2DOGA

Solution structure of the n-terminal domain of rimm from thermus thermophilus hb8
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
85
structure length
85
Chain Sequence
MRLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVADLPPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the ribosome maturation protein, RimM
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords Probable 16S rRNA-processing protein rimM
total genus 11
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 2dogA00
2DYIA 3H9NA 2QGGA 2DOGA 3A1PA 2F1LA
chains in the Genus database with same CATH superfamily
2Q6IA 3WBJA 3Q38A 4XMYA 4XOPA 3CCSB 1MRZA 1S4MA 4P3IA 1KK0A 1KTVA 1YJWB 4M53A 4P12A 4G5GA 4TKOB 4YAOA 4DNTB 4LBYA 2FVGA 4QVAA 1HVXA 4YHBA 1QFZA 2DEUA 2DERA 2ZBVA 4G7XA 3QFRA 4XNFA 5H59A 2BMWA 4G7WA 1ZM2A 3A3GA 3D26A 3LQ6A 2BV3A 1KJZA 2C5HA 3ONUA 3CTAA 1PJ6A 3OKXA 4Y7CA 1S0UA 2ZL5A 1GAWA 1R5OA 1VLYA 3LO8A 1JJ2B 1V0EA 4PC1A 4PC6A 4XLHA 4E0FA 1W34A 3CCVB 1ZM3A 2YWGA 2V31A 2C77A 5THXA 3CCUB 4RCYA 4X06A 1T6ZA 2D3LA 1KZLA 4P1VA 3OZUA 3WNCA 3ONYA 3CMAB 1VF7A 3GVJA 1U2RA 2PLFA 1TVCA 4C0SA 2VBVA 1W0JA 1CQXA 2YWEA 1QVFB 2Q6KA 2EFGA 2QN6A 1CNEA 3CCLB 4N3GA 4ZGNB 4Z4UA 5CDFA 4Z4YA 2X6YA 4XN0A 5FA6A 5IYWA 2C2WA 3QFCA 4XLCA 2VZLA 2YWHA 3OEEA 2WSSA 3ZIAA 3GVKA 1WTHD 1QGZA 2BM0A 4XLAA 2M5SA 4B43A 3B82A 2R6HA 3SKBA 1V5VA 1YITB 4PABA 3T51B 4XONA 4Z4SA 2HCJB 1GAQA 4DK0A 4RDJA 4P6VF 3SLDA 3Q39A 3ASTA 4P25A 2PIAA 1YJ9B 4ZCIA 1WOPA 3J81k 4XM3A 3CP2A 2WJVA 2JIZA 3VO2A 4RD3A 1SKYB 2GPJA 1WPCA 3CB4A 3W5VA 3OAAA 5KW9A 2B7BA 3G4SB 2DETA 3R6JA 3U6KA 1E1QA 2XGJA 3ASPA 5TY0A 4Z1MA 3OZVA 1H8EA 5BSYA 4XQFA 2OBTA 4Y9RA 4XN3A 1YJNB 3I56B 2FX3A 3H9NA 3V7AA 2VBTA 3W2HA 1QUFA 2AHOA 3OJXA 3AGPA 1M1KD 1V0FA 1FRQA 1H85A 1N0UA 4K1XA 3ZC3A 1YIJB 5HZBA 5FIUA 1JA1A 2JJ1A 2VNHA 1Q81D 4XKVA 4AF6A 3A35A 1W0KA 1I18A 3ZZ0A 2DCUA 2YWFA 1TTTA 2R9VA 3P26A 4WZEA 3KEWA 4II2A 2Q6OA 3OFNA 2ZZEA 1BX1A 3PVDA 2X8KA 5HKKA 2WYRA 4X7EA 3DDYA 1KMHA 1QH0A 1W9XA 1E64A 