2DOGA

Solution structure of the n-terminal domain of rimm from thermus thermophilus hb8
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
85
structure length
85
Chain Sequence
MRLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVADLPPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Probable 16S rRNA-processing protein rimM
publication title Structural characterization of the ribosome maturation protein, RimM
pubmed doi rcsb
source organism Thermus thermophilus
total genus 11
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 2dogA00
2DOGA 2QGGA 3H9NA 3A1PA 2DYIA 2F1LA
chains in the Genus database with same CATH superfamily
4KKUA 1NDHA 4XN0A 3CRZA 1MRZA 1SM4A 1FRQA 4QVJA 5TR9A 4PC7A 4XLHA 1K73D 3G4SB 1UD5A 3WQZA 4II2A 4L8JA 4XN3A 4ZGQB 4AF6A 4RPDA 1BX1A 1PKVA 1GR1A 4Z1MA 2HLDA 2JN9A 2DETA 3W2GA 1B2RA 2BF4A 4KKSA 2GPJA 3W5UA 4P3YA 2ZXIA 2YWGA 1EP2B 1WOSA 3CC2B 3W2IA 4FWTA 4FXUA 2VBUA 4MYTA 4XR6A 3CESA 1XFOA 1HVXA 4YAOA 1KK2A 2BM0A 1H8EA 3CC7B 1R5BA 3GQBA 1RQRA 5FIUA 5H59A 1E64A 4XMYA 4WWVA 1KQSB 1G7CA 4ASUA 4M1KA 3P26A 2X6XA 2ZTNA 2YWEA 2ZL5A 1DDIA 4Z4VA 4TMZA 2PIAA 2ZTGA 4RCYA 1W0KA 4TN1A 5BSYA 2C77A 1W0JA 4UZEA 4M4SA 2WJYA 4P2NA 5DSZA 3BCFA 2VJJA 2V7UA 2ZXHA 4Z4ZA 1FDRA 3AVUA 3WXMA 1VQ6B 4TMVA 3I55B 1V0EA 1E1RA 5LMZA 2KVOA 1AIPA 3Q39A 4RD0A 3G6EB 4WZTA 3WNDA 1UD8A 3GIRA 1N8RD 4PAAA 3AVWA 1DG1G 2F1MA 2X6WA 3SEJA 3CPXA 1E62A 4X05A 3U6BA 1P4MA 1I7PA 3RY8A 1NB0A 2ZZQA 1BLIA 1KMHA 2NV4A 1UD2A 3Q3AA 4G5GA 5KNLA 2CF4A 4B3FX 2C2WA 1E43A 1V5VA 3CB4A 3GVJA 4OPOA 4NCNA 1BQEA 2V4DA 4RJLA 4TMTA 2F4NA 5IYWA 2X3UA 1HZEA 2OBTA 1QFYA 4P3IA 1WORA 3R6JA 1GJRA 1WOOA 3W2FA 3QFTA 4PABA 4X0CA 4XD7A 3LNNA 4AVZA 3ASSA 4YHBA 3VNUA 1PJ6A 4RM0A 2C78A 5GV7A 1CNEA 3ZZTA 1GVHA 1E3ZA 4XKVA 3ZPNA 1W2BB 2BPOA 3VNVA 1QX4A 1FRNA 4RLZA 4UZFA 3SLDA 1EWYA 1VLYA 4NBSA 2BN4A 4HIZA 1FNDA 1J9ZA 3BNWA 1PJ5A 1I8DA 5F4OA 4DK1A 1BX0A 2FX3A 4F7DA 1YI2B 1KTVA 3W2HA 3W5VA 1H8HA 4DNTB 3U6KA 2ZZGA 3CPWB 3PVDA 2BSAA 4YAFA 1R5NA 4Y9RA 