4DNRB

Crystal structure of the cusba heavy-metal efflux complex from escherichia coli, e716f mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Cation efflux system protein CusB
publication title Crystal structures of the pre-extrusion and extrusion states of the CusBA adaptor-transporter complex
rcsb
source organism Escherichia coli
total genus 56
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00529 HlyD HlyD membrane-fusion protein of T1SS
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4dnrB02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dnrB03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 4dnrB01
4OO1G 3A8KE 4H13C 4JBWA 2A68D 3PUZA 1TKWB 1E2WA 2BE5D 3QG1A 1EWHA 2BDOA 1GUSA 2A6EC 2BA1A 1GUOA 1T5EA 1H9MA 3P20A 5JEAH 2JEAI 4LJZC 2K7VA 3VR6A 4IFDG 1FYCA 1CTMA 1GHJA 1ONLA 2BA0A 3PUXA 2ZT9C 1OXXK 4KN4C 1Q12A 2AWOA 1DD2A 2JXMB 1Y8OB 3D31A 4L8JA 3T53B 1HCZA 2EJFC 3M4YA 2AUJD 2DN8A 3ND9A 4PV1C 3VR4A 3M7NA 1E2ZA 1Z7TA 1E2VA 2EJGC 3PUWA 5BN4A 2K33A 2BE5C 1SMYC 1ZKOA 1YNNC 1O78A 1YNJC 4LK1C 3KLRA 3WDNA 2EJMA 3ND8A 3QIAA 1CFMA 2A68C 1LABA 2A6HD 2E76C 5C0XH 1Z6HA 2JEBI 2B8GA 3LNNA 3A7LA 4KI0A 3VR2A 1GUTA 3N6RA 4KHZA 1IYUA 1LACA 3W3AA 3D4RA 3I73A 1OXSC 2L5TA 2F1MA 4HR7B 1Q90A 4XIGS 2EDGA 2NN6H 2B8FA 4IQZA 2K32A 1Q1BA 3A8JE 3I72A 4JK1C 3PUVA 4OGQC 2IT1A 3VR3A 2Q8IB 1PMRA 1HTPA 2PPBC 4KKTA 1DCZA 1Y8NB 2YYZA 2O5IC 2PCFB 2V4DA 3GD7A 2O5JC 1G291 1V8QA 1CI3M 4DK0A 1B9NA 4DK1A 4H0LC 3PV0A 3MFYA 4TKOB 1OXTA 2A6HC 3QJYA 3U9SA 1GJXA 5KNDA 5JEAG 4KKSA 2A69D 3CRKC 3GQBA 4DNRB 3T51B 1VCIA 4KMUC 5K36H 1K8MA 1O7LA 4DNTB 1H9KA 2EVBA 3PUYA 1A6XA 2E74C 5BN5A 3BG3A 2R6GA 5BN3A 4RCNA 1Q1EA 2E75C 2D2CC 3DXJC 2DNEA 1VDZA 3OPOA 3AB9A 3LWUA 1I6VC 1IYVA 1H9SB 3T56B 4OO1H 1HQMC 5C0XG 4KN7C 4G7OC 2A69C 3EQLC 4XTCS 2PNRC 3VA7A 4IFDH 3FPPA 1OXUA 1IW7D 2JE6I 4BA1I 2KA7A 1DXMA 3OW7A 2NN6G 3OOCA 1V43A 3A8IE 5A35A 5KNBA 1H9SA 1OXVA 3CRLC 1B9MA 2AUKA 3VR5A 3SE0A 3M85A 1ZYRC 1GHKA 1H9JA 1Y69U 2DNCA 2A6ED 3MXUA 5KNCA 3H94A 3IKJA 5K36G 1BDOA 1QJOA 3A7AB 2CW0C 3TZUA 4BA2I 3NE5B 3HGBA 4TQUS 1K8OA 1FR3A 3RLFA 3L7ZC 1IW7C 2D5DA 2NN6I 4G7ZC 2KCCA 3FMCA 1Y8PB 1GUGA 4H44C 1GUNA 4I7ZC 3SDZA 3I4LA 1HPCA 1TU2B 2LMCB 4GZYC 4G7HC 3BDOA 1VF5C 2D62A 3IFTA 1VF7A 4KKUA 2QF7A 1H9RA
chains in the Genus database with same CATH superfamily
4OO1G 1EEID 4H02A 2W6IA 3PUZA 2B5OA 5BR8L 3KYHC 2BA1A 1QNUA 1GUOA 1A2TA 1H9MA 4LJZC 2WAQE 3A35A 1SAPA 4A3FB 2Q6IA 1ENFA 1KDCA 2L0CA 4UP9A 2Z6KA 1RCVD 1NJIC 3GTQH 1AW7A 3M4YA 2IHFA 2EYFA 1KK0A 3E0EA 1SE2A 2UXBQ 5JJLA 1GUWA 1STEA 2PZUA 5J1ZA 1CNFA 1CNEA 1ILPA 2FJ2A 1VJSA 1SSOA 4P1VA 5IP9H 1A3UA 2ZXRA 3Q0AA 5C0XH 2XGTA 1GUTA 3N6RA 2VXWA 1IBKL 4BXXH 1NUCA 3LGJA 1F9RA 4DR3L 2C35B 4HIMA 3ASPA 4M0LA 1PKVA 2NUCA 1PH2A 4NNJA 5KW9A 1LLRD 4QIWE 3ZIAA 3AVUA 5GV8A 1TQOA 3T16A 2J7KA 1CK1A 2ZL6A 5FJ8G 2WJYA 5I9PA 1HFNA 2RDFA 4XNFA 1I4QA 3N52A 1BR9A 3W2FA 2X6WA 3QR8A 1QNKA 4OELB 2QE7A 2Y0SB 5KYLA 3GVLA 1FD7D 1GAQA 1SNOA 2A1AA 4HTHA 1E3PA 1OB0A 5GAEC 4DAMA 1EXMA 1LM0A 2E74C 1FNBA 1JWUD 1RF2D 4QB4A 4BWGB 4RKLA 1P4MA 2XNCA 1C7YA 5AJ3L 1BF4A 1VQNB 2BGIA 4NMZA 2K28A 2CVRA 5CYUA 1X65A 3HOZB 3BDLA 4K2KA 1Q81C 5F4OA 1TVXA 2A19A 2WR8A 2YWFA 5AFWA 5IP9G 5C0XG 3KFUA 3CCMB 1UE7A 5C3EB 1MRZA 5ELOA 4BXXG 2O4XA 1YJ9B 3OFNA 3G7LA 1FJGL 1QCBD 3W2EA 1H42A 1STNA 3A5ZB 1DG1G 2G5DA 1U4LA 4J8QA 3A8IE 4DGZA 2Q2TA 1N32Q 4X66Q 2P3MA 1SROA 4OHJA 3K5NA 4JI6Q 2VS1A 4NDXA 2XRQD 2VBSA 3FEWX 2A73B 3ERSX 3SE0A 2UUCL 3TRZA 5A2QE 3CCSB 2P5ZX 3RR5A 2NBFA 3URYA 4BBSB 1BQQT 1E62A 1AIPA 1WOOA 1UNSA 4GNXB 2N3SA 1WCMG 3KF6B 3G6EB 2JDIA 3A3BA 1CM9A 4LF7Q 4OPSA 1LTRD 3M3YB 2D9UA 3BVMA 3FMCA 3S15B 1N8RD 1HPCA 2LMCB 2HMAA 3NUCA 2WACA 3TS0A 1SFOB 5AN9A 3TP7A 1G7SA 3BCDA 4GN5A 3X3MA 5FLXc 2PQAA 1EIFA 5THXA 2DJFC 2C78A 2QA4B 1I50B 1P16A 2IX3A 4JYAL 2XWJB 4XQQA 1F9PA 3S14B 4DR4L 2RCNA 4YHHL 4DR7L 3EVQA 4B47A 4Y9UA 3CPXA 1LTBD 2Z6KC 4DXGA 2LY7A 1YITA 5LMUL 2OTLA 4IOAA 5CV7A 3W1BA 3WOFA 3SEJA 3QE2A 4LF9L 1MJEA 4TMZA 1CFMA 2A68C 1PA6A 1Z6HA 4IPGA 4B3XA 4LFBQ 5FO1A 4KI0A 1JOKA 4GQNA 4QFMA 4HAEA 2X53S 4BBRH 3J7YW 1RKNA 1G7CA 4R4TA 2HT1A 2JJ2A 2OK8A 2R61A 4X3KA 1NTGA 1CUKA 3GSIA 2NB0A 1J9OA 1MHWC 1SBBB 1CSQA 2OBSA 1EEFD 2OXPA 3PCOB 1Y1WB 3ONUA 1IBLQ 1PJ5A 4WZTA 3PV0A 1EY9A 1OXTA 3M9BA 1PYBA 4PZ6A 4KKSA 3J7AV 1I6HB 4B44A 1K8MA 2QEJC 5FLXE 1VMPA 5FA6A 2F4VQ 4WWVA 4A3IH 1L1OB 2Z0SA 3KLSA 4HCEA 2RC5A 2F43A 5I6WA 4QVAA 4CDEC 2D9RA 5M3MG 1Y1VH 2OK7A 2CNDA 1U5KA 2NVQH 4X7DA 2VQFQ 4XL9A 1I6VC 1IBMQ 2DYIA 2B3GA 3AMUA 1NB0A 4FO2A 1N34Q 1F9SA 3SK4A 4AVZA 4ZCKA 1AE3A 4QF4A 3S24A 3S1MB 1YX2A 1XFOA 1ICFB 2GQFA 1BCPB 1HTLD 4IFDH 1XQBA 3CCUB 4DUYL 2EPBA 4BBRG 1M8AA 2DY8A 1BNZA 1TY0A 4JI8L 3CCRA 3OJXA 1DYQA 2OBTA 1QGAA 1SN8A 2I5LX 5CV6A 1VQOA 2EIXA 3NTIA 3BYTB 4LF6L 1JWSD 1SNPA 3NQIA 1H9JA 4QCLA 1KZLA 2F0IA 1YJNB 5C4JH 3QOLA 4DV7L 1PH8A 4LBZA 2ZJRA 5IGBA 1JORA 3ONYA 3A7AB 5IYDH 1O7IA 4A3IG 3LWEA 5TR9A 3AYHB 2OTJA 2BN4A 3S1QB 1WTWA 4TSSA 4I7ZC 3DEPA 1Y1VG 2E1RA 4G7HC 1VQGA 4HE6A 2D62A 1F9QA 3IFTA 1PH7A 1QUFA 1SMYD 2OF1A 4PC6A 2QF7A 4ME3A 3WQZA 2DUDA 4H13C 4A3KH 3ASRA 3D6WA 3D26A 4EX5A 1JA0A 2JEAI 1M90D 5IP7H 4GKKL 1DDIA 3K5LA 1PTOF 4IFDG 4X62Q 4P74A 1MKHA 3GO5A 2GJRA 1GHJA 2DCUA 1L2FA 2B2UA 2IWHA 2NZ1D 2TMPA 1TT2A 2F0UA 4ZUJA 1HCZA 3CTAA 3K58A 2WKDA 4KD4A 3AVXA 1K28D 2BOSA 5BN4A 2K5WA 1LUZA 1JOQA 1YNJC 1NMGA 2X6XA 4P2CB 4ZUIA 3TP8A 3CMMA 1EIYB 2UU9L 3WY9A 4DR2L 4WJ3M 2C2WA 1KTVA 2F1LA 1QWYA 3A7LA 4HJ8A 3GTLB 5IYDG 2X8KA 1HZAA 1VQ9B 1HNXQ 3FKIH 2ZXOA 3VR3A 1SEBD 2Q8IB 4LBVA 4KKTA 5C3EH 1LO5D 3A74A 2JA8B 4PG3A 4XLAA 3Q39A 1PTOC 5ELEA 1V1OA 5DEHA 2F0PA 4A3KG 1ASYA 4JPBW 1QE6A 2Q8RE 2A6HC 3HRZC 1HFGA 3CCLB 2K75A 3J80c 5IP7G 4TN1A 1HNWQ 1BVSA 3T51B 2K50A 3ER0A 4K5VA 4KHVA 4C3HH 1K73D 3GTGH 1Q8KA 4HJ9A 1W6JA 2Y0SG 4YCWA 2K5DA 1EU3A 3CC7B 2IW3A 4JCVE 1W9XA 1KNEA 2NVTH 4AYBB 1S5CD 3MEFA 2QW7A 2Z4IA 2CQAA 3D4WA 4ALPA 3SR1A 4OPVA 5A88A 5HGQA 2MHVA 2N55A 4RH6A 2JJ1A 1MD2D 4NXNQ 1EY4A 4KD3A 1SFOH 3FKIG 4DNIA 2LS01 1N33L 4DA2A 4CHTB 2PO4A 4RFBA 5C3EG 2I0QA 3AU7A 4FDBA 3M85A 3OAAA 1FRQA 1XNRQ 4HMIA 1EWIA 5I2YA 1STGA 1I8DA 2A6ED 3NWSA 3ISXA 3IKJA 4DAPA 2EIFA 2EE1A 1NNXA 4IUNA 2BM0A 1SLJA 3HOXH 3J80E 4G7ZC 2GK7A 2Q2IA 2CWPA 1W87A 4FF2A 2KCTA 1GUGA 3NENA 1J8IA 1TR5A 3KK7A 4ZAIA 4GZYC 5DLQE 4QUZA 2R7ZB 1N32L 5IGEA 1HZEA 2YWGA 4XKWA 2BE5D 4LFCQ 4R9WA 3ZJYC 1BQEA 4JI6L 5KGUA 1W6KA 2NVYH 4GN4B 3MXPA 2BDNA 4Y7NB 1Y14B 5HZBA 1KRSA 2K7VA 2BSAA 1IKLA 4N9PA 1SNMA 2QDBA 2NZHA 1I4HA 2M00A 4LF7L 2B2UC 5C4ZA 2JSOA 4RGMA 5EQ0A 1V0FA 2PNHA 1PYSB 3ONAB 3ASSA 1BXTA 2JA7H 4A76A 4N8X1 2B29A 1O78A 3DMUA 2ZJQA 4EVOA 5LL6S 3HKZB 3QIAA 3HOUH 2F0EA 2YTYA 4DV0Q 3H3VH 1QVFB 5BSYA 5C3XA 3EROA 1BBXC 5EAYA 1EQRA 1SXTA 5KYIA 2NWGA 1GJRA 2KQ3A 1TTTA 2KBNA 3D6CA 4HR7B 3HOXG 4DR3Q 1COWA 3PUVA 2IT1A 1V9PA 1K83H 1HTPA 2VJIA 1EU4A 3MZ5A 3BS1A 2NVXB 3CC2A 1DM0B 2ZTEA 4P12A 1D5XC 4K2LA 3W5HA 2X6LA 5IYQA 2QN6A 3NQTA 2QGQA 4NBSA 1AN8A 3BU2A 3JC66 3VYSA 4QY7A 3I56A 2CH4W 3PUYA 1IL8A 4DV2Q 4LFBL 5FIUA 3I70A 2PMDA 3EIVA 3H0GH 2ALYB 1XB2A 1WJJA 5AJ3Q 4RPDA 2V31A 3I55B 4FXKC 2JA7G 3HZXA 3GV3A 1QH0A 3E9HA 5LMNL 5J35A 2Q6OA 1NR2A 3CQZH 3S1QH 1X54A 5A2QL 2ZXPA 4YWKA 4NXMQ 4F7DA 4ACBA 1PZKD 2DOGA 2K6AA 2F0QA 2RKSA 4M4SA 4PNYA 2X6GA 1IW7D 2XRSD 4HEDA 2FHTA 4ULLA 1HZ9A 3UDIA 2JA6B 2H4OA 2AMCB 1NCVA 1KLGD 1E79A 3C2QA 2F4VL 3K6OA 3G05A 3OIPA 3I4OA 3Q22A 4O1NA 2XNDA 1N0VC 1Q82C 5CR3A 4LUVA 1YJ9A 3L3OC 3A0JA 4RGTA 1GXDC 3MXUA 3WYAA 1IBML 5CV4A 3G6JB 4NP5A 1N34L 5JBQA 3OIQA 3RLNA 2B39A 2UUBL 3HEJA 1VQKB 4MIUA 1F77A 4RDKA 3MVVA 4ZGNB 4X6AH 1TLLA 1X3QA 3H0GG 3SXHA 1EFUA 3WOEA 3MXGA 4GNXA 2R92B 2RDGA 3KF6A 1ZEQX 3M7GA 2QTZA 1VQ7A 2VNUD 2F52A 1OHHA 4KJNA 2HLDA 3H9NA 3DEOA 2JP1A 2V7TA 1VQ5B 4E0FA 3CXCB 4R8NA 2JA8H 3MFGA 1XE1A 1ZM3A 1JB3A 1V1PB 2F0DA 3MHBA 3PUXA 4DR4Q 4DR7Q 2WJVA 3VR4A 1S72B 3F2UA 4OWXB 5H5JA 2VNIA 1TS5A 3QFRA 1Z7TA 4RCOA 3EA6A 3MAQA 2QA4A 1Q86D 1SR3A 3I3CA 1WU8A 4PC7A 4OO1I 3DLLA 2J0TD 1SYEA 2IL8A 2QDLA 4OWTB 5IYBH 3HOVH 1K3RA 1N9WA 3I90A 4FYDA 3BVGA 4IN3A 2RC6A 2K32A 3A8JE 5C5LA 4X65Q 4ZGQB 4XQNA 5FLXL 1XYIA 2PPBC 3QFSA 1DCZA 3ERQA 4IUPA 3RNUA 2PCFB 3GTMB 1VQPB 3OZVA 1HRJA 4DF7A 2XZOA 4HIDA 3P27A 3J81j 1CT1D 4KMUC 2JA8G 2X85A 3ULJA 4JI2Q 2EVBA 3RZDB 1SNCA 2DETA 5BN5A 4DUZQ 1KXLA 1SDFA 4RCNA 2WAQB 2E75C 1D1KA 1KMHA 4DKAC 1VDZA 1HNXL 4BY7B 1I18A 5T1GA 1XPOA 1A0IA 3V76A 1VQ4A 3G4SB 3PIO3 1BLIA 2OYNA 2HDNB 1FGBD 3GTPB 1L1OA 3GTOH 3T1YL 4X8IA 5IYBG 3PUNA 4JC0A 3GTJB 2VNKA 1K3BC 4YWMA 3BY1A 1R5OA 1HNWL 5CGKA 4OIKA 5IODA 3C3LA 4N8FA 1B9MA 4Y7NH 3S17B 3S2HB 4A3CG 4PMWA 3JQRA 4LF6Q 4A3MB 2F3WA 4HSPA 1TY2A 1UAPA 1EY7A 5C0XI 4OL7A 1PRTF 1YHAA 1KD1C 2BGJA 2CW0C 1ET6A 1K8OA 2EXZA 1BCPD 3UDXA 1FR3A 1U4MA 3A8KA 3FDTA 4F7XA 1Y8PB 2NTSA 1BJKA 5FKAC 3SK5A 4H44C 4NXNL 4LFAQ 3IRBA 3S1RH 4LNQA 4P73A 1PDQA 2ICEC 1T9HA 2ZJPA 4GNXC 2XSCA 4Z4YA 3VDYA 3CCEB 2C5CA 1OGIA 2V7QA 1UMKA 5LMZA 4OOSA 2Q2UA 4ID6A 4ZV4A 1STBA 3J7AF 3P20A 1XNRL 4GKKQ 4I7AA 1K8AC 4JW0A 3OTOQ 1L0WA 3WBKA 5T1IA 3U50C 1NE3A 2Q2HA 1SKYB 4LF5Q 1PRTC 1UE6A 1TUIA 3ZC3A 1VHEA 4IUQA 4RD4A 4LK1C 1ESFA 1E0BA 5ELFA 2XN9C 2HIVA 1CQVA 1D5MC 2E76C 3NTKA 1YBYA 5G3LD 2OCEA 3RZOB 4LFCL 4G4KA 5CV9A 4YEJA 3CPWA 1HA3A 3K57A 5E3FA 1TWFB 3TREA 1QZHA 4IUTA 2EY6A 3HKZG 3K0YA 2J4XA 4C2MB 4DV5L 4LF8Q 1PMRA 3S16B 2V7UA 1VQLA 2D0PA 3QO2A 1RQRA 2CQOA 3GD7A 4DR1Q 1LTAD 4C0SA 5ISRA 4DK0A 5J3OA 4AF6A 3QJYA 5KNDA 3GQBA 1X6OA 3S1NH 4R8IA 1JB7A 1Q3LA 3K59A 4DNTB 4DV0L 4AIMA 1TWAB 2B2YA 1IB0A 4Q5VA 1JB9A 3QWNA 5HURA 3DXJC 3JQPA 3E20A 3G48A 4RD6A 1I94Q 3VNUA 4V190 2KHSA 3LWUA 2ID0A 4UY8C 2JA5B 3U6BA 2JK8A 3KOJA 3V96A 2JN4A 2RVLA 1ZUNB 3FP9A 2X69A 4XONA 4GOPA 2DJGC 4U68A 1X3PA 5F4JA 1K9MD 1SYFA 1WFQA 5EKIA 3H3VC 1DXMA 1WCMH 1QFYA 1V43A 1T6XA 5KNBA 4ZK9B 4G57A 2X6YA 1VQ6B 1K0RA 3SEBA 3VA5A 3RMHA 3NBHA 1N33Q 3QFCA 2B2WC 1XXGA 2PMZE 4DV2L 3J80L 1D7QA 5M5YB 4RGOS 1LTSD 4MYUA 3AEVA 4RCZA 1QX4A 1XTDA 3W2HA 2K04A 2DNCA 5GROA 1OB2A 4OOXA 3WNDA 4YIJA 3K80C 1QJOA 1QFZA 2E2IB 3ES9A 4NXML 2QDXA 1ASZA 1A8PA 2VNHA 4RJLA 2MNAA 3CCQA 2QEXB 4GLXA 1YJWA 3BY2A 3FKSA 2KEEA 4XMYA 4A3DH 3U4VA 1FVIA 3B8HA 1GOZA 4RPBA 2E2JB 2HDMA 2UUAQ 1JOOA 1VMCA 3QG1A 1FX0A 1EWHA 5M3FB 4BY1B 4YWLA 1HVXA 1JJCB 4IZ8A 3VR6A 4XT3B 1N05A 1V1QA 2HIXA 1JWMD 4DU9A 1FNWA 3JAMi 2ZTCA 3J7ZC 3GTMH 3CMEB 1CQXA 2W6JA 1G2SA 5JVG3 1ZM4A 2DN8A 1E1OA 