4DNRB

Crystal structure of the cusba heavy-metal efflux complex from escherichia coli, e716f mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
322
structure length
322
Chain Sequence
b'ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein CusB
publication title Crystal structures of the pre-extrusion and extrusion states of the CusBA adaptor-transporter complex
rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 56
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00529 HlyD HlyD membrane-fusion protein of T1SS
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4dnrB02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dnrB03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 4dnrB01
2K32A 2L5TA 2JEAI 1OXVA 2QF7A 1DCZA 4JBWA 1Y69U 1B9MA 4DK1A 2JEBI 1GUTA 3WDNA 4H0LC 3SE0A 1E2ZA 1H9MA 4DNTB 2K7VA 2PCFB 1Q1BA 4XTCS 1PMRA 2B8FA 2JXMB 2AUJD 2EVBA 3DXJC 3OW7A 3VR5A 4I7ZC 4IQZA 2Q8IB 1A6XA 3LNNA 3AB9A 1Y8PB 3FPPA 3H94A 3ND9A 4HR7B 1OXTA 1GJXA 2DNCA 1BDOA 3U9SA 5KNCA 2V4DA 4KMUC 3CRKC 3FMCA 3IKJA 1V43A 3T53B 4TKOB 3D31A 4G7OC 4G7ZC 1IW7D 4KKSA 4OGQC 1E2WA 1VF5C 3NE5B 1Q90A 2E76C 4DNRB 1H9SB 3D4RA 5BN3A 5JEAH 4OO1H 3CRLC 2A6HD 2BDOA 2D5DA 1IW7C 2EJGC 4KI0A 1G291 4G7HC 1H9SA 1ZYRC 3T51B 1TU2B 4IFDG 2A6HC 3GQBA 4KN4C 1K8OA 4KKUA 2NN6H 4BA1I 1CTMA 3M4YA 1HQMC 2E75C 3OOCA 2DNEA 2AWOA 1TKWB 3VR2A 1CFMA 1H9JA 5K36H 1QJOA 2CW0C 3ND8A 3L7ZC 2AUKA 5C0XH 2R6GA 2A6ED 3BG3A 1ONLA 2KA7A 3TZUA 2EJFC 3A8JE 4TQUS 1I6VC 2B8GA 2A68D 1Q12A 1Y8NB 3PUYA 1GHKA 1OXUA 3A8IE 3I4LA 3PUXA 3VR3A 4GZYC 2ZT9C 3LWUA 1SMYC 2A6EC 1ZKOA 1EWHA 3PUZA 2BA1A 3PV0A 1CI3M 1LACA 2A68C 2IT1A 2K33A 3MFYA 1FYCA 2NN6I 3VA7A 3KLRA 1YNNC 3OPOA 3I72A 2D2CC 5BN4A 2O5JC 1Z6HA 1IYUA 1HTPA 2JE6I 3M85A 2PPBC 1LABA 3QG1A 3MXUA 4L8JA 1GUOA 3A8KE 1Q1EA 2EDGA 3M7NA 3I73A 3QJYA 5JEAG 4OO1G 1Y8OB 1O7LA 2YYZA 4KHZA 3VR4A 2BE5D 2O5IC 3W3AA 1VCIA 1O78A 2A69D 3HGBA 1HCZA 3A7LA 4DK0A 3BDOA 1VDZA 3P20A 2DN8A 4BA2I 3SDZA 1HPCA 1H9RA 2NN6G 1H9KA 1OXXK 2BE5C 2A69C 1GHJA 4RCNA 4H13C 3VR6A 3A7AB 1B9NA 3GD7A 1FR3A 2D62A 5BN5A 1DD2A 4H44C 5K36G 1T5EA 3PUWA 5C0XG 3IFTA 1OXSC 4LJZC 4LK1C 1V8QA 2BA0A 2KCCA 3N6RA 1E2VA 2E74C 4PV1C 5KNBA 2F1MA 4KKTA 3RLFA 4KN7C 4IFDH 3EQLC 1GUSA 4XIGS 1DXMA 4JK1C 2PNRC 1GUGA 2EJMA 3QIAA 1Z7TA 1IYVA 1K8MA 1YNJC 2LMCB 3PUVA 5A35A 5KNDA 3T56B 1VF7A 1GUNA
chains in the Genus database with same CATH superfamily
1VQ9B 1B53A 2CQOA 4A3BH 4RD4A 4YELA 2B2YC 1PYWD 3QWNA 1E24A 4A3JH 4AYBG 3J7ZC 1Y1WH 3D0FA 1UD3A 1HZCA 3NXWA 4APVA 4GN3B 1VQ8B 4XYQA 1EY9A 2HT1A 2H4OA 3RN5A 5ELEA 4NXML 4TKOB 2F3VA 2K01A 5A2QL 5CBAE 1IW7D 1CA5A 1RIPA 1DONA 1E2WA 3VYUA 5KYLA 2DY8A 2ZBVA 5IT9E 3ZZ0A 3ER0A 1JJGA 4A3EH 1I5FA 1KK0A 1K83H 3LO8A 1IW7C 4QF4A 1CNEA 4Q7JB 2B2VA 4ME3A 3PF4A 2JJQA 1D2EA 5J39A 3P7JA 5ISRA 2HHHQ 3HOYB 1HQMC 1EFID 1E79A 1WOSA 4GKJL 2OYNA 4M4SA 5FA6A 3MC0B 4WJ4A 5IIFA 1QG7A 2EY2A 4ACAA 2LFNA 3U4VA 1LV9A 4BBRG 4JOIC 2RDGA 5FO8B 3GVJA 3HG9A 4A3IB 1ICWA 5IOCA 3GTJH 2PQEA 3PF5A 1UD4A 4P2CB 1EWHA 1MJCA 2Q6OA 4XR6A 2C35B 2EYMA 4HN7A 4R1JA 3U9OA 2PQAB 1WU8A 3MFYA 1QUQA 1LTSD 2HIVA 1N34Q 3HOYG 2XNJA 3WXMA 1IYUA 4K5XA 4GKJQ 5IE8A 1QGYA 2BGJA 2IJ0A 1R5OA 3FP9A 3NK9A 3J7AF 2NVYB 4C3IH 3MXUA 1X65A 2ZJPA 1VQ7B 3DHQA 3CCRA 2QTZA 1KLUD 1EWYA 2YYZA 2O2LD 2NVQH 4JYAQ 3K6OA 2BE5D 2WIIB 2WPDA 1X54A 4XXEA 4DR7L 4P1VA 1SXTA 5H1SE 2BE5C 3OIPA 3Q3AA 2RDHA 3PIPA 2VZLA 3PO2B 4XKWA 3LQEA 1SYCA 1PFSA 5FJ8G 3A7AB 4K14A 2NZOA 1VQDA 4NMZA 4BY7B 1R4PB 1EUJA 5C0XG 4LUVA 4PC6A 1FVIA 3TN2A 1A8PA 4IPHA 3S2HH 4LFBQ 4B3FX 4DV5L 4DA2A 3LGJA 1HNXQ 1Z7TA 3FKIG 3NEMA 3G4SB 4FO2A 4DR7Q 3I2ZA 1O7YA 2MP1A 3KF8A 1HUNA 2B2UA 4A3DH 2K32A 3PO2G 4X62L 4DQLA 4ZK9B 1SN8A 2I5MX 4EVOA 1PFBA 1DYQA 3S14B 4YHHQ 4O1NA 1G8ZD 3BVGA 1QVFB 4B48A 3PUNA 2ZXPA 1Q8KA 2K5NA 4LF4L 3FEWX 3ULJA 3E0JA 1CA6A 4JBMA 3CCQB 4RWSC 2KBNA 3DXJC 5C5LA 4R8NA 4QFMA 1BR9A 4L5QA 4HSPA 2Z4HA 5KNCA 4C3JB 3CCMB 1OB2A 4RMFA 4XQJA 3CP8A 4X3TA 2PMZE 1PZJD 5EJWA 1C8CA 5L46A 1ASYA 1QFYA 3NWSA 2E76C 3SXHA 1XMOQ 1B50A 1LTRD 1FNVA 4IN3A 2DOGA 2EJGC 1RD9D 3J81L 4XNFA 2VXWA 3D8GA 2QGGA 5EGTA 5IGFA 2ZTNA 2C77A 3I55A 1PDQA 4RGNA 4G57A 1F2LA 2NUCA 4O42A 1AMOA 3G6JB 3CRZA 5KGUA 5K36H 3ZJYC 5C6AA 3VO1A 1CKMA 4OO1I 1HZBA 2RCFA 3MAQA 4ROXA 1BCPD 2BVNA 1SYBA 5LMNL 5B6IA 1KZLA 3ZBUA 4LBVA 2PO4A 2RA4A 4MYTA 1IHMA 1NTGA 3PV0A 3RR5A 2NTTA 4Z4SA 1BCPC 1I3QB 3B78A 1VQ6B 4X7EA 4BXXG 4H7BA 5JVG3 2M00A 4C56C 5A2QE 2NZ1D 2J7ZA 1JR0D 4QJFA 5IY0A 1HTPA 3CKIB 1JQYD 1WTXA 2B2WA 3ZZUA 4JI0Q 4B3GA 4B9WA 1Q86D 3FPUB 1G7CA 4ZCMA 1M4VA 3UDXA 1ASZA 1N36Q 2WB1B 5H5JA 3H0GH 4DUZQ 4UHVA 2AHOB 2CK3A 2KEDA 2RCNA 4J1MA 2RF4A 2R7ZB 1Q86C 2O5IC 2WAQG 4YWKA 1H8HA 5AJ3L 5C44B 3ZBTA 4R4IA 4ULLA 2R6HA 2F0UA 2HCIA 1GHJA 3S9WA 3RN2A 3WQZA 3G71B 1Q7YD 2P3MA 1XTDA 1OTCA 3KLSX 3KJOA 4AF6A 1IBML 4NXNQ 1Q46A 2JJ1A 3AFPA 4R8IA 2F0JA 2WB1G 2E5LQ 1PH3A 4DGZA 5I6WA 5C3WA 4Z4UA 1Q7YC 4G5GA 4FNFA 2R7ZG 1F9PA 2XIWA 1T6YA 4JI3Q 2XOKA 1HTLD 3QR8A 3GSIA 1R5BA 2EYHA 1IYVA 1SKYB 2X6YA 2OCEA 3CW2C 2JEAI 2UUAQ 3CXCA 5IYQA 4A3IH 1SYDA 2X8KA 4JBWA 1VQOA 1D2BA 4OWWB 4NBSA 1WTHD 5J35A 1CUKA 4I65A 2NV4A 4DXGA 3ZIAA 1HR0L 1E2ZA 4RD1A 4WZEA 5CR3A 4B47A 1ZXTA 5FL7A 4YY3Q 1W2BB 4BWGB 3W5HA 3GO5A 4AQYQ 4CJ2C 2NVYH 2V4DA 4HIDA 1YJWA 2ZITA 3HFZB 4DF7A 3G6EA 4DR1Q 1MBYA 3CRKC 4CKBA 2F0OA 3JAMc 1OGJA 2F4NA 1LO5D 4RKBA 5CV5A 4U673 4JI2Q 3CCVB 5DSZA 2UXDL 2I0QA 4B43A 4LBZA 2QA4A 3S1NB 2A6HD 1TWCB 4QUCA 4X65Q 4YCWA 1MABA 4YAUA 2UUCL 1VQ4A 3TS2A 3S1QB 1H9SA 3PO2H 5CC4A 3OTOL 2A6HC 2X3UA 4BY7H 3PENA 2I07B 5IYCG 3TP8A 1YIJA 1NE3A 3ASPA 1BCPF 3OZVA 2EIXA 2LS01 5M5WB 2JIZA 4XLCA 1ONLA 2F03A 4TRDA 4A3KB 2QKIC 1KK2A 1GHKA 1Q12A 5C3EH 1EIFA 4ACBA 2LY7A 4R4OA 4PG3A 3VR3A 3VYTA 2L12A 1FD7D 2BH8A 3ONUA 1JB9A 2Q2UA 5J1ZA 1TLLA 2ICEC 3V96A 3S14H 1AW7A 4O2DA 2HCJB 2D2CC 3QOJA 1ZM4A 4TSSA 4GNXC 4FWTA 4PZ8A 4UZUA 5JJZA 2JA8B 2JA5H 3BH4A 3NTKA 1I4GA 1GUOA 4A3KG 2K5WA 3J80i 4C3JH 1CQVA 5I4DA 4XM3A 2Z1CA 1J8IA 1KXLA 3LWEA 2GJKA 4LBYA 1BCPB 1U2RA 2KCNA 1B3AA 1JC7A 5C3XA 3I70A 2YU9B 2DN8A 2PMZB 2LXKA 4PABA 2ZXOA 1YJNB 1CZWA 2KVOA 4X3UA 2JA6B 4YHBA 1SNCA 1NB9A 1FR3A 2MHVA 2JA8G 3RNUA 2G5DA 1HRJA 3M4OB 1T5EA 3A8IA 2XEXA 1MKHA 2N78A 5JPMC 3D4WA 4LJZC 2KCCA 5CYUA 1D7QA 3RLFA 1EY6A 2CF4A 2Q8RE 3QB3A 4HEDA 4JK1C 3HEJA 2M5SA 2OK7A 4M53A 4YXWA 1TY0A 4ID6A 1DCZA 1VQMB 4CQJA 4ZAIA 2KQ3A 4QV2A 4P73A 1GUTA 1TS2A 1NUCA 4V0BA 1I3QH 1YZ6A 1N05A 4G6IA 2B8FA 3A3BA 2JXMB 4A3GH 2AUJD 4RHRA 1FNUA 1WTPA 3CP2A 3OW7A 5DAUA 3VR5A 3Q23A 1Y8PB 1Q9SA 2XNAC 3VMFA 2MPMA 1CQFA 2K05A 5LMNW 1OGIA 2RSOA 3L3OC 2QW7A 1W6JA 2MNAA 3SJPA 1K8GA 1S72B 4K2LA 4LF5L 3OP1A 1Z47A 5HGQA 1V43A 2DJFC 2EXDA 3KYHC 4ZCKA 2R7ZH 1D5XC 3S1MB 5FO1A 1SYEA 4OX9L 1Q90A 4B4DA 4LWCA 2E2DC 5C44H 4DV4Q 2NTSA 1G51A 2D0PA 3CESA 1JORA 2XVSA 1A3UA 2IHFA 4B3TL 2IY5B 1KAAA 4P74A 2OXPA 3NBHA 4NKLA 3EFXD 2B63G 3T51B 4DR5L 2K4KA 3GTMB 1KK3A 5JVH3 4Y9UA 2IL8A 2GPJA 1K3BC 1MHWC 2CH4W 5CBEE 2DCUA 3VR2A 3RMHA 5HXBA 2ZXIA 2UXCL 1LLRD 1V9PA 5IP7G 4JI4L 5CORA 4HCEA 3PUYA 2K5DA 3OMGA 4HJ5A 3B8HA 4U9UA 1IXRA 3T4AC 3KF6A 2F0MA 2W6IA 4K6DA 2NB0A 4KLKA 1V1PA 1L0WA 4DR5Q 4AYBE 4DR4L 3BYYB 1TWFB 4WJWA 3WNDA 1S5ED 2ALYB 5EMNA 4E0FA 3CCSB 4K8IA 3DWAA 1QG0A 1A2UA 1CQXA 5IWAL 1XMQL 3BZDB 5F4JA 1QOHA 1Y8OB 4X64Q 3AEVA 4KHZA 1HR0W 1ENAA 3S2DB 4KY6A 5IYCH 4RLZA 1GOZA 3WNBA 1UD6A 3HGBA 1VMPA 4Y52H 4HJ9A 2K50A 1MJEA 2NN6G 2IW3A 3ES9A 1TWCH 4DR4Q 2YWEA 2UU9Q 4S3SA 4RCNA 2RKSA 4JI8Q 3S1QH 1GO3E 1VQIA 1DD2A 2VNUD 1K0RA 4DR2L 2V7VA 3FPKA 1TXYA 4IFDJ 1YLOA 4R4QA 5IWAQ 1X55A 1T5XD 3CC4B 1TWGB 1W87A 1LTAD 1KC8C 1VQHA 1U9RA 3OW2A 3J81c 3RZOH 5JBQA 4EQOA 5A35A 2Q8TA 3PA1A 2B7CA 1U0LA 1GUNA 4PMBA 3T1HQ 3CB4A 1K9MD 1QZGA 1L1OC 1FNCA 3BZCA 3Q6QA 3P26A 1COWA 2F0FA 3VDYA 4GKKL 4IUQA 2R93B 4ASUA 2EFGA 4QVAA 1K9MC 4JC0A 1DG1G 3CC2A 4ZKBB 4G7XA 4IQZA 2N49A 1GXDC 2PLFA 1Q81D 1NCVA 4KTAA 3ZPNA 4LMQD 2JA8H 1GAQA 1UMKA 3K0YA 2V7QA 3OJWA 5EPKA 2QDXA 4M2LA 2F0KA 3EJIA 4DV0L 1Q81C 4J15A 2C9OA 1F20A 5TRDA 3HKZB 2YU9H 1FGUA 1VMCA 4X66L 2RDFA 1M1KD 1NAPA 2JA6H 3W2FA 1SROA 4IOCA 3S17B 1SJHD 1JA1A 2D3NA 3Q6RA 4II3A 2Z6KA 3EA6A 4GOPA 1LTID 3M4OH 3S16B 2CWAA 1M1KC 2NZHA 3OOCA 1GD7A 4P26A 1DGSA 1TKWB 3QSYA 4CDEC 5M3MB 1C7YA 3FKSA 4KY7A 2JP1A 1BBXC 3HKZG 4X07A 2R6GA 4GLVB 1K28D 1PZID 1MSHA 3A8JE 4TQUS 3RY8A 1JJ2A 1UD2A 5FO0A 1I4QA 3A0JA 1STBA 2F43A 3CCJA 1WFQA 4WQMA 1XYIA 3N52A 3ZZTA 2JA7G 1CI3M 2N88A 2MQHA 1N33Q 2JK8A 1EY5A 5M5XB 4IPDA 5F4OA 4RDLA 2L55A 2V7UA 1RODA 1CSQA 5CGKA 2CVRA 4G7WA 3G7LA 2BN4A 1EU4A 1EWIA 2KVMA 4F87A 3A8KE 1EIYB 1MIUA 4UY8C 1XNQQ 2VUMG 3M7NA 5TR9A 5IYWA 1G91A 4ME5A 4LC0A 2F0LA 1LUZA 3UI2A 1RQRA 4A3LH 1WOPA 2WJVA 1O78A 2DGYA 4EQ5A 3GVKA 1PZKD 2F4VQ 3S1MH 1S5DD 3W1GA 4BA2I 1E62A 4RD0A 3WNCA 2K28A 1H9RA 1IBLQ 4A3CG 5GAEC 1RHPA 2A1AA 1FDRA 3D4DA 3NQIA 3NBIA 3BY1A 1S5CD 4OWXB 3CPXA 3JAML 3CPWB 1FNWA 2GJPA 5EPLA 1XJVA 2O4XA 2EQSA 1E2VA 3BZKA 1XWEA 2QDBA 1UE6A 1VQ8A 3KOJA 2WYRA 3EQLC 1FJGL 3P75A 1NSNS 1YBYA 1YHQB 2FHTA 3BC9A 2K03A 4TN1A 3U6KA 3I4MH 1PH8A 4IOAA 2QF7A 5HKKA 4B3RL 1XNRQ 4I7AA 3K5LA 5CMDA 4DV6L 3WDNA 3UDFA 4DR3Q 1HH2P 3PGZA 1AP0A 5EAYA 1CHPD 3X3NA 1O7ZA 1TWFH 2B2VC 3OWFA 4R4CA 4AYBB 1V5VA 3HOXB 3FPPA 3H94A 4X0CA 5IYRA 1CKNB 3U9SA 2ZZEA 1QE6A 1QCBD 1NY4A 3I91A 4G7OC 4TMTA 2F0IA 3ASTA 2WAQE 1BUVT 3EROA 2DY7A 3D4RA 1F9QA 1Y1VG 3QO2A 2UUBL 4F88A 1PA6A 5LHY1 1BOSA 5AFWA 3IL8A 2G9HD 1TWHH 5GADC 3HOXG 5ELFA 4IFDG 1JNYA 2IPKD 1XFOA 1II3A 4BA1I 4N9TA 2WB1E 2F0QA 3TMEA 5ELDA 3F2BA 1ENFA 3Q38A 4P25A 3TDQA 1YITB 3CU7A 3GTPB 4DV2L 4CJ0B 4A3MB 1UE7A 4IUTA 4GN5A 1G7TA 4C43A 3EIVA 1EY0A 4A4IA 1VLOA 1RDPD 3D6CA 4BBRB 2K6AA 2Z9HA 4LNQA 1QGAA 1FYCA 5C4ZA 2R93H 4UP9A 3CMMA 3U4ZA 1S3OA 5FOBB 1ESFA 4UP7A 3K57A 5GV7A 5AN9A 4A3MG 2XRSD 2CWPA 1I94L 2NWGA 2JN4A 4JI6L 4CDCC 2Y0SB 1EYGA 4XOTA 2MO0A 2WSSA 1JE4A 1IYJB 4NXMQ 4UAJA 3SK4A 2DIEA 1KNAA 2PW5A 2HUGA 5ELCA 1EP3B 3H6MA 4K6LA 3W3AA 1QH0A 3CCUA 5M3FG 2JYOA 1E1RA 1OHHA 1SNDA 3G4SA 3AVWA 2R7FA 4RDKA 2B2UC 3IRBA 4X8IA 1KK1A 3OMCA 4K5VA 1E1OA 3Q8DA 2JDIA 1OB0A 3S17H 2Y0SG 2CC2A 1QVFA 2Q2IA 2QEXA 3S24A 3S16H 3WWVA 1AE3A 1VQKA 1N06A 1CM9A 3ERQA 3C3LA 1FNBA 5M3MH 4QHYA 3U6BA 3HP3A 4K0KL 3QIAA 1K8MA 2X53S 3CCMA 5KNLA 2B2YA 3D3RA 3DMUA 4OPSA 1JB3A 2L5TA 4ZCLA 1GVPA 3FRPB 4XORA 1NR4A 3CCEB 1WCMH 2OTLA 3FKIB 4RPDA 1HNZL 3PVDA 2JEBI 3BDLA 2AMCB 1TIID 2V7WA 1B4OA 4DAYB 2ICIA 3ISXA 