4DNRB

Crystal structure of the cusba heavy-metal efflux complex from escherichia coli, e716f mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the pre-extrusion and extrusion states of the CusBA adaptor-transporter complex
rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Cation efflux system protein CusB
total genus 56
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00529 HlyD HlyD membrane-fusion protein of T1SS
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4dnrB02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dnrB03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 4dnrB01
1OXUA 1GHKA 1HPCA 2E74C 2KA7A 1GHJA 3VA7A 2AWOA 2A68C 3LWUA 5KNBA 1H9RA 3PV0A 2BA0A 2KCCA 3PUZA 5C0XG 3H94A 2A69D 4LJZC 3OPOA 5KNDA 3AB9A 1BDOA 4GZYC 1VF7A 2F1MA 2EVBA 5K36H 2A6HC 1DD2A 3FMCA 1IYUA 3VR2A 3T56B 4KN4C 1H9MA 3GD7A 2DNEA 1DXMA 2NN6H 3BDOA 3L7ZC 2D62A 2K33A 2QF7A 4JBWA 2A6EC 2BE5C 3CRKC 5KNCA 3PUWA 3SDZA 3PUYA 1GUNA 4DK0A 2ZT9C 2AUJD 1G291 2YYZA 4OO1G 4PV1C 1LABA 1V8QA 2DN8A 4KKUA 1T5EA 1CTMA 1Y8PB 3QG1A 5BN5A 1ZKOA 2PNRC 2PPBC 1B9NA 2K32A 3M85A 4G7OC 3BG3A 1Y69U 1YNJC 1K8OA 2IT1A 1E2WA 1H9JA 1E2VA 1H9SA 3D31A 3HGBA 2E76C 1IW7D 2EJFC 4H44C 1E2ZA 1HTPA 3DXJC 3A8KE 3VR4A 1IYVA 4BA2I 4KN7C 1ZYRC 2D2CC 2NN6G 3I73A 2CW0C 4H0LC 1DCZA 3I4LA 1Y8OB 3T51B 2AUKA 2A68D 2EDGA 4IFDH 3CRLC 2B8FA 4RCNA 1V43A 2K7VA 4L8JA 1TU2B 3PUVA 1HCZA 4TKOB 1Q1EA 3TZUA 5A35A 1GJXA 4H13C 2A6HD 1Q12A 3T53B 2BA1A 3MFYA 1K8MA 5JEAG 3MXUA 1FR3A 4OGQC 4KI0A 1GUGA 3U9SA 4JK1C 3OOCA 3IFTA 4KKSA 1Z6HA 5BN3A 1YNNC 3ND9A 4G7HC 3VR5A 3I72A 3N6RA 2D5DA 4IQZA 3GQBA 1Q1BA 3IKJA 1B9MA 3KLRA 1GUTA 3P20A 3RLFA 1ONLA 1FYCA 1VF5C 4XIGS 4HR7B 4KHZA 1OXTA 1IW7C 3WDNA 1I6VC 1OXSC 2JEBI 2O5IC 1VCIA 3M7NA 4OO1H 5K36G 1H9KA 2JXMB 3EQLC 1QJOA 1OXVA 2A69C 2B8GA 2E75C 2JEAI 2LMCB 1O7LA 1LACA 1SMYC 1HQMC 2V4DA 1OXXK 4BA1I 2O5JC 2EJGC 1Z7TA 2JE6I 2R6GA 1PMRA 3A8JE 3M4YA 4IFDG 2A6ED 2BE5D 3VR6A 3W3AA 2BDOA 4G7ZC 1Y8NB 4KKTA 1O78A 4DK1A 1CFMA 3A8IE 4I7ZC 1A6XA 1GUOA 2NN6I 4XTCS 4LK1C 3VR3A 3LNNA 3A7LA 3SE0A 1H9SB 1VDZA 5BN4A 4DNRB 1GUSA 4DNTB 1TKWB 2PCFB 3PUXA 4TQUS 1EWHA 4KMUC 3D4RA 5C0XH 5JEAH 3NE5B 3A7AB 2Q8IB 3FPPA 2EJMA 2L5TA 3QJYA 2DNCA 3ND8A 1Q90A 3QIAA 3OW7A 1CI3M
chains in the Genus database with same CATH superfamily
1HFGA 2QW7A 5COYA 4GLXA 4X8IA 2AMCB 4BXXG 2JSOA 4KHPQ 1I4GA 3WXMA 3BJUA 3OE7A 1ZXTA 2V7QA 4HMIA 3SR1A 4PZ7A 4N3NA 3ASRA 4HJ7A 1QG7A 4Y7CA 4K1XA 4AVZA 2WV6D 4BS9A 5CBAE 5M3FH 1HNXQ 3RN2A 2DNEA 3C1FA 4OWXB 1PJ5A 2JYOA 1WPCA 3H09A 1OTCA 3U4ZA 4JI6Q 1WFQA 3CCQA 5LMUQ 3OZVA 3CCMB 2UUAL 3L9AX 1M1KD 1R9TB 2HCCA 2NYZD 1HA3A 1SKYB 4AF6A 2BPOA 3CHBD 4EVOA 4HMJA 3TSSA 4DV0Q 2E2IH 4RHRA 3BYTB 4II2A 1B23P 2QCPX 3ZIAA 2K5HA 1B7YB 2K01A 4S3SA 5IYDG 4II3A 1SYCA 4ILWA 4R4CA 3AQQA 1V5VA 1SKQA 4MYTA 3DDYA 1D2BA 4Z1MA 2L11A 4A3BG 1Q7YD 1WTXA 2RDFA 1Y1WH 3LO8A 1V43A 5LL6X 3KDFB 5TSSA 4IFDJ 1OHHA 1HCZA 4GKKL 3AVVA 4B44A 4JV5Q 2F1LA 4XXEA 3GDEA 4RH6A 4GKJL 2XSCA 4RDKA 4JI6L 4JG2A 1IBKQ 3MFYA 1K8MA 1XNRQ 1BKBA 2I5MX 4P2NA 5F4JA 4OGQC 1UE5A 3FKIG 3K59A 1SYDA 3V7AA 3OOCA 1CUKA 5IP9G 4P3IA 2ZL5A 2EPBA 3I4NH 4X65L 2E8GA 4ZCMA 1QNUA 4RGMA 2V7WA 1I18A 2E1RA 1UAPA 3SXHA 2N8NA 2XOKA 3A8IA 1ET9A 4JPBW 2B2YC 4QCLA 2QEXB 1OXVA 4FVMA 3W2IA 5CORA 4CJ1B 1LACA 2XIWA 3S15H 3ULLA 3M9BA 4IFDG 1VQ8A 3G71B 1XX8A 1JC7A 4IPDA 3ONUA 2QA4A 5FIUA 5IP7G 4DK1A 4I65A 2X69A 3CP0A 4PMBA 1UD8A 2GA4B 1KD1C 1LM0A 4P74A 1RCVD 2F3WA 2KVOA 3QSYA 1PTOF 2A19A 2XNAC 2VUMB 1H95A 4NKLA 2CWPA 4PG3A 1N06A 5J39A 4BBRG 1EWHA 3KF6B 3O13A 1TTTA 2EJMA 3WYAA 1AW7A 4OP7A 2L5TA 1QGAA 1K73C 5FK9C 1Q90A 3QIAA 3CCLA 1VQCA 5CV4A 3HOXB 5FLXE 3KDFA 1P4MA 4C56C 3M4QA 3OW2B 2D3LA 3S17H 1SYEA 4G7WA 3PIPA 4GQNA 2CRVA 3R6KA 4K2KA 4B3MQ 2OBRA 1EEID 1KDBA 5C3XA 3S2HH 4BY1G 4K8IA 4KV6A 1PA6A 1MGSA 1GD7A 1N36L 5K36H 4X62Q 3FMCA 1BBUA 1TXYA 2L4NA 4KN4C 4OOSA 2NUCA 3FPUB 4X7CA 1SYBA 4HN7A 4NPSA 1KAAA 1K8AC 1QVGB 1LT3D 1GAQA 2IX0A 1PH9A 4PMCA 4FF2A 1BCPB 3CRKC 4XQNA 1U0LA 1CKNB 4QUFA 3JAML 1WTQA 2YYZA 2DYIA 1FNUA 5C3WA 1V8QA 4RD6A 1EUJA 2AQ2B 2WAQE 2JA6H 2PPBC 1B9NA 2VBTA 4K6DA 3M85A 4HJ9A 1EQQA 3PVDA 2F3VA 5M9OA 5CDFA 3ZUGA 1EY9A 4C1NI 5IWAL 1HA6A 1EY0A 4YAOA 2WB1E 1FNCA 3KK7A 3KF8B 4B3RL 4ME5A 2Q8TA 1EFCA 2V1CC 3Q24A 3KFUA 2NPFA 3UE0A 4B3GA 2HT1A 4JI7Q 4J6HA 2UXDL 3CCSB 4LF8L 2R92B 3H0GB 1PH2A 1GJXA 4U673 2OQKA 3J81j 5BR8Q 4OX9L 3CCEA 4TVAB 1M90D 3H0GH 1SSOA 1XMOQ 2OTLB 3CQZB 1G7TA 2BVNA 2PMZB 5KSWB 1QUEA 4GLAC 4PZ8A 3DM3A 3F1ZA 1EXMA 1TWHH 4XLHA 1JB9A 4KLKA 1XMQQ 4A3EG 1K8GA 4DR4L 4WZTA 3BDCA 4DR1L 5J1ZA 2JDIA 1KRTA 1KXLA 1AZPA 2F0PA 4BA1I 3T1HL 2F0DA 1JB3A 2I07B 3W3AA 3OP1A 4G7ZC 2CHBD 1EEFD 2Q6IA 5FNZA 5JJLA 1WOOA 2K1BA 1ELOA 1PXUA 1PYSB 2D9RA 3SE0A 1JJGA 3J7AF 4KD4A 4RDLA 2VXWA 2I5HA 4TQUS 1PFNA 5IE8A 3MXNB 4FDBA 1IHMA 3CP8A 1S72B 1N8RD 2FXQA 4MNOA 4EGVA 3S16B 1G2SA 4BBSB 4JI0L 5ELFA 4GNXC 1IBML 3GTOB 5IYNA 1YITA 3LVBA 3LX0A 3CC4A 1B2TA 2ZJPA 2PYKA 3BVZA 4R4IA 2ZBUA 1O7YA 3IRBA 1DOLA 3A74A 3PO2H 3FP9A 4O0AA 3GSIA 3D4WA 1TWAB 4POGA 3AB9A 4P72A 5IYDH 3J7ZC 5KRUA 2R93H 2VB2X 2X0KA 4L5RC 3EA6A 5GROA 4DUZQ 3RY8A 2ZTGA 2F0HA 3GD7A 1BX0A 3U6KA 1X3QA 3BY2A 5IGEA 4QB4A 2VNIA 2B7CA 5F4MA 3MVVA 3P1HA 3EIVA 1SR3A 1PHJA 2HDMA 4G5GA 3H3VI 1QNKA 3TP5A 3TRZA 3TS0A 3CMEA 2K03A 1BO0A 1JWMD 4PZ6A 3NWTA 1T5EA 3GTLB 3E20A 1WYDA 5I2XA 1ZKOA 4PQXA 1YHAA 4DU9A 1PRTD 1JICA 1HNWL 4G7OC 4GS3A 1E2WA 1E2VA 1LUZA 3U4VA 2J4XA 1SNMA 2RBMA 4HIKA 2VNUD 1D5MC 2MNAA 3OTOQ 1S72A 2L9HA 5LMNL 3L0OA 3S17B 3UDXA 3VO2A 4P6YA 3PO3G 4A3IG 3VNUA 4JI2Q 3X3MA 5HGTA 1KK2A 4UZEA 1Q8KA 2WFWA 4A3DB 1CQVA 2XZOA 2M9VA 4HJ8A 2GJRA 1QH0A 3OZWA 4DA2A 1I3QH 4CBVA 1YLOA 3ZBTA 3T53B 3CC7B 5IK2A 1F2LA 1MSGA 3HP3A 1J9ZA 2V7UA 3HOYG 4JK1C 1BCPF 1Q81C 3ZC3A 5I4DA 5GV8A 1GJRA 3N6RA 2E2HB 1PYWD 2G5DA 4XOTA 1SFOB 4WJ4A 3P7JA 5IGGA 4HCEA 1SNCA 1VHEA 1S5DD 4YAUA 1OXSC 2KENA 5A88A 2YWEA 4RLZA 2VNHA 1A2UA 4HTHA 2PNHA 1L1OA 3MAQA 2DCUA 1UD5A 4DV1Q 3J80c 5DEHA 2VJJA 4Z9CB 2JE6I 2I46A 1I4QA 3M4YA 4L6TB 5C44G 1NRKA 3VR6A 5C3EH 1NBWA 4H02A 2E2IB 1S5BD 4FYDA 1YIJA 3F2BA 4RD1A 3A8KA 2Z4HA 1QGZA 4LK1C 3BZKA 1XYIA 3BVMA 5BN4A 4DV2L 1UEAB 4AYBB 2F0GA 1RQPA 4A3MG 1SYFA 4A3CG 2GJPA 3GTPH 1N32Q 1EZ6A 1LTSD 2C2WA 3HOUG 3AMUA 5EKKA 2ZZGA 2ZXPA 3OAAA 4IPHA 3DLLA 5AN9A 3FPKA 2PO4A 1IHZA 3C2QA 1YNND 5BR8L 1HZEA 4HIZA 2K5VA 1EY4A 3M4PA 4DR3L 5C4JB 3H94A 4APVA 5CC4A 1VQEA 2XNCA 1PTOC 4A75A 1KTVA 1F9RA 1O7IA 4ZAIA 3GTGH 1VMPA 1C9OA 4K6LA 1I6HH 3CPXA 2KHSA 5JAVA 1J6QA 5FJ8H 1EWIA 1H9MA 4RFBA 5IP7H 1D1NA 1Q86D 1BF4A 1PFSA 2FINB 3Q38A 4AH6A 3GTMB 4K0KQ 5JPMC 1RF2D 2QDXA 1HH2P 3A5UA 4DXFA 1IL2A 4RD0A 1TY2A 4B3SL 1TVCA 5NUCA 5A89A 2YTVA 1H42A 4Z4RA 2JQOA 2AUJD 5A2QE 1SN8A 2VY3A 3GTQB 3CF5A 1EY5A 1Y8PB 1SE3A 3DWPA 4OWTB 4TMWA 2KHJA 2PNRC 2XGJA 3EN2A 3MFGA 3W2EA 4UHVA 1P16A 1EY7A 1HNZQ 1IXRA 1K8OA 5KIXA 1GKHA 5IGCA 2EJFC 3A8KE 4DV0L 1ZYRC 1QCBD 3HEJA 4JI8Q 3SVMA 3I73A 1S4MA 2RCFA 4UY8C 4DR5L 1FDRA 4FXKC 4DAVA 4IN3A 5IYRA 1WTPA 4CHTB 2K14A 1N33L 3TZUA 1Q86C 2Q2HA 2JA7B 3F2UA 4QVAA 2GVAA 3NBHB 1GM5A 5CBEE 4BBSG 1N8RC 4RHSA 1TWGH 3NQIA 2D5DA 5D3DA 2E5LL 2MO1A 1VQDA 2H5XA 4XQJA 4A3KB 1VQFA 1FRQA 1VQ9A 4PC2A 1EFUA 2R6HA 1EFID 3OEEA 1K9MD 2V7VA 3AVUA 4XYQA 2X85A 4OHJA 5FO8B 4OOXA 4GNXB 1XMQL 2QKIC 4OL7A 1OO9B 3RMHA 4YWKA 2ZM6Q 1IL8A 1YBYA 1KJZA 3FDTA 3ISXA 4QUZA 2KEEA 1L1OB 3GV3A 2ZTNA 1D1IA 2GK6A 4K5VA 2NVQH 1A15A 3CRZA 3A1PA 1KK3A 1EOTA 2YU9H 5DM73 2HHHQ 2NZ1D 4Z4ZA 4XLFA 5CMDA 1VS0A 1WDTA 4BY1B 3ASSA 1VQOB 2VZAA 4NXNL 1IKMA 3JU4A 1BVSA 4G1BA 1W2BA 4JI2L 5FL7A 2WINB 3EROA 4DV7Q 1E24A 1OXUA 3V96A 4XKWA 3PIOA 3NSWA 4FN5A 1GHJA 1BJKA 4TN1A 3D0FA 4IUUA 3VA7A 1QGYA 2J7KA 2PQAA 5C3EB 1IZ6A 4LF4Q 2F0JA 2QDLA 5C0XG 3OPOA 4O1NA 4EQ5A 2VZLA 1BDOA 3AVWA 4N8X1 4IURA 2B5OA 3GVLA 4GN3B 2VQEL 3MZ5A 1XNQL 4X64Q 1UE6A 3BNWA 5IGBA 2CH4W 2L12A 2N55A 1F2ZA 1KABA 4J1MA 4CKCA 2OK8A 1RHPA 3FKIB 4DAYB 1F9QA 3PUYA 1TS2A 4DUZL 1R5NA 1KD1D 3D8GA 2C78A 1Y1VG 2PQEA 2P3MA 4P2CB 4KJNA 1KC8D 2QA4B 1PZID 2Y0SG 3A55A 1GO3E 4UP8A 2JA6G 2F0WA 4OONA 4UAJA 2WSSA 4KY7A 1EQVA 2IJ0A 5IYQA 1H9SA 2RCNA 2HDLA 4RGNA 1IW7D 1V1PA 3ZZUA 1GVHA 3HKZB 1BXTA 5FO0A 1GOZA 4XL9A 4FF3A 2IX1A 1II3A 2EDGA 4MHEA 2B2VC 4C3HG 2L0CA 1WCMH 1PVOA 3A54A 3AGQA 3PUVA 4C3JB 2VNJA 2QTLA 1SM4A 5ELBA 3GTMH 1U4MA 5LMNQ 1SMXA 3H3VH 1VQ9B 3G71A 2WPDA 4POFA 1Z6HA 3G6JB 5J3BA 4HEDA 1VQ6B 1TLLA 1PRTC 3I7FA 5HZAA 3P20A 4CQJA 2F0VA 4DPGA 3NBHA 1QVFB 2Q2UA 2JEBI 4YAFA 2O5IC 4RM0A 1FNMA 2EIXA 4WQMA 2VBUA 1QJOA 3TEHB 2UU9Q 2VUMH 2C5CA 2PLFA 4IUTA 2ZTEA 4OPVA 5C5MA 1O78A 1VQNA 3D6CA 2WAQB 4M0LA 3TBIB 1GUOA 2NN6I 3S15B 3I56B 2B2UA 2DOGA 2JJQA 4YCVA 4ZUJA 3T1HQ 3AYHB 1JA1A 2MQHA 4KMUC 1LTRD 3K0YA 1PH1A 5J35A 5ISRA 5E6TA 4C2MH 2YWGA 1XQBA 2BCOA 2F0KA 4RWSC 5H5JA 1TWFB 2M5SA 3TS2A 1NB9A 1VQIA 2ES2A 1L0XB 2UXBL 1BMFA 2GVBA 1NCVA 1PFBA 1HPCA 1W2BB 4Y9UA 3IL8A 1FL0A 4LMQD 4IO9A 1W0KA 2CW5A 1B4OA 3PO2G 2OF1A 1ZYRD 2HDNB 4TSFA 3L2PA 4B47A 3CCVB 1STYA 2B2WC 2F1MA 3KJOA 1JE5A 1LTAD 1QUQA 4LF6Q 1WOSA 1RJTA 1NUCA 2HUGA 3CESA 4K14A 1W6JA 1K28A 5TR9A 3S2DH 1JA0A 5H1SE 2JA5B 5LMNW 3PUWA 2VUMG 4HCSA 4AQYL 4P1VA 2FJ2A 5IY0A 3CQZH 3K58A 1NDHA 4PV1C 3MMPA 4YHHQ 3CW2A 1FNWA 3VNVA 5BN5A 2AHOB 3KBXA 2ZL7A 4TMZA 3HGBA 4JBKA 4NP5A 2K04A 2F03A 5C4XH 5GAEC 4JBJA 1F60A 3MC0B 4JYAL 2QEJC 4IALA 4XQQA 1SNQA 1HR0L 4LFAL 4YELA 1JOKA 1RODA 2NN6G 2PQAB 4EX5A 2E1BA 4YEJA 3S1MB 1KQSA 5FJ8G 4B4DA 1NAPA 3DEPA 3QFRA 5EPJA 3D6WA 3SK5A 4LF8Q 1QZGA 3CC4B 2VBSA 3PENA 2DERA 1K8AD 3ERQA 3PIP3 5A35A 3S1QB 2NVXB 3OTOL 2C5HA 3MWYW 1SJED 4DQKA 2MJ8A 2YU9B 4F87A 2NVXH 3S1QH 2B39A 3PUMA 1O80A 4ABNA 2EYJA 3B82A 1MKHA 4ZRZA 4IUQA 1Y1WB 2YV5A 5C5LA 4C43A 1FYCA 4JVZA 5C3EG 3M4OB 1I6VC 1DONA 1T5XD 1A2TA 3KJPA 3BDLA 3CD6B 4G6IA 1JOOA 4NB3A 2B8GA 1WORA 4ALPA 2D74A 2UXCL 1HQMC 1PTOB 5HXBA 2C4UA 4UDUC 4ASUA 5LMZA 2CKZB 2RHQB 3R2TA 2BDOA 4YIJA 3JAMc 1Z9FA 2L1BA 1IBLQ 2E2JH 2PIAA 3A8IE 1AH9A 2HD3A 2QEXA 1N0VC 5JJKA 1UEBA 1ENAA 2BF4A 5GAGC 3Q8DA 1Q81D 3HOVG 2L15A 2B2TC 1RDPD 2C5BA 4DV2Q 5I2YA 4DUYQ 3CB4A 2BM1A 1DDIA 1QUQB 3BU2A 2X53S 3SEBA 4CGYB 2KA7A 4RDJA 3PO3H 5KYIA 1D2EA 5EPLA 1QB5D 3PMFA 2EIFA 3E3XA 2XGTA 1EOVA 2BA0A 3MCAA 2L55A 4X07A 1V1OA 1F77A 5A2QL 4NXML 3DMUA 1E7ZA 1DD2A 2LS01 1FGBD 3VR2A 2PMZE 1YX2A 4DV4Q 1AZQA 1YIJB 4JV5L 4ZQ3A 2NN6H 3FKSA 3BDOA 3WNDA 4ZCIA 2K33A 3T4AC 1RIPA 4Y7NB 3HRZC 4DK6C 2SDFA 