4DNRB

Crystal structure of the cusba heavy-metal efflux complex from escherichia coli, e716f mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the pre-extrusion and extrusion states of the CusBA adaptor-transporter complex
rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Cation efflux system protein CusB
total genus 56
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00529 HlyD HlyD membrane-fusion protein of T1SS
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4dnrB02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dnrB03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 4dnrB01
4GZYC 3VR2A 4G7OC 1GUTA 4IFDG 3PUWA 4DNTB 1YNNC 2O5JC 2R6GA 5BN5A 1Q1EA 4TKOB 2JXMB 1ONLA 2D62A 1T5EA 3VA7A 3VR5A 2DN8A 2NN6H 5JEAH 2A6EC 3T51B 3ND9A 1IW7C 3M7NA 3IFTA 5K36H 1GUNA 2EDGA 3PUYA 1A6XA 3I4LA 4I7ZC 2EVBA 1GUSA 1HTPA 1VCIA 2PNRC 3SDZA 5BN4A 1BDOA 3PUZA 3I73A 1K8MA 4KN4C 3FPPA 1CI3M 1CTMA 2PCFB 5C0XH 4H44C 4XIGS 3LWUA 2Q8IB 3TZUA 2JEAI 1VF7A 3T53B 1H9SA 5A35A 1TKWB 2LMCB 1Q12A 1IYUA 3T56B 1HQMC 2K33A 4BA2I 1H9KA 1K8OA 3A8KE 2A6ED 4DK0A 2JEBI 2PPBC 1B9MA 4LK1C 3A7AB 2A6HC 3IKJA 4JBWA 2JE6I 2D5DA 3OPOA 1GUOA 4PV1C 4OO1H 4TQUS 4BA1I 2BDOA 3QJYA 5C0XG 3PV0A 4H0LC 4G7ZC 1G291 2F1MA 3LNNA 1LABA 3A8IE 3OOCA 1Q90A 2EJGC 5KNDA 2EJFC 1Y69U 3N6RA 1OXUA 3OW7A 3U9SA 3VR6A 4KHZA 3BG3A 4IFDH 2V4DA 4KKSA 1DCZA 1QJOA 3GD7A 4OGQC 4L8JA 1GHKA 3W3AA 1Y8NB 4IQZA 2K32A 1HCZA 1O78A 2A68C 3CRLC 2E75C 3L7ZC 3H94A 1H9JA 1E2ZA 2B8GA 3M4YA 4KKTA 1ZYRC 3A8JE 1FR3A 1IYVA 1Q1BA 3DXJC 1TU2B 1DD2A 1I6VC 4DNRB 1ZKOA 2B8FA 2DNCA 3BDOA 2A69C 2IT1A 2QF7A 1OXXK 1VF5C 1O7LA 2NN6I 4OO1G 3D4RA 1V43A 4RCNA 2KCCA 2NN6G 3FMCA 4KKUA 2YYZA 1V8QA 2ZT9C 3RLFA 2E76C 2A69D 2AUKA 2BA0A 2DNEA 3MXUA 2KA7A 4XTCS 3M85A 2A6HD 3GQBA 1Z7TA 1FYCA 3PUVA 5BN3A 1B9NA 3PUXA 4KN7C 3VR4A 1LACA 4G7HC 2AWOA 3EQLC 1GUGA 2AUJD 2L5TA 1OXVA 1H9MA 1VDZA 2EJMA 1GJXA 2K7VA 2D2CC 1HPCA 2A68D 1Y8PB 1EWHA 1OXTA 3AB9A 3I72A 3QIAA 3VR3A 1SMYC 1CFMA 3NE5B 4KMUC 5KNCA 3SE0A 2BE5C 1YNJC 4HR7B 2BE5D 3HGBA 3MFYA 3KLRA 3D31A 3A7LA 2BA1A 4KI0A 1OXSC 1Z6HA 3WDNA 3ND8A 1DXMA 1IW7D 1H9SB 4JK1C 4DK1A 1PMRA 5JEAG 3QG1A 1H9RA 2CW0C 2E74C 1E2VA 4LJZC 3P20A 5K36G 1E2WA 3CRKC 1GHJA 4H13C 5KNBA 2O5IC 1Y8OB
chains in the Genus database with same CATH superfamily
4LF8L 5FLMH 2LKVA 4OEMB 1YNNC 1SKYB 3NBHA 3SKBA 4IPHA 5CV7A 5E1FA 4G4KA 1EZ6A 2R7ZG 2Z0SA 5DAUA 4UP9A 4V0BA 3J7AF 2PYKA 2DETA 4A3DB 3J80i 1CQXA 1FNDA 4K5WA 2CH4A 4JI5L 1AZQA 1LUZA 1B3QA 2V31A 4K6LA 4I7ZC 3OWFA 4O42A 4DAPA 3C3LA 5A2QL 5C3EH 2UUAL 2R3ZA 3JAML 3CCRA 1IBMQ 3BDCA 4YAUA 3QFRA 1WSRA 1BJKA 2E1BA 4Y9UA 3CCSB 1JICA 4K8IA 4RCOA 1LM0A 2IW3A 1BR9A 1VQJA 3V7AA 1IXRA 1F9QA 1VQFA 4X64L 1GUWA 5GADC 1KDCA 2F0DA 1R5OA 3J81i 3EN2A 4GN4B 3QJYA 3OW2A 3WYAA 1WPCA 4QY7A 1XX8A 4CJ2C 3J81j 1SAPA 2R92B 1JT8A 3UDXA 3BQJA 4Z4SA 3W2EA 1EY9A 5EPKA 2WZPP 4DQLA 3OKXA 2B2VA 4A3KH 3KBXA 1N33Q 2DY7A 1E2ZA 2V7VA 5IYBG 4DR2Q 2VNUD 1G7TA 2F3VA 3CQZH 5T1GA 2QGGA 4JI3Q 1OXXK 4LF9Q 4LF4L 4DV0Q 3TREA 2NN6I 4GQNA 2E1RA 2KECA 4O0AA 3K8AA 3U2QA 4RCNA 4YWMA 3K7UC 1IBKL 2HDNB 2N78A 2YTXA 2HHHQ 3PCOB 2A69D 2BA0A 4ME3A 4YWLA 2XNAC 1AH9A 5M3FH 4X7CA 1Z7TA 5JEAJ 4P3IA 4LF6L 3SLNA 4IPGA 4LC0A 1M90D 2WIIB 1U2RA 4NPSA 1MGSA 4RM0A 2H4OA 1WSVA 4DR1L 1GJXA 1XNRL 3CCUB 4A3FB 1V0FA 3WBJA 1EOTA 4KJNA 3I72A 1EWIA 3MEFA 3WWVA 3JAME 4YEJA 1JWSD 1S5ED 1TWFB 4A3IG 4QUZA 1HZBA 3KLRA 4K5XA 1KABA 3EROA 1D7QA 1RQPA 1VQPB 4C1NK 3S1RB 5IYCH 4ZK9B 5THXA 1SNMA 2XZOA 3QG1A 1MJEA 4CKBA 1D1IA 4LJZC 1NMGA 5CR3A 5I4DA 4FXDA 2KHJA 2UUCL 1QUEA 5A8AA 3CC7B 3WBKA 5IYDH 4GZYC 4RGOS 1MABA 1HVXA 2K50A 4DV2Q 3PUWA 5ELOA 3CMMA 2HIXA 1ZM2A 2OBRA 4OHJA 3OW2B 4LF7Q 3PENA 5KNLA 5EKKA 2BCOA 3ND9A 4Z4RA 5IGFA 2EYLA 3A5ZB 2E5LQ 1HNWQ 1K83B 3M7NA 1X3FA 2JA5B 2CF4A 1XPUA 2TMPA 1TS2A 1T5XD 5C44H 3T1YL 1KQSA 2QEXB 1PDQA 1HQMC 1VQEA 2I07B 4NB3A 3S1MH 3CCVB 5GAEC 4LK1C 1EXMA 1O80A 5CV6A 4X62Q 1XTDA 1GUOA 5M3FB 2LXKA 3HOVB 4TQUS 1GO3E 3ULJA 3GVKA 5B6IA 1UD5A 1VQBA 2I0QA 1AEXA 1YI2A 1E1OA 1WOOA 1AN8A 3OOCA 1Q90A 2ALYB 5EBCA 1PZJD 4FWTA 1PH7A 1P8LA 3GIRA 4XLHA 2B63B 2KHIA 1BNZA 3BNWA 3W3AA 4U68A 4APVA 3R3OA 3T1HQ 3SJPA 4DXFA 4K8JA 1TU2B 4FXKC 5CC4A 3S2DH 5ELBA 2NVYH 4HJ9A 1SKQA 3F2DA 2GK6A 1VQ6B 4X07A 3A56A 4ZKBB 3Q0AA 4R9WA 3PVDA 3MVVA 3TMEA 1D1KA 5I6YA 4X7FA 2CW5A 4WQMA 3I7FA 3U9OA 3RMHA 1E3ZA 3U4VA 2KCCA 3MMPA 2V7UA 4JI1Q 4IUUA 3W2GA 3SJZA 4XDXA 1X55A 4BBSG 1YJNA 2AQ3B 2TSSA 1EOVA 2YWHA 4RGMA 1IBLL 1HH2P 2Z8LA 4P6YA 3E20A 2KUMA 3J81c 2JDIA 2ZTNA 4XQQA 4QUCA 3PO2G 4AF7A 2XN9C 4JW0A 2ZXRA 2EIXA 4DV6L 1MSGA 3S9WA 5KSWB 4C43A 1CFMA 3F1ZA 4J15A 1WTPA 2JA5G 3SK6A 3GTMH 4RCYA 2XGJA 5FO0A 4KD4A 3TQYA 1WD0A 3ER0A 4A3DH 3M7GA 1E2VA 2BGJA 2A73B 4DA2A 5J22A 4LFAL 3HOZB 1NMFA 4A76A 4OOSA 1FX0A 2QILA 1QGZA 1Q8KA 2QDBA 3RR5A 2O5JC 1IYJB 1Q1EA 1B3AA 1KD1D 4PMWA 3RLNA 1LTRD 1T5EA 4P22A 4XR6A 4B3GA 1YI2B 4XT1B 5LMZA 1VQ5B 1F2MA 2C5HA 4TSSA 4XYQA 3A8KA 1FNBA 4X7DA 5IYWA 3I70A 4NBSA 1GOZA 3ASTA 1ZM9A 5IYCG 2V7QA 5JOBA 4LFCL 2I46A 2VNJA 4A3BG 3G05A 2HCCA 5IK2A 2CQAA 2Q8IB 3CCSA 3I4MB 2GVAA 3KLSX 4EX5A 4IPDA 3W5VA 1VF7A 4ZCMA 4Q7JB 1K3RA 4X3TA 2MHVA 2Z6KC 3LGJA 4OPVA 4A3EB 4LW1A 5LMUL 3ISXA 1Y1VH 1NE3A 1HA6A 4H7BA 3OPOA 3CHBD 4HTHA 3F2BA 4HJ7A 1S72A 2KVOA 4A3LG 1Q46A 1EYAA 1PV4A 4TVAB 2O2LD 3FKIB 4G7ZC 2SNMA 1TS3A 1D8TA 3KDFA 2UUBQ 3LQ6A 1PTOF 1TWHH 1T6ZA 1M8AA 2EYMA 4YAOA 3RZDB 4GLXA 2KJXA 2XNCA 4FN5A 4KHZA 3CMAA 1QJOA 1PH1A 5I6WA 4UZFA 2EOTA 1ESRA 1TWAH 2FJ2A 2IHFA 4MYTA 4HMIA 1OGJA 2B8FA 1O7IA 1PH8A 1ENCA 1DDGA 4Z4UA 5BR8L 3OWEB 2F1LA 1RHPA 2JN4A 1FNVA 2DIEA 4A3FH 2VY3A 2QTLA 4XYOA 1MHWC 4ZGNB 2NN6G 3GDEA 1QCBD 1LV9A 1E79A 2JN9A 4DV5Q 3AGQA 1A8PA 3M85A 3G4SB 2WYRA 5IGGA 2Q8RE 2B2TA 4AC9A 2FX3A 3AVWA 4KY5A 5D3DA 1L1OA 1JB9A 4L5TA 2RC5A 4QVAA 2CWAA 3DM3A 1PH5A 3PGZA 3OIQA 3VR3A 4EQPA 2B7BA 4RCZA 2X85A 1A63A 2ZZQA 2VS1A 1FGBD 4A93B 1EY0A 3MEHA 3A7LA 2F0NA 3AMUA 2JYOA 1N32L 4IPCA 4RWSC 5FO8B 5M9OA 2WKCA 1GAQA 2ZZEA 3URYA 1KD1C 1II3A 4H13C 2MFIA 4HCEA 1SYGA 2O4XA 1E7ZA 1SBBB 2O5IC 1E1TA 1OB2A 3VR2A 4PC3A 3Q3AA 2X0KA 1I3QB 3E5SA 1F2YA 3DWPA 2L11A 4TKOB 3CW2A 1LO5D 3UE0A 1I50H 2HD3A 3KDFB 5FJ8G 3OHXC 4YELA 2UXDQ 1ET6A 1Y1WG 2XNJA 3I4LA 2CW0D 3CMAB 3M4OH 1TWCB 2K04A 2EXDA 4K14A 3HOZH 3CKIB 1NB9A 1BDOA 1BCPD 3EFXD 2NTSA 2Z6BD 4A3GH 2IHEA 4J8QA 2NUCA 3T53B 1WOPA 2SOBA 4M2LA 1E64A 3Q24A 1G2SA 4Z4YA 2B2VC 2J7ZA 2JEBI 3TP7A 1YIJA 1N33L 4NMZA 2J7KA 5FO1A 5FLMG 4BA1I 3E1YE 4G5GA 4EVOA 1H8HA 2JIZA 3KYHC 5CYUA 4JI3L 2LSSA 4CKEA 4RGNA 3TRZA 3TP6A 1GXDC 4LF4Q 2R7ZH 4XM3A 1L1OB 3HOWH 3VYRA 5J39A 1YVCA 1N8RD 4AYBE 4YXWA 1CA5A 2Z1CA 1SLJA 3L9AX 5FK9C 2HHHL 4A3EG 2HCIA 1FD7D 2F3WA 1WTHD 5EJWA 3VYSA 3L7ZC 3PUYA 4UDUC 3OFNA 1I4PA 4ACBA 4U673 4RKLA 1FR3A 2CQOA 4IUQA 4YAFA 4G1VA 1I6VC 1X3GA 2WINB 1DG1G 5CV9A 1L1OC 2XRSD 4MZ9A 4NCNA 4DR7L 4DR1Q 1VMPA 2OXPA 4MTKA 4HE5A 1QG7A 3U58A 4QQBX 5AJ3L 3IRBA 1EP2B 1PFBA 4IOCA 2NZHA 5FLXL 4MNOA 1KRTA 4AIMA 2WR8A 4F7XA 2HIVA 3P7JA 4ZAIA 3H09A 5C6AA 4PQXA 3LX0A 4DV4L 4MYUA 1YITA 1SR3A 3I56B 2FMCA 4J1MA 3EJIA 3HKSA 3ERQA 1XXGA 2BH8A 4FO2A 2NYZD 2NVTH 3OJXA 4LF5Q 3S15H 4M1UB 1B2RA 2L9HA 4P9SA 3AB9A 2OQKA 1ENFA 2V7XA 3AVUA 1G51A 1NAPA 2WAQG 2Z9HA 4A3JH 1SM4A 4LF7L 4QV2A 2K5HA 3HGBA 4QJFA 5JJLA 1W34A 1I4RA 3S1RH 5EKIA 1NBWA 4RG1A 4B43A 4GNXC 2CW0C 2KBNA 3UDIA 2D0PA 5D3IB 1W87A 5TV2A 3NBIA 1IHZA 4TRDA 2PQAB 1I94L 1GJRA 3MXGA 1KC8D 5GAHC 2E2IB 2D62A 3C1FA 4I7AA 1DM0B 2NN6H 1EFTA 2BMWA 4M4SA 2RCNA 1JB7A 2F0MA 4L5QA 1QG0A 2C4TA 2N8NA 4B9XA 2YU9B 2GN5A 1GUNA 2EDGA 2F0FA 2L0CA 1N34Q 3V96A 4A3KG 3S14H 4Z4VA 2PW7A 5DSZA 4M53A 2JA7H 2ENBA 3E0EA 2CRVA 5BN4A 2B29A 4C3JG 2VL6A 4HSPA 4RKBA 1PFSA 3T4AC 4A75A 3PUNA 3HOYH 4JOIA 4ODGA 1FNCA 1TKWB 1EFWA 2J0TD 4A3MB 1EP3B 3NENA 4EQ5A 3QR8A 4Z4ZA 3M4PA 3B82A 4HN7A 3GTJH 1WORA 3T1HL 1WTQA 2E2HH 1VMCA 1PH6A 4B9WA 3VO1A 5HXBA 3F2CA 4BBRH 2R93G 4DKAC 1LTSD 4S3SA 1K3BC 4AYBG 3DMUA 2B2YA 4X7EA 2LY7A 5ELNA 1FVIA 3NWTA 3TP8A 2GJRA 1S3OA 2F4VQ 3BY1A 4HE6A 2EJFC 2JA6B 2PE3A 1C8CA 1QVGA 4XKVA 2BPOA 1CQVA 3GTOB 2V4DA 3GD7A 2HDLA 1LTID 3W2DA 4CQJA 4JI6L 1O7ZA 1VQKA 1PRTC 1HHVA 2MGSA 1UD2A 3D4WA 2IL8A 1O7LA 2VUMG 3ZJYC 4II2A 1B1ZA 4DR3Q 5D14A 2HQLA 4RD2A 4G6IA 3NUCA 2ZITA 3NSWA 1ILPA 3NP8A 1ILQA 4MHEA 4A93H 1U4LA 2MO1A 2C9OA 1BCPF 5BN3A 4CJ0B 5G3LF 3T13A 3EVQA 4BXXG 2ZXHA 3A3BA 1JC7A 1YEZA 5C4HA 3G48A 1QZGA 2HT1A 4TMWA 1VQLB 4RHSA 4LFAQ 2EJMA 1H9MA 1DYQA 1UE6A 4BS9A 4Y7NH 1D2EA 4R4CA 2WB1G 1SE4A 1Y8PB 2OBTA 1E22A 1BXTA 4KMUC 4DV1L 1Y1VB 2L4NA 2CC2A 4DR5L 2BE5D 2D0OA 1TY0A 1W2BA 4XKWA 3KL9A 4IO9A 1B8AA 4RDKA 5C4JB 1RL2A 3RLOA 2X6WA 4P2NA 4RDLA 4HJ5A 4PGOA 1OGIA 3OIPA 4XORA 2I1LA 1EY5A 3I90A 4E0FA 3R8BA 3PIOA 4G7OC 1ENAA 1KC8C 3ASPA 4V190 3AVVA 4KY6A 3J81k 3LO8A 1CZWA 2Z6KA 5IYNA 1FNUA 4JOIC 4JI2Q 3WOEA 3FJOA 2B63H 5LMUQ 5JEAH 5J3OA 3CPWA 1W35A 2X6YA 1HFNA 1MD2D 3IFTA 2KCTA 5ELCA 2YTVA 1I4GA 5CV4A 3CTAA 1KTKA 1TR5A 1GUSA 3JAMi 2VUMB 3MFGA 3BC9A 4LBYA 4TMZA 2OQ0A 5IT9L 1QE6A 4ALPA 3I73A 3U6BA 2JA8G 1HNZL 1V1PB 3OE7A 3STBC 5LMNW 3I4MH 5IYRA 2PZWA 3GTKB 4Y9RA 1D6EC 1RODA 2E2IH 1AW7A 2JP1A 4DXGA 5M5XB 5DNFA 5KYLA 3RN2A 1K28A 1PH2A 3JQQA 1QGAA 2K33A 3K5MA 3M3YB 2OTJA 2K14A 3TBIB 1YJWA 2WPDA 1Q82D 2PPBC 4DR6L 2ZL5A 1TWGB 5LL6X 3PIPA 3SK5A 1QVCA 2OT2A 1HXYD 2MPMA 4ASUA 4A3BH 2J4XA 2BDOA 1Y14B 4B3RQ 3C1EA 3LNNA 1Z47A 4OWWB 5GV7A 1HA5A 4U9UA 3I2ZA 2EJGC 3A5UA 1JWMD 5M3FG 1Y69U 1Q81C 1NR4A 3HKZG 2ZBVA 1CKMA 1NRKA 1JMCA 1N08A 1SROA 2WKDA 5BSXA 1VQ9B 2PLFA 4OGQC 3HOUG 2NBFA 4B47A 3D8GA 1V5VA 4IQZA 4JV5Q 2JA5H 4A3LH 1MRZA 2D3NA 1KRSA 1DD2A 1FJGL 1BLIA 1VQAA 1CHQD 2FVGA 1CK1A 2HUGA 3JQRA 4ZV4A 3DWQA 4BBSB 3SR1A 3W1BA 2D74A 4K0KL 5DM63 3CP8A 1BUVT 1QNUA 1ML0D 1UD4A 4TN1A 2NVQH 2PIAA 4X6AH 1Y1VG 3DEOA 4KKUA 2RC6A 4UHVA 4X65Q 1UNSA 3MXPA 3ZIAA 1I5FA 1M4VA 1O7YA 1VQMB 4X3SA 1VQOB 3GQBA 1NNXA 2RHQB 1SE2A 2GK7A 2K28A 3PUXA 3PA2A 2AWOA 3IAYA 1E3PA 4C3HH 4P71A 1DOMA 4NKLA 4PMBA 5FLXc 2WB1E 3PF5A 2DY1A 1Q82C 4JVZA 1HPCA 2A68D 1XPRA 1EU4A 2RQXA 3H0GG 4IJHA 3KF6A 1IZ6A 1PTOB 4Y7CA 2BE5C 4OWTB 2F0UA 2F0QA 1HQRD 3CW2C 3C2PA 1KDBA 3S2HB 3CPXA 2QCPX 4B3SL 4GKJQ 4J0QA 2UXBQ 4AH6A 4DK1A 3FPKA 4XD7A 2EYOA 1YHQA 3VYTA 1H9RA 2KCNA 1PA6A 2PQAA 3F8TA 4XLAA 3P20A 5K36G 4A3FG 3VNUA 5H1SE 3QE2A 4HJAA 1QUFA 4IALA 1R9TH 4FK8A 2E2JB 2ICEC 4BY1B 1W6KA 2ZZFA 4N3NA 2F0KA 2G9HD 1N36Q 3BCDA 3OP1A 2GJPA 1UAPA 