4DNRB

Crystal structure of the cusba heavy-metal efflux complex from escherichia coli, e716f mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
322
structure length
322
Chain Sequence
b'ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein CusB
molecule tags Transport protein
source organism Escherichia coli
publication title Crystal structures of the pre-extrusion and extrusion states of the CusBA adaptor-transporter complex
rcsb
total genus 56
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00529 HlyD HlyD membrane-fusion protein of T1SS
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4dnrB02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dnrB03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 4dnrB01
1I6VC 5BN4A 1ZYRC 4OGQC 2EDGA 1A6XA 1V43A 1H9SB 3A7LA 1DXMA 1BDOA 2PPBC 3SE0A 1FR3A 1LACA 1GUGA 3PUZA 4OO1G 1Q12A 1HQMC 1SMYC 2BA0A 2K32A 3I73A 2R6GA 1H9MA 1GUSA 3RLFA 1FYCA 3PUXA 3QG1A 4LK1C 4KN7C 1H9SA 2AUKA 2B8GA 2EVBA 1Q1BA 3OW7A 3DXJC 4KKSA 2DNCA 1O7LA 1OXVA 3NE5B 3FMCA 4KKUA 2A69D 3P20A 3A8KE 2O5JC 3A8IE 3M4YA 4KHZA 3N6RA 5KNBA 5K36H 2A6ED 3VR2A 4IQZA 1Y69U 2A69C 4G7OC 2PCFB 4KI0A 3A8JE 2AWOA 2EJFC 3L7ZC 2A6EC 4I7ZC 1H9JA 2CW0C 2DN8A 1CI3M 1Q90A 3T53B 1IW7D 2O5IC 3M7NA 3PV0A 3I72A 3FPPA 1Q1EA 2EJMA 4PV1C 2E76C 1GUNA 3VR3A 1IW7C 1K8OA 2V4DA 3QJYA 1GUTA 1VCIA 2BA1A 2KCCA 4JBWA 5JEAH 4DNRB 1HCZA 1Y8PB 4H0LC 2LMCB 3ND9A 3ND8A 1TKWB 4G7ZC 3EQLC 4TKOB 2NN6G 1G291 1B9MA 1E2VA 2A68C 4GZYC 3A7AB 2BDOA 3M85A 3BDOA 1GHJA 2E75C 1Z7TA 3H94A 1H9KA 4H13C 1IYUA 4IFDG 2B8FA 2A68D 5C0XH 3HGBA 4DNTB 1T5EA 2K7VA 1HTPA 1IYVA 5KNCA 4JK1C 1VDZA 4KKTA 2AUJD 1YNNC 5A35A 1E2ZA 3IFTA 3SDZA 2PNRC 3TZUA 3QIAA 5KNDA 1DCZA 3T56B 5BN3A 4IFDH 1K8MA 4H44C 1VF7A 3OPOA 3T51B 4DK1A 1OXUA 2F1MA 4DK0A 2IT1A 3GQBA 3PUWA 2D62A 2JEBI 2JE6I 3D31A 1LABA 1PMRA 2YYZA 3D4RA 3CRKC 3I4LA 1ZKOA 1GHKA 4L8JA 1EWHA 3PUYA 2KA7A 4HR7B 1O78A 3IKJA 4KMUC 2A6HD 3MFYA 3VR5A 2JXMB 3OOCA 2K33A 5K36G 1B9NA 1CTMA 2ZT9C 2D5DA 2E74C 1OXXK 2EJGC 2A6HC 2L5TA 1TU2B 1VF5C 3CRLC 2BE5C 1HPCA 4LJZC 3WDNA 2JEAI 4BA1I 1CFMA 1DD2A 3VR4A 1OXTA 3AB9A 1GUOA 5C0XG 3VR6A 2BE5D 1Y8NB 4TQUS 1YNJC 5JEAG 3KLRA 4RCNA 1OXSC 3GD7A 2Q8IB 1V8QA 2NN6I 4XTCS 1QJOA 3U9SA 1H9RA 2D2CC 3LWUA 3BG3A 2NN6H 4BA2I 5BN5A 2DNEA 1Y8OB 3VA7A 1Z6HA 4KN4C 1ONLA 4G7HC 3W3AA 4XIGS 4OO1H 3LNNA 2QF7A 1GJXA 3PUVA 1E2WA 3MXUA
chains in the Genus database with same CATH superfamily
5BN4A 3K81C 3PO2G 2R3ZA 4FDBA 4DAMA 2E2JH 4OGQC 2EDGA 5CR3A 2C5BA 4Z9CB 3A7LA 4DA2A 4XT3B 1XMQQ 1VQ8B 2ZTGA 3TZDA 2WIIB 4A3CH 1QCBD 4NW2A 2NTSA 2ZXPA 3VYRA 4QGUA 2JA9A 5IYQA 1SE8A 4X64Q 3CAMA 3WNDA 2PZUA 2B8GA 2YTXA 4ZYSA 1G6ZA 1Q1BA 3HKZB 3BVMA 3ONAB 2OTLA 5A8AA 1V0FA 1HQRD 2EY1A 4PQXA 3RR5A 1R5BA 3ZYYX 1HA6A 5CV6A 1K3BC 4QIWB 4DR6L 2XEXA 4H9GA 4G7OC 1E64A 3L7ZC 4OELB 2EYJA 4LFBQ 4LF7Q 1CT1D 5F4JA 3A5ZB 3FPPA 4B3XA 1MGSA 2XVSA 5C3EH 3VR3A 1G2TA 5DNFA 2VZLA 3JAME 1YHQB 3I55B 1N32Q 3S16B 4ZUJA 2GN5A 2D3NA 3PA2A 3CCSB 3CCMB 1XFOA 1SNMA 2JA8H 2WP8J 4FF1A 2K1BA 4P25A 4PMBA 1EXMA 4G57A 3LGJA 2NVQB 1J5EQ 4FP5D 1FNDA 2G9DA 1DOKA 3R6KA 4C3HH 2B29A 2NYZD 5EPJA 3IFDA 4V0BA 4YWMA 3LVBA 1Y14B 4NXNQ 4LF9Q 2WZNA 4PGOA 3QIAA 5IOCA 2VBTA 1ZM4A 3D4DA 2C9OA 5LMUL 1D8TA 5FJ8H 2Z0SA 1EQQA 3V96A 3I3CA 1ZEQX 4TN1A 4KJNA 4R8IA 1DONA 1VJSA 3B82A 1IL2A 5AFWA 4DR3Q 1S40A 1KQSA 3A8KA 2HCCA 4XQJA 1WTVA 1Y1WB 3OOCA 1H8EA 2V7XA 2PMDA 4BXXG 4X7DA 3S15B 2CQAA 2Q2UA 1HUMA 1PH5A 2VBSA 1WSVA 4FXKC 4YWKA 3BVGA 3L3OC 3ZUGA 1U4LA 1W35A 1YITA 3BS1A 2QEXB 1I4RA 1HZEA 3G71B 3NQIA 1N0UA 1JJCB 5C4JB 2VYQA 2NN6I 5G3LF 1HNXL 3JC66 5ELFA 1ASYA 1Y8OB 5CGKA 3R2TA 5ELEA 3T1YL 2XSCA 5I2YA 1LO5D 1KMHA 3CCUA 4YCWA 4K8IA 2XNJA 1M1KC 1PYBA 3OE7A 1MRZA 4F8MA 4LUVA 1X3GA 1Y1VG 2CVRA 2XRSD 4QUCA 1WTXA 2IX1A 3NSWA 2D9RA 2NV4A 3ZBTA 3HOXH 3KFUA 1WORA 1BBWA 1E22A 2OQKA 3D6CA 1F20A 1MKHA 2K5WA 1A2UA 1EOVA 1CKMA 1XTDA 1VQMA 3P7JA 4KN7C 4LF4Q 2B2UC 3GTKB 2KEDA 1WFQA 4CQJA 3M7GA 4UAIA 1S5FD 1KXLA 2P3MA 2ZL6A 1FL0A 1STYA 3R3OA 4YY3L 1G51A 3OTOL 1AZQA 5TV2A 4XOTA 1KD1C 2O5JC 2W6IA 3LO8A 4MYUA 1AMOA 3M4YA 5HGTA 1N36L 3CHBD 2A69C 5CV4A 1JJ2A 1VQIA 4BBRG 2A19A 1CQVA 4QHYA 3NBHA 1FNCA 4RD3A 4B43A 5LL6X 4LFBL 4BPRA 1PTOH 2ZJQA 1GO2A 3KJOA 3AVVA 1XNQQ 1UD6A 1Y0YA 1N9WA 4C0SA 1Y1WH 3E0EA 1NNXA 3EFXD 4TKOB 4S3SA 2JA7B 5IWAQ 3K59A 4B3TQ 2DOGA 5ELNA 3K5LA 1QUFA 4DAYB 2IY5B 2RKSA 2PIAA 1AZPA 1U0LA 5C0XH 4Q7JB 4PZ7A 1IBLL 1NY4A 4DUYQ 3H9NA 1H95A 1Z9FA 4RAUC 5KYIA 3F1ZA 4P6YA 1QVGB 1VQBA 4ZKCB 3FJOA 2K5NA 3KDFA 2JJ2A 2F0MA 2VQFQ 4X62Q 4G1VA 4J1MA 3J80L 2PZTA 1STAA 2ZXOA 4EQNA 1U4PA 2QCPX 3J80c 3PIPA 1LABA 1S0UA 5HKKA 3CRKC 5FA6A 1L2FA 2WINB 4OPVA 2DY8A 3CCLB 4KHVA 4FWTA 4DR3L 3H3VI 4DR7Q 1S3OA 3E20A 2ZT9C 3TMEA 3GTGB 2A6HC 3NK9A 3FP9A 4MNOA 1JE5A 4O0AA 4XDXA 4LFCQ 4WZEA 4UY8C 2QTZA 1IBMQ 3WDNA 2JEAI 4BA1I 1YIJB 1OXTA 1DARA 1R5OA 4B3SL 3GV6A 4TQUS 3SEBA 3KLRA 1SRUA 4XTCS 4A3FG 1BMFA 2D2CC 1SYEA 2NVXH 3QWNA 1UEAB 4EQPA 2GREA 1W9XA 1TQOA 1Z6HA 2A1AA 2NVYH 3OYYA 5FO7B 2KHSA 3Q0AA 1PZID 2EYOA 1KNEA 1UE7A 4R4OA 1EY0A 4A3JH 3VYUA 1H42A 1GJXA 2K14A 5GROA 3S1QB 4RD6A 3K0YA 4B3RL 3HOVG 3FPUB 1LTID 4JI6L 4K1XA 4RGNA 4II2A 4P9SA 1PFNA 5C3WA 1TWGB 1ZYRD 3S1NB 2BOSA 1LTRD 2R7ZG 4UAJA 4TT3A 4X07A 1SNCA 4B44A 1S5DD 2BVNA 3U2QA 1KD1D 3ULPA 3S16H 2XOKA 1LLRD 2DJGC 1FD7D 3K6OA 4DU9A 1O7LA 3W2FA 3KLSA 5LHY1 3CCSA 4GN4B 4TMZA 4BY7B 4RGMA 1C4QA 2GVAA 1QGAA 3UE0A 3F2UA 2VS1A 1UMKA 1DYQA 4RLZA 2AQ1B 5ELDA 3FRPB 3M7NA 2B7BA 4LF6L 3W2GA 3QB3A 2E76C 2BCOA 2PW7A 2JA5G 2D74A 3CCEB 1WTHD 3SK4A 3HS0C 2KCCA 5FO0A 4IJHA 5G3LD 5JEAH 2E5LQ 1HCZA 2WPDA 3OEHA 1MIUA 3ND8A 4K5WA 3NWTA 1BNZA 1QB5D 3GV3A 4HAEA 3AGPA 1HZAA 4EQOA 2DERA 2UUBQ 4DR2Q 3DUZA 5IIFA 2DGYA 5C4XH 3PIO3 1T5EA 1K28D 4A93G 1JWUD 4DV2Q 2N88A 1WU8A 1IYVA 1L0YB 5LMNL 5IYDH 3HOYH 3H3VC 4OIJA 1YNNC 3Q38A 2JQOA 3IFTA 3K8AA 2L11A 3H0GG 5BN3A 4OPOA 1FNWA 2ZZEA 5J22A 3HOZB 4TMTA 3QSYA 1LV9A 2NBFA 2F0SA 4R9WA 1A15A 3S14H 5C44G 2KUMA 3QFRA 4KHPL 4WZKA 3T1HL 1W3SA 1QG0A 2A6HD 3NQTA 2K33A 1SKQA 1CTMA 1BOSA 4QMGA 2VBUA 5EBDA 5GADC 4CDEC 1K73C 1FGBD 4OIKA 4YAOA 4BY7G 1EY8A 1WTRA 5EPKA 1PYWD 1W34A 1BUVT 2BE5D 2Z6KC 4L5TA 5JPNC 1IBML 1U4MA 3S2DH 1S72B 4U68A 5LMNW 5H5JA 1S4MA 1XB2A 3TP8A 3H09A 1V8QA 5IGEA 4WZTA 2ZXRA 4DPGA 1E7ZA 1E1QA 5EKLA 3TS2A 1F60A 3KBGA 4KN4C 3K58A 4YAUA 1FJGL 1HNWQ 1B7YB 2Z1CA 3IRBA 3G6EB 3JU4A 2N49A 3TBIB 1PH4A 4A3EH 2UXBL 1WCMG 2WAQG 4ZUIA 2WKCA 1O7YA 4TRDA 1SEBD 2RSOA 2ZBUA 4JI7L 2ZL5A 1FNMA 4XKVA 1GUGA 2DUDA 5JJZA 3AGQA 5M5YB 1J8IA 3S15H 2K32A 4ROXA 3GTOB 4QIWE 2NWGA 3WYAA 3VA5A 3K5NA 3DDYA 1IHMA 5CV7A 3G4SB 2ZBVA 3NBIA 4JI3Q 1D2BA 3KL9A 5IYNA 1O7ZA 3CCRA 3P20A 3EROA 4GLAC 1VQJA 1WD0A 1SN8A 1II3A 1VQAA 1M90C 4OP7A 3BZKA 3TS0A 2QN6A 2WV6D 2XN9C 4DXFA 1XYIA 1STBA 1QVFB 1Q8KA 3SHLA 4A3MH 2F0EA 3B78A 5TR9A 3K57A 3PIP3 5JVG3 1GUNA 4LMQD 2BA1A 3CC2B 2MP1A 1PTOF 4Y52H 1TKWB 4G7ZC 1HHVA 2NUCA 3EQLC 5M9OA 1K0SA 1G291 3A7AB 4AQYL 3VNVA 1HA3A 1F2YA 1HVXA 2WJYA 4H13C 4Y9UA 2EYPA 4F87A 4A3DH 1YHQA 1GD7A 2YU9H 1A2TA 3D4WA 4K5VA 1Q8IA 2XNAC 1KL9A 1QFYA 2K6AA 2UUBL 4I7AA 3VYSA 1U5KA 4XQFA 2R92H 4HIOA 2AKWB 1XPUA 4C3JG 2VZAA 1YIJA 3GTKH 4OL7A 4XLAA 1DOMA 1YITB 3OPOA 3H91A 1OXUA 3BCFA 1XXGA 3NUCA 3PQIA 3I4LA 4PZ6A 4Y9RA 1AEXA 4Y7CA 3OZWA 1TS2A 5CBEE 2NVYB 4FO2A 4JI1Q 1X9NA 1V0EA 5JEAJ 4ABNA 3A56A 3EJIA 1GVPA 1D1IA 4Z4YA 3F2CA 1V9PA 3ASSA 1QOHA 1IB0A 5AN9A 5D65A 2K28A 1N33Q 4QCLA 2QILA 1DM0B 1D6EC 1VQFA 4C2MB 3JQRA 1M4VA 3AVUA 3M4OB 4DR4L 3I4NG 3A3GA 3WWVA 1SFOH 1UEBA 3BJUA 4B3ML 4GKJL 4GOPA 1VQ9A 3S2HB 4C56C 3GTMB 1I6VC 1NTGA 4GNXC 2X3UA 2R7ZH 3K7AH 4A76A 1ZYRC 2C4UA 4G6IA 1K0RA 1UE5A 1ZXTA 5M3FG 4JPBW 4MN3A 3HOZG 4G1BA 2PZWA 4X7EA 1BKBA 1HA5A 3SE0A 4OO1G 3U9OA 3TRZA 1Q7YD 3CCRB 4R71A 2MPMA 2F0GA 5TSSA 2HIVA 4DAPA 1LT6D 3Q22A 4OEMB 1LTLA 2LXKA 4ME3A 4X0CA 2AUKA 4YEJA 1WOPA 3JQQA 5M5WB 5ELOA 4R4QA 1TVCA 1TTTA 4Z4VA 4DGZA 2C5CA 5GV8A 5IGDA 4OONA 1B3QA 2BF4A 4K8JA 2NVXB 1KK2A 1AH9A 2LXJA 2MUYA 4OWXB 2VXWA 1G6PA 4FF3A 1VQLB 2N78A 4A3JB 4JI4L 3SKBA 1I50H 5I2XA 1I7PA 1SXTA 3PV0A 2Z6BA 2MFIA 4YHHL 5KW9A 3D3RA 2D0OA 3L0OA 4DV5L 1U2RA 1HH2P 4DNRB 1KC8D 3ZJYC 3A35A 4F88A 2EXZA 4HE6A 4OX9Q 2VL6A 2R93G 4HIDA 3U4ZA 4P26A 2A68C 2C78A 1YHBA 4M0LA 2L12A 4GKKQ 4A3BG 3A5UA 1EQRA 1J9OA 3J7ZC 3CCEA 2UUCL 5D3DA 4IFDG 2OTLB 3H0GH 5J35A 5HURA 1CSPA 5LMNQ 4Y7NB 4JI0Q 1GJRA 4FVMA 1B2RA 2RHSB 1YHAA 3OAAA 3G71A 1RKNA 1WD1A 1JNYA 2H1EA 3P26A 5C44H 3I70A 4YALA 3SDZA 2PNRC 4G7WA 4P22A 3DEPA 1K8AD 1RD9D 1SAPA 1N34Q 4HTHA 2VQEL 1KABA 4FXUA 2PNHA 1FVIA 2JJQA 1JQYD 3D4RA 3VYTA 4JV5Q 5H1SE 2CBXA 1B1ZA 3PUYA 3J80i 2B2VA 1VQHA 4WRDA 2JXMB 2D5DA 4ACAA 1JOKA 5KRUA 4JI1L 4P3YA 3S9WA 4JYAQ 1Q81C 4LJZC 5JJKA 2I5HA 1ENCA 1SJED 1DDGA 3AB9A 1GUOA 4NP5A 5EKKA 3FHWA 1K83B 3UDGA 2F0VA 4NCNA 2OXPA 2ZL7A 1UD8A 3LWUA 3V2TA 1IXRA 4JI8L 2F0JA 4Q5VA 1N0VC 1B70B 2XGJA 4N3NA 4AH6A 1X3EA 3B8HA 5C4ZA 5C3XA 1AP0A 3HKSA 3ONUA 1KDBA 4JI7Q 4ILWA 3KF8B 1FNVA 4I65A 4IPCA 4EVOA 4LF5Q 1TY0A 4UP9A 2E2HH 4KTAA 4PC1A 4DFAA 1BDOA 4HJAA 1FR3A 2RF4A 2WR8A 3FVQA 2HMAA 3E6ZX 2PQEA 4IALA 2PI2E 1ET6A 4R4CA 2EXDA 1IYJB 1JB7A 1JCKB 3G6JB 4GNXB 1QVCA 4ODGA 2EYMA 1SDFA 3OWEB 4IUUA 4WJ3M 1LTSD 2F0LA 2JN4A 4GN3B 4A3LH 4YHBA 2ENBA 2VNIA 5I9PA 2XZPA 3UE1A 4KHZA 2Q2HA 1D1NA 4DV0Q 4DQLA 1TWAB 1WJJA 3PCOB 2B5OA 3URYA 5K36H 1Y69U 1J6QA 1E1RA 1GO3E 2OBRA 2MO1A 1NMGA 3A8JE 3SXHA 2UXCQ 2R9VA 4R1JA 5K5PA 4L5SA 3GSIA 1UUPA 2E5LL 2EJMA 4MTNA 2YTYA 4JI4Q 4Q0FA 4X7CA 4IUPA 4IJLA 4DR6Q 2K75A 4QJFA 2LMCB 4XQNA 4X06A 4DV7Q 5IGCA 2IWHA 1ENAA 1I3QB 3M85A 4LF7L 3K5OA 5M3MG 2WAQE 1ICWA 4DV2L 2VQFL 2L0CA 5CV8A 1HRJA 1K8GA 3CU7A 1N8RC 3K7UC 3P27A 3CCJB 2XIWA 3PO2B 4XN0A 4CJ2C 2OTJB 1HZ9A 5CV9A 1KHIA 4AIMA 3GTJH 2UU9Q 1K8MA 2EZVA 1CUKA 2RC5A 1LM0A 4IUQA 2CK3A 4B3FX 2HDLA 3KF8A 1WVLA 5DSZA 1WTWA 3ULJA 3GP7A 4HR7B 2VQEQ 4LF9L 3ZZTA 4X3UA 1N08A 1KZLA 3D0FA 1FNUA 4LUZA 4EQ5A 2ICEC 3VO2A 1VF5C 2QGGA 2QDLA 3ES9A 2K04A 4XD7A 4DNIA 3AVTA 3VR4A 4C43A 3KF6B 4JYAL 1B8AA 3Q6SA 4HEDA 4DR4Q 1PTOD 1Y8NB 5E3FA 3A1PA 1BCPD 3M4QA 1GUWA 3OMGA 3CCQA 1BCPC 4BA2I 3WBKA 4A3IG 4A93B 2UXBQ 2PMZE 1JWMD 1XTCD 1LTAD 4GNXA 4PC6A 3FKIH 3MXUA 5IYCG 3UDFA 2B39A 2IHEA 1UD2A 4A3KB 1I94L 3QFTA 1ICFB 5FIUA 3HOWG 3S1RB 2FINB 3MZ5A 2ASBA 1VQEA 1QUQB 4U673 3A8IA 2EYFA 4L5RC 4LFAL 3TP5A 4POFA 3QG1A 1UD5A 2X6XA 1BR9A 1E1TA 4WJWA 3GIRA 4C3JB 1Z47A 3W5HA 4LF6Q 2I1LA 2BPOA 