4DNRB

Crystal structure of the cusba heavy-metal efflux complex from escherichia coli, e716f mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein CusB
publication title Crystal structures of the pre-extrusion and extrusion states of the CusBA adaptor-transporter complex
rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 56
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00529 HlyD HlyD membrane-fusion protein of T1SS
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4dnrB02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dnrB03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 4dnrB01
3VR2A 4IFDH 2B8GA 2O5JC 1DXMA 4XIGS 1Y8OB 2L5TA 4RCNA 1E2VA 2PPBC 4HR7B 2K33A 1OXVA 1GJXA 3PUYA 4H44C 3CRKC 2O5IC 2ZT9C 3VR3A 1H9SA 1I6VC 1VF7A 4IQZA 2JEBI 3D4RA 4JK1C 2YYZA 4KKUA 5C0XG 2KCCA 4G7HC 2BE5D 2D5DA 4OGQC 3TZUA 3M7NA 2DN8A 1H9MA 3A7LA 1E2WA 1Y69U 1QJOA 3QIAA 3A8KE 2BA1A 1CI3M 3BG3A 3VR4A 4IFDG 1DD2A 3ND9A 3T56B 4PV1C 5BN4A 2A68C 2EJFC 4TQUS 1H9RA 4DNRB 3VR5A 1IYVA 2EJMA 2V4DA 2LMCB 1E2ZA 3D31A 3PUWA 3CRLC 3PV0A 3QG1A 1Q12A 2DNEA 1Q90A 1OXTA 3VR6A 3PUXA 2PCFB 3FMCA 1K8OA 1O78A 1H9SB 3M4YA 1B9MA 1Q1BA 4KKTA 1Z6HA 2IT1A 3A7AB 3FPPA 4KKSA 2EVBA 5KNDA 1GUTA 2JEAI 3KLRA 2K7VA 3H94A 2JE6I 1IW7D 2A6HD 1O7LA 2B8FA 3A8IE 1HQMC 1A6XA 4OO1H 1OXSC 2F1MA 4KHZA 4GZYC 3I73A 1YNJC 3EQLC 3QJYA 2A6ED 1H9KA 2NN6H 1BDOA 1TKWB 1SMYC 1Z7TA 1K8MA 1GHJA 3OPOA 1LABA 3W3AA 2AUKA 3GQBA 4KN4C 3SDZA 1IW7C 2A6HC 2DNCA 5BN3A 1GUSA 3A8JE 2BE5C 5JEAH 2A69D 3M85A 2EDGA 1DCZA 1H9JA 4BA1I 1FYCA 1OXXK 2NN6I 4G7ZC 1TU2B 4OO1G 2A6EC 1B9NA 1CTMA 4LJZC 4BA2I 3LWUA 1GUOA 3OW7A 1VDZA 1Y8PB 4H13C 4G7OC 2PNRC 1OXUA 2KA7A 2NN6G 1HTPA 3PUZA 1V8QA 3BDOA 3U9SA 1HCZA 4KN7C 3T53B 4TKOB 4L8JA 3GD7A 1Y8NB 1ZYRC 3IKJA 3T51B 5JEAG 2EJGC 1HPCA 1LACA 1ONLA 1IYUA 1VF5C 2D62A 3ND8A 4I7ZC 5KNBA 3NE5B 2E75C 2Q8IB 3VA7A 1EWHA 3L7ZC 3SE0A 5BN5A 2R6GA 1CFMA 4H0LC 1V43A 1GUNA 5K36H 4KMUC 3HGBA 3LNNA 2D2CC 1G291 2QF7A 3MFYA 1FR3A 2A68D 2E74C 4KI0A 4LK1C 1T5EA 2K32A 1GUGA 1PMRA 2AUJD 4DK1A 3IFTA 3P20A 3MXUA 5KNCA 2AWOA 2JXMB 2BDOA 3AB9A 5A35A 2CW0C 3I72A 3OOCA 1YNNC 1ZKOA 1GHKA 2A69C 3PUVA 1VCIA 4DNTB 4XTCS 3WDNA 5K36G 3DXJC 2BA0A 3I4LA 5C0XH 1Q1EA 4JBWA 4DK0A 3N6RA 2E76C 3RLFA
chains in the Genus database with same CATH superfamily
2BOSA 1L0WA 1J5EQ 1NR4A 3ERSX 5J3OA 2ICEC 1E2VA 1M4VA 2E2IB 1U5KA 1MIUA 2B2VC 4JI3Q 4P2NA 3BY2A 1ZM2A 1OTCA 4JK1C 4L5SA 2YYZA 5M5YH 1STNA 1UD8A 1E63A 3GIRA 4GQNA 4M1UB 3I4NH 4C3JG 3F2BA 3QIAA 4HIMA 2VQEQ 2KCTA 4HSVA 1EY4A 2TMPA 4LFAL 3D0FA 2F4VQ 1E2ZA 1R4QB 4UZEA 3MZ5A 1CQXA 2VUMB 3VR6A 3FEWX 4JI8L 4CJ2C 2WB1E 3DDYA 4XXEA 3M4QA 1DOMA 3BYTB 5C3EH 2UU9L 1ZM9A 5COYA 2EYJA 3HOVH 2WP8J 2ENBA 3PO2B 3OP1A 4A3EH 4DV1L 2K7VA 4IUPA 1KRHA 1F9RA 2X6GA 4LC0A 4LFBL 3PA2A 1W35A 4HSPA 4E0FA 4ZLTF 2J0TD 3R6KA 4R4CA 1XMQL 3QJYA 2G9DA 2QGGA 4RCOA 3UDXA 1R5BA 2VNJA 3VNUA 3M3YH 1V0FA 4N9PA 2F0PA 1LABA 1K3BC 3CCJB 4JW0A 1IW7C 3RN2A 3A8JE 4C0SA 3U9OA 4YAWA 1H9JA 4DGZA 3Q39A 2HD3A 3JU4A 1VHEA 4DR6L 1W6KA 3SJZA 2R7ZG 3NP8A 4MTKA 1EU3A 4JI0L 3MXNB 3B82A 1V1QA 2GA4B 4MZ9A 1T9HA 4A3FG 3T53B 1P4MA 1STBA 3OW2B 1VF5C 1ONLA 2KOLA 2IL8A 3NELA 4N9TA 1XPOA 3M4PA 5TR9A 4A3IB 1EFCA 4PC3A 3LNNA 3S14H 2QF7A 4J6HA 2JA6B 5C44G 1IB0A 4ZCIA 1YVCA 1VMCA 4FF4A 1PMRA 2JA8H 1HJPA 2VBUA 2XZOA 2VQFQ 3CCEA 3BVGA 1PH1A 1HQRD 3HAGA 1STGA 1XQBA 3TREA 4YWMA 4BY1H 4J0QA 4KHVA 3TRZA 3V76A 4XLHA 1TUIA 5K36G 4G4KA 1HRJA 3NENA 3CCLA 3MMPA 1NJIC 4OWTB 1XFOA 4IW3B 4RDKA 2F0TA 1K8AC 1W6JA 3K59A 3J7A5 4UPAA 4ILWA 4JBJA 3AYHB 2CRVA 1HNXL 1E79A 3UE0A 4H44C 3DMUA 2ZT9C 1SNPA 4Z9CB 1VF7A 4YIJA 4CHTB 1JB9A 2VB2X 3W1GA 1BXTA 1MSGA 1QGYA 4ZAIA 2JA7H 2VYQA 1S72A 1JE5A 3KUPA 4YCWA 2HQLA 2L4NA 3A7LA 2BPOA 3VR4A 5C0XJ 1SXTA 1KLUD 2JA5H 4QV2A 1O7ZA 4DNRB 2V7TA 2OCEA 5NUCA 2JN4A 4WZTA 5KGUA 1VQLB 3I4MH 4XL9A 3KDFB 4WJ4A 2LZJA 2XNDA 1I5FA 2I5LX 2IWHA 2EYHA 1FNMA 1JJ2B 3FPPA 1U9RA 1S40A 3TP6A 3CD6B 1OGJA 1Y1VH 4IUQA 4FYDA 1I18A 1M90C 4JI3L 1X3EA 1X3GA 1STHA 2OXPA 4RAUC 2WINB 4OIKA 2F1MA 1R4PB 3IFDA 4JVZA 4KHZA 1D5MC 3J80c 3NBHB 1PH2A 4GZYC 1EFRA 2RHQB 4IJHA 3ICEA 4P9SA 1WSVA 5IGCA 1KQSA 2R93B 4XQNA 1A2TA 4DV4Q 1H95A 5FLXc 2CH4W 4P1VA 1JWMD 4OO1G 4AF7A 1R9TH 2A6EC 4G7XA 2KBNA 4V0BA 1H85A 3ERQA 1EP2B 2NYZD 4ASUA 5HKKA 1A62A 1UE1A 4IPCA 1C8CA 4A3GB 4P12A 4JG2A 1GVHA 3H91A 4Q0FA 3CQZB 1SNCA 2RDGA 1EYGA 3PUNA 4XLEA 3K80C 3WBJA 1G7TA 3ES9A 4DV5Q 2AQ2B 2D62A 1TWFH 3K7AB 4I7ZC 2K5HA 2KECA 2EZVA 1FNDA 3MXPA 5J3BA 2VY3A 3HOYG 1WTRA 5IP7H 4C3IB 4MNOA 4PQXA 3OYYA 2DEUA 2A73B 4HEDA 2NZ1D 1HH2P 4UZUA 4JBMA 2EQSA 1VQMA 3I4OA 1BKBA 3I72A 1AN8A 3GTLB 1QH0A 1KDBA 1YNNC 2ZITA 1K9MC 2ZTNA 1YIJA 1IL2A 1SNDA 4B3GA 2R9VA 1EWCA 1CKNA 3VR2A 5LL6S 1N36Q 2BVNA 1ASYA 2OTLA 2AWNA 4POGA 1PXUA 3AFPA 4RCNA 2PPBC 2K33A 1I7PA 1WTXA 1EEID 4ZUJA 3PUYA 2XIWA 1DONA 3WOEA 1SBBB 2OK7A 3CPWA 4DUZQ 2F0UA 1PZKD 2XNAC 2E2HB 3HG9A 4DAYA 1VQAA 2A8VA 4LF8L 2C78A 1KAAA 2R7FA 4LW1A 2R92H 3M7NA 4B4DA 2ZM6L 5C5MA 1YLOA 4DV0L 1H9MA 2EY1A 2SOBA 2JDIA 4DR3L 3I1FA 1DGSA 5DS0A 4UP8A 3T4AC 1TR5A 1KC8C 4IPDA 1JCKB 5IGDA 2EJFC 4CBVA 2QMUA 5C4XG 4HE5A 3K5MA 3Q38A 4P3IA 4PMWA 3ZPNA 1J9ZA 3PUWA 1K0RA 2IW3A 5EGTA 3G4SA 3W5OA 1EFID 1K8OA 1W0JA 3U2QA 3TP7A 4A3LG 3AVUA 1WOPA 2EVBA 4H7BA 5EPLA 3HKZG 3CCEB 2UUBQ 2ZXPA 1EOVA 4A3DH 2EYLA 2VNKA 2A6HD 4OELB 1VLYA 5CYUA 1JORA 3ZZ0A 4KK7A 4C3HB 5L37A 3S9WA 3BZKA 5JPMC 3I73A 1PH8A 3GTKB 3CCLB 3H0GB 1JE4A 4DR7Q 1AH9A 4DR4L 1QFZA 4QVJA 3FKIB 1IJFA 5JEAH 1HR0W 3P7JA 4N3GA 4Z4SA 4JI7L 4FWTA 1SE3A 1C9OA 5FLXL 1QCBD 4K5VA 2GVAA 3CAMA 3F1ZA 3PQIA 4RHSA 3OW7A 3WOFA 1P16A 2HLDA 3S2DH 1OXUA 2KA7A 4PGOA 1PTOH 3MEHA 1ET9A 5I9OA 1S72B 3BDOA 1F2MA 1WI5A 1CHPD 3A56A 1VQNA 2BN4A 3QFRA 3PO3H 1IYUA 1SE8A 4H02A 1QUQA 4BY7G 1MABA 1FRNA 2UXBQ 3VNVA 1TT2A 4J8QA 4ZYSA 1N34Q 3L3OC 5BN5A 5DLQE 2IY5B 4X06A 5HGTA 1BCPF 3HGBA 3VO1A 2Q6OA 1N33Q 4CJ0B 2XGTA 1PFNA 1KL9A 3NUCA 4X7EA 4A93B 5AJ3Q 1IBML 5EJWA 1VJSA 4DV4L 1V0EA 3EJIA 5IWAL 2L15A 4MYTA 4BS9A 2ASBA 2QE7A 4DF7A 4HIZA 2AHOA 2CK3A 5GAEC 1SJED 4B3MQ 1I4XA 4UP9A 1ENFA 3ASTA 4GLXA 4JI4Q 4DR2L 2PW5A 3CMEA 1Q1EA 4ZCKA 5GQOA 4UAIA 1KQSB 1E1TA 1RDPD 2ZL7A 5M3MB 2OTJA 5IYCH 4HJAA 2WV6D 4ID6A 1IBKQ 1GXDC 2GVBA 3GTJH 1Q3LA 1ZM3A 3HOXH 4OPSA 1Q86D 4X64Q 3K81C 4WRDA 3UDFA 2RSNA 4LF9Q 1EL0A 1TQOA 2EIXA 4HCSA 1I50B 2A19A 2DN8A 2MFIA 1LTGD 2NVYH 3UE1A 3SVMA 3I55A 4RD6A 1M1KC 4BXXG 2VZLA 2BA1A 2VBTA 1CI3M 2XOKA 2F4IA 3ND9A 4AYBE 2HIXA 1IBLQ 1EIYB 4PC7A 4QB4A 1V1OA 1PHJA 3SK8A 1YBYA 1OXTA 3URYA 4HIKA 4BBRH 2VJIA 4TT3A 4EH1A 2XWBB 1S4MA 1VQFA 1NNXA 2W6JA 3A7AB 5C6AA 1N36L 3RZOB 1GUTA 5CC4A 4QFMA 3F2DA 2X6YA 4APVA 1AFPA 1SN8A 1VQMB 4K8JA 4ZRZA 4B3SL 5FO7B 1K28D 5KNLA 1T5XD 3U58A 2YU9B 1HZBA 4A3CH 3ZIAA 1YIJB 3KLSA 2ZL6A 2L1BA 4X7FA 1KHIA 5M5WH 1CKNB 1GHJA 2AUKA 4OIJA 2EYPA 2OTLB 3S1RB 3Q24A 3AVWA 4GNXC 1DCZA 2IX3A 1NCVA 1F9PA 4G7ZC 4NCNA 3HOWB 3Q6QA 4X3UA 1BX1A 3CPWB 2EY2A 4BA2I 2F0FA 4DAYB 4I7AA 4DQLA 1K8AD 4B9WA 4X0CA 2Q6KA 4OL7A 1SYEA 3SJPA 1VQDA 1T6ZA 1WTHA 5GROA 5A2QL 4P72A 2K5QA 3AGPA 1SKQA 3E5SA 1Y1WH 3ZJYC 3GVKA 2Y0SG 4YWKA 5JAVA 3GTQH 3K5LA 1RF2D 3STBD 4CQJA 4C3JB 4DV7Q 4QUCA 5IODA 1XMOL 1VQ8A 2K03A 2Z9HA 3GTOH 1WJJA 3G4SB 1V43A 1S3OA 1JICA 1NMGA 2JA6H 2QKIC 2IX1A 1ELOA 3S15H 2L55A 1LTID 1NMFA 2K32A 3GO5A 3E1YE 3SK4A 3SR1A 1SYFA 3KF6A 3X3NA 4YHHQ 2K50A 3J80i 3J81k 5C3WA 3AMUA 1F20A 4WJ3M 1CZGA 1J8IA 2CW0C 2CQAA 3NQTA 3NBIA 1EYCA 3GTGH 3Q3AA 4G1BA 4HCEA 2D9UA 2MNAA 4DK6C 1Q9SA 3DXJC 3WYAA 5C0XH 1S4ZA 2IJ0A 1M90D 1X6OA 4RD4A 3VMFA 5DN6A 4AF6A 2K5NA 5M3FH 3K6OA 3MCAA 1JJGA 5ELDA 5TV2A 3CCUA 1LV9A 1G2TA 2WAQB 5IY0A 1KIXA 2B2YA 1DDIA 1BOSA 3A5ZB 1AE2A 2D0OA 5EAYA 2QTZA 4ZUIA 3A1PA 3W5HA 5F4MA 4BWGB 1WCMH 1EWYA 5EPKA 1PTOD 1X56A 3FJOA 2EYFA 4RWSC 3CP0A 3U6KA 1O7IA 4LFAQ 1FJGQ 2A5HA 3M4OB 1BLIA 1JA0A 4K5WA 5C3XA 1VQNB 4K2KA 3VYTA 2R7ZB 4JI8Q 1QUQB 4C1NI 4IFDJ 4RD2A 5E4WC 3HFZB 4WZKA 3AVXA 2UU9Q 1JWUD 1TWCB 2BDNA 4B3ML 1Q90A 2DJFC 2DY8A 4P74A 4JI2L 2PCFB 1F2LA 3I4NG 4DV1Q 3DEPA 3M4YA 4LFBQ 4K5XA 3KF8B 5IYWA 4A3JB 1QVGA 1XMQQ 3CMMA 1HA3A 4XN3A 4WFN3 1HQMC 2AHOB 5HGQA 2JK8A 3CMEB 1SKYB 1QE6A 4IUNA 4AIMA 5C3EG 2RA4A 2OTJB 3BZCA 4XT3B 4DR6Q 1VQBA 4OO1I 5BN3A 2WJYA 4XD7A 3HOVG 4U68A 4A3EG 1YNND 5FO0A 1J6QA 2M2LA 1VMPA 2VJJA 1K9MD 5M5XH 1IBLL 4ZQ3A 1F9QA 2F0IA 4A3MB 5ELFA 4PG3A 3MA2B 4DV6L 5EKKA 1S0UA 1PRTF 3I55B 1FL0A 5HURA 4L8JA 1VQIA 3QE2A 1QWYA 2D0PA 3T51B 4RCZA 5C4HA 1LYLA 1T6XA 3V96A 2JA9A 5EQ0A 2VW9A 1XTCD 4C3IH 3VA7A 3I2ZA 3L7ZC 5CDFA 2YWGA 1ML0D 5I9PA 2WZPP 1CFMA 3ONAB 4HJ9A 1VLOA 2Z4HA 2OK8A 1SDFA 1E24A 3A8IA 3S17B 1STYA 3ISXA 2JP1A 4KI0A 2NWGA 3VYSA 3VYUA 2FJ2A 3Q6SA 1PH5A 4DK1A 1VHOA 3D6CA 3MXUA 3PGZA 3WQZA 2ZBUA 5IE8A 4Y7CA 4L5RC 1W87A 2NVQB 4DK3C 1C4QA 3GTMB 4II2A 1K83H 2MP1A 3KLWA 1HNXQ 2N78A 5D14A 5ELOA 3RLFA 3JC66 3UDGA 1B23P 2JA8G 1D1KA 3KBXA 4Z1MA 1Q82C 2B7CA 2E2HH 4BY1G 1PV4A 1TWHB 2JEBI 2PZUA 5EBCA 1QVCA 1U4PA 2I07B 5GADC 3HOZH 2DYIA 2XRQD 2DERA 3WNBA 2XEXA 4JBKA 5FIUA 3AEVA 4A3BH 1OB5A 4DKAC 1B3QA 3RN5A 2GJKA 2VS1A 4X05A 4EX5A 3CXCA 2EJMA 1VQ8B 1KAWA 1HA5A 1OB2A 3U4ZA 3MVVA 1F60A 2HCCA 2EXDA 2WJVA 1O78A 2JA7G 4RFBA 2UUCL 1TXYA 3KF6B 4GLAC 3T1YL 4ZCMA 1YI2A 3HOYB 2FMMA 2WIIB 3ASPA 1ESRA 1K0SA 3U6BA 2JA5G 2KEEA 2KHSA 3A35A 1SJHD 2QTLA 4Y52H 3V7AA 1E7ZA 3I4MG 4KY5A 3CPXA 1H9KA 4GNXA 4X8IA 3FKIH 3RR5A 4YCVA 1PH6A 3D6WA 1FJGL 3TN2A 4B9XA 4Y7NB 1CKOA 1TWGH 2CH4A 5KRUA 3CCUB 1Y1VG 2L9HA 5LMZA 5CGKA 3WBKA 4RA8A 3M85A 3KOJA 1OXXK 3E6ZX 1JJCB 4CDFC 2WB1G 1HNZL 2VBSA 1ZXTA 4CDEC 5KYIA 3FVQA 4G7OC 4B3TL 1GD7A 3A3GA 3PUZA 1DM0B 1V8QA 1KK3A 1HTLD 1QGZA 3Q23A 2QDLA 3IKJA 3HOUB 5TRDA 1QG0A 2Q2TA 3NHHA 3NE5B 5FLMH 4JPBW 1SFOB 2K1BA 2K5DA 1PJ7A 1BQQT 1EWHA 2ZJRA 1RQPA 4WWVA 2RDFA 2F03A 4Z4UA 3S2HB 2Z6BD 4YELA 1HZCA 2NB0A 1PTOF 2K6AA 3WXMA 3ZYYX 2E74C 4LK1C 5C4XB 2C5CA 1QVGB 4LMQD 1XX8A 4KY7A 4XDXA 1Y14B 3OTOQ 5LMNQ 1HZ9A 4IZ8A 2WAQE 2K05A 4CKCA 2P5ZX 1NDHA 1SLJA 5IP7G 1E3PA 2F3IA 5IGFA 3HKZB 3WDNA 3SK6A 5KIXA 4WZLA 2MO0A 1F2YA 2F4NA 1XNRL 1QVFA 1Q46A 2O5JC 4YY3Q 3R3OA 1DXMA 4R1JA 2DCUA 4QCLA 1QZGA 4LF8Q 3OWEB 2ZM6Q 4DV0Q 3QWNA 4DR3Q 3LGJA 2I46A 3J80E 2HUGA 3FRPB 3LX0A 3H3VH 1ASZA 2FX3A 1N0VC 1A8PA 3A8KE 2X3UA 3OIPA 3WWVA 2NVXB 4XQFA 4HE6A 3J81j 4Z4RA 3BVZA 1SSOA 4LFCL 5FLXE 4RD3A 1QILA 3CRLC 4RPDA 5G3LD 5E6TA 5C4ZA 1FGUA 4JYAL 4C56C 1CNEA 4LF5L 2C4UA 1TVCA 5M9OA 1KLGD 