1VQHA 3GTPB 3RN5A 2XOKA 1JJ2A 1DOLA 2A74C 3TDQA 4DU9A 1CNFA 1PH3A 1B50A 1HUMA 3ZZTA 1QVFB 1SDFA 1G2TA 2PNRC 4A3CG 1RJTA 1XWEA 3OZUA 1EYCA 4QF4A 3FHWA 4NDXA 5LHY1 1D5XC 1K9MC 2ZZGA 4TMXA 3UI2A 5KYIA 3LQEA 4CDDC 4JI4Q 4JBKA 2VZLA 4II3A 2NVQB 1EQRA 3CC4B 4FP5D 2ZJRA 3A8KE 4DK0A 4GLAC 5CBAE 3I4NH 3IKJA 2HLDA 1WTXA 3E3XA 3HOZG 1X54A 1QZHA 2JA9A 1BF4A 3CB4A 2F3IA 5M3MB 2Q2TA 1GVHA 1B4OA 4DR7Q 4KK7A 1SE3A 1TY2A 1E1QA 3ZZUA 4IJLA 4DV3L 1ZM3A 1SRUA 2KEEA 3CCQB 4RGTA 5DEHA 3QSYA 1VQLA 2EIFA 1L0YB 5FNZA 3AFQA 4YCWA 1P4MA 1CHPD 4LUOA 2VJIA 2KCMA 2IX0A 1VLYA 3ES9A 2A68C 3CRLC 3QO2A 3H94A 3R2IA 4GOPB 4A3BB 1XFOA 2B2UC 3W5UA 3PO3G 1SN8A 1UD8A 4WZEA 4ZCIA 1TT2A 4JI7Q 5IIFA 4LMQD 3D4RA 1EY6A 2B5OA 1PFMA 5AN9A 4X06A 2K6AA 4ZUJA 4DV7Q 5D65A 2ZT9C 4A3DG 4R4IA 2AUKA 2DNEA 4OX9L 3FP9A 2SEBD 4DNIA 3Q8DA 4GOPC 2XRQD 4K1XA 3S17B 4JG2A 1XQBA 4KTAA 4FYDA 3K58A 1VQDA 2Q8TA 3P1HA 2A19A 5IYQA 4OONA 1LTTD 4DUYL 4WZKA 3E6ZX 5ELEA 2PZUA 3ZC3A 2IX1A 1W2BB 3GTQB 2EY6A 2B2WA 1XNQL 4M0LA 4Z1MA 1GKHA 1TWAB 1HNXQ 3HOXB 4BBRB 4BPRA 2DOGA 4A4IA 1N34L 1X3PA 4R1JA 1VJSA 3M4QA 2IPKD 1RTNA 3KF8A 4FVMA 3S16H 3CP0A 4LF9L 3G7LA 4FDBA 1SMYD 3ITPA 4PMCA 1WYDA 4HJ8A 1PYSB 4GKKL 3RD4A 3S2HH 1BMFA 3KJOA 1IBKQ 2Q2HA 1L2FA 1HTLD 3S14B 2W6JA 1VQ9A 3K5NA 5DS0A 5FL7A 5HURA 2K5WA 3W2IA 1K8MA 1IL2A 2DCUA 1CI3M 2PCFB 3FDTA 2MUYA 2F4VL 2F0EA 2A8VA 4RH6A 4ZCKA 3A1PA 3W2HA 4AVZA 3QFSA 2K01A 1QGYA 3BVMA 3TP5A 1NBMA 3H0GH 1EY4A 1DARA 4DR4L 1B9MA 3SVMA 1LT6D 2IWHA 4AQYQ 3AQQA 3TZDA 5NUCA 1STBA 3CQZB 3CCUA 3X3NA 5FOBB 1U4RA 4YHHL 1OB5A 3CPFA 1CKNA 5GQOA 1FNMA 2Y0SE 4JC0A 5A88A 5KNDA 1CSQA 1BBUA 4DV2L 5IY0A 2E8GA 1D5MC 3CCLB 4X05A 4PG3A 4TMVA 1YJNB 3A0JA 1JOQA 1H9JA 3M4OB 2R93H 4R4OA 5M3MH 3ZPNA 3AVTA 1HNWL 2PMZE 2V7WA 2GPJA 2W6IA 3P27A 2IT1A 3OEHA 2NVXB 5CBEE 2X69A 5JJIA 2BOSA 1Q7YD 4C3IH 2F43A 1VQMA 1EIFA 1AIPA 2E76C 4DK6C 1BQQT 1T6XA 1FRNA 1KAWA 4XTCS 4KHPQ 2D9UA 4KY7A 1AP0A 1PJ6A 5GV8A 2K5NA 2K5QA 5IYPA 2YWFA 4JI8Q 2NZOA 2H1EA 5COYA 1W6JA 4JYAL 1TS5A 4KHVA 3DLLA 4H02A 1JJ2B 1G7RA 1U9RA 2CHBD 1OXTA 3QIAA 2GQFA 2YWGA 1HR0Q 4LBWA 4DAYA 4XQNA 4PZ7A 1HZAA 1Y1WH 4JI2L 1WFQA 2DJGC 4OIKA 4OL7A 2F0TA 1KXLA 2OF1A 5JEAG 4PNYA 4H9GA 2K52A 1WTHA 4GN3B 4TSFA 3ONYA 4A3GG 1GHJA 3AGPA 3N52A 5C44B 1NSNS 1JE4A 1T6YA 1EIGA 2ID0A 3HS0C 3PO2B 1Q81D 1QUQA 1KHIA 3OSOA 1RTOA 4X3KA 3CCQA 1EQVA 2MQHA 2OBSA 1SE8A 1WCMB 5DLQE 1IW7C 3HOXG 2QA4A 1G6PA 3D6WA 3HAGA 1S5CD 2VJJA 2OTLA 2JSOA 3AFPA 4LAAA 5IP7G 2MP1A 1IBLQ 3J7A5 1FGUA 3KJPA 2RCFA 1UEAB 2AKWB 3QFCA 4KN4C 5IWAL 4RFBA 1ICWA 4H44C 4DV6Q 2ZL7A 1KK1A 3AVXA 4K2KA 2JEAI 2R6HA 1YNND 1I4HA 1YZ6A 4N9TA 3VDYA 3CCEB 1H9SA 1WOSA 2ZM6L 2K05A 4KV6A 5I9OA 3I55A 1LLRD 1TXYA 4K2LA 1PZID 2M9VA 1PTOD 4ZGQB 2A6HC 5HGTA 2PI2A 2XGTA 3CP2A 4PV1C 2X6XA 3JAMc 1FJGQ 1WVLA 3KFUA 3ICEA 1K73D 3RZOB 4DN4M 1EFCA 3PMFA 4K0KQ 4FXGC 4TT3A 2VQEL 1BVSA 3IFDA 2C2WA 1IKMA 4X65L 2BV3A 3VYUA 3QWNA 5J35A 1MBYA 2UU9L 1IYVA 3E0JA 5L46A 1XPOA 3GTPH 4QIWE 1WDTA 1K8AD 1AE3A 1YBYA 2KEDA 3K81C 2ASBA 1D2BA 5C4XH 5C4XB 1K28D 4P12A 2D3LA 1JB3A 3RLFA 1V8QA 3KF8B 1SNQA 2WAQB 2B2TC 3OAAA 3KLWA 1D5ZC 2V7TA 5C4ZA 3K7AH 4FXUA 1ZM4A 4KN7C 3B78A 3MA2B 5C0XI 1LTAD 3NTHA 1N9WA 3Q22A 4G7HC 1TS4A 4IW3B 3Q6RA 1SJED 3KF6B 1PXUA 2K7VA 1RQRA 4B3FX 4BY7H 1QFJA 3NTIA 5EGTA 1BKBA 1WD1A 5HKKA 1K8GA 5KNCA 1OHHA 2UUBL 5TY0A 3I4NB 3FPUB 2N55A 1SNCA 4B3MQ 1N36L 2BA1A 5CV5A 4BWGB 2P3MA 1VQIA 2JA7G 1IW7D 3OTOQ 4HMJA 1PMRA 3CCEA 3A74A 3BYTB 1PRTD 2IJ0A 1EFRA 1E2WA 3BDLA 4BY7G 1H95A 1X3EA 3HOWB 3PF4A 2F0OA 1YJ9B 1SFOH 2B3GA 5IGBA 4UP7A 2BVNA 3BU2A 1GUTA 3G71B 3VO2A 4NXNL 3OYYA 1S5BD 2CK3A 4JI4L 2ZTCA 5KGUA 1I6HB 1QX4A 2JXMB 3CAMA 3VA7A 3A35A 4LFBQ 1UEBA 5EBDA 4BBRG 4C3IG 2MNAA 1ZYRD 1WJJA 4DV5L 5K36H 1D1NA 3BZCA 4HSVA 5HGQA 1B70B 1RF2D 1C48A 2ATWA 4A93G 5LMNL 1U0LA 1PH9A 4XNFA 1J5EL 4WZTA 2WACA 3PO2H 1VQNA 2SNSA 2FHTA 2LMCB 1ASYA 1EFID 1Q12A 1KAAA 2VXWA 3DEPA 4DUZQ 2D5DA 1EEFD 3K7AB 1VLOA 3BJUA 4UAIA 3JU4A 2WFWA 4MN3A 5TR9A 2ZXIA 1YHAA 1JOOA 4KJOA 2K4KA 5FLXE 1LT4D 4DGZA 1ET9A 3L2PA 2F1MA 1GVPA 3OMGA 3CF5A 4LBVA 5GROA 4DV7L 3KUPA 4XQFA 5J3BA 1TQOA 3BG3A 1R5NA 4OX9Q 2HDMA 4XOTA 5F4JA 5AFWA 2R7DA 1G91A 2GA4B 1VQCA 1PLFA 1Q1BA 4XMYA 4WJWA 4KLKA 3RZOH 3DUZA 3WOFA 2CCZA 2BF4A 1A15A 1AE2A 2A69C 5M5WB 4LF8Q 3GTKH 1JOKA 4WJ4A 3HOUB 3MHPA 2P5ZX 4DUYQ 1A0IA 2BN4A 3TEHB 4OO1I 4A3EH 4R8NA 5C5MA 4X0CA 1YJ9A 4IUPA 1Y1WB 1BO0A 3NWSA 4JI5Q 1SEBD 1EWCA 1UE1A 1YNXA 3H0GB 5IODA 1Q86C 3BVGA 3VR4A 1GUGA 4YCUA 5HY6A 4CDFC 5GAGC 4PZ8A 1OXVA 3S1NB 3AYHB 3HOYB 3I1FA 1NCVA 2JJ2A 4PC1A 1N05A 3NTKA 5C0XJ 3MWYW 5T1IA 1WU8A 3SE0A 3J7AV 1QFYA 1YNJC 2F0PA 4LUVA 1YIJB 1R4PB 2E2HB 1B2TA 1HRJA 3GTMB 1KTVA 2C5BA 1J8IA 4RD1A 2C35B 3WDNA 1CNEA 1T9HA 1DXMA 3MXNB 3O13A 1H9SB 4M8AA 4X64Q 3GTOH 2ICIA 3CMEA 4R8IA 1J9ZA 4BY1G 3IL8A 2E74C 1C0AA 4LWCA 3PIP3 5KNBA 2K5DA 2C4UA 2A5HA 3D0FA 4PZ6A 5C3EB 5J1ZA 1F2ZA 1I18A 3H9NA 1QVGB 2G9DA 1EUJA 2WV6D 3A55A 5BN5A 5E3FA 3A8IA 3DWAA 3HKZE 1HR0W 2VB3X 5AJ3Q 4J6HA 1UD3A 2Y0SG 1QOHA 4AQYL 4HIDA 3CCMB 1A6XA 1F60A 4LNQA 4PC2A 4NNJA 1EYDA 4N9PA 1B53A 3U4ZA 1VCIA 1HTPA 4DAMA 3J7ZC 4YHHQ 1BCPC 4L6TB 2NVYB 1BBWA 2NZ1D 4LF5L 3FPPA 3J80L 3T16A 3OZVA 4QL5A 3RUZA 2R92H 1I4QA 4YY3Q 2UXCL 3GV6A 5JPNC 4YAWA 2LS01 1PVOA 1E1RA 4M1KA 3UDFA 1K8OA 1S0UA 4C3JB 4JBWA 1PTOC 1PYWD 4R71A 3Q38A 3M9BA 4B48A 3J80c 2F0WA 2B2YC 3Q23A 2JA7B 3PUMA 4CHTB 5C4JH 5C4XG 2JA8B 3BS1A 2C5CA 3PV0A 4CDCC 1G291 2JJQA 3S1NH 1I94Q 3JQPA 1U4PA 4B08A 1N8RC 1C4QA 1NB0A 2KHSA 2Z4IA 3MCAA 4OOVA 1OXUA 1XJVA 2IX3A 2LFNA 3TN2A 3GTJB 4KHPL 4A3JG 1CUKA 2VYQA 1A3TA 4C3HG 5M5YB 5TSSA 4UAJA 1E62A 5H5JA 1JJCB 1X56A 2QEJC 5KRUA 5JJZA 3K5LA 4DNRB 2PW5A 4HIMA 4UPAA 1IL8A 1EWYA 4JYAQ 4IURA 3CC2A 4QVJA 4ACAA 4EQOA 2BM1A 3E9HA 3JC66 4BY7B 3Q6SA 5E7NA 1HR0L 3SK8A 2GVBA 4B44A 3EBEA 1JCKB 2ZTDA 4YWKA 2VNHA 2EFGA 3WNBA 2FINB 2KA7A 3G71A 2E5LL 4A3IH 5M3MG 3R6KA 3CD6A 2NPFA 2BM0A 2QGQA 3GVJA 1YX2A 4QIWB 1G6ZA 4OWXB 1W0KA 3GTLB 2AUJD 4CGYB 4C3HB 3T1YQ 2QKIC 3DHQA 2R7ZB 2XZPA 2EXZA 1TVCA 1MJCA 4WORA 5IGCA 1XMOQ 2R7FA 2CWPA 1DOKA 2XEXA 3QB3A 1TIID 1SNPA 4QGUA 3K0YA 4P3YA 5IP9G 4X62L 2OWOA 1W9XA 3GVLA 1K0SA 1VQNB 2DJFC 3L3OC 4IOAA 1I7PA 2ZTGA 2RF4A 2YV5A 1WTWA 3ULPA 1I8DA 4A3KB 4JI6Q 5E4XA 3ASSA 4QHYA 1A2TA 1IKLA 2QMUA 3A3GA 2EQSA 4FF3A 1ZEQX 1Y8OB 4XQJA 4Z4TA 4AF6A 4L5SA 4G7XA 5HZBA 1KL9A 1I3QH 3KK7A 4P26A 4DR3L 5IT9c 2QA4B 2ZM6Q 4FF2A 2OTJB 4N3GA 1AZPA 1G7CA 2X6GA 4P75A 1VQPA 1JJGA 3H6MA 3VA5A 3G6EB 5IT9E 1VQKB 1JE5A 1JR0D 1SYFA 4YHBA 1P16A 1CA6A 2R93B 2EE1A 3NEMA 1PRTB 3HOVH 1DJRD 3PUZA 1LTLA 1IJEA 1BX0A 1CQFA 4O1NA 4ZLTF 3TZUA 1STHA 2VQEQ 1UE7A 5DM73 5IGDA 1A2UA 3SK4A 1QH0A 3HOXH 3D4DA 1GR1A 2RBMA 3W5OA 4DR5Q 2X3UA 4F7DA 1EQTA 3U50C 2MO0A 3SXHA 4RD4A 3HEJA 2X8KA 4ZUIA 3CXCB 3A8JA 3MC0B 1I4XA 1MIUA 4XL9A 5H59A 3CC7A 1CZGA 2DGYA 2DEUA 1IHMA 3BVZA 1RD9D 3ULLA 3BH4A 3OW7A 1PH4A 1M1KC 3MTSA 3K59A 4B3TL 3V2TA 1Y8NB 4BY1H 1E0BA 2K32A 1YHQB 4WRDA 4B3XA 5FKAC 2AWNA 4HCSA 1ZYRC 1VQ5A 3WNDA 2JA8H 2RVLA 1ZKOA 5JVH3 1VHEA 1K83H 3CC4A 3MXNA 2X53S 4F88A 2EYPA 1EEID 4POGA 1F77A 3S24A 1TWHB 4P2CB 3NELA 1KIXA 4UP8A 3J81L 4KD3A 4A3MH 3K80C 1OTCA 1GD7A 4RD3A 5M5YH 2M5SA 4IUTA 4IFDJ 2C78A 2XTIA 4OP7A 1H42A 1ASZA 3PUVA 2VBUA 1FYCA 1IJFA 4EGVA 4R4QA 3W2FA 3GTGH 1JORA 1L0XB 2B7CA 2OCEA 3ZYYX 3PO3B 4MTNA 1X6OA 4LFCQ 1KMHA 1XB2A 1VDZA 3I8ZA 3S15B 3G6EA 5IYBH 3GO5A 4EH1A 2FMMA 4B3RL 4XLFA 3V05A 2FFKB 2VNIA 3B6YA 1EWHA 2VB2X 4X66L 1EIHA 2X6LA 3BCFA 3NE5B 2AMCB 3GTQH 2ZJQA 2Q6KA 5EPLA 3TSSA 4LFBL 1EFUA 1STYA 1YHBA 1FL0A 4JK1C 2WJYA 1U5KA 2K03A 4JV5L 4UZEA 2QEXA 3H3VI 3ONAB 3ZZ0A 2F0HA 1K73C 1QVFA 2AHOB 3HOYG 1UWVA 1F2LA 3S2DB 1RCVD 4IFDI 1EQQA 1G8ZD 1BPLA 4WWVA 3P26A 1Y0YA 4F8MA 1X65A 4Z9CB 1W3SA 4JCVE 3C2QA 4OOXA 5E4WC 5M5XH 2DUDA 4C2MH 1ONLA 1BOSA 3WY9A 4JPBW 2RKSA 1CM9A 4DUZL 1KK0A 3LWEA 5A2QE 3AVYA 3L0OA 3PSIA 1TWGH 5EMNA 3PQIA 4IUVA 3BY2A 1Q8IA 2R61A 2XWBB 4DFAA 5BR8Q 1X9NA 1N07A 4XONA 1PFNA 1WI5A 2F4IA 3HP3A 2FXQA 2RDHA 3S1QH 1STNA 1SYDA 2L55A 1WCMG 2CKZB 3I4OA 5C0XH 4NXML 1STEA 5FO9B 2JQOA 2VZAA 3S1MB 1VQOA 2XSCA 4QB4A 3BYYB 1CKOA 3D6CA 1H8EA 1DONA 1RDPD 2JE6I 3OMCA 4GKJL 1C9OA 5IP9H 3H91A 4UY8C 2UXBL 2XNDA 1HZCA 2EY5A 4OO1H 4ZYSA 2BDNA 1N06A 1EU3A 3TS0A 5C0XG 4F87A 1L0WA 3V76A 3A8IE 1X3QA 3W1GA 2R9VA 3D3RA 3G6JB 2GREA 5FJ8H 1S5FD 4L5RC 1ELOA 1YLOA 3U9SA 1M1KD 4KKSA 1F20A 1K8AC 1N32Q 4XT3B 1A3UA 4CBVA 1O78A 1ICFB 2LZJA 1EZ8A 4KKTA 3ZBUA 1PYBA 4WJ3M 4A3CH 2GJKA 3A54A 1WTVA 5TRDA 5CV8A 1H85A 2RDGA 5IP7H 3SLDA 2NVXH 3CCJA 2BSAA 4K6DA 3R93A 3M3YH 3FMCA 5IGEA 2ZBUA 5KW9A 4GLVB 4NP5A 2M00A 1SYEA 1V9PA 2UXDL 1SYBA 3F2UA 3NK9A 1I6HH 3CRZA 2A6HD 4JI0L 2QDXA 4PC6A 2ZJPA 2VBVA 1FDRA 1WTRA 2BH2A 1YNJD 2M2LA 1KZLA 1LT5D 3QOLA 2XIWA 1NDHA 5ISRA 1JNYA 3NQIA 1QILA 3ASRA 1NJID 5C3EG 1N0UA 2N88A 1IB0A 1UUPA 1LTGD 2EYJA 4KI0A 3HKZB 1DGSA 4EQNA 3PO3H 4BBSH 2QDLA 3NPPA 2NWGA 3HZXA 5IE8A 1XMQL 2B2UA 1CSPA 1SNDA 2F0SA 2RHSB 4I65A 1Z9FA 2RSNA 4HEDA 1S72B 2B39A 4JI7L 5HZAA 2R6GA 1B23P 4L63B 4YY3L 2UXCQ 2VQFQ 1AMOA 4RJLA 3NBHB 1E63A 4ILWA 4P73A 4AYBB 1C7YA 4GOPA 4DAYB 1KRHA 2VUMH 1DDIA 2XWJB 4K5VA 5BSYA 4G1BA 1CKNB 4XIGS 3NHHA 3HOUH 1JA0A 4DQKA 2YWEA 5F4MA 1S5DD 4PAAA 4RD6A 3B8HA 3I3CA 3HG9A 1WTOA 2B2WC 1H9KA 1XNQQ 4DV4Q 1U4MA 1BBXC 3CCJB 4OXPA 3MAQA 2YU9H 1HNXL 3CXCA 1VQ4B 1HA3A 2L12A 5IYDG 2CFMA 3P75A 3S1QB 2I5LX 1BQEA 2UUAQ 2KQ3A 2C77A 3R2TA 4JBMA 1LABA 2CNDA 1KNAA 3STBD 4G7WA 1EY7A 3J81E 2XZLA 1TLLA 3G4SA 4B4DA 1FNWA 1IBML 5F4OA 3FVQA 1STGA 1JA1A 1UD6A 4QMGA 4FF1A 3SEBA 4GKKQ 1GHKA 4L8JA 4CKCA 2E75C 3EIVA 4GNXA 2BGIA 1D8LA 2WB1B 3A8JE 4XLCA 3CC2B 2DY8A 3K0XA 3GTGB 2DNCA 4DF7A 2Q6LA 1HZEA 4OPOA 3RY8A 4Q5VA 2R92G 4PC7A 5JJKA 1XMOL 1QB5D 4OO1G 1GAWA 2ZXOA 3CESA 2PQEA 2Q2IA 1OO9B 2B63G 5I9PA 4P6VF 1QUQB 2HCJB 3CD6B 1WCMH 2WAQE 4RD0A 1HFGA 3PIO3 4LBZA 2E2DC 3MXUA 4ZQ3A 3GSIA 4A3IB 1KNEA 2OTLB 1Y0RA 2G5DA 1Q86D 1B9NA 1E3XA 4DR2L 4DR4Q 2Y0SB 3LVBA 3GTLH 4QFMA 1VQ8B 3K5OA 4A3GB 2QW7A 5JPMC 3ZUGA 4CJ1B 4LUZA 4DV0L 2Q6IA 1SYCA 3DM1A 3EA6A 3UDGA 2ZXPA 4OIJA 4HR7B 3MFYA 5KIXA 1VHOA 4XN0A 1F9RA 3D31A 3H3VC 2QN6A 3ND8A 3WXMA 4RA8A 4LF6Q 2AHOA 1EL0A 1RKNA 4P25A 4IUNA 2VBTA 2F0IA 1XNRQ 3ASQA 3MHBA 2WJVA 1NUCA 1SSOA 3BZKA 2CH4W 1A8VA 2KVMA 1VQ4A 1R9TB 4IFDG 2NTTA 3CCLA 1TTTA 4ULLA 2PMDA 3I55B 2JK8A 1EP1B 2KOLA 3VR5A 2K1BA 2EY1A 3S17H 1FRQA 3T51B 1SNOA 4Y52H 5FA6A 1QFZA 1PJ7A 1TWCH 3I56A 2NV4A 4JI8L 