1VJSA 3LNNA 1XB2A 2ZZGA 5J3OA 5BSXA 1S72B 2CK3A 3V76A 3A1PA 3ISXA 2OBSA 1VQ5B 5TRDA 4YALA 3VNUA 2V7XA 2V7TA 1IHMA 5FL7A 2WZNA 5B6IA 2F43A 4M1KA 1VQ8B 1DARA 3ZUGA 4DQKA 3W2IA 1JNYA 4XL9A 1NB0A 1R5NA 4MYUA 2X3UA 2CF4A 4XD7A 1QVGB 3SLNA 1GR1A 2C5BA 3G71B 2QDXA 4B4DA 4XORA 3OJWA 2OTJB 3CPXA 1OB2A 4JMQA 5LMZA 1G7RA 4Z4VA 2V4DA 3G05A 3CCMB 1BLIA 2ZL6A 2RC5A 2D74A 1BJKA 4RDKA 5F4JA 4ZV4A 4NNJA 1BMFA 4N3NA 1Q7YD 4LC0A 1VHEA 4ACBA 1FRNA 3CC4B 2ZTNA 2DIEA 1WSVA 4YELA 1NBMA 3BCFA 5F4MA 1NB9A 2KVOA 2WJYA 4DNRB 4P22A 2CRVA 4EH1A 3U6BA 3AVTA 1B2RA 2ZXIA 3ZBTA 3BY1A 3CMEB 1UD3A 1GO2A 1UD8A 3VO1A 2GQFA 2ZITA 4PGOA 1ZUNB 3OE7A 3OOCA 2BSAA 4QV2A 4Z4RA 3CCQB 4J0QA 2HMAA 2CC2A 1VQ4B 2C78A 1WOOA 3A3BA 3GQBA 3PUNA 4AC9A 3I55B 1TUIA 2BGIA 2OYNA 1PJ5A 1PKVA 1SM4A 1XFOA 2ZL7A 2BF4A 1HZEA 4GQNA 1FNMA 2QMUA 5A8AA 4P2NA 5FO0A 4RCZA 3WBKA 1OB5A 2ZZFA 1VQPB 4FXUA 1I8DA 3A8JA 4OOSA 1VQLB 1VQ7B 4OPVA 4TN1A 4WZLA 4L8JA 3FPKA 5FO1A 1KQSB 1Q86D 4WZKA 3CW2A 2X85A 2GK7A 4RPDA 2BN4A 2NV4A 4PC2A 4XKWA 2E1RA 5TV2A 1YLOA 2GK6A 3GVLA 5IYQA 2XZLA 3BNWA 2XNJA 4NCNA 1G7SA 1Y0RA 2GREA 1R5BA 2VBSA 1YX2A 3QFTA 4LBVA 1WP6A 1T6YA 1FNDA 4OPOA 2XZPA 1Q9SA 2VJIA 1KK2A 1N08A 4HE6A 1BX0A 2VBUA 1K28D 4KKTA 2GJPA 1UMKA 1FX0A 3JQRA 3VNVA 3W2EA 1COWA 2QE7A 3AVVA 3WYAA 1EXMA 1N07A 4RD1A 2ZZQA 4PC7A 3ES9A 3H94A 3T53B 3KL9A 3Q3AA 4RD2A 2PMDA 3PUMA 4M2LA 4X07A 2ZXHA 4ASUA 1YHQB 1KC8D 4ZCMA 2W6IA 1EFUA 4FWTA 1D1NA 1FNBA 3AVYA 4G1BA 4DQLA 1K9MD 2F1MA 4TMVA 5H5JA 3CPWB 1E1RA 2E1BA 1WSRA 4FK8A 2W6JA 4RJLA 3PENA 1KRHA 3VR6A 4AF7A 3CC2B 2VYQA 1PJ7A 2V7QA 3MCAA 4HE5A 4TMTA 1WDTA 3OPOA 4X0CA 2QEXB 4U9UA 4LBZA 4Q7JB 2QTZA 2DYIA 2CW5A 1BPLA 1JB9A 3OZWA 2C4UA 4YAUA 5IYPA 5JBQA 5DSZA 1BQEA 4YEJA 4Z4ZA 3WNBA 4M4SA 1H8HA 1VQKB 2HDNB 1E3ZA 4Y9UA 1E62A 1N06A 3B78A 3WXMA 3BCDA 3SJZA 3E20A 3CC7B 5GV8A 2V7WA 4P3YA 2WZPP 1VQ6B 4UZEA 5DN6A 4NBSA 2F4NA 3WY9A 3I1FA 1WU8A 3JU4A 1HA3A 1EWYA 4RD6A 1W2BB 4OP7A 3E1YE 4TMXA 2VNJA 4AVZA 1TLLA 2JJ2A 1E63A 1DDGA 3NE5B 1EFRA 3G6EB 3QSYA 