FA 4YDSA 4AF6A 4TYYA 1P4SA 2GF0A 3RDPA 4JLNA 4WVFA 4LPKA 2GHIA 1AS0A 1XTQA 1VCIA 1W49A 2GZAA 3H84A 3U3MA 5GVRA 4D0GA 2DERA 2C96A 5EP2A 5C4MA 1VCOA 3WMFA 3LLMA 4IVQA 3BFVA 2OBMA 3MLEA 4JJZA 4URYR 1ZINA 2W83A 5IK2D 4QNMA 2HT1A 5JBQA 1QVRA 1FQJA 2R6GA 2ZE8A 3CPJB 2X2EA 1DO2A 4HAZA 1QVAA 2V7QD 4UNQA 1QF9A 4G01B 2ZU0C 4CDGA 5AJVB 1RPZA 5TARA 2OILA 4YHBA 1SM4A 1QHYA 2VQSA 5EJEA 1G3QA 5AJXA 2VZLA 1RYHA 1S1CA 2DETA 3IHWA 1NBMA 4DDVA 2O8DB 1KJZA 1KO4A 2NZJA 4OBEA 3K0AB 4QNRA 4TYQA 3GLFE 1VDZA 821PA 3WBJA 1YHNA 5EQTA 1S2MA 2ZSEA 3I3SR 2FEOA 3U44B 3KXLA 3QPWA 2YJTD 1UBEA 3VKGA 1ZC4A 4NYJR 2IS6A 3CPHA 4FWTA 3W9YA 4JT4A 1UDWA 5M04A 4ZDIA 1RVDA 4LI0A 3VO1A 3SI7A 1YZUA 5H1YA 1YI2B 2ZJOA 3OZUA 2PMDA 4OQXA 2CE2X 1YQTA 3LXRA 5F98A 2YHSA 1L4UA 4PHHA 2W2XA 1VQ6B 2BJVA 4LC1A 2PJZA 4DQLA 1BX0A 1R5NA 4UJ5A 3SJCA 4EPVA 4O3MA 4II7A 3CX8A 4FIDA 1DDGA 4M9QA 2PZGA 4MYCA 1H8HD 4GSYA 3LBIA 1S3GA 3X1WA 1CR2A 4KV9A 4OHVA 1F48A 4B34A 1LF5A 4B3XA 3CCEB 1KGDA 3D31A 4TN1A 3O47A 2IS1A 3W5JA 2ZJ2A 2ZRFA 4EFMA 2DFKB 1G21E 1Z6XA 4Z8XA 4Y9RA 4MKGA 5A0FA 4TL9A 1Z6YA 4HZUB 4MGYR 4EJSA 5GJVC 3A1WA 4MYUA 1HY3A 3A36A 1E0AA 3GJ5A 4TMTA 4POAA 2QTFA 3KUDA 2C8VA 3LXXA 4TQUS 3SJAA 3GLIB 3LWNA 1T8UA 2AL7A 2GETA 3T61A 1SKYB 1W5SA 5K8LA 1GRNA 4HAXA 2O8EA 4N1AA 5EZ6B 2QMOA 3NC0C 5KSYA 3QE0A 1S8FA 5SZKB 3FVQA 1TQDA 2F43B 2NO9A 3OZXA 2WPDD 3LW8A 1DDIA 1DAEA 1GITA 1ZM7A 5FOSA 2G6BA 2O8BA 4KYIB 1EFRD 1M8PA 2CLSA 2BN4A 2YC4C 4CW7A 4CT5A 5EXTA 2VHJA 1R0WA 1NNEA 3AB3A 3RS5A 3B9PA 5JFGA 2WVJA 4B32A 3FMPB 1W0JD 3U5ZB 4KFSA 1GL6A 3N70A 3B2EA 3T5GA 3ZC3A 1YZLA 2EYUA 5B58C 3REGA 3FFBA 4Q4LA 4ERNA 2QBYB 2Z6VA 4MKHA 5JI2E 1XWIA 1DBSA 1E1RA 4UNSA 3SQXA 4IDPA 1GKYA 2GNOA 2XOKD 1IY2A 2ZSFA 4CGZA 4X8OA 3WBKA 2PEZA 2J7PD 4A2PA 5FUVA 2QQEA 2W6JA 2J3EA 3AVPA 2BPOA 3J81k 2YWEA 1B23P 4NYMQ 4URWR 3LX8A 5TXGA 2CK3D 2P5SA 2AWNA 1A7JA 2CBZA 1XMSA 3IPYA 4DCTA 4A15A 2BM0A 2QE7A 4LGMA 4LWZA 4P33A 1UBCA 3QPUA 2FZ4A 3C5CA 4ZI3A 2DWOA 1U90A 2OSBA 3K09C 1GWNA 1NRJB 1EK0A 1KY2A 4LBYA 1SZPA 3SYKA 2JLWA 1JQLB 4O2LA 5D3MA 4V0LA 4AIIA 5HE9A 1M7GA 1ESNA 3W34A 3CH4B 2QORA 2EQBA 5TDHA 2KB0A 4PANA 4M1TA 2ZXUA 1IXSB 2JJ2A 1XJ0A 5IF9A 4B4DA 1BIFA 2J7KA 4H9GA 2JLXA 1NJGA 1JR6A 3GLHB 1GO2A 2YWHA 3FPKA 1VQ7B 1BMFD 1IY1A 1N6IA 3MUFA 3W8RA 3ZDQA 1XU4A 5JJLA 3RS4A 4Y7CA 2QRZA 4K46A 2NPFA 4C0SA 2XZOA 2CCKA 3CF6R 1GKIA 2AD5A 4B2LA 2DHRA 4Q9LA 3ES9A 4C30A 3T34A 4EDHA 3OEHD 2VSFA 4MRSA 1T5IA 2CXXA 2ZRBA 5FR1A 3UMRA 4E03A 3HR8A 1QHXA 2ZROA 2ZREA 4DXAA 2FA9A 2P65A 1N6LA 4G1BA 2XZLA 2CLDX 4Q48A 3VU9B 4PC3A 4RJLA 2O8FB 1XB2A 1L2TA 1WE2A 1ZVQA 4LCBA 1KI2A 2NZ8A 1CNEA 1F5NA 3TH5A 4CEHA 3P4YA 4LK2A 2HDNB 1VG8A 1GRQA 2ODWA 1NI3A 3WP1B 3U7GA 1QGZA 5C4GB 2WWHA 4ZPXA 4P4UA 3BS4A 1FTNA 1Z6TA 2F1HA 3CWZA 5FBWB 1KZ7B 1QRAA 3A4MA 1W2BB 1ZNZA 3P20A 1JAHA 1G6OA 2Z0MA 3IO3A 2J59A 2VRWA 4QOSA 2FG5A 1Q3TA 1NN0A 4C0QC 3N2EA 4IKEA 4F91B 3V00A 3PJRA 1H8ED 5C1BA 3OJXA 4PSAA 5HKKA 1M7BA 3BB4A 2VH5R 1CP2A 1II8B 1IOZA 1Q12A 2ODNA 3QBTA 1E9RA 1VG9B 1I4TD 1A2KC 4TMZA 3WNCA 1VQ8B 1QFYA 4ZGNB 1E1QA 4FINA 4PQRA 1JQJC 4C0KA 1CJMA 4NL4H 5FBLB 2R2AA 2ZIAA 1U9IC 4JLKA 5E7JA 3I55B 2P67A 3EPJA 1AM4D 1VTKA 2CL6X 4IVPA 4QJ4A 5FR2A 1SKYE 3CX7A 4TSFA 1ZD9A 5G41A 4EAQA 2XAUA 3AVVA 4NP6A 2NQ2C 4M53A 3TVDA 2HYIC 4F4IA 2J46A 3U4QA 4OL0A 1ZU5A 2P2LA 2PZEA 2NGRA 4RZ2A 4V03A 2PBRA 2YWFA 3CMEB 1FNNA 1OLOA 1QHHB 3EIHA 4I99A 4HUQA 4XWKA 1IN5A 3EPKA 2BDTA 2PX3A 2WIBA 3K0SA 2IYXA 1UKVY 1GJRA 2CRVA 2ZUCA 3EC2A 3QF7A 4XWOA 1KJWA 4G5GA 2ZYUX 1HH4A 1COWA 1RRGA 3RNLA 2YOFA 3K9GA 2R44A 2CVFA 2FFBA 2ZJ8A 4NCJA 5L8VA 3KKNA 2I1VB 3R9IA 4ZDKA 4M0LA 2WBLC 2WWFA 3FPAA 1FZQA 3GEHA 3N2IA 4LHZA 2QAGC 2VP2A 3IIJA 1RRCA 1M74A 2ZI5A 2J0UB 2LCFA 3PIRA 2GKSA 2R9VA 3QF4B 4BLPA 4GP6A 4CF7A 4UXIA 3LBNA 5G3ZA 3DO6A 4YMVA 3Q85A 4NTZA 2RB4A 2ZJ5A 1Z83A 3OZWA 3AV0B 4ZKDA 4OI0A 3RS7A 1US8A 3BH7A 3SYLA 1TNDA 4RZUA 4KCGA 4PX9A 4MUBA 1WMSA 3BK7A 4AWXA 5GVSA 2QPTA 4LDJA 1FFHA 2CL0X 2WSSD 4YMSA 3AF2A 1MABB 1P2VA 3NKVA 2A5YB 3F8TA 1VCMA 3K09A 1DELA 3HU1A 3BWDD 2WMNB 4TZ6A 3ZQJA 1DEKA 3LA6A 4RD3A 2BV3A 2PCJA 2R6FA 2VL7A 3T5DA 3O8BA 1G6HA 3D8BA 1L7VC 3UIEA 5FTKA 4PZZA 3THWB 3S1AA 2V4ZA 3RAPR 1DAHA 4DEYA 1A82A 4I1OA 2UZ3A 3ADCA 3BIFA 3AKDA 4KAXA 2V9PA 1EP2B 3CR7A 2AXPA 4DLSA 3VQTA 5BXQC 5DLQC 1X8KA 4NCKA 1E2FA 2G1JA 2I1QA 3QUSA 5DISB 5J47A 2JLYA 1DAFA 1TVCA 2WKQA 3QEJA 1R4AA 3TRFA 