2IY5B 3SDZA 2UUCQ 2QTZA 3FKIG 4P74A 2N3SA 4XN3A 4ID6A 3LWUA 3PA1A 4C0SA 4N8X1 1A62A 5FIUA 1N0VC 2D9RA 1KJZA 1WP6A 3CCRB 1QWYA 2PO4A 1KQSB 4MIUA 2YTYA 4B3TQ 2ES2A 5C3WA 1E43A 1W0JA 2HMAA 1XE1A 1HJPA 2A6ED 2F52A 2NB0A 3I91A 2SDFA 1EIYB 3CU7A 4FNFA 4RMFA 5C44G 1F9PA 2DYIA 4O2DA 2L15A 2CVRA 4BXXH 1G7SA 1UMKA 4TMTA 4DK3C 2DERA 3W5HA 1WOCA 4H0LC 4X3UA 2AQ1B 3VMFA 1K9MD 3BZDB 4DV1Q 3R6JA 1YITB 1SFOB 3TS2A 3D26A 1JQYD 3N6RA 2LXJA 3VR6A 2WP8J 1PTOH 5IOCA 4QCLA 4OPSA 2F0GA 3KEWA 3ONUA 1SJHD 2B8GA 3CPWB 2I5HA 4GS3A 4G57A 1ZXTA 2VBSA 3BDOA 4XXEA 4JBJA 1Q9SA 5I2XA 1PZKD 1PKVA 5JBQA 3HFZB 4DPGA 3K57A 1NR2A 1GO2A 4X66Q 5IWAQ 2F4NA 1V43A 1VQ6A 2EYFA 1J9OA 3ERSX 1MI2A 3KBGA 1BCPB 1KLGD 1KDAA 2EPBA 2YYZA 2Z6BA 3H3VH 4NW2A 4C1NI 4CDEC 2F03A 1J6QA 2EZVA 4HIKA 5CDFA 1V0EA 1B7YB 4WZLA 2H5XA 1EY8A 1M90C 5A89A 3FKSA 1LACA 3SHLA 3FEWX 1V1QA 1HNZQ 4UZUA 5EKLA 1E24A 5DN6A 5CGKA 3J7YW 1KK2A 1SMXA 5G3LD 1SMYC 3J80E 3Q39A 4JI1L 4A3JB 1XYIA 1JWUD 4ZCLA 4P72A 4DR6Q 2K5VA 2OK8A 1OXSC 5KEEA 2OEOA 5JVG3 3C46A 5E6TA 4IZ8A 2I5MX 1S4ZA 4RAUC 4RDJA 2UU9Q 2RDFA 1PJ5A 4HIOA 1HUNA 4XOPA 3QFTA 1LYLA 2MJ8A 4A3MG 2JA6H 1V1OA 2HQEA 1VQ7B 4NXMQ 4DNTB 1UE5A 1X32A 3I4MG 5EPJA 4DAVA 4YIJA 4POFA 2PMZB 1S40A 5L37A 2DN8A 3SEJA 3VNVA 4X8IA 2A6EC 4YCVA 2WSSA 1TUIA 4HIZA 2XVSA 3K6OA 4R4TA 5M5WH 1QNKA 5ELFA 1NTGA 2WZNA 2JA6G 1Q3LA 2EVBA 3U6KA 1COWA 4ZRZA 3AEVA 1CT1D 2ZL6A 1CTMA 2PNHA 4C56C 2QE7A 4Y7NB 1KLUD 5A35A 1GM5A 4YALA 1AFPA 1IYUA 3T56B 4BA2I 3OJWA 1BX1A 4B3ML 3A7AB 2JJ1A 1K0RA 2PZTA 2OYNA 4WFN3 3KLSA 2RSOA 3OTOL 3FRPB 5EAYA 1DZ1A 3ZBTA 2A1AA 3NXWA 2V1CC 1A3VA 4FF4A 3DDYA 4ROXA 3NQTA 2NVTB 4N8FA 1R5BA 1F9SA 5I2YA 5EQ0A 5FO7B 1EYGA 5F2DA 1NJIC 3Q6QA 1HZ9A 1I50B 1PRTF 1VQ8A 1Q7YC 4HAEA 3MZ5A 2OK7A 4E6IA 5ELDA 4NXNQ 4B3SQ 1B44D 3GV3A 4GNXB 4IFDH 1DCZA 1HCZA 2KENA 3H15A 4JI0Q 4ZKCB 3WQZA 3SGIA 4RHRA 5K5PA 1RIPA 3M4YA 3RNUA 1PHJA 2N49A 4GN5A 1VQGA 3DXJC 1SXTA 1TVXA 1LTBD 1NY4A 3OEEA 4JMQA 5LMNQ 1S4MA 2F0LA 2QF7A 2Q6OA 1VF5C 2VNKA 1OB0A 3CCVA 1MSHA 1J5EQ 3HRZC 3GP7A 3X3MA 5JAVA 1R4QB 3S16B 4C3IB 2VW9A 1LT3D 3I4NG 1TWFH 5CMDA 5LL6S 1VQ7A 3OZWA 4C2MB 1ZUNB 4P1VA 1YJWB 4Q0FA 3KOJA 4Z4WA 1ESFA 3CCMA 1XTCD 4PABA 1STAA 3CMEB 2Q2UA 2F0JA 3E9IA 3UE1A 2F0VA 4C3JH 3EQLC 4ME5A 1XMQQ 2L5TA 3HOWG 2Z4HA 2PI2E 3WNCA 1MKHA 2K75A 2D2CC 4XLEA 4RPDA 2EYHA 2ZTEA 2AQ2B 4OELB 2VQFL 2E2JH 4IN3A 1VS0A 4QUFA 3RZDH 3QOJA 2L1BA 1Z6HA 2RA4A 5CORA 4RPBA 1V1PA 2CBXA 3HOVG 1KK3A 2EY2A 4ABNA 3AU7A 3FKIH 5C3XA 5C5LA 4DV3Q 3CRKC 4RLZA
chains in the Genus database with same CATH topology
2LKVA 1YNNC 1SKYB 3NBHA 5CV7A 5E1FA 4G4KA 1EZ6A 5DAUA 4V0BA 3J7AF 2PYKA 4A3DB 4K5WA 1AZQA 2V31A 4K6LA 4I7ZC 3OWFA 4O42A 4DAPA 3C3LA 5A2QL 2R3ZA 3JAML 3BDCA 2E1BA 4K8IA 1JICA 4RCOA 2IW3A 1BR9A 1F9QA 1GUWA 1KDCA 2F0DA 3QJYA 1WPCA 1XX8A 4CJ2C 1SAPA 2R92B 1EY9A 5EPKA 2WZPP 2B2VA 3KBXA 2DY7A 1E2ZA 2VNUD 2F3VA 5T1GA 1OXXK 2NN6I 4GQNA 2KECA 4RCNA 2A69D 2BA0A 2XNAC 1Z7TA 5JEAJ 2WIIB 1MGSA 2H4OA 1GJXA 4A3FB 1V0FA 1EOTA 4KJNA 3I72A 3JAME 4YEJA 1JWSD 1S5ED 1TWFB 3KLRA 4K5XA 1KABA 3EROA 4C1NK 3S1RB 4ZK9B 1SNMA 2XZOA 3QG1A 4CKBA 1D1IA 4LJZC 5CR3A 5I4DA 4FXDA 4GZYC 4RGOS 1MABA 1HVXA 3PUWA 3CMMA 4OHJA 5KNLA 5EKKA 2BCOA 3ND9A 5IGFA 2EYLA 1K83B 3M7NA 2JA5B 2TMPA 1TS2A 1T5XD 1PDQA 1HQMC 2I07B 4LK1C 1O80A 5CV6A 1GUOA 5M3FB 3HOVB 4TQUS 3GVKA 1UD5A 1AEXA 1AN8A 3OOCA 1Q90A 5EBCA 1PZJD 4XLHA 2B63B 1BNZA 3W3AA 4U68A 3R3OA 4DXFA 4K8JA 1TU2B 4FXKC 5CC4A 5ELBA 2GK6A 3A56A 4ZKBB 3Q0AA 4R9WA 3MVVA 3TMEA 5I6YA 1D1KA 3U9OA 3RMHA 1E3ZA 2KCCA 4IUUA 4XDXA 2AQ3B 2TSSA 4RGMA 2Z8LA 2KUMA 2JDIA 2ZTNA 4XQQA 4QUCA 2XN9C 2ZXRA 1MSGA 3S9WA 1CFMA 1WTPA 3SK6A 2XGJA 4KD4A 1WD0A 3M7GA 1E2VA 2A73B 4DA2A 5J22A 3HOZB 1FX0A 2QILA 2QDBA 2O5JC 1Q1EA 1B3AA 4PMWA 1LTRD 1T5EA 4P22A 4XR6A 4B3GA 4XT1B 1F2MA 4TSSA 4XYQA 3I70A 1GOZA 2V7QA 5JOBA 2I46A 3G05A 2HCCA 5IK2A 2CQAA 2Q8IB 3I4MB 3KLSX 1VF7A 4X3TA 2MHVA 4A3EB 1HA6A 4H7BA 3OPOA 3CHBD 4HTHA 2KVOA 1EYAA 2O2LD 3FKIB 4G7ZC 2SNMA 1TS3A 1PTOF 2EYMA 1M8AA 3RZDB 2KJXA 4KHZA 1QJOA 5I6WA 2EOTA 1ESRA 2FJ2A 4HMIA 2B8FA 1ENCA 3OWEB 1RHPA 1FNVA 2DIEA 4XYOA 2NN6G 1QCBD 1LV9A 1E79A 3M85A 5IGGA 2Q8RE 2B2TA 4KY5A 5D3DA 3OIQA 3VR3A 4EQPA 2X85A 2ZZQA 1FGBD 4A93B 1EY0A 3MEHA 3A7LA 2F0NA 3AMUA 2JYOA 4RWSC 5FO8B 5M9OA 2WKCA 2ZZEA 3URYA 1II3A 4H13C 4HCEA 2O5IC 1SYGA 2O4XA 1SBBB 3VR2A 1I3QB 3E5SA 1F2YA 3DWPA 2L11A 4TKOB 1LO5D 3OHXC 4YELA 1ET6A 3I4LA 2CW0D 1TWCB 2K04A 4K14A 3CKIB 1BDOA 1BCPD 3EFXD 2NTSA 2Z6BD 4J8QA 2NUCA 3T53B 2SOBA 3Q24A 1G2SA 2B2VC 2JEBI 2J7ZA 3TP7A 4NMZA 4BA1I 4EVOA 1H8HA 2JIZA 5CYUA 4CKEA 4RGNA 3TP6A 1GXDC 4XM3A 3VYRA 5J39A 4YXWA 1CA5A 2Z1CA 5FK9C 3L9AX 2HCIA 1FD7D 2F3WA 1WTHD 5EJWA 3VYSA 3L7ZC 4UDUC 3PUYA 3OFNA 1I4PA 4U673 4RKLA 1FR3A 4IUQA 1I6VC 2WINB 5CV9A 2XRSD 1VMPA 2OXPA 1QG7A 1PFBA 5FLXL 4F7XA 3P7JA 4ZAIA 3H09A 5C6AA 4PQXA 3LX0A 2FMCA 4J1MA 3EJIA 3ERQA 1XXGA 4FO2A 2NYZD 4M1UB 2L9HA 3AB9A 1ENFA 1NAPA 3HGBA 1I4RA 5EKIA 2CW0C 5D3IB 3NBIA 1IHZA 4TRDA 3MXGA 2E2IB 2D62A 3C1FA 1DM0B 2NN6H 2F0MA 4B9XA 2YU9B 1GUNA 2EDGA 2F0FA 2L0CA 3V96A 2PW7A 2ENBA 5BN4A 4C3JG 4HSPA 4RKBA 3T4AC 4ODGA 1TKWB 2J0TD 4A3MB 4HN7A 1WTQA 1VMCA 4B9WA 1LTSD 4S3SA 3DMUA 2B2YA 2LY7A 3NWTA 3TP8A 2GJRA 2JA6B 2EJFC 1C8CA 4XKVA 1CQVA 3GTOB 2V4DA 3GD7A 2HDLA 1LTID 3W2DA 1O7ZA 1PRTC 1HHVA 2MGSA 1UD2A 3D4WA 2IL8A 1O7LA 4II2A 1B1ZA 5D14A 4G6IA 3NUCA 3NSWA 1ILPA 3NP8A 1ILQA 4MHEA 1U4LA 2C9OA 1BCPF 5BN3A 4CJ0B 5G3LF 3T13A 3EVQA 2ZXHA 3A3BA 1JC7A 5C4HA 4RHSA 2EJMA 1H9MA 1DYQA 4BS9A 1SE4A 1Y8PB 1BXTA 4KMUC 1Y1VB 2L4NA 2BE5D 1TY0A 4XKWA 5C4JB 2X6WA 3OIPA 4XORA 1EY5A 3I90A 4E0FA 3R8BA 4G7OC 1ENAA 4V190 4KY6A 1CZWA 1FNUA 3WOEA 5JEAH 2X6YA 1HFNA 1MD2D 3IFTA 5ELCA 1I4GA 5CV4A 1KTKA 1TR5A 1GUSA 2VUMB 3MFGA 3BC9A 5IT9L 1QE6A 3I73A 1V1PB 3OE7A 3GTKB 2PZWA 1D6EC 1RODA 1AW7A 2JP1A 4DXGA 5M5XB 5DNFA 5KYLA 2K33A 3K5MA 3M3YB 3TBIB 2WPDA 2PPBC 1TWGB 5LL6X 3SK5A 2OT2A 1HXYD 2MPMA 4ASUA 2J4XA 2BDOA 3C1EA 3LNNA 1Z47A 1HA5A 2EJGC 1JWMD 1Y69U 1NR4A 1NRKA 2WKDA 4OGQC 2NBFA 3D8GA 4IQZA 2D3NA 1DD2A 1BLIA 1CHQD 1CK1A 2HUGA 3DWQA 4BBSB 3SR1A 5DM63 3CP8A 1BUVT 1QNUA 1ML0D 1UD4A 3DEOA 4KKUA 1UNSA 3MXPA 3ZIAA 1M4VA 1O7YA 4X3SA 3GQBA 1SE2A 2GK7A 2K28A 3PUXA 2AWOA 3IAYA 1DOMA 4NKLA 4PMBA 1HPCA 2A68D 1EU4A 2RQXA 1PTOB 2BE5C 2F0UA 2F0QA 1HQRD 3C2PA 1KDBA 3S2HB 2QCPX 4DK1A 4XD7A 2EYOA 3VYTA 1H9RA 2KCNA 4XLAA 3P20A 5K36G 4IALA 2E2JB 2ICEC 4BY1B 1W6KA 2ZZFA 2F0KA 2G9HD 3BCDA 2GJPA 1UAPA 3GTPB 2XOKA 1DOLA 2A74C 3TDQA 4DU9A 1B50A 1HUMA 1SDFA 1G2TA 2PNRC 1RJTA 1XWEA 4QF4A 1EYCA 4NDXA 5LHY1 1D5XC 2ZZGA 5KYIA 3UI2A 4II3A 2NVQB 4FP5D 3A8KE 4DK0A 5CBAE 3IKJA 2HLDA 1WTXA 1BF4A 5M3MB 1B4OA 4KK7A 1SE3A 1TY2A 1E1QA 2KEEA 4RGTA 5DEHA 1L0YB 1CHPD 2VJIA 2IX0A 1VLYA 2A68C 3CRLC 3QO2A 3H94A 3R2IA 4A3BB 2B2UC 1UD8A 1TT2A 5IIFA 4LMQD 3D4RA 1EY6A 1PFMA 2K6AA 4ZUJA 5D65A 2ZT9C 2AUKA 2DNEA 2SEBD 2XRQD 3S17B 4KTAA 4FYDA 3K58A 2Q8TA 3P1HA 1LTTD 3E6ZX 5ELEA 2PZUA 2IX1A 3GTQB 2EY6A 2B2WA 4Z1MA 1TWAB 3HOXB 4BBRB 1X3PA 1VJSA 2IPKD 1RTNA 3KF8A 4FVMA 3G7LA 1SMYD 3ITPA 4PMCA 3RD4A 1BMFA 1HTLD 3S14B 2W6JA 3K5NA 5FL7A 5HURA 2K5WA 1K8MA 1CI3M 2PCFB 3FDTA 2MUYA 2F0EA 4RH6A 2K01A 4AVZA 3TP5A 3BVMA 1NBMA 1EY4A 1B9MA 3SVMA 1LT6D 2IWHA 3TZDA 5NUCA 1STBA 3CQZB 3X3NA 5FOBB 1U4RA 5KNDA 1D5MC 1JOQA 1H9JA 3M4OB 3ZPNA 2W6IA 2IT1A 3OEHA 2NVXB 5CBEE 2X69A 2BOSA 2F43A 2E76C 1BQQT 4XTCS 2D9UA 4KY7A 1AP0A 2K5QA 2H1EA 5COYA 1W6JA 1TS5A 4KHVA 1U9RA 2CHBD 1OXTA 3QIAA 4DAYA 4XQNA 4OIKA 4OL7A 2F0TA 2OF1A 5JEAG 4PNYA 4TSFA 1GHJA 3N52A 5C44B 1NSNS 1JE4A 1EIGA 2ID0A 3HS0C 3PO2B 3OSOA 1RTOA 4X3KA 1EQVA 1WCMB 1IW7C 3D6WA 3HAGA 1S5CD 2VJJA 2JSOA 4LAAA 2MP1A 1UEAB 4KN4C 4RFBA 1ICWA 4H44C 4K2KA 2JEAI 1YNND 1I4HA 4N9TA 1H9SA 2K05A 4KV6A 5I9OA 1LLRD 4K2LA 1PZID 2M9VA 1PTOD 2A6HC 5HGTA 4PV1C 3CP2A 2X6XA 1WVLA 3RZOB 4DN4M 3PMFA 4FXGC 4TT3A 3IFDA 1IKMA 3VYUA 3QWNA 1MBYA 1IYVA 3E0JA 2KEDA 1D2BA 5C4XB 1K28D 2D3LA 1JB3A 3RLFA 1V8QA 1SNQA 2WAQB 2B2TC 3OAAA 1D5ZC 5C4ZA 4FXUA 4KN7C 3MA2B 5C0XI 1LTAD 3NTHA 3Q22A 4G7HC 1TS4A 1SJED 1PXUA 2K7VA 4B3FX 3NTIA 5EGTA 1WD1A 5HKKA 5KNCA 1OHHA 3I4NB 3FPUB 2N55A 1SNCA 2BA1A 5CV5A 4BWGB 1IW7D 4HMJA 1PMRA 3BYTB 1PRTD 2IJ0A 1EFRA 1E2WA 3BDLA 3HOWB 2F0OA 5IGBA 1GUTA 1S5BD 2CK3A 5KGUA 1I6HB 2JXMB 3VA7A 3A35A 5EBDA 4C3IG 1ZYRD 5K36H 4HSVA 1RF2D 1C48A 4XNFA 2WACA 2SNSA 2FHTA 2LMCB 1EFID 1Q12A 1KAAA 2VXWA 3DEPA 2D5DA 1EEFD 3K7AB 4UAIA 3JU4A 4MN3A 2ZXIA 1JOOA 4KJOA 5FLXE 1LT4D 4DGZA 1ET9A 2F1MA 3OMGA 3KUPA 4XQFA 1TQOA 3BG3A 2HDMA 4XOTA 5AFWA 1G91A 2GA4B 1PLFA 1Q1BA 4XMYA 4WJWA 3DUZA 3WOFA 1A15A 5M5WB 2A69C 1JOKA 3HOUB 4OO1I 4R8NA 5C5MA 4IUPA 1Y1WB 1BO0A 3NWSA 1SEBD 1EWCA 3H0GB 5IODA 3BVGA 3VR4A 1GUGA 1OXVA 3S1NB 3HOYB 1NCVA 2JJ2A 3NTKA 5C0XJ 3MWYW 5T1IA 3SE0A 3J7AV 1YNJC 2F0PA 1B2TA 1R4PB 2E2HB 1HRJA 3GTMB 1J8IA 3WDNA 4M8AA 1DXMA 3O13A 1H9SB 2ICIA 4R8IA 3IL8A 2E74C 3PIP3 5KNBA 2K5DA 2A5HA 5C3EB 5J1ZA 1F2ZA 1I18A 2G9DA 2WV6D 3A55A 5BN5A 5E3FA 3DWAA 2VB3X 4J6HA 1UD3A 1QOHA 1A6XA 4NNJA 1EYDA 4N9PA 1B53A 1VCIA 1HTPA 1BCPC 4L6TB 2NVYB 2NZ1D 3FPPA 3J80L 3T16A 3RUZA 1I4QA 3GV6A 5JPNC 2LS01 1E1RA 1K8OA 4C3JB 4JBWA 1PTOC 1PYWD 3Q23A 2F0WA 2B2YC 2JA7B 4CHTB 2JA8B 3BS1A 2C5CA 3PV0A 1G291 1U4PA 4B08A 1C4QA 2KHSA 2Z4IA 1OXUA 2IX3A 2LFNA 3TN2A 3GTJB 5M5YB 1A3TA 4C3HG 5TSSA 2QEJC 5KRUA 5JJZA 3K5LA 4DNRB 2PW5A 1IL8A 4IURA 4EQOA 4BY7B 3Q6SA 3SK8A 1JCKB 2FINB 2KA7A 3GVJA 4QIWB 1G6ZA 1W0KA 3GTLB 2AUJD 4CGYB 4C3HB 2R7ZB 2QKIC 3DHQA 2XZPA 2EXZA 4WORA 5IGCA 1DOKA 3QB3A 1TIID 1SNPA 3K0YA 1W9XA 3GVLA 3L3OC 2ZTGA 1WTWA 1I8DA 4A3KB 5E4XA 1A2TA 1IKLA 3A3GA 4FF3A 1ZEQX 1Y8OB 4XQJA 4G7XA 3KK7A 4FF2A 1AZPA 2X6GA 3H6MA 3VA5A 5IT9E 1JR0D 1SYFA 1CA6A 2R93B 2EE1A 1PRTB 1DJRD 3PUZA 1CQFA 4O1NA 4ZLTF 3TZUA 1STHA 5DM73 5IGDA 1A2UA 3SK4A 3D4DA 2RBMA 1EQTA 3SXHA 3HEJA 2X8KA 4ZUIA 3MC0B 1I4XA 4XL9A 1CZGA 3BVZA 1RD9D 3BH4A 3OW7A 3MTSA 3K59A 3V2TA 1Y8NB 1E0BA 2K32A 4WRDA 5FKAC 2AWNA 4HCSA 1ZYRC 2RVLA 1ZKOA 5JVH3 3MXNA 4F88A 2X53S 2EYPA 1EEID 1F77A 1TWHB 4P2CB 3J81L 4KD3A 2M5SA 4IUTA 4IFDJ 3PUVA 1FYCA 4EGVA 1JORA 1L0XB 3ZYYX 3PO3B 1KMHA 1VDZA 3I8ZA 3S15B 3GO5A 2FMMA 3V05A 4XLFA 2FFKB 1EWHA 2VB2X 1EIHA 2X6LA 3BCFA 3NE5B 5EPLA 3TSSA 1STYA 4JK1C 2WJYA 2K03A 3ONAB 2F0HA 1F2LA 3S2DB 1RCVD 4IFDI 1G8ZD 1BPLA 4F8MA 4Z9CB 5E4WC 1ONLA 1BOSA 2RKSA 1CM9A 3LWEA 5A2QE 4IUVA 1Q8IA 2R61A 2XWBB 4DFAA 4XONA 1PFNA 2F4IA 3HP3A 2RDHA 1STNA 1SYDA 2L55A 