1I3QH 2R92G 4QIWB 3J7YW 4JI6L 3RZOH 4BY7B 2WKCA 3QOLA 1SMYD 4IOAA 3CPFA 2EPBA 1U0LA 1N8RD 1NY4A 1MJEA 5LMUL 3F2UA 2JE6I 1UE7A 2DGYA 2YU9H 2B2UC 3OMCA 4HJ8A 4DR4Q 1EZ6A 2NZOA 4C2MB 1FNVA 2HT1A 1EFUA 3RUZA 2WACA 1E1RA 1LT3D 1II3A 1UWVA 2X6XA 4JI7Q 3S1RH 1TS3A 4FF3A 3ZZTA 4XYQA 4HMIA 3KK7A 1MBYA 2C5BA 1SNMA 3BQJA 4A4IA 4A3DG 1ZYRD 2EDGA 2RHSB 5I4DA 5JVG3 1HUNA 2ZZGA 2PYKA 2B63H 1U4MA 1X65A 3RNUA 3K0YA 2N8NA 3NTIA 4TMVA 1WTOA 4LF7L 2PNHA 1MD2D 1E3XA 5IYBH 1HTPA 1EIHA 1B2TA 4EQPA 4FO2A 1VQ9A 4B47A 1Z9FA 4HTHA 4XLFA 4X65Q 1RTNA 2ID0A 1C7YA 2HIVA 4GN5A 1TVXA 1WU8A 1TS4A 2ZTCA 3KYHC 3NPPA 5JEAG 4A3KH 4BBSH 1C0AA 1WOSA 3ER0A 3CXCB 4M0LA 3CCVA 2HMAA 3S1MB 4M4SA 5F4OA 4M2LA 5JJKA 4HMJA 2K4KA 1IBMQ 3GVLA 2FXQA 4B44A 4JCVE 1T5EA 5IWAQ 4KY6A 1EFWA 1L2FA 2B5OA 1LTRD 1YI2B 1SR3A 3P20A 4B3FX 3PO3G 3OZWA 2BH8A 4DR2Q 1SYBA 1QX4A 4WORA 2PW7A 2PZWA 4X07A 5ELBA 2VXWA 3PUVA 4GNXB 3C2QA 4DR1Q 1EFTA 1GAQA 1F77A 1HNWL 3DEOA 2D3LA 4IFDH 2B8GA 4X62L 1A3UA 1OXVA 5CMDA 4FNFA 4YAOA 3VA5A 4RCYA 1AE3A 2I5MX 2JJQA 1UD5A 1DOKA 4HIDA 1C48A 1EQTA 3LWEA 1JC7A 1EU4A 1YHAA 5GV8A 4IURA 2ES2A 1E2WA 1A2UA 4NNJA 5IYCG 2NVTH 1ZM4A 3BG3A 3JQQA 4G7WA 1Z47A 1I4QA 3OTOL 3W1BA 4TMXA 3I56A 5LMNL 4N8X1 4TSSA 3S16B 5CV8A 1F9SA 1TWCH 4TQUS 3I70A 2C35B 2V4DA 2LMCB 3HOXG 4IALA 3PV0A 1B44D 1Q12A 5I6YA 3KEWA 2V7VA 3QSYA 3B8HA 2GPJA 1NSNS 1YNJD 4A3JH 1LUZA 4N8FA 2LKVA 4B3SQ 3CTAA 3C3LA 4DN4M 5KNDA 1HZEA 4YY3L 4JV5L 3W5UA 2JEAI 2X0KA 1IXRA 4P3YA 4K14A 4B3RL 3CKIB 5ELCA 1EQRA 2Q6IA 1I6HB 1BCPB 1PDQA 1A6XA 2YWFA 4IPGA 1K8GA 2B2YC 1I4HA 1EY8A 3ASRA 4BBRG 1KD1D 2NN6H 4UY8C 2MJ8A 1QVFB 3HRZC 1KK2A 4G5GA 1TS2A 5GAGC 4WJWA 3D8GA 1JR0D 2VNIA 3QFSA 4A3MH 2Q2HA 2RVLA 2RDHA 4XOPA 4K6DA 4A3CG 1B53A 3LWUA 4RLZA 3BVMA 3MAQA 5IT9E 1G51A 5BR8L 1WTVA 1K73D 1Q8KA 4IOCA 2KHIA 3R8BA 3CCQA 4Z4WA 1TWAB 1XNQL 1XMOQ 4LF6L 1KRSA 4GN3B 5C4JH 2O4XA 4FXDA 5THXA 4ACAA 1UEAB 1L1OC 1N32L 4OP7A 4K1XA 4RGMA 2OT2A 2HHHL 2UXDL 4X6AH 3ONYA 2BM0A 4YCUA 3BH4A 5IIFA 1Y1WG 3IRBA 1WSRA 4NPSA 2WKDA 1GOZA 1D5XC 3ITPA 5M5YB 5IYNA 2AWOA 2UUAL 1OHHA 5A35A 5KYLA 2PZTA 1NTGA 4A3IG 1DDGA 1EYAA 5IYQA 1B70B 2JA6G 3E20A 3L2PA 1KDCA 5J22A 4DK0A 4RMFA 3T13A 4X65L 2BMWA 1EQQA 1FNUA 4X7DA 2L5TA 3RZDH 3LQ6A 1N08A 2QN6A 2E2JH 4CDCC 1TWHH 1EY7A 2M00A 1QNUA 3CRKC 4XOTA 3OEHA 1KXLA 1I6VC 5C3EB 2Q2UA 3KF8A 1DOLA 3HOVB 1KNEA 2B7BA 1JOQA 3HP3A 5C0XG 4G7HC 1LT6D 2A1AA 4A3EB 1O7YA 1VQ9B 3S1NB 5M3FG 1CSPA 4NKLA 1FD7D 3T56B 3LQEA 1AEXA 5BSXA 1LTBD 2F0VA 3CW2C 4JI2Q 3M3YB 4AH6A 3ZUGA 3GVJA 5HZAA 3CCVB 3D31A 3BDLA 3EA6A 2B2TA 2E2IH 2BM1A 1G7SA 4C43A 1IKMA 4G1VA 2PIAA 1WCMG 3PIPA 4DR1L 2B2UA 1F2ZA 5IYDH 4FDBA 3OKXA 3R2IA 1UAPA 1CZWA 1WVLA 4PAAA 2X6WA 4X7CA 2VBVA 4YAFA 5CV4A 1IW7D 1FNWA 1B8AA 2CBXA 1STEA 2B8FA 2V7XA 4FN5A 5HZBA 4O2DA 5IT9c 5K5PA 2OYNA 2IPKD 5J39A 2F43A 4AYBG 3GQBA 2VUMH 4ZCLA 1MSHA 2CC2A 1EWIA 2A74C 1WTPA 2N3SA 2D74A 4K6LA 4DV6Q 3S14B 3FDTA 1BR9A 3PO2H 4DA2A 1PFMA 1XE1A 3KJPA 2R93G 3K7UC 3HOUH 4X3KA 2BV3A 4TKOB 4KTAA 2BGJA 4BY1B 4UAJA 5KSWB 2ATWA 1KNAA 2XRSD 3I56B 1EEFD 4FP5D 5J35A 5JPNC 3TEHB 1LTTD 1S5DD 1TY2A 3W5VA 3K5NA 3BY1A 3PVDA 3SE0A 4WQMA 1E43A 3C1FA 3FPUB 2NUCA 1CQVA 1GUNA 2V7WA 4LNQA 2OQ0A 1Y0YA 2RC5A 1JB3A 1NJID 3QFCA 1AMOA 1HHVA 1LT4D 2GQFA 2EE1A 2JSOA 3H6MA 4IPHA 2JXMB 2BDOA 1V1PA 2E1BA 4XMYA 4C3IG 1Q8IA 5CV6A 2F0EA 1MI2A 3BDCA 1GHKA 1PFSA 4FVMA 1KJZA 4LBZA 3RY8A 1X55A 2BA0A 4AC9A 4NXNL 4F87A 1VQEA 1CT1D 1M8AA 1MGSA 1FGBD 4A3IH 4CGYB 4HR7B 3I4MB 2SDFA 4LBYA 1L0YB 4OWXB 4HN7A 4XT1B 4OX9L 4L63B 3S24A 1UD3A 5D65A 3EIVA 3TZUA 3CCQB 2WR8A 2NVXH 1ZEQX 3K58A 2WB1B 1X9NA 2F0LA 4P25A 1TS5A 3JAMc 4Z4VA 3G6EA 1PJ5A 1PRTB 1SROA 2FMCA 2Z6KC 3MWYW 1BCPC 2UUCQ 4E6IA 3P26A 3T1YQ 1TY0A 4GOPA 2P3MA 3HOZG 3CCMA 1H9SB 4QQBX 3L9AX 2IX0A 2JN9A 1NB9A 1BBWA 4JC0A 3J81c 2HCIA 3AU7A 1EP1B 4A3BG 4XORA 1GKHA 3TQYA 5KW9A 3MFGA 4K2LA 2AKWB 1E3ZA 5FJ8G 2HQEA 2ZXHA 2OBTA 2A6ED 2EYMA 5IT9L 2NV4A 2PLFA 1GJRA 2DUDA 1TWFB 1EXMA 3OPOA 1SEBD 2BF4A 4PC6A 5TY0A 4DV2Q 4A3FB 1WFQA 1RCVD 3GV3A 1HNZQ 1EIGA 3OWFA 1JB7A 2DOGA 4B3TQ 3SXHA 1B9NA 4XKWA 1WTHD 2MGSA 4R9WA 2K28A 3W2GA 4LAAA 2MQHA 2PNRC 3FKIG 5T1GA 5DAUA 2F0JA 4TRDA 1SYDA 3U9SA 3G05A 3W2DA 4WZEA 1L1OA 2ZTEA 3CC7A 2KEDA 4M8AA 5C44B 4ULLA 2E8GA 4ACBA 1RD9D 1EY0A 2E75C 2Q8IB 3ZC3A 2R93H 4R4OA 1B7YB 2NZHA 4HJ5A 2YTXA 1GM5A 1MRZA 5DM73 3T1HL 5DNFA 4RGNA 2K01A 2ALYB 2D2CC 1G291 5IK2A 1XTDA 1JWSD 5E3FA 5FK9C 4A3GH 3GDEA 1EY5A 4ZGQB 3I3CA 5A8AA 4RG1A 5FLMG 3J7AF 2QDXA 3CQZH 1J9OA 4P71A 4NMZA 2V7UA 3U50C 1NB0A 2R92B 4ZK9B 1XNRQ 3K7AH 3H15A 3I4LA 3E3XA 4KLKA 3KJOA 1FDRA 1CNFA 1D1IA 4LBWA 4A76A 4NW2A 1Y8OB 2ICIA 3G7LA 2MUYA 2RF4A 1GAWA 4ALPA 4CJ1B 2QA4A 2QW7A 1KC8D 1JMCA 2ZJQA 4Z4TA 2R3ZA 1D8TA 1Q81C 4GKKL 3LO8A 4RHRA 2N49A 3DUZA 3CW2A 3GTLH 1KZLA 1UNSA 3F8TA 1BJKA 2I1LA 4LFCQ 1KK0A 3V2TA 1SNQA 1E1QA 1RJTA 3S16H 3CP8A 5JJIA 5GAHC 5I6WA 1DD2A 4R4QA 3SKBA 2A68C 4JYAQ 3SEBA 1W34A 4LF5Q 1CKMA 3JAML 1WYDA 1U4LA 4NXML 3BC9A 2EYOA 4JI6Q 4X66L 1BO0A 4DFAA 4AQYL 1JOKA 3FMCA 3B78A 4F7DA 5LMUQ 2F0WA 1B3AA 1B9MA 1Q1BA 4RKBA 5LHY1 3J81L 1I6HH 2RCNA 1I94L 4GN4B 4P73A 1QZHA 1WDTA 3S2DB 1V1PB 2LFNA 2KHJA 1PTOB 1KTKA 5JOBA 1OXSC 2ZZFA 3BCDA 1BVSA 1YJWA 1BUVT 1PYSB 5FL7A 4L6TB 3GTPB 2MHVA 1X54A 3PMFA 2RC6A 1BDOA 1I4RA 3PO3B 1RHPA 2CW5A 4XKVA 4F8MA 3E9HA 5FJ8H 4NB3A 2A6HC 2DNCA 1GUSA 3G48A 4UZFA 5EMNA 4LF7Q 1WP6A 1HXYD 4K0KL 1GO2A 2XNJA 5AN9A 1EY9A 2KQ3A 1FYCA 3AFQA 3OHXC 1NUCA 1WD1A 1OB0A 2QDBA 2BGIA 3DM3A 1SRUA 2F1LA 4OONA 3OSOA 3DWPA 2KVMA 1TWAH 1XPRA 4C3HH 3H9NA 4YXWA 3SGIA 1AW7A 5FO9B 2XZPA 1XYIA 4DUYL 3GD7A 3ULJA 3GTKH 1FVIA 5FNZA 3V05A 5LL6X 5CV5A 3H0GH 2IHFA 1PLFA 4P26A 1TLLA 1LACA 2EJGC 3MEFA 3G6EB 4N3NA 3TS2A 2B63G 3QR8A 3CF5A 2CKZB 4ME3A 3BNWA 1N05A 2B29A 4GOPB 1G6PA 5IYBG 2YWEA 3CCMB 4QUFA 5ELEA 4DPGA 1QNKA 1G2SA 1NR2A 1W3SA 1CA5A 2CQOA 3GTJB 3HOXB 4S3SA 4DV2L 3K57A 4BBSG 4KHPL 3X3MA 4A3KG 1PKVA 1LLRD 2PE3A 3AGQA 4M53A 4CKBA 1HNWQ 1KRTA 2YV5A 4C1NK 3CESA 2HDMA 2NVYB 4IUVA 2WYRA 4X62Q 2J7ZA 2CCZA 1QFYA 2NBFA 2KENA 2JJ2A 1H42A 2FFKB 2OF1A 2E76C 2PQEA 2XVSA 2N88A 3T16A 2EY6A 1M1KD 4JOIC 1QG7A 4MN3A 4BBRB 5C0XI 1XXGA 4LF4Q 1CK1A 2ZXOA 4A93H 3J7ZC 2PQAA 2MO1A 2PMDA 3P75A 1VQ6A 4GKJQ 1JNYA 4RDJA 1PRTC 1WOCA 2B2WC 3QFTA 4OOSA 3TP5A 3S1NH 4KD3A 2D5DA 2M5SA 4BPRA 3CC7B 1VQ7A 1L1OB 2Z6KA 3BS1A 4II3A 4JI1L 3GSIA 1ILQA 2WAQG 4IFDG 1SMXA 3I90A 1AP0A 1S5BD 5D3IB 5M3MH 1Q86C 2Z8LA 1U4RA 3A3BA 4PZ6A 5M5WB 3FP9A 4K8IA 4JV5Q 3ZBUA 2V7QA 1G7CA 3PUXA 2X85A 2WPDA 1L0XB 4B3RQ 3JQRA 4KJOA 1PVOA 4FXUA 3OFNA 4HAEA 3GV6A 2RBMA 1I50H 1RTOA 1N0UA 3CRZA 4XONA 3C2PA 4ROXA 1HR0L 4XNFA 4DV3L 1Y1WB 3J7AV 4HJ7A 3EQLC 1RL2A 4XQQA 3GTQB 2GREA 3EVQA 1S5ED 3O13A 1ICFB 4A3JG 4DAVA 1K8MA 3E9IA 2JYOA 3CCSA 2OWOA 3GTOB 1AZQA 2QA4B 1A3TA 2Z0SA 3N52A 3PA1A 5BR8Q 4MYUA 4RGTA 1X32A 3PIOA 4R8NA 3Q8DA 3S15B 1XB2A 3PSIA 4O42A 5B6IA 1G6ZA 1XNQQ 4H9GA 4KJNA 4DU9A 4H13C 4CDDC 1R5OA 5H1SE 2WFWA 2B2TC 2NN6G 5IP9H 4LF6Q 3JAMi 1QUEA 5F4JA 1PZJD 2F0SA 4DXGA 4QF4A 5C5LA 3PENA 1N32Q 1SYCA 1VQCA 3WNCA 1YHBA 3G6JB 3GTGB 2UXCL 2HHHQ 2UXDQ 1ZUNB 2JIZA 2RKSA 5KNBA 4A3MG 1WTWA 2ZZEA 4DAMA 3D4DA 3CC2B 5M3FB 3K5OA 3J81i 2E2DC 2AMCB 1ET6A 4FF1A 2CW0D 2H1EA 3KL9A 1GO3E 3NWTA 1KDAA 3C46A 3HOWH 2NPFA 1I8DA 5IGGA 2UUAQ 2E5LQ 2AUJD 4JI5Q 2F0DA 3AVTA 2YTVA 3STBC 3WY9A 2R7DA 2DY1A 1BCPD 4ODGA 3TP8A 4R8IA 5ISRA 1AIPA 1N07A 1WCMB 3EFXD 2B3GA 2WZNA 3A55A 4MIUA 2I0QA 3OE7A 1X3QA 1YJWB 4XM3A 3SHLA 1YITB 4DNTB 3NEMA 1YJ9A 1N9WA 4C3JH 2X53S 3U4VA 1Q7YC 2C5HA 3WNDA 1AZPA 2I5HA 1UE5A 1ICWA 2N55A 4XIGS 4U673 1EZ8A 4R4TA 2DY7A 2OEOA 4KV6A 4NP5A 3BCFA 3FPKA 4ZKBB 1J5EL 1I4GA 3VR3A 5FO1A 2H4OA 4AYBB 3D4RA 3VDYA 3G71A 2CF4A 2CHBD 3CHBD 3TBIB 3OAAA 2F0MA 4UDUC 2BSAA 2CNDA 1QFJA 1QJOA 5F2DA 2RCFA 1JOOA 2V1CC 3CP2A 4F88A 1HFGA 4PV1C 5BN4A 3ONUA 1SE2A 1W2BA 1B50A 4JMQA 2QILA 4ZV4A 1PYWD 2MPMA 2QEJC 3AVVA 3KLSX 3QG1A 2VQEL 1WOOA 1VQGA 1YJNA 4V190 1BMFA 1PTOC 2DNEA 2ZJPA 3W2IA 1GR1A 4PNYA 3C1EA 1GUWA 2F4VL 3FKSA 5M5XB 2KJXA 1YNXA 1VQHA 4KD4A 4TVAB 1UE6A 4RGOS 5I2YA 5E7NA 4YEJA 4OWWB 4EQNA 4LF4L 3M4OH 1ENAA 2HDNB 5D3DA 4FXKC 3SLNA 2R7ZH 4IUUA 4CKEA 1TKWB 5IYDG 1H8EA 2C4TA 4A3FH 1KMHA 1DG1G 2LXJA 2PI2A 2C9OA 2BE5C 2F0KA 4UHVA 3Q6RA 2Y0SB 4IO9A 4EGVA 1TU2B 1EOTA 1I4PA 5EKIA 4TN1A 1HVXA 1VQ6B 2PQAB 5A2QE 3D3RA 5I2XA 1HUMA 2VNHA 3A54A 4QMGA 1VQOA 1LTLA 5HXBA 4OPOA 4Y9RA 1VQ7B 2L12A 5JJZA 5C44H 3EROA 4GOPC 2VUMG 2Q2IA 2LY7A 4O1NA 1KABA 4OEMB 5A89A 1Q81D 2B2VA 5FO8B 3MXGA 3EBEA 1K83B 2CFMA 1G8ZD 4PMCA 3PO2G 2R61A 1SYGA 4PABA 3W2FA 5K36H 4KMUC 1UD2A 3MFYA 1EUJA 1FR3A 2A68D 3HOUG 2RQXA 3UDIA 2QCPX 1E62A 3QB3A 4L5QA 1UUPA 3PIO3 1E22A 3NTKA 1EYDA 3NSWA 1SE4A 5CBEE 3S1QB 4NXNQ 3HOZB 1P8LA 3OOCA 2EXZA 2R6HA 1Q82D 2VQFL 3BZDB 2A69C 4ZKCB 4XTCS 4JOIA 5GV7A 2PMZB 4A3BB 2Q6LA 1MHWC 4LUOA 2L0CA 3QOJA 4TMWA 2GJPA 4PZ8A 1LT5D 4OX9Q 2B2WA 3CCSB 3HZXA 3S17H 5IOCA 4PC1A 1D5ZC 3W2HA 3HKZE 4XYOA 5IYPA 1S5CD 4FF2A 1D2EA 1H9SA 2QEXA 1OGIA 3EN2A 1IHZA 1PA6A 1PH4A 1X3PA 3D4WA 1CM9A 4YAUA 2CWPA 2EIFA 2F52A 2KCCA 4LUVA 5DM63 4XLCA 1FRQA 1JA1A 3JQPA 4OGQC 1V5VA 3I4NB 2FHTA 2XZLA 4P75A 4JI5L 1BX0A 5G3LF 4R4IA 2E5LL 2NVQH 3GTMH 3J80L 4EQOA 3A8JA 1A0IA 1YZ6A 4Z4YA 3HEJA 2J4XA 5E1FA 3BJUA 1IYVA 3H3VI 4G6IA 2VNUD 1TWGB 2SNSA 4Y9UA 2CWAA 2XN9C 3OZUA 3ULLA 3CB4A 3PF5A 2HCJB 4POFA 3CC4A 4B08A 3ZZUA 4QVAA 5FA6A 1IKLA 4TMZA 2CVRA 1VQPA 3A8IE 1CA6A 3GTPH 4OO1H 1HFNA 5FOBB 4QIWE 2GJRA 1YJ9B 1K28A 1SAPA 2IHEA 5TSSA 4RPBA 1VQKA 1ILPA 1EP3B 1Z7TA 1BNZA 3CMAA 2F3VA 2O2LD 2VB3X 4EVOA 1D2BA 3OMGA 4RJLA 3A8KA 3TZDA 3HOYH 1PYBA 2EOTA 1Y8PB 4YWLA 3G71B 4FK8A 3DWAA 3RD4A 5L46A 3OJWA 5AFWA 1B1ZA 4QY7A 1LO5D 1Y8NB 3R2TA 1W9XA 2XSCA 4OXPA 5CV9A 4P2CB 5H59A 1W2BB 1HPCA 3T1HQ 1QUFA 2QGQA 1PRTD 4PZ7A 2F0QA 2SEBD 2K04A 4Y7NH 1NRKA 4OPVA 1UD4A 1YJNB 5DEHA 2V31A 2ZBVA 2M9VA 3NXWA 4DV5L 4FXGC 3QO2A 4GS3A 4F7XA 1IZ6A 1A15A 4RD0A 5CR3A 2NTTA 5BSYA 1A8VA 2JA8B 5FKAC 2ZTDA 2FVGA 3AB9A 4P6VF 1TTTA 4X3SA 3R93A 2F0OA 3JAME 1BF4A 1XWEA 1DARA 1ZKOA 1QB5D 1VCIA 1E0BA 4U9UA 1STAA 1SFOH 2G5DA 2ZXRA 4JBWA 1YHQA 3IAYA 3F2CA 3S2HH 4RM0A 4A3GG 4GKKQ 1PH9A 2GK7A 4LWCA 3J81E 2E1RA 5C4XH 4OHJA 1FX0A 2O5IC 1CUKA 1I3QB 3TMEA 1GVPA 4IQZA 1G91A 1EY6A 3I91A 4IFDI 1VQOB 4KKUA 4Q7JB 1CQFA 2Q8RE 2AQ3B 2VZAA 2GK6A 4XLAA 4IN3A 3SLDA 4A3LH 4DUZL 5DSZA 5IGEA 1D1NA 2WSSA 4NXMQ 2JA7B 3DHQA 1PH3A 1A63A 4X66Q 2LSSA 1XJVA 1VQ5A 4AQYQ 2YWHA 4QGUA 1H9RA 