1TTTA 3OAAA 3AP2A 4PZYA 2ZJYA 1IXZA 2NO6A 4M1MA 1CEEA 1VPLA 2N1BA 3VR5A 3I5YA 2EW1A 1A2BA 4BPRA 2V55B 1WXQA 4MITA 4D6PA 4DCSA 1EWRA 4H1UA 2IUUA 5JS8A 4W5JA 3SS8A 4QL3A 2JLUA 3IQXA 4G1VA 2ZITA 3GJXC 3SQWA 4YDHB 4XTCS 4XD7D 4K1XA 2KBFA 1P72A 2HV8A 2QRNA 1FPMA 5JWRA 3EASA 1NVXQ 2OV2A 1Z28A 1QZXA 3RRNA 2WHXA 2KBEA 1X86B 4NE2A 1F60A 2Q21A 1WDTA 4OQNA 4PQYA 3CR8A 2A30A 5CDFE 4Q9JA 1YR6A 3THYB 4EPTA 3KQUA 3THOA 2F1IA 3FHTA 1HYQA 3ICQB 1EWQA 1YJNB 1WBBA 3QVVA 2ORVA 2EWVA 1W36C 4LJ4A 3KTAA 5ELXA 4X8HA 3QXHA 3MRSA 5HCIA 3I32A 2WWIA 2FN4A 3HP1A 3FFAA 2ZRPA 3EWSA 2H57A 1AZSC 2IK8A 2Z4SA 1U9IA 2H8KA 4JSTA 2ZS9A 5CM8B 4QM7A 1YITB 2BMDA 2D3WA 1TQ6A 4ZCIA 1YR7A 4GMDA 1MR3F 5C46F 2W58A 2RCNA 1I2DA 1YIJB 2ZVQX 3WP0A 2ZRMA 4ZI2A 4LOAA 3U3OA 2BBSA 3IO5A 2R6HA 3CRRA 3OESA 5EE1A 5L3SA 3A1VA 4LBZA 3TQFA 5AUOB 2YZ2A 4OK6A 1HQCA 1S9DA 4QRHA 4WZ6A 4BFUA 1W7AA 1ZAKA 1ZD1A 2N46A 2Q3FA 2ZRCA 4LC0A 1FP7A 2NIPA 2Q6TA 3MFYA 3MG9A 2YYZA 4BASA 4US2R 2BF4A 2VNJA 1KI3A 1IHUA 4IOKA 3SNHA 2DYKA 3LQQA 2B8TA 2ZSBA 3TVTA 2J0VA 2QDXA 1M6NA 4UNNA 3HU3A 3AH8A 5HPYB 1YKSA 2ZTSA 4MA4A 2GTPA 3GEIA 4A8JC 5FOVA 1JA1A 2VHUA 5AN9A 4I1VA 3ZYCA 3GPLA 2TMKA 5THXA 3NXSA 4PC6A 1MRSA 2JJ1D 2QAGA 1XEFA 2AD1A 4TQ9A 3QFCA 2ZI9A 5J4YA 4RD2A 4OQMA 5CB8A 2BEJA 4Y9UA 4HDOB 3PENA 3CD6B 1D2NA 1NP6A 1SXJD 1OV4A 2C04A 4F93B 3EIEA 4KODA 4LHYA 2NO0A 3GEEA 3CMAB 2CNWA 1QVFB 3C5HA 2G1KA 1UF9A 3BORA 1FX0A 3SC3A 3WNBA 2CL7X 3MD0A 2QPOA 3QI2A 2P3SA 2ZJAA 2QL6A 3UG7A 3EZ6A 1XXHE 4D4LA 3GLGE 3KQHA 3ND8A 2ZRLA 1KO5A 3GLGA 4MGKR 2GZDA 1HT1E 5P21A 4IW3B 3GP8A 1OH8A 4A0GA 4Q1BA 1KMHB 1KRHA 4JS0A 1P2SA 5FPTA 2OT3B 1QG0A 5KDDA 3X1XA 1XJQA 3IPXA 3TGPA 3PVSA 4KJZA 2G9NA 1JALA 2A78A 4GOKA 1OKKD 3CUEF 4HLUC 4BFTA 2WWYA 2V3CC 4LZZA 3MWKA 3UXMA 3CCJB 2GCNA 3OE7A 3GLFB 2ANCA 2FE4A 3U60B 2JIZA 1JJ2B 2OCYC 3VKHA 4Q1EA 4RCYA 2VP6A 2J41A 2GK7A 2ODBA 1LFDB 4Y0VA 1IY0A 5GJWC 4TWZA 1G64A 2C78A 3IGFA 2QM8A 1KI8A 1GUAA 1ZM2A 3UK6A 2ZAMA 3H86A 3HPRA 1KIMA 5BQ5A 4B3FX 4EFLA 3VTKA 1T4GA 2IUTA 2C95A 2CNDA 2O52A 1Z06A 3ND9A 4PXAA 3VX4A 3K0FB 4GP7A 2XGJA 5HR5A 1Z8FA 2ORWA 2A2ZA 2CLCX 1KY3A 1GAWA 1QUEA 1XD8A 2OUKA 4PHFA 1CJVC 1M2OB 1CRPA 1FNDA 4PC2A 2OAP1 3OFND 4NKRA 5A4JA 3ZIAD 3EZ9A 1YRAA 4EPYA 3K8YA 2BC9A 3JVVA 2AX4A 2LKDA 2G88A 2A3RA 2BJWA 3NH9A 1RJ9A 1UJ2A 1W34A 4LJ8A 1A5TA 1RYFA 4A2WA 5FA6A 1KO7A 1E9AA 1YJ5A 1DG1G 2GXAA 2WJJA 3ZS9A 3KL4A 3GJ0A 4Q4JA 4XH9B 2DY1A 2FZLA 1DVRA 4NDZA 2VNKA 2GEDA 3IIKA 1E0KA 3NG1A 3RC8A 1WRBA 1K9MD 3QKRB 3SYNA 4D82A 2ZYWX 4TTRA 4EJSB 2OBLA 4O25A 1NVVQ 3CCQB 1MO5A 1IAQA 3KUCA 1W0KA 5TY0A 4EPRA 2VTKA 2A5GA 3B1WA 1E2QA 4AKHA 2AK3A 3PEUA 1LY1A 2FDCA 4DT1A 1TF7A 3E1YE 4IHQA 3W2IA 3TJZA 4AG5A 3HDTA 1HUQA 2O8EB 1KI6A 4EFNA 4PPQA 2ZR0A 1XF9A 1VQOB 3SFZA 1Z5ZA 1DOAA 3AUXA 3FHCB 3AEZA 4PSKA 1S9HA 1C9KA 4TT3A 5CM9C 2OK8A 4E22A 1G8FA 5F9HA 3MAAC 2P0EA 4PAQA 3ZJYA 2ZQ5A 5JHHB 2OEPA 4JVNA 3BC1A 4U00A 2QP4A 2ZR9A 2J0SA 2W2TA 5F3WB 1Z2CA 2Z4RA 4Q47A 1W48A 4MDEA 5IT5A 3ETLA 5JWOA 2ZAOA 3LVQE 1UFQA 3QKTA 5A5GA 1Z0KA 4Q7KA 4IVRA 4NU0A 1KI1A 4NYIQ 1XE1A 3GFPA 4N3GA 2J45A 4I1UA 1Q20A 4U9UA 2AHOA 4I1SA 4PPGA 3RYTC 3CNOA 1NY5A 1Y3AA 3EZ7A 2G0TA 2CMKA 4Q01A 4LBWA 1B2RA 1UBFA 4WA7A 1SVKA 1Z2AA 1XD9A 4A8JA 2FSFA 2FGJA 3R20A 4Z1MA 3QIAA 5EXXA 3TAHA 3PUZA 5IDVA 4KO8A 1M34E 2Y8EA 3IHLA 4B44A 1GVNB 2Z5FA 4Q19A 1W44A 4F92B 2AKYA 4HAYA 3CLVA 3IKJA 1NMZA 5FUXA 4AI6A 1AKYA 4IFEA 2ATXA 3BJIC 5CK5A 2O5VA 2B5OA 2QSZA 2ZR7A 2YINC 3FYHA 3V4FA 1GSIA 5JSZB 3K70C 3M4YA 1Y63A 4DSNA 1I7PA 1YZGA 5E7IA 5B2ZA 3WMGA 2KWIA 1P75A 2DWPA 2EVWX 5D3MB 1KQSB 1N5LA 5BWMA 4TMWA 1W87A 3LX5A 4W5WA 2JATA 1HURA 2W6ID 1XRJA 3MHPA 2YC2C 1QVGB 2CHQA 4M4SA 1IJEA 3X2SA 4XIGS 1NVUQ 2IS4A 2WOOA 3EA5A 3ZBUA 2R8RA 2OXCA 1OB2A 1NBME 3DMDA 2K5UA 3UWOA 2IXFA 2JCSA 4DDWA 4HLUA 1CS4C 3D3QA 4JBWA 1K5GA 1W2HA 3WMEA 3EC1A 5DGXA 4NHOA 4BPBA 1C1YA 3QSYA 1GP2A 2IHYA 3LAWA 1GR1A 1NLFA 4ARZA 3QFSA 4M9XA 3OF5A 4C2UA 3QVUA 1D2EA 4TL7A 1GNQA 3QG1A 4JL8A 4YONB 4ITRC 1YE8A 2H5EA 4JLAA 1XJCA 4ACBA 2QZ4A 4JMPA 4KI0A 5CJ2A 1D9ZA 2FPLA 4C9BA 1ZU4A 2D7CA 4OK3A 1Z6GA 1Q57A 1ZM3A 2OAQ1 3Q7PA 2BHRA 2OCBA 1NLYA 4CEHB 4CEIA 2BVNA 2KJQA 3VHXA 3VR6A 1KZGB 3QKSB 3UWKA 4DSUA 3AGQA 2QP9X 2RHDA 3BGWA 4UAJA 2CVHA 3CCRB 3VR1A 4A82A 3NTUA 5G53C 1ZM4A 4KFTA 1E62A 1G9XA 2OCAA 4GOXA 3REFA 1G41A 1KAGA 3CW2A 3WHLA 5FI0B 1LS1A 2ZUDA 2QA4B 2CCJA 3CH5A 5CITA 4GNKA 