1BJKA 1FGUA 2A69D 4RDJA 2LSSA 3BC9A 1TXYA 2B63H 3JQPA 3A8IE 3H15A 1IJFA 1SNOA 1T9HA 2MQHA 2OTJA 5JVH3 2FJ2A 2KBNA 1E62A 1PZJD 3PUMA 1NDHA 1B44D 1ML0D 3KLSX 3NELA 3F8TA 4PNYA 4DV5Q 4IW3B 1Q1EA 1IKLA 2MNAA 1LTGD 1KC8C 4A3BH 2Z4IA 1TUIA 2N55A 5DEHA 3CMAB 2D3LA 4TSFA 2NTTA 1G7SA 5FLXc 4LUOA 5EJWA 4QY7A 4RFBA 1SKYB 5F4MA 3KDFB 3Q6RA 3BDOA 4DV3Q 2E75C 4DV7L 1H9KA 4QVJA 1W2BA 4OOSA 2F4IA 2AQ2B 3KOJA 1YNND 4X05A 1WOCA 1MBYA 5A35A 1QVFA 1E2ZA 2OCEA 4RCYA 4B3GA 5C0XJ 2K05A 3HOXG 4A3KG 3RZOB 3BY2A 3WNCA 2PQAA 3CP8A 1A8VA 4ULLA 3OJXA 2NVTH 3HOUB 1C48A 1PRTC 1PJ7A 2PE3A 1I4HA 3J7YW 1P16A 4KMUC 2LY7A 3VR5A 4DUZQ 1B9NA 1VQOA 4IOAA 1EIGA 1W2BB 5CDFA 2HLDA 3D26A 1TU2B 2ZTCA 2VNKA 5CMDA 1R9TH 3LX0A 1PTOC 1DD2A 1CNFA 1ET9A 4E0FA 1CFMA 4H02A 4WFN3 2VJJA 1K73D 4UPAA 4Y7NH 4KD3A 2N8NA 4YCUA 4O1NA 5ELCA 4BBRB 4X6AH 1XNRQ 1QX4A 1Y1VB 4KY6A 1O80A 4XT1B 4DR7L 4RGTA 1RJTA 1VQMB 1WOSA 4IOCA 1A63A 5C4XB 2WJVA 5B6IA 4POGA 3TEHB 1TWCH 4ZGNB 1TWGH 1S5BD 1YNXA 5IP9H 1XQBA 5EGTA 1EZ8A 3MFGA 2WYRA 4BY1B 1PYSB 4OXPA 2Z8LA 1B23P 1Q12A 4JBJA 1RTNA 4JC0A 3W1BA 3R8BA 1ZM9A 4LW1A 4NPSA 4LF4L 2I0QA 2DIEA 2GQFA 3BQJA 1GUSA 2QW7A 4X66Q 1FYCA 1D5ZC 1F2ZA 1W6KA 2RA4A 2ZTDA 4LK1C 1PJ5A 2K50A 3DXJC 2JK8A 1D5XC 4KKSA 1E24A 4GN5A 3FMCA 1I4QA 1VMCA 1XE1A 1A3UA 3S1MB 4P1VA 4CDDC 2EFGA 3A54A 3RMHA 4ZCLA 2F0UA 3W1GA 3SR1A 3HFZB 5AJ3L 3EBEA 3I4OA 4UP8A 2AWOA 3PGZA 3MWYW 3NPPA 4MTKA 4YHHQ 4GOPB 1CSQA 2F4VQ 1MABA 4XN3A 1M90D 2VNJA 2KCMA 4IPGA 1V1QA 2I46A 1HUNA 1PLFA 5C5LA 2V4DA 1YJWB 1IBKL 1VCIA 3HOUH 1UE6A 3KK7A 4GOPC 1U9RA 2ZZGA 1KRHA 3TSSA 2UUCQ 2Q8RE 1E2VA 4WORA 3A0JA 1KTVA 2SNMA 1BBXC 5KGUA 1Z7TA 3GTPH 3H94A 4A3JG 1RHPA 3SLDA 1HXYD 4E6IA 4XLEA 1HTPA 4HMJA 4TVAB 2ZZFA 3S1NH 2CNDA 4DV6Q 2F0NA 3HP3A 4CJ1B 2CCZA 3TZUA 2ALYB 4LBVA 3T56B 5FO9B 1IL8A 1JR0D 4BY1G 5IP7H 1KRTA 2QKIC 2F1LA 1EU4A 3OHXC 1QILA 2D62A 2DCUA 4XLFA 5T1GA 1EFTA 4XQQA 3X3NA 1CKNB 4L8JA 2BSAA 2WB1E 3CCJA 2HHHQ 1JB3A 4IUTA 3CCVA 4P6VF 2ZJPA 5GQOA 3U50C 3J80E 1K28A 1QE6A 1EIHA 3RNUA 1N06A 2Q8TA 1BCPB 4AF7A 2M9VA 1HR0L 3VR6A 2JA5H 2KCNA 1G91A 1TWFH 5FLMG 3SJPA 1JMCA 3GD7A 4HSVA 4P12A 2F0OA 2RDFA 4G4KA 3STBD 2FX3A 1AFPA 5JOBA 2K5DA 1XNRL 3RZOH 3PIOA 3HOWH 3VA7A 2DNEA 4KV6A 1SYFA 5M5XB 4CJ0B 1R9TB 3A74A 4RDKA 2KOLA 5CYUA 4A75A 3SVMA 4L5QA 2RDGA 5IYBH 1EP2B 1MHWC 2WB1G 1D8LA 1PFMA 3FEWX 3OSOA 1JJ2B 1EY6A 1BF4A 1W0KA 1EWYA 1RQPA 1V1PA 1DXMA 1JB9A 4YY3Q 4ZLTF 2KJXA 4ZAIA 1HQMC 1SMYC 4KD4A 4L6TB 2DETA 2FVGA 1UE1A 2ZITA 3EA6A 1SMYD 1QG7A 3WBJA 1TS4A 2C4TA 4X66L 3OW7A 1IKMA 2E8GA 1EP3B 3CCMA 3FKSA 3HAGA 3NE5B 2DYIA 5BSYA 3A8KE 5KNBA 2L1BA 2ID0A 2GJRA 5J3BA 3VR2A 3W5OA 1PH1A 3RLOA 1XNQL 4K0KL 3PENA 2F0KA 2CRVA 1D1KA 5HXBA 2EY5A 4X64L 3I8ZA 1CI3M 1EZ6A 1TY2A 1VQKB 3RD4A 4BY7H 2ZXHA 5C4JH 2WAQB 2KCTA 3BNWA 1KNAA 1GUTA 1TLLA 3BYYB 1OGIA 3J81c 4B9XA 3T4AC 4A3FH 2QTLA 3NP8A 4A4IA 3SK6A 5L37A 2EIFA 4DR5L 3V76A 1S5ED 2NN6G 1QNKA 4GZYC 1UD4A 3JAMi 2JA6G 1EWCA 4A3EB 3ONYA 4KJOA 1DG1G 1V1OA 3CCLA 2QGQA 4C3IG 4C1NI 2Z6KA 4RCOA 4DNTB 1B3AA 1N07A 1SE2A 1NAPA 2AHOA 1QGYA 2B63B 2NVTB 1A0IA 2K01A 3SK5A 3Q23A 1CQFA 4KKTA 4K5XA 1ZM2A 4O42A 2E1BA 1I6HH 2F0QA 4X65L 3K0XA 4P72A 3GVJA 3AVWA 3J81L 1G8ZD 3Q3AA 3CTAA 3ZC3A 4RM0A 2FFKB 1BQQT 2XNDA 4DK1A 5JBQA 4LFCL 2IT1A 3I4MH 1HJPA 4TMVA 1Q46A 2JEBI 4C1NK 2OF1A 4NDXA 4Z4WA 2BDNA 3QOLA 2SNSA 5FO8B 4CBVA 1PH8A 5FO1A 2OWOA 5IGGA 5LMUQ 2HHHL 1HNZL 1G7CA 3AFQA 4J8QA 4RA8A 1T6XA 2PMZB 3SK8A 1I8DA 4HIKA 2F0WA 3AFPA 4OWWB 4L63B 4EX5A 5C44B 4B3RQ 1WCMH 3U6BA 5I4DA 1B53A 3U9SA 2V1CC 5GAEC 5C3EB 1PHJA 3G7LA 1F2MA 5BN5A 2AWNA 2HD3A 2ZM6L 1CNEA 1R4PB 1WPCA 1XPOA 2EPBA 3CW2A 1XMOQ 3PUVA 1I94Q 3MHBA 1GXDC 2X6GA 1N33L 5TY0A 3DWQA 2GJPA 5C4XG 4RD2A 1V5VA 1G2SA 1YVCA 2IJ0A 2PW5A 1V43A 1HNXQ 5IYDG 3HOYG 3CB4A 3BZCA 4AYBE 3ZIAA 2C2WA 3E1YE 4ZRZA 3I55A 1L0WA 4JBMA 1QWYA 2W6JA 1EU3A 3J7AF 4QB4A 3DLLA 3RLFA 1VQOB 4Z4RA 2KHIA 1SR3A 3EVQA 3MMPA 2R93B 2EY2A 4LBYA 4P2CB 3CC4B 5IT9c 4RCZA 4KLKA 5JJLA 2BH8A 1VS0A 4A3MG 1TT2A 3MXGA 3E9HA 3MXNB 1SLJA 3EIVA 1QFZA 4LWCA 4XMYA 5AJ3Q 3LWEA 4HCSA 2RQXA 4DV1L 3I4NB 1EYGA 5E1FA 2XRQD 4KI0A 1MSHA 2AQ3B 2O4XA 4APVA 2I5MX 2H5XA 5LMZA 1IBKQ 5CBAE 1VLYA 4CKEA 3M3YH 4PAAA 3C3LA 4JBWA 2YWFA 4IPHA 1CHPD 4DAVA 2PQAB 2YWEA 1VQNB 1F9RA 3DWPA 4H0LC 3PO3H 4AQYQ 2OK7A 2KEEA 4CKBA 1JE4A 1GAQA 4IUNA 4PMCA 5CORA 1CM9A 3CC4A 1OB5A 1ILQA 2CHBD 2WKDA 4BS9A 2X6YA 2Q2TA 4A3EG 2XNCA 1U4RA 3GO5A 4BY1H 3CP2A 1B2TA 1F9SA 3ZZ0A 1IZ6A 4ALPA 1PZKD 2JYOA 2X6WA 1A8PA 4A3DB 3AQQA 4YIJA 2F3WA 1JOQA 2VB2X 2WACA 5I9OA 4NKLA 1UD3A 2Q6LA 2HDMA 2HIXA 3S17B 4RJLA 4H44C 2NVQH 1EFID 1H8HA 1FDRA 3ZPNA 3HOXB 2Q6KA 2V7UA 5J3OA 1CHQD 3CMAA 4FN5A 3CMEA 1JJGA 5THXA 4PC3A 3E3XA 4ZV4A 2KA7A 5M5XH 1EQVA 1YJ9B 3C1EA 5I6YA 1YJWA 1EUJA 2E74C 3MXPA 1WYDA 2SOBA 2EJGC 4TSSA 1PXUA 4WWVA 3TQYA 1YZ6A 1HZCA 1X3QA 1V1PB 2RHQB 1Q81D 1BCPF 1E0BA 2JN9A 1E63A 3Q24A 2I07B 1OXSC 2G9HD 4A3GH 2X85A 3I7FA 3SEJA 1SROA 3M9BA 4K2LA 3KEWA 4G7HC 1BX1A 4QL5A 5C0XI 3STBC 4OO1H 3WQZA 1CA6A 2F0DA 4B9WA 5C6AA 2YWGA 2ZM6Q 4XXEA 5LL6S 2M5SA 2XZLA 4IZ8A 2K03A 1OO9B 2VJIA 3CC7B 4QFMA 2VUMH 2OK8A 4WZLA 3W2HA 2PPBC 3CPWB 1VQNA 3HOVB 5KNLA 3FPKA 2X8KA 2Z6BD 1M1KD 1VQGA 4JI8Q 5A2QL 1C7YA 3PO3B 3RN5A 1PDQA 4RG1A 1HFNA 1XMQL 1PH6A 2R6GA 1BBUA 3CCVB 2IW3A 2F03A 1WSRA 2BV3A 3CCQB 3PUXA 1TIID 1E79A 3DHQA 4A3FB 2EY6A 4K0KQ 2NB0A 2RBMA 2FXQA 2ATWA 4OOXA 2OBSA 1TVXA 1PJ6A 1HTLD 1EYAA 3CCUB 3G6EA 4P74A 3RLNA 3A8JA 3FKIB 4I7ZC 1H9JA 1NRKA 3RY8A 2CW0C 2Z4HA 4HJ5A 2R93H 1IW7D 3GTGH 4X3TA 2E1RA 3ASPA 3AU7A 2ZJRA 4OO1I 4C3IH 4PMWA 1X3PA 1ELOA 4RD4A 1Q82D 2OEOA 2B2WA 1Y8PB 2QA4A 5DAUA 3GTLB 4IFDI 2V7QA 2ZTNA 1KRSA 1LTTD 3DWAA 3I4NH 1YLOA 2D0PA 1AN8A 2PYKA 4HE5A 4NB3A 2FMMA 4Z4TA 5ELBA 1GHJA 5C3EG 3KJPA 5IY0A 5IODA 4XORA 4UP7A 3CD6B 3HOYB 3V05A 3PO2H 1AW7A 3S1RH 4RD1A 4ZCMA 1SYDA 1FNBA 1GOZA 3CQZH 4HJ7A 3AYHB 1VQLA 3GTJB 4PABA 3HOZH 2F43A 1OTCA 4X65Q 3GTOH 3H3VH 3X3MA 4Z4SA 3T1HQ 3OZUA 1EFUA 4B3TL 5C5MA 1NB9A 4QVAA 1D2EA 2F3VA 1BXTA 4P71A 3GTQH 4UZEA 1IBLQ 1TS3A 2LKVA 2NZ1D 2BN4A 1VQ4A 3GQBA 2IL8A 4DR1L 1VHEA 2VY3A 4GQNA 2JE6I 4IPDA 2D9UA 3ZZUA 2RCFA 3CKIB 1GHKA 1ZKOA 3P1HA 3J81j 1TR5A 1TWAH 2VUMB 1O78A 3NHHA 5E4WC 1KDAA 2F0HA 4R8NA 5K36G 5FJ8G 4ZCKA 3KBXA 3S14B 1OXXK 3CD6A 2I5LX 4M2LA 1HR0Q 5KSWB 2BE5C 1HPCA 4GKJQ 1VQ7B 4N9TA 4NNJA 1SFOB 4ZGQB 4KK7A 1QFJA 2M00A 4KHPQ 5IYWA 1VQPA 2A8VA 1EFCA 5GAHC 3WNBA 4PG3A 1SNQA 1XJVA 2H4OA 1COWA 1XMOL 2AHOB 3BG3A 4AYBG 4M1UB 3PVDA 3CESA 3UDIA 1HFGA 5DN6A 4M8AA 2JA8G 2BM1A 2K5VA 3LNNA 2QDXA 1AE2A 2B2WC 2SDFA 3Q39A 2ZXIA 3UDXA 4AVZA 1Y0RA 5M5YH 1KLGD 1BX0A 2RCNA 1RQRA 1A6XA 5H59A 2F3IA 1VQDA 5ISRA 1CZWA 3A55A 2QA4B 4NMZA 2X0KA 3ASTA 1JC7A 3PUZA 4NXML 3GTLH 2B7CA 4B48A 1DZ1A 4N8FA 4P3IA 5EMNA 5JPMC 3QOJA 5A89A 4ZKBB 4IO9A 2VBVA 5FKAC 3ULLA 1SNDA 1AE3A 1Y1VH 4O2DA 4XYOA 3OJWA 3M3YB 4DAYA 2EYHA 3H6MA 2B2VC 5DS0A 1MD2D 1N32L 4BXXH 1A62A 1JWSD 4OX9L 2PLFA 5E6TA 4BBSG 2VNHA 4GKKL 1STHA 2QE7A 4Z4UA 3BYTB 3I72A 1C8CA 3M4OH 3BH4A 1WP6A 3W2IA 3W5UA 4J15A 5IGFA 4DV4L 4IFDJ 4QUFA 5C4HA 2GJKA 1EY7A 3LQEA 1KJZA 1P8LA 2A73B 2F0IA 4JMQA 3MC0B 3MEFA 3J7AV 5J39A 4CDFC 1GR1A 2LFNA 1I5FA 1X65A 5DM73 3S17H 1SM4A 1EP1B 4TMWA 1IYUA 1EEID 2Y0SB 2R61A 3JAMc 1CK1A 1F9PA 1NMFA 4RMFA 5IYCH 3JAML 1YJ9A 2GA4B 3ERSX 3AEVA 2GVBA 1R4QB 2RSNA 1E3ZA 4X8IA 1LT4D 1CKOA 3HEJA 1HZBA 4C3HB 4MZ9A 4PZ8A 3D6WA 5CC4A 1H85A 3N52A 5FOBB 1VQ6B 4M1KA 4RDLA 3PUWA 2B3GA 2EYLA 1N05A 3D31A 2XGTA 3J7A5 4RGOS 5M3FB 4AC9A 3GVKA 3RUZA 1ASZA 2DY7A 4F7XA 2J4XA 3MFYA 3BCDA 3J81i 4FF2A 1VHOA 3ISXA 1O7IA 5EQ0A 3GTPB 5FK9C 1X54A 2L5TA 2IX3A 3G48A 4RHSA 3CRLC 2WSSA 4A3IH 4LC0A 1QUQA 3NEMA 3TN2A 1YNJD 1PV4A 1LYLA 4F7DA 1QVGA 2UUAL 2UXDL 3WY9A 3SJZA 1I4PA 4DUZL 1MJCA 3DMUA 1X3FA 1EOTA 1QH0A 3WOFA 2VUMG 3GTQB 4AYBB 4M53A 3J81k 2HQEA 4II3A 2QF7A 5M3MH 2E2IB 4N8X1 5C0XG 4JI2L 2EOTA 5FNZA 4A93H 2O2LD 4LFAQ 5HGQA 2B2YA 2CC2A 1HNWL 4YWLA 3C1FA 4GLXA 5BR8L 5T1IA 4JI6Q 1E1OA 2K5QA 2BA0A 1JOOA 5IYRA 2J7KA 3KLWA 3ITPA 4A3KH 3DM3A 5NUCA 1Q7YC 1VLOA 5JAVA 1BO0A 4UHVA 2XZOA 2VB3X 4XONA 2UXCL 3VMFA 2XTIA 4CDCC 3I56B 2JA6B 2MGSA 2DNCA 2NPFA 2TSSA 1OXVA 4ACBA 4OOVA 1TS5A 4K6LA 2DEUA 2A6ED 3AMUA 1JT8A 2L55A 3CP0A 3CPFA 1GVHA 2F52A 1ESRA 3AVYA 4K2KA 5IT9E 2A6EC 3C2QA 4OWTB 4UZFA 2JA5B 2F0PA 2DN8A 1G7RA 1JICA 2JDIA 3T53B 1K83H 2J7ZA 2OQ0A 3NWSA 4X3KA 2JSOA 1IW7C 3NTKA 1DOLA 1P4MA 3LQ6A 2B2TA 5A2QE 1X32A 4TMXA 2R7DA 5COYA 3CW2C 4GLVB 1RTOA 1PH3A 2J0TD 4DV3L 4DV4Q 1VQ8A 1E3XA 4OPSA 4BWGB 1VQ7A 3OIQA 4IURA 4EH1A 2NZHA 3U58A 5E4XA 2B8FA 3S24A 1L1OC 5IP9G 1CKNA 3HOVH 4QF4A 4YELA 3IL8A 4DR2L 1QZGA 1E43A 5KIXA 2R7ZB 4JK1C 1RCVD 3CXCA 3H0GB 1KTKA 5KEEA 3C46A 2AUJD 1K8AC 5GAGC 2KHJA 4Z1MA 4JVZA 4DR1Q 2JP1A 1IJEA 1VF7A 2IX0A 1EL0A 5GV7A 3G05A 1PRTD 3TP7A 1WOOA 1YI2A 4XYQA 3GDEA 2R92B 4C3IB 1NCVA 3NBHB 1EFWA 3CF5A 4B4DA 4MHEA 3IKJA 4NXNL 4DXGA 3T13A 4LNQA 1JA1A 2CW5A 3OP1A 3QFSA 1XPRA 1X56A 3CC7A 1N34L 4LBZA 1RODA 1D7QA 1TWHH 4ZQ3A 4JOIA 2VNUD 3DM1A 4QQBX 3OW2A 4JI5L 2EE1A 1I50B 3ZBUA 3MXNA 5JEAG 4XR6A 2F0FA 3HOUG 3I1FA 5KYLA 4LF5L 2UUAQ 3CXCB 2GPJA 3R93A 3O13A 1RF2D 3CMMA 1VQKA 2L4NA 3OFNA 4XIGS 3PF4A 3R2IA 1A3VA 1KK0A 1JORA 3KYHC 1FJGQ 3HKZG 3HRZC 3MEHA 4QUZA 5HY6A 1JA0A 1VQPB 2OT2A 3NXWA 3T16A 1BQEA 3NENA 1H9SB 3UI2A 1STEA 3J81E 4JCVE 1PH2A 2KENA 1TWCB 4FXGC 3T1YQ 2R92G 2X6LA 5J1ZA 4DV1Q 4DK3C 4X3SA 4JOIC 1B50A 2HQLA 1QZHA 1T6ZA 3BY1A 1L1OB 4WJ4A 4BBSH 3Q8DA 4ZCIA 3RZDB 4PC2A 4XKWA 2DY1A 3MA2B 1SYBA 1PKVA 1ZUNB 2JA7G 3L9AX 1PFBA 4ME5A 3CC2A 2CWPA 1KAAA 3NTIA 2E2IH 1AIPA 5D3IB 1LTBD 1YJNB 2Z9HA 2YV5A 4Z4ZA 3HKZE 4AF6A 4H7BA 4RKBA 2Q6OA 1QGZA 1WI5A 2CQOA 4PV1C 3SLNA 3QJYA 3VO1A 1KQSB 3DEOA 5FLMH 5CV5A 2A74C 3VNUA 3W2EA 1VQ4B 3S2DB 1IHZA 3ND9A 1K3RA 3I4MB 1MJEA 4FNFA 4OHJA 4MIUA 4CHTB 2ES2A 1L1OA 5L46A 1NBWA 1GAWA 3OKXA 1NSNS 1W6JA 3PF5A 2K7VA 1SE3A 3K80C 2R6HA 1HR0W 2CFMA 1UWVA 2F0TA 5M3FH 3BDLA 2WB1B 1I18A 5IWAL 3V7AA 4EGVA 3KF6A 2B2TC 1EY5A 3HG9A 4A3DG 2C77A 5IGBA 4CGYB 3PMFA 2X53S 1EY4A 1MSGA 4YAWA 4DK0A 4A3IB 4DUYL 1WCMB 3QFCA 4LF8L 3OZVA 1QNUA 1D5MC 4ID6A 1LT3D 1VMPA 1VQ5A 5IYPA 1WTPA 3ASRA 1ESFA 1YBYA 1EFRA 1FRNA 2N3SA 4FXDA 2KQ3A 4C2MH 4NBSA 4X62L 3GVLA 1STGA 5EKIA 4JV5L 2ZTEA 2WFWA 2NZOA 2WZPP 2C35B 3RZDH 1PVOA 1T5XD 5IYBG 3QE2A 4P75A 1S5CD 2B2YC 2RC6A 1H9RA 2OYNA 1F2LA 2FHTA 3MAQA 1X55A 3W3AA 4X7FA 1I4XA 2JA6H 1EEFD 1SNPA 1K8OA 4RD0A 3U6KA 2YWHA 3MTSA 4B3MQ 1W87A 4B08A 1I3QH 2QMUA 