2DOGA

Solution structure of the n-terminal domain of rimm from thermus thermophilus hb8
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
85
structure length
85
Chain Sequence
MRLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVADLPPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable 16S rRNA-processing protein rimM
publication title Structural characterization of the ribosome maturation protein, RimM
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 11
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 2dogA00
2DYIA 2DOGA 3H9NA 2QGGA 3A1PA 2F1LA
chains in the Genus database with same CATH superfamily
5HZAA 3VR6A 3Q38A 3LQEA 4OP7A 3PVDA 4ASUA 1WORA 1MRZA 2C5BA 5E6TA 3A8IA 2V7UA 5HZBA 4EH1A 3QE2A 1NB0A 2QTZA 4LBZA 3JU4A 3OJWA 2ZBUA 4BPRA 4XD7A 2ZL5A 1R5BA 3CPWB 1W35A 3ISXA 1ZM4A 1WOSA 5F4MA 4Z4RA 5KNLA 1F60A 2NV4A 2YWHA 1WDTA 1YI2B 2M5SA 3CCEB 1WU8A 4R71A 1AMOA 3FJOA 1D1NA 2D74A 1G7TA 4QHYA 3SLDA 4WWVA 4HE6A 3MMPA 4M1KA 2VNKA 2OYNA 4XN3A 3PENA 4MYTA 3BH4A 1M90D 4Z4UA 5KW9A 1E64A 4PC3A 4B3FX 2C4UA 2EIXA 1K8AD 2BPOA 4II2A 3WYAA 1QGZA 1PJ5A 2BF4A 4OOXA 3U6KA 2JN9A 2XZOA 5H59A 1FNDA 1AIPA 4B48A 2BMWA 5IYWA 2LZJA 2V7XA 3CB4A 4AC9A 1Q81D 4L8JA 1SKQA 4M0LA 4P6YA 2ZBVA 4IW3B 1GAWA 1VLOA 4TMVA 1W87A 1D2EA 2FX3A 2X53S 1N0UA 1G7SA 2ZZFA 1UD3A 1GR1A 4KKTA 2C78A 4ACAA 3ONUA 1BX0A 1W9XA 1M1KD 1YHQB 3AGQA 3CMAB 4DNTB 2QN6A 1EFRA 4DQKA 2E1RA 3ASRA 3CPXA 1E1RA 1BMFA 1KK0A 2DYIA 2X8KA 3OEHA 4Z1MA 4QVJA 3OW2B 3CCJB 3CTAA 1QG0A 5FL7A 3T56B 1S72B 4YALA 1T6XA 2X85A 4Y7CA 3BNWA 2F43A 4DK0A 1A8PA 2P3MA 4P26A 5J35A 4OOSA 3QFSA 5FO0A 1EWYA 4PGOA 1GO2A 4PC2A 4JMQA 3D26A 3Q6RA 5IYRA 1NJID 4DK1A 5DS0A 3G4SB 2F4NA 4FK8A 4ZCLA 1V0FA 1H8EA 4ZGQB 1OB5A 1WOOA 2WR8A 2QMUA 1ELOA 3CXCB 1YITB 2HMAA 3U2QA 3AVYA 4M4SA 2X3UA 3PA1A 4RDJA 3FPKA 2VBVA 3VO2A 4F7DA 5B6IA 2GREA 4P12A 1VQPB 4AVZA 2XNCA 3VO1A 1CQXA 1QVGB 3CCMB 1KC8D 2V7WA 4YEJA 5DN6A 4Z4SA 2V7TA 1V5VA 3OZWA 2EFGA 2RC6A 3Q3AA 4PABA 2Z6BD 2OTLB 3GVJA 2OK8A 2QDXA 3W5HA 1IB0A 1BPLA 4WZTA 1IJEA 2GJPA 4U9UA 3OZVA 3GQBA 1YX2A 4UZUA 5TRDA 3QFCA 3A1PA 1KZLA 4PC7A 3CW2A 3CP8A 3HAGA 2BVNA 3SEJA 4X7DA 1BJKA 1KRHA 3JQPA 2X0KA 2OK7A 2R6HA 4H9GA 1JA1A 4RD0A 3CC7B 2QE7A 2FVGA 1V0EA 2CW5A 2JJ2A 3T53B 2OBTA 5CDFA 1PJ7A 4Z4WA 1YIJB 1FNCA 1T5EA 1EFCA 4XN0A 1WPCA 3VMFA 2D3LA 3RY8A 3AVUA 3CESA 4P3YA 4XL9A 3GVKA 3OKXA 4B4DA 1UD4A 1E79A 2BGJA 4G1BA 4RPBA 1VQOB 3Q6QA 4QVAA 2NPFA 3I55B 5A88A 3GIRA 1WP6A 1NDHA 1RQPA 3CCSB 1NBMA 3ASSA 1WSVA 2WSSA 2GJKA 2VNHA 1JB9A 1CNFA 4RJLA 3G6EB 1EP3B 4OPSA 2QGGA 1MABA 3P26A 3QFTA 4TKOB 4X7FA 1I8DA 3ASPA 1K73D 1W2BB 3CMEB 1XB2A 2DCUA 1XQBA 1WSRA 2ZXIA 1VQKB 4ROXA 2ZZEA 4AF7A 2B7CA 3ZIAA 5A8AA 3W2GA 5LMZA 5AN9A 4NCNA 4KKUA 3J81k 3B78A 1COWA 2VBUA 5TV2A 2XOKA 1OB0A 4X0CA 4HE5A 2F1MA 3PUNA 1N8RD 3CCRB 1VLYA 2C2WA 4ZCMA 1KK1A 4LBWA 1F20A 1Q86D 2WJVA 1UD2A 3G05A 5F4JA 4WZEA 4YAOA 2CBXA 5KSWB 2W6JA 1YJ9B 3SKBA 1K28D 2XNDA 4P1VA 5L46A 3BC9A 2JDIA 4NBSA 3OPOA 4X8IA 3OOCA 1CNEA 3AVVA 2I1LA 3ES9A 1FRQA 3E20A 2ZZQA 5FO1A 3W5VA 4RLZA 4DNRB 4XLFA 1VQ6B 2D9RA 2ZITA 2VJIA 1W34A 1GJRA 2CNDA 1BX1A 3BCFA 3FPPA 4RCZA 3I56B 5HKKA 1QFJA 1WOPA 3FKSA 3SJPA 4WZLA 1OGJA 1E63A 2X6XA 3ZBTA 4YAFA 1OHHA 3A3BA 1EFTA 1KTVA 2BV3A 2HLDA 5J3OA 4B47A 1E43A 4WZKA 2CF4A 3ASTA 4P22A 1TLLA 3R6JA 1QFYA 4G1VA 2OTJB 2VYQA 3WNCA 3CC4B 2DEUA 1SKYB 3MHPA 4OOVA 1Y0YA 2GK7A 5IK2A 1D8TA 1N08A 2VNIA 3ONYA 2PLFA 4B44A 4YELA 4G5GA 2ZL7A 1QGAA 4N3NA 2VNJA 2W6IA 1TTTA 2WPDA 3ZPNA 3H94A 1ZM2A 2AHOA 5FNZA 4C43A 5EMNA 1N06A 3WNBA 1XE1A 4CQJA 2R9VA 1FDRA 5THXA 2XZPA 5GV8A 3JQQA 4TT3A 1VQ4B 3AVWA 1R5OA 3OEEA 3ZUGA 4YAUA 5HXBA 1JA0A 1KK2A 4P25A 4X7CA 4XLHA 1N0VC 2XZLA 2B5OA 2GQFA 3CMMA 3A3GA 4XMYA 4XQFA 2GPJA 4QV2A 4TMXA 2VBTA 1H8HA 1E62A 3ZBUA 2BSAA 1KQSB 3B82A 1BLIA 4DQLA 3KL9A 2VJJA 1RQRA 4XM3A 5BSYA 4XR6A 3OZUA 2XEXA 1YJNB 1W0KA 3P27A 3ZZUA 1UMKA 4Y9UA 4X05A 2XGJA 4AF6A 3T51B 1N05A 3CP2A 5IYNA 3W2IA 1KMHA 1U2RA 3OE7A 4TSFA 3CCLB 1EP1B 2ZZGA 1VQ7B 1VHOA 1H85A 2VZLA 2Q6LA 3R6KA 1OB2A 2CRVA 5TR9A 