4M53A

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in complex with gdpcp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
403
structure length
403
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 104
structure length 403
sequence length 403
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m53A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m53A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m53A01
5GJVC 1EFRD 1Z06A 5JCZA 1QX4A 2RAPA 4A36A 4X8OA 1JA1A 1YHNA 3ZZUA 2A78A 3SN6A 3R20A 4HB4A 3PUXA 1ZBDA 1IOZA 4R9UC 3ZGXA 2EFEB 3RLFA 1GRQA 1RJ9B 2R8RA 1F5NA 3NC1C 4V0NA 3RANA 2ZSFA 1G20E 1FOEB 1VG0B 5CITA 2GF0A 4TYNA 4CEHA 4TZ0A 4KBGA 2RMKA 2B8WA 2LCFA 1U2RA 2UVQA 1W4RA 2RCNA 5DI3B 4Q7KA 5CDFA 3SJBA 2O0KA 4LYFA 1EESA 2OXRA 1QHXA 1XMIA 4M2LA 2QAGA 1CEEA 1XXHB 2LKDA 3TK1A 1F3OA 4KJZA 4PAQA 1VMAA 3W6NA 1FMJA 2VYFA 1E0JA 2ZAOA 4YMWA 3FMFA 2QMUA 4QHSA 5KNCA 3QVVA 1XJ0A 4JVSB 1F2TB 1UBEA 2CLSA 4QNRA 4Q47A 4MDEA 2CVFA 4E03A 3EZ6A 3OF5A 4TLBA 1P7CA 1Z0FA 3NVAA 3PITA 2CK3A 3AP3A 4HYYA 2ZR7A 3SZRA 3LVQE 3WYAA 3CKLA 4CDGA 2WMOB 3SJZA 4C0BA 4PTLA 2OAQ1 3EPHA 4JKIA 5C18A 1QFZA 3PV0A 1JALA 5JRJA 4PC3A 1P5ZB 1TADA 3P4YA 5JHGB 4BPRA 2IYSA 2FX3A 4V0OA 2R65A 2EQBA 1JB1A 2F43B 5FPYA 2PZEA 1R0ZA 5IK2A 1ZD9A 1R0WA 1IJFA 2ZEJA 4BUJA 3EPJA 1OLOA 4DB2A 3BXZA 4BGDA 4URUR 2EFGA 3JVVA 4Q18A 1P60A 4TZ6A 4B6EA 3QBTA 3GMTA 4Q7JB 3VR6A 3QEOA 4L5BA 3O8CA 4FMCF 2XJ9A 1C9KA 3CR8A 2BF4A 2VYQA 1EP1B 4AY2A 3VKGA 1PZNA 3IBYA 4Y0VA 2ODWA 2REOA 4UXIA 4E09A 5IT5A 3MHPA 1X86B 4ZDJA 4L15A 4OBEA 3KJHA 1Z63A 4WZBE 1FQJA 4QBHA 1RYHA 1HY3A 1NY5A 3BJIC 1W47A 1ZU5A 4UNQA 1Q12A 1G3QA 3RWMB 4RJLA 1G21E 4AKEA 1HA3A 1ZUHA 3O8DA 3AVQA 3R9IA 5EUQB 2XZOA 1NMYA 1LFDB 2CCGA 3DL0A 2GF9A 2HEIA 3QVUA 4G3XA 2IX3A 3TQFA 4LY6A 1MRSA 3CLVA 4Y0AA 1CLUA 1G3IA 3OEHD 1S9DA 1A8PA 1GNQA 1GSIA 1TMKA 4Q4HA 1NDHA 5KNDA 1JR6A 4NCNA 1Q44A 3A4LA 2BVNA 2VL7A 1X8LA 1GO2A 5H68A 4ESHA 3OW2B 1Q1ZA 4US1R 1NJGA 5DI9A 1U0HC 1KJWA 2H57A 4AYTA 3AKYA 2XZPA 1BIFA 4FXPA 3PXGA 3THOA 4IDQA 3WRYC 4Q9LA 5KNBA 4RFSB 1J7KA 3HR8A 3BB1A 1U0JA 2RC5A 1MV5A 2BPOA 3CD6B 4W5JA 1R8SA 1M90D 2BGJA 5EXSA 1ZC3A 2GJKA 4LSGA 1SVLA 4EUNA 4DWJA 3IIKA 1T6NA 3BH0A 2YOFA 3GJ8A 4ABYA 1XTQA 2NO0A 4QRHA 4V0LA 4DHEA 2F43A 4OQLA 3B1ZA 1NN5A 1AK2A 2R6AA 1T5LA 2IXEA 1VQ6B 5CB6A 3OZVA 2DPXA 3OE7D 2EVWX 2HT6A 3RNLA 3GPLA 3ZVMA 3A1VA 3K09C 4O0MA 4EAQA 2XX3A 4HZUB 2IUSA 3D6TB 2PX3A 1UEIA 2IT1A 3O47A 3EIHA 1R7RA 4MKIA 3TQCA 4TLAA 2CLDX 3Q3JB 2WJGA 4PO8A 1M34E 3WYGA 4B43A 3OFNA 1Z29A 1GVHA 1W44A 4DCSA 4GT1A 3GLIE 3ICEA 2Q3MA 5DYIA 4ZIRA 1I7PA 3BIFA 4L8GA 1D9XA 5CJ2A 1YRBA 1R6BX 2VPPA 3UANA 2VLIA 2GZAA 1Z3IX 5G41A 4C0QC 5EE1A 1P9RA 3KJGA 1EFUA 1G8HA 3WMEA 4BZXA 2QP3A 4D0GA 1KSGA 1HURA 5FOWA 1VYVA 5HZHA 1VCMA 3EWSA 4XTCS 2J0UA 4LPSA 2PT7A 1OKKD 3M0EA 4PC7A 1G5RA 1JXMA 4Y7CA 4LJ7A 4Z1MD 3I4LA 3S1AA 1S72B 1VG9B 3QQ5A 5LD2B 2ZS8A 4Q9KA 2JEOA 4M9XA 2HF8A 3DMDA 2AFHE 4C7OB 2ZRCA 2IYWA 2XITA 2FSHA 3TSOA 3K0CC 3IBGA 1II8B 1E79D 2ERYA 1T91A 1DO0A 1DAMA 4GOXA 2IEZA 1DOAA 4YAOA 2QY9A 4HB3A 2F9LA 4AF7A 2P6UA 3CRMA 1S4QA 3P20A 4GBMA 3Q7PA 3KUDA 4Q48A 1E1QD 1XP8A 1EFTA 1TUIA 3LO8A 1EXMA 4NL4H 2AD1A 4EFNA 4E22A 2A9KA 4PR0A 1BX0A 1YZNA 2HXSA 1KI2A 2GA8A 4WAUA 3GLFA 1IN5A 4PHGA 2D7DA 5BYJA 2H18A 1VQ5B 4JL5A 1KO8A 2FPMA 3REGA 3EA0A 1K5DA 2GRJA 5F98A 4HE6A 2O8CA 2J0UB 2YKGA 4M1YA 1XCPA 4AWXA 2OM2A 1ESMA 4Q7LA 3T5DA 4WIAA 1F60A 5JEEA 2IA5A 2I1VB 2C78A 4EPWA 1Z22A 1JJ7A 3P32A 1JAIA 3V00A 2D62A 2ZIAA 3B7GA 4IVQA 1SXJA 5EE3A 3LD9A 5EXTA 4ZIRB 2A3RA 2PIAA 2VBCA 4EFLA 4KYUA 4DUGA 1GZSA 221PA 1U9IC 3OJXA 3VMFA 4YXWD 3ZS9A 1N5LA 5GJCA 3UATA 5DLQC 4FCWA 5FR1A 2XGJA 2H92A 1ZU4A 1N5IA 1CRPA 1UBGA 3B6EA 1XD9A 4DT1A 1SXJD 3V76A 4IOJA 3GLFB 3FKSA 4NYMQ 1US8B 4RY2A 2DFNA 1E1QA 3PR1A 4EPYA 4ERNA 3GEIA 3THWA 2PCLA 2AK2A 2OT3B 5G40A 4NCHA 1DDIA 4XD7D 5EP2A 3RRYA 4TYQA 4YMVA 2KBFA 1TF2A 3Q5EA 4TYWA 1S1CA 2OBLA 2ZSBA 4W5HA 1WQ1R 2RC6A 1XEWY 2EU8A 2G83A 1XXHE 3DZDA 4K8OA 3W5UA 4YMSA 4ZDIA 2DERA 2OSBA 1GRNA 5TB5A 1ZMXA 3EAQA 1G1MA 3Q9LA 1WF3A 1HT1E 3BFKA 5KU1A 2OFWA 1DDGA 5FBWB 3TR5A 1YRAA 1SQ5A 4TQAA 4D25A 1YITB 3KX2A 4RFSA 1KAGA 2CL6X 2D3WA 3AVXA 3L8ZA 4C7OA 3OESA 3QXXA 4P4SA 3K53A 3CB4A 2A5DA 1AM4D 5HXBA 3A4MA 4GOJA 1TNDA 4N3NA 4JKYA 4OI4A 4U02A 4LV5B 3CNNA 1FP6A 3FHTA 1XFAA 2ZROA 5H5JA 1LF5A 4LV6A 1E9EA 1OT3A 4PO1A 3UMSA 2FZ4A 5CM9C 1W0KA 2WSMA 3NHAA 1SVOA 2WVJA 1GVNB 2RGEA 3BB4A 5TR9A 3M1IA 3GLHE 4XSHA 1JR3A 4IRUB 2OESA 5DN6A 4A8JC 1S1MA 3I5XA 3P4XA 2ATVA 3CCLB 3KQNA 1VQ9B 1KKLA 1YZGA 1PVOA 1VKJA 1ZRHA 2JJ8A 3VX4A 4MGZR 1I4LD 4PQYA 1C4OA 4WXPA 2CK3D 3K9NA 1DAIA 3AKEA 3EARA 3K0AA 4BASA 521PA 2QE7D 1CXZA 4IEEA 4DIDA 2QU8A 4IVPA 3LVRE 1J99A 1NMZA 3PUWA 3CPHA 3PFIA 3TVDA 3CONA 4C0HA 3OAAA 3AVYA 2ZRJA 1H8ED 4GFDA 4BRUA 1WA5A 2AWNA 1G17A 2WWFA 3A8TA 1K73D 4TT3A 2FH5B 3LA6A 3JZAA 1IN7A 4LPKA 1A7JA 1VQNB 1XF9A 1OXUA 4YHBA 1L8QA 2QE7A 3H86A 4BLRA 2Z5FA 3NHBA 1G5TA 5HR5A 1MKYA 5G3YA 4L16A 4XWKA 2ZS9A 4LC1A 1H8EA 3U3RA 5ELXA 2VIIA 621PA 4ZKEA 2JA1A 2F6RA 