5C0XH 1STEA 5FO9B 3S1MB 2XSCA 4QB4A 3BYYB 3D6CA 1H8EA 1DONA 1RDPD 2JE6I 3OMCA 3H91A 2XNDA 2EY5A 4OO1H 4ZYSA 2BDNA 1EU3A 5C0XG 4F87A 3A8IE 1X3QA 2R9VA 3D3RA 3G6JB 1S5FD 3U9SA 4KKSA 4XT3B 1A3UA 4CBVA 1O78A 2LZJA 1EZ8A 4KKTA 2GJKA 3A54A 1WTVA 5CV8A 2RDGA 4K6DA 3R93A 3FMCA 5IGEA 4NP5A 2M00A 1SYEA 1SYBA 3F2UA 3NK9A 2A6HD 1WTRA 1YNJD 2M2LA 1KZLA 1LT5D 3QOLA 2XIWA 5ISRA 3NQIA 1QILA 2N88A 1UUPA 1LTGD 2EYJA 4KI0A 3HKZB 4EQNA 3NPPA 2NWGA 3HZXA 2B2UA 1SNDA 2F0SA 4I65A 2RSNA 4HEDA 2B39A 2R6GA 4L63B 4ILWA 4AYBB 2XWJB 4K5VA 4XIGS 3NHHA 1S5DD 3I3CA 3HG9A 1WTOA 2B2WC 1H9KA 1U4MA 1BBXC 3MAQA 2L12A 3P75A 3S1QB 2KQ3A 3R2TA 1LABA 1KNAA 4G7WA 1EY7A 3J81E 2XZLA 1FNWA 3FVQA 1STGA 1UD6A 4QMGA 4FF1A 3SEBA 1GHKA 4L8JA 4CKCA 2E75C 2WB1B 3A8JE 4XLCA 2DY8A 3GTGB 2DNCA 4DF7A 1HZEA 4Q5VA 1QB5D 4OO1G 2ZXOA 3CESA 2PQEA 1OO9B 5I9PA 1HFGA 3PIO3 2E2DC 3MXUA 4ZQ3A 4A3IB 1KNEA 1B9NA 1E3XA 2Y0SB 3K5OA 4A3GB 5JPMC 4CJ1B 1SYCA 3DM1A 3EA6A 2ZXPA 4OIJA 4HR7B 3MFYA 5KIXA 4XN0A 1F9RA 3D31A 3H3VC 3ND8A 4RA8A 1EL0A 1RKNA 4IUNA 2F0IA 3MHBA 2WJVA 1NUCA 1SSOA 1R9TB 2KVMA 4IFDG 2NTTA 4ULLA 3VR5A 2KOLA 2K1BA 2EY1A 3T51B 1SNOA 3SDZA 4ID6A 4XN3A 3LWUA 1WP6A 1QWYA 2PO4A 4MIUA 5C3WA 1E43A 1W0JA 2A6ED 2NB0A 3I91A 2SDFA 3CU7A 4FNFA 1F9PA 2CVRA 4H0LC 4X3UA 2AQ1B 3BZDB 1SFOB 1JQYD 3N6RA 3VR6A 2WP8J 1PTOH 5IOCA 4QCLA 2F0GA 3KEWA 1SJHD 2B8GA 4G57A 1ZXTA 4XXEA 3BDOA 5I2XA 1PZKD 1PKVA 3K57A 1NR2A 1V43A 2EYFA 1J9OA 1MI2A 3KBGA 1BCPB 1KLGD 1KDAA 2EPBA 2YYZA 4NW2A 4C1NI 2F03A 2EZVA 5CDFA 1V0EA 1EY8A 3FKSA 1LACA 3SHLA 3FEWX 4UZUA 5EKLA 5DN6A 5CGKA 3J7YW 3J80E 5G3LD 1SMYC 4A3JB 1XYIA 1JWUD 1OXSC 5KEEA 2OEOA 5JVG3 3C46A 4IZ8A 1S4ZA 4RAUC 2RDFA 1HUNA 4XOPA 2MJ8A 1V1OA 2HQEA 4DNTB 1X32A 5EPJA 4DAVA 4YIJA 2PMZB 2DN8A 2A6EC 2WSSA 4HIZA 2XVSA 3K6OA 1QNKA 5ELFA 1Q3LA 2EVBA 1COWA 4ZRZA 1CT1D 1CTMA 4C56C 2QE7A 4Y7NB 1KLUD 5A35A 1AFPA 1IYUA 3T56B 4BA2I 3A7AB 2JJ1A 2PZTA 4WFN3 3KLSA 2RSOA 3FRPB 1DZ1A 3NXWA 1A3VA 4FF4A 3DDYA 3NQTA 2NVTB 1F9SA 5I2YA 5EQ0A 5FO7B 5F2DA 1I50B 1PRTF 4HAEA 3MZ5A 4E6IA 5ELDA 1B44D 3GV3A 4IFDH 1DCZA 1HCZA 4ZKCB 3WQZA 4RHRA 5K5PA 3M4YA 3DXJC 1SXTA 1TVXA 1LTBD 3OEEA 4JMQA 2QF7A 2F0LA 1VF5C 1OB0A 1MSHA 3HRZC 3GP7A 3X3MA 5JAVA 1R4QB 3S16B 4C3IB 1LT3D 5CMDA 5LL6S 4C2MB 4Q0FA 1ESFA 1XTCD 1STAA 2F0JA 2F0VA 3EQLC 4ME5A 2L5TA 2Z4HA 2D2CC 4XLEA 2EYHA 2AQ2B 4IN3A 4QUFA 3QOJA 2L1BA 1Z6HA 2RA4A 5CORA 1V1PA 2EY2A 4ABNA 3AU7A 5C3XA 5C5LA 3CRKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZY C;  3VR2 A;  4G7O C;  1GUT A;  4IFD G;  3PUW A;  4DNT B;  1YNN C;  2O5J C;  2R6G A;  5BN5 A;  1Q1E A;  4TKO B;  2JXM B;  1ONL A;  2D62 A;  1T5E A;  3VA7 A;  3VR5 A;  2DN8 A;  2NN6 H;  5JEA H;  2A6E C;  3T51 B;  3ND9 A;  1IW7 C;  3M7N A;  3IFT A;  5K36 H;  1GUN A;  2EDG A;  3PUY A;  1A6X A;  3I4L A;  4I7Z C;  2EVB A;  1GUS A;  1HTP A;  1VCI A;  2PNR C;  3SDZ A;  5BN4 A;  1BDO A;  3PUZ A;  3I73 A;  1K8M A;  4KN4 C;  3FPP A;  1CI3 M;  1CTM A;  2PCF B;  5C0X H;  4H44 C;  4XIG S;  3LWU A;  2Q8I B;  3TZU A;  2JEA I;  1VF7 A;  3T53 B;  1H9S A;  5A35 A;  1TKW B;  2LMC B;  1Q12 A;  1IYU A;  3T56 B;  1HQM C;  2K33 A;  4BA2 I;  1H9K A;  1K8O A;  3A8K E;  2A6E D;  4DK0 A;  2JEB I;  2PPB C;  1B9M A;  4LK1 C;  3A7A B;  2A6H C;  3IKJ A;  4JBW A;  2JE6 I;  2D5D A;  3OPO A;  1GUO A;  4PV1 C;  4OO1 H;  4TQU S;  4BA1 I;  2BDO A;  3QJY A;  5C0X G;  3PV0 A;  4H0L C;  4G7Z C;  1G29 1;  2F1M A;  3LNN A;  1LAB A;  3A8I E;  3OOC A;  1Q90 A;  2EJG C;  5KND A;  2EJF C;  1Y69 U;  3N6R A;  1OXU A;  3OW7 A;  3U9S A;  3VR6 A;  4KHZ A;  3BG3 A;  4IFD H;  2V4D A;  4KKS A;  1DCZ A;  1QJO A;  3GD7 A;  4OGQ C;  4L8J A;  1GHK A;  3W3A A;  1Y8N B;  4IQZ A;  2K32 A;  1HCZ A;  1O78 A;  2A68 C;  3CRL C;  2E75 C;  3L7Z C;  3H94 A;  1H9J A;  1E2Z A;  2B8G A;  3M4Y A;  4KKT A;  1ZYR C;  3A8J E;  1FR3 A;  1IYV A;  1Q1B A;  3DXJ C;  1TU2 B;  1DD2 A;  1I6V C;  4DNR B;  1ZKO A;  2B8F A;  2DNC A;  3BDO A;  2A69 C;  2IT1 A;  2QF7 A;  1OXX K;  1VF5 C;  1O7L A;  2NN6 I;  4OO1 G;  3D4R A;  1V43 A;  4RCN A;  2KCC A;  2NN6 G;  3FMC A;  4KKU A;  2YYZ A;  1V8Q A;  2ZT9 C;  3RLF A;  2E76 C;  2A69 D;  2AUK A;  2BA0 A;  2DNE A;  3MXU A;  2KA7 A;  4XTC S;  3M85 A;  2A6H D;  3GQB A;  1Z7T A;  1FYC A;  3PUV A;  5BN3 A;  1B9N A;  3PUX A;  4KN7 C;  3VR4 A;  1LAC A;  4G7H C;  2AWO A;  3EQL C;  1GUG A;  2AUJ D;  2L5T A;  1OXV A;  1H9M A;  1VDZ A;  2EJM A;  1GJX A;  2K7V A;  2D2C C;  1HPC A;  2A68 D;  1Y8P B;  1EWH A;  1OXT A;  3AB9 A;  3I72 A;  3QIA A;  3VR3 A;  1SMY C;  1CFM A;  3NE5 B;  4KMU C;  5KNC A;  3SE0 A;  2BE5 C;  1YNJ C;  4HR7 B;  2BE5 D;  3HGB A;  3MFY A;  3KLR A;  3D31 A;  3A7L A;  2BA1 A;  4KI0 A;  1OXS C;  1Z6H A;  3WDN A;  3ND8 A;  1DXM A;  1IW7 D;  1H9S B;  4JK1 C;  4DK1 A;  1PMR A;  5JEA G;  3QG1 A;  1H9R A;  2CW0 C;  2E74 C;  1E2V A;  4LJZ C;  3P20 A;  5K36 G;  1E2W A;  3CRK C;  1GHJ A;  4H13 C;  5KNB A;  2O5I C;  1Y8O B; 
#chains in the Genus database with same CATH topology
 4LF8 L;  5FLM H;  2LKV A;  4OEM B;  1YNN C;  1SKY B;  3NBH A;  3SKB A;  4IPH A;  5CV7 A;  5E1F A;  4G4K A;  1EZ6 A;  2R7Z G;  2Z0S A;  5DAU A;  4UP9 A;  4V0B A;  3J7A F;  2PYK A;  2DET A;  4A3D B;  3J80 i;  1CQX A;  1FND A;  4K5W A;  2CH4 A;  4JI5 L;  1AZQ A;  1LUZ A;  1B3Q A;  2V31 A;  4K6L A;  4I7Z C;  3OWF A;  4O42 A;  4DAP A;  3C3L A;  5A2Q L;  5C3E H;  2UUA L;  2R3Z A;  3JAM L;  3CCR A;  1IBM Q;  3BDC A;  4YAU A;  3QFR A;  1WSR A;  1BJK A;  2E1B A;  4Y9U A;  3CCS B;  1JIC A;  4K8I A;  4RCO A;  1LM0 A;  2IW3 A;  1BR9 A;  1VQJ A;  3V7A A;  1IXR A;  1F9Q A;  1VQF A;  4X64 L;  1GUW A;  5GAD C;  1KDC A;  2F0D A;  1R5O A;  3J81 i;  3EN2 A;  4GN4 B;  3QJY A;  3OW2 A;  3WYA A;  1WPC A;  4QY7 A;  1XX8 A;  4CJ2 C;  3J81 j;  1SAP A;  2R92 B;  1JT8 A;  3UDX A;  3BQJ A;  4Z4S A;  3W2E A;  1EY9 A;  5EPK A;  2WZP P;  4DQL A;  3OKX A;  2B2V A;  4A3K H;  3KBX A;  1N33 Q;  2DY7 A;  1E2Z A;  2V7V A;  5IYB G;  4DR2 Q;  2VNU D;  1G7T A;  2F3V A;  3CQZ H;  5T1G A;  2QGG A;  4JI3 Q;  1OXX K;  4LF9 Q;  4LF4 L;  4DV0 Q;  3TRE A;  2NN6 I;  4GQN A;  2E1R A;  2KEC A;  4O0A A;  3K8A A;  3U2Q A;  4RCN A;  4YWM A;  3K7U C;  1IBK L;  2HDN B;  2N78 A;  2YTX A;  2HHH Q;  3PCO B;  2A69 D;  2BA0 A;  4ME3 A;  4YWL A;  2XNA C;  1AH9 A;  5M3F H;  4X7C A;  1Z7T A;  5JEA J;  4P3I A;  4LF6 L;  3SLN A;  4IPG A;  4LC0 A;  1M90 D;  2WII B;  1U2R A;  4NPS A;  1MGS A;  4RM0 A;  2H4O A;  1WSV A;  4DR1 L;  1GJX A;  1XNR L;  3CCU B;  4A3F B;  1V0F A;  3WBJ A;  1EOT A;  4KJN A;  3I72 A;  1EWI A;  3MEF A;  3WWV A;  3JAM E;  4YEJ A;  1JWS D;  1S5E D;  1TWF B;  4A3I G;  4QUZ A;  1HZB A;  3KLR A;  4K5X A;  1KAB A;  3ERO A;  1D7Q A;  1RQP A;  1VQP B;  4C1N K;  3S1R B;  5IYC H;  4ZK9 B;  5THX A;  1SNM A;  2XZO A;  3QG1 A;  1MJE A;  4CKB A;  1D1I A;  4LJZ C;  1NMG A;  5CR3 A;  5I4D A;  4FXD A;  2KHJ A;  2UUC L;  1QUE A;  5A8A A;  3CC7 B;  3WBK A;  5IYD H;  4GZY C;  4RGO S;  1MAB A;  1HVX A;  2K50 A;  4DV2 Q;  3PUW A;  5ELO A;  3CMM A;  2HIX A;  1ZM2 A;  2OBR A;  4OHJ A;  3OW2 B;  4LF7 Q;  3PEN A;  5KNL A;  5EKK A;  2BCO A;  3ND9 A;  4Z4R A;  5IGF A;  2EYL A;  3A5Z B;  2E5L Q;  1HNW Q;  1K83 B;  3M7N A;  1X3F A;  2JA5 B;  2CF4 A;  1XPU A;  2TMP A;  1TS2 A;  1T5X D;  5C44 H;  3T1Y L;  1KQS A;  2QEX B;  1PDQ A;  1HQM C;  1VQE A;  2I07 B;  4NB3 A;  3S1M H;  3CCV B;  5GAE C;  4LK1 C;  1EXM A;  1O80 A;  5CV6 A;  4X62 Q;  1XTD A;  1GUO A;  5M3F B;  2LXK A;  3HOV B;  4TQU S;  1GO3 E;  3ULJ A;  3GVK A;  5B6I A;  1UD5 A;  1VQB A;  2I0Q A;  1AEX A;  1YI2 A;  1E1O A;  1WOO A;  1AN8 A;  3OOC A;  1Q90 A;  2ALY B;  5EBC A;  1PZJ D;  4FWT A;  1PH7 A;  1P8L A;  3GIR A;  4XLH A;  2B63 B;  2KHI A;  1BNZ A;  3BNW A;  3W3A A;  4U68 A;  4APV A;  3R3O A;  3T1H Q;  3SJP A;  4DXF A;  4K8J A;  1TU2 B;  4FXK C;  5CC4 A;  3S2D H;  5ELB A;  2NVY H;  4HJ9 A;  1SKQ A;  3F2D A;  2GK6 A;  1VQ6 B;  4X07 A;  3A56 A;  4ZKB B;  3Q0A A;  4R9W A;  3PVD A;  3MVV A;  3TME A;  1D1K A;  5I6Y A;  4X7F A;  2CW5 A;  4WQM A;  3I7F A;  3U9O A;  3RMH A;  1E3Z A;  3U4V A;  2KCC A;  3MMP A;  2V7U A;  4JI1 Q;  4IUU A;  3W2G A;  3SJZ A;  4XDX A;  1X55 A;  4BBS G;  1YJN A;  2AQ3 B;  2TSS A;  1EOV A;  2YWH A;  4RGM A;  1IBL L;  1HH2 P;  2Z8L A;  4P6Y A;  3E20 A;  2KUM A;  3J81 c;  2JDI A;  2ZTN A;  4XQQ A;  4QUC A;  3PO2 G;  4AF7 A;  2XN9 C;  4JW0 A;  2ZXR A;  2EIX A;  4DV6 L;  1MSG A;  3S9W A;  5KSW B;  4C43 A;  1CFM A;  3F1Z A;  4J15 A;  1WTP A;  2JA5 G;  3SK6 A;  3GTM H;  4RCY A;  2XGJ A;  5FO0 A;  4KD4 A;  3TQY A;  1WD0 A;  3ER0 A;  4A3D H;  3M7G A;  1E2V A;  2BGJ A;  2A73 B;  4DA2 A;  5J22 A;  4LFA L;  3HOZ B;  1NMF A;  4A76 A;  4OOS A;  1FX0 A;  2QIL A;  1QGZ A;  1Q8K A;  2QDB A;  3RR5 A;  2O5J C;  1IYJ B;  1Q1E A;  1B3A A;  1KD1 D;  4PMW A;  3RLN A;  1LTR D;  1T5E A;  4P22 A;  4XR6 A;  4B3G A;  1YI2 B;  4XT1 B;  5LMZ A;  1VQ5 B;  1F2M A;  2C5H A;  4TSS A;  4XYQ A;  3A8K A;  1FNB A;  4X7D A;  5IYW A;  3I70 A;  4NBS A;  1GOZ A;  3AST A;  1ZM9 A;  5IYC G;  2V7Q A;  5JOB A;  4LFC L;  2I46 A;  2VNJ A;  4A3B G;  3G05 A;  2HCC A;  5IK2 A;  2CQA A;  2Q8I B;  3CCS A;  3I4M B;  2GVA A;  3KLS X;  4EX5 A;  4IPD A;  3W5V A;  1VF7 A;  4ZCM A;  4Q7J B;  1K3R A;  4X3T A;  2MHV A;  2Z6K C;  3LGJ A;  4OPV A;  4A3E B;  4LW1 A;  5LMU L;  3ISX A;  1Y1V H;  1NE3 A;  1HA6 A;  4H7B A;  3OPO A;  3CHB D;  4HTH A;  3F2B A;  4HJ7 A;  1S72 A;  2KVO A;  4A3L G;  1Q46 A;  1EYA A;  1PV4 A;  4TVA B;  2O2L D;  3FKI B;  4G7Z C;  2SNM A;  1TS3 A;  1D8T A;  3KDF A;  2UUB Q;  3LQ6 A;  1PTO F;  1TWH H;  1T6Z A;  1M8A A;  2EYM A;  4YAO A;  3RZD B;  4GLX A;  2KJX A;  2XNC A;  4FN5 A;  4KHZ A;  3CMA A;  1QJO A;  1PH1 A;  5I6W A;  4UZF A;  2EOT A;  1ESR A;  1TWA H;  2FJ2 A;  2IHF A;  4MYT A;  4HMI A;  1OGJ A;  2B8F A;  1O7I A;  1PH8 A;  1ENC A;  1DDG A;  4Z4U A;  5BR8 L;  3OWE B;  2F1L A;  1RHP A;  2JN4 A;  1FNV A;  2DIE A;  4A3F H;  2VY3 A;  2QTL A;  4XYO A;  1MHW C;  4ZGN B;  2NN6 G;  3GDE A;  1QCB D;  1LV9 A;  1E79 A;  2JN9 A;  4DV5 Q;  3AGQ A;  1A8P A;  3M85 A;  3G4S B;  2WYR A;  5IGG A;  2Q8R E;  2B2T A;  4AC9 A;  2FX3 A;  3AVW A;  4KY5 A;  5D3D A;  1L1O A;  1JB9 A;  4L5T A;  2RC5 A;  4QVA A;  2CWA A;  3DM3 A;  1PH5 A;  3PGZ A;  3OIQ A;  3VR3 A;  4EQP A;  2B7B A;  4RCZ A;  2X85 A;  1A63 A;  2ZZQ A;  2VS1 A;  1FGB D;  4A93 B;  1EY0 A;  3MEH