4P22A

Crystal structure of n-terminal fragments of e1
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
381
structure length
370
Chain Sequence
IDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTPLEDQLRVGEFCHNRGIKLVVADTRGLFGQLFCDFGEEMILTDSPLSAMVSMVTKDNPGVVTCLDRHGFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLVASLAEPDFVKFSRPAQLHIGFQALHQFCAQHGRPPRPRNDEDAAELVALAQAVNARALPAVQQNNLDEDLIRKLAYVAAGDLAPINAFIGGLAAQEVMKACSGKFMPIMQWLYFDALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression, purification, and crystal structure of N-terminal domains of human ubiquitin-activating enzyme (E1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-like modifier-activating enzyme 1
total genus 105
structure length 370
sequence length 381
chains with identical sequence B
ec nomenclature ec 6.2.1.45: E1 ubiquitin-activating enzyme.
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16190 E1_FCCH Ubiquitin-activating enzyme E1 FCCH domain
A PF16191 E1_4HB Ubiquitin-activating enzyme E1 four-helix bundle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.180 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4p22A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4p22A01
4YYZA 4J9VA 3JQAB 4NBUA 5DOZA 1CYDA 1LBEA 2WYVA 3DC2A 3JD1A 4YBZA 5GZ1A 2NQ8A 5IZCC 4A7PA 1KIFA 2QHXA 5THQA 1MB4A 3GHHA 4A26A 4W9NA 1A9YA 2Y0EA 1MFPA 1KBZA 1D1TA 2CUKA 2SCUA 4KUHA 4N18A 4AJEA 1G0OA 1LSOA 4IMPA 5FF9A 2O7QA 2Y1CA 3ICCA 1N8KA 3SXPA 3VAZA 2VYVD 3PWKA 3I9JA 4RPGA 1NVTA 3PGXA 4BKOA 2EGHA 4ZD6A 5KVSA 3UH1A 5L4SA 2E49A 2RH8A 2NTNA 1F14A 4NK5A 4OAQA 1PSDA 3AI2A 3I9OA 4IDEA 3RVDA 1YDWA 4TRNA 1AGNA 3BMNA 3KBOA 5A9TA 1H6BA 2IYPA 1ZVMA 4CQMA 3AOEA 1E5QA 4DC1A 4R41A 1PIWA 2V6GA 4LK3A 1ZK1A 1Y9AA 2UV8A 3JQDA 4MPDA 1O89A 4R5MA 1HE4A 3T4XA 4BGEA 3ABIA 1H2BA 3D7LA 3OJOA 4CM5A 3GVPA 4DC0A 4CMKA 4J1QA 2PNFA 4BL5A 2PZLA 3B6ZA 3MJVA 3VPFA 3MZ0A 5JXWA 1DLJA 3F1KA 3WJ7A 4XIYA 1HSZA 3PLNA 5AXDA 3ICPA 4QEDA 4B4UA 5G2OA 4FJ0A 2DTDA 3QRWA 1ZO8A 1SB9A 3PDJA 2NQTA 4II3A 3LQFA 1QP8A 1B2LA 4YAEA 4CR6A 1JDJA 2BFAA 3F5SA 2WDZA 4TKLA 3M6IA 4WLUA 5HBRA 2CSUA 2YHIB 1UDBA 3V5NA 3FR8A 2P68A 1MXHA 3ANLA 3M2PA 1ISIA 5BNTA 4ZVVA 2GERA 3K6JA 3R3JA 4GH5A 4J0FA 1W8DA 2R00C 3IAHA 1BVRA 4LN1A 