5M5XH 1LT4D 4JG2A 1PMRA 4JI7L 1RF2D 2VJIA 4XDXA 1SKQA 3BDCA 1U4PA 3E9IA 1X32A 3I7FA 3V2TA 4Z4ZA 5G3LD 1PFNA 1IBKL 5FNZA 2B39A 4KMUC 1PTOH 3C1FA 5JEAJ 1U4RA 4P2NA 5HY6A 3JAME 4G7ZC 4KKSA 1AE2A 1B70B 1JB7A 1VF5C 1HA5A 2KJXA 5BN3A 1HNZQ 1O7IA 2M2LA 3CF5A 2PMDA 3PIP3 1HHVA 1SR3A 1YVCA 4JI7Q 3HOUB 1PLFA 1V1QA 2M9VA 3GTQB 1NDHA 1G6ZA 3GQBA 4JCVE 3J7YW 4A93B 4BBSH 5DS0A 1J5EL 4CKEA 1CSPA 4DV5Q 2AWOA 4ZCIA 1DOKA 1DOLA 2OTJA 1I8DA 1VQ5B 1F2ZA 1EFWA 5A89A 3PMFA 2EJFC 1E22A 2B8GA 4X62Q 1BMFA 4HAEA 1HNWL 2AHOA 1EYCA 3HOUG 1QUQB 3TQYA 2SEBD 3Q0AA 1CT1D 5IYBH 4G1VA 3PUZA 2EPBA 4B9XA 1TWAB 4A93G 1HXYD 2MJ8A 2K33A 3LQ6A 5FLMH 5A88A 4LF4Q 1PH2A 1N0VC 2PE3A 4C2MH 4EQPA 2BMWA 3SVMA 5JJIA 2GK7A 3CCRB 3G71A 2WP8J 3CP0A 1D1IA 3QG1A 4B3SL 1X3GA 3OHXC 4IPCA 1EP2B 3OJXA 5C4JB 3PIO3 1E1QA 5COYA 2SDFA 1P8LA 4JBKA 5GV8A 2QGQA 1JWMD 2VQEL 1GO2A 1UD5A 4XN0A 1CNFA 1GVHA 3BDOA 1FNDA 1LT3D 4DV3L 4LBWA 5IGGA 3MXNA 2WAQB 4J8QA 3HKSA 5IP9G 3Q22A 4Z4VA 2BCOA 4WZTA 4PC2A 4PZ7A 2ZL7A 1DOMA 4WRDA 3TP6A 4DR6L 2AQ3B 4LK1C 1PH7A 1EP1B 4DNIA 1E63A 3KF8B 3A56A 4E6IA 1SDFA 3NP8A 4KN7C 3QFSA 4A3FG 3GTPH 2PNRC 4K8JA 1X6OA 4A3MH 3NUCA 1VQNB 1VF7A 3AVVA 1E0BA 5LMNQ 3QFTA 2CNDA 4F8MA 1WTRA 3F8TA 1YNXA 1EQVA 2OBSA 2W6JA 3W2IA 4BBRH 1A3VA 2ID0A 4DFAA 1UAPA 5CV8A 4FF2A 1NJID 5NUCA 1EYAA 4DR6Q 5ELOA 4GLAC 3EBEA 2L1BA 5G3LF 4I7ZC 3TS0A 1KRHA 3AGPA 1SNPA 1KL9A 1NJIC 4HR7B 4BY1B 3HOYH 3CPFA 1GR1A 1AN8A 3NTHA 4OIJA 5FO7B 4PC1A 3IKJA 4RGOS 1S40A 3PSIA 5T1GA 1JWSD 2IHEA 3LVBA 5AJ3Q 4HIKA 4P3YA 4XLFA 5JAVA 4MIUA 1T6ZA 4GQNA 2R3ZA 3E0EA 1H42A 3J80c 1FNMA 3I55B 1YJ9A 4LFAL 1KHIA 2MGSA 3KLWA 1KD1D 3K0XA 4BY1G 1IBMQ 1F2YA 4KN4C 2JJ2A 2CCZA 2CW0D 1QFJA 1H8EA 2F0EA 3BS1A 1KD1C 5FJ8H 2OK8A 4XT1B 3R8BA 2A73B 2VS1A 1X3PA 1Y0RA 2CW0C 3ND8A 4L63B 5C0XH 4PGOA 4O0AA 5JJKA 2KA7A 2FMCA 2Z6BD 4BS9A 1FL0A 3TSSA 2GREA 1P16A 4ZUIA 1VQLB 2ZT9C 5IYNA 4OEMB 1I4XA 4NDXA 1HR0Q 3CAMA 3FKIH 2L4NA 3AU7A 3KLRA 3M3YB 3MCAA 4II2A 4QIWE 1W35A 3B6YA 3TZDA 2ZZFA 2JE6I 2PPBC 1LABA 2A19A 4B3ML 2AWNA 3QE2A 2SOBA 3DM3A 4GS3A 5I2XA 2I5LX 5TY0A 3KK7A 2NVTB 1WTWA 5GROA 5JEAG 3SK6A 1GM5A 4OO1G 4Q0FA 4P6YA 1IL8A 2UXBL 1SJED 1XB2A 2CRVA 2UXDQ 4P12A 1OO9B 4M1KA 3DLLA 5E1FA 3A7LA 3H3VH 3MMPA 2IX3A 2ZZGA 1WD1A 3IAYA 2UUCQ 2ZXRA 3I3CA 4PC7A 1FX0A 3OTOQ 4H13C 3VR6A 1VQMA 3O13A 2SNSA 1SMXA 4XD7A 2JSOA 2N55A 3PUWA 2WZNA 2WKCA 2EYLA 1JT8A 1BKBA 3N6RA 3ONYA 3CXCB 1Y14B 3T16A 3SLDA 3J81E 4HMIA 4DKAC 1YNJC 1VQOB 3HKZE 1TT2A 2P5ZX 1S72A 3K80C 2RC6A 2F1LA 1G2SA 5IODA 1AH9A 3J7A5 4ALPA 2VBVA 3CCLB 1QNUA 3F2UA 4FF4A 1EY4A 3BYTB 3SE0A 1TWAH 3W2GA 3G48A 5HURA 3S1RB 2K7VA 2XWBB 1Q1BA 4LF9L 3GTGB 5I6YA 4FK8A 4Y7CA 3MVVA 1QUEA 4PZ6A 1A6XA 3G6EB 1NMFA 2DEUA 4X6AH 4MTKA 2Q6LA 5E4XA 4DUYL 1EZ8A 4BXXH 1I4RA 4QY7A 4X3KA 1S4ZA 1HZAA 2BDNA 3Q24A 1BQQT 5C4JH 1EQQA 2VBUA 2D3LA 3E9HA 3C2PA 2IX0A 1E7ZA 4Z4TA 4RKLA 4OGQC 3NE5B 3I56A 2QEJC 1H9SB 3I90A 5DN6A 4DV7L 1YX2A 1IHZA 2PZWA 2EYFA 2VL6A 3HOVB 3BY2A 4OPVA 2E2JB 1EFRA 1KJZA 3K5MA 4TSFA 1K8OA 3VA5A 2C5HA 2GK6A 4P3IA 3HOZG 1EOTA 4DUYQ 2L15A 2YTXA 1F9SA 4X7CA 3WYAA 2FFKB 2PI2E 2B63B 4JPBW 1CFMA 1EEFD 5F4MA 3K7AB 3TEHB 4G4KA 3CCSA 3MHPA 3W5VA 1SMYD 3HOWG 2E8GA 1E43A 3BG3A 4QCLA 5KW9A 2K1BA 1A3TA 5FLXL 3HOVG 1VQPA 3C1EA 1SMYC 1F77A 1ZKOA 2BA1A 2IT1A 2ASBA 3WOFA 1I18A 4YWMA 1YI2A 1R5NA 5BN4A 3OEHA 1OB5A 3ASQA 1B3QA 5I9OA 2F0PA 3VYSA 4C1NK 1XPRA 2XZOA 2E1BA 5C4XG 1SNOA 4LF5Q 1W34A 3WY9A 2F0NA 3I4NB 2ZZQA 1WTOA 3CC4A 1UE5A 2N8NA 3AGQA 5FK9C 5EKKA 4C3HG 5THXA 5FO9B 4HIOA 4OX9Q 5IK2A 1VCIA 1HCZA 4KHPL 3P20A 1BNZA 2ZBUA 1VHOA 1HPCA 4XQQA 4B3TQ 1A2TA 4QQBX 3AFQA 1BX0A 2B2TA 2HDNB 2XNDA 1L0XB 2JQOA 3L0OA 4NNJA 2WR8A 1EEID 4OPOA 4PNYA 1KDAA 3IFTA 3W2HA 3I4NG 1PV4A 1GUWA 2UXCQ 3E6ZX 4RH6A 5DNFA 2E74C 1EU3A 2ZM6L 3A5UA 1FGBD 5HZBA 1QB5D 4JI4Q 4J0QA 1GUGA 3T1YL 2BOSA 1BJKA 1SBBB 1J6QA 3J81j 2VNKA 4QL5A 4GNXB 2K5QA 4P75A 3CD6B 3S1NH 1PRTD 3F2DA 2X6LA 2MFIA 4DNTB 1Y0YA 4NB3A 4XTCS 3KL9A 1KC8D 1PRTC 3K81C 2OEOA 4TMVA 2Z6KC 4QIWB 3DDYA 3ND9A 4GOPC 1OXTA 1EZ6A 1XMQQ 1BDOA 4N8FA 1G7RA 5C5MA 3L2PA 2PW7A 3BCDA 5HGTA 5M9OA 4XN3A 2JA9A 1N9WA 3NHHA 5M5WH 1S0UA 4LUZA 4A3KH 2GJRA 1F9RA 2HIXA 2J4XA 4OWTB 3NENA 4A3JB 1IB0A 3RLOA 2KOLA 2GVBA 1I6HB 3ASSA 4JI5L 1G6PA 5IGBA 3Q6SA 3ULLA 3NELA 1TU2B 3JC66 1KMHA 5E6TA 4WORA 4XMYA 5EQ0A 4DR2Q 2ZTDA 2ATWA 1R4QB 2ENBA 4B44A 2B5OA 2Y0SE 1A8VA 2DNEA 2XN9C 3PCOB 3PQIA 4NPSA 4JI1L 1H9JA 4HMJA 1AIPA 2CHBD 1SLJA 1B2TA 2L0CA 2CH4A 4FN5A 2PIAA 4TT3A 3TZUA 4A3JG 2A68D 4L6TB 1BF4A 3EN2A 1EOVA 1K83B 2K5VA 2Z0SA 3NSWA 2RQXA 2E2IB 2VQFL 4XOPA 2EY5A 5CV7A 2A68C 1QVGB 2FJ2A 4HE5A 4TVAB 4GKKQ 1BPLA 3P27A 4EQNA 1I4PA 4OELB 1EYDA 3S1RH 2WZPP 4POFA 3GTGH 5TV2A 3GV6A 4FXGC 2JA7B 2C4UA 1O80A 1CZGA 3OZUA 2RVLA 5BSYA 4OONA 4QUFA 3ERSX 2C2WA 3MA2B 1DZ1A 4DXFA 1LTBD 4FF3A 4HIZA 4DV0Q 1WOOA 2D0OA 3VR4A 1QUFA 1GKHA 2VUMB 3KBXA 4HCSA 4N8X1 4AVZA 1YHQA 1K73D 1SE3A 4X66Q 5LMUL 3CMAA 4IURA 2BPOA 1D1NA 3VNUA 2D9UA 4LFCL 2WKDA 2E2JH 2CQAA 1K73C 3IFDA 1HZEA 1K8AD 4L5TA 1HA6A 3BU2A 3OW2B 4KY5A 3E5SA 3MEHA 4DV1L 1PJ7A 2QMUA 4RA8A 4Z9CB 3V76A 1K8AC 2B63H 3K59A 3K7AH 2C5BA 1GUSA 5J22A 3J80L 1CKNA 4XLAA 3H15A 1WOCA 1PRTF 2V7TA 1KQSB 1BVSA 1G7SA 2ZJRA 3GP7A 1A63A 4RJLA 4OHJA 3OYYA 3SGIA 4IO9A 5IP7H 1WI5A 3SR1A 2RSNA 2QTLA 3V05A 4AC9A 1JICA 4P72A 1VQ9A 4C3IG 4LF7L 4FYDA 2OBTA 2F0VA 3ZYYX 3OAAA 3S15B 1YHBA 3KFUA 1KNEA 3URYA 3J81k 2XZLA 1BBWA 3GTMH 1SEBD 3BVMA 2EZVA 1RTOA 4ZKCB 3PUMA 3A3GA 1XPUA 2XTIA 1S4MA 3A35A 4DK6C 2X6XA 4R9WA 1I7PA 3FMCA 4XKVA 1QILA 3T53B 3D31A 1STEA 3F2CA 3HS0C 5D14A 2XZPA 2AKWB 1ZYRD 2XWJB 4ZV4A 2F0WA 2F0DA 1PRTB 5IYPA 3CRLC 2R92B 3NTIA 2DETA 4GOPB 4BPRA 4KI0A 4RD3A 1ZYRC 1TVXA 1PH4A 1Y1VB 4X3SA 3A5ZB 3T13A 2WV6D 2CBXA 3VO2A 2NN6H 3KDFB 5BR8L 1KTKA 4M0LA 3NPPA 3C2QA 4A3DG 1UWVA 1FJGQ 2A74C 2FINB 3L7ZC 1ZM9A 3ASRA 4C1NI 1EQTA 1L1OB 2Q2TA 2R92G 4RDJA 4WWVA 2QDLA 3S2DH 5E3FA 4QUZA 4B3RQ 3TREA 4Z1MA 4DV6Q 4YAWA 4OXPA 5D65A 3SKBA 3D6WA 4LF6L 1TS3A 2O5JC 1Z9FA 2F52A 1Z6HA 2F4IA 1MI2A 1U4MA 3GVLA 4EX5A 2VYQA 1ET6A 2PQAA 1WDTA 3VNVA 2F3IA 5C0XI 4L8JA 1G2TA 3U58A 1TWGH 4GN4B 3OZWA 3TP7A 1X9NA 1O7LA 3GTKB 4UZFA 4JW0A 5D3DA 1VQ7A 3CMEB 2UUBQ 5D3IB 1E3ZA 3I8ZA 4LF6Q 1VQCA 1ET9A 1I6HH 3CCEA 3A8JA 5M3FB 2L11A 4HSVA 3D26A 5K36G 1W9XA 4WZKA 4PC3A 4RGTA 4DAYA 2EXZA 3UDIA 1LM0A 1V8QA 2HHHL 3SLNA 1STYA 1A15A 2C5CA 2R7DA 4NCNA 1M90D 4POGA 3H0GB 4DV2Q 1RQPA 2FVGA 3H3VI 2LMCB 2HQLA 1M90C 2CKZB 3GTOB 3T56B 2ZTCA 5J3BA 4Y7NB 4PMCA 3CC7B 4NP5A 1CKOA 3A8KA 1OXVA 1UE1A 3WBKA 2E2IH 1B9MA 1BQEA 4DK1A 3J7AV 1H9MA 1N34L 1X3QA 1TVCA 3GDEA 3ITPA 1L0YB 3H0GG 4DPGA 5FLXc 3DWPA 2IWHA 2I1LA 2VB3X 4XLEA 1W6KA 2JA7H 1LYLA 3AB9A 1I94Q 3B82A 1RTNA 1UNSA 4JI6Q 2DNCA 3CCQA 2LKVA 3PO3B 1JJCB 1QWYA 4YAOA 2QILA 3CHBD 1HZ9A 2PNHA 4OOSA 1B7YB 4HTHA 2XSCA 4DQKA 5JPNC 1PH5A 2MUYA 4JYAL 4B08A 1VQ5A 2Q2HA 1WTVA 2VUMH 1JE5A 4OL7A 1VQEA 1X3FA 1I4HA 1T9HA 4RAUC 2RBMA 2HD3A 1TS5A 2BDOA 2R61A 1MGSA 2PYKA 1M8AA 3J80E 2ZJQA 5KYIA 1WTQA 3R2IA 1V1OA 1W0JA 1NNXA 4KD4A 1UEBA 1TR5A 3PO3G 4A3CH 4Y9RA 2E75C 4HJ7A 1EIHA 2LSSA 1VQFA 4LFBL 3OWEB 4A3IG 4UPAA 4K1XA 1QJOA 4K0KQ 2AUKA 1HNXL 2NVXB 4A76A 1U4LA 4HJ8A 2F0SA 3I1FA 1IZ6A 2VW9A 3HRZC 1D1KA 5KRUA 4FXDA 2VY3A 1Q82D 1CK1A 5LL6X 1AFPA 4H02A 3MWYW 1P4MA 2Z4IA 2VNHA 2XGTA 2C78A 4UDUC 4XLHA 3VA7A 4YHHL 2K5HA 3I72A 1Q82C 4IW3B 1N07A 2K04A 1PYBA 1NB0A 3KBGA 2IX1A 3S15H 4J6HA 4Q5VA 1VQ6A 3FJOA 2I5HA 1R9TB 2NPFA 2BV3A 3ZUGA 2H1EA 1IBKQ 2B2WC 3H09A 4JOIA 4RCYA 4RM0A 4CDDC 4PMWA 4V190 3CCUB 5EKIA 4HIMA 1DJRD 4KV6A 3BCFA 5C3EB 3DEOA 5E7NA 2OQ0A 1RL2A 2LXJA 1VDZA 3Q39A 5ELBA 2C4TA 1XMOL 1VQNA 4BY7G 2R92H 3NQTA 1C9OA 4MHEA 2QEXB 1VQKB 1ILQA 1Y1VH 2Z8LA 3EVQA 1J5EQ 1DARA 1PVOA 2JA5B 1IKMA 5C3EG 2R9VA 3W5UA 5KNBA 3PIOA 4KKTA 3HOXH 1RKNA 4IFDH 2YWFA 1B23P 1DXMA 1EFCA 4XIGS 4IJHA 1J9ZA 1HFGA 2OTLB 1HNWQ 4X7FA 4OOXA 1PJ6A 1UUPA 1D5ZC 3JQPA 2F0HA 2VZAA 2QN6A 4A3FB 1KTVA 2G9DA 1Y69U 1KDBA 4RD6A 1WORA 3A74A 3M7GA 1QVCA 2JA5G 2B3GA 1XQBA 1EY7A 3X3MA 4L5SA 3BJUA 4C3JG 1SE2A 1W3SA 2YV5A 1W0KA 4CBVA 2Q8IB 1SYFA 3A54A 4B3SQ 2EOTA 3I4OA 2KHJA 4JI0L 1W2BA 3R3OA 4TMXA 2EY1A 3QFRA 1ENCA 5E4WC 1WYDA 1N36L 4DUZL 3GTKH 1S5FD 1N0UA 2VQEQ 3MHBA 2MO1A 4XT3B 1N32L 1KIXA 4RPBA 1JA0A 5IT9c 4DV3Q 4MZ9A 5M5YB 4Z4RA 4DNRB 2E1RA 4EGVA 4CJ1B 2L9HA 2ZL5A 4DAPA 3CCVA 1VQLA 5KSWB 4K5WA 5IYDG 5CV6A 1PH6A 4A3GB 5M3FH 1ZEQX 2HDMA 2YWHA 2KECA 2DUDA 2OTJB 1CTMA 1LTGD 3M4QA 3M4YA 4NXNL 5L37A 2E5LL 1JOQA 2K75A 2XGJA 2HQEA 3CTAA 1UEAB 3MFGA 4RG1A 4JI3L 1HJPA 1LTLA 1N32Q 2F0TA 4TMZA 4B3XA 3GTOH 4Y7NH 4IPGA 5T1IA 1OXUA 3A8IE 4PQXA 2DY1A 2UUAL 4G1BA 4A3GG 1J9OA 1VQJA 2X69A 4FF1A 2WACA 1TY2A 4P22A 3BVZA 1EWCA 4YY3L 1ICFB 3F1ZA 3H9NA 4N9PA 3AYHB 1VQBA 4AQYL 1QZHA 3BNWA 3FDTA 1STNA 2EDGA 1FRQA 2HLDA 2NBFA 3I73A 3PO3H 5C44G 1K3RA 4DR1L 3R93A 1D5MC 1DM0B 4K2KA 2A69D 3MXNB 3W5OA 4JI2L 1B1ZA 4WZLA 4DK0A 4IUNA 3SDZA 3MEFA 4LFAQ 1H9KA 3SK8A 2A69C 4MTNA 5I9PA 4X65L 1SSOA 3FHWA 1X56A 3CCLA 5GAGC 2D62A 4IUPA 4OIKA 2YWGA 4CKCA 3K5NA 3NWTA 1YJNA 2BA0A 3R6JA 2OQKA 1YHAA 2X6GA 3AQQA 1HA3A 2QCPX 4LUOA 1PJ5A 1F2MA 2BH2A 2KUMA 2EJMA 4MN3A 2NVXH 2E2HB 1B8AA 1JCKB 1SNMA 4KJOA 1KLGD 3SHLA 4KD3A 3K8AA 2V7XA 1LT6D 1SAPA 4DU9A 4R4TA 3R6KA 4IALA 1Q3LA 3HOUH 3GTQH 4B3MQ 1V0FA 4A93H 2KENA 4RGMA 1F60A 1MD2D 1YNJD 1R9TH 3RZOB 1WSRA 4IJLA 4YALA 3LX0A 1KAWA 3CW2A 2RHQB 1ZM2A 2UXBQ 1XTCD 2VBSA 1YJ9B 3RLNA 2EYOA 1UD8A 1DDIA 1C0AA 4IUUA 1AZQA 1WPCA 3KLSA 4G7HC 4HE6A 1WTHA 2N3SA 2VJJA 3E1YE 2A5HA 3FVQA 3SEBA 2HMAA 1D8TA 1JOOA 2TSSA 3TP5A 1YJWB 2GVAA 1VQAA 4JBJA 4GLXA 3OIQA 1LT5D 1RJTA 5IP9H 3QOLA 1VJSA 1Q8IA 3HOZB 5CV4A 1FRNA 2F0GA 4TMWA 2QA4B 3RUZA 2RC5A 1I6VC 1I50B 1XE1A 5FIUA 2Z6BA 4CHTB 3SJZA 1VQ4B 3HOWB 4A3FH 2KCMA 4DAMA 1H85A 4OP7A 3M9BA 5J3OA 4LF9Q 2NN6I 4YCVA 3JAMi 5GAHC 2B2TC 4ABNA 4YIJA 3R2TA 1PH9A 1YIJB 3G05A 2KEEA 3CQZB 5IYDH 1EFTA 3MXPA 3UE0A 4NW2A 4DK3C 2X85A 4ILWA 2PZUA 1XPOA 4IZ8A 4QVJA 2AQ2B 1WSVA 5C4XB 5LL6S 2JA6G 1QX4A 4DV7Q 2VBTA 2J0TD 2BM1A 5CDFA 1VS0A 3GIRA 4CGYB 5M5YH 3M4PA 4DV4L 4C3HB 4DN4M 3V7AA 1B44D 2KHSA 1BBUA 4RD2A 1XXGA 4GNXA 4KHVA 1DDGA 2Q6IA 3CD6A 3GD7A 1E3XA 2PZTA 4ZRZA 4H44C 3TRZA 4QB4A 4P71A 1PXUA 1SFOB 4X7DA 5C4HA 2TMPA 4BY1H 3RZDB 5FKAC 4XL9A 5BSXA 3GTLB 2SNMA 2ES2A 2EE1A 3PUVA 4RCOA 4R71A 5DEHA 3W1BA 1PH1A 4M1UB 4FXKC 4AH6A 5EKLA 5A8AA 2DERA 3JQRA 4RHSA 2BGIA 4LF8L 1SYGA 1VHEA 2D74A 1GAWA 3AVXA 5ELNA 4XYOA 1AEXA 2PCFB 4YCUA 4F7DA 