A;  3A7L A;  2F0N A;  3AMU A;  2JYO A;  1N32 L;  4IPC A;  4RWS C;  5FO8 B;  5M9O A;  2WKC A;  1GAQ A;  2ZZE A;  3URY A;  1KD1 C;  1II3 A;  4H13 C;  2MFI A;  4HCE A;  1SYG A;  2O4X A;  1E7Z A;  1SBB B;  2O5I C;  1E1T A;  1OB2 A;  3VR2 A;  4PC3 A;  3Q3A A;  2X0K A;  1I3Q B;  3E5S A;  1F2Y A;  3DWP A;  2L11 A;  4TKO B;  3CW2 A;  1LO5 D;  3UE0 A;  1I50 H;  2HD3 A;  3KDF B;  5FJ8 G;  3OHX C;  4YEL A;  2UXD Q;  1ET6 A;  1Y1W G;  2XNJ A;  3I4L A;  2CW0 D;  3CMA B;  3M4O H;  1TWC B;  2K04 A;  2EXD A;  4K14 A;  3HOZ H;  3CKI B;  1NB9 A;  1BDO A;  1BCP D;  3EFX D;  2NTS A;  2Z6B D;  4A3G H;  2IHE A;  4J8Q A;  2NUC A;  3T53 B;  1WOP A;  2SOB A;  4M2L A;  1E64 A;  3Q24 A;  1G2S A;  4Z4Y A;  2B2V C;  2J7Z A;  2JEB I;  3TP7 A;  1YIJ A;  1N33 L;  4NMZ A;  2J7K A;  5FO1 A;  5FLM G;  4BA1 I;  3E1Y E;  4G5G A;  4EVO A;  1H8H A;  2JIZ A;  3KYH C;  5CYU A;  4JI3 L;  2LSS A;  4CKE A;  4RGN A;  3TRZ A;  3TP6 A;  1GXD C;  4LF4 Q;  2R7Z H;  4XM3 A;  1L1O B;  3HOW H;  3VYR A;  5J39 A;  1YVC A;  1N8R D;  4AYB E;  4YXW A;  1CA5 A;  2Z1C A;  1SLJ A;  3L9A X;  5FK9 C;  2HHH L;  4A3E G;  2HCI A;  1FD7 D;  2F3W A;  1WTH D;  5EJW A;  3VYS A;  3L7Z C;  3PUY A;  4UDU C;  3OFN A;  1I4P A;  4ACB A;  4U67 3;  4RKL A;  1FR3 A;  2CQO A;  4IUQ A;  4YAF A;  4G1V A;  1I6V C;  1X3G A;  2WIN B;  1DG1 G;  5CV9 A;  1L1O C;  2XRS D;  4MZ9 A;  4NCN A;  4DR7 L;  4DR1 Q;  1VMP A;  2OXP A;  4MTK A;  4HE5 A;  1QG7 A;  3U58 A;  4QQB X;  5AJ3 L;  3IRB A;  1EP2 B;  1PFB A;  4IOC A;  2NZH A;  5FLX L;  4MNO A;  1KRT A;  4AIM A;  2WR8 A;  4F7X A;  2HIV A;  3P7J A;  4ZAI A;  3H09 A;  5C6A A;  4PQX A;  3LX0 A;  4DV4 L;  4MYU A;  1YIT A;  1SR3 A;  3I56 B;  2FMC A;  4J1M A;  3EJI A;  3HKS A;  3ERQ A;  1XXG A;  2BH8 A;  4FO2 A;  2NYZ D;  2NVT H;  3OJX A;  4LF5 Q;  3S15 H;  4M1U B;  1B2R A;  2L9H A;  4P9S A;  3AB9 A;  2OQK A;  1ENF A;  2V7X A;  3AVU A;  1G51 A;  1NAP A;  2WAQ G;  2Z9H A;  4A3J H;  1SM4 A;  4LF7 L;  4QV2 A;  2K5H A;  3HGB A;  4QJF A;  5JJL A;  1W34 A;  1I4R A;  3S1R H;  5EKI A;  1NBW A;  4RG1 A;  4B43 A;  4GNX C;  2CW0 C;  2KBN A;  3UDI A;  2D0P A;  5D3I B;  1W87 A;  5TV2 A;  3NBI A;  1IHZ A;  4TRD A;  2PQA B;  1I94 L;  1GJR A;  3MXG A;  1KC8 D;  5GAH C;  2E2I B;  2D62 A;  3C1F A;  4I7A A;  1DM0 B;  2NN6 H;  1EFT A;  2BMW A;  4M4S A;  2RCN A;  1JB7 A;  2F0M A;  4L5Q A;  1QG0 A;  2C4T A;  2N8N A;  4B9X A;  2YU9 B;  2GN5 A;  1GUN A;  2EDG A;  2F0F A;  2L0C A;  1N34 Q;  3V96 A;  4A3K G;  3S14 H;  4Z4V A;  2PW7 A;  5DSZ A;  4M53 A;  2JA7 H;  2ENB A;  3E0E A;  2CRV A;  5BN4 A;  2B29 A;  4C3J G;  2VL6 A;  4HSP A;  4RKB A;  1PFS A;  3T4A C;  4A75 A;  3PUN A;  3HOY H;  4JOI A;  4ODG A;  1FNC A;  1TKW B;  1EFW A;  2J0T D;  4A3M B;  1EP3 B;  3NEN A;  4EQ5 A;  3QR8 A;  4Z4Z A;  3M4P A;  3B82 A;  4HN7 A;  3GTJ H;  1WOR A;  3T1H L;  1WTQ A;  2E2H H;  1VMC A;  1PH6 A;  4B9W A;  3VO1 A;  5HXB A;  3F2C A;  4BBR H;  2R93 G;  4DKA C;  1LTS D;  4S3S A;  1K3B C;  4AYB G;  3DMU A;  2B2Y A;  4X7E A;  2LY7 A;  5ELN A;  1FVI A;  3NWT A;  3TP8 A;  2GJR A;  1S3O A;  2F4V Q;  3BY1 A;  4HE6 A;  2EJF C;  2JA6 B;  2PE3 A;  1C8C A;  1QVG A;  4XKV A;  2BPO A;  1CQV A;  3GTO B;  2V4D A;  3GD7 A;  2HDL A;  1LTI D;  3W2D A;  4CQJ A;  4JI6 L;  1O7Z A;  1VQK A;  1PRT C;  1HHV A;  2MGS A;  1UD2 A;  3D4W A;  2IL8 A;  1O7L A;  2VUM G;  3ZJY C;  4II2 A;  1B1Z A;  4DR3 Q;  5D14 A;  2HQL A;  4RD2 A;  4G6I A;  3NUC A;  2ZIT A;  3NSW A;  1ILP A;  3NP8 A;  1ILQ A;  4MHE A;  4A93 H;  1U4L A;  2MO1 A;  2C9O A;  1BCP F;  5BN3 A;  4CJ0 B;  5G3L F;  3T13 A;  3EVQ A;  4BXX G;  2ZXH A;  3A3B A;  1JC7 A;  1YEZ A;  5C4H A;  3G48 A;  1QZG A;  2HT1 A;  4TMW A;  1VQL B;  4RHS A;  4LFA Q;  2EJM A;  1H9M A;  1DYQ A;  1UE6 A;  4BS9 A;  4Y7N H;  1D2E A;  4R4C A;  2WB1 G;  1SE4 A;  1Y8P B;  2OBT A;  1E22 A;  1BXT A;  4KMU C;  4DV1 L;  1Y1V B;  2L4N A;  2CC2 A;  4DR5 L;  2BE5 D;  2D0O A;  1TY0 A;  1W2B A;  4XKW A;  3KL9 A;  4IO9 A;  1B8A A;  4RDK A;  5C4J B;  1RL2 A;  3RLO A;  2X6W A;  4P2N A;  4RDL A;  4HJ5 A;  4PGO A;  1OGI A;  3OIP A;  4XOR A;  2I1L A;  1EY5 A;  3I90 A;  4E0F A;  3R8B A;  3PIO A;  4G7O C;  1ENA A;  1KC8 C;  3ASP A;  4V19 0;  3AVV A;  4KY6 A;  3J81 k;  3LO8 A;  1CZW A;  2Z6K A;  5IYN A;  1FNU A;  4JOI C;  4JI2 Q;  3WOE A;  3FJO A;  2B63 H;  5LMU Q;  5JEA H;  5J3O A;  3CPW A;  1W35 A;  2X6Y A;  1HFN A;  1MD2 D;  3IFT A;  2KCT A;  5ELC A;  2YTV A;  1I4G A;  5CV4 A;  3CTA A;  1KTK A;  1TR5 A;  1GUS A;  3JAM i;  2VUM B;  3MFG A;  3BC9 A;  4LBY A;  4TMZ A;  2OQ0 A;  5IT9 L;  1QE6 A;  4ALP A;  3I73 A;  3U6B A;  2JA8 G;  1HNZ L;  1V1P B;  3OE7 A;  3STB C;  5LMN W;  3I4M H;  5IYR A;  2PZW A;  3GTK B;  4Y9R A;  1D6E C;  1ROD A;  2E2I H;  1AW7 A;  2JP1 A;  4DXG A;  5M5X B;  5DNF A;  5KYL A;  3RN2 A;  1K28 A;  1PH2 A;  3JQQ A;  1QGA A;  2K33 A;  3K5M A;  3M3Y B;  2OTJ A;  2K14 A;  3TBI B;  1YJW A;  2WPD A;  1Q82 D;  2PPB C;  4DR6 L;  2ZL5 A;  1TWG B;  5LL6 X;  3PIP A;  3SK5 A;  1QVC A;  2OT2 A;  1HXY D;  2MPM A;  4ASU A;  4A3B H;  2J4X A;  2BDO A;  1Y14 B;  4B3R Q;  3C1E A;  3LNN A;  1Z47 A;  4OWW B;  5GV7 A;  1HA5 A;  4U9U A;  3I2Z A;  2EJG C;  3A5U A;  1JWM D;  5M3F G;  1Y69 U;  1Q81 C;  1NR4 A;  3HKZ G;  2ZBV A;  1CKM A;  1NRK A;  1JMC A;  1N08 A;  1SRO A;  2WKD A;  5BSX A;  1VQ9 B;  2PLF A;  4OGQ C;  3HOU G;  2NBF A;  4B47 A;  3D8G A;  1V5V A;  4IQZ A;  4JV5 Q;  2JA5 H;  4A3L H;  1MRZ A;  2D3N A;  1KRS A;  1DD2 A;  1FJG L;  1BLI A;  1VQA A;  1CHQ D;  2FVG A;  1CK1 A;  2HUG A;  3JQR A;  4ZV4 A;  3DWQ A;  4BBS B;  3SR1 A;  3W1B A;  2D74 A;  4K0K L;  5DM6 3;  3CP8 A;  1BUV T;  1QNU A;  1ML0 D;  1UD4 A;  4TN1 A;  2NVQ H;  2PIA A;  4X6A H;  1Y1V G;  3DEO A;  4KKU A;  2RC6 A;  4UHV A;  4X65 Q;  1UNS A;  3MXP A;  3ZIA A;  1I5F A;  1M4V A;  1O7Y A;  1VQM B;  4X3S A;  1VQO B;  3GQB A;  1NNX A;  2RHQ B;  1SE2 A;  2GK7 A;  2K28 A;  3PUX A;  3PA2 A;  2AWO A;  3IAY A;  1E3P A;  4C3H H;  4P71 A;  1DOM A;  4NKL A;  4PMB A;  5FLX c;  2WB1 E;  3PF5 A;  2DY1 A;  1Q82 C;  4JVZ A;  1HPC A;  2A68 D;  1XPR A;  1EU4 A;  2RQX A;  3H0G G;  4IJH A;  3KF6 A;  1IZ6 A;  1PTO B;  4Y7C A;  2BE5 C;  4OWT B;  2F0U A;  2F0Q A;  1HQR D;  3CW2 C;  3C2P A;  1KDB A;  3S2H B;  3CPX A;  2QCP X;  4B3S L;  4GKJ Q;  4J0Q A;  2UXB Q;  4AH6 A;  4DK1 A;  3FPK A;  4XD7 A;  2EYO A;  1YHQ A;  3VYT A;  1H9R A;  2KCN A;  1PA6 A;  2PQA A;  3F8T A;  4XLA A;  3P20 A;  5K36 G;  4A3F G;  3VNU A;  5H1S E;  3QE2 A;  4HJA A;  1QUF A;  4IAL A;  1R9T H;  4FK8 A;  2E2J B;  2ICE C;  4BY1 B;  1W6K A;  2ZZF A;  4N3N A;  2F0K A;  2G9H D;  1N36 Q;  3BCD A;  3OP1 A;  2GJP A;  1UAP A;  1VQH A;  3GTP B;  3RN5 A;  2XOK A;  1JJ2 A;  1DOL A;  2A74 C;  3TDQ A;  4DU9 A;  1CNF A;  1PH3 A;  1B50 A;  1HUM A;  3ZZT A;  1QVF B;  1SDF A;  1G2T A;  2PNR C;  4A3C G;  1RJT A;  1XWE A;  3OZU A;  1EYC A;  4QF4 A;  3FHW A;  4NDX A;  5LHY 1;  1D5X C;  1K9M C;  2ZZG A;  4TMX A;  3UI2 A;  5KYI A;  3LQE A;  4CDD C;  4JI4 Q;  4JBK A;  2VZL A;  4II3 A;  2NVQ B;  1EQR A;  3CC4 B;  4FP5 D;  2ZJR A;  3A8K E;  4DK0 A;  4GLA C;  5CBA E;  3I4N H;  3IKJ A;  2HLD A;  1WTX A;  3E3X A;  3HOZ G;  1X54 A;  1QZH A;  2JA9 A;  1BF4 A;  3CB4 A;  2F3I A;  5M3M B;  2Q2T A;  1GVH A;  1B4O A;  4DR7 Q;  4KK7 A;  1SE3 A;  1TY2 A;  1E1Q A;  3ZZU A;  4IJL A;  4DV3 L;  1ZM3 A;  1SRU A;  2KEE A;  3CCQ B;  4RGT A;  5DEH A;  3QSY A;  1VQL A;  2EIF A;  1L0Y B;  5FNZ A;  3AFQ A;  4YCW A;  1P4M A;  1CHP D;  4LUO A;  2VJI A;  2KCM A;  2IX0 A;  1VLY A;  3ES9 A;  2A68 C;  3CRL C;  3QO2 A;  3H94 A;  3R2I A;  4GOP B;  4A3B B;  1XFO A;  2B2U C;  3W5U A;  3PO3 G;  1SN8 A;  1UD8 A;  4WZE A;  4ZCI A;  1TT2 A;  4JI7 Q;  5IIF A;  4LMQ D;  3D4R A;  1EY6 A;  2B5O A;  1PFM A;  5AN9 A;  4X06 A;  2K6A A;  4ZUJ A;  4DV7 Q;  5D65 A;  2ZT9 C;  4A3D G;  4R4I A;  2AUK A;  2DNE A;  4OX9 L;  3FP9 A;  2SEB D;  4DNI A;  3Q8D A;  4GOP C;  2XRQ D;  4K1X A;  3S17 B;  4JG2 A;  1XQB A;  4KTA A;  4FYD A;  3K58 A;  1VQD A;  2Q8T A;  3P1H A;  2A19 A;  5IYQ A;  4OON A;  1LTT D;  4DUY L;  4WZK A;  3E6Z X;  5ELE A;  2PZU A;  3ZC3 A;  2IX1 A;  1W2B B;  3GTQ B;  2EY6 A;  2B2W A;  1XNQ L;  4M0L A;  4Z1M A;  1GKH A;  1TWA B;  1HNX Q;  3HOX B;  4BBR B;  4BPR A;  2DOG A;  4A4I A;  1N34 L;  1X3P A;  4R1J A;  1VJS A;  3M4Q A;  2IPK D;  1RTN A;  3KF8 A;  4FVM A;  3S16 H;  3CP0 A;  4LF9 L;  3G7L A;  4FDB A;  1SMY D;  3ITP A;  4PMC A;  1WYD A;  4HJ8 A;  1PYS B;  4GKK L;  3RD4 A;  3S2H H;  1BMF A;  3KJO A;  1IBK Q;  2Q2H A;  1L2F A;  1HTL D;  3S14 B;  2W6J A;  1VQ9 A;  3K5N A;  5DS0 A;  5FL7 A;  5HUR A;  2K5W A;  3W2I A;  1K8M A;  1IL2 A;  2DCU A;  1CI3 M;  2PCF B;  3FDT A;  2MUY A;  2F4V L;  2F0E A;  2A8V A;  4RH6 A;  4ZCK A;  3A1P A;  3W2H A;  4AVZ A;  3QFS A;  2K01 A;  1QGY A;  3BVM A;  3TP5 A;  1NBM A;  3H0G H;  1EY4 A;  1DAR A;  4DR4 L;  1B9M A;  3SVM A;  1LT6 D;  2IWH A;  4AQY Q;  3AQQ A;  3TZD A;  5NUC A;  1STB A;  3CQZ B;  3CCU A;  3X3N A;  5FOB B;  1U4R A;  4YHH L;  1OB5 A;  3CPF A;  1CKN A;  5GQO A;  1FNM A;  2Y0S E;  4JC0 A;  5A88 A;  5KND A;  1CSQ A;  1BBU A;  4DV2 L;  5IY0 A;  2E8G A;  1D5M C;  3CCL B;  4X05 A;  4PG3 A;  4TMV A;  1YJN B;  3A0J A;  1JOQ A;  1H9J A;  3M4O B;  2R93 H;  4R4O A;  5M3M H;  3ZPN A;  3AVT A;  1HNW L;  2PMZ E;  2V7W A;  2GPJ A;  2W6I A;  3P27 A;  2IT1 A;  3OEH A;  2NVX B;  5CBE E;  2X69 A;  5JJI A;  2BOS A;  1Q7Y D;  4C3I H;  2F43 A;  1VQM A;  1EIF A;  1AIP A;  2E76 C;  4DK6 C;  1BQQ T;  1T6X A;  1FRN A;  1KAW A;  4XTC S;  4KHP Q;  2D9U A;  4KY7 A;  1AP0 A;  1PJ6 A;  5GV8 A;  2K5N A;  2K5Q A;  5IYP A;  2YWF A;  4JI8 Q;  2NZO A;  2H1E A;  5COY A;  1W6J A;  4JYA L;  1TS5 A;  4KHV A;  3DLL A;  4H02 A;  1JJ2 B;  1G7R A;  1U9R A;  2CHB D;  1OXT A;  3QIA A;  2GQF A;  2YWG A;  1HR0 Q;  4LBW A;  4DAY A;  4XQN A;  4PZ7 A;  1HZA A;  1Y1W H;  4JI2 L;  1WFQ A;  2DJG C;  4OIK A;  4OL7 A;  2F0T A;  1KXL A;  2OF1 A;  5JEA G;  4PNY A;  4H9G A;  2K52 A;  1WTH A;  4GN3 B;  4TSF A;  3ONY A;  4A3G G;  1GHJ A;  3AGP A;  3N52 A;  5C44 B;  1NSN S;  1JE4 A;  1T6Y A;  1EIG A;  2ID0 A;  3HS0 C;  3PO2 B;  1Q81 D;  1QUQ A;  1KHI A;  3OSO A;  1RTO A;  4X3K A;  3CCQ A;  1EQV A;  2MQH A;  2OBS A;  1SE8 A;  1WCM B;  5DLQ E;  1IW7 C;  3HOX G;  2QA4 A;  1G6P A;  3D6W A;  3HAG A;  1S5C D;  2VJJ A;  2OTL A;  2JSO A;  