3Q6RA 2CFMA 3SJZA 3CP0A 4RWSC 2GVAA 1CQFA 1UD5A 2J7ZA 1YIJB 2R93H 3ND8A 2ZZFA 4DV6L 4C3IB 3SK6A 1PV4A 1EFTA 2QTLA 1TWCB 2OQ0A 4YAOA 4IFDI 4BY7H 4IOCA 1RIPA 1EUJA 1YLOA 1LACA 1JJ2B 2F0TA 1EYDA 3OMCA 3HOWB 2NTTA 4PC3A 4XOTA 4DR6L 1P8LA 2K5HA 1HZCA 2RDHA 4RGNA 4A3DG 5M5XB 1YI2B 2V4DA 3NBIA 1JICA 4CKBA 1QVFA 2K4KA 2EYHA 3STBD 3GTJH 1I5FA 5ELBA 2N49A 5J3BA 1STYA 2F0GA 5M3MH 2N8NA 1CKNB 2SNMA 2IHEA 1G6ZA 1WI5A 4RG1A 3I4MB 1QG0A 2WB1B 3A8JA 4A3GB 4L6TB 1XJVA 3FVQA 1S5BD 3K0XA 4ACAA 3G71B 1ICWA 1KQSA 2R6GA 2B2YC 2EYJA 1XTCD 2IPKD 2DNEA 1PH6A 3U2QA 3OPOA 4N3NA 4UZFA 3CKIB 4X65L 2F3IA 1EQVA 2R93G 1IYVA 1H9SB 2F0JA 1MSHA 3KLSX 4CJ1B 1BKBA 4PZ8A 5LMNQ 5IGGA 1HH2P 4QGUA 4BY7G 1C4QA 2NZOA 2Y0SE 4P22A 1NRKA 1SM4A 4Y52H 1IHMA 4GOPC 2KA7A 3OEEA 1WTXA 3OWEB 3KDFA 3H6MA 3KL9A 4JI2L 1JE5A 1KRTA 1A2UA 1R9TH 4L5SA 5EJWA 4DUZL 4HIKA 2MUYA 5GAGC 1NDHA 1E3ZA 4WZKA 4P71A 2FINB 5IT9c 1WOCA 4MYTA 4II2A 1EP1B 4B48A 3S2DB 1MSGA 1E1RA 2UUBQ 2MJ8A 4B43A 2QMUA 2KCCA 1WTRA 4ASUA 4XORA 4LC0A 2Z6BD 3WXMA 2GJPA 4P75A 4DV1Q 3KBGA 1QUEA 1T6ZA 1HQRD 1TWFH 1VF7A 4K6LA 2IY5B 4Z4UA 1H9RA 3TBIB 4Z4RA 1WOSA 3A1PA 1F2ZA 4C2MH 5LL6X 4DQKA 4A3FH 2ZTDA 2JN9A 2R9VA 4B3RQ 2FVGA 1I3QB 4M53A 1GR1A 1KRHA 2YWEA 1HNZL 1VQJA 1X3GA 4OIJA 1EY5A 1AZPA 3HFZB 4PV1C 2EJFC 3OZUA 1JR0D 2L15A 1A3TA 1N8RC 4B4DA 1R5BA 1E2ZA 1ESRA 4ZKCB 3UE1A 4POGA 4KY6A 4KLKA 3PUMA 2VZAA 4LFAL 4POFA 3I4NB 2GA4B 4AQYQ 1U4RA 1L0YB 1LABA 4HIZA 1GD7A 3C1EA 3CMAA 3B82A 3CCJA 3PSIA 1QZGA 1N07A 2Q6LA 1HXYD 1KL9A 2B2VA 3PO3B 2D3LA 3OP1A 3W3AA 1OXSC 4HN7A 1Q46A 3KLWA 2B8FA 1V0EA 4IQZA 4JK1C 3OTOL 4WFN3 1Q9SA 2PW5A 3LO8A 2GK6A 1QB5D 1K28A 3E1YE 4JBJA 5C4HA 1SNQA 1FRNA 5JAVA 4JI4L 1G291 2BMWA 4LF5L 2VW9A 3M4QA 1BX0A 1NY4A 1YHBA 2UXCQ 4A3FG 3DWQA 3JQQA 2A69D 1EFWA 4CQJA 4XN3A 1PFMA 1VCIA 3PGZA 3PIP3 2Q6KA 1FNDA 1EWYA 5HXBA 1EOTA 3OW2B 1FNMA 4MNOA 1U9RA 2F0MA 4G1BA 2SEBD 4PMBA 2WINB 3HOZH 2VNJA 2EZVA 2LZJA 1B3AA 4DV4Q 4LF8L 2I46A 3KF8B 5L37A 2ENBA 4DR1L 1EQTA 3T1YQ 4G7OC 1B53A 1Q7YD 2KVOA 4ZLTF 3OZWA 3BNWA 2M2LA 3MWYW 5EMNA 3OW7A 2KHJA 3Q24A 3QB3A 5CV8A 1QOHA 3TN2A 3O13A 5D3IB 4BBSH 3CB4A 1NAPA 1PH4A 1YNXA 1JJGA 1DARA 3Q6QA 2L9HA 1V5VA 3HOYB 4A3BB 1I94L 1ZM2A 4B9WA 3H3VI 1PZID 4GS3A 3K7UC 5IOCA 3M3YH 2EY5A 4YXWA 1W2BB 1LTLA 4XQFA 3S15H 3PIOA 1R4PB 2K5QA 2R6HA 5GADC 2QILA 4XM3A 4RAUC 4G7WA 3HOZG 5LMNW 4C43A 1LV9A 2VB3X 2E2HB 5DN6A 2RBMA 3K5MA 3LVBA 4KKUA 1YNND 5M9OA 2EXDA 1EYAA 3A8KE 1CKMA 4CDDC 5IGCA 1I50H 3CC4B 1DZ1A 3S14H 2B7BA 3OWFA 4P6YA 3P75A 3W2GA 4YELA 4K5XA 4L5QA 3J81k 4YAUA 3L9AX 2PZTA 5I2XA 1CKOA 3MEHA 4QQBX 2EYMA 2PIAA 1YHQA 3AVYA 1DOMA 2ATWA 3ASTA 3SLDA 4N3GA 5EBCA 4BBSG 4A3EB 1VQ8B 1U2RA 1SMYC 1ZKOA 4O42A 4IPHA 4B3ML 2EJMA 1B2RA 5D14A 2XZPA 4WQMA 2A8VA 3SK8A 3VR2A 1M90C 1G6PA 3RD4A 3VYUA 3MXNA 2UUAL 3AFQA 4H7BA 4PC1A 1B4OA 3CPFA 5IYNA 4DV5Q 1D1IA 1KHIA 1PH1A 1NBWA 1Y1WH 1KTKA 1V8QA 5H59A 3J81i 1C9OA 5C44B 1I6HH 1X3FA 1ENAA 4I65A 4F88A 2RQXA 3R3OA 2VQEQ 5M5WB 3CP8A 2PZWA 1GJXA 3D3RA 1WD1A 3E3XA 1EFRA 2DY7A 3BZDB 4OXPA 2OEOA 4TMVA 3BVZA 2GVBA 1Q1EA 1WP6A 3A3GA 4E6IA 1TWHB 3NPPA 1AZQA 2K14A 3E5SA 3S1MH 2HCIA 1S5ED 4G1VA 1W34A 3BQJA 1SYGA 5EGTA 3A55A 2PQAB 2MFIA 4DV3Q 4CDFC 1RL2A 1GM5A 2BCOA 4M2LA 4XYOA 3CD6B 4K6DA 5COYA 1K73C 1MJCA 4BA1I 1WYDA 3R2IA 1OXVA 4V0BA 3CAMA 3CRLC 4NPSA 4CBVA 1YITB 4UP8A 4JI1L 4WJWA 1Y1WG 4JI0Q 1L0XB 1I3QH 1GHKA 4FF3A 2HQEA 2VZLA 5KIXA 1Y69U 3NK9A 1H8EA 1UD8A 1XMOQ 1BDOA 4II3A 1KC8D 1VQ6A 2KOLA 3TZUA 2C5HA 2DGYA 2F4IA 4Y9RA 3AGPA 5B6IA 4QV2A 3L0OA 1EQQA 1QGZA 2RCFA 1A63A 4RA8A 4JV5Q 1PTOB 1VQNA 4P2NA 3PO3H 5CBAE 5FO8B 2PYKA 1F2MA 3H15A 2CHBD 1F60A 4X64Q 5C4XB 1JC7A 1TKWB 4NB3A 4O2DA 2BDOA 3B78A 2A6EC 3CCMA 5L46A 2AQ3B 4JOIA 1XPUA 4ZQ3A 4WZLA 3DUZA 1AP0A 4XLCA 4R71A 1KK3A 4DAVA 2AWOA 1DD2A 1K0SA 3SLNA 1Y8OB 4YY3Q 4XLHA 3DM1A 2NYZD 3GTQB 2GPJA 4ZCLA 2SDFA 2VB2X 1MGSA 3CCSA 4GLAC 4FF4A 2CH4A 3DHQA 2BE5C 1RQPA 4ZCMA 3VNVA 3C1FA 3IFDA 3CMEA 2JYOA 1YEZA 1FNCA 4DV1L 5IYWA 4DV6Q 3GTLH 1HUNA 3G6EA 2B8GA 4OWWB 2LSSA 4L5RC 1QVCA 4KHZA 4PMCA 3D4DA 3M4OB 2K52A 4DFAA 1GO3E 4ZCIA 2VUMB 2BM1A 2CCZA 1NR4A 2PW7A 1KDAA 2FMCA 1H8HA 4DR6Q 3OE7A 4DXFA 4B3RL 1ET9A 3CCRB 5ELNA 1VQOB 3Q8DA 3PO3G 2O5JC 3OMGA 4RKBA 1E1TA 4A75A 4EQNA 4ODGA 1X3EA 4U673 4HJAA 4R4CA 1QVGB 3HKZE 2WSSA 1S3OA 4AQYL 4AC9A 3ZYYX 1O7LA 4TMTA 1E63A 1H9KA 1BOSA 4UP7A 2OTJB 3HOYH 2HQLA 2XTIA 1MBYA 5BN3A 3JAMc 1IJFA 4LMQD 1QUQB 5FO9B 3U58A 3I8ZA 4UZUA 1ZYRD 4CJ2C 3UDGA 1WTOA 1KABA 2E5LQ 1SE8A 1JE4A 1EZ8A 4A3CH 1EYCA 4PZ7A 4XD7A 2E2HH 4PGOA 4CDCC 2BV3A 2UXCL 4APVA 4QVJA 2JE6I 3FPUB 3WNCA 3OOCA 1FGUA 2D3NA 2E8GA 3E9IA 1H9SA 4MHEA 2VBVA 3W2IA 3ASQA 2KCNA 2K05A 5JPNC 2V7XA 4TMXA 1NB9A 4OOVA 1M1KD 4DQLA 4LW1A 4TRDA 2F03A 4F87A 1N36L 5C6AA 4DV4L 1UE5A 2CRVA 3H09A 1IL2A 3QFTA 4DN4M 2E2DC 3RLFA 1IW7C 1NJID 3HOYG 3Q23A 2H1EA 2CW5A 5CV5A 2MQHA 2R7ZH 2TSSA 4AYBG 4LWCA 1VQAA 4CKEA 1LTGD 2YU9B 4WZEA 1VF5C 4L63B 4F8MA 1OB5A 2L11A 3JAME 4RCYA 4XLFA 5IWAL 4MN3A 1VLOA 1ZXTA 3NXWA 5KSWB 4JBMA 3CCUA 4WJ4A 5TY0A 1J5EL 5KEEA 5TRDA 4QIWB 2BA0A 2JJQA 2ZT9C 2V7VA 2D0OA 1FL0A 5K5PA 4UAJA 1HNZQ 2IX0A 4HSVA 3U9SA 4L8JA 2K01A 3ND9A 3BZKA 1KJZA 2G9HD 1EIGA 1QFJA 3HS0C 4TSFA 3PA2A 1EY8A 3R93A 2L55A 2EOTA 3KLRA 3HAGA 1YJNA 2XOKA 3U6KA 2JEBI 1TWHH 3I1FA 3SJPA 3D4RA 3ULPA 3F2DA 1JQYD 1O7ZA 3I72A 4BBRB 2R7ZG 3CCVB 3CRZA 2NVXH 3HKSA 1HZBA 5HGTA 1D1NA 1RDPD 4JI4Q 1Q81D 1VQDA 4IURA 1Q86C 2YTXA 4H0LC 1H95A 2EQSA 1S4ZA 4UZEA 3ICEA 2C4TA 2ZXIA 4QUFA 1HHVA 1X9NA 5GV7A 2SNSA 4JI7Q 1Q8IA 1U4PA 2XNJA 2MO0A 4EGVA 5C44G 3PMFA 4HJ5A 4A3IB 4XKVA 1Y0RA 3AVWA 1SRUA 1NMFA 4Z4VA 5BSXA 1D6EC 1WTQA 1IXRA 1XX8A 2NVQB 5FNZA 3T56B 2ICIA 2HCCA 5NUCA 1PJ6A 4FP5D 3AVTA 5FK9C 3OW2A 1VHOA 2I5HA 3VA7A 2XZLA 2Z4HA 2JA6H 4DK6C 2VQEL 1VQ9A 1RODA 3L2PA 2X3UA 1VQFA 5A35A 1E1QA 4J0QA 5C4XH 4GKJQ 1B7YB 4M1KA 3KF8A 3Q3AA 2AUKA 3I7FA 1FNUA 3PIPA 1BCPF 2HD3A 4XN0A 1GVPA 1EIHA 3LQ6A 3W5UA 4ABNA 5ELDA 1EL0A 3NSWA 1Y0YA 2AHOB 4S3SA 5C3WA 3CCLA 4RD1A 4M8AA 4TMWA 1SJED 5C4JB 5IK2A 3VO2A 1G2TA 3TMEA 1EP2B 1WTPA 4DV3L 4XQJA 2R92H 1L1OC 1D8LA 1TIID 4X3SA 5FLMH 1GUNA 2QCPX 5IGFA 1FNVA 3CC7A 2IX1A 1TU2B 5HKKA 1GAWA 2I5MX 4J6HA 5EKKA 3K7AB 3P1HA 3M4OH 1GO2A 3CC2B 2F0KA 2VUMH 3C2PA 1W2BA 1CZGA 2XVSA 1HA5A 2A68D 2XNAC 5JJZA 4JI0L 4RHRA 1XNQL 4Z4ZA 1RTNA 2K03A 1JMCA 4A3KB 1DGSA 5IY0A 5IIFA 3F8TA 5KRUA 2JA6G 1T6YA 1BCPC 3I56B 5DM73 2F3VA 1Q12A 1XMOL 5G3LF 5C4XG 1BUVT 3D31A 3T53B 3UE0A 2Z1CA 1I4XA 4ZRZA 4H9GA 1KNAA 3CC4A 1B23P 2ZZEA 4UDUC 4X07A 2K33A 4JV5L 3T1HQ 4B3MQ 4XXEA 1SJHD 4Z1MA 4YHBA 2BH8A 4Z4WA 2ZTNA 2PI2A 4QUCA 1VQBA 4X64L 2WZNA 1EY6A 4UAIA 4IJLA 2R92G 1VQ8A 2EDGA 2NN6H 4NCNA 4K8IA 2UXDL 1Q1BA 4KK7A 5FLMG 2C9OA 5IYPA 1TWGB 4K1XA 2O2LD 3FKIB 4JG2A 3AFPA 2YYZA 3F1ZA 1LT5D 1T5XD 3S9WA 3W2DA 4YY3L 2F0LA 3MCAA 2VUMG 1HJPA 2KUMA 4LUZA 1D2BA 4DK1A 3PENA 3MFYA 4TKOB 2R7FA 3CRKC 3PF5A 4DNRB 3PQIA 4LUOA 3RZDH 1QGYA 3X3NA 2HDLA 3CESA 3VO1A 1KLUD 2EYLA 1VS0A 3CP2A 2OT2A 2ZXHA 4FVMA 4C3HB 2AQ1B 4YAWA 2NPFA 3MTSA 3BYYB 2XGJA 3GTGB 2L12A 4FK8A 1CA5A 1XMQQ 2LFNA 1QILA 1STAA 3VMFA 3GTPH 2NVTB 1VQ7B 1UEBA 2VYQA 1B1ZA 1W35A 2RHQB 2ES2A 4K0KL 4ROXA 1FDRA 3EQLC 2B63B 5GQOA 1RTOA 1BO0A 3SGIA 2YU9H 4DAYB 4KTAA 3U9OA 4C3JB 1PH9A 4DR5L 2NN6G 1WSRA 2LKVA 5FO0A 2HUGA 4G7XA 3MC0B 1TS4A 3MHPA 3S17H 4Z9CB 1PRTB 3W5OA 3S2HH 1IYJB 3HP3A 5H1SE 4A3MH 1DDGA 3TQYA 4C56C 5CORA 3BC9A 2MP1A 4JI1Q 1M4VA 3RUZA 2KVMA 2PLFA 4OP7A 4IUVA 3TSSA 3CD6A 3TZDA 2YWHA 1S4MA 1UD4A 2HCJB 5CDFA 3KUPA 2E5LL 4FF1A 1R4QB 3J81c 2F0NA 4BA2I 3T4AC 3HGBA 1K9MC 2WFWA 3L7ZC 5CBEE 2WAQG 1VQMB 4HJ7A 1PJ7A 2DERA 4G5GA 3HOXB 1EFCA 2F0OA 4J1MA 3SDZA 3OEHA 1WDTA 2GN5A 4XOPA 1HR0Q 1UE1A 2CF4A 4J15A 3I55A 5E6TA 4R4IA 3A5UA 2ASBA 1YNJD 4PC2A 3DWAA 3Q6SA 1ELOA 2C5BA 3V05A 2Q8TA 1UD6A 3TDQA 2ZBUA 3P26A 2NVYB 1TXYA 1A62A 2XIWA 2D74A 4EH1A 1FYCA 4KN4C 3OHXC 1LTID 1A15A 1LT6D 2Z6BA 4KY5A 4A3MG 4HIOA 2FX3A 1E2VA 3UDFA 1PTOD 2JIZA 2KEDA 1IKMA 1VQ4B 4KHPQ 1N08A 5TV2A 3RZOH 2A6HD 2JA7B 1LT4D 2F0FA 1S5FD 4LF4L 3LNNA 3V2TA 3HOUB 1IYUA 3SHLA 4B3GA 4A3JB 1X32A 1VQKA 4OONA 4XIGS 3S16H 3AQQA 1A8VA 1UD2A 3J81E 1MIUA 2O5IC 1EZ6A 3AGQA 3KEWA 2PQEA 4QMGA 1K83B 3M4PA 1CI3M 2A5HA 1E64A 1PHJA 4K5WA 1VQ5A 4O0AA 3CXCA 5IYCH 4OX9L 1TWAH 1V1PA 4A93B 1IZ6A 4FNFA 4P9SA 1GVHA 2KECA 3DDYA 1S72A 1VQCA 4DPGA 3H0GB 1QVGA 4WORA 2JA5H 3TP5A 1MABA 4DK3C 5HY6A 5IT9E 4EQ5A 3STBC 3U4ZA 2ZM6Q 1CSPA 2R3ZA 3BH4A 1I4PA 3WBJA 1X55A 3DWPA 2OWOA 1YZ6A 4JI5Q 1G8ZD 1KAAA 2HHHL 4B3TQ 2C4UA 2FMMA 3KBXA 2CWAA 3CQZB 1BPLA 3CF5A 3A54A 3K7AH 1IJEA 2ZITA 2RHSB 1G7RA 1QUQA 1PFNA 1UD3A 1E24A 1WOPA 2WB1E 4ME5A 5M5YH 1S5DD 3ZPNA 3A56A 4Z4TA 3VR5A 4JI7L 5DSZA 1VQPA 1G7TA 4JBKA 3NTHA 4K14A 4B3SL 1O7YA 2RF4A 3GP7A 1N36Q 4X06A 2E1BA 1OO9B 2E2IH 1DONA 1PZJD 5IYCG 3JAML 1KK2A 2YTVA 4P72A 5C5MA 3CPWB 4M1UB 4X7CA 5JEAJ 4A3LH 2D5DA 5DNFA 1WTHA 4ILWA 3EJIA 4XDXA 3IAYA 2QGGA 3I4LA 2DEUA 1VQIA 4BPRA 1DOKA 4X3TA 1VQLB 1VLYA 2E2JH 3CW2A 1U0LA 2WP8J 3OJWA 2ZBVA 2LXJA 1S40A 2JA5G 4GKJL 3G4SA 1N06A 1RHPA 5M3FH 1WTHD 2OQKA 5EPLA 5I6YA 4BY1H 1CHPD 2RSNA 3SKBA 1E22A 4CJ0B 5IWAQ 1TWGH 5E4WC 4XLEA 2EYPA 4IO9A 1T5EA 4B08A 3OSOA 1C8CA 3OKXA 1C0AA 4U9UA 1BBWA 1CTMA 3NELA 1J5EQ 1N0UA 1OXXK 2KHIA 2K1BA 1LT3D 5LHY1 3BDCA 4JI3Q 4C1NI 1S0UA 4JMQA 2UXBL 3M7NA 1SYCA 3FHWA 2B7CA 2EJGC 4RDJA 5DS0A 2AWNA 4C3IH 3K8AA 1EFID 2BH2A 1TWCH 2EY2A 2L4NA 5JOBA 1TVCA 3HOWH 4GOPB 3NHHA 4A3LG 1HR0W 2F1MA 1Q90A 3HOVB 3PO2B 1I4RA 1RJTA 4PABA 4IPDA 5M5XH 4OGQC 2B2TA 3NBHB 4K8JA 5DM63 2FFKB 2B63H 4CKCA 2RSOA 2BPOA 2Z8LA 1KDBA 5J22A 5M3FG 4RLZA 3CCEA 3AVVA 4NW2A 4BY1G 3R8BA 4C3JH 3I4MH 2K5NA 4A3GH 2ZZQA 5FL7A 5CC4A 4QJFA 2KCMA 2CBXA 4P3IA 3GV6A 3T1HL 3B6YA 3CCVA 5FO7B 2CC2A 1A6XA 4PAAA 5E1FA 1PVOA 3V7AA 1UEAB 3R6JA 3CCQB 4IJHA 2F0SA 1YJWB 1MI2A 2JQOA 3R2TA 1CHQD 4X0CA 2B2VC 1Q82D 4C3IG 2X0KA 3A8IA 2BF4A 4C3HG 4OPOA 3GVJA 1HQMC 3I2ZA 4RDLA 4KN7C 1SNDA 2A69C 3HOWG 3VYTA 3GTOB 1OXUA 1PXUA 3EFXD 1E3XA 1G91A 4IALA 4UPAA 4X66L 1BMFA 5TSSA 2B63G 2F0HA 3RLOA 1B3QA 2V1CC 4Y7CA 3P7JA 3E0JA 5BR8Q 4Q0FA 4ZYSA 1B2TA 4C3JG 3QOJA 2Z9HA 3I4MG 4YCUA 4A3GG 2WB1G 1XMQL 5KNCA 5F4MA 3S2DH 4KV6A 5I9OA 1Q7YC 4TQUS 4FXGC 4IW3B 3GVKA 2MO1A 1DOLA 3MMPA 1W3SA 5KNLA 1UUPA 2AHOA 4A3JH 4P25A 2A74C 3MA2B 3S1RB 3CHBD 2WKCA 3CW2C 2CKZB 5EPKA 1IBKQ 4JBWA 2OTLB 4UHVA 1GUSA 1PH5A 1XNQQ 3PVDA 4KY7A 1EYGA 5JJKA 1DJRD 1B70B 5C0XJ 1Z9FA 3K5OA 2ZL7A 4AYBE 2M5SA 4BS9A 1VQHA 