1FRNA 4G7WA 1I7PA 2J7KA 3QSYA 4X06A 3CCUB 4YHBA 2V7QA 4GQNA 4FN5A 3OW7A 1B2RA 3BCDA 4K1XA 4YAWA 3OP1A 1QGYA 1G7RA 4LC0A 4LBVA 4RD2A 3ZZTA 1HZEA 4XKWA 1DDIA 1DG1G 2XNJA 4MYUA 1JJ2B 1UD5A 3LQ6A 3LO8A 3U6BA 2WYRA 4ACBA 2WJYA 1DDGA 2BM1A 1VQ5B 2YWGA 1KJZA 1GVHA 4ZCIA 1R5NA 1S4MA 4XKVA 3LVBA 3AVXA 2DETA 1P4MA 3CD6B 3CCQB 1QUEA 1N07A 3A8JA 4TMWA 4J0QA 3ASQA 4TMTA 2QTLA 3OFNA 1EP2B 2BM0A 4ZV4A 4FXUA 1ZUNB 1H42A 2CC2A 1PJ6A 4RD1A 3I1FA 5GV7A 2X6WA 3A8KA 2BGIA 1Y0RA 1EFUA 3WXMA 2RC5A 1QFZA 4XOPA 4B3GA 3NE5B 3V76A 3LNNA 2HCJB 2HDNB 1NRKA 3BQJA 4B3XA 1GAQA 2DY1A 3BY1A 1ZM3A 4PC1A 2ZL6A 4RDKA 2PMDA 2WZPP 4Q7JB 3ZC3A 1NB9A 3V7AA 3AVTA 3WBJA 3OAAA 4XLAA 4UAJA 3B8HA 2B7BA 4P2NA 1J9ZA 1VHEA 2QA4B 1VQ9B 3W2HA 4X07A 1QUFA 4YXWA 5TY0A 1IJFA 1HVXA 2YWFA 3WBKA 2PIAA 1QVFB 1VQMB 2V7VA 2WZNA 4RM0A 1VQLB 2BN4A 3E1YE 4FWTA 1TUIA 4PC6A 2E1BA 2DIEA 3SLNA 3PUMA 2V4DA 2OBSA 5DSZA 4HIZA 4N3GA 1VQNB 4P3IA 4RD6A 3CCVB 3PA2A 3W2EA 1SM4A 4OPVA 4NNJA 5H5JA 2F1LA 1EXMA 1E3ZA 1WTHD 1IHMA 1G7CA 4M53A 5F4OA 2Q6KA 3QFRA 4RDLA 3W5UA 4LBYA 4QUZA 3SJZA 2JJ1A 2D3NA 3WQZA 4B43A 5BSXA 2QEXB 3JQRA 4TMZA 3GVLA 4Z4ZA 1KK3A 4RD4A 2ZTNA 1UD8A 1OGIA 3A35A 4G7XA 4RCYA 1K9MD 3DDYA 1I18A 1FNMA 1HA3A 2C77A 1E3XA 4P6VF 4ZGNB 4PAAA 1Q7YD 2X6YA 2ZXHA 4II3A 4XNFA 1FX0A 3G71B 5FA6A 2DERA 1B23P 1QX4A 1TVCA 1W0JA 5IYPA 1QH0A 4OPOA 3H9NA 1S0UA 2KVOA 4XLEA 2C5HA 1T6YA 4C0SA 3OJXA 1DARA 4G6IA 4KKSA 2Q6OA 3VNVA 5JBQA 1PKVA 4TN1A 4X7EA 1Q9SA 4XONA 1JNYA 3GSIA 2Q6IA 4UZFA 1BQEA 2JIZA 3AGPA 2DOGA 3WY9A 4M2LA 4QFMA 4UZEA 2PE3A 3CRZA 4XOTA 1E1QA 3KEWA 4Z4TA 1KD1D 4E0FA 3WNDA 1ZM9A 5A89A 1YJWB 1UD6A 4XORA 1FNBA 4RD3A 4WQMA 4XLCA 2YWEA 1VQ8B 1XFOA 1Q82D 1VJSA 2CK3A 1VF7A 1YLOA 2VBSA 3CC2B 3VNUA 2C4TA 3MCAA 1T6ZA 2GJRA 2GK6A 2ZTGA 4P9SA 3BY2A 2V31A 3Q39A 3W2FA 2OBRA 3ZZ0A 5IYQA 4RPDA 4Z4YA 5FIUA 4Z4VA 4Y9RA
chains in the Genus database with same CATH topology
2DYIA 2DOGA 3H9NA 2QGGA 3A1PA 2F1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYI A;  2DOG A;  3H9N A;  2QGG A;  3A1P A;  2F1L A; 
