5THXA

Crystal structure of a ferredoxin nadp+ reductase from neisseria gonorrhoeae with bound nadp and fad
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
257
structure length
257
Chain Sequence
AAFNTQKVLSVHHWTDAYFTFTCIRDESLRFENGQFVMVGLMADGKPLMRAYSVASANWEEHLEFFSIKVQDGPLTSRLQHLKVGDEVLISKKPTGTLVACDLNPGKHLYLLSTGTGIAPFLSITKDPEIYEQFEKIILVHGVRYKKDLAYYDRFTKELPEHEYLGDLVKEKLIYYPIVSREEFEHRGRLTDLMVSGKLFEDIGLPKINPQDDRAMLCGSPAMLKDTCKVLDDFGLTVSPKTGVRGDYLIERAFVDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a ferredoxin NADP+ reductase from Neisseria gonorrhoeae with bound NADP and FAD
rcsb
source organism Neisseria gonorrhoeae mia_2011_03-10
molecule tags Oxidoreductase
molecule keywords Ferredoxin--NADP reductase
total genus 84
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2016-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5thxA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 5thxA02
1JB9A 4UAJA 5GV7A 4PC2A 1D2EA 2QMUA 4LBZA 3CPWB 3CB4A 1XB2A 1ZM4A 4TMXA 2YWGA 2BPOA 1QFYA 3I1FA 3AVUA 3VNUA 1SM4A 3W2HA 1BX0A 3JQPA 4C43A 3VO1A 3W2FA 3AGPA 2VZLA 1YHQB 2QA4B 1KC8D 4FK8A 2R6HA 4QFMA 1QG0A 2BSAA 2VYQA 1BQEA 1EXMA 4NCNA 4PC7A 1D1NA 4ZCMA 4PGOA 2BGIA 1NDHA 2XNJA 2AHOA 1VQPB 3PENA 2HDNB 1VQ8B 2OK7A 1GAWA 2ZITA 3CCMB 2B7BA 4H9GA 2XNCA 4YAOA 2FX3A 3FJOA 1GR1A 1OB5A 2C77A 3WNCA 4ACBA 4N3GA 1GJRA 3CXCB 3W2GA 2PMDA 2PIAA 3CCLB 1GAQA 4B43A 4RJLA 1W87A 4RCZA 3WBJA 1VQLB 1OGJA 1JA1A 4P3YA 5TY0A 2VNHA 4YAUA 2J7KA 4DQLA 3CCEB 1DDGA 2GPJA 4AF7A 1KQSB 1G7CA 4RD3A 1F60A 1QGZA 1FNCA 1IJFA 1FRQA 4AC9A 2QN6A 1S0UA 5EMNA 3CCQB 1KTVA 4M4SA 1FDRA 1JNYA 1W34A 4K1XA 1CQXA 2B5OA 2RC6A 3QE2A 2PLFA 4PC3A 4YAWA 4LBWA 1KK2A 3CC4B 1K73D 1KD1D 1VQ5B 1EFUA 4ZGNB 3I56B 1KK1A 4YALA 3CC2B 3VO2A 1KJZA 1HA3A 4B3XA 4PC1A 4Q7JB 5H59A 4Y9UA 1E64A 1ZM9A 1QVGB 4J0QA 4F7DA 2DERA 3QFCA 2GQFA 3OZVA 1GO2A 2VNJA 1JJ2B 3ZBTA 2QTLA 1TLLA 5KSWB 1EP2B 1QFJA 1CNFA 4ZGQB 3LRXA 3CCJB 5HXBA 1R5BA 4PC6A 3U6KA 3AVTA 1G7RA 3I55B 1Q86D 3OZUA 2C78A 4ZCLA 4YHBA 1G7TA 1S72B 1TUIA 1TTTA 3A1FA 3ZBUA 4TMTA 2OTLB 1KK3A 1YIJB 4U9UA 1QFZA 4DQKA 3OZWA 3QSYA 3CRZA 4AF6A 4RD6A 2D74A 1ELOA 1A8PA 1N0UA 3ZC3A 2BN4A 1TVCA 3QFTA 4IW3B 3G71B 4ZV4A 3ES9A 3W5UA 4N3NA 2B7CA 3AVVA 1EFCA 3J81k 3P26A 1IJEA 4YAFA 1J9ZA 4HE5A 1OB2A 1IB0A 1JA0A 4WQMA 5FA6A 3V76A 4C0SA 2YWHA 3QFSA 2RC5A 2DEUA 2OK8A 1DARA 3CC7B 1WDTA 3CCRB 1EFTA 4RD4A 1QUFA 1Q7YD 1VQKB 4RD1A 1FNDA 3E20A 4G5GA 4HE6A 2BF4A 3WBKA 4BPRA 3AGQA 1E62A 3CMEB 3CCVB 1N0VC 5DSZA 1EWYA 2NPFA 2BM0A 1EP3B 3B8HA 3U2QA 4NBSA 3CCSB 3MMPA 3B82A 4FWTA 4ACAA 1M90D 1K8AD 3CMAB 4P6VF 1Q82D 1H85A 3SJZA 1VQOB 4ZCIA 3W2IA 3WXMA 5TR9A 2X3UA 1YI2B 4TMWA 3MCAA 1Q81D 4RD2A 3W2EA 1D8TA 1GVHA 3G6EB 1DDIA 2BVNA 1XE1A 3AVYA 3MHPA 3CD6B 4EH1A 1AMOA 1YJ9B 1VQ6B 3JQRA 1U2RA 1F20A 2DCUA 2CRVA 4M0LA 1KRHA 1QGYA 1QX4A 3W5HA 1BJKA 2OTJB 2EIXA 1FNBA 4M1KA 2HCJB 1UMKA 5THXA 1VQNB 3LVBA 3G4SB 2BV3A 4B4DA 4FN5A 2XEXA 2YWEA 4B47A 3AVWA 2BMWA 4TN1A 1B2RA 1YJWB 3W5VA 1I7PA 1OGIA 1QGAA 3WY9A 1VQ9B 2BGJA 3WYAA 3AVXA 5JBQA 5GV8A 4R71A 4B48A 1YJNB 1K9MD 1YITB 1AIPA 2HMAA 1N8RD 3LO8A 1QUEA 2YWFA 4MYTA 2CNDA 5AN9A 4TMVA 1SKQA 1NJID 1QVFB 3OJWA 2VNIA 3FPKA 1QH0A 4RCYA 4G1BA 2QDXA 4LBYA 3VMFA 3ZZ0A 1M1KD 3ZZTA 3B78A 1G7SA 3LYUA 1E63A 4G1VA 2VNKA 2QTZA 3JQQA 1H42A 1DG1G 2BM1A 4M2LA 5TV2A 1B23P 1VQMB 4RD0A 1EP1B 4MYUA 3QFRA 1ZM3A 4TMZA 4Y9RA 3ZZUA 3CW2A 1KK0A 4Y7CA 2QEXB 3E1YE 1FNMA 2E1RA 2DY1A 3OJXA 1W35A 1VQ4B 1ZUNB 3P27A 3WNDA 1VQ7B 3VNVA 4M53A 3CCUB 2DETA 1W2BB 5H5JA 4LC0A 1R5NA 1R5OA 4LBVA 4QHYA 3U6BA 3OW2B 3WNBA 4B44A 1ZM2A 2EFGA 1CNEA 1FRNA 1BX1A
chains in the Genus database with same CATH superfamily
4LY0A 3PNVA 5F23A 1IIBA 2H9IA 3QWAA 5DM4A 5LA6B 4P0QB 2V3VA 3VKGA 4Y98A 3GNQA 4X7BA 3WLRA 2DKOA 5CGZA 1P6QA 1TX4B 2FJUA 4H6PA 4ADSG 4EPXA 5HIIA 2WICA 1RPTA 2WMYA 1CP2A 4HK4A 3OMXA 4D44A 2FI1A 1ONSA 3DBLB 3MUFA 2WA2A 3UAOA 1XB2A 4AI6A 3N7TA 1RI2A 1SBCA 3ZCQA 1YU9A 3PUXA 2FPIB 4HIZA 2QZ4A 5K0EA 1ZK3A 4PHCA 4XAQA 1HDCA 4NFYA 5IAJA 1SBIA 4LK2A 3COZA 3ZWBA 4DUYB 2FAXA 4ZZ2A 3MTJA 3UC9A 1G55A 1JSZA 3VYTB 2SECE 4CHTA 1YS9A 4PAQA 4CKZA 2XE4A 1YHQB 1ORTA 3TQOA 2BH9A 3VJLA 4FK8A 2GDJA 1PJ8A 5E6UA 3DOHA 4EI8A 1QF7A 1XWWA 2H1IA 4CMIB 2BSAA 4E3WA 5KWIA 1IAQA 1L6IA 2O3UA 2WU0A 3F4BA 2MR5A 3G7NA 3IBFA 2ZZQA 3P7MA 4ILKA 4UD6A 6ABPA 2FMXA 2H7YA 2VBGA 3JYQA 5IASA 5K0FA 3DO8A 2QSZA 1EVIA 3ZLUA 4CE6A 2H3HA 4E4YA 2IOHA 3FH0A 4JOQA 2VAXA 3R76A 4G4SP 2D54A 3D6TB 2YOGA 3G23A 1J09A 1PGJA 1GAWA 1QP4A 3PHHA 1OA1A 3EVCA 2ZITA 1Z2PX 1Z8HA 1ESEA 3KOYA 5EMLA 4H9GA 1KS9A 3IR5A 3FM9A 1THZA 2VK8A 3OZRA 4YAIA 4EHHA 3H9BA 2R8EA 4KFUA 3ACBA 3DM5A 1T91A 3QBJA 4O2AB 3CX8A 1G20A 3Q6IA 2QM0A 2VRBA 3FJOA 5AHRA 2FY8A 4RSGA 1RIIA 2CXQA 2Q4EA 4A03A 2C77A 1U7UA 4CMHA 2V65A 1AJEA 2Y4OA 4B17A 2LD4A 1QORA 3W2GA 1P7PA 2H9YA 3MELA 1TJYA 1GAQA 1YQUA 4WA8A 4XD2A 1WPGA 3P9SA 2OZEA 2X6YA 3KVNA 1AMNA 3WHLA 3K8YA 3D64A 3FA2A 3L7KA 3FF4A 3O9MA 3ONUA 4IWNA 3GOQA 3ROKA 2ZJAA 3RREA 3SR0A 4QSHA 4LOJA 1JVSA 2ZRLA 3KG2A 4CT0A 4YY3B 1EGVB 1JDUA 1WCIA 1YDHA 2IYPA 3ICEA 1LDEA 4BJ5A 4LKOA 2FUG6 2PGXA 