3K1JA 2J9RA 4KO8A 3ZD7A 4RKFA 3SYNA 2V7QD 3FFAA 4B33A 1OH5A 3FGNA 4C0JA 2QAGB 3CH4B 3KJEA 3ECCA 1WCV1 2V9PA 3QF4A 4Q01A 1CJUC 2ZR0A 4LDJA 4MYUA 4UKDA 4F7WA 3AVWA 1ZNZA 1AS2A 4R71A 4B3FX 4MITA 4IW3B 1GL6A 3Q8XB 4HSEA 1R2QA 4Q4HB 1QUEA 3G71B 4KVGA 4S2EA 2OZEA 2XNJA 5HKKA 1E0AA 3JZMA 1UJ2A 4WBSA 5BN4A 3TRFA 4UAJA 4EPXA 3ND9A 2VRWA 2YVUA 2Z6VA 2ONKA 1N3BA 2XTMA 5BN5A 3MJRA 4O25A 1LV7A 2CCKA 1GILA 3ADBA 3SFVA 3BRWD 2F3RA 1ANKA 1D1NA 5TMPA 2I3BA 1V43A 3ADKA 3ASZA 1T4GA 4IFEA 2EYQA 5J4HA 3JQQA 4H1UA 2PMDA 5BN3A 1YR8A 5E4FA 4P4SB 2ZRIA 1Q3HA 1TEXA 4A15A 4CEIB 5IDVA 2GJSA 4XVRA 3WBJA 2CJWB 5JHHB 3ND8A 3BOSA 1AKEA 1D9ZA 2F7SA 1CULC 3LXXA 2KE5A 2REBA 3EPKA 1XJCA 4AKGA 2P5SA 4AG5A 2L0XA 5KSZA 2GCOB 2J87A 3B13B 1Z6AA 2J46A 2QZ4A 1AKYA 2R6HA 5HE9A 5EE5B 1JQJC 4BFYA 3CZQA 1ZM7A 2FFAA 4DLVA 2ZSEA 1E2LA 4X8HA 4M9ZA 3THXB 4G5OA 3IIJA 1KZ7B 3JQPA 1KSFX 3FKQA 4R98A 3NKVA 2PH1A 4G01B 4HAUA 2YWFA 1JXOA 3W2FA 1ZM9A 2BMDA 1UBCA 2NZJA 1M2OB 4B47A 4ZCIA 4IDPA 1FW6A 4JJZA 1U98A 4JT4A 5J4KA 2W2XA 2W6ID 1N0WA 3P27A 4WQMA 1LNZA 3K0AB 3UXMA 2DBYA 4FMBB 2C98A 4MGIR 5GJBA 3CZPA 3VR3A 1G4UR 5G53C 4ZI3A 1E1RA 5DO9A 3B2EA 1HEIA 2G1KA 5LPNA 1P4SA 3B82A 3KQLA 2QTLA 3HP1A 1OFTA 3RVBA 1UDWA 4QGHA 1E63A 4QG7A 1MR3F 3NC0C 1F20A 3B1YA 1CKEA 4A82A 4P33A 4U9UA 2YJTD 4PANA 1Q1BA 1XWIA 1MO3A 1XXHA 3CRVA 3LNCA 2W6JA 3FHCB 3IKJA 5HCIA 3RC3A 1ZNWA 2C77A 3GJ3A 2XZLA 3U6BA 4DEYA 4OI1A 8OHMA 4A8JB 2IS1A 3FTQA 1WXQA 1TVCA 1RJ9A 2QRNA 3HU1A 5L3QB 3KQHA 4LC0A 1RKBA 2Q0HA 4HLQB 5DHAA 3AM1A 2Y8EA 1KTVA 3QFTA 1NNEA 4TL8A 1AA9A 4I81A 1RPZA 1XD2B 2JGNA 2ZJ2A 2X77A 4K1XA 3NBYC 5EP4A 2WAYA 2WAXA 3GCGA 4UJ5A 421PA 4DDWA 4URYR 2IYVA 2EYUA 1NSFA 4DQLA 1ONBA 2OCPA 4HE5A 5KSWB 3VU9A 3QIAA 4AK9A 4BFVA 3MSXA 4D6PA 5H8WA 1GR1A 1G7CA 2VO1A 4U7DA 1P2TA 4FW9A 3MLEA 1TL7C 1CTQA 3G82C 5CJPA 1M74A 2EWWA 3SEAA 4RD1A 1II0A 3RS0A 3PJRA 2JDID 4KITB 4V02A 2NO6A 2ZRFA 3H4MA 1TUEA 4KLNA 3VR4A 1KMHA 3EXAA 1QF9A 3QF7A 3CMEB 1J8MF 4Q9IA 2QAJA 1IXSB 3FMIA 3HU2A 4KSBA 3U3KA 1A2BA 4M1SA 1P9WA 2QT1A 4XOIA 4M53A 4G5QA 2GEVA 4I1UA 3S1AB 4CEJB 5UKDA 2XSZD 2ZRNA 4OI0A 3K0FA 4TL7A 5KSYA 2RGNA 1NVXQ 1XCMA 2B6HA 4DRZA 4B35A 1TQ4A 5DGXA 4TYYA 3SBEA 1SXJE 3OIVA 4EPRA 5SZIA 2FSFA 1JR3E 4KLZA 1BOFA 1DTSA 4R2IA 2BCGY 3CCUB 1TF5A 2V55B 4TL9A 5JJKA 2KI5A 2ZTSA 3WNDA 1KKMA 5FA6A 1XPOA 2QM7A 2A5JA 2R6CA 3MCAA 3NDPA 1ZM2A 2BBTA 2BIFA 4IXMA 4FINA 4DQKA 4C43A 2NQ2C 4ZKDA 1GNRA 5JI3E 4J0QA 2DFTA 4MKFA 1KO5A 2ZRGA 2WOJA 3GLFE 1ZCBA 3TKLA 1J2JA 4HZUA 1IBRA 1UKZA 3CF6R 5GVSA 2FA9A 5FH9A 3FPAA 4TTRA 2F1IA 4P4TA 1I2MA 2A7QA 2ECKA 3A1WA 5EXXA 1PJRA 2ZRMA 5KUTA 2WBLC 3TLXA 1HYQA 2QTZA 4JLVA 2QPTA 2UZIR 1GUAA 3T35A 4PHHA 3FWYA 3HR7A 2QBYB 3LX8A 2NPIA 3W34A 1II9A 4GMDA 2ZI7A 3E70C 2GNOA 3PUZA 3K09A 2WWWA 4HUTA 4F4JA 5AUPB 1W4CA 3C4JA 4M9SA 5DH9A 5F3WB 4BEJA 3MG9A 1WBDA 2VP0A 2PLRA 4LJ4A 1W4BA 3ES9A 1EFRA 2AKYA 4FWIB 1Q7YD 4LCBA 2QA5A 5EE9A 3UKDA 2IYUA 2WWYA 5BQ5A 3REFA 3I73A 1NLFA 5L3VA 1E64A 1AIPA 1ZIPA 3NEYA 2DFKB 1E96A 4YDSA 2D4HA 3MWJA 4BFWA 3QF4B 1VYTA 3RRZA 1MOZA 3R8CA 2R6DA 2JLWA 4XSGA 2QEQA 1CNFA 4ZCMA 1T3SA 3GJ4A 4LUCA 3A1TA 2ZETA 1G6OA 1BQEA 1FDRA 1Z8FA 1E2HA 3L82B 2B92A 2YWGA 5J40A 1QHNA 4DJTA 3CRRA 1NLZA 4BLTA 2BHRA 2VNIA 3OEED 2ZJ8A 4AIIA 2GXSA 4PO9A 3U2QA 5D3MA 1SHKA 1EP2B 1SKYE 4FWTA 1PLJA 3WP0A 1CBUA 1TF7A 1UKVY 4LI0A 4JLMA 1SVIA 4LBYA 1KI3A 2ZE5A 1JR3D 4PGOA 3ICQB 4B73A 1FMLA 3RS7A 1Z0AA 3IILA 3K9LA 4CYMA 3ASYA 1EWQA 3C8UA 1FFHA 4OYHA 4TYPA 2P67A 1XTIA 5J4VA 3QBVA 2FGKA 3BE4A 4LJYA 1AGPA 5JWRA 2NIPA 2O0JA 2ZPTX 4B32A 3K0EA 3N5CA 1ODFA 3HYTA 3QKRB 4MKHA 4YQFA 4HDQB 3GLHA 1R0XA 4IVRA 4QGGA 1G8YA 1YJWB 1ZNXA 1GDDA 1G9XA 3LBIA 2VSFA 3CX8A 3GFTA 3F8TA 3OIUA 3QPVA 5AK0A 2V4ZA 1UAAA 3VTKA 1OH6A 3NBFA 3QUSA 2V1XA 3KTAA 2BGIA 2DY1A 4JYCA 1ZUNB 2ORWA 4KFSA 3T1OA 3BH7A 3CW2A 1N5KA 3WMFA 3W9YA 4YXWA 2ERXA 3GJ0A 1YZTA 3LXRA 1GIAA 4DSNA 2WTUA 3ZZTA 1OXVA 1KNQA 3MMPA 5FBVB 1NBME 5DISB 3NXSA 3OEEA 4D81A 1U8AA 1Q86D 1XDBA 1MO5A 1KY2A 4D2IA 3P1JA 2V3CC 4DCVA 3J81k 2BM1A 2W58A 1GWNA 3FKSD 4UXHA 2YOHA 4Z8YA 4Q02A 4G1BA 2PZGA 1P2UA 1W2HA 2FOLA 1D8TA 2ZRBA 3DKVA 5A4JA 3G4SB 4AF6A 3UK6A 2QTHA 1IXRC 2HMAA 1G6HA 2C8VA 1Q81D 2HUPA 3DEFA 3SS8A 3THYB 1SZPA 4WVFA 5JI2E 4N3GA 4RZ2A 4G1UC 4RD3A 3BH6A 3EZ9A 4URZR 3OZUA 4B2LA 3THWB 1AJEA 5C1BA 1YHQB 4KFTA 2H16A 5J5CA 2C5LA 3ONWA 3RS4A 3K0SA 3L2OB 2O8BB 3LBNA 2BKEA 5EZ5A 3W90A 1IONA 1NLYA 4FK8A 1G7TA 2IS6A 1Z0JA 2NTYC 3W3ZB 5CIWA 1DAFA 1T3LA 3NH9A 2B7BA 1BH2A 5C4MA 2R9VA 2WSSD 2HLDD 4MYCA 3ZVNA 1W5SA 2IBMA 2PT5A 2QTFA 4TMWA 3CCQB 4FIDA 4EJSB 5A5GA 4WXRA 1XMJA 1DG1G 1ZUIA 4ZGNB 4ARZA 5E7IA 3VO1A 4II7A 4LHYA 3RHFA 5L8VA 4C0AC 2JASA 2ZYTX 2C9CA 4U00A 4KSCA 1E2IA 5B64A 1P72A 3NBXX 4OQNA 3SDZA 721PA 3GJXC 2GETA 2YHSA 4XH9B 5EQTA 2O8EA 4BZPA 1F2UB 2YZ2A 3OE7A 3PENA 2Z83A 1P2VA 5IRCD 3QFSA 3DHWC 1EG7A 3H0KA 4QGAA 3T61A 2JLVA 1KC8D 2ZI9A 2RGGA 4XTRA 1AGRA 4YMUA 2Z43A 3GLIB 1Z2CA 1JQLB 3NBZC 5JBQA 2WWXA 3LW8A 3OAAD 3CX6A 4WZAE 4D4LA 3RC8A 1XBTA 3KJIA 1P9NA 1E2JA 2IF0A 5CYOA 3CF2A 2ANCA 5KDLA 5FUWA 1COWA 