5GQOA 1EP3B 2A6EC 4X3SA 5KNCA 4JI0Q 3HOZB 2HQEA 4DR4Q 2JA8H 1XNQQ 4A93G 3NENA 5JVG3 5CV5A 4K0KL 4WFN3 3A3BA 3QG1A 1K83H 2V7XA 2XZPA 4ZUIA 2VJIA 3BG3A 3Q39A 3D31A 1E1RA 1B3QA 1EL0A 2WZPP 4DV3L 2EFGA 2ASBA 3I4OA 2UXCQ 3H15A 5IYWA 2IL8A 2IY5B 4X05A 2B2WA 5EAYA 2R7ZH 4RCZA 3BQJA 3CRLC 1CSPA 1LYLA 3ES9A 3MA2B 4TKOB 2EOTA 4BBSH 2WKCA 3VDYA 1EIFA 1KHIA 1I4HA 2A6HD 3C3LA 1Q12A 1AE3A 1GO2A 1WTHA 1G7CA 1X56A 1E64A 4IUPA 4P25A 1IYJB 3BZDB 4DV6Q 2OXPA 4IZ8A 3C2PA 4QHYA 4BWGB 2AWNA 1LT5D 1XB2A 2P5ZX 2C9OA 1R5BA 5DN6A 3H0GG 2OTLA 2XEXA 3GV6A 1TUIA 1U9RA 4QFMA 1IB0A 3I70A 4PNYA 1UE7A 3S1RB 3QR8A 5D65A 3IAYA 1G2TA 2X6GA 3VMFA 3JAME 3HOXH 5DSZA 1U2RA 1NSNS 4DV1L 4XORA 1O7LA 1JORA 3GTGB 1N36Q 2FMMA 2KEDA 4O2DA 1CZWA 2RDHA 4MTNA 1A3VA 4A3BB 4OWWB 2MP1A 2JA5G 4HE5A 5ELCA 1V1QA 2WACA 3S14H 3GTKB 1A6XA 1Y0YA 1XWEA 5KW9A 4FXGC 1UD4A 1EYCA 2RC5A 4DNTB 1Z47A 2PCFB 1X3GA 3PUXA 2OT2A 4ZCKA 3H9NA 1KK1A 4CKBA 2EQSA 3NE5B 1C8CA 1T6XA 4A3KH 3ZPNA 3KBGA 2JA9A 3GTQH 1L2FA 4YWMA 4LUVA 3AVYA 1WCMB 3CCLB 2F52A 2E74C 3A3GA 1FJGL 2XN9C 2E2JB 4DV3Q 3HKZE 4DAMA 3RZDB 4LJZC 1SYGA 1EP1B 3W2HA 2Z6BD 2A6HC 2G9HD 3FVQA 4RPBA 1SRUA 1MHWC 2KCMA 2DIEA 1D6EC 4DNIA 4B3RQ 2JA6B 1DJRD 5FOBB 1TT2A 1LT4D 4H7BA 1STNA 4K2LA 1RTOA 2D62A 4N3GA 3CMEB 1I94Q 4V190 2QF7A 2JA7H 1B3AA 1T6ZA 1OB0A 1MSHA 5I9PA 3CCQB 4U9UA 4OO1G 4IFDI 4RCYA 4F8MA 1L0YB 2OTJB 2DY8A 3CCJA 1LTBD 2WYRA 4EH1A 3NEMA 1NTGA 2K32A 4DR3Q 4KTAA 1JT8A 1H9JA 3E6ZX 5T1GA 3VR4A 1TQOA 2F43A 3S2HB 4FWTA 2BH2A 1AE2A 2Y0SB 1DZ1A 4Y7NH 4XR6A 4XT1B 3OSOA 4IFDH 3Q6SA 5ELNA 3E9HA 1TU2B 4QUCA 2IPKD 1HA5A 4IJLA 4YY3Q 2QMUA 4HSVA 4M8AA 2CWAA 1AMOA 2CCZA 3TP8A 4FXUA 3AU7A 3U9SA 2FFKB 4A3IB 1JJ2A 1KDCA 2E5LQ 2IWHA 5C4JH 2C35B 3IKJA 1QVFA 1W0JA 1JE4A 1M8AA 3RLFA 2VQFQ 4KHZA 1YVCA 3GTPB 2D3NA 5JEAJ 1EFTA 1SE8A 4UP7A 4HAEA 3DUZA 3ERSX 1PH6A 3C46A 1BPLA 1H9KA 2HIXA 2E75C 2A69C 1AEXA 3UDGA 2JEAI 2LMCB 4CJ0B 3SEJA 2ZM6L 1JWUD 2EJGC 3T1YL 3I4MB 4QIWB 5EJWA 4RKLA 2RHSB 1D7QA 1EIGA 3TREA 4DR6Q 2YWHA 4B3TL 4RJLA 3G4SA 1C7YA 1BOSA 1CA6A 3NTKA 4KHVA 1NNXA 3VR3A 4YY3L 4RGTA 3HOZG 1G91A 3I2ZA 1QVCA 2O2LD 4LWCA 4TMXA 1CHQD 3EJIA 1STAA 2HHHL 1V0EA 1RL2A 1B44D 2CQAA 3I4MH 2BSAA 1H8HA 2W6JA 2MHVA 2NVQB 3ZYYX 3OW7A 5M5YH 3K5LA 3CCSA 1VQ6A 3J7A5 3L7ZC 2ID0A 4QF4A 3J80L 4DUYL 1M4VA 3S14B 5HY6A 3I55B 4AYBG 2F0TA 5G3LD 2ZZQA 5M5WH 3S9WA 2A68C 4OOVA 5L37A 5KNLA 2Q6KA 1YI2A 1J5EL 1H9RA 5ELDA 4X3UA 1EY6A 2A69D 2RSOA 1JB7A 3URYA 3SKBA 1BCPC 4DV6L 5JJIA 2F0FA 2VYQA 2K6AA 5C0XI 4JI4Q 1V9PA 4X64L 2YWFA 1VQ5A 1VQJA 1BQQT 2XTIA 4KHPL 3MHPA 4LFBL 3CC2A 3KLSX 4KY5A 4XN3A 3MTSA 1V0FA 1NE3A 2HLDA 1OGJA 4Q0FA 1ZM3A 5G3LF 1E1TA 3I3CA 1WVLA 2WR8A 3NHHA 4A3DH 4Z4VA 3E9IA 1AN8A 3ITPA 5HZBA 1TR5A 4LW1A 1PZJD 4DV7L 4A3EH 2YTXA 2Z6KA 4IOAA 2IHFA 3WNCA 5CV6A 4A3FB 3HOVH 3U58A 1PH8A 2K75A 2NWGA 1WSRA 2XRQD 2ZTDA 2I0QA 1JOQA 1C0AA 2VB3X 2ICIA 4RD2A 4WJ3M 3K5MA 4C3JH 3LQ6A 5M3MB 3UE1A 3M4OH 5FO7B 2D2CC 4NMZA 2UUCQ 2F0MA 1E1OA 5I6WA 4LC0A 4IOCA 4CDFC 4OX9Q 4DR2Q 2A68D 4WWVA 3K80C 2Z9HA 1H85A 1KL9A 1E3ZA 4PGOA 3Q23A 1XMOL 1E43A 5M5XB 3FHWA 3PUNA 3UI2A 2Z1CA 1ESRA 3M3YH 2ZZEA 3I91A 3OIQA 5DAUA 3W5VA 4K5XA 4KD3A 4ZYSA 1FR3A 2PI2E 3K57A 1MABA 4X7FA 4GNXA 3W1BA 4JI3Q 3IFTA 5I6YA 2JA8B 2IHEA 3HOUH 1WCMG 5KGUA 1JJ2B 4GKJQ 2MO0A 4IQZA 2JA7G 2BV3A 4HIMA 1QOHA 1KLGD 1X3FA 3ULJA 4ZKCB 2Q2TA 2R92H 2DY7A 1PH3A 4QY7A 1LV9A 3WNBA 4Z4UA 1KDAA 2KQ3A 4C3IB 2V4DA 5GADC 2R7ZB 1YJ9B 2F4IA 4ULLA 1HRJA 2QDBA 3ER0A 2MUYA 4ZK9B 1XJVA 4C3HB 3PO3B 3VYSA 3SK8A 3I4NB 1Q8IA 4B48A 4C3JG 2XNJA 3ONAB 1QX4A 1WJJA 4ZKBB 1I50B 4X3KA 4DNRB 1GUSA 4C1NK 5EMNA 3G4SB 1E62A 1VQAA 3S1NB 1YHQB 2LXKA 3MEHA 2FX3A 4B3ML 3TP6A 3DM1A 4UPAA 2K5QA 1HUNA 3D26A 3Q0AA 1PLFA 2K52A 3ASPA 2XWJB 3PCOB 1KMHA 4P12A 2AWOA 3LWUA 3CD6A 2NVTB 1Y0RA 3VYTA 2MFIA 2Y0SE 1SMYD 1I4PA 2F3IA 1B2RA 1BR9A 1OGIA 4G4KA 3A0JA 2R7FA 4BY7B 3QE2A 1FJGQ 3PF4A 4L5QA 3RZOH 4QL5A 5BSYA 4A3JB 3G48A 5ELEA 1D5ZC 2F4VQ 3FEWX 5FKAC 3DHQA 1NBMA 1PH4A 5E4XA 3HS0C 4JBWA 2BE5C 1MJCA 2UU9L 2EY2A 4NNJA 3HZXA 1X6OA 4P22A 3HAGA 2JP1A 5D14A 1Q82D 2X6YA 1G291 4KY6A 1Y1WG 4CKEA 2RKSA 3OIPA 4B9WA 3WQZA 4QV2A 2C4TA 2CNDA 1YNJC 4B3TQ 3B6YA 2JK8A 4Z4YA 2F0SA 1HTPA 1UD2A 5IP9H 2EYHA 5KEEA 1MJEA 3R93A 3JAMi 3FKIH 3PO2B 1HUMA 1E0BA 1Y1VB 3CPFA 4K8JA 3RLOA 2CW0C 3TZDA 4RKBA 2Z4IA 1G7SA 2B8FA 3CCVA 4MN3A 1Q1EA 1STGA 3HOZH 1DDGA 1W35A 1C4QA 4DV5Q 2A74C 1CSQA 1YHBA 2KECA 2D0OA 5JEAG 3KLSA 5GAHC 4A3FH 3HOVB 4KI0A 1A3TA 5M3FG 2SOBA 3HOWH 1I4XA 3SHLA 1S5ED 1N08A 1SXTA 5TV2A 4KKSA 4F7DA 5B6IA 2NZOA 2GJKA 4L63B 1SROA 1VQHA 1GUTA 1QWYA 2YTYA 5FLMH 4J8QA 3DEOA 1OB2A 2OTJA 2VQFL 4F7XA 1HVXA 2R9VA 1QFJA 3PQIA 3TN2A 2JXMB 3KOJA 4A4IA 1IJFA 3MHBA 1O7ZA 1IJEA 5C4HA 3CC7A 1G7RA 4JI5L 4A3CH 4U68A 3OWEB 1LLRD 4JC0A 1CFMA 4XD7A 4GOPC 4DR6L 4GKKQ 4P75A 4XDXA 5AFWA 3A7LA 4DQLA 4UP9A 4HJAA 1VDZA 3T1YQ 1QE6A 2Z0SA 4A93B 4DFAA 4HIDA 1BUVT 3W5UA 2BMWA 2LZJA 3ZZ0A 3QWNA 2DNCA 1S40A 5TY0A 1CZGA 4NW2A 2ENBA 2NTTA 3HFZB 4WJWA 4X65Q 4R4QA 5IYCH 3K5OA 1AIPA 2K5WA 1KQSB 1VQKB 4XLAA 3CP2A 4LF7L 1SAPA 2H1EA 2EY6A 3X3NA 1ZM2A 1QFYA 1X3PA 1N34Q 2NVYB 1EY8A 2RDGA 1PV4A 2GPJA 5EKIA 1K83B 4MIUA 1NJID 4X0CA 1HZAA 3S1NH 2EXZA 1ICWA 3BCFA 3W5OA 1B1ZA 3QFCA 5IYPA 3H91A 3F2DA 1TS4A 1ZM9A 2KCNA 2WP8J 3S24A 4EQNA 4ACAA 5EBDA 4C2MB 1EZ8A 1NR2A 4YWLA 2UUBQ 1ENFA 1BBWA 1DM0B 1EWCA 1HZ9A 4JI8L 1I3QB 5C4XB 2IT1A 3PV0A 4OELB 3KL9A 3WY9A 1CK1A 4G7HC 1CA5A 3DXJC 1UWVA 3HOWG 4FF4A 1AFPA 4RD4A 1YJNB 1PH7A 1PRTF 2X3UA 1PRTB 2EXDA 4LF7Q 2ZZFA 3SK4A 2ZJRA 1VQ4B 2X6WA 3I4LA 1DOKA 5JVH3 1UD6A 1ZUNB 4PC1A 2SNMA 3HOYH 1JWSD 3HG9A 1OB5A 5IT9L 4XYOA 1VQLB 4Z4TA 4FO2A 1W6KA 2QTZA 2DGYA 3R6JA 4RD3A 1D8LA 2V7TA 1VQLA 1VQKA 2B63H 1KIXA 1L1OC 2B7BA 3CAMA 4CDCC 2Q6OA 5CV8A 1GUGA 3U6BA 3HOXG 1YNNC 2KOLA 1KNEA 3ND9A 2K50A 4QJFA 3VR5A 3I56A 4GN5A 1YITB 3GQBA 1E3PA 2PW7A 1JMCA 3RR5A 2RA4A 1LO5D 3WDNA 4JMQA 4X66L 5IOCA 3J81E 5E1FA 5BSXA 4JI1Q 2XWBB 5LHY1 1B70B 4PMWA 3BYYB 1SMYC 4G1VA 2GQFA 2HMAA 4WZLA 2FVGA 4DXGA 3CPWA 4KKTA 2BH8A 3TMEA 4DR1Q 4IUNA 3RN5A 1EFWA 2VQEQ 2WJVA 2DUDA 1TWGB 1VHOA 2JJ1A 3MXPA 5F2DA 1J9OA 4P9SA 1NMFA 4LFCQ 4O42A 3I4MG 2F0IA 4DF7A 4P3YA 4QGUA 2JIZA 2PZTA 3QJYA 1F9SA 1DARA 2KBNA 3W2GA 1CNEA 1CI3M 2A1AA 3TQYA 2XRSD 4G57A 2C77A 1N0UA 4TMTA 4LAAA 3W1GA 1BNZA 4LF9Q 1YNXA 4C3HH 2Z8LA 1WD1A 4LF5Q 4QIWE 2B63G 1S4ZA 4ZCLA 4DV5L 5T1IA 1A3UA 3EVQA 1T9HA 5HKKA 1X9NA 2D0PA 4AC9A 1F2YA 1UUPA 4DK3C 3RUZA 4EQPA 1SJHD 1MRZA 2EVBA 4B3SQ 1A8VA 1WOPA 2J7ZA 2EE1A 3NUCA 5EQ0A 1VQNB 3G6EB 4XMYA 4Q7JB 3ZBUA 1DXMA 1TS3A 1SNPA 1FNDA 2F0LA 2KJXA 3I1FA 2FHTA 4RGOS 1X3EA 3LWEA 3A8JA 3STBD 1PDQA 5IYBH 3QB3A 1WP6A 1IKLA 3NPPA 4DAYA 5LL6S 5JOBA 1LTID 4Q5VA 3GTJB 1EIYB 3M3YB 1JNYA 1WTHD 1EP2B 2IW3A 2BGIA 2SEBD 3ZJYC 3OJWA 1P8LA 2BGJA 3LQEA 1F20A 2EY1A 1N33Q 4WZEA 5CV9A 3U50C 2N88A 4R8IA 1SFOH 2Z6KC 3BC9A 4H0LC 2A5HA 1JCKB 2AUKA 2K28A 3VYUA 5JJZA 4X6AH 4L5SA 2OK7A 1PZKD 4XT3B 3ULPA 2UUCL 4UZFA 5M3MG 1HTLD 1VQOA 4DR5Q 3AVTA 1IBLL 1NB0A 3EBEA 2PE3A 4FXDA 3EFXD 3OWFA 1VQPB 2EYLA 1Q82C 2OWOA 4MYUA 1R9TH 2CBXA 1TS5A 5K5PA 4R4TA 1KC8C 1BX1A 3CCUB 3CCMA 1A0IA 4LF9L 2LXJA 3GTOH 1ONLA 2BN4A 1GAWA 2DJFC 1YZ6A 3WOFA 5AJ3L 2M2LA 4MZ9A 1I5FA 1I94L 5HGQA 3PA2A 4A3JH 1E3XA 2I1LA 5IWAQ 3KEWA 1BQEA 4NBSA 1TWCB 5ELOA 5K36G 5IYBG 3WOEA 1EQRA 2WB1B 4FNFA 5IT9c 4BY1H 1YNJD 1NMGA 4JCVE 1K0SA 3A8JE 1PMRA 2BOSA 4IW3B 4R1JA 2K5NA 3NTIA 1YJ9A 5M5WB 3J81c 2NTSA 1I7PA 3LNNA 3GIRA 3GTKH 4A76A 4LUOA 1CM9A 1V1PB 4X7DA 2UXBQ 2NBFA 2B2YA 2MGSA 3CMAA 3TDQA 3OW2A 1VQPA 5JEAH 4E0FA 3OZUA 1C48A 2RQXA 4XM3A 1B8AA 3NTHA 3CW2C 4RMFA 2X6LA 3ND8A 4M4SA 3KLWA 1S3OA 5C4XG 4R71A 1K0RA 4FF1A 4HSPA 1GHKA 4G7XA 3JQQA 1N05A 3J81k 1MBYA 2K5DA 3J7AV 3K8AA 3NWSA 3RZDH 2KHIA 2E2DC 1RQRA 3N52A 1A62A 3G7LA 3WBKA 1DOMA 2KCTA 4GZYC 2CH4A 1CKNA 4A3DG 1DGSA 1SEBD 1S0UA 1IYUA 3SLDA 2HCJB 3T56B 4AF7A 3F2CA 4A3GG 1HZBA 2QGGA 4EQOA 2R3ZA 2BM0A 2WJYA 3CCRA 4DKAC 5DNFA 1KRSA 5J3OA 5CYUA 5E7NA 3SDZA 2R61A 1GUNA 2F0EA 4DK0A 3I8ZA 4JI1L 4KJOA 2EYOA 4NDXA 2DN8A 2AQ1B 2N78A 3K7AB 1IBKL 4JBMA 1T6YA 1NR4A 4Z4WA 3E5SA 1COWA 3WBJA 4AYBE 1HFNA 1ESFA 2Z6BA 3CXCA 4TMVA 1YJNA 1SE2A 1DG1G 3VO1A 4V0BA 1G8ZD 1I4RA 2R93B 1U4LA 3CXCB 3MEFA 4I7AA 5H59A 4BA2I 2A73B 2CQOA 2OBTA 3CMMA 3W2FA 3J80E 1BCPD 3I90A 1D8TA 1Y8OB 2XVSA 2N3SA 3T51B 3M7GA 3RLNA 4QQBX 1GR1A 5E3FA 2F4VL 2K7VA 4L8JA 2WIIB 3J81L 2LKVA 1D1KA 2ZXIA 3QFSA 3BCDA 5DLQE 2F0QA 2RC6A 4BBRB 4OO1I 2RSNA 2BA1A 3UDFA 1WI5A 1RD9D 1VQGA 4LBYA 4GLVB 1XNRL 4A93H 1UMKA 3Q6QA 4ZLTF 1HNZL 5FLXc 1BBXC 3OHXC 3E0JA 3A35A 4A3BH 2QGQA 4JW0A 4PC3A 3QO2A 2B63B 3CPWB 1JQYD 1MD2D 5IYCG 2NVYH 2HCIA 1FNVA 3OMGA 4OO1H 3WWVA 2MPMA 3PA1A 1VQBA 1LT6D 1CT1D 1I50H 2Q2IA 4BY7G 3AGPA 2VW9A 3S1RH 2O5JC 4KK7A 1FRNA 2LSSA 4DV4L 2BE5D 4N9PA 3CTAA 1Y8NB 4XQFA 5CGKA 4FP5D 1PKVA 4OEMB 1Q9SA 2NZHA 4X62L 3FRPB 5J22A 4JI5Q 4QVJA 2ZL6A 2AHOA 5C6AA 3F8TA 1G6PA 3D4RA 1Q46A 1PJ7A 4DR2L 4LFCL 2ZJQA 4PC7A 4BY7H 4B08A 1YJWA 4GOPA 4A3LG 2ZXHA 1FX0A 4ACBA 1STEA 1ET6A 1ML0D 2KUMA 2EYMA 1K3RA 1SE4A 2CFMA 4LBWA 1Y1VH 1H8EA 1BLIA 3G6EA 1G6ZA 1VF7A 4ZGNB 3K0XA 3OJXA 3P27A 4LF5L 4ODGA 2UUAQ 1QUFA 3D4DA 3PSIA 3ONYA 4A3FG 1X55A 3CCEB 1LTLA 1WOCA 4R4OA 5C0XJ 1XPRA 1E22A 4JI7L 2UXDQ 3CC2B 2AQ3B 2NB0A 3CKIB 4LUZA 3JQRA 2F0OA 3HOWB 1HHVA 3CCRB 2ZXRA 3GVJA 4KKUA 1R5OA 1CTMA 2VS1A 1CQXA 4B43A 2GREA 5FO9B 4DAPA 4ME3A 3CCJB 2VBVA 2N49A 4LF4L 1Y69U 4J0QA 1WTRA 3Q6RA 1XFOA 2G9DA 1VJSA 2KVMA 4H44C 2F0UA 1E2ZA 3FJOA 1HZCA 4YCUA 1IYVA 2Q6LA 2QN6A 4OPOA 5TRDA 3NXWA 4GN4B 1E79A 4YCWA 2XZLA 4YHHL 1QVGA 2QE7A 5IODA 1ILPA 4X3TA 1DCZA 1S5FD 3KYHC 2LY7A 4RCNA 2VNKA 3GVKA 2K4KA 2RF4A 4HIOA 2CF4A 3NK9A 3U9OA 1MI2A 1AP0A 2DJGC 2PMDA 1MIUA 1STBA 4AIMA 1U5KA 1ILQA 3K7AH 2AKWB 3MXNA 3R8BA 1HQRD 4OXPA 5CV7A 1E1QA 1J8IA 4L5TA 4UZUA 4BPRA 1A63A 3B8HA 3AFQA 2M00A 4OIJA 1B9MA 3KLRA 2R7ZG 4B3FX 2CVRA 2TSSA 4XOPA 4MTKA 2WZNA 1PTOD 4HR7B 2X6XA 1A8PA 4H9GA 4OIKA 1W34A 3J80i 4BBRH 2RVLA 5HURA 1J5EQ 4Y9RA 2QILA 2PI2A 3P75A 4C3IH 2JN4A 3JQPA 1TWFH 4K5WA 1S5CD 3T13A 1ZM4A 3NP8A 2JA8G 1R4QB 3SJPA 2SNSA 4RCOA 4XONA 3SK6A 1GUWA 4X66Q 2NVTH 1ZEQX 4TSSA 1L0WA 1XE1A 1HXYD 1ENCA 3G05A 4I7ZC 1W3SA 2DETA 3RD4A 1WD0A 1HNWQ 4B9XA 3E1YE 5F4OA 1H9SB 4WORA 3JC66 4X7EA 1B50A 1X54A 3V76A 4XLCA 3A5ZB 1VQMA 3STBC 1N9WA 1FD7D 3A7AB 3FPPA 1VQMB 5M3FB 3H3VC 3OFNA 1ASZA 3V05A 1FNBA 1KZLA 1IBMQ 1ASYA 1EYDA 1N07A 1CHPD 3UDIA 2O4XA 2EY5A 2B3GA 