2WR8A 1EVEA 2WSSA 1ZGHA 3AM4A 1O89A 2GHRA 1M67A 2W6MA 1TJPB 3LKVA 3MYRA 2N46A 1EDBA 2WTAA 2YZ2A 5EIBC 3QQ5A 1OFHA 4QGAA 1CLUA 1JSCA 2QRVB 4YK7A 5B12A 1UKZA 1EWTA 1PW7A 1X1AA 2I4LA 1FRQA 2K7ZA 3GRKA 1Q0UA 3KR9A 1WSVA 3UJ3X 3IEMA 1VB5A 3DBRA 1M5RA 1GSHA 1SIWA 3B1WA 2WU8A 3B3GA 3B6IA 4KDCA 1L8LA 2ZUCA 3GH3A 2IYYA 3NATA 3WS7A 5IYRA 2RFLA 3FYHA 1W4LA 1OC2A 4GOXA 2BKEA 4K6KA 4A2PA 4EKNB 1EX6A 2Q9CA 2JFFA 1FUIA 3I8SA 2P9YA 3ZE9A 1TT5B 2GD2A 1DQSA 5IMSA 5J43A 4HGQA 5JW6A 1W36B 5BW4A 4C05A 3SXPA 3R7NA 4WAUA 5CDTA 4R3UC 1X9IA 2QR2A 3WQZA 2RG7A 4EF4A 3JR7A 1T35A 1Y34E 2HCRA 4NI5A 1JKXA 1NJ1A 1TM4E 3TH5A 1LJUA 4B6GA 3O8OB 1YB2A 3DAGA 2LE0A 3LUCA 5DH9A 4O33A 4YH1A 4CF5A 1VYUA 2ZL6A 1M0WA 1W9HA 3HV2A 3I32A 3R3JA 4G2NA 2GK6A 4XLTA 5A7HA 1PYGA 2PUFA 1F7UA 2EFYA 3L9XA 4OB8A 3DP9A 3FWYA 5TSDA 4JI3B 3E6AA 4KITB 1PX0A 3RU9A 1EZ1A 1YBFA 4G1CA 1ZD3A 1YX2A 1Z5GA 2W4MA 4BBZA 4M9UA 4MUNA 1CS0A 1G3UA 2FMTA 1ADYA 4PPFA 1ZQ1A 7ABPA 2C31A 2FUG1 4WK0B 3V97A 2H1FA 3FJYA 3NTOA 2B1JA 4BJ1A 5MHTA 4US0R 2F90A 1K06A 4X7CA 3VVBA 4M60A 3I5MA 4ZO7A 1Z45A 4R05A 3AJRA 5FI3A 4CR6A 3LT0A 5GP1A 4XB6B 3DULA 5KNBH 3LLCA 4UNPA 1T8TA 3BGOS 3FSGD 3NHJA 5SZJA 5HKOA 2PXHA 3FOWA 3GCZA 5F78A 4F3NA 1AO3A 4NCJA 4TWBA 4QVIA 3EWNA 2O8BB 5B1DA 4AJIA 2B36A 1T0JB 3VAYA 4H1WA 5LYJF 1C0LA 1C30B 3C45A 4H4DA 4OTZA 2AD1A 4X7MA 3WK7A 4ETIA 3P2YA 3HVUA 3FXAA 3GRVA 5HS4A 2C9CA 2WQ7A 4EENA 1JKMA 4Q1BA 9ABPA 1XTKA 2KBEA 1UXKA 1OASA 4S1VA 2KBFA 1IBKB 3FX2A 4UJ3A 4BNZA 3LT2A 3TDKA 3I92A 4FWBA 1AX9A 1O87A 2HXSA 1B3BA 4NJMA 3HBMA 3RS2A 4U63A 1OZFA 3MIIA 2FLVA 2GJ8A 4B84A 3S8YA 2F7SA 1NYRA 3FD8A 2C5HA 2A0KA 1P4GA 2H31A 3G8CA 3L79A 3A1FA 2YXEA 3SIPA 4CEHA 4BWFB 3TQQA 1V2HE 5J3JA 2WZDA 1T9BA 3BDAA 4WECA 4US2R 5AVKA 4MVJA 4ZKEA 4U9UA 4XXHA 4ZT6A 3BBPA 5FEMA 3O94A 2GX6A 1G291 4JL8A 5IBRA 5JJKA 4EJ2A 3DAHA 3ND5A 2A1TS 5G0SA 3S7ZA 2Q2VA 4L4YA 3DBHB 5A71A 4FHCA 4DQDA 3TIGA 5IWCA 3PNPA 2D13A 4QPCA 3T34A 3RS3A 1MORA 1GRRA 5KDOA 2HSDA 2I9KA 1GEEA 1OLSA 4Q34A 5A8AA 2GYVA 2R3SA 2HT1A 5SY9A 4DWVA 5DGHA 1XNGA 1PL8A 4WIAA 2N0SA 2NUPB 3WRWA 3T7KA 4CT4B 3Q72A 4FYPA 1QCCA 3HDQA 4OXYA 5F3DA 5LMUB 1G4HA 3TRHA 3L1KA 4CQLB 4IW3B 2WD9A 3BXEA 1ZR2A 1YFLA 4P4SB 2GS9A 1G4UR 2OOKA 4M6WB 1A27A 4WZBE 1PWXA 2A9FA 2F9LA 4OHCA 4G9GA 4MMZB 4TRNA 4Y6OA 4RVNA 1J7KA 3PVCA 1BXRB 2DPXA 2D8AA 3ICWA 5LP1A 1NW5A 2J0UB 2JDIA 2ZTUA 3WVNA 1XN4A 2Q1XA 3AEQB 4NC9A 4XX1A 5DM2A 2M6RA 2J41A 2RK6A 4EL0A 2PMWB 3P26A 3Q0EA 2RKWA 3ZDBA 3I62A 1C29B 2PZ8A 4MR8A 3KXPA 2X1VA 2B1IA 3CX7A 4R8MA 4HV4A 1RAFA 4PLPA 2ZI5A 3BRCA 4A91A 3D6MA 4WQMA 1Q15A 3KYIB 3CP2A 3MXOA 4MIOA 3WAGA 1IL0A 2QTGA 3CX4A 3V34A 4E5VA 4IUBS 1POWA 3OMWA 3L1UA 1MF7A 3URKA 2DFVA 4CM8A 4LRYA 1U1DA 2VDJA 2C2WA 5E7QA 1DARA 2WT9A 3R6KA 4PLYA 1F0KA 3PE3A 4Y1RA 3RGGA 3CCRB 1HBJA 2OECA 1EU1A 1U5BA 3GFVA 2ZRGA 1JEYB 4ANFA 1ZI8A 2FWRA 5AICA 5B55A 3Q8WA 1DAHA 3GK3A 3LSTA 1CX9B 2QMQA 4N0QA 1AUXA 3HQ4O 4NYJR 1QFXA 1ECBA 2HJSA 1DWUA 2UVPA 4LHEA 4PLGA 5BRJA 4ZMBA 3MJVA 3HUEA 4C4XA 2CXTA 1ZIOA 1OLOA 4RMIA 5BUSA 1FRVA 4ZVNA 2BF4A 1MCZA 4R2LA 4TSFD 3WJ1A 5M5BA 3DDNA 5DNCA 4JOSA 3HTXA 3TLXA 1GSIA 4EQZA 4JNCA 1E62A 1MA3A 3FPGA 3IEUA 4R6XA 3CCVB 1VBMA 2WJ3A 2QAIA 2VHTA 3CRW1 3RSOA 3P96A 3IBGA 4OXRA 4F3RA 3QVJA 2AG1A 3EVAA 3T94A 3DNMA 2P1DA 1CUGA 5DSZA 5DLEA 2VR1A 1U11A 2BHNA 3A4MA 4HQ0A 4WT7A 4MEBA 2FN3A 2QYSA 2SNIE 4P7KA 4JS0A 4AXBA 3K72B 1K8QA 4KIJA 4XDHA 1JJIA 2IOFK 2JGMA 4O8ZA 4Z4YA 3MUEA 4AS3A 4GS5A 4DWOA 3B82A 3S2YA 1Y3DE 2H7XA 3NONA 3MZ0A 1E2EA 5AW3A 1D9XA 3VQTA 1NG9A 2AC2A 2WWTA 4FCVA 4FE3A 3ZKWA 4PZYA 5MFZA 1CDZA 3CX3A 4XR6A 3RF7A 3Q8KA 2LZJA 2ZRIA 4D6PA 4RKWA 2ASVA 4FMCB 3G8BA 3UAWA 3U1TA 3H11A 2YHAA 2I4NA 3CO0S 1KFCB 1OILA 4K3VA 3K5HA 2QIPA 3ONDA 4WK4B 1PJ4A 1XKXA 1H6CA 1NJ8A 1NLMA 4CG1A 1CUWA 2F9MA 2VDQB 2CLLB 3VNSA 3DKRA 1W85A 2DHQA 1J2TA 2PU5A 4R1SA 1RQNA 4RD2A 4IUDS 5DN6D 4ZQGA 2AK2A 3ZDCA 3EC7A 5AM5A 2XDQB 3D1VA 4B2LA 3NDJA 4UNNA 2IYWA 1EB8A 2JZNA 4N49A 3ZD7A 1N33B 1NVDA 2FRDA 2ZL5A 1M1YB 1USGA 2O52A 3R3UA 4O63O 2DJIA 2GN9A 4YEDA 5D3KA 3EQ2A 3OCWA 5KOYA 3HB5X 2G9RA 3D6JA 3U9LA 3GJXC 2YVLA 3WMFA 4I2VA 4D3ZA 4E46A 3X2EA 3CD6B 3ICQB 1HX7A 2PRKA 5ALIA 4OMFG 3V8EA 1BS2A 3WLNA 1YF3A 3CLSC 4F0JA 1VKZA 1SZCA 2W2KB 4E6PA 5JZVA 2HQSA 4JY7A 2ZTSA 4C03A 1FTGA 3OT5A 2GAAA 1V3QE 2ZUVA 1V16B 1YFZA 4B5KA 3G2NA 1QX4A 1MOZA 1A98A 4GVPA 1RHJA 2OZKA 3ESRA 4LVOA 5BPHA 2I54A 4MDYA 5EP2A 3PJFA 5AHKA 2EYQA 4ZEMA 3T7JA 2OHHA 4BNGA 3ILYA 3H5TA 2GREA 3ZE6A 4COOA 1E9CA 3RIMA 3LY8A 1C3VA 3LZ6A 4G0PA 3WKEA 1UMKA 5JDIC 1J39A 1NF3A 5IAAA 1O03A 1ZJ4A 2JIQA 5LZ7A 2G07A 3ICPA 4K05A 5ALDA 4C4PA 1QRTA 1SCKA 1ISGA 2QI9F 3RAPR 3WOVA 3KXKA 4QAJA 4TRJA 3T9FA 3VU0A 1UPCA 4U2GA 2INGX 4IG4A 1ETHA 2D4AA 3IQZA 2FMFA 2FUCA 2I8AA 2XSZD 2DFKB 5B1IA 4BXOA 1YJAA 5HS6A 3OQIB 4MDFA 1PQWA 2H51A 3PI6A 4K8OA 1T5EA 2YRXA 4LPKA 3LBFA 5EESA 1UFKA 4EPRA 2H54A 3PVDA 1NNUA 2HSWA 2CDNA 1KVUA 1RJGA 2Q1WA 3H3FA 1I14A 5ALSA 4A82A 3EXFA 2YWBA 1RAIA 4HLUA 1G6OA 5H9VA 3BC9A 2OR3A 1L4FA 1N6LA 1WCXA 4HGYA 3LBAA 2NUTA 5KYKA 2PQ0A 4YWJA 1TVKB 3LA6A 1CJUC 1E9VA 1VKJA 4FMPA 4I50B 3HKBB 5EIBD 3Q3JB 5BSTA 1N8RD 