1KQSB 2ZL5A 4LBWA 2AUJD 2H5XA 3K81C 3VYRA 3D8GA 1JNYA 2BVNA 4P3YA 3DM3A 1PFBA 3I4NH 3GTKB 3PUWA 1ZM9A 4A93H 3JU4A 5IE8A 1YNNC 2EY1A 2VJJA 3WDNA 4P26A 1AE2A 1HR0L 1XWEA 4FXUA 2FXQA 4GN3B 2K5VA 1EWCA 3CU7A 4B3FX 4Q7JB 1EP3B 1PFSA 3TP6A 2L5TA 4IUUA 3RY8A 1OTCA 4XR6A 1PYWD 3KDFB 2QEXA 5EPJA 2UXDQ 4RHSA 5ELCA 2PI2E 1Y8NB 3HOUG 3BJUA 1QG7A 4A3JG 2B2TC 2MGSA 1I4GA 2VL6A 2WV6D 1B9NA 2PE3A 2GREA 1IBLL 1WPCA 1FJGQ 5D65A 1EY0A 3ZZ0A 3GDEA 3PA1A 4R4QA 1SYDA 4KHPL 5K36H 2N88A 2ZTGA 4P6VF 1PLFA 3WWVA 3S1NB 2UUCQ 3BG3A 3IL8A 4X7FA 5CMDA 2AKWB 4TVAB 1D5ZC 3EBEA 3I4NG 2VQFL 4A93G 1WSVA 4Z4SA 2AQ2B 5IGDA 5J39A 1YIJA 4EQPA 2XWBB 1SYBA 4RM0A 1YVCA 3ULLA 4K0KQ 1RD9D 1KD1D 4XTCS 2WZPP 4YAFA 3W5VA 1SKQA 3FJOA 3ZZTA 3FPPA 2CW0D 1JJ2A 2EYOA 2DIEA 4LAAA 3RN5A 1F2YA 4DR5Q 1Z47A 3FPKA 1E7ZA 3GIRA 3F2CA 2WPDA 1WCMB 3I91A 4MZ9A 1K8GA 3PF4A 2QKIC 1YI2A 4YCVA 4RD2A 3ZZUA 4A3BH 2R7DA 2SOBA 3BZCA 1XPRA 4DAYA 4JYAQ 1CKNA 3E6ZX 3CCJB 5FOBB 4FN5A 3CMAB 4YHHQ 3H94A 2ZM6L 1K8AD 5K36G 4QL5A 2LXKA 3LX0A 3NE5B 4JI5L 5LMUQ 4B3TL 4ZKBB 4RD3A 3G71A 4JVZA 3HG9A 4WRDA 4X3UA 1AMOA 4LF9Q 2V7WA 2CK3A 3ZBTA 5A89A 1PRTD 3W1GA 1F2LA 3KJPA 3J7A5 3J80i 4A3DB 3PO2H 3LQEA 2MPMA 3TEHB 3BCFA 1E2WA 3QSYA 4R4OA 1W0JA 1AH9A 1JA1A 1VQMA 4QHYA 4R1JA 5JEAH 1WORA 4X62L 3RN2A 1KC8C 4X7EA 3ZBUA 4RMFA 1UWVA 3SVMA 1SMXA 4FXDA 1ONLA 2ZZGA 4HMJA 5E7NA 1OGJA 2JXMB 4XYQA 1ILQA 4KJOA 2F4NA 4A3EH 2DY1A 4C1NK 5HZAA 1R5NA 1II3A 4LBYA 4A3BG 1IHZA 3J81L 1GKHA 5JJIA 1BX1A 1G51A 1D2EA 2R93B 5IYRA 1LYLA 1WVLA 1VQEA 1STHA 2VBTA 4LF4Q 2OBRA 4CGYB 1B44D 4MTKA 2RA4A 3I73A 4MTNA 5EKLA 5D3DA 3Q38A 1WD0A 4EQOA 1I7PA 4RD0A 1EOVA 1KK1A 4B9XA 3H91A 4JOIC 3OYYA 4PQXA 1JT8A 1J9ZA 4JI3L 4NKLA 5C44H 4L5TA 3HOVG 2KJXA 5M5WH 3PO2G 4DUYQ 3NP8A 2XEXA 2WYRA 1KAWA 1AFPA 1J6QA 2IJ0A 3D0FA 5IT9L 4TT3A 5JEAG 5M3MB 2B2WA 3KJOA 1F20A 4OX9Q 4FWTA 4N9TA 4JI8Q 2F0VA 3ZUGA 1LTTD 1H85A 5A8AA 1AEXA 1X56A 2M9VA 2PMZB 1KIXA 4IFDJ 3EN2A 4OEMB 1BBUA 4A3EG 3R6KA 4G6IA 1W0KA 4YALA 1NBMA 2D2CC 3AB9A 2VY3A 2G9DA 2YV5A 4DV7Q 3NWTA 4IPCA 1SE4A 2N78A 1WTVA 4HE5A 1C48A 1PH3A 2F0WA 2WIIB 4OO1H 1NSNS 4AH6A 4HCSA 1SE3A 2HHHQ 1TS3A 2I07B 1CA6A 1HA6A 2VBUA 2PNRC 2L1BA 3NEMA 2JA9A 3F2BA 4X05A 5E4XA 1YHQB 2KENA 4GLVB 5JPMC 2I1LA 1D8TA 3UI2A 3WNBA 5JVH3 1ML0D 3T13A 1ZYRC 1R9TB 5F2DA 4B3SQ 5EBDA 2C77A 1B8AA 1JCKB 2NV4A 3C46A 2EFGA 2GJKA 1Y1VB 5I4DA 1TS2A 3MXNB 3GTKH 1E43A 1O80A 1A3VA 2NN6I 4XT1B 1HUMA 1PTOH 1ENCA 3FRPB 5GAHC 3TS2A 1B50A 4A4IA 2UU9Q 5FJ8H 4DR2Q 3BDOA 1M1KC 5DAUA 3ITPA 4AF7A 1CZWA
chains in the Genus database with same CATH topology
4OO1G 1EEID 2W6IA 3PUZA 2BA1A 1QNUA 1GUOA 1A2TA 1H9MA 4LJZC 3A35A 1SAPA 4A3FB 1ENFA 1KDCA 2L0CA 1RCVD 1AW7A 3M4YA 2EYFA 1SE2A 1GUWA 1STEA 2PZUA 5J1ZA 1ILPA 2FJ2A 1VJSA 1SSOA 1A3UA 2ZXRA 3Q0AA 5C0XH 1GUTA 3N6RA 2VXWA 1NUCA 1F9RA 2NUCA 1PKVA 4NNJA 1LLRD 3ZIAA 1TQOA 3T16A 1HFNA 1CK1A 2WJYA 5I9PA 2RDFA 4XNFA 1I4QA 3N52A 1BR9A 2X6WA 1QNKA 2QE7A 2Y0SB 5KYLA 3GVLA 1FD7D 1SNOA 4HTHA 1OB0A 2E74C 1JWUD 1RF2D 4QB4A 4BWGB 4RKLA 1BF4A 4NMZA 2K28A 2CVRA 5CYUA 3HOZB 3BDLA 4K2KA 1TVXA 5AFWA 5C0XG 5C3EB 2O4XA 3OFNA 3G7LA 1QCBD 1STNA 1U4LA 4J8QA 3A8IE 4DGZA 4OHJA 3K5NA 4NDXA 2XRQD 3FEWX 2A73B 3SE0A 5A2QE 2NBFA 3URYA 4BBSB 1BQQT 1UNSA 2JDIA 3A3BA 1CM9A 1LTRD 3M3YB 2D9UA 3BVMA 3FMCA 3S15B 1HPCA 2LMCB 3NUCA 2WACA 1SFOB 3TP7A 3BCDA 3X3MA 1I50B 2IX3A 2XWJB 4XQQA 1F9PA 3S14B 3EVQA 1LTBD 4DXGA 2LY7A 5CV7A 3WOFA 1CFMA 2A68C 1Z6HA 4KI0A 1JOKA 4GQNA 4HAEA 2X53S 3J7YW 1RKNA 2JJ2A 2R61A 4X3KA 2NB0A 1J9OA 1SBBB 1EEFD 2OXPA 1Y1WB 3PV0A 1EY9A 1OXTA 4KKSA 3J7AV 1I6HB 1K8MA 2QEJC 5FLXE 1VMPA 3KLSA 4HCEA 2F43A 5I6WA 4XL9A 1I6VC 3AMUA 4FO2A 1F9SA 3SK4A 4AVZA 4QF4A 3S1MB 1HTLD 1BCPB 4IFDH 2EPBA 1M8AA 2DY8A 1BNZA 1TY0A 1DYQA 5CV6A 3NTIA 3BYTB 1JWSD 1SNPA 3NQIA 1H9JA 4QCLA 1KZLA 2F0IA 3QOLA 5IGBA 1JORA 3A7AB 3LWEA 3S1QB 1WTWA 4TSSA 4I7ZC 3DEPA 4G7HC 2D62A 1F9QA 3IFTA 1SMYD 2OF1A 2QF7A 3WQZA 4H13C 3D6WA 2JEAI 4IFDG 3K5LA 1PTOF 3GO5A 2GJRA 1GHJA 2B2UA 2IWHA 2NZ1D 2TMPA 1TT2A 4ZUJA 2F0UA 1HCZA 3K58A 2WKDA 4KD4A 1K28D 2BOSA 5BN4A 2K5WA 1JOQA 1YNJC 4ZUIA 4P2CB 2X6XA 3TP8A 3CMMA 1QWYA 3A7LA 3GTLB 2X8KA 2ZXOA 3VR3A 1SEBD 2Q8IB 4KKTA 1LO5D 2JA8B 4XLAA 1PTOC 5ELEA 1V1OA 5DEHA 2F0PA 1QE6A 2Q8RE 2A6HC 3HRZC 1HFGA 3T51B 4K5VA 4KHVA 1W6JA 2K5DA 1EU3A 2IW3A 1W9XA 1KNEA 4AYBB 1S5CD 2Z4IA 2CQAA 3D4WA 3SR1A 2MHVA 2N55A 4RH6A 2JJ1A 1MD2D 1EY4A 4KD3A 2LS01 4DA2A 4CHTB 2PO4A 4RFBA 3AU7A 3M85A 3OAAA 4HMIA 5I2YA 1STGA 1I8DA 2A6ED 3NWSA 3IKJA 4DAPA 2EE1A 4IUNA 3J80E 4G7ZC 2GK7A 4FF2A 1GUGA 1J8IA 1TR5A 3KK7A 4ZAIA 4GZYC 2R7ZB 5IGEA 1HZEA 4XKWA 2BE5D 4R9WA 5KGUA 1W6KA 3MXPA 2BDNA 4Y7NB 2K7VA 1IKLA 4N9PA 1SNMA 2QDBA 1I4HA 2M00A 2B2UC 5C4ZA 2JSOA 4RGMA 5EQ0A 1V0FA 3ONAB 1BXTA 1O78A 3DMUA 4EVOA 5LL6S 3HKZB 3QIAA 2F0EA 5C3XA 3EROA 1BBXC 1SXTA 5KYIA 2NWGA 2KQ3A 4HR7B 3D6CA 1COWA 3PUVA 2IT1A 1HTPA 2VJIA 1EU4A 3MZ5A 3BS1A 2NVXB 1DM0B 1D5XC 4K2LA 2X6LA 3NQTA 1AN8A 3VYSA 3PUYA 1IL8A 3I70A 2V31A 4FXKC 3HZXA 3GV3A 1NR2A 5A2QL 2ZXPA 1PZKD 2K6AA 2F0QA 2RKSA 4PNYA 2X6GA 1IW7D 2XRSD 4HEDA 2FHTA 4ULLA 2JA6B 2H4OA 1NCVA 1KLGD 1E79A 3K6OA 3G05A 3OIPA 3Q22A 4O1NA 2XNDA 5CR3A 3L3OC 4RGTA 1GXDC 3MXUA 5CV4A 3G6JB 4NP5A 3OIQA 2B39A 3HEJA 4MIUA 1F77A 3MVVA 1X3QA 3SXHA 3WOEA 3MXGA 2R92B 2RDGA 1ZEQX 3M7GA 2VNUD 1OHHA 4KJNA 2HLDA 3DEOA 2JP1A 4E0FA 4R8NA 3MFGA 1JB3A 1V1PB 2F0DA 3MHBA 3PUXA 2WJVA 3VR4A 3F2UA 1TS5A 4RCOA 1Z7TA 3EA6A 3MAQA 3I3CA 4OO1I 2J0TD 1SYEA 2IL8A 3I90A 4FYDA 3BVGA 4IN3A 2K32A 3A8JE 5C5LA 4XQNA 5FLXL 1XYIA 2PPBC 1DCZA 3ERQA 4IUPA 2PCFB 3GTMB 1HRJA 4DF7A 2XZOA 1CT1D 4KMUC 2X85A 2EVBA 3RZDB 1SNCA 5BN5A 1SDFA 4RCNA 2WAQB 2E75C 1D1KA 1KMHA 4BY7B 1VDZA 1I18A 5T1GA 3PIO3 1BLIA 1FGBD 3GTPB 3GTJB 5CGKA 4OIKA 5IODA 3C3LA 1B9MA 3S17B 3S2HB 4PMWA 4A3MB 2F3WA 4HSPA 1TY2A 1UAPA 1EY7A 5C0XI 4OL7A 1PRTF 2CW0C 1ET6A 1K8OA 2EXZA 1BCPD 1FR3A 1U4MA 3FDTA 4F7XA 1Y8PB 2NTSA 5FKAC 3SK5A 4H44C 1PDQA 2ICEC 2XSCA 2C5CA 2V7QA 4ID6A 1STBA 3J7AF 3P20A 5T1IA 1SKYB 1PRTC 4IUQA 4LK1C 1ESFA 1E0BA 5ELFA 2XN9C 1CQVA 1D5MC 2E76C 3NTKA 5G3LD 3RZOB 4G4KA 5CV9A 4YEJA 3K57A 5E3FA 1TWFB 4IUTA 2EY6A 3K0YA 2J4XA 4C2MB 1PMRA 3S16B 3QO2A 3GD7A 1LTAD 5ISRA 4DK0A 3QJYA 5KNDA 3GQBA 4R8IA 1Q3LA 3K59A 4DNTB 1TWAB 2B2YA 4Q5VA 3QWNA 5HURA 3DXJC 4V190 2KHSA 3LWUA 2ID0A 2JA5B 3V96A 2RVLA 2X69A 4XONA 4U68A 1X3PA 1SYFA 5EKIA 3H3VC 1DXMA 1V43A 5KNBA 4ZK9B 4G57A 2X6YA 3SEBA 3VA5A 3RMHA 3NBHA 2B2WC 1XXGA 3J80L 5M5YB 4RGOS 1LTSD 2K04A 2DNCA 4YIJA 1QJOA 2E2IB 3FKSA 2KEEA 4XMYA 1GOZA 2E2JB 2HDMA 1JOOA 1VMCA 3QG1A 1FX0A 1EWHA 5M3FB 4BY1B 1HVXA 4IZ8A 4XT3B 3VR6A 1JWMD 4DU9A 1FNWA 2W6JA 1G2SA 5JVG3 2DN8A 4RWSC 1CQFA 1UD5A 2J7ZA 3ND8A 2ZZFA 4C3IB 3SK6A 1TWCB 4IFDI 1LACA 2F0TA 1EYDA 3OMCA 3HOWB 2NTTA 4XOTA 2RDHA 4RGNA 5M5XB 2V4DA 3NBIA 1JICA 4CKBA 2EYHA 5ELBA 1STYA 2F0GA 2SNMA 1G6ZA 3I4MB 4A3GB 2WB1B 4L6TB 3FVQA 1S5BD 1ICWA 2R6GA 2B2YC 2EYJA 1XTCD 2IPKD 2DNEA 3OPOA 3CKIB 1EQVA 1IYVA 1H9SB 2F0JA 1MSHA 3KLSX 4CJ1B 5IGGA 1C4QA 4P22A 1NRKA 2KA7A 3OEEA 1WTXA 3OWEB 3H6MA 1A2UA 5EJWA 2MUYA 1E3ZA 2FINB 4II2A 3S2DB 1MSGA 1E1RA 2MJ8A 2KCCA 1WTRA 4ASUA 4XORA 2Z6BD 2GJPA 3KBGA 1HQRD 4K6LA 1VF7A 1H9RA 3TBIB 1F2ZA 5LL6X 2R9VA 1I3QB 4OIJA 1EY5A 1AZPA 4PV1C 2EJFC 1JR0D 1A3TA 1ESRA 1E2ZA 4ZKCB 4KY6A 3I4NB 2GA4B 1U4RA 1L0YB 1LABA 4HIZA 3C1EA 3PO3B 1HXYD 2B2VA 2D3LA 3W3AA 1OXSC 4HN7A 2B8FA 1V0EA 4IQZA 4JK1C 4WFN3 2PW5A 2GK6A 1QB5D 5C4HA 1SNQA 5JAVA 1G291 3DWQA 2A69D 4XN3A 1PFMA 1VCIA 3PIP3 1EOTA 1U9RA 2F0MA 4PMBA 2SEBD 2WINB 2EZVA 2LZJA 1B3AA 2I46A 2ENBA 1EQTA 4G7OC 1B53A 2KVOA 4ZLTF 2M2LA 3MWYW 3OW7A 3Q24A 3QB3A 5CV8A 1QOHA 3TN2A 3O13A 5D3IB 1NAPA 2L9HA 3HOYB 4A3BB 4B9WA 1PZID 5IOCA 2EY5A 4YXWA 4XQFA 1R4PB 2K5QA 2QILA 4XM3A 4RAUC 4G7WA 1LV9A 2VB3X 2E2HB 5DN6A 2RBMA 3K5MA 1YNND 4KKUA 5M9OA 1EYAA 3A8KE 5IGCA 1DZ1A 3OWFA 3P75A 4YELA 4K5XA 3L9AX 2PZTA 5I2XA 3MEHA 2EYMA 1DOMA 5EBCA 4A3EB 1SMYC 1ZKOA 4O42A 2EJMA 5D14A 2XZPA 3SK8A 3VR2A 3RD4A 3VYUA 3MXNA 4H7BA 1B4OA 1D1IA 1KTKA 1V8QA 5C44B 1ENAA 4I65A 4F88A 2RQXA 3R3OA 5M5WB 1GJXA 3CP8A 2PZWA 3D3RA 1WD1A 1EFRA 2DY7A 3BZDB 2OEOA 3BVZA 1Q1EA 1WP6A 3A3GA 4E6IA 1TWHB 3NPPA 1AZQA 3E5SA 2HCIA 1S5ED 1SYGA 5EGTA 3A55A 2BCOA 4XYOA 4K6DA 5COYA 4BA1I 3R2IA 1OXVA 4V0BA 3CRLC 4CBVA 4WJWA 1L0XB 1GHKA 4FF3A 2HQEA 5KIXA 1Y69U 3NK9A 1H8EA 1UD8A 1BDOA 4II3A 2KOLA 3TZUA 2F4IA 4RA8A 1PTOB 5CBAE 5FO8B 2PYKA 1F2MA 2CHBD 5C4XB 1JC7A 1TKWB 2BDOA 2A6EC 2AQ3B 4ZQ3A 1AP0A 3DUZA 4XLCA 4DAVA 2AWOA 1DD2A 1Y8OB 4XLHA 3DM1A 2NYZD 3GTQB 2SDFA 2VB2X 1MGSA 4FF4A 3DHQA 2BE5C 3C1FA 3IFDA 2JYOA 1HUNA 2B8GA 4KHZA 4PMCA 3D4DA 3M4OB 4DFAA 2VUMB 1NR4A 2PW7A 1KDAA 2FMCA 1H8HA 3OE7A 4DXFA 1ET9A 2O5JC 3OMGA 4RKBA 4EQNA 4ODGA 4U673 2WSSA 3ZYYX 1O7LA 1H9KA 1BOSA 1MBYA 5BN3A 4LMQD 5FO9B 3I8ZA 4UZUA 1ZYRD 4CJ2C 1WTOA 1KABA 1JE4A 1EZ8A 1EYCA 4XD7A 2JE6I 3FPUB 3OOCA 2D3NA 1H9SA 4MHEA 2KCNA 5JPNC 2K05A 4TRDA 2F03A 4F87A 5C6AA 3H09A 4DN4M 2E2DC 3RLFA 1IW7C 3Q23A 2H1EA 5CV5A 2TSSA 4CKEA 1LTGD 2YU9B 1VF5C 4L63B 4F8MA 2L11A 3JAME 4XLFA 4MN3A 1ZXTA 3NXWA 5KEEA 4QIWB 2BA0A 2ZT9C 5K5PA 2IX0A 4HSVA 3U9SA 4L8JA 2K01A 3ND9A 2G9HD 1EIGA 3HS0C 4TSFA 1EY8A 3R93A 2L55A 2EOTA 3KLRA 3HAGA 2XOKA 2JEBI 3D4RA 1JQYD 1O7ZA 3I72A 4BBRB 5HGTA 1RDPD 4IURA 4H0LC 1S4ZA 2ZXIA 1HHVA 4QUFA 2SNSA 1Q8IA 1U4PA 4EGVA 3PMFA 4A3IB 4XKVA 1D6EC 1WTQA 1XX8A 2NVQB 3T56B 2ICIA 2HCCA 5NUCA 4FP5D 5FK9C 3VA7A 2XZLA 2Z4HA 1RODA 5A35A 1E1QA 3KF8A 2AUKA 1FNUA 1BCPF 4XN0A 1EIHA 4ABNA 5ELDA 1EL0A 3NSWA 4S3SA 5C3WA 4M8AA 1SJED 5C4JB 5IK2A 1G2TA 3TMEA 1WTPA 4XQJA 1TIID 4X3SA 1GUNA 2QCPX 5IGFA 1FNVA 2IX1A 1TU2B 5HKKA 4J6HA 5EKKA 3K7AB 3P1HA 2F0KA 3C2PA 1CZGA 2XVSA 1HA5A 2A68D 2XNAC 5JJZA 4RHRA 1RTNA 2K03A 4A3KB 5IIFA 5KRUA 1BCPC 5DM73 2F3VA 1Q12A 5G3LF 1BUVT 3D31A 3T53B 2Z1CA 1I4XA 4ZRZA 1KNAA 2ZZEA 4UDUC 2K33A 4XXEA 1SJHD 4Z1MA 2ZTNA 4QUCA 1EY6A 4UAIA 2EDGA 2NN6H 4K8IA 1Q1BA 4KK7A 2C9OA 1TWGB 3FKIB 2O2LD 2YYZA 1LT5D 1T5XD 3S9WA 3W2DA 2F0LA 2KUMA 1D2BA 4DK1A 3MFYA 4TKOB 3CRKC 4DNRB 3X3NA 2HDLA 3CESA 1KLUD 2EYLA 3CP2A 2OT2A 2ZXHA 4FVMA 4C3HB 2AQ1B 3MTSA 3BYYB 2XGJA 3GTGB 2L12A 1CA5A 2LFNA 1QILA 1STAA 2NVTB 1B1ZA 3EQLC 2B63B 1RTOA 1BO0A 4KTAA 3U9OA 4C3JB 2NN6G 2LKVA 3MC0B 2HUGA 4G7XA 1TS4A 4Z9CB 1PRTB 3HP3A 4C56C 5CORA 3BC9A 2MP1A 3RUZA 1M4VA 2KVMA 4IUVA 3TSSA 3TZDA 1UD4A 5CDFA 3KUPA 4FF1A 1R4QB 2F0NA 4BA2I 3T4AC 3HGBA 3L7ZC 5CBEE 3HOXB 2F0OA 4J1MA 3SDZA 3OEHA 