2D06A 5K8TA 3CC4B 1F2TA 2AXNA 4FCTA 4CVNA 1KNQA 4LYAA 2CJWA 5GV8A 2EWWA 4PTLA 3VR4A 2Q9AA 1J2JA 1SHKA 3LNCA 3FDIA 1UMKA 1AZTA 2JGNA 2FSHA 4P31A 5EMNA 1UEJA 4P4SB 1Q81D 1B0UA 2EYQA 3KQNA 2SHKA 4DEXA 2ZS7A 3P4XA 3ZBTA 4DIEA 3A1TA 2N42A 1J8YF 1DAKA 3BH6A 1NVWQ 2GEVA 4MRRA 1XPRA 3ZH9B 2YV5A 5GV7A 1ZUNB 2OG2A 4QJ3A 3U4QB 3CRVA 5JMTA 3DL0A 1N6HA 4HE6A 1NJFA 4IDNA 1SVOA 4G0NA 5LDDC 3OEED 4MH0R 5AK0A 3ZD6A 2BBWA 1LNZA 2YWGA 4YALA 4YAFA 4HUQB 1KAOA 3CF0A 4ON9A 1BS1A 5DHAA 5HZHA 1M1YE 3R9XA 1YR8A 3DOEA 2GVZC 2VHCA 5DH9A 1ZNWA 1IM2A 1OHHA 1E4VA 1R6BX 1YRBA 2KI5A 3AF3A 3A58B 1JPJA 2QTHA 3C15C 4N0DA 2E1RA 1UADA 3MWYW 3QBVA 5DI3A 4YAOA 4LYJA 3PITA 2R62A 1TADA 4FCVA 2G83A 1E9CA 3SHFA 1BYIA 5J4KA 4O2RA 4KBGA 3IBGA 1G4AE 5KSWB 1XCGB 4OQFA 1KSFX 3GJ4A 4HEJA 4IEEA 2QEXB 1E2DA 4LBVA 1R0YA 3E20A 221PA 4JBXA 3RWMB 4DWJA 3KXIA 3I92A 5TV2A 1D9XA 3RS3A 1KI7A 3O8DA 1KSGA 1YJWB 2B92A 5FTNA 2DBYA 5AJZA 5TB5A 1AIPA 2WAXA 4TLAA 1JJ7A 1VKJA 1TQ4A 4FMCB 2ECKA 3AVTA 3K1JA 4RFVA 3TLXA 1PLKA 1W4AA 2NO7A 4Q5IA 2H7VA 4TYWA 2X77A 1KDRA 2BKEA 1ZP6A 1P6XA 2A7QA 1GIAA 1J90A 1X8JA 2FEMA 4PO1A 1LTQA 3DM5A 4PO9A 3OIVA 2EFEB 2NPIA 1VIYA 2V6IA 2IYLD 3UKDA 1N5IA 3LVBA 2ERXA 4UNRA 4P4TA 2F7SA 2BOVA 4L4UA 2OCPA 2FFHA 4DJTA 3S1AB 421PA 2ODEA 3I4LA 2ERYA 5DHFA 5AWFC 4ABYA 3CRQA 3KXKA 1O3YA 3IEUA 3VMFA 3BB1A 4MRPA 3TE6A 5FL7D 1Z0JA 1HTWA 5FOUA 4L8GA 4MGZR 3V4RA 1OPXA 4LY6A 1XCPA 3OJWA 4WZAE 4V02A 2VP9A 4B3BA 4L9SA 1E32A 3A6PC 4FN5A 5J5CA 4RZXA 2WTUA 3M1IA 3HPQA 4UQOA 2QGNA 1VMAA 1N3BA 2YVUA 1KDOA 2VSOA 3RC3A 1OT3A 4F7DA 2WJHA 3L8YA 1KDTA 1XNJA 1X1RA 5KSZA 1GOTA 1NJID 1YZNA 2ZRDA 4G3XA 3OIYA 4E09A 2BMWA 3O8RA 5GJBA 1EFUA 5B30A 1OXSC 2VIIA 5CLLA 4HDQB 2WJIA 4M22A 2ANBA 4AK9A 1QGYA 1MOZA 3RANA 4C0LA 2RH5A 4JLVA 4IFBA 3CWQA 1J9ZA 5TR9A 1JEDA 1R10A 3BFKA 1RRFA 3K0AA 2FU5C 4HI0E 4C0HA 1C4OA 5JJIA 3T1OA 2C9CA 1EG7A 1KKLA 2WJYA 3U44A 3OW2B 4R7ZA 3N5CA 2ZJBA 5JLJA 1N6KA 5JJKA 4DUGA 3TNFA 4TMXA 5J4HA 1NKSA 2IWRA 3EX7C 4JVLA 4JKIA 4TLEA 3ASYA 2VYFA 5AJWA 3SBDA 1ZUHA 3Q8XB 2F3RA 3TSOA 5J40A 2ZI6A 2VHQA 1QGAA 4B47A 1E79D 4Q1DA 4BFYA 4XVQA 5FTMA 1XTSA 4DBLC 3QG5A 1K8AD 5FPKA 3GD7A 5K8UA 1S72B 1E9FA 2GF9A 1J70A 1ZCAA 3L0SA 3LDAA 5FPSA 1VCNA 1N6NA 4Q4AB 2C77A 3FKSD 2XSZA 3KTAB 3B6EA 4JJKA 2JLRA 1YVDA 5B57C 2D7DA 4NYJQ 2ZRAA 1DPFA 4RD1A 2C9YA 4TL6A 3MWJA 4C0JA 4HE5A 1JXOA 2GXSA 1ZCBA 4N0EA 2LKCA 1Q1ZA 3EARA 4LYHA 2HLDA 4ASUD 2YOHA 3CRZA 1DS6A 5CJPA 3KFXA 4D4JA 4R2HA 4A92A 2BM1A 1CR0A 2FPMA 3G71B 2J5XA 4QBGB 3DKPA 5CK4A 5KSPA 2QROA 1VQPB 1NLZA 4Q7LA 1ZM9A 2GCOA 2QNRA 1JR3A 4A2QA 2P6RA 3EZ2A 3OHMA 4S35A 5GADl 1QHIA 3KB2A 1NSTA 1Q86D 2RGBA 4PC7A 4GL2A 3QENA 1F2UA 1TAGA 4Z8YA 2C2HA 1VG1A 1AJEA 2IF2A 5KNCA 1GDDA 3JQPA 3PG5A 4XWAA 1AK2A 1D8TA 1P2TA 1JAIA 4OJQA 5DO9A 1FNCA 3W2FA 2JDIA 2DWQA 3GLIA 4QXAA 1E94E 3W8NA 2FF7A 1JB1A 1NIPA 1E2IA 1S0UA 2EU8A 4IOLA 4FI3C 2OFXA 4Q4HB 4DDTA 4XSHA 1DADA 5DN6A 5HE8A 4YXWD 3KX2A 3QQ5A 4M9SA 1E2PA 1NF3A 1PLLA 1E2LA 4LJYA 5BYJA 2IYUA 4LYFA 3BFXA 1FOEB 4B71A 4IDHA 5FUWA 1EFTA 2XNDA 3W3AA 5L3QA 2QI9C 2R6AA 5H70A 1TUIA 3CRMA 5EE3A 4BRWA 4BZQA 2YOGA 4Q02A 1CJTC 2WMOB 2XNSA 3CXCB 1FX0B 4WXPA 3CNNA 1S1MA 3I72A 2ZRJA 4TZ0A 4JLJA 2QTZA 2H1LA 3FMIA 3GLGB 3DHWC 2OM2A 1XXHB 3SZRA 2BMEA 4R71A 3K9LA 2VF8A 1VQKB 2IC5A 4ZCMA 1K73D 4AC9A 1E2NA 1PUJA 4PPFA 1Q22A 1G3RA 1CIPA 5IK2A 1JJVA 1TLLA 3QY0A 1NN5A 2V54A 4LJ6A 5LD2B 3R9WA 3EWAA 3GMTA 1P62B 2ZEJA 4PGOA 1D5CA 2V7QA 1GKUB 2E9SA 2XX3A 3H4MA 3BBPA 3W5UA 4TTPA 5DSZA 4FWIB 4F4CA 1Z3IX 4LRWA 2ONJA 4QM6A 2GXQA 1KHTA 5EZ5A 3LLUA 3TK1A 1XP8A 5KPJA 4IOMA 4Q00A 2HJGA 3UPUA 4BRUA 5KPDA 5L3RA 4W9MC 1OH5A 4HB3A 3T1QA 2FFAA 2JLVA 1LB1B 4QG7A 4GRAA 2O0JA 1NBMD 2QTVB 2PIAA 2IYSA 1GFIA 3ASZA 3VAAA 2FMXA 3M0EA 1XEXA 4TMVA 4FW9A 3RS2A 3UMSA 3WHKA 4TYPA 2XTZA 1GL9B 4BLQA 3WYGA 3U3JA 1AGPA 3I62A 2WICA 1Z0AA 4X8MA 5GJCA 4IJMA 1DARA 2QG6A 1E2HA 3W5VA 1HT2E 1KSJA 1XFAA 2GRJA 2W2VA 4L5BA 4ESHA 1A1VA 4CEJB 5KHOC 1E9BA 1X3SA 2IXEA 4LUCA 1XD2A 1J7KA 3IUYA 2HMAA 1XX6A 1VQNB 3ZVMA 3QPVA 2ZVPX 3WNDA 1U2RA 4ZIRB 5KO2A 4HUTA 2XNCA 1H8HA 2REBA 5EE9A 3B5JA 2XITA 621PA 3IDQA 4MGIR 4RFSA 4M21A 2GA8A 4DQKA 1BOFA 1P2UA 1VIAA 4MRNA 3VU9A 1ONBA 1OXUA 4OI2A 1W36B 4E07A 4GPTA 2GPJA 3JQRA 121PA 1G7CA 4BFSA 4UXJA 5AJYA 2UKDA 4OK5A 1U0LA 2QN6A 1KI6B 3L0OA 2ZM5A 1KO1A 2RC6A 1J99A 3AKCA 2ZRIA 3DZDA 1CXZA 2O0KA 4R2IA 3U61B 3BRWD 4I4LA 