4MYTA 1XNQB 2A84A 4PHGA 3GNTA 2GBFA 4OP1A 3UC5A 2V3WA 4EM6A 1KEEA 4E14A 4HX5A 2WJVA 2DR2A 1QYIA 4FI3C 4GGOA 2Z1MA 1Y6RA 4EUSA 1OWPA 1COWD 4DWWA 8ADHA 4MI6A 1MZVA 3B9QA 1JAZA 1V71A 1J9EA 1QGED 1Y3CE 2FE4A 1I2BA 1L4HA 4YJ3A 5T4HA 3T7TA 1KE1A 3ON5A 3GGSA 2VTBB 3EF1A 3VMFA 3IV6A 3ZQKA 1L7DA 1QNLA 2RK3A 3V1YA 1FYWA 4F5ZA 1PWYE 2XI4A 1Z2NX 1EESA 3GZ4A 4HNHA 2GM3A 3LYUA 4C1NA 2OCIA 4KQ6A 4G1VA 2VNKA 1UOQA 1Y3FE 3DDUA 1IPEA 3KUUA 3A9TA 4RAQA 4X1YA 3TQIA 3VTFA 1BW9B 3JQQA 4ZDKA 4HGOA 3KEWA 5K0ZA 1VE9A 3FI0A 1W7AA 2Z9BA 2Z04A 1KBOA 3QW2A 5CVUA 4P3XA 2DF8A 1ZLYA 1YE8A 2TYSB 4YASA 1QGUA 1BWSA 1GU1A 2NVBA 3EYAA 4FZVA 3STYA 5HUHA 3IEVA 4RLZA 4GM4A 2ZR9A 4EHBA 1FXWF 1QO7A 2WAYA 2LPMA 3GVXA 1JJVA 3ND7A 3EVZA 4E70A 4EEXA 4BRUA 3RV4A 4YPFA 4HZIA 2V59A 2ZI9A 4FN4A 2AG0A 1L7BA 3L6UA 1VZ3A 2IXFA 4DQUA 4F45A 5BWMA 4JFRA 4BAZA 5KQMA 3L4KA 4GAEA 4Y7CA 1A9XA 1X7GA 3UOAB 3F73A 1Y5RA 1NUUA 3TNFA 4DYDA 3P9XA 1IHMA 4O3MA 2NU7B 3NGLA 1VQ4B 3MCZA 5DYWA 3RSHA 5CVVA 5IJXA 2NU8B 3PNLA 1Z4MA 1KZLA 3RC8A 3IEIA 1KH1A 1JP7A 2O2ZA 2OHIA 2VCYA 3DOJA 3IEPA 1R5OA 1GGEA 5KNDA 5BYKA 4ENVA 1RHQA 4B44A 2GBIA 2ZPUA 1ZESA 2KWIA 1OX4A 1NOJA 2R6DA 3DJFA 4YV7A 3QP9A 3NWBA 5DM70 1XG5A 1AHHA 1ZO8A 3RGWS 2AQIA 1JX6A 3TVDA 1WB9A 3BZUA 4N8SA 1HI9A 5BWLA 3QWHA 4B74A 1YJCA 3H2YA 1I30A 1R4NA 1SWWA 2YIMA 3JTMA 3OKPA 3Q0IA 4KO8A 1H0KA 4UU7A 4KPFC 3SDBA 3T3PB 3T41A 4BNDB 3R0XA 2QYHA 3CPWB 1GPH1 4ZTBA 2PZLA 3LXXA 1YVPA 1KQPA 3GPDG 1YJ8A 3CB4A 3M49A 2W6JA 3OPVA 4A2CA 3WL6A 1XPJA 3T95A 3OZSA 4ZICA 3ZDAA 1F4VA 2AC7A 4F21A 2GCGA 1W0CA 2BEKA 2IYNA 1OD6A 1T9GR 3DMHA 4I1UA 4UEWA 5KC9A 4PTLA 2DR0A 1B0UA 5CNIA 1P91A 1ZD5A 3FRHA 1JB1A 4L4RA 4HLUC 3RC7A 3CCFA 1EMDA 1S8OA 3AESB 4PRYA 1FDUA 4FDLA 5BSMA 1M1YA 2VS1A 3OP1A 4P1VA 1XDGA 1NRIA 2JD1A 3OUUA 3SYLA 2WSSD 3K4HA 1KC8D 4LZZA 3CXUA 3B6KA 4M7OA 3VJKA 1QMGA 1C9EA 3Q7RA 4GW3A 1WXGA 3OJOA 1NXPA 2HIMA 2YHSA 4NMWA 5J5CA 3K9FC 3QTBA 4HDKB 1D1NA 2BDEA 1Q0TA 5AKZA 2JI6A 2VHWA 1CJBA 3ZDRA 3LQQA 3MM4A 4PLCA 3ZZNA 3LDFA 4XWKA 2OFPA 1X74A 1KBZA 2MIIA 4OXNA 4W5OA 3PENA 2A5FA 3KPVA 2BMJA 4DY4A 2O5CA 2R62A 3AEUA 4FFVA 4W63A 1OX5A 3IQEA 4L5IA 5DV9A 1UC8A 4F97A 2P27A 1R6BX 3LY9A 4C89A 2CF5A 1T3LA 5KTMA 1B8VA 1DCTA 4UZSA 1F9AA 5EXPA 1XTZA 4CEIA 1X1QA 2VDPB 4MW6A 4GSYA 1VMAA 2H1WA 3D6FA 3T9EA 2P9JA 3W3AD 5EJ8A 5HDQA 2ZSHA 1RWWA 3HHEA 3IAM6 3K6SB 1NVMB 2AFIB 3CURA 4I0WB 5KOIA 2Y66A 1I1QB 1SVUA 4IAOA 4ZMRA 2AYYA 4QPNA 3GJ3A 4B43A 1P4HA 4BLUA 1PLLA 3GX1A 3QENA 5FR1A 3C97A 3Q1LA 1KO8A 2P3MA 2A2ZA 2NTNA 3WE7A 2ZBUA 1J7JA 3V2HA 2OAQ1 3KU4A 4ITVA 3H2ZA 1FU4A 1SCUB 3GPIA 2QS9A 1RWQA 1MO5A 1E6MA 5DT9A 1L4MA 4O4LA 4JUIA 3UTDA 2W71A 3U7QA 4AF7A 1DL5A 1UBTS 2BLNA 3E22A 3P19A 5K51A 2UVPB 1H2EA 1U7HA 2G0TA 2II6A 4X45A 1AVTA 1GQYA 5JD6A 1M73E 1XTSA 1AV6A 3ASQA 4DWJA 1XDDA 5JYCA 3GLHE 1U3CA 3CISA 1CEXA 4LIPD 1S0UA 2XOXA 4RO0A 4D3SA 1WMSA 3GLGA 2IYVA 4BP8A 1KTIA 3USCS 1VPLA 3C7AA 4MCIA 4PPYA 4WPGA 3ESZA 4B45A 5JAUA 3BXPA 1F38A 2W6ZA 2V3CC 2Q3MA 1QZ3A 2OYRA 1J2EA 2XE8A 2LKCA 5HOQA 1PI3A 1ZGGA 3O82A 3QUSA 1NNI1 5CRIA 8ATCA 5IANA 4LG1A 2PMFA 3CGWA 2X2OA 3LTEA 1YQGA 5CLHA 3GA5A 2B4AA 3KPUA 2M98A 2CLDX 3K09C 4I55F 3K8OE 4ISCA 3U0BA 3KZXA 3L7AA 4H3SA 3DUFA 1VQ5B 1W5SA 1BE1A 4IYJA 1G8FA 1JR4A 3MGAA 3VVLA 3CUTA 2CXNA 1AGNA 1DBIA 3B6EA 2QZPA 2D5IA 5D86A 4BO6A 3FOZA 1DNPA 1NLFA 2DX7A 4MJXA 4M6WA 3CLRD 1MB2A 4QLAA 1I9GA 4TGLA 5ESXA 1US8A 1CU1A 1D2HA 1EWVA 1FFXA 4P34A 4L8JA 2ISSD 3FNIA 4PZAA 4ZZ1A 3QJ5A 4BKQA 4QWMA 3U4HA 4BBPA 1A7JA 1EM6A 2WOOA 4PLWA 4EG3A 1WPQA 3IDQA 2V5VA 3E2MA 1HDIA 1MNAA 5AI8A 5IBPA 3A1DA 4YP9A 1CUEA 1Z33A 4LWOA 3DAYA 3D0QA 1U2GC 1ZSVA 2GLTA 4C07A 2FLWA 4RKRA 5JEDA 3BORA 1YIDA 2FK7A 2HX1A 2XT6A 1VE5A 5BSUA 1Q11A 3CRMA 1KY4A 1WTHD 1ZGAA 3DFMA 3HCEA 2R9VA 5EQJB 5FI0B 4QUZA 2FSVC 3RYHA 3ORSA 5A5EA 1ILEA 3OPYI 3CGGA 3DAPA 1VHLA 1H1TA 4KNWA 4A1OA 1VG1A 4O2BB 1TYAE 3ZJTA 2GFQA 3N2NA 4OAOA 4Q6WA 3G13A 4LXTA 3VZDA 4ROSA 2ACVA 2HD4A 3E7DA 2Q5OA 3GEIA 3H5OA 4F3KA 1DMSA 5KREA 1VOTA 1AU9A 2OFOA 4BO0A 1CNFA 2C4TA 4U9HS 4WCDA 1U98A 4J0KA 2FQWA 4DGQA 1VJ1A 1H6BA 3UYKA 5ITVA 5FXMA 3U44A 3LUHA 3RABA 4KBYA 1UM9B 2C5BA 4GM0A 4DFDA 1GPKA 3G85A 3UHAA 1A4XA 2JDID 4MQFB 3WRXA 2XT0A 3CZAA 1NQOA 1XZFA 5P8WA 4XASA 2FQ1A 3EEFA 1SB8A 5KTKA 4KFTA 1HFEL 2JI7A 3QLTA 4UDOA 1YR9A 4RPIA 3FWZA 3IBTA 3MTAA 4OUDA 3UATA 1DIGA 2BJHA 4FYJA 3EGVA 3UB3A 1L5YA 1XA4A 5AM1A 3FCOA 1YQWA 4JUBA 3GD5A 1DLIA 3BJMA 4CIWA 1EYZA 4D8YA 1E66A 1YSCA 4KMMA 4QNRA 2O1EA 1B26A 4MPRA 2XYVA 3ZIAA 2ZT8A 3OPNA 4QU8A 1S2DA 4GMKA 4AJLA 4BO8A 5JH7A 2XDWA 3EW7A 3T7AA 3HFSA 1AKWA 1KL7A 1X1RA 3FZEA 2W22A 4X3CA 3SY8A 3TLJA 5B58C 4OYHA 2J0EA 2NZJA 2XW6A 3HEMA 2IS6A 4IF4A 5EFZA 2IU3A 4OGLA 3DUFB 3D6UA 2IP4A 2YZMA 4OHFA 3R6TA 4DMHA 1P0MA 4INPA 2KSQA 5B6PA 5E8JA 1A82A 1ELOA 1WW3A 3I4CA 4JITA 1FTQA 1P9RA 2Q46A 3DH0A 3EBOA 5DSXA 1J23A 5DFAA 3TOCA 3TNDA 3SG0A 1NU8A 1YZQA 3ZZMA 4HGPA 1UFRA 2VYVD 3OUZA 2JIDA 2QLFA 4P84A 4H2DA 1OKKD 4RTNA 4N3NA 2RHLA 3G8DA 2WU3A 4KQCA 1QG4A 2I7TA 4Q21A 4B0PA 1QS0B 2YRWA 5BYBA 1DTWA 3L5OA 5KNBA 4JQOA 1Z29A 3FKJA 5JZMA 1KI3A 1SOMA 1Z6YA 4IHAA 1WCWA 3M70A 3IAXA 4PRLA 4U0JA 