4XOPA 1YNJD 3Q6SA 3DWAA 3V05A 2Q8TA 1UD6A 3TDQA 2NVYB 2XIWA 1FYCA 4KN4C 3OHXC 1LTID 1A15A 1LT6D 4KY5A 1E2VA 1PTOD 2JIZA 2KEDA 1IKMA 2A6HD 2JA7B 1LT4D 2F0FA 1S5FD 3LNNA 3V2TA 3HOUB 1IYUA 3SHLA 4B3GA 4A3JB 1X32A 4XIGS 1UD2A 3J81E 2O5IC 1EZ6A 3KEWA 2PQEA 4QMGA 1K83B 1CI3M 2A5HA 4K5WA 1V1PA 4A93B 4FNFA 2KECA 3DDYA 3H0GB 4WORA 3TP5A 1MABA 5IT9E 2R3ZA 3BH4A 1I4PA 3DWPA 1G8ZD 1KAAA 2FMMA 3KBXA 3CQZB 1BPLA 3A54A 1PFNA 1UD3A 4ME5A 1S5DD 3ZPNA 3A56A 3VR5A 3NTHA 4K14A 1O7YA 3GP7A 2E1BA 1OO9B 1DONA 1PZJD 3JAML 5C5MA 4M1UB 5JEAJ 2D5DA 5DNFA 4ILWA 3EJIA 4XDXA 3IAYA 3I4LA 4X3TA 1DOKA 1VLYA 2WP8J 1RHPA 1WTHD 5I6YA 5EPLA 1CHPD 2RSNA 4CJ0B 5E4WC 4XLEA 2EYPA 1T5EA 4B08A 3OSOA 1C8CA 1CTMA 1OXXK 2K1BA 1LT3D 5LHY1 3BDCA 4C1NI 4JMQA 3M7NA 1SYCA 2EJGC 2AWNA 1EFID 2EY2A 2L4NA 5JOBA 3NHHA 2F1MA 1Q90A 3HOVB 3PO2B 1I4RA 1RJTA 4OGQC 2B2TA 4K8JA 5DM63 2FFKB 4CKCA 2RSOA 2Z8LA 1KDBA 5J22A 4NW2A 3R8BA 2ZZQA 5FL7A 5CC4A 3GV6A 5FO7B 1A6XA 5E1FA 1UEAB 2F0SA 1MI2A 3R2TA 1CHQD 2B2VC 4C3IG 4C3HG 3GVJA 1HQMC 4KN7C 1SNDA 2A69C 3VYTA 3GTOB 1OXUA 1PXUA 3EFXD 1E3XA 1G91A 4IALA 1BMFA 5TSSA 2F0HA 3P7JA 3E0JA 4Q0FA 4ZYSA 1B2TA 4C3JG 3QOJA 5KNCA 4KV6A 5I9OA 4TQUS 4FXGC 3GVKA 1DOLA 5KNLA 1UUPA 2A74C 3MA2B 3S1RB 3CHBD 2WKCA 5EPKA 4JBWA 1GUSA 4KY7A 1DJRD 5C0XJ 3K5OA 2M5SA 4BS9A 2AUJD 3VYRA 3D8GA 1PFBA 3GTKB 3PUWA 3JU4A 1YNNC 2EY1A 2VJJA 3WDNA 1XWEA 4FXUA 1EWCA 3CU7A 4B3FX 3TP6A 2L5TA 4IUUA 4XR6A 1PYWD 5EPJA 4RHSA 5ELCA 1Y8NB 1QG7A 2B2TC 2MGSA 1I4GA 2WV6D 1B9NA 1WPCA 5D65A 1EY0A 1SYDA 5K36H 2N88A 2ZTGA 1PLFA 3S1NB 3BG3A 3IL8A 5CMDA 1D5ZC 2AQ2B 5IGDA 5J39A 4EQPA 2XWBB 1SYBA 1RD9D 4XTCS 2WZPP 2CW0D 3FPPA 2EYOA 2DIEA 4LAAA 1F2YA 1Z47A 2WPDA 1WCMB 3I91A 2QKIC 2SOBA 4DAYA 3E6ZX 5FOBB 3H94A 5K36G 3LX0A 3NE5B 4ZKBB 3HG9A 4WRDA 4X3UA 2CK3A 1PRTD 1F2LA 4A3DB 2MPMA 3BCFA 1E2WA 1W0JA 5JEAH 3SVMA 4FXDA 1ONLA 2ZZGA 4HMJA 2JXMB 4XYQA 1ILQA 4KJOA 4C1NK 1II3A 1IHZA 3J81L 2R93B 1WVLA 1STHA 4CGYB 1B44D 2RA4A 5EKLA 3I73A 5D3DA 1WD0A 4EQOA 4B9XA 3H91A 4PQXA 4NKLA 2KJXA 3NP8A 1AFPA 2IJ0A 5JEAG 5IT9L 4TT3A 5M3MB 2B2WA 4N9TA 2F0VA 1LTTD 2M9VA 1AEXA 2PMZB 4IFDJ 4G6IA 1W0KA 1NBMA 2D2CC 3AB9A 2G9DA 1WTVA 3NWTA 1SE4A 1C48A 2F0WA 2WIIB 4OO1H 1NSNS 4HCSA 1SE3A 1TS3A 2I07B 1CA6A 1HA6A 2PNRC 2L1BA 5E4XA 5JPMC 3UI2A 5JVH3 1ML0D 3T13A 1ZYRC 1R9TB 5F2DA 5EBDA 1JCKB 3C46A 2GJKA 1Y1VB 5I4DA 1TS2A 1E43A 1O80A 1A3VA 2NN6I 4XT1B 1HUMA 1PTOH 1ENCA 3FRPB 1B50A 3BDOA 5DAUA 3ITPA 1CZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO1 G;  3A8K E;  4H13 C;  4JBW A;  2A68 D;  3PUZ A;  1TKW B;  1E2W A;  2BE5 D;  3QG1 A;  1EWH A;  2BDO A;  1GUS A;  2A6E C;  2BA1 A;  1GUO A;  1T5E A;  1H9M A;  3P20 A;  5JEA H;  2JEA I;  4LJZ C;  2K7V A;  3VR6 A;  4IFD G;  1FYC A;  1CTM A;  1GHJ A;  1ONL A;  2BA0 A;  3PUX A;  2ZT9 C;  1OXX K;  4KN4 C;  1Q12 A;  2AWO A;  1DD2 A;  2JXM B;  1Y8O B;  3D31 A;  4L8J A;  3T53 B;  1HCZ A;  2EJF C;  3M4Y A;  2AUJ D;  2DN8 A;  3ND9 A;  4PV1 C;  3VR4 A;  3M7N A;  1E2Z A;  1Z7T A;  1E2V A;  2EJG C;  3PUW A;  5BN4 A;  2K33 A;  2BE5 C;  1SMY C;  1ZKO A;  1YNN C;  1O78 A;  1YNJ C;  4LK1 C;  3KLR A;  3WDN A;  2EJM A;  3ND8 A;  3QIA A;  1CFM A;  2A68 C;  1LAB A;  2A6H D;  2E76 C;  5C0X H;  1Z6H A;  2JEB I;  2B8G A;  3LNN A;  3A7L A;  4KI0 A;  3VR2 A;  1GUT A;  3N6R A;  4KHZ A;  1IYU A;  1LAC A;  3W3A A;  3D4R A;  3I73 A;  1OXS C;  2L5T A;  2F1M A;  4HR7 B;  1Q90 A;  4XIG S;  2EDG A;  2NN6 H;  2B8F A;  4IQZ A;  2K32 A;  1Q1B A;  3A8J E;  3I72 A;  4JK1 C;  3PUV A;  4OGQ C;  2IT1 A;  3VR3 A;  2Q8I B;  1PMR A;  1HTP A;  2PPB C;  4KKT A;  1DCZ A;  1Y8N B;  2YYZ A;  2O5I C;  2PCF B;  2V4D A;  3GD7 A;  2O5J C;  1G29 1;  1V8Q A;  1CI3 M;  4DK0 A;  1B9N A;  4DK1 A;  4H0L C;  3PV0 A;  3MFY A;  4TKO B;  1OXT A;  2A6H C;  3QJY A;  3U9S A;  1GJX A;  5KND A;  5JEA G;  4KKS A;  2A69 D;  3CRK C;  3GQB A;  4DNR B;  3T51 B;  1VCI A;  4KMU C;  5K36 H;  1K8M A;  1O7L A;  4DNT B;  1H9K A;  2EVB A;  3PUY A;  1A6X A;  2E74 C;  5BN5 A;  3BG3 A;  2R6G A;  5BN3 A;  4RCN A;  1Q1E A;  2E75 C;  2D2C C;  3DXJ C;  2DNE A;  1VDZ A;  3OPO A;  3AB9 A;  3LWU A;  1I6V C;  1IYV A;  1H9S B;  3T56 B;  4OO1 H;  1HQM C;  5C0X G;  4KN7 C;  4G7O C;  2A69 C;  3EQL C;  4XTC S;  2PNR C;  3VA7 A;  4IFD H;  3FPP A;  1OXU A;  1IW7 D;  2JE6 I;  4BA1 I;  2KA7 A;  1DXM A;  3OW7 A;  2NN6 G;  3OOC A;  1V43 A;  3A8I E;  5A35 A;  5KNB A;  1H9S A;  1OXV A;  3CRL C;  1B9M A;  2AUK A;  3VR5 A;  3SE0 A;  3M85 A;  1ZYR C;  1GHK A;  1H9J A;  1Y69 U;  2DNC A;  2A6E D;  3MXU A;  5KNC A;  3H94 A;  3IKJ A;  5K36 G;  1BDO A;  1QJO A;  3A7A B;  2CW0 C;  3TZU A;  4BA2 I;  3NE5 B;  3HGB A;  4TQU S;  1K8O A;  1FR3 A;  3RLF A;  3L7Z C;  1IW7 C;  2D5D A;  2NN6 I;  4G7Z C;  2KCC A;  3FMC A;  1Y8P B;  1GUG A;  4H44 C;  1GUN A;  4I7Z C;  3SDZ A;  3I4L A;  1HPC A;  1TU2 B;  2LMC B;  4GZY C;  4G7H C;  3BDO A;  1VF5 C;  2D62 A;  3IFT A;  1VF7 A;  4KKU A;  2QF7 A;  1H9R A; 
#chains in the Genus database with same CATH topology
 4OO1 G;  1EEI D;  4H02 A;  2W6I A;  3PUZ A;  2B5O A;  5BR8 L;  3KYH C;  2BA1 A;  1QNU A;  1GUO A;  1A2T A;  1H9M A;  4LJZ C;  2WAQ E;  3A35 A;  1SAP A;  4A3F B;  2Q6I A;  1ENF A;  1KDC A;  2L0C A;  4UP9 A;  2Z6K A;  1RCV D;  1NJI C;  3GTQ H;  1AW7 A;  3M4Y A;  2IHF A;  2EYF A;  1KK0 A;  3E0E A;  1SE2 A;  2UXB Q;  5JJL A;  1GUW A;  1STE A;  2PZU A;  5J1Z A;  1CNF A;  1CNE A;  1ILP A;  2FJ2 A;  1VJS A;  1SSO A;  4P1V A;  5IP9 H;  1A3U A;  2ZXR A;  3Q0A A;  5C0X H;  2XGT A;  1GUT A;  3N6R A;  2VXW A;  1IBK L;  4BXX H;  1NUC A;  3LGJ A;  1F9R A;  4DR3 L;  2C35 B;  4HIM A;  3ASP A;  4M0L A;  1PKV A;  2NUC A;  1PH2 A;  4NNJ A;  5KW9 A;  1LLR D;  4QIW E;  3ZIA A;  3AVU A;  5GV8 A;  1TQO A;  3T16 A;  2J7K A;  1CK1 A;  2ZL6 A;  5FJ8 G;  2WJY A;  5I9P A;  1HFN A;  2RDF A;  4XNF A;  1I4Q A;  3N52 A;  1BR9 A;  3W2F A;  2X6W A;  3QR8 A;  1QNK A;  4OEL B;  2QE7 A;  2Y0S B;  5KYL A;  3GVL A;  1FD7 D;  1GAQ A;  1SNO A;  2A1A A;  4HTH A;  1E3P A;  1OB0 A;  5GAE C;  4DAM A;  1EXM A;  1LM0 A;  2E74 C;  1FNB A;  1JWU D;  1RF2 D;  4QB4 A;  4BWG B;  4RKL A;  1P4M A;  2XNC A;  1C7Y A;  5AJ3 L;  1BF4 A;  1VQN B;  2BGI A;  4NMZ A;  2K28 A;  2CVR A;  5CYU A;  1X65 A;  3HOZ B;  3BDL A;  4K2K A;  1Q81 C;  5F4O A;  1TVX A;  2A19 A;  2WR8 A;  2YWF A;  5AFW A;  5IP9 G;  5C0X G;  3KFU A;  3CCM B;  1UE7 A;  5C3E B;  1MRZ A;  5ELO A;  4BXX G;  2O4X A;  1YJ9 B;  3OFN A;  3G7L A;  1FJG L;  1QCB D;  3W2E A;  1H42 A;  1STN A;  3A5Z B;  1DG1 G;  2G5D A;  1U4L A;  4J8Q A;  3A8I E;  4DGZ A;  2Q2T A;  1N32 Q;  4X66 Q;  2P3M A;  1SRO A;  4OHJ A;  3K5N A;  4JI6 Q;  2VS1 A;  4NDX A;  2XRQ D;  2VBS A;  3FEW X;  2A73 B;  3ERS X;  3SE0 A;  2UUC L;  3TRZ A;  5A2Q E;  3CCS B;  2P5Z X;  3RR5 A;  2NBF A;  3URY A;  4BBS B;  1BQQ T;  1E62 A;  1AIP A;  1WOO A;  1UNS A;  4GNX B;  2N3S A;  1WCM G;  3KF6 B;  3G6E B;  2JDI A;  3A3B A;  1CM9 A;  4LF7 Q;  4OPS A;  1LTR D;  3M3Y B;  2D9U A;  3BVM A;  3FMC A;  3S15 B;  1N8R D;  1HPC A;  2LMC B;  2HMA A;  3NUC A;  2WAC A;  3TS0 A;  1SFO B;  5AN9 A;  3TP7 A;  1G7S A;  3BCD A;  4GN5 A;  3X3M A;  5FLX c;  2PQA A;  1EIF A;  5THX A;  2DJF C;  2C78 A;  2QA4 B;  1I50 B;  1P16 A;  2IX3 A;  4JYA L;  2XWJ B;  4XQQ A;  1F9P A;  3S14 B;  4DR4 L;  2RCN A;  4YHH L;  4DR7 L;  3EVQ A;  4B47 A;  4Y9U A;  3CPX A;  1LTB D;  2Z6K C;  4DXG A;  2LY7 A;  1YIT A;  5LMU L;  2OTL A;  4IOA A;  5CV7 A;  3W1B A;  3WOF A;  3SEJ A;  3QE2 A;  4LF9 L;  1MJE A;  4TMZ A;  1CFM A;  2A68 C;  1PA6 A;  1Z6H A;  4IPG A;  4B3X A;  4LFB Q;  5FO1 A;  4KI0 A;  1JOK A;  4GQN A;  4QFM A;  4HAE A;  2X53 S;  4BBR H;  3J7Y W;  1RKN A;  1G7C A;  4R4T A;  2HT1 A;  2JJ2 A;  2OK8 A;  2R61 A;  4X3K A;  1NTG A;  1CUK A;  3GSI A;  2NB0 A;  1J9O A;  1MHW C;  1SBB B;  1CSQ A;  2OBS A;  1EEF D;  2OXP A;  3PCO B;  1Y1W B;  3ONU A;  1IBL Q;  1PJ5 A;  4WZT A;  3PV0 A;  1EY9 A;  1OXT A;  3M9B A;  1PYB A;  4PZ6 A;  4KKS A;  3J7A V;  1I6H B;  4B44 A;  1K8M A;  2QEJ C;  5FLX E;  1VMP A;  5FA6 A;  2F4V Q;  4WWV A;  4A3I H;  1L1O B;  2Z0S A;  3KLS A;  4HCE A;  2RC5 A;  2F43 A;  5I6W A;  4QVA A;  4CDE C;  2D9R A;  5M3M G;  1Y1V H;  2OK7 A;  2CND A;  1U5K A;  2NVQ H;  4X7D A;  2VQF Q;  4XL9 A;  1I6V C;  1IBM Q;  2DYI A;  2B3G A;  3AMU A;  1NB0 A;  4FO2 A;  1N34 Q;  1F9S A;  3SK4 A;  4AVZ A;  4ZCK A;  1AE3 A;  4QF4 A;  3S24 A;  3S1M B;  1YX2 A;  1XFO A;  1ICF B;  2GQF A;  1BCP B;  1HTL D;  4IFD H;  1XQB A;  3CCU B;  4DUY L;  2EPB A;  4BBR G;  1M8A A;  2DY8 A;  1BNZ A;  1TY0 A;  4JI8 L;  3CCR A;  3OJX A;  1DYQ A;  2OBT A;  1QGA A;  1SN8 A;  2I5L X;  5CV6 A;  1VQO A;  2EIX A;  3NTI A;  3BYT B;  4LF6 L;  1JWS D;  1SNP A;  3NQI A;  1H9J A;  4QCL A;  1KZL A;  2F0I A;  1YJN B;  5C4J H;  3QOL A;  4DV7 L;  1PH8 A;  4LBZ A;  2ZJR A;  5IGB A;  1JOR A;  3ONY A;  3A7A B;  5IYD H;  1O7I A;  4A3I G;  3LWE A;  5TR9 A;  3AYH B;  2OTJ A;  2BN4 A;  3S1Q B;  1WTW A;  4TSS A;  4I7Z C;  3DEP A;  1Y1V G;  2E1R A;  4G7H C;  1VQG A;  4HE6 A;  2D62 A;  1F9Q A;  3IFT A;  1PH7 A;  1QUF A;  1SMY D;  2OF1 A;  4PC6 A;  2QF7 A;  4ME3 A;  3WQZ A;  2DUD A;  4H13 C;  4A3K H;  3ASR A;  3D6W A;  3D26 A;  4EX5 A;  1JA0 A;  2JEA I;  1M90 D;  5IP7 H;  4GKK L;  1DDI A;  3K5L A;  1PTO F;  4IFD G;  4X62 Q;  4P74 A;  1MKH A;  3GO5 A;  2GJR A;  1GHJ A;  2DCU A;  1L2F A;  2B2U A;  2IWH A;  2NZ1 D;  2TMP A;  1TT2 A;  2F0U A;  4ZUJ A;  1HCZ A;  3CTA A;  3K58 A;  2WKD A;  4KD4 A;  3AVX A;  1K28 D;  2BOS A;  5BN4 A;  2K5W A;  1LUZ A;  1JOQ A;  1YNJ C;  1NMG A;  2X6X A;  4P2C B;  4ZUI A;  3TP8 A;  3CMM A;  1EIY B;  2UU9 L;  3WY9 A;  4DR2 L;  4WJ3 M;  2C2W A;  1KTV A;  2F1L A;  1QWY A;  3A7L A;  4HJ8 A;  3GTL B;  5IYD G;  2X8K A;  1HZA A;  1VQ9 B;  1HNX Q;  3FKI H;  2ZXO A;  3VR3 A;  1SEB D;  2Q8I B;  4LBV A;  4KKT A;  5C3E H;  1LO5 D;  3A74 A;  2JA8 B;  4PG3 A;  4XLA A;  3Q39 A;  1PTO C;  5ELE A;  1V1O A;  5DEH A;  2F0P A;  4A3K G;  1ASY A;  4JPB W;  1QE6 A;  2Q8R E;  2A6H C;  3HRZ C;  1HFG A;  3CCL B;  2K75 A;  3J80 c;  5IP7 G;  4TN1 A;  1HNW Q;  1BVS A;  3T51 B;  2K50 A;  3ER0 A;  4K5V A;  4KHV A;  4C3H H;  1K73 D;  3GTG H;  1Q8K A;  4HJ9 A;  1W6J A;  2Y0S G;  4YCW A;  2K5D A;  1EU3 A;  3CC7 B;  2IW3 A;  4JCV E;  1W9X A;  1KNE A;  2NVT H;  4AYB B;  1S5C D;  3MEF A;  2QW7 A;  2Z4I A;  2CQA A;  3D4W A;  4ALP A;  3SR1 A;  