The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
84
|
sequence length |
257
|
structure length |
257
|
Chain Sequence |
AAFNTQKVLSVHHWTDAYFTFTCIRDESLRFENGQFVMVGLMADGKPLMRAYSVASANWEEHLEFFSIKVQDGPLTSRLQHLKVGDEVLISKKPTGTLVACDLNPGKHLYLLSTGTGIAPFLSITKDPEIYEQFEKIILVHGVRYKKDLAYYDRFTKELPEHEYLGDLVKEKLIYYPIVSREEFEHRGRLTDLMVSGKLFEDIGLPKINPQDDRAMLCGSPAMLKDTCKVLDDFGLTVSPKTGVRGDYLIERAFVDQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal Structure of a ferredoxin NADP+ reductase from Neisseria gonorrhoeae with bound NADP and FAD
rcsb |
| molecule tags |
Oxidoreductase
|
| source organism |
Neisseria gonorrhoeae mia_2011_03-10
|
| molecule keywords |
Ferredoxin--NADP reductase
|
| total genus |
84
|
| structure length |
257
|
| sequence length |
257
|
| ec nomenclature | |
| pdb deposition date | 2016-09-30 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00175 | NAD_binding_1 | Oxidoreductase NAD-binding domain |
| A | PF00970 | FAD_binding_6 | Oxidoreductase FAD-binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Barrel | Elongation Factor Tu (Ef-tu); domain 3 | Translation factors | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module |