2GASA 2B2XA 2ZAMA 4RAOA 3U7RA 3UHJA 4AQDA 3GNLA 3EA4A 3OU6A 4L74A 5EZSA 4Q02A 4EG1A 2R4QA 2RHJA 3NI2A 1GILA 4GP9A 1ZN7A 5DX8A 2V7TA 4NBUA 1SCUA 5BUQA 1QQ6A 2Q5EA 1A4RA 1BH6A 1SHZA 5GONB 3A06A 4LSZA 4FW9A 5JQWA 1S3IA 5K3FA 1RXYA 2OCXA 1XHLA 4RY8A 2B25A 2O6LA 2G06A 2D06A 3KKZA 5JRJA 3QE9Y 1KZ1A 5IARA 5AOAA 2F43A 1YHYA 2WZQA 1Y1PA 4I1SA 1U8AA 3QUBA 1NUHA 4AZTA 3T56B 1ONNA 5ITZA 2Y0DA 3ZDZB 5JXJA 1RE1A 2BTQB 2I3BA 1BQ4A 3KR1A 4M37A 2LIPA 4IIJB 2JIZA 4PAGA 5JSUA 1W36D 4MICA 2JAQA 1GITA 2JGKA 4XWYA 2HGZA 4J43A 1QPGA 4L2IA 1YB6A 1P1RA 4Q7MB 5A4AA 4J0HA 5LWQA 5AXDA 5KYUB 4QVGA 4DTCA 3DD5A 4M8IA 2Z3WA 1EUCA 1KAOA 3CPJB 1VJRA 3HMKA 4YNBA 1FJXA 4Z51A 1W44A 3EC2A 2J1LA 1NQXA 3X1WA 1CUFA 1S02A 5JCXA 4G0UA 3ZGZA 3G0DA 1GPBA 1XI2A 1DKPA 4QBTA 2XB6A 5JNRA 4KK4A 8MHTA 1VE3A 3DVSX 3L04A 4HPJB 4AQYB 1IY9A 3OE5A 4LHZA 4P6VF 5FBRB 5JCPA 2YX1A 1Q7RA 3CLUD 4BKRA 1G8KA 4E13A 4OOEA 2DXIA 4R8RA 3TTWA 4DSOA 3GLFA 3DMYA 3I9V6 2DHCA 1DXYA 1LSUA 2YYAA 3AZQA 5CB6A 3VYRB 5HZGA 2B35A 3FFBA 1R4ZA 3DVQX 2BZSA 1KJNA 1RXVA 1E7YA 3O8LA 5EE9A 1OXVA 1Q1EA 3TD6A 1BNCA 1JHQA 1ZW1A 4HXYA 3V8MA 4DL9A 1N36B 3M6MD 1WV0A 3HN6A 2WWHA 3HWRA 4Z0PA 3D5QA 1WTAA 5EZ6B 1Z0DA 3EC1A 5EL0A 2OV3A 5L95A 2RHGB 4M22A 1WCV1 3GRUA 2IX3A 3F0TA 2NXWA 1WBDA 1NSTA 1GZDA 4QBHA 1IXYA 1JMYA 2W2VA 3OFKA 5JPIA 3SQDA 2VJPA 3M3PA 3QK7A 2RH9B 2PZJA 3DEIA 1WOYA 1N4DA 2NG1A 1E9SA 5KYWA 2FWPA 1U2RA 1NJFA 1F20A 4ND4A 5JECA 1LW6E 1HYEA 3KKEA 1GRQA 1B1AA 1XMOB 2DULA 1LUAA 1JU9A 1NXOA 3I8OA 2XEDA 5EWMB 4MAFA 1BXGB 3ZCXA 1KWKA 2B78A 2QORA 4NONA 4N5HX 2IH5A 3SZ3A 4MEJA 4OBXA 4B8ZA 5F98A 1ZH6A 1RE0A 2ZBVA 3U17A 3GBSA 4M1KA 2CFSA 3DE0X 2HCJB 3EFOB 1NL3A 1U4SA 5I4KA 1N0HA 1P2BA 2EW2A 2JEZA 3S70A 3ZD9A 4UMEA 1VLHA 2QVLA 1SKYE 3OC6A 3K8ZA 3AVWA 4QDZA 4Y9DA 4BN4A 1PSWA 1LDYA 4OHXA 3VC7A 2OBTA 3ZVLA 4MRPA 5GAJA 3HDVA 1PEAA 2AX3A 1YJWB 2VATA 4I99A 1WBBA 4REOA 1I7PA 3LVFO 4OU5A 2OV2A 4M9ZA 4IFTA 5ED0A 2CMFA 3GARA 1WD5A 1DQRA 3F74A 4KTTE 3G9QA 3E05A 4HAZA 2GRJA 1Q17A 2QRUA 4QPDA 2FZGA 4UBKA 2YJGA 4C0KA 1KNQA 3GJZA 4GGMX 1HT2E 1TZBA 2ODEA 3EZNA 5BN1A 5JH7B 3C5CA 1HZZA 1DAKA 3JTEA 1ZA1A 2Q6TA 2ZUDA 3MGBA 4UOQA 4KQXA 5ENZA 4JDPA 2VTBA 3BULA 2RMKA 1NLUA 3SF8A 1WMDA 3ENVA 2OYSA 1NXTA 2HJRA 3PFCA 2KX7A 2F3PA 2ONJA 4QU9A 4HVLA 1IRIA 1QFSA 3N2KB 4NZOA 1QIGA 4LHYA 4GPAA 2DT5A 1TEZA 4DT1B 1BW9A 3FY4A 4OYLA 5C1DA 2EJUA 3WHPA 4Q3NA 4M8SA 1DGQA 3UJ8A 4MGYR 1TM2A 1XVAA 5JQGA 2UYYA 4F2GA 4PLZA 4HNAB 4OUKX 4RQBA 3N6XA 3LYLA 1TECE 1XZDA 1ZXLA 4WFIA 3BY1A 2DBZA 3A10A 3B7PA 3PC2A 1M1KD 1F2TB 1NKVA 2CJXA 4PQYA 1JHOA 4X94A 3LDUA 4CM8B 4AMZA 2OHGA 5DHUA 2HOQA 3O7MA 5FLXA 4JZKA 3E58A 4Q39A 3TFWA 4X90A 1NLYA 1IU9A 1EX1A 1UP6A 1QZUA 2WJZB 3IQWA 3ZR4B 1EA5A 5F2NA 5KQGA 2UAGA 2YJTD 3ROTA 2VJDA 1J97A 1E2KA 2NZYA 4JYAB 1TJNA 2X8AA 3A6ZA 3NR2A 2RJOA 5TV2A 2O1XA 4NE2A 2F1OA 4DSAA 2VRCD 5IYZA 3R3WA 2W6JD 2ZM5A 1EFKA 1GA4A 1KEPA 1ZISA 2ALJA 2CVOA 3FSGA 2ZJFA 5H81A 3KYCA 2FFRA 1TF2A 4J9UE 2H8KA 2RAUA 4GXNA 4FGLA 3KZKA 4Q4HA 3RUEA 4ZPJA 1RYMA 3SMVA 1I6MA 1PQ4A 3DKVA 2WUDA 1F51E 3D7RA 4FEAA 2GPYA 1T24A 1CRQA 1Q84A 3HXKA 4NYMR 3IUPA 3SS7X 5IFLA 2OM2A 1Q5PA 1Y37A 4HNUA 2D2VA 1UJCA 2PK3A 1Z22A 1ZONA 4DCVA 1QO0A 2IEBA 1NXVA 2IOYA 3HZZA 4RTRA 5I7UA 3IA2A 2WJHA 2BGLA 2WD8A 3PLRA 4TS4A 1RZ3A 2P78A 2ZBDA 4JMQA 3T5AA 3N39C 3PQ5A 4FDMA 1M6HA 1NWCA 2POCA 3WP0A 5JALA 1XAHA 3GP8A 4LC0A 1FP1D 3GCXA 3H75A 4MUYA 4V0MA 4WNAB 2WYIA 4CKEA 5M3BA 3PA2A 3TYXA 1XLTC 4O4IB 4XLFA 3KD2A 3ITKA 4UFOA 1JG7A 1TQ6A 5A5GA 5EIXA 2W70A 3GAMA 1HQCA 2WM3A 3TZLA 2ZK7A 3GLFE 5EIAA 3UAXA 1T8PA 4EJ0A 5JD4A 5KX5A 1FQJA 3EASA 1A9QA 3H1EA 2IS4A 2H17A 1LDBA 4UAJA 2GZ1A 2JLUA 5J5VA 4DGSA 2JGRA 1VHEA 2W9XA 1GGJA 4MWGA 3ZBPA 4AFNA 4EUHA 3DDOA 1G20E 2GJ9A 1I3MA 3QPUA 4K3UA 5I9TA 1GZ5A 2GPAA 2PT7A 4LVCA 2DQZA 5HQ3B 1BGVA 5BYJA 3ZE2B 4BFSA 3IHKA 3NUZA 1SQFA 1R9NA 1KP9A 2ZSAA 3H8WA 4I6JA 5EUCA 4QGSA 3TEMA 2GH1A 3FMGA 1R6DA 4NEGA 5HQTA 3EVEA 4XRGA 5CURA 1PUJA 1WOPA 2QTHA 4FLMA 5ESRA 4I14A 3KQVA 5BWCA 1DBRA 5K3AA 1ZKDA 3BGVA 2IPXA 5L6LB 3I83A 4D9KA 1K4MA 4TVKA 2OQIA 4E09A 2I03A 3LPCA 4NCNA 3RO7A 3F6YA 1M8PA 1VCNA 2A9OA 4GQAA 4B0OA 1GAJA 1NA5A 4M7WA 4CF4A 2I0FA 5DOZA 3M4NA 1ZSNA 4Y0AA 1VSBA 3M6AA 2WM2A 4BFCA 4M86A 2OO3A 4CIAA 3JWJA 1U3UA 1SU7A 4QRIA 3A3NA 4BMXA 1NG1A 1E8DA 3K0CA 4DCPA 3CCMB 4M1MA 3A1PA 4POOA 2ILTA 3NM5A 2EG5A 4BX3A 5KJ1A 1RBQA 3GV0A 4QBIA 5FUMA 1KGSA 3N05A 4BECA 3O4FA 1N9KA 3BCSA 2R96A 2YVUA 5F2EA 16PKA 1F8YA 2MYTA 3KT8A 3SHTA 5LQAA 5JCOC 1SPXA 4BBAA 2V6FA 3CZRA 1UBLS 6REQB 5FTKA 3G2MA 1UODA 3BH0A 4CMKA 3WKBA 4MYHA 4TSFA 4ZGWA 2B6HA 2XUZA 3AEZA 3FE2A 4PIMA 4PAAA 4J8PA 3M7IA 2R6JA 1Y3AA 1K7CA 2EC5A 3LDHA 3MTBA 2JI4A 3R7WB 3SHWA 2C8LA 1Z63A 2I67A 1NMZA 1SUFA 2OV6A 3CE6A 2UDPA 3W5BA 4MWSA 5IK2A 2ARKA 5LP6C 4F7WA 4DMGA 3IT3A 4N18A 3S8MA 2P90A 4P3YA 3RSGA 4ZV9A 1T3SA 4ZD6A 3UXHA 3PFKA 2ZYVX 2BEWB 3X1ZA 4CU2A 2J7KA 1ACMA 2Z2XA 5FI1B 1B93A 4L3WA 2AOXA 5K8IA 5EYPB 2OFXA 1NMEA 1C1DA 1XQWA 3O3CA 2YZ7A 5FBZA 2P30A 4MP6A 1ODFA 4JSTA 3PD7A 4AJKA 2BYTA 4CEJB 1GM5A 2I4RA 2PA3A 3LUGA 4P3NA 4FM9A 2AVDA 4NBRA 1RW4A 1JHMA 1QR2A 2CUNA 3A9VA 4P3IA 3FCXA 