4AF7A 4B47A 4AC9A 5F4JA 3CCUB 1FNBA 4YAWA 1N05A 1R5OA 2ZITA 3CP2A 5EMNA 1BPLA 1VF7A 1SKYB 2WYRA 4X07A 2VNHA 2PE3A 3WYAA 2WJVA 1F20A 5IYQA 2GREA 1GAWA 2Q6OA 1QVFB 2FVGA 1S0UA 1T6ZA 2X85A 1VQPB 4RD3A 3MHPA 4B4DA 2VNKA 1COWA 1S4MA 3OEEA 1VQMB 2DOGA 4OOSA 1WSRA 1H85A 1UMKA 1GAQA 3Q6RA 1KJZA 4P22A 4P6YA 1YJNB 1CQXA 2B7BA 1VHEA 2OK8A 4PC3A 3BCDA 3BH4A 4B43A 2QEXB 2JDIA 2E1BA 4PC2A 3BY2A 2GK7A 4NNJA 4RCZA 2B5OA 1G7SA 1BJKA 3J81k 3QFSA 1NRKA 1QVGB 3AGPA 1UD4A 4G7XA 1YX2A 4H9GA 4G6IA 4XOTA 2ZZEA 4YXWA 3VO2A 2OTLB 3AVYA 5AN9A 3QE2A 1UD6A 4Z4RA 1QUEA 1W35A 1WTHD 3OPOA 4E0FA 4J0QA 2X6YA 3E20A 4M0LA 4XQFA 4N3NA 4QVAA 1QH0A 1E3XA 2V7TA 4ZV4A 3QSYA 1TTTA 1EP1B 1YLOA 2X53S 3LO8A 1QGZA 1TUIA 2WPDA 4C43A 1EFRA 3PA1A 1H42A 1VQ5B 4UAJA 3I1FA 4ACAA 4OOVA 2BGJA 3Q38A 2QMUA 3LVBA 1ZM9A 2XNJA 1QFZA 1M1KD 1NBMA 2YWFA 1Q9SA 1U2RA 3ZZ0A 3FPPA 3V76A 3A35A 4R71A 5F4MA 4ZCIA 3W2EA 3LQEA 3OE7A 4Z4WA 3T51B 2D74A 3B82A 3MMPA 4RDJA 3CCLB 2OK7A 2Q6LA 3FJOA 4P1VA 3CCRB 3P27A 2CBXA 1N06A 2VBSA 5IK2A 1UD3A 1IB0A 1WSVA 5FNZA 1WPCA 5FO1A 2XZLA 2PMDA 2BV3A 3CW2A 2CNDA 2C4UA 2DEUA 3CCVB 5TV2A 2RC6A 1D2EA 2P3MA 2D9RA 4QHYA 4RD6A 2ZL7A 4TKOB 4WZKA 2VNIA 1VQNB 3JU4A 4XNFA 2QGGA 1JA0A 2WSSA 4P6VF 2QDXA 4TMWA 3JQPA 4U9UA 5DN6A 2EFGA 3E1YE 2BM1A 4OOXA 2CC2A 4XONA 1KZLA 2VZLA 4LC0A 4B48A 1NJID 1EFCA 4N3GA 2QTLA 3ONUA 3OEHA 1K8AD 1Q82D 4WZLA 3OJWA 2OBSA 3OOCA 1VQ4B 2X0KA 4KKTA 4B3XA 4LBWA 1QFJA 2JIZA 2F1LA 5B6IA 1D1NA 2GK6A 4P12A 4RD2A 2I1LA 1VQOB 4G1VA 3CCMB 3VR6A 2Q6KA 3OFNA 4ZGNB 2LZJA 2Z6BD 2EIXA 3OP1A 3ZZUA 2BMWA 1OB0A 1XB2A 2W6IA 4XLCA 3H9NA 3GVKA 1VQ7B 3CMEB 1OB2A 4K1XA 4TMXA 3A8JA 1T6YA 2B7CA 2OBRA 2XNCA 1F60A 1PJ7A 3D26A 1E1QA 1K9MD 4YALA 2XZOA 4PC1A 3SJPA 1QGYA 5E6TA 2XOKA 4XLEA 1W9XA 3HAGA 5FA6A 3WBJA 4XLAA 3ZBUA 3GSIA 4YELA 1KK1A 1VLOA 2RC5A 3KEWA 1AMOA 2XGJA 3DDYA 1EP3B 5BSXA 2GJRA 5TRDA 3SKBA 4TSFA 2DCUA 4QUZA 5IYPA 1HA3A 1IJEA 4LBYA 4XOPA 4QV2A 1QUFA 2GQFA 5A88A 5L46A 1Y0RA 4Y9UA 1MABA 4PC6A 1OGJA 4DQKA 1K28D 4RD4A 4LBZA 3ZC3A 5KSWB 4X7DA 