4P6YA 1YEZA 2K52A 4DQKA 4B3XA 3CU7A 3NK9A 4G57A 2X8KA 5JBQA 2JA5B 3K0XA 3CCRA 3TS0A 4QL5A 2Q8TA 3RLOA 1COWA 2KVOA 2KCMA 1I94Q 2JJ1A 3K8AA 5JJLA 1G7RA 4DXFA 2F3WA 2ZL5A 4IUTA 5LMNW 3ULPA 1Z6HA 2IT1A 2B63B 1DZ1A 4M1KA 2DETA 4DNIA 1DJRD 3I7FA 3KLRA 1D8LA 5T1IA 3OZVA 4TSFA 4IJLA 1KK1A 5HY6A 1RIPA 1Y1VB 2K5VA 2Y0SE 1VQ4A 1RKNA 2ZTGA 3P27A 1MKHA 2UUBL 2F0NA 3AQQA 5ELNA 4XR6A 4A75A 1R5NA 4DR5Q 1W0KA 2KCNA 2LXKA 4BBSB 3BU2A 4K0KQ 1SMYC 4J15A 4A3KB 3M7GA 1B4OA 1N8RC 3W3AA 1EIFA 1RODA 1UMKA 2OBSA 4Z4ZA 3A74A 4DR7L 4BA1I 3PF4A 1KTVA 4BY7H 2NN6I 2QEXB 2XWJB 1Q7YD 4DUYQ 1GUOA 1QOHA 2OQKA 1R9TB 3P1HA 1LM0A 4O0AA 4I65A 2F0HA 2D3NA 1IJEA 3I8ZA 3OJXA 3MC0B 3KFUA 2K5WA 4C2MH 4HIOA 3LVBA 3HKSA 1ZYRC 4QJFA 3NTHA 2LS01 1WTQA 4B48A 1IL8A 1X3FA 3ND8A 2B39A 1WD0A 4LBVA 3B6YA 1U2RA 2RSOA 3ASQA 2EFGA 1MJCA 4R71A 4H0LC 2C2WA 2DJGC 1LTAD 4KHPQ 2PMZE 4C3HG 2UXBL 1N34L 3W2EA 3CC4B 1VS0A 1GUGA 5IGBA 3FHWA 5CORA 3PIP3 1RQRA 1BBUA 3IFTA 3DM1A 3H0GG 4J1MA 1NAPA 1N33L 1NBWA 1PH7A 1VQPB 2DIEA 3MHBA 3SK5A 1WORA 1IHMA 5AJ3L 1TIID 3R6JA 4DAPA 5EBDA 4OOXA 2NVTB 1S5FD 2VL6A 1CHQD 2JQOA 4NDXA 5J1ZA 1VQKB 3VO2A 1H8HA 3DLLA 3CMAB 3S1MH 2SNMA 3N6RA 4BXXH 1O80A 2PO4A 1E64A 1WPCA 3CCJA 4JI4L 4L5TA 2Z1CA 1GJXA 1PZID 4EQ5A 2K14A 3TDQA 2Z4IA 3L0OA 4JI1Q 1IBKL 1A3VA 3MXNA 2BE5D 4OOVA 1NE3A 2K75A 1XPUA 4RH6A 4X64L 1Y69U 1HZAA 1K3RA 5A88A 2NTSA 1JT8A 1T6YA 4LF9L 4RDLA 3OW2A 1PJ6A 1Y0RA 1OO9B 3ASSA 2GN5A 2YTYA 3VR5A 2H5XA 1SM4A 4A93G 3GP7A 2AQ1B 4PC2A 1E1OA 4JI0Q 3MHPA 4XN0A 2XTIA 4LUZA 4MTNA 5EPJA 4Q5VA 1SNOA 4YHBA 4KKTA 1BQEA 3AVYA 4KKSA 3OIQA 2XGJA 4ZGNB 1HR0Q 3BYYB 4DV3Q 1HA6A 4PMBA 3H94A 1O7LA 1YX2A 3UI2A 2XNCA 3PUMA 4QUZA 5H5JA 5M3MG 1ESFA 4A3DB 2ZXIA 2BCOA 2KUMA 3E0EA 3OEEA 1CSQA 3RMHA 1YNJC 1LTSD 2D9RA 1UEBA 2OBRA 1YHQB 3SEJA 2EY5A 4KN4C 5C4JB 3Q0AA 4MHEA 3SDZA 1QGAA 3CC2A 1EQVA 5E4XA 1V9PA 3TSSA 4XQJA 2A69D 3NWSA 2X6LA 3DWQA 3D26A 4GKJL 1CTMA 4LJZC 1KD1C 2C77A 4RKLA 4ME5A 1VDZA 1NBMA 4AVZA 1PFBA 4RD1A 3A5UA 2W6IA 5CV7A 2UXCQ 2J7KA 1D7QA 5JVH3 4QHYA 1B2RA 1HCZA 4KN7C 3RLNA 3IL8A 2X69A 3M9BA 2L11A 3NQIA 1VQ5B 3H09A 5EKLA 1YITA 1N06A 2FINB 1VQJA 4NBSA 3CCRB 5JEAJ 2R6GA 4TMTA 1IYJB 4YALA 2F0GA 1K73C 3H3VC 1VQLA 3KDFA 4DR5L 5IP9G 3RZDB 2BH2A 3E0JA 4GLVB 4X3TA 4DV7L 2Z6BA 4P22A 2E2JB 1ENCA 5IYRA 3KBGA 2G9HD 1JJ2A 3VYRA 1D6EC 2PI2E 4B43A 3CD6A 3S1QH 3Q22A 1FNBA 1JQYD 2HDLA 2ZZQA 5KNCA 1VQ4B 3A0JA 1BPLA 1BBXC 2TSSA 1DYQA 3PCOB 4YHHL 3ZBTA 3HS0C 1UD6A 4UP7A 3NBHA 5KEEA 1FNCA 4ABNA 3HOWG 5CBAE 3MTSA
chains in the Genus database with same CATH topology
2BOSA 1NR4A 2ICEC 1E2VA 1M4VA 2E2IB 2B2VC 4JK1C 2YYZA 1STNA 1UD8A 4GQNA 4M1UB 4C3JG 3QIAA 4HSVA 1EY4A 2TMPA 1E2ZA 1R4QB 3MZ5A 2VUMB 3VR6A 3FEWX 4CJ2C 3DDYA 4XXEA 1DOMA 3BYTB 5COYA 2EYJA 2WP8J 2ENBA 3PO2B 2K7VA 4IUPA 1F9RA 2X6GA 4HSPA 4ZLTF 4E0FA 2J0TD 3QJYA 2G9DA 4RCOA 1V0FA 4N9PA 2F0PA 1LABA 1IW7C 3A8JE 3U9OA 1H9JA 4DGZA 3JU4A 1W6KA 3NP8A 1EU3A 2GA4B 3T53B 1STBA 1VF5C 1ONLA 2KOLA 2IL8A 4N9TA 4A3IB 3LNNA 2QF7A 4J6HA 2JA6B 1VMCA 4FF4A 1PMRA 2XZOA 3BVGA 1HQRD 3HAGA 1STGA 4KHVA 4XLHA 5K36G 4G4KA 1HRJA 2F0TA 1W6JA 3K59A 4ILWA 1E79A 4H44C 3DMUA 2ZT9C 1SNPA 4Z9CB 1VF7A 4YIJA 4CHTB 2VB2X 1BXTA 1MSGA 4ZAIA 3KUPA 2L4NA 3A7LA 3VR4A 5C0XJ 1SXTA 1KLUD 1O7ZA 4DNRB 5NUCA 5KGUA 4XL9A 2LZJA 2XNDA 2IWHA 2EYHA 3FPPA 1U9RA 3TP6A 4IUQA 4FYDA 1I18A 1STHA 2OXPA 4RAUC 2WINB 4OIKA 2F1MA 1R4PB 3IFDA 4KHZA 4GZYC 1D5MC 1EFRA 5IGCA 2R93B 4XQNA 1A2TA 1JWMD 4OO1G 2A6EC 4G7XA 4V0BA 3ERQA 2NYZD 4ASUA 5HKKA 1C8CA 4A3GB 3H91A 4Q0FA 3CQZB 1SNCA 2RDGA 4XLEA 2AQ2B 2D62A 3K7AB 4I7ZC 2EZVA 2KECA 3MXPA 1WTRA 4C3IB 4PQXA 2A73B 4HEDA 2NZ1D 4UZUA 3I72A 1AN8A 3GTLB 1KDBA 1YNNC 2ZTNA 1SNDA 4B3GA 2R9VA 1EWCA 3VR2A 5LL6S 2AWNA 1PXUA 4RCNA 2PPBC 2K33A 1WTXA 1EEID 4ZUJA 3PUYA 2XIWA 1DONA 3WOEA 1SBBB 2F0UA 1PZKD 2XNAC 2E2HB 3HG9A 4DAYA 1KAAA 3M7NA 5C5MA 1H9MA 2EY1A 2SOBA 2JDIA 3T4AC 1TR5A 1JCKB 5IGDA 2EJFC 4CBVA 3K5MA 4PMWA 3ZPNA 3PUWA 2IW3A 5EGTA 1EFID 1K8OA 1W0JA 3TP7A 2EVBA 4H7BA 5EPLA 2ZXPA 2EYLA 2A6HD 1VLYA 5CYUA 1JORA 4C3HB 4KK7A 3S9WA 5JPMC 3I73A 3GTKB 3H0GB 1JE4A 3FKIB 5JEAH 3P7JA 1SE3A 5FLXL 1QCBD 4K5VA 4RHSA 3OW7A 3WOFA 2HLDA 1OXUA 2KA7A 1PTOH 3MEHA 1ET9A 5I9OA 3BDOA 1F2MA 1CHPD 3A56A 1IYUA 1MABA 1TT2A 4J8QA 4ZYSA 3L3OC 5BN5A 5HGTA 1BCPF 3HGBA 4CJ0B 1PFNA 3NUCA 4A93B 5EJWA 1VJSA 1V0EA 3EJIA 4BS9A 2QE7A 4DF7A 4HIZA 2CK3A 1SJED 1I4XA 1ENFA 2PW5A 1Q1EA 4UAIA 1RDPD 5M3MB 2WV6D 4ID6A 1GXDC 1Q3LA 4WRDA 2RSNA 1EL0A 1TQOA 4HCSA 1I50B 2DN8A 1LTGD 3SVMA 2BA1A 1CI3M 2XOKA 2F4IA 3ND9A 4QB4A 1V1OA 3SK8A 3URYA 1OXTA 2VJIA 4TT3A 2XWBB 3A7AB 2W6JA 5C6AA 3RZOB 1GUTA 5CC4A 2X6YA 1AFPA 4K8JA 4ZRZA 5FO7B 1K28D 5KNLA 1T5XD 2YU9B 3ZIAA 3KLSA 2L1BA 1GHJA 2AUKA 4OIJA 2EYPA 3S1RB 3Q24A 1DCZA 2IX3A 1NCVA 1F9PA 4G7ZC 3HOWB 4X3UA 2EY2A 4BA2I 2F0FA 4B9WA 4OL7A 1SYEA 5A2QL 2K5QA 3E5SA 3GVKA 5JAVA 3K5LA 1RF2D 4C3JB 4QUCA 5IODA 2K03A 1V43A 1JICA 2QKIC 2IX1A 2L55A 1LTID 2K32A 3GO5A 3SR1A 3SK4A 3X3NA 1SYFA 5C3WA 3AMUA 1CZGA 1J8IA 2CW0C 2CQAA 3NQTA 3NBIA 1EYCA 4HCEA 2D9UA 3DXJC 5C0XH 1S4ZA 2IJ0A 5DN6A 3K6OA 5ELDA 1LV9A 1G2TA 2WAQB 2B2YA 1BOSA 4ZUIA 4BWGB 5EPKA 1PTOD 2EYFA 4RWSC 2A5HA 3M4OB 1BLIA 5C3XA 4K5WA 4K2KA 3VYTA 2R7ZB 4C1NI 4IFDJ 5E4WC 1JWUD 1TWCB 2BDNA 1Q90A 2DY8A 2PCFB 1F2LA 3DEPA 3M4YA 4K5XA 4A3JB 3CMMA 4XN3A 4WFN3 1HQMC 1SKYB 1QE6A 4IUNA 2RA4A 4XT3B 4OO1I 5BN3A 2WJYA 4XD7A 4U68A 1YNND 2M2LA 1VMPA 2VJJA 4ZQ3A 1F9QA 2F0IA 4A3MB 5ELFA 3MA2B 5EKKA 1PRTF 5HURA 4L8JA 1QWYA 3T51B 5C4HA 3V96A 5EQ0A 1XTCD 3VA7A 3L7ZC 5CDFA 1ML0D 5I9PA 2WZPP 1CFMA 3ONAB 2Z4HA 1SDFA 3S17B 1STYA 2JP1A 4KI0A 2NWGA 3VYSA 3VYUA 2FJ2A 3Q6SA 4DK1A 3D6CA 3MXUA 3WQZA 2NVQB 3GTMB 1C4QA 4II2A 2MP1A 5D14A 3RLFA 1D1KA 3KBXA 4Z1MA 1TWHB 2JEBI 2PZUA 5EBCA 1U4PA 2I07B 2XRQD 2GJKA 2EJMA 1HA5A 3MVVA 2HCCA 2WJVA 1O78A 4RFBA 3HOYB 2FMMA 2WIIB 1ESRA 2KEEA 2KHSA 3A35A 1SJHD 4KY5A 1H9KA 3D6WA 3TN2A 4B9XA 4Y7NB 5KRUA 2L9HA 5CGKA 3M85A 4RA8A 1OXXK 3E6ZX 1ZXTA 4G7OC 5KYIA 3FVQA 3A3GA 3PUZA 1DM0B 1V8QA 1HTLD 3Q23A 3IKJA 3HOUB 3NHHA 3NE5B 1SFOB 2K1BA 2K5DA 1BQQT 1EWHA 2RDFA 3S2HB 2F03A 2Z6BD 4YELA 2NB0A 1PTOF 2K6AA 3ZYYX 2E74C 4LK1C 5C4XB 2C5CA 4LMQD 1XX8A 4KY7A 4XDXA 4IZ8A 2K05A 4CKCA 5IGFA 3HKZB 3WDNA 3SK6A 5KIXA 1F2YA 2O5JC 3R3OA 1DXMA 4QCLA 3OWEB 3QWNA 2I46A 3J80E 2HUGA 3FRPB 3LX0A 3A8KE 3OIPA 2NVXB 4XQFA 3BVZA 1SSOA 5FLXE 5G3LD 1QILA 3CRLC 5C4ZA 4C56C 5M9OA 1KLGD 4QIWB 3J7YW 4BY7B 2WKCA 3QOLA 1SMYD 2EPBA 3F2UA 2JE6I 2B2UC 3OMCA 1EZ6A 4C2MB 1FNVA 3RUZA 2WACA 1E1RA 1LT3D 1II3A 2X6XA 1TS3A 4FF3A 4XYQA 4HMIA 3KK7A 1MBYA 1SNMA 1ZYRD 2EDGA 5I4DA 5JVG3 1HUNA 2ZZGA 2PYKA 1U4MA 3K0YA 3NTIA 1WTOA 1MD2D 1E3XA 1HTPA 1EIHA 1B2TA 4EQPA 4FO2A 4HTHA 4XLFA 1RTNA 2ID0A 1TVXA 1TS4A 5JEAG 3NPPA 3S1MB 4HMJA 3GVLA 1T5EA 4KY6A 1LTRD 3P20A 4B3FX 1SYBA 4WORA 5ELBA 2PW7A 2PZWA 2VXWA 3PUVA 1F77A 3DEOA 2D3LA 4IFDH 2B8GA 1A3UA 1OXVA 5CMDA 4FNFA 3VA5A 1UD5A 1DOKA 1C48A 1EQTA 3LWEA 1JC7A 1EU4A 4IURA 1E2WA 4NNJA 1A2UA 3BG3A 4G7WA 1Z47A 1I4QA 4TSSA 3S16B 5CV8A 1F9SA 4TQUS 3I70A 2V4DA 2LMCB 4IALA 3PV0A 1B44D 1Q12A 5I6YA 3KEWA 1NSNS 1YNJD 2LKVA 3C3LA 4DN4M 5KNDA 1HZEA 2JEAI 4K14A 3CKIB 5ELCA 1I6HB 1BCPB 1PDQA 1A6XA 2B2YC 1I4HA 1EY8A 2NN6H 2MJ8A 3HRZC 1TS2A 4WJWA 3D8GA 1JR0D 2RVLA 2RDHA 4XOPA 4K6DA 1B53A 3LWUA 3BVMA 3MAQA 1WTVA 3R8BA 1TWAB 2O4XA 4FXDA 1UEAB 4RGMA 2OT2A 3BH4A 5IIFA 2WKDA 1GOZA 1D5XC 3ITPA 5M5YB 2AWOA 1OHHA 5A35A 5KYLA 2PZTA 1EYAA 1KDCA 5J22A 4DK0A 3T13A 1FNUA 2L5TA 1EY7A 2M00A 1QNUA 3CRKC 4XOTA 3OEHA 1I6VC 5C3EB 3KF8A 1DOLA 3HOVB 1KNEA 1JOQA 3HP3A 5C0XG 4G7HC 1LT6D 4A3EB 1O7YA 3S1NB 4NKLA 1FD7D 3T56B 1AEXA 1LTBD 2F0VA 3M3YB 3GVJA 3D31A 3BDLA 3EA6A 2B2TA 1IKMA 2B2UA 1F2ZA 3R2IA 1UAPA 1CZWA 1WVLA 2X6WA 5CV4A 1IW7D 1FNWA 1STEA 2B8FA 5K5PA 2IPKD 5J39A 2F43A 3GQBA 1MSHA 2A74C 1WTPA 4K6LA 3S14B 3FDTA 1BR9A 4DA2A 1PFMA 4X3KA 4TKOB 4KTAA 4BY1B 1KNAA 2XRSD 1EEFD 4FP5D 5JPNC 1LTTD 1S5DD 1TY2A 3K5NA 3SE0A 3FPUB 1E43A 3C1FA 2NUCA 1CQVA 1GUNA 1JB3A 1HHVA 1LT4D 2EE1A 2JSOA 3H6MA 2JXMB 2BDOA 1V1PA 2E1BA 4XMYA 4C3IG 1Q8IA 5CV6A 2F0EA 1MI2A 3BDCA 1GHKA 4FVMA 2BA0A 4F87A 1CT1D 1M8AA 1MGSA 1FGBD 4CGYB 4HR7B 3I4MB 2SDFA 1L0YB 4HN7A 4XT1B 4L63B 1UD3A 5D65A 3TZUA 1ZEQX 3K58A 2WB1B 2F0LA 1TS5A 1PRTB 2FMCA 3MWYW 1BCPC 4E6IA 1TY0A 1H9SB 3L9AX 2IX0A 2HCIA 3AU7A 4XORA 3MFGA 4K2LA 1E3ZA 2HQEA 2ZXHA 2A6ED 2EYMA 5IT9L 1TWFB 3OPOA 1SEBD 4A3FB 1RCVD 3GV3A 1EIGA 3OWFA 3SXHA 1B9NA 4XKWA 1WTHD 2MGSA 4R9WA 2K28A 4LAAA 2PNRC 5T1GA 5DAUA 2F0JA 4TRDA 1SYDA 3U9SA 3G05A 3W2DA 2KEDA 4M8AA 5C44B 4ULLA 1RD9D 1EY0A 2E75C 2Q8IB 5DM73 5DNFA 4RGNA 2K01A 2D2CC 1G291 5IK2A 1JWSD 5E3FA 5FK9C 1EY5A 3I3CA 3J7AF 1J9OA 2R92B 4NMZA 4ZK9B 3I4LA 1D1IA 4NW2A 1Y8OB 2ICIA 3G7LA 2MUYA 4CJ1B 2R3ZA 4RHRA 3DUZA 1KZLA 1UNSA 3V2TA 1SNQA 1E1QA 1RJTA 3CP8A 1DD2A 5I6WA 2A68C 3SEBA 3JAML 1U4LA 3BC9A 2EYOA 1BO0A 4DFAA 1JOKA 3FMCA 2F0WA 1B3AA 4RKBA 1B9MA 1Q1BA 5LHY1 3J81L 3S2DB 1V1PB 2LFNA 1PTOB 1KTKA 5JOBA 1OXSC 2ZZFA 3BCDA 1BUVT 5FL7A 4L6TB 3GTPB 2MHVA 3PMFA 1BDOA 1I4RA 3PO3B 1RHPA 4XKVA 4F8MA 2A6HC 2DNCA 1GUSA 1WP6A 1HXYD 1EY9A 2KQ3A 1FYCA 3OHXC 1NUCA 1WD1A 1OB0A 2QDBA 3OSOA 3DWPA 2KVMA 4YXWA 5FO9B 1AW7A 2XZPA 1XYIA 3GD7A 3V05A 5LL6X 5CV5A 1PLFA 2EJGC 1LACA 4QUFA 5ELEA 1CA5A 1QNKA 1G2SA 1NR2A 3GTJB 3HOXB 4S3SA 3K57A 3X3MA 1PKVA 1LLRD 4CKBA 4C1NK 3CESA 2HDMA 2NVYB 4IUVA 2J7ZA 2NBFA 2JJ2A 2FFKB 2OF1A 2E76C 2PQEA 2XVSA 2N88A 3T16A 2EY6A 1QG7A 4MN3A 4BBRB 5C0XI 1XXGA 1CK1A 2ZXOA 3P75A 1PRTC 2B2WC 3TP5A 4KD3A 2D5DA 2M5SA 3BS1A 4II3A 4IFDG 1ILQA 3I90A 1AP0A 1S5BD 5D3IB 2Z8LA 1U4RA 3A3BA 5M5WB 4K8IA 2V7QA 3PUXA 2X85A 2WPDA 1L0XB 4KJOA 4FXUA 3OFNA 4HAEA 3GV6A 2RBMA 1RTOA 4XONA 3C2PA 4XNFA 3J7AV 1Y1WB 3EQLC 4XQQA 3GTQB 3EVQA 1S5ED 3O13A 4DAVA 1K8MA 2JYOA 3GTOB 1AZQA 1A3TA 3N52A 4RGTA 1X32A 4R8NA 3S15B 4O42A 1G6ZA 4KJNA 4DU9A 4H13C 2B2TC 2NN6G 1PZJD 2F0SA 4DXGA 4QF4A 5C5LA 1SYCA 3G6JB 3GTGB 2JIZA 2RKSA 5KNBA 1WTWA 2ZZEA 3D4DA 5M3FB 3K5OA 2E2DC 1ET6A 4FF1A 2CW0D 2H1EA 3NWTA 1KDAA 3C46A 1I8DA 5IGGA 2AUJD 2F0DA 3TP8A 1BCPD 4R8IA 4ODGA 5ISRA 3EFXD 1WCMB 3A55A 4MIUA 3OE7A 1X3QA 4XM3A 3SHLA 4DNTB 2X53S 1AZPA 2N55A 4U673 1ICWA 4XIGS 1EZ8A 2DY7A 2OEOA 4KV6A 4NP5A 3BCFA 4ZKBB 1I4GA 3VR3A 2H4OA 4AYBB 3D4RA 2CHBD 3CHBD 3TBIB 3OAAA 2F0MA 4UDUC 1QJOA 5F2DA 1JOOA 3CP2A 4F88A 1HFGA 4PV1C 5BN4A 1SE2A 1B50A 4JMQA 2QILA 1PYWD 2MPMA 2QEJC 3KLSX 3QG1A 4V190 1BMFA 1PTOC 2DNEA 4PNYA 3C1EA 