3QPAA 1QC5B 1R6XA 3AVOA 1KQNA 3ZV4A 4B9AA 4D9BA 1P1IA 4EITA 3AEQA 5EHXA 1EVLA 1K4YA 2G7MC 1IIRA 4O4IA 4E7OA 2E37A 4K9PA 2IUTA 4BB0A 4R54A 5DKFA 3QUCA 3Q15C 3GIRA 2FETA 1A04A 4JMLA 1EFDN 2OXIA 1W36C 3RLIA 5LXTF 2B5OA 3SU8A 4EJ6A 4M0MA 5FYQA 1FMTA 2XA2A 1WUIS 1AMUA 4LNHA 4F6CA 2IDKA 5DN6A 3B36A 5JSZA 1E60A 2QQEA 3F2VA 1JTFA 1HNNA 4UDXX 1NBMD 2Y6UA 4YRGA 5JAHA 1E5VA 5GY7A 3NGMA 1SC4A 4FNMA 1TYCA 5HDBB 1BN7A 2X0NA 1EJ2A 2ZM6B 1Q77A 2WNSA 3X2FA 1YL5A 3O90A 3H5VA 4CIXA 1LI7A 2QOEA 2PYZA 2C1XA 2NYUA 2AL7A 3N87A 3NDPA 1ZC4A 3WYFA 1MC4A 1AV7A 1QKKA 3JRXA 3SVZA 1PJTA 3GWGA 4B3XA 3PF9A 4N8DA 3TKYA 4YQEA 3O4VA 2EBWA 5K6AC 3ZD8A 1ISMA 4NH0A 2MINA 1X2EA 5BSHA 4KR7A 4G0VA 3HACA 3EISA 1XMXA 2QT0A 4LEIA 4LYAA 4QULA 5E1DA 1XU4A 2ZANA 1NVKA 3GRAA 4WGFA 2HFKA 4FOTA 1PFGA 1XKQA 1DQPA 3M2PA 4YROA 2LV8A 2GF9A 1PCXA 5CT9A 3V4LA 4DSUA 3SAJA 2PT5A 4P33A 4WEQA 1K0UA 3O03A 3EG5A 3TLBA 4IV8A 4IH9A 4MXDA 5CFMA 2Z8XA 3NTQA 3Q85A 1KIMA 5HFAA 2YWJA 3CSSA 3NNDA 1X8XA 4EHFA 1N7IA 3AV0B 1DC4A 3FSJX 1RC1A 3OI7A 4P54A 5FBQB 2VHJA 4BMCA 1ND5A 2I7XA 2XCUA 3FLEA 1E8MA 2FCAA 1KNXA 2N1BA 3QA3E 4UHJA 5REQB 4BTLA 4ERXA 2GJRA 3A3PA 3FBTA 3LRXA 1U7TA 1X8LA 5JC8A 5FWYA 1MVLA 2AMLA 3LDGA 1E94E 2VCEA 3MWYW 3P0EA 3ZHRA 4BGDA 2X9LA 5DHFA 1FSGA 2F4NA 3UGKA 1RLTA 2GUGA 3NG1A 4G0YA 1Q95A 5FBWB 2OZLA 2JFWA 4NJOA 3QLUA 4QYMA 4R81A 3BUSA 2QPAA 2X0KA 5LLSA 3VAZA 2PUTA 2PUAA 3CRQA 3A8KA 4G4SO 1E7WA 4X71A 3SZMA 5SY4A 1E8NA 3H9GA 1M8FA 1U0SY 2BTOA 1N8TA 4L4XA 4YBZA 2CBZA 2QTCA 2QVCA 1JRLA 2DTEA 1PKEA 3ASRA 4OVKA 4AJHA 1O58A 3ZPNA 5CCXA 2J0QA 2CK3D 1JTEA 4C08A 1VL8A 4FCWA 1KP3A 3QPDA 4GD3Q 4C6TA 3AI2A 3P9QA 4AG6A 3EMBA 2BHTA 4DQKA 3ZJ5A 3MFYA 4MK4A 2HR1A 1QIMA 1H8EA 3VR6A 1A97A 1ISSA 1K7FB 2VYFA 3PCTA 4R1NA 4Y9SA 1JWBB 4MPJA 2X3YA 3SNKA 1W94A 3BMCA 3CUVA 4IINA 3W1WA 4AF6A 2AG5A 2PVSA 1T36B 4LYFA 4W8OA 5AKLA 3GVJA 1P6UA 2DLDA 1W1UA 4XWGA 2J7PA 3IIMA 1OQAA 2JHAA 1AT1A 4UVIA 2GD0A 2PBFA 3JARB 1N6RA 2GQ0A 3IB6A 1Q91A 3KTOA 1M72A 3MPUA 3W6UA 2BI8A 3ZWQA 2GCPA 2FZ5A 2O8DA 2P9CA 1YZFA 2JIZD 2P2SA 1E3XA 1A8PA 4D7AA 1X77A 1YKFA 2GD1O 4Z54A 1OT3A 3OFSA 4LOLA 3ABRB 3JSXA 4WN3A 3BFVA 1TXGA 2GZAA 2QU8A 1SVMA 3GVPA 3QVXA 3PQEA 1VRWA 2ZJ8A 2H2AA 3WMEA 4DJEC 1BDIA 2GVZC 4JC5A 2PWYA 5K8TA 2CDBA 2Q7DA 5FPKA 1H4SA 1O95C 2GPNA 1QIKA 2UVDA 1PDWA 1N8NA 2YDYA 3JRNA 5LDDC 5F35A 1LK7A 3KCQA 1ZINA 1ZMTA 3G79A 1B42A 1F2UA 2REXB 2YL2A 3G0IA 2GPBA 3WIOA 3BMNB 1NQ5A 2HNKA 2X4DA 4M98A 2IYLD 3BB3A 3T5CA 1TKCA 1XU9A 2FRVA 2FZCA 1XFOA 4IGIA 3SDZA 2R1TB 4DJJA 3VRHA 5EWMA 2B8TA 3EJ6A 2W8BA 3O8CA 3G2LA 4EYOA 5CH3A 5GTDA 4RUKA 4BNLA 4R2IA 2D2XA 4Z9AA 3M1IA 5ECWA 4BWYA 3D7KA 4ARAA 3E03A 3DD1A 1D0SA 1RACA 2G6TA 3H3JA 1JU3A 3K1AB 4LFCB 1YR8A 4C22A 2JKYA 2XRFA 4KKVA 3AEUB 4DYHA 1NE7A 3RJMA 5K0JA 2F8SA 3A27A 1PWZA 3MN1A 1C9JA 4EY8A 3KQNA 3U09A 3LP6A 2FWAA 3E20A 4Y2XA 4D3DA 1DEKA 4L6CA 1HOTA 3KLNA 5GJCA 3ETEA 5FULA 1P7ZA 3IE0A 4QJIA 4Q1FA 3BN3A 1BMFA 3SK0A 3H5IA 1TU0A 4HL6A 3U5ZB 4Q00A 1EE9A 2XUKA 3LUDA 3G68A 4V39A 5ALYA 1G2PA 2CMGA 1W46A 1U9YA 5G0VA 3K1YA 4XQFA 1Q19A 2E21A 1AKTA 1KZ7B 1PJ2A 1LPBB 3D2CA 3RVKA 1EH5A 4NQRA 3JALA 3CCSB 1V6SA 4MMYB 3ONVA 3QLEA 3O93A 1WOMA 1WZCA 5AKYA 2ONYA 3PC8A 2DPLA 4FT4A 2NXCA 3UA3A 2B4QA 5C9ZA 5C53B 3QVWA 2OHFA 3E9CA 4FI3F 1K8XB 5KTYA 4AMVA 3LBIA 4ESVA 3UH1A 1V0FA 3Q6MA 3LLUA 1F12A 1E5LA 3X44A 1JXOA 4HRVA 2J6CA 3LYAA 2CWDA 1ZM7A 3JD1A 2R1TA 4DBLE 1T9HA 4OQMA 5JAOA 3HXMA 1T5DX 3GJYA 5I7AA 1G60A 1TUGA 1IUOA 2IZ0A 4PFSA 4ZCIA 2ODNA 3PX3A 1G5HA 5CW2A 2DFPA 1F5SA 1VSTA 2IGTA 3K53A 2YINC 1I3OA 3OC0A 2JEYA 2PUGA 2HCTA 2FNAA 3U3ZA 1GXSA 5JC1A 4W5NA 4OGWA 1T8UA 2FHPA 4X24A 2I8LA 3CNOA 1ULTA 2VT6A 4CMIA 4ER6A 1DPGA 1ODCA 2EF1A 3MLBA 5EXXA 4EFNA 1VLYA 1S89A 4F85A 4YELA 1CEYA 2VBIA 1FLNA 1D5WA 1Z4OA 4M0PA 3RQSA 3JWEA 1BGWA 1YL6A 5EQTA 3G0CA 2D0DA 4IOKA 4KWHA 2C8VA 3TOSA 2CY0A 3K5PA 2F4VB 2DQKA 4D0GA 1N05A 3MT8A 3WKDA 1UZAA 2HHJA 4ALJA 4IIVA 1TPYA 2GJKA 2O8NA 2V6MA 2FMUA 2O2SA 1A3CA 1VQ6B 2LBPA 2EP5A 1W8DA 3VR0A 1M0EA 3ANNA 2VPXA 1D1SA 5EGSA 3TX6A 1K6IA 2CRVA 2VOJA 3ETCA 5EEGA 4IWYA 4J49A 4MIYA 2GEVA 5T3YA 4OFWA 1GGFA 3EXIB 3RC1A 3SPXA 2YC2C 2IPMA 2X2EA 3IS3A 4KQ1A 4NZPA 2DSTA 1IE3A 3JWGA 4NYIQ 5IG2A 4WZBA 5CIQA 3MUOA 2VPPA 4RZ2A 1G19A 3ZU5A 1FSPA 1XMVA 1KY3A 2ZVQX 3JARA 4M89A 2LDXA 3L8GA 4EF6A 1SA0B 2H16A 2PUJA 3GDWA 1RBMA 1W48A 3TZHA 4CLEA 4CCWA 1MO3A 1VQNB 1T2NA 4IUYA 4Z3OA 5IABA 1CYDA 2A7QA 3HBFA 2YWEA 3U9TA 2VJNA 4ZK6A 5CBPA 2PBLA 4RNCA 2ZRQA 5LA6F 3L77A 2A5DA 4GOKA 3W5IA 4RZSA 2HWWA 2GA9A 4IQ8A 1KEVA 3HVKA 2W2NA 5CH5A 2IXEA 2J32A 2VRCA 4R40A 4ALMA 1T5HX 5F9FA 4EB6A 4CF7A 2OXRA 3BDIA 3JQAA 4TS9A 3MHTA 2XBUA 1JXQA 1W76A 3IQDB 5I7EA 1OGIA 3C6QA 5LB4A 3X1YA 3UMCA 1BRMA 3I9LA 5JMTA 3PIDA 2B5WA 2C95A 2OXFA 1C0EA 2PR7A 4XJXA 1PYOA 1WSDA 4DNRB 4LZOA 5A4KA 4QGHA 2WJ4A 4B48A 1XV5A 1I80A 4DR3B 1MJNA 2QTFA 4I50A 1EJBA 3TX2A 1N92A 1ECGA 4WZKA 3C1OA 1P7YA 2CF4A 4URWR 5EY5B 1TYEB 2B1GA 1CY2A 2JGEA 2QL5A 3KCNA 3HB0A 1MQ9A 3TOZA 2FSFA 3MGKA 3OOSA 3AK4A 5AWFC 2I6GA 1IOLA 4IUCS 4KLAA 4U0KA 2C42A 4YRJA 3OJWA 1MH1A 1RI4A 3MMZA 5D3MA 3TLGA 2L17A 2G40A 3W7AA 3STWA 1PYDA 1EXNA 