#chains in the Genus database with same CATH topology
 5HZA A;  3VR6 A;  3Q38 A;  3LQE A;  4OP7 A;  3PVD A;  4ASU A;  1WOR A;  1MRZ A;  2C5B A;  5E6T A;  3A8I A;  2V7U A;  5HZB A;  4EH1 A;  3QE2 A;  1NB0 A;  2QTZ A;  4LBZ A;  3JU4 A;  3OJW A;  2ZBU A;  4BPR A;  4XD7 A;  2ZL5 A;  1R5B A;  3CPW B;  1W35 A;  3ISX A;  1ZM4 A;  1WOS A;  5F4M A;  4Z4R A;  5KNL A;  1F60 A;  2NV4 A;  2YWH A;  1WDT A;  1YI2 B;  2M5S A;  3CCE B;  1WU8 A;  4R71 A;  1AMO A;  3FJO A;  1D1N A;  2D74 A;  1G7T A;  4QHY A;  3SLD A;  4WWV A;  4HE6 A;  3MMP A;  4M1K A;  2VNK A;  2OYN A;  4XN3 A;  3PEN A;  4MYT A;  3BH4 A;  1M90 D;  4Z4U A;  5KW9 A;  1E64 A;  4PC3 A;  4B3F X;  2C4U A;  2EIX A;  1K8A D;  2BPO A;  4II2 A;  3WYA A;  1QGZ A;  1PJ5 A;  2BF4 A;  4OOX A;  3U6K A;  2JN9 A;  2XZO A;  5H59 A;  1FND A;  1AIP A;  4B48 A;  2BMW A;  5IYW A;  2LZJ A;  2V7X A;  3CB4 A;  4AC9 A;  1Q81 D;  4L8J A;  1SKQ A;  4M0L A;  4P6Y A;  2ZBV A;  4IW3 B;  1GAW A;  1VLO A;  4TMV A;  1W87 A;  1D2E A;  2FX3 A;  2X53 S;  1N0U A;  1G7S A;  2ZZF A;  1UD3 A;  1GR1 A;  4KKT A;  2C78 A;  4ACA A;  3ONU A;  1BX0 A;  1W9X A;  1M1K D;  1YHQ B;  3AGQ A;  3CMA B;  4DNT B;  2QN6 A;  1EFR A;  4DQK A;  2E1R A;  3ASR A;  3CPX A;  1E1R A;  1BMF A;  1KK0 A;  2DYI A;  2X8K A;  3OEH A;  4Z1M A;  4QVJ A;  3OW2 B;  3CCJ B;  3CTA A;  1QG0 A;  5FL7 A;  3T56 B;  1S72 B;  4YAL A;  1T6X A;  2X85 A;  4Y7C A;  3BNW A;  2F43 A;  4DK0 A;  1A8P A;  2P3M A;  4P26 A;  5J35 A;  4OOS A;  3QFS A;  5FO0 A;  1EWY A;  4PGO A;  1GO2 A;  4PC2 A;  4JMQ A;  3D26 A;  3Q6R A;  5IYR A;  1NJI D;  4DK1 A;  5DS0 A;  3G4S B;  2F4N A;  4FK8 A;  4ZCL A;  1V0F A;  1H8E A;  4ZGQ B;  1OB5 A;  1WOO A;  2WR8 A;  2QMU A;  1ELO A;  3CXC B;  1YIT B;  2HMA A;  3U2Q A;  3AVY A;  4M4S A;  2X3U A;  3PA1 A;  4RDJ A;  3FPK A;  2VBV A;  3VO2 A;  4F7D A;  5B6I A;  2GRE A;  4P12 A;  1VQP B;  4AVZ A;  2XNC A;  3VO1 A;  1CQX A;  1QVG B;  3CCM B;  1KC8 D;  2V7W A;  4YEJ A;  5DN6 A;  4Z4S A;  2V7T A;  