2GCPA 4JLBA 1NBMD 1XRJA 1OXTA 2RGBA 4AC9A 1S2MA 1CQXA 1DADA 4IEIA 2D2FA 4BLQA 1MABA 3U6KA 1Z0KA 2BSAA 2ZJYA 3KZ1E 1MT0A 5DIFA 1FUUA 3IPYA 4M21A 3U3JA 5BXQC 1KJZA 2BBWA 1FL9A 1XD2A 3RSLA 5FTJA 4GZLA 2BM0A 2OCAA 3F0TA 2H7VA 3DPUA 3R9XA 1IHUA 2J0SA 1F6BA 1L2TA 2W00A 4M1KA 5H70A 4MA4A 3HU3A 2YOGA 1T3HA 1VQLB 3CRZA 4IJMA 2CMKA 1YZUA 1AMOA 4ZGQB 4EPVA 2V54A 3CNOA 3T1VA 1KI9A 2IYQA 4FI3C 4Q5IA 2MSEB 3IQXA 3RRNA 1SULA 1VG8A 5TARA 3V4FA 4P4UA 4A92A 5BWMA 1NVWQ 3VKHA 1U9IA 3CBQA 5F9FA 2A5YB 2WM9B 5TV2A 1GKYA 4LV8B 1DELA 3W2GA 4BPBA 3KUCA 2D06A 1I2DA 1RRGA 4LBVA 2QMOA 3LRPA 5HE8A 1DAHA 4QBIA 2CXXA 4KFRA 2HYIC 3NTUA 4DUGD 4MYTA 4HAXA 3EWAA 5K8TA 2MMCA 2AFIE 3EIEA 1IB0A 4RZUA 5FR2A 3DZ8A 3R7WA 4IOLA 1K5GA 1GM5A 3PUVA 1S3SA 4JLKA 3CNLA 3MUFA 1E2FA 4BLOA 2ZAMA 3FYHA 4LJ9A 1N6KA 1IN6A 4PHFA 4F7DA 3OIWA 4JLJA 4B2PA 3LQRA 5DYGA 4URVR 2QTVB 3I72A 3QKTA 4MKGA 4YAWA 4QXAA 3TAHA 2H8KA 4JLAA 3ZJYA 1R5OA 1M8PA 2VSXA 4ZO4A 4A1FA 5K8LA 1IY1A 4FN5A 1Z5ZA 2VP5A 3DM5A 1QUFA 2OE2A 1YIJB 2NZ8A 5E7JA 1XTRA 2BEJA 2QN6A 1Z6TA 1Q1QA 3T06B 3MGCA 3PEUA 4BLPA 1W36B 1KI4A 1KI6A 4P32A 2AD5A 1ZAKA 4CT4B 3R9WA 1MH1A 5CLQA 2B8TA 2CJWA 1FNCA 3Q72A 1DPFA 4MQBA 2YC2C 5FOSA 5AJYA 3WNBA 4HEJA 4RCYA 1E2GA 4MUAA 1BMFD 2IS4A 3UG6A 4B2IA 4AKIA 4NYIR 1LS1A 3CR7A 4B71A 1JB9A 4JLNA 4RD0A 2PMKA 3IUYA 1NKTA 1ZC4A 4HLUC 4V0ME 4Q7MB 4DSUA 1E1RD 1NIPA 3R8FA 3X1ZA 2G9NA 1FNNA 4TMZA 4OHWA 4Q1AA 3QSYA 3B1VA 1EK0A 1XMSA 3IEUA 3KKOA 3PEVA 3SJCA 4F4CA 4A2QA 1YKSA 1B0UA 3CIOA 4FMDF 5JCPA 4CIDA 1DEKA 2Q9CA 3P26A 3FE2A 5JS7A 3AUXA 5DHFA 5FI1B 2AKAB 1OYYA 1R4AA 5FOTA 4PHTA 2ONJA 4C2UA 1U8ZA 1FZQA 1YQTA 3QY0A 4MGYR 2CLCX 5FTKA 1W49A 4R7ZA 4A6PA 1VQKB 5C4GB 3CWQA 4D0NA 1J70A 3BFVA 3DOEA 1XU4A 2ZRLA 3ZH9B 1OSNA 4JL8A 3G6EB 1VIAA 4ASUA 3SOPA 4QKQA 1E2DA 1E99A 1X1SA 4LJAA 4C4PA 1BO6A 1OH7A 4RD6A 2ZYUX 2IYRA 5KSOA 2OLJA 4PPGA 2Q9AA 3I62A 2OLKA 4ITRC 4B44A 4DDVA 4DLXA 3ZBTA 1NJID 2TMKA 2FEMA 3MWKA 5JLJA 2QNRA 4D4JA 4DLRA 3KXIA 1M1YE 4TSFA 3OJWA 3T5GA 2GXQA 2ZI3A 4KHZA 4L9WA 4KYIB 4XVUA 2WHXA 1ZM3A 4PC2A 5J47A 3ZDQA 2IXGA 4NCJA 4P31A 4ON9A 2ANBA 2BMFA 5E7MA 4WOPA 2R44A 4LHWA 1NBMA 3WMGA 1FUKA 4H9GA 2J45A 1YE8A 5FTLA 3FHOA 5ANRB 4NBSA 2N46A 1KI1A 4MRVA 1Q3TA 2JDIA 3WNCA 4R2HA 4C0KA 1E79A 3NH6A 1JBKA 2XAUA 1DE0A 2P2LA 2R6FA 3KKQA 3PQCA 4PSAA 2RGDA 2X2EA 1SKQA 3HPRA 4ZDKA 3M4YA 2B21A 2HYDA 3LBHA 1E62A 5KDOA 2GEDA 1G3MA 1O3YA 1D2MA 4QJ4A 2GAOA 1E2KA 1ZP6A 3BFXA 4QC2A 5BYKA 2FJUA 4KAXA 4IDHA 4OHVA 3FJOA 1XPRA 121PA 1N25A 2PJZA 1IN8A 2VTKA 3BBPA 2HF9A 1Z2AA 3D7MA 1D2EA 1VQ7B 1A82A 2C96A 1N6IA 2CBZA 4YONB 5G3ZA 1Z0DA 4HUQB 5IHPA 3SFZA 1FX0A 3NIBA 4I1SA 1A4RA 3GJ7A 1AN0A 3AH8A 4OKSA 3WHKA 2GBLC 3IIMA 1KJYA 1E9AA 4XJXA 3T34A 4BQSA 1QFYA 2HCBA 2Z4SA 1ETUA 2OK7A 4UQOA 3FFBA 2W2TA 4FCTA 3I61A 1RRFA 1ZVQA 4EFMA 3U4QB 4RD2A 1GFIA 1OE0A 2QAGC 4BFSA 3SR0A 3D3QA 2FDCA 1E2NA 1RVDA 4X8LA 4XWAA 1K6MA 3WYFA 1CR1A 2VP2A 2JLYA 1WE2A 3TNFA 5J4YA 4LYJA 5AWFC 2VNHA 1OHHD 2QORA 5AUNB 2WV9A 4LHVA 1T0JB 1ESNA 4LBZA 2FPKA 1OIXA 2XTZA 3N70A 3QEJA 4NPHA 1SKYB 2FF7A 2WKQA 1PLKA 1US8A 4LJ5A 3CXCB 3M6AA 2OTLB 1E2PA 4BZQA 2AK3A 2AN9A 5EMNA 1F2UA 3UIEA 3TW8B 1QHHB 1JA0A 2VP9A 2ZE6A 1TX4B 3QKSA 1A1VA 5FPTA 3GEHA 4JIMA 3GLGE 4ESVA 1VQOB 1KI6B 3ZIAD 3AUYA 2O0HA 4D82A 4RZXA 1NG1A 5AN9A 4PC1A 2GVZC 4QHYA 4LHXA 5CLLA 3VNVA 2ZRAA 2ZR9A 4W9MC 1WB9A 2J7PD 1I4DD 4UXJA 5CK4A 1E32A 1BMFA 2ZRHA 3TMKA 4ARZB 2ZJZA 4IDOA 2QROA 2RKOA 4US0R 4UNPA 5LDDC 4MDFA 3VR5A 4M4SA 1ZD1A 2QA4B 5FL3A 3OEHA 3QFCA 1UMKA 1UKYA 4QJ5A 2HCJB 2ZSDA 4CZ2A 3B8HA 2GESA 2C99A 1P75A 1QHHA 2REXB 4BRWA 2O8CB 2WKRA 2O8FB 3TSZA 4B3DA 1VQPB 1HQYE 4DLYA 2VHCA 3D8BA 3C41J 4JLPA 1DAKA 3WHLA 2Q6TA 3TSWA 2ZI5A 4MRSA 1E0SA 2JAQA 1E9RA 4IFBA 1U0LA 2X2FA 3PVSA 3NG1A 4D80A 3KKPA 2A30A 3CH5A 1COWD 2C95A 1RRCA 1CR2A 2ZJBA 3RYTC 4YAUA 1Z08A 1O87A 5GJWC 1W1WA 2VP6A 3RDPA 4CGZA 3KFVA 4DDUA 3AGQA 1JPNA 2ZXUA 4RZ3A 3L0PA 1SVMA 1TAGA 4D4MA 5D3QA 5JSZB 1QGYA 3E1YE 1QVGB 3X2SA 3EZ7A 1OKKA 3C7KA 4WA7A 2OK8A 1P6XA 4Q1EA 821PA 5EJEA 1VYUA 5HTKA 4Q9HA 4QM6A 1B23P 2PEZA 2G1JA 3I3SR 3SYKA 2IUUA 1SVWA 1U81A 3CWZA 3FMOB 4TWZA 1DBSA 2FGJA 2JLRA 4JL6A 4TSFD 1KK1A 3U61B 4LYAA 3IEVA 3QPWA 4C9BA 3SJAA 5SZJA 1A2KC 2BJWA 1K9MD 1WMSA 3T15A 2HJGA 2DETA 2H1LA 1UPTA 1S3GA 1W48A 2WPDA 1YR9A 4PZLA 5JFGA 2YC4C 4Y9UA 4ZV4A 4DC9A 4KBFA 2PL3A 3SU8A 3VHXA 1EWRA 1ZM4A 2EFDB 2W2VA 1D6JA 4LWZA 4PPQA 3CCMB 4G5SA 3C5CA 2DCUA 4GRAA 3W2HA 4UNRA 3U60B 5A0FA 4BEBA 3CPWB 2X3UA 2DEUA 1Z07A 3AF2A 4E5UA 1G41A 2CL7X 3L0SA 3T1QA 3K9HA 1G3RA 4RD4A 2IEYA 5FPKA 3KKNA 1YJNB 1XEFA 1EP3B 3TIFA 5H1YA 1JNYA 2XB4A 2NMVA 1KAOA 2XB2A 5FTNA 5FBLB 1OV4A 4XIGS 2CEAA 3UMFA 4PPFA 4PQRA 2BMWA 1W2GA 2E87A 4C0LA 1NJFA 2VHTA 5DSZA 2IXFA 4PSVA 4PAMA 2BN4A 5GVRA 2NPFA 1PUIA 2A5FA 3GJ6A 4C2TA 2QDXA 2ZS7A 2C9YA 1P2SA 1WP9A 3QENA 4QHTA 2W0SA 3E1SA 3LO5A 2RGXA 3UMRA 1YJ5A 1NSTA 3LV8A 1Z0IA 1LF0A 5EP3A 1P62B 4Q1CA 1G3UA 3O8RA 1RC8A 1KDOA 2CNDA 2FMXA 4EIWA 4CEIA 2O8BA 2IWHA 4HAVA 4YC7A 3SHWA 1ZW6A 1M7GA 1W5TA 3QG5A 4XWOA 1UEJA 4EDHA 4Z54A 3CF0A 1OXSC 