2G04A 3EXG1 2V4ZA 1TRKA 2R1UA 5L3ZA 4EO9A 1OFUX 2G0AA 3C3DA 3EZ6A 5EE5B 5JMOA 2ZVPX 2PSDA 4TV8A 1JHYA 2K6GA 4WOPA 2P9QA 1ZNYA 4NX2A 2OKCA 2WHPA 1VIDA 1C8LA 4X8IA 3GU3A 4LOKA 4MQ5A 5A9TA 1KVTA 1G7SA 2Z08A 4MDEA 1C30A 3DT8A 1P5RA 4YRRA 2QTZA 1QH8A 2G7ZA 2IYAA 4OI1A 3EDRA 3OQBA 4BU0A 4QV2A 1FDSA 2X42A 2DBQA 4RWEA 4BZWA 3P9IA 4I5DA 3B5JA 4A2WA 3PXAA 1KYQA 1CXZA 4DLUA 2P3SA 1UK6A 4J1SA 2WP0A 3O75A 5AJYA 4YRMA 5KMGA 4YXWD 1H3NA 3BXFA 1T2CA 1PTKA 3CBQA 3BIFA 2HTFA 2EEZA 1CB0A 5LOVA 4L50A 2J08A 4MX8A 3AUJB 1KYZA 5HX7A 1QWOA 4DMLA 3H9CA 1Z35A 2WSIA 1I7DA 1J8VA 3SYMA 1RYHA 1NBIA 4FXPA 2UZ1B 3IVMA 1Z2DA 4JLOA 4V0LA 1EK2A 1NT4A 3Q3AA 3ZI7A 4PINA 1MEOA 4X85A 1F14A 2C9YA 4NHEA 4G6IA 2JLBA 4RW0A 1FSFA 4DLZA 5JSZB 2W58A 4RY9A 5LBIA 3UGQA 5DBFA 3QXHA 4BB5A 5JDIA 3OEYA 3U39A 4DS3A 5I4IA 4HS4A 2ZJ0A 1W2BB 3TB4A 1YRBA 4JROA 3LBYA 3LX8A 2FP4B 1S8FA 2VUTA 3KOOA 1EWKA 4UBNA 2WJPA 1QHHB 1ZZEA 1RPZA 3D43A 3ZX4A 1E4YA 2AR0A 1RQLA 3L0YA 2EJCA 3B51X 3DVAB 3R1IA 3ROFA 4AZ0A 2FPMA 1DB3A 2I8CA 2W2MA 1CNEA 2VQDA 4GE3A 2I22A 3IOMA 1WHTA 1KDPA 3DE7X 5HF9A 3MT7A 5EHIA 1GNTA 1O96B 5K0SA 1T2UA 1JB9A 2XUFA 3HB9A 1BWRA 4BJ3A 4HTAA 4XRRA 4L8YA 4KYTA 1TM5E 3TNYA 4Q9IA 3KLOA 3PR2B 3HDJA 3K2IA 3DOCA 2G5CA 3S0JA 3NT5A 2XQJA 3C3AA 3FNGA 1JR3D 3C3KA 1AUOA 2NT4A 3AQ4A 3IEXA 3PXDA 2VWPA 2NTVA 2QM7A 1CD5A 1NU6A 3LUFA 4EPYA 4KVFA 5HRAA 2Y0BA 5H8WA 5IK2D 3VNUA 1EEHA 3FUVA 3T8YA 3I3SR 1CJMA 1M75A 5B57C 1Q21A 2AG6A 4ER3A 4U6QA 5CH8A 2OORC 4KXUA 2BGNA 2HWYA 3HJUA 5BR7A 5I9SA 3RC9A 4HGZA 2WDZA 4W1SA 2VZLA 2AN3A 1P3Y1 3P0FA 4PX5A 4IJMA 3WLQA 1H22A 1Z6QA 3RHFA 1Z5NA 1XT6A 2CHFA 4DKXA 3PGJA 2ZSDA 3TL2A 3A6LA 5GJWC 5KO2A 4MWBA 4RTSA 3ANTA 1UKAA 2I2DA 4TT3A 2CCKA 4OHBA 1I2ZA 3NPMA 5KVCA 3OUTA 4DDUA 3HDYA 3SYKA 3W5SA 3HY6A 3L8EA 1Z7WA 1DBVO 4RK5A 3TWOA 4YIHA 3JVUA 2AHOA 1R74A 1FMLA 3AUXA 2VAMA 1JPNA 4YCSA 2DZDA 4FC6A 1STOA 4KE6A 3RYFA 5CEFA 5AK4A 1I1NA 3FRIA 4EG6A 4D26A 3D7SA 5EKXA 2IT1A 1AS2A 1YJXA 3SKVA 4Q37A 1X80A 3KJHA 5COAA 3ZHOA 4A1FA 2NPOA 3O84A 2B9VA 4DRYA 5AM2A 4NK5A 6GPBA 4HDMA 3DKPA 3V00A 4LYYA 4ZDWA 1II8A 5J23A 1KXZA 1BSVA 2JEOA 2ZUTA 4OQZA 3JALB 5LSAA 4MB0A 1Y3IA 3REFA 4Y8VA 1Y9JA 4EQ6A 1DCKA 1XA3A 4DA4A 1HGXA 4HI0E 4QLBA 2Z56A 4EDHA 2Z1NA 5BN5A 2VBCA 3JATB 2OQRA 3RTAA 3ZGXA 5K99A 3O4IA 4RJLA 5T6BA 5U4QA 1E5XA 1VQLB 1F8GA 3H5RA 4PXAA 4HH0A 5IXJA 4TWAA 4JCCA 3T1NA 3C2QA 3IR6A 3LCCA 3ZU6A 5U1PA 3UKDA 3AH8A 4BS9A 4RL4A 4DQLA 2NO4A 3CCEB 3AHCA 1FDWA 3D81A 4LZLA 3FOBA 1E1DA 1CV2A 4JLDA 2QNRA 2VWHA 5IJ0B 3BE6A 1A71A 4HAOA 1N2BA 2UXCB 3OZ7A 4OMDA 4N03A 3GLKA 5E0KB 4BCDA 4DZRA 3BFXA 5DTEA 1JFTA 1SVOA 3C6KA 4IIYA 1N25A 1GTJ1 1HDZA 1VE1A 3KB8A 1HE3A 4I46A 2YXLA 3KPYA 4BQNA 2AN1A 3A4VA 3EUAA 1NZJA 4JU8A 4LXIA 1DJPA 3MS4A 5DCYA 3ESBA 4BY9E 1PUXA 3HG7A 1TL7C 3D2AA 1CDDA 3HLTA 3JR3A 1DC7A 4KBGA 1X92A 3TZEA 2XWJI 4DMRA 1Y82A 3WGGA 3HP4A 2R4UA 1XYYA 2ZRPA 4RSHA 1SELA 2AQ8A 3B9RA 1A95A 1XEXA 5KU1A 3UHPA 3LS2A 3WSTA 4OHKA 1RQRA 2PCJA 4W8GA 1XMQB 5IU6A 1F1BA 4YCNA 3UN1A 5I8PA 1DKQA 3I76A 3KKKA 5CYPA 4AZ3B 4PVDA 3N5KA 5AOVA 2EJTA 4G0OA 4UMFA 1OBHA 1JFVA 5CA1B 3S28A 2FEMA 4UUAA 2X86A 3QY9A 4TL6A 5CFRA 4KYVA 3AP3A 3DWFA 5AW6A 2H7VA 2IU0A 2HB6A 2JCVA 4QUEA 3SFTA 4HWKA 3RKSA 3AF4A 1CQZA 3RSZA 1QTQA 1CRZA 2IEYA 2NQ8A 2WJJA 3LC0A 4FDVA 4WNCA 1UMDB 3ET5A 3INTA 2Z0MA 2HF8A 5LMNB 4TKMA 5JJBA 1XCOA 3W5JA 1UEIA 4LX0A 1J99A 4EB6B 5K0BA 2WI8A 3M6WA 4A4DA 5C31A 1I7SB 3E5RA 1EE1A 2OGWA 2ZR0A 3LCRA 4ZCPA 3USZA 4ZDJA 4YHHB 4DR4B 3C3WA 1C0PA 4XVHA 2NP6A 1FVXA 1P9WA 2ZG6A 1EZZA 4M88A 2EKBA 4E1BA 3AF0A 2AR9A 4QASA 4GKAA 2I7DA 3VO8A 1IY1A 2X8BA 2AN4A 1D09A 1WSWA 1RYBA 1Y1LA 1YHZA 2HJVA 2IYTA 2XKAA 3BQMB 3KR0A 3N2KA 4XM2A 5HF8A 4DTIA 3NHBA 3JAMA 1CR4A 1XAIA 2WF5A 5FHRA 1SU4A 1HT3A 2Z09A 3LXUX 4YRCA 4U00A 4F2PA 4R3NA 3T3NA 1Y6FA 4KH1A 1YVUA 2HNAA 5DGIA 3MT0A 3VPFA 3AVTA 2HI0A 2WHYA 3NHZA 2UUAB 4C0QC 1MHTA 1EK0A 1U5CA 1VZ2A 2WV9A 2PGAA 5HKAA 5FWYB 5HZAA 4Z1OA 4ZYVA 4ND6A 2VT2A 3RRYA 3UBMA 4YP7A 3QITA 1W93A 3KOUA 4HVAA 3WK8A 1H0SA 3ISTA 5C4MA 2YKGA 1CIPA 1ZD9A 1IH8A 5CK4A 4AB1A 1OF1A 1JLLA 3L8HA 4PZ0A 1DADA 1B8UA 1YBMA 3T38A 4AYWA 2I4IA 4DLAA 5IVPA 2IX9A 5SZHB 4UULA 1PHRA 1WKVA 2KLBA 2YUIA 1A1SA 3OF2A 4YRNA 2YBEA 3WLSA 1X3SA 5B3JC 3RVLA 5HZMA 4IP0A 1ZIXA 1OFTA 2QU7A 3UMRA 5DLYA 2V0CA 1PS9A 1Z9BA 5HEKA 1AHNA 1ZAKA 5AJXA 2JVIA 5TARA 2Q6LA 2OPBA 2ZJOA 3H16A 5ARDA 4BLQA 4RXUA 3N3BC 2D74A 1IWOA 1XF1A 3DMDA 2AH5A 3LD9A 4O1HA 2EF0A 5EHQA 1ZMBA 3KQWA 1VGQA 2QUHA 3ZU4A 4AO7A 4RADA 3AINA 1WNFA 5E7MA 5L53A 3URMA 1HLFA 1LVUA 3EQ6A 3FB4A 3PUHA 3C6BA 4LF5B 1TK9A 2IOFA 4M9CA 2RGEA 1KU6A 3HJNA 4NECA 3KUDA 3W5UA 1RC8A 5KVQA 2AZXA 1GRCA 5BV7A 1G21B 3AZOA 3JVEA 3RC3A 2PAAA 1NY6A 2H4ZA 3BJEA 2B7CA 1HZJA 1SKMA 3ZV3A 1P4SA 2QG9A 3P5SA 3PDIA 4D4JA 4R6WA 2X9VA 4DCUA 4MRMB 4KFSA 5K0GA 4XVQA 3I4FA 3P2EA 4KIFA 1RWPA 4HJRA 4HRAA 4NF2A 5EE0A 4EZBA 1BYIA 1KMQA 3PQCA 4XGRA 4YAEA 1PWHA 3V4ZA 4DBZA 1PVOA 4I8DA 3R09A 1ISRA 1QDUA 4I4TB 3QKSA 4Z4TA 3A6DA 5F51A 5TVKA 2B3TA 2DEUA 1K68A 4TWJA 3CG4A 2R7LA 1HNXB 3EMKA 2BE7A 2RG1A 5BO5A 3UM9A 3L82B 1FF9A 2MYPA 1A50B 1ZJ6A 3GT3A 4QJBA 5FOVA 4CM9D 4DA7A 3UZUA 