4OPV A;  5A88 A;  5HGQ A;  2MHV A;  2N55 A;  4RH6 A;  2JJ1 A;  1MD2 D;  4NXN Q;  1EY4 A;  4KD3 A;  1SFO H;  3FKI G;  4DNI A;  2LS0 1;  1N33 L;  4DA2 A;  4CHT B;  2PO4 A;  4RFB A;  5C3E G;  2I0Q A;  3AU7 A;  4FDB A;  3M85 A;  3OAA A;  1FRQ A;  1XNR Q;  4HMI A;  1EWI A;  5I2Y A;  1STG A;  1I8D A;  2A6E D;  3NWS A;  3ISX A;  3IKJ A;  4DAP A;  2EIF A;  2EE1 A;  1NNX A;  4IUN A;  2BM0 A;  1SLJ A;  3HOX H;  3J80 E;  4G7Z C;  2GK7 A;  2Q2I A;  2CWP A;  1W87 A;  4FF2 A;  2KCT A;  1GUG A;  3NEN A;  1J8I A;  1TR5 A;  3KK7 A;  4ZAI A;  4GZY C;  5DLQ E;  4QUZ A;  2R7Z B;  1N32 L;  5IGE A;  1HZE A;  2YWG A;  4XKW A;  2BE5 D;  4LFC Q;  4R9W A;  3ZJY C;  1BQE A;  4JI6 L;  5KGU A;  1W6K A;  2NVY H;  4GN4 B;  3MXP A;  2BDN A;  4Y7N B;  1Y14 B;  5HZB A;  1KRS A;  2K7V A;  2BSA A;  1IKL A;  4N9P A;  1SNM A;  2QDB A;  2NZH A;  1I4H A;  2M00 A;  4LF7 L;  2B2U C;  5C4Z A;  2JSO A;  4RGM A;  5EQ0 A;  1V0F A;  2PNH A;  1PYS B;  3ONA B;  3ASS A;  1BXT A;  2JA7 H;  4A76 A;  4N8X 1;  2B29 A;  1O78 A;  3DMU A;  2ZJQ A;  4EVO A;  5LL6 S;  3HKZ B;  3QIA A;  3HOU H;  2F0E A;  2YTY A;  4DV0 Q;  3H3V H;  1QVF B;  5BSY A;  5C3X A;  3ERO A;  1BBX C;  5EAY A;  1EQR A;  1SXT A;  5KYI A;  2NWG A;  1GJR A;  2KQ3 A;  1TTT A;  2KBN A;  3D6C A;  4HR7 B;  3HOX G;  4DR3 Q;  1COW A;  3PUV A;  2IT1 A;  1V9P A;  1K83 H;  1HTP A;  2VJI A;  1EU4 A;  3MZ5 A;  3BS1 A;  2NVX B;  3CC2 A;  1DM0 B;  2ZTE A;  4P12 A;  1D5X C;  4K2L A;  3W5H A;  2X6L A;  5IYQ A;  2QN6 A;  3NQT A;  2QGQ A;  4NBS A;  1AN8 A;  3BU2 A;  3JC6 6;  3VYS A;  4QY7 A;  3I56 A;  2CH4 W;  3PUY A;  1IL8 A;  4DV2 Q;  4LFB L;  5FIU A;  3I70 A;  2PMD A;  3EIV A;  3H0G H;  2ALY B;  1XB2 A;  1WJJ A;  5AJ3 Q;  4RPD A;  2V31 A;  3I55 B;  4FXK C;  2JA7 G;  3HZX A;  3GV3 A;  1QH0 A;  3E9H A;  5LMN L;  5J35 A;  2Q6O A;  1NR2 A;  3CQZ H;  3S1Q H;  1X54 A;  5A2Q L;  2ZXP A;  4YWK A;  4NXM Q;  4F7D A;  4ACB A;  1PZK D;  2DOG A;  2K6A A;  2F0Q A;  2RKS A;  4M4S A;  4PNY A;  2X6G A;  1IW7 D;  2XRS D;  4HED A;  2FHT A;  4ULL A;  1HZ9 A;  3UDI A;  2JA6 B;  2H4O A;  2AMC B;  1NCV A;  1KLG D;  1E79 A;  3C2Q A;  2F4V L;  3K6O A;  3G05 A;  3OIP A;  3I4O A;  3Q22 A;  4O1N A;  2XND A;  1N0V C;  1Q82 C;  5CR3 A;  4LUV A;  1YJ9 A;  3L3O C;  3A0J A;  4RGT A;  1GXD C;  3MXU A;  3WYA A;  1IBM L;  5CV4 A;  3G6J B;  4NP5 A;  1N34 L;  5JBQ A;  3OIQ A;  3RLN A;  2B39 A;  2UUB L;  3HEJ A;  1VQK B;  4MIU A;  1F77 A;  4RDK A;  3MVV A;  4ZGN B;  4X6A H;  1TLL A;  1X3Q A;  3H0G G;  3SXH A;  1EFU A;  3WOE A;  3MXG A;  4GNX A;  2R92 B;  2RDG A;  3KF6 A;  1ZEQ X;  3M7G A;  2QTZ A;  1VQ7 A;  2VNU D;  2F52 A;  1OHH A;  4KJN A;  2HLD A;  3H9N A;  3DEO A;  2JP1 A;  2V7T A;  1VQ5 B;  4E0F A;  3CXC B;  4R8N A;  2JA8 H;  3MFG A;  1XE1 A;  1ZM3 A;  1JB3 A;  1V1P B;  2F0D A;  3MHB A;  3PUX A;  4DR4 Q;  4DR7 Q;  2WJV A;  3VR4 A;  1S72 B;  3F2U A;  4OWX B;  5H5J A;  2VNI A;  1TS5 A;  3QFR A;  1Z7T A;  4RCO A;  3EA6 A;  3MAQ A;  2QA4 A;  1Q86 D;  1SR3 A;  3I3C A;  1WU8 A;  4PC7 A;  4OO1 I;  3DLL A;  2J0T D;  1SYE A;  2IL8 A;  2QDL A;  4OWT B;  5IYB H;  3HOV H;  1K3R A;  1N9W A;  3I90 A;  4FYD A;  3BVG A;  4IN3 A;  2RC6 A;  2K32 A;  3A8J E;  5C5L A;  4X65 Q;  4ZGQ B;  4XQN A;  5FLX L;  1XYI A;  2PPB C;  3QFS A;  1DCZ A;  3ERQ A;  4IUP A;  3RNU A;  2PCF B;  3GTM B;  1VQP B;  3OZV A;  1HRJ A;  4DF7 A;  2XZO A;  4HID A;  3P27 A;  3J81 j;  1CT1 D;  4KMU C;  2JA8 G;  2X85 A;  3ULJ A;  4JI2 Q;  2EVB A;  3RZD B;  1SNC A;  2DET A;  5BN5 A;  4DUZ Q;  1KXL A;  1SDF A;  4RCN A;  2WAQ B;  2E75 C;  1D1K A;  1KMH A;  4DKA C;  1VDZ A;  1HNX L;  4BY7 B;  1I18 A;  5T1G A;  1XPO A;  1A0I A;  3V76 A;  1VQ4 A;  3G4S B;  3PIO 3;  1BLI A;  2OYN A;  2HDN B;  1FGB D;  3GTP B;  1L1O A;  3GTO H;  3T1Y L;  4X8I A;  5IYB G;  3PUN A;  4JC0 A;  3GTJ B;  2VNK A;  1K3B C;  4YWM A;  3BY1 A;  1R5O A;  1HNW L;  5CGK A;  4OIK A;  5IOD A;  3C3L A;  4N8F A;  1B9M A;  4Y7N H;  3S17 B;  3S2H B;  4A3C G;  4PMW A;  3JQR A;  4LF6 Q;  4A3M B;  2F3W A;  4HSP A;  1TY2 A;  1UAP A;  1EY7 A;  5C0X I;  4OL7 A;  1PRT F;  1YHA A;  1KD1 C;  2BGJ A;  2CW0 C;  1ET6 A;  1K8O A;  2EXZ A;  1BCP D;  3UDX A;  1FR3 A;  1U4M A;  3A8K A;  3FDT A;  4F7X A;  1Y8P B;  2NTS A;  1BJK A;  5FKA C;  3SK5 A;  4H44 C;  4NXN L;  4LFA Q;  3IRB A;  3S1R H;  4LNQ A;  4P73 A;  1PDQ A;  2ICE C;  1T9H A;  2ZJP A;  4GNX C;  2XSC A;  4Z4Y A;  3VDY A;  3CCE B;  2C5C A;  1OGI A;  2V7Q A;  1UMK A;  5LMZ A;  4OOS A;  2Q2U A;  4ID6 A;  4ZV4 A;  1STB A;  3J7A F;  3P20 A;  1XNR L;  4GKK Q;  4I7A A;  1K8A C;  4JW0 A;  3OTO Q;  1L0W A;  3WBK A;  5T1I A;  3U50 C;  1NE3 A;  2Q2H A;  1SKY B;  4LF5 Q;  1PRT C;  1UE6 A;  1TUI A;  3ZC3 A;  1VHE A;  4IUQ A;  4RD4 A;  4LK1 C;  1ESF A;  1E0B A;  5ELF A;  2XN9 C;  2HIV A;  1CQV A;  1D5M C;  2E76 C;  3NTK A;  1YBY A;  5G3L D;  2OCE A;  3RZO B;  4LFC L;  4G4K A;  5CV9 A;  4YEJ A;  3CPW A;  1HA3 A;  3K57 A;  5E3F A;  1TWF B;  3TRE A;  1QZH A;  4IUT A;  2EY6 A;  3HKZ G;  3K0Y A;  2J4X A;  4C2M B;  4DV5 L;  4LF8 Q;  1PMR A;  3S16 B;  2V7U A;  1VQL A;  2D0P A;  3QO2 A;  1RQR A;  2CQO A;  3GD7 A;  4DR1 Q;  1LTA D;  4C0S A;  5ISR A;  4DK0 A;  5J3O A;  4AF6 A;  3QJY A;  5KND A;  3GQB A;  1X6O A;  3S1N H;  4R8I A;  1JB7 A;  1Q3L A;  3K59 A;  4DNT B;  4DV0 L;  4AIM A;  1TWA B;  2B2Y A;  1IB0 A;  4Q5V A;  1JB9 A;  3QWN A;  5HUR A;  3DXJ C;  3JQP A;  3E20 A;  3G48 A;  4RD6 A;  1I94 Q;  3VNU A;  4V19 0;  2KHS A;  3LWU A;  2ID0 A;  4UY8 C;  2JA5 B;  3U6B A;  2JK8 A;  3KOJ A;  3V96 A;  2JN4 A;  2RVL A;  1ZUN B;  3FP9 A;  2X69 A;  4XON A;  4GOP A;  2DJG C;  4U68 A;  1X3P A;  5F4J A;  1K9M D;  1SYF A;  1WFQ A;  5EKI A;  3H3V C;  1DXM A;  1WCM H;  1QFY A;  1V43 A;  1T6X A;  5KNB A;  4ZK9 B;  4G57 A;  2X6Y A;  1VQ6 B;  1K0R A;  3SEB A;  3VA5 A;  3RMH A;  3NBH A;  1N33 Q;  3QFC A;  2B2W C;  1XXG A;  2PMZ E;  4DV2 L;  3J80 L;  1D7Q A;  5M5Y B;  4RGO S;  1LTS D;  4MYU A;  3AEV A;  4RCZ A;  1QX4 A;  1XTD A;  3W2H A;  2K04 A;  2DNC A;  5GRO A;  1OB2 A;  4OOX A;  3WND A;  4YIJ A;  3K80 C;  1QJO A;  1QFZ A;  2E2I B;  3ES9 A;  4NXM L;  2QDX A;  1ASZ A;  1A8P A;  2VNH A;  4RJL A;  2MNA A;  3CCQ A;  2QEX B;  4GLX A;  1YJW A;  3BY2 A;  3FKS A;  2KEE A;  4XMY A;  4A3D H;  3U4V A;  1FVI A;  3B8H A;  1GOZ A;  4RPB A;  2E2J B;  2HDM A;  2UUA Q;  1JOO A;  1VMC A;  3QG1 A;  1FX0 A;  1EWH A;  5M3F B;  4BY1 B;  4YWL A;  1HVX A;  1JJC B;  4IZ8 A;  3VR6 A;  4XT3 B;  1N05 A;  1V1Q A;  2HIX A;  1JWM D;  4DU9 A;  1FNW A;  3JAM i;  2ZTC A;  3J7Z C;  3GTM H;  3CME B;  1CQX A;  2W6J A;  1G2S A;  5JVG 3;  1ZM4 A;  2DN8 A;  1E1O A;  3Q6R A;  2CFM A;  3SJZ A;  3CP0 A;  4RWS C;  2GVA A;  1CQF A;  1UD5 A;  2J7Z A;  1YIJ B;  2R93 H;  3ND8 A;  2ZZF A;  4DV6 L;  4C3I B;  3SK6 A;  1PV4 A;  1EFT A;  2QTL A;  1TWC B;  2OQ0 A;  4YAO A;  4IFD I;  4BY7 H;  4IOC A;  1RIP A;  1EUJ A;  1YLO A;  1LAC A;  1JJ2 B;  2F0T A;  1EYD A;  3OMC A;  3HOW B;  2NTT A;  4PC3 A;  4XOT A;  4DR6 L;  1P8L A;  2K5H A;  1HZC A;  2RDH A;  4RGN A;  4A3D G;  5M5X B;  1YI2 B;  2V4D A;  3NBI A;  1JIC A;  4CKB A;  1QVF A;  2K4K A;  2EYH A;  3STB D;  3GTJ H;  1I5F A;  5ELB A;  2N49 A;  5J3B A;  1STY A;  2F0G A;  5M3M H;  2N8N A;  1CKN B;  2SNM A;  2IHE A;  1G6Z A;  1WI5 A;  4RG1 A;  3I4M B;  1QG0 A;  2WB1 B;  3A8J A;  4A3G B;  4L6T B;  1XJV A;  3FVQ A;  1S5B D;  3K0X A;  4ACA A;  3G71 B;  1ICW A;  1KQS A;  2R6G A;  2B2Y C;  2EYJ A;  1XTC D;  2IPK D;  2DNE A;  1PH6 A;  3U2Q A;  3OPO A;  4N3N A;  4UZF A;  3CKI B;  4X65 L;  2F3I A;  1EQV A;  2R93 G;  1IYV A;  1H9S B;  2F0J A;  1MSH A;  3KLS X;  4CJ1 B;  1BKB A;  4PZ8 A;  5LMN Q;  5IGG A;  1HH2 P;  4QGU A;  4BY7 G;  1C4Q A;  2NZO A;  2Y0S E;  4P22 A;  1NRK A;  1SM4 A;  4Y52 H;  1IHM A;  4GOP C;  2KA7 A;  3OEE A;  1WTX A;  3OWE B;  3KDF A;  3H6M A;  3KL9 A;  4JI2 L;  1JE5 A;  1KRT A;  1A2U A;  1R9T H;  4L5S A;  5EJW A;  4DUZ L;  4HIK A;  2MUY A;  5GAG C;  1NDH A;  1E3Z A;  4WZK A;  4P71 A;  2FIN B;  5IT9 c;  1WOC A;  4MYT A;  4II2 A;  1EP1 B;  4B48 A;  3S2D B;  1MSG A;  1E1R A;  2UUB Q;  2MJ8 A;  4B43 A;  2QMU A;  2KCC A;  1WTR A;  4ASU A;  4XOR A;  4LC0 A;  2Z6B D;  3WXM A;  2GJP A;  4P75 A;  4DV1 Q;  3KBG A;  1QUE A;  1T6Z A;  1HQR D;  1TWF H;  1VF7 A;  4K6L A;  2IY5 B;  4Z4U A;  1H9R A;  3TBI B;  4Z4R A;  1WOS A;  3A1P A;  1F2Z A;  4C2M H;  5LL6 X;  4DQK A;  4A3F H;  2ZTD A;  2JN9 A;  2R9V A;  4B3R Q;  2FVG A;  1I3Q B;  4M53 A;  1GR1 A;  1KRH A;  2YWE A;  1HNZ L;  1VQJ A;  1X3G A;  4OIJ A;  1EY5 A;  1AZP A;  3HFZ B;  4PV1 C;  2EJF C;  3OZU A;  1JR0 D;  2L15 A;  1A3T A;  1N8R C;  4B4D A;  1R5B A;  1E2Z A;  1ESR A;  4ZKC B;  3UE1 A;  4POG A;  4KY6 A;  4KLK A;  3PUM A;  2VZA A;  4LFA L;  4POF A;  3I4N B;  2GA4 B;  4AQY Q;  1U4R A;  1L0Y B;  1LAB A;  4HIZ A;  1GD7 A;  3C1E A;  3CMA A;  3B82 A;  3CCJ A;  3PSI A;  1QZG A;  1N07 A;  2Q6L A;  1HXY D;  1KL9 A;  2B2V A;  3PO3 B;  2D3L A;  3OP1 A;  3W3A A;  1OXS C;  4HN7 A;  1Q46 A;  3KLW A;  2B8F A;  1V0E A;  4IQZ A;  4JK1 C;  3OTO L;  4WFN 3;  1Q9S A;  2PW5 A;  3LO8 A;  2GK6 A;  1QB5 D;  1K28 A;  3E1Y E;  4JBJ A;  5C4H A;  1SNQ A;  1FRN A;  5JAV A;  4JI4 L;  1G29 1;  2BMW A;  4LF5 L;  2VW9 A;  3M4Q A;  1BX0 A;  1NY4 A;  1YHB A;  2UXC Q;  4A3F G;  3DWQ A;  3JQQ A;  2A69 D;  1EFW A;  4CQJ A;  4XN3 A;  1PFM A;  1VCI A;  3PGZ A;  3PIP 3;  2Q6K A;  1FND A;  1EWY A;  5HXB A;  1EOT A;  3OW2 B;  1FNM A;  4MNO A;  1U9R A;  2F0M A;  4G1B A;  2SEB D;  4PMB A;  2WIN B;  3HOZ H;  2VNJ A;  2EZV A;  2LZJ A;  1B3A A;  4DV4 Q;  4LF8 L;  2I46 A;  3KF8 B;  5L37 A;  2ENB A;  4DR1 L;  1EQT A;  3T1Y Q;  4G7O C;  1B53 A;  1Q7Y D;  2KVO A;  4ZLT F;  3OZW A;  3BNW A;  2M2L A;  3MWY W;  5EMN A;  3OW7 A;  2KHJ A;  3Q24 A;  3QB3 A;  5CV8 A;  1QOH A;  3TN2 A;  3O13 A;  5D3I B;  4BBS H;  3CB4 A;  1NAP A;  1PH4 A;  1YNX A;  1JJG A;  1DAR A;  3Q6Q A;  2L9H A;  1V5V A;  3HOY B;  4A3B B;  1I94 L;  1ZM2 A;  4B9W A;  3H3V I;  1PZI D;  4GS3 A;  3K7U C;  5IOC A;  3M3Y H;  2EY5 A;  4YXW A;  1W2B B;  1LTL A;  4XQF A;  3S15 H;  3PIO A;  1R4P B;  2K5Q A;  2R6H A;  5GAD C;  2QIL A;  4XM3 A;  4RAU C;  4G7W A;  3HOZ G;  5LMN W;  4C43 A;  1LV9 A;  2VB3 X;  2E2H B;  5DN6 A;  2RBM A;  3K5M A;  3LVB A;  4KKU A;  1YNN D;  5M9O A;  2EXD A;  1EYA A;  3A8K E;  1CKM A;  4CDD C;  5IGC A;  1I50 H;  