3SI7A 1XEXA 2OBNA 3QNUA 1IXZA 4QOSA 4UNNA 1CP2A 1XE1A 1N6NA 3K70D 1Q20A 4W5WA 1AZTA 1E9FA 4Y9RA 1LVGA 5LD2C 1N6HA 2WKPA 1OIWA 1VQ8B 1L4YA 1XZQA 2AXNA 2IK8A 1XZPA 3A6PC 1R5NA 1AS0A 4PC6A 2ORIA 1XJQA 4RSGA 1G7SA 2P65A 3RRMA 4KI0A 2IYXA 1GTVA 3SC3A 2ZRPA 4JBXA 4ZDWA 4QFMA 1QBKC 1QG2A 2QMHA 2OILA 4B74A 2G3YA 2DHRA 1J8YF 1W36D 3VFDA 3LLMA 4Q9JA 4Q4JA 1HT2E 4OHZA 1GNPA 1ZYUA 1NRJB 2J7PA 2GK6A 1Y3AA 2FG5A 1DG3A 3ADDA 5FI0B 2SHKA 3Q5DA 2JIZD 4ASUD 3U3OA 1UFQA 4XD7A 1KI7A 1UADA 1DAGA 3W6OA 3C5HA 4QM7A 1W0JD 4GNKA 2XNSA 5L3SB 1OGIA 2R6GA 5D3MB 2VA8A 5KO2A 3GFOA 2G88A 1HUQA 1YZQA 3LX5A 4Q4AB 2J59A 3QKRA 2W6JD 1QHGA 3IHWA 1G16A 1NIJA 2GXUA 4LGMA 4N0DA 3DMNA 1KQSB 1KIMA 4TQUS 3U5ZB 4OK3A 3F3YA 1KDRA 1TU4A 3WBKA 4KU4A 3R7WB 2QL6A 3TW4A 1E4YA 2VHQA 2VZLA 2Q9BA 2VH5R 3A4NA 3EW9A 1P73A 1N8RD 1Y63A 2JJ2A 1YR7A 1IY0A 2BKUA 2ZUDA 2ZU6A 5JWOA 2ZSAA 3DVLA 1A5TA 4M22A 2F1HA 5JSZA 1T8UA 1KK0A 3CUEF 4M1TA 1Q57A 1FP7A 6Q21A 1ELOA 2XJ4A 4HDOB 3QXJA 2P0EA 4LHZA 1R0YA 2J41A 4IXNA 3B78A 5C46F 4TMTA 1BYUA 1H8HD 1IY2A 3FMPB 1E94E 4D4KA 3TAUA 4OL0A 3IGFA 4KCGA 1WDTA 2AL7A 4K81B 1XEXB 1GJRA 5CYPA 3QXHA 4A4DA 3H84A 4JSYA 3D31A 4WZ6A 2BJVA 2IYLD 1KO1A 3B85A 5FPHA 2QENA 1CJVC 1HE8B 2ZANA 4V0KA 4JVLA 4KVAA 2ZRKA 1TTTA 1X8KA 5GV7A 2JLSA 2WWGA 3BAFA 2ZJ5A 4PPNA 4MYHA 1OXXK 2KBEA 1OFIA 2D7CA 4F38A 5KSPA 2CRVA 4DVGA 3QOFA 2GK7A 5JZVA 2RHDA 1BJKA 2FSIA 3MD0A 2P5TB 1KDTA 4PSKA 1RRPA 2D74A 2WJIA 1KZGB 2XSZA 3EC1A 4NONA 3B60A 2DB3A 3EX7C 1ZD8A 3I32A 4HB0A 4NCIA 1VECA 2ZUBA 4N0EA 5FOUA 2QSYA 3ZLJA 4TN1A 4M1OA 3CCVB 1YJ9B 2OTJB 3EG5A 5FUXA 2ASEA 3NDBB 5KPDA 2E9SA 4GL2A 4DDTA 5EE0A 5KOYA 4KV9A 2ZI6A 5KDDA 2BBSA 2QG6A 1W4AA 2C04A 4LK2A 2OO7A 3PG5A 1E9BA 2VHJA 1VTKA 1HE1C 2XXAB 4FD2A 2JIZA 2GXAA 2H5EA 1VIYA 3THXA 2IWRA 1SVSA 1OB2A 4NDZA 1CJTC 4JS0A 1YI2B 3AKDA 3PEWA 4EH1A 2GBLA 2OFOA 4LZZA 1FTSA 1ZIOA 4B3CA 2ODBA 3E20A 1Z47A 1T0HB 3GJ5A 4M8NE 1QVAA 2ZYWX 4YDHB 1S9HA 2YINC 3I92A 1KGDA 3QE0A 2UZ3A 3KFXA 1OGJA 1LB1B 1Z28A 3C14C 4MUBA 5FOVA 5H59A 2WIAA 4B3GA 1PLLA 1X8JA 1E2EA 1G5PA 2ODNA 2IS2A 1SGWA 1GRRA 1XX6A 5AJZA 2JJ1D 2X8AA 4HUQA 3I8SA 4YMTA 3RWOA 2G6BA 4JVNA 2ZUCA 4DSTA 1MO4A 4HDCA 4HAZA 2ZM5A 4JMPA 4DSOA 5KYKA 1IM2A 2EWVA 4X8MA 1YVDA 2EW1A 3W8RA 2I4IA 5E3HA 1MRNA 2V6IA 1KSHA 3CM0A 2K5UA 3EZ2A 1Z6YA 3SQWA 2ZYVX 2O8DB 3BERA 3AF4A 1V5WA 4DIEA 2F3TA 1PV4A 2GJ9A 2O8DA 1NY6A 1QDEA 3B1WA 3OZXA 2FFBA 1DARA 1OW3B 2HT1A 2RH5A 3PUYA 4V03A 5FTMA 2P6RA 3L0OA 2BEKA 1NL3A 4EKDA 2X1VA 2WWHA 3G0HA 2RGAA 3AGPA 3AB3A 4KXFB 2ZU0C 4GDFA 2OCYC 3KB1A 1RZ3A 4DLUA 1H65A 3OHMA 1NVVR 1GAQA 2GAAA 1G8PA 3EIQA 3WRXC 3GD7A 3K9GA 4BFTA 1OH8A 2BOVA 2VHUA 1H85A 3NEJA 4LX0A 5AUOB 2OEPA 1DVRA 1OF1A 1ZINA 1JJ2B 1F48A 1NF3A 3TR0A 2BCJQ 3L0IB 3ZYCA 2ZITA 4BFZA 4EQ6A 3TUIC 3C16C 3TVTA 1VQ4B 3WP1B 3UG7A 1KK3A 2JJ2D 5L3SA 4Z8XA 4N1AA 3VO2A 3HPQA 1KO7A 4NCKA 4A9AA 2IYYA 3SHFA 2BBOA 5JWHA 1XPUA 4POAA 2LWIA 3T12A 4Q1BA 4IOMA 4DEXA 4Q19A 3AVVA 4B76A 1S8FA 1GL9B 3U7GA 3GLIA 3B9PA 1E9DA 4O2LA 2QP4A 5L3RA 3KB2A 2V1UA 1Q82D 4PZZA 2WJHA 1G291 3FOZA 4B4DA 3IPXA 2ATXA 1CR4A 2FSGA 4FCVA 4OQMA 5AR1A 5CM8B 1YR6A 2BV3A 4TLDA 3ZS8A 4A0FA 3LFUA 5J4LA 3IO5A 5FBQB 3VAAA 4GP7A 4DCNA 1HV8A 4CW7A 5KPJA 2VF7A 4OQFA 1VHTA 3T1TA 1G19A 4EJSA 1KOFA 3FVQA 4IOKA 4JSTA 3SE0A 1QH0A 2KB0A 3U3MA 3AVOA 3CPEA 4JBYA 5B2ZA 4XVQA 3X1YA 2BC9A 3K0CA 4LOAA 2FWRA 4JT2A 4NYMR 4B48A 2IHBA 1EWYA 2QPAA 4DB4A 1DAEA 1Z6XA 2A2ZA 3WXMA 1W36C 3LWNA 2QGNA 1P61B 4F91B 2OG2A 5KHOC 2ZRDA 1YZKA 2D2EA 3EA5A 3VQTA 3FPKA 1LTQA 4AYXA 4YALA 2JLQA 2ORVA 1XTSA 1G64A 2IF2A 2VEDA 1SM4A 4CT5A 4NYJQ 1QZXA 4HB2A 2QM8A 1AZSC 3VR1A 3RAPR 1AQYA 1TEVA 5KTYA 3QG1A 3EZFA 2VF8A 1GOTA 2JLUA 4I99A 5JECA 1UM8A 2ZVQX 3KL4A 3TGPA 3GLHB 2YWHA 4CVNA 3KXLA 4AG6A 4DZZA 3ZQ6A 3CMAB 2ZJAA 1G7RA 4G1VA 3L8YA 3LAWA 2VP4A 3GQBA 4JYBA 5F9HA 2AXPA 3CX7A 3OFND 3MJHA 1U94A 3QXCA 1J90A 1HTWA 3UPUA 2FE4A 2F55A 4S35A 3W5JA 1LS6A 4BE7B 4TL6A 4BLSA 1KO4A 2VQSA 1SXJC 4EPTA 5CDFE 1UBFA 2P6NA 2Q3FA 2FPLA 1XD8A 4UJ3A 1G8GA 4GSYA 4Q1DA 5JRZA 1OFHA 4L4UA 2P3SA 1OYWA 3X1WA 1QHYA 3ETLA 1IAQA 2GDJA 4NKRA 4Z1MA 2E1RA 2GVDC 2JJ1A 5TXGA 2XNDD 4M0LA 1X3SA 2QSZA 4QL3A 1QGZA 3CRW1 4TT3D 4OI2A 1W7AA 2PJRA 1NI3A 1GP2A 1QG0A 2WOOA 4JLDA 2ZE8A 3SNHA 1W87A 2V7QA 4PFSA 3OIYA 3QJYA 4LBWA 1NMXA 1ZCAA 4HI0E 4JJKA 3LW7A 3K0FB 3U44A 4LJ8A 2PBRA 4LRWA 4Q4JB 2WMNB 4U5XA 1JEEA 4QBGB 3DO6A 4MRRA 3N2EA 2PEYA 1UDXA 1KD1D 4B3BA 3VKWA 5GV8A 4G5RA 4I4LA 2NO7A 4A0HA 4MRNA 2BMEA 4Z51A 4IHQA 1XMVA 5DN6D 2QP9X 4MRPA 5FPSA 1CS4C 2DR3A 3AEZA 1KYIA 5EUMA 3AQ4A 3UWOA 5FL7D 4ILEA 2FN4A 2QBYA 4HAYA 2Z0MA 2ZJOA 1G18A 2PX0A 3O8BA 4GP6A 4P0TA 3I8XA 3SYLA 3AVPA 1KRHA 3MRSA 5DE3A 4BFUA 2X19A 1KI8A 3UWKA 3QKUA 5M04A 2QMEA 4CF7A 5IF9A 1KY3A 1FNBA 1RE0A 2HJVA 1J9ZA 1CR0A 1H8HA 3BK7A 3X1DA 3QPUA 4QGFA 1IN4A 1SHZA 4M9QA 2YV5A 4EJSC 4OQXA 2WJJA 5THXA 3DDCA 4NTZA 1QFJA 2PCJA 2B7CA 1MABB 4C0SA 2DYKA 2Q3HA 2QPOA 4TQ9A 4AKHA 2OFXA 2F1RA 3QI2A 1M7HA 1N6LA 1S96A 2RB4A 3A36A 3BWDD 5JEDA 4AI6A 2QT0A 1XTJA 1BS1A 3EPLA 4ACBA 3MFYA 4URXR 3ZQJA 4M1WA 4RCZA 4TTQA 