3KUPA 1TWHB 5KNBA 1SNOA 4IPGA 1B53A 1KRHA 1PTOH 3ICEA 3TP7A 1HJPA 5DS0A 3J7YW 1YJWB 5LMUL 1WTVA 1G51A 2OBSA 1UE1A 5FLXL 1VQ7B 1EU4A 4HJ5A 4B3XA 1PJ6A 1ICFB 1VQ7A 1TY0A 3C1EA 4TRDA 4LF6L 1RKNA 4IJHA 3W2DA 2BDNA 1M90C 1YEZA 4LNQA 1WU8A 2UUBL 5IGFA 1LABA 3IFDA 3RNUA 4BXXH 4E6IA 2OCEA 1Q3LA 4A3LH 3V2TA 1KAWA 1I6HB 2GK7A 1SDFA 3L3OC 4OPSA 5EBCA 5EKLA 1QZHA 2VL6A 2R92G 2CK3A 1TWAH 1U4PA 4X06A 1KLUD 4KN7C 2EYPA 2F4NA 1XXGA 3K7UC 3S1MH 1VMCA 3NBIA 3MXGA 4M53A 2HIVA 3K6OA 4JOIA 2CC2A 4YAWA 1N32L 2ZBVA 5M3MH 2ICEC 1NY4A 1DYQA 1EWYA 5JPNC 5FA6A 1STHA 2W6IA 1PFMA 4JYAQ 2A8VA 2JJ2A 5FO1A 5GV7A 1UNSA 4F88A 1UD3A 2B2UC 5THXA 4A3KG 1YI2B 5C44H 3OEHA 1EQTA 4A3EB 3T16A 3GTJH 1YHQA 3NELA 1D5XC 2NV4A 5IGDA 4LBVA 3OYYA 1EU3A 2I5LX 1WSVA 2WB1G 1QFZA 5BN3A 3PGZA 1VQ5B 4PAAA 2H4OA 2X8KA 3BY1A 5I9OA 2JA5H 3S2DB 5D3IB 4P73A 1IW7C 4RG1A 2OYNA 5EPKA 1VCIA 4YXWA 3AFPA 5M5XH 5C4ZA 3ASQA 3EQLC 4DGZA 3BH4A 1K3BC 1OXXK 3SJZA 5AJ3Q 2R6GA 1Z7TA 2PW5A 2F0NA 2R7DA 2LFNA 1QG0A 1FGUA 2J0TD 5JBQA 3OMCA 4R9WA 1XPOA 1F2MA 5FLMG 4LFBQ 1X65A 4M1KA 2OEOA 3A56A 2ZTCA 1R4PB 2HQLA 4JI4L 4RPDA 2E2HH 3K5NA 1RTNA 4J15A 5IT9E 1W87A 3AEVA 1EIHA 1W9XA 3VA5A 1Q7YC 4PC6A 4C0SA 4A3IH 4CDDC 1KK0A 3GO5A 3PF5A 1FVIA 2Q8IB 2JN9A 1F9PA 3QOJA 4RAUC 4HE6A 4NCNA 1EYGA 1JR0D 3DWQA 1LTTD 1HR0W 3E0EA 4A3GB 3BVGA 1VQ4A 5DM63 1EYAA 4IUVA 1EFRA 4DN4M 4ZV4A 1X32A 3PUZA 2KCCA 5KNDA 4ROXA 2ZITA 3ASTA 4A3GH 1PH5A 2CW0D 3SGIA 4C3IG 3Q22A 4DR7Q 5EGTA 4FK8A 4Y52H 1CNFA 1VQ8B 2DEUA 2PZUA 4RA8A 2Q8RE 3I4NG 3GP7A 1JJCB 2ATWA 3VYRA 4P26A 4CDEC 2R93G 1PYBA 1CKMA 2ZT9C 3HKZG 4N9TA 3P26A 5M5YB 4XKVA 1TVXA 3QFTA 1SBBB 4P6VF 3NQTA 4WZKA 4M1UB 3BS1A 1WTOA 3KF8A 1WTWA 1CKOA 2B2TA 3RZOB 1CQFA 1KNAA 1I8DA 4Z4SA 2EYFA 3KF6A 1LTGD 4TT3A 4ID6A 4JI3L 3CU7A 1SNDA 1GXDC 4M2LA 2E76C 1K9MC 1TWCH 4NXMQ 1VLYA 3J81i 1TIID 1XTDA 4P71A 2DY1A 3LGJA 5IIFA 4YHBA 2FMCA 3PIO3 4PABA 3CCUA 1K28D 2PZWA 1VLOA 4N8FA 2TMPA 4AQYQ 4XNFA 4UAIA 2GN5A 4LBZA 1K73D 4H13C 4A3JG 1GVPA 3QOLA 3S16H 3Q3AA 3BZCA 5E4WC 4XLEA 3HKSA 4IPCA 3MXUA 5CR3A 1M1KC 3GTLH 1Y14B 4WRDA 4GOPB 2B2VA 4CJ2C 1KTKA 2B29A 3R2IA 3I72A 1Q1BA 4YALA 2ZXOA 4R8NA 1VF5C 4XIGS 1HR0Q 1OXTA 4XN0A 2WAQG 3K81C 3M7NA 3HOYB 3DWAA 3B78A 3H6MA 5L46A 4LFAQ 2D9UA 4DR7L 1SLJA 4JOIC 4A3MB 2EZVA 2A6ED 1QILA 1HNXL 3AVXA 5A8AA 3D3RA 2V31A 4QMGA 1E63A 3HOUB 4XTCS 1NJIC 1N34L 2XNDA 3U2QA 5KYLA 3OKXA 1U4RA 1TKWB 2WKDA 2OQ0A 5C0XH 2ALYB 5C44B 1XTCD 2K05A 4A3MH 1XPUA 3I55A 3SLNA 3W5HA 3CMAB 4ZGQB 2IX3A 4NXNQ 3R3OA 3ZZTA
chains in the Genus database with same CATH topology
1HFGA 5COYA 2JSOA 1I4GA 3OE7A 1ZXTA 2V7QA 4HMIA 3SR1A 1QG7A 5CBAE 4AVZA 2WV6D 4BS9A 2DNEA 3C1FA 2JYOA 1WPCA 3H09A 3L9AX 1R9TB 2HCCA 2NYZD 3CHBD 1SKYB 4EVOA 4HMJA 3TSSA 4RHRA 3BYTB 4II2A 2QCPX 3ZIAA 2K01A 4S3SA 4II3A 1SYCA 4ILWA 3DDYA 1D2BA 4Z1MA 2L11A 1WTXA 2RDFA 1V43A 5LL6X 5TSSA 4IFDJ 1HCZA 4XXEA 4RH6A 2XSCA 3MFYA 1K8MA 4OGQC 3K59A 1SYDA 3OOCA 2EPBA 1QNUA 4RGMA 1I18A 1UAPA 3SXHA 1ET9A 2XOKA 2B2YC 4QCLA 1OXVA 4FVMA 5CORA 4CJ1B 1LACA 2XIWA 4IFDG 1XX8A 1JC7A 4DK1A 4I65A 2X69A 4PMBA 1UD8A 2GA4B 1RCVD 2F3WA 2KVOA 1PTOF 2XNAC 2VUMB 4NKLA 5J39A 1EWHA 3O13A 2EJMA 1AW7A 2L5TA 5FK9C 1Q90A 3QIAA 5CV4A 3HOXB 5FLXE 4C56C 2D3LA 1SYEA 4G7WA 4GQNA 4K2KA 1EEID 1KDBA 5C3XA 4K8IA 4KV6A 1MGSA 5K36H 3FMCA 2L4NA 4KN4C 2NUCA 3FPUB 1SYBA 4HN7A 1KAAA 1LT3D 2IX0A 4PMCA 4FF2A 1BCPB 3CRKC 4XQNA 4QUFA 3JAML 1WTQA 2YYZA 1FNUA 5C3WA 1V8QA 2AQ2B 2PPBC 1B9NA 3M85A 4K6DA 2F3VA 5M9OA 5CDFA 1EY9A 4C1NI 1HA6A 1EY0A 3KK7A 4ME5A 2Q8TA 3Q24A 4B3GA 4J6HA 2R92B 3H0GB 1GJXA 4U673 1SSOA 3CQZB 2PMZB 4XLHA 3BDCA 5J1ZA 2JDIA 1AZPA 2F0PA 4BA1I 2F0DA 1JB3A 2I07B 3W3AA 4G7ZC 2CHBD 1EEFD 2K1BA 1PXUA 3SE0A 3J7AF 4KD4A 2VXWA 4TQUS 1PFNA 3CP8A 4EGVA 3S16B 1G2SA 4BBSB 5ELFA 3GTOB 3LX0A 1B2TA 2PYKA 3BVZA 1O7YA 1DOLA 3D4WA 1TWAB 3AB9A 5KRUA 2VB2X 3EA6A 2ZTGA 2F0HA 3GD7A 5IGEA 1X3QA 4QB4A 3MVVA 3P1HA 2HDMA 1QNKA 3TP5A 2K03A 1BO0A 1JWMD 3NWTA 1T5EA 3GTLB 5I2XA 1ZKOA 4PQXA 4DU9A 1PRTD 1JICA 4G7OC 1E2WA 1E2VA 2J4XA 1SNMA 2RBMA 2VNUD 1D5MC 2L9HA 3S17B 3X3MA 5HGTA 4A3DB 1CQVA 2XZOA 2M9VA 2GJRA 4DA2A 4CBVA 3T53B 5IK2A 1F2LA 1MSGA 3HP3A 4JK1C 1BCPF 5I4DA 3N6RA 2E2HB 1PYWD 4XOTA 1SFOB 3P7JA 5IGGA 4HCEA 1SNCA 1S5DD 1OXSC 1A2UA 4HTHA 3MAQA 1UD5A 5DEHA 2VJJA 4Z9CB 2JE6I 2I46A 3M4YA 1I4QA 4L6TB 1NRKA 3VR6A 2E2IB 1S5BD 4FYDA 2Z4HA 4LK1C 1XYIA 3BVMA 5BN4A 1UEAB 4AYBB 2F0GA 1SYFA 2GJPA 1EZ6A 1LTSD 3AMUA 5EKKA 2ZZGA 2ZXPA 3OAAA 2PO4A 1IHZA 1YNND 1HZEA 4HIZA 1EY4A 5C4JB 3H94A 5CC4A 1PTOC 1F9RA 4ZAIA 1VMPA 4K6LA 2KHSA 5JAVA 1H9MA 4RFBA 1BF4A 2FINB 3GTMB 5JPMC 1RF2D 4DXFA 1TY2A 5NUCA 2AUJD 5A2QE 3GTQB 1EY5A 1Y8PB 1SE3A 3DWPA 2PNRC 2XGJA 3MFGA 1EY7A 1K8OA 5KIXA 5IGCA 2EJFC 3A8KE 1ZYRC 1QCBD 3HEJA 3SVMA 3I73A 4FXKC 4DAVA 4IN3A 1WTPA 4CHTB 3TZUA 2JA7B 3F2UA 5CBEE 4RHSA 3NQIA 2D5DA 5D3DA 4XQJA 4A3KB 3OEEA 1EFID 4XYQA 2X85A 4OHJA 5FO8B 2QKIC 4OL7A 1OO9B 3RMHA 1IL8A 3FDTA 2KEEA 3GV3A 2ZTNA 1D1IA 2GK6A 4K5VA 1A15A 1EOTA 5DM73 2NZ1D 4XLFA 5CMDA 1IKMA 4BY1B 3JU4A 3EROA 2WINB 5FL7A 1OXUA 3V96A 4XKWA 3NSWA 4IUUA 1GHJA 3VA7A 5C3EB 2F0JA 5C0XG 3OPOA 4O1NA 1BDOA 4IURA 3GVLA 3MZ5A 5IGBA 2L12A 2N55A 1F2ZA 1KABA 4J1MA 4CKCA 1RHPA 3FKIB 1F9QA 3PUYA 1TS2A 3D8GA 2PQEA 4P2CB 4KJNA 1PZID 3A55A 2F0WA 2WSSA 4KY7A 1EQVA 2IJ0A 1H9SA 4RGNA 2HDLA 1IW7D 1V1PA 3HKZB 1BXTA 1GOZA 4XL9A 4FF3A 2IX1A 1II3A 2EDGA 4MHEA 2B2VC 4C3HG 2L0CA 3A54A 3PUVA 4C3JB 5ELBA 1U4MA 2WPDA 1Z6HA 3G6JB 4HEDA 1PRTC 3P20A 2F0VA 3NBHA 2JEBI 2O5IC 1QJOA 2C5CA 4IUTA 5C5MA 1O78A 3D6CA 2WAQB 3TBIB 1GUOA 2NN6I 3S15B 2B2UA 4ZUJA 4KMUC 1LTRD 3K0YA 5ISRA 2BCOA 2F0KA 4RWSC 1TWFB 2M5SA 1L0XB 1BMFA 1NCVA 1PFBA 1HPCA 4LMQD 3IL8A 1W0KA 1B4OA 2OF1A 1ZYRD 4TSFA 1STYA 2B2WC 2F1MA 1LTAD 1RJTA 1NUCA 2HUGA 3CESA 4K14A 1W6JA 2JA5B 3PUWA 4HCSA 2FJ2A 3K58A 4PV1C 1FNWA 5BN5A 3KBXA 3HGBA 4NP5A 2K04A 2F03A 3MC0B 2QEJC 4IALA 4XQQA 1SNQA 4YELA 1JOKA 1RODA 2NN6G 2E1BA 4YEJA 3S1MB 1NAPA 3DEPA 5EPJA 3D6WA 3SK5A 3ERQA 3PIP3 5A35A 3S1QB 2NVXB 3MWYW 1SJED 2MJ8A 2YU9B 4F87A 2B39A 1O80A 4ABNA 2EYJA 4ZRZA 1Y1WB 4IUQA 5C5LA 1FYCA 3M4OB 1I6VC 1DONA 1T5XD 1A2TA 3BDLA 4G6IA 1JOOA 2B8GA 1HQMC 1PTOB 4UDUC 4ASUA 3R2TA 2BDOA 4YIJA 2L1BA 3A8IE 1ENAA 2B2TC 1RDPD 5I2YA 2X53S 3SEBA 4CGYB 2KA7A 5KYIA 5EPLA 1QB5D 3PMFA 2BA0A 2L55A 1V1OA 1F77A 5A2QL 3DMUA 1DD2A 2LS01 1FGBD 3VR2A 1AZQA 4ZQ3A 2NN6H 3FKSA 3BDOA 4Y7NB 2K33A 3T4AC 3HRZC 3HOZB 2SDFA 4X3SA 2A6EC 5KNCA 2HQEA 5JVG3 5CV5A 4WFN3 3A3BA 3QG1A 2XZPA 4ZUIA 2VJIA 3BG3A 3D31A 1E1RA 1EL0A 2WZPP 2IL8A 2B2WA 3CRLC 3MA2B 4TKOB 2EOTA 2WKCA 1I4HA 2A6HD 3C3LA 1Q12A 4IUPA 3BZDB 2OXPA 4IZ8A 3C2PA 4BWGB 2AWNA 1LT5D 2C9OA 5DN6A 3GV6A 1U9RA 3I70A 4PNYA 3S1RB 5D65A 3IAYA 1G2TA 2X6GA 3JAME 1NSNS 4XORA 1O7LA 1JORA 3GTGB 2FMMA 2KEDA 1CZWA 2RDHA 1A3VA 4A3BB 2MP1A 5ELCA 2WACA 3GTKB 1A6XA 1XWEA 4FXGC 1UD4A 1EYCA 4DNTB 1Z47A 2PCFB 3PUXA 2OT2A 4CKBA 3NE5B 1C8CA 3ZPNA 3KBGA 1WCMB 2E74C 3A3GA 2XN9C 2E2JB 3RZDB 4LJZC 1SYGA 2Z6BD 2A6HC 2G9HD 3FVQA 2DIEA 1D6EC 2JA6B 1DJRD 5FOBB 1TT2A 1LT4D 4H7BA 1STNA 4K2LA 1RTOA 2D62A 4V190 2QF7A 1B3AA 1OB0A 1MSHA 5I9PA 4OO1G 4IFDI 4F8MA 1L0YB 2DY8A 1LTBD 2K32A 4KTAA 1H9JA 3E6ZX 5T1GA 3VR4A 1TQOA 2F43A 3S2HB 2Y0SB 1DZ1A 4XR6A 4XT1B 3OSOA 4IFDH 3Q6SA 1TU2B 4QUCA 2IPKD 1HA5A 4HSVA 4M8AA 3TP8A 4FXUA 3AU7A 3U9SA 2FFKB 4A3IB 1KDCA 2IWHA 3IKJA 1W0JA 1JE4A 1M8AA 3RLFA 4KHZA 3GTPB 2D3NA 5JEAJ 4HAEA 3DUZA 3C46A 1BPLA 1H9KA 2E75C 2A69C 1AEXA 2JEAI 2LMCB 4CJ0B 1JWUD 2EJGC 3I4MB 4QIWB 5EJWA 4RKLA 1EIGA 1BOSA 1CA6A 3NTKA 4KHVA 3VR3A 4RGTA 1G91A 2O2LD 1CHQD 3EJIA 1STAA 1V0EA 1B44D 2CQAA 1H8HA 2W6JA 2MHVA 2NVQB 3ZYYX 3OW7A 3K5LA 3L7ZC 2ID0A 4QF4A 3J80L 3S14B 1M4VA 2F0TA 5G3LD 2ZZQA 3S9WA 2A68C 5KNLA 1H9RA 5ELDA 4X3UA 1EY6A 2A69D 2RSOA 3URYA 1BCPC 2F0FA 2K6AA 5C0XI 1BQQT 3KLSX 4KY5A 4XN3A 3MTSA 1V0FA 2HLDA 4Q0FA 5G3LF 3I3CA 1WVLA 3NHHA 1AN8A 3ITPA 1TR5A 1PZJD 5CV6A 4A3FB 2NWGA 2XRQD 1JOQA 2VB3X 2ICIA 3K5MA 5M3MB 5FO7B 2D2CC 4NMZA 2F0MA 5I6WA 2A68D 1E3ZA 3Q23A 1E43A 5M5XB 3UI2A 2Z1CA 1ESRA 2ZZEA 3I91A 3OIQA 5DAUA 4K5XA 4KD3A 4ZYSA 1FR3A 3K57A 1MABA 3IFTA 5I6YA 2JA8B 5KGUA 4IQZA 1QOHA 1KLGD 4ZKCB 2DY7A 1LV9A 1KDAA 4C3IB 2KQ3A 2V4DA 2R7ZB 2F4IA 4ULLA 1HRJA 2QDBA 3PO3B 2MUYA 4ZK9B 4C3HB 3VYSA 3SK8A 3I4NB 1Q8IA 4C3JG 3ONAB 4ZKBB 1I50B 4X3KA 4DNRB 1GUSA 4C1NK 3S1NB 3MEHA 3TP6A 3DM1A 2K5QA 1HUNA 3Q0AA 1PLFA 2XWJB 1KMHA 2AWOA 3LWUA 2NVTB 3VYTA 1SMYD 1I4PA 1BR9A 4G4KA 4BY7B 4A3JB 5ELEA 1D5ZC 3FEWX 5FKAC 3DHQA 1NBMA 5E4XA 3HS0C 4JBWA 2BE5C 2EY2A 4NNJA 3HZXA 4P22A 3HAGA 2JP1A 5D14A 2X6YA 1G291 4KY6A 4CKEA 2RKSA 3OIPA 4B9WA 3WQZA 1YNJC 2F0SA 1HTPA 1UD2A 2EYHA 5KEEA 3R93A 3PO2B 1HUMA 1E0BA 1Y1VB 4K8JA 2CW0C 3TZDA 4RKBA 2Z4IA 2B8FA 4MN3A 1Q1EA 1STGA 1C4QA 2A74C 2KECA 5JEAG 3KLSA 3HOVB 4KI0A 1A3TA 2SOBA 1I4XA 3SHLA 1S5ED 1SXTA 4KKSA 2GJKA 4L63B 1GUTA 1QWYA 4J8QA 3DEOA 4F7XA 1HVXA 2R9VA 3TN2A 2JXMB 3MHBA 1O7ZA 5C4HA 4U68A 3OWEB 1LLRD 1CFMA 4XD7A 5AFWA 4XDXA 3A7LA 1VDZA 1QE6A 4A93B 4DFAA 1BUVT 2LZJA 3QWNA 2DNCA 1CZGA 4NW2A 2ENBA 2NTTA 4WJWA 3K5OA 2K5WA 4XLAA 3CP2A 1SAPA 2H1EA 2EY6A 3X3NA 1X3PA 2NVYB 1EY8A 2RDGA 5EKIA 1K83B 4MIUA 2EXZA 1ICWA 3BCFA 1B1ZA 3H91A 1TS4A 2KCNA 2WP8J 4EQNA 5EBDA 4C2MB 1EZ8A 1NR2A 1ENFA 1DM0B 1EWCA 1I3QB 5C4XB 2IT1A 3PV0A 1CK1A 4G7HC 3DXJC 1AFPA 4FF4A 1PRTF 1PRTB 2ZZFA 3SK4A 2X6WA 3I4LA 1DOKA 5JVH3 1UD6A 2SNMA 1JWSD 3HG9A 5IT9L 4XYOA 4FO2A 1W6KA 5CV8A 1GUGA 1YNNC 2KOLA 1KNEA 3ND9A 3VR5A 3GQBA 2PW7A 2RA4A 1LO5D 3WDNA 4JMQA 5IOCA 3J81E 5E1FA 2XWBB 5LHY1 4PMWA 3BYYB 1SMYC 4DXGA 4KKTA 3TMEA 4IUNA 2WJVA 1TWGB 3MXPA 2JJ1A 5F2DA 1J9OA 4O42A 2F0IA 4DF7A 2JIZA 2PZTA 3QJYA 1F9SA 1CI3M 2XRSD 4G57A 4LAAA 1BNZA 2Z8LA 1WD1A 1S4ZA 5T1IA 1A3UA 3EVQA 5HKKA 1F2YA 1UUPA 3RUZA 4EQPA 1SJHD 2EVBA 2J7ZA 2EE1A 3NUCA 5EQ0A 4XMYA 1DXMA 1TS3A 1SNPA 2F0LA 2KJXA 2FHTA 4RGOS 3LWEA 1PDQA 3QB3A 1WP6A 1IKLA 3NPPA 4DAYA 5LL6S 5JOBA 1LTID 4Q5VA 3GTJB 3M3YB 1WTHD 2IW3A 2SEBD 2EY1A 5CV9A 2N88A 4R8IA 3BC9A 4H0LC 2A5HA 1JCKB 2AUKA 2K28A 3VYUA 5JJZA 4XT3B 1PZKD 1HTLD 4FXDA 3EFXD 3OWFA 2EYLA 1TS5A 5K5PA 1ONLA 3WOFA 2M2LA 1E3XA 3KEWA 1TWCB 5K36G 3WOEA 2WB1B 4FNFA 1YNJD 3A8JE 1PMRA 2BOSA 3NTIA 5M5WB 2NTSA 3LNNA 1CM9A 1V1PB 2NBFA 2B2YA 2MGSA 3TDQA 5JEAH 4E0FA 1C48A 2RQXA 4XM3A 3NTHA 2X6LA 3ND8A 4FF1A 4HSPA 1GHKA 4G7XA 2K5DA 1MBYA 3J7AV 3NWSA 2E2DC 3N52A 3G7LA 1DOMA 4GZYC 1SEBD 1IYUA 3T56B 4EQOA 2R3ZA 2WJYA 5DNFA 5CYUA 3SDZA 2R61A 1GUNA 