1GUWA 3FKSA 5M5XB 2KJXA 4KD4A 5I2YA 4RGOS 4YEJA 4EQNA 1ENAA 5D3DA 4FXKC 4IUUA 4CKEA 1TKWB 1H8EA 1KMHA 2C9OA 2BE5C 2F0KA 2Y0SB 4EGVA 1TU2B 1EOTA 1I4PA 5EKIA 5A2QE 1HVXA 3D3RA 5I2XA 1HUMA 3A54A 4QMGA 2L12A 5JJZA 3EROA 4O1NA 2LY7A 1KABA 2B2VA 5FO8B 3MXGA 1K83B 1G8ZD 4PMCA 2R61A 1SYGA 5K36H 4KMUC 1UD2A 3MFYA 1FR3A 2A68D 2RQXA 2QCPX 3QB3A 3PIO3 1UUPA 3NTKA 1EYDA 3NSWA 1SE4A 5CBEE 3S1QB 3HOZB 3OOCA 2EXZA 3BZDB 2A69C 4ZKCB 4XTCS 2PMZB 4A3BB 2L0CA 3QOJA 2GJPA 1LT5D 2B2WA 3HZXA 5IOCA 1D5ZC 4XYOA 1S5CD 4FF2A 1H9SA 1IHZA 1X3PA 3D4WA 1CM9A 2KCCA 5DM63 5IT9E 4XLCA 4OGQC 3I4NB 2FHTA 2XZLA 5G3LF 3J80L 4EQOA 3HEJA 2J4XA 5E1FA 1IYVA 4G6IA 2VNUD 1TWGB 2SNSA 2XN9C 4B08A 1IKLA 2CVRA 3A8IE 1CA6A 4OO1H 1HFNA 5FOBB 2GJRA 1SAPA 5TSSA 1ILPA 1Z7TA 1BNZA 2F3VA 2O2LD 2VB3X 4EVOA 1D2BA 3OMGA 3TZDA 2EOTA 1Y8PB 3DWAA 3RD4A 5AFWA 1B1ZA 1LO5D 1Y8NB 3R2TA 1W9XA 2XSCA 5CV9A 4P2CB 1HPCA 1PRTD 2F0QA 2SEBD 2K04A 1NRKA 1UD4A 5DEHA 2V31A 2M9VA 3NXWA 4FXGC 3QO2A 4F7XA 1A15A 5CR3A 2NTTA 2JA8B 5FKAC 3AB9A 4X3SA 3R93A 2F0OA 3JAME 1BF4A 1XWEA 1ZKOA 1QB5D 1VCIA 1E0BA 1STAA 2ZXRA 4JBWA 3IAYA 2GK7A 3J81E 4OHJA 1FX0A 2O5IC 1I3QB 3TMEA 4IQZA 1G91A 1EY6A 3I91A 4IFDI 4KKUA 1CQFA 2Q8RE 2AQ3B 2GK6A 4XLAA 4IN3A 5IGEA 2JA7B 2WSSA 3DHQA 1H9RA 3NK9A 4G57A 3CU7A 2X8KA 2JA5B 2Q8TA 1COWA 2KVOA 2JJ1A 4DXFA 2F3WA 4IUTA 1Z6HA 2IT1A 2B63B 1DZ1A 1DJRD 3KLRA 5T1IA 4TSFA 1Y1VB 1RKNA 2ZTGA 2F0NA 4XR6A 1W0KA 2KCNA 4BBSB 1SMYC 4A3KB 3M7GA 1B4OA 3W3AA 1RODA 4BA1I 2NN6I 2XWJB 1GUOA 1QOHA 1R9TB 3P1HA 4I65A 2F0HA 2D3NA 3I8ZA 3MC0B 2K5WA 1WTQA 1ZYRC 3NTHA 2LS01 1IL8A 3ND8A 2B39A 1WD0A 2RSOA 4H0LC 1LTAD 4C3HG 5IGBA 1GUGA 5CORA 3PIP3 3IFTA 3DM1A 4J1MA 1NAPA 2DIEA 3MHBA 3SK5A 1TIID 4DAPA 5EBDA 2NVTB 1S5FD 1CHQD 4NDXA 5J1ZA 1H8HA 2SNMA 3N6RA 1O80A 2PO4A 1WPCA 2Z1CA 1GJXA 1PZID 3TDQA 2Z4IA 1A3VA 3MXNA 2BE5D 4RH6A 1Y69U 2NTSA 1OO9B 3VR5A 3GP7A 2AQ1B 4XN0A 4Q5VA 5EPJA 1SNOA 4KKTA 3OIQA 4KKSA 2XGJA 3BYYB 1HA6A 4PMBA 3H94A 1O7LA 3UI2A 1ESFA 4A3DB 2ZXIA 2BCOA 2KUMA 3OEEA 3RMHA 1YNJC 1LTSD 2EY5A 4KN4C 5C4JB 3Q0AA 4MHEA 3SDZA 1EQVA 5E4XA 3TSSA 4XQJA 2A69D 3NWSA 2X6LA 3DWQA 1CTMA 4LJZC 4RKLA 4ME5A 1VDZA 1NBMA 4AVZA 1PFBA 2W6IA 5CV7A 5JVH3 1HCZA 4KN7C 3IL8A 2X69A 2L11A 3NQIA 3H09A 5EKLA 2FINB 5JEAJ 2R6GA 2F0GA 3H3VC 3RZDB 3E0JA 4X3TA 2E2JB 4P22A 1ENCA 3KBGA 2G9HD 3VYRA 1D6EC 3Q22A 1JQYD 2HDLA 2ZZQA 5KNCA 1BPLA 1BBXC 2TSSA 1DYQA 3HS0C 1UD6A 3NBHA 5KEEA 4ABNA 5CBAE 3MTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VR2 A;  4IFD H;  2B8G A;  2O5J C;  1DXM A;  4XIG S;  1Y8O B;  2L5T A;  4RCN A;  1E2V A;  2PPB C;  4HR7 B;  2K33 A;  1OXV A;  1GJX A;  3PUY A;  4H44 C;  3CRK C;  2O5I C;  2ZT9 C;  3VR3 A;  1H9S A;  1I6V C;  1VF7 A;  4IQZ A;  2JEB I;  3D4R A;  4JK1 C;  2YYZ A;  4KKU A;  5C0X G;  2KCC A;  4G7H C;  2BE5 D;  2D5D A;  4OGQ C;  3TZU A;  3M7N A;  2DN8 A;  1H9M A;  3A7L A;  1E2W A;  1Y69 U;  1QJO A;  3QIA A;  3A8K E;  2BA1 A;  1CI3 M;  3BG3 A;  3VR4 A;  4IFD G;  1DD2 A;  3ND9 A;  3T56 B;  4PV1 C;  5BN4 A;  2A68 C;  2EJF C;  4TQU S;  1H9R A;  4DNR B;  3VR5 A;  1IYV A;  2EJM A;  2V4D A;  2LMC B;  1E2Z A;  3D31 A;  3PUW A;  3CRL C;  3PV0 A;  3QG1 A;  1Q12 A;  2DNE A;  1Q90 A;  1OXT A;  3VR6 A;  3PUX A;  2PCF B;  3FMC A;  1K8O A;  1O78 A;  1H9S B;  3M4Y A;  1B9M A;  1Q1B A;  4KKT A;  1Z6H A;  2IT1 A;  3A7A B;  3FPP A;  4KKS A;  2EVB A;  5KND A;  1GUT A;  2JEA I;  3KLR A;  2K7V A;  3H94 A;  2JE6 I;  1IW7 D;  2A6H D;  1O7L A;  2B8F A;  3A8I E;  1HQM C;  1A6X A;  4OO1 H;  1OXS C;  2F1M A;  4KHZ A;  4GZY C;  3I73 A;  1YNJ C;  3EQL C;  3QJY A;  2A6E D;  1H9K A;  2NN6 H;  1BDO A;  1TKW B;  1SMY C;  1Z7T A;  1K8M A;  1GHJ A;  3OPO A;  1LAB A;  3W3A A;  2AUK A;  3GQB A;  4KN4 C;  3SDZ A;  1IW7 C;  2A6H C;  2DNC A;  5BN3 A;  1GUS A;  3A8J E;  2BE5 C;  5JEA H;  2A69 D;  3M85 A;  2EDG A;  1DCZ A;  1H9J A;  4BA1 I;  1FYC A;  1OXX K;  2NN6 I;  4G7Z C;  1TU2 B;  4OO1 G;  2A6E C;  1B9N A;  1CTM A;  4LJZ C;  4BA2 I;  3LWU A;  1GUO A;  3OW7 A;  1VDZ A;  1Y8P B;  4H13 C;  4G7O C;  2PNR C;  1OXU A;  2KA7 A;  2NN6 G;  1HTP A;  3PUZ A;  1V8Q A;  3BDO A;  3U9S A;  1HCZ A;  4KN7 C;  3T53 B;  4TKO B;  4L8J A;  3GD7 A;  1Y8N B;  1ZYR C;  3IKJ A;  3T51 B;  5JEA G;  2EJG C;  1HPC A;  1LAC A;  1ONL A;  1IYU A;  1VF5 C;  2D62 A;  3ND8 A;  4I7Z C;  5KNB A;  3NE5 B;  2E75 C;  2Q8I B;  3VA7 A;  1EWH A;  3L7Z C;  3SE0 A;  5BN5 A;  2R6G A;  1CFM A;  4H0L C;  1V43 A;  1GUN A;  5K36 H;  4KMU C;  3HGB A;  3LNN A;  2D2C C;  1G29 1;  2QF7 A;  3MFY A;  1FR3 A;  2A68 D;  2E74 C;  4KI0 A;  4LK1 C;  1T5E A;  2K32 A;  1GUG A;  1PMR A;  2AUJ D;  4DK1 A;  3IFT A;  3P20 A;  3MXU A;  5KNC A;  2AWO A;  2JXM B;  2BDO A;  3AB9 A;  5A35 A;  2CW0 C;  3I72 A;  3OOC A;  1YNN C;  1ZKO A;  1GHK A;  2A69 C;  3PUV A;  1VCI A;  4DNT B;  4XTC S;  3WDN A;  5K36 G;  3DXJ C;  2BA0 A;  3I4L A;  5C0X H;  1Q1E A;  4JBW A;  4DK0 A;  3N6R A;  2E76 C;  3RLF A; 
#chains in the Genus database with same CATH topology
 2BOS A;  1L0W A;  1J5E Q;  1NR4 A;  3ERS X;  5J3O A;  2ICE C;  1E2V A;  1M4V A;  2E2I B;  1U5K A;  1MIU A;  2B2V C;  4JI3 Q;  4P2N A;  3BY2 A;  1ZM2 A;  1OTC A;  4JK1 C;  4L5S A;  2YYZ A;  5M5Y H;  1STN A;  1UD8 A;  1E63 A;  3GIR A;  4GQN A;  4M1U B;  3I4N H;  4C3J G;  3F2B A;  3QIA A;  4HIM A;  2VQE Q;  2KCT A;  4HSV A;  1EY4 A;  2TMP A;  4LFA L;  3D0F A;  2F4V Q;  1E2Z A;  1R4Q B;  4UZE A;  3MZ5 A;  1CQX A;  2VUM B;  3VR6 A;  3FEW X;  4JI8 L;  4CJ2 C;  2WB1 E;  3DDY A;  4XXE A;  3M4Q A;  1DOM A;  3BYT B;  5C3E H;  2UU9 L;  1ZM9 A;  5COY A;  2EYJ A;  3HOV H;  2WP8 J;  2ENB A;  3PO2 B;  3OP1 A;  4A3E H;  4DV1 L;  2K7V A;  4IUP A;  1KRH A;  1F9R A;  2X6G A;  4LC0 A;  4LFB L;  3PA2 A;  1W35 A;  4HSP A;  4E0F A;  4ZLT F;  2J0T D;  3R6K A;  4R4C A;  1XMQ L;  3QJY A;  2G9D A;  2QGG A;  4RCO A;  3UDX A;  1R5B A;  2VNJ A;  3VNU A;  3M3Y H;  1V0F A;  4N9P A;  2F0P A;  1LAB A;  1K3B C;  3CCJ B;  4JW0 A;  1IW7 C;  3RN2 A;  3A8J E;  4C0S A;  3U9O A;  4YAW A;  1H9J A;  4DGZ A;  3Q39 A;  2HD3 A;  3JU4 A;  1VHE A;  4DR6 L;  1W6K A;  3SJZ A;  2R7Z G;  3NP8 A;  4MTK A;  1EU3 A;  4JI0 L;  3MXN B;  3B82 A;  1V1Q A;  2GA4 B;  4MZ9 A;  1T9H A;  4A3F G;  3T53 B;  1P4M A;  1STB A;  3OW2 B;  1VF5 C;  1ONL A;  2KOL A;  2IL8 A;  3NEL A;  4N9T A;  1XPO A;  3M4P A;  5TR9 A;  4A3I B;  1EFC A;  4PC3 A;  3LNN A;  3S14 H;  2QF7 A;  4J6H A;  2JA6 B;  5C44 G;  1IB0 A;  4ZCI A;  1YVC A;  1VMC A;  4FF4 A;  1PMR A;  2JA8 H;  1HJP A;  2VBU A;  2XZO A;  2VQF Q;  3CCE A;  3BVG A;  1PH1 A;  1HQR D;  3HAG A;  1STG A;  1XQB A;  3TRE A;  4YWM A;  4BY1 H;  4J0Q A;  4KHV A;  3TRZ A;  3V76 A;  4XLH A;  1TUI A;  5K36 G;  4G4K A;  1HRJ A;  3NEN A;  3CCL A;  3MMP A;  1NJI C;  4OWT B;  1XFO A;  4IW3 B;  4RDK A;  2F0T A;  1K8A C;  1W6J A;  3K59 A;  3J7A 5;  4UPA A;  4ILW A;  4JBJ A;  3AYH B;  2CRV A;  1HNX L;  1E79 A;  3UE0 A;  4H44 C;  3DMU A;  2ZT9 C;  1SNP A;  4Z9C B;  1VF7 A;  4YIJ A;  4CHT B;  1JB9 A;  2VB2 X;  3W1G A;  1BXT A;  1MSG A;  1QGY A;  4ZAI A;  2JA7 H;  2VYQ A;  1S72 A;  1JE5 A;  3KUP A;  4YCW A;  2HQL A;  2L4N A;  3A7L A;  2BPO A;  3VR4 A;  5C0X J;  1SXT A;  1KLU D;  2JA5 H;  4QV2 A;  1O7Z A;  4DNR B;  2V7T A;  2OCE A;  5NUC A;  2JN4 A;  4WZT A;  5KGU A;  1VQL B;  3I4M H;  4XL9 A;  3KDF B;  4WJ4 A;  2LZJ A;  2XND A;  1I5F A;  2I5L X;  2IWH A;  2EYH A;  1FNM A;  1JJ2 B;  3FPP A;  1U9R A;  1S40 A;  3TP6 A;  3CD6 B;  1OGJ A;  1Y1V H;  4IUQ A;  4FYD A;  1I18 A;  1M90 C;  4JI3 L;  1X3E A;  1X3G A;  1STH A;  2OXP A;  4RAU C;  2WIN B;  4OIK A;  2F1M A;  1R4P B;  3IFD A;  4JVZ A;  4KHZ A;  1D5M C;  3J80 c;  3NBH B;  1PH2 A;  4GZY C;  1EFR A;  2RHQ B;  4IJH A;  3ICE A;  4P9S A;  1WSV A;  5IGC A;  1KQS A;  2R93 B;  4XQN A;  1A2T A;  4DV4 Q;  1H95 A;  5FLX c;  2CH4 W;  4P1V A;  1JWM D;  4OO1 G;  4AF7 A;  1R9T H;  2A6E C;  4G7X A;  2KBN A;  4V0B A;  1H85 A;  3ERQ A;  1EP2 B;  2NYZ D;  4ASU A;  5HKK A;  1A62 A;  1UE1 A;  4IPC A;  1C8C A;  4A3G B;  4P12 A;  4JG2 A;  1GVH A;  3H91 A;  4Q0F A;  3CQZ B;  1SNC A;  2RDG A;  1EYG A;  3PUN A;  4XLE A;  3K80 C;  3WBJ A;  1G7T A;  3ES9 A;  4DV5 Q;  2AQ2 B;  2D62 A;  1TWF H;  3K7A B;  4I7Z C;  2K5H A;  2KEC A;  2EZV A;  1FND A;  3MXP A;  5J3B A;  2VY3 A;  3HOY G;  1WTR A;  5IP7 H;  4C3I B;  4MNO A;  4PQX A;  3OYY A;  2DEU A;  2A73 B;  4HED A;  2NZ1 D;  1HH2 P;  4UZU A;  4JBM A;  2EQS A;  1VQM A;  3I4O A;  1BKB A;  3I72 A;  1AN8 A;  3GTL B;  1QH0 A;  1KDB A;  1YNN C;  2ZIT A;  1K9M C;  2ZTN A;  1YIJ A;  1IL2 A;  1SND A;  4B3G A;  2R9V A;  1EWC A;  1CKN A;  3VR2 A;  5LL6 S;  1N36 Q;  2BVN A;  1ASY A;  2OTL A;  2AWN A;  4POG A;  1PXU A;  3AFP A;  4RCN A;  2PPB C;  2K33 A;  1I7P A;  1WTX A;  1EEI D;  4ZUJ A;  3PUY A;  2XIW A;  1DON A;  3WOE A;  1SBB B;  2OK7 A;  3CPW A;  4DUZ Q;  2F0U A;  1PZK D;  2XNA C;  2E2H B;  3HG9 A;  4DAY A;  1VQA A;  2A8V A;  4LF8 L;  2C78 A;  1KAA A;  2R7F A;  4LW1 A;  2R92 H;  3M7N A;  4B4D A;  2ZM6 L;  5C5M A;  1YLO A;  4DV0 L;  1H9M A;  2EY1 A;  2SOB A;  2JDI A;  4DR3 L;  3I1F A;  1DGS A;  5DS0 A;  4UP8 A;  3T4A C;  1TR5 A;  1KC8 C;  4IPD A;  1JCK B;  5IGD A;  2EJF C;  4CBV A;  2QMU A;  5C4X G;  4HE5 A;  3K5M A;  3Q38 A;  4P3I A;  4PMW A;  3ZPN A;  1J9Z A;  3PUW A;  1K0R A;  2IW3 A;  5EGT A;  3G4S A;  3W5O A;  1EFI D;  1K8O A;  1W0J A;  3U2Q A;  3TP7 A;  4A3L G;  3AVU A;  1WOP A;  2EVB A;  4H7B A;  5EPL A;  3HKZ G;  3CCE B;  2UUB Q;  2ZXP A;  1EOV A;  4A3D H;  2EYL A;  2VNK A;  2A6H D;  4OEL B;  1VLY A;  5CYU A;  1JOR A;  3ZZ0 A;  4KK7 A;  4C3H B;  5L37 A;  3S9W A;  3BZK A;  5JPM C;  3I73 A;  1PH8 A;  3GTK B;  3CCL B;  3H0G B;  1JE4 A;  4DR7 Q;  1AH9 A;  4DR4 L;  1QFZ A;  4QVJ A;  3FKI B;  1IJF A;  5JEA H;  1HR0 W;  3P7J A;  4N3G A;  4Z4S A;  4JI7 L;  4FWT A;  1SE3 A;  1C9O A;  5FLX L;  1QCB D;  4K5V A;  2GVA A;  3CAM A;  3F1Z A;  3PQI A;  4RHS A;  3OW7 A;  3WOF A;  1P16 A;  2HLD A;  3S2D H;  1OXU A;  2KA7 A;  4PGO A;  1PTO H;  3MEH A;  1ET9 A;  5I9O A;  1S72 B;  3BDO A;  1F2M A;  1WI5 A;  1CHP D;  3A56 A;  1VQN A;  2BN4 A;  3QFR A;  3PO3 H;  1IYU A;  1SE8 A;  4H02 A;  1QUQ A;  4BY7 G;  1MAB A;  1FRN A;  2UXB Q;  3VNV A;  1TT2 A;  4J8Q A;  4ZYS A;  1N34 Q;  3L3O C;  5BN5 A;  5DLQ E;  2IY5 B;  4X06 A;  5HGT A;  1BCP F;  3HGB A;  3VO1 A;  2Q6O A;  1N33 Q;  4CJ0 B;  2XGT A;  1PFN A;  