1OHHA 3ZBUA 4NYJR 4OHXA 3W5IA 1TQ2A 3DKPA 2BDTA 4TMKA 2AX4A 3CCSB 2AHOA 1DO2A 3V4RA 1WRBA 4GZMA 2CNWA 3GEEA 4AD8A 4PXAA 1NN3A 3FDIA 5EXPA 1ZJ6A 4E07A 2MMGA 2O8FA 3KKMA 3I56B 4AYWA 4NP6A 4B6FA 2JLXA 2W6IA 2O8EB 2H17A 1K8AD 1HH4A 1T9HA 1K8RA 3AVUA 2GJ8A 4OHYA 1NP6A 3IQWA 1FRQA 3ZD6A 2BWJA 2J3EA 2KSQA 1E0KA 3ZIAA 2CNWD 1IJEA 1VCNA 1SXJB 3ZZ0A 4ACAA 3VR2A 3ZVLA 4DKXA 1ZNYA 4KFUA 4KODA 5CIQA 3AF0A 4M1MA 2QGZA 2J0VA 2GCOA 1NG9A 3SBDA 2IYZA 4K46A 5HPYB 3SQXA 2WJYA 4DCUA 2Q21A 3RABA 1E9CA 2C9OA 2KWIA 1JECA 1QVRA 3H2YA 4P3YA 2IW3A 4BECA 3W2IA 2BMJA 1VQMB 2GWHA 2NOAA 2CE7A 3AP1A 2FZLA 2WIBA 2Z4RA 5SZKB 3TH5A 1NN1A 4ZPXA 2CDNA 4C30A 4DBLC 5IK2D 1TLLA 3X1XA 3RS3A 1OJLA 3KQKA 3QFRA 1FPMA 2DWOA 2JLZA 1G8FA 1WBBA 2YWEA 5B58C 1BKDR 4O2RA 2DWPA 5EZ6B 1VDZA 2FV8A 3THYA 3A1SA 3CCRB 1X6VA 5AJXA 1VHLA 3ZVRA 3U4QA 1RW4A 1VG1A 4A0GA 1JJVA 1W35A 1N0UA 1R8QA 1N6RA 2O5VA 3VU9B 3CC2B 4RFVA 4BFXA 1FNDA 1M6NA 1RFLA 3B1XA 2DFLA 4GPTA 1TQ6A 1XNJA 2MSDB 3W5HA 2OCBA 3HYRA 4PAOA 5TDHA 4LYHA 1EX6A 1Q0UA 4FMDB 4I1VA 5F2EA 5JMTA 1P3JA 2W83A 1KNXA 4A8JA 1NVVQ 2OAP1 2LKCA 3W8NA 3U44B 1U90A 1AQUA 1G4AE 1EX7A 3B5JA 4JVMA 1U8YA 3E5HA 3IO3A 3Q7QA 4OJQA 5JJIA 4B3XA 2XOKD 3VX3A 1L4UA 1IQPA 3U7FB 4Q4AA 1JPJA 1QGAA 1E9SA 2CHGA 3TUJC 1CF4A 3KQUA 5B30A 1E98A 1CJKC 1CU1A 1UF9A 3BD9A 2EIXA 4MH0R 4ZI2A 4OK5A 2GZDA 1TU3A 5LBIA 3V9PA 1JEDA 2OBMA 2IHYA 2AWOA 2WWIA 1FQKA 3AV0B 3Q85A 3QKSB 3EC2A 3VNUA 2GCNA 1W2BB 4QJ3A 1T8TA 3AF3A 1GAWA 1KMQA 2C03A 2GILA 2WICA 3LY5A 1LY1A 3BC1A 3MAAC 2QQ0A 5FUYA 2YYZA 1QHIA 3AF1A 4A0RA 4HATA 1CIPA 2J1LA 3PIRA 3PCRB 1EGAA 3OZWA 4YAFA 1M1KD 3LDAA 4RKEA 2OUKA 2HLDA 2G0NA 2IC5A 4G5GA 1Q1EA 2V8OA 4OJKA 4HAWA 4JBWA 2WJVA 1T5IA 3U7HB 2QEXB 3B9QA 3QE2A 2I1QA 4PZYA 5FFMA 3RS5A 3LLUA 3RS2A 3GFPA 3G5UA 3CC7B 4HZIA 4TMVA 3FB4A 1UKEA 1VCIA 3F5FA 1KDPA 2VSOA 3K8YA 4OK6A 1GKUB 4US2R 1FX0B 5DI3A 1M7BA 1KSJA 4BWYA 4A6XA 1FNMA 4B75A 2GEUA 3CO5A 1OIVA 2WPDD 4Q4LA 5HCNA 4D0LB 2UKDA 4CEHB 1CRQA 1YZLA 1LW7A 5K8IA 2NO1A 2J5XA 2WZQA 2HDNB 4DLZA 2CVHA 1HQCA 2NO9A 4YLGA 3TE6A 4F93B 2IUTA 1E6CA 2GJAA 1OB5A 3KTAB 4I1OA 2QRZA 4QBFA 4DCTA 1QG4A 3CRQA 1W0JA 3TUZC 3PEYA 1Q21A 1CJMA 1BX1A 4O3MA 2FNAA 2OHFA 3VHLB 1E2MA 1EFCA 3JQRA 4HLCA 3K70B 2CHVA 4NMMA 4DLWA 1W46A 3AP2A 3IHLA 2FU5C 3BS4A 3MWLA 4GI7A 4GOKA 1BYIA 4NE2A 3K70C 2IYTA 3W3AA 4Q66C 4IDNA 5FBRB 1DS6A 5LB4A 4JLOA 1EFHA 4A2PA 1FTNA 3ADCA 2ODEA 1N0VC 3C15C 3W6PA 2GQFA 1RIFA 4LJ6A 5P21A 4WW0A 4NHOA 4TMXA 1QHSA 4QNMA 2WSSA 1W0KD 2ZQ5A 1KMHB 2CE2X 2C2HA 3AVTA 2XOKA 3AKCA 4IKEA 1W34A 3I1FA 1JAHA 1GL7A 3A37A 3W2EA 4AURA 1OFUX 1F2TA 3E2IA 3IDQA 3CPJB 1E2QA 2FEOA 1VCOA 5AUQA 5AJVB 3JVUA 4EQ6B 1XTKA 2XNCA 1XCGB 4W7SA 4B34A 5GADl 1NN0A 5E95A 2CL0X 2F1JA 5FL7A 4F92B 4NH0A 2FFQA 3I5YA 3LH5A 4HLDA 4F4IA 2NGRA 4L9SA 4UNSA 4DLTA 1SVKA 1C1YA 2GZHA 2MSCB 2HXYA 3W5VA 3CC4B 2OV2A 2YNMA 4Q03A 2PZFA 5TVKA 3HJNA 1NKSA 2EFCB 3I55B 4V0MA 3RSOA 2A5GA 5EP1A 5CB8A 1VPLA 3TJZA 2RGCA 4FMCB 3QXSA 4TLCA 4URWR 3GLGB 1FRNA 2CHQA 3GP8A 1CNEA 1D2NA 1Z6GA 2QI9C 5JJLA 4G0NA 5AJWA 1AS3A 2B5OA 3A1UA 4TLEA 2ZI4A 2QQEA 4RVCA 1X1RA 2JCSA 1XEWX 2ZREA 2CCJA 1L7VC 2AR7A 3BB3A 4JZKA 5K8UA 2VNJA 2OXCA 2V6JA 3H1TA 2O52A 4MGKR 2XTNA 1PUJA 1E3MA 1N6PA 5FOXA 3ZC3A 1II8A 1NVUQ 3DOFA 2NG1A 3GLGA 1GAJA 5L3QA 3KDSE 2QUZA 4D26A 1KK2A 1N5JA 2R2AA 3HWSA 1GITA 1KHTA 3CCEB 4DT1B 1JI0A 1I4TD 3WY9A 2KJQA 1E4VA 2PLFA 2G77B 3U7EB 1S0UA 2GTPA 5HKKD 4DLSA 5JS8A 2VNKA 4P6VF 4H1VA 2IL1A 1QRAA 5FUVA 2RHMA 1R10A 2ZVPX 3NWJA 1H42A 2R62A 3A58B 2GPJA 4Q1FA 3MWYW 3DM9B 1GG2A 1GKIA 2J7KA 2FFHA 2RGNC 5LB2A 5DNYB 4GMXA 3HDTA 4HLUA 3TBKA 2XXAA 3LQQA 5BW8A 1TPZA 2W0MA 2JATA 2N42A 1YU9A 1B2RA 3L43A 3CCJB 3LVBA 4A2WA 5CK5A 4NYIQ 5HZKA 4CEJA 5TY0A 3EASA 2HV8A 2GKSA 1QVFB 2XEXA 3BGWA 1N6OA 5C2JB 4Q21A 2ZE7A 1R5BA 1OPXA 1Q22A 2EFHB 2N1BA 1MO6A 1N2CE 1D5CA 1TQDA 4Q00A 1RYFA 2DWQA 3BORA 5B57C 1E69A 4C3ZA 3N2IA 4DXAA 4PX9A 1U99A 4PQFA 1XB2A 2G0TA 2J0QA 4ZCLA 4NU0A 2F9MA 2GHIA 3KXKA 1Z83A 5SZHB 4CRWB 2XNDA 4TTPA 4NZYA
chains in the Genus database with same CATH superfamily
3WL5A 1NQTA 1XTBA 2CF4A 2VDRB 3TE7A 1XCJA 3T4EA 5IVHA 3MYRA 4H1HA 4H35A 3EFBA 4FLEA 2BH9A 2X1HA 4OVKA 4M7WA 4HB4A 4MWCA 3ZGXA 2BI8A 4GRDA 2EFEB 3AERB 3M4JA 4TV8A 1GRQA 2R8RA 1F5NA 3PDIB 1O89A 4V0NA 1EEHA 1YA4A 2J3IA 2PT6A 3DOIA 2AJDA 3B3FA 4IXDA 2RMKA 5TQVA 4DA8A 5CDFA 3EF0A 3G2JA 5LSAA 4CL2A 4NZNA 2QAGA 1NB0A 4M2LA 4BGIA 3KUUA 1U1FA 3TLCA 3H9QA 1PT8A 2JJQA 4KJZA 2Z3ZA 2I2AA 3E82A 1L5HA 2FLWA 3W1WA 2FW1A 3AR7A 3MTBA 2VYFA 2ZAOA 4HWGA 4CKCA 4MNTA 4IJ5A 4WLEA 4BFLA 1X14A 4FDMA 4DAOA 3R7DA 1UBEA 2ZWVA 3Q7IA 2CLSA 5L4SA 3M4ZA 4Q47A 1L5YA 4CFSA 4RY0A 4BGEA 3B1KA 1U3UA 3OF5A 5J2TA 1XZIA 3JYPA 3JAKA 2OHGA 1Z0FA 2YIJA 4IJ6A 3PITA 1YB4A 3RADC 2CXHA 4HYYA 1R0BA 3GUUA 4H7FA 3DWEX 5JG7A 4RTMA 5I5GA 3K1AA 4Q6BA 4GWLA 4CDGA 4C89A 4PTLA 4E32A 3PJGA 3HB0A 2OFFA 5EQFA 5C8YF 4I2NA 1NJ8A 4JKIA 5E3IA 4YAJA 5JYCA 3G13A 2GEJA 4B8ZA 2PUHA 5IM4F 4BIMA 3KVOA 3ZGZA 4BUCA 4XJTA 4XWWA 4G0UA 4Y2GA 4L51A 4K9SA 4HNRA 3WLIA 4TUYA 1MFZA 4AG3A 2EQBA 1JJBA 