3W6OA 2A9KA 1ELOA 4I81A 1KKMA 2BBTA 4BWYA 1DAGA 2WJVA 4BLOA 3T1TA 1CF4A 3U6KA 1EFCA 3ICEA 1RC8A 1XEWY 4C43A 2D62A 4JLDA 2REXB 2H92A 4B48A 2WPDA 5KTYA 4ZV4A 2C5LA 5JWHA 2GJ8A 1R0XA 3Q7QA 1NY6A 1BH2A 2GBLC 1EFRA 2R65A 5SZIA 3CC2B 2VEDA 4M1OA 1MV5A 1DAMA 3PCRB 4DLTA 2GXUA 5IHPA 1QBKC 1FL9A 1T3LA 3HYTA 4GOJA 4DDUA 4PC1A 4AURA 2X2FA 2Q9CA 4DZZA 3PEVA 3LQRA 5BYKA 1W0JA 3BH0A 4LJ9A 1I4DD 2IWHA 2QY9A 5JCZA 2VYQA 1QHNA 4A8JB 2F6RA 3EW9A 3K9NA 4B3DA 1GTVA 3WRYC 4QHYA 4QGHA 5AUQA 1TMKA 2F3TA 1E2EA 1QHHA 4HDCA 4A36A 4BEJA 4NCHA 3BD9A 2XOKA 3SHWA 4Q03A 5BW8A 3FKQA 1W4BA 2ATVA 2J7PA 4FXPA 4OYHA 2ZSDA 3MCAA 4DHEA 4JL5A 3LVRE 3BB3A 1G5TA 1NMXA 2F9MA 3FE2A 3G5UA 3CF2A 3SE0A 1O87A 3CCLB 1OF1A 2HXSA 3JVUA 1E1RD 2CK3A 1Q21A 2FSGA 3FJOA 4M1WA 1KD1D 1UBGA 4R9UC 5FUYA 5K8IA 2W6JD 1MH1A 4GI7A 2FH5B 2J0UA 3W2GA 4ZDJA 3QF4A 1Z0DA 2H16A 4DLRA 2GJAA 2QE7D 4KITB 2IBMA 2C03A 2NO1A 1G1MA 1QDEA 3FOZA 3ZVNA 2ZYVX 1M1KD 2AR7A 1RRPA 4NH0A 3QFTA 4URZR 3CC7B 3GJ7A 1P73A 4BFVA 1PJRA 5DNYB 1KDPA 2GQFA 1ZMXA 2X1VA 3SJZA 1N6RA 5EP1A 3VR2A 2JLZA 1WBDA 1MABA 1A4RA 1YHQB 5CYPA 3RWOA 1EX7A 4PAMA 3FGNA 4DB2A 2JJ2D 3LY5A 1JPNA 3L0PA 3B78A 2VNIA 1U0HC 1W4RA 1OIVA 5DYIA 5AR1A 3RSOA 3OEHA 3THWA 3DM9B 4KSBA 2CHVA 1II9A 5KDLA 3G4SB 3LBHA 2IX3A 1W35A 1G16A 3NDPA 4ILEA 2MSDB 3HU2A 4L15A 4LHVA 4ZKEA 3T12A 3WYAA 4IOJA 1XEWX 2RGDA 2F9LA 4EIWA 4RD0A 1G7TA 3PV0A 1L8QA 2UZIR 3ZVRA 1ZRHA 1IONA 4LV6A 2HCJB 3LO5A 3H1TA 4M8NE 1RKBA 4TTQA 1LV7A 1WQ1R 1A8PA 1LW7A 4D4KA 3G0HA 4QHTA 3CKLA 2AN9A 2BWJA 1F2TB 1G5RA 3EAQA 2WKPA 5FH9A 1E0JA 4TQAA 2EIXA 2RGNC 2CJWB 5FFMA 4CRWB 1MO3A 3AQ4A 1G7RA 4AG6A 3HYRA 4HLDA 2Q0HA 5BN4A 1AS2A 1H8EA 2O8CA 3F5FA 2IS2A 3AP1A 1XCMA 5DIFA 3IQWA 3CRW1 2CE7A 1EWYA 3VX3A 1FTSA 2VBCA 4NONA 5EUMA 2D4HA 2Z83A 1U0JA 3R7WA 4RD6A 3P1JA 3U6BA 1N5KA 2P6UA 3PEYA 4B75A 2R6CA 3AVWA 4ZCLA 5HKKD 3KQLA 4OKSA 4BEBA 1VECA 2GEUA 5JS7A 1OH6A 1VG0B 1E9DA 2A5DA 2OO7A 5DYGA 1PVOA 4A6PA 2O8BB 1OXXK 1R0ZA 3L2OB 1JNYA 1E1QD 1QG4A 3L43A 3MGCA 3AKYA 1GILA 4PPNA 3U7EB 3A1SA 4TYNA 1Z6AA 4DLYA 3AUYA 3OIUA 2H17A 3JZMA 3B60A 1N0UA 1FNBA 2PLFA 3WY9A 4WBSA 1ZIOA 3KB1A 4K8OA 1ANKA 5H8WA 2GBLA 3BE4A 4TSFD 1QH0A 4PO8A 2AWOA 4LV8B 3QNUA 5F9FA 4C2TA 2WWGA 4HAVA 4EUNA 2RGEA 5CIWA 2HT6A 4NCNA 3TW8B 1UM8A 3KJIA 4NMMA 1NG1A 1CJUC 1R8SA 3QEOA 2RC5A 4JLOA 1YU9A 1UDXA 1SULA 5FPHA 3AVXA 1D2MA 4YMTA 2WV9A 1KI4A 4XVUA 4URXR 4B33A 2W0MA 2GZHA 2MSEB 3P32A 2JDID 4P32A 3RSLA 1WF3A 4MUAA 1L4YA 1COWD 2F1RA 3B8HA 2HYDA 1JB9A 4QGGA 4HZIA 4IEIA 2Z43A 4DLZA 1NG9A 1SXJC 2I3BA 2IW3A 4JLMA 1SVIA 4HYYA 1Q3HA 4D80A 2YNMA 1IXRC 4N3NA 1MT0A 1N0VC 4KLZA 2BBOA 3QXXA 1Z08A 3AKEA 4P3YA 2EFGA 2CCGA 1N25A 3F0TA 3PQCA 1U8AA 4KFRA 2ZI3A 4A6XA 2WSSA 1BQEA 2HCBA 1UKEA 1E2GA 2IEYA 1ZNXA 2J0QA 2WOJA 2ZANA 1XTJA 1NKTA 2QMHA 5FOWA 5TVKA 1P9WA 2PEYA 3RHFA 3B13B 4ZGQB 3A4LA 1N8RD 3A8TA 2HF9A 4XSGA 1SQ5A 2H18A 3DMNA 3EPHA 2FJUA 2F55A 3CONA 2BIFA 4G5QA 1AA9A 2R6DA 2ZI7A 3FTQA 1IQPA 1HA3A 1CU1A 3ZLJA 5HCNA 4B6FA 5E7MA 3EA0A 1FRQA 1UEIA 4L16A 4RKEA 3V76A 4KVGA 4EQ6A 4C7OA 1II0A 1KMHA 2MSCB 1CRQA 4LJAA 5DE3A 5AUPB 5L3VA 1LVGA 4QJ5A 5H59A 2PLRA 2QUZA 3D6TB 1GNRA 3C7KA 3Q72A 1FMJA 2BGJA 5KSOA 4O0MA 4BLRA 3QXSA 3THXA 3VFDA 4AKGA 3OAAD 4QC2A 3GLFA 1OJLA 2OFOA 2GWHA 2FWRA 2IYQA 1Q1EA 2RAPA 4LJ5A 4WOPA 4XD7A 4BFZA 4KBFA 1HQYE 4FD2A 4IDQA 1FP6A 3MJRA 1AKEA 2J87A 1N0WA 2ZETA 2RHMA 2XXAA 1G4UR 4JIMA 1PLJA 1WA5A 4UXHA 2DPXA 2JLQA 5E4FA 2G77B 2DCUA 5HXBA 1IN7A 5EP4A 4ESVA 3K53A 4YAUA 1XMIA 3KDSE 2RGCA 4CIDA 1Z07A 3K0FA 3BERA 2RGNA 4LHXA 2B6HA 1T3HA 2IYRA 2W0SA 2QAJA 3QOFA 3AM1A 3H0KA 4B3GA 1CR1A 3A4NA 1TL7C 3TUZC 1VYTA 2DFTA 4JLPA 2NTYC 2EFCB 3C16C 3VHLB 1QUFA 4HAUA 1XZPA 1JBKA 1Q0UA 3KFVA 1K5DA 3RRMA 3UG6A 1JXMA 4EPXA 1EX6A 2QMEA 3GFOA 3ONWA 4Q1FA 1YZTA 2VP4A 1DAIA 2QA5A 3AVOA 1OXVA 3LO8A 1TF2A 3NEYA 5KU1A 1KK2A 2QT0A 2HXYA 5JHGB 3E2IA 1E6CA 1G8PA 3GQBA 2GCOB 2ONKA 1KTVA 3CCMB 3CPEA 4Z54A 3WRXC 5JI3E 3U7HB 3QKRA 1VQLB 3LFUA 1F2UB 4DSTA 1RE0A 1WP9A 2VNHA 2QPAA 3W2HA 1T3SA 3E1SA 4YMUA 3SDZA 3OZVA 3RABA 4RZ3A 1UAAA 1XZQA 1MRNA 1KK3A 3IEVA 2XB4A 1SVSA 3KQKA 3EIQA 3NH6A 2BSAA 2QQ0A 3I8SA 1P5ZB 1T0HB 5KUTA 1U8ZA 1HE1C 4Q9KA 1JI0A 5D3QA 5FBVB 1DTSA 2IF0A 2RGAA 3QKUA 1KSHA 4PHTA 3ZZTA 3AGPA 5EE5B 4E5UA 1EFHA 2IT1A 1FRNA 4U7DA 5LB2A 3DPUA 1U81A 4KSCA 2V1XA 1CULC 3GFTA 2MMCA 3TKLA 5L3QB 1ZUIA 4G1UC 1T9HA 1E2JA 4KLNA 1IJFA 2FGKA 