1TLLA 3ASTA 4P9SA 4X06A 4RDKA 3FPKA 2PLFA 4FK8A 4Y7CA 2OTJB 4B3GA 4XLFA 1VQ9B 3OZVA 1N08A 1EFUA 4ROXA 1YITB 3VO1A 2NPFA 2XEXA 4DQLA 4HE6A 3QFCA 2ZBVA 4QFMA 2GJKA 3ONYA 3T53B 1IHMA 3CXCB 2HCJB 1VHOA 4Z4YA 3OAAA 4Z4TA 2XNDA 2VBTA 2ZBUA 3A8KA 2R6HA 3BY1A 1KD1D 1YJ9B 2F43A 3KL9A 3A3BA 3ZBTA 1I18A 5H5JA 3AVVA 2CRVA 4RDLA 2HDNB 2V31A 4WZEA 1ZM4A 3U2QA 1ELOA 1QG0A 1DARA 4B44A 5HZBA 3CCSB 3ZUGA 2C5BA 5FO0A 1WP6A 2ZL6A 3LQ6A 2E1RA 1VQLB 1G7RA 4C0SA 4BPRA 3V7AA 3CP8A 1QGAA 3JQQA 1M90D 3G05A 3JQRA 3PENA 2CW5A 1Y0YA 3B78A 3G71B 2HMAA 1WDTA 1GO2A 4P25A 3CMAB 5HZAA 2DERA 2YWHA 2DYIA 1W34A 4ZCLA 1OGIA 2WR8A 4X7CA 2OYNA 4OPVA 5IYRA 1Q7YD 2R9VA 1B23P 1WOPA 4X7FA 3AVTA 5A8AA 4OPSA 1V0FA 1JNYA 4IW3B 3T56B 2VJIA 3A8IA 1E63A 5GV8A 1N0UA 1KK3A 4XORA 3H94A 1IJFA 2QE7A 2DY1A 1Q81D 2C5HA 4LBVA 2VNJA 2VYQA 3ES9A 3QFRA 4WQMA 3A3GA 1JA1A 1N07A 3OJXA 1WU8A 3FKSA 3B8HA 5IYNA 4M53A 1G7TA 2WZNA 3ASQA 3ASPA 3OW7A 4JMQA 4P26A 4X8IA 4XL9A 2QA4B 5FL7A 1CNFA 1KK0A 3A1PA 3OZWA 3CD6B 5J35A 1BMFA 1VQKB 3AVXA 2JJ2A 4YAUA 2V7VA 1XQBA 3BC9A 4HE5A 4OP7A 1OB5A 3CTAA 1W87A 4Z4SA 1FNCA 3ZIAA 4EH1A 5JBQA 1S72B 1JJ2B 1FX0A 2V7XA 5KW9A 4UZUA 5DS0A 2WZPP 3BQJA 1YHQB 1FNMA 1A8PA 4RPBA 2CK3A 3PUMA 2QTZA 4GQNA 4DK0A 5J3OA 4II3A 1XE1A 3ISXA 1RQPA 4RD1A 1VJSA 3Q6QA 4DNRB 1TVCA 4X7EA 3AGQA 5CDFA 3OKXA 1T5EA 4M2LA 1E79A 3W5HA 3WNBA 2Q6IA 3WNCA 1T6XA 1NB9A 3CMMA 2C4TA 4PGOA 2BGIA 2J7KA 4XM3A 3CC4B 3PUNA 4MYUA 1ZM3A 2XZPA 4TT3A 1YJWB 2QN6A 1KC8D 3SJZA 3OW2B 3OZUA 3GVLA 2VBVA 4ZCMA 2ZZFA 1Q86D 2M5SA 5HXBA 3MCAA 1JB9A 1ZUNB 2V7QA 2BVNA 3R6KA 3VMFA 3NE5B 3CCQB 1KRHA 1D8TA 4Z4UA 1VQ8B 1ZM2A 3WY9A 2GJPA 2X8KA 3ASRA 2AHOA 2D3LA 4G1BA 1SKQA 1DDGA 2W6JA 4Q7JB 4G7WA 2D3NA 4CQJA 1EFTA 3PA2A 3CCEB 1YIJB 2JJ1A 3CCJB 3WBKA 4XKWA 5HKKA 3SLNA 3I56B 4YEJA 1OHHA 4ACBA 5A89A 5THXA 2DIEA 4FN5A 2V7WA 1EXMA 1N0VC 5TY0A
chains in the Genus database with same CATH topology
2DOGA 2QGGA 3H9NA 3A1PA 2DYIA 2F1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DOG A;  2QGG A;  3H9N A;  3A1P A;  2DYI A;  2F1L A; 