2WINB 3KUPA 4L5RC 1AZPA 1EIGA 3LNNA 4A3LG 3VYRA 1U5KA 2XRQD 1GJXA 4P6VF 4XQNA 3JU4A 2F3WA 5DM73 1IJEA 3I56B 3UE1A 1SE4A 4FVMA 1PTOD 3OE7A 1KRSA 5KEEA 4X64L 4C0SA 1NBWA 2NYZD 4ZQ3A 2X0KA 2XNCA 3OKXA 1SM4A 2GA4B 3I4MB 4KHPQ 3E20A 5IGDA 2OWOA 3K7UC 4LF8Q 1PTOC 1TS4A 5JEAH 4OO1H 1QGZA 4XONA 3BQJA 5TSSA 1XX8A 1E3PA 3KJPA 1TQOA 1EY8A 2UU9L 2EYJA 5I2YA 4JI8L 4EH1A 1QVGA 1QNKA 3M3YH 3MZ5A 4KKUA 4ZLTF 3TBIB 1PYSB 1SRUA 4WJ3M 2ZM6Q 4ODGA 3U50C 1MRZA 1BLIA 3AVTA 4FXUA 1D8LA 3I4MG 4UP8A 4FDBA 2BSAA 2NVTH 1VQPB 1STAA 3T1YQ 3C46A 3WBJA 1HUMA 1NR2A 2V1CC 2E2HH 4MYUA 1NRKA 2CFMA 4A3BB 3I4LA 4XQFA 4JMQA 1YNND 3LWUA 2BF4A 1YI2B 3AVYA 5KIXA 3NBHB 2CW5A 4PAAA 1PKVA 4M8AA 3T1HL 3ZC3A 1LACA 1TWHB 5DLQE 1HVXA 1YEZA 1LTTD 1Y1WB 1IJFA 2D9RA 1YNNC 1SE8A 1EFUA 3A1PA 3M85A 4A75A 3RD4A 1PHJA 1B2RA 1JWUD 1L2FA 4P9SA 3W2DA 2QE7A 4A3BG 4Z4YA 2K52A 1D6EC 3A55A 5JJLA 3KF6B 2ZL6A 4WFN3 2PI2A 3OEEA 4UAIA 1Y1WG 1V1PB 2BM0A 1KQSA 4A3EB 1STHA 4JI5Q 1V0EA 3QFCA 3JQQA 2LZJA 1ESRA 4UZEA 3SEJA 3K5OA 5LMZA 5BN5A 2OF1A 3ULPA 2VNIA 1BX1A 5F2DA 2B7BA 5IT9L 4JI1Q 2KHIA 4YWLA 3CPWA 1H95A 1A0IA 1KABA 2FXQA 1WVLA 2WJYA 3HOZH 1CHQD 4A3EG 4LW1A 1I50H 2R93G 2FX3A 4N3GA 3GTJB 1TTTA 2VQFQ 1NBMA 3HOWH 3STBD 2A8VA 4H0LC 2DYIA 4AF7A 1N33L 3HOVH 2I46A 2YTVA 3SK5A 1ZUNB 2EVBA 3STBC 1ELOA 1C48A 2DJGC 3OSOA 3P1HA 5FLXE 1PTOF 3ONAB 4C3IB 4IFDI 1KDCA 3CQZH 1S5BD 1NMGA 3KDFA 1XNQL 2NVQB 1KRTA 3K58A 4KK7A 5JOBA 5K5PA 1E1TA 4H9GA 5C4XH 4YAFA 5LMUQ 2JN9A 1WCMB 1L1OA 3DWQA 2HCCA 2F4VL 1EL0A 4LFCQ 1X3EA 2D5DA 4C3HH 3CC2B 4F7XA 3J81i 4FP5D 1G291 1IBLL 1VQGA 3HAGA 4AIMA 5M3MG 2X6WA 2H5XA 4RFBA 4DV1Q 3S2HB 2ZTEA 1ILPA 3MTSA 5C0XJ 1E64A 3U2QA 1SFOH 4ZGQB 2AQ1B 1ZM3A 1VLYA 5HZAA 3UDGA 1PTOB 3W2EA 3RZDH 1HQRD 1WCMG 2EYPA 1IKLA 2VB2X 2A6ED 1IL2A 3GTLH 3I4NH 1WD0A 5H59A 4ZGNB 3DEPA 5IGCA 4A3DB 1YITA 2J7KA 1Y8NB 4GZYC 2RHSB 4OOVA 3PUXA 2OBRA 1JMCA 3OFNA 2A6EC 1N8RD 4QMGA 3CMEA 4LF7Q 1XNRL 4LAAA 1WJJA 1GJRA 3H91A 2V31A 4DR3L 3OPOA 1ML0D 4BBSB 3DM1A 4ZUJA 1N8RC 2ZTGA 2VNJA 2OT2A 2B29A 1PFMA 4JVZA 1STGA 4ZYSA 4Z4WA 1HFNA 4JV5L 5EPJA 1Q1EA 2ZXHA 1K0SA 2GN5A 3QJYA 4QGUA 1N08A 3WOEA 1JJ2B 5DM63 3CMAB 4IUVA 2EIFA 3E3XA 5CV9A 4HJAA 2K14A 4YEJA 3CCJB 1MSGA 1K28A 4CDFC 4N3NA 1A62A 1QFZA 1TUIA 5EBCA 1EXMA 1SNQA 2GQFA 2EY6A 4BBSG 1OXXK 4RCZA 3PA2A 3CC7A 4DAVA 4C2MB 3AMUA 1JOKA 3H3VC 2FMMA 1B9NA 2KCTA 5GQOA 1EQRA 4U68A 2HDLA 5BR8Q 4X06A 4X05A 2WFWA 4MNOA 1OXSC 4JV5Q 2Q6KA 3MXGA 1BO0A 5IGEA 4PV1C 1T6XA 2F1MA 4KJNA 3DUZA 1WP6A 3HZXA 2YTYA 3AVUA 3GV3A 1C4QA 1BXTA 5EBDA 5IYBG 3L9AX 3KEWA 1RCVD 5KNDA 5FLMG 3ICEA
chains in the Genus database with same CATH topology
1B53A 4YELA 2B2YC 1PYWD 3QWNA 1UD3A 3NXWA 4XYQA 1EY9A 2H4OA 5ELEA 4TKOB 2F3VA 2K01A 5A2QL 5CBAE 1IW7D 1CA5A 1DONA 1E2WA 3VYUA 5KYLA 2DY8A 5IT9E 1IW7C 4QF4A 2B2VA 5J39A 3P7JA 5ISRA 3HOYB 1HQMC 1EFID 1E79A 3MC0B 5IIFA 1QG7A 2EY2A 2LFNA 1LV9A 2RDGA 5FO8B 3GVJA 3HG9A 4A3IB 1ICWA 5IOCA 2PQEA 1UD4A 4P2CB 1EWHA 4XR6A 3U9OA 2EYMA 4HN7A 3MFYA 1LTSD 1IYUA 4K5XA 2IJ0A 3NK9A 3J7AF 2NVYB 3MXUA 3DHQA 1KLUD 2YYZA 2O2LD 3K6OA 2BE5D 2WIIB 2WPDA 4XXEA 1SXTA 2BE5C 3OIPA 2RDHA 3PO2B 4XKWA 1SYCA 3A7AB 4K14A 4NMZA 4BY7B 1R4PB 5C0XG 3TN2A 4B3FX 4DA2A 1Z7TA 4FO2A 3KF8A 1O7YA 2MP1A 1HUNA 2B2UA 2K32A 4ZK9B 4EVOA 1PFBA 1DYQA 3S14B 4O1NA 1G8ZD 3BVGA 2ZXPA 3FEWX 3E0JA 1CA6A 4RWSC 3DXJC 5C5LA 4R8NA 1BR9A 4HSPA 2Z4HA 5KNCA 4C3JB 4XQJA 3CP8A 4X3TA 1PZJD 5EJWA 1C8CA 3NWSA 2E76C 3SXHA 1B50A 1LTRD 1FNVA 4IN3A 2EJGC 1RD9D 3J81L 4XNFA 2VXWA 3D8GA 5EGTA 5IGFA 2ZTNA 1PDQA 4RGNA 4G57A 1F2LA 2NUCA 4O42A 3G6JB 5KGUA 5K36H 5C6AA 4OO1I 3MAQA 1BCPD 1SYBA 1KZLA 2PO4A 2RA4A 3PV0A 2NTTA 1BCPC 1I3QB 4H7BA 5JVG3 2M00A 4C56C 5A2QE 2NZ1D 2J7ZA 1JR0D 1HTPA 3CKIB 1JQYD 1WTXA 2B2WA 4B3GA 4B9WA 3FPUB 1M4VA 2WB1B 2CK3A 2KEDA 4J1MA 2R7ZB 2O5IC 1H8HA 5C44B 4ULLA 2F0UA 2HCIA 1GHJA 3S9WA 3WQZA 3KLSX 2JJ1A 4R8IA 2F0JA 4DGZA 5I6WA 5C3WA 4FNFA 1F9PA 2XIWA 2XOKA 1HTLD 2EYHA 1IYVA 1SKYB 2X6YA 2JEAI 1SYDA 2X8KA 4JBWA 1D2BA 1WTHD 4DXGA 4I65A 3ZIAA 1E2ZA 5CR3A 1ZXTA 5FL7A 4BWGB 3GO5A 4CJ2C 2V4DA 4DF7A 1MBYA 3CRKC 4CKBA 2F0OA 4U673 1LO5D 4RKBA 5CV5A 3S1NB 2A6HD 1TWCB 4QUCA 1MABA 3S1QB 1H9SA 5CC4A 2A6HC 2I07B 3TP8A 1BCPF 2LS01 5M5WB 2JIZA 4XLCA 1ONLA 2F03A 4TRDA 4A3KB 2QKIC 1GHKA 1Q12A 2LY7A 3VR3A 3VYTA 2L12A 1FD7D 5J1ZA 2ICEC 3V96A 1AW7A 2D2CC 3QOJA 4TSSA 4UZUA 5JJZA 2JA8B 3BH4A 3NTKA 1I4GA 1GUOA 2K5WA 5I4DA 1CQVA 4XM3A 2Z1CA 1J8IA 3LWEA 2GJKA 1BCPB 2KCNA 1B3AA 1JC7A 5C3XA 3I70A 2YU9B 2DN8A 2PMZB 2ZXOA 1CZWA 4X3UA 2KVOA 2JA6B 1SNCA 1FR3A 2MHVA 1HRJA 3M4OB 1T5EA 5JPMC 3D4WA 4LJZC 2KCCA 5CYUA 3RLFA 1EY6A 2Q8RE 3QB3A 4JK1C 4HEDA 3HEJA 2M5SA 4YXWA 1TY0A 4ID6A 1DCZA 4ZAIA 2KQ3A 1GUTA 1TS2A 1NUCA 4V0BA 4G6IA 2B8FA 3A3BA 2JXMB 2AUJD 4RHRA 1FNUA 1WTPA 5DAUA 3CP2A 3OW7A 3VR5A 3Q23A 1Y8PB 2XNAC 2MPMA 1CQFA 2K05A 2RSOA 3L3OC 1W6JA 4K2LA 1Z47A 1V43A 1D5XC 3S1MB 1SYEA 1Q90A 2E2DC 2NTSA 3CESA 1JORA 2XVSA 1A3UA 1KAAA 2OXPA 3NBHA 4NKLA 3EFXD 3T51B 3GTMB 5JVH3 2IL8A 5CBEE 3VR2A 3RMHA 2ZXIA 1LLRD 5CORA 4HCEA 3PUYA 2K5DA 3OMGA 3T4AC 2F0MA 2W6IA 4K6DA 2NB0A 1V1PA 3BYYB 1TWFB 4WJWA 1S5ED 4K8IA 4E0FA 3DWAA 1A2UA 3BZDB 1QOHA 1Y8OB 4KHZA 1ENAA 3S2DB 4KY6A 1GOZA 1UD6A 3HGBA 1VMPA 2NN6G 2IW3A 4S3SA 4RCNA 2RKSA 1DD2A 2VNUD 4IFDJ 1T5XD 1TWGB 1LTAD 1U9RA 4EQOA 5A35A 2Q8TA 1GUNA 4PMBA 1COWA 2F0FA 2R93B 4IUQA 4ASUA 4ZKBB 4G7XA 4IQZA 1GXDC 4LMQD 1NCVA 4KTAA 3ZPNA 3K0YA 2V7QA 5EPKA 2F0KA 3EJIA 2C9OA 3HKZB 1VMCA 2RDFA 1NAPA 3S17B 1SJHD 2D3NA 4II3A 3EA6A 1LTID 3S16B 3OOCA 1TKWB 5M3MB 3FKSA 4KY7A 2JP1A 1BBXC 2R6GA 1K28D 1PZID 1MSHA 3A8JE 4TQUS 1UD2A 1I4QA 1STBA 2F43A 1XYIA 3N52A 1CI3M 2N88A 1EY5A 5M5XB 2L55A 1RODA 5CGKA 2CVRA 4G7WA 3G7LA 1EU4A 4F87A 2KVMA 3A8KE 3M7NA 1G91A 4ME5A 2F0LA 3UI2A 2WJVA 1O78A 3GVKA 1PZKD 1S5DD 4BA2I 2K28A 1H9RA 1RHPA 3D4DA 3NQIA 3NBIA 1S5CD 3JAML 1FNWA 2GJPA 5EPLA 2O4XA 1E2VA 1XWEA 2QDBA 3EQLC 3P75A 1NSNS 2FHTA 3BC9A 2K03A 2QF7A 5HKKA 3K5LA 5CMDA 3WDNA 1AP0A 1CHPD 3X3NA 1O7ZA 2B2VC 3OWFA 4AYBB 3HOXB 3FPPA 3H94A 3U9SA 2ZZEA 1QE6A 1QCBD 3I91A 4G7OC 2F0IA 1BUVT 3EROA 2DY7A 3D4RA 1F9QA 3QO2A 4F88A 5LHY1 1BOSA 5AFWA 3IL8A 2G9HD 5ELFA 4IFDG 2IPKD 1II3A 4BA1I 4N9TA 2F0QA 3TMEA 5ELDA 1ENFA 3TDQA 3CU7A 3GTPB 4CJ0B 4A3MB 4IUTA 1EY0A 3D6CA 1RDPD 4BBRB 2K6AA 1FYCA 5C4ZA 3CMMA 5FOBB 1ESFA 3K57A 2XRSD 2NWGA 2Y0SB 4XOTA 2WSSA 1JE4A 3SK4A 2DIEA 1KNAA 2PW5A 2HUGA 5ELCA 3H6MA 4K6LA 3W3AA 2JYOA 1E1RA 1OHHA 1SNDA 2B2UC 3OMCA 4K5VA 2JDIA 1OB0A 3ERQA 1CM9A 3C3LA 3HP3A 3QIAA 1K8MA 2X53S 5KNLA 2B2YA 3D3RA 3DMUA 1JB3A 2L5TA 3FRPB 4XORA 1NR4A 3FKIB 2JEBI 3BDLA 1TIID 1B4OA 2ICIA 1LT4D 1PMRA 1RF2D 2VJIA 4XDXA 3BDCA 1U4PA 1X32A 3V2TA 5G3LD 1PFNA 2B39A 4KMUC 1PTOH 3C1FA 5JEAJ 1U4RA 3JAME 4G7ZC 4KKSA 1VF5C 1HA5A 2KJXA 5BN3A 2M2LA 3PIP3 1HHVA 3HOUB 1PLFA 2M9VA 3GTQB 1G6ZA 3GQBA 3J7YW 4A93B 4CKEA 2AWOA 1DOKA 1DOLA 1I8DA 1F2ZA 3PMFA 2EJFC 2B8GA 1BMFA 4HAEA 1EYCA 2SEBD 3Q0AA 1CT1D 3PUZA 2EPBA 4B9XA 1TWAB 1HXYD 2MJ8A 2K33A 4EQPA 3SVMA 2GK7A 2WP8J 1D1IA 3QG1A 3OHXC 5C4JB 3PIO3 1E1QA 5COYA 2SDFA 1JWMD 1UD5A 4XN0A 3BDOA 1LT3D 5IGGA 3MXNA 2WAQB 4J8QA 3Q22A 2BCOA 4WRDA 1DOMA 3TP6A 2AQ3B 4LK1C 3A56A 4E6IA 1SDFA 3NP8A 4KN7C 2PNRC 4K8JA 3NUCA 1E0BA 1VF7A 4F8MA 1WTRA 1EQVA 2W6JA 1A3VA 2ID0A 4DFAA 1UAPA 5CV8A 4FF2A 5NUCA 1EYAA 2L1BA 5G3LF 4I7ZC 1SNPA 4HR7B 4BY1B 1AN8A 3NTHA 4OIJA 5FO7B 3IKJA 4RGOS 5T1GA 1JWSD 4XLFA 5JAVA 4MIUA 4GQNA 2R3ZA 2MGSA 1F2YA 4KN4C 2JJ2A 2CW0D 1H8EA 2F0EA 3BS1A 4XT1B 3R8BA 2A73B 1X3PA 3ND8A 2CW0C 4L63B 5C0XH 2KA7A 2FMCA 2Z6BD 4BS9A 3TSSA 4ZUIA 2ZT9C 1I4XA 4NDXA 2L4NA 3AU7A 3KLRA 3M3YB 4II2A 3TZDA 2ZZFA 2JE6I 2PPBC 1LABA 2AWNA 2SOBA 5I2XA 3KK7A 2NVTB 1WTWA 5JEAG 3SK6A 4OO1G 4Q0FA 1IL8A 1SJED 1OO9B 5E1FA 3A7LA 2IX3A 2ZZGA 1WD1A 3IAYA 2ZXRA 3I3CA 1FX0A 4H13C 3VR6A 3O13A 2SNSA 4XD7A 2JSOA 2N55A 3PUWA 2WKCA 2EYLA 3N6RA 3T16A 3J81E 4HMIA 1YNJC 1TT2A 1G2SA 5IODA 1QNUA 3F2UA 4FF4A 1EY4A 3BYTB 3SE0A 5HURA 3S1RB 2K7VA 2XWBB 1Q1BA 3GTGB 5I6YA 3MVVA 1A6XA 5E4XA 1EZ8A 1I4RA 4X3KA 1S4ZA 2BDNA 3Q24A 1BQQT 2D3LA 3C2PA 2IX0A 4RKLA 4OGQC 3NE5B 2QEJC 1H9SB 3I90A 5DN6A 1IHZA 2PZWA 2EYFA 3HOVB 2E2JB 1EFRA 3K5MA 4TSFA 1K8OA 3VA5A 2GK6A 1EOTA 1F9SA 2FFKB 2B63B 1CFMA 1EEFD 3K7AB 4G4KA 1SMYD 1E43A 3BG3A 4QCLA 2K1BA 1A3TA 5FLXL 3C1EA 1SMYC 1F77A 1ZKOA 2BA1A 2IT1A 3WOFA 1I18A 5BN4A 3OEHA 5I9OA 2F0PA 3VYSA 4C1NK 2XZOA 2E1BA 1SNOA 2F0NA 3I4NB 2ZZQA 1WTOA 5FK9C 5EKKA 4C3HG 5FO9B 5IK2A 1VCIA 1HCZA 3P20A 1BNZA 1HPCA 4XQQA 1A2TA 2B2TA 2XNDA 1L0XB 4NNJA 1EEID 4PNYA 1KDAA 3IFTA 1GUWA 3E6ZX 4RH6A 5DNFA 2E74C 1EU3A 1FGBD 1QB5D 1GUGA 2BOSA 1SBBB 2K5QA 1PRTD 2X6LA 4DNTB 4XTCS 1PRTC 2OEOA 4QIWB 3DDYA 3ND9A 1OXTA 1EZ6A 1BDOA 5C5MA 2PW7A 3BCDA 5HGTA 5M9OA 4XN3A 3NHHA 2GJRA 1F9RA 2J4XA 4A3JB 2KOLA 1I6HB 5IGBA 3Q6SA 1TU2B 4WORA 1KMHA 5EQ0A 4XMYA 1R4QB 2ENBA 2DNEA 2XN9C 1H9JA 4HMJA 2CHBD 1B2TA 2L0CA 4TT3A 3TZUA 2A68D 4L6TB 1BF4A 1K83B 3NSWA 2RQXA 2E2IB 4XOPA 2EY5A 5CV7A 2A68C 2FJ2A 1BPLA 4EQNA 1I4PA 1EYDA 2WZPP 3GV6A 4FXGC 2JA7B 1O80A 1CZGA 2RVLA 4QUFA 3MA2B 1DZ1A 4DXFA 1LTBD 4FF3A 4HIZA 3VR4A 2VUMB 3KBXA 4HCSA 4AVZA 1SE3A 4IURA 2D9UA 2WKDA 2CQAA 3IFDA 1HZEA 1HA6A 4KY5A 3E5SA 3MEHA 4RA8A 4Z9CB 3K59A 1GUSA 3J80L 5J22A 4XLAA 1PRTF 3GP7A 4OHJA 3SR1A 2RSNA 3V05A 1JICA 4C3IG 4FYDA 2F0VA 3ZYYX 3OAAA 3S15B 1KNEA 3URYA 2XZLA 1SEBD 3BVMA 2EZVA 1RTOA 4ZKCB 3A3GA 3A35A 2X6XA 4R9WA 3FMCA 4XKVA 1QILA 3T53B 3D31A 1STEA 3HS0C 5D14A 2XZPA 1ZYRD 2XWJB 2F0WA 2F0DA 1PRTB 2R92B 3CRLC 3NTIA 4KI0A 1ZYRC 1TVXA 1Y1VB 4X3SA 3T13A 2WV6D 2NN6H 1KTKA 3NPPA 2A74C 2FINB 3L7ZC 4C1NI 1EQTA 5E3FA 4Z1MA 5D65A 3D6WA 1TS3A 2O5JC 2F4IA 1Z6HA 1MI2A 1U4MA 3GVLA 1ET6A 5C0XI 4L8JA 1G2TA 3TP7A 1O7LA 3GTKB 5D3DA 5D3IB 1E3ZA 3I8ZA 1ET9A 5M3FB 2L11A 4HSVA 5K36G 1W9XA 4RGTA 4DAYA 2EXZA 1V8QA 1STYA 1A15A 2C5CA 3H0GB 2LMCB 3GTOB 3T56B 4Y7NB 4PMCA 4NP5A 1OXVA 1B9MA 4DK1A 3J7AV 1H9MA 1X3QA 3ITPA 1L0YB 3DWPA 2IWHA 2VB3X 4XLEA 1W6KA 3AB9A 1RTNA 1UNSA 2DNCA 2LKVA 3PO3B 3CHBD 1QWYA 4HTHA 2QILA 2XSCA 5JPNC 2MUYA 4B08A 1WTVA 4OL7A 1I4HA 4RAUC 2RBMA 2R61A 1TS5A 2BDOA 1MGSA 2PYKA 1M8AA 3J80E 5KYIA 1WTQA 3R2IA 1V1OA 1W0JA 4KD4A 1TR5A 2E75C 1EIHA 3OWEB 1QJOA 2AUKA 2NVXB 1U4LA 2F0SA 3HRZC 1D1KA 5KRUA 4FXDA 1AFPA 1CK1A 5LL6X 3MWYW 2Z4IA 4UDUC 4XLHA 3VA7A 3I72A 2K04A 2IX1A 3KBGA 4J6HA 4Q5VA 1R9TB 2H1EA 2B2WC 3H09A 4V190 4PMWA 5EKIA 1DJRD 4KV6A 3BCFA 5C3EB 3DEOA 1VDZA 5ELBA 3NQTA 4MHEA 1ILQA 2Z8LA 3EVQA 