3FDZA 1OFGA 4PGAA 4Q4AB 4B09A 4BNYA 3OOYA 5B3KA 1QUFA 2QQ5A 5TMEA 5CG2A 5CPBA 3DCJA 3EPPA 5CVJA 1N78A 3CT4A 1W47A 2X1LA 3LW7A 5BUZA 3IHTA 1UADA 1NZDA 1XZMA 3OJCA 4TYQA 1J24A 5JWHA 4WVLA 2TSYB 1S2OA 2CSUA 2G3YA 1VLLA 4MW2A 3WWDA 2GNPA 4U9IS 3SXUB 4AW9A 3OPYB 3AGQA 4JKYA 3JQ7A 4UM9D 5DK6A 4D8VA 2P2LA 1MC8A 2XVZA 4RIHA 5IYNA 2ZUWA 5FOUA 3TZQA 2XWPA 3OTWA 4L78A 2SKEA 3FGPA 4F96A 3L7IA 5CEJA 7ADHA 3EODA 5DXJA 2PX2A 3DE1X 4OF4A 1HYQA 2O0JA 2F1IA 1FFSA 1M2JA 4XTCS 3C14C 1SZPA 2Y2UA 1SHJA 3FETA 4DV0B 3BK2A 4X1KA 4B5LA 3LX5A 1G3IA 3O4JA 1QANA 2PZGA 1NYQA 4ZT5A 4D6YA 1KMHB 5CG1A 2W6NA 1UD5A 4QUBA 1U2QA 4X3PA 3T54A 3ZGLA 5CBKA 4XUEA 1A69A 4RACA 2IDJA 2Q3LA 4D4IA 3MRVA 1OC4A 1O57A 4XIJA 4G41A 1CJSA 2X1HA 3ISJA 4NZMA 1CYEA 2H4YA 2XHEA 3Q8XB 4C3OB 1IFXA 3ELUA 3S2GA 3KKLA 4IWXA 4ENRA 5CJ2A 4BWVA 1FXSA 1I8TA 4DF3A 3RIXA 4Z7NB 3OICA 1WPCA 3D2BA 3EVDA 3R77A 3KFVA 5K6TA 2VXOA 4N47A 3OQMA 1GCAA 2VSQA 1XZQA 4LKRA 3G6EB 4GVXA 3QF7A 5DYTA 1FP6A 2W6PA 1BRTA 2O0HA 3HKEA 2BRUA 1HORA 3UW1A 5LP6A 1IQUA 3AI7A 2OKGA 3P20A 4G09A 3PKJA 4GBJA 5T67A 3VU3A 5B7GA 4O1MA 3IQIX 4FMBB 3OH8A 1YRYE 4KV7A 1JHDA 1TOAA 4WWVA 2C57A 4AJPA 2ZDHA 3OZXA 1WXWA 1FPQA 2PNFA 3RYIA 3IVAA 2QM3A 3TZBA 4A15A 1QTNA 2QA5A 1NP7A 2D1SA 3OY2A 4KQWA 5AUNB 3JQRA 1RLIA 1NRKA 1DQZA 3OFJA 2WAAA 2QRJA 2Q21A 3PFFA 1VG9B 4MV9A 4QBFA 5ERYA 1BHJA 2BTEA 1GCIA 5BOVA 3V9AA 4EVSA 3AR4A 4CKYA 2OZLB 1UBCA 4BNMA 4OFZA 1NBHA 3W5HA 1WIWA 1F4LA 1SQGA 4G07A 3HUDA 2Y67A 1GG8A 1GTL1 2Q1SA 1L4GA 5C7OO 2WJYA 1VSQA 2VHYA 3C1AA 1QONA 4EFMA 4IFEA 3VDRA 5I48A 2P4HX 4YUAA 1K08A 3CLHA 4JBGA 1GL7A 5CVDA 4DRZA 4A36A 1C0KA 3CMMA 1JAIA 3RS9A 1UD4A 3AHHA 2A5YB 1FMCA 4OXXA 5DCLA 4B47A 3K0FB 4E03A 4Q4HB 1NONA 2QRHA 1KEKA 2WD7A 1NFRA 3ZVRA 5KMGB 4ZOQI 3A04A 4KACA 5HIAA 1QWSA 1SWVA 1UFVA 4EA9A 4GMGA 3ZN2A 4HUTA 5DI9A 1U0BB 3CCCA 3U44B 2RGBA 1QAQA 2O5EA 3WY9A 3NAZA 4DLVA 1ZUWA 2C4UA 1PNVA 2A3NA 2G80A 1P0FA 1AUQA 3O2SB 4XOPA 2WJ6A 1M1NB 3MWDB 1MPTA 4NHOA 1I0IA 1TF7A 3Q7SA 2EFCB 5C1PA 3CESA 1P81A 3BCHA 8AT1A 2JFVA 2V1XA 1GN9A 3EEOA 1YJNB 4Q0MA 3HMQA 4FJ0A 1SOAA 1MPXA 3A1CA 1PGQA 1R3DA 3FZGA 1AIPA 3DLPX 4H4CA 4TV8B 5K1ZA 3WMRA 3VBEA 5A62A 3MJFA 1ZBDA 5EMKA 4ZRDA 2BMDA 3ELBA 3E18A 5AHOA 1KEUA 1U3FA 3LFTA 2H1SA 1F48A 3OG9A 3QHPA 1M74A 2PX6A 3JVIA 4Z0TA 5JCZA 4XN3A 4IHQA 1G17A 3BAZA 4OX9Y 3VFDA 2LRHA 3ZHSA 4B3BA 4G1BA 1S9HA 4TTPA 3RK4A 1EG2A 3VGJA 4I5GA 2PD3A 4ON9A 2QNIA 1WVIA 3DPIA 5K3OA 4BO9A 1W52X 4D8XA 1F2TA 2BCGY 1ONBA 1QIFA 2O2DA 4KR3A 4PLTA 3ZDYB 2WZCA 1B74A 3UUFA 4KO3S 3H2JA 4NZZA 1QKJA 2VYCA 4TTIA 3S27A 4BZXA 5IPFA 5BOSB 3E8MA 1H5QA 1VBFA 4RPJA 5A4DA 4PCAA 4WH0A 2EQ5A 2Z8YM 2EGUA 3PHIA 1K3UB 2RIRA 4XYEA 4BX2A 2F1LA 1NVGA 4C7KA 9GPBA 2QPOA 4MH0R 5AW5A 3RT7A 3ZVNA 2PWPA 3LW8A 3OA2A 4GUAA 3AB3A 1NB0A 1OBCA 3EIFA 2EW8A 5IT5A 3WZLA 3CUSA 4GM1A 3HB7A 4OIMA 1L3CA 4D42A 3LCJA 4LHWA 1RZVA 4RKEA 2WYHA 1R9MA 1WZ2A 4R1TA 1L4YA 4OLBA 2R8XA 3O8QA 5GWXA 4MI1A 4RM2A 1NNEA 1EK5A 5J2TF 4FPXA 1C9DB 4L76A 4UFPA 4MUAA 3R8XA 5JHHB 3CVVA 3I01M 3NC1C 1S2NA 5FOQA 3LNCA 2Z6QA 1KK0A 2QX6A 1J1ZA 4M8NE 3E1YE 1CBUA 1BVUA 1U8TA 2FVXA 4K81B 3CU5A 1PL0A 2PS9A 2XWQA 2ZBGA 4IF6A 4TT3D 3BHNA 5E2BA 2O7NA 1ZD8A 2VJQA 1W35A 1K27A 3MJSA 4GEGA 5FR2A 3TMYA 1DXHA 2PLNA 3E22B 4EZEA 1E2IA 3QOYA 4QQFA 4Q3EA 4E5YA 3Q88A 4IDNA 3IULA 2UYHA 5A4IS 5H5JA 3AU9A 3OW2B 4ZI7F 3N3AC 2OCPA 3WLFA 2PHZA 2XCSB 5F5NA 4M9QA 1QZZA 1J42A 1Q0RA 3LQ1A 4NZ9A 2ZUUA 3S2ZA 4QM6A 1SVNA 5CIWA 3RU7A 1OBFO 2HIGA 1SXJE 1FRNA 4YCCA 4BN0A 1SRRA 2XB9A 2IEDA 3P94A 2AQHA 4OJMX 5AKGA 1RQXA 4ZYTA 3CF4A 1JS1X 3Q87B 3HA5A 1T1JA 3PNSA 5BQPA 2FWNA 3FMOB 2EDAA 2VQ3A 4PC2A 2QG4A 3TBKA 5AM0A 4DEYA 621PA 3WSWA 1FE8A 2GEBA 1RJDA 2ZSFA 4X8MA 5E0OA 4MR7B 4NAUA 1U6IA 2QTTA 4CN8A 1SCAA 4ABYA 3U31A 3DXXA 3L18A 4HAXA 1ABFA 4G4IA 4AY4A 4LJSA 3F5MA 3I42A 2J3LA 4TTVA 1K1EA 4RDIA 4UDYX 3RRXA 1JVNA 3ZYZA 2RHTA 3VPDA 1XXHB 5KAPA 5F7XA 2YW2A 3W2HA 3DCNA 1A7UA 4LJLA 3VKFA 4DNFA 5KPJA 2FPXA 2MMCA 3M5DA 1X7XB 2I2WA 3KSRA 2QE7A 3RUFA 1UBJS 4OLFA 2WLTA 4UARA 2PGDA 3GFGA 5KWVA 2ZVJA 4JQSA 4D4KA 2ODBA 1AQUA 1PJRA 3BHJA 3E9DA 1PQPA 3R24A 1Y8CA 3GA0A 1XZLA 3MYYA 5DYNA 5LQRA 4PYJA 2F3SA 1GNSA 4ZEOA 1X7WA 1KI4A 1M6YA 2IEGA 1KR2A 3AKYA 3AY0A 4UNIA 4K6GA 5AK5A 1KDVA 3IO3A 4XCVA 3TTSA 3UG7A 4K87A 3KAJA 1CR6A 1MT0A 2EX1A 4MWDA 2BC9A 4KUEA 5FYDA 3Q3EA 1X7XA 4IV5A 2HJ9A 4RF2A 3UANA 4YYEA 5M04A 1K63A 4KLRA 2WF9A 3WK9A 1J2JA 1VQ8B 4ZVKA 4LDNA 3D7NA 1L5LA 5EPEA 2VJJA 1MIOA 2VTEA 3F98A 2HK9A 3H84A 3DR5A 4G9EA 1E3QA 1JXAA 4KGVA 1G21A 2FWMX 2OCBA 1Z0JA 2W2TA 2GLXA 2IGBA 2OB1A 5ENVA 1TLTA 1KAEA 4JB2A 2B5VA 3MJEA 1MTZA 4U3JB 4XUCA 4BEJA 4PGGA 1LTHR 3GMSA 1RWVA 2GZMA 3F7NA 3TR0A 5A1TA 5JNWA 3R6GA 3UMYA 2R6ZA 2YXPX 2P5TB 2VHUA 4KKTA 2CLSA 3WRYC 2ZOSA 4KXQA 1J22A 4I4IA 4I4TF 5A0FA 2K2WA 2RI0A 2ZIXB 3HA3A 1C2TA 2WG0A 1QDLB 2I1VB 4OYRA 4EGQA 3JYNA 3CLTD 3NDIA 1DKNA 1QR6A 2D3TA 4IHJA 4OOVA 1Y7HA 2X6TA 4FDTA 4Z4CA 2JJ8A 4R41A 1WA5A 2VG8A 3KE8A 2GPJA 1MV5A 4PNHA 4RETA 1PJ7A 4ZARA 1WAMA 1IUPA 1CUDA 1PGPA 3FZQA 1JDZA 2JH8A 2X9GA 4HEJA 2W4QA 3B3JA 3QV1A 4ZCTA 5AUPB 1U0GA 2GARA 4Z0HO 1JLLB 3ESDA 4AC9A 3BB1A 