#chains in the Genus database with same CATH topology
 4KKU A;  1NDH A;  4XN0 A;  3CRZ A;  1MRZ A;  1SM4 A;  1FRQ A;  4QVJ A;  5TR9 A;  4PC7 A;  4XLH A;  1K73 D;  3G4S B;  1UD5 A;  3WQZ A;  4II2 A;  4L8J A;  4XN3 A;  4ZGQ B;  4AF6 A;  4RPD A;  1BX1 A;  1PKV A;  1GR1 A;  4Z1M A;  2HLD A;  2JN9 A;  2DET A;  3W2G A;  1B2R A;  2BF4 A;  4KKS A;  2GPJ A;  3W5U A;  4P3Y A;  2ZXI A;  2YWG A;  1EP2 B;  1WOS A;  3CC2 B;  3W2I A;  4FWT A;  4FXU A;  2VBU A;  4MYT A;  4XR6 A;  3CES A;  1XFO A;  1HVX A;  4YAO A;  1KK2 A;  2BM0 A;  1H8E A;  3CC7 B;  1R5B A;  3GQB A;  1RQR A;  5FIU A;  5H59 A;  1E64 A;  4XMY A;  4WWV A;  1KQS B;  1G7C A;  4ASU A;  4M1K A;  3P26 A;  2X6X A;  2ZTN A;  2YWE A;  2ZL5 A;  1DDI A;  4Z4V A;  4TMZ A;  2PIA A;  2ZTG A;  4RCY A;  1W0K A;  4TN1 A;  5BSY A;  2C77 A;  1W0J A;  4UZE A;  4M4S A;  2WJY A;  4P2N A;  5DSZ A;  3BCF A;  2VJJ A;  2V7U A;  2ZXH A;  4Z4Z A;  1FDR A;  3AVU A;  3WXM A;  1VQ6 B;  4TMV A;  3I55 B;  1V0E A;  1E1R A;  5LMZ A;  2KVO A;  1AIP A;  3Q39 A;  4RD0 A;  3G6E B;  4WZT A;  3WND A;  1UD8 A;  3GIR A;  1N8R D;  4PAA A;  3AVW A;  1DG1 G;  2F1M A;  2X6W A;  3SEJ A;  3CPX A;  1E62 A;  4X05 A;  3U6B A;  1P4M A;  1I7P A;  3RY8 A;  1NB0 A;  2ZZQ A;  1BLI A;  1KMH A;  2NV4 A;  1UD2 A;  3Q3A A;  4G5G A;  5KNL A;  2CF4 A;  4B3F X;  2C2W A;  1E43 A;  1V5V A;  3CB4 A;  3GVJ A;  4OPO A;  4NCN A;  1BQE A;  2V4D A;  4RJL A;  4TMT A;  2F4N A;  5IYW A;  2X3U A;  1HZE A;  2OBT A;  1QFY A;  4P3I A;  1WOR A;  3R6J A;  1GJR A;  1WOO A;  3W2F A;  3QFT A;  4PAB A;  4X0C A;  4XD7 A;  3LNN A;  4AVZ A;  3ASS A;  4YHB A;  3VNU A;  1PJ6 A;  4RM0 A;  2C78 A;  5GV7 A;  1CNE A;  3ZZT A;  1GVH A;  1E3Z A;  4XKV A;  3ZPN A;  1W2B B;  2BPO A;  3VNV A;  1QX4 A;  1FRN A;  4RLZ A;  4UZF A;  3SLD A;  1EWY A;  1VLY A;  4NBS A;  2BN4 A;  4HIZ A;  1FND A;  1J9Z A;  3BNW A;  1PJ5 A;  1I8D A;  5F4O A;  4DK1 A;  1BX0 A;  2FX3 A;  4F7D A;  1YI2 B;  1KTV A;  3W2H A;  3W5V A;  1H8H A;  