4ZAFA 2F43B 5CA0A 3U13A 3LP8A 2PQ2A 4MPRA 5IK2A 1U3WA 1R0WA 2PZKA 4NH4A 1SUFA 1DB3A 1OLOA 1B1AA 2B69A 3EPJA 3URMA 4BGDA 3ORHA 4MUMA 4I9NA 3K7EA 2EFGA 2X6XA 4C88A 1P19A 2QRQA 5MGNA 3WGKA 1F6WA 3ANMA 2HMYB 4Q7JB 4ZA2A 1QZUA 4GKBA 5EIEA 1G0OA 4L5BA 4EKNB 1UPBA 2ZTNA 2CBGA 4Q15A 5T7BA 3EB9A 2VYQA 1A88A 4AY2A 1N1MA 1DC6A 3DPIA 2I9KA 2ZB8A 4RHUA 4E09A 2REOA 4UXIA 4RV4A 1JDVA 3G9UA 3I1YA 1RWMA 4YASA 4B82A 3OCCA 5GONF 1J2UA 4FD3A 4OBEA 3E3AA 4I6EA 1DEOA 2ZZEA 1VC2A 3KJHA 3R7AA 1Z63A 1XDGA 4TVBA 1NY5A 2WFZA 2YWDA 1W47A 3A27A 1CVIA 4BV8A 4H4EA 1G3QA 4MW0A 3V2GA 4LNUB 4AKEA 1TRHA 1T36B 2HMVA 3AVQA 5EUQB 5IAEA 1ORWA 5J1TB 1ISFA 3OOEA 4BIIA 3KYCA 1OU0A 2CCGA 5IVKA 2HEIA 1ZL0A 2IX3A 3DL4A 4MWBA 4LY6A 4XCVA 2WA2A 1XXLA 3OEHD 1A8PA 1GNQA 2AFRA 1A50B 1JR6A 4LNHA 4E94A 4EM6A 1G2IA 1ML4A 3DHYA 3F4LA 3IQDB 5H68A 4A26A 4BB5A 1QQBA 4ESHA 4X91A 2HZ7A 3BWCA 3TEMA 1OZHA 2R48A 4D97A 1DQYA 1X1BA 3IV7A 3CV3A 3LDUA 1FSPA 4ZVVA 2V3WA 3MQFA 4M87A 3K0KA 4U3JA 3I4FA 4P08A 4Q9LA 5CHEA 3KTDA 3GRCA 5AQEA 3DDOA 4LF6B 2CUKA 1EZZA 1LNSA 3BB1A 3GJSA 5ADHA 3G7SA 1U0JA 2OR3A 4BJHB 3PC4A 4M0EA 4XZ3A 4N3BA 3TLGB 1IPEA 1M90D 1IDOA 1WPGA 3KR2A 3IXQA 3ZHXA 4LHSA 1JFVA 4MJ7A 3A8IA 3NO4A 4O4HA 4Q3BA 3IIKA 4JJ4A 1T6NA 3BH0A 4YDRA 3VPGA 4FYJA 4GD3Q 5EQDA 4ABYA 1XTQA 2B1RA 4LXYA 2AMVA 1JHRA 1ZEMA 3MWEB 4OLHA 4V0LA 4ALLA 3C4QA 4DHEA 1HLFA 2ROQA 4W5QA 3D8NA 2VSNA 1NN5A 5K6RA 4DMLA 1V47A 4LXHA 1T5LA 4NBNA 3OE7D 5FBZA 4KRYA 3KOYA 4FFBA 3KQVA 4DNOA 5KQMA 3GPLA 3K09C 3HVHA 3FSRA 3JQ9A 2IUSA 3D6TB 4G8DA 2PX3A 4E12A 1YWGO 5EIXA 5K4GA 1X2EA 3GDGA 2QVLA 2IT1A 4PVDA 3MCVA 3EIHA 3VBCA 1R7RA 4X85A 4RDLA 4KQXA 5DM70 4TLAA 3DEHA 2WJGA 1N9GA 1O95A 2OYCA 3NAGA 4BVKA 3I2KA 3OCWA 1U7ZA 4HWKA 4CMKA 4Y6GB 2Q2WA 4ZEXA 2MIIA 4CV2A 1N36B 4AROA 4GT1A 3GLIE 3ICEA 2Q3MA 2AOTA 1T5EA 2V9ZA 1I7PA 1BJTA 2DR0A 1D9XA 3BIFA 2VPPA 1TJ5A 1K8ZB 4DCGA 4YRIA 1Z3IX 2JGDA 2ODAA 2ON6A 3OZAA 1WCXA 2VDUE 3ENWA 4J16C 4QATA 2JK1A 2W98A 3LECA 3LQ6A 2AXQA 2QP3A 2EERA 1WXEA 2IU4A 4YQEA 3ISTA 1J9GA 3FMVA 3O1JC 4LPSA 4XTCS 3DAYA 2PT7A 1OKKD 3N8IA 2C4VA 4D56A 4L57A 2OM6A 3KRTA 5KAPA 2I6TA 1VG9B 1VBNA 1YDFA 3QQ5A 1FFEA 4JEUA 4KYVA 4BO5A 3ESAA 4Q9KA 4BE4A 2HF8A 1WOPA 1P4GA 1V9SA 1RJFA 3W7AA 2ZRCA 3Q9SA 5HZMA 4C7OB 1YDHA 3C8ZA 3LL7A 2Q3BA 2AB0A 3AEXA 2XQJA 1FQOA 4J2TA 1C3OA 4HG2A 3TXAA 1P1IA 2IEZA 2CLHB 1D8AA 4HB3A 5HS6A 4Q16A 1G8KA 2CYCA 1R1DA 2EZTA 1FYFA 4ZAYA 1HZJA 1IZYA 3OPNA 4PLVA 4AVYA 3EJ6A 3KUDA 1PJAA 3EZGA 3WE7A 2I7TA 3DZFA 1A76A 1E1QD 3DSRA 4FGKA 4HGNA 4EJMA 1FLVA 3WFZA 1RQNA 3ACCA 3LO8A 4OSPA 5F3RA 4LC9A 2F90A 2AD1A 2PX8A 1FDTA 3D3KA 1J25A 3Q41A 4JWKA 4R81A 4OP7A 3VKUA 1SG6A 1BX0A 2V7UA 3WI7A 3PI6A 3PCTA 4WAUA 5K7SA 5DCUA 2D7DA 5BYJA 1VGQA 1P33A 3FIUA 1F2DA 2GRJA 2PH7A 4KKVA 4TT8A 4WBNA 5EIBC 3PUNA 4OFBA 3M2PA 5TE9A 1CJSA 2A9PA 4IKOA 4M1YA 5AM4A 4AWXA 5K0TA 1EWTA 3KO8A 3DZKA 4FS8A 4KUHA 4CV1A 3E8MA 4Q7LA 1HE5A 4WIAA 3T5DA 3WO0A 4HV4A 4PAWA 5JEEA 2IA5A 3N2KA 1PQPA 2G07A 4QARA 3KSRA 1MH9A 4EPWA 1ODLA 4UD2A 1N0HA 2D62A 3FTFA 3VYWA 3AFOA 3OC0A 3RRJA 3U7QA 3LF1A 5G02A 4LF8B 2O5CA 2HFJA 4RA6B 5EE3A 3LD9A 2HU7A 4O4HB 3ABQB 3IMGA 2GFQA 4P58A 4EFLA 4DUGA 1GZSA 4RAQA 1U9IC 2IFTA 2FPWA 4MROA 3UATA 3QKIA 4RMIA 3ASTA 1CUIA 3BHIA 3LOPA 4FCWA 4BMOB 4OOVA 3PD0A 4DLPA 3QEAZ 1BKYA 1SUPA 1CQIB 3UJNA 1SJ9A 4NCAA 4J2HA 1CRPA 4IRXA 3B6EA 1XD9A 2HHLA 2RAFA 3MJ4A 2Y9MB 2PRZA 2RBKA 4IOJA 1Y80A 3QWBA 4XQCA 4NYMQ 1C9YA 4J49A 2EZ9A 1E1QA 2GBPA 2ZBRA 3FPJA 3NWBA 3U1BA 3BN3A 3MT0A 4J0HA 2JAPA 4MS1B 5JMPA 3ZHBA 1DDIA 2JFFA 1IAVA 3F6EX 4XD7D 4TYQA 3VR4H 1RZRA 3WV5A 2NACA 2HPZA 1BCSA 3IYLW 2P9ZA 1EVEA 3MS4A 5DU2A 2OBLA 4DIUA 1RI1A 4FDVA 1FYDA 4GPEA 1XEWY 2WR8A 1XXHE 1ZD4A 2Z1MA 1M54A 2DERA 3ZWDA 4E2WA 3G79A 2JCBA 2OO5C 4TUYF 4EB8A 3PR3A 3Q9LA 1G1MA 3DXZA 3RU2A 1XAHA 3QEKA 4D25A 1YRAA 1W7AA 4RPJA 2GEKA 2OV3A 3W06A 3NIFB 4RFSA 3EXG2 1KAGA 4CDRA 5HKLA 4F3RA 1VKRA 4OHRA 2WUWE 3BICA 3OESA 4KRFA 3KJQA 3K53A 4RKYA 4QECA 1BRMA 4UDNA 3RJMA 4QIHA 4G65A 3A4MA 4GOJA 4N3NA 4OI4A 2DHDA 4X93A 1FP6A 4W6ZA 3G2KA 1E9EA 1OT3A 3K92A 4ID3A 1N7IA 4JA0A 2FZ4A 4PO1A 4Q37A 3V48A 3WDSA 2IUEA 4UU1A 2AOWA 2H29A 4DGQA 3P0RA 3BB4A 3A04A 3PVCA 3NM5A 4RL4A 5KOHA 4XSHA 5CVEA 2WILA 4IRUB 3Q6MA 1YRWA 4LVNA 3K6SB 1PKXA 2NUAB 3WK6A 4ZT6A 4F5WA 1WTCA 3C6BA 4IMJB 1AUPA 1KKLA 1YZGA 3N0TA 1D5WA 1PVOA 2QZ9A 2PKCA 1HDXA 1E3SA 5K3EA 2J3MA 4CQJA 2FXVA 3FBWA 3L8GA 4FC7A 1T5TA 5EYPA 3UCXA 4WXPA 4KNYA 1SFRA 2GR9A 3ZI0A 3T5MA 4EEZA 2O57A 3K0AA 2H48A 2H2AA 4IVPA 4MI9A 1D7AA 1J99A 3WSVA 2I4RA 3PUWA 4NX2A 4P84A 4OXXA 4MYSA 3WQZA 4WE3A 4YRSA 5KNCD 4YRRA 1DXOA 1I1HA 1KZ6A 1MOSA 3WGIA 4JI7B 3OX1A 3AVYA 3D3EA 4GFDA 1WA5A 2AWNA 3A8TA 4BMSA 2D0OB 2HWYA 5IAJA 1MHTA 5C34B 4K6MA 3VDNB 1MVNA 1MX9A 2G4CA 1UZLA 2G5PA 3IAM6 1OAOC 1A7JA 4G24A 4EI8A 3KYIB 4GIBA 4ZXFA 5LYJA 2Z5FA 2AN5A 3OE4A 1HNZB 3LX4A 4KXXA 2H1WA 4P3KA 3HCDA 3FYTA 5ITVA 5G3YA 1I13A 1UMBA 1Z37A 4G97A 4Z4RA 2VIIA 5ELXA 4D6XA 4ZKEA 1E5VA 621PA 2JA1A 2ZTGA 1QHFA 2B30A 2GAFA 1LK7A 2J9RA 3N6RA 1V6CA 3QNMA 3D02A 2FEPA 4YV1A 4N7JA 4JEHA 3ZCRA 