3CC4 B;  1DZ1 A;  3S14 H;  2B7B A;  3OWF A;  4P6Y A;  3P75 A;  3W2G A;  4YEL A;  4K5X A;  4L5Q A;  3J81 k;  4YAU A;  3L9A X;  2PZT A;  5I2X A;  1CKO A;  3MEH A;  4QQB X;  2EYM A;  2PIA A;  1YHQ A;  3AVY A;  1DOM A;  2ATW A;  3AST A;  3SLD A;  4N3G A;  5EBC A;  4BBS G;  4A3E B;  1VQ8 B;  1U2R A;  1SMY C;  1ZKO A;  4O42 A;  4IPH A;  4B3M L;  2EJM A;  1B2R A;  5D14 A;  2XZP A;  4WQM A;  2A8V A;  3SK8 A;  3VR2 A;  1M90 C;  1G6P A;  3RD4 A;  3VYU A;  3MXN A;  2UUA L;  3AFQ A;  4H7B A;  4PC1 A;  1B4O A;  3CPF A;  5IYN A;  4DV5 Q;  1D1I A;  1KHI A;  1PH1 A;  1NBW A;  1Y1W H;  1KTK A;  1V8Q A;  5H59 A;  3J81 i;  1C9O A;  5C44 B;  1I6H H;  1X3F A;  1ENA A;  4I65 A;  4F88 A;  2RQX A;  3R3O A;  2VQE Q;  5M5W B;  3CP8 A;  2PZW A;  1GJX A;  3D3R A;  1WD1 A;  3E3X A;  1EFR A;  2DY7 A;  3BZD B;  4OXP A;  2OEO A;  4TMV A;  3BVZ A;  2GVB A;  1Q1E A;  1WP6 A;  3A3G A;  4E6I A;  1TWH B;  3NPP A;  1AZQ A;  2K14 A;  3E5S A;  3S1M H;  2HCI A;  1S5E D;  4G1V A;  1W34 A;  3BQJ A;  1SYG A;  5EGT A;  3A55 A;  2PQA B;  2MFI A;  4DV3 Q;  4CDF C;  1RL2 A;  1GM5 A;  2BCO A;  4M2L A;  4XYO A;  3CD6 B;  4K6D A;  5COY A;  1K73 C;  1MJC A;  4BA1 I;  1WYD A;  3R2I A;  1OXV A;  4V0B A;  3CAM A;  3CRL C;  4NPS A;  4CBV A;  1YIT B;  4UP8 A;  4JI1 L;  4WJW A;  1Y1W G;  4JI0 Q;  1L0X B;  1I3Q H;  1GHK A;  4FF3 A;  2HQE A;  2VZL A;  5KIX A;  1Y69 U;  3NK9 A;  1H8E A;  1UD8 A;  1XMO Q;  1BDO A;  4II3 A;  1KC8 D;  1VQ6 A;  2KOL A;  3TZU A;  2C5H A;  2DGY A;  2F4I A;  4Y9R A;  3AGP A;  5B6I A;  4QV2 A;  3L0O A;  1EQQ A;  1QGZ A;  2RCF A;  1A63 A;  4RA8 A;  4JV5 Q;  1PTO B;  1VQN A;  4P2N A;  3PO3 H;  5CBA E;  5FO8 B;  2PYK A;  1F2M A;  3H15 A;  2CHB D;  1F60 A;  4X64 Q;  5C4X B;  1JC7 A;  1TKW B;  4NB3 A;  4O2D A;  2BDO A;  3B78 A;  2A6E C;  3CCM A;  5L46 A;  2AQ3 B;  4JOI A;  1XPU A;  4ZQ3 A;  4WZL A;  3DUZ A;  1AP0 A;  4XLC A;  4R71 A;  1KK3 A;  4DAV A;  2AWO A;  1DD2 A;  1K0S A;  3SLN A;  1Y8O B;  4YY3 Q;  4XLH A;  3DM1 A;  2NYZ D;  3GTQ B;  2GPJ A;  4ZCL A;  2SDF A;  2VB2 X;  1MGS A;  3CCS A;  4GLA C;  4FF4 A;  2CH4 A;  3DHQ A;  2BE5 C;  1RQP A;  4ZCM A;  3VNV A;  3C1F A;  3IFD A;  3CME A;  2JYO A;  1YEZ A;  1FNC A;  4DV1 L;  5IYW A;  4DV6 Q;  3GTL H;  1HUN A;  3G6E A;  2B8G A;  4OWW B;  2LSS A;  4L5R C;  1QVC A;  4KHZ A;  4PMC A;  3D4D A;  3M4O B;  2K52 A;  4DFA A;  1GO3 E;  4ZCI A;  2VUM B;  2BM1 A;  2CCZ A;  1NR4 A;  2PW7 A;  1KDA A;  2FMC A;  1H8H A;  4DR6 Q;  3OE7 A;  4DXF A;  4B3R L;  1ET9 A;  3CCR B;  5ELN A;  1VQO B;  3Q8D A;  3PO3 G;  2O5J C;  3OMG A;  4RKB A;  1E1T A;  4A75 A;  4EQN A;  4ODG A;  1X3E A;  4U67 3;  4HJA A;  4R4C A;  1QVG B;  3HKZ E;  2WSS A;  1S3O A;  4AQY L;  4AC9 A;  3ZYY X;  1O7L A;  4TMT A;  1E63 A;  1H9K A;  1BOS A;  4UP7 A;  2OTJ B;  3HOY H;  2HQL A;  2XTI A;  1MBY A;  5BN3 A;  3JAM c;  1IJF A;  4LMQ D;  1QUQ B;  5FO9 B;  3U58 A;  3I8Z A;  4UZU A;  1ZYR D;  4CJ2 C;  3UDG A;  1WTO A;  1KAB A;  2E5L Q;  1SE8 A;  1JE4 A;  1EZ8 A;  4A3C H;  1EYC A;  4PZ7 A;  4XD7 A;  2E2H H;  4PGO A;  4CDC C;  2BV3 A;  2UXC L;  4APV A;  4QVJ A;  2JE6 I;  3FPU B;  3WNC A;  3OOC A;  1FGU A;  2D3N A;  2E8G A;  3E9I A;  1H9S A;  4MHE A;  2VBV A;  3W2I A;  3ASQ A;  2KCN A;  2K05 A;  5JPN C;  2V7X A;  4TMX A;  1NB9 A;  4OOV A;  1M1K D;  4DQL A;  4LW1 A;  4TRD A;  2F03 A;  4F87 A;  1N36 L;  5C6A A;  4DV4 L;  1UE5 A;  2CRV A;  3H09 A;  1IL2 A;  3QFT A;  4DN4 M;  2E2D C;  3RLF A;  1IW7 C;  1NJI D;  3HOY G;  3Q23 A;  2H1E A;  2CW5 A;  5CV5 A;  2MQH A;  2R7Z H;  2TSS A;  4AYB G;  4LWC A;  1VQA A;  4CKE A;  1LTG D;  2YU9 B;  4WZE A;  1VF5 C;  4L63 B;  4F8M A;  1OB5 A;  2L11 A;  3JAM E;  4RCY A;  4XLF A;  5IWA L;  4MN3 A;  1VLO A;  1ZXT A;  3NXW A;  5KSW B;  4JBM A;  3CCU A;  4WJ4 A;  5TY0 A;  1J5E L;  5KEE A;  5TRD A;  4QIW B;  2BA0 A;  2JJQ A;  2ZT9 C;  2V7V A;  2D0O A;  1FL0 A;  5K5P A;  4UAJ A;  1HNZ Q;  2IX0 A;  4HSV A;  3U9S A;  4L8J A;  2K01 A;  3ND9 A;  3BZK A;  1KJZ A;  2G9H D;  1EIG A;  1QFJ A;  3HS0 C;  4TSF A;  3PA2 A;  1EY8 A;  3R93 A;  2L55 A;  2EOT A;  3KLR A;  3HAG A;  1YJN A;  2XOK A;  3U6K A;  2JEB I;  1TWH H;  3I1F A;  3SJP A;  3D4R A;  3ULP A;  3F2D A;  1JQY D;  1O7Z A;  3I72 A;  4BBR B;  2R7Z G;  3CCV B;  3CRZ A;  2NVX H;  3HKS A;  1HZB A;  5HGT A;  1D1N A;  1RDP D;  4JI4 Q;  1Q81 D;  1VQD A;  4IUR A;  1Q86 C;  2YTX A;  4H0L C;  1H95 A;  2EQS A;  1S4Z A;  4UZE A;  3ICE A;  2C4T A;  2ZXI A;  4QUF A;  1HHV A;  1X9N A;  5GV7 A;  2SNS A;  4JI7 Q;  1Q8I A;  1U4P A;  2XNJ A;  2MO0 A;  4EGV A;  5C44 G;  3PMF A;  4HJ5 A;  4A3I B;  4XKV A;  1Y0R A;  3AVW A;  1SRU A;  1NMF A;  4Z4V A;  5BSX A;  1D6E C;  1WTQ A;  1IXR A;  1XX8 A;  2NVQ B;  5FNZ A;  3T56 B;  2ICI A;  2HCC A;  5NUC A;  1PJ6 A;  4FP5 D;  3AVT A;  5FK9 C;  3OW2 A;  1VHO A;  2I5H A;  3VA7 A;  2XZL A;  2Z4H A;  2JA6 H;  4DK6 C;  2VQE L;  1VQ9 A;  1ROD A;  3L2P A;  2X3U A;  1VQF A;  5A35 A;  1E1Q A;  4J0Q A;  5C4X H;  4GKJ Q;  1B7Y B;  4M1K A;  3KF8 A;  3Q3A A;  2AUK A;  3I7F A;  1FNU A;  3PIP A;  1BCP F;  2HD3 A;  4XN0 A;  1GVP A;  1EIH A;  3LQ6 A;  3W5U A;  4ABN A;  5ELD A;  1EL0 A;  3NSW A;  1Y0Y A;  2AHO B;  4S3S A;  5C3W A;  3CCL A;  4RD1 A;  4M8A A;  4TMW A;  1SJE D;  5C4J B;  5IK2 A;  3VO2 A;  1G2T A;  3TME A;  1EP2 B;  1WTP A;  4DV3 L;  4XQJ A;  2R92 H;  1L1O C;  1D8L A;  1TII D;  4X3S A;  5FLM H;  1GUN A;  2QCP X;  5IGF A;  1FNV A;  3CC7 A;  2IX1 A;  1TU2 B;  5HKK A;  1GAW A;  2I5M X;  4J6H A;  5EKK A;  3K7A B;  3P1H A;  3M4O H;  1GO2 A;  3CC2 B;  2F0K A;  2VUM H;  3C2P A;  1W2B A;  1CZG A;  2XVS A;  1HA5 A;  2A68 D;  2XNA C;  5JJZ A;  4JI0 L;  4RHR A;  1XNQ L;  4Z4Z A;  1RTN A;  2K03 A;  1JMC A;  4A3K B;  1DGS A;  5IY0 A;  5IIF A;  3F8T A;  5KRU A;  2JA6 G;  1T6Y A;  1BCP C;  3I56 B;  5DM7 3;  2F3V A;  1Q12 A;  1XMO L;  5G3L F;  5C4X G;  1BUV T;  3D31 A;  3T53 B;  3UE0 A;  2Z1C A;  1I4X A;  4ZRZ A;  4H9G A;  1KNA A;  3CC4 A;  1B23 P;  2ZZE A;  4UDU C;  4X07 A;  2K33 A;  4JV5 L;  3T1H Q;  4B3M Q;  4XXE A;  1SJH D;  4Z1M A;  4YHB A;  2BH8 A;  4Z4W A;  2ZTN A;  2PI2 A;  4QUC A;  1VQB A;  4X64 L;  2WZN A;  1EY6 A;  4UAI A;  4IJL A;  2R92 G;  1VQ8 A;  2EDG A;  2NN6 H;  4NCN A;  4K8I A;  2UXD L;  1Q1B A;  4KK7 A;  5FLM G;  2C9O A;  5IYP A;  1TWG B;  4K1X A;  2O2L D;  3FKI B;  4JG2 A;  3AFP A;  2YYZ A;  3F1Z A;  1LT5 D;  1T5X D;  3S9W A;  3W2D A;  4YY3 L;  2F0L A;  3MCA A;  2VUM G;  1HJP A;  2KUM A;  4LUZ A;  1D2B A;  4DK1 A;  3PEN A;  3MFY A;  4TKO B;  2R7F A;  3CRK C;  3PF5 A;  4DNR B;  3PQI A;  4LUO A;  3RZD H;  1QGY A;  3X3N A;  2HDL A;  3CES A;  3VO1 A;  1KLU D;  2EYL A;  1VS0 A;  3CP2 A;  2OT2 A;  2ZXH A;  4FVM A;  4C3H B;  2AQ1 B;  4YAW A;  2NPF A;  3MTS A;  3BYY B;  2XGJ A;  3GTG B;  2L12 A;  4FK8 A;  1CA5 A;  1XMQ Q;  2LFN A;  1QIL A;  1STA A;  3VMF A;  3GTP H;  2NVT B;  1VQ7 B;  1UEB A;  2VYQ A;  1B1Z A;  1W35 A;  2RHQ B;  2ES2 A;  4K0K L;  4ROX A;  1FDR A;  3EQL C;  2B63 B;  5GQO A;  1RTO A;  1BO0 A;  3SGI A;  2YU9 H;  4DAY B;  4KTA A;  3U9O A;  4C3J B;  1PH9 A;  4DR5 L;  2NN6 G;  1WSR A;  2LKV A;  5FO0 A;  2HUG A;  4G7X A;  3MC0 B;  1TS4 A;  3MHP A;  3S17 H;  4Z9C B;  1PRT B;  3W5O A;  3S2H H;  1IYJ B;  3HP3 A;  5H1S E;  4A3M H;  1DDG A;  3TQY A;  4C56 C;  5COR A;  3BC9 A;  2MP1 A;  4JI1 Q;  1M4V A;  3RUZ A;  2KVM A;  2PLF A;  4OP7 A;  4IUV A;  3TSS A;  3CD6 A;  3TZD A;  2YWH A;  1S4M A;  1UD4 A;  2HCJ B;  5CDF A;  3KUP A;  2E5L L;  4FF1 A;  1R4Q B;  3J81 c;  2F0N A;  4BA2 I;  3T4A C;  3HGB A;  1K9M C;  2WFW A;  3L7Z C;  5CBE E;  2WAQ G;  1VQM B;  4HJ7 A;  1PJ7 A;  2DER A;  4G5G A;  3HOX B;  1EFC A;  2F0O A;  4J1M A;  3SDZ A;  3OEH A;  1WDT A;  2GN5 A;  4XOP A;  1HR0 Q;  1UE1 A;  2CF4 A;  4J15 A;  3I55 A;  5E6T A;  4R4I A;  3A5U A;  2ASB A;  1YNJ D;  4PC2 A;  3DWA A;  3Q6S A;  1ELO A;  2C5B A;  3V05 A;  2Q8T A;  1UD6 A;  3TDQ A;  2ZBU A;  3P26 A;  2NVY B;  1TXY A;  1A62 A;  2XIW A;  2D74 A;  4EH1 A;  1FYC A;  4KN4 C;  3OHX C;  1LTI D;  1A15 A;  1LT6 D;  2Z6B A;  4KY5 A;  4A3M G;  4HIO A;  2FX3 A;  1E2V A;  3UDF A;  1PTO D;  2JIZ A;  2KED A;  1IKM A;  1VQ4 B;  4KHP Q;  1N08 A;  5TV2 A;  3RZO H;  2A6H D;  2JA7 B;  1LT4 D;  2F0F A;  1S5F D;  4LF4 L;  3LNN A;  3V2T A;  3HOU B;  1IYU A;  3SHL A;  4B3G A;  4A3J B;  1X32 A;  1VQK A;  4OON A;  4XIG S;  3S16 H;  3AQQ A;  1A8V A;  1UD2 A;  3J81 E;  1MIU A;  2O5I C;  1EZ6 A;  3AGQ A;  3KEW A;  2PQE A;  4QMG A;  1K83 B;  3M4P A;  1CI3 M;  2A5H A;  1E64 A;  1PHJ A;  4K5W A;  1VQ5 A;  4O0A A;  3CXC A;  5IYC H;  4OX9 L;  1TWA H;  1V1P A;  4A93 B;  1IZ6 A;  4FNF A;  4P9S A;  1GVH A;  2KEC A;  3DDY A;  1S72 A;  1VQC A;  4DPG A;  3H0G B;  1QVG A;  4WOR A;  2JA5 H;  3TP5 A;  1MAB A;  4DK3 C;  5HY6 A;  5IT9 E;  4EQ5 A;  3STB C;  3U4Z A;  2ZM6 Q;  1CSP A;  2R3Z A;  3BH4 A;  1I4P A;  3WBJ A;  1X55 A;  3DWP A;  2OWO A;  1YZ6 A;  4JI5 Q;  1G8Z D;  1KAA A;  2HHH L;  4B3T Q;  2C4U A;  2FMM A;  3KBX A;  2CWA A;  3CQZ B;  1BPL A;  3CF5 A;  3A54 A;  3K7A H;  1IJE A;  2ZIT A;  2RHS B;  1G7R A;  1QUQ A;  1PFN A;  1UD3 A;  1E24 A;  1WOP A;  2WB1 E;  4ME5 A;  5M5Y H;  1S5D D;  3ZPN A;  3A56 A;  4Z4T A;  3VR5 A;  4JI7 L;  5DSZ A;  1VQP A;  1G7T A;  4JBK A;  3NTH A;  4K14 A;  4B3S L;  1O7Y A;  2RF4 A;  3GP7 A;  1N36 Q;  4X06 A;  2E1B A;  1OO9 B;  2E2I H;  1DON A;  1PZJ D;  5IYC G;  3JAM L;  1KK2 A;  2YTV A;  4P72 A;  5C5M A;  3CPW B;  4M1U B;  4X7C A;  5JEA J;  4A3L H;  2D5D A;  5DNF A;  1WTH A;  4ILW A;  3EJI A;  4XDX A;  3IAY A;  2QGG A;  3I4L A;  2DEU A;  1VQI A;  4BPR A;  1DOK A;  4X3T A;  1VQL B;  1VLY A;  2E2J H;  3CW2 A;  1U0L A;  2WP8 J;  3OJW A;  2ZBV A;  2LXJ A;  1S40 A;  2JA5 G;  4GKJ L;  3G4S A;  1N06 A;  1RHP A;  5M3F H;  1WTH D;  2OQK A;  5EPL A;  5I6Y A;  4BY1 H;  1CHP D;  2RSN A;  3SKB A;  1E22 A;  4CJ0 B;  5IWA Q;  1TWG H;  5E4W C;  4XLE A;  2EYP A;  4IO9 A;  1T5E A;  4B08 A;  3OSO A;  1C8C A;  3OKX A;  1C0A A;  4U9U A;  1BBW A;  1CTM A;  3NEL A;  1J5E Q;  1N0U A;  1OXX K;  2KHI A;  2K1B A;  1LT3 D;  5LHY 1;  3BDC A;  4JI3 Q;  4C1N I;  1S0U A;  4JMQ A;  2UXB L;  3M7N A;  1SYC A;  3FHW A;  2B7C A;  2EJG C;  4RDJ A;  5DS0 A;  2AWN A;  4C3I H;  3K8A A;  1EFI D;  2BH2 A;  1TWC H;  2EY2 A;  2L4N A;  5JOB A;  1TVC A;  3HOW H;  4GOP B;  3NHH A;  4A3L G;  1HR0 W;  2F1M A;  1Q90 A;  3HOV B;  