1V5V A;  3OZW A;  2EFG A;  2RC6 A;  3Q3A A;  4PAB A;  2Z6B D;  2OTL B;  3GVJ A;  2OK8 A;  2QDX A;  3W5H A;  1IB0 A;  1BPL A;  4WZT A;  1IJE A;  2GJP A;  4U9U A;  3OZV A;  3GQB A;  1YX2 A;  4UZU A;  5TRD A;  3QFC A;  3A1P A;  1KZL A;  4PC7 A;  3CW2 A;  3CP8 A;  3HAG A;  2BVN A;  3SEJ A;  4X7D A;  1BJK A;  1KRH A;  3JQP A;  2X0K A;  2OK7 A;  2R6H A;  4H9G A;  1JA1 A;  4RD0 A;  3CC7 B;  2QE7 A;  2FVG A;  1V0E A;  2CW5 A;  2JJ2 A;  3T53 B;  2OBT A;  5CDF A;  1PJ7 A;  4Z4W A;  1YIJ B;  1FNC A;  1T5E A;  1EFC A;  4XN0 A;  1WPC A;  3VMF A;  2D3L A;  3RY8 A;  3AVU A;  3CES A;  4P3Y A;  4XL9 A;  3GVK A;  3OKX A;  4B4D A;  1UD4 A;  1E79 A;  2BGJ A;  4G1B A;  4RPB A;  1VQO B;  3Q6Q A;  4QVA A;  2NPF A;  3I55 B;  5A88 A;  3GIR A;  1WP6 A;  1NDH A;  1RQP A;  3CCS B;  1NBM A;  3ASS A;  1WSV A;  2WSS A;  2GJK A;  2VNH A;  1JB9 A;  1CNF A;  4RJL A;  3G6E B;  1EP3 B;  4OPS A;  2QGG A;  1MAB A;  3P26 A;  3QFT A;  4TKO B;  4X7F A;  1I8D A;  3ASP A;  1K73 D;  1W2B B;  3CME B;  1XB2 A;  2DCU A;  1XQB A;  1WSR A;  2ZXI A;  1VQK B;  4ROX A;  2ZZE A;  4AF7 A;  2B7C A;  3ZIA A;  5A8A A;  3W2G A;  5LMZ A;  5AN9 A;  4NCN A;  4KKU A;  3J81 k;  3B78 A;  1COW A;  2VBU A;  5TV2 A;  2XOK A;  1OB0 A;  4X0C A;  4HE5 A;  2F1M A;  3PUN A;  1N8R D;  3CCR B;  1VLY A;  2C2W A;  4ZCM A;  1KK1 A;  4LBW A;  1F20 A;  1Q86 D;  2WJV A;  1UD2 A;  3G05 A;  5F4J A;  4WZE A;  4YAO A;  2CBX A;  5KSW B;  2W6J A;  1YJ9 B;  3SKB A;  1K28 D;  2XND A;  4P1V A;  5L46 A;  3BC9 A;  2JDI A;  4NBS A;  3OPO A;  4X8I A;  3OOC A;  1CNE A;  3AVV A;  2I1L A;  3ES9 A;  1FRQ A;  3E20 A;  2ZZQ A;  5FO1 A;  3W5V A;  4RLZ A;  4DNR B;  4XLF A;  1VQ6 B;  2D9R A;  2ZIT A;  2VJI A;  1W34 A;  1GJR A;  2CND A;  1BX1 A;  3BCF A;  3FPP A;  4RCZ A;  3I56 B;  5HKK A;  1QFJ A;  1WOP A;  3FKS A;  3SJP A;  4WZL A;  1OGJ A;  1E63 A;  2X6X A;  3ZBT A;  4YAF A;  1OHH A;  3A3B A;  1EFT A;  1KTV A;  2BV3 A;  2HLD A;  5J3O A;  4B47 A;  1E43 A;  4WZK A;  2CF4 A;  3AST A;  4P22 A;  1TLL