4MICA 1TC1A 2W48A 5FIUA 2Y27A 1EFAA 2E21A 1KORA 4OQZA 4DR2B 1Y6QA 1JHZA 1JHDA 1M2JA 2ZIUB 3S2FA 5A4IS 1D2HA 2PH3A 2Y0DA 3PQDA 5KNCH 3JQBA 3SWWA 5D3ZA 2ZR0A 5A2QA 3CPSA 1ZNZA 2GBIA 3QUCA 4E3ZA 4LKRA 4B3FX 1TEZA 3OZFA 4M8KA 4UM9B 4IW3B 3Q7RA 4Q4HB 4FYIA 5HKKA 1R2QA 1YOVB 4KTVE 5FA5A 5TVGA 2XNJA 5BYAA 4WADA 3ICVA 4M1EA 4ALNA 3MJTA 1WW3A 4OQYA 3MHTA 2W6MA 1YBFA 2CLFB 3AB8A 1NQWA 2OCLA 3L7CA 3CN7A 3FPFA 2VRWA 2W2NA 4QEKA 1Y8ZA 1JG1A 4YRDA 4JELA 5JYDA 3BJEA 3GAFA 5BN5A 1DJLA 4P1VA 4MV9A 2PDAA 1PN3A 1LV7A 1T43A 2X4IA 3ZW8A 4XVCA 1EGHA 2X42A 3KIPA 4AJEA 1JEYB 2PZLA 3QU7A 6NULA 2E4XA 3ADKA 1T4GA 1R4NA 2HUNA 2R5FA 3ZGYA 2Q1WA 4ZOAA 2HH9A 1AQLA 2PWBA 1EDZA 5L7TA 1NAIA 5E4FA 4CU5A 2MJLA 1H3EA 3GD5A 2R79A 5DEIA 2FYTA 3ILHA 3RG2A 1DTEA 1KP3A 1MA0A 2G9VA 3WBJA 2CJWB 1YD7A 3K4QA 5JHHB 3PC2A 4GWGA 2F7SA 2PRJA 3LXXA 5HS4A 3WAKA 5JCZA 1W52X 4CGYA 3F6SA 4RJ2A 4R84A 4Z4TA 2P5SA 5KSZA 2CVPA 4LQ4A 3B13B 4DV2B 4G8JA 2R6HA 4N6OA 3U7QB 1JQJC 4B3JA 3IUEA 5TMBA 4I7EA 1KPGA 1YDWA 1LVHA 2PWAA 2QGGA 1QTIA 1E2LA 3R24A 2PO7A 3R23A 1P7WA 4DLVA 5JAIA 3IIJA 1C0KA 1NUTA 1WCIB 3FKQA 4MR7A 4BNXA 3O8LA 1V11B 4G01B 4ENTA 3A9WA 1KJIA 1O8BA 2I2FA 2YWFA 3UYKA 1JXOA 5LLDA 1PJ2A 1ZM9A 1UBCA 1G42A 3IR7A 3U37A 1T4BA 2FW8A 3AF5A 3T52A 1JSXA 4QTZA 5J2TF 4F9GA 1X7WA 4PONA 4BRZA 4JJZA 5J4KA 4IDAA 5EZQA 2W6ID 4ZQBA 2OBFA 3P27A 1EVQA 1VLZA 1T8RA 2M98A 1SHLA 2JS7A 3WL6A 5KNDH 3P2EA 2VYND 4F3NA 1RACA 3OPYI 4BRSA 4YRAA 5JNUA 3VZPA 2CZQA 5AM0A 2A59A 3B82A 3KQLA 1GCIA 1FS4A 5K2MA 3N0VA 3P2MA 2JAXA 5DSXA 1UDWA 3RVBA 2DTDA 5AK6A 2Z9DA 2C9BA 1F20A 1W1UA 2QN9A 4N7RA 1DQNA 3GVJA 1B43A 3EJWA 4P33A 1ISGA 1MB9A 4FUTA 3U4AA 1P0QA 1MO3A 2XA1A 1XXHA 2NYVA 1N8NA 3IKJA 5HCIA 1M83A 3RC3A 1NUPA 3B3JA 2WVGA 2Y93A 4L8YA 4JGIA 1CZKA 4B7XA 2XZLA 2P3LA 5CPBA 4YXFA 5KKCA 1NFRA 1AKVA 4CXMA 3CISA 4HZGA 4ZGWA 3CN9A 4PG5A 1RKBA 4HLQB 1VHDA 2ZZKA 1DCKA 1M2NA 1LBIA 2K7FA 3FUXA 2TECE 5LOVA 2JGNA 3NBYC 2X77A 2FKNA 3GBSA 1XHLA 3GCGA 4UJ5A 2BKLA 2IYVA 4DQLA 4RHFA 1ONBA 4TX1A 4HE5A 3WKDA 2FR8C 4NNJA 1QZ3A 2IZ0A 5CJPA 1XNHA 1YVPA 3LKBA 4WNCA 3PJRA 1II0A 3O4VA 3RS0A 3SD7A 2JDID 4V02A 1XSEA 3C45A 2NO6A 3GGDA 1C3EA 4C04A 1G8JA 1QJ4A 4KLNA 1XQ6A 2QRJA 3NHJA 1G5QA 5DHSA 5B3LA 1OBVA 1QF9A 1ZKDA 3G0BA 3EUAA 3R44A 2JD2A 1IXSB 3EHDA 3AM3A 4FHEA 4MKRA 4Q9IA 4M1SA 3KP1A 1Z8NA 1UZMA 2BGLA 4K9KA 4B3IA 4L9AA 1DMRA 1K7YA 2Q62A 2XSZD 2ZRNA 5AK5A 2YCLA 5IN5A 5FKJA 2I29A 2ZWPA 4J91A 4MVJH 4TPKA 3ZD9A 4B35A 2B35A 2WV7A 3A9RA 4YACA 4J4TA 3TD9A 5EMMA 4JNCA 1SXJE 1H5QA 5LNK6 3DCYA 4BBJA 2A7XA 5SZIA 4MLDA 1DJNA 3E18A 4W4TA 5LKRA 1TF5A 5JJKA 1F8XA 1V71A 2KI5A 1HXHA 4RLFA 1XPOA 4D57A 1PU2A 2OAGA 2A5JA 3V8QA 2BIFA 1UK9A 2AI3A 3TNJA 5CBPB 2NQ2C 4ZMSA 1Y4UA 1RBZA 2ZUUA 5JI3E 2DLDA 1NGSA 2VK2A 4FPXA 2WPNA 2DFTA 5BQ3A 2HB6A 1PT6A 4C6HA 1S2NA 1B6GA 4HDSB 4DZRA 5IHXA 4HZUA 1MAUA 1IBRA 1RBYA 2XOXA 2ZJ4A 5EERA 3QLVA 4EYQA 5GVSA 2D2XA 2IH4A 3IVCA 1JU3A 2UUPA 2ECKA 1NPTO 4I4TF 3EOAI 1ZK1A 3SIXA 3T9BA 1FXUA 4RLQA 2G5TA 3PD7A 2HWUA 3UUGA 4I1PA 3HWWA 1U3FA 1JBEA 1XVVA 1GUAA 1ZI8A 3AONB 3NT2A 5E6RB 3T35A 1M73E 3HR7A 3V42A 2QBYB 4RCVA 2ZTMA 4P6YA 3WJ1A 4UZFA 1E3ZA 3GA7A 1QOQB 3PUZA 1QONA 2WWWA 4MP3A 2AF4C 4ND2A 4ZODA 3T3IA 4F4JA 1Q0TA 4P82A 1T4MA 3C4JA 4KXUA 1MTOA 3PKZA 5KAMA 4CT0A 2AKYA 4BJ3A 3QYJA 4IQ8A 3UKDA 4DNFA 4JC0A 1MB2A 2IYUA 1ZGGA 3T9CA 1LGYA 3K6RA 3BZWA 1Y8AA 4S1PA 5L3VA 3FWKA 5DTMA 4DL9A 5JD4A 1TA9A 1FNSA 3V80A 2D4HA 2V4MA 1PJ8A 3CZRA 5DNDA 2WSBA 1NMQA 4HQLA 5I7EA 2NVBA 4KAFA 3GGOA 4MVYA 1GUDA 4ND1A 5B12A 2V65A 3V1NA 1JEJA 1Z8FA 4G1CA 1K6XA 4Y1RB 3OF2A 2YWGA 1QIFA 5ESWA 1NR5A 1WJGA 3CRRA 2WHYA 1ST2A 5ICGA 4G89A 4H6VA 2HLPA 4X1YB 1WUIS 3HO8A 3NBKA 3U2QA 3NIWA 2QTAA 2HF2A 5D3MA 2ZWOA 1GNVA 1Q19A 3IUQA 1P1BA 1JLLA 1WXHA 3AYZB 3JQBC 1SHKA 4P54A 4OSEA 4FWTA 2JIDA 4P3IA 1PLJA 3HVJA 3H1FA 3H5OA 1I1QB 1RC0A 4YREA 1UKVY 1FDSA 5DK6A 2ZUTA 1JG2A 1KEEB 1WPCA 1U7HA 2VXYA 2XODA 3ESCA 1IHDA 2ZE5A 2YRFA 3GRAA 4I5FA 3DOJA 2PQMA 4LOLA 3ICQB 4FYHA 4B73A 1FMLA 1MORA 2HR1A 2BKAA 3JQ7B 3GEMA 2A9FA 2C82A 3CVUA 4PQEA 1FFHA 3FWHA 3RG8A 1XO1A 1QP0A 1TTQB 1XVTA 4TYPA 3B89A 3WK9A 5HHTA 1XTTA 2FGKA 3J80A 3ACDA 3JPWA 1PS9A 1UKCA 3EF3A 2O0JA 3I76A 4DG8A 3JWPA 4CKEA 3QKRB 2WG0A 4IWYA 4MKHA 3GLHA 1ZZGA 1G8YA 5FTWA 2BSXA 5FD8A 1UAAA 2DZDA 4R2KA 2V3VA 3E7DA 1Z5GA 2X4GA 4X1KA 3ZU2A 1BA3A 3VTKA 4WKBA 1VJ5A 4UOQA 4JI6B 2NVUB 5B3JC 1D1SA 1RYZA 4JYCA 1E6UA 1UWVA 2I71A 5DGDA 1TE2A 3PDCA 3T1OA 2M5SA 1N5KA 2GQ0A 4YXWA 4DC1A 2ERXA 4HFNA 4RPKA 5FYQA 1GIAA 1RCTE 1HQKA 3GLRA 4MUFA 4DSNA 5L6MB 1KNQA 2OCGA 5HXAA 3CINA 3MERA 2R2GA 3E7WA 3FPSA 2DJ5A 1Q2UA 3GG9A 1KY2A 4D2IA 5GZ6A 5JC8A 5J1SB 3NWPA 5TPWA 1Q0QA 3HB1A 1CUUA 2UZAA 3JRXA 4Q12A 4I8IA 3UHAA 4UXHA 4KQGA 1IVYA 2NO4A 3AI1A 1EE9A 4KRGA 3CVOA 2IRWA 1MC1A 1Y1SA 1RKUA 2PA3A 1KERA 3A1NA 1TO6A 3FWPA 4B8WA 3GUZA 1E7QA 4BATA 1U2DA 4GI1A 1LDYA 1TGYA 1O96A 1V35A 1Y1TA 3HFGA 1Z75A 1VXRA 4TRMA 2HMAA 3U48A 5COQA 2JBAA 1P6QA 2ZSHA 4B9AA 3D5TA 1MNAA 4Y9SA 1WLYA 5AW1A 3THYB 3UJ8A 1RBQA 1SZPA 3OWOA 4L5YA 4C14A 3ROQA 2EG9A 2YW9A 2Y92A 