1W35A 4X7DA 1XE1A 4QFMA 2V7VA 3U2QA 1EP3B 1EFCA 2LZJA 2XOKA 3BY2A 2NPFA 3WQZA 1A8PA 3CESA 3FKSA 4X05A 3Q6QA 4FN5A 1KK1A 4TT3A 3W5HA 2X6XA 4CQJA 4KKSA 3ZBUA 2GJRA 1QGAA 1NJID 3GIRA 3W2FA 2ZTGA 1SKQA 2QGGA 4X7CA 3ZZUA 4B44A 3LQEA 2WPDA 4QVJA 1K73D 1VQOB 3SEJA 1N8RD 5HXBA 2BGJA 1F60A 1H42A 3B8HA 3ASSA 2F1LA 1N05A 1OHHA 3W5UA 5A88A 1RQRA 5A89A 3QFSA 3OW7A 4B47A 1ZM4A 1KK3A 1T6XA 4UZUA 2D9RA 1GVHA 2QTLA 3CMMA 5E6TA 1GJRA 3CCRB 2VNIA 3CD6B 1E3XA 3CCEB 2OTLB 2B7CA 1UD2A 1EFTA 3MMPA 3OP1A 3BC9A 1UD4A 2DOGA 1VQ9B 1F20A 4XLFA 2XZOA 1KD1D 4X7FA 5TR9A 2GJKA 2ZBUA 1AIPA 3Q6RA 4RD4A 2D3NA 3BH4A 5IYNA 4F7DA 3CRZA 2WR8A 2BPOA 4PC3A 3T56B 1IJEA 1NRKA 1WOSA 4MYTA 5KNLA 4XOTA 1E79A 1QGYA 5J35A 4B3XA 5HZAA 4ACAA 4TMWA 1IJFA 2B5OA 1Q82D 4QUZA 3QE2A 3OW2B 2P3MA 3ZPNA 3CP8A 2BM1A 1G7CA 1OGJA 2OK7A 1FDRA 1RQPA 4OOXA 4WZTA 5GV7A 4BPRA 5IYRA 4G6IA 2VNKA 3MHPA 3FPPA 2BVNA 2C4TA 1VHOA 3AVXA 5F4OA 2HLDA 4Z4WA 1NDHA 2XNCA 1DDIA 1E43A 1ELOA 3LVBA 4LBWA 1N0VC 2CBXA 2JN9A 1T5EA 4TMZA 4WQMA 1G7TA 3ASQA 4IW3B 5EMNA 1B23P 1D8TA 3AVUA 3GSIA 5DS0A 4PAAA 4YAWA 2OK8A 3HAGA 1QUEA 3WNDA 4B3FX 4P9SA 1JA0A 2Z6BD 4OPSA 1P4MA 4RDLA 2EIXA 2J7KA 4YAFA 2I1LA 1OGIA 4II3A 1WORA 4P6YA 1UD6A 4H9GA 2CNDA 1CNFA 4OOVA 3A8IA 3ASRA 1QX4A 2JDIA 1OB0A 1K8AD 3R6KA 1EP1B 1Y0YA 2V7UA 1VLOA 4WWVA 3RY8A 1QFJA 2Q6LA 4RM0A 1XQBA 1VQMB 2X0KA 1EP2B 1M90D 1D2EA 2OBRA 3FJOA 3ZZTA 2QA4B 1FNCA 2DY1A 4P26A 4Z4TA 1MABA 3CCJB 2X6WA 2PE3A 4ZGQB 3P27A 4G1VA 4ROXA 4UAJA 4RD0A 4RLZA 4UZFA 2VJJA 2X53S 5AN9A 1QFYA 3AGQA 3OEHA 1W87A 4TSFA 2XEXA 3W2GA 4XR6A 4XLEA 3PA1A 3BQJA 4RPBA 5IK2A 5L46A 3AVWA 4B3GA 4X8IA 1ZM9A 4KKUA 3SJPA 1AMOA 1J9ZA 1VQNB 1UD5A 2RC6A 1YI2B 1I7PA 3A8KA 4C43A 4M0LA 3PA2A 4R71A 4ZCLA 3JQPA 3JQQA 1QG0A 4B48A 5KSWB 5FNZA 4YXWA 2XNDA 3CXCB 4DK1A 1DG1G 4HIZA 3VMFA 1IB0A 4QHYA
chains in the Genus database with same CATH topology
2DYIA 3H9NA 2QGGA 2DOGA 3A1PA 2F1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYI A;  3H9N A;  2QGG A;  2DOG A;  3A1P A;  2F1L A; 