1TPZA 4MQBA 1P3JA 2JJ1A 1E0SA 3JQQA 4S2EA 1US8B 1AGRA 4AD8A 1SXJE 2PCLA 3AF4A 1GG2A 1G8GA 4JLBA 1SXJA 3I61A 2PH1A 4V0OA 3QE2A 2UVQA 3C14C 4H1VA 2PMKA 1ZNYA 2IUSA 1KC8D 1IN4A 2XJ9A 4D81A 4BLSA 5BN5A 1N6OA 4RD4A 1UKYA 2BMJA 3CZQA 3KZ1E 1CKEA 2ASEA 4TLBA 2MMGA 2KE5A 3UMFA 1XPOA 2CNWD 3B1XA 3MMPA 2IHBA 3M6AA 3F3YA 4US0R 5EXPA 3TBKA 5J4VA 2HF8A 5FL3A 3SFVA 3FWYA 1QFJA 1X6VA 5JSZA 5FTJA 4RY2A 1OKKA 4US1R 3CBQA 1CJKC 4R98A 4PR0A 5ANRB 3L8ZA 2NOAA 4HATA 3CM0A 2WIAA 5JZVA 1G7SA 4MKIA 3Q5DA 3X1YA 4DLUA 1U94A 4V0KA 2GJSA 1XEXB 2IYZA 3LD9A 4HB0A 3OE7D 5FBRB 3VO2A 1GL7A 4RKFA 1G8YA 4A0RA 2JIZD 4AKIA 3GCGA 1VQ9B 1KYIA 3U3KA 3DEFA 2O8DA 4L9WA 4D26A 2RGGA 3DOFA 4FCWA 5IRCD 5E3HA 2A5FA 1SVWA 1CTQA 3GJ3A 1XMVA 4LHWA 1V5WA 2AFHE 3CX6A 4JVMA 1OIXA 3OFNA 4LPSA 4U5XA 521PA 2DB3A 3BAFA 3K0CC 5FBQB 1XD2B 3ZIAA 1N5JA 2RMKA 3PUYA 1NL3A 3AF0A 4B2IA 2OZEA 1GRRA 4BLTA 1X8LA 2C9OA 3ZS8A 3T1VA 2WWWA 5H5JA 1WCV1 3AVQA 4RFSB 2OTLB 5HZKA 2OTJB 1D1NA 2ZYTX 4FMCF 1P7CA 1ETUA 3BOSA 3ZQ6A 4IXNA 2OLKA 3U2QA 4JT2A 4UJ3A 1OYWA 1SGWA 2OFWA 4PQFA 1K6MA 1MKYA 3QKSA 4QGAA 4CZ2A 4Q7JB 2ZU6A 3CIOA 1VQ4B 4RCZA 1TUEA 1FQKA 4B73A 4HB4A 2BMFA 4W7SA 3TUJC 1BX1A 3B9QA 4Q1AA 3RRYA 1I2MA 4HB2A 1JEEA 1VYVA 2PT7A 1W0KD 2B7BA 4JVSB 1G19A 1JR3E 1I4LD 2CDNA 1PZNA 1AMOA 5L3SB 2P6NA 1KJYA
chains in the Genus database with same CATH superfamily
3HCRA 5JEEA 3TF5A 1BN7A 2JH9A 3WRXA 4L0QA 3F3MA 1UOQA 1RQRA 2CDCA 2C4KA 4UHJA 4ZTZB 3I56B 1Y5MA 4Q9IA 2A5JA 4HZUA 4ZXPA 2Q6OA 2QMUA 4AUKA 1I1HA 2MHCA 3IAEA 3JQGB 3C85A 1IUNA 4DIFA 2WKRA 3SXJA 1PS9A 3GLIE 4R1MA 2X3UA 3LW7A 1CY6A 2VOEA 4WIAA 3HBMA 1VFPA 3S2FA 3HCWA 4E88A 4KVZA 3D3JA 4GFDA 2YMQA 4LXHA 1OW3B 1JLKA 3TM4A 4HAIA 5MN6A 2XWPA 3B3GA 2OGUA 3DHYA 3OTGA 3ISVA 4DIDA 4NFYA 3E22B 4R68A 1IB0A 4W5RA 3UC9A 3MA0A 4YQZA 1JTVA 4K6MA 4AZWA 5LNK6 3PHJA 3PUWA 4ZQHA 1OGJA 4R1OA 4L8VA 4J6EA 3F2IA 4LXYA 5A2GA 4CKEA 4ESOA 3HUUA 1XTKA 1YQXA 2DZDA 2HHAA 3GUUA 4FDMA 5TPZD 4YQFA 2X4GA 4OI4A 5KYYA 2CLOB 3Q7IA 3B82A 2BGRA 2O5RA 3T06B 1TPYA 5EWLA 4K9SA 4K81B 1MW9X 2QHXA 1HQDA 5JBIA 1QP7A 1P8AA 4AQDA 4U6NA 4PZPA 2B30A 1DCTA 1KO8A 3OICA 4TSRA 3DQQA 3K1ZA 4UUQA 1OC2A 1SIWA 2YR0A 1D6NA 1NP3A 2QU8A 3CGWA 3W04A 4BNTA 2XZDA 5JYDA 4MXDA 1KOFA 1ZN7A 3MJCA 3L7MA 1H2EA 4Z1MD 1CCWA 2IOFK 3KSBC 1R0RE 2UVDA 2FOLA 4GX1A 1B76A 1M73E 1W1IA 3RYHA 3OCYA 5KQPA 2X0RA 5D86A 3IV9A 3PI6A 1GG8A 5DSTA 1AHIA 4G0QA 1NI4B 1JIUA 1N9GA 4YC7A 1G5PA 3A3BA 3QVJA 5JRJA 4IHJA 2Y93A 3H13A 4EO4A 2P9HA 3SOPA 2Q4OA 3P9PA 1DXQA 4YRRA 1U4NA 1IHOA 2J3KA 3OF3A 4MVJA 4XDYA 2VXBA 5KNDA 3NWJA 1VYUA 5U9CA 1NUUA 2QLTA 1ZFNA 3R6JA 5IDWA 3NV7A 1CR4A 3SJBA 1USIA 1UDAA 2DHDA 2GQ0A 2YMPA 3MERA 3FX2A 2YHIA 4TZKA 4CV1A 5KNCA 1TK9A 2WU1A 5GZ1A 4H08A 5K0FA 1NV9A 4IDCA 4ZTBA 1A95A 1CZRA 1MGPA 3LY8A 3SBEA 1KMMA 4HVAA 2VUHB 3FZGA 1TW2A 4HXFB 4Q18A 3G1UA 2X19A 1K0FA 3JQCA 3C6QA 4RHTA 4CYMA 2Y2VA 3Q9SA 3ZWBA 3F7NA 1V8FA 3QP9A 4OB8A 4D0LB 2IYVA 2V6BA 3PIIA 2FWBA 3GL9A 1SQGA 4FGSA 4WI1A 1V43A 4BMOB 1V11A 2EX4A 2I4IA 3OOYA 1YR9A 5KTNA 5HVNA 1AQYA 1K89A 3UK2A 1G9SA 4ERXA 3U1BA 4I6JA 4I1IA 3SZ3A 5ED4A 3AJEA 4KXFB 2Q3MA 2O7QA 4GMFA 4YBZA 1WM1A 2HLPA 3F6SA 4UNPA 2F8MA 1K7XB 4FMDB 4DA4A 2E4ZA 1UKZA 4LJ7A 1W8IA 3P27A 4MYTA 2C8JA 5EA2A 1IAVA 2GFIA 1J1ZA 2R00A 4MI6A 4BLUA 3U7IA 3KB8A 4BZPA 1Z5VA 4LZWA 4GX5A 1R7RA 5IAEA 5IVIA 2FK7A 1JA0A 1MC1A 2BKUA 5BMVF 2OECA 1NONA 5FKJA 5SZJA 1E4YA 4G2NA 4AN1A 1X87A 2HIAA 3GVHA 3ODPA 1PV4A 2AFIA 5CFMA 3N28A 4ID9A 1CHDA 3VR6D 1NLMA 2GD1O 2XI4A 2C5FA 3BQ9A 3IB6A 3TDKA 4DQDA 4UUBA 2O8CB 4XN3A 2FW6A 4DRZA 1LV8A 3MWGA 2R7KA 4DCVA 1K7FB 4TLCA 5AOAA 3WG9A 3VNUA 3MTBA 3Q1LA 4IIXA 3EFOB 1G63A 1GEEA 2BGMA 1E0DA 4KW7A 5AI0A 4BO8A 4P12A 1IOWA 2DP4E 4HGZA 1Q0SA 3R3ZA 2DQKA 4F5ZA 3BMOB 5JYBA 3TZKA 4AZ0A 1NSYA 2F62A 2HNBA 3P9IA 3PS9A 3RLFA 4DFDA 5A62A 5B64A 3DR3A 1OFTA 1RHRA 4W5HA 4AF7A 3FPHA 1GYQA 4QFMA 3LV8A 4FR2A 4YWJA 2ZI4A 3PTZA 4KQ9A 4YA6A 4Z51A 1JTFA 4M36A 1FFAA 4LDRA 5DBHX 3LT1A 1KY5A 4D2IA 3GJSA 1J0XO 4MYSA 1XLTC 1I32A 3QFHA 2BGWA 4Q4AA 5DFAA 5GY7A 4OQPA 2HY7A 1F8UA 1DO8A 1O08A 3FGOA 3PKIA 1YL5A 3INRA 1B42A 3IIMA 3OFKA 5ALDA 3RU7A 1ATZA 4MR9B 4P1VA 1Z4JA 4FZ5A 4X64B 1XLVA 3WGUA 2OBNA 4P6YA 2C99A 3KVYA 3GEBA 2I54A 4QKQA 1I1QB 1QH1B 1IBCA 3NAQA 4PSDA 1U7HA 2OA0A 3K9HA 1SD1A 4AYXA 4DLVA 1SK9A 4Y0AA 4KNYA 4P4NA 2BFNA 1PYOA 4REQA 2C9DA 1N8NA 2YXPX 4U39A 3N39C 4EMSA 2N9UA 