3PTZA 5EIOA 3WMWA 3U09A 1E7WA 3D1LA 4O63O 3VH3A 5T5QA 2POQX 2DUUA 3PHJA 2HMSA 4BNKA 3BHIA 3HDQA 4UVDA 1Y7TA 3ZV6A 3PHGA 1AHIA 4ROSA 1U3TA 1HWYA 4GVLA 1WXDA 1P1HA 3PLRA 1PU2A 4OJNA 4DRYA 4CLOA 2LZJA 4G5HA 1ONNA 1ONOA 3O8QA 1HZJA 3DBHA 1J6UA 2I3AA 3CH6A 1E3IA 1U2GA 4CPDA 1E6WA 4CM8B 3QVXA 1E0DA 1E92A 5DULA 2I76A 1TEHA 1E6EA 2JAPA 3PRJA 3FI9A 4L4RA 3GRKA 4PLZA 4CJXA 1IPEA 3ZWXA 5LCXA 2CNBA 3KVOA 1U2DA 3TZHA 3D5QA 2GN9A 2FHSA 3K2EA 2VNSA 4YR9A 3OA2A 4IINA 4NU6A 3VZRA 3MJCA 4IXTA 1SNYA 1UJMA 3WYCA 1UXGA 1CIVA 4PLFA 4XR4A 3P7MA 1WDKA 5L95A 1YKFA 1L1FA 1G1AA 3DONA 3K2BA 3WX0A 2V6BA 4YJDA 1PZEA 1YL7A 2IDZA 3H9QA 5G0UA 3GEDA 1U9JA 3RUIA 3SC6A 3EYWA 2NVWA 4RPLA 4Z3KA 4OL9A 3TQHA 1LLDA 1P0CA 2VWPA 3PQEA 4Q9NA 3UCXA 1UAGA 2D5AA 1LDGA 2JCYA 1QYDA 3F4BA 3IUSA 5BNIA 3HZZA 2C7GA 1WLYA 1DHRA 2GZ1A 2GDZA 4MVJD 5H83A 4GX1A 1Y8RB 4F6CA 3GZNA 3IKVA 4AL4A 4AICA 4BGVA 5TLSA 3B1JA 3CINA 1ULSA 1B8VA 1SBYA 1M66A 1R16A 1XEAA 2EWMA 3JQ8B 3WGIA 2C0CA 3IKTA 3DEYX 1T2EA 2O3QA 3BAZA 4PVCA 2OHXA 4RDHA 3OQ6A 4XEHA 1FDUA 4NHEA 5TT1A 3HQ4O 4AG3A 5COQA 3F3SA 2CDBA 4CLXA 1R15A 1PJLA 1JWAB 4Q3NA 2DTEA 4GKBA 3PP8A 2YV3A 1PJ2A 2QZ9A 5A04A 1NP3A 2VT2A 3EUWA 4YT5A 3L6DA 3MOIA 3INRA 4J0EA 5L4NA 2AQHA 4BKQA 1GYRA 3W1VA 2GRAA 2HCTA 4UUPA 3VDRA 2Y99A 5I9LA 1I3MA 2FWMX 4GWKA 5LDHA 3OFSA 4E3ZA 5ADHA 3N58A 3OEWA 1QV7A 3X2EA 3SLGA 1PQWA 4D43A 4UVGA 1DIGA 5I8ZA 4OGWA 1E1MA 3WWZA 3GG2A 2VNAA 4PLCA 3EAGA 2Y68A 2TMGA 3DAFA 2NTJA 4MIYA 4YTEA 5G0TA 2AXQA 1E3EA 3DL2A 4CQLB 1QG6A 2YY7A 4U8GA 4HBGA 3CZRA 1LRKA 4BO9A 1HDGO 2I67A 5KOIA 1DIHA 1DFGA 3A1NA 1B3RA 1RM5A 3JQCA 1M76A 3TFQA 1E7QA 2CZCA 2RH4A 5IG2A 3AM4A 1HYGA 3I3OA 3ORFA 5L4LA 3WDSA 5K0ZA 2A4KA 1I2CA 1H94A 5DT9A 1KEVA 4PG8A 1GR0A 5JDIA 3FPCA 2XPCA 4IDBA 3C3XA 3FNEA 3GC6A 3RBVA 1BG6A 5CDUA 4F6LA 1H93A 3NT4A 1R66A 1A27A 4D0SA 4OXYA 5JFOA 5J23A 2JFHA 4JX8A 2WYWA 2EF1A 4R3NA 3RSHA 1S7CA 3JYQA 1P1RA 5B1YA 4YVFA 3LT1A 3MEQA 4D79A 3NYWA 4MP8A 3W4JA 5G0SA 1NPYA 2O4CA 4JXKA 1WMBA 4D0RA 3PYXA 5HWSA 3RASA 1F06A 5FI3A 1DLIA 3WJAA 1M67A 2HDHA 3QWFA 1QR6A 3AFMA 3I83A 4M49A 5T67A 3ZH2A 2LDXA 2G82A 2E48A 4XD2A 4FFMA 4CV1A 3LVFO 4E2YA 1NQAO 5JDCA 3QVOA 4E2WA 1IY8A 2VYVA 3ZWPA 2E37A 1CDOA 4RPJA 1MP0A 1JKJA 1SCUA 2Q4BA 2G76A 3DOOA 1P1KA 4QSMA 1IPFA 2Q1WA 