2F0EA 4DK0A 3I8ZA 4KJOA 2EYOA 4NDXA 2DN8A 2AQ1B 3K7AB 1NR4A 3E5SA 1COWA 1HFNA 1ESFA 1SE2A 4V0BA 1G8ZD 1I4RA 2R93B 1U4LA 4BA2I 2A73B 3CMMA 3J80E 1BCPD 3I90A 1Y8OB 2XVSA 3T51B 3M7GA 5E3FA 2K7VA 4L8JA 2WIIB 3J81L 2LKVA 1D1KA 2ZXIA 3BCDA 2F0QA 4BBRB 4OO1I 2RSNA 2BA1A 1RD9D 4ZLTF 1BBXC 3OHXC 3E0JA 3A35A 3QO2A 2B63B 1JQYD 1MD2D 2HCIA 1FNVA 3OMGA 4OO1H 2MPMA 1LT6D 1CT1D 2O5JC 4KK7A 2BE5D 4N9PA 1Y8NB 4XQFA 5CGKA 4FP5D 1PKVA 3FRPB 5J22A 5C6AA 3D4RA 4B08A 2ZXHA 1FX0A 1STEA 1ET6A 1ML0D 2KUMA 2EYMA 1SE4A 1H8EA 1BLIA 1G6ZA 1VF7A 4ODGA 3D4DA 5C0XJ 2AQ3B 2NB0A 3CKIB 2F0OA 3HOWB 1HHVA 2ZXRA 3GVJA 4KKUA 1CTMA 5FO9B 4DAPA 1Y69U 1WTRA 2G9DA 1VJSA 2KVMA 4H44C 2F0UA 1E2ZA 1IYVA 3NXWA 1CA5A 1E79A 2XZLA 2QE7A 5IODA 1ILPA 4X3TA 1DCZA 1S5FD 2LY7A 4RCNA 3GVKA 3NK9A 3U9OA 1MI2A 1AP0A 1STBA 1ILQA 3MXNA 3R8BA 1HQRD 5CV7A 1E1QA 1J8IA 4UZUA 4OIJA 2M00A 1B9MA 3KLRA 4B3FX 2CVRA 2TSSA 4XOPA 1PTOD 4HR7B 2X6XA 4OIKA 2RVLA 5HURA 2QILA 3P75A 4K5WA 3T13A 1S5CD 3NP8A 1GUWA 1R4QB 2SNSA 4RCOA 3SK6A 4XONA 1ZEQX 4TSSA 1HXYD 1ENCA 3G05A 4I7ZC 3RD4A 1WD0A 4B9XA 1H9SB 4WORA 1B50A 4XLCA 1FD7D 3A7AB 3FPPA 3H3VC 5M3FB 3OFNA 3V05A 1KZLA 1EYDA 1CHPD 2O4XA 2EY5A 3KUPA 1TWHB 5KNBA 1SNOA 1B53A 1PTOH 3TP7A 3J7YW 1WTVA 5FLXL 1EU4A 1TY0A 3C1EA 4TRDA 1RKNA 3W2DA 2BDNA 5IGFA 1LABA 3IFDA 4E6IA 1Q3LA 3V2TA 1I6HB 2GK7A 1SDFA 3L3OC 5EBCA 5EKLA 2CK3A 1U4PA 1KLUD 4KN7C 2EYPA 1XXGA 1VMCA 3NBIA 3MXGA 3K6OA 2ICEC 1DYQA 5JPNC 1STHA 2W6IA 1PFMA 2JJ2A 1UNSA 4F88A 1UD3A 2B2UC 3OEHA 1EQTA 4A3EB 3T16A 1D5XC 5IGDA 1EU3A 5BN3A 2H4OA 2X8KA 5I9OA 3S2DB 5D3IB 1IW7C 5EPKA 1VCIA 4YXWA 5C4ZA 3EQLC 4DGZA 3BH4A 1OXXK 2R6GA 1Z7TA 2PW5A 2F0NA 4R9WA 3OMCA 2LFNA 2J0TD 1F2MA 2OEOA 3A56A 1R4PB 3K5NA 1RTNA 5IT9E 1EIHA 1W9XA 3VA5A 3GO5A 2Q8IB 1F9PA 3QOJA 4RAUC 1JR0D 3DWQA 1LTTD 4A3GB 3BVGA 5DM63 1EYAA 4IUVA 1EFRA 4DN4M 1X32A 3PUZA 2KCCA 5KNDA 2CW0D 3Q22A 4C3IG 5EGTA 2PZUA 4RA8A 2Q8RE 3GP7A 3VYRA 2ZT9C 4N9TA 5M5YB 4XKVA 1TVXA 1SBBB 3NQTA 1WTOA 4M1UB 3BS1A 1WTWA 3KF8A 2B2TA 3RZOB 1CQFA 1KNAA 1I8DA 2EYFA 4ID6A 1LTGD 4TT3A 3CU7A 1SNDA 1GXDC 2E76C 1VLYA 1TIID 5IIFA 2FMCA 3PIO3 1K28D 2PZWA 2TMPA 4XNFA 4UAIA 4H13C 3QOLA 5E4WC 4XLEA 3MXUA 5CR3A 4WRDA 2B2VA 4CJ2C 1KTKA 3R2IA 3I72A 1Q1BA 2ZXOA 4R8NA 1VF5C 4XIGS 4XN0A 1OXTA 3M7NA 3HOYB 3DWAA 3H6MA 2D9UA 4A3MB 2EZVA 2A6ED 1QILA 3D3RA 2V31A 4QMGA 3HOUB 4XTCS 2XNDA 5KYLA 1U4RA 1TKWB 2WKDA 5C0XH 5C44B 1XTCD 2K05A 2IX3A 3R3OA 1OHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXU A;  1GHK A;  1HPC A;  2E74 C;  2KA7 A;  1GHJ A;  3VA7 A;  2AWO A;  2A68 C;  3LWU A;  5KNB A;  1H9R A;  3PV0 A;  2BA0 A;  2KCC A;  3PUZ A;  5C0X G;  3H94 A;  2A69 D;  4LJZ C;  3OPO A;  5KND A;  3AB9 A;  1BDO A;  4GZY C;  1VF7 A;  2F1M A;  2EVB A;  5K36 H;  2A6H C;  1DD2 A;  3FMC A;  1IYU A;  3VR2 A;  3T56 B;  4KN4 C;  1H9M A;  3GD7 A;  2DNE A;  1DXM A;  2NN6 H;  3BDO A;  3L7Z C;  2D62 A;  2K33 A;  2QF7 A;  4JBW A;  2A6E C;  2BE5 C;  3CRK C;  5KNC A;  3PUW A;  3SDZ A;  3PUY A;  1GUN A;  4DK0 A;  2ZT9 C;  2AUJ D;  1G29 1;  2YYZ A;  4OO1 G;  4PV1 C;  1LAB A;  1V8Q A;  2DN8 A;  4KKU A;  1T5E A;  1CTM A;  1Y8P B;  3QG1 A;  5BN5 A;  1ZKO A;  2PNR C;  2PPB C;  1B9N A;  2K32 A;  3M85 A;  4G7O C;  3BG3 A;  1Y69 U;  1YNJ C;  1K8O A;  2IT1 A;  1E2W A;  1H9J A;  1E2V A;  1H9S A;  3D31 A;  3HGB A;  2E76 C;  1IW7 D;  2EJF C;  4H44 C;  1E2Z A;  1HTP A;  3DXJ C;  3A8K E;  3VR4 A;  1IYV A;  4BA2 I;  4KN7 C;  1ZYR C;  2D2C C;  2NN6 G;  3I73 A;  2CW0 C;  4H0L C;  1DCZ A;  3I4L A;  1Y8O B;  3T51 B;  2AUK A;  2A68 D;  2EDG A;  4IFD H;  3CRL C;  2B8F A;  4RCN A;  1V43 A;  2K7V A;  4L8J A;  1TU2 B;  3PUV A;  1HCZ A;  4TKO B;  1Q1E A;  3TZU A;  5A35 A;  1GJX A;  4H13 C;  2A6H D;  1Q12 A;  3T53 B;  2BA1 A;  3MFY A;  1K8M A;  5JEA G;  3MXU A;  1FR3 A;  4OGQ C;  4KI0 A;  1GUG A;  3U9S A;  4JK1 C;  3OOC A;  3IFT A;  4KKS A;  1Z6H A;  5BN3 A;  1YNN C;  3ND9 A;  4G7H C;  3VR5 A;  3I72 A;  3N6R A;  2D5D A;  4IQZ A;  3GQB A;  1Q1B A;  3IKJ A;  1B9M A;  3KLR A;  1GUT A;  3P20 A;  3RLF A;  1ONL A;  1FYC A;  1VF5 C;  4XIG S;  4HR7 B;  4KHZ A;  1OXT A;  1IW7 C;  3WDN A;  1I6V C;  1OXS C;  2JEB I;  2O5I C;  1VCI A;  3M7N A;  4OO1 H;  5K36 G;  1H9K A;  2JXM B;  3EQL C;  1QJO A;  1OXV A;  2A69 C;  2B8G A;  2E75 C;  2JEA I;  2LMC B;  1O7L A;  1LAC A;  1SMY C;  1HQM C;  2V4D A;  1OXX K;  4BA1 I;  2O5J C;  2EJG C;  1Z7T A;  2JE6 I;  2R6G A;  1PMR A;  3A8J E;  3M4Y A;  4IFD G;  2A6E D;  2BE5 D;  3VR6 A;  3W3A A;  2BDO A;  4G7Z C;  1Y8N B;  4KKT A;  1O78 A;  4DK1 A;  1CFM A;  3A8I E;  4I7Z C;  1A6X A;  1GUO A;  2NN6 I;  4XTC S;  4LK1 C;  3VR3 A;  3LNN A;  3A7L A;  3SE0 A;  1H9S B;  1VDZ A;  5BN4 A;  4DNR B;  1GUS A;  4DNT B;  1TKW B;  2PCF B;  3PUX A;  4TQU S;  1EWH A;  4KMU C;  3D4R A;  5C0X H;  5JEA H;  3NE5 B;  3A7A B;  2Q8I B;  3FPP A;  2EJM A;  2L5T A;  3QJY A;  2DNC A;  3ND8 A;  1Q90 A;  3QIA A;  3OW7 A;  1CI3 M; 
#chains in the Genus database with same CATH topology
 1HFG A;  2QW7 A;  5COY A;  4GLX A;  4X8I A;  2AMC B;  4BXX G;  2JSO A;  4KHP Q;  1I4G A;  3WXM A;  3BJU A;  3OE7 A;  1ZXT A;  2V7Q A;  4HMI A;  3SR1 A;  4PZ7 A;  4N3N A;  3ASR A;  4HJ7 A;  1QG7 A;  4Y7C A;  4K1X A;  4AVZ A;  2WV6 D;  4BS9 A;  5CBA E;  5M3F H;  1HNX Q;  3RN2 A;  2DNE A;  3C1F A;  4OWX B;  1PJ5 A;  2JYO A;  1WPC A;  3H09 A;  1OTC A;  3U4Z A;  4JI6 Q;  1WFQ A;  3CCQ A;  5LMU Q;  3OZV A;  3CCM B;  2UUA L;  3L9A X;  1M1K D;  1R9T B;  2HCC A;  2NYZ D;  1HA3 A;  1SKY B;  4AF6 A;  2BPO A;  3CHB D;  4EVO A;  4HMJ A;  3TSS A;  4DV0 Q;  2E2I H;  4RHR A;  3BYT B;  4II2 A;  1B23 P;  2QCP X;  3ZIA A;  2K5H A;  1B7Y B;  2K01 A;  4S3S A;  5IYD G;  4II3 A;  1SYC A;  4ILW A;  4R4C A;  3AQQ A;  1V5V A;  1SKQ A;  4MYT A;  3DDY A;  1D2B A;  4Z1M A;  2L11 A;  4A3B G;  1Q7Y D;  1WTX A;  2RDF A;  1Y1W H;  3LO8 A;  1V43 A;  5LL6 X;  3KDF B;  5TSS A;  4IFD J;  1OHH A;  1HCZ A;  4GKK L;  3AVV A;  4B44 A;  4JV5 Q;  2F1L A;  4XXE A;  3GDE A;  4RH6 A;  4GKJ L;  2XSC A;  4RDK A;  4JI6 L;  4JG2 A;  1IBK Q;  3MFY A;  1K8M A;  1XNR Q;  1BKB A;  2I5M X;  4P2N A;  5F4J A;  4OGQ C;  1UE5 A;  3FKI G;  3K59 A;  1SYD A;  3V7A A;  3OOC A;  1CUK A;  5IP9 G;  4P3I A;  2ZL5 A;  2EPB A;  3I4N H;  4X65 L;  2E8G A;  4ZCM A;  1QNU A;  4RGM A;  2V7W A;  1I18 A;  2E1R A;  1UAP A;  3SXH A;  2N8N A;  2XOK A;  3A8I A;  1ET9 A;  4JPB W;  2B2Y C;  4QCL A;  2QEX B;  1OXV A;  4FVM A;  3W2I A;  5COR A;  4CJ1 B;  1LAC A;  2XIW A;  3S15 H;  3ULL A;  3M9B A;  4IFD G;  1VQ8 A;  3G71 B;  1XX8 A;  1JC7 A;  4IPD A;  3ONU A;  2QA4 A;  5FIU A;  5IP7 G;  4DK1 A;  4I65 A;  2X69 A;  3CP0 A;  4PMB A;  1UD8 A;  2GA4 B;  1KD1 C;  1LM0 A;  4P74 A;  1RCV D;  2F3W A;  2KVO A;  3QSY A;  1PTO F;  2A19 A;  2XNA C;  2VUM B;  1H95 A;  4NKL A;  2CWP A;  4PG3 A;  1N06 A;  5J39 A;  4BBR G;  1EWH A;  3KF6 B;  3O13 A;  1TTT A;  2EJM A;  3WYA A;  1AW7 A;  4OP7 A;  2L5T A;  1QGA A;  1K73 C;  5FK9 C;  1Q90 A;  3QIA A;  3CCL A;  1VQC A;  5CV4 A;  3HOX B;  5FLX E;  3KDF A;  1P4M A;  4C56 C;  3M4Q A;  3OW2 B;  2D3L A;  3S17 H;  1SYE A;  4G7W A;  3PIP A;  4GQN A;  2CRV A;  3R6K A;  4K2K A;  4B3M Q;  2OBR A;  1EEI D;  1KDB A;  5C3X A;  3S2H H;  4BY1 G;  4K8I A;  4KV6 A;  1PA6 A;  1MGS A;  1GD7 A;  1N36 L;  5K36 H;  4X62 Q;  3FMC A;  1BBU A;  1TXY A;  2L4N A;  4KN4 C;  4OOS A;  2NUC A;  3FPU B;  4X7C A;  1SYB A;  4HN7 A;  4NPS A;  1KAA A;  1K8A C;  1QVG B;  1LT3 D;  1GAQ A;  2IX0 A;  1PH9 A;  4PMC A;  4FF2 A;  1BCP B;  3CRK C;  4XQN A;  1U0L A;  1CKN B;  4QUF A;  3JAM L;  1WTQ A;  2YYZ A;  2DYI A;  1FNU A;  5C3W A;  1V8Q A;  4RD6 A;  1EUJ A;  2AQ2 B;  2WAQ E;  2JA6 H;  2PPB C;  1B9N A;  2VBT A;  4K6D A;  3M85 A;  4HJ9 A;  1EQQ A;  3PVD A;  2F3V A;  5M9O A;  5CDF A;  3ZUG A;  1EY9 A;  4C1N I;  5IWA L;  1HA6 A;  1EY0 A;  4YAO A;  2WB1 E;  1FNC A;  3KK7 A;  3KF8 B;  4B3R L;  4ME5 A;  2Q8T A;  1EFC A;  2V1C C;  3Q24 A;  3KFU A;  2NPF A;  3UE0 A;  4B3G A;  2HT1 A;  4JI7 Q;  4J6H A;  2UXD L;  3CCS B;  4LF8 L;  2R92 B;  3H0G B;  1PH2 A;  1GJX A;  4U67 3;  2OQK A;  3J81 j;  5BR8 Q;  4OX9 L;  3CCE A;  4TVA B;  1M90 D;  3H0G H;  1SSO A;  1XMO Q;  2OTL B;  3CQZ B;  1G7T A;  2BVN A;  2PMZ B;  5KSW B;  1QUE A;  4GLA C;  4PZ8 A;  3DM3 A;  3F1Z A;  1EXM A;  1TWH H;  4XLH A;  1JB9 A;  4KLK A;  1XMQ Q;  4A3E G;  1K8G A;  4DR4 L;  4WZT A;  3BDC A;  4DR1 L;  5J1Z A;  2JDI A;  1KRT A;  1KXL A;  1AZP A;  2F0P A;  4BA1 I;  3T1H L;  2F0D A;  1JB3 A;  2I07 B;  3W3A A;  3OP1 A;  4G7Z C;  2CHB D;  1EEF D;  2Q6I A;  5FNZ A;  5JJL A;  1WOO A;  2K1B A;  1ELO A;  1PXU A;  1PYS B;  2D9R A;  3SE0 A;  1JJG A;  3J7A F;  4KD4 A;  4RDL A;  2VXW A;  2I5H A;  4TQU S;  1PFN A;  5IE8 A;  3MXN B;  4FDB A;  1IHM A;  3CP8 A;  1S72 B;  1N8R D;  2FXQ A;  4MNO A;  4EGV A;  3S16 B;  1G2S A;  4BBS B;  4JI0 L;  5ELF A;  4GNX C;  1IBM L;  3GTO B;  5IYN A;  1YIT A;  3LVB A;  3LX0 A;  3CC4 A;  1B2T A;  2ZJP A;  2PYK A;  3BVZ A;  4R4I A;  2ZBU A;  1O7Y A;  3IRB A;  1DOL A;  3A74 A;  3PO2 H;  3FP9 A;  4O0A A;  3GSI A;  3D4W A;  1TWA B;  4POG A;  3AB9 A;  4P72 A;  5IYD H;  3J7Z C;  5KRU A;  2R93 H;  2VB2 X;  2X0K A;  4L5R C;  3EA6 A;  5GRO A;  4DUZ Q;  3RY8 A;  2ZTG A;  2F0H A;  3GD7 A;  1BX0 A;  3U6K A;  1X3Q A;  3BY2 A;  5IGE A;  4QB4 A;  2VNI A;  2B7C A;  5F4M A;  3MVV A;  3P1H A;  3EIV A;  1SR3 A;  1PHJ A;  2HDM A;  4G5G A;  3H3V I;  1QNK A;  3TP5 A;  3TRZ A;  3TS0 A;  3CME A;  2K03 A;  1BO0 A;  1JWM D;  4PZ6 A;  3NWT A;  1T5E A;  3GTL B;  3E20 A;  1WYD A;  5I2X A;  1ZKO A;  4PQX A;  1YHA A;  4DU9 A;  1PRT D;  1JIC A;  1HNW L;  4G7O C;  4GS3 A;  1E2W A;  1E2V A;  1LUZ A;  3U4V A;  2J4X A;  1SNM A;  2RBM A;  4HIK A;  2VNU D;  1D5M C;  2MNA A;  3OTO Q;  1S72 A;  2L9H A;  5LMN L;  3L0O A;  3S17 B;  3UDX A;  3VO2 A;  4P6Y A;  3PO3 G;  4A3I G;  3VNU A;  4JI2 Q;  3X3M A;  5HGT A;  1KK2 A;  4UZE A;  1Q8K A;  2WFW A;  4A3D B;  1CQV A;  2XZO A;  2M9V A;  4HJ8 A;  2GJR A;  1QH0 A;  3OZW A;  4DA2 A;  1I3Q H;  4CBV A;  1YLO A;  3ZBT A;  3T53 B;  3CC7 B;  5IK2 A;  1F2L A;  1MSG A;  3HP3 A;  1J9Z A;  2V7U A;  3HOY G;  4JK1 C;  1BCP F;  1Q81 C;  3ZC3 A;  5I4D A;  5GV8 A;  1GJR A;  3N6R A;  2E2H B;  1PYW D;  2G5D A;  4XOT A;  1SFO B;  4WJ4 A;  3P7J A;  5IGG A;  4HCE A;  1SNC A;  1VHE A;  1S5D D;  4YAU A;  1OXS C;  2KEN A;  5A88 A;  2YWE A;  4RLZ A;  2VNH A;  1A2U A;  4HTH A;  2PNH A;  1L1O A;  3MAQ A;  2DCU A;  1UD5 A;  4DV1 Q;  3J80 c;  5DEH A;  2VJJ A;  4Z9C B;  2JE6 I;  2I46 A;  1I4Q A;  3M4Y A;  4L6T B;  5C44 G;  1NRK A;  3VR6 A;  5C3E H;  1NBW A;  4H02 A;  2E2I B;  1S5B D;  4FYD A;  1YIJ A;  3F2B A;  4RD1 A;  3A8K A;  2Z4H A;  1QGZ A;  4LK1 C;  3BZK A;  1XYI A;  3BVM A;  5BN4 A;  4DV2 L;  1UEA B;  4AYB B;  2F0G A;  1RQP A;  4A3M G;  1SYF A;  4A3C G;  2GJP A;  3GTP H;  1N32 Q;  1EZ6 A;  1LTS D;  2C2W A;  3HOU G;  3AMU A;  5EKK A;  2ZZG A;  2ZXP A;  3OAA A;  4IPH A;  3DLL A;  5AN9 A;  3FPK A;  2PO4 A;  1IHZ A;  3C2Q A;  1YNN D;  5BR8 L;  1HZE A;  4HIZ A;  2K5V A;  1EY4 A;  3M4P A;  4DR3 L;  5C4J B;  3H94 A;  4APV A;  5CC4 A;  1VQE A;  2XNC A;  1PTO C;  4A75 A;  1KTV A;  1F9R A;  1O7I A;  4ZAI A;  3GTG H;  1VMP A;  1C9O A;  4K6L A;  1I6H H;  3CPX A;  2KHS A;  5JAV A;  1J6Q A;  5FJ8 H;  1EWI A;  1H9M A;  4RFB A;  5IP7 H;  1D1N A;  1Q86 D;  1BF4 A;  1PFS A;  2FIN B;  3Q38 A;  4AH6 A;  3GTM B;  4K0K Q;  5JPM C;  1RF2 D;  2QDX A;  1HH2 P;  3A5U A;  4DXF A;  1IL2 A;  4RD0 A;  1TY2 A;  4B3S L;  1TVC A;  5NUC A;  5A89 A;  2YTV A;  1H42 A;  4Z4R A;  2JQO A;  2AUJ D;  5A2Q E;  1SN8 A;  2VY3 A;  3GTQ B;  3CF5 A;  1EY5 A;  1Y8P B;  1SE3 A;  3DWP A;  4OWT B;  4TMW A;  2KHJ A;  2PNR C;  2XGJ A;  3EN2 A;  3MFG A;  3W2E A;  4UHV A;  1P16 A;  1EY7 A;  1HNZ Q;  1IXR A;  1K8O A;  5KIX A;  1GKH A;  5IGC A;  2EJF C;  3A8K E;  4DV0 L;  1ZYR C;  1QCB D;  3HEJ A;  4JI8 Q;  3SVM A;  3I73 A;  1S4M A;  2RCF A;  4UY8 C;  4DR5 L;  1FDR A;  4FXK C;  4DAV A;  4IN3 A;  5IYR A;  1WTP A;  4CHT B;  2K14 A;  1N33 L;  3TZU A;  1Q86 C;  2Q2H A;  2JA7 B;  3F2U A;  4QVA A;  2GVA A;  3NBH B;  1GM5 A;  5CBE E;  4BBS G;  1N8R C;  4RHS A;  1TWG H;  3NQI A;  2D5D A;  5D3D A;  2E5L L;  2MO1 A;  1VQD A;  2H5X A;  4XQJ A;  4A3K B;  1VQF A;  1FRQ A;  1VQ9 A;  4PC2 A;  1EFU A;  2R6H A;  1EFI D;  3OEE A;  1K9M D;  2V7V A;  3AVU A;  4XYQ A;  2X85 A;  4OHJ A;  5FO8 B;  4OOX A;  4GNX B;  1XMQ L;  2QKI C;  4OL7 A;  1OO9 B;  3RMH A;  4YWK A;  2ZM6 Q;  1IL8 A;  1YBY A;  1KJZ A;  3FDT A;  3ISX A;  4QUZ A;  2KEE A;  1L1O B;  3GV3 A;  2ZTN A;  1D1I A;  2GK6 A;  4K5V A;  2NVQ H;  1A15 A;  3CRZ A;  3A1P A;  1KK3 A;  1EOT A;  2YU9 H;  5DM7 3;  2HHH Q;  2NZ1 D;  4Z4Z A;  4XLF A;  5CMD A;  1VS0 A;  1WDT A;  4BY1 B;  3ASS A;  1VQO B;  2VZA A;  4NXN L;  1IKM A;  3JU4 A;  1BVS A;  4G1B A;  1W2B A;  4JI2 L;  5FL7 A;  2WIN B;  3ERO A;  4DV7 Q;  1E24 A;  1OXU A;  3V96 A;  4XKW A;  3PIO A;  3NSW A;  4FN5 A;  1GHJ A;  1BJK A;  4TN1 A;  3D0F A;  4IUU A;  3VA7 A;  1QGY A;  2J7K A;  2PQA A;  5C3E B;  1IZ6 A;  4LF4 Q;  2F0J A;  2QDL A;  5C0X G;  3OPO A;  4O1N A;  4EQ5 A;  2VZL A;  1BDO A;  3AVW A;  4N8X 1;  4IUR A;  2B5O A;  3GVL A;  4GN3 B;  2VQE L;  3MZ5 A;  1XNQ L;  4X64 Q;  1UE6 A;  3BNW A;  5IGB A;  2CH4 W;  2L12 A;  2N55 A;  1F2Z A;  1KAB A;  4J1M A;  4CKC A;  2OK8 A;  1RHP A;  3FKI B;  4DAY B;  1F9Q A;  3PUY A;  1TS2 A;  4DUZ L;  1R5N A;  1KD1 D;  3D8G A;  2C78 A;  1Y1V G;  2PQE A;  2P3M A;  4P2C B;  4KJN A;  1KC8 D;  2QA4 B;  1PZI D;  2Y0S G;  3A55 A;  1GO3 E;  4UP8 A;  2JA6 G;  2F0W A;  4OON A;  4UAJ A;  2WSS A;  4KY7 A;  1EQV A;  2IJ0 A;  5IYQ A;  1H9S A;  2RCN A;  2HDL A;  4RGN A;  1IW7 D;  1V1P A;  3ZZU A;  1GVH A;  3HKZ B;  1BXT A;  5FO0 A;  1GOZ A;  4XL9 A;  4FF3 A;  2IX1 A;  1II3 A;  2EDG A;  4MHE A;  2B2V C;  4C3H G;  2L0C A;  1WCM H;  1PVO A;  3A54 A;  3AGQ A;  3PUV A;  4C3J B;  2VNJ A;  2QTL A;  1SM4 A;  5ELB A;  3GTM H;  1U4M A;  5LMN Q;  1SMX A;  3H3V H;  1VQ9 B;  3G71 A;  2WPD A;  4POF A;  1Z6H A;  3G6J B;  5J3B A;  4HED A;  1VQ6 B;  1TLL A;  1PRT C;  3I7F A;  5HZA A;  3P20 A;  4CQJ A;  2F0V A;  4DPG A;  3NBH A;  1QVF B;  2Q2U A;  2JEB I;  4YAF A;  2O5I C;  4RM0 A;  1FNM A;  2EIX A;  4WQM A;  2VBU A;  1QJO A;  3TEH B;  2UU9 Q;  2VUM H;  2C5C A;  2PLF A;  4IUT A;  2ZTE A;  4OPV A;  5C5M A;  1O78 A;  1VQN A;  3D6C A;  2WAQ B;  4M0L A;  3TBI B;  1GUO A;  2NN6 I;  3S15 B;  3I56 B;  2B2U A;  2DOG A;  2JJQ A;  4YCV A;  4ZUJ A;  3T1H Q;  3AYH B;  1JA1 A;  2MQH A;  4KMU C;  1LTR D;  3K0Y A;  1PH1 A;  5J35 A;  5ISR A;  5E6T A;  4C2M H;  2YWG A;  1XQB A;  2BCO A;  2F0K A;  4RWS C;  5H5J A;  1TWF B;  2M5S A;  3TS2 A;  1NB9 A;  1VQI A;  2ES2 A;  1L0X B;  2UXB L;  1BMF A;  2GVB A;  1NCV A;  1PFB A;  1HPC A;  1W2B B;  4Y9U A;  3IL8 A;  1FL0 A;  4LMQ D;  4IO9 A;  1W0K A;  2CW5 A;  1B4O A;  3PO2 G;  2OF1 A;  1ZYR D;  2HDN B;  4TSF A;  3L2P A;  4B47 A;  3CCV B;  1STY A;  2B2W C;  2F1M A;  3KJO A;  1JE5 A;  1LTA D;  1QUQ A;  4LF6 Q;  1WOS A;  1RJT A;  1NUC A;  2HUG A;  3CES A;  4K14 A;  1W6J A;  1K28 A;  5TR9 A;  3S2D H;  1JA0 A;  5H1S E;  2JA5 B;  5LMN W;  3PUW A;  2VUM G;  4HCS A;  4AQY L;  4P1V A;  2FJ2 A;  5IY0 A;  3CQZ H;  3K58 A;  1NDH A;  4PV1 C;  3MMP A;  4YHH Q;  3CW2 A;  1FNW A;  3VNV A;  5BN5 A;  2AHO B;  3KBX A;  2ZL7 A;  4TMZ A;  3HGB A;  4JBK A;  4NP5 A;  2K04 A;  2F03 A;  5C4X H;  5GAE C;  4JBJ A;  1F60 A;  3MC0 B;  4JYA L;  2QEJ C;  4IAL A;  4XQQ A;  1SNQ A;  1HR0 L;  4LFA L;  4YEL A;  1JOK A;  1ROD A;  2NN6 G;  2PQA B;  4EX5 A;  2E1B A;  4YEJ A;  3S1M B;  1KQS A;  5FJ8 G;  4B4D A;  1NAP A;  3DEP A;  3QFR A;  5EPJ A;  3D6W A;  3SK5 A;  4LF8 Q;  1QZG A;  3CC4 B;  2VBS A;  3PEN A;  2DER A;  1K8A D;  3ERQ A;  3PIP 3;  5A35 A;  3S1Q B;  2NVX B;  3OTO L;  2C5H A;  3MWY W;  1SJE D;  4DQK A;  2MJ8 A;  2YU9 B;  4F87 A;  2NVX H;  3S1Q H;  2B39 A;  3PUM A;  1O80 A;  4ABN A;  2EYJ A;  3B82 A;  1MKH A;  4ZRZ A;  4IUQ A;  1Y1W B;  2YV5 A;  5C5L A;  4C43 A;  1FYC A;  4JVZ A;  5C3E G;  3M4O B;  1I6V C;  1DON A;  1T5X D;  1A2T A;  3KJP A;  3BDL A;  3CD6 B;  4G6I A;  1JOO A;  4NB3 A;  2B8G A;  1WOR A;  4ALP A;  2D74 A;  2UXC L;  1HQM C;  1PTO B;  5HXB A;  2C4U A;  4UDU C;  4ASU A;  5LMZ A;  2CKZ B;  2RHQ B;  3R2T A;  2BDO A;  4YIJ A;  3JAM c;  1Z9F A;  2L1B A;  1IBL Q;  2E2J H;  2PIA A;  3A8I E;  1AH9 A;  2HD3 A;  2QEX A;  1N0V C;  5JJK A;  1UEB A;  1ENA A;  2BF4 A;  5GAG C;  3Q8D A;  1Q81 D;  3HOV G;  2L15 A;  2B2T C;  1RDP D;  2C5B A;  4DV2 Q;  5I2Y A;  4DUY Q;  3CB4 A;  2BM1 A;  1DDI A;  1QUQ B;  3BU2 A;  2X53 S;  3SEB A;  4CGY B;  2KA7 A;  4RDJ A;  3PO3 H;  5KYI A;  1D2E A;  5EPL A;  1QB5 D;  3PMF A;  2EIF A;  3E3X A;  2XGT A;  1EOV A;  2BA0 A;  3MCA A;  2L55 A;  4X07 A;  1V1O A;  1F77 A;  5A2Q L;  4NXM L;  3DMU A;  1E7Z A;  1DD2 A;  2LS0 1;  1FGB D;  3VR2 A;  2PMZ E;  1YX2 A;  4DV4 Q;  1AZQ A;  1YIJ B;  4JV5 L;  4ZQ3 A;  2NN6 H;  3FKS A;  3BDO A;  3WND A;  4ZCI A;  2K33 A;  3T4A C;  1RIP A;  4Y7N B;  3HRZ C;  4DK6 C;  2SDF A;  5GQO A;  1EP3 B;  2A6E C;  4X3S A;  5KNC A;  4JI0 Q;  3HOZ B;  2HQE A;  4DR4 Q;  2JA8 H;  1XNQ Q;  4A93 G;  3NEN A;  5JVG 3;  5CV5 A;  4K0K L;  4WFN 3;  3A3B A;  3QG1 A;  1K83 H;  2V7X A;  2XZP A;  4ZUI A;  2VJI A;  3BG3 A;  3Q39 A;  3D31 A;  1E1R A;  1B3Q A;  1EL0 A;  2WZP P;  4DV3 L;  2EFG A;  2ASB A;  3I4O A;  2UXC Q;  3H15 A;  5IYW A;  2IL8 A;  2IY5 B;  4X05 A;  2B2W A;  5EAY A;  2R7Z H;  4RCZ A;  3BQJ A;  3CRL C;  1CSP A;  1LYL A;  3ES9 A;  3MA2 B;  4TKO B;  2EOT A;  4BBS H;  2WKC A;  3VDY A;  1EIF A;  1KHI A;  1I4H A;  2A6H D;  3C3L A;  1Q12 A;  1AE3 A;  1GO2 A;  1WTH A;  1G7C A;  1X56 A;  1E64 A;  4IUP A;  4P25 A;  1IYJ B;  3BZD B;  4DV6 Q;  2OXP A;  4IZ8 A;  3C2P A;  4QHY A;  4BWG B;  2AWN A;  1LT5 D;  1XB2 A;  2P5Z X;  2C9O A;  1R5B A;  5DN6 A;  3H0G G;  2OTL A;  2XEX A;  3GV6 A;  1TUI A;  1U9R A;  4QFM A;  1IB0 A;  3I70 A;  4PNY A;  1UE7 A;  3S1R B;  3QR8 A;  5D65 A;  3IAY A;  1G2T A;  2X6G A;  3VMF A;  3JAM E;  3HOX H;  5DSZ A;  1U2R A;  1NSN S;  4DV1 L;  4XOR A;  1O7L A;  1JOR A;  3GTG B;  1N36 Q;  2FMM A;  2KED A;  4O2D A;  1CZW A;  2RDH A;  4MTN A;  1A3V A;  4A3B B;  4OWW B;  2MP1 A;  2JA5 G;  4HE5 A;  5ELC A;  1V1Q A;  2WAC A;  3S14 H;  3GTK B;  1A6X A;  1Y0Y A;  1XWE A;  5KW9 A;  4FXG C;  1UD4 A;  1EYC A;  2RC5 A;  4DNT B;  1Z47 A;  2PCF B;  1X3G A;  3PUX A;  2OT2 A;  4ZCK A;  3H9N A;  1KK1 A;  4CKB A;  2EQS A;  3NE5 B;  1C8C A;  1T6X A;  4A3K H;  3ZPN A;  3KBG A;  2JA9 A;  3GTQ H;  1L2F A;  4YWM A;  4LUV A;  3AVY A;  1WCM B;  3CCL B;  2F52 A;  2E74 C;  3A3G A;  1FJG L;  2XN9 C;  2E2J B;  4DV3 Q;  3HKZ E;  4DAM A;  3RZD B;  4LJZ C;  1SYG A;  1EP1 B;  3W2H A;  2Z6B D;  2A6H C;  2G9H D;  3FVQ A;  4RPB A;  1SRU A;  1MHW C;  2KCM A;  2DIE A;  1D6E C;  4DNI A;  4B3R Q;  2JA6 B;  1DJR D;  5FOB B;  1TT2 A;  1LT4 D;  4H7B A;  1STN A;  4K2L A;  1RTO A;  2D62 A;  4N3G A;  3CME B;  1I94 Q;  4V19 0;  2QF7 A;  2JA7 H;  1B3A A;  1T6Z A;  1OB0 A;  1MSH A;  5I9P A;  3CCQ B;  4U9U A;  4OO1 G;  4IFD I;  4RCY A;  4F8M A;  1L0Y B;  2OTJ B;  2DY8 A;  3CCJ A;  1LTB D;  2WYR A;  4EH1 A;  3NEM A;  1NTG A;  2K32 A;  4DR3 Q;  4KTA A;  1JT8 A;  1H9J A;  3E6Z X;  5T1G A;  3VR4 A;  1TQO A;  2F43 A;  3S2H B;  4FWT A;  2BH2 A;  1AE2 A;  2Y0S B;  1DZ1 A;  4Y7N H;  4XR6 A;  4XT1 B;  3OSO A;  4IFD H;  3Q6S A;  5ELN A;  3E9H A;  1TU2 B;  4QUC A;  2IPK D;  1HA5 A;  4IJL A;  4YY3 Q;  2QMU A;  4HSV A;  4M8A A;  2CWA A;  1AMO A;  2CCZ A;  3TP8 A;  4FXU A;  3AU7 A;  3U9S A;  2FFK B;  4A3I B;  1JJ2 A;  1KDC A;  2E5L Q;  2IWH A;  5C4J H;  2C35 B;  3IKJ A;  1QVF A;  1W0J A;  1JE4 A;  1M8A A;  3RLF A;  2VQF Q;  4KHZ A;  1YVC A;  3GTP B;  2D3N A;  5JEA J;  1EFT A;  1SE8 A;  4UP7 A;  4HAE A;  3DUZ A;  3ERS X;  1PH6 A;  3C46 A;  1BPL A;  1H9K A;  2HIX A;  2E75 C;  2A69 C;  1AEX A;  3UDG A;  2JEA I;  2LMC B;  4CJ0 B;  3SEJ A;  2ZM6 L;  1JWU D;  2EJG C;  3T1Y L;  3I4M B;  4QIW B;  5EJW A;  4RKL A;  2RHS B;  1D7Q A;  1EIG A;  3TRE A;  4DR6 Q;  2YWH A;  4B3T L;  4RJL A;  3G4S A;  1C7Y A;  1BOS A;  1CA6 A;  3NTK A;  4KHV A;  1NNX A;  3VR3 A;  4YY3 L;  4RGT A;  3HOZ G;  1G91 A;  3I2Z A;  1QVC A;  2O2L D;  4LWC A;  4TMX A;  1CHQ D;  3EJI A;  1STA A;  2HHH L;  1V0E A;  1RL2 A;  1B44 D;  2CQA A;  3I4M H;  2BSA A;  1H8H A;  2W6J A;  2MHV A;  2NVQ B;  3ZYY X;  3OW7 A;  5M5Y H;  3K5L A;  3CCS A;  1VQ6 A;  3J7A 5;  3L7Z C;  2ID0 A;  4QF4 A;  3J80 L;  4DUY L;  1M4V A;  3S14 B;  5HY6 A;  3I55 B;  4AYB G;  2F0T A;  5G3L D;  2ZZQ A;  5M5W H;  3S9W A;  2A68 C;  4OOV A;  5L37 A;  5KNL A;  2Q6K A;  1YI2 A;  1J5E L;  1H9R A;  5ELD A;  4X3U A;  1EY6 A;  2A69 D;  2RSO A;  1JB7 A;  3URY A;  