2A35A 1H42A 2FV8A 3EXAA 1ISIA 1AUQA 1T36B 2IYWA 5DSXA 3W1WA 2FFQA 1HEIA 1EJBA 1USKA 4GZLA 2NZUG 2X2PA 3RUCA 2JJ8A 2Q3HA 3NIGB 2IDJA 3OHSX 5ES3A 3DB1A 4CKCA 4IFTA 3D7MA 1HFEL 5LMZA 1KK0A 1WUHS 5IBCA 3DVLA 4OAOA 2PH3A 3NC1C 4RVOA 2QD5A 2NSDA 5EXSA 1QC5B 1YJ9B 5FT9A 5G40A 4MUYA 1V3UA 4NBLA 3TLMA 3PUVA 2YS7A 3ONYA 3BDAA 2LBPA 4V0NA 5KYKA 4RC9A 1LLUA 1FVHA 1V5IA 1G3MA 2Q4RA 3PVCA 3L6BA 4YUVA 3U3RA 3UV6A 1LXCA 4CKWA 3D2AA 5DNEA 1U7OA 3GY0A 3NHBA 2JEOA 2PJDA 4FYKA 4I50B 1ZITA 2XGOA 3PLRA 5H68A 2XZTA 5I9IA 3FGPA 2IYTA 2ZB8A 5BMVA 5JECA 3HCNA 2ZZMA 4KXNA 3OIFA 2VK4A 4JWKA 5KKAA 4J0IA 3U0BA 3SSMA 2E21A 1VJ0A 1RYZA 5ULLA 3ZGXA 3T56B 3ZXXA 1K4MA 1NJ2A 4EKYA 3ZZ0A 3FIUA 2CZQA 5BV8A 6GPBA 3GRFA 2IH5A 4E5PA 2NVUB 5HRUA 4Q1CA 5J2TB 5EN4A 1FNMA 3UAWA 4AW9A 2GESA 1Z0ZA 3BIJA 3K70D 2R11A 3EHDA 3LS2A 2AG6A 1CRLA 2IFTA 4RWZA 3FYTA 3PGVA 1OFIA 2PBLA 2VP5A 1NQXA 1ST2A 1MX1A 2NQ8A 1JEQA 3R6WA 4FFLA 1BZYA 3Q40A 1ZKDA 4H2DA 3U4CA 3CLHA 1Q1BA 4G63A 1F20A 4XORA 3WMXA 2LRHA 4ZVOA 2DR0A 4XM2A 3RS8A 4AG3A 3IC5A 3ZHVA 4R8VA 4M2LA 3FF4A 5EZQA 2D74A 2J3QA 5CJJA 5E95A 4EDFA 5HUJA 2J3LA 5EE0A 1Z29A 3PEWA 5ERGB 1E1CA 3IVCA 3J81A 4DR6B 1FFYA 1VHOA 3LCVB 5AD1A 3HN2A 3KELA 4LV5B 4GOLD 5C5DA 5C8VA 5K45A 2DUUA 1T0PA 1YI0A 2BUBA 2C83A 1QFZA 2VKTA 4EL5A 2ORIA 4OI1A 4MGHA 2G5CA 1I4WA 1YR3A 4LE2A 4Q24A 4XJVA 3ZDEA 1ZOIA 4YMWA 3ZG6A 1E7WA 1DL5A 4X0EA 2CLKB 2FEPA 3UOWA 3ZKWB 2RGRA 1F4VA 1P0FA 3THXB 4HLCA 2X76A 4PFKA 2OG1A 1S8AA 1CB7A 1ORIA 5AW7A 3HUTA 2GJ9A 3HB7A 3CLUC 2IIBA 4BBZA 1Y1KE 2XXAB 4PIMA 3GK3A 3A7EA 1XQ1A 3BXZA 3OOSA 3UYKA 3D3NA 3LIIA 1EHCA 4MV0A 4DW8A 3B1YA 2V65A 2MYUA 5EIFA 2LXNA 4NI5A 4LXQA 4AYTA 1NN3A 5BSYA 3W5SA 3AP3A 3PHLA 4JOSA 3O84A 1FXWA 3KJEA 2I2DA 2XMSA 1WMEA 2VUIB 1R5OA 3HWRA 2EL9A 5B3JC 2XJ4A 1XFOA 2R97A 1CF9A 1KJQA 1VLJA 3H2SA 4C20A 2XVZA 2XMDA 3OMWA 4U9IS 1VBNA 1HDXA 1Z0SA 4HDSA 4ALIA 5REQA 2V0GA 4MUHA 4D44A 1DMRA 2CNOA 4CDNA 2HUPA 4ZEMA 2WUWE 5KWJA 2C5EA 4ZCQA 3ZV5A 1QQ5A 3D4OA 3GAMA 3R7DA 2BONA 3ASSA 4LDZA 3K30A 4GQIA 4RDLA 4NESA 1T6XA 4E12A 1L5WA 1ULZA 4K3VA 4CEJA 5FPYA 1HFKA 4ZYWA 2ZE6A 2C2KA 4M1SA 5JCXA 4OHZA 3A1UA 4GKBA 4PAOA 1GLNA 5FI1B 1NJ1A 3VNBA 2OOSA 3MMXA 1T1JA 4RTJA 2VQFB 4ZIRA 4CCAA 3CNLA 1JJIA 2WLSA 3EZFA 1VQ5B 1YFKA 4B17A 2V6JA 5LB4A 5A5EA 4MQLA 5CCDA 1ZJ4A 3ILVA 3KD2A 5LP1A 1PJ5A 3VA7A 3ZTWA 4GDFA 1H65A 4GM1A 2XEXA 4ZVLA 1OZAA 2V45A 3VYUB 2PSEA 3HP4A 4IXMA 3V1LA 3KJHA 2UUAB 1G3UA 2IQ5A 1Q2UA 3IR6A 1I36A 5CXUA 4C6TB 2C29D 4A8HA 1FFWA 1HE8B 2ZPTX 2HTFA 2AFVA 1KMIY 3EN0A 4V0MA 3OHPA 4QOFA 1ZJJA 1XDZA 3OE1A 1RZUA 3G5TA 3ZKAA 1W46A 1CUFA 2QRVB 4H6XA 4HLQB 1RFLA 2IHKA 4NYMR 4NABA 4TROA 3IRUA 5UKDA 3KUKA 3ZXSA 3DV9A 3OE4A 4BFWA 1FFXB 3CVYA 3N8GA 5EJ6A 4BGDA 1EDDA 1EXWA 3S2UA 5J4LA 3WB9A 2BH2A 1TUGA 4EH1A 3LDUA 3BILA 4C0AC 3GFSA 3D54D 1ZR2A 4OQZA 2NG1A 4CM9D 4KEAA 2WTNA 4PBRA 4A0FA 4E13A 4A0HA 1LRJA 3BE5A 4ER7A 3WYFA 4YXWA 1CQXA 2WNHA 2XYGA 3DULA 3S2EA 4EHAA 4V1CA 3Q3CA 1RKXA 1U2PA 4OHWA 1EX1A 3CCSB 1BKYA 5E6TA 1MJNA 4U02A 3PUXA 2XF8A 1KQFA 3BRCA 3NHLA 5AHOA 2WD9A 4AN0A 1XJWA 2BGKA 1X1SA 1XV5A 2Y68A 3HRKA 1TRHA 2HZ7A 3C6KA 5DN6D 1ZBDA 4J1TA 4QOGA 3SEJA 3H1AA 4INAA 4KO2S 3BMCA 4K9MA 4KR9A 1WMFA 2R79A 4AO8A 1EP1B 3ONUA 4DMMA 1GYPA 1XZCA 3M7IA 1L1FA 4RORA 1EZZA 3ZNPA 2Q3BA 1Z0FA 1NXPA 3ETCA 2X7XA 1OBFO 2B6NA 1C4WA 1UAGA 2Y99A 4AF6A 2FQ1A 4Z7QB 2Y4OA 3CP2A 1D2HA 2BEVB 2GF0A 3KZOA 4FR5A 4QE3A 4WVFA 2GCGA 4LPKA 1LRKA 5EWMA 5K0GA 2GHIA 4BMVA 4MMXB 2X9LA 2Q7XA 5I9LA 4OUDB 4AKTA 3FLAA 1JHUA 3U3MA 3DKRA 4BGEA 2DERA 5HNKA 1QU3A 1G8SA 2J9YB 3Q6MA 5CP8A 3E2MA 1M2KA 1Q84A 4MYRA 5T67A 3LLMA 1SXPA 2L42A 2A3NA 3HUFA 3AERB 4A8PA 2HT1A 2A1TS 1PJ6A 5FFNA 1Y5LA 1C8BA 1HDYA 2X2EA 3SLNA 2H5LA 3LCRA 5DXAA 3SF0A 4HSGA 5DCUA 3WDLA 1QVAA 3A9UA 2V7QD 1S02A 2Q41A 4UM9D 5G4KB 4IJ5A 1P7YA 4C0XA 4B7CA 1SM4A 1SUDA 5EJAA 3LSTA 1N8TA 2O57A 3QEMA 4KR2A 1S1CA 2QTAA 4ABTA 4Z4IA 4P36A 3WAKA 2NZJA 2VZ8A 4QNRA 2LPMA 5KOJA 1FSZA 3DV0B 3I3SR 4Q3AA 2FEOA 2R6R1 2PHZA 4GXNA 3CHYA 4BO0A 1JXQA 2IGBA 2OWEA 2YJTD 3D43A 1UBEA 4LOIA 1ZC4A 4NCXA 4NYJR 1FBNA 4NPAA 4Y1GA 3WGOA 1EE9A 2Z2KA 5A4DA 3T7DA 1BVUA 4G97A 1LX7A 1SC3A 3WJ2A 2BZGA 2EW8A 3EXHC 3NCHA 5CGQB 4A0QA 2DIEA 1KOJA 3VO1A 3GIDA 2HCTA 1N0HA 1U5AA 1Z38A 2BR3A 3UB2A 1KJJA 4ZICA 1VSVA 1NQVA 2KHZA 3ZLTA 4IIJB 2JI4A 1IBLB 1K9SA 1JQ3A 4PX5A 2ZSJA 2DH5A 4D3ZA 3A9VA 3C3MA 5F98A 2G9RA 4PHHA 1N7GA 