3AFP A;  4LAA A;  5IP7 G;  2MP1 A;  1IBL Q;  3J7A 5;  1FGU A;  3KJP A;  2RCF A;  1UEA B;  2AKW B;  3QFC A;  4KN4 C;  5IWA L;  4RFB A;  1ICW A;  4H44 C;  4DV6 Q;  2ZL7 A;  1KK1 A;  3AVX A;  4K2K A;  2JEA I;  2R6H A;  1YNN D;  1I4H A;  1YZ6 A;  4N9T A;  3VDY A;  3CCE B;  1H9S A;  1WOS A;  2ZM6 L;  2K05 A;  4KV6 A;  5I9O A;  3I55 A;  1LLR D;  1TXY A;  4K2L A;  1PZI D;  2M9V A;  1PTO D;  4ZGQ B;  2A6H C;  5HGT A;  2PI2 A;  2XGT A;  3CP2 A;  4PV1 C;  2X6X A;  3JAM c;  1FJG Q;  1WVL A;  3KFU A;  3ICE A;  1K73 D;  3RZO B;  4DN4 M;  1EFC A;  3PMF A;  4K0K Q;  4FXG C;  4TT3 A;  2VQE L;  1BVS A;  3IFD A;  2C2W A;  1IKM A;  4X65 L;  2BV3 A;  3VYU A;  3QWN A;  5J35 A;  1MBY A;  2UU9 L;  1IYV A;  3E0J A;  5L46 A;  1XPO A;  3GTP H;  4QIW E;  1WDT A;  1K8A D;  1AE3 A;  1YBY A;  2KED A;  3K81 C;  2ASB A;  1D2B A;  5C4X H;  5C4X B;  1K28 D;  4P12 A;  2D3L A;  1JB3 A;  3RLF A;  1V8Q A;  3KF8 B;  1SNQ A;  2WAQ B;  2B2T C;  3OAA A;  3KLW A;  1D5Z C;  2V7T A;  5C4Z A;  3K7A H;  4FXU A;  1ZM4 A;  4KN7 C;  3B78 A;  3MA2 B;  5C0X I;  1LTA D;  3NTH A;  1N9W A;  3Q22 A;  4G7H C;  1TS4 A;  4IW3 B;  3Q6R A;  1SJE D;  3KF6 B;  1PXU A;  2K7V A;  1RQR A;  4B3F X;  4BY7 H;  1QFJ A;  3NTI A;  5EGT A;  1BKB A;  1WD1 A;  5HKK A;  1K8G A;  5KNC A;  1OHH A;  2UUB L;  5TY0 A;  3I4N B;  3FPU B;  2N55 A;  1SNC A;  4B3M Q;  1N36 L;  2BA1 A;  5CV5 A;  4BWG B;  2P3M A;  1VQI A;  2JA7 G;  1IW7 D;  3OTO Q;  4HMJ A;  1PMR A;  3CCE A;  3A74 A;  3BYT B;  1PRT D;  2IJ0 A;  1EFR A;  1E2W A;  3BDL A;  4BY7 G;  1H95 A;  1X3E A;  3HOW B;  3PF4 A;  2F0O A;  1YJ9 B;  1SFO H;  2B3G A;  5IGB A;  4UP7 A;  2BVN A;  3BU2 A;  1GUT A;  3G71 B;  3VO2 A;  4NXN L;  3OYY A;  1S5B D;  2CK3 A;  4JI4 L;  2ZTC A;  5KGU A;  1I6H B;  1QX4 A;  2JXM B;  3CAM A;  3VA7 A;  3A35 A;  4LFB Q;  1UEB A;  5EBD A;  4BBR G;  4C3I G;  2MNA A;  1ZYR D;  1WJJ A;  4DV5 L;  5K36 H;  1D1N A;  3BZC A;  4HSV A;  5HGQ A;  1B70 B;  1RF2 D;  1C48 A;  2ATW A;  4A93 G;  5LMN L;  1U0L A;  1PH9 A;  4XNF A;  1J5E L;  4WZT A;  2WAC A;  3PO2 H;  1VQN A;  2SNS A;  2FHT A;  2LMC B;  1ASY A;  1EFI D;  1Q12 A;  1KAA A;  2VXW A;  3DEP A;  4DUZ Q;  2D5D A;  1EEF D;  3K7A B;  1VLO A;  3BJU A;  4UAI A;  3JU4 A;  2WFW A;  4MN3 A;  5TR9 A;  2ZXI A;  1YHA A;  1JOO A;  4KJO A;  2K4K A;  5FLX E;  1LT4 D;  4DGZ A;  1ET9 A;  3L2P A;  2F1M A;  1GVP A;  3OMG A;  3CF5 A;  4LBV A;  5GRO A;  4DV7 L;  3KUP A;  4XQF A;  5J3B A;  1TQO A;  3BG3 A;  1R5N A;  4OX9 Q;  2HDM A;  4XOT A;  5F4J A;  5AFW A;  2R7D A;  1G91 A;  2GA4 B;  1VQC A;  1PLF A;  1Q1B A;  4XMY A;  4WJW A;  4KLK A;  3RZO H;  3DUZ A;  3WOF A;  2CCZ A;  2BF4 A;  1A15 A;  1AE2 A;  2A69 C;  5M5W B;  4LF8 Q;  3GTK H;  1JOK A;  4WJ4 A;  3HOU B;  3MHP A;  2P5Z X;  4DUY Q;  1A0I A;  2BN4 A;  3TEH B;  4OO1 I;  4A3E H;  4R8N A;  5C5M A;  4X0C A;  1YJ9 A;  4IUP A;  1Y1W B;  1BO0 A;  3NWS A;  4JI5 Q;  1SEB D;  1EWC A;  1UE1 A;  1YNX A;  3H0G B;  5IOD A;  1Q86 C;  3BVG A;  3VR4 A;  1GUG A;  4YCU A;  5HY6 A;  4CDF C;  5GAG C;  4PZ8 A;  1OXV A;  3S1N B;  3AYH B;  3HOY B;  3I1F A;  1NCV A;  2JJ2 A;  4PC1 A;  1N05 A;  3NTK A;  5C0X J;  3MWY W;  5T1I A;  1WU8 A;  3SE0 A;  3J7A V;  1QFY A;  1YNJ C;  2F0P A;  4LUV A;  1YIJ B;  1R4P B;  2E2H B;  1B2T A;  1HRJ A;  3GTM B;  1KTV A;  2C5B A;  1J8I A;  4RD1 A;  2C35 B;  3WDN A;  1CNE A;  1T9H A;  1DXM A;  3MXN B;  3O13 A;  1H9S B;  4M8A A;  4X64 Q;  3GTO H;  2ICI A;  3CME A;  4R8I A;  1J9Z A;  4BY1 G;  3IL8 A;  2E74 C;  1C0A A;  4LWC A;  3PIP 3;  5KNB A;  2K5D A;  2C4U A;  2A5H A;  3D0F A;  4PZ6 A;  5C3E B;  5J1Z A;  1F2Z A;  1I18 A;  3H9N A;  1QVG B;  2G9D A;  1EUJ A;  2WV6 D;  3A55 A;  5BN5 A;  5E3F A;  3A8I A;  3DWA A;  3HKZ E;  1HR0 W;  2VB3 X;  5AJ3 Q;  4J6H A;  1UD3 A;  2Y0S G;  1QOH A;  4AQY L;  4HID A;  3CCM B;  1A6X A;  1F60 A;  4LNQ A;  4PC2 A;  4NNJ A;  1EYD A;  4N9P A;  1B53 A;  3U4Z A;  1VCI A;  1HTP A;  4DAM A;  3J7Z C;  4YHH Q;  1BCP C;  4L6T B;  2NVY B;  1BBW A;  2NZ1 D;  4LF5 L;  3FPP A;  3J80 L;  3T16 A;  3OZV A;  4QL5 A;  3RUZ A;  2R92 H;  1I4Q A;  4YY3 Q;  2UXC L;  3GV6 A;  5JPN C;  4YAW A;  2LS0 1;  1PVO A;  1E1R A;  4M1K A;  3UDF A;  1K8O A;  1S0U A;  4C3J B;  4JBW A;  1PTO C;  1PYW D;  4R71 A;  3Q38 A;  3M9B A;  4B48 A;  3J80 c;  2F0W A;  2B2Y C;  3Q23 A;  2JA7 B;  3PUM A;  4CHT B;  5C4J H;  5C4X G;  2JA8 B;  3BS1 A;  2C5C A;  3PV0 A;  4CDC C;  1G29 1;  2JJQ A;  3S1N H;  1I94 Q;  3JQP A;  1U4P A;  4B08 A;  1N8R C;  1C4Q A;  1NB0 A;  2KHS A;  2Z4I A;  3MCA A;  4OOV A;  1OXU A;  1XJV A;  2IX3 A;  2LFN A;  3TN2 A;  3GTJ B;  4KHP L;  4A3J G;  1CUK A;  2VYQ A;  1A3T A;  4C3H G;  5M5Y B;  5TSS A;  4UAJ A;  1E62 A;  5H5J A;  1JJC B;  1X56 A;  2QEJ C;  5KRU A;  5JJZ A;  3K5L A;  4DNR B;  2PW5 A;  4HIM A;  4UPA A;  1IL8 A;  1EWY A;  4JYA Q;  4IUR A;  3CC2 A;  4QVJ A;  4ACA A;  4EQO A;  2BM1 A;  3E9H A;  3JC6 6;  4BY7 B;  3Q6S A;  5E7N A;  1HR0 L;  3SK8 A;  2GVB A;  4B44 A;  3EBE A;  1JCK B;  2ZTD A;  4YWK A;  2VNH A;  2EFG A;  3WNB A;  2FIN B;  2KA7 A;  3G71 A;  2E5L L;  4A3I H;  5M3M G;  3R6K A;  3CD6 A;  2NPF A;  2BM0 A;  2QGQ A;  3GVJ A;  1YX2 A;  4QIW B;  1G6Z A;  4OWX B;  1W0K A;  3GTL B;  2AUJ D;  4CGY B;  4C3H B;  3T1Y Q;  2QKI C;  3DHQ A;  2R7Z B;  2XZP A;  2EXZ A;  1TVC A;  1MJC A;  4WOR A;  5IGC A;  1XMO Q;  2R7F A;  2CWP A;  1DOK A;  2XEX A;  3QB3 A;  1TII D;  1SNP A;  4QGU A;  3K0Y A;  4P3Y A;  5IP9 G;  4X62 L;  2OWO A;  1W9X A;  3GVL A;  1K0S A;  1VQN B;  2DJF C;  3L3O C;  4IOA A;  1I7P A;  2ZTG A;  2RF4 A;  2YV5 A;  1WTW A;  3ULP A;  1I8D A;  4A3K B;  4JI6 Q;  5E4X A;  3ASS A;  4QHY A;  1A2T A;  1IKL A;  2QMU A;  3A3G A;  2EQS A;  4FF3 A;  1ZEQ X;  1Y8O B;  4XQJ A;  4Z4T A;  4AF6 A;  4L5S A;  4G7X A;  5HZB A;  1KL9 A;  1I3Q H;  3KK7 A;  4P26 A;  4DR3 L;  5IT9 c;  2QA4 B;  2ZM6 Q;  4FF2 A;  2OTJ B;  4N3G A;  1AZP A;  1G7C A;  2X6G A;  4P75 A;  1VQP A;  1JJG A;  3H6M A;  3VA5 A;  3G6E B;  5IT9 E;  1VQK B;  1JE5 A;  1JR0 D;  1SYF A;  4YHB A;  1P16 A;  1CA6 A;  2R93 B;  2EE1 A;  3NEM A;  1PRT B;  3HOV H;  1DJR D;  3PUZ A;  1LTL A;  1IJE A;  1BX0 A;  1CQF A;  4O1N A;  4ZLT F;  3TZU A;  1STH A;  2VQE Q;  1UE7 A;  5DM7 3;  5IGD A;  1A2U A;  3SK4 A;  1QH0 A;  3HOX H;  3D4D A;  1GR1 A;  2RBM A;  3W5O A;  4DR5 Q;  2X3U A;  4F7D A;  1EQT A;  3U50 C;  2MO0 A;  3SXH A;  4RD4 A;  3HEJ A;  2X8K A;  4ZUI A;  3CXC B;  3A8J A;  3MC0 B;  1I4X A;  1MIU A;  4XL9 A;  5H59 A;  3CC7 A;  1CZG A;  2DGY A;  2DEU A;  1IHM A;  3BVZ A;  1RD9 D;  3ULL A;  3BH4 A;  3OW7 A;  1PH4 A;  1M1K C;  3MTS A;  3K59 A;  4B3T L;  3V2T A;  1Y8N B;  4BY1 H;  1E0B A;  2K32 A;  1YHQ B;  4WRD A;  4B3X A;  5FKA C;  2AWN A;  4HCS A;  1ZYR C;  1VQ5 A;  3WND A;  2JA8 H;  2RVL A;  1ZKO A;  5JVH 3;  1VHE A;  1K83 H;  3CC4 A;  3MXN A;  2X53 S;  4F88 A;  2EYP A;  1EEI D;  4POG A;  1F77 A;  3S24 A;  1TWH B;  4P2C B;  3NEL A;  1KIX A;  4UP8 A;  3J81 L;  4KD3 A;  4A3M H;  3K80 C;  1OTC A;  1GD7 A;  4RD3 A;  5M5Y H;  2M5S A;  4IUT A;  4IFD J;  2C78 A;  2XTI A;  4OP7 A;  1H42 A;  1ASZ A;  3PUV A;  2VBU A;  1FYC A;  1IJF A;  4EGV A;  4R4Q A;  3W2F A;  3GTG H;  1JOR A;  1L0X B;  2B7C A;  2OCE A;  3ZYY X;  3PO3 B;  4MTN A;  1X6O A;  4LFC Q;  1KMH A;  1XB2 A;  1VDZ A;  3I8Z A;  3S15 B;  3G6E A;  5IYB H;  3GO5 A;  4EH1 A;  2FMM A;  4B3R L;  4XLF A;  3V05 A;  2FFK B;  2VNI A;  3B6Y A;  1EWH A;  2VB2 X;  4X66 L;  1EIH A;  2X6L A;  3BCF A;  3NE5 B;  2AMC B;  3GTQ H;  2ZJQ A;  2Q6K A;  5EPL A;  3TSS A;  4LFB L;  1EFU A;  1STY A;  1YHB A;  1FL0 A;  4JK1 C;  2WJY A;  1U5K A;  2K03 A;  4JV5 L;  4UZE A;  2QEX A;  3H3V I;  3ONA B;  3ZZ0 A;  2F0H A;  1K73 C;  1QVF A;  2AHO B;  3HOY G;  1UWV A;  1F2L A;  3S2D B;  1RCV D;  4IFD I;  1EQQ A;  1G8Z D;  1BPL A;  4WWV A;  3P26 A;  1Y0Y A;  4F8M A;  1X65 A;  4Z9C B;  1W3S A;  4JCV E;  3C2Q A;  4OOX A;  5E4W C;  5M5X H;  2DUD A;  4C2M H;  1ONL A;  1BOS A;  3WY9 A;  4JPB W;  2RKS A;  1CM9 A;  4DUZ L;  1KK0 A;  3LWE A;  5A2Q E;  3AVY A;  3L0O A;  3PSI A;  1TWG H;  5EMN A;  3PQI A;  4IUV A;  3BY2 A;  1Q8I A;  2R61 A;  2XWB B;  4DFA A;  5BR8 Q;  1X9N A;  1N07 A;  4XON A;  1PFN A;  1WI5 A;  2F4I A;  3HP3 A;  2FXQ A;  2RDH A;  3S1Q H;  1STN A;  1SYD A;  2L55 A;  1WCM G;  2CKZ B;  3I4O A;  5C0X H;  4NXM L;  1STE A;  5FO9 B;  2JQO A;  2VZA A;  3S1M B;  1VQO A;  2XSC A;  4QB4 A;  3BYY B;  1CKO A;  3D6C A;  1H8E A;  1DON A;  1RDP D;  2JE6 I;  3OMC A;  4GKJ L;  1C9O A;  5IP9 H;  3H91 A;  4UY8 C;  2UXB L;  2XND A;  1HZC A;  2EY5 A;  4OO1 H;  4ZYS A;  2BDN A;  1N06 A;  1EU3 A;  3TS0 A;  5C0X G;  4F87 A;  1L0W A;  3V76 A;  3A8I E;  1X3Q A;  3W1G A;  2R9V A;  3D3R A;  3G6J B;  2GRE A;  5FJ8 H;  1S5F D;  4L5R C;  1ELO A;  1YLO A;  3U9S A;  1M1K D;  4KKS A;  1F20 A;  1K8A C;  1N32 Q;  4XT3 B;  1A3U A;  4CBV A;  1O78 A;  1ICF B;  2LZJ A;  1EZ8 A;  4KKT A;  3ZBU A;  1PYB A;  4WJ3 M;  4A3C H;  2GJK A;  3A54 A;  1WTV A;  5TRD A;  5CV8 A;  1H85 A;  2RDG A;  5IP7 H;  3SLD A;  2NVX H;  3CCJ A;  2BSA A;  4K6D A;  3R93 A;  3M3Y H;  3FMC A;  5IGE A;  2ZBU A;  5KW9 A;  4GLV B;  4NP5 A;  2M00 A;  1SYE A;  1V9P A;  2UXD L;  1SYB A;  3F2U A;  3NK9 A;  1I6H H;  3CRZ A;  2A6H D;  4JI0 L;  2QDX A;  4PC6 A;  2ZJP A;  2VBV A;  1FDR A;  1WTR A;  2BH2 A;  1YNJ D;  2M2L A;  1KZL A;  1LT5 D;  3QOL A;  2XIW A;  1NDH A;  5ISR A;  1JNY A;  3NQI A;  1QIL A;  3ASR A;  1NJI D;  5C3E G;  1N0U A;  2N88 A;  1IB0 A;  1UUP A;  1LTG D;  2EYJ A;  4KI0 A;  3HKZ B;  1DGS A;  4EQN A;  3PO3 H;  4BBS H;  2QDL A;  3NPP A;  2NWG A;  3HZX A;  5IE8 A;  1XMQ L;  2B2U A;  1CSP A;  1SND A;  2F0S A;  2RHS B;  4I65 A;  1Z9F A;  2RSN A;  4HED A;  1S72 B;  2B39 A;  4JI7 L;  5HZA A;  2R6G A;  1B23 P;  4L63 B;  4YY3 L;  2UXC Q;  2VQF Q;  1AMO A;  4RJL A;  3NBH B;  1E63 A;  4ILW A;  4P73 A;  4AYB B;  1C7Y A;  4GOP A;  4DAY B;  1KRH A;  2VUM H;  1DDI A;  2XWJ B;  4K5V A;  5BSY A;  4G1B A;  1CKN B;  4XIG S;  3NHH A;  3HOU H;  1JA0 A;  4DQK A;  2YWE A;  5F4M A;  1S5D D;  4PAA A;  4RD6 A;  3B8H A;  3I3C A;  3HG9 A;  1WTO A;  2B2W C;  1H9K A;  1XNQ Q;  4DV4 Q;  1U4M A;  1BBX C;  3CCJ B;  4OXP A;  3MAQ A;  2YU9 H;  1HNX L;  3CXC A;  1VQ4 B;  1HA3 A;  2L12 A;  5IYD G;  2CFM A;  3P75 A;  3S1Q B;  2I5L X;  1BQE A;  2UUA Q;  2KQ3 A;  2C77 A;  3R2T A;  4JBM A;  1LAB A;  2CND