2JA5B 1IKMA 2R9VA 5KNBA 4KKTA 1RKNA 4IFDH 4XIGS 1DXMA 1HFGA 1UUPA 1D5ZC 2F0HA 4A3FB 2G9DA 1Y69U 1KDBA 3M7GA 3X3MA 1EY7A 4C3JG 1SE2A 1W0KA 4CBVA 2Q8IB 1SYFA 3A54A 2EOTA 3R3OA 2EY1A 1ENCA 5E4WC 1S5FD 3MHBA 4XT3B 5M5YB 4DNRB 4EGVA 4CJ1B 2L9HA 4DAPA 4K5WA 4A3GB 5CV6A 1ZEQX 2HDMA 2KECA 1JOQA 1CTMA 1LTGD 3M4YA 2XGJA 2HQEA 1UEAB 3MFGA 2F0TA 5T1IA 1OXUA 3A8IE 4PQXA 1J9OA 2X69A 4FF1A 2WACA 1TY2A 4P22A 3BVZA 1EWCA 4N9PA 3FDTA 1STNA 2EDGA 2HLDA 2NBFA 3I73A 3R93A 1D5MC 1DM0B 4K2KA 2A69D 1B1ZA 4DK0A 4IUNA 3SDZA 1H9KA 3SK8A 2A69C 5I9PA 1SSOA 2D62A 4IUPA 4OIKA 4CKCA 3K5NA 3NWTA 2BA0A 2X6GA 2QCPX 1F2MA 2KUMA 2EJMA 4MN3A 2E2HB 1JCKB 1SNMA 4KJOA 1KLGD 3SHLA 4KD3A 1LT6D 1SAPA 4DU9A 4IALA 1Q3LA 1V0FA 4RGMA 1MD2D 1YNJD 3RZOB 3LX0A 1XTCD 2EYOA 1UD8A 4IUUA 1AZQA 1WPCA 3KLSA 4G7HC 2VJJA 2A5HA 3FVQA 3SEBA 1JOOA 3TP5A 2TSSA 3OIQA 1LT5D 1RJTA 3QOLA 1VJSA 1Q8IA 3HOZB 5CV4A 2F0GA 3RUZA 1I50B 1I6VC 4CHTB 3HOWB 2NN6I 2B2TC 4ABNA 4YIJA 3R2TA 3G05A 2KEEA 3CQZB 3MXPA 4NW2A 2X85A 4ILWA 2PZUA 4IZ8A 2AQ2B 5C4XB 5LL6S 2J0TD 5CDFA 4CGYB 4C3HB 4DN4M 1B44D 2KHSA 1XXGA 4KHVA 3GD7A 1E3XA 2PZTA 4ZRZA 4H44C 4QB4A 1PXUA 1SFOB 5C4HA 2TMPA 3RZDB 5FKAC 4XL9A 3GTLB 2SNMA 2EE1A 3PUVA 4RCOA 5DEHA 4M1UB 4FXKC 5EKLA 4RHSA 1SYGA 4XYOA 1AEXA 2PCFB 2WINB 3KUPA 1AZPA 1EIGA 3LNNA 3VYRA 2XRQD 1GJXA 4XQNA 3JU4A 2F3WA 5DM73 1SE4A 4FVMA 1PTOD 3OE7A 5KEEA 2NYZD 4ZQ3A 2GA4B 3I4MB 5IGDA 1PTOC 1TS4A 5JEAH 4OO1H 4XONA 5TSSA 1XX8A 1TQOA 1EY8A 2EYJA 5I2YA 1QNKA 3MZ5A 4KKUA 4ZLTF 3TBIB 4ODGA 1BLIA 4FXUA 1STAA 3C46A 1HUMA 1NR2A 1NRKA 4A3BB 3I4LA 4XQFA 4JMQA 1YNND 3LWUA 5KIXA 4M8AA 1PKVA 1LACA 1TWHB 1HVXA 1LTTD 1Y1WB 1YNNC 3M85A 3RD4A 1JWUD 3W2DA 2QE7A 1D6EC 3A55A 4WFN3 3OEEA 4UAIA 1V1PB 4A3EB 1STHA 1V0EA 2LZJA 1ESRA 3K5OA 5BN5A 2OF1A 5F2DA 5IT9L 1KABA 1WVLA 2WJYA 1CHQD 3GTJB 1NBMA 4H0LC 2I46A 3SK5A 2EVBA 1C48A 3OSOA 5FLXE 3P1HA 4C3IB 1PTOF 3ONAB 4IFDI 1KDCA 1S5BD 2NVQB 3K58A 4KK7A 5JOBA 5K5PA 1WCMB 3DWQA 2HCCA 1EL0A 2D5DA 4F7XA 4FP5D 1G291 3HAGA 2X6WA 4RFBA 3S2HB 1ILPA 3MTSA 5C0XJ 2AQ1B 1VLYA 1PTOB 1HQRD 2EYPA 1IKLA 2VB2X 2A6ED 1WD0A 3DEPA 5IGCA 4A3DB 1Y8NB 4GZYC 3PUXA 3OFNA 2A6EC 4QMGA 4LAAA 3H91A 2V31A 3OPOA 1ML0D 4BBSB 3DM1A 4ZUJA 2ZTGA 2OT2A 1PFMA 1STGA 4ZYSA 1HFNA 5EPJA 1Q1EA 2ZXHA 3QJYA 3WOEA 5DM63 4IUVA 5CV9A 4YEJA 1MSGA 5EBCA 1SNQA 2EY6A 1OXXK 4DAVA 4C2MB 3AMUA 1JOKA 3H3VC 2FMMA 1B9NA 4U68A 2HDLA 1OXSC 3MXGA 1BO0A 5IGEA 4PV1C 2F1MA 4KJNA 3DUZA 1WP6A 3HZXA 3GV3A 5EBDA 1C4QA 1BXTA 3L9AX 3KEWA 1RCVD 5KNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K32 A;  2L5T A;  2JEA I;  1OXV A;  2QF7 A;  1DCZ A;  4JBW A;  1Y69 U;  1B9M A;  4DK1 A;  2JEB I;  1GUT A;  3WDN A;  4H0L C;  3SE0 A;  1E2Z A;  1H9M A;  4DNT B;  2K7V A;  2PCF B;  1Q1B A;  4XTC S;  1PMR A;  2B8F A;  2JXM B;  2AUJ D;  2EVB A;  3DXJ C;  3OW7 A;  3VR5 A;  4I7Z C;  4IQZ A;  2Q8I B;  1A6X A;  3LNN A;  3AB9 A;  1Y8P B;  3FPP A;  3H94 A;  3ND9 A;  4HR7 B;  1OXT A;  1GJX A;  2DNC A;  1BDO A;  3U9S A;  5KNC A;  2V4D A;  4KMU C;  3CRK C;  3FMC A;  3IKJ A;  1V43 A;  3T53 B;  4TKO B;  3D31 A;  4G7O C;  4G7Z C;  1IW7 D;  4KKS A;  4OGQ C;  1E2W A;  1VF5 C;  3NE5 B;  1Q90 A;  2E76 C;  4DNR B;  1H9S B;  3D4R A;  5BN3 A;  5JEA H;  4OO1 H;  3CRL C;  2A6H D;  2BDO A;  2D5D A;  1IW7 C;  2EJG C;  4KI0 A;  1G29 1;  4G7H C;  1H9S A;  1ZYR C;  3T51 B;  1TU2 B;  4IFD G;  2A6H C;  3GQB A;  4KN4 C;  1K8O A;  4KKU A;  2NN6 H;  4BA1 I;  1CTM A;  3M4Y A;  1HQM C;  2E75 C;  3OOC A;  2DNE A;  2AWO A;  1TKW B;  3VR2 A;  1CFM A;  1H9J A;  5K36 H;  1QJO A;  2CW0 C;  3ND8 A;  3L7Z C;  2AUK A;  5C0X H;  2R6G A;  2A6E D;  3BG3 A;  1ONL A;  2KA7 A;  3TZU A;  2EJF C;  3A8J E;  4TQU S;  1I6V C;  2B8G A;  2A68 D;  1Q12 A;  1Y8N B;  3PUY A;  1GHK A;  1OXU A;  3A8I E;  3I4L A;  3PUX A;  3VR3 A;  4GZY C;  2ZT9 C;  3LWU A;  1SMY C;  2A6E C;  1ZKO A;  1EWH A;  3PUZ A;  2BA1 A;  3PV0 A;  1CI3 M;  1LAC A;  2A68 C;  2IT1 A;  2K33 A;  3MFY A;  1FYC A;  2NN6 I;  3VA7 A;  3KLR A;  1YNN C;  3OPO A;  3I72 A;  2D2C C;  5BN4 A;  2O5J C;  1Z6H A;  1IYU A;  1HTP A;  2JE6 I;  3M85 A;  2PPB C;  1LAB A;  3QG1 A;  3MXU A;  4L8J A;  1GUO A;  3A8K E;  1Q1E A;  2EDG A;  3M7N A;  3I73 A;  3QJY A;  5JEA G;  4OO1 G;  1Y8O B;  1O7L A;  2YYZ A;  4KHZ A;  3VR4 A;  2BE5 D;  2O5I C;  3W3A A;  1VCI A;  1O78 A;  2A69 D;  3HGB A;  1HCZ A;  3A7L A;  4DK0 A;  3BDO A;  1VDZ A;  3P20 A;  2DN8 A;  4BA2 I;  3SDZ A;  1HPC A;  1H9R A;  2NN6 G;  1H9K A;  1OXX K;  2BE5 C;  2A69 C;  1GHJ A;  4RCN A;  4H13 C;  3VR6 A;  3A7A B;  1B9N A;  3GD7 A;  1FR3 A;  2D62 A;  5BN5 A;  1DD2 A;  4H44 C;  5K36 G;  1T5E A;  3PUW A;  5C0X G;  3IFT A;  1OXS C;  4LJZ C;  4LK1 C;  1V8Q A;  2BA0 A;  2KCC A;  3N6R A;  1E2V A;  2E74 C;  4PV1 C;  5KNB A;  2F1M A;  4KKT A;  3RLF A;  4KN7 C;  4IFD H;  3EQL C;  1GUS A;  4XIG S;  1DXM A;  4JK1 C;  2PNR C;  1GUG A;  2EJM A;  3QIA A;  1Z7T A;  1IYV A;  1K8M A;  1YNJ C;  2LMC B;  3PUV A;  5A35 A;  5KND A;  3T56 B;  1VF7 A;  1GUN A; 
#chains in the Genus database with same CATH topology
 1VQ9 B;  1B53 A;  2CQO A;  4A3B H;  4RD4 A;  4YEL A;  2B2Y C;  1PYW D;  3QWN A;  1E24 A;  4A3J H;  4AYB G;  3J7Z C;  1Y1W H;  3D0F A;  1UD3 A;  1HZC A;  3NXW A;  4APV A;  4GN3 B;  1VQ8 B;  4XYQ A;  1EY9 A;  2HT1 A;  2H4O A;  3RN5 A;  5ELE A;  4NXM L;  4TKO B;  2F3V A;  2K01 A;  5A2Q L;  5CBA E;  1IW7 D;  1CA5 A;  1RIP A;  1DON A;  1E2W A;  3VYU A;  5KYL A;  2DY8 A;  2ZBV A;  5IT9 E;  3ZZ0 A;  3ER0 A;  1JJG A;  4A3E H;  1I5F A;  1KK0 A;  1K83 H;  3LO8 A;  1IW7 C;  4QF4 A;  1CNE A;  4Q7J B;  2B2V A;  4ME3 A;  3PF4 A;  2JJQ A;  1D2E A;  5J39 A;  3P7J A;  5ISR A;  2HHH Q;  3HOY B;  1HQM C;  1EFI D;  1E79 A;  1WOS A;  4GKJ L;  2OYN A;  4M4S A;  5FA6 A;  3MC0 B;  4WJ4 A;  5IIF A;  1QG7 A;  2EY2 A;  4ACA A;  2LFN A;  3U4V A;  1LV9 A;  4BBR G;  4JOI C;  2RDG A;  5FO8 B;  3GVJ A;  3HG9 A;  4A3I B;  1ICW A;  5IOC A;  3GTJ H;  2PQE A;  3PF5 A;  1UD4 A;  4P2C B;  1EWH A;  1MJC A;  2Q6O A;  4XR6 A;  2C35 B;  2EYM A;  4HN7 A;  4R1J A;  3U9O A;  2PQA B;  1WU8 A;  3MFY A;  1QUQ A;  1LTS D;  2HIV A;  1N34 Q;  3HOY G;  2XNJ A;  3WXM A;  1IYU A;  4K5X A;  4GKJ Q;  5IE8 A;  1QGY A;  2BGJ A;  2IJ0 A;  1R5O A;  3FP9 A;  3NK9 A;  3J7A F;  2NVY B;  4C3I H;  3MXU A;  1X65 A;  2ZJP A;  1VQ7 B;  3DHQ A;  3CCR A;  2QTZ A;  1KLU D;  1EWY A;  2YYZ A;  2O2L D;  2NVQ H;  4JYA Q;  3K6O A;  2BE5 D;  2WII B;  2WPD A;  1X54 A;  4XXE A;  4DR7 L;  4P1V A;  1SXT A;  5H1S E;  2BE5 C;  3OIP A;  3Q3A A;  2RDH A;  3PIP A;  2VZL A;  3PO2 B;  4XKW A;  3LQE A;  1SYC A;  1PFS A;  5FJ8 G;  3A7A B;  4K14 A;  2NZO A;  1VQD A;  4NMZ A;  4BY7 B;  1R4P B;  1EUJ A;  5C0X G;  4LUV A;  4PC6 A;  1FVI A;  3TN2 A;  1A8P A;  4IPH A;  3S2H H;  4LFB Q;  4B3F X;  4DV5 L;  4DA2 A;  3LGJ A;  1HNX Q;  1Z7T A;  3FKI G;  3NEM A;  3G4S B;  4FO2 A;  4DR7 Q;  3I2Z A;  1O7Y A;  2MP1 A;  3KF8 A;  1HUN A;  2B2U A;  4A3D H;  2K32 A;  3PO2 G;  4X62 L;  4DQL A;  4ZK9 B;  1SN8 A;  2I5M X;  4EVO A;  1PFB A;  1DYQ A;  3S14 B;  4YHH Q;  4O1N A;  1G8Z D;  3BVG A;  1QVF B;  4B48 A;  3PUN A;  2ZXP A;  1Q8K A;  2K5N A;  4LF4 L;  3FEW X;  3ULJ A;  3E0J A;  1CA6 A;  4JBM A;  3CCQ B;  4RWS C;  2KBN A;  3DXJ C;  5C5L A;  4R8N A;  4QFM A;  1BR9 A;  4L5Q A;  4HSP A;  2Z4H A;  5KNC A;  4C3J B;  3CCM B;  1OB2 A;  4RMF A;  4XQJ A;  3CP8 A;  4X3T A;  2PMZ E;  1PZJ D;  5EJW A;  1C8C A;  5L46 A;  1ASY A;  1QFY A;  3NWS A;  2E76 C;  3SXH A;  1XMO Q;  1B50 A;  1LTR D;  1FNV A;  4IN3 A;  2DOG A;  2EJG C;  1RD9 D;  3J81 L;  4XNF A;  2VXW A;  3D8G A;  2QGG A;  5EGT A;  5IGF A;  2ZTN A;  2C77 A;  3I55 A;  1PDQ A;  4RGN A;  4G57 A;  1F2L A;  2NUC A;  4O42 A;  1AMO A;  3G6J B;  3CRZ A;  5KGU A;  5K36 H;  3ZJY C;  5C6A A;  3VO1 A;  1CKM A;  4OO1 I;  1HZB A;  2RCF A;  3MAQ A;  4ROX A;  1BCP D;  2BVN A;  1SYB A;  5LMN L;  5B6I A;  1KZL A;  3ZBU A;  4LBV A;  2PO4 A;  2RA4 A;  4MYT A;  1IHM A;  1NTG A;  3PV0 A;  3RR5 A;  2NTT A;  4Z4S A;  1BCP C;  1I3Q B;  3B78 A;  1VQ6 B;  4X7E A;  4BXX G;  4H7B A;  5JVG 3;  2M00 A;  4C56 C;  5A2Q E;  2NZ1 D;  2J7Z A;  1JR0 D;  4QJF A;  5IY0 A;  1HTP A;  3CKI B;  1JQY D;  1WTX A;  2B2W A;  3ZZU A;  4JI0 Q;  4B3G A;  4B9W A;  1Q86 D;  3FPU B;  1G7C A;  4ZCM A;  1M4V A;  3UDX A;  1ASZ A;  1N36 Q;  2WB1 B;  5H5J A;  3H0G H;  4DUZ Q;  4UHV A;  2AHO B;  2CK3 A;  2KED A;  2RCN A;  4J1M A;  2RF4 A;  2R7Z B;  1Q86 C;  2O5I C;  2WAQ G;  4YWK A;  1H8H A;  5AJ3 L;  5C44 B;  3ZBT A;  4R4I A;  4ULL A;  2R6H A;  2F0U A;  2HCI A;  1GHJ A;  3S9W A;  3RN2 A;  3WQZ A;  3G71 B;  1Q7Y D;  2P3M A;  1XTD A;  1OTC A;  3KLS X;  3KJO A;  4AF6 A;  1IBM L;  4NXN Q;  1Q46 A;  2JJ1 A;  3AFP A;  4R8I A;  2F0J A;  2WB1 G;  2E5L Q;  1PH3 A;  4DGZ A;  5I6W A;  5C3W A;  4Z4U A;  1Q7Y C;  4G5G A;  4FNF A;  2R7Z G;  1F9P A;  2XIW A;  1T6Y A;  4JI3 Q;  2XOK A;  1HTL D;  3QR8 A;  3GSI A;  1R5B A;  2EYH A;  1IYV A;  1SKY B;  2X6Y A;  2OCE A;  3CW2 C;  2JEA I;  2UUA Q;  3CXC A;  5IYQ A;  4A3I H;  1SYD A;  2X8K A;  4JBW A;  1VQO A;  1D2B A;  4OWW B;  4NBS A;  1WTH D;  5J35 A;  1CUK A;  4I65 A;  2NV4 A;  4DXG A;  3ZIA A;  1HR0 L;  1E2Z A;  4RD1 A;  4WZE A;  5CR3 A;  4B47 A;  1ZXT A;  5FL7 A;  4YY3 Q;  1W2B B;  4BWG B;  3W5H A;  3GO5 A;  4AQY Q;  4CJ2 C;  2NVY H;  2V4D A;  4HID A;  1YJW A;  2ZIT A;  3HFZ B;  4DF7 A;  3G6E A;  4DR1 Q;  1MBY A;  3CRK C;  4CKB A;  2F0O A;  3JAM c;  1OGJ A;  2F4N A;  1LO5 D;  4RKB A;  5CV5 A;  4U67 3;  4JI2 Q;  3CCV B;  5DSZ A;  2UXD L;  2I0Q A;  4B43 A;  4LBZ A;  2QA4 A;  3S1N B;  2A6H D;  1TWC B;  4QUC A;  4X65 Q;  4YCW A;  1MAB A;  4YAU A;  2UUC L;  1VQ4 A;  3TS2 A;  3S1Q B;  1H9S A;  3PO2 H;  5CC4 A;  3OTO L;  2A6H C;  2X3U A;  4BY7 H;  3PEN A;  2I07 B;  5IYC G;  3TP8 A;  1YIJ A;  1NE3 A;  3ASP A;  1BCP F;  3OZV A;  2EIX A;  2LS0 1;  5M5W B;  2JIZ A;  4XLC A;  1ONL A;  2F03 A;  4TRD A;  4A3K B;  2QKI C;  1KK2 A;  1GHK A;  1Q12 A;  5C3E H;  1EIF A;  4ACB A;  2LY7 A;  4R4O A;  4PG3 A;  3VR3 A;  3VYT A;  2L12 A;  1FD7 D;  2BH8 A;  3ONU A;  1JB9 A;  2Q2U A;  5J1Z A;  1TLL A;  2ICE C;  3V96 A;  3S14 H;  1AW7 A;  4O2D A;  2HCJ B;  2D2C C;  3QOJ A;  1ZM4 A;  4TSS A;  4GNX C;  4FWT A;  4PZ8 A;  4UZU A;  5JJZ A;  2JA8 B;  2JA5 H;  3BH4 A;  3NTK A;  1I4G A;  1GUO A;  4A3K G;  2K5W A;  3J80 i;  4C3J H;  1CQV A;  5I4D A;  4XM3 A;  2Z1C A;  1J8I A;  