4G5HA 4JYMA 3TIVA 1RJDA 2PJZA 2HSZA 4JCCA 1HKUA 2PO5A 5JFTA 4RHUA 1BX0A 1TA0A 3D3WA 1WHSB 1Y7TA 2GBFA 4II7A 4FIDA 2XNKA 3GRUA 4FGZA 3TLZA 3T99A 3I34X 5KTSA 1H8HD 3NIWA 4CR8A 4II2A 1Y5IA 1JVBA 3LBIA 2B25A 1Z35A 3PFNA 4FKZA 4KV9A 3AR3A 2CMGA 4E31A 3QA9A 4HV4A 2CJPA 4MVJP 3A10A 5ALEA 2WHPB 4B3XA 2WUFA 3M33A 2HTEA 5JJBA 2PUGA 1JG7A 2EQ5A 5JBNA 2UZ1A 2ZRFA 3PNSA 5TT1A 4G26A 2H9AA 3QH4A 4Y9RA 1R88A 4Y30A 4TL9A 1Z6YA 4HZUB 5A0FA 1I8DA 4Q39A 4EEXA 5GJVC 1OWOA 4A91A 2EKDA 4WLVA 3WHPA 4ALJA 2QTWB 3A36A 1Y6RA 2QSJA 3HY3A 4CLXA 4POAA 1N1EA 3KUDA 3SJAA 2ZCUA 3QPBA 3JX9A 1G60A 1XQXA 3DTVA 2GETA 3N2ZB 5AYVA 1YT5A 1SKYB 2G09A 1CUHA 5K8LA 2UXDB 1GRNA 4TM8A 2DHCA 3ZUPA 2OMKA 1DIGA 1TVKA 3NHPA 4YRCA 4O3FA 5KSYA 2ZUWA 3R0ZA 3LWZA 4DJ5X 1TUBA 3OZXA 5EIOA 2HC9A 1GN9A 3CX4A 1ZM7A 1GITA 5FOSA 3C7DB 4ALLA 2Z6QA 1SXHA 1TM4E 4KYIB 1TRKA 3AHEA 3FVWA 2BN4A 3E0XA 2YC4C 5ELMA 4R5MA 5ED0A 3EMDA 1C0KA 3UUGA 2R0QC 3R5XA 5ILGA 2VHJA 5EWLB 3RRBA 3TCKA 4YCLA 2GCIA 1NNEA 4QA9A 4YJFA 3AB3A 3L93A 3TLKA 1Y1TA 4QDKA 3TFQA 2XT9A 5JS6A 1KETA 1W0JD 3O8LA 3OTQA 1YCGA 3ZLUA 4TKUA 3PD0A 5B58C 2EYUA 2Q3DA 5K0SA 2PUWA 3H9QA 2GN8A 4G0XA 4Q4LA 4ERNA 1A4XA 1RKQA 5CTAA 2PKCA 1QE5A 5JI2E 2R8BA 1NDUA 2Y1FA 4A7PA 3U7QB 4UASA 4IDPA 4TQGA 1GKYA 5B5SA 3IT1A 1PR2A 2HMYB 1IY2A 4CGZA 2JAPA 2AG8A 4X8OA 4A2PA 4I14A 1WX1A 2CLLB 1QGUA 2QR3A 2ZIGA 3KTOA 3NBAA 4FEGA 2OV4A 5B1EA 1XFDA 2J3EA 2BPOA 3AVPA 3J81k 4ZAZA 5ILOA 4KR0A 4A16A 3HVIA 4URWR 3EGEA 3FAKA 4KQWA 2ZJ1A 1MC4A 1A7JA 2AWNA 1XMSA 2NM0A 4IFIA 4MIOA 5BPFA 4A15A 1E66A 2VLBA 1W0CA 1FU7A 4ZC8A 2F2TA 4ZI3A 1ACJA 2XECA 2DWOA 1U0BB 3NETA 1IZ9A 1GWNA 1PU2A 3CZ5A 1KY2A 2FG6C 2YICA 1PZEA 5HYVA 3SYKA 2GX6A 4GH5A 4D46A 1YR2A 2W2LD 4L4RA 1JVNA 2ODQA 2GH1A 4P8RA 1BTOA 4RPHA 4Q12A 1YBMA 2QORA 4QFBA 4PANA 2V31A 3PRHA 4RY0A 2WSBA 1V11B 3KLMX 2JJ2A 4R83A 1XJ0A 3B70A 1BIFA 3MNFA 1Y0RA 2EGGA 1USWA 1JYFA 3EEYA 1QQTA 3ELUA 1TCBA 4B3TB 3VR2D 1ENZA 4DK1A 1BMFD 4TVBA 1IY1A 1IVYA 1N6IA 3AYZB 2FZ5A 4N8DA 1CQPA 3KLOA 3ZDQA 4CIAA 3H83A 4Y7CA 3TQOA 3D4NA 4ENUA 2NPFA 1KARA 3A04A 4UBNA 1IZ0A 1OASA 3CF6R 5SYMA 4C4SA 4B2LA 5AKIA 3T34A 4RADA 1JKIA 3OEHD 1XN4A 4HVTA 2FP3A 5JROA 2VSFA 2WDPA 3UMRA 2AOTB 2ZUTA 1PKVA 4J91A 3KK0A 3WKDA 5KYUB 2XMZA 3AL3A 4AICA 4LZPA 2B4RO 4D98A 1Z16A 2AFIB 2ZROA 3GLTA 3J7AC 3NOXA 2VC2B 1XCLA 4ZZ0A 2X0NA 3LZDA 1X1BA 4Q48A 5BNIA 3VU9B 3B3AA 5IVPA 1M0SA 1XB2A 1PE0A 1L2TA 1WE2A 3RT7A 3O4HA 4LCBA 3QEBZ 2Q7DA 2YBDA 4HLNA 1MMFB 1MOSA 3L01A 1OVGA 2VDUE 2DHEA 3F5DA 4IGIA 1VG8A 1P31A 1WLYA 1ZJWA 3G9XA 4FYYA 4O4HA 4RKYA 4CI0B 5G0SA 1GPNA 1E4EB 1FTNA 1P91A 2F1HA 3CA8A 1QRAA 2F9FA 3SIPA 4D99A 3BE8A 4G84A 2Z0MA 3IJRA 3IO3A 2PR7A 2FG5A 1Q3TA 1NN0A 2VYCA 3DZKA 4QXRA 5DP2A 4I5EA 2VWPA 1P2GA 2QIOA 3R4CA 3PJRA 4A73A 1PSDA 5MFPA 3OJXA 1F0YA 2B20A 3HCFA 3CGGA 3DLCA 4HF7A 3RSZA 4PNEA 1VQ1A 1XQYA 3BB4A 5HDBB 1IOZA 3FVRA 1MFZA 1E9RA 3QBTA 2NUBA 3D8RA 1BEEA 2HK8A 4S04A 1VC2A 4QYWA 3MTEA 4ADSG 4W6ZA 2EJWA 4BEWA 3CRNA 3VYTB 1I10A 2QVLA 2VF2A 4QYMA 3I55B 4P7GA 3BQNB 4N76A 1CDDA 2P67A 4YMIA 2J9ZB 4EG0A 3NRJA 4EW2A 1EXVA 4IVPA 4QJ4A 3EPJA 3IAFA 1ISHA 1SKYE 4L0DA 1TZ2A 1BFUA 4WK0B 1E3EA 3CX7A 3A9SA 3AL0C 5LA6A 1NBEA 4BBAA 1T4CB 3AVVA 4GSKA 3ZU3A 2NQ2C 1BHQ1 3LCCA 3NYRA 3E7DA 3GRCA 2OORA 1A77A 1SCJA 2ODTX 2PWPA 1J8QA 1ZU5A 2NAFA 4YR7A 3COYA 4FYHA 4CMIA 1I0ZA 2P8JA 3EPKA 3M6MD 4X92A 4X7EA 3FLMA 4NZPA 3K0SA 1RLTA 3MBKA 1DEOA 4F9TA 4QUZA 3A6HA 4G89A 2QUHA 1E8DA 1Z4KA 2FEAA 2Q5IA 1FTGA 1G2QA 4BP9A 4G5YA 5IU6A 1X8XA 3PZBA 1BVHA 2ZWPA 5K6AA 4X1YA 2YOFA 4OQYA 5CA0F 3K9GA 5ITSA 2CVFA 3HLTA 1E9VA 2I1VB 3KKNA 1UP7A 3R0VA 3WE7A 4FFDA 2B0CA 2Y76A 4V2UA 2BZSA 2WWFA 3N2IA 1YGPA 3GEHA 1VJ1A 3M4NA 5J9FA 2BD0A 3BEOA 4CM4A 4QUDA 4HNTA 3IUSA 2ZVDA 5FLYA 4CT0A 3QF4B 1F2DA 1UH5A 2VHWA 2CVZA 4BUZA 4CF7A 1CIJA 4I5FA 1J21A 2WI8A 2ZJ5A 3RBZA 1Z83A 3AV0B 3NHSA 3O9ZA 3S2IA 1Q7BA 4ZKDA 3DVSX 1SHTX 4X65B 4MVJE 4WCFC 4KN9S 3BH7A 3IMKA 2GNPA 2E6UX 4DMFA 1JEQB 3R7LA 1KZHA 4CMCA 4PX9A 3STHA 1WMSA 4AWXA 5GVSA 2DR2A 1I2ZA 2L17A 2QPTA 2QZZA 3A6FA 1FFHA 1ORWA 1JQEA 4LDJA 4YMSA 5J63A 1P2VA 3C3JA 4WZBB 2WSYB 3F8TA 1VCMA 1X80A 3MBIA 1U9YA 3ZBQA 3A3PA 4KR3A 3NWBA 3ZQJA 4TZ6A 5IAKA 3LA6A 1E1CB 2HPHA 1M2JA 5HJ2A 2BV3A 1UPCA 2CXQA 4AJ1A 5LOVB 4OHBA 1UKCA 1L7VC 4LGYA 1MQAA 4U7TB 1FYDA 1DPGA 2XGGA 2J4CA 3GGDA 1UFVA 3B48A 2IELA 3HDGA 3F98A 4M98A 2IP1A 2QD4A 3MN1A 3MS2A 4HCJA 