4DNT B;  3U6K A;  2ZZG A;  3CPW B;  3PVD A;  2BSA A;  4YAF A;  1R5N A;  4Y9R A;  4AF7 A;  4B47 A;  4AC9 A;  5F4J A;  3CCU B;  1FNB A;  4YAW A;  1N05 A;  1R5O A;  2ZIT A;  3CP2 A;  5EMN A;  1BPL A;  1VF7 A;  1SKY B;  2WYR A;  4X07 A;  2VNH A;  2PE3 A;  3WYA A;  2WJV A;  1F20 A;  5IYQ A;  2GRE A;  1GAW A;  2Q6O A;  1QVF B;  2FVG A;  1S0U A;  1T6Z A;  2X85 A;  1VQP B;  4RD3 A;  3MHP A;  4B4D A;  2VNK A;  1COW A;  1S4M A;  3OEE A;  1VQM B;  2DOG A;  4OOS A;  1WSR A;  1H85 A;  1UMK A;  1GAQ A;  3Q6R A;  1KJZ A;  4P22 A;  4P6Y A;  1YJN B;  1CQX A;  2B7B A;  1VHE A;  2OK8 A;  4PC3 A;  3BCD A;  3BH4 A;  4B43 A;  2QEX B;  2JDI A;  2E1B A;  4PC2 A;  3BY2 A;  2GK7 A;  4NNJ A;  4RCZ A;  2B5O A;  1G7S A;  1BJK A;  3J81 k;  3QFS A;  1NRK A;  1QVG B;  3AGP A;  1UD4 A;  4G7X A;  1YX2 A;  4H9G A;  4G6I A;  4XOT A;  2ZZE A;  4YXW A;  3VO2 A;  2OTL B;  3AVY A;  5AN9 A;  3QE2 A;  1UD6 A;  4Z4R A;  1QUE A;  1W35 A;  1WTH D;  3OPO A;  4E0F A;  4J0Q A;  2X6Y A;  3E20 A;  4M0L A;  4XQF A;  4N3N A;  4QVA A;  1QH0 A;  1E3X A;  2V7T A;  4ZV4 A;  3QSY A;  1TTT A;  1EP1 B;  1YLO A;  2X53 S;  3LO8 A;  1QGZ A;  1TUI A;  2WPD A;  4C43 A;  1EFR A;  3PA1 A;  1H42 A;  1VQ5 B;  4UAJ A;  3I1F A;  4ACA A;  4OOV A;  2BGJ A;  3Q38 A;  2QMU A;  3LVB A;  1ZM9 A;  2XNJ A;  1QFZ A;  1M1K D;  1NBM A;  2YWF A;  1Q9S A;  1U2R A;  3ZZ0 A;  3FPP A;  3V76 A;  3A35 A;  4R71 A;  5F4M A;  4ZCI A;  3W2E A;  3LQE A;  3OE7 A;  4Z4W A;  3T51 B;  2D74 A;  3B82 A;  3MMP A;  4RDJ A;  3CCL B;  2OK7 A;  2Q6L A;  3FJO A;  4P1V A;  3CCR B;  3P27 A;  2CBX A;  1N06 A;  2VBS A;  5IK2 A;  1UD3 A;  1IB0 A;  1WSV A;  5FNZ A;  1WPC A;  5FO1 A;  2XZL A;  2PMD A;  2BV3 A;  3CW2 A;  2CND A;  2C4U A;  2DEU A;  3CCV B;  5TV2 A;  2RC6 A;  1D2E A;  2P3M A;  2D9R A;  4QHY A;  4RD6 A;  2ZL7 A;  4TKO B;  4WZK A;  2VNI A;  1VQN B;  3JU4 A;  4XNF A;  2QGG A;  1JA0 A;  2WSS A;  4P6V F;  2QDX A;  4TMW A;  3JQP A;  4U9U A;  5DN6 A;  2EFG A;  3E1Y E;  2BM1 A;  4OOX A;  2CC2 A;  4XON A;  