2QTGA 3NYRA 4RZ2A 4RD3A 3BH6A 4TKMA 3A4IA 3OZUA 4B2LA 2ZZFA 4Z99A 4HYTA 4HT3B 1YHQB 2QRMA 1HK7A 3IEPA 3RS4A 3EGDA 2LBPA 4XNFA 3EFHA 3L2OB 3ZN2A 4J7UA 4E0BA 3DHNA 1BA2A 3EGXB 1G7TA 4I4TA 1I3CA 3E22B 3OCXA 1DAFA 2YZKA 2HTEA 3HTXA 4PRZA 1HF3A 1BH2A 5EHZA 2HLDD 3ROZA 3FETA 3ZVNA 2IBMA 2QTFA 1V8ZA 2TMDA 3CCQB 3V8BA 3EDRA 4WXRA 4UZUA 1XMJA 1ZUIA 4TWIA 3AW8A 2P9TA 3S7ZA 3NAMA 3F2IA 2WB2A 1JHMA 1QDLB 5IDYA 2XNKA 4ZEOA 5AKLA 4OY3A 2P78A 4C0AC 2GK3A 5I7OA 4I8DA 5HFNA 4B6GA 2JANA 1XVUA 1IBCA 1UAYA 3FPBA 3C5VA 1YFJA 4D98A 4XRGA 5JH7B 3FOAA 2GETA 5EQTA 5E2AA 4J76A 2RHOA 5JNVA 3OJFA 2YZ2A 2V4UA 5KTTA 1AUVA 1P2VA 3GC6A 4C4ZA 2FX2A 5IRCD 3H0KA 3DW1X 4JQZA 2JLVA 1FJHA 1CS0A 1LK0A 2ZI9A 3FYDA 3ULKA 4FFNA 3GLIB 3B51X 3IAXA 5KS2A 4KR2A 1JQLB 3N2YA 2RHRA 4WZAE 4K9PA 1EGVB 6PFKA 4JUIA 3SYMA 2H85A 3BZBA 2B1JA 1NBMD 1XRJA 3EQ7A 4HGRA 1VE3A 4PAGA 1OXTA 1T24A 2WSIA 3GUYA 3M6UA 2H9YA 4DMMA 2FZWA 5IULC 3HYLA 1DADA 3OKCA 1RYYA 4GWKA 4IEIA 3OUTA 4TZTA 1J33A 4XKJA 2OGWA 3U6KA 3KZ1E 1M1YA 5JV5A 3U3JA 1JJIA 3A3PA 4I19A 2I22A 3U4MA 5E1BA 1P2GA 4GZLA 4UOZA 5IEJA 1GPMA 3F0TA 4MUXA 3DPUA 4EHIA 3R9XA 1IHUA 1UFOA 1ISIA 1WMEA 3G5MA 1EB9A 3GFGA 2HREA 5AI8A 2QUKA 2BFAA 2W2MA 4GR9A 5E8RA 2PYIA 1E1MA 2AG8A 2ZB7A 3G9XA 3I8OA 3JD1A 1O6CA 3PS9A 1FJXA 2ARKA 3IX7A 3CRZA 1MB4A 2HIGA 4IJMA 5DM2A 2X0DA 5L6LB 1MPTA 3PX7A 1JUDA 2IE8A 3IUSA 5T3YA 3RU3A 2MSEB 3IQXA 2VJNA 3WBFA 2ATCA 3V4FA 1NVWQ 1U9IA 3CBQA 1TUGA 1G8MA 2WRZA 3LT5A 4EG7A 3A70A 1E7SA 5TV2A 4IGAA 4LTMA 4BPBA 4TS9A 2FCRA 3IR5A 3FCOA 1U6KA 1YRHA 3WWYA 1JTEA 1Y0BA 5U4XA 1GPJA 2BEWB 2IQIA 5DDIP 2NTNA 1YA6A 3NTUA 2QR5A 2ZJFA 3VC7A 3A32A 2LV8A 1W6RA 1LBEA 1WDWB 3A31A 2MMCA 3EGEA 3EIEA 3GN2A 3I0MA 4RPCA 4RZUA 3R7WA 3O83A 4IMRA 1M2OA 3SKBA 2RK4A 2X8WA 4NE9A 5JSHA 1Y4SA 1PNVA 2CDBA 3LUPA 4QYSA 1NXTA 1S3SA 5ENZA 5IVDA 4JXKA 1EVZA 4QAQA 2SKEA 4WECA 4H18A 4DV6B 1P2DA 5CH8A 1ZW1A 1TKAA 1N6KA 1IN6A 1GQFA 1JRLA 1OI3A 3PXUA 4RA9A 5LQKA 4D9HA 4B2PA 1QX3A 2E48A 3GBPA 3I5MA 3LQRA 4MIYA 1W1IA 2QTVB 2H4JA 4YAWA 3TAHA 2H1FA 2O4UX 5LFAA 1NZJA 3ADOA 4PZAA 4FN5A 2I3DA 1ZQ1A 4FSHA 4KKSA 1BOOA 2OE2A 4KN9S 4KUEA 5IYQA 1Z6TA 4TXJA 2H0RA 1N3IA 5J63A 3RQSA 3PU6A 1NU6A 3GUHA 4HDKB 4MKXA 3RSCA 2O6HA 1JQKA 5JT1A 5JYEA 1NYRA 2WWYA 3HV2A 1MH1A 3IAM1 2CJWA 3GO4A 2ZJ7A 2RHGB 1CQWA 1P9OA 5I48A 1V3TA 1XRMA 2MSLA 5ALPA 1HDCA 1L8OA 2IHVA 3DHVA 1K7XB 3NWOA 2V96A 5AJYA 4XORA 3WNBA 4V3CA 1E2GA 2NXNA 4LJKA 2F8MA 4NU6A 4AKIA 1JEQA 5REQB 1FP4B 3LT2A 4R83A 2O2IA 2HTFA 3VO9A 4PTYA 3E9NA 1SURA 1NKTA 1ZC4A 2EL9A 2GPAA 2Q99A 3IUYA 3PXAA 3R3HA 4MW7A 2JNWA 4V0ME 2CZCA 1T8PA 3V7YA 4DSUA 3QNWA 3X1ZA 4Y7DA 1MIOA 2W93A 1U11A 3VPHA 2E4YA 1WF6A 3I37X 5B1IA 2I4OA 5IC5A 3B1VA 4OTZA 1SC1A 4YP9A 2UXBB 1XMSA 1TCBA 1KVRA 3PEVA 4ZJPA 1U6JA 3EW7A 4FMDF 5BVGA 2VDQB 3TOXA 3RO7A 1Y7TA 3U9SA 3P26A 3ZX5A 1LBHA 5DHFA 3EISA 1OTHA 1Q74A 2Z3VA 4YCAA 4PHTA 4BBPA 1YR3A 4NY1A 1GPWB 2XD4A 1HPLA 5CW2A 4I1RA 4X7DA 4FEEA 3UT0A 4C2UA 1W49A 5BW5A 3HRIA 4OJMX 5IJAA 3IDAA 3NDIA 3OOYA 3ZH9B 4FGZA 4KRXA 5DK4A 3LPNA 3AEQA 1U7OA 4LE1A 1QXSA 1Y1PA 2XRMA 2A92A 1VIAA 2FWNA 5DBEX 2AJ8A 4NOJA 3SOPA 3VNSA 1X1SA 2WYVA 1OH7A 4CN8A 2MYUA 2FPRA 3SM9A 2FRDA 2PWPA 2XMBA 1DIGA 2I2XB 4HOYA 1Q7EA 4J0FA 5JLJA 5FJIA 1PS8A 2Y0PA 3KXIA 4TSFA 3IP3A 2GXQA 1C0EA 4G85A 1C0LA 4KVZA 1TTHA 4KWIA 4KYIB 2WHXA 2J3JA 4BZWA 5CDSA 4PC2A 5J47A 4RM3A 3NHPA 3CLRC 3O7MA 1AKNA 5I4CA 2E5FA 1WB4A 4G81A 4LHWA 3PTZA 1FUKA 3QX9A 5KCZA 2IPAB 2B8JA 2OWDA 5M5BA 2EX4A 2XMQA 5KTSA 4KN6A 2JIMA 2Z8XA 1WDKA 2WI8A 4KQMA 3WQSB 2N46A 2R8XA 3WNCA 4IIVA 1FFGA 6REQA 2IEBA 2VK8A 1DE0A 2EIHA 1A5AB 3IQHX 5T4EA 1FTGA 4LMBA 3GRKA 3HJBA 1U3TA 4H7EA 4ZTBA 4BVLA 4BB9A 1P0CA 1E89A 1G3MA 1DKOA 4EY4A 3LK6A 5CDGA 5HM6A 3HVKA 2GAOA 1E2KA 1P5RA 1ZP6A 4J07A 4KAXA 3FJOA 3ST7A 1WZIA 2L19A 3EDYA 5JFTA 1R12A 2PJZA 1VL0A 3T7RA 3F4BA 4CNQA 3A9CA 2VPQA 3BBPA 1NVTA 2HF9A 1AO0A 3D7MA 3RIYA 1BU8A 1ZJJA 4NNPA 4PCLA 3MWDA 1VQ7B 4W63A 4BNMA 4OGLA 5GPBA 4RNDB 2C96A 2FFRA 3OO0A 4ZC8A 2CBZA 2GHRA 1RQ7A 1Z0DA 4QEZA 5G3ZA 2PMBA 1FX0A 1WCWA 4EYKA 3GJ7A 2X3FA 2VSYA 3WHKA 3SIRA 2LNDA 4PV7A 4G0VA 1B3BA 2QZJA 3HXKA 4L0QA 1HDYA 2NU9A 1KJYA 4NPAA 1KFEB 1E9AA 1Z17A 3ABSB 1NQOA 4ER0A 4ZI7F 5BSVA 2OBRA 2ZUWA 4BQSA 1UZAA 1Z0SA 3FFBA 1QYDA 2W2TA 3KLNA 1XRPA 4ZEMA 1R5JA 2QYTA 3KYJB 3I61A 2PUDA 3U4QB 1JE1A 2OAEA 1ECLA 2XD9A 5ESRA 4BKPA 4XWAA 1N8TA 3CW9A 4JC5A 2OBTA 1T3ZA 1WSVA 1PJ5A 2JLYA 4HWOA 1MVOA 2BFMA 3HB9A 5AWFC 5A5EA 3EMKA 2WSLA 4MB0A 1CF2O 3ZV6A 3G05A 5IYZF 1S7CA 3L7KA 3QEJA 1SKYB 2WHPB 5JH7F 1PLKA 1EGQA 1VMDA 3CXCB 3M6AA 2OTLB 1C1DB 1P5HA 2C83A 1PR5A 3NKLA 4Q7EA 3LPAA 2QQGA 2AN9A 3LLSA 1R88A 1K08A 3UIEA 3TW8B 1QRUA 1M72A 4X7BA 1JA0A 1W5EA 9ATCA 4GQAA 3QKSA 3V55A 3GEHA 1T2UA 2OBYA 3CLUC 4CCYB 1VQOB 4UU0A 1O2DA 4H3VA 2JFYA 2O0HA 3ZIAD 4B4WA 2QLJA 1PYOA 1WMDA 5CBPA 4KX5A 3DW3X 4L85A 1QG6A 3PYMA 3QZUA 2AXEA 5IARA 5CLLA 1O6FA 3IFSA 1V25A 2ZRAA 4KH0A 4YY3B 2VDMB 3RIEA 4CMHA 4UBMA 4IMIB 1E32A 2HA3A 1REQB 2ZJZA 3KUXA 4NK4A 1MGPA 3SY8A 1WSWA 1RAHA 4US0R 1LRLA 4B7ZA 1SKAA 5C37A 4GKAA 1T9ZA 1ZCJA