3MHPA 4JI3L 3VDYA 3HOWB 4QV2A 4DK6C 4G5GA 2Y0SG 1EQTA 1NR2A 4XM3A 1SE4A 4C3JH 5D14A 2P5ZX 4N3GA 5IP7G 3S1MH 5EAYA 2E2HB 5FL7A 1LUZA 2LS01 5IE8A 3I4MG 2SEBD 1PFSA 3KUPA 5HZBA 2BGIA 2EVBA 3I90A 3U4VA 1PRTF 4A3GB 3WOEA 4DKAC 3BZDB 4ASUA 4GS3A 1SYGA 3OEEA 4A3CG 3OTOQ 3W2DA 4IQZA 1J9ZA 1F9QA 2CH4A 4ZK9B 4FF4A 1NUCA 2PCFB 1UNSA 2A5HA 5DM63 1T6YA 2EJFC 2G5DA 5M3MB 1BVSA 5A88A 2KVMA 2CW0D 2R7FA 1W0JA 4RHRA 2Y0SE 4DR5Q 2BGJA 2CWAA 4DV0L 3OWFA 2L9HA 1EIFA 1VQ6A 4U9UA 2RVLA 4LAAA 2MHVA 2C5HA 4N9PA 4HJ9A 1KIXA 1RDPD 2BDOA 4HJ8A 2DJFC 2MJ8A 3ER0A 2TMPA 5HZAA 3OMCA 4KY7A 3K5MA 1B4OA 4YCVA 2A68D 3BU2A 4J0QA 4JBKA 3PA1A 3HGBA 4HIMA 1CA5A 3C2PA 4A3MB 1MI2A 1EY9A 4PC7A 5KNCA 4HCEA 4MYTA 2X69A 3ERQA 1VDZA 1NB0A 1N8RD 1SBBB 3W5VA 1X6OA 1S72A 3B6YA 3NTHA 4IFDH 2JA8B 1DCZA 1DJRD 5E7NA 4UZUA 2K52A 2IHFA 1WDTA 3T51B 3E9IA 4C3HG 3CRZA 1KK1A 3L2PA 1PMRA 2YYZA 2V7TA 2QDBA 3PUNA 5IK2A 1EYDA 2E2JB 1RL2A 4J6HA 1NE3A 3PSIA 2LZJA 4K14A 3MVVA 3TDQA 2UU9L 1C9OA 1OB0A 4HIZA 1YX2A 1L0XB 2ICIA 1YI2B 3FDTA 4DN4M 4UDUC 2UXDQ 1K9MD 2B2UA 1G7TA 1M8AA 4R4TA 1LT5D 1DGSA 2F4NA 2HT1A 1K9MC 3AVXA 2CH4W 3RN2A 4JG2A 1FRQA 2PI2A 2Q8IB 3WXMA 1PTOB 2V7VA 3TREA 1NJID 1QJOA 4B3SQ 3ICEA 4A3BB 1NR4A 1YJNA 1UAPA 2V7WA 2NN6H 5FLXL 4NXMQ 3BDCA 4LBWA 4CKCA 4BBSB 5I6WA 1ILPA 5TRDA 2M2LA 2CKZB 1XX8A 2HUGA 2QEXA 4IN3A 2L15A 1WTOA 5BR8Q 1WTQA 2YU9B 2EIXA 2HCJB 1LACA 1F77A 1PH7A 1Q9SA 3E5SA 2HCIA 3CPXA 2KVOA 2OBTA 3I73A 2K4KA 2JA7H 1H9MA 3I91A 4RWSC 1VQ9B 1TWHB 2ZZQA 1SJHD 1E3PA 1H9SA 5BSXA 4HMIA 5EBCA 2EQSA 4FYDA 1KLUD 4RKLA 1R5NA 2BM0A 4KKUA 4RH6A 3TP6A 3A3BA 3K7AB 3N6RA 2BMWA 1XWEA 4V190 4YXWA 1Q3LA 3I56A 1N36Q 3HZXA 1Q90A 2O5IC 4A3LG 3IAYA 1Q82C 4P73A 1PA6A 2RDHA 1Q86D 1KAWA 1STNA 1YEZA 4R4IA 4JI0L 3I2ZA 1SMXA 4G7XA 4A3GG 1Q86C 4BBRH 4JW0A 2XWBB 2KECA 2K5HA 5DLQE 3E0JA 1BPLA 1B9MA 2YTVA 3CQZB 5F4OA 1OB2A 2Q6IA 1EYCA 1VQCA 5EPLA 2F4VL 2E2DC 2CF4A 3FKIG 1BLIA 2GK7A 3G4SA 3F2BA 1J5EL 1ENFA 1I6HB 4XOPA 3ASQA 3OIPA 1Y1WG 1VQ5B 4XL9A 2QEJC 1EWIA 1PH9A 1GM5A 5IT9L 1KK3A 5KNDA 1FX0A 4K6DA 4RPDA 2HDNB 1QUEA 4P2NA 4LF8Q 1NBMA 1HNZQ 3OW2B 4WQMA 1WTHA 2F1MA 4DF7A 2JIZA 3BVZA 2GK6A 3M4PA 3Q6QA 3S1QH 3S2HH 1SYCA 3GTMH 2V31A 2IPKD 4IUVA 4HSPA 4KY5A 2PO4A 1EWHA 3R6JA 3QO2A 4DV6L 4DQKA 2B63G 1ZM3A 2Q2IA 1C0AA 2VW9A 1CZGA 4M4SA 4B47A 1OGJA 3CMEB 1GKHA 1TWFB 3EN2A 1EIYB 3CPWA 3F2DA 4JI5Q 3D8GA 4XLCA 3P75A 4HN7A 2XWJB 5JJIA 1DDIA 1PRTB 1NJIC 4XNFA 1YNJC 4JI2Q 4RCNA 5F2DA 4FK8A 1CQXA 1I4GA 2FMCA 5M5WH 3PO3G 1S4ZA 3SGIA 4YAFA 4RPBA 1KDCA 1SSOA 2AMCB 2MO0A 2BH2A 1ONLA 3MCAA 3QR8A 1OHHA 5FLXE 1A3TA 1RIPA 2JJ1A 1E2WA 4XLHA
chains in the Genus database with same CATH topology
5BN4A 2R3ZA 4OGQC 2EDGA 5CR3A 4Z9CB 3A7LA 4DA2A 4XT3B 2ZTGA 3TZDA 2WIIB 1QCBD 4NW2A 2NTSA 2ZXPA 3VYRA 2PZUA 2B8GA 4ZYSA 1G6ZA 1Q1BA 3HKZB 3BVMA 3ONAB 4PQXA 1V0FA 1HQRD 2EY1A 3ZYYX 1HA6A 5CV6A 4QIWB 4G7OC 3L7ZC 2EYJA 1CT1D 3FPPA 1MGSA 2XVSA 3VR3A 1G2TA 5DNFA 3JAME 3S16B 4ZUJA 2D3NA 1SNMA 2WP8J 4FF1A 2K1BA 4PMBA 4G57A 2NVQB 4FP5D 2G9DA 1DOKA 2NYZD 5EPJA 3IFDA 4V0BA 3QIAA 5IOCA 3D4DA 2C9OA 3V96A 3I3CA 1ZEQX 4KJNA 4R8IA 1DONA 1VJSA 5AFWA 2HCCA 4XQJA 1WTVA 1Y1WB 3OOCA 1H8EA 3S15B 2CQAA 1HUMA 4FXKC 3BVGA 3L3OC 1U4LA 3BS1A 1I4RA 1HZEA 3NQIA 5C4JB 5G3LF 2NN6I 5ELFA 1Y8OB 5CGKA 3R2TA 5ELEA 2XSCA 5I2YA 1LO5D 1KMHA 4K8IA 3OE7A 4F8MA 2CVRA 2XRSD 4QUCA 1WTXA 2IX1A 3NSWA 3D6CA 2K5WA 1A2UA 3GTKB 3P7JA 4KN7C 2B2UC 2KEDA 3M7GA 4UAIA 1S5FD 1STYA 3R3OA 1AZQA 4XOTA 2O5JC 2W6IA 3M4YA 5HGTA 3CHBD 2A69C 5CV4A 1CQVA 3NBHA 5LL6X 1PTOH 1UD6A 3EFXD 4TKOB 4S3SA 2JA7B 3K59A 3K5LA 2RKSA 1AZPA 5C0XH 4RAUC 5KYIA 4ZKCB 2JJ2A 2F0MA 4J1MA 3J80L 2PZTA 1STAA 2ZXOA 4EQNA 1U4PA 2QCPX 1LABA 5HKKA 3CRKC 2WINB 2DY8A 4KHVA 2ZT9C 3GTGB 3TMEA 2A6HC 3NK9A 4XDXA 2JEAI 3WDNA 4BA1I 1OXTA 3GV6A 4TQUS 3SEBA 3KLRA 4XTCS 1BMFA 2D2CC 1SYEA 3QWNA 1UEAB 4EQPA 1TQOA 1W9XA 1Z6HA 5FO7B 2KHSA 3Q0AA 1PZID 2EYOA 1KNEA 1EY0A 1GJXA 3VYUA 3S1QB 3K0YA 3FPUB 1LTID 4RGNA 4II2A 1PFNA 5C3WA 1TWGB 1ZYRD 3S1NB 2BOSA 1LTRD 4TT3A 1SNCA 1S5DD 2XOKA 1LLRD 1FD7D 3K6OA 4DU9A 1O7LA 3KLSA 5LHY1 4BY7B 4RGMA 1C4QA 3F2UA 1DYQA 2AQ1B 5ELDA 3FRPB 3M7NA 3QB3A 2E76C 2BCOA 2PW7A 1WTHD 3SK4A 3HS0C 2KCCA 5JEAH 5G3LD 1HCZA 2WPDA 3OEHA 3ND8A 4K5WA 3NWTA 1BNZA 1QB5D 3GV3A 4HAEA 4EQOA 3DUZA 5IIFA 3PIO3 1T5EA 1K28D 1JWUD 2N88A 1IYVA 1L0YB 3H3VC 4OIJA 1YNNC 3IFTA 2L11A 5BN3A 1FNWA 5J22A 2ZZEA 3HOZB 1LV9A 2NBFA 2F0SA 4R9WA 1A15A 2KUMA 2A6HD 3NQTA 2K33A 1CTMA 1BOSA 4QMGA 5EBDA 1FGBD 4OIKA 1EY8A 1WTRA 5EPKA 1PYWD 1BUVT 2BE5D 5JPNC 1U4MA 4U68A 3TP8A 3H09A 1V8QA 5IGEA 2ZXRA 1E1QA 5EKLA 3KBGA 4KN4C 3K58A 2Z1CA 3JU4A 3TBIB 4ZUIA 2WKCA 1O7YA 4TRDA 1SEBD 2RSOA 5JJZA 4XKVA 1GUGA 5M5YB 1J8IA 2K32A 3GTOB 2NWGA 3VA5A 3K5NA 3DDYA 5CV7A 3NBIA 1D2BA 1O7ZA 3P20A 3EROA 1WD0A 1II3A 2WV6D 2XN9C 4DXFA 1XYIA 1STBA 3SHLA 2F0EA 3K57A 3PIP3 5JVG3 1GUNA 4LMQD 2BA1A 2MP1A 1PTOF 1TKWB 4G7ZC 1HHVA 2NUCA 3EQLC 5M9OA 1G291 3A7AB 1F2YA 4F87A 1HVXA 2WJYA 4H13C 2EYPA 1A2TA 3D4WA 4K5VA 1Q8IA 2XNAC 2K6AA 3VYSA 4XQFA 4C3JG 4OL7A 4XLAA 1DOMA 3H91A 3OPOA 1OXUA 3BCFA 1XXGA 3NUCA 3I4LA 1AEXA 1TS2A 5CBEE 2NVYB 4FO2A 1V0EA 5JEAJ 4ABNA 3A56A 3EJIA 1D1IA 1QOHA 5D65A 2K28A 4QCLA 2QILA 1DM0B 1D6EC 4C2MB 1M4VA 3M4OB 3A3GA 3S2HB 4C56C 3GTMB 1I6VC 1ZYRC 4G6IA 1ZXTA 4MN3A 2PZWA 3SE0A 1HA5A 4OO1G 3U9OA 2MPMA 5TSSA 2F0GA 4DAPA 1LT6D 3Q22A 2AUKA 4YEJA 5M5WB 4DGZA 2C5CA 5IGDA 2NVXB 4K8JA 2MUYA 2VXWA 4FF3A 4A3JB 5I2XA 1SXTA 3PV0A 3D3RA 4DNRB 3A35A 4F88A 2EXZA 2A68C 2L12A 1J9OA 5D3DA 4IFDG 5HURA 4Y7NB 4FVMA 3OAAA 1RKNA 1WD1A 2H1EA 3I70A 3SDZA 2PNRC 4G7WA 4P22A 3DEPA 1RD9D 1SAPA 4HTHA 1KABA 4FXUA 3D4RA 1JQYD 3VYTA 1B1ZA 3PUYA 2B2VA 4WRDA 2JXMB 2D5DA 1JOKA 5KRUA 3S9WA 4LJZC 1ENCA 1SJED 3AB9A 1GUOA 4NP5A 5EKKA 1K83B 2F0VA 2OXPA 1UD8A 3LWUA 3V2TA 2F0JA 4Q5VA 2XGJA 5C4ZA 5C3XA 1AP0A 1KDBA 4ILWA 4EVOA 1FNVA 4I65A 1TY0A 4KTAA 4DFAA 1BDOA 1FR3A 3FVQA 3E6ZX 2PQEA 4IALA 1ET6A 1JCKB 3G6JB 4ODGA 2EYMA 1SDFA 3OWEB 4IUUA 1LTSD 2F0LA 2ENBA 5I9PA 2XZPA 4KHZA 5K36H 1TWAB 3URYA 1Y69U 1E1RA 3A8JE 3SXHA 2R9VA 5K5PA 1UUPA 2EJMA 4Q0FA 4IUPA 2LMCB 4XQNA 5IGCA 2IWHA 1ENAA 1I3QB 3M85A 3K5OA 1ICWA 2L0CA 5CV8A 1HRJA 3CU7A 2XIWA 3PO2B 4XN0A 4CJ2C 5CV9A 1K8MA 2EZVA 4IUQA 2CK3A 4B3FX 2HDLA 3KF8A 1WVLA 1WTWA 3GP7A 4HR7B 4X3UA 1KZLA 1FNUA 2ICEC 1VF5C 2K04A 4XD7A 3VR4A 3Q6SA 4HEDA 1PTOD 1Y8NB 5E3FA 1BCPD 1GUWA 3OMGA 1BCPC 4BA2I 4A93B 1JWMD 1XTCD 1LTAD 3MXUA 2B39A 1UD2A 4A3KB 3S1RB 2FINB 3MZ5A 4U673 2EYFA 3TP5A 3QG1A 1UD5A 2X6XA 1BR9A 4WJWA 4C3JB 1Z47A 2A69D 3BC9A 3A8IE 1SNOA 5JVH3 2FJ2A 1PZJD 1B44D 1ML0D 3KLSX 4PNYA 1Q1EA 1IKLA 1LTGD 2Z4IA 2N55A 5DEHA 2D3LA 4TSFA 2NTTA 5EJWA 4RFBA 1SKYB 3BDOA 2E75C 1H9KA 2F4IA 2AQ2B 1YNND 1MBYA 5A35A 1E2ZA 4B3GA 5C0XJ 2K05A 3RZOB 3CP8A 4ULLA 3HOUB 1C48A 1PRTC 1I4HA 3J7YW 4KMUC 2LY7A 3VR5A 1B9NA 1EIGA 5CDFA 2HLDA 1TU2B 5CMDA 3LX0A 1PTOC 1DD2A 1ET9A 4E0FA 1CFMA 4WFN3 2VJJA 4KD3A 4BBRB 4O1NA 5ELCA 1Y1VB 4KY6A 1O80A 4XT1B 4RGTA 1RJTA 5C4XB 2WJVA 1S5BD 5EGTA 1EZ8A 3MFGA 4BY1B 2Z8LA 1Q12A 1RTNA 3R8BA 2DIEA 1GUSA 1FYCA 1D5ZC 1F2ZA 1W6KA 2RA4A 4LK1C 3DXJC 1D5XC 4KKSA 3FMCA 1I4QA 1VMCA 1A3UA 3S1MB 3A54A 3RMHA 2F0UA 3SR1A 2AWOA 3MWYW 3NPPA 1MABA 4XN3A 2I46A 1HUNA 1PLFA 5C5LA 2V4DA 1VCIA 3KK7A 1U9RA 2ZZGA 3TSSA 2Q8RE 1E2VA 4WORA 2SNMA 1BBXC 5KGUA 1Z7TA 3H94A 1RHPA 1HXYD 4E6IA 4XLEA 1HTPA 4HMJA 2ZZFA 2F0NA 3HP3A 4CJ1B 3TZUA 3T56B 5FO9B 1IL8A 1JR0D 2QKIC 1EU4A 3OHXC 1QILA 2D62A 4XLFA 5T1GA 3X3NA 4XQQA 4L8JA 1JB3A 4IUTA 3J80E 1QE6A 1EIHA 2Q8TA 1BCPB 2M9VA 3VR6A 2KCNA 1G91A 3GD7A 4HSVA 2F0OA 2RDFA 4G4KA 1AFPA 5JOBA 2K5DA 3VA7A 2DNEA 4KV6A 1SYFA 5M5XB 4CJ0B 1R9TB 2KOLA 5CYUA 3SVMA 2RDGA 1PFMA 3FEWX 3OSOA 1EY6A 1BF4A 1W0KA 1V1PA 1DXMA 4ZLTF 2KJXA 4ZAIA 1HQMC 1SMYC 4KD4A 4L6TB 3EA6A 1SMYD 1QG7A 1TS4A 3OW7A 1IKMA 3FKSA 3HAGA 3NE5B 3A8KE 5KNBA 2L1BA 2ID0A 2GJRA 3VR2A 2F0KA 1D1KA 2EY5A 3I8ZA 1CI3M 1EZ6A 1TY2A 3RD4A 2ZXHA 2WAQB 1KNAA 1GUTA 3BYYB 4B9XA 3T4AC 3NP8A 3SK6A 1S5ED 2NN6G 1QNKA 4GZYC 1UD4A 1EWCA 4A3EB 4KJOA 1V1OA 4C3IG 4C1NI 4RCOA 4DNTB 1B3AA 1SE2A 1NAPA 2B63B 2NVTB 2K01A 3SK5A 3Q23A 1CQFA 4KKTA 4K5XA 4O42A 2E1BA 2F0QA 3GVJA 3J81L 1G8ZD 2FFKB 1BQQT 4DK1A 2XNDA 2IT1A 2JEBI 4C1NK 2OF1A 4NDXA 2BDNA 3QOLA 2SNSA 5FO8B 4CBVA 5IGGA 4J8QA 4RA8A 2PMZB 3SK8A 1I8DA 2F0WA 4L63B 5C44B 5C3EB 5I4DA 1B53A 3U9SA 3G7LA 1F2MA 5BN5A 2AWNA 1R4PB 1WPCA 2EPBA 3PUVA 3MHBA 1GXDC 2X6GA 3DWQA 2GJPA 1G2SA 2PW5A 2IJ0A 1V43A 3ZIAA 4ZRZA 1QWYA 2W6JA 1EU3A 3J7AF 4QB4A 3RLFA 3EVQA 2R93B 2EY2A 4P2CB 1TT2A 3MXGA 4XMYA 3LWEA 4HCSA 2RQXA 3I4NB 5E1FA 2XRQD 4KI0A 1MSHA 2AQ3B 2O4XA 5CBAE 1VLYA 4CKEA 3C3LA 4JBWA 1CHPD 4DAVA 1F9RA 4H0LC 3DWPA 2KEEA 4CKBA 1JE4A 4IUNA 5CORA 4PMCA 1CM9A 1ILQA 2CHBD 2WKDA 4BS9A 2X6YA 1U4RA 3GO5A 3CP2A 1B2TA 1F9SA 1PZKD 2JYOA 2X6WA 4A3DB 4YIJA 2F3WA 1JOQA 2VB2X 2WACA 5I9OA 4NKLA 1UD3A 3S17B 2HDMA 4H44C 1EFID 1H8HA 3ZPNA 3HOXB 1CHQD 2KA7A 1EQVA 3C1EA 5I6YA 2E74C 3MXPA 2SOBA 2EJGC 4TSSA 1PXUA 1X3QA 1V1PB 1BCPF 1E0BA 3Q24A 2I07B 1OXSC 2G9HD 2X85A 4K2LA 3KEWA 4G7HC 5C0XI 4OO1H 3WQZA 1CA6A 2F0DA 4B9WA 5C6AA 4XXEA 5LL6S 2M5SA 2XZLA 4IZ8A 2K03A 1OO9B 2VJIA 3HOVB 2PPBC 5KNLA 3PO3B 2X8KA 2Z6BD 5A2QL 1PDQA 1HFNA 2R6GA 2IW3A 2F03A 3PUXA 1TIID 1E79A 3DHQA 4A3FB 2EY6A 2NB0A 2RBMA 1TVXA 1HTLD 1EYAA 3FKIB 4I7ZC 1H9JA 1NRKA 2CW0C 2Z4HA 1IW7D 4X3TA 3AU7A 4OO1I 4PMWA 1X3PA 2OEOA 2B2WA 1Y8PB 5DAUA 3GTLB 4IFDI 2V7QA 2ZTNA 1LTTD 3DWAA 1AN8A 2PYKA 2FMMA 5ELBA 1GHJA 5IODA 4XORA 3HOYB 3V05A 1AW7A 1SYDA 1GOZA 3GTJB 2F43A 3X3MA 5C5MA 2F3VA 1BXTA 1TS3A 2LKVA 2NZ1D 3GQBA 2IL8A 4GQNA 2JE6I 2D9UA 1GHKA 3CKIB 1ZKOA 3P1HA 1TR5A 2VUMB 1O78A 3NHHA 5E4WC 1KDAA 2F0HA 4R8NA 5K36G 3KBXA 3S14B 1OXXK 2BE5C 1HPCA 4N9TA 4NNJA 1SFOB 4KK7A 2M00A 1SNQA 2H4OA 1COWA 3BG3A 4M1UB 3CESA 1HFGA 5DN6A 4M8AA 3LNNA 2SDFA 2B2WC 2ZXIA 4AVZA 1KLGD 1A6XA 5ISRA 1CZWA 3A55A 4NMZA 1JC7A 3PUZA 1DZ1A 5JPMC 3QOJA 4ZKBB 5FKAC 1SNDA 4XYOA 3M3YB 4DAYA 2EYHA 3H6MA 2B2VC 1MD2D 1JWSD 1STHA 2QE7A 3I72A 3BYTB 1C8CA 3BH4A 1WP6A 5IGFA 4IFDJ 4QUFA 5C4HA 2GJKA 1EY7A 2A73B 2F0IA 4JMQA 3MC0B 3J7AV 5J39A 2LFNA 5DM73 1EEID 1IYUA 2Y0SB 2R61A 1CK1A 1F9PA 3JAML 2GA4B 1R4QB 2RSNA 1E3ZA 1LT4D 3HEJA 4C3HB 3D6WA 5CC4A 3N52A 5FOBB 3PUWA 2EYLA 3D31A 4RGOS 5M3FB 3GVKA 3RUZA 2DY7A 4F7XA 2J4XA 3MFYA 3BCDA 4FF2A 5EQ0A 3GTPB 5FK9C 2L5TA 2IX3A 4RHSA 3CRLC 2WSSA 3TN2A 1YNJD 1I4PA 3DMUA 1EOTA 3WOFA 3GTQB 4AYBB 2HQEA 4II3A 2QF7A 2E2IB 5C0XG 2EOTA 2O2LD 