1KL9 A;  3NUC A;  4X7E A;  4A93 B;  5AJ3 Q;  1IBM L;  5EJW A;  1VJS A;  4DV4 L;  1V0E A;  3EJI A;  5IWA L;  2L15 A;  4MYT A;  4BS9 A;  2ASB A;  2QE7 A;  4DF7 A;  4HIZ A;  2AHO A;  2CK3 A;  5GAE C;  1SJE D;  4B3M Q;  1I4X A;  4UP9 A;  1ENF A;  3AST A;  4GLX A;  4JI4 Q;  4DR2 L;  2PW5 A;  3CME A;  1Q1E A;  4ZCK A;  5GQO A;  4UAI A;  1KQS B;  1E1T A;  1RDP D;  2ZL7 A;  5M3M B;  2OTJ A;  5IYC H;  4HJA A;  2WV6 D;  4ID6 A;  1IBK Q;  1GXD C;  2GVB A;  3GTJ H;  1Q3L A;  1ZM3 A;  3HOX H;  4OPS A;  1Q86 D;  4X64 Q;  3K81 C;  4WRD A;  3UDF A;  2RSN A;  4LF9 Q;  1EL0 A;  1TQO A;  2EIX A;  4HCS A;  1I50 B;  2A19 A;  2DN8 A;  2MFI A;  1LTG D;  2NVY H;  3UE1 A;  3SVM A;  3I55 A;  4RD6 A;  1M1K C;  4BXX G;  2VZL A;  2BA1 A;  2VBT A;  1CI3 M;  2XOK A;  2F4I A;  3ND9 A;  4AYB E;  2HIX A;  1IBL Q;  1EIY B;  4PC7 A;  4QB4 A;  1V1O A;  1PHJ A;  3SK8 A;  1YBY A;  1OXT A;  3URY A;  4HIK A;  4BBR H;  2VJI A;  4TT3 A;  4EH1 A;  2XWB B;  1S4M A;  1VQF A;  1NNX A;  2W6J A;  3A7A B;  5C6A A;  1N36 L;  3RZO B;  1GUT A;  5CC4 A;  4QFM A;  3F2D A;  2X6Y A;  4APV A;  1AFP A;  1SN8 A;  1VQM B;  4K8J A;  4ZRZ A;  4B3S L;  5FO7 B;  1K28 D;  5KNL A;  1T5X D;  3U58 A;  2YU9 B;  1HZB A;  4A3C H;  3ZIA A;  1YIJ B;  3KLS A;  2ZL6 A;  2L1B A;  4X7F A;  1KHI A;  5M5W H;  1CKN B;  1GHJ A;  2AUK A;  4OIJ A;  2EYP A;  2OTL B;  3S1R B;  3Q24 A;  3AVW A;  4GNX C;  1DCZ A;  2IX3 A;  1NCV A;  1F9P A;  4G7Z C;  4NCN A;  3HOW B;  3Q6Q A;  4X3U A;  1BX1 A;  3CPW B;  2EY2 A;  4BA2 I;  2F0F A;  4DAY B;  4I7A A;  4DQL A;  1K8A D;  4B9W A;  4X0C A;  2Q6K A;  4OL7 A;  1SYE A;  3SJP A;  1VQD A;  1T6Z A;  1WTH A;  5GRO A;  5A2Q L;  4P72 A;  2K5Q A;  3AGP A;  1SKQ A;  3E5S A;  1Y1W H;  3ZJY C;  3GVK A;  2Y0S G;  4YWK A;  5JAV A;  3GTQ H;  3K5L A;  1RF2 D;  3STB D;  4CQJ A;  4C3J B;  4DV7 Q;  4QUC A;  5IOD A;  1XMO L;  1VQ8 A;  2K03 A;  2Z9H A;  3GTO H;  1WJJ A;  3G4S B;  1V43 A;  1S3O A;  1JIC A;  1NMG A;  2JA6 H;  2QKI C;  2IX1 A;  1ELO A;  3S15 H;  2L55 A;  1LTI D;  1NMF A;  2K32 A;  3GO5 A;  3E1Y E;  3SK4 A;  3SR1 A;  1SYF A;  3KF6 A;  3X3N A;  4YHH Q;  2K50 A;  3J80 i;  3J81 k;  5C3W A;  3AMU A;  1F20 A;  4WJ3 M;  1CZG A;  1J8I A;  2CW0 C;  2CQA A;  3NQT A;  3NBI A;  1EYC A;  3GTG H;  3Q3A A;  4G1B A;  4HCE A;  2D9U A;  2MNA A;  4DK6 C;  1Q9S A;  3DXJ C;  3WYA A;  5C0X H;  1S4Z A;  2IJ0 A;  1M90 D;  1X6O A;  4RD4 A;  3VMF A;  5DN6 A;  4AF6 A;  2K5N A;  5M3F H;  3K6O A;  3MCA A;  1JJG A;  5ELD A;  5TV2 A;  3CCU A;  1LV9 A;  1G2T A;  2WAQ B;  5IY0 A;  1KIX A;  2B2Y A;  1DDI A;  1BOS A;  3A5Z B;  1AE2 A;  2D0O A;  5EAY A;  2QTZ A;  4ZUI A;  3A1P A;  3W5H A;  5F4M A;  4BWG B;  1WCM H;  1EWY A;  5EPK A;  1PTO D;  1X56 A;  3FJO A;  2EYF A;  4RWS C;  3CP0 A;  3U6K A;  1O7I A;  4LFA Q;  1FJG Q;  2A5H A;  3M4O B;  1BLI A;  1JA0 A;  4K5W A;  5C3X A;  1VQN B;  4K2K A;  3VYT A;  2R7Z B;  4JI8 Q;  1QUQ B;  4C1N I;  4IFD J;  4RD2 A;  5E4W C;  3HFZ B;  4WZK A;  3AVX A;  2UU9 Q;  1JWU D;  1TWC B;  2BDN A;  4B3M L;  1Q90 A;  2DJF C;  2DY8 A;  4P74 A;  4JI2 L;  2PCF B;  1F2L A;  3I4N G;  4DV1 Q;  3DEP A;  3M4Y A;  4LFB Q;  4K5X A;  3KF8 B;  5IYW A;  4A3J B;  1QVG A;  1XMQ Q;  3CMM A;  1HA3 A;  4XN3 A;  4WFN 3;  1HQM C;  2AHO B;  5HGQ A;  2JK8 A;  3CME B;  1SKY B;  1QE6 A;  4IUN A;  4AIM A;  5C3E G;  2RA4 A;  2OTJ B;  3BZC A;  4XT3 B;  4DR6 Q;  1VQB A;  4OO1 I;  5BN3 A;  2WJY A;  4XD7 A;  3HOV G;  4U68 A;  4A3E G;  1YNN D;  5FO0 A;  1J6Q A;  2M2L A;  1VMP A;  2VJJ A;  1K9M D;  5M5X H;  1IBL L;  4ZQ3 A;  1F9Q A;  2F0I A;  4A3M B;  5ELF A;  4PG3 A;  3MA2 B;  4DV6 L;  5EKK A;  1S0U A;  1PRT F;  3I55 B;  1FL0 A;  5HUR A;  4L8J A;  1VQI A;  3QE2 A;  1QWY A;  2D0P A;  3T51 B;  4RCZ A;  5C4H A;  1LYL A;  1T6X A;  3V96 A;  2JA9 A;  5EQ0 A;  2VW9 A;  1XTC D;  4C3I H;  3VA7 A;  3I2Z A;  3L7Z C;  5CDF A;  2YWG A;  1ML0 D;  5I9P A;  2WZP P;  1CFM A;  3ONA B;  4HJ9 A;  1VLO A;  2Z4H A;  2OK8 A;  1SDF A;  1E24 A;  3A8I A;  3S17 B;  1STY A;  3ISX A;  2JP1 A;  4KI0 A;  2NWG A;  3VYS A;  3VYU A;  2FJ2 A;  3Q6S A;  1PH5 A;  4DK1 A;  1VHO A;  3D6C A;  3MXU A;  3PGZ A;  3WQZ A;  2ZBU A;  5IE8 A;  4Y7C A;  4L5R C;  1W87 A;  2NVQ B;  4DK3 C;  1C4Q A;  3GTM B;  4II2 A;  1K83 H;  2MP1 A;  3KLW A;  1HNX Q;  2N78 A;  5D14 A;  5ELO A;  3RLF A;  3JC6 6;  3UDG A;  1B23 P;  2JA8 G;  1D1K A;  3KBX A;  4Z1M A;  1Q82 C;  2B7C A;  2E2H H;  4BY1 G;  1PV4 A;  1TWH B;  2JEB I;  2PZU A;  5EBC A;  1QVC A;  1U4P A;  2I07 B;  5GAD C;  3HOZ H;  2DYI A;  2XRQ D;  2DER A;  3WNB A;  2XEX A;  4JBK A;  5FIU A;  3AEV A;  4A3B H;  1OB5 A;  4DKA C;  1B3Q A;  3RN5 A;  2GJK A;  2VS1 A;  4X05 A;  4EX5 A;  3CXC A;  2EJM A;  1VQ8 B;  1KAW A;  1HA5 A;  1OB2 A;  3U4Z A;  3MVV A;  1F60 A;  2HCC A;  2EXD A;  2WJV A;  1O78 A;  2JA7 G;  4RFB A;  2UUC L;  1TXY A;  3KF6 B;  4GLA C;  3T1Y L;  4ZCM A;  1YI2 A;  3HOY B;  2FMM A;  2WII B;  3ASP A;  1ESR A;  1K0S A;  3U6B A;  2JA5 G;  2KEE A;  2KHS A;  3A35 A;  1SJH D;  2QTL A;  4Y52 H;  3V7A A;  1E7Z A;  3I4M G;  4KY5 A;  3CPX A;  1H9K A;  4GNX A;  4X8I A;  3FKI H;  3RR5 A;  4YCV A;  1PH6 A;  3D6W A;  1FJG L;  3TN2 A;  4B9X A;  4Y7N B;  1CKO A;  1TWG H;  2CH4 A;  5KRU A;  3CCU B;  1Y1V G;  2L9H A;  5LMZ A;  5CGK A;  3WBK A;  4RA8 A;  3M85 A;  3KOJ A;  1OXX K;  3E6Z X;  1JJC B;  4CDF C;  2WB1 G;  1HNZ L;  2VBS A;  1ZXT A;  4CDE C;  5KYI A;  3FVQ A;  4G7O C;  4B3T L;  1GD7 A;  3A3G A;  3PUZ A;  1DM0 B;  1V8Q A;  1KK3 A;  1HTL D;  1QGZ A;  3Q23 A;  2QDL A;  3IKJ A;  3HOU B;  5TRD A;  1QG0 A;  2Q2T A;  3NHH A;  3NE5 B;  5FLM H;  4JPB W;  1SFO B;  2K1B A;  2K5D A;  1PJ7 A;  1BQQ T;  1EWH A;  2ZJR A;  1RQP A;  4WWV A;  2RDF A;  2F03 A;  4Z4U A;  3S2H B;  2Z6B D;  4YEL A;  1HZC A;  2NB0 A;  1PTO F;  2K6A A;  3WXM A;  3ZYY X;  2E74 C;  4LK1 C;  5C4X B;  2C5C A;  1QVG B;  4LMQ D;  1XX8 A;  4KY7 A;  4XDX A;  1Y14 B;  3OTO Q;  5LMN Q;  1HZ9 A;  4IZ8 A;  2WAQ E;  2K05 A;  4CKC A;  2P5Z X;  1NDH A;  1SLJ A;  5IP7 G;  1E3P A;  2F3I A;  5IGF A;  3HKZ B;  3WDN A;  3SK6 A;  5KIX A;  4WZL A;  2MO0 A;  1F2Y A;  2F4N A;  1XNR L;  1QVF A;  1Q46 A;  2O5J C;  4YY3 Q;  3R3O A;  1DXM A;  4R1J A;  2DCU A;  4QCL A;  1QZG A;  4LF8 Q;  3OWE B;  2ZM6 Q;  4DV0 Q;  3QWN A;  4DR3 Q;  3LGJ A;  2I46 A;  3J80 E;  2HUG A;  3FRP B;  3LX0 A;  3H3V H;  1ASZ A;  2FX3 A;  1N0V C;  1A8P A;  3A8K E;  2X3U A;  3OIP A;  3WWV A;  2NVX B;  4XQF A;  4HE6 A;  3J81 j;  4Z4R A;  3BVZ A;  1SSO A;  4LFC L;  5FLX E;  4RD3 A;  1QIL A;  3CRL C;  4RPD A;  5G3L D;  5E6T A;  5C4Z A;  1FGU A;  4JYA L;  4C56 C;  1CNE A;  4LF5 L;  2C4U A;  1TVC A;  5M9O A;  1KLG D;  1I3Q H;  2R92 G;  4QIW B;  3J7Y W;  4JI6 L;  3RZO H;  4BY7 B;  2WKC A;  3QOL A;  1SMY D;  4IOA A;  3CPF A;  2EPB A;  1U0L A;  1N8R D;  1NY4 A;  1MJE A;  5LMU L;  3F2U A;  2JE6 I;  1UE7 A;  2DGY A;  2YU9 H;  2B2U C;  3OMC A;  4HJ8 A;  4DR4 Q;  1EZ6 A;  2NZO A;  4C2M B;  1FNV A;  2HT1 A;  1EFU A;  3RUZ A;  2WAC A;  1E1R A;  1LT3 D;  1II3 A;  1UWV A;  2X6X A;  4JI7 Q;  3S1R H;  1TS3 A;  4FF3 A;  3ZZT A;  4XYQ A;  4HMI A;  3KK7 A;  1MBY A;  2C5B A;  1SNM A;  3BQJ A;  4A4I A;  4A3D G;  1ZYR D;  2EDG A;  2RHS B;  5I4D A;  5JVG 3;  1HUN A;  2ZZG A;  2PYK A;  2B63 H;  1U4M A;  1X65 A;  3RNU A;  3K0Y A;  2N8N A;  3NTI A;  4TMV A;  1WTO A;  4LF7 L;  2PNH A;  1MD2 D;  1E3X A;  5IYB H;  1HTP A;  1EIH A;  1B2T A;  4EQP A;  4FO2 A;  1VQ9 A;  4B47 A;  1Z9F A;  4HTH A;  4XLF A;  4X65 Q;  1RTN A;  2ID0 A;  1C7Y A;  2HIV A;  4GN5 A;  1TVX A;  1WU8 A;  1TS4 A;  2ZTC A;  3KYH C;  3NPP A;  5JEA G;  4A3K H;  4BBS H;  1C0A A;  1WOS A;  3ER0 A;  3CXC B;  4M0L A;  3CCV A;  2HMA A;  3S1M B;  4M4S A;  5F4O A;  4M2L A;  5JJK A;  4HMJ A;  2K4K A;  1IBM Q;  3GVL A;  2FXQ A;  4B44 A;  4JCV E;  1T5E A;  5IWA Q;  4KY6 A;  1EFW A;  1L2F A;  2B5O A;  1LTR D;  1YI2 B;  1SR3 A;  3P20 A;  4B3F X;  3PO3 G;  3OZW A;  2BH8 A;  4DR2 Q;  1SYB A;  1QX4 A;  4WOR A;  2PW7 A;  2PZW A;  4X07 A;  5ELB A;  2VXW A;  3PUV A;  4GNX B;  3C2Q A;  4DR1 Q;  1EFT A;  1GAQ A;  1F77 A;  1HNW L;  3DEO A;  2D3L A;  4IFD H;  2B8G A;  4X62 L;  1A3U A;  1OXV A;  5CMD A;  4FNF A;  4YAO A;  3VA5 A;  4RCY A;  1AE3 A;  2I5M X;  2JJQ A;  1UD5 A;  1DOK A;  4HID A;  1C48 A;  1EQT A;  3LWE A;  1JC7 A;  1EU4 A;  1YHA A;  5GV8 A;  4IUR A;  2ES2 A;  1E2W A;  1A2U A;  4NNJ A;  5IYC G;  2NVT H;  1ZM4 A;  3BG3 A;  3JQQ A;  4G7W A;  1Z47 A;  1I4Q A;  3OTO L;  3W1B A;  4TMX A;  3I56 A;  5LMN L;  4N8X 1;  4TSS A;  3S16 B;  5CV8 A;  1F9S A;  1TWC H;  4TQU S;  3I70 A;  2C35 B;  2V4D A;  2LMC B;  3HOX G;  4IAL A;  3PV0 A;  1B44 D;  1Q12 A;  5I6Y A;  3KEW A;  2V7V A;  3QSY A;  3B8H A;  2GPJ A;  1NSN S;  1YNJ D;  4A3J H;  1LUZ A;  4N8F A;  2LKV A;  4B3S Q;  3CTA A;  3C3L A;  4DN4 M;  5KND A;  1HZE A;  4YY3 L;  4JV5 L;  3W5U A;  2JEA I;  2X0K A;  1IXR A;  4P3Y A;  4K14 A;  4B3R L;  3CKI B;  5ELC A;  1EQR A;  2Q6I A;  1I6H B;  1BCP B;  1PDQ A;  1A6X A;  2YWF A;  4IPG A;  1K8G A;  2B2Y C;  1I4H A;  1EY8 A;  3ASR A;  4BBR G;  1KD1 D;  2NN6 H;  4UY8 C;  2MJ8 A;  1QVF B;  3HRZ C;  1KK2 A;  4G5G A;  1TS2 A;  5GAG C;  4WJW A;  3D8G A;  1JR0 D;  2VNI A;  3QFS A;  4A3M H;  2Q2H A;  2RVL A;  2RDH A;  4XOP A;  4K6D A;  4A3C G;  1B53 A;  3LWU A;  4RLZ A;  3BVM A;  3MAQ A;  5IT9 E;  1G51 A;  5BR8 L;  1WTV A;  1K73 D;  1Q8K A;  4IOC A;  2KHI A;  3R8B A;  3CCQ A;  4Z4W A;  1TWA B;  1XNQ L;  1XMO Q;  4LF6 L;  1KRS A;  4GN3 B;  5C4J H;  2O4X A;  4FXD A;  5THX A;  4ACA A;  1UEA B;  1L1O C;  1N32 L;  4OP7 A;  4K1X A;  4RGM A;  2OT2 A;  2HHH L;  2UXD L;  4X6A H;  3ONY A;  2BM0 A;  4YCU A;  3BH4 A;  5IIF A;  1Y1W G;  3IRB A;  1WSR A;  4NPS A;  2WKD A;  1GOZ A;  1D5X C;  3ITP A;  5M5Y B;  5IYN A;  2AWO A;  2UUA L;  1OHH A;  5A35 A;  5KYL A;  2PZT A;  1NTG A;  4A3I G;  1DDG A;  1EYA A;  5IYQ A;  1B70 B;  2JA6 G;  3E20 A;  3L2P A;  1KDC A;  5J22 A;  4DK0 A;  4RMF A;  3T13 A;  4X65 L;  2BMW A;  1EQQ A;  1FNU A;  4X7D A;  2L5T A;  3RZD H;  3LQ6 A;  1N08 A;  2QN6 A;  2E2J H;  4CDC C;  1TWH H;  1EY7 A;  2M00 A;  1QNU A;  3CRK C;  4XOT A;  3OEH A;  1KXL A;  1I6V C;  5C3E B;  2Q2U A;  3KF8 A;  1DOL A;  3HOV B;  1KNE A;  2B7B A;  1JOQ A;  3HP3 A;  5C0X G;  4G7H C;  1LT6 D;  2A1A A;  4A3E B;  1O7Y A;  1VQ9 B;  3S1N B;  5M3F G;  1CSP A;  4NKL A;  1FD7 D;  3T56 B;  