1KZL A;  2VZL A;  4LC0 A;  4B48 A;  1NJI D;  1EFC A;  4N3G A;  2QTL A;  3ONU A;  3OEH A;  1K8A D;  1Q82 D;  4WZL A;  3OJW A;  2OBS A;  3OOC A;  1VQ4 B;  2X0K A;  4KKT A;  4B3X A;  4LBW A;  1QFJ A;  2JIZ A;  2F1L A;  5B6I A;  1D1N A;  2GK6 A;  4P12 A;  4RD2 A;  2I1L A;  1VQO B;  4G1V A;  3CCM B;  3VR6 A;  2Q6K A;  3OFN A;  4ZGN B;  2LZJ A;  2Z6B D;  2EIX A;  3OP1 A;  3ZZU A;  2BMW A;  1OB0 A;  1XB2 A;  2W6I A;  4XLC A;  3H9N A;  3GVK A;  1VQ7 B;  3CME B;  1OB2 A;  4K1X A;  4TMX A;  3A8J A;  1T6Y A;  2B7C A;  2OBR A;  2XNC A;  1F60 A;  1PJ7 A;  3D26 A;  1E1Q A;  1K9M D;  4YAL A;  2XZO A;  4PC1 A;  3SJP A;  1QGY A;  5E6T A;  2XOK A;  4XLE A;  1W9X A;  3HAG A;  5FA6 A;  3WBJ A;  4XLA A;  3ZBU A;  3GSI A;  4YEL A;  1KK1 A;  1VLO A;  2RC5 A;  3KEW A;  1AMO A;  2XGJ A;  3DDY A;  1EP3 B;  5BSX A;  2GJR A;  5TRD A;  3SKB A;  4TSF A;  2DCU A;  4QUZ A;  5IYP A;  1HA3 A;  1IJE A;  4LBY A;  4XOP A;  4QV2 A;  1QUF A;  2GQF A;  5A88 A;  5L46 A;  1Y0R A;  4Y9U A;  1MAB A;  4PC6 A;  1OGJ A;  4DQK A;  1K28 D;  4RD4 A;  4LBZ A;  3ZC3 A;  5KSW B;  4X7D A;  1TLL A;  3AST A;  4P9S A;  4X06 A;  4RDK A;  3FPK A;  2PLF A;  4FK8 A;  4Y7C A;  2OTJ B;  4B3G A;  4XLF A;  1VQ9 B;  3OZV A;  1N08 A;  1EFU A;  4ROX A;  1YIT B;  3VO1 A;  2NPF A;  2XEX A;  4DQL A;  4HE6 A;  3QFC A;  2ZBV A;  4QFM A;  2GJK A;  3ONY A;  3T53 B;  1IHM A;  3CXC B;  2HCJ B;  1VHO A;  4Z4Y A;  3OAA A;  4Z4T A;  2XND A;  2VBT A;  2ZBU A;  3A8K A;  2R6H A;  3BY1 A;  1KD1 D;  1YJ9 B;  2F43 A;  3KL9 A;  3A3B A;  3ZBT A;  1I18 A;  5H5J A;  3AVV A;  2CRV A;  4RDL A;  2HDN B;  2V31 A;  4WZE A;  1ZM4 A;  3U2Q A;  1ELO A;  1QG0 A;  1DAR A;  4B44 A;  5HZB A;  3CCS B;  3ZUG A;  2C5B A;  5FO0 A;  1WP6 A;  2ZL6 A;  3LQ6 A;  2E1R A;  1VQL B;  1G7R A;  4C0S A;  4BPR A;  3V7A A;  3CP8 A;  1QGA A;  3JQQ A;  1M90 D;  3G05 A;  3JQR A;  3PEN A;  2CW5 A;  1Y0Y A;  3B78 A;  3G71 B;  2HMA A;  1WDT A;  1GO2 A;  4P25 A;  3CMA B;  5HZA A;  2DER A;  2YWH A;  2DYI A;  1W34 A;  4ZCL A;  