2B2YA 3C1FA 5T1IA 2K5QA 2BA0A 1JOOA 3ITPA 5NUCA 5JAVA 1BO0A 2XZOA 2VB3X 4XONA 2JA6B 2MGSA 2DNCA 2TSSA 1OXVA 1TS5A 4K6LA 2A6ED 3AMUA 2L55A 1ESRA 4K2KA 5IT9E 2A6EC 2JA5B 2F0PA 2DN8A 1JICA 2J7ZA 2JDIA 3T53B 3NWSA 4X3KA 2JSOA 1IW7C 3NTKA 1DOLA 5A2QE 2B2TA 1X32A 5COYA 1RTOA 2J0TD 1E3XA 4BWGB 3OIQA 4IURA 5E4XA 2B8FA 4QF4A 4YELA 3IL8A 1E43A 5KIXA 2R7ZB 4JK1C 1RCVD 3H0GB 1KTKA 5KEEA 3C46A 2AUJD 4Z1MA 2JP1A 1VF7A 2IX0A 1EL0A 3G05A 1PRTD 3TP7A 4XYQA 2R92B 4C3IB 1NCVA 4MHEA 3IKJA 4DXGA 3T13A 1RODA 4ZQ3A 2VNUD 3DM1A 2EE1A 1I50B 3MXNA 5JEAG 4XR6A 2F0FA 5KYLA 3R93A 3O13A 1RF2D 3CMMA 2L4NA 3OFNA 4XIGS 3R2IA 1A3VA 1JORA 3HRZC 3MEHA 3NXWA 2OT2A 3T16A 1H9SB 3UI2A 1STEA 3J81E 4FXGC 1TWCB 2X6LA 5J1ZA 4X3SA 1B50A 3RZDB 4XKWA 3MA2B 1SYBA 1PKVA 3L9AX 1PFBA 4ME5A 3NTIA 1KAAA 5D3IB 1LTBD 4H7BA 4RKBA 4PV1C 3QJYA 3DEOA 5CV5A 2A74C 3S2DB 1IHZA 3ND9A 3I4MB 4FNFA 4OHJA 4MIUA 4CHTB 1NSNS 1W6JA 2K7VA 1SE3A 2F0TA 3BDLA 2WB1B 1I18A 4EGVA 2B2TC 1EY5A 3HG9A 5IGBA 4CGYB 3PMFA 1EY4A 2X53S 1MSGA 4DK0A 4A3IB 1WCMB 1QNUA 1D5MC 4ID6A 1LT3D 1VMPA 1WTPA 1ESFA 1EFRA 4FXDA 2KQ3A 3GVLA 1STGA 5EKIA 2WZPP 1T5XD 1S5CD 2B2YC 1H9RA 1F2LA 2FHTA 3MAQA 3W3AA 1I4XA 1EEFD 1SNPA 1K8OA 3MTSA 4B08A 3HOWB 1EQTA 1NR2A 4XM3A 1SE4A 5D14A 2E2HB 5FL7A 2LS01 2SEBD 3KUPA 2EVBA 3I90A 1PRTF 4A3GB 3WOEA 3BZDB 4ASUA 1SYGA 3OEEA 3W2DA 4IQZA 1F9QA 4ZK9B 4FF4A 1NUCA 2PCFB 1UNSA 2A5HA 5DM63 2EJFC 5M3MB 2KVMA 2CW0D 1W0JA 4RHRA 3OWFA 2L9HA 2RVLA 4LAAA 2MHVA 4N9PA 1RDPD 2BDOA 2MJ8A 2TMPA 3OMCA 4KY7A 3K5MA 1B4OA 2A68D 3HGBA 1CA5A 3C2PA 4A3MB 1MI2A 1EY9A 5KNCA 4HCEA 2X69A 3ERQA 1VDZA 1SBBB 3NTHA 4IFDH 2JA8B 1DCZA 1DJRD 4UZUA 3T51B 4C3HG 1PMRA 2YYZA 2QDBA 5IK2A 1EYDA 2E2JB 4J6HA 2LZJA 4K14A 3MVVA 3TDQA 1OB0A 4HIZA 1L0XB 2ICIA 3FDTA 4DN4M 4UDUC 2B2UA 1M8AA 1LT5D 2Q8IB 1PTOB 4A3BB 1QJOA 1NR4A 1UAPA 5FLXL 2NN6H 3BDCA 4CKCA 4BBSB 5I6WA 1ILPA 2M2LA 1XX8A 2HUGA 4IN3A 1WTOA 1WTQA 2YU9B 1LACA 1F77A 3E5SA 2HCIA 2KVOA 3I73A 1H9MA 3I91A 4RWSC 1TWHB 2ZZQA 1SJHD 1H9SA 4HMIA 5EBCA 4FYDA 1KLUD 4RKLA 4KKUA 4RH6A 3TP6A 3A3BA 3K7AB 3N6RA 1XWEA 4V190 4YXWA 1Q3LA 3HZXA 1Q90A 2O5IC 3IAYA 2RDHA 1STNA 4G7XA 2XWBB 2KECA 3E0JA 1BPLA 1B9MA 3CQZB 5EPLA 1EYCA 2E2DC 1BLIA 2GK7A 1I6HB 1ENFA 4XOPA 3OIPA 4XL9A 2QEJC 5IT9L 5KNDA 1FX0A 4K6DA 1NBMA 4DF7A 2F1MA 2JIZA 3BVZA 2GK6A 1SYCA 2V31A 2IPKD 4IUVA 4HSPA 4KY5A 2PO4A 1EWHA 3QO2A 1CZGA 1TWFB 3D8GA 4XLCA 3P75A 4HN7A 2XWJB 1PRTB 4XNFA 1YNJC 4RCNA 5F2DA 1I4GA 2FMCA 1S4ZA 1KDCA 1SSOA 1ONLA 1OHHA 5FLXE 1A3TA 2JJ1A 1E2WA 4XLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6V C;  5BN4 A;  1ZYR C;  4OGQ C;  2EDG A;  1A6X A;  1V43 A;  1H9S B;  3A7L A;  1DXM A;  1BDO A;  2PPB C;  3SE0 A;  1FR3 A;  1LAC A;  1GUG A;  3PUZ A;  4OO1 G;  1Q12 A;  1HQM C;  1SMY C;  2BA0 A;  2K32 A;  3I73 A;  2R6G A;  1H9M A;  1GUS A;  3RLF A;  1FYC A;  3PUX A;  3QG1 A;  4LK1 C;  4KN7 C;  1H9S A;  2AUK A;  2B8G A;  2EVB A;  1Q1B A;  3OW7 A;  3DXJ C;  4KKS A;  2DNC A;  1O7L A;  1OXV A;  3NE5 B;  3FMC A;  4KKU A;  2A69 D;  3P20 A;  3A8K E;  2O5J C;  3A8I E;  3M4Y A;  4KHZ A;  3N6R A;  5KNB A;  5K36 H;  2A6E D;  3VR2 A;  4IQZ A;  1Y69 U;  2A69 C;  4G7O C;  2PCF B;  4KI0 A;  3A8J E;  2AWO A;  2EJF C;  3L7Z C;  2A6E C;  4I7Z C;  1H9J A;  2CW0 C;  2DN8 A;  1CI3 M;  1Q90 A;  3T53 B;  1IW7 D;  2O5I C;  3M7N A;  3PV0 A;  3I72 A;  3FPP A;  1Q1E A;  2EJM A;  4PV1 C;  2E76 C;  1GUN A;  3VR3 A;  1IW7 C;  1K8O A;  2V4D A;  3QJY A;  1GUT A;  1VCI A;  2BA1 A;  2KCC A;  4JBW A;  5JEA H;  4DNR B;  1HCZ A;  1Y8P B;  4H0L C;  2LMC B;  3ND9 A;  3ND8 A;  1TKW B;  4G7Z C;  3EQL C;  4TKO B;  2NN6 G;  1G29 1;  1B9M A;  1E2V A;  2A68 C;  4GZY C;  3A7A B;  2BDO A;  3M85 A;  3BDO A;  1GHJ A;  2E75 C;  1Z7T A;  3H94 A;  1H9K A;  4H13 C;  1IYU A;  4IFD G;  2B8F A;  2A68 D;  5C0X H;  3HGB A;  4DNT B;  1T5E A;  2K7V A;  1HTP A;  1IYV A;  5KNC A;  4JK1 C;  1VDZ A;  4KKT A;  2AUJ D;  1YNN C;  5A35 A;  1E2Z A;  3IFT A;  3SDZ A;  2PNR C;  3TZU A;  3QIA A;  5KND A;  1DCZ A;  3T56 B;  5BN3 A;  4IFD H;  1K8M A;  4H44 C;  1VF7 A;  3OPO A;  3T51 B;  4DK1 A;  1OXU A;  2F1M A;  4DK0 A;  2IT1 A;  3GQB A;  3PUW A;  2D62 A;  2JEB I;  2JE6 I;  3D31 A;  1LAB A;  1PMR A;  2YYZ A;  3D4R A;  3CRK C;  3I4L A;  1ZKO A;  1GHK A;  4L8J A;  1EWH A;  3PUY A;  2KA7 A;  4HR7 B;  1O78 A;  3IKJ A;  4KMU C;  2A6H D;  3MFY A;  3VR5 A;  2JXM B;  3OOC A;  2K33 A;  5K36 G;  1B9N A;  1CTM A;  2ZT9 C;  2D5D A;  2E74 C;  1OXX K;  2EJG C;  2A6H C;  2L5T A;  1TU2 B;  1VF5 C;  3CRL C;  2BE5 C;  1HPC A;  4LJZ C;  3WDN A;  2JEA I;  4BA1 I;  1CFM A;  1DD2 A;  3VR4 A;  1OXT A;  3AB9 A;  1GUO A;  5C0X G;  3VR6 A;  2BE5 D;  1Y8N B;  4TQU S;  1YNJ C;  5JEA G;  3KLR A;  4RCN A;  1OXS C;  3GD7 A;  2Q8I B;  1V8Q A;  2NN6 I;  4XTC S;  1QJO A;  3U9S A;  1H9R A;  2D2C C;  3LWU A;  3BG3 A;  2NN6 H;  4BA2 I;  5BN5 A;  2DNE A;  1Y8O B;  3VA7 A;  1Z6H A;  4KN4 C;  1ONL A;  4G7H C;  3W3A A;  4XIG S;  4OO1 H;  3LNN A;  2QF7 A;  1GJX A;  3PUV A;  1E2W A;  3MXU A; 
#chains in the Genus database with same CATH topology
 5BN4 A;  3K81 C;  3PO2 G;  2R3Z A;  4FDB A;  4DAM A;  2E2J H;  4OGQ C;  2EDG A;  5CR3 A;  2C5B A;  4Z9C B;  3A7L A;  4DA2 A;  4XT3 B;  1XMQ Q;  1VQ8 B;  2ZTG A;  3TZD A;  2WII B;  4A3C H;  1QCB D;  4NW2 A;  2NTS A;  2ZXP A;  3VYR A;  4QGU A;  2JA9 A;  5IYQ A;  1SE8 A;  4X64 Q;  3CAM A;  3WND A;  2PZU A;  2B8G A;  2YTX A;  4ZYS A;  1G6Z A;  1Q1B A;  3HKZ B;  3BVM A;  3ONA B;  2OTL A;  5A8A A;  1V0F A;  1HQR D;  2EY1 A;  4PQX A;  3RR5 A;  1R5B A;  3ZYY X;  1HA6 A;  5CV6 A;  1K3B C;  4QIW B;  4DR6 L;  2XEX A;  4H9G A;  4G7O C;  1E64 A;  3L7Z C;  4OEL B;  2EYJ A;  4LFB Q;  4LF7 Q;  1CT1 D;  5F4J A;  3A5Z B;  3FPP A;  4B3X A;  1MGS A;  2XVS A;  5C3E H;  3VR3 A;  1G2T A;  5DNF A;  2VZL A;  3JAM E;  1YHQ B;  3I55 B;  1N32 Q;  3S16 B;  4ZUJ A;  2GN5 A;  2D3N A;  3PA2 A;  3CCS B;  3CCM B;  1XFO A;  1SNM A;  2JA8 H;  2WP8 J;  4FF1 A;  2K1B A;  4P25 A;  4PMB A;  1EXM A;  4G57 A;  3LGJ A;  2NVQ B;  1J5E Q;  4FP5 D;  1FND A;  2G9D A;  1DOK A;  3R6K A;  4C3H H;  2B29 A;  2NYZ D;  5EPJ A;  3IFD A;  4V0B A;  4YWM A;  3LVB A;  1Y14 B;  4NXN Q;  4LF9 Q;  2WZN A;  4PGO A;  3QIA A;  5IOC A;  2VBT A;  1ZM4 A;  3D4D A;  2C9O A;  5LMU L;  1D8T A;  5FJ8 H;  2Z0S A;  1EQQ A;  3V96 A;  3I3C A;  1ZEQ X;  4TN1 A;  4KJN A;  4R8I A;  1DON A;  1VJS A;  3B82 A;  1IL2 A;  5AFW A;  4DR3 Q;  1S40 A;  1KQS A;  3A8K A;  2HCC A;  4XQJ A;  1WTV A;  1Y1W B;  3OOC A;  1H8E A;  2V7X A;  2PMD A;  4BXX G;  4X7D A;  3S15 B;  2CQA A;  2Q2U A;  1HUM A;  1PH5 A;  2VBS A;  1WSV A;  4FXK C;  4YWK A;  3BVG A;  3L3O C;  3ZUG A;  1U4L A;  1W35 A;  1YIT A;  3BS1 A;  2QEX B;  1I4R A;  1HZE A;  3G71 B;  3NQI A;  1N0U A;  1JJC B;  5C4J B;  2VYQ A;  2NN6 I;  5G3L F;  1HNX L;  3JC6 6;  5ELF A;  1ASY A;  1Y8O B;  5CGK A;  3R2T A;  5ELE A;  3T1Y L;  2XSC A;  5I2Y A;  1LO5 D;  1KMH A;  3CCU A;  4YCW A;  4K8I A;  2XNJ A;  1M1K C;  1PYB A;  3OE7 A;  1MRZ A;  4F8M A;  4LUV A;  1X3G A;  1Y1V G;  2CVR A;  2XRS D;  4QUC A;  1WTX A;  2IX1 A;  3NSW A;  2D9R A;  2NV4 A;  3ZBT A;  3HOX H;  3KFU A;  1WOR A;  1BBW A;  1E22 A;  2OQK A;  3D6C A;  1F20 A;  1MKH A;  2K5W A;  1A2U A;  1EOV A;  1CKM A;  1XTD A;  1VQM A;  3P7J A;  4KN7 C;  4LF4 Q;  2B2U C;  3GTK B;  2KED A;  1WFQ A;  4CQJ A;  3M7G A;  4UAI A;  1S5F D;  1KXL A;  2P3M A;  2ZL6 A;  1FL0 A;  1STY A;  3R3O A;  4YY3 L;  1G51 A;  3OTO L;  1AZQ A;  5TV2 A;  4XOT A;  1KD1 C;  2O5J C;  2W6I A;  3LO8 A;  4MYU A;  1AMO A;  3M4Y A;  5HGT A;  1N36 L;  3CHB D;  2A69 C;  5CV4 A;  1JJ2 A;  1VQI A;  4BBR G;  2A19 A;  1CQV A;  4QHY A;  3NBH A;  1FNC A;  4RD3 A;  4B43 A;  5LL6 X;  4LFB L;  4BPR A;  1PTO H;  2ZJQ A;  1GO2 A;  3KJO A;  3AVV A;  1XNQ Q;  1UD6 A;  1Y0Y A;  1N9W A;  4C0S A;  1Y1W H;  3E0E A;  1NNX A;  3EFX D;  4TKO B;  4S3S A;  2JA7 B;  5IWA Q;  3K59 A;  4B3T Q;  2DOG A;  5ELN A;  3K5L A;  1QUF A;  4DAY B;  2IY5 B;  2RKS A;  2PIA A;  1AZP A;  1U0L A;  5C0X H;  4Q7J B;  4PZ7 A;  1IBL L;  1NY4 A;  4DUY Q;  3H9N A;  1H95 A;  1Z9F A;  4RAU C;  5KYI A;  3F1Z A;  4P6Y A;  1QVG B;  1VQB A;  4ZKC B;  3FJO A;  2K5N A;  3KDF A;  2JJ2 A;  2F0M A;  2VQF Q;  4X62 Q;  4G1V A;  4J1M A;  3J80 L;  2PZT A;  1STA A;  2ZXO A;  4EQN A;  1U4P A;  2QCP X;  3J80 c;  3PIP A;  1LAB A;  1S0U A;  5HKK A;  3CRK C;  5FA6 A;  1L2F A;  2WIN B;  4OPV A;  2DY8 A;  3CCL B;  4KHV A;  4FWT A;  4DR3 L;  3H3V I;  4DR7 Q;  1S3O A;  3E20 A;  2ZT9 C;  3TME A;  3GTG B;  2A6H C;  3NK9 A;  3FP9 A;  4MNO A;  1JE5 A;  4O0A A;  4XDX A;  4LFC Q;  4WZE A;  4UY8 C;  2QTZ A;  1IBM Q;  3WDN A;  2JEA I;  4BA1 I;  1YIJ B;  1OXT A;  1DAR A;  1R5O A;  4B3S L;  3GV6 A;  4TQU S;  3SEB A;  3KLR A;  1SRU A;  4XTC S;  4A3F G;  1BMF A;  2D2C C;  1SYE A;  2NVX H;  3QWN A;  1UEA B;  4EQP A;  2GRE A;  1W9X A;  1TQO A;  1Z6H A;  2A1A A;  2NVY H;  3OYY A;  5FO7 B;  2KHS A;  3Q0A A;  1PZI D;  2EYO A;  1KNE A;  1UE7 A;  4R4O A;  1EY0 A;  4A3J H;  3VYU A;  1H42 A;  1GJX A;  2K14 A;  5GRO A;  3S1Q B;  4RD6 A;  3K0Y A;  4B3R L;  3HOV G;  3FPU B;  1LTI D;  4JI6 L;  4K1X A;  4RGN A;  4II2 A;  4P9S A;  1PFN A;  5C3W A;  1TWG B;  1ZYR D;  3S1N B;  2BOS A;  1LTR D;  2R7Z G;  4UAJ A;  4TT3 A;  4X07 A;  1SNC A;  4B44 A;  1S5D D;  2BVN A;  3U2Q A;  1KD1 D;  3ULP A;  3S16 H;  2XOK A;  1LLR D;  2DJG C;  1FD7 D;  3K6O A;  4DU9 A;  1O7L A;  3W2F A;  3KLS A;  5LHY 1;  3CCS A;  4GN4 B;  4TMZ A;  4BY7 B;  4RGM A;  1C4Q A;  2GVA A;  1QGA A;  3UE0 A;  3F2U A;  2VS1 A;  1UMK A;  1DYQ A;  4RLZ A;  2AQ1 B;  5ELD A;  3FRP B;  3M7N A;  2B7B A;  4LF6 L;  3W2G A;  3QB3 A;  2E76 C;  2BCO A;  2PW7 A;  2JA5 G;  2D74 A;  3CCE B;  1WTH D;  3SK4 A;  3HS0 C;  2KCC A;  5FO0 A;  4IJH A;  5G3L D;  5JEA H;  2E5L Q;  1HCZ A;  2WPD A;  3OEH A;  1MIU A;  3ND8 A;  4K5W A;  3NWT A;  1BNZ A;  1QB5 D;  3GV3 A;  4HAE A;  3AGP A;  1HZA A;  4EQO A;  2DER A;  2UUB Q;  4DR2 Q;  3DUZ A;  5IIF A;  2DGY A;  5C4X H;  3PIO 3;  1T5E A;  1K28 D;  4A93 G;  1JWU D;  4DV2 Q;  2N88 A;  1WU8 A;  1IYV A;  1L0Y B;  5LMN L;  5IYD H;  3HOY H;  3H3V C;  4OIJ A;  1YNN C;  3Q38 A;  2JQO A;  3IFT A;  3K8A A;  2L11 A;  3H0G G;  5BN3 A;  4OPO A;  1FNW A;  2ZZE A;  5J22 A;  3HOZ B;  4TMT A;  3QSY A;  1LV9 A;  2NBF A;  2F0S A;  4R9W A;  1A15 A;  3S14 H;  5C44 G;  2KUM A;  3QFR A;  4KHP L;  4WZK A;  3T1H