3LQE A;  1AEX A;  5BSX A;  1LTB D;  2F0V A;  3CW2 C;  4JI2 Q;  3M3Y B;  4AH6 A;  3ZUG A;  3GVJ A;  5HZA A;  3CCV B;  3D31 A;  3BDL A;  3EA6 A;  2B2T A;  2E2I H;  2BM1 A;  1G7S A;  4C43 A;  1IKM A;  4G1V A;  2PIA A;  1WCM G;  3PIP A;  4DR1 L;  2B2U A;  1F2Z A;  5IYD H;  4FDB A;  3OKX A;  3R2I A;  1UAP A;  1CZW A;  1WVL A;  4PAA A;  2X6W A;  4X7C A;  2VBV A;  4YAF A;  5CV4 A;  1IW7 D;  1FNW A;  1B8A A;  2CBX A;  1STE A;  2B8F A;  2V7X A;  4FN5 A;  5HZB A;  4O2D A;  5IT9 c;  5K5P A;  2OYN A;  2IPK D;  5J39 A;  2F43 A;  4AYB G;  3GQB A;  2VUM H;  4ZCL A;  1MSH A;  2CC2 A;  1EWI A;  2A74 C;  1WTP A;  2N3S A;  2D74 A;  4K6L A;  4DV6 Q;  3S14 B;  3FDT A;  1BR9 A;  3PO2 H;  4DA2 A;  1PFM A;  1XE1 A;  3KJP A;  2R93 G;  3K7U C;  3HOU H;  4X3K A;  2BV3 A;  4TKO B;  4KTA A;  2BGJ A;  4BY1 B;  4UAJ A;  5KSW B;  2ATW A;  1KNA A;  2XRS D;  3I56 B;  1EEF D;  4FP5 D;  5J35 A;  5JPN C;  3TEH B;  1LTT D;  1S5D D;  1TY2 A;  3W5V A;  3K5N A;  3BY1 A;  3PVD A;  3SE0 A;  4WQM A;  1E43 A;  3C1F A;  3FPU B;  2NUC A;  1CQV A;  1GUN A;  2V7W A;  4LNQ A;  2OQ0 A;  1Y0Y A;  2RC5 A;  1JB3 A;  1NJI D;  3QFC A;  1AMO A;  1HHV A;  1LT4 D;  2GQF A;  2EE1 A;  2JSO A;  3H6M A;  4IPH A;  2JXM B;  2BDO A;  1V1P A;  2E1B A;  4XMY A;  4C3I G;  1Q8I A;  5CV6 A;  2F0E A;  1MI2 A;  3BDC A;  1GHK A;  1PFS A;  4FVM A;  1KJZ A;  4LBZ A;  3RY8 A;  1X55 A;  2BA0 A;  4AC9 A;  4NXN L;  4F87 A;  1VQE A;  1CT1 D;  1M8A A;  1MGS A;  1FGB D;  4A3I H;  4CGY B;  4HR7 B;  3I4M B;  2SDF A;  4LBY A;  1L0Y B;  4OWX B;  4HN7 A;  4XT1 B;  4OX9 L;  4L63 B;  3S24 A;  1UD3 A;  5D65 A;  3EIV A;  3TZU A;  3CCQ B;  2WR8 A;  2NVX H;  1ZEQ X;  3K58 A;  2WB1 B;  1X9N A;  2F0L A;  4P25 A;  1TS5 A;  3JAM c;  4Z4V A;  3G6E A;  1PJ5 A;  1PRT B;  1SRO A;  2FMC A;  2Z6K C;  3MWY W;  1BCP C;  2UUC Q;  4E6I A;  3P26 A;  3T1Y Q;  1TY0 A;  4GOP A;  2P3M A;  3HOZ G;  3CCM A;  1H9S B;  4QQB X;  3L9A X;  2IX0 A;  2JN9 A;  1NB9 A;  1BBW A;  4JC0 A;  3J81 c;  2HCI A;  3AU7 A;  1EP1 B;  4A3B G;  4XOR A;  1GKH A;  3TQY A;  5KW9 A;  3MFG A;  4K2L A;  2AKW B;  1E3Z A;  5FJ8 G;  2HQE A;  2ZXH A;  2OBT A;  2A6E D;  2EYM A;  5IT9 L;  2NV4 A;  2PLF A;  1GJR A;  2DUD A;  1TWF B;  1EXM A;  3OPO A;  1SEB D;  2BF4 A;  4PC6 A;  5TY0 A;  4DV2 Q;  4A3F B;  1WFQ A;  1RCV D;  3GV3 A;  1HNZ Q;  1EIG A;  3OWF A;  1JB7 A;  2DOG A;  4B3T Q;  3SXH A;  1B9N A;  4XKW A;  1WTH D;  2MGS A;  4R9W A;  2K28 A;  3W2G A;  4LAA A;  2MQH A;  2PNR C;  3FKI G;  5T1G A;  5DAU A;  2F0J A;  4TRD A;  1SYD A;  3U9S A;  3G05 A;  3W2D A;  4WZE A;  1L1O A;  2ZTE A;  3CC7 A;  2KED A;  4M8A A;  5C44 B;  4ULL A;  2E8G A;  4ACB A;  1RD9 D;  1EY0 A;  2E75 C;  2Q8I B;  3ZC3 A;  2R93 H;  4R4O A;  1B7Y B;  2NZH A;  4HJ5 A;  2YTX A;  1GM5 A;  1MRZ A;  5DM7 3;  3T1H L;  5DNF A;  4RGN A;  2K01 A;  2ALY B;  2D2C C;  1G29 1;  5IK2 A;  1XTD A;  1JWS D;  5E3F A;  5FK9 C;  4A3G H;  3GDE A;  1EY5 A;  4ZGQ B;  3I3C A;  5A8A A;  4RG1 A;  5FLM G;  3J7A F;  2QDX A;  3CQZ H;  1J9O A;  4P71 A;  4NMZ A;  2V7U A;  3U50 C;  1NB0 A;  2R92 B;  4ZK9 B;  1XNR Q;  3K7A H;  3H15 A;  3I4L A;  3E3X A;  4KLK A;  3KJO A;  1FDR A;  1CNF A;  1D1I A;  4LBW A;  4A76 A;  4NW2 A;  1Y8O B;  2ICI A;  3G7L A;  2MUY A;  2RF4 A;  1GAW A;  4ALP A;  4CJ1 B;  2QA4 A;  2QW7 A;  1KC8 D;  1JMC A;  2ZJQ A;  4Z4T A;  2R3Z A;  1D8T A;  1Q81 C;  4GKK L;  3LO8 A;  4RHR A;  2N49 A;  3DUZ A;  3CW2 A;  3GTL H;  1KZL A;  1UNS A;  3F8T A;  1BJK A;  2I1L A;  4LFC Q;  1KK0 A;  3V2T A;  1SNQ A;  1E1Q A;  1RJT A;  3S16 H;  3CP8 A;  5JJI A;  5GAH C;  5I6W A;  1DD2 A;  4R4Q A;  3SKB A;  2A68 C;  4JYA Q;  3SEB A;  1W34 A;  4LF5 Q;  1CKM A;  3JAM L;  1WYD A;  1U4L A;  4NXM L;  3BC9 A;  2EYO A;  4JI6 Q;  4X66 L;  1BO0 A;  4DFA A;  4AQY L;  1JOK A;  3FMC A;  3B78 A;  4F7D A;  5LMU Q;  2F0W A;  1B3A A;  1B9M A;  1Q1B A;  4RKB A;  5LHY 1;  3J81 L;  1I6H H;  2RCN A;  1I94 L;  4GN4 B;  4P73 A;  1QZH A;  1WDT A;  3S2D B;  1V1P B;  2LFN A;  2KHJ A;  1PTO B;  1KTK A;  5JOB A;  1OXS C;  2ZZF A;  3BCD A;  1BVS A;  1YJW A;  1BUV T;  1PYS B;  5FL7 A;  4L6T B;  3GTP B;  2MHV A;  1X54 A;  3PMF A;  2RC6 A;  1BDO A;  1I4R A;  3PO3 B;  1RHP A;  2CW5 A;  4XKV A;  4F8M A;  3E9H A;  5FJ8 H;  4NB3 A;  2A6H C;  2DNC A;  1GUS A;  3G48 A;  4UZF A;  5EMN A;  4LF7 Q;  1WP6 A;  1HXY D;  4K0K L;  1GO2 A;  2XNJ A;  5AN9 A;  1EY9 A;  2KQ3 A;  1FYC A;  3AFQ A;  3OHX C;  1NUC A;  1WD1 A;  1OB0 A;  2QDB A;  2BGI A;  3DM3 A;  1SRU A;  2F1L A;  4OON A;  3OSO A;  3DWP A;  2KVM A;  1TWA H;  1XPR A;  4C3H H;  3H9N A;  4YXW A;  3SGI A;  1AW7 A;  5FO9 B;  2XZP A;  1XYI A;  4DUY L;  3GD7 A;  3ULJ A;  3GTK H;  1FVI A;  5FNZ A;  3V05 A;  5LL6 X;  5CV5 A;  3H0G H;  2IHF A;  1PLF A;  4P26 A;  1TLL A;  1LAC A;  2EJG C;  3MEF A;  3G6E B;  4N3N A;  3TS2 A;  2B63 G;  3QR8 A;  3CF5 A;  2CKZ B;  4ME3 A;  3BNW A;  1N05 A;  2B29 A;  4GOP B;  1G6P A;  5IYB G;  2YWE A;  3CCM B;  4QUF A;  5ELE A;  4DPG A;  1QNK A;  1G2S A;  1NR2 A;  1W3S A;  1CA5 A;  2CQO A;  3GTJ B;  3HOX B;  4S3S A;  4DV2 L;  3K57 A;  4BBS G;  4KHP L;  3X3M A;  4A3K G;  1PKV A;  1LLR D;  2PE3 A;  3AGQ A;  4M53 A;  4CKB A;  1HNW Q;  1KRT A;  2YV5 A;  4C1N K;  3CES A;  2HDM A;  2NVY B;  4IUV A;  2WYR A;  4X62 Q;  2J7Z A;  2CCZ A;  1QFY A;  2NBF A;  2KEN A;  2JJ2 A;  1H42 A;  2FFK B;  2OF1 A;  2E76 C;  2PQE A;  2XVS A;  2N88 A;  3T16 A;  2EY6 A;  1M1K D;  4JOI C;  1QG7 A;  4MN3 A;  4BBR B;  5C0X I;  1XXG A;  4LF4 Q;  1CK1 A;  2ZXO A;  4A93 H;  3J7Z C;  2PQA A;  2MO1 A;  2PMD A;  3P75 A;  1VQ6 A;  4GKJ Q;  1JNY A;  4RDJ A;  1PRT C;  1WOC A;  2B2W C;  3QFT A;  4OOS A;  3TP5 A;  3S1N H;  4KD3 A;  2D5D A;  2M5S A;  4BPR A;  3CC7 B;  1VQ7 A;  1L1O B;  2Z6K A;  3BS1 A;  4II3 A;  4JI1 L;  3GSI A;  1ILQ A;  2WAQ G;  4IFD G;  1SMX A;  3I90 A;  1AP0 A;  1S5B D;  5D3I B;  5M3M H;  1Q86 C;  2Z8L A;  1U4R A;  3A3B A;  4PZ6 A;  5M5W B;  3FP9 A;  4K8I A;  4JV5 Q;  3ZBU A;  2V7Q A;  1G7C A;  3PUX A;  2X85 A;  2WPD A;  1L0X B;  4B3R Q;  3JQR A;  4KJO A;  1PVO A;  4FXU A;  3OFN A;  4HAE A;  3GV6 A;  2RBM A;  1I50 H;  1RTO A;  1N0U A;  3CRZ A;  4XON A;  3C2P A;  4ROX A;  1HR0 L;  4XNF A;  4DV3 L;  1Y1W B;  3J7A V;  4HJ7 A;  3EQL C;  1RL2 A;  4XQQ A;  3GTQ B;  2GRE A;  3EVQ A;  1S5E D;  3O13 A;  1ICF B;  4A3J G;  4DAV A;  1K8M A;  3E9I A;  2JYO A;  3CCS A;  2OWO A;  3GTO B;  1AZQ A;  2QA4 B;  1A3T A;  2Z0S A;  3N52 A;  3PA1 A;  5BR8 Q;  4MYU A;  4RGT A;  1X32 A;  3PIO A;  4R8N A;  3Q8D A;  3S15 B;  1XB2 A;  3PSI A;  4O42 A;  5B6I A;  1G6Z A;  1XNQ Q;  4H9G A;  4KJN A;  4DU9 A;  4H13 C;  4CDD C;  1R5O A;  5H1S E;  2WFW A;  2B2T C;  2NN6 G;  5IP9 H;  4LF6 Q;  3JAM i;  1QUE A;  5F4J A;  1PZJ D;  2F0S A;  4DXG A;  4QF4 A;  5C5L A;  3PEN A;  1N32 Q;  1SYC A;  1VQC A;  3WNC A;  1YHB A;  3G6J B;  3GTG B;  2UXC L;  2HHH Q;  2UXD Q;  1ZUN B;  2JIZ A;  2RKS A;  5KNB A;  4A3M G;  1WTW A;  2ZZE A;  4DAM A;  3D4D A;  3CC2 B;  5M3F B;  3K5O A;  3J81 i;  2E2D C;  2AMC B;  1ET6 A;  4FF1 A;  2CW0 D;  2H1E A;  3KL9 A;  1GO3 E;  3NWT A;  1KDA A;  3C46 A;  3HOW H;  2NPF A;  1I8D A;  5IGG A;  2UUA Q;  2E5L Q;  2AUJ D;  4JI5 Q;  2F0D A;  3AVT A;  2YTV A;  3STB C;  3WY9 A;  2R7D A;  2DY1 A;  1BCP D;  4ODG A;  3TP8 A;  4R8I A;  5ISR A;  1AIP A;  1N07 A;  1WCM B;  3EFX D;  2B3G A;  2WZN A;  3A55 A;  4MIU A;  2I0Q A;  3OE7 A;  1X3Q A;  1YJW B;  4XM3 A;  3SHL A;  1YIT B;  4DNT B;  3NEM A;  1YJ9 A;  1N9W A;  4C3J H;  2X53 S;  3U4V A;  1Q7Y C;  2C5H A;  3WND A;  1AZP A;  2I5H A;  1UE5 A;  1ICW A;  2N55 A;  4XIG S;  4U67 3;  1EZ8 A;  4R4T A;  2DY7 A;  2OEO A;  4KV6 A;  4NP5 A;  3BCF A;  3FPK A;  4ZKB B;  1J5E L;  1I4G A;  3VR3 A;  5FO1 A;  2H4O A;  4AYB B;  3D4R A;  3VDY A;  3G71 A;  2CF4 A;  2CHB D;  3CHB D;  3TBI B;  3OAA A;  2F0M A;  4UDU C;  2BSA A;  2CND A;  1QFJ A;  1QJO A;  5F2D A;  2RCF A;  1JOO A;  2V1C C;  3CP2 A;  4F88 A;  1HFG A;  4PV1 C;  5BN4 A;  3ONU A;  1SE2 A;  1W2B A;  1B50 A;  4JMQ A;  2QIL A;  4ZV4 A;  1PYW D;  2MPM A;  2QEJ C;  3AVV A;  3KLS X;  3QG1 A;  2VQE L;  1WOO A;  1VQG A;  1YJN A;  4V19 0;  1BMF A;  1PTO C;  2DNE A;  2ZJP A;  3W2I A;  1GR1 A;  4PNY A;  3C1E A;  1GUW A;  2F4V L;  3FKS A;  5M5X B;  2KJX A;  1YNX A;  1VQH A;  4KD4 A;  4TVA B;  1UE6 A;  4RGO S;  5I2Y A;  5E7N A;  4YEJ A;  4OWW B;  4EQN A;  4LF4 L;  3M4O H;  1ENA A;  2HDN B;  5D3D A;  4FXK C;  3SLN A;  2R7Z H;  4IUU A;  4CKE A;  1TKW B;  5IYD G;  1H8E A;  2C4T A;  4A3F H;  1KMH A;  1DG1 G;  2LXJ A;  2PI2 A;  2C9O A;  2BE5 C;  2F0K A;  4UHV A;  3Q6R A;  2Y0S B;  4IO9 A;  4EGV A;  1TU2 B;  1EOT A;  1I4P A;  5EKI A;  4TN1 A;  1HVX A;  1VQ6 B;  2PQA B;  5A2Q E;  3D3R A;  5I2X A;  1HUM A;  2VNH A;  3A54 A;  4QMG A;  1VQO A;  1LTL A;  5HXB A;  4OPO A;  4Y9R A;  1VQ7 B;  2L12 A;  5JJZ A;  5C44 H;  3ERO A;  4GOP C;  2VUM G;  2Q2I A;  2LY7 A;  4O1N A;  1KAB A;  4OEM B;  5A89 A;  1Q81 D;  2B2V A;  5FO8 B;  3MXG A;  3EBE A;  1K83 B;  2CFM A;  1G8Z D;  4PMC A;  3PO2 G;  2R61 A;  1SYG A;  4PAB A;  3W2F A;  5K36 H;  4KMU C;  1UD2 A;  3MFY A;  1EUJ A;  1FR3 A;  2A68 D;  3HOU G;  2RQX A;  3UDI A;  2QCP X;  1E62 A;  3QB3 A;  4L5Q A;  1UUP A;  3PIO 3;  1E22 A;  3NTK A;  1EYD A;  3NSW A;  1SE4 A;  5CBE E;  3S1Q B;  4NXN Q;  3HOZ B;  1P8L A;  3OOC A;  2EXZ A;  2R6H A;  1Q82 D;  2VQF L;  3BZD B;  2A69 C;  4ZKC B;  4XTC S;  4JOI A;  5GV7 A;  2PMZ B;  4A3B B;  2Q6L A;  1MHW C;  4LUO A;  2L0C A;  3QOJ A;  4TMW A;  2GJP A;  4PZ8 A;  1LT5 D;  4OX9 Q;  2B2W A;  3CCS B;  3HZX A;  3S17 H;  5IOC A;  4PC1 A;  1D5Z C;  3W2H A;  3HKZ E;  4XYO A;  5IYP A;  1S5C D;  4FF2 A;  1D2E A;  1H9S A;  2QEX A;  1OGI A;  3EN2 A;  1IHZ A;  1PA6 A;  1PH4 A;  1X3P A;  3D4W A;  1CM9 A;  4YAU A;  2CWP A;  2EIF A;  2F52 A;  2KCC A;  4LUV A;  5DM6 3;  4XLC A;  1FRQ A;  1JA1 A;  3JQP A;  4OGQ C;  1V5V A;  3I4N B;  2FHT A;  2XZL A;  4P75 A;  4JI5 L;  1BX0 A;  5G3L F;  4R4I A;  2E5L L;  2NVQ H;  3GTM H;  3J80 L;  4EQO A;  3A8J A;  1A0I A;  1YZ6 A;  4Z4Y A;  3HEJ A;  2J4X A;  5E1F A;  3BJU A;  1IYV A;  3H3V I;  4G6I A;  2VNU D;  1TWG B;  2SNS A;  4Y9U A;  2CWA A;  2XN9 C;  3OZU A;  3ULL A;  3CB4 A;  3PF5 A;  2HCJ B;  4POF A;  3CC4 A;  4B08 A;  3ZZU A;  4QVA A;  5FA6 A;  1IKL A;  4TMZ A;  2CVR A;  1VQP A;  3A8I E;  1CA6 A;  3GTP H;  4OO1 H;  1HFN A;  5FOB