3PO2 B;  1I4R A;  1RJT A;  4PAB A;  4IPD A;  5M5X H;  4OGQ C;  2B2T A;  3NBH B;  4K8J A;  5DM6 3;  2FFK B;  2B63 H;  4CKC A;  2RSO A;  2BPO A;  2Z8L A;  1KDB A;  5J22 A;  5M3F G;  4RLZ A;  3CCE A;  3AVV A;  4NW2 A;  4BY1 G;  3R8B A;  4C3J H;  3I4M H;  2K5N A;  4A3G H;  2ZZQ A;  5FL7 A;  5CC4 A;  4QJF A;  2KCM A;  2CBX A;  4P3I A;  3GV6 A;  3T1H L;  3B6Y A;  3CCV A;  5FO7 B;  2CC2 A;  1A6X A;  4PAA A;  5E1F A;  1PVO A;  3V7A A;  1UEA B;  3R6J A;  3CCQ B;  4IJH A;  2F0S A;  1YJW B;  1MI2 A;  2JQO A;  3R2T A;  1CHQ D;  4X0C A;  2B2V C;  1Q82 D;  4C3I G;  2X0K A;  3A8I A;  2BF4 A;  4C3H G;  4OPO A;  3GVJ A;  1HQM C;  3I2Z A;  4RDL A;  4KN7 C;  1SND A;  2A69 C;  3HOW G;  3VYT A;  3GTO B;  1OXU A;  1PXU A;  3EFX D;  1E3X A;  1G91 A;  4IAL A;  4UPA A;  4X66 L;  1BMF A;  5TSS A;  2B63 G;  2F0H A;  3RLO A;  1B3Q A;  2V1C C;  4Y7C A;  3P7J A;  3E0J A;  5BR8 Q;  4Q0F A;  4ZYS A;  1B2T A;  4C3J G;  3QOJ A;  2Z9H A;  3I4M G;  4YCU A;  4A3G G;  2WB1 G;  1XMQ L;  5KNC A;  5F4M A;  3S2D H;  4KV6 A;  5I9O A;  1Q7Y C;  4TQU S;  4FXG C;  4IW3 B;  3GVK A;  2MO1 A;  1DOL A;  3MMP A;  1W3S A;  5KNL A;  1UUP A;  2AHO A;  4A3J H;  4P25 A;  2A74 C;  3MA2 B;  3S1R B;  3CHB D;  2WKC A;  3CW2 C;  2CKZ B;  5EPK A;  1IBK Q;  4JBW A;  2OTL B;  4UHV A;  1GUS A;  1PH5 A;  1XNQ Q;  3PVD A;  4KY7 A;  1EYG A;  5JJK A;  1DJR D;  1B70 B;  5C0X J;  1Z9F A;  3K5O A;  2ZL7 A;  4AYB E;  2M5S A;  4BS9 A;  1VQH A;  1KQS B;  2ZL5 A;  4LBW A;  2AUJ D;  2H5X A;  3K81 C;  3VYR A;  3D8G A;  1JNY A;  2BVN A;  4P3Y A;  3DM3 A;  1PFB A;  3I4N H;  3GTK B;  3PUW A;  1ZM9 A;  4A93 H;  3JU4 A;  5IE8 A;  1YNN C;  2EY1 A;  2VJJ A;  3WDN A;  4P26 A;  1AE2 A;  1HR0 L;  1XWE A;  4FXU A;  2FXQ A;  4GN3 B;  2K5V A;  1EWC A;  3CU7 A;  4B3F X;  4Q7J B;  1EP3 B;  1PFS A;  3TP6 A;  2L5T A;  4IUU A;  3RY8 A;  1OTC A;  4XR6 A;  1PYW D;  3KDF B;  2QEX A;  5EPJ A;  2UXD Q;  4RHS A;  5ELC A;  2PI2 E;  1Y8N B;  3HOU G;  3BJU A;  1QG7 A;  4A3J G;  2B2T C;  2MGS A;  1I4G A;  2VL6 A;  2WV6 D;  1B9N A;  2PE3 A;  2GRE A;  1IBL L;  1WPC A;  1FJG Q;  5D65 A;  1EY0 A;  3ZZ0 A;  3GDE A;  3PA1 A;  4R4Q A;  1SYD A;  4KHP L;  5K36 H;  2N88 A;  2ZTG A;  4P6V F;  1PLF A;  3WWV A;  3S1N B;  2UUC Q;  3BG3 A;  3IL8 A;  4X7F A;  5CMD A;  2AKW B;  4TVA B;  1D5Z C;  3EBE A;  3I4N G;  2VQF L;  4A93 G;  1WSV A;  4Z4S A;  2AQ2 B;  5IGD A;  5J39 A;  1YIJ A;  4EQP A;  2XWB B;  1SYB A;  4RM0 A;  1YVC A;  3ULL A;  4K0K Q;  1RD9 D;  1KD1 D;  4XTC S;  2WZP P;  4YAF A;  3W5V A;  1SKQ A;  3FJO A;  3ZZT A;  3FPP A;  2CW0 D;  1JJ2 A;  2EYO A;  2DIE A;  4LAA A;  3RN5 A;  1F2Y A;  4DR5 Q;  1Z47 A;  3FPK A;  1E7Z A;  3GIR A;  3F2C A;  2WPD A;  1WCM B;  3I91 A;  4MZ9 A;  1K8G A;  3PF4 A;  2QKI C;  1YI2 A;  4YCV A;  4RD2 A;  3ZZU A;  4A3B H;  2R7D A;  2SOB A;  3BZC A;  1XPR A;  4DAY A;  4JYA Q;  1CKN A;  3E6Z X;  3CCJ B;  5FOB B;  4FN5 A;  3CMA B;  4YHH Q;  3H94 A;  2ZM6 L;  1K8A D;  5K36 G;  4QL5 A;  2LXK A;  3LX0 A;  3NE5 B;  4JI5 L;  5LMU Q;  4B3T L;  4ZKB B;  4RD3 A;  3G71 A;  4JVZ A;  3HG9 A;  4WRD A;  4X3U A;  1AMO A;  4LF9 Q;  2V7W A;  2CK3 A;  3ZBT A;  5A89 A;  1PRT D;  3W1G A;  1F2L A;  3KJP A;  3J7A 5;  3J80 i;  4A3D B;  3PO2 H;  3LQE A;  2MPM A;  3TEH B;  3BCF A;  1E2W A;  3QSY A;  4R4O A;  1W0J A;  1AH9 A;  1JA1 A;  1VQM A;  4QHY A;  4R1J A;  5JEA H;  1WOR A;  4X62 L;  3RN2 A;  1KC8 C;  4X7E A;  3ZBU A;  4RMF A;  1UWV A;  3SVM A;  1SMX A;  4FXD A;  1ONL A;  2ZZG A;  4HMJ A;  5E7N A;  1OGJ A;  2JXM B;  4XYQ A;  1ILQ A;  4KJO A;  2F4N A;  4A3E H;  2DY1 A;  4C1N K;  5HZA A;  1R5N A;  1II3 A;  4LBY A;  4A3B G;  1IHZ A;  3J81 L;  1GKH A;  5JJI A;  1BX1 A;  1G51 A;  1D2E A;  2R93 B;  5IYR A;  1LYL A;  1WVL A;  1VQE A;  1STH A;  2VBT A;  4LF4 Q;  2OBR A;  4CGY B;  1B44 D;  4MTK A;  2RA4 A;  3I73 A;  4MTN A;  5EKL A;  5D3D A;  3Q38 A;  1WD0 A;  4EQO A;  1I7P A;  4RD0 A;  1EOV A;  1KK1 A;  4B9X A;  3H91 A;  4JOI C;  3OYY A;  4PQX A;  1JT8 A;  1J9Z A;  4JI3 L;  4NKL A;  5C44 H;  4L5T A;  3HOV G;  2KJX A;  5M5W H;  3PO2 G;  4DUY Q;  3NP8 A;  2XEX A;  2WYR A;  1KAW A;  1AFP A;  1J6Q A;  2IJ0 A;  3D0F A;  5IT9 L;  4TT3 A;  5JEA G;  5M3M B;  2B2W A;  3KJO A;  1F20 A;  4OX9 Q;  4FWT A;  4N9T A;  4JI8 Q;  2F0V A;  3ZUG A;  1LTT D;  1H85 A;  5A8A A;  1AEX A;  1X56 A;  2M9V A;  2PMZ B;  1KIX A;  4IFD J;  3EN2 A;  4OEM B;  1BBU A;  4A3E G;  3R6K A;  4G6I A;  1W0K A;  4YAL A;  1NBM A;  2D2C C;  3AB9 A;  2VY3 A;  2G9D A;  2YV5 A;  4DV7 Q;  3NWT A;  4IPC A;  1SE4 A;  2N78 A;  1WTV A;  4HE5 A;  1C48 A;  1PH3 A;  2F0W A;  2WII B;  4OO1 H;  1NSN S;  4AH6 A;  4HCS A;  1SE3 A;  2HHH Q;  1TS3 A;  2I07 B;  1CA6 A;  1HA6 A;  2VBU A;  2PNR C;  2L1B A;  3NEM A;  2JA9 A;  3F2B A;  4X05 A;  5E4X A;  1YHQ B;  2KEN A;  4GLV B;  5JPM C;  2I1L A;  1D8T A;  3UI2 A;  3WNB A;  5JVH 3;  1ML0 D;  3T13 A;  1ZYR C;  1R9T B;  5F2D A;  4B3S Q;  5EBD A;  2C77 A;  1B8A A;  1JCK B;  2NV4 A;  3C46 A;  2EFG A;  2GJK A;  1Y1V B;  5I4D A;  1TS2 A;  3MXN B;  3GTK H;  1E43 A;  1O80 A;  1A3V A;  2NN6 I;  4XT1 B;  1HUM A;  1PTO H;  1ENC A;  3FRP B;  5GAH C;  3TS2 A;  1B50 A;  4A4I A;  2UU9 Q;  5FJ8 H;  4DR2 Q;  3BDO A;  1M1K C;  5DAU A;  3ITP A;  4AF7 A;  1CZW A; 
#chains in the Genus database with same CATH homology
 4OO1 G;  1EEI D;  2W6I A;  3PUZ A;  2BA1 A;  1QNU A;  1GUO A;  1A2T A;  1H9M A;  4LJZ C;  3A35 A;  1SAP A;  4A3F B;  1ENF A;  1KDC A;  2L0C A;  1RCV D;  1AW7 A;  3M4Y A;  2EYF A;  1SE2 A;  1GUW A;  1STE A;  2PZU A;  5J1Z A;  1ILP A;  2FJ2 A;  1VJS A;  1SSO A;  1A3U A;  2ZXR A;  3Q0A A;  5C0X H;  1GUT A;  3N6R A;  2VXW A;  1NUC A;  1F9R A;  2NUC A;  1PKV A;  4NNJ A;  1LLR D;  3ZIA A;  1TQO A;  3T16 A;  1HFN A;  1CK1 A;  2WJY A;  5I9P A;  2RDF A;  4XNF A;  1I4Q A;  3N52 A;  1BR9 A;  2X6W A;  1QNK A;  2QE7 A;  2Y0S B;  5KYL A;  3GVL A;  1FD7 D;  1SNO A;  4HTH A;  1OB0 A;  2E74 C;  1JWU D;  1RF2 D;  4QB4 A;  4BWG B;  4RKL A;  1BF4 A;  4NMZ A;  2K28 A;  2CVR A;  5CYU A;  3HOZ B;  3BDL A;  4K2K A;  1TVX A;  5AFW A;  5C0X G;  5C3E B;  2O4X A;  3OFN A;  3G7L A;  1QCB D;  1STN A;  1U4L A;  4J8Q A;  3A8I E;  4DGZ A;  4OHJ A;  3K5N A;  4NDX A;  2XRQ D;  3FEW X;  2A73 B;  3SE0 A;  5A2Q E;  2NBF A;  3URY A;  4BBS B;  1BQQ T;  1UNS A;  2JDI A;  3A3B A;  1CM9 A;  1LTR D;  3M3Y B;  2D9U A;  3BVM A;  3FMC A;  3S15 B;  1HPC A;  2LMC B;  3NUC A;  2WAC A;  1SFO B;  3TP7 A;  3BCD A;  3X3M A;  1I50 B;  2IX3 A;  2XWJ B;  4XQQ A;  1F9P A;  3S14 B;  3EVQ A;  1LTB D;  4DXG A;  2LY7 A;  5CV7 A;  3WOF A;  1CFM A;  2A68 C;  1Z6H A;  4KI0 A;  1JOK A;  4GQN A;  4HAE A;  2X53 S;  3J7Y W;  1RKN A;  2JJ2 A;  2R61 A;  4X3K A;  2NB0 A;  1J9O A;  1SBB B;  1EEF D;  2OXP A;  1Y1W B;  3PV0 A;  1EY9 A;  1OXT A;  4KKS A;  3J7A V;  1I6H B;  1K8M A;  2QEJ C;  5FLX E;  1VMP A;  3KLS A;  4HCE A;  2F43 A;  5I6W A;  4XL9 A;  1I6V C;  3AMU A;  4FO2 A;  1F9S A;  3SK4 A;  4AVZ A;  4QF4 A;  3S1M B;  1HTL D;  1BCP B;  4IFD H;  2EPB A;  1M8A A;  2DY8 A;  1BNZ A;  1TY0 A;  1DYQ A;  5CV6 A;  3NTI A;  3BYT B;  1JWS D;  1SNP A;  3NQI A;  1H9J A;  4QCL A;  1KZL A;  2F0I A;  3QOL A;  5IGB A;  1JOR A;  3A7A B;  3LWE A;  3S1Q B;  1WTW A;  4TSS A;  4I7Z C;  3DEP A;  4G7H C;  2D62 A;  1F9Q A;  3IFT A;  1SMY D;  2OF1 A;  2QF7 A;  3WQZ A;  4H13 C;  3D6W A;  2JEA I;  4IFD G;  3K5L A;  1PTO F;  3GO5 A;  2GJR A;  1GHJ A;  2B2U A;  2IWH A;  2NZ1 D;  2TMP A;  1TT2 A;  4ZUJ A;  2F0U A;  1HCZ A;  3K58 A;  2WKD A;  4KD4 A;  1K28 D;  2BOS A;  5BN4 A;  2K5W A;  1JOQ A;  1YNJ C;  4ZUI A;  4P2C B;  2X6X A;  3TP8 A;  3CMM A;  1QWY A;  3A7L A;  3GTL B;  2X8K A;  2ZXO A;  3VR3 A;  1SEB D;  2Q8I B;  4KKT A;  1LO5 D;  2JA8 B;  4XLA A;  1PTO C;  5ELE A;  1V1O A;  5DEH A;  2F0P A;  1QE6 A;  2Q8R E;  2A6H C;  3HRZ C;  1HFG A;  3T51 B;  4K5V A;  4KHV A;  1W6J A;  2K5D A;  1EU3 A;  2IW3 A;  1W9X A;  1KNE A;  4AYB B;  1S5C D;  2Z4I A;  2CQA A;  3D4W A;  3SR1 A;  2MHV A;  2N55 A;  4RH6 A;  2JJ1 A;  1MD2 D;  1EY4 A;  4KD3 A;  2LS0 1;  4DA2 A;  4CHT B;  2PO4 A;  4RFB A;  3AU7 A;  3M85 A;  3OAA A;  4HMI A;  5I2Y A;  1STG A;  1I8D A;  2A6E D;  3NWS A;  3IKJ A;  4DAP A;  2EE1 A;  4IUN A;  3J80 E;  4G7Z C;  2GK7 A;  4FF2 A;  1GUG A;  1J8I A;  1TR5 A;  3KK7 A;  4ZAI A;  4GZY C;  2R7Z B;  5IGE A;  1HZE A;  4XKW A;  2BE5 D;  4R9W A;  5KGU A;  1W6K A;  3MXP A;  2BDN A;  4Y7N B;  2K7V A;  1IKL A;  4N9P A;  1SNM A;  2QDB A;  1I4H A;  2M00 A;  2B2U C;  5C4Z A;  2JSO A;  4RGM A;  5EQ0 A;  1V0F A;  3ONA B;  1BXT A;  1O78 A;  3DMU A;  4EVO A;  5LL6 S;  3HKZ B;  3QIA A;  2F0E A;  5C3X A;  3ERO A;  1BBX C;  1SXT A;  5KYI A;  2NWG A;  2KQ3 A;  4HR7 B;  3D6C A;  1COW A;  3PUV A;  2IT1 A;  1HTP A;  2VJI A;  1EU4 A;  3MZ5 A;  3BS1 A;  2NVX B;  1DM0 B;  1D5X C;  4K2L A;  2X6L A;  3NQT A;  1AN8 A;  3VYS A;  3PUY A;  1IL8 A;  3I70 A;  2V31 A;  4FXK C;  3HZX A;  3GV3 A;  1NR2 A;  5A2Q L;  2ZXP A;  1PZK D;  2K6A A;  2F0Q A;  2RKS A;  4PNY A;  2X6G A;  1IW7 D;  2XRS D;  4HED A;  2FHT A;  4ULL A;  2JA6 B;  2H4O A;  1NCV A;  1KLG D;  1E79 A;  3K6O A;  3G05 A;  3OIP A;  3Q22 A;  4O1N A;  2XND A;  5CR3 A;  3L3O C;  4RGT A;  1GXD C;  3MXU A;  5CV4 A;  3G6J B;  4NP5 A;  3OIQ A;  2B39 A;  3HEJ A;  4MIU A;  1F77 A;  3MVV A;  1X3Q A;  3SXH A;  3WOE A;  3MXG A;  2R92 B;  2RDG A;  1ZEQ X;  3M7G A;  2VNU D;  1OHH A;  4KJN A;  2HLD A;  3DEO A;  2JP1 A;  4E0F A;  4R8N A;  3MFG A;  1JB3 A;  1V1P B;  2F0D A;  3MHB A;  3PUX A;  2WJV A;  3VR4 A;  3F2U A;  1TS5 A;  4RCO A;  1Z7T A;  3EA6 A;  3MAQ A;  3I3C A;  4OO1 I;  2J0T D;  1SYE A;  2IL8 A;  3I90 A;  4FYD A;  3BVG A;  4IN3 A;  2K32 A;  3A8J E;  5C5L A;  4XQN A;  5FLX L;  1XYI A;  2PPB C;  1DCZ A;  3ERQ A;  4IUP A;  2PCF B;  3GTM B;  1HRJ A;  4DF7 A;  2XZO A;  1CT1 D;  4KMU C;  2X85 A;  2EVB A;  3RZD B;  1SNC A;  5BN5 A;  1SDF A;  4RCN A;  2WAQ B;  2E75 C;  1D1K A;  1KMH A;  4BY7 B;  1VDZ A;  1I18 A;  5T1G A;  3PIO 3;  1BLI A;  1FGB D;  3GTP B;  3GTJ B;  5CGK A;  4OIK A;  5IOD A;  3C3L A;  1B9M A;  3S17 B;  3S2H B;  4PMW A;  4A3M B;  2F3W A;  4HSP A;  1TY2 A;  1UAP A;  1EY7 A;  5C0X I;  4OL7 A;  1PRT F;  2CW0 C;  1ET6 A;  1K8O A;  2EXZ A;  1BCP D;  1FR3 A;  1U4M A;  3FDT A;  4F7X A;  1Y8P B;  2NTS A;  5FKA C;  3SK5 A;  4H44 C;  1PDQ A;  2ICE C;  2XSC A;  2C5C A;  2V7Q A;  4ID6 