L;  1W3S A;  1QG0 A;  2A6H D;  3NQT A;  2K33 A;  1SKQ A;  1CTM A;  1BOS A;  4QMG A;  2VBU A;  5EBD A;  5GAD C;  4CDE C;  1K73 C;  1FGB D;  4OIK A;  4YAO A;  4BY7 G;  1EY8 A;  1WTR A;  5EPK A;  1PYW D;  1W34 A;  1BUV T;  2BE5 D;  2Z6K C;  4L5T A;  5JPN C;  1IBM L;  1U4M A;  3S2D H;  1S72 B;  4U68 A;  5LMN W;  5H5J A;  1S4M A;  1XB2 A;  3TP8 A;  3H09 A;  1V8Q A;  5IGE A;  4WZT A;  2ZXR A;  4DPG A;  1E7Z A;  1E1Q A;  5EKL A;  3TS2 A;  1F60 A;  3KBG A;  4KN4 C;  3K58 A;  4YAU A;  1FJG L;  1HNW Q;  1B7Y B;  2Z1C A;  3IRB A;  3G6E B;  3JU4 A;  2N49 A;  3TBI B;  1PH4 A;  4A3E H;  2UXB L;  1WCM G;  2WAQ G;  4ZUI A;  2WKC A;  1O7Y A;  4TRD A;  1SEB D;  2RSO A;  2ZBU A;  4JI7 L;  2ZL5 A;  1FNM A;  4XKV A;  1GUG A;  2DUD A;  5JJZ A;  3AGQ A;  5M5Y B;  1J8I A;  3S15 H;  2K32 A;  4ROX A;  3GTO B;  4QIW E;  2NWG A;  3WYA A;  3VA5 A;  3K5N A;  3DDY A;  1IHM A;  5CV7 A;  3G4S B;  2ZBV A;  3NBI A;  4JI3 Q;  1D2B A;  3KL9 A;  5IYN A;  1O7Z A;  3CCR A;  3P20 A;  3ERO A;  4GLA C;  1VQJ A;  1WD0 A;  1SN8 A;  1II3 A;  1VQA A;  1M90 C;  4OP7 A;  3BZK A;  3TS0 A;  2QN6 A;  2WV6 D;  2XN9 C;  4DXF A;  1XYI A;  1STB A;  1QVF B;  1Q8K A;  3SHL A;  4A3M H;  2F0E A;  3B78 A;  5TR9 A;  3K57 A;  3PIP 3;  5JVG 3;  1GUN A;  4LMQ D;  2BA1 A;  3CC2 B;  2MP1 A;  1PTO F;  4Y52 H;  1TKW B;  4G7Z C;  1HHV A;  2NUC A;  3EQL C;  5M9O A;  1K0S A;  1G29 1;  3A7A B;  4AQY L;  3VNV A;  1HA3 A;  1F2Y A;  1HVX A;  2WJY A;  4H13 C;  4Y9U A;  2EYP A;  4F87 A;  4A3D H;  1YHQ A;  1GD7 A;  2YU9 H;  1A2T A;  3D4W A;  4K5V A;  1Q8I A;  2XNA C;  1KL9 A;  1QFY A;  2K6A A;  2UUB L;  4I7A A;  3VYS A;  1U5K A;  4XQF A;  2R92 H;  4HIO A;  2AKW B;  1XPU A;  4C3J G;  2VZA A;  1YIJ A;  3GTK H;  4OL7 A;  4XLA A;  1DOM A;  1YIT B;  3OPO A;  3H91 A;  1OXU A;  3BCF A;  1XXG A;  3NUC A;  3PQI A;  3I4L A;  4PZ6 A;  4Y9R A;  1AEX A;  4Y7C A;  3OZW A;  1TS2 A;  5CBE E;  2NVY B;  4FO2 A;  4JI1 Q;  1X9N A;  1V0E A;  5JEA J;  4ABN A;  3A56 A;  3EJI A;  1GVP A;  1D1I A;  4Z4Y A;  3F2C A;  1V9P A;  3ASS A;  1QOH A;  1IB0 A;  5AN9 A;  5D65 A;  2K28 A;  1N33 Q;  4QCL A;  2QIL A;  1DM0 B;  1D6E C;  1VQF A;  4C2M B;  3JQR A;  1M4V A;  3AVU A;  3M4O B;  4DR4 L;  3I4N G;  3A3G A;  3WWV A;  1SFO H;  1UEB A;  3BJU A;  4B3M L;  4GKJ L;  4GOP A;  1VQ9 A;  3S2H B;  4C56 C;  3GTM B;  1I6V C;  1NTG A;  4GNX C;  2X3U A;  2R7Z H;  3K7A H;  4A76 A;  1ZYR C;  2C4U A;  4G6I A;  1K0R A;  1UE5 A;  1ZXT A;  5M3F G;  4JPB W;  4MN3 A;  3HOZ G;  4G1B A;  2PZW A;  4X7E A;  1BKB A;  1HA5 A;  3SE0 A;  4OO1 G;  3U9O A;  3TRZ A;  1Q7Y D;  3CCR B;  4R71 A;  2MPM A;  2F0G A;  5TSS A;  2HIV A;  4DAP A;  1LT6 D;  3Q22 A;  4OEM B;  1LTL A;  2LXK A;  4ME3 A;  4X0C A;  2AUK A;  4YEJ A;  1WOP A;  3JQQ A;  5M5W B;  5ELO A;  4R4Q A;  1TVC A;  1TTT A;  4Z4V A;  4DGZ A;  2C5C A;  5GV8 A;  5IGD A;  4OON A;  1B3Q A;  2BF4 A;  4K8J A;  2NVX B;  1KK2 A;  1AH9 A;  2LXJ A;  2MUY A;  4OWX B;  2VXW A;  1G6P A;  4FF3 A;  1VQL B;  2N78 A;  4A3J B;  4JI4 L;  3SKB A;  1I50 H;  5I2X A;  1I7P A;  1SXT A;  3PV0 A;  2Z6B A;  2MFI A;  4YHH L;  5KW9 A;  3D3R A;  2D0O A;  3L0O A;  4DV5 L;  1U2R A;  1HH2 P;  4DNR B;  1KC8 D;  3ZJY C;  3A35 A;  4F88 A;  2EXZ A;  4HE6 A;  4OX9 Q;  2VL6 A;  2R93 G;  4HID A;  3U4Z A;  4P26 A;  2A68 C;  2C78 A;  1YHB A;  4M0L A;  2L12 A;  4GKK Q;  4A3B G;  3A5U A;  1EQR A;  1J9O A;  3J7Z C;  3CCE A;  2UUC L;  5D3D A;  4IFD G;  2OTL B;  3H0G H;  5J35 A;  5HUR A;  1CSP A;  5LMN Q;  4Y7N B;  4JI0 Q;  1GJR A;  4FVM A;  1B2R A;  2RHS B;  1YHA A;  3OAA A;  3G71 A;  1RKN A;  1WD1 A;  1JNY A;  2H1E A;  3P26 A;  5C44 H;  3I70 A;  4YAL A;  3SDZ A;  2PNR C;  4G7W A;  4P22 A;  3DEP A;  1K8A D;  1RD9 D;  1SAP A;  1N34 Q;  4HTH A;  2VQE L;  1KAB A;  4FXU A;  2PNH A;  1FVI A;  2JJQ A;  1JQY D;  3D4R A;  3VYT A;  4JV5 Q;  5H1S E;  2CBX A;  1B1Z A;  3PUY A;  3J80 i;  2B2V A;  1VQH A;  4WRD A;  2JXM B;  2D5D A;  4ACA A;  1JOK A;  5KRU A;  4JI1 L;  4P3Y A;  3S9W A;  4JYA Q;  1Q81 C;  4LJZ C;  5JJK A;  2I5H A;  1ENC A;  1SJE D;  1DDG A;  3AB9 A;  1GUO A;  4NP5 A;  5EKK A;  3FHW A;  1K83 B;  3UDG A;  2F0V A;  4NCN A;  2OXP A;  2ZL7 A;  1UD8 A;  3LWU A;  3V2T A;  1IXR A;  4JI8 L;  2F0J A;  4Q5V A;  1N0V C;  1B70 B;  2XGJ A;  4N3N A;  4AH6 A;  1X3E A;  3B8H A;  5C4Z A;  5C3X A;  1AP0 A;  3HKS A;  3ONU A;  1KDB A;  4JI7 Q;  4ILW A;  3KF8 B;  1FNV A;  4I65 A;  4IPC A;  4EVO A;  4LF5 Q;  1TY0 A;  4UP9 A;  2E2H H;  4KTA A;  4PC1 A;  4DFA A;  1BDO A;  4HJA A;  1FR3 A;  2RF4 A;  2WR8 A;  3FVQ A;  2HMA A;  3E6Z X;  2PQE A;  4IAL A;  2PI2 E;  1ET6 A;  4R4C A;  2EXD A;  1IYJ B;  1JB7 A;  1JCK B;  3G6J B;  4GNX B;  1QVC A;  4ODG A;  2EYM A;  1SDF A;  3OWE B;  4IUU A;  4WJ3 M;  1LTS D;  2F0L A;  2JN4 A;  4GN3 B;  4A3L H;  4YHB A;  2ENB A;  2VNI A;  5I9P A;  2XZP A;  3UE1 A;  4KHZ A;  2Q2H A;  1D1N A;  4DV0 Q;  4DQL A;  1TWA B;  1WJJ A;  3PCO B;  2B5O A;  3URY A;  5K36 H;  1Y69 U;  1J6Q A;  1E1R A;  1GO3 E;  2OBR A;  2MO1 A;  1NMG A;  3A8J E;  3SXH A;  2UXC Q;  2R9V A;  4R1J A;  5K5P A;  4L5S A;  3GSI A;  1UUP A;  2E5L L;  2EJM A;  4MTN A;  2YTY A;  4JI4 Q;  4Q0F A;  4X7C A;  4IUP A;  4IJL A;  4DR6 Q;  2K75 A;  4QJF A;  2LMC B;  4XQN A;  4X06 A;  4DV7 Q;  5IGC A;  2IWH A;  1ENA A;  1I3Q B;  3M85 A;  4LF7 L;  3K5O A;  5M3M G;  2WAQ E;  1ICW A;  4DV2 L;  2VQF L;  2L0C A;  5CV8 A;  1HRJ A;  1K8G A;  3CU7 A;  1N8R C;  3K7U C;  3P27 A;  3CCJ B;  2XIW A;  3PO2 B;  4XN0 A;  4CJ2 C;  2OTJ B;  1HZ9 A;  5CV9 A;  1KHI A;  4AIM A;  3GTJ H;  2UU9 Q;  1K8M A;  2EZV A;  1CUK A;  2RC5 A;  1LM0 A;  4IUQ A;  2CK3 A;  4B3F X;  2HDL A;  3KF8 A;  1WVL A;  5DSZ A;  1WTW A;  3ULJ A;  3GP7 A;  4HR7 B;  2VQE Q;  4LF9 L;  3ZZT A;  4X3U A;  1N08 A;  1KZL A;  3D0F A;  1FNU A;  4LUZ A;  4EQ5 A;  2ICE C;  3VO2 A;  1VF5 C;  2QGG A;  2QDL A;  3ES9 A;  2K04 A;  4XD7 A;  4DNI A;  3AVT A;  3VR4 A;  4C43 A;  3KF6 B;  4JYA L;  1B8A A;  3Q6S A;  4HED A;  4DR4 Q;  1PTO D;  1Y8N B;  5E3F A;  3A1P A;  1BCP D;  3M4Q A;  1GUW A;  3OMG A;  3CCQ A;  1BCP C;  4BA2 I;  3WBK A;  4A3I G;  4A93 B;  2UXB Q;  2PMZ E;  1JWM D;  1XTC D;  1LTA D;  4GNX A;  4PC6 A;  3FKI H;  3MXU A;  5IYC G;  3UDF A;  2B39 A;  2IHE A;  1UD2 A;  4A3K B;  1I94 L;  3QFT A;  1ICF B;  5FIU A;  3HOW G;  3S1R B;  2FIN B;  3MZ5 A;  2ASB A;  1VQE A;  1QUQ B;  4U67 3;  3A8I A;  2EYF A;  4L5R C;  4LFA L;  3TP5 A;  4POF A;  3QG1 A;  1UD5 A;  2X6X A;  1BR9 A;  1E1T A;  4WJW A;  3GIR A;  4C3J B;  1Z47 A;  3W5H A;  4LF6 Q;  2I1L A;  2BPO A;  1BJK A;  1FGU A;  2A69 D;  4RDJ A;  2LSS A;  3BC9 A;  1TXY A;  2B63 H;  3JQP A;  3A8I E;  3H15 A;  1IJF A;  1SNO A;  1T9H A;  2MQH A;  2OTJ A;  5JVH 3;  2FJ2 A;  2KBN A;  1E62 A;  1PZJ D;  3PUM A;  1NDH A;  1B44 D;  1ML0 D;  3KLS X;  3NEL A;  3F8T A;  4PNY A;  4DV5 Q;  4IW3 B;  1Q1E A;  1IKL A;  2MNA A;  1LTG D;  1KC8 C;  4A3B H;  2Z4I A;  1TUI A;  2N55 A;  5DEH A;  3CMA B;  2D3L A;  4TSF A;  2NTT A;  1G7S A;  5FLX c;  4LUO A;  5EJW A;  4QY7 A;  4RFB A;  1SKY B;  5F4M A;  3KDF B;  3Q6R A;  3BDO A;  4DV3 Q;  2E75 C;  4DV7 L;  1H9K A;  4QVJ A;  1W2B A;  4OOS A;  2F4I A;  2AQ2 B;  3KOJ A;  1YNN D;  4X05 A;  1WOC A;  1MBY A;  5A35 A;  1QVF A;  1E2Z A;  2OCE A;  4RCY A;  4B3G A;  5C0X J;  2K05 A;  3HOX G;  4A3K G;  3RZO B;  3BY2 A;  3WNC A;  2PQA A;  3CP8 A;  1A8V A;  4ULL A;  3OJX A;  2NVT H;  3HOU B;  1C48 A;  1PRT C;  1PJ7 A;  2PE3 A;  1I4H A;  3J7Y W;  1P16 A;  4KMU C;  2LY7 A;  3VR5 A;  4DUZ Q;  1B9N A;  1VQO A;  4IOA A;  1EIG A;  1W2B B;  5CDF A;  2HLD A;  3D26 A;  1TU2 B;  2ZTC A;  2VNK A;  5CMD A;  1R9T H;  3LX0 A;  1PTO C;  1DD2 A;  1CNF A;  1ET9 A;  4E0F A;  1CFM A;  4H02 A;  4WFN 3;  2VJJ A;  1K73 D;  4UPA A;  4Y7N H;  4KD3 A;  2N8N A;  4YCU A;  4O1N A;  5ELC A;  4BBR B;  4X6A H;  1XNR Q;  1QX4 A;  1Y1V B;  4KY6 A;  1O80 A;  4XT1 B;  4DR7 L;  4RGT A;  1RJT A;  1VQM B;  1WOS A;  4IOC A;  1A63 A;  5C4X B;  2WJV A;  5B6I A;  4POG A;  3TEH B;  1TWC H;  4ZGN B;  1TWG H;  1S5B D;  1YNX A;  5IP9 H;  1XQB A;  5EGT A;  1EZ8 A;  3MFG A;  2WYR A;  4BY1 B;  1PYS B;  4OXP A;  2Z8L A;  1B23 P;  1Q12 A;  4JBJ A;  1RTN A;  4JC0 A;  3W1B A;  3R8B A;  1ZM9 A;  4LW1 A;  4NPS A;  4LF4 L;  2I0Q A;  2DIE A;  2GQF A;  3BQJ A;  1GUS A;  2QW7 A;  4X66 Q;  1FYC A;  1D5Z C;  1F2Z A;  1W6K A;  2RA4 A;  2ZTD A;  4LK1 C;  1PJ5 A;  2K50 A;  3DXJ C;  2JK8 A;  1D5X C;  4KKS A;  1E24 A;  4GN5 A;  3FMC A;  1I4Q A;  1VMC A;  1XE1 A;  1A3U A;  3S1M B;  4P1V A;  4CDD C;  2EFG A;  3A54 A;  3RMH A;  4ZCL A;  2F0U A;  3W1G A;  3SR1 A;  3HFZ B;  5AJ3 L;  3EBE A;  3I4O A;  4UP8 A;  2AWO A;  3PGZ A;  3MWY W;  3NPP A;  4MTK A;  4YHH Q;  4GOP B;  1CSQ A;  2F4V Q;  1MAB A;  4XN3 A;  1M90 D;  2VNJ A;  2KCM A;  4IPG A;  1V1Q A;  2I46 A;  1HUN A;  1PLF A;  5C5L A;  2V4D A;  1YJW B;  1IBK L;  1VCI A;  3HOU H;  1UE6 A;  3KK7 A;  4GOP C;  1U9R A;  2ZZG A;  1KRH A;  3TSS A;  2UUC Q;  2Q8R E;  1E2V A;  4WOR A;  3A0J A;  1KTV A;  2SNM A;  1BBX C;  5KGU A;  1Z7T A;  3GTP H;  3H94 A;  4A3J G;  1RHP A;  3SLD A;  1HXY D;  4E6I A;  4XLE A;  1HTP A;  4HMJ A;  4TVA B;  2ZZF A;  3S1N H;  2CND A;  4DV6 Q;  2F0N A;  3HP3 A;  4CJ1 B;  2CCZ A;  3TZU A;  2ALY B;  4LBV A;  3T56 B;  5FO9 B;  1IL8 A;  1JR0 D;  4BY1 G;  5IP7 H;  1KRT A;  2QKI C;  2F1L A;  1EU4 A;  3OHX C;  1QIL A;  2D62 A;  2DCU A;  4XLF A;  5T1G A;  1EFT A;  4XQQ A;  3X3N A;  1CKN B;  4L8J A;  2BSA A;  2WB1 E;  3CCJ A;  2HHH Q;  1JB3 A;  4IUT A;  3CCV A;  4P6V F;  2ZJP A;  5GQO A;  3U50 C;  3J80 E;  1K28 A;  1QE6 A;  1EIH A;  3RNU A;  1N06 A;  2Q8T A;  1BCP B;  4AF7 A;  2M9V A;  1HR0 L;  3VR6 A;  2JA5 H;  2KCN A;  1G91 A;  1TWF H;  5FLM G;  3SJP A;  1JMC A;  3GD7 A;  4HSV A;  4P12 A;  2F0O A;  2RDF A;  4G4K A;  3STB D;  2FX3 A;  1AFP A;  5JOB A;  2K5D A;  1XNR L;  3RZO H;  3PIO A;  3HOW H;  3VA7 A;  2DNE A;  4KV6 A;  1SYF A;  5M5X B;  4CJ0 B;  1R9T B;  3A74 A;  4RDK A;  2KOL A;  5CYU A;  4A75 A;  3SVM A;  4L5Q A;  2RDG A;  5IYB H;  1EP2 B;  1MHW C;  2WB1 G;  1D8L A;  1PFM A;  3FEW X;  3OSO A;  1JJ2 B;  1EY6 A;  1BF4 A;  1W0K A;  1EWY A;  1RQP A;  1V1P A;  1DXM A;  1JB9 A;  4YY3 Q;  4ZLT F;  2KJX A;  4ZAI A;  1HQM C;  1SMY C;  4KD4 A;  4L6T B;  2DET A;  2FVG A;  1UE1 A;  2ZIT A;  3EA6 A;  1SMY D;  1QG7 A;  3WBJ A;  1TS4 A;  2C4T A;  4X66 L;  3OW7 A;  1IKM