B;  4QIW E;  2GJR A;  1YJ9 B;  1K28 A;  1SAP A;  2IHE A;  5TSS A;  4RPB A;  1VQK A;  1ILP A;  1EP3 B;  1Z7T A;  1BNZ A;  3CMA A;  2F3V A;  2O2L D;  2VB3 X;  4EVO A;  1D2B A;  3OMG A;  4RJL A;  3A8K A;  3TZD A;  3HOY H;  1PYB A;  2EOT A;  1Y8P B;  4YWL A;  3G71 B;  4FK8 A;  3DWA A;  3RD4 A;  5L46 A;  3OJW A;  5AFW A;  1B1Z A;  4QY7 A;  1LO5 D;  1Y8N B;  3R2T A;  1W9X A;  2XSC A;  4OXP A;  5CV9 A;  4P2C B;  5H59 A;  1W2B B;  1HPC A;  3T1H Q;  1QUF A;  2QGQ A;  1PRT D;  4PZ7 A;  2F0Q A;  2SEB D;  2K04 A;  4Y7N H;  1NRK A;  4OPV A;  1UD4 A;  1YJN B;  5DEH A;  2V31 A;  2ZBV A;  2M9V A;  3NXW A;  4DV5 L;  4FXG C;  3QO2 A;  4GS3 A;  4F7X A;  1IZ6 A;  1A15 A;  4RD0 A;  5CR3 A;  2NTT A;  5BSY A;  1A8V A;  2JA8 B;  5FKA C;  2ZTD A;  2FVG A;  3AB9 A;  4P6V F;  1TTT A;  4X3S A;  3R93 A;  2F0O A;  3JAM E;  1BF4 A;  1XWE A;  1DAR A;  1ZKO A;  1QB5 D;  1VCI A;  1E0B A;  4U9U A;  1STA A;  1SFO H;  2G5D A;  2ZXR A;  4JBW A;  1YHQ A;  3IAY A;  3F2C A;  3S2H H;  4RM0 A;  4A3G G;  4GKK Q;  1PH9 A;  2GK7 A;  4LWC A;  3J81 E;  2E1R A;  5C4X H;  4OHJ A;  1FX0 A;  2O5I C;  1CUK A;  1I3Q B;  3TME A;  1GVP A;  4IQZ A;  1G91 A;  1EY6 A;  3I91 A;  4IFD I;  1VQO B;  4KKU A;  4Q7J B;  1CQF A;  2Q8R E;  2AQ3 B;  2VZA A;  2GK6 A;  4XLA A;  4IN3 A;  3SLD A;  4A3L H;  4DUZ L;  5DSZ A;  5IGE A;  1D1N A;  2WSS A;  4NXM Q;  2JA7 B;  3DHQ A;  1PH3 A;  1A63 A;  4X66 Q;  2LSS A;  1XJV A;  1VQ5 A;  4AQY Q;  2YWH A;  4QGU A;  1H9R A;  4P6Y A;  1YEZ A;  2K52 A;  4DQK A;  4B3X A;  3CU7 A;  3NK9 A;  4G57 A;  2X8K A;  5JBQ A;  2JA5 B;  3K0X A;  3CCR A;  3TS0 A;  4QL5 A;  2Q8T A;  3RLO A;  1COW A;  2KVO A;  2KCM A;  1I94 Q;  2JJ1 A;  3K8A A;  5JJL A;  1G7R A;  4DXF A;  2F3W A;  2ZL5 A;  4IUT A;  5LMN W;  3ULP A;  1Z6H A;  2IT1 A;  2B63 B;  1DZ1 A;  4M1K A;  2DET A;  4DNI A;  1DJR D;  3I7F A;  3KLR A;  1D8L A;  5T1I A;  3OZV A;  4TSF A;  4IJL A;  1KK1 A;  5HY6 A;  1RIP A;  1Y1V B;  2K5V A;  2Y0S E;  1VQ4 A;  1RKN A;  2ZTG A;  3P27 A;  1MKH A;  2UUB L;  2F0N A;  3AQQ A;  5ELN A;  4XR6 A;  4A75 A;  1R5N A;  4DR5 Q;  1W0K A;  2KCN A;  2LXK A;  4BBS B;  3BU2 A;  4K0K Q;  1SMY C;  4J15 A;  4A3K B;  3M7G A;  1B4O A;  1N8R C;  3W3A A;  1EIF A;  1ROD A;  1UMK A;  2OBS A;  4Z4Z A;  3A74 A;  4DR7 L;  4BA1 I;  3PF4 A;  1KTV A;  4BY7 H;  2NN6 I;  2QEX B;  2XWJ B;  1Q7Y D;  4DUY Q;  1GUO A;  1QOH A;  2OQK A;  1R9T B;  3P1H A;  1LM0 A;  4O0A A;  4I65 A;  2F0H A;  2D3N A;  1IJE A;  3I8Z A;  3OJX A;  3MC0 B;  3KFU A;  2K5W A;  4C2M H;  4HIO A;  3LVB A;  3HKS A;  1ZYR C;  4QJF A;  3NTH A;  2LS0 1;  1WTQ A;  4B48 A;  1IL8 A;  1X3F A;  3ND8 A;  2B39 A;  1WD0 A;  4LBV A;  3B6Y A;  1U2R A;  2RSO A;  3ASQ A;  2EFG A;  1MJC A;  4R71 A;  4H0L C;  2C2W A;  2DJG C;  1LTA D;  4KHP Q;  2PMZ E;  4C3H G;  2UXB L;  1N34 L;  3W2E A;  3CC4 B;  1VS0 A;  1GUG A;  5IGB A;  3FHW A;  5COR A;  3PIP 3;  1RQR A;  1BBU A;  3IFT A;  3DM1 A;  3H0G G;  4J1M A;  1NAP A;  1N33 L;  1NBW A;  1PH7 A;  1VQP B;  2DIE A;  3MHB A;  3SK5 A;  1WOR A;  1IHM A;  5AJ3 L;  1TII D;  3R6J A;  4DAP A;  5EBD A;  4OOX A;  2NVT B;  1S5F D;  2VL6 A;  1CHQ D;  2JQO A;  4NDX A;  5J1Z A;  1VQK B;  3VO2 A;  1H8H A;  3DLL A;  3CMA B;  3S1M H;  2SNM A;  3N6R A;  4BXX H;  1O80 A;  2PO4 A;  1E64 A;  1WPC A;  3CCJ A;  4JI4 L;  4L5T A;  2Z1C A;  1GJX A;  1PZI D;  4EQ5 A;  2K14 A;  3TDQ A;  2Z4I A;  3L0O A;  4JI1 Q;  1IBK L;  1A3V A;  3MXN A;  2BE5 D;  4OOV A;  1NE3 A;  2K75 A;  1XPU A;  4RH6 A;  4X64 L;  1Y69 U;  1HZA A;  1K3R A;  5A88 A;  2NTS A;  1JT8 A;  1T6Y A;  4LF9 L;  4RDL A;  3OW2 A;  1PJ6 A;  1Y0R A;  1OO9 B;  3ASS A;  2GN5 A;  2YTY A;  3VR5 A;  2H5X A;  1SM4 A;  4A93 G;  3GP7 A;  2AQ1 B;  4PC2 A;  1E1O A;  4JI0 Q;  3MHP A;  4XN0 A;  2XTI A;  4LUZ A;  4MTN A;  5EPJ A;  4Q5V A;  1SNO A;  4YHB A;  4KKT A;  1BQE A;  3AVY A;  4KKS A;  3OIQ A;  2XGJ A;  4ZGN B;  1HR0 Q;  3BYY B;  4DV3 Q;  1HA6 A;  4PMB A;  3H94 A;  1O7L A;  1YX2 A;  3UI2 A;  2XNC A;  3PUM A;  4QUZ A;  5H5J A;  5M3M G;  1ESF A;  4A3D B;  2ZXI A;  2BCO A;  2KUM A;  3E0E A;  3OEE A;  1CSQ A;  3RMH A;  1YNJ C;  1LTS D;  2D9R A;  1UEB A;  2OBR A;  1YHQ B;  3SEJ A;  2EY5 A;  4KN4 C;  5C4J B;  3Q0A A;  4MHE A;  3SDZ A;  1QGA A;  3CC2 A;  1EQV A;  5E4X A;  1V9P A;  3TSS A;  4XQJ A;  2A69 D;  3NWS A;  2X6L A;  3DWQ A;  3D26 A;  4GKJ L;  1CTM A;  4LJZ C;  1KD1 C;  2C77 A;  4RKL A;  4ME5 A;  1VDZ A;  1NBM A;  4AVZ A;  1PFB A;  4RD1 A;  3A5U A;  2W6I A;  5CV7 A;  2UXC Q;  2J7K A;  1D7Q A;  5JVH 3;  4QHY A;  1B2R A;  1HCZ A;  4KN7 C;  3RLN A;  3IL8 A;  2X69 A;  3M9B A;  2L11 A;  3NQI A;  1VQ5 B;  3H09 A;  5EKL A;  1YIT A;  1N06 A;  2FIN B;  1VQJ A;  4NBS A;  3CCR B;  5JEA J;  2R6G A;  4TMT A;  1IYJ B;  4YAL A;  2F0G A;  1K73 C;  3H3V C;  1VQL A;  3KDF A;  4DR5 L;  5IP9 G;  3RZD B;  2BH2 A;  3E0J A;  4GLV B;  4X3T A;  4DV7 L;  2Z6B A;  4P22 A;  2E2J B;  1ENC A;  5IYR A;  3KBG A;  2G9H D;  1JJ2 A;  3VYR A;  1D6E C;  2PI2 E;  4B43 A;  3CD6 A;  3S1Q H;  3Q22 A;  1FNB A;  1JQY D;  2HDL A;  2ZZQ A;  5KNC A;  1VQ4 B;  3A0J A;  1BPL A;  1BBX C;  2TSS A;  1DYQ A;  3PCO B;  4YHH L;  3ZBT A;  3HS0 C;  1UD6 A;  4UP7 A;  3NBH A;  5KEE A;  1FNC A;  4ABN A;  3HOW G;  5CBA E;  3MTS A; 
#chains in the Genus database with same CATH homology
 2BOS A;  1NR4 A;  2ICE C;  1E2V A;  1M4V A;  2E2I B;  2B2V C;  4JK1 C;  2YYZ A;  1STN A;  1UD8 A;  4GQN A;  4M1U B;  4C3J G;  3QIA A;  4HSV A;  1EY4 A;  2TMP A;  1E2Z A;  1R4Q B;  3MZ5 A;  2VUM B;  3VR6 A;  3FEW X;  4CJ2 C;  3DDY A;  4XXE A;  1DOM A;  3BYT B;  5COY A;  2EYJ A;  2WP8 J;  2ENB A;  3PO2 B;  2K7V A;  4IUP A;  1F9R A;  2X6G A;  4HSP A;  4ZLT F;  4E0F A;  2J0T D;  3QJY A;  2G9D A;  4RCO A;  1V0F A;  4N9P A;  2F0P A;  1LAB A;  1IW7 C;  3A8J E;  3U9O A;  1H9J A;  4DGZ A;  3JU4 A;  1W6K A;  3NP8 A;  1EU3 A;  2GA4 B;  3T53 B;  1STB A;  1VF5 C;  1ONL A;  2KOL A;  2IL8 A;  4N9T A;  4A3I B;  3LNN A;  2QF7 A;  4J6H A;  2JA6 B;  1VMC A;  4FF4 A;  1PMR A;  2XZO A;  3BVG A;  1HQR D;  3HAG A;  1STG A;  4KHV A;  4XLH A;  5K36 G;  4G4K A;  1HRJ A;  2F0T A;  1W6J A;  3K59 A;  4ILW A;  1E79 A;  4H44 C;  3DMU A;  2ZT9 C;  1SNP A;  4Z9C B;  1VF7 A;  4YIJ A;  4CHT B;  2VB2 X;  1BXT A;  1MSG A;  4ZAI A;  3KUP A;  2L4N A;  3A7L A;  3VR4 A;  5C0X J;  1SXT A;  1KLU D;  1O7Z A;  4DNR B;  5NUC A;  5KGU A;  4XL9 A;  2LZJ A;  2XND A;  2IWH A;  2EYH A;  3FPP A;  1U9R A;  3TP6 A;  4IUQ A;  4FYD A;  1I18 A;  1STH A;  2OXP A;  4RAU C;  2WIN B;  4OIK A;  2F1M A;  1R4P B;  3IFD A;  4KHZ A;  4GZY C;  1D5M C;  1EFR A;  5IGC A;  2R93 B;  4XQN A;  1A2T A;  1JWM D;  4OO1 G;  2A6E C;  4G7X A;  4V0B A;  3ERQ A;  2NYZ D;  4ASU A;  5HKK A;  1C8C A;  4A3G B;  3H91 A;  4Q0F A;  3CQZ B;  1SNC A;  2RDG A;  4XLE A;  2AQ2 B;  2D62 A;  3K7A B;  4I7Z C;  2EZV A;  2KEC A;  3MXP A;  1WTR A;  4C3I B;  4PQX A;  2A73 B;  4HED A;  2NZ1 D;  4UZU A;  3I72 A;  1AN8 A;  3GTL B;  1KDB A;  1YNN C;  2ZTN A;  1SND A;  4B3G A;  2R9V A;  1EWC A;  3VR2 A;  5LL6 S;  2AWN A;  1PXU A;  4RCN A;  2PPB C;  2K33 A;  1WTX A;  1EEI D;  4ZUJ A;  3PUY A;  2XIW A;  1DON A;  3WOE A;  1SBB B;  2F0U A;  1PZK D;  2XNA C;  2E2H B;  3HG9 A;  4DAY A;  1KAA A;  3M7N A;  5C5M A;  1H9M A;  2EY1 A;  2SOB A;  2JDI A;  3T4A C;  1TR5 A;  1JCK B;  5IGD A;  2EJF C;  4CBV A;  3K5M A;  4PMW A;  3ZPN A;  3PUW A;  2IW3 A;  5EGT A;  1EFI D;  1K8O A;  1W0J A;  3TP7 A;  2EVB A;  4H7B A;  5EPL A;  2ZXP A;  2EYL A;  2A6H D;  1VLY A;  5CYU A;  1JOR A;  4C3H B;  4KK7 A;  3S9W A;  5JPM C;  3I73 A;  3GTK B;  3H0G B;  1JE4 A;  3FKI B;  5JEA H;  3P7J A;  1SE3 A;  5FLX L;  1QCB D;  4K5V A;  4RHS A;  3OW7 A;  3WOF A;  2HLD A;  1OXU A;  2KA7 A;  1PTO H;  3MEH A;  1ET9 A;  5I9O A;  3BDO A;  1F2M A;  1CHP D;  3A56 A;  1IYU A;  1MAB A;  1TT2 A;  4J8Q A;  4ZYS A;  3L3O C;  5BN5 A;  5HGT A;  1BCP F;  3HGB A;  4CJ0 B;  1PFN A;  3NUC A;  4A93 B;  5EJW A;  1VJS A;  1V0E A;  3EJI A;  4BS9 A;  2QE7 A;  4DF7 A;  4HIZ A;  2CK3 A;  1SJE D;  1I4X A;  1ENF A;  2PW5 A;  1Q1E A;  4UAI A;  1RDP D;  5M3M B;  2WV6 D;  4ID6 A;  1GXD C;  1Q3L A;  4WRD A;  2RSN A;  1EL0 A;  1TQO A;  4HCS A;  1I50 B;  2DN8 A;  1LTG D;  3SVM A;  2BA1 A;  1CI3 M;  2XOK A;  2F4I A;  3ND9 A;  4QB4 A;  1V1O A;  3SK8 A;  3URY A;  1OXT A;  2VJI A;  4TT3 A;  2XWB B;  3A7A B;  2W6J A;  5C6A A;  3RZO B;  1GUT A;  5CC4 A;  2X6Y A;  1AFP A;  4K8J A;  4ZRZ A;  5FO7 B;  1K28 D;  5KNL A;  1T5X D;  2YU9 B;  3ZIA A;  3KLS A;  2L1B A;  1GHJ A;  2AUK A;  4OIJ A;  2EYP A;  3S1R B;  3Q24 A;  1DCZ A;  2IX3 A;  1NCV A;  1F9P A;  4G7Z C;  3HOW B;  4X3U A;  2EY2 A;  4BA2 I;  2F0F A;  4B9W A;  4OL7 A;  1SYE A;  5A2Q L;  2K5Q A;  3E5S A;  3GVK A;  5JAV A;  3K5L A;  1RF2 D;  4C3J B;  4QUC A;  5IOD A;  2K03 A;  1V43 A;  1JIC A;  2QKI C;  2IX1 A;  2L55 A;  1LTI D;  2K32 A;  3GO5 A;  3SR1 A;  3SK4 A;  3X3N A;  1SYF A;  5C3W A;  3AMU A;  1CZG A;  1J8I A;  2CW0 C;  2CQA A;  3NQT A;  3NBI A;  1EYC A;  4HCE A;  2D9U A;  3DXJ C;  5C0X H;  1S4Z A;  2IJ0 A;  5DN6 A;  3K6O A;  5ELD A;  1LV9 A;  1G2T A;  2WAQ B;  2B2Y A;  1BOS A;  4ZUI A;  4BWG B;  5EPK A;  1PTO D;  2EYF A;  4RWS C;  2A5H A;  3M4O B;  1BLI A;  5C3X A;  4K5W A;  4K2K A;  3VYT A;  2R7Z B;  4C1N I;  4IFD J;  5E4W C;  1JWU D;  1TWC B;  2BDN A;  1Q90 A;  2DY8 A;  2PCF B;  1F2L A;  3DEP A;  3M4Y A;  4K5X A;  4A3J B;  3CMM A;  4XN3 A;  4WFN 3;  1HQM C;  1SKY B;  1QE6 A;  4IUN A;  2RA4 A;  4XT3 B;  4OO1 I;  5BN3 A;  2WJY A;  4XD7 A;  4U68 A;  1YNN D;  2M2L A;  1VMP A;  2VJJ A;  4ZQ3 A;  1F9Q A;  2F0I A;  4A3M B;  5ELF A;  3MA2 B;  5EKK A;  1PRT F;  5HUR A;  4L8J A;  1QWY A;  3T51 B;  5C4H A;  3V96 A;  5EQ0 A;  1XTC D;  3VA7 A;  3L7Z C;  5CDF A;  1ML0 D;  5I9P A;  2WZP P;  1CFM A;  3ONA B;  2Z4H A;  1SDF A;  3S17 B;  1STY A;  2JP1 A;  4KI0 A;  2NWG A;  3VYS A;  3VYU A;  2FJ2 A;  3Q6S A;  4DK1 A;  3D6C A;  3MXU A;  3WQZ A;  2NVQ B;  3GTM B;  1C4Q A;  4II2 A;  2MP1 A;  5D14 A;  3RLF A;  1D1K A;  3KBX A;  4Z1M A;  1TWH B;  2JEB I;  2PZU A;  5EBC A;  1U4P A;  2I07 B;  2XRQ D;  2GJK A;  2EJM A;  1HA5 A;  3MVV A;  2HCC A;  2WJV A;  1O78 A;  4RFB A;  3HOY B;  2FMM A;  2WII B;  1ESR A;  2KEE A;  2KHS A;  3A35 A;  1SJH D;  4KY5 A;  1H9K A;  3D6W A;  3TN2 A;  4B9X A;  4Y7N B;  5KRU A;  2L9H A;  5CGK A;  3M85 A;  4RA8 A;  1OXX K;  