A;  1KNA A;  3STB D;  4G7W A;  1EY7 A;  3J81 E;  2XZL A;  1TLL A;  3G4S A;  4B4D A;  1FNW A;  1IBM L;  5F4O A;  3FVQ A;  1STG A;  1JA1 A;  1UD6 A;  4QMG A;  4FF1 A;  3SEB A;  4GKK Q;  1GHK A;  4L8J A;  4CKC A;  2E75 C;  3EIV A;  4GNX A;  2BGI A;  1D8L A;  2WB1 B;  3A8J E;  4XLC A;  3CC2 B;  2DY8 A;  3K0X A;  3GTG B;  2DNC A;  4DF7 A;  2Q6L A;  1HZE A;  4OPO A;  3RY8 A;  4Q5V A;  2R92 G;  4PC7 A;  5JJK A;  1XMO L;  1QB5 D;  4OO1 G;  1GAW A;  2ZXO A;  3CES A;  2PQE A;  2Q2I A;  1OO9 B;  2B63 G;  5I9P A;  4P6V F;  1QUQ B;  2HCJ B;  3CD6 B;  1WCM H;  2WAQ E;  4RD0 A;  1HFG A;  3PIO 3;  4LBZ A;  2E2D C;  3MXU A;  4ZQ3 A;  3GSI A;  4A3I B;  1KNE A;  2OTL B;  1Y0R A;  2G5D A;  1Q86 D;  1B9N A;  1E3X A;  4DR2 L;  4DR4 Q;  2Y0S B;  3LVB A;  3GTL H;  4QFM A;  1VQ8 B;  3K5O A;  4A3G B;  2QW7 A;  5JPM C;  3ZUG A;  4CJ1 B;  4LUZ A;  4DV0 L;  2Q6I A;  1SYC A;  3DM1 A;  3EA6 A;  3UDG A;  2ZXP A;  4OIJ A;  4HR7 B;  3MFY A;  5KIX A;  1VHO A;  4XN0 A;  1F9R A;  3D31 A;  3H3V C;  2QN6 A;  3ND8 A;  3WXM A;  4RA8 A;  4LF6 Q;  2AHO A;  1EL0 A;  1RKN A;  4P25 A;  4IUN A;  2VBT A;  2F0I A;  1XNR Q;  3ASQ A;  3MHB A;  2WJV A;  1NUC A;  1SSO A;  3BZK A;  2CH4 W;  1A8V A;  2KVM A;  1VQ4 A;  1R9T B;  4IFD G;  2NTT A;  3CCL A;  1TTT A;  4ULL A;  2PMD A;  3I55 B;  2JK8 A;  1EP1 B;  2KOL A;  3VR5 A;  2K1B A;  2EY1 A;  3S17 H;  1FRQ A;  3T51 B;  1SNO A;  4Y52 H;  5FA6 A;  1QFZ A;  1PJ7 A;  1TWC H;  3I56 A;  2NV4 A;  4JI8 L;  2IY5 B;  3SDZ A;  2UUC Q;  2QTZ A;  3FKI G;  4P74 A;  2N3S A;  4XN3 A;  4ID6 A;  3LWU A;  3PA1 A;  4C0S A;  4N8X 1;  1A62 A;  5FIU A;  1N0V C;  2D9R A;  1KJZ A;  1WP6 A;  3CCR B;  1QWY A;  2PO4 A;  1KQS B;  4MIU A;  2YTY A;  4B3T Q;  2ES2 A;  5C3W A;  1E43 A;  1W0J A;  2HMA A;  1XE1 A;  1HJP A;  2A6E D;  2F52 A;  2NB0 A;  3I91 A;  2SDF A;  1EIY B;  3CU7 A;  4FNF A;  4RMF A;  5C44 G;  1F9P A;  2DYI A;  4O2D A;  2L15 A;  2CVR A;  4BXX H;  1G7S A;  1UMK A;  4TMT A;  4DK3 C;  2DER A;  3W5H A;  1WOC A;  4H0L C;  4X3U A;  2AQ1 B;  3VMF A;  1K9M D;  3BZD B;  4DV1 Q;  3R6J A;  1YIT B;  1SFO B;  3TS2 A;  3D26 A;  1JQY D;  3N6R A;  2LXJ A;  3VR6 A;  2WP8 J;  1PTO H;  5IOC A;  4QCL A;  4OPS A;  2F0G A;  3KEW A;  3ONU A;  1SJH D;  2B8G A;  3CPW B;  2I5H A;  4GS3 A;  4G57 A;  1ZXT A;  2VBS A;  3BDO A;  4XXE A;  4JBJ A;  1Q9S A;  5I2X A;  1PZK D;  1PKV A;  5JBQ A;  3HFZ B;  4DPG A;  3K57 A;  1NR2 A;  1GO2 A;  4X66 Q;  5IWA Q;  2F4N A;  1V43 A;  1VQ6 A;  2EYF A;  1J9O A;  3ERS X;  1MI2 A;  3KBG A;  1BCP B;  1KLG D;  1KDA A;  2EPB A;  2YYZ A;  2Z6B A;  3H3V H;  4NW2 A;  4C1N I;  4CDE C;  2F03 A;  1J6Q A;  2EZV A;  4HIK A;  5CDF A;  1V0E A;  1B7Y B;  4WZL A;  2H5X A;  1EY8 A;  1M90 C;  5A89 A;  3FKS A;  1LAC A;  3SHL A;  3FEW X;  1V1Q A;  1HNZ Q;  4UZU A;  5EKL A;  1E24 A;  5DN6 A;  5CGK A;  3J7Y W;  1KK2 A;  1SMX A;  5G3L D;  1SMY C;  3J80 E;  3Q39 A;  4JI1 L;  4A3J B;  1XYI A;  1JWU D;  4ZCL A;  4P72 A;  4DR6 Q;  2K5V A;  2OK8 A;  1OXS C;  5KEE A;  2OEO A;  5JVG 3;  3C46 A;  5E6T A;  4IZ8 A;  2I5M X;  1S4Z A;  4RAU C;  4RDJ A;  2UU9 Q;  2RDF A;  1PJ5 A;  4HIO A;  1HUN A;  4XOP A;  3QFT A;  1LYL A;  2MJ8 A;  4A3M G;  2JA6 H;  1V1O A;  2HQE A;  1VQ7 B;  4NXM Q;  4DNT B;  1UE5 A;  1X32 A;  3I4M G;  5EPJ A;  4DAV A;  4YIJ A;  4POF A;  2PMZ B;  1S40 A;  5L37 A;  2DN8 A;  3SEJ A;  3VNV A;  4X8I A;  2A6E C;  4YCV A;  2WSS A;  1TUI A;  4HIZ A;  2XVS A;  3K6O A;  4R4T A;  5M5W H;  1QNK A;  5ELF A;  1NTG A;  2WZN A;  2JA6 G;  1Q3L A;  2EVB A;  3U6K A;  1COW A;  4ZRZ A;  3AEV A;  1CT1 D;  2ZL6 A;  1CTM A;  2PNH A;  4C56 C;  2QE7 A;  4Y7N B;  1KLU D;  5A35 A;  1GM5 A;  4YAL A;  1AFP A;  1IYU A;  3T56 B;  4BA2 I;  3OJW A;  1BX1 A;  4B3M L;  3A7A B;  2JJ1 A;  1K0R A;  2PZT A;  2OYN A;  4WFN 3;  3KLS A;  2RSO A;  3OTO L;  3FRP B;  5EAY A;  1DZ1 A;  3ZBT A;  2A1A A;  3NXW A;  2V1C C;  1A3V A;  4FF4 A;  3DDY A;  4ROX A;  3NQT A;  2NVT B;  4N8F A;  1R5B A;  1F9S A;  5I2Y A;  5EQ0 A;  5FO7 B;  1EYG A;  5F2D A;  1NJI C;  3Q6Q A;  1HZ9 A;  1I50 B;  1PRT F;  1VQ8 A;  1Q7Y C;  4HAE A;  3MZ5 A;  2OK7 A;  4E6I A;  5ELD A;  4NXN Q;  4B3S Q;  1B44 D;  3GV3 A;  4GNX B;  4IFD H;  1DCZ A;  1HCZ A;  2KEN A;  3H15 A;  4JI0 Q;  4ZKC B;  3WQZ A;  3SGI A;  4RHR A;  5K5P A;  1RIP A;  3M4Y A;  3RNU A;  1PHJ A;  2N49 A;  4GN5 A;  1VQG A;  3DXJ C;  1SXT A;  1TVX A;  1LTB D;  1NY4 A;  3OEE A;  4JMQ A;  5LMN Q;  1S4M A;  2F0L A;  2QF7 A;  2Q6O A;  1VF5 C;  2VNK A;  1OB0 A;  3CCV A;  1MSH A;  1J5E Q;  3HRZ C;  3GP7 A;  3X3M A;  5JAV A;  1R4Q B;  3S16 B;  4C3I B;  2VW9 A;  1LT3 D;  3I4N G;  1TWF H;  5CMD A;  5LL6 S;  1VQ7 A;  3OZW A;  4C2M B;  1ZUN B;  4P1V A;  1YJW B;  4Q0F A;  3KOJ A;  4Z4W A;  1ESF A;  3CCM A;  1XTC D;  4PAB A;  1STA A;  3CME B;  2Q2U A;  2F0J A;  3E9I A;  3UE1 A;  2F0V A;  4C3J H;  3EQL C;  4ME5 A;  1XMQ Q;  2L5T A;  3HOW G;  2Z4H A;  2PI2 E;  3WNC A;  1MKH A;  2K75 A;  2D2C C;  4XLE A;  4RPD A;  2EYH A;  2ZTE A;  2AQ2 B;  4OEL B;  2VQF L;  2E2J H;  4IN3 A;  1VS0 A;  4QUF A;  3RZD H;  3QOJ A;  2L1B A;  1Z6H A;  2RA4 A;  5COR A;  4RPB A;  1V1P A;  2CBX A;  3HOV G;  1KK3 A;  2EY2 A;  4ABN A;  3AU7 A;  3FKI H;  5C3X A;  5C5L A;  4DV3 Q;  3CRK C;  4RLZ A; 
#chains in the Genus database with same CATH homology
 2LKV A;  1YNN C;  1SKY B;  3NBH A;  5CV7 A;  5E1F A;  4G4K A;  1EZ6 A;  5DAU A;  4V0B A;  3J7A F;  2PYK A;  4A3D B;  4K5W A;  1AZQ A;  2V31 A;  4K6L A;  4I7Z C;  3OWF A;  4O42 A;  4DAP A;  3C3L A;  5A2Q L;  2R3Z A;  3JAM L;  3BDC A;  2E1B A;  4K8I A;  1JIC A;  4RCO A;  2IW3 A;  1BR9 A;  1F9Q A;  1GUW A;  1KDC A;  2F0D A;  3QJY A;  1WPC A;  1XX8 A;  4CJ2 C;  1SAP A;  2R92 B;  1EY9 A;  5EPK A;  2WZP P;  2B2V A;  3KBX A;  2DY7 A;  1E2Z A;  2VNU D;  2F3V A;  5T1G A;  1OXX K;  2NN6 I;  4GQN A;  2KEC A;  4RCN A;  2A69 D;  2BA0 A;  2XNA C;  1Z7T A;  5JEA J;  2WII B;  1MGS A;  2H4O A;  1GJX A;  4A3F B;  1V0F A;  1EOT A;  4KJN A;  3I72 A;  3JAM E;  4YEJ A;  1JWS D;  1S5E D;  1TWF B;  3KLR A;  4K5X A;  1KAB A;  3ERO A;  4C1N K;  3S1R B;  4ZK9 B;  1SNM A;  2XZO A;  3QG1 A;  4CKB A;  1D1I A;  4LJZ C;  5CR3 A;  5I4D A;  4FXD A;  4GZY C;  4RGO S;  1MAB A;  1HVX A;  3PUW A;  3CMM A;  4OHJ A;  5KNL A;  5EKK A;  2BCO A;  3ND9 A;  5IGF A;  2EYL A;  1K83 B;  3M7N A;  2JA5 B;  2TMP A;  1TS2 A;  1T5X D;  1PDQ A;  1HQM C;  2I07 B;  4LK1 C;  1O80 A;  5CV6 A;  1GUO A;  5M3F B;  3HOV B;  4TQU S;  3GVK A;  1UD5 A;  1AEX A;  1AN8 A;  3OOC A;  1Q90 A;  5EBC A;  1PZJ D;  4XLH A;  2B63 B;  1BNZ A;  3W3A A;  4U68 A;  3R3O A;  4DXF A;  4K8J A;  1TU2 B;  4FXK C;  5CC4 A;  5ELB A;  2GK6 A;  3A56 A;  4ZKB B;  3Q0A A;  4R9W A;  3MVV A;  3TME A;  5I6Y A;  1D1K A;  3U9O A;  3RMH A;  1E3Z A;  2KCC A;  4IUU A;  4XDX A;  2AQ3 B;  2TSS A;  4RGM A;  2Z8L A;  2KUM A;  2JDI A;  2ZTN A;  4XQQ A;  4QUC A;  2XN9 C;  2ZXR A;  1MSG A;  3S9W A;  1CFM A;  1WTP A;  3SK6 A;  2XGJ A;  4KD4 A;  1WD0 A;  3M7G A;  1E2V A;  2A73 B;  4DA2 A;  5J22 A;  3HOZ B;  1FX0 A;  2QIL A;  2QDB A;  2O5J C;  1Q1E A;  1B3A A;  4PMW A;  1LTR D;  1T5E A;  4P22 A;  4XR6 A;  4B3G A;  4XT1 B;  1F2M A;  4TSS A;  4XYQ A;  3I70 A;  1GOZ A;  2V7Q A;  5JOB A;  2I46 A;  3G05 A;  2HCC A;  5IK2 A;  2CQA A;  2Q8I B;  3I4M B;  3KLS X;  1VF7 A;  4X3T A;  2MHV A;  4A3E B;  1HA6 A;  4H7B A;  3OPO A;  3CHB D;  4HTH A;  2KVO A;  1EYA A;  2O2L D;  3FKI B;  4G7Z C;  2SNM A;  1TS3 A;  1PTO F;  2EYM A;  1M8A A;  3RZD B;  2KJX A;  4KHZ A;  1QJO A;  5I6W A;  2EOT A;  1ESR A;  2FJ2 A;  4HMI A;  2B8F A;  1ENC A;  3OWE B;  1RHP A;  1FNV A;  2DIE A;  4XYO A;  2NN6 G;  1QCB D;  1LV9 A;  1E79 A;  3M85 A;  5IGG A;  2Q8R E;  2B2T A;  4KY5 A;  5D3D A;  3OIQ A;  3VR3 A;  4EQP A;  2X85 A;  2ZZQ A;  1FGB D;  4A93 B;  1EY0 A;  3MEH A;  3A7L A;  2F0N A;  3AMU A;  2JYO A;  4RWS C;  5FO8 B;  5M9O A;  2WKC A;  2ZZE A;  3URY A;  1II3 A;  4H13 C;  4HCE A;  2O5I C;  1SYG A;  2O4X A;  1SBB B;  3VR2 A;  1I3Q B;  3E5S A;  1F2Y A;  3DWP A;  2L11 A;  4TKO B;  1LO5 D;  3OHX C;  4YEL A;  1ET6 A;  3I4L A;  2CW0 D;  1TWC B;  2K04 A;  4K14 A;  3CKI B;  1BDO A;  1BCP D;  3EFX D;  2NTS A;  2Z6B D;  4J8Q A;  2NUC A;  3T53 B;  2SOB A;  3Q24 A;  1G2S A;  2B2V C;  2JEB I;  2J7Z A;  3TP7 A;  4NMZ A;  4BA1 I;  4EVO A;  1H8H A;  2JIZ A;  5CYU A;  4CKE A;  4RGN A;  3TP6 A;  1GXD C;  4XM3 A;  3VYR A;  5J39 A;  4YXW A;  1CA5 A;  2Z1C A;  5FK9 C;  3L9A X;  2HCI A;  1FD7 D;  2F3W A;  1WTH D;  5EJW A;  3VYS A;  3L7Z C;  4UDU C;  3PUY A;  3OFN A;  1I4P A;  4U67 3;  4RKL A;  1FR3 A;  4IUQ A;  1I6V C;  2WIN B;  5CV9 A;  2XRS D;  1VMP A;  2OXP A;  1QG7 A;  1PFB A;  5FLX L;  4F7X A;  3P7J A;  4ZAI A;  3H09 A;  5C6A A;  4PQX A;  3LX0 A;  2FMC A;  4J1M A;  3EJI A;  3ERQ A;  1XXG A;  4FO2 A;  2NYZ D;  4M1U B;  2L9H A;  3AB9 A;  1ENF A;  1NAP A;  3HGB A;  1I4R A;  5EKI A;  2CW0 C;  5D3I B;  3NBI A;  1IHZ A;  4TRD A;  3MXG A;  2E2I B;  2D62 A;  3C1F A;  1DM0 B;  2NN6 H;  2F0M A;  4B9X A;  2YU9 B;  1GUN A;  2EDG A;  2F0F A;  2L0C A;  3V96 A;  2PW7 A;  2ENB A;  5BN4 A;  4C3J G;  4HSP A;  4RKB A;  3T4A C;  4ODG A;  1TKW B;  2J0T D;  4A3M B;  4HN7 A;  1WTQ A;  1VMC A;  4B9W A;  1LTS D;  4S3S A;  3DMU A;  2B2Y A;  2LY7 A;  3NWT A;  3TP8 A;  2GJR A;  2JA6 B;  2EJF C;  1C8C A;  4XKV A;  1CQV A;  3GTO B;  2V4D A;  3GD7 A;  2HDL A;  1LTI D;  3W2D A;  1O7Z A;  1PRT C;  1HHV A;  2MGS A;  1UD2 A;  3D4W A;  2IL8 A;  1O7L A;  4II2 A;  1B1Z A;  5D14 A;  4G6I A;  3NUC A;  3NSW A;  1ILP A;  3NP8 A;  1ILQ A;  4MHE A;  1U4L A;  2C9O A;  1BCP F;  5BN3 A;  4CJ0 B;  5G3L F;  3T13 A;  3EVQ A;  2ZXH A;  3A3B A;  1JC7 A;  5C4H A;  4RHS A;  2EJM A;  1H9M A;  1DYQ A;  4BS9 A;  1SE4 A;  1Y8P B;  1BXT A;  4KMU C;  1Y1V B;  2L4N A;  2BE5 D;  1TY0 A;  4XKW A;  5C4J B;  2X6W A;  3OIP A;  4XOR A;  1EY5 A;  3I90 A;  4E0F A;  3R8B A;  4G7O C;  1ENA A;  4V19 0;  4KY6 A;  1CZW A;  1FNU A;  3WOE A;  5JEA H;  2X6Y A;  1HFN A;  1MD2 D;  3IFT A;  5ELC A;  1I4G A;  5CV4 A;  1KTK A;  1TR5 A;  1GUS A;  2VUM B;  3MFG A;  3BC9 A;  5IT9 L;  1QE6 A;  3I73 A;  1V1P B;  3OE7 A;  3GTK B;  2PZW A;  1D6E C;  1ROD A;  1AW7 A;  2JP1 A;  4DXG A;  5M5X B;  5DNF A;  5KYL A;  2K33 A;  3K5M A;  3M3Y B;  3TBI B;  2WPD A;  2PPB C;  1TWG B;  5LL6 X;  3SK5 A;  2OT2 A;  1HXY D;  2MPM A;  4ASU A;  2J4X A;  2BDO A;  