#chains in the Genus database with same CATH topology
 2Q6I A;  3WBJ A;  3Q38 A;  4XMY A;  4XOP A;  3CCS B;  1MRZ A;  1S4M A;  4P3I A;  1KK0 A;  1KTV A;  1YJW B;  4M53 A;  4P12 A;  4G5G A;  4TKO B;  4YAO A;  4DNT B;  4LBY A;  2FVG A;  4QVA A;  1HVX A;  4YHB A;  1QFZ A;  2DEU A;  2DER A;  2ZBV A;  4G7X A;  3QFR A;  4XNF A;  5H59 A;  2BMW A;  4G7W A;  1ZM2 A;  3A3G A;  3D26 A;  3LQ6 A;  2BV3 A;  1KJZ A;  2C5H A;  3ONU A;  3CTA A;  1PJ6 A;  3OKX A;  4Y7C A;  1S0U A;  2ZL5 A;  1GAW A;  1R5O A;  1VLY A;  3LO8 A;  1JJ2 B;  1V0E A;  4PC1 A;  4PC6 A;  4XLH A;  4E0F A;  1W34 A;  3CCV B;  1ZM3 A;  2YWG A;  2V31 A;  2C77 A;  5THX A;  3CCU B;  4RCY A;  4X06 A;  1T6Z A;  2D3L A;  1KZL A;  4P1V A;  3OZU A;  3WNC A;  3ONY A;  3CMA B;  1VF7 A;  3GVJ A;  1U2R A;  2PLF A;  1TVC A;  4C0S A;  2VBV A;  1W0J A;  1CQX A;  2YWE A;  1QVF B;  2Q6K A;  2EFG A;  2QN6 A;  1CNE A;  3CCL B;  4N3G A;  4ZGN B;  4Z4U A;  5CDF A;  4Z4Y A;  2X6Y A;  4XN0 A;  5FA6 A;  5IYW A;  2C2W A;  3QFC A;  4XLC A;  2VZL A;  2YWH A;  3OEE A;  2WSS A;  3ZIA A;  3GVK A;  1WTH D;  1QGZ A;  2BM0 A;  4XLA A;  2M5S A;  4B43 A;  3B82 A;  2R6H A;  3SKB A;  1V5V A;  1YIT B;  4PAB A;  3T51 B;  4XON A;  4Z4S A;  2HCJ B;  1GAQ A;  4DK0 A;  4RDJ A;  4P6V F;  3SLD A;  3Q39 A;  3AST A;  4P25 A;  2PIA A;  1YJ9 B;  4ZCI A;  1WOP A;  3J81 k;  4XM3 A;  3CP2 A;  2WJV A;  2JIZ A;  3VO2 A;  4RD3 A;  1SKY B;  2GPJ A;  1WPC A;  3CB4 A;  3W5V A;  3OAA A;  5KW9 A;  2B7B A;  3G4S B;  2DET A;  3R6J A;  3U6K A;  1E1Q A;  2XGJ A;  3ASP A;  5TY0 A;  4Z1M A;  3OZV A;  1H8E A;  5BSY A;  4XQF A;  2OBT A;  4Y9R A;  4XN3 A;  1YJN B;  3I56 B;  2FX3 A;  3H9N A;  3V7A A;  2VBT A;  3W2H A;  1QUF A;  2AHO A;  3OJX A;  3AGP A;  1M1K D;  1V0F A;  1FRQ A;  1H85 A;  1N0U A;  4K1X A;  3ZC3 A;  1YIJ B;  5HZB A;  5FIU A;  1JA1 A;  2JJ1 A;  2VNH A;  1Q81 D;  4XKV A;  4AF6 A;  3A35 A;  1W0K A;  1I18 A;  3ZZ0 A;  2DCU A;  2YWF A;  1TTT A;  2R9V A;  3P26 A;  4WZE A;  3KEW A;  4II2 A;  2Q6O