A;  2E8G A;  1EP3 B;  3CCM A;  3FKS A;  3HAG A;  3NE5 B;  2DYI A;  5BSY A;  3A8K E;  5KNB A;  2L1B A;  2ID0 A;  2GJR A;  5J3B A;  3VR2 A;  3W5O A;  1PH1 A;  3RLO A;  1XNQ L;  4K0K L;  3PEN A;  2F0K A;  2CRV A;  1D1K A;  5HXB A;  2EY5 A;  4X64 L;  3I8Z A;  1CI3 M;  1EZ6 A;  1TY2 A;  1VQK B;  3RD4 A;  4BY7 H;  2ZXH A;  5C4J H;  2WAQ B;  2KCT A;  3BNW A;  1KNA A;  1GUT A;  1TLL A;  3BYY B;  1OGI A;  3J81 c;  4B9X A;  3T4A C;  4A3F H;  2QTL A;  3NP8 A;  4A4I A;  3SK6 A;  5L37 A;  2EIF A;  4DR5 L;  3V76 A;  1S5E D;  2NN6 G;  1QNK A;  4GZY C;  1UD4 A;  3JAM i;  2JA6 G;  1EWC A;  4A3E B;  3ONY A;  4KJO A;  1DG1 G;  1V1O A;  3CCL A;  2QGQ A;  4C3I G;  4C1N I;  2Z6K A;  4RCO A;  4DNT B;  1B3A A;  1N07 A;  1SE2 A;  1NAP A;  2AHO A;  1QGY A;  2B63 B;  2NVT B;  1A0I A;  2K01 A;  3SK5 A;  3Q23 A;  1CQF A;  4KKT A;  4K5X A;  1ZM2 A;  4O42 A;  2E1B A;  1I6H H;  2F0Q A;  4X65 L;  3K0X A;  4P72 A;  3GVJ A;  3AVW A;  3J81 L;  1G8Z D;  3Q3A A;  3CTA A;  3ZC3 A;  4RM0 A;  2FFK B;  1BQQ T;  2XND A;  4DK1 A;  5JBQ A;  4LFC L;  2IT1 A;  3I4M H;  1HJP A;  4TMV A;  1Q46 A;  2JEB I;  4C1N K;  2OF1 A;  4NDX A;  4Z4W A;  2BDN A;  3QOL A;  2SNS A;  5FO8 B;  4CBV A;  1PH8 A;  5FO1 A;  2OWO A;  5IGG A;  5LMU Q;  2HHH L;  1HNZ L;  1G7C A;  3AFQ A;  4J8Q A;  4RA8 A;  1T6X A;  2PMZ B;  3SK8 A;  1I8D A;  4HIK A;  2F0W A;  3AFP A;  4OWW B;  4L63 B;  4EX5 A;  5C44 B;  4B3R Q;  1WCM H;  3U6B A;  5I4D A;  1B53 A;  3U9S A;  2V1C C;  5GAE C;  5C3E B;  1PHJ A;  3G7L A;  1F2M A;  5BN5 A;  2AWN A;  2HD3 A;  2ZM6 L;  1CNE A;  1R4P B;  1WPC A;  1XPO A;  2EPB A;  3CW2 A;  1XMO Q;  3PUV A;  1I94 Q;  3MHB A;  1GXD C;  2X6G A;  1N33 L;  5TY0 A;  3DWQ A;  2GJP A;  5C4X G;  4RD2 A;  1V5V A;  1G2S A;  1YVC A;  2IJ0 A;  2PW5 A;  1V43 A;  1HNX Q;  5IYD G;  3HOY G;  3CB4 A;  3BZC A;  4AYB E;  3ZIA A;  2C2W A;  3E1Y E;  4ZRZ A;  3I55 A;  1L0W A;  4JBM A;  1QWY A;  2W6J A;  1EU3 A;  3J7A F;  4QB4 A;  3DLL A;  3RLF A;  1VQO B;  4Z4R A;  2KHI A;  1SR3 A;  3EVQ A;  3MMP A;  2R93 B;  2EY2 A;  4LBY A;  4P2C B;  3CC4 B;  5IT9 c;  4RCZ A;  4KLK A;  5JJL A;  2BH8 A;  1VS0 A;  4A3M G;  1TT2 A;  3MXG A;  3E9H A;  3MXN B;  1SLJ A;  3EIV A;  1QFZ A;  4LWC A;  4XMY A;  5AJ3 Q;  3LWE A;  4HCS A;  2RQX A;  4DV1 L;  3I4N B;  1EYG A;  5E1F A;  2XRQ D;  4KI0 A;  1MSH A;  2AQ3 B;  2O4X A;  4APV A;  2I5M X;  2H5X A;  5LMZ A;  1IBK Q;  5CBA E;  1VLY A;  4CKE A;  3M3Y H;  4PAA A;  3C3L A;  4JBW A;  2YWF A;  4IPH A;  1CHP D;  4DAV A;  2PQA B;  2YWE A;  1VQN B;  1F9R A;  3DWP A;  4H0L C;  3PO3 H;  4AQY Q;  2OK7 A;  2KEE A;  4CKB A;  1JE4 A;  1GAQ A;  4IUN A;  4PMC A;  5COR A;  1CM9 A;  3CC4 A;  1OB5 A;  1ILQ A;  2CHB D;  2WKD A;  4BS9 A;  2X6Y A;  2Q2T A;  4A3E G;  2XNC A;  1U4R A;  3GO5 A;  4BY1 H;  3CP2 A;  1B2T A;  1F9S A;  3ZZ0 A;  1IZ6 A;  4ALP A;  1PZK D;  2JYO A;  2X6W A;  1A8P A;  4A3D B;  3AQQ A;  4YIJ A;  2F3W A;  1JOQ A;  2VB2 X;  2WAC A;  5I9O A;  4NKL A;  1UD3 A;  2Q6L A;  2HDM A;  2HIX A;  3S17 B;  4RJL A;  4H44 C;  2NVQ H;  1EFI D;  1H8H A;  1FDR A;  3ZPN A;  3HOX B;  2Q6K A;  2V7U A;  5J3O A;  1CHQ D;  3CMA A;  4FN5 A;  3CME A;  1JJG A;  5THX A;  4PC3 A;  3E3X A;  4ZV4 A;  2KA7 A;  5M5X H;  1EQV A;  1YJ9 B;  3C1E A;  5I6Y A;  1YJW A;  1EUJ A;  2E74 C;  3MXP A;  1WYD A;  2SOB A;  2EJG C;  4TSS A;  1PXU A;  4WWV A;  3TQY A;  1YZ6 A;  1HZC A;  1X3Q A;  1V1P B;  2RHQ B;  1Q81 D;  1BCP F;  1E0B A;  2JN9 A;  1E63 A;  3Q24 A;  2I07 B;  1OXS C;  2G9H D;  4A3G H;  2X85 A;  3I7F A;  3SEJ A;  1SRO A;  3M9B A;  4K2L A;  3KEW A;  4G7H C;  1BX1 A;  4QL5 A;  5C0X I;  3STB C;  4OO1 H;  3WQZ A;  1CA6 A;  2F0D A;  4B9W A;  5C6A A;  2YWG A;  2ZM6 Q;  4XXE A;  5LL6 S;  2M5S A;  2XZL A;  4IZ8 A;  2K03 A;  1OO9 B;  2VJI A;  3CC7 B;  4QFM A;  2VUM H;  2OK8 A;  4WZL A;  3W2H A;  2PPB C;  3CPW B;  1VQN A;  3HOV B;  5KNL A;  3FPK A;  2X8K A;  2Z6B D;  1M1K D;  1VQG A;  4JI8 Q;  5A2Q L;  1C7Y A;  3PO3 B;  3RN5 A;  1PDQ A;  4RG1 A;  1HFN A;  1XMQ L;  1PH6 A;  2R6G A;  1BBU A;  3CCV B;  2IW3 A;  2F03 A;  1WSR A;  2BV3 A;  3CCQ B;  3PUX A;  1TII D;  1E79 A;  3DHQ A;  4A3F B;  2EY6 A;  4K0K Q;  2NB0 A;  2RBM A;  2FXQ A;  2ATW A;  4OOX A;  2OBS A;  1TVX A;  1PJ6 A;  1HTL D;  1EYA A;  3CCU B;  3G6E A;  4P74 A;  3RLN A;  3A8J A;  3FKI B;  4I7Z C;  1H9J A;  1NRK A;  3RY8 A;  2CW0 C;  2Z4H A;  4HJ5 A;  2R93 H;  1IW7 D;  3GTG H;  4X3T A;  2E1R A;  3ASP A;  3AU7 A;  2ZJR A;  4OO1 I;  4C3I H;  4PMW A;  1X3P A;  1ELO A;  4RD4 A;  1Q82 D;  2OEO A;  2B2W A;  1Y8P B;  2QA4 A;  5DAU A;  3GTL B;  4IFD I;  2V7Q A;  2ZTN A;  1KRS A;  1LTT D;  3DWA A;  3I4N H;  1YLO A;  2D0P A;  1AN8 A;  2PYK A;  4HE5 A;  4NB3 A;  2FMM A;  4Z4T A;  5ELB A;  1GHJ A;  5C3E G;  3KJP A;  5IY0 A;  5IOD A;  4XOR A;  4UP7 A;  3CD6 B;  3HOY B;  3V05 A;  3PO2 H;  1AW7 A;  3S1R H;  4RD1 A;  4ZCM A;  1SYD A;  1FNB A;  1GOZ A;  3CQZ H;  4HJ7 A;  3AYH B;  1VQL A;  3GTJ B;  4PAB A;  3HOZ H;  2F43 A;  1OTC A;  4X65 Q;  3GTO H;  3H3V H;  3X3M A;  4Z4S A;  3T1H Q;  3OZU A;  1EFU A;  4B3T L;  5C5M A;  1NB9 A;  4QVA A;  1D2E A;  2F3V A;  1BXT A;  4P71 A;  3GTQ H;  4UZE A;  1IBL Q;  1TS3 A;  2LKV A;  2NZ1 D;  2BN4 A;  1VQ4 A;  3GQB A;  2IL8 A;  4DR1 L;  1VHE A;  2VY3 A;  4GQN A;  2JE6 I;  4IPD A;  2D9U A;  3ZZU A;  2RCF A;  3CKI B;  1GHK A;  1ZKO A;  3P1H A;  3J81 j;  1TR5 A;  1TWA H;  2VUM B;  1O78 A;  3NHH A;  5E4W C;  1KDA A;  2F0H A;  4R8N A;  5K36 G;  5FJ8 G;  4ZCK A;  3KBX A;  3S14 B;  1OXX K;  3CD6 A;  2I5L X;  4M2L A;  1HR0 Q;  5KSW B;  2BE5 C;  1HPC A;  4GKJ Q;  1VQ7 B;  4N9T A;  4NNJ A;  1SFO B;  4ZGQ B;  4KK7 A;  1QFJ A;  2M00 A;  4KHP Q;  5IYW A;  1VQP A;  2A8V A;  1EFC A;  5GAH C;  3WNB A;  4PG3 A;  1SNQ A;  1XJV A;  2H4O A;  1COW A;  1XMO L;  2AHO B;  3BG3 A;  4AYB G;  4M1U B;  3PVD A;  3CES A;  3UDI A;  1HFG A;  5DN6 A;  4M8A A;  2JA8 G;  2BM1 A;  2K5V A;  3LNN A;  2QDX A;  1AE2 A;  2B2W C;  2SDF A;  3Q39 A;  2ZXI A;  3UDX A;  4AVZ A;  1Y0R A;  5M5Y H;  1KLG D;  1BX0 A;  2RCN A;  1RQR A;  1A6X A;  5H59 A;  2F3I A;  1VQD A;  5ISR A;  1CZW A;  3A55 A;  2QA4 B;  4NMZ A;  2X0K A;  3AST A;  1JC7 A;  3PUZ A;  4NXM L;  3GTL H;  2B7C A;  4B48 A;  1DZ1 A;  4N8F A;  4P3I A;  5EMN A;  5JPM C;  3QOJ A;  5A89 A;  4ZKB B;  4IO9 A;  2VBV A;  5FKA C;  3ULL A;  1SND A;  1AE3 A;  1Y1V H;  4O2D A;  4XYO A;  3OJW A;  3M3Y B;  4DAY A;  2EYH A;  3H6M A;  2B2V C;  5DS0 A;  1MD2 D;  1N32 L;  4BXX H;  1A62 A;  1JWS D;  4OX9 L;  2PLF A;  5E6T A;  4BBS G;  2VNH A;  4GKK L;  1STH A;  2QE7 A;  4Z4U A;  3BYT B;  3I72 A;  1C8C A;  3M4O H;  3BH4 A;  1WP6 A;  3W2I A;  3W5U A;  4J15 A;  5IGF A;  4DV4 L;  4IFD J;  4QUF A;  5C4H A;  2GJK A;  1EY7 A;  3LQE A;  1KJZ A;  1P8L A;  2A73 B;  2F0I A;  4JMQ A;  3MC0 B;  3MEF A;  3J7A V;  5J39 A;  4CDF C;  1GR1 A;  2LFN A;  1I5F A;  1X65 A;  5DM7 3;  3S17 H;  1SM4 A;  1EP1 B;  4TMW A;  1IYU A;  1EEI D;  2Y0S B;  2R61 A;  3JAM c;  1CK1 A;  1F9P A;  1NMF A;  4RMF A;  5IYC H;  3JAM L;  1YJ9 A;  2GA4 B;  3ERS X;  3AEV A;  2GVB A;  1R4Q B;  2RSN A;  1E3Z A;  4X8I A;  1LT4 D;  1CKO A;  3HEJ A;  1HZB A;  4C3H B;  4MZ9 A;  4PZ8 A;  3D6W A;  5CC4 A;  1H85 A;  3N52 A;  5FOB B;  1VQ6 B;  4M1K A;  4RDL A;  3PUW A;  2B3G A;  2EYL A;  1N05 A;  3D31 A;  2XGT A;  3J7A 5;  4RGO S;  5M3F B;  4AC9 A;  3GVK A;  3RUZ A;  1ASZ A;  2DY7 A;  4F7X A;  2J4X A;  3MFY A;  3BCD A;  3J81 i;  4FF2 A;  1VHO A;  3ISX A;  1O7I A;  5EQ0 A;  3GTP B;  5FK9 C;  1X54 A;  2L5T A;  2IX3 A;  3G48 A;  4RHS A;  3CRL C;  2WSS A;  4A3I H;  4LC0 A;  1QUQ A;  3NEM A;  3TN2 A;  1YNJ D;  1PV4 A;  1LYL A;  4F7D A;  1QVG A;  2UUA L;  2UXD L;  3WY9 A;  3SJZ A;  1I4P A;  4DUZ L;  1MJC A;  3DMU A;  1X3F A;  1EOT A;  1QH0 A;  3WOF A;  2VUM G;  3GTQ B;  4AYB B;  4M53 A;  3J81 k;  2HQE A;  4II3 A;  2QF7 A;  5M3M H;  2E2I B;  4N8X 1;  5C0X G;  4JI2 L;  2EOT A;  5FNZ A;  4A93 H;  2O2L D;  4LFA Q;  5HGQ A;  2B2Y A;  2CC2 A;  1HNW L;  4YWL A;  3C1F A;  4GLX A;  5BR8 L;  5T1I A;  4JI6 Q;  1E1O A;  2K5Q A;  2BA0 A;  1JOO A;  5IYR A;  2J7K A;  3KLW A;  3ITP A;  4A3K H;  3DM3 A;  5NUC A;  1Q7Y C;  1VLO A;  5JAV A;  1BO0 A;  4UHV A;  2XZO A;  2VB3 X;  4XON A;  2UXC L;  3VMF A;  2XTI A;  4CDC C;  3I56 B;  2JA6 B;  2MGS A;  2DNC A;  2NPF A;  2TSS A;  1OXV A;  4ACB A;  4OOV A;  1TS5 A;  4K6L A;  2DEU A;  2A6E D;  3AMU A;  1JT8 A;  2L55 A;  3CP0 A;  3CPF A;  1GVH A;  2F52 A;  1ESR A;  3AVY A;  4K2K A;  5IT9 E;  2A6E C;  3C2Q A;  4OWT B;  4UZF A;  2JA5 B;  2F0P A;  2DN8 A;  1G7R A;  1JIC A;  2JDI A;  3T53 B;  1K83 H;  2J7Z A;  2OQ0 A;  3NWS A;  4X3K A;  2JSO A;  1IW7 C;  3NTK A;  1DOL A;  1P4M A;  3LQ6 A;  2B2T A;  5A2Q E;  1X32 A;  4TMX A;  2R7D A;  5COY A;  3CW2 C;  4GLV B;  1RTO A;  1PH3 A;  2J0T D;  4DV3 L;  4DV4 Q;  1VQ8 A;  1E3X A;  4OPS A;  4BWG B;  1VQ7 A;  3OIQ A;  4IUR A;  4EH1 A;  2NZH A;  3U58 A;  5E4X A;  2B8F A;  3S24 A;  1L1O C;  5IP9 G;  1CKN A;  3HOV H;  4QF4 A;  4YEL A;  3IL8 A;  4DR2 L;  1QZG A;  1E43 A;  5KIX A;  2R7Z B;  4JK1 C;  1RCV D;  3CXC A;  3H0G B;  1KTK A;  5KEE A;  3C46 A;  2AUJ D;  1K8A C;  5GAG C;  2KHJ A;  4Z1M A;  4JVZ A;  4DR1 Q;  2JP1 A;  1IJE A;  1VF7 A;  2IX0 A;  1EL0 A;  5GV7 A;  3G05 A;  1PRT D;  3TP7 A;  1WOO A;  1YI2 A;  4XYQ A;  3GDE A;  2R92 B;  4C3I B;  1NCV A;  3NBH B;  1EFW A;  3CF5 A;  4B4D A;  4MHE A;  3IKJ A;  4NXN L;  4DXG A;  3T13 A;  4LNQ A;  1JA1 A;  2CW5 A;  3OP1 A;  3QFS A;  1XPR A;  1X56 A;  3CC7 A;  1N34 L;  4LBZ A;  1ROD A;  1D7Q A;  1TWH H;  4ZQ3 A;  4JOI A;  2VNU D;  3DM1 A;  4QQB X;  3OW2 A;  4JI5 L;  2EE1 A;  1I50 B;  3ZBU A;  3MXN A;  5JEA G;  4XR6 A;  2F0F A;  3HOU G;  3I1F A;  5KYL A;  4LF5 L;  2UUA Q;  3CXC B;  2GPJ A;  3R93 A;  3O13 A;  1RF2 D;  3CMM A;  1VQK A;  2L4N A;  3OFN A;  4XIG S;  3PF4 A;  3R2I A;  1A3V A;  1KK0 A;  1JOR A;  3KYH C;  1FJG Q;  3HKZ G;  3HRZ C;  3MEH A;  4QUZ A;  5HY6 A;  1JA0 A;  1VQP B;  2OT2 A;  3NXW A;  3T16 A;  1BQE A;  3NEN A;  1H9S B;  3UI2 A;  1STE A;  3J81 E;  4JCV E;  1PH2 A;  2KEN A;  1TWC B;  4FXG C;  3T1Y Q;  2R92 G;  2X6L A;  5J1Z A;  4DV1 Q;  4DK3 C;  4X3S A;  4JOI C;  1B50 A;  2HQL A;  1QZH A;  1T6Z A;  3BY1 A;  1L1O B;  4WJ4 A;  4BBS H;  3Q8D A;  4ZCI A;  3RZD B;  4PC2 A;  4XKW A;  2DY1 A;  3MA2 B;  1SYB A;  1PKV A;  1ZUN B;  2JA7 G;  3L9A X;  1PFB A;  4ME5 A;  