A;  1STB A;  3J7A F;  3P20 A;  5T1I A;  1SKY B;  1PRT C;  4IUQ A;  4LK1 C;  1ESF A;  1E0B A;  5ELF A;  2XN9 C;  1CQV A;  1D5M C;  2E76 C;  3NTK A;  5G3L D;  3RZO B;  4G4K A;  5CV9 A;  4YEJ A;  3K57 A;  5E3F A;  1TWF B;  4IUT A;  2EY6 A;  3K0Y A;  2J4X A;  4C2M B;  1PMR A;  3S16 B;  3QO2 A;  3GD7 A;  1LTA D;  5ISR A;  4DK0 A;  3QJY A;  5KND A;  3GQB A;  4R8I A;  1Q3L A;  3K59 A;  4DNT B;  1TWA B;  2B2Y A;  4Q5V A;  3QWN A;  5HUR A;  3DXJ C;  4V19 0;  2KHS A;  3LWU A;  2ID0 A;  2JA5 B;  3V96 A;  2RVL A;  2X69 A;  4XON A;  4U68 A;  1X3P A;  1SYF A;  5EKI A;  3H3V C;  1DXM A;  1V43 A;  5KNB A;  4ZK9 B;  4G57 A;  2X6Y A;  3SEB A;  3VA5 A;  3RMH A;  3NBH A;  2B2W C;  1XXG A;  3J80 L;  5M5Y B;  4RGO S;  1LTS D;  2K04 A;  2DNC A;  4YIJ A;  1QJO A;  2E2I B;  3FKS A;  2KEE A;  4XMY A;  1GOZ A;  2E2J B;  2HDM A;  1JOO A;  1VMC A;  3QG1 A;  1FX0 A;  1EWH A;  5M3F B;  4BY1 B;  1HVX A;  4IZ8 A;  4XT3 B;  3VR6 A;  1JWM D;  4DU9 A;  1FNW A;  2W6J A;  1G2S A;  5JVG 3;  2DN8 A;  4RWS C;  1CQF A;  1UD5 A;  2J7Z A;  3ND8 A;  2ZZF A;  4C3I B;  3SK6 A;  1TWC B;  4IFD I;  1LAC A;  2F0T A;  1EYD A;  3OMC A;  3HOW B;  2NTT A;  4XOT A;  2RDH A;  4RGN A;  5M5X B;  2V4D A;  3NBI A;  1JIC A;  4CKB A;  2EYH A;  5ELB A;  1STY A;  2F0G A;  2SNM A;  1G6Z A;  3I4M B;  4A3G B;  2WB1 B;  4L6T B;  3FVQ A;  1S5B D;  1ICW A;  2R6G A;  2B2Y C;  2EYJ A;  1XTC D;  2IPK D;  2DNE A;  3OPO A;  3CKI B;  1EQV A;  1IYV A;  1H9S B;  2F0J A;  1MSH A;  3KLS X;  4CJ1 B;  5IGG A;  1C4Q A;  4P22 A;  1NRK A;  2KA7 A;  3OEE A;  1WTX A;  3OWE B;  3H6M A;  1A2U A;  5EJW A;  2MUY A;  1E3Z A;  2FIN B;  4II2 A;  3S2D B;  1MSG A;  1E1R A;  2MJ8 A;  2KCC A;  1WTR A;  4ASU A;  4XOR A;  2Z6B D;  2GJP A;  3KBG A;  1HQR D;  4K6L A;  1VF7 A;  1H9R A;  3TBI B;  1F2Z A;  5LL6 X;  2R9V A;  1I3Q B;  4OIJ A;  1EY5 A;  1AZP A;  4PV1 C;  2EJF C;  1JR0 D;  1A3T A;  1ESR A;  1E2Z A;  4ZKC B;  4KY6 A;  3I4N B;  2GA4 B;  1U4R A;  1L0Y B;  1LAB A;  4HIZ A;  3C1E A;  3PO3 B;  1HXY D;  2B2V A;  2D3L A;  3W3A A;  1OXS C;  4HN7 A;  2B8F A;  1V0E A;  4IQZ A;  4JK1 C;  4WFN 3;  2PW5 A;  2GK6 A;  1QB5 D;  5C4H A;  1SNQ A;  5JAV A;  1G29 1;  3DWQ A;  2A69 D;  4XN3 A;  1PFM A;  1VCI A;  3PIP 3;  1EOT A;  1U9R A;  2F0M A;  4PMB A;  2SEB D;  2WIN B;  2EZV A;  2LZJ A;  1B3A A;  2I46 A;  2ENB A;  1EQT A;  4G7O C;  1B53 A;  2KVO A;  4ZLT F;  2M2L A;  3MWY W;  3OW7 A;  3Q24 A;  3QB3 A;  5CV8 A;  1QOH A;  3TN2 A;  3O13 A;  5D3I B;  1NAP A;  2L9H A;  3HOY B;  4A3B B;  4B9W A;  1PZI D;  5IOC A;  2EY5 A;  4YXW A;  4XQF A;  1R4P B;  2K5Q A;  2QIL A;  4XM3 A;  4RAU C;  4G7W A;  1LV9 A;  2VB3 X;  2E2H B;  5DN6 A;  2RBM A;  3K5M A;  1YNN D;  4KKU A;  5M9O A;  1EYA A;  3A8K E;  5IGC A;  1DZ1 A;  3OWF A;  3P75 A;  4YEL A;  4K5X A;  3L9A X;  2PZT A;  5I2X A;  3MEH A;  2EYM A;  1DOM A;  5EBC A;  4A3E B;  1SMY C;  1ZKO A;  4O42 A;  2EJM A;  5D14 A;  2XZP A;  3SK8 A;  3VR2 A;  3RD4 A;  3VYU A;  3MXN A;  4H7B A;  1B4O A;  1D1I A;  1KTK A;  1V8Q A;  5C44 B;  1ENA A;  4I65 A;  4F88 A;  2RQX A;  3R3O A;  5M5W B;  1GJX A;  3CP8 A;  2PZW A;  3D3R A;  1WD1 A;  1EFR A;  2DY7 A;  3BZD B;  2OEO A;  3BVZ A;  1Q1E A;  1WP6 A;  3A3G A;  4E6I A;  1TWH B;  3NPP A;  1AZQ A;  3E5S A;  2HCI A;  1S5E D;  1SYG A;  5EGT A;  3A55 A;  2BCO A;  4XYO A;  4K6D A;  5COY A;  4BA1 I;  3R2I A;  1OXV A;  4V0B A;  3CRL C;  4CBV A;  4WJW A;  1L0X B;  1GHK A;  4FF3 A;  2HQE A;  5KIX A;  1Y69 U;  3NK9 A;  1H8E A;  1UD8 A;  1BDO A;  4II3 A;  2KOL A;  3TZU A;  2F4I A;  4RA8 A;  1PTO B;  5CBA E;  5FO8 B;  2PYK A;  1F2M A;  2CHB D;  5C4X B;  1JC7 A;  1TKW B;  2BDO A;  2A6E C;  2AQ3 B;  4ZQ3 A;  1AP0 A;  3DUZ A;  4XLC A;  4DAV A;  2AWO A;  1DD2 A;  1Y8O B;  4XLH A;  3DM1 A;  2NYZ D;  3GTQ B;  2SDF A;  2VB2 X;  1MGS A;  4FF4 A;  3DHQ A;  2BE5 C;  3C1F A;  3IFD A;  2JYO A;  1HUN A;  2B8G A;  4KHZ A;  4PMC A;  3D4D A;  3M4O B;  4DFA A;  2VUM B;  1NR4 A;  2PW7 A;  1KDA A;  2FMC A;  1H8H A;  3OE7 A;  4DXF A;  1ET9 A;  2O5J C;  3OMG A;  4RKB A;  4EQN A;  4ODG A;  4U67 3;  2WSS A;  3ZYY X;  1O7L A;  1H9K A;  1BOS A;  1MBY A;  5BN3 A;  4LMQ D;  5FO9 B;  3I8Z A;  4UZU A;  1ZYR D;  4CJ2 C;  1WTO A;  1KAB A;  1JE4 A;  1EZ8 A;  1EYC A;  4XD7 A;  2JE6 I;  3FPU B;  3OOC A;  2D3N A;  1H9S A;  4MHE A;  2KCN A;  5JPN C;  2K05 A;  4TRD A;  2F03 A;  4F87 A;  5C6A A;  3H09 A;  4DN4 M;  2E2D C;  3RLF A;  1IW7 C;  3Q23 A;  2H1E A;  5CV5 A;  2TSS A;  4CKE A;  1LTG D;  2YU9 B;  1VF5 C;  4L63 B;  4F8M A;  2L11 A;  3JAM E;  4XLF A;  4MN3 A;  1ZXT A;  3NXW A;  5KEE A;  4QIW B;  2BA0 A;  2ZT9 C;  5K5P A;  2IX0 A;  4HSV A;  3U9S A;  4L8J A;  2K01 A;  3ND9 A;  2G9H D;  1EIG A;  3HS0 C;  4TSF A;  1EY8 A;  3R93 A;  2L55 A;  2EOT A;  3KLR A;  3HAG A;  2XOK A;  2JEB I;  3D4R A;  1JQY D;  1O7Z A;  3I72 A;  4BBR B;  5HGT A;  1RDP D;  4IUR A;  4H0L C;  1S4Z A;  2ZXI A;  1HHV A;  4QUF A;  2SNS A;  1Q8I A;  1U4P A;  4EGV A;  3PMF A;  4A3I B;  4XKV A;  1D6E C;  1WTQ A;  1XX8 A;  2NVQ B;  3T56 B;  2ICI A;  2HCC A;  5NUC A;  4FP5 D;  5FK9 C;  3VA7 A;  2XZL A;  2Z4H A;  1ROD A;  5A35 A;  1E1Q A;  3KF8 A;  2AUK A;  1FNU A;  1BCP F;  4XN0 A;  1EIH A;  4ABN A;  5ELD A;  1EL0 A;  3NSW A;  4S3S A;  5C3W A;  4M8A A;  1SJE D;  5C4J B;  5IK2 A;  1G2T A;  3TME A;  1WTP A;  4XQJ A;  1TII D;  4X3S A;  1GUN A;  2QCP X;  5IGF A;  1FNV A;  2IX1 A;  1TU2 B;  5HKK A;  4J6H A;  5EKK A;  3K7A B;  3P1H A;  2F0K A;  3C2P A;  1CZG A;  2XVS A;  1HA5 A;  2A68 D;  2XNA C;  5JJZ A;  4RHR A;  1RTN A;  2K03 A;  4A3K B;  5IIF A;  5KRU A;  1BCP C;  5DM7 3;  2F3V A;  1Q12 A;  5G3L F;  1BUV T;  3D31 A;  3T53 B;  2Z1C A;  1I4X A;  4ZRZ A;  1KNA A;  2ZZE A;  4UDU C;  2K33 A;  4XXE A;  1SJH D;  4Z1M A;  2ZTN A;  4QUC A;  1EY6 A;  4UAI A;  2EDG A;  2NN6 H;  4K8I A;  1Q1B A;  4KK7 A;  2C9O A;  1TWG B;  3FKI B;  2O2L D;  2YYZ A;  1LT5 D;  1T5X D;  3S9W A;  3W2D A;  2F0L A;  2KUM A;  1D2B A;  4DK1 A;  3MFY A;  4TKO B;  3CRK C;  4DNR B;  3X3N A;  2HDL A;  3CES A;  1KLU D;  2EYL A;  3CP2 A;  2OT2 A;  2ZXH A;  4FVM A;  4C3H B;  2AQ1 B;  3MTS A;  3BYY B;  2XGJ A;  3GTG B;  2L12 A;  1CA5 A;  2LFN A;  1QIL A;  1STA A;  2NVT B;  1B1Z A;  3EQL C;  2B63 B;  1RTO A;  1BO0 A;  4KTA A;  3U9O A;  4C3J B;  2NN6 G;  2LKV A;  3MC0 B;  2HUG A;  4G7X A;  1TS4 A;  4Z9C B;  1PRT B;  3HP3 A;  4C56 C;  5COR A;  3BC9 A;  2MP1 A;  3RUZ A;  1M4V A;  2KVM A;  4IUV A;  3TSS A;  3TZD A;  1UD4 A;  5CDF A;  3KUP A;  4FF1 A;  1R4Q B;  2F0N A;  4BA2 I;  3T4A C;  3HGB A;  3L7Z C;  5CBE E;  3HOX B;  2F0O A;  4J1M A;  3SDZ A;  3OEH A;  4XOP A;  1YNJ D;  3Q6S A;  3DWA A;  3V05 A;  2Q8T A;  1UD6 A;  3TDQ A;  2NVY B;  2XIW A;  1FYC A;  4KN4 C;  3OHX C;  1LTI D;  1A15 A;  1LT6 D;  4KY5 A;  1E2V A;  1PTO D;  2JIZ A;  2KED A;  1IKM A;  2A6H D;  2JA7 B;  1LT4 D;  2F0F A;  1S5F D;  3LNN A;  3V2T A;  3HOU B;  1IYU A;  3SHL A;  4B3G A;  4A3J B;  1X32 A;  4XIG S;  1UD2 A;  3J81 E;  2O5I C;  1EZ6 A;  3KEW A;  2PQE A;  4QMG A;  1K83 B;  1CI3 M;  2A5H A;  4K5W A;  1V1P A;  4A93 B;  4FNF A;  2KEC A;  3DDY A;  3H0G B;  4WOR A;  3TP5 A;  1MAB A;  5IT9 E;  2R3Z A;  3BH4 A;  1I4P A;  3DWP A;  1G8Z D;  1KAA A;  2FMM A;  3KBX A;  3CQZ B;  1BPL A;  3A54 A;  1PFN A;  1UD3 A;  4ME5 A;  1S5D D;  3ZPN A;  3A56 A;  3VR5 A;  3NTH A;  4K14 A;  1O7Y A;  3GP7 A;  2E1B A;  1OO9 B;  1DON A;  1PZJ D;  3JAM L;  5C5M A;  4M1U B;  5JEA J;  2D5D A;  5DNF A;  4ILW A;  3EJI A;  4XDX A;  3IAY A;  3I4L A;  4X3T A;  1DOK A;  1VLY A;  2WP8 J;  1RHP A;  1WTH D;  5I6Y A;  5EPL A;  1CHP D;  2RSN A;  4CJ0 B;  5E4W C;  4XLE A;  2EYP A;  1T5E A;  4B08 A;  3OSO A;  1C8C A;  1CTM A;  1OXX K;  2K1B A;  1LT3 D;  5LHY 1;  3BDC A;  4C1N I;  4JMQ A;  3M7N A;  1SYC A;  2EJG C;  2AWN A;  1EFI D;  2EY2 A;  2L4N A;  5JOB A;  3NHH A;  2F1M A;  1Q90 A;  3HOV B;  3PO2 B;  1I4R A;  1RJT A;  4OGQ C;  2B2T A;  4K8J A;  5DM6 3;  2FFK B;  4CKC A;  2RSO A;  2Z8L A;  1KDB A;  5J22 A;  4NW2 A;  3R8B A;  2ZZQ A;  5FL7 A;  5CC4 A;  3GV6 A;  5FO7 B;  1A6X A;  5E1F A;  1UEA B;  2F0S A;  1MI2 A;  3R2T A;  1CHQ D;  2B2V C;  4C3I G;  4C3H G;  3GVJ A;  1HQM C;  4KN7 C;  1SND A;  2A69 C;  3VYT A;  3GTO B;  1OXU A;  1PXU A;  3EFX D;  1E3X A;  1G91 A;  4IAL A;  1BMF A;  5TSS A;  2F0H A;  3P7J A;  3E0J A;  4Q0F A;  4ZYS A;  1B2T A;  4C3J G;  3QOJ A;  5KNC A;  4KV6 A;  5I9O A;  4TQU S;  4FXG C;  3GVK A;  1DOL A;  5KNL A;  1UUP A;  2A74 C;  3MA2 B;  3S1R B;  3CHB D;  2WKC A;  5EPK A;  4JBW A;  1GUS A;  4KY7 A;  1DJR D;  5C0X J;  3K5O A;  2M5S A;  4BS9 A;  2AUJ D;  3VYR A;  3D8G A;  1PFB A;  3GTK B;  3PUW A;  3JU4 A;  1YNN C;  2EY1 A;  2VJJ A;  3WDN A;  1XWE A;  4FXU A;  1EWC A;  3CU7 A;  4B3F X;  3TP6 A;  2L5T A;  4IUU A;  4XR6 A;  1PYW D;  5EPJ A;  4RHS A;  5ELC A;  1Y8N B;  1QG7 A;  2B2T C;  2MGS A;  1I4G A;  2WV6 D;  1B9N A;  1WPC A;  5D65 A;  1EY0 A;  1SYD A;  5K36 H;  2N88 A;  2ZTG A;  1PLF A;  3S1N B;  3BG3 A;  3IL8 A;  5CMD A;  1D5Z C;  2AQ2 B;  5IGD A;  5J39 A;  4EQP A;  2XWB B;  1SYB A;  1RD9 D;  4XTC S;  2WZP P;  2CW0 D;  3FPP A;  2EYO A;  2DIE A;  4LAA A;  1F2Y A;  1Z47 A;  2WPD A;  1WCM B;  3I91 A;  2QKI C;  2SOB A;  4DAY A;  3E6Z X;  5FOB B;  3H94 A;  5K36 G;  3LX0 A;  3NE5 B;  4ZKB B;  3HG9 A;  4WRD A;  4X3U A;  2CK3 A;  1PRT D;  1F2L A;  4A3D B;  2MPM A;  3BCF A;  1E2W A;  1W0J A;  5JEA H;  3SVM A;  4FXD A;  1ONL A;  2ZZG A;  4HMJ A;  2JXM B;  4XYQ A;  1ILQ A;  4KJO A;  4C1N K;  1II3 A;  1IHZ A;  3J81 L;  2R93 B;  1WVL A;  1STH A;  4CGY B;  1B44 D;  2RA4 A;  5EKL A;  3I73 A;  5D3D A;  1WD0 A;  4EQO A;  4B9X A;  3H91 A;  4PQX A;  4NKL A;  2KJX A;  3NP8 A;  1AFP A;  2IJ0 A;  5JEA G;  5IT9 L;  4TT3 A;  5M3M B;  2B2W A;  4N9T A;  2F0V A;  1LTT D;  2M9V A;  1AEX A;  2PMZ B;  4IFD J;  4G6I A;  1W0K A;  1NBM A;  2D2C C;  3AB9 A;  2G9D A;  1WTV A;  3NWT A;  1SE4 A;  1C48 A;  2F0W A;  2WII B;  4OO1 H;  1NSN S;  4HCS A;  1SE3 A;  1TS3 A;  2I07 B;  1CA6 A;  1HA6 A;  2PNR C;  2L1B A;  5E4X A;  5JPM C;  3UI2 A;  5JVH 3;  1ML0 D;  3T13 A;  1ZYR C;  1R9T B;  5F2D A;  5EBD A;  1JCK B;  3C46 A;  2GJK A;  1Y1V B;  5I4D A;  1TS2 A;  1E43 A;  1O80 A;  1A3V A;  2NN6 I;  4XT1 B;  1HUM A;  1PTO H;  1ENC A;  3FRP B;  1B50 A;  3BDO A;  5DAU A;  3ITP A;  1CZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...