A;  3OFN A;  2ZZE A;  1BX1 A;  3PVD A;  2X8K A;  5HKK A;  2WYR A;  4X7E A;  3DDY A;  1KMH A;  1QH0 A;  1W9X A;  1E64 A;  1VJS A;  3LNN A;  1XB2 A;  2ZZG A;  5J3O A;  5BSX A;  1S72 B;  2CK3 A;  3V76 A;  3A1P A;  3ISX A;  2OBS A;  1VQ5 B;  5TRD A;  4YAL A;  3VNU A;  2V7X A;  2V7T A;  1IHM A;  5FL7 A;  2WZN A;  5B6I A;  2F43 A;  4M1K A;  1VQ8 B;  1DAR A;  3ZUG A;  4DQK A;  3W2I A;  1JNY A;  4XL9 A;  1NB0 A;  1R5N A;  4MYU A;  2X3U A;  2CF4 A;  4XD7 A;  1QVG B;  3SLN A;  1GR1 A;  2C5B A;  3G71 B;  2QDX A;  4B4D A;  4XOR A;  3OJW A;  2OTJ B;  3CPX A;  1OB2 A;  4JMQ A;  5LMZ A;  1G7R A;  4Z4V A;  2V4D A;  3G05 A;  3CCM B;  1BLI A;  2ZL6 A;  2RC5 A;  2D74 A;  1BJK A;  4RDK A;  5F4J A;  4ZV4 A;  4NNJ A;  1BMF A;  4N3N A;  1Q7Y D;  4LC0 A;  1VHE A;  4ACB A;  1FRN A;  3CC4 B;  2ZTN A;  2DIE A;  1WSV A;  4YEL A;  1NBM A;  3BCF A;  5F4M A;  1NB9 A;  2KVO A;  2WJY A;  4DNR B;  4P22 A;  2CRV A;  4EH1 A;  3U6B A;  3AVT A;  1B2R A;  2ZXI A;  3ZBT A;  3BY1 A;  3CME B;  1UD3 A;  1GO2 A;  1UD8 A;  3VO1 A;  2GQF A;  2ZIT A;  4PGO A;  1ZUN B;  3OE7 A;  3OOC A;  2BSA A;  4QV2 A;  4Z4R A;  3CCQ B;  4J0Q A;  2HMA A;  2CC2 A;  1VQ4 B;  2C78 A;  1WOO A;  3A3B A;  3GQB A;  3PUN A;  4AC9 A;  3I55 B;  1TUI A;  2BGI A;  2OYN A;  1PJ5 A;  1PKV A;  1SM4 A;  1XFO A;  2ZL7 A;  2BF4 A;  1HZE A;  4GQN A;  1FNM A;  2QMU A;  5A8A A;  4P2N A;  5FO0 A;  4RCZ A;  3WBK A;  1OB5 A;  2ZZF A;  1VQP B;  4FXU A;  1I8D A;  3A8J A;  4OOS A;  1VQL B;  1VQ7 B;  4OPV A;  4TN1 A;  4WZL A;  4L8J A;  3FPK A;  5FO1 A;  1KQS B;  1Q86 D;  4WZK A;  3CW2 A;  2X85 A;  2GK7 A;  4RPD A;  2BN4 A;  2NV4 A;  4PC2 A;  4XKW A;  2E1R A;  5TV2 A;  1YLO A;  2GK6 A;  3GVL A;  5IYQ A;  2XZL A;  3BNW A;  2XNJ A;  4NCN A;  1G7S A;  1Y0R A;  2GRE A;  1R5B A;  2VBS A;  1YX2 A;  3QFT A;  4LBV A;  1WP6 A;  1T6Y A;  1FND A;  4OPO A;  2XZP A;  1Q9S A;  2VJI A;  1KK2 A;  1N08 A;  4HE6 A;  1BX0 A;  2VBU A;  1K28 D;  4KKT A;  2GJP A;  1UMK A;  1FX0 A;  3JQR A;  3VNV A;  3W2E