1OGI A;  2WR8 A;  4X7C A;  2OYN A;  4OPV A;  5IYR A;  1Q7Y D;  2R9V A;  1B23 P;  1WOP A;  4X7F A;  3AVT A;  5A8A A;  4OPS A;  1V0F A;  1JNY A;  4IW3 B;  3T56 B;  2VJI A;  3A8I A;  1E63 A;  5GV8 A;  1N0U A;  1KK3 A;  4XOR A;  3H94 A;  1IJF A;  2QE7 A;  2DY1 A;  1Q81 D;  2C5H A;  4LBV A;  2VNJ A;  2VYQ A;  3ES9 A;  3QFR A;  4WQM A;  3A3G A;  1JA1 A;  1N07 A;  3OJX A;  1WU8 A;  3FKS A;  3B8H A;  5IYN A;  4M53 A;  1G7T A;  2WZN A;  3ASQ A;  3ASP A;  3OW7 A;  4JMQ A;  4P26 A;  4X8I A;  4XL9 A;  2QA4 B;  5FL7 A;  1CNF A;  1KK0 A;  3A1P A;  3OZW A;  3CD6 B;  5J35 A;  1BMF A;  1VQK B;  3AVX A;  2JJ2 A;  4YAU A;  2V7V A;  1XQB A;  3BC9 A;  4HE5 A;  4OP7 A;  1OB5 A;  3CTA A;  1W87 A;  4Z4S A;  1FNC A;  3ZIA A;  4EH1 A;  5JBQ A;  1S72 B;  1JJ2 B;  1FX0 A;  2V7X A;  5KW9 A;  4UZU A;  5DS0 A;  2WZP P;  3BQJ A;  1YHQ B;  1FNM A;  1A8P A;  4RPB A;  2CK3 A;  3PUM A;  2QTZ A;  4GQN A;  4DK0 A;  5J3O A;  4II3 A;  1XE1 A;  3ISX A;  1RQP A;  4RD1 A;  1VJS A;  3Q6Q A;  4DNR B;  1TVC A;  4X7E A;  3AGQ A;  5CDF A;  3OKX A;  1T5E A;  4M2L A;  1E79 A;  3W5H A;  3WNB A;  2Q6I A;  3WNC A;  1T6X A;  1NB9 A;  3CMM A;  2C4T A;  4PGO A;  2BGI A;  2J7K A;  4XM3 A;  3CC4 B;  3PUN A;  4MYU A;  1ZM3 A;  2XZP A;  4TT3 A;  1YJW B;  2QN6 A;  1KC8 D;  3SJZ A;  3OW2 B;  3OZU A;  3GVL A;  2VBV A;  4ZCM A;  2ZZF A;  1Q86 D;  2M5S A;  5HXB A;  3MCA A;  1JB9 A;  1ZUN B;  2V7Q A;  2BVN A;  3R6K A;  3VMF A;  3NE5 B;  3CCQ B;  1KRH A;  1D8T A;  4Z4U A;  1VQ8 B;  1ZM2 A;  3WY9 A;  2GJP A;  2X8K A;  3ASR A;  2AHO A;  2D3L A;  4G1B A;  1SKQ A;  1DDG A;  2W6J A;  4Q7J B;  4G7W A;  2D3N A;  4CQJ A;  1EFT A;  3PA2 A;  3CCE B;  1YIJ B;  2JJ1 A;  3CCJ B;  3WBK A;  4XKW A;  5HKK A;  3SLN A;  3I56 B;  4YEJ A;  1OHH A;  4ACB A;  5A89 A;  5THX A;  2DIE A;  4FN5 A;  2V7W A;  1EXM A;  1N0V C;  5TY0 A; 
#chains in the Genus database with same CATH homology
 2DOG A;  2QGG A;  3H9N A;  3A1P A;  2DYI A;  2F1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...