3C1E A;  3LNN A;  1Z47 A;  1HA5 A;  2EJG C;  1JWM D;  1Y69 U;  1NR4 A;  1NRK A;  2WKD A;  4OGQ C;  2NBF A;  3D8G A;  4IQZ A;  2D3N A;  1DD2 A;  1BLI A;  1CHQ D;  1CK1 A;  2HUG A;  3DWQ A;  4BBS B;  3SR1 A;  5DM6 3;  3CP8 A;  1BUV T;  1QNU A;  1ML0 D;  1UD4 A;  3DEO A;  4KKU A;  1UNS A;  3MXP A;  3ZIA A;  1M4V A;  1O7Y A;  4X3S A;  3GQB A;  1SE2 A;  2GK7 A;  2K28 A;  3PUX A;  2AWO A;  3IAY A;  1DOM A;  4NKL A;  4PMB A;  1HPC A;  2A68 D;  1EU4 A;  2RQX A;  1PTO B;  2BE5 C;  2F0U A;  2F0Q A;  1HQR D;  3C2P A;  1KDB A;  3S2H B;  2QCP X;  4DK1 A;  4XD7 A;  2EYO A;  3VYT A;  1H9R A;  2KCN A;  4XLA A;  3P20 A;  5K36 G;  4IAL A;  2E2J B;  2ICE C;  4BY1 B;  1W6K A;  2ZZF A;  2F0K A;  2G9H D;  3BCD A;  2GJP A;  1UAP A;  3GTP B;  2XOK A;  1DOL A;  2A74 C;  3TDQ A;  4DU9 A;  1B50 A;  1HUM A;  1SDF A;  1G2T A;  2PNR C;  1RJT A;  1XWE A;  4QF4 A;  1EYC A;  4NDX A;  5LHY 1;  1D5X C;  2ZZG A;  5KYI A;  3UI2 A;  4II3 A;  2NVQ B;  4FP5 D;  3A8K E;  4DK0 A;  5CBA E;  3IKJ A;  2HLD A;  1WTX A;  1BF4 A;  5M3M B;  1B4O A;  4KK7 A;  1SE3 A;  1TY2 A;  1E1Q A;  2KEE A;  4RGT A;  5DEH A;  1L0Y B;  1CHP D;  2VJI A;  2IX0 A;  1VLY A;  2A68 C;  3CRL C;  3QO2 A;  3H94 A;  3R2I A;  4A3B B;  2B2U C;  1UD8 A;  1TT2 A;  5IIF A;  4LMQ D;  3D4R A;  1EY6 A;  1PFM A;  2K6A A;  4ZUJ A;  5D65 A;  2ZT9 C;  2AUK A;  2DNE A;  2SEB D;  2XRQ D;  3S17 B;  4KTA A;  4FYD A;  3K58 A;  2Q8T A;  3P1H A;  1LTT D;  3E6Z X;  5ELE A;  2PZU A;  2IX1 A;  3GTQ B;  2EY6 A;  2B2W A;  4Z1M A;  1TWA B;  3HOX B;  4BBR B;  1X3P A;  1VJS A;  2IPK D;  1RTN A;  3KF8 A;  4FVM A;  3G7L A;  1SMY D;  3ITP A;  4PMC A;  3RD4 A;  1BMF A;  1HTL D;  3S14 B;  2W6J A;  3K5N A;  5FL7 A;  5HUR A;  2K5W A;  1K8M A;  1CI3 M;  2PCF B;  3FDT A;  2MUY A;  2F0E A;  4RH6 A;  2K01 A;  4AVZ A;  3TP5 A;  3BVM A;  1NBM A;  1EY4 A;  1B9M A;  3SVM A;  1LT6 D;  2IWH A;  3TZD A;  5NUC A;  1STB A;  3CQZ B;  3X3N A;  5FOB B;  1U4R A;  5KND A;  1D5M C;  1JOQ A;  1H9J A;  3M4O B;  3ZPN A;  2W6I A;  2IT1 A;  3OEH A;  2NVX B;  5CBE E;  2X69 A;  2BOS A;  2F43 A;  2E76 C;  1BQQ T;  4XTC S;  2D9U A;  4KY7 A;  1AP0 A;  2K5Q A;  2H1E A;  5COY A;  1W6J A;  1TS5 A;  4KHV A;  1U9R A;  2CHB D;  1OXT A;  3QIA A;  4DAY A;  4XQN A;  4OIK A;  4OL7 A;  2F0T A;  2OF1 A;  5JEA G;  4PNY A;  4TSF A;  1GHJ A;  3N52 A;  5C44 B;  1NSN S;  1JE4 A;  1EIG A;  2ID0 A;  3HS0 C;  3PO2 B;  3OSO A;  1RTO A;  4X3K A;  1EQV A;  1WCM B;  1IW7 C;  3D6W A;  3HAG A;  1S5C D;  2VJJ A;  2JSO A;  4LAA A;  2MP1 A;  1UEA B;  4KN4 C;  4RFB A;  1ICW A;  4H44 C;  4K2K A;  2JEA I;  1YNN D;  1I4H A;  4N9T A;  1H9S A;  2K05 A;  4KV6 A;  5I9O A;  1LLR D;  4K2L A;  1PZI D;  2M9V A;  1PTO D;  2A6H C;  5HGT A;  4PV1 C;  3CP2 A;  2X6X A;  1WVL A;  3RZO B;  4DN4 M;  3PMF A;  4FXG C;  4TT3 A;  3IFD A;  1IKM A;  3VYU A;  3QWN A;  1MBY A;  1IYV A;  3E0J A;  2KED A;  1D2B A;  5C4X B;  1K28 D;  2D3L A;  1JB3 A;  3RLF A;  1V8Q A;  1SNQ A;  2WAQ B;  2B2T C;  3OAA A;  1D5Z C;  5C4Z A;  4FXU A;  4KN7 C;  3MA2 B;  5C0X I;  1LTA D;  3NTH A;  3Q22 A;  4G7H C;  1TS4 A;  1SJE D;  1PXU A;  2K7V A;  4B3F X;  3NTI A;  5EGT A;  1WD1 A;  5HKK A;  5KNC A;  1OHH A;  3I4N B;  3FPU B;  2N55 A;  1SNC A;  2BA1 A;  5CV5 A;  4BWG B;  1IW7 D;  4HMJ A;  1PMR A;  3BYT B;  1PRT D;  2IJ0 A;  1EFR A;  1E2W A;  3BDL A;  3HOW B;  2F0O A;  5IGB A;  1GUT A;  1S5B D;  2CK3 A;  5KGU A;  1I6H B;  2JXM B;  3VA7 A;  3A35 A;  5EBD A;  4C3I G;  1ZYR D;  5K36 H;  4HSV A;  1RF2 D;  1C48 A;  4XNF A;  2WAC A;  2SNS A;  2FHT A;  2LMC B;  1EFI D;  1Q12 A;  1KAA A;  2VXW A;  3DEP A;  2D5D A;  1EEF D;  3K7A B;  4UAI A;  3JU4 A;  4MN3 A;  2ZXI A;  1JOO A;  4KJO A;  5FLX E;  1LT4 D;  4DGZ A;  1ET9 A;  2F1M A;  3OMG A;  3KUP A;  4XQF A;  1TQO A;  3BG3 A;  2HDM A;  4XOT A;  5AFW A;  1G91 A;  2GA4 B;  1PLF A;  1Q1B A;  4XMY A;  4WJW A;  3DUZ A;  3WOF A;  1A15 A;  5M5W B;  2A69 C;  1JOK A;  3HOU B;  4OO1 I;  4R8N A;  5C5M A;  4IUP A;  1Y1W B;  1BO0 A;  3NWS A;  1SEB D;  1EWC A;  3H0G B;  5IOD A;  3BVG A;  3VR4 A;  1GUG A;  1OXV A;  3S1N B;  3HOY B;  1NCV A;  2JJ2 A;  3NTK A;  5C0X J;  3MWY W;  5T1I A;  3SE0 A;  3J7A V;  1YNJ C;  2F0P A;  1B2T A;  1R4P B;  2E2H B;  1HRJ A;  3GTM B;  1J8I A;  3WDN A;  4M8A A;  1DXM A;  3O13 A;  1H9S B;  2ICI A;  4R8I A;  3IL8 A;  2E74 C;  3PIP 3;  5KNB A;  2K5D A;  2A5H A;  5C3E B;  5J1Z A;  1F2Z A;  1I18 A;  2G9D A;  2WV6 D;  3A55 A;  5BN5 A;  5E3F A;  3DWA A;  2VB3 X;  4J6H A;  1UD3 A;  1QOH A;  1A6X A;  4NNJ A;  1EYD A;  4N9P A;  1B53 A;  1VCI A;  1HTP A;  1BCP C;  4L6T B;  2NVY B;  2NZ1 D;  3FPP A;  3J80 L;  3T16 A;  3RUZ A;  1I4Q A;  3GV6 A;  5JPN C;  2LS0 1;  1E1R A;  1K8O A;  4C3J B;  4JBW A;  1PTO C;  1PYW D;  3Q23 A;  2F0W A;  2B2Y C;  2JA7 B;  4CHT B;  2JA8 B;  3BS1 A;  2C5C A;  3PV0 A;  1G29 1;  1U4P A;  4B08 A;  1C4Q A;  2KHS A;  2Z4I A;  1OXU A;  2IX3 A;  2LFN A;  3TN2 A;  3GTJ B;  5M5Y B;  1A3T A;  4C3H G;  5TSS A;  2QEJ C;  5KRU A;  5JJZ A;  3K5L A;  4DNR B;  2PW5 A;  1IL8 A;  4IUR A;  4EQO A;  4BY7 B;  3Q6S A;  3SK8 A;  1JCK B;  2FIN B;  2KA7 A;  3GVJ A;  4QIW B;  1G6Z A;  1W0K A;  3GTL B;  2AUJ D;  4CGY B;  4C3H B;  2R7Z B;  2QKI C;  3DHQ A;  2XZP A;  2EXZ A;  4WOR A;  5IGC A;  1DOK A;  3QB3 A;  1TII D;  1SNP A;  3K0Y A;  1W9X A;  3GVL A;  3L3O C;  2ZTG A;  1WTW A;  1I8D A;  4A3K B;  5E4X A;  1A2T A;  1IKL A;  3A3G A;  4FF3 A;  1ZEQ X;  1Y8O B;  4XQJ A;  4G7X A;  3KK7 A;  4FF2 A;  1AZP A;  2X6G A;  3H6M A;  3VA5 A;  5IT9 E;  1JR0 D;  1SYF A;  1CA6 A;  2R93 B;  2EE1 A;  1PRT B;  1DJR D;  3PUZ A;  1CQF A;  4O1N A;  4ZLT F;  3TZU A;  1STH A;  5DM7 3;  5IGD A;  1A2U A;  3SK4 A;  3D4D A;  2RBM A;  1EQT A;  3SXH A;  3HEJ A;  2X8K A;  4ZUI A;  3MC0 B;  1I4X A;  4XL9 A;  1CZG A;  3BVZ A;  1RD9 D;  3BH4 A;  3OW7 A;  3MTS A;  3K59 A;  3V2T A;  1Y8N B;  1E0B A;  2K32 A;  4WRD A;  5FKA C;  2AWN A;  4HCS A;  1ZYR C;  2RVL A;  1ZKO A;  5JVH 3;  3MXN A;  4F88 A;  2X53 S;  2EYP A;  1EEI D;  1F77 A;  1TWH B;  4P2C B;  3J81 L;  4KD3 A;  2M5S A;  4IUT A;  4IFD J;  3PUV A;  1FYC A;  4EGV A;  1JOR A;  1L0X B;  3ZYY X;  3PO3 B;  1KMH A;  1VDZ A;  3I8Z A;  3S15 B;  3GO5 A;  2FMM A;  3V05 A;  4XLF A;  2FFK B;  1EWH A;  2VB2 X;  1EIH A;  2X6L A;  3BCF A;  3NE5 B;  5EPL A;  3TSS A;  1STY A;  4JK1 C;  2WJY A;  2K03 A;  3ONA B;  2F0H A;  1F2L A;  3S2D B;  1RCV D;  4IFD I;  1G8Z D;  1BPL A;  4F8M A;  4Z9C B;  5E4W C;  1ONL A;  1BOS A;  2RKS A;  1CM9 A;  3LWE A;  5A2Q E;  4IUV A;  1Q8I A;  2R61 A;  2XWB B;  4DFA A;  4XON A;  1PFN A;  2F4I A;  3HP3 A;  2RDH A;  1STN A;  1SYD A;  2L55 A;  5C0X H;  1STE A;  5FO9 B;  3S1M B;  2XSC A;  4QB4 A;  3BYY B;  3D6C A;  1H8E A;  1DON A;  1RDP D;  2JE6 I;  3OMC A;  3H91 A;  2XND A;  2EY5 A;  4OO1 H;  4ZYS A;  2BDN A;  1EU3 A;  5C0X G;  4F87 A;  3A8I E;  1X3Q A;  2R9V A;  3D3R A;  3G6J B;  1S5F D;  3U9S A;  4KKS A;  4XT3 B;  1A3U A;  4CBV A;  1O78 A;  2LZJ A;  1EZ8 A;  4KKT A;  2GJK A;  3A54 A;  1WTV A;  5CV8 A;  2RDG A;  4K6D A;  3R93 A;  3FMC A;  5IGE A;  4NP5 A;  2M00 A;  1SYE A;  1SYB A;  3F2U A;  3NK9 A;  2A6H D;  1WTR A;  1YNJ D;  2M2L A;  1KZL A;  1LT5 D;  3QOL A;  2XIW A;  5ISR A;  3NQI A;  1QIL A;  2N88 A;  1UUP A;  1LTG D;  2EYJ A;  4KI0 A;  3HKZ B;  4EQN A;  3NPP A;  2NWG A;  3HZX A;  2B2U A;  1SND A;  2F0S A;  4I65 A;  2RSN A;  4HED A;  2B39 A;  2R6G A;  4L63 B;  4ILW A;  4AYB B;  2XWJ B;  4K5V A;  4XIG S;  3NHH A;  1S5D D;  3I3C A;  3HG9 A;  1WTO A;  2B2W C;  1H9K A;  1U4M A;  1BBX C;  3MAQ A;  2L12 A;  3P75 A;  3S1Q B;  2KQ3 A;  3R2T A;  1LAB A;  1KNA A;  4G7W A;  1EY7 A;  3J81 E;  2XZL A;  1FNW A;  3FVQ A;  1STG A;  1UD6 A;  4QMG A;  4FF1 A;  3SEB A;  1GHK A;  4L8J A;  4CKC A;  2E75 C;  2WB1 B;  3A8J E;  4XLC A;  2DY8 A;  3GTG B;  2DNC A;  4DF7 A;  1HZE A;  4Q5V A;  1QB5 D;  4OO1 G;  2ZXO A;  3CES A;  2PQE A;  1OO9 B;  5I9P A;  1HFG A;  3PIO 3;  2E2D C;  3MXU A;  4ZQ3 A;  4A3I B;  1KNE A;  1B9N A;  1E3X A;  2Y0S B;  3K5O A;  4A3G B;  5JPM C;  4CJ1 B;  1SYC A;  3DM1 A;  3EA6 A;  2ZXP A;  4OIJ A;  4HR7 B;  3MFY A;  5KIX A;  4XN0 A;  1F9R A;  3D31 A;  3H3V C;  3ND8 A;  4RA8 A;  1EL0 A;  1RKN A;  4IUN A;  2F0I A;  3MHB A;  2WJV A;  1NUC A;  1SSO A;  1R9T B;  2KVM A;  4IFD G;  2NTT A;  4ULL A;  3VR5 A;  2KOL A;  2K1B A;  2EY1 A;  3T51 B;  1SNO A;  3SDZ A;  4ID6 A;  4XN3 A;  3LWU A;  1WP6 A;  1QWY A;  2PO4 A;  4MIU A;  5C3W A;  1E43 A;  1W0J A;  2A6E D;  2NB0 A;  3I91 A;  2SDF A;  3CU7 A;  4FNF A;  1F9P A;  2CVR A;  4H0L C;  4X3U A;  2AQ1 B;  3BZD B;  1SFO B;  1JQY D;  3N6R A;  3VR6 A;  2WP8 J;  1PTO H;  5IOC A;  4QCL A;  2F0G A;  3KEW A;  1SJH D;  2B8G A;  4G57 A;  1ZXT A;  4XXE A;  3BDO A;  5I2X A;  1PZK D;  1PKV A;  3K57 A;  1NR2 A;  1V43 A;  2EYF A;  1J9O A;  1MI2 A;  3KBG A;  1BCP B;  1KLG D;  1KDA A;  2EPB A;  2YYZ A;  4NW2 A;  4C1N I;  2F03 A;  2EZV A;  5CDF A;  1V0E A;  1EY8 A;  3FKS A;  1LAC A;  3SHL A;  3FEW X;  4UZU A;  5EKL A;  5DN6 A;  5CGK A;  3J7Y W;  3J80 E;  5G3L D;  1SMY C;  4A3J B;  1XYI A;  1JWU D;  1OXS C;  5KEE A;  2OEO A;  5JVG 3;  3C46 A;  4IZ8 A;  1S4Z A;  4RAU C;  2RDF A;  1HUN A;  4XOP A;  2MJ8 A;  1V1O A;  2HQE A;  4DNT B;  1X32 A;  5EPJ A;  4DAV A;  4YIJ A;  2PMZ B;  2DN8 A;  2A6E C;  2WSS A;  4HIZ A;  2XVS A;  3K6O A;  1QNK A;  5ELF A;  1Q3L A;  2EVB A;  1COW A;  4ZRZ A;  1CT1 D;  1CTM A;  4C56 C;  2QE7 A;  4Y7N B;  1KLU D;  5A35 A;  1AFP A;  1IYU A;  3T56 B;  4BA2 I;  3A7A B;  2JJ1 A;  2PZT A;  4WFN 3;  3KLS A;  2RSO A;  3FRP B;  1DZ1 A;  3NXW A;  1A3V A;  4FF4 A;  3DDY A;  3NQT A;  2NVT B;  1F9S A;  5I2Y A;  5EQ0 A;  5FO7 B;  5F2D A;  1I50 B;  1PRT F;  4HAE A;  3MZ5 A;  4E6I A;  5ELD A;  1B44 D;  3GV3 A;  4IFD H;  1DCZ A;  1HCZ A;  4ZKC B;  3WQZ A;  4RHR A;  5K5P A;  3M4Y A;  3DXJ C;  1SXT A;  1TVX A;  1LTB D;  3OEE A;  4JMQ A;  2QF7 A;  2F0L A;  1VF5 C;  1OB0 A;  1MSH A;  3HRZ C;  3GP7 A;  3X3M A;  5JAV A;  1R4Q B;  3S16 B;  4C3I B;  1LT3 D;  5CMD A;  5LL6 S;  4C2M B;  4Q0F A;  1ESF A;  1XTC D;  1STA A;  2F0J A;  2F0V A;  3EQL C;  4ME5 A;  2L5T A;  2Z4H A;  2D2C C;  4XLE A;  2EYH A;  2AQ2 B;  4IN3 A;  4QUF A;  3QOJ A;  2L1B A;  1Z6H A;  2RA4 A;  5COR A;  1V1P A;  2EY2 A;  4ABN A;  3AU7 A;  5C3X A;  5C5L A;  3CRK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...