1RYMA 4CDMA 5AFSA 3FTPA 3AKDA 4CTJA 2QTTA 4KAXA 3USCS 4XVHA 2RE8A 2AN1A 2AXPA 2GMWA 5T4EA 3BULA 4EUEA 1X8KA 2Q5HA 2QV7A 1QTQA 3BIOA 5DISB 4PN3A 1TVCA 1EM8A 2WKQA 3GD5A 4V38A 1TTTA 1ARZA 3OAAA 2XIJA 1ISFA 2VXCA 1QNFA 3AP2A 4DNTB 1YFLA 4XPZA 5HSGA 1IXZA 1JRLA 2VH1A 4FKMA 1CEEA 2N1BA 3RE1A 1XZJA 4UDNA 3I5YA 4DPLA 4KH1A 1ZEMA 4BPRA 2YXNA 1WXQA 1B74A 1C1XA 4I9HA 4MITA 1EQAA 3OKAA 1DBIA 4IV8A 3ASVA 3AJAA 1PQYA 3AXSA 2NSHA 5BN4B 4QL3A 4HL6A 5ENVA 1NNLA 5K51A 5REQB 4G1VA 4Z0HO 1YZ3A 4HDAA 4K1XA 4RMGA 5HZGA 1OLXB 2Z56A 4CMGA 5JWRA 2WF9A 3EAFA 3UVEA 5HG0A 1L4KA 1DKRA 5B1SA 5KQLA 1WD5A 2C5GA 3O4GA 3R6KA 1LVUA 1U8XX 1QZXA 5CA0A 4D9EA 2WHXA 1TA4A 5CLIA 1VZ3A 1N2GA 1MA0A 3EB9A 5AW3A 1D3AA 5IAJA 2Y71A 5CBKA 4L8JA 4WXEA 5KAMA 2EZ4A 1WNFA 3GWGA 3HFGA 2FMTA 1VZ2A 3U16A 2G71A 3THOA 2GGSA 3FHTA 1HYQA 1DJPA 1KBZA 3COVA 3PE4A 4UBJA 5AW8A 2UU9B 2IZ1A 3LKDA 1WBBA 2X0KA 4F4HA 1H23A 4OQEA 4ECEA 1NYRA 5LJLA 1BGWA 1YU6A 3M70A 1ULBA 1X9GA 4U7WA 1N4DA 2ZRPA 3EWSA 1HZZA 1AG9A 1AZSC 1N7JA 3FWHA 1Y6FA 1U02A 4HHEA 3Q2OA 4QM7A 1V6AA 3DDNA 5KU7A 1NQUA 4KGDA 4FFNA 3WBBA 4F0JA 1RIIA 1ZONA 4CMHA 2JBWA 4BC1A 1GUZA 5TQVA 2W58A 1K3UB 4MV7A 5CD9A 1LNSA 5H4GA 1LK0A 1VLLA 3PLNA 4H1TA 3S2SA 3TEMA 4KRGA 2O9JA 2MSWA 3M5PA 1EFKA 1NPYA 2BBSA 3PP8A 1LSUA 5E7QA 4JI1B 5CFOA 5EE1A 5AUOB 2C9ZA 4HEHA 3TQFA 3WL6A 4CUJA 1M66A 2ZVJA 3EFBA 3FD8A 4V1CB 2A0FA 1E6UA 5F77A 1ZD1A 3HQ4O 1QANA 2XUIA 2O05A 2NIPA 2V03A 3MS7A 2Q6TA 4US2R 3JRXA 1IWOA 4CJXA 3EWIA 2HYIC 4IOKA 1NM5A 4HS9A 3PT9A 2IIPA 2ZSBA 1QSGA 4AECA 2DWUA 3DBLA 4UBIA 1PR9A 1I0LA 2REQB 2QDXA 1M6NA 2AI3A 2MJLA 4LZAA 4UNNA 3UAYA 2EKPA 2O6HA 1GARA 4A8JC 2CLIB 1T15A 3WB0A 4BU1A 5AN9A 4I1VA 5FQOA 4GICA 2TMKA 3BMCB 4Y7DA 2JAHA 3JQFC 1YI1A 3IBSA 4G67A 3HCOA 3CVWA 5THXA 4PC6A 1RYDA 2CF4A 1Z4QA 3DD5A 2V7TA 3VO8A 5C7OO 4WNIA 3FSRA 2QAGA 5E7IA 5LU9A 1XEFA 2FW0A 4QEKA 2IH2A 1O95D 2X13A 3QFCA 3DVQX 3EQ7A 2AX3A 1YKFA 3L6UA 2BEJA 2A1UA 1FA9A 5IKXA 3CD6B 1D2NA 2WM8A 3OPVA 4HP8A 4JNKA 4WE3A 5EWMB 1YQQA 1GPAA 3TFWA 4TYMA 3AUTA 1KH2A 1U0OC 3U80A 4GQNA 3GEEA 3CMAB 4JX9A 1V95A 3C5HA 4EABA 5DT9A 1NPDA 2G1KA 2I6UA 3EUFA 3NC4A 1FX0A 2WF5A 3ZU4A 1UK9A 2NP6A 2CL7X 4ZGWA 2QPOA 5FOQA 1VA4A 2P3SA 2ZJAA 3GLGE 1Y6ZA 2QL7A 4UFNA 3KQHA 4FDLA 1KO5A 2HSEA 4MGKR 1OI3A 4L50A 1IOVA 2GZDA 5IJZA 2J9XB 4DRXA 4MUEA 1BXGB 2ZSKA 4E6PA 1YS1X 1Z62A 4IW3B 3GP8A 1OH8A 3ABZA 3K5PA 5HM6A 4LY0A 1KRHA 2AN3A 1B8OA 2GEBA 4JWTA 3E0QA 3QEMB 3STUA 1PZXA 1QYIA 1PFYA 3R0JA 3EMBA 1E3IA 4BNXA 4DAEA 2PE5A 2JVIA 4GR9A 4HGOA 4DDHA 5KINB 1JZTA 2A78A 2H7YA 3OJ0A 4GOKA 4H77A 4QPNA 4DM7A 2G7MC 2V3CC 1K2VN 3UXMA 2ENUA 2Q2QA 3PLAE 2GCNA 3GLFB 1DINA 3KM0A 3O1LA 2JIZA 2V74B 1J7JA 3VKHA 4LNUA 1J25A 5LZ8A 4W82A 2JHGA 3UOGA 2AJBA 3SZLA 4RCYA 2Z6UA 2ODBA 5ALNA 5GJWC 3IBFA 1G64A 3K72B 3WLHA 3PXUA 2C78A 1A27A 4P4GA 1GUAA 1FDIA 1Y8QB 3H86A 1GRCA 3M83A 1HT3A 3PJGA 3TTUA 3IB3A 3ZDXB 5EIXA 1SUSA 5FXMA 1Z06A 4NOMA 3WTBA 1FZTA 4D3SA 1D6SA 4XQ9A 2QTVA 1NX6A 3K0FB 3NNDA 4CKXA 2Q0SA 1JHQA 1KU6A 3OT5A 2UVPB 3ELDA 1HDOA 1KY3A 2PZ8A 3IR5A 2PBZA 1CJVC 2A0WA 3T94A 1GY8A 1YZFA 3DE4X 4RF3A 2WD8A 3PC3A 5I51A 4EI9A 4P08A 2A3RA 2JCGA 1WCIA 1RJ9A 1W52X 1W34A 3O74A 4HGQA 2J5BA 3GFBA 1H1DA 1NZFA 1E9AA 2FZVA 3KL4A 3OJLA 3RIEA 1Y34E 2DY1A 1Z4OA 1LBSA 2GAFA 1ULUA 4ZT5A 3DE1X 4WA8A 3ZXYA 5A3QA 1SR8A 3QELB 4OBBA 3NG1A 1N8SA 2J09A 4FNAA 2C59A 1YB4A 3ENQA 3LTEA 4RIFA 3SP1A 1A5AB 4EJSB 4HDMA 4RLHA 4W5TA 3AEUB 5DK4A 3L02A 1H94A 2QJTA 4QDOA 2Q5CA 4YEJA 5T8KC 3WNQA 2DKFA 2QTCA 2EDAA 2F1MA 3B1WA 4AKHA 4S0XA 4KQCA 2AK3A 2MWMA 3COSA 4P3IA 3JQEA 3MS4A 3C3KA 5JE8A 3DTVB 2R7MA 3LU1A 4EYSA 5D6OA 2FPPB 5BNWA 2GEKA 3FBGA 4IHQA 1TVKB 5KTMA 4EFNA 2PYIA 2ZR0A 4PPQA 3P2EA 3VU3A 4AJLA 3B20A 3QWFA 3UMVA 1C30A 1TUBB 1NOIA 2WYVA 1P0QA 4MUIA 4J16A 3ZE8A 4TT3A 1C9KA 5CM9C 2OK8A 2XQGA 3DL7A 3B36A 2R87A 2PWZA 1GTJ1 3TRIA 5K0TA 3I6QA 1J56A 4DCPA 5LMUB 5CVVA 5B4TA 3DDOA 2QP4A 4DREA 4GKVA 5DMXA 4HUJA 3AFNA 1CYDA 4YJFB 5DBFA 3WIDA 5DCLA 3P45A 4NEGA 4DNXA 4Q47A 3Q1KA 3Q3GE 4HFMA 4TLMB 1XDGA 3OQOA 1PG2A 3ANSA 3K05A 1TCVA 4JBGA 2DPYA 3A9TA 4TKUB 4IVRA 1ZW1A 1FK8A 1KI1A 3RAFC 2YL2A 4I1PA 1TM2A 4MRMA 3RYTC 1Q20A 3CZCA 3LI2A 3K35A 1N77A 3S27A 3GVXA 5DEIA 3EZ7A 2D3LA 2I8LA 2XEDA 2OQVA 5BSUA 4X97A 4LBWA 1E3TA 4JUFA 4RK4A 1FJ2A 1Z2AA 2Z8YM 2I7XA 5DYNA 3E3OA 3R20A 1REQA 3QIAA 4IM7A 1QGUB 2BHSA 2VT7A 3MJTA 2E4AA 1YJXA 3NDJA 4TWIA