3CC2 A;  2CWP A;  1KAA A;  3NTI A;  2E2I H;  1AIP A;  5D3I B;  1LTB D;  1YJN B;  2Z9H A;  2YV5 A;  4Z4Z A;  3HKZ E;  4AF6 A;  4H7B A;  4RKB A;  2Q6O A;  1QGZ A;  1WI5 A;  2CQO A;  4PV1 C;  3SLN A;  3QJY A;  3VO1 A;  1KQS B;  3DEO A;  5FLM H;  5CV5 A;  2A74 C;  3VNU A;  3W2E A;  1VQ4 B;  3S2D B;  1IHZ A;  3ND9 A;  1K3R A;  3I4M B;  1MJE A;  4FNF A;  4OHJ A;  4MIU A;  4CHT B;  2ES2 A;  1L1O A;  5L46 A;  1NBW A;  1GAW A;  3OKX A;  1NSN S;  1W6J A;  3PF5 A;  2K7V A;  1SE3 A;  3K80 C;  2R6H A;  1HR0 W;  2CFM A;  1UWV A;  2F0T A;  5M3F H;  3BDL A;  2WB1 B;  1I18 A;  5IWA L;  3V7A A;  4EGV A;  3KF6 A;  2B2T C;  1EY5 A;  3HG9 A;  4A3D G;  2C77 A;  5IGB A;  4CGY B;  3PMF A;  2X53 S;  1EY4 A;  1MSG A;  4YAW A;  4DK0 A;  4A3I B;  4DUY L;  1WCM B;  3QFC A;  4LF8 L;  3OZV A;  1QNU A;  1D5M C;  4ID6 A;  1LT3 D;  1VMP A;  1VQ5 A;  5IYP A;  1WTP A;  3ASR A;  1ESF A;  1YBY A;  1EFR A;  1FRN A;  2N3S A;  4FXD A;  2KQ3 A;  4C2M H;  4NBS A;  4X62 L;  3GVL A;  1STG A;  5EKI A;  4JV5 L;  2ZTE A;  2WFW A;  2NZO A;  2WZP P;  2C35 B;  3RZD H;  1PVO A;  1T5X D;  5IYB G;  3QE2 A;  4P75 A;  1S5C D;  2B2Y C;  2RC6 A;  1H9R A;  2OYN A;  1F2L A;  2FHT A;  3MAQ A;  1X55 A;  3W3A A;  4X7F A;  1I4X A;  2JA6 H;  1EEF D;  1SNP A;  1K8O A;  4RD0 A;  3U6K A;  2YWH A;  3MTS A;  4B3M Q;  1W87 A;  4B08 A;  1I3Q H;  2QMU A;  3MHP A;  4JI3 L;  3VDY A;  3HOW B;  4QV2 A;  4DK6 C;  4G5G A;  2Y0S G;  1EQT A;  1NR2 A;  4XM3 A;  1SE4 A;  4C3J H;  5D14 A;  2P5Z X;  4N3G A;  5IP7 G;  3S1M H;  5EAY A;  2E2H B;  5FL7 A;  1LUZ A;  2LS0 1;  5IE8 A;  3I4M G;  2SEB D;  1PFS A;  3KUP A;  5HZB A;  2BGI A;  2EVB A;  3I90 A;  3U4V A;  1PRT F;  4A3G B;  3WOE A;  4DKA C;  3BZD B;  4ASU A;  4GS3 A;  1SYG A;  3OEE A;  4A3C G;  3OTO Q;  3W2D A;  4IQZ A;  1J9Z A;  1F9Q A;  2CH4 A;  4ZK9 B;  4FF4 A;  1NUC A;  2PCF B;  1UNS A;  2A5H A;  5DM6 3;  1T6Y A;  2EJF C;  2G5D A;  5M3M B;  1BVS A;  5A88 A;  2KVM A;  2CW0 D;  2R7F A;  1W0J A;  4RHR A;  2Y0S E;  4DR5 Q;  2BGJ A;  2CWA A;  4DV0 L;  3OWF A;  2L9H A;  1EIF A;  1VQ6 A;  4U9U A;  2RVL A;  4LAA A;  2MHV A;  2C5H A;  4N9P A;  4HJ9 A;  1KIX A;  1RDP D;  2BDO A;  4HJ8 A;  2DJF C;  2MJ8 A;  3ER0 A;  2TMP A;  5HZA A;  3OMC A;  4KY7 A;  3K5M A;  1B4O A;  4YCV A;  2A68 D;  3BU2 A;  4J0Q A;  4JBK A;  3PA1 A;  3HGB A;  4HIM A;  1CA5 A;  3C2P A;  4A3M B;  1MI2 A;  1EY9 A;  4PC7 A;  5KNC A;  4HCE A;  4MYT A;  2X69 A;  3ERQ A;  1VDZ A;  1NB0 A;  1N8R D;  1SBB B;  3W5V A;  1X6O A;  1S72 A;  3B6Y A;  3NTH A;  4IFD H;  2JA8 B;  1DCZ A;  1DJR D;  5E7N A;  4UZU A;  2K52 A;  2IHF A;  1WDT A;  3T51 B;  3E9I A;  4C3H G;  3CRZ A;  1KK1 A;  3L2P A;  1PMR A;  2YYZ A;  2V7T A;  2QDB A;  3PUN A;  5IK2 A;  1EYD A;  2E2J B;  1RL2 A;  4J6H A;  1NE3 A;  3PSI A;  2LZJ A;  4K14 A;  3MVV A;  3TDQ A;  2UU9 L;  1C9O A;  1OB0 A;  4HIZ A;  1YX2 A;  1L0X B;  2ICI A;  1YI2 B;  3FDT A;  4DN4 M;  4UDU C;  2UXD Q;  1K9M D;  2B2U A;  1G7T A;  1M8A A;  4R4T A;  1LT5 D;  1DGS A;  2F4N A;  2HT1 A;  1K9M C;  3AVX A;  2CH4 W;  3RN2 A;  4JG2 A;  1FRQ A;  2PI2 A;  2Q8I B;  3WXM A;  1PTO B;  2V7V A;  3TRE A;  1NJI D;  1QJO A;  4B3S Q;  3ICE A;  4A3B B;  1NR4 A;  1YJN A;  1UAP A;  2V7W A;  2NN6 H;  5FLX L;  4NXM Q;  3BDC A;  4LBW A;  4CKC A;  4BBS B;  5I6W A;  1ILP A;  5TRD A;  2M2L A;  2CKZ B;  1XX8 A;  2HUG A;  2QEX A;  4IN3 A;  2L15 A;  1WTO A;  5BR8 Q;  1WTQ A;  2YU9 B;  2EIX A;  2HCJ B;  1LAC A;  1F77 A;  1PH7 A;  1Q9S A;  3E5S A;  2HCI A;  3CPX A;  2KVO A;  2OBT A;  3I73 A;  2K4K A;  2JA7 H;  1H9M A;  3I91 A;  4RWS C;  1VQ9 B;  1TWH B;  2ZZQ A;  1SJH D;  1E3P A;  1H9S A;  5BSX A;  4HMI A;  5EBC A;  2EQS A;  4FYD A;  1KLU D;  4RKL A;  1R5N A;  2BM0 A;  4KKU A;  4RH6 A;  3TP6 A;  3A3B A;  3K7A B;  3N6R A;  2BMW A;  1XWE A;  4V19 0;  4YXW A;  1Q3L A;  3I56 A;  1N36 Q;  3HZX A;  1Q90 A;  2O5I C;  4A3L G;  3IAY A;  1Q82 C;  4P73 A;  1PA6 A;  2RDH A;  1Q86 D;  1KAW A;  1STN A;  1YEZ A;  4R4I A;  4JI0 L;  3I2Z A;  1SMX A;  4G7X A;  4A3G G;  1Q86 C;  4BBR H;  4JW0 A;  2XWB B;  2KEC A;  2K5H A;  5DLQ E;  3E0J A;  1BPL A;  1B9M A;  2YTV A;  3CQZ B;  5F4O A;  1OB2 A;  2Q6I A;  1EYC A;  1VQC A;  5EPL A;  2F4V L;  2E2D C;  2CF4 A;  3FKI G;  1BLI A;  2GK7 A;  3G4S A;  3F2B A;  1J5E L;  1ENF A;  1I6H B;  4XOP A;  3ASQ A;  3OIP A;  1Y1W G;  1VQ5 B;  4XL9 A;  2QEJ C;  1EWI A;  1PH9 A;  1GM5 A;  5IT9 L;  1KK3 A;  5KND A;  1FX0 A;  4K6D A;  4RPD A;  2HDN B;  1QUE A;  4P2N A;  4LF8 Q;  1NBM A;  1HNZ Q;  3OW2 B;  4WQM A;  1WTH A;  2F1M A;  4DF7 A;  2JIZ A;  3BVZ A;  2GK6 A;  3M4P A;  3Q6Q A;  3S1Q H;  3S2H H;  1SYC A;  3GTM H;  2V31 A;  2IPK D;  4IUV A;  4HSP A;  4KY5 A;  2PO4 A;  1EWH A;  3R6J A;  3QO2 A;  4DV6 L;  4DQK A;  2B63 G;  1ZM3 A;  2Q2I A;  1C0A A;  2VW9 A;  1CZG A;  4M4S A;  4B47 A;  1OGJ A;  3CME B;  1GKH A;  1TWF B;  3EN2 A;  1EIY B;  3CPW A;  3F2D A;  4JI5 Q;  3D8G A;  4XLC A;  3P75 A;  4HN7 A;  2XWJ B;  5JJI A;  1DDI A;  1PRT B;  1NJI C;  4XNF A;  1YNJ C;  4JI2 Q;  4RCN A;  5F2D A;  4FK8 A;  1CQX A;  1I4G A;  2FMC A;  5M5W H;  3PO3 G;  1S4Z A;  3SGI A;  4YAF A;  4RPB A;  1KDC A;  1SSO A;  2AMC B;  2MO0 A;  2BH2 A;  1ONL A;  3MCA A;  3QR8 A;  1OHH A;  5FLX E;  1A3T A;  1RIP A;  2JJ1 A;  1E2W A;  4XLH A; 
#chains in the Genus database with same CATH homology
 5BN4 A;  2R3Z A;  4OGQ C;  2EDG A;  5CR3 A;  4Z9C B;  3A7L A;  4DA2 A;  4XT3 B;  2ZTG A;  3TZD A;  2WII B;  1QCB D;  4NW2 A;  2NTS A;  2ZXP A;  3VYR A;  2PZU A;  2B8G A;  4ZYS A;  1G6Z A;  1Q1B A;  3HKZ B;  3BVM A;  3ONA B;  4PQX A;  1V0F A;  1HQR D;  2EY1 A;  3ZYY X;  1HA6 A;  5CV6 A;  4QIW B;  4G7O C;  3L7Z C;  2EYJ A;  1CT1 D;  3FPP A;  1MGS A;  2XVS A;  3VR3 A;  1G2T A;  5DNF A;  3JAM E;  3S16 B;  4ZUJ A;  2D3N A;  1SNM A;  2WP8 J;  4FF1 A;  2K1B A;  4PMB A;  4G57 A;  2NVQ B;  4FP5 D;  2G9D A;  1DOK A;  2NYZ D;  5EPJ A;  3IFD A;  4V0B A;  3QIA A;  5IOC A;  3D4D A;  2C9O A;  3V96 A;  3I3C A;  1ZEQ X;  4KJN A;  4R8I A;  1DON A;  1VJS A;  5AFW A;  2HCC A;  4XQJ A;  1WTV A;  1Y1W B;  3OOC A;  1H8E A;  3S15 B;  2CQA A;  1HUM A;  4FXK C;  3BVG A;  3L3O C;  1U4L A;  3BS1 A;  1I4R A;  1HZE A;  3NQI A;  5C4J B;  5G3L F;  2NN6 I;  5ELF A;  1Y8O B;  5CGK A;  3R2T A;  5ELE A;  2XSC A;  5I2Y A;  1LO5 D;  1KMH A;  4K8I A;  3OE7 A;  4F8M A;  2CVR A;  2XRS D;  4QUC A;  1WTX A;  2IX1 A;  3NSW A;  3D6C A;  2K5W A;  1A2U A;  3GTK B;  3P7J A;  4KN7 C;  2B2U C;  2KED A;  3M7G A;  4UAI A;  1S5F D;  1STY A;  3R3O A;  1AZQ A;  4XOT A;  2O5J C;  2W6I A;  3M4Y A;  5HGT A;  3CHB D;  2A69 C;  5CV4 A;  1CQV A;  3NBH A;  5LL6 X;  1PTO H;  1UD6 A;  3EFX D;  4TKO B;  4S3S A;  2JA7 B;  3K59 A;  3K5L A;  2RKS A;  1AZP A;  5C0X H;  4RAU C;  5KYI A;  4ZKC B;  2JJ2 A;  2F0M A;  4J1M A;  3J80 L;  2PZT A;  1STA A;  2ZXO A;  4EQN A;  1U4P A;  2QCP X;  1LAB A;  5HKK A;  3CRK C;  2WIN B;  2DY8 A;  4KHV A;  2ZT9 C;  3GTG B;  3TME A;  2A6H C;  3NK9 A;  4XDX A;  2JEA I;  3WDN A;  4BA1 I;  1OXT A;  3GV6 A;  4TQU S;  3SEB A;  3KLR A;  4XTC S;  1BMF A;  2D2C C;  1SYE A;  3QWN A;  1UEA B;  4EQP A;  1TQO A;  1W9X A;  1Z6H A;  5FO7 B;  2KHS A;  3Q0A A;  1PZI D;  2EYO A;  1KNE A;  1EY0 A;  1GJX A;  3VYU A;  3S1Q B;  3K0Y A;  3FPU B;  1LTI D;  4RGN A;  4II2 A;  1PFN A;  5C3W A;  1TWG B;  1ZYR D;  3S1N B;  2BOS A;  1LTR D;  4TT3 A;  1SNC A;  1S5D D;  2XOK A;  1LLR D;  1FD7 D;  3K6O A;  4DU9 A;  1O7L A;  3KLS A;  5LHY 1;  4BY7 B;  4RGM A;  1C4Q A;  3F2U A;  1DYQ A;  2AQ1 B;  5ELD A;  3FRP B;  3M7N A;  3QB3 A;  2E76 C;  2BCO A;  2PW7 A;  1WTH D;  3SK4 A;  3HS0 C;  2KCC A;  5JEA H;  5G3L D;  1HCZ A;  2WPD A;  3OEH A;  3ND8 A;  4K5W A;  3NWT A;  1BNZ A;  1QB5 D;  3GV3 A;  4HAE A;  4EQO A;  3DUZ A;  5IIF A;  3PIO 3;  1T5E A;  1K28 D;  1JWU D;  2N88 A;  1IYV A;  1L0Y B;  3H3V C;  4OIJ A;  1YNN C;  3IFT A;  2L11 A;  5BN3 A;  1FNW A;  5J22 A;  2ZZE A;  3HOZ B;  1LV9 A;  2NBF A;  2F0S A;  4R9W A;  1A15 A;  2KUM A;  2A6H D;  3NQT A;  2K33 A;  1CTM A;  1BOS A;  4QMG A;  5EBD A;  1FGB D;  4OIK A;  1EY8 A;  1WTR A;  5EPK A;  1PYW D;  1BUV T;  2BE5 D;  5JPN C;  1U4M A;  4U68 A;  3TP8 A;  3H09 A;  1V8Q A;  5IGE A;  2ZXR A;  1E1Q A;  5EKL A;  3KBG A;  4KN4 C;  3K58 A;  2Z1C A;  3JU4 A;  3TBI B;  4ZUI A;  2WKC A;  1O7Y A;  4TRD A;  1SEB D;  2RSO A;  5JJZ A;  4XKV A;  1GUG A;  5M5Y B;  1J8I A;  2K32 A;  3GTO B;  2NWG A;  3VA5 A;  3K5N A;  3DDY A;  5CV7 A;  3NBI A;  1D2B A;  1O7Z A;  3P20 A;  3ERO A;  1WD0 A;  1II3 A;  2WV6 D;  2XN9 C;  4DXF A;  1XYI A;  1STB A;  3SHL A;  2F0E A;  3K57 A;  3PIP 3;  5JVG 3;  1GUN A;  4LMQ D;  2BA1 A;  2MP1 A;  1PTO F;  1TKW B;  4G7Z C;  1HHV A;  2NUC A;  3EQL C;  5M9O A;  1G29 1;  3A7A B;  1F2Y A;  4F87 A;  1HVX A;  2WJY A;  4H13 C;  2EYP A;  1A2T A;  3D4W A;  4K5V A;  1Q8I A;  2XNA C;  2K6A A;  3VYS A;  4XQF A;  4C3J G;  4OL7 A;  4XLA A;  1DOM A;  3H91 A;  3OPO A;  1OXU A;  3BCF A;  1XXG A;  3NUC A;  3I4L A;  1AEX A;  1TS2 A;  5CBE E;  2NVY B;  4FO2 A;  1V0E A;  5JEA J;  4ABN A;  3A56 A;  3EJI A;  1D1I A;  1QOH A;  5D65 A;  2K28 A;  4QCL A;  2QIL A;  1DM0 B;  1D6E C;  4C2M B;  1M4V A;  3M4O B;  3A3G A;  3S2H B;  4C56 C;  3GTM B;  1I6V C;  1ZYR C;  4G6I A;  1ZXT A;  4MN3 A;  2PZW A;  3SE0 A;  1HA5 A;  4OO1 G;  3U9O A;  2MPM A;  5TSS A;  2F0G A;  4DAP A;  1LT6 D;  3Q22 A;  2AUK A;  4YEJ A;  5M5W B;  4DGZ A;  2C5C A;  5IGD A;  2NVX B;  4K8J A;  2MUY A;  2VXW A;  4FF3 A;  4A3J B;  5I2X A;  1SXT A;  3PV0 A;  3D3R A;  4DNR B;  3A35 A;  4F88 A;  2EXZ A;  2A68 C;  2L12 A;  1J9O A;  5D3D A;  4IFD G;  5HUR A;  4Y7N B;  4FVM A;  3OAA A;  1RKN A;  1WD1 A;  2H1E A;  3I70 A;  3SDZ A;  2PNR C;  4G7W A;  4P22 A;  3DEP A;  1RD9 D;  1SAP A;  4HTH A;  1KAB A;  4FXU A;  3D4R A;  1JQY D;  3VYT A;  1B1Z A;  3PUY A;  2B2V A;  4WRD A;  2JXM B;  2D5D A;  1JOK A;  5KRU A;  3S9W A;  4LJZ C;  1ENC A;  1SJE D;  3AB9 A;  1GUO A;  4NP5 A;  5EKK A;  1K83 B;  2F0V A;  2OXP A;  1UD8 A;  3LWU A;  3V2T A;  2F0J A;  4Q5V A;  2XGJ A;  5C4Z A;  5C3X A;  1AP0 A;  1KDB A;  4ILW A;  4EVO A;  1FNV A;  4I65 A;  1TY0 A;  4KTA A;  4DFA A;  1BDO A;  1FR3 A;  3FVQ A;  3E6Z X;  2PQE A;  4IAL A;  1ET6 A;  1JCK B;  3G6J B;  4ODG A;  2EYM A;  1SDF A;  3OWE B;  4IUU A;  1LTS D;  2F0L A;  2ENB A;  5I9P A;  2XZP A;  4KHZ A;  5K36 H;  1TWA B;  3URY A;  1Y69 U;  1E1R A;  