1KXL A;  3LWE A;  2GJK A;  4LBY A;  1BCP B;  1U2R A;  2KCN A;  1B3A A;  1JC7 A;  5C3X A;  3I70 A;  2YU9 B;  2DN8 A;  2PMZ B;  2LXK A;  4PAB A;  2ZXO A;  1YJN B;  1CZW A;  2KVO A;  4X3U A;  2JA6 B;  4YHB A;  1SNC A;  1NB9 A;  1FR3 A;  2MHV A;  2JA8 G;  3RNU A;  2G5D A;  1HRJ A;  3M4O B;  1T5E A;  3A8I A;  2XEX A;  1MKH A;  2N78 A;  5JPM C;  3D4W A;  4LJZ C;  2KCC A;  5CYU A;  1D7Q A;  3RLF A;  1EY6 A;  2CF4 A;  2Q8R E;  3QB3 A;  4HED A;  4JK1 C;  3HEJ A;  2M5S A;  2OK7 A;  4M53 A;  4YXW A;  1TY0 A;  4ID6 A;  1DCZ A;  1VQM B;  4CQJ A;  4ZAI A;  2KQ3 A;  4QV2 A;  4P73 A;  1GUT A;  1TS2 A;  1NUC A;  4V0B A;  1I3Q H;  1YZ6 A;  1N05 A;  4G6I A;  2B8F A;  3A3B A;  2JXM B;  4A3G H;  2AUJ D;  4RHR A;  1FNU A;  1WTP A;  3CP2 A;  3OW7 A;  5DAU A;  3VR5 A;  3Q23 A;  1Y8P B;  1Q9S A;  2XNA C;  3VMF A;  2MPM A;  1CQF A;  2K05 A;  5LMN W;  1OGI A;  2RSO A;  3L3O C;  2QW7 A;  1W6J A;  2MNA A;  3SJP A;  1K8G A;  1S72 B;  4K2L A;  4LF5 L;  3OP1 A;  1Z47 A;  5HGQ A;  1V43 A;  2DJF C;  2EXD A;  3KYH C;  4ZCK A;  2R7Z H;  1D5X C;  3S1M B;  5FO1 A;  1SYE A;  4OX9 L;  1Q90 A;  4B4D A;  4LWC A;  2E2D C;  5C44 H;  4DV4 Q;  2NTS A;  1G51 A;  2D0P A;  3CES A;  1JOR A;  2XVS A;  1A3U A;  2IHF A;  4B3T L;  2IY5 B;  1KAA A;  4P74 A;  2OXP A;  3NBH A;  4NKL A;  3EFX D;  2B63 G;  3T51 B;  4DR5 L;  2K4K A;  3GTM B;  1KK3 A;  5JVH 3;  4Y9U A;  2IL8 A;  2GPJ A;  1K3B C;  1MHW C;  2CH4 W;  5CBE E;  2DCU A;  3VR2 A;  3RMH A;  5HXB A;  2ZXI A;  2UXC L;  1LLR D;  1V9P A;  5IP7 G;  4JI4 L;  5COR A;  4HCE A;  3PUY A;  2K5D A;  3OMG A;  4HJ5 A;  3B8H A;  4U9U A;  1IXR A;  3T4A C;  3KF6 A;  2F0M A;  2W6I A;  4K6D A;  2NB0 A;  4KLK A;  1V1P A;  1L0W A;  4DR5 Q;  4AYB E;  4DR4 L;  3BYY B;  1TWF B;  4WJW A;  3WND A;  1S5E D;  2ALY B;  5EMN A;  4E0F A;  3CCS B;  4K8I A;  3DWA A;  1QG0 A;  1A2U A;  1CQX A;  5IWA L;  1XMQ L;  3BZD B;  5F4J A;  1QOH A;  1Y8O B;  4X64 Q;  3AEV A;  4KHZ A;  1HR0 W;  1ENA A;  3S2D B;  4KY6 A;  5IYC H;  4RLZ A;  1GOZ A;  3WNB A;  1UD6 A;  3HGB A;  1VMP A;  4Y52 H;  4HJ9 A;  2K50 A;  1MJE A;  2NN6 G;  2IW3 A;  3ES9 A;  1TWC H;  4DR4 Q;  2YWE A;  2UU9 Q;  4S3S A;  4RCN A;  2RKS A;  4JI8 Q;  3S1Q H;  1GO3 E;  1VQI A;  1DD2 A;  2VNU D;  1K0R A;  4DR2 L;  2V7V A;  3FPK A;  1TXY A;  4IFD J;  1YLO A;  4R4Q A;  5IWA Q;  1X55 A;  1T5X D;  3CC4 B;  1TWG B;  1W87 A;  1LTA D;  1KC8 C;  1VQH A;  1U9R A;  3OW2 A;  3J81 c;  3RZO H;  5JBQ A;  4EQO A;  5A35 A;  2Q8T A;  3PA1 A;  2B7C A;  1U0L A;  1GUN A;  4PMB A;  3T1H Q;  3CB4 A;  1K9M D;  1QZG A;  1L1O C;  1FNC A;  3BZC A;  3Q6Q A;  3P26 A;  1COW A;  2F0F A;  3VDY A;  4GKK L;  4IUQ A;  2R93 B;  4ASU A;  2EFG A;  4QVA A;  1K9M C;  4JC0 A;  1DG1 G;  3CC2 A;  4ZKB B;  4G7X A;  4IQZ A;  2N49 A;  1GXD C;  2PLF A;  1Q81 D;  1NCV A;  4KTA A;  3ZPN A;  4LMQ D;  2JA8 H;  1GAQ A;  1UMK A;  3K0Y A;  2V7Q A;  3OJW A;  5EPK A;  2QDX A;  4M2L A;  2F0K A;  3EJI A;  4DV0 L;  1Q81 C;  4J15 A;  2C9O A;  1F20 A;  5TRD A;  3HKZ B;  2YU9 H;  1FGU A;  1VMC A;  4X66 L;  2RDF A;  1M1K D;  1NAP A;  2JA6 H;  3W2F A;  1SRO A;  4IOC A;  3S17 B;  1SJH D;  1JA1 A;  2D3N A;  3Q6R A;  4II3 A;  2Z6K A;  3EA6 A;  4GOP A;  1LTI D;  3M4O H;  3S16 B;  2CWA A;  1M1K C;  2NZH A;  3OOC A;  1GD7 A;  4P26 A;  1DGS A;  1TKW B;  3QSY A;  4CDE C;  5M3M B;  1C7Y A;  3FKS A;  4KY7 A;  2JP1 A;  1BBX C;  3HKZ G;  4X07 A;  2R6G A;  4GLV B;  1K28 D;  1PZI D;  1MSH A;  3A8J E;  4TQU S;  3RY8 A;  1JJ2 A;  1UD2 A;  5FO0 A;  1I4Q A;  3A0J A;  1STB A;  2F43 A;  3CCJ A;  1WFQ A;  4WQM A;  1XYI A;  3N52 A;  3ZZT A;  2JA7 G;  1CI3 M;  2N88 A;  2MQH A;  1N33 Q;  2JK8 A;  1EY5 A;  5M5X B;  4IPD A;  5F4O A;  4RDL A;  2L55 A;  2V7U A;  1ROD A;  1CSQ A;  5CGK A;  2CVR A;  4G7W A;  3G7L A;  2BN4 A;  1EU4 A;  1EWI A;  2KVM A;  4F87 A;  3A8K E;  1EIY B;  1MIU A;  4UY8 C;  1XNQ Q;  2VUM G;  3M7N A;  5TR9 A;  5IYW A;  1G91 A;  4ME5 A;  4LC0 A;  2F0L A;  1LUZ A;  3UI2 A;  1RQR A;  4A3L H;  1WOP A;  2WJV A;  1O78 A;  2DGY A;  4EQ5 A;  3GVK A;  1PZK D;  2F4V Q;  3S1M H;  1S5D D;  3W1G A;  4BA2 I;  1E62 A;  4RD0 A;  3WNC A;  2K28 A;  1H9R A;  1IBL Q;  4A3C G;  5GAE C;  1RHP A;  2A1A A;  1FDR A;  3D4D A;  3NQI A;  3NBI A;  3BY1 A;  1S5C D;  4OWX B;  3CPX A;  3JAM L;  3CPW B;  1FNW A;  2GJP A;  5EPL A;  1XJV A;  2O4X A;  2EQS A;  1E2V A;  3BZK A;  1XWE A;  2QDB A;  1UE6 A;  1VQ8 A;  3KOJ A;  2WYR A;  3EQL C;  1FJG L;  3P75 A;  1NSN S;  1YBY A;  1YHQ B;  2FHT A;  3BC9 A;  2K03 A;  4TN1 A;  3U6K A;  3I4M H;  1PH8 A;  4IOA A;  2QF7 A;  5HKK A;  4B3R L;  1XNR Q;  4I7A A;  3K5L A;  5CMD A;  4DV6 L;  3WDN A;  3UDF A;  4DR3 Q;  1HH2 P;  3PGZ A;  1AP0 A;  5EAY A;  1CHP D;  3X3N A;  1O7Z A;  1TWF H;  2B2V C;  3OWF A;  4R4C A;  4AYB B;  1V5V A;  3HOX B;  3FPP A;  3H94 A;  4X0C A;  5IYR A;  1CKN B;  3U9S A;  2ZZE A;  1QE6 A;  1QCB D;  1NY4 A;  3I91 A;  4G7O C;  4TMT A;  2F0I A;  3AST A;  2WAQ E;  1BUV T;  3ERO A;  2DY7 A;  3D4R A;  1F9Q A;  1Y1V G;  3QO2 A;  2UUB L;  4F88 A;  1PA6 A;  5LHY 1;  1BOS A;  5AFW A;  3IL8 A;  2G9H D;  1TWH H;  5GAD C;  3HOX G;  5ELF A;  4IFD G;  1JNY A;  2IPK D;  1XFO A;  1II3 A;  4BA1 I;  4N9T A;  2WB1 E;  2F0Q A;  3TME A;  5ELD A;  3F2B A;  1ENF A;  3Q38 A;  4P25 A;  3TDQ A;  1YIT B;  3CU7 A;  3GTP B;  4DV2 L;  4CJ0 B;  4A3M B;  1UE7 A;  4IUT A;  4GN5 A;  1G7T A;  4C43 A;  3EIV A;  1EY0 A;  4A4I A;  1VLO A;  1RDP D;  3D6C A;  4BBR B;  2K6A A;  2Z9H A;  4LNQ A;  1QGA A;  1FYC A;  5C4Z A;  2R93 H;  4UP9 A;  3CMM A;  3U4Z A;  1S3O A;  5FOB B;  1ESF A;  4UP7 A;  3K57 A;  5GV7 A;  5AN9 A;  4A3M G;  2XRS D;  2CWP A;  1I94 L;  2NWG A;  2JN4 A;  4JI6 L;  4CDC C;  2Y0S B;  1EYG A;  4XOT A;  2MO0 A;  2WSS A;  1JE4 A;  1IYJ B;  4NXM Q;  4UAJ A;  3SK4 A;  2DIE A;  1KNA A;  2PW5 A;  2HUG A;  5ELC A;  1EP3 B;  3H6M A;  4K6L A;  3W3A A;  1QH0 A;  3CCU A;  5M3F G;  2JYO A;  1E1R A;  1OHH A;  1SND A;  3G4S A;  3AVW A;  2R7F A;  4RDK A;  2B2U C;  3IRB A;  4X8I A;  1KK1 A;  3OMC A;  4K5V A;  1E1O A;  3Q8D A;  2JDI A;  1OB0 A;  3S17 H;  2Y0S G;  2CC2 A;  1QVF A;  2Q2I A;  2QEX A;  3S24 A;  3S16 H;  3WWV A;  1AE3 A;  1VQK A;  1N06 A;  1CM9 A;  3ERQ A;  3C3L A;  1FNB A;  5M3M H;  4QHY A;  3U6B A;  3HP3 A;  4K0K L;  3QIA A;  1K8M A;  2X53 S;  3CCM A;  5KNL A;  2B2Y A;  3D3R A;  3DMU A;  4OPS A;  1JB3 A;  2L5T A;  4ZCL A;  1GVP A;  3FRP B;  4XOR A;  1NR4 A;  3CCE B;  1WCM H;  2OTL A;  3FKI B;  4RPD A;  1HNZ L;  3PVD A;  2JEB I;  3BDL A;  2AMC B;  1TII D;  2V7W A;  1B4O A;  4DAY B;  2ICI A;  3ISX A;  5M5X H;  1LT4 D;  4JG2 A;  1PMR A;  4JI7 L;  1RF2 D;  2VJI A;  4XDX A;  1SKQ A;  3BDC A;  1U4P A;  3E9I A;  1X32 A;  3I7F A;  3V2T A;  4Z4Z A;  5G3L D;  1PFN A;  1IBK L;  5FNZ A;  2B39 A;  4KMU C;  1PTO H;  3C1F A;  5JEA J;  1U4R A;  4P2N A;  5HY6 A;  3JAM E;  4G7Z C;  4KKS A;  1AE2 A;  1B70 B;  1JB7 A;  1VF5 C;  1HA5 A;  2KJX A;  5BN3 A;  1HNZ Q;  1O7I A;  2M2L A;  3CF5 A;  2PMD A;  3PIP 3;  1HHV A;  1SR3 A;  1YVC A;  4JI7 Q;  3HOU B;  1PLF A;  1V1Q A;  2M9V A;  3GTQ B;  1NDH A;  1G6Z A;  3GQB A;  4JCV E;  3J7Y W;  4A93 B;  4BBS H;  5DS0 A;  1J5E L;  4CKE A;  1CSP A;  4DV5 Q;  2AWO A;  4ZCI A;  1DOK A;  1DOL A;  2OTJ A;  1I8D A;  1VQ5 B;  1F2Z A;  1EFW A;  5A89 A;  3PMF A;  2EJF C;  1E22 A;  2B8G A;  4X62 Q;  1BMF A;  4HAE A;  1HNW L;  2AHO A;  1EYC A;  3HOU G;  1QUQ B;  3TQY A;  2SEB D;  3Q0A A;  1CT1 D;  5IYB H;  4G1V A;  3PUZ A;  2EPB A;  4B9X A;  1TWA B;  4A93 G;  1HXY D;  2MJ8 A;  2K33 A;  3LQ6 A;  5FLM H;  5A88 A;  4LF4 Q;  1PH2 A;  1N0V C;  2PE3 A;  4C2M H;  4EQP A;  2BMW A;  3SVM A;  5JJI A;  2GK7 A;  3CCR B;  3G71 A;  2WP8 J;  3CP0 A;  1D1I A;  3QG1 A;  4B3S L;  1X3G A;  3OHX C;  4IPC A;  1EP2 B;  3OJX A;  5C4J B;  3PIO 3;  1E1Q A;  5COY A;  2SDF A;  1P8L A;  4JBK A;  5GV8 A;  2QGQ A;  1JWM D;  2VQE L;  1GO2 A;  1UD5 A;  4XN0 A;  1CNF A;  1GVH A;  3BDO A;  1FND A;  1LT3 D;  4DV3 L;  4LBW A;  5IGG A;  3MXN A;  2WAQ B;  4J8Q A;  3HKS A;  5IP9 G;  3Q22 A;  4Z4V A;  2BCO A;  4WZT A;  4PC2 A;  4PZ7 A;  2ZL7 A;  1DOM A;  4WRD A;  3TP6 A;  4DR6 L;  2AQ3 B;  4LK1 C;  1PH7 A;  1EP1 B;  4DNI A;  1E63 A;  3KF8 B;  3A56 A;  4E6I A;  1SDF A;  3NP8 A;  4KN7 C;  3QFS A;  4A3F G;  3GTP H;  2PNR C;  4K8J A;  1X6O A;  4A3M H;  3NUC A;  1VQN B;  1VF7 A;  3AVV A;  1E0B A;  5LMN Q;  3QFT A;  2CND A;  4F8M A;  1WTR A;  3F8T A;  1YNX A;  1EQV A;  2OBS A;  2W6J A;  3W2I A;  4BBR H;  1A3V A;  2ID0 A;  4DFA A;  1UAP A;  5CV8 A;  4FF2 A;  1NJI D;  5NUC A;  1EYA A;  4DR6 Q;  5ELO A;  4GLA C;  3EBE A;  2L1B A;  5G3L F;  4I7Z C;  3TS0 A;  1KRH A;  3AGP A;  1SNP A;  1KL9 A;  1NJI C;  4HR7 B;  4BY1 B;  3HOY H;  3CPF A;  1GR1 A;  1AN8 A;  3NTH A;  4OIJ A;  5FO7 B;  4PC1 A;  3IKJ A;  4RGO S;  1S40 A;  3PSI A;  5T1G A;  1JWS D;  2IHE A;  3LVB A;  5AJ3 Q;  4HIK A;  4P3Y A;  4XLF A;  5JAV A;  4MIU A;  1T6Z A;  4GQN A;  2R3Z A;  3E0E A;  1H42 A;  3J80 c;  1FNM A;  3I55 B;  1YJ9 A;  4LFA L;  1KHI A;  2MGS A;  3KLW A;  1KD1 D;  3K0X A;  4BY1 G;  1IBM Q;  1F2Y A;  4KN4 C;  2JJ2 A;  2CCZ A;  2CW0 D;  1QFJ A;  1H8E A;  2F0E A;  3BS1 A;  1KD1 C;  5FJ8 H;  2OK8 A;  4XT1 B;  3R8B A;  2A73 B;  2VS1 A;  1X3P A;  1Y0R A;  2CW0 C;  3ND8 A;  4L63 B;  5C0X H;  4PGO A;  4O0A A;  5JJK A;  2KA7 A;  2FMC A;  2Z6B D;  4BS9 A;  1FL0 A;  3TSS A;  2GRE A;  1P16 A;  4ZUI A;  1VQL B;  2ZT9 C;  5IYN A;  4OEM B;  1I4X A;  4NDX A;  1HR0 Q;  3CAM A;  3FKI H;  2L4N A;  3AU7 A;  3KLR A;  3M3Y B;  3MCA A;  4II2 A;  4QIW E;  1W35 A;  3B6Y A;  3TZD A;  2ZZF A;  2JE6 I;  2PPB C;  1LAB A;  2A19 A;  4B3M L;  2AWN A;  3QE2 A;  2SOB A;  3DM3 A;  4GS3 A;  5I2X A;  2I5L X;  5TY0 A;  3KK7 A;  2NVT B;  1WTW A;  5GRO A;  5JEA G;  3SK6 A;  1GM5 A;  4OO1 G;  4Q0F A;  4P6Y A;  1IL8 A;  2UXB L;  1SJE D;  1XB2 A;  2CRV A;  2UXD Q;  4P12 A;  1OO9 B;  4M1K A;  3DLL A;  5E1F A;  3A7L A;  3H3V H;  3MMP A;  2IX3 A;  2ZZG A;  1WD1 A;  3IAY A;  2UUC Q;  2ZXR A;  3I3C A;  4PC7 A;  1FX0 A;  3OTO Q;  4H13 C;  3VR6 A;  1VQM A;  3O13 A;  2SNS A;  1SMX A;  4XD7 A;  2JSO A;  2N55 A;  3PUW A;  2WZN A;  2WKC A;  2EYL A;  1JT8 A;  1BKB A;  3N6R A;  3ONY A;  3CXC B;  1Y14 B;  3T16 A;  3SLD A;  3J81 E;  4HMI A;  4DKA C;  1YNJ C;  1VQO B;  3HKZ E;  1TT2 A;  2P5Z X;  1S72 A;  3K80 C;  2RC6 A;  2F1L A;  1G2S A;  5IOD A;  1AH9 A;  