A;  3R6J A;  1QFY A;  4G1V A;  2OTJ B;  2VYQ A;  3WNC A;  3CC4 B;  2DEU A;  1SKY B;  3MHP A;  4OOV A;  1Y0Y A;  2GK7 A;  5IK2 A;  1D8T A;  1N08 A;  2VNI A;  3ONY A;  2PLF A;  4B44 A;  4YEL A;  4G5G A;  2ZL7 A;  1QGA A;  4N3N A;  2VNJ A;  2W6I A;  1TTT A;  2WPD A;  3ZPN A;  3H94 A;  1ZM2 A;  2AHO A;  5FNZ A;  4C43 A;  5EMN A;  1N06 A;  3WNB A;  1XE1 A;  4CQJ A;  2R9V A;  1FDR A;  5THX A;  2XZP A;  5GV8 A;  3JQQ A;  4TT3 A;  1VQ4 B;  3AVW A;  1R5O A;  3OEE A;  3ZUG A;  4YAU A;  5HXB A;  1JA0 A;  1KK2 A;  4P25 A;  4X7C A;  4XLH A;  1N0V C;  2XZL A;  2B5O A;  2GQF A;  3CMM A;  3A3G A;  4XMY A;  4XQF A;  2GPJ A;  4QV2 A;  4TMX A;  2VBT A;  1H8H A;  1E62 A;  3ZBU A;  2BSA A;  1KQS B;  3B82 A;  1BLI A;  4DQL A;  3KL9 A;  2VJJ A;  1RQR A;  4XM3 A;  5BSY A;  4XR6 A;  3OZU A;  2XEX A;  1YJN B;  1W0K A;  3P27 A;  3ZZU A;  1UMK A;  4Y9U A;  4X05 A;  2XGJ A;  4AF6 A;  3T51 B;  1N05 A;  3CP2 A;  5IYN A;  3W2I A;  1KMH A;  1U2R A;  3OE7 A;  4TSF A;  3CCL B;  1EP1 B;  2ZZG A;  1VQ7 B;  1VHO A;  1H85 A;  2VZL A;  2Q6L A;  3R6K A;  1OB2 A;  2CRV A;  5TR9 A;  1FRN A;  4G7W A;  1I7P A;  2J7K A;  3QSY A;  4X06 A;  3CCU B;  4YHB A;  2V7Q A;  4GQN A;  4FN5 A;  3OW7 A;  1B2R A;  3BCD A;  4K1X A;  4YAW A;  3OP1 A;  1QGY A;  1G7R A;  4LC0 A;  4LBV A;  4RD2 A;  3ZZT A;  1HZE A;  4XKW A;  1DDI A;  1DG1 G;  2XNJ A;  4MYU A;  1JJ2 B;  1UD5 A;  3LQ6 A;  3LO8 A;  3U6B A;  2WYR A;  4ACB A;  2WJY A;  1DDG A;  2BM1 A;  1VQ5 B;  2YWG A;  1KJZ A;  1GVH A;  4ZCI A;  1R5N A;  1S4M A;  4XKV A;  3LVB A;  3AVX A;  2DET A;  1P4M A;  3CD6 B;  3CCQ B;  1QUE A;  1N07 A;  3A8J A;  4TMW A;  4J0Q A;  3ASQ A;  4TMT A;  2QTL A;  3OFN A;  1EP2 B;  2BM0 A;  4ZV4 A;  4FXU A;  1ZUN B;  1H42 A;  2CC2 A;  1PJ6 A;  4RD1 A;  3I1F A;  5GV7 A;  2X6W A;  3A8K A;  2BGI A;  1Y0R A;  1EFU A;  3WXM A;  2RC5 A;  1QFZ A;  4XOP A;  4B3G A;  3NE5 B;  3V76 A;  3LNN A;  2HCJ B;  2HDN B;  1NRK A;  3BQJ A;  4B3X A;  1GAQ A;  2DY1 A;  3BY1 A;  1ZM3 A;  4PC1 A;  2ZL6 A;  