A;  1COW A;  2QE7 A;  3AVV A;  3WYA A;  1EXM A;  1N07 A;  4RD1 A;  2ZZQ A;  4PC7 A;  3ES9 A;  3H94 A;  3T53 B;  3KL9 A;  3Q3A A;  4RD2 A;  2PMD A;  3PUM A;  4M2L A;  4X07 A;  2ZXH A;  4ASU A;  1YHQ B;  1KC8 D;  4ZCM A;  2W6I A;  1EFU A;  4FWT A;  1D1N A;  1FNB A;  3AVY A;  4G1B A;  4DQL A;  1K9M D;  2F1M A;  4TMV A;  5H5J A;  3CPW B;  1E1R A;  2E1B A;  1WSR A;  4FK8 A;  2W6J A;  4RJL A;  3PEN A;  1KRH A;  3VR6 A;  4AF7 A;  3CC2 B;  2VYQ A;  1PJ7 A;  2V7Q A;  3MCA A;  4HE5 A;  4TMT A;  1WDT A;  3OPO A;  4X0C A;  2QEX B;  4U9U A;  4LBZ A;  4Q7J B;  2QTZ A;  2DYI A;  2CW5 A;  1BPL A;  1JB9 A;  3OZW A;  2C4U A;  4YAU A;  5IYP A;  5JBQ A;  5DSZ A;  1BQE A;  4YEJ A;  4Z4Z A;  3WNB A;  4M4S A;  1H8H A;  1VQK B;  2HDN B;  1E3Z A;  4Y9U A;  1E62 A;  1N06 A;  3B78 A;  3WXM A;  3BCD A;  3SJZ A;  3E20 A;  3CC7 B;  5GV8 A;  2V7W A;  4P3Y A;  2WZP P;  1VQ6 B;  4UZE A;  5DN6 A;  4NBS A;  2F4N A;  3WY9 A;  3I1F A;  1WU8 A;  3JU4 A;  1HA3 A;  1EWY A;  4RD6 A;  1W2B B;  4OP7 A;  3E1Y E;  4TMX A;  2VNJ A;  4AVZ A;  1TLL A;  2JJ2 A;  1E63 A;  1DDG A;  3NE5 B;  1EFR A;  3G6E B;  3QSY A;  1W35 A;  4X7D A;  1XE1 A;  4QFM A;  2V7V A;  3U2Q A;  1EP3 B;  1EFC A;  2LZJ A;  2XOK A;  3BY2 A;  2NPF A;  3WQZ A;  1A8P A;  3CES A;  3FKS A;  4X05 A;  3Q6Q A;  4FN5 A;  1KK1 A;  4TT3 A;  3W5H A;  2X6X A;  4CQJ A;  4KKS A;  3ZBU A;  2GJR A;  1QGA A;  1NJI D;  3GIR A;  3W2F A;  2ZTG A;  1SKQ A;  2QGG A;  4X7C A;  3ZZU A;  4B44 A;  3LQE A;  2WPD A;  4QVJ A;  1K73 D;  1VQO B;  3SEJ A;  1N8R D;  5HXB A;  2BGJ A;  1F60 A;  1H42 A;  3B8H A;  3ASS A;  2F1L A;  1N05 A;  1OHH A;  3W5U A;  5A88 A;  1RQR A;  5A89 A;  3QFS A;  3OW7 A;  4B47 A;  1ZM4 A;  1KK3 A;  1T6X A;  4UZU A;  2D9R A;  1GVH A;  2QTL A;  3CMM A;  5E6T A;  1GJR A;  3CCR B;  2VNI A;  3CD6 B;  1E3X A;  3CCE B;  2OTL B;  2B7C A;  1UD2 A;  1EFT A;  3MMP A;  3OP1 A;  3BC9 A;  1UD4 A;  2DOG A;  1VQ9 B;  1F20 A;  4XLF A;  2XZO A;  1KD1 D;  4X7F A;  5TR9 A;  2GJK A;  2ZBU A;  1AIP