3J7A 5;  4ALP A;  2VBV A;  3CCL B;  1QNU A;  3F2U A;  4FF4 A;  1EY4 A;  3BYT B;  3SE0 A;  1TWA H;  3W2G A;  3G48 A;  5HUR A;  3S1R B;  2K7V A;  2XWB B;  1Q1B A;  4LF9 L;  3GTG B;  5I6Y A;  4FK8 A;  4Y7C A;  3MVV A;  1QUE A;  4PZ6 A;  1A6X A;  3G6E B;  1NMF A;  2DEU A;  4X6A H;  4MTK A;  2Q6L A;  5E4X A;  4DUY L;  1EZ8 A;  4BXX H;  1I4R A;  4QY7 A;  4X3K A;  1S4Z A;  1HZA A;  2BDN A;  3Q24 A;  1BQQ T;  5C4J H;  1EQQ A;  2VBU A;  2D3L A;  3E9H A;  3C2P A;  2IX0 A;  1E7Z A;  4Z4T A;  4RKL A;  4OGQ C;  3NE5 B;  3I56 A;  2QEJ C;  1H9S B;  3I90 A;  5DN6 A;  4DV7 L;  1YX2 A;  1IHZ A;  2PZW A;  2EYF A;  2VL6 A;  3HOV B;  3BY2 A;  4OPV A;  2E2J B;  1EFR A;  1KJZ A;  3K5M A;  4TSF A;  1K8O A;  3VA5 A;  2C5H A;  2GK6 A;  4P3I A;  3HOZ G;  1EOT A;  4DUY Q;  2L15 A;  2YTX A;  1F9S A;  4X7C A;  3WYA A;  2FFK B;  2PI2 E;  2B63 B;  4JPB W;  1CFM A;  1EEF D;  5F4M A;  3K7A B;  3TEH B;  4G4K A;  3CCS A;  3MHP A;  3W5V A;  1SMY D;  3HOW G;  2E8G A;  1E43 A;  3BG3 A;  4QCL A;  5KW9 A;  2K1B A;  1A3T A;  5FLX L;  3HOV G;  1VQP A;  3C1E A;  1SMY C;  1F77 A;  1ZKO A;  2BA1 A;  2IT1 A;  2ASB A;  3WOF A;  1I18 A;  4YWM A;  1YI2 A;  1R5N A;  5BN4 A;  3OEH A;  1OB5 A;  3ASQ A;  1B3Q A;  5I9O A;  2F0P A;  3VYS A;  4C1N K;  1XPR A;  2XZO A;  2E1B A;  5C4X G;  1SNO A;  4LF5 Q;  1W34 A;  3WY9 A;  2F0N A;  3I4N B;  2ZZQ A;  1WTO A;  3CC4 A;  1UE5 A;  2N8N A;  3AGQ A;  5FK9 C;  5EKK A;  4C3H G;  5THX A;  5FO9 B;  4HIO A;  4OX9 Q;  5IK2 A;  1VCI A;  1HCZ A;  4KHP L;  3P20 A;  1BNZ A;  2ZBU A;  1VHO A;  1HPC A;  4XQQ A;  4B3T Q;  1A2T A;  4QQB X;  3AFQ A;  1BX0 A;  2B2T A;  2HDN B;  2XND A;  1L0X B;  2JQO A;  3L0O A;  4NNJ A;  2WR8 A;  1EEI D;  4OPO A;  4PNY A;  1KDA A;  3IFT A;  3W2H A;  3I4N G;  1PV4 A;  1GUW A;  2UXC Q;  3E6Z X;  4RH6 A;  5DNF A;  2E74 C;  1EU3 A;  2ZM6 L;  3A5U A;  1FGB D;  5HZB A;  1QB5 D;  4JI4 Q;  4J0Q A;  1GUG A;  3T1Y L;  2BOS A;  1BJK A;  1SBB B;  1J6Q A;  3J81 j;  2VNK A;  4QL5 A;  4GNX B;  2K5Q A;  4P75 A;  3CD6 B;  3S1N H;  1PRT D;  3F2D A;  2X6L A;  2MFI A;  4DNT B;  1Y0Y A;  4NB3 A;  4XTC S;  3KL9 A;  1KC8 D;  1PRT C;  3K81 C;  2OEO A;  4TMV A;  2Z6K C;  4QIW B;  3DDY A;  3ND9 A;  4GOP C;  1OXT A;  1EZ6 A;  1XMQ Q;  1BDO A;  4N8F A;  1G7R A;  5C5M A;  3L2P A;  2PW7 A;  3BCD A;  5HGT A;  5M9O A;  4XN3 A;  2JA9 A;  1N9W A;  3NHH A;  5M5W H;  1S0U A;  4LUZ A;  4A3K H;  2GJR A;  1F9R A;  2HIX A;  2J4X A;  4OWT B;  3NEN A;  4A3J B;  1IB0 A;  3RLO A;  2KOL A;  2GVB A;  1I6H B;  3ASS A;  4JI5 L;  1G6P A;  5IGB A;  3Q6S A;  3ULL A;  3NEL A;  1TU2 B;  3JC6 6;  1KMH A;  5E6T A;  4WOR A;  4XMY A;  5EQ0 A;  4DR2 Q;  2ZTD A;  2ATW A;  1R4Q B;  2ENB A;  4B44 A;  2B5O A;  2Y0S E;  1A8V A;  2DNE A;  2XN9 C;  3PCO B;  3PQI A;  4NPS A;  4JI1 L;  1H9J A;  4HMJ A;  1AIP A;  2CHB D;  1SLJ A;  1B2T A;  2L0C A;  2CH4 A;  4FN5 A;  2PIA A;  4TT3 A;  3TZU A;  4A3J G;  2A68 D;  4L6T B;  1BF4 A;  3EN2 A;  1EOV A;  1K83 B;  2K5V A;  2Z0S A;  3NSW A;  2RQX A;  2E2I B;  2VQF L;  4XOP A;  2EY5 A;  5CV7 A;  2A68 C;  1QVG B;  2FJ2 A;  4HE5 A;  4TVA B;  4GKK Q;  1BPL A;  3P27 A;  4EQN A;  1I4P A;  4OEL B;  1EYD A;  3S1R H;  2WZP P;  4POF A;  3GTG H;  5TV2 A;  3GV6 A;  4FXG C;  2JA7 B;  2C4U A;  1O80 A;  1CZG A;  3OZU A;  2RVL A;  5BSY A;  4OON A;  4QUF A;  3ERS X;  2C2W A;  3MA2 B;  1DZ1 A;  4DXF A;  1LTB D;  4FF3 A;  4HIZ A;  4DV0 Q;  1WOO A;  2D0O A;  3VR4 A;  1QUF A;  1GKH A;  2VUM B;  3KBX A;  4HCS A;  4N8X 1;  4AVZ A;  1YHQ A;  1K73 D;  1SE3 A;  4X66 Q;  5LMU L;  3CMA A;  4IUR A;  2BPO A;  1D1N A;  3VNU A;  2D9U A;  4LFC L;  2WKD A;  2E2J H;  2CQA A;  1K73 C;  3IFD A;  1HZE A;  1K8A D;  4L5T A;  1HA6 A;  3BU2 A;  3OW2 B;  4KY5 A;  3E5S A;  3MEH A;  4DV1 L;  1PJ7 A;  2QMU A;  4RA8 A;  4Z9C B;  3V76 A;  1K8A C;  2B63 H;  3K59 A;  3K7A H;  2C5B A;  1GUS A;  5J22 A;  3J80 L;  1CKN A;  4XLA A;  3H15 A;  1WOC A;  1PRT F;  2V7T A;  1KQS B;  1BVS A;  1G7S A;  2ZJR A;  3GP7 A;  1A63 A;  4RJL A;  4OHJ A;  3OYY A;  3SGI A;  4IO9 A;  5IP7 H;  1WI5 A;  3SR1 A;  2RSN A;  2QTL A;  3V05 A;  4AC9 A;  1JIC A;  4P72 A;  1VQ9 A;  4C3I G;  4LF7 L;  4FYD A;  2OBT A;  2F0V A;  3ZYY X;  3OAA A;  3S15 B;  1YHB A;  3KFU A;  1KNE A;  3URY A;  3J81 k;  2XZL A;  1BBW A;  3GTM H;  1SEB D;  3BVM A;  2EZV A;  1RTO A;  4ZKC B;  3PUM A;  3A3G A;  1XPU A;  2XTI A;  1S4M A;  3A35 A;  4DK6 C;  2X6X A;  4R9W A;  1I7P A;  3FMC A;  4XKV A;  1QIL A;  3T53 B;  3D31 A;  1STE A;  3F2C A;  3HS0 C;  5D14 A;  2XZP A;  2AKW B;  1ZYR D;  2XWJ B;  4ZV4 A;  2F0W A;  2F0D A;  1PRT B;  5IYP A;  3CRL C;  2R92 B;  3NTI A;  2DET A;  4GOP B;  4BPR A;  4KI0 A;  4RD3 A;  1ZYR C;  1TVX A;  1PH4 A;  1Y1V B;  4X3S A;  3A5Z B;  3T13 A;  2WV6 D;  2CBX A;  3VO2 A;  2NN6 H;  3KDF B;  5BR8 L;  1KTK A;  4M0L A;  3NPP A;  3C2Q A;  4A3D G;  1UWV A;  1FJG Q;  2A74 C;  2FIN B;  3L7Z C;  1ZM9 A;  3ASR A;  4C1N I;  1EQT A;  1L1O B;  2Q2T A;  2R92 G;  4RDJ A;  4WWV A;  2QDL A;  3S2D H;  5E3F A;  4QUZ A;  4B3R Q;  3TRE A;  4Z1M A;  4DV6 Q;  4YAW A;  4OXP A;  5D65 A;  3SKB A;  3D6W A;  4LF6 L;  1TS3 A;  2O5J C;  1Z9F A;  2F52 A;  1Z6H A;  2F4I A;  1MI2 A;  1U4M A;  3GVL A;  4EX5 A;  2VYQ A;  1ET6 A;  2PQA A;  1WDT A;  3VNV A;  2F3I A;  5C0X I;  4L8J A;  1G2T A;  3U58 A;  1TWG H;  4GN4 B;  3OZW A;  3TP7 A;  1X9N A;  1O7L A;  3GTK B;  4UZF A;  4JW0 A;  5D3D A;  1VQ7 A;  3CME B;  2UUB Q;  5D3I B;  1E3Z A;  3I8Z A;  4LF6 Q;  1VQC A;  1ET9 A;  1I6H H;  3CCE A;  3A8J A;  5M3F B;  2L11 A;  4HSV A;  3D26 A;  5K36 G;  1W9X A;  4WZK A;  4PC3 A;  4RGT A;  4DAY A;  2EXZ A;  3UDI A;  1LM0 A;  1V8Q A;  2HHH L;  3SLN A;  1STY A;  1A15 A;  2C5C A;  2R7D A;  4NCN A;  1M90 D;  4POG A;  3H0G B;  4DV2 Q;  1RQP A;  2FVG A;  3H3V I;  2LMC B;  2HQL A;  1M90 C;  2CKZ B;  3GTO B;  3T56 B;  2ZTC A;  5J3B A;  4Y7N B;  4PMC A;  3CC7 B;  4NP5 A;  1CKO A;  3A8K A;  1OXV A;  1UE1 A;  3WBK A;  2E2I H;  1B9M A;  1BQE A;  4DK1 A;  3J7A V;  1H9M A;  1N34 L;  1X3Q A;  1TVC A;  3GDE A;  3ITP A;  1L0Y B;  3H0G G;  4DPG A;  5FLX c;  3DWP A;  2IWH A;  2I1L A;  2VB3 X;  4XLE A;  1W6K A;  2JA7 H;  1LYL A;  3AB9 A;  1I94 Q;  3B82 A;  1RTN A;  1UNS A;  4JI6 Q;  2DNC A;  3CCQ A;  2LKV A;  3PO3 B;  1JJC B;  1QWY A;  4YAO A;  2QIL A;  3CHB D;  1HZ9 A;  2PNH A;  4OOS A;  1B7Y B;  4HTH A;  2XSC A;  4DQK A;  5JPN C;  1PH5 A;  2MUY A;  4JYA L;  4B08 A;  1VQ5 A;  2Q2H A;  1WTV A;  2VUM H;  1JE5 A;  4OL7 A;  1VQE A;  1X3F A;  1I4H A;  1T9H A;  4RAU C;  2RBM A;  2HD3 A;  1TS5 A;  2BDO A;  2R61 A;  1MGS A;  2PYK A;  1M8A A;  3J80 E;  2ZJQ A;  5KYI A;  1WTQ A;  3R2I A;  1V1O A;  1W0J A;  1NNX A;  4KD4 A;  1UEB A;  1TR5 A;  3PO3 G;  4A3C H;  4Y9R A;  2E75 C;  4HJ7 A;  1EIH A;  2LSS A;  1VQF A;  4LFB L;  3OWE B;  4A3I G;  4UPA A;  4K1X A;  1QJO A;  4K0K Q;  2AUK A;  1HNX L;  2NVX B;  4A76 A;  1U4L A;  4HJ8 A;  2F0S A;  3I1F A;  1IZ6 A;  2VW9 A;  3HRZ C;  1D1K A;  5KRU A;  4FXD A;  2VY3 A;  1Q82 D;  1CK1 A;  5LL6 X;  1AFP A;  4H02 A;  3MWY W;  1P4M A;  2Z4I A;  2VNH A;  2XGT A;  2C78 A;  4UDU C;  4XLH A;  3VA7 A;  4YHH L;  2K5H A;  3I72 A;  1Q82 C;  4IW3 B;  1N07 A;  2K04 A;  1PYB A;  1NB0 A;  3KBG A;  2IX1 A;  3S15 H;  4J6H A;  4Q5V A;  1VQ6 A;  3FJO A;  2I5H A;  1R9T B;  2NPF A;  2BV3 A;  3ZUG A;  2H1E A;  1IBK Q;  2B2W C;  3H09 A;  4JOI A;  4RCY A;  4RM0 A;  4CDD C;  4PMW A;  4V19 0;  3CCU B;  5EKI A;  4HIM A;  1DJR D;  4KV6 A;  3BCF A;  5C3E B;  3DEO A;  5E7N A;  2OQ0 A;  1RL2 A;  2LXJ A;  1VDZ A;  3Q39 A;  5ELB A;  2C4T A;  1XMO L;  1VQN A;  4BY7 G;  2R92 H;  3NQT A;  1C9O A;  4MHE A;  2QEX B;  1VQK B;  1ILQ A;  1Y1V H;  2Z8L A;  3EVQ A;  1J5E Q;  1DAR A;  1PVO A;  2JA5 B;  1IKM A;  5C3E G;  2R9V A;  3W5U A;  5KNB A;  3PIO A;  4KKT A;  3HOX H;  1RKN A;  4IFD H;  2YWF A;  1B23 P;  1DXM A;  1EFC A;  4XIG S;  4IJH A;  1J9Z A;  1HFG A;  2OTL B;  1HNW Q;  4X7F A;  4OOX A;  1PJ6 A;  1UUP A;  1D5Z C;  3JQP A;  2F0H A;  2VZA A;  2QN6 A;  4A3F B;  1KTV A;  2G9D A;  1Y69 U;  1KDB A;  4RD6 A;  1WOR A;  3A74 A;  3M7G A;  1QVC A;  2JA5 G;  2B3G A;  1XQB A;  1EY7 A;  3X3M A;  4L5S A;  3BJU A;  4C3J G;  1SE2 A;  1W3S A;  2YV5 A;  1W0K A;  4CBV A;  2Q8I B;  1SYF A;  3A54 A;  4B3S Q;  2EOT A;  3I4O A;  2KHJ A;  4JI0 L;  1W2B A;  3R3O A;  4TMX A;  2EY1 A;  3QFR A;  1ENC A;  5E4W C;  1WYD A;  1N36 L;  4DUZ L;  3GTK H;  1S5F D;  1N0U A;  2VQE Q;  3MHB A;  2MO1 A;  4XT3 B;  1N32 L;  1KIX A;  4RPB A;  1JA0 A;  5IT9 c;  4DV3 Q;  4MZ9 A;  5M5Y B;  4Z4R A;  4DNR B;  2E1R A;  4EGV A;  4CJ1 B;  2L9H A;  2ZL5 A;  4DAP A;  3CCV A;  1VQL A;  5KSW B;  4K5W A;  5IYD G;  5CV6 A;  1PH6 A;  4A3G B;  5M3F H;  1ZEQ X;  2HDM A;  2YWH A;  2KEC A;  2DUD A;  2OTJ B;  1CTM A;  1LTG D;  3M4Q A;  3M4Y A;  4NXN L;  5L37 A;  2E5L L;  1JOQ A;  2K75 A;  2XGJ A;  2HQE A;  3CTA A;  1UEA B;  3MFG A;  4RG1 A;  4JI3 L;  1HJP A;  1LTL A;  1N32 Q;  2F0T A;  4TMZ A;  4B3X A;  3GTO H;  4Y7N H;  4IPG A;  5T1I A;  1OXU A;  3A8I E;  4PQX A;  2DY1 A;  2UUA L;  4G1B A;  4A3G G;  1J9O A;  1VQJ A;  2X69 A;  4FF1 A;  2WAC A;  1TY2 A;  4P22 A;  3BVZ A;  1EWC A;  4YY3 L;  1ICF B;  3F1Z A;  3H9N A;  4N9P A;  3AYH B;  1VQB A;  4AQY L;  1QZH A;  3BNW A;  3FDT A;  1STN A;  2EDG A;  1FRQ A;  2HLD A;  2NBF A;  3I73 A;  3PO3 H;  5C44 G;  1K3R A;  4DR1 L;  3R93 A;  1D5M C;  1DM0 B;  4K2K A;  2A69 D;  3MXN B;  3W5O A;  4JI2 L;  1B1Z A;  4WZL A;  4DK0 A;  4IUN A;  3SDZ A;  3MEF A;  4LFA Q;  1H9K A;  3SK8 A;  2A69 C;  4MTN A;  5I9P A;  4X65 L;  1SSO A;  3FHW A;  1X56 A;  3CCL A;  5GAG C;  2D62 A;  4IUP A;  4OIK A;  2YWG A;  4CKC A;  3K5N A;  3NWT A;  1YJN A;  2BA0 A;  3R6J A;  2OQK A;  1YHA A;  2X6G A;  3AQQ A;  1HA3 A;  2QCP X;  4LUO A;  1PJ5 A;  1F2M A;  2BH2 A;  2KUM A;  2EJM A;  4MN3 A;  2NVX H;  2E2H B;  1B8A A;  1JCK B;  1SNM A;  4KJO A;  1KLG D;  3SHL A;  4KD3 A;  3K8A A;  2V7X A;  1LT6 D;  1SAP A;  4DU9 A;  4R4T A;  3R6K A;  4IAL A;  1Q3L A;  3HOU H;  3GTQ H;  4B3M Q;  1V0F A;  4A93 H;  2KEN A;  4RGM A;  1F60 A;  1MD2 D;  1YNJ D;  1R9T H;  3RZO B;  1WSR A;  4IJL A;  4YAL A;  3LX0 A;  1KAW A;  3CW2 A;  2RHQ B;  1ZM2 A;  2UXB Q;  1XTC D;  2VBS A;  1YJ9 B;  3RLN A;  2EYO A;  1UD8 A;  1DDI A;  1C0A A;  4IUU A;  1AZQ A;  1WPC A;  3KLS A;  4G7H C;  4HE6 A;  1WTH A;  2N3S A;  2VJJ A;  3E1Y E;  2A5H A;  