4RDK A;  2PMD A;  2WZP P;  4Q7J B;  3ZC3 A;  1NB9 A;  3V7A A;  3AVT A;  3WBJ A;  3OAA A;  4XLA A;  4UAJ A;  3B8H A;  2B7B A;  4P2N A;  1J9Z A;  1VHE A;  2QA4 B;  1VQ9 B;  3W2H A;  4X07 A;  1QUF A;  4YXW A;  5TY0 A;  1IJF A;  1HVX A;  2YWF A;  3WBK A;  2PIA A;  1QVF B;  1VQM B;  2V7V A;  2WZN A;  4RM0 A;  1VQL B;  2BN4 A;  3E1Y E;  4FWT A;  1TUI A;  4PC6 A;  2E1B A;  2DIE A;  3SLN A;  3PUM A;  2V4D A;  2OBS A;  5DSZ A;  4HIZ A;  4N3G A;  1VQN B;  4P3I A;  4RD6 A;  3CCV B;  3PA2 A;  3W2E A;  1SM4 A;  4OPV A;  4NNJ A;  5H5J A;  2F1L A;  1EXM A;  1E3Z A;  1WTH D;  1IHM A;  1G7C A;  4M53 A;  5F4O A;  2Q6K A;  3QFR A;  4RDL A;  3W5U A;  4LBY A;  4QUZ A;  3SJZ A;  2JJ1 A;  2D3N A;  3WQZ A;  4B43 A;  5BSX A;  2QEX B;  3JQR A;  4TMZ A;  3GVL A;  4Z4Z A;  1KK3 A;  4RD4 A;  2ZTN A;  1UD8 A;  1OGI A;  3A35 A;  4G7X A;  4RCY A;  1K9M D;  3DDY A;  1I18 A;  1FNM A;  1HA3 A;  2C77 A;  1E3X A;  4P6V F;  4ZGN B;  4PAA A;  1Q7Y D;  2X6Y A;  2ZXH A;  4II3 A;  4XNF A;  1FX0 A;  3G71 B;  5FA6 A;  2DER A;  1B23 P;  1QX4 A;  1TVC A;  1W0J A;  5IYP A;  1QH0 A;  4OPO A;  3H9N A;  1S0U A;  2KVO A;  4XLE A;  2C5H A;  1T6Y A;  4C0S A;  3OJX A;  1DAR A;  4G6I A;  4KKS A;  2Q6O A;  3VNV A;  5JBQ A;  1PKV A;  4TN1 A;  4X7E A;  1Q9S A;  4XON A;  1JNY A;  3GSI A;  2Q6I A;  4UZF A;  1BQE A;  2JIZ A;  3AGP A;  2DOG A;  3WY9 A;  4M2L A;  4QFM A;  4UZE A;  2PE3 A;  3CRZ A;  4XOT A;  1E1Q A;  3KEW A;  4Z4T A;  1KD1 D;  4E0F A;  3WND A;  1ZM9 A;  5A89 A;  1YJW B;  1UD6 A;  4XOR A;  1FNB A;  4RD3 A;  4WQM A;  4XLC A;  2YWE A;  1VQ8 B;  1XFO A;  1Q82 D;  1VJS A;  2CK3 A;  1VF7 A;  1YLO A;  2VBS A;  3CC2 B;  3VNU A;  2C4T A;  3MCA A;  1T6Z A;  2GJR A;  2GK6 A;  2ZTG A;  4P9S A;  3BY2 A;  2V31 A;  3Q39 A;  3W2F A;  2OBR A;  3ZZ0 A;  5IYQ A;  4RPD A;  4Z4Y A;  5FIU A;  4Z4V A;  4Y9R A; 
#chains in the Genus database with same CATH homology
 2DYI A;  2DOG A;  3H9N A;  2QGG A;  3A1P A;  2F1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...