3SKB A;  1BCP C;  4DV6 L;  5JJI A;  2F0F A;  2VYQ A;  2K6A A;  5C0X I;  4JI4 Q;  1V9P A;  4X64 L;  2YWF A;  1VQ5 A;  1VQJ A;  1BQQ T;  2XTI A;  4KHP L;  3MHP A;  4LFB L;  3CC2 A;  3KLS X;  4KY5 A;  4XN3 A;  3MTS A;  1V0F A;  1NE3 A;  2HLD A;  1OGJ A;  4Q0F A;  1ZM3 A;  5G3L F;  1E1T A;  3I3C A;  1WVL A;  2WR8 A;  3NHH A;  4A3D H;  4Z4V A;  3E9I A;  1AN8 A;  3ITP A;  5HZB A;  1TR5 A;  4LW1 A;  1PZJ D;  4DV7 L;  4A3E H;  2YTX A;  2Z6K A;  4IOA A;  2IHF A;  3WNC A;  5CV6 A;  4A3F B;  3HOV H;  3U58 A;  1PH8 A;  2K75 A;  2NWG A;  1WSR A;  2XRQ D;  2ZTD A;  2I0Q A;  1JOQ A;  1C0A A;  2VB3 X;  2ICI A;  4RD2 A;  4WJ3 M;  3K5M A;  4C3J H;  3LQ6 A;  5M3M B;  3UE1 A;  3M4O H;  5FO7 B;  2D2C C;  4NMZ A;  2UUC Q;  2F0M A;  1E1O A;  5I6W A;  4LC0 A;  4IOC A;  4CDF C;  4OX9 Q;  4DR2 Q;  2A68 D;  4WWV A;  3K80 C;  2Z9H A;  1H85 A;  1KL9 A;  1E3Z A;  4PGO A;  3Q23 A;  1XMO L;  1E43 A;  5M5X B;  3FHW A;  3PUN A;  3UI2 A;  2Z1C A;  1ESR A;  3M3Y H;  2ZZE A;  3I91 A;  3OIQ A;  5DAU A;  3W5V A;  4K5X A;  4KD3 A;  4ZYS A;  1FR3 A;  2PI2 E;  3K57 A;  1MAB A;  4X7F A;  4GNX A;  3W1B A;  4JI3 Q;  3IFT A;  5I6Y A;  2JA8 B;  2IHE A;  3HOU H;  1WCM G;  5KGU A;  1JJ2 B;  4GKJ Q;  2MO0 A;  4IQZ A;  2JA7 G;  2BV3 A;  4HIM A;  1QOH A;  1KLG D;  1X3F A;  3ULJ A;  4ZKC B;  2Q2T A;  2R92 H;  2DY7 A;  1PH3 A;  4QY7 A;  1LV9 A;  3WNB A;  4Z4U A;  1KDA A;  2KQ3 A;  4C3I B;  2V4D A;  5GAD C;  2R7Z B;  1YJ9 B;  2F4I A;  4ULL A;  1HRJ A;  2QDB A;  3ER0 A;  2MUY A;  4ZK9 B;  1XJV A;  4C3H B;  3PO3 B;  3VYS A;  3SK8 A;  3I4N B;  1Q8I A;  4B48 A;  4C3J G;  2XNJ A;  3ONA B;  1QX4 A;  1WJJ A;  4ZKB B;  1I50 B;  4X3K A;  4DNR B;  1GUS A;  4C1N K;  5EMN A;  3G4S B;  1E62 A;  1VQA A;  3S1N B;  1YHQ B;  2LXK A;  3MEH A;  2FX3 A;  4B3M L;  3TP6 A;  3DM1 A;  4UPA A;  2K5Q A;  1HUN A;  3D26 A;  3Q0A A;  1PLF A;  2K52 A;  3ASP A;  2XWJ B;  3PCO B;  1KMH A;  4P12 A;  2AWO A;  3LWU A;  3CD6 A;  2NVT B;  1Y0R A;  3VYT A;  2MFI A;  2Y0S E;  1SMY D;  1I4P A;  2F3I A;  1B2R A;  1BR9 A;  1OGI A;  4G4K A;  3A0J A;  2R7F A;  4BY7 B;  3QE2 A;  1FJG Q;  3PF4 A;  4L5Q A;  3RZO H;  4QL5 A;  5BSY A;  4A3J B;  3G48 A;  5ELE A;  1D5Z C;  2F4V Q;  3FEW X;  5FKA C;  3DHQ A;  1NBM A;  1PH4 A;  5E4X A;  3HS0 C;  4JBW A;  2BE5 C;  1MJC A;  2UU9 L;  2EY2 A;  4NNJ A;  3HZX A;  1X6O A;  4P22 A;  3HAG A;  2JP1 A;  5D14 A;  1Q82 D;  2X6Y A;  1G29 1;  4KY6 A;  1Y1W G;  4CKE A;  2RKS A;  3OIP A;  4B9W A;  3WQZ A;  4QV2 A;  2C4T A;  2CND A;  1YNJ C;  4B3T Q;  3B6Y A;  2JK8 A;  4Z4Y A;  2F0S A;  1HTP A;  1UD2 A;  5IP9 H;  2EYH A;  5KEE A;  1MJE A;  3R93 A;  3JAM i;  3FKI H;  3PO2 B;  1HUM A;  1E0B A;  1Y1V B;  3CPF A;  4K8J A;  3RLO A;  2CW0 C;  3TZD A;  4RKB A;  2Z4I A;  1G7S A;  2B8F A;  3CCV A;  4MN3 A;  1Q1E A;  1STG A;  3HOZ H;  1DDG A;  1W35 A;  1C4Q A;  4DV5 Q;  2A74 C;  1CSQ A;  1YHB A;  2KEC A;  2D0O A;  5JEA G;  3KLS A;  5GAH C;  4A3F H;  3HOV B;  4KI0 A;  1A3T A;  5M3F G;  2SOB A;  3HOW H;  1I4X A;  3SHL A;  1S5E D;  1N08 A;  1SXT A;  5TV2 A;  4KKS A;  4F7D A;  5B6I A;  2NZO A;  2GJK A;  4L63 B;  1SRO A;  1VQH A;  1GUT A;  1QWY A;  2YTY A;  5FLM H;  4J8Q A;  3DEO A;  1OB2 A;  2OTJ A;  2VQF L;  4F7X A;  1HVX A;  2R9V A;  1QFJ A;  3PQI A;  3TN2 A;  2JXM B;  3KOJ A;  4A4I A;  1IJF A;  3MHB A;  1O7Z A;  1IJE A;  5C4H A;  3CC7 A;  1G7R A;  4JI5 L;  4A3C H;  4U68 A;  3OWE B;  1LLR D;  4JC0 A;  1CFM A;  4XD7 A;  4GOP C;  4DR6 L;  4GKK Q;  4P75 A;  4XDX A;  5AFW A;  3A7L A;  4DQL A;  4UP9 A;  4HJA A;  1VDZ A;  3T1Y Q;  1QE6 A;  2Z0S A;  4A93 B;  4DFA A;  4HID A;  1BUV T;  3W5U A;  2BMW A;  2LZJ A;  3ZZ0 A;  3QWN A;  2DNC A;  1S40 A;  5TY0 A;  1CZG A;  4NW2 A;  2ENB A;  2NTT A;  3HFZ B;  4WJW A;  4X65 Q;  4R4Q A;  5IYC H;  3K5O A;  1AIP A;  2K5W A;  1KQS B;  1VQK B;  4XLA A;  3CP2 A;  4LF7 L;  1SAP A;  2H1E A;  2EY6 A;  3X3N A;  1ZM2 A;  1QFY A;  1X3P A;  1N34 Q;  2NVY B;  1EY8 A;  2RDG A;  1PV4 A;  2GPJ A;  5EKI A;  1K83 B;  4MIU A;  1NJI D;  4X0C A;  1HZA A;  3S1N H;  2EXZ A;  1ICW A;  3BCF A;  3W5O A;  1B1Z A;  3QFC A;  5IYP A;  3H91 A;  3F2D A;  1TS4 A;  1ZM9 A;  2KCN A;  2WP8 J;  3S24 A;  4EQN A;  4ACA A;  5EBD A;  4C2M B;  1EZ8 A;  1NR2 A;  4YWL A;  2UUB Q;  1ENF A;  1BBW A;  1DM0 B;  1EWC A;  1HZ9 A;  4JI8 L;  1I3Q B;  5C4X B;  2IT1 A;  3PV0 A;  4OEL B;  3KL9 A;  3WY9 A;  1CK1 A;  4G7H C;  1CA5 A;  3DXJ C;  1UWV A;  3HOW G;  4FF4 A;  1AFP A;  4RD4 A;  1YJN B;  1PH7 A;  1PRT F;  2X3U A;  1PRT B;  2EXD A;  4LF7 Q;  2ZZF A;  3SK4 A;  2ZJR A;  1VQ4 B;  2X6W A;  3I4L A;  1DOK A;  5JVH 3;  1UD6 A;  1ZUN B;  4PC1 A;  2SNM A;  3HOY H;  1JWS D;  3HG9 A;  1OB5 A;  5IT9 L;  4XYO A;  1VQL B;  4Z4T A;  4FO2 A;  1W6K A;  2QTZ A;  2DGY A;  3R6J A;  4RD3 A;  1D8L A;  2V7T A;  1VQL A;  1VQK A;  2B63 H;  1KIX A;  1L1O C;  2B7B A;  3CAM A;  4CDC C;  2Q6O A;  5CV8 A;  1GUG A;  3U6B A;  3HOX G;  1YNN C;  2KOL A;  1KNE A;  3ND9 A;  2K50 A;  4QJF A;  3VR5 A;  3I56 A;  4GN5 A;  1YIT B;  3GQB A;  1E3P A;  2PW7 A;  1JMC A;  3RR5 A;  2RA4 A;  1LO5 D;  3WDN A;  4JMQ A;  4X66 L;  5IOC A;  3J81 E;  5E1F A;  5BSX A;  4JI1 Q;  2XWB B;  5LHY 1;  1B70 B;  4PMW A;  3BYY B;  1SMY C;  4G1V A;  2GQF A;  2HMA A;  4WZL A;  2FVG A;  4DXG A;  3CPW A;  4KKT A;  2BH8 A;  3TME A;  4DR1 Q;  4IUN A;  3RN5 A;  1EFW A;  2VQE Q;  2WJV A;  2DUD A;  1TWG B;  1VHO A;  2JJ1 A;  3MXP A;  5F2D A;  1J9O A;  4P9S A;  1NMF A;  4LFC Q;  4O42 A;  3I4M G;  2F0I A;  4DF7 A;  4P3Y A;  4QGU A;  2JIZ A;  2PZT A;  3QJY A;  1F9S A;  1DAR A;  2KBN A;  3W2G A;  1CNE A;  1CI3 M;  2A1A A;  3TQY A;  2XRS D;  4G57 A;  2C77 A;  1N0U A;  4TMT A;  4LAA A;  3W1G A;  1BNZ A;  4LF9 Q;  1YNX A;  4C3H H;  2Z8L A;  1WD1 A;  4LF5 Q;  4QIW E;  2B63 G;  1S4Z A;  4ZCL A;  4DV5 L;  5T1I A;  1A3U A;  3EVQ A;  1T9H A;  5HKK A;  1X9N A;  2D0P A;  4AC9 A;  1F2Y A;  1UUP A;  4DK3 C;  3RUZ A;  4EQP A;  1SJH D;  1MRZ A;  2EVB A;  4B3S Q;  1A8V A;  1WOP A;  2J7Z A;  2EE1 A;  3NUC A;  5EQ0 A;  1VQN B;  3G6E B;  4XMY A;  4Q7J B;  3ZBU A;  1DXM A;  1TS3 A;  1SNP A;  1FND A;  2F0L A;  2KJX A;  3I1F A;  2FHT A;  4RGO S;  1X3E A;  3LWE A;  3A8J A;  3STB D;  1PDQ A;  5IYB H;  3QB3 A;  1WP6 A;  1IKL A;  3NPP A;  4DAY A;  5LL6 S;  5JOB A;  1LTI D;  4Q5V A;  3GTJ B;  1EIY B;  3M3Y B;  1JNY A;  1WTH D;  1EP2 B;  2IW3 A;  2BGI A;  2SEB D;  3ZJY C;  3OJW A;  1P8L A;  2BGJ A;  3LQE A;  1F20 A;  2EY1 A;  1N33 Q;  4WZE A;  5CV9 A;  3U50 C;  2N88 A;  4R8I A;  1SFO H;  2Z6K C;  3BC9 A;  4H0L C;  2A5H A;  1JCK B;  2AUK A;  2K28 A;  3VYU A;  5JJZ A;  4X6A H;  4L5S A;  2OK7 A;  1PZK D;  4XT3 B;  3ULP A;  2UUC L;  4UZF A;  5M3M G;  1HTL D;  1VQO A;  4DR5 Q;  3AVT A;  1IBL L;  1NB0 A;  3EBE A;  2PE3 A;  4FXD A;  3EFX D;  3OWF A;  1VQP B;  2EYL A;  1Q82 C;  2OWO A;  4MYU A;  1R9T H;  2CBX A;  1TS5 A;  5K5P A;  4R4T A;  1KC8 C;  1BX1 A;  3CCU B;  3CCM A;  1A0I A;  4LF9 L;  2LXJ A;  3GTO H;  1ONL A;  2BN4 A;  1GAW A;  2DJF C;  1YZ6 A;  3WOF A;  5AJ3 L;  2M2L A;  4MZ9 A;  1I5F A;  1I94 L;  5HGQ A;  3PA2 A;  4A3J H;  1E3X A;  2I1L A;  5IWA Q;  3KEW A;  1BQE A;  4NBS A;  1TWC B;  5ELO A;  5K36 G;  5IYB G;  3WOE A;  1EQR A;  2WB1 B;  4FNF A;  5IT9 c;  4BY1 H;  1YNJ D;  1NMG A;  4JCV E;  1K0S A;  3A8J E;  1PMR A;  2BOS A;  4IW3 B;  4R1J A;  2K5N A;  3NTI A;  1YJ9 A;  5M5W B;  3J81 c;  2NTS A;  1I7P A;  3LNN A;  3GIR A;  3GTK H;  4A76 A;  4LUO A;  1CM9 A;  1V1P B;  4X7D A;  2UXB Q;  2NBF A;  2B2Y A;  2MGS A;  3CMA A;  3TDQ A;  3OW2 A;  1VQP A;  5JEA H;  4E0F A;  3OZU A;  1C48 A;  2RQX A;  4XM3 A;  1B8A A;  3NTH A;  3CW2 C;  4RMF A;  2X6L A;  3ND8 A;  4M4S A;  3KLW A;  1S3O A;  5C4X G;  4R71 A;  1K0R A;  4FF1 A;  4HSP A;  1GHK A;  4G7X A;  3JQQ A;  1N05 A;  3J81 k;  1MBY A;  2K5D A;  3J7A V;  3K8A A;  3NWS A;  3RZD H;  2KHI A;  2E2D C;  1RQR A;  3N52 A;  1A62 A;  3G7L A;  3WBK A;  1DOM A;  2KCT A;  4GZY C;  2CH4 A;  1CKN A;  4A3D G;  1DGS A;  1SEB D;  1S0U A;  1IYU A;  3SLD A;  2HCJ B;  3T56 B;  4AF7 A;  3F2C A;  4A3G G;  1HZB A;  2QGG A;  4EQO A;  2R3Z A;  2BM0 A;  2WJY A;  3CCR A;  4DKA C;  5DNF A;  1KRS A;  5J3O A;  5CYU A;  5E7N A;  3SDZ A;  2R61 A;  1GUN A;  2F0E A;  4DK0 A;  3I8Z A;  4JI1 L;  4KJO A;  2EYO A;  4NDX A;  2DN8 A;  2AQ1 B;  2N78 A;  3K7A B;  1IBK L;  4JBM A;  1T6Y A;  1NR4 A;  4Z4W A;  3E5S A;  1COW A;  3WBJ A;  4AYB E;  1HFN A;  1ESF A;  2Z6B A;  3CXC A;  4TMV A;  1YJN A;  1SE2 A;  1DG1 G;  3VO1 A;  4V0B A;  1G8Z D;  1I4R A;  2R93 B;  1U4L A;  3CXC B;  3MEF A;  4I7A A;  5H59 A;  4BA2 I;  2A73 B;  2CQO A;  2OBT A;  3CMM A;  3W2F A;  3J80 E;  1BCP D;  3I90 A;  1D8T A;  1Y8O B;  2XVS A;  2N3S A;  3T51 B;  3M7G A;  3RLN A;  4QQB X;  1GR1 A;  5E3F A;  2F4V L;  2K7V A;  4L8J A;  2WII B;  3J81 L;  2LKV A;  1D1K A;  2ZXI A;  3QFS A;  3BCD A;  5DLQ E;  2F0Q A;  2RC6 A;  4BBR B;  4OO1 I;  2RSN A;  2BA1 A;  3UDF A;  1WI5 A;  1RD9 D;  1VQG A;  4LBY A;  4GLV B;  1XNR L;  4A93 H;  1UMK A;  3Q6Q A;  4ZLT F;  1HNZ L;  5FLX c;  1BBX C;  3OHX C;  3E0J A;  3A35 A;  4A3B H;  2QGQ A;  4JW0 A;  4PC3 A;  3QO2 A;  2B63 B;  3CPW B;  1JQY D;  1MD2 D;  5IYC G;  2NVY H;  2HCI A;  1FNV A;  3OMG A;  4OO1 H;  3WWV A;  2MPM A;  3PA1 A;  1VQB A;  1LT6 D;  1CT1 D;  1I50 H;  2Q2I A;  4BY7 G;  3AGP A;  2VW9 A;  3S1R H;  2O5J C;  4KK7 A;  1FRN A;  2LSS A;  4DV4 L;  2BE5 D;  4N9P A;  3CTA A;  1Y8N B;  4XQF A;  5CGK A;  4FP5 D;  1PKV A;  4OEM B;  1Q9S A;  2NZH A;  4X62 L;  3FRP B;  5J22 A;  4JI5 Q;  4QVJ A;  2ZL6 A;  2AHO A;  5C6A A;  3F8T A;  1G6P A;  3D4R A;  1Q46 A;  1PJ7 A;  4DR2 L;  4LFC L;  2ZJQ A;  4PC7 A;  4BY7 H;  4B08 A;  1YJW A;  4GOP A;  4A3L G;  2ZXH A;  1FX0 A;  4ACB A;  1STE A;  1ET6 A;  1ML0 D;  2KUM A;  2EYM A;  1K3R A;  1SE4 A;  2CFM A;  4LBW A;  1Y1V H;  1H8E A;  1BLI A;  3G6E A;  1G6Z A;  1VF7 A;  4ZGN B;  3K0X A;  3OJX A;  3P27 A;  4LF5 L;  4ODG A;  2UUA Q;  1QUF A;  3D4D A;  3PSI A;  3ONY A;  4A3F G;  1X55 A;  3CCE B;  1LTL A;  1WOC A;  4R4O A;  5C0X J;  1XPR A;  1E22 A;  4JI7 L;  2UXD Q;  3CC2 B;  2AQ3 B;  2NB0 A;  3CKI B;  4LUZ A;  3JQR A;  2F0O A;  3HOW B;  1HHV A;  3CCR B;  2ZXR A;  3GVJ A;  4KKU A;  1R5O A;  1CTM A;  2VS1 A;  1CQX A;  4B43 A;  2GRE A;  5FO9 B;  4DAP A;  4ME3 A;  3CCJ B;  2VBV A;  2N49 A;  4LF4 L;  1Y69 U;  4J0Q A;  1WTR A;  3Q6R