3FVQ A;  3SEB A;  2HMA A;  1D8T A;  1JOO A;  2TSS A;  3TP5 A;  1YJW B;  2GVA A;  1VQA A;  4JBJ A;  4GLX A;  3OIQ A;  1LT5 D;  1RJT A;  5IP9 H;  3QOL A;  1VJS A;  1Q8I A;  3HOZ B;  5CV4 A;  1FRN A;  2F0G A;  4TMW A;  2QA4 B;  3RUZ A;  2RC5 A;  1I6V C;  1I50 B;  1XE1 A;  5FIU A;  2Z6B A;  4CHT B;  3SJZ A;  1VQ4 B;  3HOW B;  4A3F H;  2KCM A;  4DAM A;  1H85 A;  4OP7 A;  3M9B A;  5J3O A;  4LF9 Q;  2NN6 I;  4YCV A;  3JAM i;  5GAH C;  2B2T C;  4ABN A;  4YIJ A;  3R2T A;  1PH9 A;  1YIJ B;  3G05 A;  2KEE A;  3CQZ B;  5IYD H;  1EFT A;  3MXP A;  3UE0 A;  4NW2 A;  4DK3 C;  2X85 A;  4ILW A;  2PZU A;  1XPO A;  4IZ8 A;  4QVJ A;  2AQ2 B;  1WSV A;  5C4X B;  5LL6 S;  2JA6 G;  1QX4 A;  4DV7 Q;  2VBT A;  2J0T D;  2BM1 A;  5CDF A;  1VS0 A;  3GIR A;  4CGY B;  5M5Y H;  3M4P A;  4DV4 L;  4C3H B;  4DN4 M;  3V7A A;  1B44 D;  2KHS A;  1BBU A;  4RD2 A;  1XXG A;  4GNX A;  4KHV A;  1DDG A;  2Q6I A;  3CD6 A;  3GD7 A;  1E3X A;  2PZT A;  4ZRZ A;  4H44 C;  3TRZ A;  4QB4 A;  4P71 A;  1PXU A;  1SFO B;  4X7D A;  5C4H A;  2TMP A;  4BY1 H;  3RZD B;  5FKA C;  4XL9 A;  5BSX A;  3GTL B;  2SNM A;  2ES2 A;  2EE1 A;  3PUV A;  4RCO A;  4R71 A;  5DEH A;  3W1B A;  1PH1 A;  4M1U B;  4FXK C;  4AH6 A;  5EKL A;  5A8A A;  2DER A;  3JQR A;  4RHS A;  2BGI A;  4LF8 L;  1SYG A;  1VHE A;  2D74 A;  1GAW A;  3AVX A;  5ELN A;  4XYO A;  1AEX A;  2PCF B;  4YCU A;  4F7D A;  2WIN B;  3KUP A;  4L5R C;  1AZP A;  1EIG A;  3LNN A;  4A3L G;  3VYR A;  1U5K A;  2XRQ D;  1GJX A;  4P6V F;  4XQN A;  3JU4 A;  2F3W A;  5DM7 3;  1IJE A;  3I56 B;  3UE1 A;  1SE4 A;  4FVM A;  1PTO D;  3OE7 A;  1KRS A;  5KEE A;  4X64 L;  4C0S A;  1NBW A;  2NYZ D;  4ZQ3 A;  2X0K A;  2XNC A;  3OKX A;  1SM4 A;  2GA4 B;  3I4M B;  4KHP Q;  3E20 A;  5IGD A;  2OWO A;  3K7U C;  4LF8 Q;  1PTO C;  1TS4 A;  5JEA H;  4OO1 H;  1QGZ A;  4XON A;  3BQJ A;  5TSS A;  1XX8 A;  1E3P A;  3KJP A;  1TQO A;  1EY8 A;  2UU9 L;  2EYJ A;  5I2Y A;  4JI8 L;  4EH1 A;  1QVG A;  1QNK A;  3M3Y H;  3MZ5 A;  4KKU A;  4ZLT F;  3TBI B;  1PYS B;  1SRU A;  4WJ3 M;  2ZM6 Q;  4ODG A;  3U50 C;  1MRZ A;  1BLI A;  3AVT A;  4FXU A;  1D8L A;  3I4M G;  4UP8 A;  4FDB A;  2BSA A;  2NVT H;  1VQP B;  1STA A;  3T1Y Q;  3C46 A;  3WBJ A;  1HUM A;  1NR2 A;  2V1C C;  2E2H H;  4MYU A;  1NRK A;  2CFM A;  4A3B B;  3I4L A;  4XQF A;  4JMQ A;  1YNN D;  3LWU A;  2BF4 A;  1YI2 B;  3AVY A;  5KIX A;  3NBH B;  2CW5 A;  4PAA A;  1PKV A;  4M8A A;  3T1H L;  3ZC3 A;  1LAC A;  1TWH B;  5DLQ E;  1HVX A;  1YEZ A;  1LTT D;  1Y1W B;  1IJF A;  2D9R A;  1YNN C;  1SE8 A;  1EFU A;  3A1P A;  3M85 A;  4A75 A;  3RD4 A;  1PHJ A;  1B2R A;  1JWU D;  1L2F A;  4P9S A;  3W2D A;  2QE7 A;  4A3B G;  4Z4Y A;  2K52 A;  1D6E C;  3A55 A;  5JJL A;  3KF6 B;  2ZL6 A;  4WFN 3;  2PI2 A;  3OEE A;  4UAI A;  1Y1W G;  1V1P B;  2BM0 A;  1KQS A;  4A3E B;  1STH A;  4JI5 Q;  1V0E A;  3QFC A;  3JQQ A;  2LZJ A;  1ESR A;  4UZE A;  3SEJ A;  3K5O A;  5LMZ A;  5BN5 A;  2OF1 A;  3ULP A;  2VNI A;  1BX1 A;  5F2D A;  2B7B A;  5IT9 L;  4JI1 Q;  2KHI A;  4YWL A;  3CPW A;  1H95 A;  1A0I A;  1KAB A;  2FXQ A;  1WVL A;  2WJY A;  3HOZ H;  1CHQ D;  4A3E G;  4LW1 A;  1I50 H;  2R93 G;  2FX3 A;  4N3G A;  3GTJ B;  1TTT A;  2VQF Q;  1NBM A;  3HOW H;  3STB D;  2A8V A;  4H0L C;  2DYI A;  4AF7 A;  1N33 L;  3HOV H;  2I46 A;  2YTV A;  3SK5 A;  1ZUN B;  2EVB A;  3STB C;  1ELO A;  1C48 A;  2DJG C;  3OSO A;  3P1H A;  5FLX E;  1PTO F;  3ONA B;  4C3I B;  4IFD I;  1KDC A;  3CQZ H;  1S5B D;  1NMG A;  3KDF A;  1XNQ L;  2NVQ B;  1KRT A;  3K58 A;  4KK7 A;  5JOB A;  5K5P A;  1E1T A;  4H9G A;  5C4X H;  4YAF A;  5LMU Q;  2JN9 A;  1WCM B;  1L1O A;  3DWQ A;  2HCC A;  2F4V L;  1EL0 A;  4LFC Q;  1X3E A;  2D5D A;  4C3H H;  3CC2 B;  4F7X A;  3J81 i;  4FP5 D;  1G29 1;  1IBL L;  1VQG A;  3HAG A;  4AIM A;  5M3M G;  2X6W A;  2H5X A;  4RFB A;  4DV1 Q;  3S2H B;  2ZTE A;  1ILP A;  3MTS A;  5C0X J;  1E64 A;  3U2Q A;  1SFO H;  4ZGQ B;  2AQ1 B;  1ZM3 A;  1VLY A;  5HZA A;  3UDG A;  1PTO B;  3W2E A;  3RZD H;  1HQR D;  1WCM G;  2EYP A;  1IKL A;  2VB2 X;  2A6E D;  1IL2 A;  3GTL H;  3I4N H;  1WD0 A;  5H59 A;  4ZGN B;  3DEP A;  5IGC A;  4A3D B;  1YIT A;  2J7K A;  1Y8N B;  4GZY C;  2RHS B;  4OOV A;  3PUX A;  2OBR A;  1JMC A;  3OFN A;  2A6E C;  1N8R D;  4QMG A;  3CME A;  4LF7 Q;  1XNR L;  4LAA A;  1WJJ A;  1GJR A;  3H91 A;  2V31 A;  4DR3 L;  3OPO A;  1ML0 D;  4BBS B;  3DM1 A;  4ZUJ A;  1N8R C;  2ZTG A;  2VNJ A;  2OT2 A;  2B29 A;  1PFM A;  4JVZ A;  1STG A;  4ZYS A;  4Z4W A;  1HFN A;  4JV5 L;  5EPJ A;  1Q1E A;  2ZXH A;  1K0S A;  2GN5 A;  3QJY A;  4QGU A;  1N08 A;  3WOE A;  1JJ2 B;  5DM6 3;  3CMA B;  4IUV A;  2EIF A;  3E3X A;  5CV9 A;  4HJA A;  2K14 A;  4YEJ A;  3CCJ B;  1MSG A;  1K28 A;  4CDF C;  4N3N A;  1A62 A;  1QFZ A;  1TUI A;  5EBC A;  1EXM A;  1SNQ A;  2GQF A;  2EY6 A;  4BBS G;  1OXX K;  4RCZ A;  3PA2 A;  3CC7 A;  4DAV A;  4C2M B;  3AMU A;  1JOK A;  3H3V C;  2FMM A;  1B9N A;  2KCT A;  5GQO A;  1EQR A;  4U68 A;  2HDL A;  5BR8 Q;  4X06 A;  4X05 A;  2WFW A;  4MNO A;  1OXS C;  4JV5 Q;  2Q6K A;  3MXG A;  1BO0 A;  5IGE A;  4PV1 C;  1T6X A;  2F1M A;  4KJN A;  3DUZ A;  1WP6 A;  3HZX A;  2YTY A;  3AVU A;  3GV3 A;  1C4Q A;  1BXT A;  5EBD A;  5IYB G;  3L9A X;  3KEW A;  1RCV D;  5KND A;  5FLM G;  3ICE A; 
#chains in the Genus database with same CATH homology
 1B53 A;  4YEL A;  2B2Y C;  1PYW D;  3QWN A;  1UD3 A;  3NXW A;  4XYQ A;  1EY9 A;  2H4O A;  5ELE A;  4TKO B;  2F3V A;  2K01 A;  5A2Q L;  5CBA E;  1IW7 D;  1CA5 A;  1DON A;  1E2W A;  3VYU A;  5KYL A;  2DY8 A;  5IT9 E;  1IW7 C;  4QF4 A;  2B2V A;  5J39 A;  3P7J A;  5ISR A;  3HOY B;  1HQM C;  1EFI D;  1E79 A;  3MC0 B;  5IIF A;  1QG7 A;  2EY2 A;  2LFN A;  1LV9 A;  2RDG A;  5FO8 B;  3GVJ A;  3HG9 A;  4A3I B;  1ICW A;  5IOC A;  2PQE A;  1UD4 A;  4P2C B;  1EWH A;  4XR6 A;  3U9O A;  2EYM A;  4HN7 A;  3MFY A;  1LTS D;  1IYU A;  4K5X A;  2IJ0 A;  3NK9 A;  3J7A F;  2NVY B;  3MXU A;  3DHQ A;  1KLU D;  2YYZ A;  2O2L D;  3K6O A;  2BE5 D;  2WII B;  2WPD A;  4XXE A;  1SXT A;  2BE5 C;  3OIP A;  2RDH A;  3PO2 B;  4XKW A;  1SYC A;  3A7A B;  4K14 A;  4NMZ A;  4BY7 B;  1R4P B;  5C0X G;  3TN2 A;  4B3F X;  4DA2 A;  1Z7T A;  4FO2 A;  3KF8 A;  1O7Y A;  2MP1 A;  1HUN A;  2B2U A;  2K32 A;  4ZK9 B;  4EVO A;  1PFB A;  1DYQ A;  3S14 B;  4O1N A;  1G8Z D;  3BVG A;  2ZXP A;  3FEW X;  3E0J A;  1CA6 A;  4RWS C;  3DXJ C;  5C5L A;  4R8N A;  1BR9 A;  4HSP A;  2Z4H A;  5KNC A;  4C3J B;  4XQJ A;  3CP8 A;  4X3T A;  1PZJ D;  5EJW A;  1C8C A;  3NWS A;  2E76 C;  3SXH A;  1B50 A;  1LTR D;  1FNV A;  4IN3 A;  2EJG C;  1RD9 D;  3J81 L;  4XNF A;  2VXW A;  3D8G A;  5EGT A;  5IGF A;  2ZTN A;  1PDQ A;  4RGN A;  4G57 A;  1F2L A;  2NUC A;  4O42 A;  3G6J B;  5KGU A;  5K36 H;  5C6A A;  4OO1 I;  3MAQ A;  1BCP D;  1SYB A;  1KZL A;  2PO4 A;  2RA4 A;  3PV0 A;  2NTT A;  1BCP C;  1I3Q B;  4H7B A;  5JVG 3;  2M00 A;  4C56 C;  5A2Q E;  2NZ1 D;  2J7Z A;  1JR0 D;  1HTP A;  3CKI B;  1JQY D;  1WTX A;  2B2W A;  4B3G A;  4B9W A;  3FPU B;  1M4V A;  2WB1 B;  2CK3 A;  2KED A;  4J1M A;  2R7Z B;  2O5I C;  1H8H A;  5C44 B;  4ULL A;  2F0U A;  2HCI A;  1GHJ A;  3S9W A;  3WQZ A;  3KLS X;  2JJ1 A;  4R8I A;  2F0J A;  4DGZ A;  5I6W A;  5C3W A;  4FNF A;  1F9P A;  2XIW A;  2XOK A;  1HTL D;  2EYH A;  1IYV A;  1SKY B;  2X6Y A;  2JEA I;  1SYD A;  2X8K A;  4JBW A;  1D2B A;  1WTH D;  4DXG A;  4I65 A;  3ZIA A;  1E2Z A;  5CR3 A;  1ZXT A;  5FL7 A;  4BWG B;  3GO5 A;  4CJ2 C;  2V4D A;  4DF7 A;  1MBY A;  3CRK C;  4CKB A;  2F0O A;  4U67 3;  1LO5 D;  4RKB A;  5CV5 A;  3S1N B;  2A6H D;  1TWC B;  4QUC A;  1MAB A;  3S1Q B;  1H9S A;  5CC4 A;  2A6H C;  2I07 B;  3TP8 A;  1BCP F;  2LS0 1;  5M5W B;  2JIZ A;  4XLC A;  1ONL A;  2F03 A;  4TRD A;  4A3K B;  2QKI C;  1GHK A;  1Q12 A;  2LY7 A;  3VR3 A;  3VYT A;  2L12 A;  1FD7 D;  5J1Z A;  2ICE C;  3V96 A;  1AW7 A;  2D2C C;  3QOJ A;  4TSS A;  4UZU A;  5JJZ A;  2JA8 B;  3BH4 A;  3NTK A;  1I4G A;  1GUO A;  2K5W A;  5I4D A;  1CQV A;  4XM3 A;  2Z1C A;  1J8I A;  3LWE A;  2GJK A;  1BCP B;  2KCN A;  1B3A A;  1JC7 A;  5C3X A;  3I70 A;  2YU9 B;  2DN8 A;  2PMZ B;  2ZXO A;  1CZW A;  4X3U A;  2KVO A;  2JA6 B;  1SNC A;  1FR3 A;  2MHV A;  1HRJ A;  3M4O B;  1T5E A;  5JPM C;  3D4W A;  4LJZ C;  2KCC A;  5CYU A;  3RLF A;  1EY6 A;  2Q8R E;  3QB3 A;  4JK1 C;  4HED A;  3HEJ A;  2M5S A;  4YXW A;  1TY0 A;  4ID6 A;  1DCZ A;  4ZAI A;  2KQ3 A;  1GUT A;  1TS2 A;  1NUC A;  4V0B A;  4G6I A;  2B8F A;  3A3B A;  2JXM B;  2AUJ D;  4RHR A;  1FNU A;  1WTP A;  5DAU A;  3CP2 A;  3OW7 A;  3VR5 A;  3Q23 A;  1Y8P B;  2XNA C;  2MPM A;  1CQF A;  2K05 A;  2RSO A;  3L3O C;  1W6J A;  4K2L A;  1Z47 A;  1V43 A;  1D5X C;  3S1M B;  1SYE A;  1Q90 A;  2E2D C;  2NTS A;  3CES A;  1JOR A;  2XVS A;  1A3U A;  1KAA A;  2OXP A;  3NBH A;  4NKL A;  3EFX D;  3T51 B;  3GTM B;  5JVH 3;  2IL8 A;  5CBE E;  3VR2 A;  3RMH A;  2ZXI A;  1LLR D;  5COR A;  4HCE A;  3PUY A;  2K5D A;  3OMG A;  3T4A C;  2F0M A;  2W6I A;  4K6D A;  2NB0 A;  1V1P A;  3BYY B;  1TWF B;  4WJW A;  1S5E D;  4K8I A;  4E0F A;  3DWA A;  1A2U A;  3BZD B;  1QOH A;  1Y8O B;  4KHZ A;  1ENA A;  3S2D B;  4KY6 A;  1GOZ A;  1UD6 A;  3HGB A;  1VMP A;  2NN6 G;  2IW3 A;  4S3S A;  4RCN A;  2RKS A;  1DD2 A;  2VNU D;  4IFD J;  1T5X D;  1TWG B;  1LTA D;  1U9R A;  4EQO A;  5A35 A;  2Q8T A;  1GUN A;  4PMB A;  1COW A;  2F0F A;  2R93 B;  4IUQ A;  4ASU A;  4ZKB B;  4G7X A;  4IQZ A;  1GXD C;  4LMQ D;  1NCV A;  4KTA A;  3ZPN A;  3K0Y A;  2V7Q A;  5EPK A;  2F0K A;  3EJI A;  2C9O A;  3HKZ B;  1VMC A;  2RDF A;  1NAP A;  3S17 B;  1SJH D;  2D3N A;  4II3 A;  3EA6 A;  1LTI D;  3S16 B;  3OOC A;  1TKW B;  5M3M B;  3FKS A;  4KY7 A;  2JP1 A;  1BBX C;  2R6G A;  1K28 D;  1PZI D;  1MSH A;  3A8J E;  4TQU S;  1UD2 A;  1I4Q A;  1STB A;  2F43 A;  1XYI A;  3N52 A;  1CI3 M;  2N88 A;  1EY5 A;  5M5X B;  2L55 A;  1ROD A;  5CGK A;  2CVR A;  4G7W A;  3G7L A;  1EU4 A;  4F87 A;  2KVM A;  3A8K E;  3M7N A;  1G91 A;  4ME5 A;  2F0L A;  3UI2 A;  2WJV A;  1O78 A;  3GVK A;  1PZK D;  1S5D D;  4BA2 I;  2K28 A;  1H9R A;  1RHP A;  3D4D A;  3NQI A;  3NBI A;  1S5C D;  3JAM L;  1FNW A;  2GJP A;  5EPL A;  2O4X A;  1E2V A;  1XWE A;  2QDB A;  3EQL C;  3P75 A;  1NSN S;  2FHT A;  3BC9 A;  2K03 A;  2QF7 A;  5HKK A;  3K5L A;  5CMD A;  3WDN A;  1AP0 A;  1CHP D;  3X3N A;  1O7Z A;  2B2V C;  3OWF A;  4AYB B;  3HOX B;  3FPP