3A8J E;  3SXH A;  2R9V A;  5K5P A;  1UUP A;  2EJM A;  4Q0F A;  4IUP A;  2LMC B;  4XQN A;  5IGC A;  2IWH A;  1ENA A;  1I3Q B;  3M85 A;  3K5O A;  1ICW A;  2L0C A;  5CV8 A;  1HRJ A;  3CU7 A;  2XIW A;  3PO2 B;  4XN0 A;  4CJ2 C;  5CV9 A;  1K8M A;  2EZV A;  4IUQ A;  2CK3 A;  4B3F X;  2HDL A;  3KF8 A;  1WVL A;  1WTW A;  3GP7 A;  4HR7 B;  4X3U A;  1KZL A;  1FNU A;  2ICE C;  1VF5 C;  2K04 A;  4XD7 A;  3VR4 A;  3Q6S A;  4HED A;  1PTO D;  1Y8N B;  5E3F A;  1BCP D;  1GUW A;  3OMG A;  1BCP C;  4BA2 I;  4A93 B;  1JWM D;  1XTC D;  1LTA D;  3MXU A;  2B39 A;  1UD2 A;  4A3K B;  3S1R B;  2FIN B;  3MZ5 A;  4U67 3;  2EYF A;  3TP5 A;  3QG1 A;  1UD5 A;  2X6X A;  1BR9 A;  4WJW A;  4C3J B;  1Z47 A;  2A69 D;  3BC9 A;  3A8I E;  1SNO A;  5JVH 3;  2FJ2 A;  1PZJ D;  1B44 D;  1ML0 D;  3KLS X;  4PNY A;  1Q1E A;  1IKL A;  1LTG D;  2Z4I A;  2N55 A;  5DEH A;  2D3L A;  4TSF A;  2NTT A;  5EJW A;  4RFB A;  1SKY B;  3BDO A;  2E75 C;  1H9K A;  2F4I A;  2AQ2 B;  1YNN D;  1MBY A;  5A35 A;  1E2Z A;  4B3G A;  5C0X J;  2K05 A;  3RZO B;  3CP8 A;  4ULL A;  3HOU B;  1C48 A;  1PRT C;  1I4H A;  3J7Y W;  4KMU C;  2LY7 A;  3VR5 A;  1B9N A;  1EIG A;  5CDF A;  2HLD A;  1TU2 B;  5CMD A;  3LX0 A;  1PTO C;  1DD2 A;  1ET9 A;  4E0F A;  1CFM A;  4WFN 3;  2VJJ A;  4KD3 A;  4BBR B;  4O1N A;  5ELC A;  1Y1V B;  4KY6 A;  1O80 A;  4XT1 B;  4RGT A;  1RJT A;  5C4X B;  2WJV A;  1S5B D;  5EGT A;  1EZ8 A;  3MFG A;  4BY1 B;  2Z8L A;  1Q12 A;  1RTN A;  3R8B A;  2DIE A;  1GUS A;  1FYC A;  1D5Z C;  1F2Z A;  1W6K A;  2RA4 A;  4LK1 C;  3DXJ C;  1D5X C;  4KKS A;  3FMC A;  1I4Q A;  1VMC A;  1A3U A;  3S1M B;  3A54 A;  3RMH A;  2F0U A;  3SR1 A;  2AWO A;  3MWY W;  3NPP A;  1MAB A;  4XN3 A;  2I46 A;  1HUN A;  1PLF A;  5C5L A;  2V4D A;  1VCI A;  3KK7 A;  1U9R A;  2ZZG A;  3TSS A;  2Q8R E;  1E2V A;  4WOR A;  2SNM A;  1BBX C;  5KGU A;  1Z7T A;  3H94 A;  1RHP A;  1HXY D;  4E6I A;  4XLE A;  1HTP A;  4HMJ A;  2ZZF A;  2F0N A;  3HP3 A;  4CJ1 B;  3TZU A;  3T56 B;  5FO9 B;  1IL8 A;  1JR0 D;  2QKI C;  1EU4 A;  3OHX C;  1QIL A;  2D62 A;  4XLF A;  5T1G A;  3X3N A;  4XQQ A;  4L8J A;  1JB3 A;  4IUT A;  3J80 E;  1QE6 A;  1EIH A;  2Q8T A;  1BCP B;  2M9V A;  3VR6 A;  2KCN A;  1G91 A;  3GD7 A;  4HSV A;  2F0O A;  2RDF A;  4G4K A;  1AFP A;  5JOB A;  2K5D A;  3VA7 A;  2DNE A;  4KV6 A;  1SYF A;  5M5X B;  4CJ0 B;  1R9T B;  2KOL A;  5CYU A;  3SVM A;  2RDG A;  1PFM A;  3FEW X;  3OSO A;  1EY6 A;  1BF4 A;  1W0K A;  1V1P A;  1DXM A;  4ZLT F;  2KJX A;  4ZAI A;  1HQM C;  1SMY C;  4KD4 A;  4L6T B;  3EA6 A;  1SMY D;  1QG7 A;  1TS4 A;  3OW7 A;  1IKM A;  3FKS A;  3HAG A;  3NE5 B;  3A8K E;  5KNB A;  2L1B A;  2ID0 A;  2GJR A;  3VR2 A;  2F0K A;  1D1K A;  2EY5 A;  3I8Z A;  1CI3 M;  1EZ6 A;  1TY2 A;  3RD4 A;  2ZXH A;  2WAQ B;  1KNA A;  1GUT A;  3BYY B;  4B9X A;  3T4A C;  3NP8 A;  3SK6 A;  1S5E D;  2NN6 G;  1QNK A;  4GZY C;  1UD4 A;  1EWC A;  4A3E B;  4KJO A;  1V1O A;  4C3I G;  4C1N I;  4RCO A;  4DNT B;  1B3A A;  1SE2 A;  1NAP A;  2B63 B;  2NVT B;  2K01 A;  3SK5 A;  3Q23 A;  1CQF A;  4KKT A;  4K5X A;  4O42 A;  2E1B A;  2F0Q A;  3GVJ A;  3J81 L;  1G8Z D;  2FFK B;  1BQQ T;  4DK1 A;  2XND A;  2IT1 A;  2JEB I;  4C1N K;  2OF1 A;  4NDX A;  2BDN A;  3QOL A;  2SNS A;  5FO8 B;  4CBV A;  5IGG A;  4J8Q A;  4RA8 A;  2PMZ B;  3SK8 A;  1I8D A;  2F0W A;  4L63 B;  5C44 B;  5C3E B;  5I4D A;  1B53 A;  3U9S A;  3G7L A;  1F2M A;  5BN5 A;  2AWN A;  1R4P B;  1WPC A;  2EPB A;  3PUV A;  3MHB A;  1GXD C;  2X6G A;  3DWQ A;  2GJP A;  1G2S A;  2PW5 A;  2IJ0 A;  1V43 A;  3ZIA A;  4ZRZ A;  1QWY A;  2W6J A;  1EU3 A;  3J7A F;  4QB4 A;  3RLF A;  3EVQ A;  2R93 B;  2EY2 A;  4P2C B;  1TT2 A;  3MXG A;  4XMY A;  3LWE A;  4HCS A;  2RQX A;  3I4N B;  5E1F A;  2XRQ D;  4KI0 A;  1MSH A;  2AQ3 B;  2O4X A;  5CBA E;  1VLY A;  4CKE A;  3C3L A;  4JBW A;  1CHP D;  4DAV A;  1F9R A;  4H0L C;  3DWP A;  2KEE A;  4CKB A;  1JE4 A;  4IUN A;  5COR A;  4PMC A;  1CM9 A;  1ILQ A;  2CHB D;  2WKD A;  4BS9 A;  2X6Y A;  1U4R A;  3GO5 A;  3CP2 A;  1B2T A;  1F9S A;  1PZK D;  2JYO A;  2X6W A;  4A3D B;  4YIJ A;  2F3W A;  1JOQ A;  2VB2 X;  2WAC A;  5I9O A;  4NKL A;  1UD3 A;  3S17 B;  2HDM A;  4H44 C;  1EFI D;  1H8H A;  3ZPN A;  3HOX B;  1CHQ D;  2KA7 A;  1EQV A;  3C1E A;  5I6Y A;  2E74 C;  3MXP A;  2SOB A;  2EJG C;  4TSS A;  1PXU A;  1X3Q A;  1V1P B;  1BCP F;  1E0B A;  3Q24 A;  2I07 B;  1OXS C;  2G9H D;  2X85 A;  4K2L A;  3KEW A;  4G7H C;  5C0X I;  4OO1 H;  3WQZ A;  1CA6 A;  2F0D A;  4B9W A;  5C6A A;  4XXE A;  5LL6 S;  2M5S A;  2XZL A;  4IZ8 A;  2K03 A;  1OO9 B;  2VJI A;  3HOV B;  2PPB C;  5KNL A;  3PO3 B;  2X8K A;  2Z6B D;  5A2Q L;  1PDQ A;  1HFN A;  2R6G A;  2IW3 A;  2F03 A;  3PUX A;  1TII D;  1E79 A;  3DHQ A;  4A3F B;  2EY6 A;  2NB0 A;  2RBM A;  1TVX A;  1HTL D;  1EYA A;  3FKI B;  4I7Z C;  1H9J A;  1NRK A;  2CW0 C;  2Z4H A;  1IW7 D;  4X3T A;  3AU7 A;  4OO1 I;  4PMW A;  1X3P A;  2OEO A;  2B2W A;  1Y8P B;  5DAU A;  3GTL B;  4IFD I;  2V7Q A;  2ZTN A;  1LTT D;  3DWA A;  1AN8 A;  2PYK A;  2FMM A;  5ELB A;  1GHJ A;  5IOD A;  4XOR A;  3HOY B;  3V05 A;  1AW7 A;  1SYD A;  1GOZ A;  3GTJ B;  2F43 A;  3X3M A;  5C5M A;  2F3V A;  1BXT A;  1TS3 A;  2LKV A;  2NZ1 D;  3GQB A;  2IL8 A;  4GQN A;  2JE6 I;  2D9U A;  1GHK A;  3CKI B;  1ZKO A;  3P1H A;  1TR5 A;  2VUM B;  1O78 A;  3NHH A;  5E4W C;  1KDA A;  2F0H A;  4R8N A;  5K36 G;  3KBX A;  3S14 B;  1OXX K;  2BE5 C;  1HPC A;  4N9T A;  4NNJ A;  1SFO B;  4KK7 A;  2M00 A;  1SNQ A;  2H4O A;  1COW A;  3BG3 A;  4M1U B;  3CES A;  1HFG A;  5DN6 A;  4M8A A;  3LNN A;  2SDF A;  2B2W C;  2ZXI A;  4AVZ A;  1KLG D;  1A6X A;  5ISR A;  1CZW A;  3A55 A;  4NMZ A;  1JC7 A;  3PUZ A;  1DZ1 A;  5JPM C;  3QOJ A;  4ZKB B;  5FKA C;  1SND A;  4XYO A;  3M3Y B;  4DAY A;  2EYH A;  3H6M A;  2B2V C;  1MD2 D;  1JWS D;  1STH A;  2QE7 A;  3I72 A;  3BYT B;  1C8C A;  3BH4 A;  1WP6 A;  5IGF A;  4IFD J;  4QUF A;  5C4H A;  2GJK A;  1EY7 A;  2A73 B;  2F0I A;  4JMQ A;  3MC0 B;  3J7A V;  5J39 A;  2LFN A;  5DM7 3;  1EEI D;  1IYU A;  2Y0S B;  2R61 A;  1CK1 A;  1F9P A;  3JAM L;  2GA4 B;  1R4Q B;  2RSN A;  1E3Z A;  1LT4 D;  3HEJ A;  4C3H B;  3D6W A;  5CC4 A;  3N52 A;  5FOB B;  3PUW A;  2EYL A;  3D31 A;  4RGO S;  5M3F B;  3GVK A;  3RUZ A;  2DY7 A;  4F7X A;  2J4X A;  3MFY A;  3BCD A;  4FF2 A;  5EQ0 A;  3GTP B;  5FK9 C;  2L5T A;  2IX3 A;  4RHS A;  3CRL C;  2WSS A;  3TN2 A;  1YNJ D;  1I4P A;  3DMU A;  1EOT A;  3WOF A;  3GTQ B;  4AYB B;  2HQE A;  4II3 A;  2QF7 A;  2E2I B;  5C0X G;  2EOT A;  2O2L D;  2B2Y A;  3C1F A;  5T1I A;  2K5Q A;  2BA0 A;  1JOO A;  3ITP A;  5NUC A;  5JAV A;  1BO0 A;  2XZO A;  2VB3 X;  4XON A;  2JA6 B;  2MGS A;  2DNC A;  2TSS A;  1OXV A;  1TS5 A;  4K6L A;  2A6E D;  3AMU A;  2L55 A;  1ESR A;  4K2K A;  5IT9 E;  2A6E C;  2JA5 B;  2F0P A;  2DN8 A;  1JIC A;  2J7Z A;  2JDI A;  3T53 B;  3NWS A;  4X3K A;  2JSO A;  1IW7 C;  3NTK A;  1DOL A;  5A2Q E;  2B2T A;  1X32 A;  5COY A;  1RTO A;  2J0T D;  1E3X A;  4BWG B;  3OIQ A;  4IUR A;  5E4X A;  2B8F A;  4QF4 A;  4YEL A;  3IL8 A;  1E43 A;  5KIX A;  2R7Z B;  4JK1 C;  1RCV D;  3H0G B;  1KTK A;  5KEE A;  3C46 A;  2AUJ D;  4Z1M A;  2JP1 A;  1VF7 A;  2IX0 A;  1EL0 A;  3G05 A;  1PRT D;  3TP7 A;  4XYQ A;  2R92 B;  4C3I B;  1NCV A;  4MHE A;  3IKJ A;  4DXG A;  3T13 A;  1ROD A;  4ZQ3 A;  2VNU D;  3DM1 A;  2EE1 A;  1I50 B;  3MXN A;  5JEA G;  4XR6 A;  2F0F A;  5KYL A;  3R93 A;  3O13 A;  1RF2 D;  3CMM A;  2L4N A;  3OFN A;  4XIG S;  3R2I A;  1A3V A;  1JOR A;  3HRZ C;  3MEH A;  3NXW A;  2OT2 A;  3T16 A;  1H9S B;  3UI2 A;  1STE A;  3J81 E;  4FXG C;  1TWC B;  2X6L A;  5J1Z A;  4X3S A;  1B50 A;  3RZD B;  4XKW A;  3MA2 B;  1SYB A;  1PKV A;  3L9A X;  1PFB A;  4ME5 A;  3NTI A;  1KAA A;  5D3I B;  1LTB D;  4H7B A;  4RKB A;  4PV1 C;  3QJY A;  3DEO A;  5CV5 A;  2A74 C;  3S2D B;  1IHZ A;  3ND9 A;  3I4M B;  4FNF A;  4OHJ A;  4MIU A;  4CHT B;  1NSN S;  1W6J A;  2K7V A;  1SE3 A;  2F0T A;  3BDL A;  2WB1 B;  1I18 A;  4EGV A;  2B2T C;  1EY5 A;  3HG9 A;  5IGB A;  4CGY B;  3PMF A;  1EY4 A;  2X53 S;  1MSG A;  4DK0 A;  4A3I B;  1WCM B;  1QNU A;  1D5M C;  4ID6 A;  1LT3 D;  1VMP A;  1WTP A;  1ESF A;  1EFR A;  4FXD A;  2KQ3 A;  3GVL A;  1STG A;  5EKI A;  2WZP P;  1T5X D;  1S5C D;  2B2Y C;  1H9R A;  1F2L A;  2FHT A;  3MAQ A;  3W3A A;  1I4X A;  1EEF D;  1SNP A;  1K8O A;  3MTS A;  4B08 A;  3HOW B;  1EQT A;  1NR2 A;  4XM3 A;  1SE4 A;  5D14 A;  2E2H B;  5FL7 A;  2LS0 1;  2SEB D;  3KUP A;  2EVB A;  3I90 A;  1PRT F;  4A3G B;  3WOE A;  3BZD B;  4ASU A;  1SYG A;  3OEE A;  3W2D A;  4IQZ A;  1F9Q A;  4ZK9 B;  4FF4 A;  1NUC A;  2PCF B;  1UNS A;  2A5H A;  5DM6 3;  2EJF C;  5M3M B;  2KVM A;  2CW0 D;  1W0J A;  4RHR A;  3OWF A;  2L9H A;  2RVL A;  4LAA A;  2MHV A;  4N9P A;  1RDP D;  2BDO A;  2MJ8 A;  2TMP A;  3OMC A;  4KY7 A;  3K5M A;  1B4O A;  2A68 D;  3HGB A;  1CA5 A;  3C2P A;  4A3M B;  1MI2 A;  1EY9 A;  5KNC A;  4HCE A;  2X69 A;  3ERQ A;  1VDZ A;  1SBB B;  3NTH A;  4IFD H;  2JA8 B;  1DCZ A;  1DJR D;  4UZU A;  3T51 B;  4C3H G;  1PMR A;  2YYZ A;  2QDB A;  5IK2 A;  1EYD A;  2E2J B;  4J6H A;  2LZJ A;  4K14 A;  3MVV A;  3TDQ A;  1OB0 A;  4HIZ A;  1L0X B;  2ICI A;  3FDT A;  4DN4 M;  4UDU C;  2B2U A;  1M8A A;  1LT5 D;  2Q8I B;  1PTO B;  4A3B B;  1QJO A;  1NR4 A;  1UAP A;  5FLX L;  2NN6 H;  3BDC A;  4CKC A;  4BBS B;  5I6W A;  1ILP A;  2M2L A;  1XX8 A;  2HUG A;  4IN3 A;  1WTO A;  1WTQ A;  2YU9 B;  1LAC A;  1F77 A;  3E5S A;  2HCI A;  2KVO A;  3I73 A;  1H9M A;  3I91 A;  4RWS C;  1TWH B;  2ZZQ A;  1SJH D;  1H9S A;  4HMI A;  5EBC A;  4FYD A;  1KLU D;  4RKL A;  4KKU A;  4RH6 A;  3TP6 A;  3A3B A;  3K7A B;  3N6R A;  1XWE A;  4V19 0;  4YXW A;  1Q3L A;  3HZX A;  1Q90 A;  2O5I C;  3IAY A;  2RDH A;  1STN A;  4G7X A;  2XWB B;  2KEC A;  3E0J A;  1BPL A;  1B9M A;  3CQZ B;  5EPL A;  1EYC A;  2E2D C;  1BLI A;  2GK7 A;  1I6H B;  1ENF A;  4XOP A;  3OIP A;  4XL9 A;  2QEJ C;  5IT9 L;  5KND A;  1FX0 A;  4K6D A;  1NBM A;  4DF7 A;  2F1M A;  2JIZ A;  3BVZ A;  2GK6 A;  1SYC A;  2V31 A;  2IPK D;  4IUV A;  4HSP A;  4KY5 A;  2PO4 A;  1EWH A;  3QO2 A;  1CZG A;  1TWF B;  3D8G A;  4XLC A;  3P75 A;  4HN7 A;  2XWJ B;  1PRT B;  4XNF A;  1YNJ C;  4RCN A;  5F2D A;  1I4G A;  2FMC A;  1S4Z A;  1KDC A;  1SSO A;  1ONL A;  1OHH A;  5FLX E;  1A3T A;  2JJ1 A;  1E2W A;  4XLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...