A;  1XFO A;  2G9D A;  1VJS A;  2KVM A;  4H44 C;  2F0U A;  1E2Z A;  3FJO A;  1HZC A;  4YCU A;  1IYV A;  2Q6L A;  2QN6 A;  4OPO A;  5TRD A;  3NXW A;  4GN4 B;  1E79 A;  4YCW A;  2XZL A;  4YHH L;  1QVG A;  2QE7 A;  5IOD A;  1ILP A;  4X3T A;  1DCZ A;  1S5F D;  3KYH C;  2LY7 A;  4RCN A;  2VNK A;  3GVK A;  2K4K A;  2RF4 A;  4HIO A;  2CF4 A;  3NK9 A;  3U9O A;  1MI2 A;  1AP0 A;  2DJG C;  2PMD A;  1MIU A;  1STB A;  4AIM A;  1U5K A;  1ILQ A;  3K7A H;  2AKW B;  3MXN A;  3R8B A;  1HQR D;  4OXP A;  5CV7 A;  1E1Q A;  1J8I A;  4L5T A;  4UZU A;  4BPR A;  1A63 A;  3B8H A;  3AFQ A;  2M00 A;  4OIJ A;  1B9M A;  3KLR A;  2R7Z G;  4B3F X;  2CVR A;  2TSS A;  4XOP A;  4MTK A;  2WZN A;  1PTO D;  4HR7 B;  2X6X A;  1A8P A;  4H9G A;  4OIK A;  1W34 A;  3J80 i;  4BBR H;  2RVL A;  5HUR A;  1J5E Q;  4Y9R A;  2QIL A;  2PI2 A;  3P75 A;  4C3I H;  2JN4 A;  3JQP A;  1TWF H;  4K5W A;  1S5C D;  3T13 A;  1ZM4 A;  3NP8 A;  2JA8 G;  1R4Q B;  3SJP A;  2SNS A;  4RCO A;  4XON A;  3SK6 A;  1GUW A;  4X66 Q;  2NVT H;  1ZEQ X;  4TSS A;  1L0W A;  1XE1 A;  1HXY D;  1ENC A;  3G05 A;  4I7Z C;  1W3S A;  2DET A;  3RD4 A;  1WD0 A;  1HNW Q;  4B9X A;  3E1Y E;  5F4O A;  1H9S B;  4WOR A;  3JC6 6;  4X7E A;  1B50 A;  1X54 A;  3V76 A;  4XLC A;  3A5Z B;  1VQM A;  3STB C;  1N9W A;  1FD7 D;  3A7A B;  3FPP A;  1VQM B;  5M3F B;  3H3V C;  3OFN A;  1ASZ A;  3V05 A;  1FNB A;  1KZL A;  1IBM Q;  1ASY A;  1EYD A;  1N07 A;  1CHP D;  3UDI A;  2O4X A;  2EY5 A;  2B3G A;  3KUP A;  1TWH B;  5KNB A;  1SNO A;  4IPG A;  1B53 A;  1KRH A;  1PTO H;  3ICE A;  3TP7 A;  1HJP A;  5DS0 A;  3J7Y W;  1YJW B;  5LMU L;  1WTV A;  1G51 A;  2OBS A;  1UE1 A;  5FLX L;  1VQ7 B;  1EU4 A;  4HJ5 A;  4B3X A;  1PJ6 A;  1ICF B;  1VQ7 A;  1TY0 A;  3C1E A;  4TRD A;  4LF6 L;  1RKN A;  4IJH A;  3W2D A;  2BDN A;  1M90 C;  1YEZ A;  4LNQ A;  1WU8 A;  2UUB L;  5IGF A;  1LAB A;  3IFD A;  3RNU A;  4BXX H;  4E6I A;  2OCE A;  1Q3L A;  4A3L H;  3V2T A;  1KAW A;  1I6H B;  2GK7 A;  1SDF A;  3L3O C;  4OPS A;  5EBC A;  5EKL A;  1QZH A;  2VL6 A;  2R92 G;  2CK3 A;  1TWA H;  1U4P A;  4X06 A;  1KLU D;  4KN7 C;  2EYP A;  2F4N A;  1XXG A;  3K7U C;  3S1M H;  1VMC A;  3NBI A;  3MXG A;  4M53 A;  2HIV A;  3K6O A;  4JOI A;  2CC2 A;  4YAW A;  1N32 L;  2ZBV A;  5M3M H;  2ICE C;  1NY4 A;  1DYQ A;  1EWY A;  5JPN C;  5FA6 A;  1STH A;  2W6I A;  1PFM A;  4JYA Q;  2A8V A;  2JJ2 A;  5FO1 A;  5GV7 A;  1UNS A;  4F88 A;  1UD3 A;  2B2U C;  5THX A;  4A3K G;  1YI2 B;  5C44 H;  3OEH A;  1EQT A;  4A3E B;  3T16 A;  3GTJ H;  1YHQ A;  3NEL A;  1D5X C;  2NV4 A;  5IGD A;  4LBV A;  3OYY A;  1EU3 A;  2I5L X;  1WSV A;  2WB1 G;  1QFZ A;  5BN3 A;  3PGZ A;  1VQ5 B;  4PAA A;  2H4O A;  2X8K A;  3BY1 A;  5I9O A;  2JA5 H;  3S2D B;  5D3I B;  4P73 A;  1IW7 C;  4RG1 A;  2OYN A;  5EPK A;  1VCI A;  4YXW A;  3AFP A;  5M5X H;  5C4Z A;  3ASQ A;  3EQL C;  4DGZ A;  3BH4 A;  1K3B C;  1OXX K;  3SJZ A;  5AJ3 Q;  2R6G A;  1Z7T A;  2PW5 A;  2F0N A;  2R7D A;  2LFN A;  1QG0 A;  1FGU A;  2J0T D;  5JBQ A;  3OMC A;  4R9W A;  1XPO A;  1F2M A;  5FLM G;  4LFB Q;  1X65 A;  4M1K A;  2OEO A;  3A56 A;  2ZTC A;  1R4P B;  2HQL A;  4JI4 L;  4RPD A;  2E2H H;  3K5N A;  1RTN A;  4J15 A;  5IT9 E;  1W87 A;  3AEV A;  1EIH A;  1W9X A;  3VA5 A;  1Q7Y C;  4PC6 A;  4C0S A;  4A3I H;  4CDD C;  1KK0 A;  3GO5 A;  3PF5 A;  1FVI A;  2Q8I B;  2JN9 A;  1F9P A;  3QOJ A;  4RAU C;  4HE6 A;  4NCN A;  1EYG A;  1JR0 D;  3DWQ A;  1LTT D;  1HR0 W;  3E0E A;  4A3G B;  3BVG A;  1VQ4 A;  5DM6 3;  1EYA A;  4IUV A;  1EFR A;  4DN4 M;  4ZV4 A;  1X32 A;  3PUZ A;  2KCC A;  5KND A;  4ROX A;  2ZIT A;  3AST A;  4A3G H;  1PH5 A;  2CW0 D;  3SGI A;  4C3I G;  3Q22 A;  4DR7 Q;  5EGT A;  4FK8 A;  4Y52 H;  1CNF A;  1VQ8 B;  2DEU A;  2PZU A;  4RA8 A;  2Q8R E;  3I4N G;  3GP7 A;  1JJC B;  2ATW A;  3VYR A;  4P26 A;  4CDE C;  2R93 G;  1PYB A;  1CKM A;  2ZT9 C;  3HKZ G;  4N9T A;  3P26 A;  5M5Y B;  4XKV A;  1TVX A;  3QFT A;  1SBB B;  4P6V F;  3NQT A;  4WZK A;  4M1U B;  3BS1 A;  1WTO A;  3KF8 A;  1WTW A;  1CKO A;  2B2T A;  3RZO B;  1CQF A;  1KNA A;  1I8D A;  4Z4S A;  2EYF A;  3KF6 A;  1LTG D;  4TT3 A;  4ID6 A;  4JI3 L;  3CU7 A;  1SND A;  1GXD C;  4M2L A;  2E76 C;  1K9M C;  1TWC H;  4NXM Q;  1VLY A;  3J81 i;  1TII D;  1XTD A;  4P71 A;  2DY1 A;  3LGJ A;  5IIF A;  4YHB A;  2FMC A;  3PIO 3;  4PAB A;  3CCU A;  1K28 D;  2PZW A;  1VLO A;  4N8F A;  2TMP A;  4AQY Q;  4XNF A;  4UAI A;  2GN5 A;  4LBZ A;  1K73 D;  4H13 C;  4A3J G;  1GVP A;  3QOL A;  3S16 H;  3Q3A A;  3BZC A;  5E4W C;  4XLE A;  3HKS A;  4IPC A;  3MXU A;  5CR3 A;  1M1K C;  3GTL H;  1Y14 B;  4WRD A;  4GOP B;  2B2V A;  4CJ2 C;  1KTK A;  2B29 A;  3R2I A;  3I72 A;  1Q1B A;  4YAL A;  2ZXO A;  4R8N A;  1VF5 C;  4XIG S;  1HR0 Q;  1OXT A;  4XN0 A;  2WAQ G;  3K81 C;  3M7N A;  3HOY B;  3DWA A;  3B78 A;  3H6M A;  5L46 A;  4LFA Q;  2D9U A;  4DR7 L;  1SLJ A;  4JOI C;  4A3M B;  2EZV A;  2A6E D;  1QIL A;  1HNX L;  3AVX A;  5A8A A;  3D3R A;  2V31 A;  4QMG A;  1E63 A;  3HOU B;  4XTC S;  1NJI C;  1N34 L;  2XND A;  3U2Q A;  5KYL A;  3OKX A;  1U4R A;  1TKW B;  2WKD A;  2OQ0 A;  5C0X H;  2ALY B;  5C44 B;  1XTC D;  2K05 A;  4A3M H;  1XPU A;  3I55 A;  3SLN A;  3W5H A;  3CMA B;  4ZGQ B;  2IX3 A;  4NXN Q;  3R3O A;  3ZZT A; 
#chains in the Genus database with same CATH homology
 1HFG A;  5COY A;  2JSO A;  1I4G A;  3OE7 A;  1ZXT A;  2V7Q A;  4HMI A;  3SR1 A;  1QG7 A;  5CBA E;  4AVZ A;  2WV6 D;  4BS9 A;  2DNE A;  3C1F A;  2JYO A;  1WPC A;  3H09 A;  3L9A X;  1R9T B;  2HCC A;  2NYZ D;  3CHB D;  1SKY B;  4EVO A;  4HMJ A;  3TSS A;  4RHR A;  3BYT B;  4II2 A;  2QCP X;  3ZIA A;  2K01 A;  4S3S A;  4II3 A;  1SYC A;  4ILW A;  3DDY A;  1D2B A;  4Z1M A;  2L11 A;  1WTX A;  2RDF A;  1V43 A;  5LL6 X;  5TSS A;  4IFD J;  1HCZ A;  4XXE A;  4RH6 A;  2XSC A;  3MFY A;  1K8M A;  4OGQ C;  3K59 A;  1SYD A;  3OOC A;  2EPB A;  1QNU A;  4RGM A;  1I18 A;  1UAP A;  3SXH A;  1ET9 A;  2XOK A;  2B2Y C;  4QCL A;  1OXV A;  4FVM A;  5COR A;  4CJ1 B;  1LAC A;  2XIW A;  4IFD G;  1XX8 A;  1JC7 A;  4DK1 A;  4I65 A;  2X69 A;  4PMB A;  1UD8 A;  2GA4 B;  1RCV D;  2F3W A;  2KVO A;  1PTO F;  2XNA C;  2VUM B;  4NKL A;  5J39 A;  1EWH A;  3O13 A;  2EJM A;  1AW7 A;  2L5T A;  5FK9 C;  1Q90 A;  3QIA A;  5CV4 A;  3HOX B;  5FLX E;  4C56 C;  2D3L A;  1SYE A;  4G7W A;  4GQN A;  4K2K A;  1EEI D;  1KDB A;  5C3X A;  4K8I A;  4KV6 A;  1MGS A;  5K36 H;  3FMC A;  2L4N A;  4KN4 C;  2NUC A;  3FPU B;  1SYB A;  4HN7 A;  1KAA A;  1LT3 D;  2IX0 A;  4PMC A;  4FF2 A;  1BCP B;  3CRK C;  4XQN A;  4QUF A;  3JAM L;  1WTQ A;  2YYZ A;  1FNU A;  5C3W A;  1V8Q A;  2AQ2 B;  2PPB C;  1B9N A;  3M85 A;  4K6D A;  2F3V A;  5M9O A;  5CDF A;  1EY9 A;  4C1N I;  1HA6 A;  1EY0 A;  3KK7 A;  4ME5 A;  2Q8T A;  3Q24 A;  4B3G A;  4J6H A;  2R92 B;  3H0G B;  1GJX A;  4U67 3;  1SSO A;  3CQZ B;  2PMZ B;  4XLH A;  3BDC A;  5J1Z A;  2JDI A;  1AZP A;  2F0P A;  4BA1 I;  2F0D A;  1JB3 A;  2I07 B;  3W3A A;  4G7Z C;  2CHB D;  1EEF D;  2K1B A;  1PXU A;  3SE0 A;  3J7A F;  4KD4 A;  2VXW A;  4TQU S;  1PFN A;  3CP8 A;  4EGV A;  3S16 B;  1G2S A;  4BBS B;  5ELF A;  3GTO B;  3LX0 A;  1B2T A;  2PYK A;  3BVZ A;  1O7Y A;  1DOL A;  3D4W A;  1TWA B;  3AB9 A;  5KRU A;  2VB2 X;  3EA6 A;  2ZTG A;  2F0H A;  3GD7 A;  5IGE A;  1X3Q A;  4QB4 A;  3MVV A;  3P1H A;  2HDM A;  1QNK A;  3TP5 A;  2K03 A;  1BO0 A;  1JWM D;  3NWT A;  1T5E A;  3GTL B;  5I2X A;  1ZKO A;  4PQX A;  4DU9 A;  1PRT D;  1JIC A;  4G7O C;  1E2W A;  1E2V A;  2J4X A;  1SNM A;  2RBM A;  2VNU D;  1D5M C;  2L9H A;  3S17 B;  3X3M A;  5HGT A;  4A3D B;  1CQV A;  2XZO A;  2M9V A;  2GJR A;  4DA2 A;  4CBV A;  3T53 B;  5IK2 A;  1F2L A;  1MSG A;  3HP3 A;  4JK1 C;  1BCP F;  5I4D A;  3N6R A;  2E2H B;  1PYW D;  4XOT A;  1SFO B;  3P7J A;  5IGG A;  4HCE A;  1SNC A;  1S5D D;  1OXS C;  1A2U A;  4HTH A;  3MAQ A;  1UD5 A;  5DEH A;  2VJJ A;  4Z9C B;  2JE6 I;  2I46 A;  3M4Y A;  1I4Q A;  4L6T B;  1NRK A;  3VR6 A;  2E2I B;  1S5B D;  4FYD A;  2Z4H A;  4LK1 C;  1XYI A;  3BVM A;  5BN4 A;  1UEA B;  4AYB B;  2F0G A;  1SYF A;  2GJP A;  1EZ6 A;  1LTS D;  3AMU A;  5EKK A;  2ZZG A;  2ZXP A;  3OAA A;  2PO4 A;  1IHZ A;  1YNN D;  1HZE A;  4HIZ A;  1EY4 A;  5C4J B;  3H94 A;  5CC4 A;  1PTO C;  1F9R A;  4ZAI A;  1VMP A;  4K6L A;  2KHS A;  5JAV A;  1H9M A;  4RFB A;  1BF4 A;  2FIN B;  3GTM B;  5JPM C;  1RF2 D;  4DXF A;  1TY2 A;  5NUC A;  2AUJ D;  5A2Q E;  3GTQ B;  1EY5 A;  1Y8P B;  1SE3 A;  3DWP A;  2PNR C;  2XGJ A;  3MFG A;  1EY7 A;  1K8O A;  5KIX A;  5IGC A;  2EJF C;  3A8K E;  1ZYR C;  1QCB D;  3HEJ A;  3SVM A;  3I73 A;  4FXK C;  4DAV A;  4IN3 A;  1WTP A;  4CHT B;  3TZU A;  2JA7 B;  3F2U A;  5CBE E;  4RHS A;  3NQI A;  2D5D A;  5D3D A;  4XQJ A;  4A3K B;  3OEE A;  1EFI D;  4XYQ A;  2X85 A;  4OHJ A;  5FO8 B;  2QKI C;  4OL7 A;  1OO9 B;  3RMH A;  1IL8 A;  3FDT A;  2KEE A;  3GV3 A;  2ZTN A;  1D1I A;  2GK6 A;  4K5V A;  1A15 A;  1EOT A;  5DM7 3;  2NZ1 D;  4XLF A;  5CMD A;  1IKM A;  4BY1 B;  3JU4 A;  3ERO A;  2WIN B;  5FL7 A;  1OXU A;  3V96 A;  4XKW A;  3NSW A;  4IUU A;  1GHJ A;  3VA7 A;  5C3E B;  2F0J A;  5C0X G;  3OPO A;  4O1N A;  1BDO A;  4IUR A;  3GVL A;  3MZ5 A;  5IGB A;  2L12 A;  2N55 A;  1F2Z A;  1KAB A;  4J1M A;  4CKC A;  1RHP A;  3FKI B;  1F9Q A;  3PUY A;  1TS2 A;  3D8G A;  2PQE A;  4P2C B;  4KJN A;  1PZI D;  3A55 A;  2F0W A;  2WSS A;  4KY7 A;  1EQV A;  2IJ0 A;  1H9S A;  4RGN A;  2HDL A;  1IW7 D;  1V1P A;  3HKZ B;  1BXT A;  1GOZ A;  4XL9 A;  4FF3 A;  2IX1 A;  1II3 A;  2EDG A;  4MHE A;  2B2V C;  4C3H G;  2L0C A;  3A54 A;  3PUV A;  4C3J B;  5ELB A;  1U4M A;  2WPD A;  1Z6H A;  3G6J B;  4HED A;  1PRT C;  3P20 A;  2F0V A;  3NBH A;  2JEB I;  2O5I C;  1QJO A;  2C5C A;  4IUT A;  5C5M A;  1O78 A;  3D6C A;  2WAQ B;  3TBI B;  1GUO A;  2NN6 I;  3S15 B;  2B2U A;  4ZUJ A;  4KMU C;  1LTR D;  3K0Y A;  5ISR A;  2BCO A;  2F0K A;  4RWS C;  1TWF B;  2M5S A;  1L0X B;  1BMF A;  1NCV A;  1PFB A;  1HPC A;  4LMQ D;  3IL8 A;  1W0K A;  1B4O A;  2OF1 A;  1ZYR D;  4TSF A;  1STY A;  2B2W C;  2F1M A;  1LTA D;  1RJT A;  1NUC A;  2HUG A;  3CES A;  4K14 A;  1W6J A;  2JA5 B;  3PUW A;  4HCS A;  2FJ2 A;  3K58 A;  4PV1 C;  1FNW A;  5BN5 A;  3KBX A;  3HGB A;  4NP5 A;  2K04 A;  2F03 A;  3MC0 B;  2QEJ C;  4IAL A;  4XQQ A;  1SNQ A;  4YEL A;  1JOK A;  1ROD A;  2NN6 G;  2E1B A;  4YEJ A;  3S1M B;  1NAP A;  3DEP A;  