A;  3H94 A;  3U9S A;  2ZZE A;  1QE6 A;  1QCB D;  3I91 A;  4G7O C;  2F0I A;  1BUV T;  3ERO A;  2DY7 A;  3D4R A;  1F9Q A;  3QO2 A;  4F88 A;  5LHY 1;  1BOS A;  5AFW A;  3IL8 A;  2G9H D;  5ELF A;  4IFD G;  2IPK D;  1II3 A;  4BA1 I;  4N9T A;  2F0Q A;  3TME A;  5ELD A;  1ENF A;  3TDQ A;  3CU7 A;  3GTP B;  4CJ0 B;  4A3M B;  4IUT A;  1EY0 A;  3D6C A;  1RDP D;  4BBR B;  2K6A A;  1FYC A;  5C4Z A;  3CMM A;  5FOB B;  1ESF A;  3K57 A;  2XRS D;  2NWG A;  2Y0S B;  4XOT A;  2WSS A;  1JE4 A;  3SK4 A;  2DIE A;  1KNA A;  2PW5 A;  2HUG A;  5ELC A;  3H6M A;  4K6L A;  3W3A A;  2JYO A;  1E1R A;  1OHH A;  1SND A;  2B2U C;  3OMC A;  4K5V A;  2JDI A;  1OB0 A;  3ERQ A;  1CM9 A;  3C3L A;  3HP3 A;  3QIA A;  1K8M A;  2X53 S;  5KNL A;  2B2Y A;  3D3R A;  3DMU A;  1JB3 A;  2L5T A;  3FRP B;  4XOR A;  1NR4 A;  3FKI B;  2JEB I;  3BDL A;  1TII D;  1B4O A;  2ICI A;  1LT4 D;  1PMR A;  1RF2 D;  2VJI A;  4XDX A;  3BDC A;  1U4P A;  1X32 A;  3V2T A;  5G3L D;  1PFN A;  2B39 A;  4KMU C;  1PTO H;  3C1F A;  5JEA J;  1U4R A;  3JAM E;  4G7Z C;  4KKS A;  1VF5 C;  1HA5 A;  2KJX A;  5BN3 A;  2M2L A;  3PIP 3;  1HHV A;  3HOU B;  1PLF A;  2M9V A;  3GTQ B;  1G6Z A;  3GQB A;  3J7Y W;  4A93 B;  4CKE A;  2AWO A;  1DOK A;  1DOL A;  1I8D A;  1F2Z A;  3PMF A;  2EJF C;  2B8G A;  1BMF A;  4HAE A;  1EYC A;  2SEB D;  3Q0A A;  1CT1 D;  3PUZ A;  2EPB A;  4B9X A;  1TWA B;  1HXY D;  2MJ8 A;  2K33 A;  4EQP A;  3SVM A;  2GK7 A;  2WP8 J;  1D1I A;  3QG1 A;  3OHX C;  5C4J B;  3PIO 3;  1E1Q A;  5COY A;  2SDF A;  1JWM D;  1UD5 A;  4XN0 A;  3BDO A;  1LT3 D;  5IGG A;  3MXN A;  2WAQ B;  4J8Q A;  3Q22 A;  2BCO A;  4WRD A;  1DOM A;  3TP6 A;  2AQ3 B;  4LK1 C;  3A56 A;  4E6I A;  1SDF A;  3NP8 A;  4KN7 C;  2PNR C;  4K8J A;  3NUC A;  1E0B A;  1VF7 A;  4F8M A;  1WTR A;  1EQV A;  2W6J A;  1A3V A;  2ID0 A;  4DFA A;  1UAP A;  5CV8 A;  4FF2 A;  5NUC A;  1EYA A;  2L1B A;  5G3L F;  4I7Z C;  1SNP A;  4HR7 B;  4BY1 B;  1AN8 A;  3NTH A;  4OIJ A;  5FO7 B;  3IKJ A;  4RGO S;  5T1G A;  1JWS D;  4XLF A;  5JAV A;  4MIU A;  4GQN A;  2R3Z A;  2MGS A;  1F2Y A;  4KN4 C;  2JJ2 A;  2CW0 D;  1H8E A;  2F0E A;  3BS1 A;  4XT1 B;  3R8B A;  2A73 B;  1X3P A;  3ND8 A;  2CW0 C;  4L63 B;  5C0X H;  2KA7 A;  2FMC A;  2Z6B D;  4BS9 A;  3TSS A;  4ZUI A;  2ZT9 C;  1I4X A;  4NDX A;  2L4N A;  3AU7 A;  3KLR A;  3M3Y B;  4II2 A;  3TZD A;  2ZZF A;  2JE6 I;  2PPB C;  1LAB A;  2AWN A;  2SOB A;  5I2X A;  3KK7 A;  2NVT B;  1WTW A;  5JEA G;  3SK6 A;  4OO1 G;  4Q0F A;  1IL8 A;  1SJE D;  1OO9 B;  5E1F A;  3A7L A;  2IX3 A;  2ZZG A;  1WD1 A;  3IAY A;  2ZXR A;  3I3C A;  1FX0 A;  4H13 C;  3VR6 A;  3O13 A;  2SNS A;  4XD7 A;  2JSO A;  2N55 A;  3PUW A;  2WKC A;  2EYL A;  3N6R A;  3T16 A;  3J81 E;  4HMI A;  1YNJ C;  1TT2 A;  1G2S A;  5IOD A;  1QNU A;  3F2U A;  4FF4 A;  1EY4 A;  3BYT B;  3SE0 A;  5HUR A;  3S1R B;  2K7V A;  2XWB B;  1Q1B A;  3GTG B;  5I6Y A;  3MVV A;  1A6X A;  5E4X A;  1EZ8 A;  1I4R A;  4X3K A;  1S4Z A;  2BDN A;  3Q24 A;  1BQQ T;  2D3L A;  3C2P A;  2IX0 A;  4RKL A;  4OGQ C;  3NE5 B;  2QEJ C;  1H9S B;  3I90 A;  5DN6 A;  1IHZ A;  2PZW A;  2EYF A;  3HOV B;  2E2J B;  1EFR A;  3K5M A;  4TSF A;  1K8O A;  3VA5 A;  2GK6 A;  1EOT A;  1F9S A;  2FFK B;  2B63 B;  1CFM A;  1EEF D;  3K7A B;  4G4K A;  1SMY D;  1E43 A;  3BG3 A;  4QCL A;  2K1B A;  1A3T A;  5FLX L;  3C1E A;  1SMY C;  1F77 A;  1ZKO A;  2BA1 A;  2IT1 A;  3WOF A;  1I18 A;  5BN4 A;  3OEH A;  5I9O A;  2F0P A;  3VYS A;  4C1N K;  2XZO A;  2E1B A;  1SNO A;  2F0N A;  3I4N B;  2ZZQ A;  1WTO A;  5FK9 C;  5EKK A;  4C3H G;  5FO9 B;  5IK2 A;  1VCI A;  1HCZ A;  3P20 A;  1BNZ A;  1HPC A;  4XQQ A;  1A2T A;  2B2T A;  2XND A;  1L0X B;  4NNJ A;  1EEI D;  4PNY A;  1KDA A;  3IFT A;  1GUW A;  3E6Z X;  4RH6 A;  5DNF A;  2E74 C;  1EU3 A;  1FGB D;  1QB5 D;  1GUG A;  2BOS A;  1SBB B;  2K5Q A;  1PRT D;  2X6L A;  4DNT B;  4XTC S;  1PRT C;  2OEO A;  4QIW B;  3DDY A;  3ND9 A;  1OXT A;  1EZ6 A;  1BDO A;  5C5M A;  2PW7 A;  3BCD A;  5HGT A;  5M9O A;  4XN3 A;  3NHH A;  2GJR A;  1F9R A;  2J4X A;  4A3J B;  2KOL A;  1I6H B;  5IGB A;  3Q6S A;  1TU2 B;  4WOR A;  1KMH A;  5EQ0 A;  4XMY A;  1R4Q B;  2ENB A;  2DNE A;  2XN9 C;  1H9J A;  4HMJ A;  2CHB D;  1B2T A;  2L0C A;  4TT3 A;  3TZU A;  2A68 D;  4L6T B;  1BF4 A;  1K83 B;  3NSW A;  2RQX A;  2E2I B;  4XOP A;  2EY5 A;  5CV7 A;  2A68 C;  2FJ2 A;  1BPL A;  4EQN A;  1I4P A;  1EYD A;  2WZP P;  3GV6 A;  4FXG C;  2JA7 B;  1O80 A;  1CZG A;  2RVL A;  4QUF A;  3MA2 B;  1DZ1 A;  4DXF A;  1LTB D;  4FF3 A;  4HIZ A;  3VR4 A;  2VUM B;  3KBX A;  4HCS A;  4AVZ A;  1SE3 A;  4IUR A;  2D9U A;  2WKD A;  2CQA A;  3IFD A;  1HZE A;  1HA6 A;  4KY5 A;  3E5S A;  3MEH A;  4RA8 A;  4Z9C B;  3K59 A;  1GUS A;  3J80 L;  5J22 A;  4XLA A;  1PRT F;  3GP7 A;  4OHJ A;  3SR1 A;  2RSN A;  3V05 A;  1JIC A;  4C3I G;  4FYD A;  2F0V A;  3ZYY X;  3OAA A;  3S15 B;  1KNE A;  3URY A;  2XZL A;  1SEB D;  3BVM A;  2EZV A;  1RTO A;  4ZKC B;  3A3G A;  3A35 A;  2X6X A;  4R9W A;  3FMC A;  4XKV A;  1QIL A;  3T53 B;  3D31 A;  1STE A;  3HS0 C;  5D14 A;  2XZP A;  1ZYR D;  2XWJ B;  2F0W A;  2F0D A;  1PRT B;  2R92 B;  3CRL C;  3NTI A;  4KI0 A;  1ZYR C;  1TVX A;  1Y1V B;  4X3S A;  3T13 A;  2WV6 D;  2NN6 H;  1KTK A;  3NPP A;  2A74 C;  2FIN B;  3L7Z C;  4C1N I;  1EQT A;  5E3F A;  4Z1M A;  5D65 A;  3D6W A;  1TS3 A;  2O5J C;  2F4I A;  1Z6H A;  1MI2 A;  1U4M A;  3GVL A;  1ET6 A;  5C0X I;  4L8J A;  1G2T A;  3TP7 A;  1O7L A;  3GTK B;  5D3D A;  5D3I B;  1E3Z A;  3I8Z A;  1ET9 A;  5M3F B;  2L11 A;  4HSV A;  5K36 G;  1W9X A;  4RGT A;  4DAY A;  2EXZ A;  1V8Q A;  1STY A;  1A15 A;  2C5C A;  3H0G B;  2LMC B;  3GTO B;  3T56 B;  4Y7N B;  4PMC A;  4NP5 A;  1OXV A;  1B9M A;  4DK1 A;  3J7A V;  1H9M A;  1X3Q A;  3ITP A;  1L0Y B;  3DWP A;  2IWH A;  2VB3 X;  4XLE A;  1W6K A;  3AB9 A;  1RTN A;  1UNS A;  2DNC A;  2LKV A;  3PO3 B;  3CHB D;  1QWY A;  4HTH A;  2QIL A;  2XSC A;  5JPN C;  2MUY A;  4B08 A;  1WTV A;  4OL7 A;  1I4H A;  4RAU C;  2RBM A;  2R61 A;  1TS5 A;  2BDO A;  1MGS A;  2PYK A;  1M8A A;  3J80 E;  5KYI A;  1WTQ A;  3R2I A;  1V1O A;  1W0J A;  4KD4 A;  1TR5 A;  2E75 C;  1EIH A;  3OWE B;  1QJO A;  2AUK A;  2NVX B;  1U4L A;  2F0S A;  3HRZ C;  1D1K A;  5KRU A;  4FXD A;  1AFP A;  1CK1 A;  5LL6 X;  3MWY W;  2Z4I A;  4UDU C;  4XLH A;  3VA7 A;  3I72 A;  2K04 A;  2IX1 A;  3KBG A;  4J6H A;  4Q5V A;  1R9T B;  2H1E A;  2B2W C;  3H09 A;  4V19 0;  4PMW A;  5EKI A;  1DJR D;  4KV6 A;  3BCF A;  5C3E B;  3DEO A;  1VDZ A;  5ELB A;  3NQT A;  4MHE A;  1ILQ A;  2Z8L A;  3EVQ A;  2JA5 B;  1IKM A;  2R9V A;  5KNB A;  4KKT A;  1RKN A;  4IFD H;  4XIG S;  1DXM A;  1HFG A;  1UUP A;  1D5Z C;  2F0H A;  4A3F B;  2G9D A;  1Y69 U;  1KDB A;  3M7G A;  3X3M A;  1EY7 A;  4C3J G;  1SE2 A;  1W0K A;  4CBV A;  2Q8I B;  1SYF A;  3A54 A;  2EOT A;  3R3O A;  2EY1 A;  1ENC A;  5E4W C;  1S5F D;  3MHB A;  4XT3 B;  5M5Y B;  4DNR B;  4EGV A;  4CJ1 B;  2L9H A;  4DAP A;  4K5W A;  4A3G B;  5CV6 A;  1ZEQ X;  2HDM A;  2KEC A;  1JOQ A;  1CTM A;  1LTG D;  3M4Y A;  2XGJ A;  2HQE A;  1UEA B;  3MFG A;  2F0T A;  5T1I A;  1OXU A;  3A8I E;  4PQX A;  1J9O A;  2X69 A;  4FF1 A;  2WAC A;  1TY2 A;  4P22 A;  3BVZ A;  1EWC A;  4N9P A;  3FDT A;  1STN A;  2EDG A;  2HLD A;  2NBF A;  3I73 A;  3R93 A;  1D5M C;  1DM0 B;  4K2K A;  2A69 D;  1B1Z A;  4DK0 A;  4IUN A;  3SDZ A;  1H9K A;  3SK8 A;  2A69 C;  5I9P A;  1SSO A;  2D62 A;  4IUP A;  4OIK A;  4CKC A;  3K5N A;  3NWT A;  2BA0 A;  2X6G A;  2QCP X;  1F2M A;  2KUM A;  2EJM A;  4MN3 A;  2E2H B;  1JCK B;  1SNM A;  4KJO A;  1KLG D;  3SHL A;  4KD3 A;  1LT6 D;  1SAP A;  4DU9 A;  4IAL A;  1Q3L A;  1V0F A;  4RGM A;  1MD2 D;  1YNJ D;  3RZO B;  3LX0 A;  1XTC D;  2EYO A;  1UD8 A;  4IUU A;  1AZQ A;  1WPC A;  3KLS A;  4G7H C;  2VJJ A;  2A5H A;  3FVQ A;  3SEB A;  1JOO A;  3TP5 A;  2TSS A;  3OIQ A;  1LT5 D;  1RJT A;  3QOL A;  1VJS A;  1Q8I A;  3HOZ B;  5CV4 A;  2F0G A;  3RUZ A;  1I50 B;  1I6V C;  4CHT B;  3HOW B;  2NN6 I;  2B2T C;  4ABN A;  4YIJ A;  3R2T A;  3G05 A;  2KEE A;  3CQZ B;  3MXP A;  4NW2 A;  2X85 A;  4ILW A;  2PZU A;  4IZ8 A;  2AQ2 B;  5C4X B;  5LL6 S;  2J0T D;  5CDF A;  4CGY B;  4C3H B;  4DN4 M;  1B44 D;  2KHS A;  1XXG A;  4KHV A;  3GD7 A;  1E3X A;  2PZT A;  4ZRZ A;  4H44 C;  4QB4 A;  1PXU A;  1SFO B;  5C4H A;  2TMP A;  3RZD B;  5FKA C;  4XL9 A;  3GTL B;  2SNM A;  2EE1 A;  3PUV A;  4RCO A;  5DEH A;  4M1U B;  4FXK C;  5EKL A;  4RHS A;  1SYG A;  4XYO A;  1AEX A;  2PCF B;  2WIN B;  3KUP A;  1AZP A;  1EIG A;  3LNN A;  3VYR A;  2XRQ D;  1GJX A;  4XQN A;  3JU4 A;  2F3W A;  5DM7 3;  1SE4 A;  4FVM A;  1PTO D;  3OE7 A;  5KEE A;  2NYZ D;  4ZQ3 A;  2GA4 B;  3I4M B;  5IGD A;  1PTO C;  1TS4 A;  5JEA H;  4OO1 H;  4XON A;  5TSS A;  1XX8 A;  1TQO A;  1EY8 A;  2EYJ A;  5I2Y A;  1QNK A;  3MZ5 A;  4KKU A;  4ZLT F;  3TBI B;  4ODG A;  1BLI A;  4FXU A;  1STA A;  3C46 A;  1HUM A;  1NR2 A;  1NRK A;  4A3B B;  3I4L A;  4XQF A;  4JMQ A;  1YNN D;  3LWU A;  5KIX A;  4M8A A;  1PKV A;  1LAC A;  1TWH B;  1HVX A;  1LTT D;  1Y1W B;  1YNN C;  3M85 A;  3RD4 A;  1JWU D;  3W2D A;  2QE7 A;  1D6E C;  3A55 A;  4WFN 3;  3OEE A;  4UAI A;  1V1P B;  4A3E B;  1STH A;  1V0E A;  2LZJ A;  1ESR A;  3K5O A;  5BN5 A;  2OF1 A;  5F2D A;  5IT9 L;  1KAB A;  1WVL A;  2WJY A;  1CHQ D;  3GTJ B;  1NBM A;  4H0L C;  2I46 A;  3SK5 A;  2EVB A;  1C48 A;  3OSO A;  5FLX E;  3P1H A;  4C3I B;  1PTO F;  3ONA B;  4IFD I;  1KDC A;  1S5B D;  2NVQ B;  3K58 A;  4KK7 A;  5JOB A;  5K5P A;  1WCM B;  3DWQ A;  2HCC A;  1EL0 A;  2D5D A;  4F7X A;  4FP5 D;  1G29 1;  3HAG A;  2X6W A;  4RFB A;  3S2H B;  1ILP A;  3MTS A;  5C0X J;  2AQ1 B;  1VLY A;  1PTO B;  1HQR D;  2EYP A;  1IKL A;  2VB2 X;  2A6E D;  1WD0 A;  3DEP A;  5IGC A;  4A3D B;  1Y8N B;  4GZY C;  3PUX A;  3OFN A;  2A6E C;  4QMG A;  4LAA A;  3H91 A;  2V31 A;  3OPO A;  1ML0 D;  4BBS B;  3DM1 A;  4ZUJ A;  2ZTG A;  2OT2 A;  1PFM A;  1STG A;  4ZYS A;  1HFN A;  5EPJ A;  1Q1E A;  2ZXH A;  3QJY A;  3WOE A;  5DM6 3;  4IUV A;  5CV9 A;  4YEJ A;  1MSG A;  5EBC A;  1SNQ A;  2EY6 A;  1OXX K;  4DAV A;  4C2M B;  3AMU A;  1JOK A;  3H3V C;  2FMM A;  1B9N A;  4U68 A;  2HDL A;  1OXS C;  3MXG A;  1BO0 A;  5IGE A;  4PV1 C;  2F1M A;  4KJN A;  3DUZ A;  1WP6 A;  3HZX A;  3GV3 A;  5EBD A;  1C4Q A;  1BXT A;  3L9A X;  3KEW A;  1RCV D;  5KND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...