A;  3Q6R A;  4RD4 A;  2D3N A;  3BH4 A;  5IYN A;  4F7D A;  3CRZ A;  2WR8 A;  2BPO A;  4PC3 A;  3T56 B;  1IJE A;  1NRK A;  1WOS A;  4MYT A;  5KNL A;  4XOT A;  1E79 A;  1QGY A;  5J35 A;  4B3X A;  5HZA A;  4ACA A;  4TMW A;  1IJF A;  2B5O A;  1Q82 D;  4QUZ A;  3QE2 A;  3OW2 B;  2P3M A;  3ZPN A;  3CP8 A;  2BM1 A;  1G7C A;  1OGJ A;  2OK7 A;  1FDR A;  1RQP A;  4OOX A;  4WZT A;  5GV7 A;  4BPR A;  5IYR A;  4G6I A;  2VNK A;  3MHP A;  3FPP A;  2BVN A;  2C4T A;  1VHO A;  3AVX A;  5F4O A;  2HLD A;  4Z4W A;  1NDH A;  2XNC A;  1DDI A;  1E43 A;  1ELO A;  3LVB A;  4LBW A;  1N0V C;  2CBX A;  2JN9 A;  1T5E A;  4TMZ A;  4WQM A;  1G7T A;  3ASQ A;  4IW3 B;  5EMN A;  1B23 P;  1D8T A;  3AVU A;  3GSI A;  5DS0 A;  4PAA A;  4YAW A;  2OK8 A;  3HAG A;  1QUE A;  3WND A;  4B3F X;  4P9S A;  1JA0 A;  2Z6B D;  4OPS A;  1P4M A;  4RDL A;  2EIX A;  2J7K A;  4YAF A;  2I1L A;  1OGI A;  4II3 A;  1WOR A;  4P6Y A;  1UD6 A;  4H9G A;  2CND A;  1CNF A;  4OOV A;  3A8I A;  3ASR A;  1QX4 A;  2JDI A;  1OB0 A;  1K8A D;  3R6K A;  1EP1 B;  1Y0Y A;  2V7U A;  1VLO A;  4WWV A;  3RY8 A;  1QFJ A;  2Q6L A;  4RM0 A;  1XQB A;  1VQM B;  2X0K A;  1EP2 B;  1M90 D;  1D2E A;  2OBR A;  3FJO A;  3ZZT A;  2QA4 B;  1FNC A;  2DY1 A;  4P26 A;  4Z4T A;  1MAB A;  3CCJ B;  2X6W A;  2PE3 A;  4ZGQ B;  3P27 A;  4G1V A;  4ROX A;  4UAJ A;  4RD0 A;  4RLZ A;  4UZF A;  2VJJ A;  2X53 S;  5AN9 A;  1QFY A;  3AGQ A;  3OEH A;  1W87 A;  4TSF A;  2XEX A;  3W2G A;  4XR6 A;  4XLE A;  3PA1 A;  3BQJ A;  4RPB A;  5IK2 A;  5L46 A;  3AVW A;  4B3G A;  4X8I A;  1ZM9 A;  4KKU A;  3SJP A;  1AMO A;  1J9Z A;  1VQN B;  1UD5 A;  2RC6 A;  1YI2 B;  1I7P A;  3A8K A;  4C43 A;  4M0L A;  3PA2 A;  4R71 A;  4ZCL A;  3JQP A;  3JQQ A;  1QG0 A;  4B48 A;  5KSW B;  5FNZ A;  4YXW A;  2XND A;  3CXC B;  4DK1 A;  1DG1 G;  4HIZ A;  3VMF A;  1IB0 A;  4QHY A; 
#chains in the Genus database with same CATH homology
 2DYI A;  3H9N A;  2QGG A;  2DOG A;  3A1P A;  2F1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...