5EPJ A;  3D6W A;  3SK5 A;  3ERQ A;  3PIP 3;  5A35 A;  3S1Q B;  2NVX B;  3MWY W;  1SJE D;  2MJ8 A;  2YU9 B;  4F87 A;  2B39 A;  1O80 A;  4ABN A;  2EYJ A;  4ZRZ A;  1Y1W B;  4IUQ A;  5C5L A;  1FYC A;  3M4O B;  1I6V C;  1DON A;  1T5X D;  1A2T A;  3BDL A;  4G6I A;  1JOO A;  2B8G A;  1HQM C;  1PTO B;  4UDU C;  4ASU A;  3R2T A;  2BDO A;  4YIJ A;  2L1B A;  3A8I E;  1ENA A;  2B2T C;  1RDP D;  5I2Y A;  2X53 S;  3SEB A;  4CGY B;  2KA7 A;  5KYI A;  5EPL A;  1QB5 D;  3PMF A;  2BA0 A;  2L55 A;  1V1O A;  1F77 A;  5A2Q L;  3DMU A;  1DD2 A;  2LS0 1;  1FGB D;  3VR2 A;  1AZQ A;  4ZQ3 A;  2NN6 H;  3FKS A;  3BDO A;  4Y7N B;  2K33 A;  3T4A C;  3HRZ C;  3HOZ B;  2SDF A;  4X3S A;  2A6E C;  5KNC A;  2HQE A;  5JVG 3;  5CV5 A;  4WFN 3;  3A3B A;  3QG1 A;  2XZP A;  4ZUI A;  2VJI A;  3BG3 A;  3D31 A;  1E1R A;  1EL0 A;  2WZP P;  2IL8 A;  2B2W A;  3CRL C;  3MA2 B;  4TKO B;  2EOT A;  2WKC A;  1I4H A;  2A6H D;  3C3L A;  1Q12 A;  4IUP A;  3BZD B;  2OXP A;  4IZ8 A;  3C2P A;  4BWG B;  2AWN A;  1LT5 D;  2C9O A;  5DN6 A;  3GV6 A;  1U9R A;  3I70 A;  4PNY A;  3S1R B;  5D65 A;  3IAY A;  1G2T A;  2X6G A;  3JAM E;  1NSN S;  4XOR A;  1O7L A;  1JOR A;  3GTG B;  2FMM A;  2KED A;  1CZW A;  2RDH A;  1A3V A;  4A3B B;  2MP1 A;  5ELC A;  2WAC A;  3GTK B;  1A6X A;  1XWE A;  4FXG C;  1UD4 A;  1EYC A;  4DNT B;  1Z47 A;  2PCF B;  3PUX A;  2OT2 A;  4CKB A;  3NE5 B;  1C8C A;  3ZPN A;  3KBG A;  1WCM B;  2E74 C;  3A3G A;  2XN9 C;  2E2J B;  3RZD B;  4LJZ C;  1SYG A;  2Z6B D;  2A6H C;  2G9H D;  3FVQ A;  2DIE A;  1D6E C;  2JA6 B;  1DJR D;  5FOB B;  1TT2 A;  1LT4 D;  4H7B A;  1STN A;  4K2L A;  1RTO A;  2D62 A;  4V19 0;  2QF7 A;  1B3A A;  1OB0 A;  1MSH A;  5I9P A;  4OO1 G;  4IFD I;  4F8M A;  1L0Y B;  2DY8 A;  1LTB D;  2K32 A;  4KTA A;  1H9J A;  3E6Z X;  5T1G A;  3VR4 A;  1TQO A;  2F43 A;  3S2H B;  2Y0S B;  1DZ1 A;  4XR6 A;  4XT1 B;  3OSO A;  4IFD H;  3Q6S A;  1TU2 B;  4QUC A;  2IPK D;  1HA5 A;  4HSV A;  4M8A A;  3TP8 A;  4FXU A;  3AU7 A;  3U9S A;  2FFK B;  4A3I B;  1KDC A;  2IWH A;  3IKJ A;  1W0J A;  1JE4 A;  1M8A A;  3RLF A;  4KHZ A;  3GTP B;  2D3N A;  5JEA J;  4HAE A;  3DUZ A;  3C46 A;  1BPL A;  1H9K A;  2E75 C;  2A69 C;  1AEX A;  2JEA I;  2LMC B;  4CJ0 B;  1JWU D;  2EJG C;  3I4M B;  4QIW B;  5EJW A;  4RKL A;  1EIG A;  1BOS A;  1CA6 A;  3NTK A;  4KHV A;  3VR3 A;  4RGT A;  1G91 A;  2O2L D;  1CHQ D;  3EJI A;  1STA A;  1V0E A;  1B44 D;  2CQA A;  1H8H A;  2W6J A;  2MHV A;  2NVQ B;  3ZYY X;  3OW7 A;  3K5L A;  3L7Z C;  2ID0 A;  4QF4 A;  3J80 L;  3S14 B;  1M4V A;  2F0T A;  5G3L D;  2ZZQ A;  3S9W A;  2A68 C;  5KNL A;  1H9R A;  5ELD A;  4X3U A;  1EY6 A;  2A69 D;  2RSO A;  3URY A;  1BCP C;  2F0F A;  2K6A A;  5C0X I;  1BQQ T;  3KLS X;  4KY5 A;  4XN3 A;  3MTS A;  1V0F A;  2HLD A;  4Q0F A;  5G3L F;  3I3C A;  1WVL A;  3NHH A;  1AN8 A;  3ITP A;  1TR5 A;  1PZJ D;  5CV6 A;  4A3F B;  2NWG A;  2XRQ D;  1JOQ A;  2VB3 X;  2ICI A;  3K5M A;  5M3M B;  5FO7 B;  2D2C C;  4NMZ A;  2F0M A;  5I6W A;  2A68 D;  1E3Z A;  3Q23 A;  1E43 A;  5M5X B;  3UI2 A;  2Z1C A;  1ESR A;  2ZZE A;  3I91 A;  3OIQ A;  5DAU A;  4K5X A;  4KD3 A;  4ZYS A;  1FR3 A;  3K57 A;  1MAB A;  3IFT A;  5I6Y A;  2JA8 B;  5KGU A;  4IQZ A;  1QOH A;  1KLG D;  4ZKC B;  2DY7 A;  1LV9 A;  1KDA A;  4C3I B;  2KQ3 A;  2V4D A;  2R7Z B;  2F4I A;  4ULL A;  1HRJ A;  2QDB A;  3PO3 B;  2MUY A;  4ZK9 B;  4C3H B;  3VYS A;  3SK8 A;  3I4N B;  1Q8I A;  4C3J G;  3ONA B;  4ZKB B;  1I50 B;  4X3K A;  4DNR B;  1GUS A;  4C1N K;  3S1N B;  3MEH A;  3TP6 A;  3DM1 A;  2K5Q A;  1HUN A;  3Q0A A;  1PLF A;  2XWJ B;  1KMH A;  2AWO A;  3LWU A;  2NVT B;  3VYT A;  1SMY D;  1I4P A;  1BR9 A;  4G4K A;  4BY7 B;  4A3J B;  5ELE A;  1D5Z C;  3FEW X;  5FKA C;  3DHQ A;  1NBM A;  5E4X A;  3HS0 C;  4JBW A;  2BE5 C;  2EY2 A;  4NNJ A;  3HZX A;  4P22 A;  3HAG A;  2JP1 A;  5D14 A;  2X6Y A;  1G29 1;  4KY6 A;  4CKE A;  2RKS A;  3OIP A;  4B9W A;  3WQZ A;  1YNJ C;  2F0S A;  1HTP A;  1UD2 A;  2EYH A;  5KEE A;  3R93 A;  3PO2 B;  1HUM A;  1E0B A;  1Y1V B;  4K8J A;  2CW0 C;  3TZD A;  4RKB A;  2Z4I A;  2B8F A;  4MN3 A;  1Q1E A;  1STG A;  1C4Q A;  2A74 C;  2KEC A;  5JEA G;  3KLS A;  3HOV B;  4KI0 A;  1A3T A;  2SOB A;  1I4X A;  3SHL A;  1S5E D;  1SXT A;  4KKS A;  2GJK A;  4L63 B;  1GUT A;  1QWY A;  4J8Q A;  3DEO A;  4F7X A;  1HVX A;  2R9V A;  3TN2 A;  2JXM B;  3MHB A;  1O7Z A;  5C4H A;  4U68 A;  3OWE B;  1LLR D;  1CFM A;  4XD7 A;  5AFW A;  4XDX A;  3A7L A;  1VDZ A;  1QE6 A;  4A93 B;  4DFA A;  1BUV T;  2LZJ A;  3QWN A;  2DNC A;  1CZG A;  4NW2 A;  2ENB A;  2NTT A;  4WJW A;  3K5O A;  2K5W A;  4XLA A;  3CP2 A;  1SAP A;  2H1E A;  2EY6 A;  3X3N A;  1X3P A;  2NVY B;  1EY8 A;  2RDG A;  5EKI A;  1K83 B;  4MIU A;  2EXZ A;  1ICW A;  3BCF A;  1B1Z A;  3H91 A;  1TS4 A;  2KCN A;  2WP8 J;  4EQN A;  5EBD A;  4C2M B;  1EZ8 A;  1NR2 A;  1ENF A;  1DM0 B;  1EWC A;  1I3Q B;  5C4X B;  2IT1 A;  3PV0 A;  1CK1 A;  4G7H C;  3DXJ C;  1AFP A;  4FF4 A;  1PRT F;  1PRT B;  2ZZF A;  3SK4 A;  2X6W A;  3I4L A;  1DOK A;  5JVH 3;  1UD6 A;  2SNM A;  1JWS D;  3HG9 A;  5IT9 L;  4XYO A;  4FO2 A;  1W6K A;  5CV8 A;  1GUG A;  1YNN C;  2KOL A;  1KNE A;  3ND9 A;  3VR5 A;  3GQB A;  2PW7 A;  2RA4 A;  1LO5 D;  3WDN A;  4JMQ A;  5IOC A;  3J81 E;  5E1F A;  2XWB B;  5LHY 1;  4PMW A;  3BYY B;  1SMY C;  4DXG A;  4KKT A;  3TME A;  4IUN A;  2WJV A;  1TWG B;  3MXP A;  2JJ1 A;  5F2D A;  1J9O A;  4O42 A;  2F0I A;  4DF7 A;  2JIZ A;  2PZT A;  3QJY A;  1F9S A;  1CI3 M;  2XRS D;  4G57 A;  4LAA A;  1BNZ A;  2Z8L A;  1WD1 A;  1S4Z A;  5T1I A;  1A3U A;  3EVQ A;  5HKK A;  1F2Y A;  1UUP A;  3RUZ A;  4EQP A;  1SJH D;  2EVB A;  2J7Z A;  2EE1 A;  3NUC A;  5EQ0 A;  4XMY A;  1DXM A;  1TS3 A;  1SNP A;  2F0L A;  2KJX A;  2FHT A;  4RGO S;  3LWE A;  1PDQ A;  3QB3 A;  1WP6 A;  1IKL A;  3NPP A;  4DAY A;  5LL6 S;  5JOB A;  1LTI D;  4Q5V A;  3GTJ B;  3M3Y B;  1WTH D;  2IW3 A;  2SEB D;  2EY1 A;  5CV9 A;  2N88 A;  4R8I A;  3BC9 A;  4H0L C;  2A5H A;  1JCK B;  2AUK A;  2K28 A;  3VYU A;  5JJZ A;  4XT3 B;  1PZK D;  1HTL D;  4FXD A;  3EFX D;  3OWF A;  2EYL A;  1TS5 A;  5K5P A;  1ONL A;  3WOF A;  2M2L A;  1E3X A;  3KEW A;  1TWC B;  5K36 G;  3WOE A;  2WB1 B;  4FNF A;  1YNJ D;  3A8J E;  1PMR A;  2BOS A;  3NTI A;  5M5W B;  2NTS A;  3LNN A;  1CM9 A;  1V1P B;  2NBF A;  2B2Y A;  2MGS A;  3TDQ A;  5JEA H;  4E0F A;  1C48 A;  2RQX A;  4XM3 A;  3NTH A;  2X6L A;  3ND8 A;  4FF1 A;  4HSP A;  1GHK A;  4G7X A;  2K5D A;  1MBY A;  3J7A V;  3NWS A;  2E2D C;  3N52 A;  3G7L A;  1DOM A;  4GZY C;  1SEB D;  1IYU A;  3T56 B;  4EQO A;  2R3Z A;  2WJY A;  5DNF A;  5CYU A;  3SDZ A;  2R61 A;  1GUN A;  2F0E A;  4DK0 A;  3I8Z A;  4KJO A;  2EYO A;  4NDX A;  2DN8 A;  2AQ1 B;  3K7A B;  1NR4 A;  3E5S A;  1COW A;  1HFN A;  1ESF A;  1SE2 A;  4V0B A;  1G8Z D;  1I4R A;  2R93 B;  1U4L A;  4BA2 I;  2A73 B;  3CMM A;  3J80 E;  1BCP D;  3I90 A;  1Y8O B;  2XVS A;  3T51 B;  3M7G A;  5E3F A;  2K7V A;  4L8J A;  2WII B;  3J81 L;  2LKV A;  1D1K A;  2ZXI A;  3BCD A;  2F0Q A;  4BBR B;  4OO1 I;  2RSN A;  2BA1 A;  1RD9 D;  4ZLT F;  1BBX C;  3OHX C;  3E0J A;  3A35 A;  3QO2 A;  2B63 B;  1JQY D;  1MD2 D;  2HCI A;  1FNV A;  3OMG A;  4OO1 H;  2MPM A;  1LT6 D;  1CT1 D;  2O5J C;  4KK7 A;  2BE5 D;  4N9P A;  1Y8N B;  4XQF A;  5CGK A;  4FP5 D;  1PKV A;  3FRP B;  5J22 A;  5C6A A;  3D4R A;  4B08 A;  2ZXH A;  1FX0 A;  1STE A;  1ET6 A;  1ML0 D;  2KUM A;  2EYM A;  1SE4 A;  1H8E A;  1BLI A;  1G6Z A;  1VF7 A;  4ODG A;  3D4D A;  5C0X J;  2AQ3 B;  2NB0 A;  3CKI B;  2F0O A;  3HOW B;  1HHV A;  2ZXR A;  3GVJ A;  4KKU A;  1CTM A;  5FO9 B;  4DAP A;  1Y69 U;  1WTR A;  2G9D A;  1VJS A;  2KVM A;  4H44 C;  2F0U A;  1E2Z A;  1IYV A;  3NXW A;  1CA5 A;  1E79 A;  2XZL A;  2QE7 A;  5IOD A;  1ILP A;  4X3T A;  1DCZ A;  1S5F D;  2LY7 A;  4RCN A;  3GVK A;  3NK9 A;  3U9O A;  1MI2 A;  1AP0 A;  1STB A;  1ILQ A;  3MXN A;  3R8B A;  1HQR D;  5CV7 A;  1E1Q A;  1J8I A;  4UZU A;  4OIJ A;  2M00 A;  1B9M A;  3KLR A;  4B3F X;  2CVR A;  2TSS A;  4XOP A;  1PTO D;  4HR7 B;  2X6X A;  4OIK A;  2RVL A;  5HUR A;  2QIL A;  3P75 A;  4K5W A;  3T13 A;  1S5C D;  3NP8 A;  1GUW A;  1R4Q B;  2SNS A;  4RCO A;  3SK6 A;  4XON A;  1ZEQ X;  4TSS A;  1HXY D;  1ENC A;  3G05 A;  4I7Z C;  3RD4 A;  1WD0 A;  4B9X A;  1H9S B;  4WOR A;  1B50 A;  4XLC A;  1FD7 D;  3A7A B;  3FPP A;  3H3V C;  5M3F B;  3OFN A;  3V05 A;  1KZL A;  1EYD A;  1CHP D;  2O4X A;  2EY5 A;  3KUP A;  1TWH B;  5KNB A;  1SNO A;  1B53 A;  1PTO H;  3TP7 A;  3J7Y W;  1WTV A;  5FLX L;  1EU4 A;  1TY0 A;  3C1E A;  4TRD A;  1RKN A;  3W2D A;  2BDN A;  5IGF A;  1LAB A;  3IFD A;  4E6I A;  1Q3L A;  3V2T A;  1I6H B;  2GK7 A;  1SDF A;  3L3O C;  5EBC A;  5EKL A;  2CK3 A;  1U4P A;  1KLU D;  4KN7 C;  2EYP A;  1XXG A;  1VMC A;  3NBI A;  3MXG A;  3K6O A;  2ICE C;  1DYQ A;  5JPN C;  1STH A;  2W6I A;  1PFM A;  2JJ2 A;  1UNS A;  4F88 A;  1UD3 A;  2B2U C;  3OEH A;  1EQT A;  4A3E B;  3T16 A;  1D5X C;  5IGD A;  1EU3 A;  5BN3 A;  2H4O A;  2X8K A;  5I9O A;  3S2D B;  5D3I B;  1IW7 C;  5EPK A;  1VCI A;  4YXW A;  5C4Z A;  3EQL C;  4DGZ A;  3BH4 A;  1OXX K;  2R6G A;  1Z7T A;  2PW5 A;  2F0N A;  4R9W A;  3OMC A;  2LFN A;  2J0T D;  1F2M A;  2OEO A;  3A56 A;  1R4P B;  3K5N A;  1RTN A;  5IT9 E;  1EIH A;  1W9X A;  3VA5 A;  3GO5 A;  2Q8I B;  1F9P A;  3QOJ A;  4RAU C;  1JR0 D;  3DWQ A;  1LTT D;  4A3G B;  3BVG A;  5DM6 3;  1EYA A;  4IUV A;  1EFR A;  4DN4 M;  1X32 A;  3PUZ A;  2KCC A;  5KND A;  2CW0 D;  3Q22 A;  4C3I G;  5EGT A;  2PZU A;  4RA8 A;  2Q8R E;  3GP7 A;  3VYR A;  2ZT9 C;  4N9T A;  5M5Y B;  4XKV A;  1TVX A;  1SBB B;  3NQT A;  1WTO A;  4M1U B;  3BS1 A;  1WTW A;  3KF8 A;  2B2T A;  3RZO B;  1CQF A;  1KNA A;  1I8D A;  2EYF A;  4ID6 A;  1LTG D;  4TT3 A;  3CU7 A;  1SND A;  1GXD C;  2E76 C;  1VLY A;  1TII D;  5IIF A;  2FMC A;  3PIO 3;  1K28 D;  2PZW A;  2TMP A;  4XNF A;  4UAI A;  4H13 C;  3QOL A;  5E4W C;  4XLE A;  3MXU A;  5CR3 A;  4WRD A;  2B2V A;  4CJ2 C;  1KTK A;  3R2I A;  3I72 A;  1Q1B A;  2ZXO A;  4R8N A;  1VF5 C;  4XIG S;  4XN0 A;  1OXT A;  3M7N A;  3HOY B;  3DWA A;  3H6M A;  2D9U A;  4A3M B;  2EZV A;  2A6E D;  1QIL A;  3D3R A;  2V31 A;  4QMG A;  3HOU B;  4XTC S;  2XND A;  5KYL A;  1U4R A;  1TKW B;  2WKD A;  5C0X H;  5C44 B;  1XTC D;  2K05 A;  2IX3 A;  3R3O A;  1OHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...