2ANCA 3M5CA 2DBYA 5CLLA 5FPTA 1WV1A 1T6YA 4KSBA 5GONA 4CXMA 1U1IA 3A9UA 1ORWA 4NH4A 3PXGA 1W34A 1SD5A 5E9QA 1WY7A 4LS3A 3DMFA 4PAOA 5ER6A 3MINA 4BNFA 1C9NA 1KY2A 1MKYA 1UKEA 3AUTA 2PLFA 1WXXA 2WT8A 2WUEA 2OGTA 3ZXUB 1G5RA 2P7HA 5CYOA 3IJ5A 4EB8A 4QZVA 2Q7XA 3ZXSA 3QEBZ 3A37A 5PNTA 2ZYTX 4YMTA 4CV2A 1K73D 4MW9A 5FWXA 4FR0A 1F3OA 4QFCA 5HK8A 5A03A 1P73A 2Y4NA 4UOEA 4GXTA 2QZZA 3RIHA 4JCOA 2HCFA 5LZ9A 4IQGA 5H83A 3VHLB 1TGVA 4UAVA 3CC2B 1O9BA 3HHPA 4XB2A 3EZ9A 1E3SA 3GG9A 1CY0A 4R9SA 1PDVA 1Z2EA 4OHOA 5DMHA 4IJUA 3HCFA 3LUPA 2L18A 3PG5A 2GCOA 1UEXC 4PLFA 4TUYF 3ROGA 3FUXA 3WQHA 2R6GA 1E64A 2YY7A 2CEKA 4X6YA 2NADA 3CJTA 3H1FA 3PDHA 5K3DA 4XSHA 3AERB 3VR5H 1I6LA 2FG6C 3L7MA 3KEFA 1ZJWA 4CEHB 3W0LB 3VH4A 2CL0X 2HN9A 3GUZA 4MVJE 4UEJA 5IUJC 1RBYA 5LOVB 5ES4B 5AKKA 1CY4A 4CKCB 2GZSA 3PHJA 1Z73A 5FI5A 4YWHA 1ZCFA 1CJCA 1V7PC 2GQFA 2Y1KA 4P92A 1Q7CA 1SUDA 1XTUA 4J4HA 1GO2A 1UMBA 1AHIA 4O2BF 4YMSA 3LVRE 5C1OA 1F6WA 2FW8A 3FAKA 3PGVA 3BXOA 3IUYA 3Q6NA 4L75A 2XYRA 2I62A 5AKHA 3WIBA 4PG6A 5H02A 4D9MA 1U7DA 1IMOA 4MZDA 1HMPA 4YXWA 3NOQA 3B1VA 2CJPA 3EFOA 3NIBA 4UM7A 421PA 2D1YA 4RESA 4BV8A 3GUHA 4BC1A 1GPLA 2A92A 1P6XA 2YTZA 5ILGA 1K6MA 2J87A 3O0TA 5FLKA 2C9OA 5CA1A 4DCNA 3RUIA 4Q1DA 3T7RA 1A76A 1E77A 2C5EA 4B85A 4MR9A 3ADPA 3ANSA 3S2UA 3R5TA 3T4EA 1JEJA 5A2GA 5KVAA 4BTVA 4XKVA 1YT5A 3AUSA 3LI2A 5FDFA 1TYBE 3H2IA 2QW8A 3SQLA 1B7GO 2OXCA 3ZHBA 3I5XA 2A9KA 4JEUA 3R23A 4CV0A 4OLHA 1YIJB 5K9ZA 2WB2A 4WACA 1NFQA 2X4GA 3AF1A 4MGKR 4AKTA 4KI7A 1GCOA 2I2FA 3G7SA 2ZULA 3AR8A 3OLVA 1UBMS 4KWCA 2M1XA 2IS2A 3ASZA 2XZOA 1Z07A 3PWTA 4FFBB 4JVOA 1V37A 4QHTA 3O6VA 5BNIA 2WTUA 4MHOA 4U5XA 2WKPA 2GLUA 1U2DA 2PU7A 2XUHA 5EI5A 4FSDA 4PBRA 1Z12A 3HO8A 5B5SA 3BQNB 1T2FA 5JLAA 3ZHCA 2VCHA 3FYSA 5KVVA 1R7RA 3IIEA 1M34B 3D9QX 1TQ8A 2EGHA 4DV3B 1YULA 1JDPA 2HA0A 3CZMA 2ORIA 2EL9A 5EZ5A 2SKCA 4DC0A 2VQFB 1TVCA 3FKSA 3QFTA 1F3LA 1RWKA 2WUWE 4S12A 5F9HA 4YR9A 3KLMX 3PUKA 3GL9A 2B3DA 1HL3A 1XCGB 4FHFA 2H18A 3H05A 1S9DA 2A58A 4WK2B 2PUHA 1TU3A 3GJ6A 3HVIA 2NVOA 3Q12A 5B53A 3QF4A 4TXNA 2UZIR 2JAOA 2XTZA 3PUNA 3Q5DA 3TM5A 4UE2A 4BQSA 4KIWA 4URXR 3D3EA 3Q40A 5E2AA 5BN5B 3CH7A 1IVSA 2BGKA 3TRDA 3IXQA 5D84A 4FFDA 3MJTA 3WMGA 3N53A 1GUYA 2VSNA 2FH5B 1P77A 3F6CA 4YXFA 3WR5A 4IM7A 1IMJA 4V2UA 3NJRA 1XJWA 3IP1A 4O4LB 3S2FA 4OHVA 1TB4A 1G2QA 2ATXA 3GR6A 2CFRA 4IYRA 1QHGA 2JAUA 2J9FA 2ZS9A 3AIOA 1VYHA 4Q16A 1WDTA 3KSUA 4QEDA 3TGWA 2NTJA 1VKHA 5MF6A 3ZV5A 4BYMA 3IQFA 3O31A 4KXXA 1WETA 3SIXA 3MW8A 1QMPA 2VF2A 4LV6A 5D1HA 4DIDA 2ABWA 1SC6A 4GWLA 4O2AF 4I3HA 5JNLA 1FNDA 2FW1A 4U7FA 3IAFA 1YUBA 4IS2A 2C2ZA 6REQA 2VK4A 2FSGA 1QHYA 2QN1A 1QVRA 1WNTA 4UUPA 1UBGA 1YMVA 1S2IA 1EDEA 3UWPA 1ZFNA 1TM7E 4IJWA 3GFRA 3GGCA 3CEHA 4H16A 4AZWA 4DQXA 1XIVA 5L4SA 3K0KA 3C4VA 5FLYA 5AKEA 2FDCA 3OURA 4L51A 3HZOA 1RJFA 2O5RA 5AXBA 4EYEA 3U7HB 1Q83A 4NDNE 4MGHA 3VH3A 1E7QA 4RV9A 5LM3A 1O96A 4FEYA 3BIWA 2RD2A 2JFHA 5F12A 5FBLB 2IKQA 3EEQA 5DLDA 1UPUA 4B6QA 1S7CA 4HBZA 4II7A 2Z30A 3MMPA 1QIDA 1HDYA 1U99A 4MPDA 1IN8A 3AW8A 4TMYA 3F6SA 5JWRA 2JGAA 2P69A 2ZAIA 3WGNA 4PO1A 4LFBB 2RJ3A 3PC3A 4FFPA 5EE3A 2GYYA 3FJ1A 3O4GA 5FUWA 2VAPA 1P39A 4JK3A 4M0DA 1BVHA 2A9JA 4W6QA 2FG5A 5T41A 4DZZA 2BW0A 3PA6A 5JWOA 1T1RA 1AQLA 3FDZB 4O2RA 2UUCB 1FY2A 1SKBA 1V5EA 2XR1A 3N74A 1XAJA 2BUCA 2QMHA 3BNWA 2O0MA 4RMHA 5BSGA 4LGVA 4F3TA 4AMYA 4WY5A 2F1RA 3Q0TA 4LE0A 2X77A 5FNVF 2AXPA 1Q81D 2C5GA 1KH2A 3C98A 4QOIA 3VNAA 3RODA 1IOVA 2CJYA 2FP4A 2ZZGA 2H4WA 1VKOA 3BSWA 4G8CA 1GVHA 4OHWA 2RBGA 4QUJA 4LW8A 7MDHA 3L4JA 2AUNA 4HAWA 3HNRA 4UM8B 1XLTA 1NY5A 4DMCA 4XKJA 4CM4A 4CKBB 5LVAA 3AVYA 1Z47A 2I6SA 4ZU1X 1KSGA 4F93B 5E4FA 1YQ9A 2ZWAA 3IC5A 3EGWA 4PYLA 4OYYA 2EWVA 4MJ7A 3WP1B 3E4CA 1II9A 3LA8A 3MNFA 4NV1A 5F7OA 2I1WA 2FOXA 2VF8A 1KPGA 4R0VA 5ALXA 2Q0QA 4CJXA 2AKEA 3HFGA 1NMXA 3CXRA 5GJBA 2IKSA 3R9IA 2WJWA 3JQFA 1N2JA 1Z6PA 1DIBA 5BSFA 3AKZA 2V7XA 4FFBA 3KRTA 1A7KA 1B15A 2WHPB 3G6KA 3L7YA 3OTQA 4Y2TA 3V9PA 1H2BA 4IDQA 1PX2A 4Z9XA 2DQ4A 2IRWA 4E21A 3D8RA 4XX0A 5KTNA 2P6NA 2XUIA 2IUUA 2EIXA 3D0OA 3M9LA 3I6IA 4ETNA 1KHHA 4DUZB 3FWPA 4RJIA 1ZG3A 1OXBB 1PK9A 1UAYA 1VP9A 2I2XB 2QP9X 3G2JA 3IDAA 4UBJA 5EUMA 3SC3A 2QMEA 1I4DD 4LPSA 2HHCA 2NN3C 5JFTA 1A8UA 1K7EB 5CNJA 3VTAA 5SYNA 1KFBB 2R00C 4MR9B 1XALA 4U2BA 1UANA 3TGPA 2QP4A 4LZAA 1RBZA 2FN7A 2PT9A 1NNLA 2XA9A 4KTVE 1R12A 4IMJB 2C1EA 4HQNA 4D8WA 2FJPA 3MOGA 4OFXA 1N2CE 5JQGB 2FSSA 3F46A 3PNBA 4WXPA 4CQMD 4TL7A 5DJ5A 3CJQA 4EVIA 1TIKA 4PIVA 2A94A 2HBRA 4TQUS 1E9AA 1ZCBA 1AS0A 4B2YA 3EH1A 3H1BA 2I80A 3WLKX 4OHPA 5D5HA 1WQ4A 3KP1A 1D2AA 4GRAA 5DX0A 3D8BA 3WWZA 1KI9A 1PNTA 4LRXA 3TD9A 3ADBA 4UQLA 1F06A 5A89A 3VX3A 1Z82A 1OWOA 4LK3A 4LXGA 2H00A 2LWIA 3EUFA 3LX6A 2ZIWB 2HDHA 1UBSB 3HLKA 3OZTA 2IIPA 4LTNA 4DARA 1ZI6A 3K9QO 4TLBA 4AJ4A 2I34A 3EZGA 3NV7A 5LJLA 3HGMA 1ECPA 1FBTA 3C70A 5DWQA 2O05A 2VBFA 1LGYA 1IY0A 1PBNA 4DT1A 2XH8A 2Z1DA 4HADA 2WTXA 2EZ9A 3RYTC 3OZAA 5D51S 4DZTA 2ZBPA 1OYYA 4JYPA 4MRVA 2G1AA 4MHTA 1A7AA 4KL8S 1NI4A 2HKIA 3PHLA 4PLVA 4PPNA 1SIUA 2C8JA 1UBUS 2CWWA 4QJ4A 4WINA 2H0AA 4D1YA 1DQNA 1K3TA 4QVAA 3PA1A 1U0FA 1VHTA 3QXCA 1VXOA 3AIKA