3E6Z X;  1ZXT A;  4G7O C;  5KYI A;  3FVQ A;  3A3G A;  3PUZ A;  1DM0 B;  1V8Q A;  1HTL D;  3Q23 A;  3IKJ A;  3HOU B;  3NHH A;  3NE5 B;  1SFO B;  2K1B A;  2K5D A;  1BQQ T;  1EWH A;  2RDF A;  3S2H B;  2F03 A;  2Z6B D;  4YEL A;  2NB0 A;  1PTO F;  2K6A A;  3ZYY X;  2E74 C;  4LK1 C;  5C4X B;  2C5C A;  4LMQ D;  1XX8 A;  4KY7 A;  4XDX A;  4IZ8 A;  2K05 A;  4CKC A;  5IGF A;  3HKZ B;  3WDN A;  3SK6 A;  5KIX A;  1F2Y A;  2O5J C;  3R3O A;  1DXM A;  4QCL A;  3OWE B;  3QWN A;  2I46 A;  3J80 E;  2HUG A;  3FRP B;  3LX0 A;  3A8K E;  3OIP A;  2NVX B;  4XQF A;  3BVZ A;  1SSO A;  5FLX E;  5G3L D;  1QIL A;  3CRL C;  5C4Z A;  4C56 C;  5M9O A;  1KLG D;  4QIW B;  3J7Y W;  4BY7 B;  2WKC A;  3QOL A;  1SMY D;  2EPB A;  3F2U A;  2JE6 I;  2B2U C;  3OMC A;  1EZ6 A;  4C2M B;  1FNV A;  3RUZ A;  2WAC A;  1E1R A;  1LT3 D;  1II3 A;  2X6X A;  1TS3 A;  4FF3 A;  4XYQ A;  4HMI A;  3KK7 A;  1MBY A;  1SNM A;  1ZYR D;  2EDG A;  5I4D A;  5JVG 3;  1HUN A;  2ZZG A;  2PYK A;  1U4M A;  3K0Y A;  3NTI A;  1WTO A;  1MD2 D;  1E3X A;  1HTP A;  1EIH A;  1B2T A;  4EQP A;  4FO2 A;  4HTH A;  4XLF A;  1RTN A;  2ID0 A;  1TVX A;  1TS4 A;  5JEA G;  3NPP A;  3S1M B;  4HMJ A;  3GVL A;  1T5E A;  4KY6 A;  1LTR D;  3P20 A;  4B3F X;  1SYB A;  4WOR A;  5ELB A;  2PW7 A;  2PZW A;  2VXW A;  3PUV A;  1F77 A;  3DEO A;  2D3L A;  4IFD H;  2B8G A;  1A3U A;  1OXV A;  5CMD A;  4FNF A;  3VA5 A;  1UD5 A;  1DOK A;  1C48 A;  1EQT A;  3LWE A;  1JC7 A;  1EU4 A;  4IUR A;  1E2W A;  4NNJ A;  1A2U A;  3BG3 A;  4G7W A;  1Z47 A;  1I4Q A;  4TSS A;  3S16 B;  5CV8 A;  1F9S A;  4TQU S;  3I70 A;  2V4D A;  2LMC B;  4IAL A;  3PV0 A;  1B44 D;  1Q12 A;  5I6Y A;  3KEW A;  1NSN S;  1YNJ D;  2LKV A;  3C3L A;  4DN4 M;  5KND A;  1HZE A;  2JEA I;  4K14 A;  3CKI B;  5ELC A;  1I6H B;  1BCP B;  1PDQ A;  1A6X A;  2B2Y C;  1I4H A;  1EY8 A;  2NN6 H;  2MJ8 A;  3HRZ C;  1TS2 A;  4WJW A;  3D8G A;  1JR0 D;  2RVL A;  2RDH A;  4XOP A;  4K6D A;  1B53 A;  3LWU A;  3BVM A;  3MAQ A;  1WTV A;  3R8B A;  1TWA B;  2O4X A;  4FXD A;  1UEA B;  4RGM A;  2OT2 A;  3BH4 A;  5IIF A;  2WKD A;  1GOZ A;  1D5X C;  3ITP A;  5M5Y B;  2AWO A;  1OHH A;  5A35 A;  5KYL A;  2PZT A;  1EYA A;  1KDC A;  5J22 A;  4DK0 A;  3T13 A;  1FNU A;  2L5T A;  1EY7 A;  2M00 A;  1QNU A;  3CRK C;  4XOT A;  3OEH A;  1I6V C;  5C3E B;  3KF8 A;  1DOL A;  3HOV B;  1KNE A;  1JOQ A;  3HP3 A;  5C0X G;  4G7H C;  1LT6 D;  4A3E B;  1O7Y A;  3S1N B;  4NKL A;  1FD7 D;  3T56 B;  1AEX A;  1LTB D;  2F0V A;  3M3Y B;  3GVJ A;  3D31 A;  3BDL A;  3EA6 A;  2B2T A;  1IKM A;  2B2U A;  1F2Z A;  3R2I A;  1UAP A;  1CZW A;  1WVL A;  2X6W A;  5CV4 A;  1IW7 D;  1FNW A;  1STE A;  2B8F A;  5K5P A;  2IPK D;  5J39 A;  2F43 A;  3GQB A;  1MSH A;  2A74 C;  1WTP A;  4K6L A;  3S14 B;  3FDT A;  1BR9 A;  4DA2 A;  1PFM A;  4X3K A;  4TKO B;  4KTA A;  4BY1 B;  1KNA A;  2XRS D;  1EEF D;  4FP5 D;  5JPN C;  1LTT D;  1S5D D;  1TY2 A;  3K5N A;  3SE0 A;  3FPU B;  1E43 A;  3C1F A;  2NUC A;  1CQV A;  1GUN A;  1JB3 A;  1HHV A;  1LT4 D;  2EE1 A;  2JSO A;  3H6M A;  2JXM B;  2BDO A;  1V1P A;  2E1B A;  4XMY A;  4C3I G;  1Q8I A;  5CV6 A;  2F0E A;  1MI2 A;  3BDC A;  1GHK A;  4FVM A;  2BA0 A;  4F87 A;  1CT1 D;  1M8A A;  1MGS A;  1FGB D;  4CGY B;  4HR7 B;  3I4M B;  2SDF A;  1L0Y B;  4HN7 A;  4XT1 B;  4L63 B;  1UD3 A;  5D65 A;  3TZU A;  1ZEQ X;  3K58 A;  2WB1 B;  2F0L A;  1TS5 A;  1PRT B;  2FMC A;  3MWY W;  1BCP C;  4E6I A;  1TY0 A;  1H9S B;  3L9A X;  2IX0 A;  2HCI A;  3AU7 A;  4XOR A;  3MFG A;  4K2L A;  1E3Z A;  2HQE A;  2ZXH A;  2A6E D;  2EYM A;  5IT9 L;  1TWF B;  3OPO A;  1SEB D;  4A3F B;  1RCV D;  3GV3 A;  1EIG A;  3OWF A;  3SXH A;  1B9N A;  4XKW A;  1WTH D;  2MGS A;  4R9W A;  2K28 A;  4LAA A;  2PNR C;  5T1G A;  5DAU A;  2F0J A;  4TRD A;  1SYD A;  3U9S A;  3G05 A;  3W2D A;  2KED A;  4M8A A;  5C44 B;  4ULL A;  1RD9 D;  1EY0 A;  2E75 C;  2Q8I B;  5DM7 3;  5DNF A;  4RGN A;  2K01 A;  2D2C C;  1G29 1;  5IK2 A;  1JWS D;  5E3F A;  5FK9 C;  1EY5 A;  3I3C A;  3J7A F;  1J9O A;  2R92 B;  4NMZ A;  4ZK9 B;  3I4L A;  1D1I A;  4NW2 A;  1Y8O B;  2ICI A;  3G7L A;  2MUY A;  4CJ1 B;  2R3Z A;  4RHR A;  3DUZ A;  1KZL A;  1UNS A;  3V2T A;  1SNQ A;  1E1Q A;  1RJT A;  3CP8 A;  1DD2 A;  5I6W A;  2A68 C;  3SEB A;  3JAM L;  1U4L A;  3BC9 A;  2EYO A;  1BO0 A;  4DFA A;  1JOK A;  3FMC A;  2F0W A;  1B3A A;  4RKB A;  1B9M A;  1Q1B A;  5LHY 1;  3J81 L;  3S2D B;  1V1P B;  2LFN A;  1PTO B;  1KTK A;  5JOB A;  1OXS C;  2ZZF A;  3BCD A;  1BUV T;  5FL7 A;  4L6T B;  3GTP B;  2MHV A;  3PMF A;  1BDO A;  1I4R A;  3PO3 B;  1RHP A;  4XKV A;  4F8M A;  2A6H C;  2DNC A;  1GUS A;  1WP6 A;  1HXY D;  1EY9 A;  2KQ3 A;  1FYC A;  3OHX C;  1NUC A;  1WD1 A;  1OB0 A;  2QDB A;  3OSO A;  3DWP A;  2KVM A;  4YXW A;  5FO9 B;  1AW7 A;  2XZP A;  1XYI A;  3GD7 A;  3V05 A;  5LL6 X;  5CV5 A;  1PLF A;  2EJG C;  1LAC A;  4QUF A;  5ELE A;  1CA5 A;  1QNK A;  1G2S A;  1NR2 A;  3GTJ B;  3HOX B;  4S3S A;  3K57 A;  3X3M A;  1PKV A;  1LLR D;  4CKB A;  4C1N K;  3CES A;  2HDM A;  2NVY B;  4IUV A;  2J7Z A;  2NBF A;  2JJ2 A;  2FFK B;  2OF1 A;  2E76 C;  2PQE A;  2XVS A;  2N88 A;  3T16 A;  2EY6 A;  1QG7 A;  4MN3 A;  4BBR B;  5C0X I;  1XXG A;  1CK1 A;  2ZXO A;  3P75 A;  1PRT C;  2B2W C;  3TP5 A;  4KD3 A;  2D5D A;  2M5S A;  3BS1 A;  4II3 A;  4IFD G;  1ILQ A;  3I90 A;  1AP0 A;  1S5B D;  5D3I B;  2Z8L A;  1U4R A;  3A3B A;  5M5W B;  4K8I A;  2V7Q A;  3PUX A;  2X85 A;  2WPD A;  1L0X B;  4KJO A;  4FXU A;  3OFN A;  4HAE A;  3GV6 A;  2RBM A;  1RTO A;  4XON A;  3C2P A;  4XNF A;  3J7A V;  1Y1W B;  3EQL C;  4XQQ A;  3GTQ B;  3EVQ A;  1S5E D;  3O13 A;  4DAV A;  1K8M A;  2JYO A;  3GTO B;  1AZQ A;  1A3T A;  3N52 A;  4RGT A;  1X32 A;  4R8N A;  3S15 B;  4O42 A;  1G6Z A;  4KJN A;  4DU9 A;  4H13 C;  2B2T C;  2NN6 G;  1PZJ D;  2F0S A;  4DXG A;  4QF4 A;  5C5L A;  1SYC A;  3G6J B;  3GTG B;  2JIZ A;  2RKS A;  5KNB A;  1WTW A;  2ZZE A;  3D4D A;  5M3F B;  3K5O A;  2E2D C;  1ET6 A;  4FF1 A;  2CW0 D;  2H1E A;  3NWT A;  1KDA A;  3C46 A;  1I8D A;  5IGG A;  2AUJ D;  2F0D A;  3TP8 A;  1BCP D;  4R8I A;  4ODG A;  5ISR A;  3EFX D;  1WCM B;  3A55 A;  4MIU A;  3OE7 A;  1X3Q A;  4XM3 A;  3SHL A;  4DNT B;  2X53 S;  1AZP A;  2N55 A;  4U67 3;  1ICW A;  4XIG S;  1EZ8 A;  2DY7 A;  2OEO A;  4KV6 A;  4NP5 A;  3BCF A;  4ZKB B;  1I4G A;  3VR3 A;  2H4O A;  4AYB B;  3D4R A;  2CHB D;  3CHB D;  3TBI B;  3OAA A;  2F0M A;  4UDU C;  1QJO A;  5F2D A;  1JOO A;  3CP2 A;  4F88 A;  1HFG A;  4PV1 C;  5BN4 A;  1SE2 A;  1B50 A;  4JMQ A;  2QIL A;  1PYW D;  2MPM A;  2QEJ C;  3KLS X;  3QG1 A;  4V19 0;  1BMF A;  1PTO C;  2DNE A;  4PNY A;  3C1E A;  1GUW A;  3FKS A;  5M5X B;  2KJX A;  4KD4 A;  5I2Y A;  4RGO S;  4YEJ A;  4EQN A;  1ENA A;  5D3D A;  4FXK C;  4IUU A;  4CKE A;  1TKW B;  1H8E A;  1KMH A;  2C9O A;  2BE5 C;  2F0K A;  2Y0S B;  4EGV A;  1TU2 B;  1EOT A;  1I4P A;  5EKI A;  5A2Q E;  1HVX A;  3D3R A;  5I2X A;  1HUM A;  3A54 A;  4QMG A;  2L12 A;  5JJZ A;  3ERO A;  4O1N A;  2LY7 A;  1KAB A;  2B2V A;  5FO8 B;  3MXG A;  1K83 B;  1G8Z D;  4PMC A;  2R61 A;  1SYG A;  5K36 H;  4KMU C;  1UD2 A;  3MFY A;  1FR3 A;  2A68 D;  2RQX A;  2QCP X;  3QB3 A;  3PIO 3;  1UUP A;  3NTK A;  1EYD A;  3NSW A;  1SE4 A;  5CBE E;  3S1Q B;  3HOZ B;  3OOC A;  2EXZ A;  3BZD B;  2A69 C;  4ZKC B;  4XTC S;  2PMZ B;  4A3B B;  2L0C A;  3QOJ A;  2GJP A;  1LT5 D;  2B2W A;  3HZX A;  5IOC A;  1D5Z C;  4XYO A;  1S5C D;  4FF2 A;  1H9S A;  1IHZ A;  1X3P A;  3D4W A;  1CM9 A;  2KCC A;  5DM6 3;  5IT9 E;  4XLC A;  4OGQ C;  3I4N B;  2FHT A;  2XZL A;  5G3L F;  3J80 L;  4EQO A;  3HEJ A;  2J4X A;  5E1F A;  1IYV A;  4G6I A;  2VNU D;  1TWG B;  2SNS A;  2XN9 C;  4B08 A;  1IKL A;  2CVR A;  3A8I E;  1CA6 A;  4OO1 H;  1HFN A;  5FOB B;  2GJR A;  1SAP A;  5TSS A;  1ILP A;  1Z7T A;  1BNZ A;  2F3V A;  2O2L D;  2VB3 X;  4EVO A;  1D2B A;  3OMG A;  3TZD A;  2EOT A;  1Y8P B;  3DWA A;  3RD4 A;  5AFW A;  1B1Z A;  1LO5 D;  1Y8N B;  3R2T A;  1W9X A;  2XSC A;  5CV9 A;  4P2C B;  1HPC A;  1PRT D;  2F0Q A;  2SEB D;  2K04 A;  1NRK A;  1UD4 A;  5DEH A;  2V31 A;  2M9V A;  3NXW A;  4FXG C;  3QO2 A;  4F7X A;  1A15 A;  5CR3 A;  2NTT A;  2JA8 B;  5FKA C;  3AB9 A;  4X3S A;  3R93 A;  2F0O A;  3JAM E;  1BF4 A;  1XWE A;  1ZKO A;  1QB5 D;  1VCI A;  1E0B A;  1STA A;  2ZXR A;  4JBW A;  3IAY A;  2GK7 A;  3J81 E;  4OHJ A;  1FX0 A;  2O5I C;  1I3Q B;  3TME A;  4IQZ A;  1G91 A;  1EY6 A;  3I91 A;  4IFD I;  4KKU A;  1CQF A;  2Q8R E;  2AQ3 B;  2GK6 A;  4XLA A;  4IN3 A;  5IGE A;  2JA7 B;  2WSS A;  3DHQ A;  1H9R A;  3NK9 A;  4G57 A;  3CU7 A;  2X8K A;  2JA5 B;  2Q8T A;  1COW A;  2KVO A;  2JJ1 A;  4DXF A;  2F3W A;  4IUT A;  1Z6H A;  2IT1 A;  2B63 B;  1DZ1 A;  1DJR D;  3KLR A;  5T1I A;  4TSF A;  1Y1V B;  1RKN A;  2ZTG A;  2F0N A;  4XR6 A;  1W0K A;  2KCN A;  4BBS B;  1SMY C;  4A3K B;  3M7G A;  1B4O A;  3W3A A;  1ROD A;  4BA1 I;  2NN6 I;  2XWJ B;  1GUO A;  1QOH A;  1R9T B;  3P1H A;  4I65 A;  2F0H A;  2D3N A;  3I8Z A;  3MC0 B;  2K5W A;  1WTQ A;  1ZYR C;  3NTH A;  2LS0 1;  1IL8 A;  3ND8 A;  2B39 A;  1WD0 A;  2RSO A;  4H0L C;  1LTA D;  4C3H G;  5IGB A;  1GUG A;  5COR A;  3PIP 3;  3IFT A;  3DM1 A;  4J1M A;  1NAP A;  2DIE A;  3MHB A;  3SK5 A;  1TII D;  4DAP A;  5EBD A;  2NVT B;  1S5F D;  1CHQ D;  4NDX A;  5J1Z A;  1H8H A;  2SNM A;  3N6R A;  1O80 A;  2PO4 A;  1WPC A;  2Z1C A;  1GJX A;  1PZI D;  3TDQ A;  2Z4I A;  1A3V A;  3MXN A;  2BE5 D;  4RH6 A;  1Y69 U;  2NTS A;  1OO9 B;  3VR5 A;  3GP7 A;  2AQ1 B;  4XN0 A;  4Q5V A;  5EPJ A;  1SNO A;  4KKT A;  3OIQ A;  4KKS A;  2XGJ A;  3BYY B;  1HA6 A;  4PMB A;  3H94 A;  1O7L A;  3UI2 A;  1ESF A;  4A3D B;  2ZXI A;  2BCO A;  2KUM A;  3OEE A;  3RMH A;  1YNJ C;  1LTS D;  2EY5 A;  4KN4 C;  5C4J B;  3Q0A A;  4MHE A;  3SDZ A;  1EQV A;  5E4X A;  3TSS A;  4XQJ A;  2A69 D;  3NWS A;  2X6L A;  3DWQ A;  1CTM A;  4LJZ C;  4RKL A;  4ME5 A;  1VDZ A;  1NBM A;  4AVZ A;  1PFB A;  2W6I A;  5CV7 A;  5JVH 3;  1HCZ A;  4KN7 C;  3IL8 A;  2X69 A;  2L11 A;  3NQI A;  3H09 A;  5EKL A;  2FIN B;  5JEA J;  2R6G A;  2F0G A;  3H3V C;  3RZD B;  3E0J A;  4X3T A;  2E2J B;  4P22 A;  1ENC A;  3KBG A;  2G9H D;  3VYR A;  1D6E C;  3Q22 A;  1JQY D;  2HDL A;  2ZZQ A;  5KNC A;  1BPL A;  1BBX C;  2TSS A;  1DYQ A;  3HS0 C;  1UD6 A;  3NBH A;  5KEE A;  4ABN A;  5CBA E;  3MTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...