2R6JA 4Y6SA 4G81A 2RHCA 2VHYA 1V9LA 4M87A 1BTOA 4RJTA 2Y05A 4RVHA 3WGHA 2BF7A 1MC5A 4BO1A 2JCXA 2EW8A 4TZKA 2WJPA 3NT5A 4KDFA 1GYQA 4S1VA 2OMEA 2C5EA 3WGGA 3E9QA 1IHYA 3WR5A 2FY8A 3TL3A 4CODB 4OMUA 4TQGA 2O48X 4RZIA 1H6DA 3ZNPA 2GN4A 2GN6A 3O4RA 1R12A 1YQDA 4C7KA 4B79A 3A9WA 3ZWVA 4NNJA 4TSKA 3GGPA 3WNQA 4E33A 3E18A 2BGKA 1P45A 3G17A 5T6BA 2OOSA 5JAMA 4I5GA 2VTEA 3UOGA 4PN3A 4MP3A 4JROA 2BFPA 2C2XA 4ALJA 3GEGA 3LSYA 5K9ZA 3UHAA 4BO4A 5G4LA 2PKQP 2I3GA 2X7HA 4WLVA 2J3HA 4A73A 3SJ7A 4DXHA 3QSGA 4W4TA 4K9DA 3PJEA 1Z75A 4E5PA 3HB4X 3IDSA 5DCWA 3F9IA 3H3JA 2BI8A 3GFBA 1I10A 4H3VA 3LU1A 3NGLA 1FDVA 3F4LA 5DCUA 3AUAA 1E7MA 3KEOA 1C14A 3RUHA 4G2NA 3CMMA 1A71A 3JQ9C 1UZMA 1VE9A 5JAQA 4FPXA 5FI5A 5DP2A 4KWIA 1X13A 4URFA 2EHDA 3KLMX 4MVJA 3T7CA 3IS3A 3U4HA 3HN2A 4EJMA 3LC7O 4M86A 3Q0EA 3WTBA 1JU9A 4PG5A 1XA0A 3GMSA 1ENYA 3DXFA 1T4DA 3VZPA 1L7DA 3RUEA 1HDRA 1TT5A 1ZXLA 1A9ZA 1K2WA 2J3IA 1R0SA 3BYZA 3RC1A 1NQ5A 1T26A 3GVHA 4HFNA 4PIVA 4IUYA 1I36A 4KQWA 4BMVA 4GGOA 3PJGA 4IIUA 4FOSA 1BSVA 1X15A 4U6QA 4BNMA 9LDTA 1P1FA 3KYCA 2O3SA 3ONFA 4IXWA 2G17A 2W90A 2A35A 1P0FA 5JPIA 3EVNA 2F00A 2BH9A 4AJHA 4MKRA 2DPGA 5CG1A 3LT0A 1ZZEA 4UAGA 4YAKA 3H5NA 3AI1A 5IAAA 4B7XA 1H9BA 6ADHA 5AOVA 1BDBA 2IODA 3KEQA 5EN4A 3V1YA 5BSEA 4GSKA 1ZMTA 1B26A 4D42A 3PI7A 4M89A 1VL6A 1PX0A 4YJGA 5KNLA 3GUYA 4NPCA 2DFVA 2WTBA 5JY1A 3JQBC 1G6KA 2ZATA 5G0VA 1O6ZA 2VHZA 4BNLA 3OQ1A 4XQ9A 3GZNB 3CZMA 4OOEA 3E1KA 1Y8RA 5ICSA 3RU7A 3AI3A 1J49A 1JA9A 1DO8A 5EJ2A 4M1QA 3I5MA 1ULUA 3ETEA 4R69A 3W6ZA 3FTNA 1YJQA 3C1TA 2VQ3A 4OQZA 1Q1NA 4HUJA 3RUAA 4CL8A 3DHNA 5ER9A 2E82A 3EK2A 1E3WB 3RI3A 4KP7A 1E1LA 4NU5A 5A9SB 3WQRA 1WNTA 2BKAA 3ZGYA 4ESOA 5IDYA 2HMVA 1HZZA 3ZWYA 4AJ4A 4YT2A 5KVCA 1YJ8A 4ZQEA 5BSGA 2NU6A 2C07A 3K9QO 5KJCA 4L4SA 3NRCA 1E77A 1Q0LA 2FZEA 2FOIA 3LT4A 4NK4A 4KTVE 2J5RA 4DQXA 4Y6PA 2CD9A 4AVYA 2OL4A 2CMDA 3ZNNA 1JN0A 5L3ZA 1UZNA 1PGJA 1GUFA 1H6AA 4CM8A 1QYCA 3EVTA 1VM6A 4RF5A 3H9EO 5MDHA 4DQVA 2DLDA 1PS0A 2ZTUA 4NI5A 1PL6A 2Q1UA 3R0IA 1XQ1A 4I5DA 5C37A 3WLFA 4BNYA 3PZBA 1ZEMA 1DJQA 1QLHA 3HDHA 2Y1EA 1U3WA 1PL8A 3C7AA 4IZIA 2F1KA 4F3YA 2DPHA 2IXAA 2ZB8A 3UUWA 1UAYA 2VHXA 2FPPA 3L07A 4DWVA 4AJNA 4CQMD 3SVTA 1B8UA 2PK3A 3TZQA 3W8FA 1HT0A 4I8XA 3L6EA 2X0JA 3KZVA 4GAEA 4YRDA 4CMCA 3PIIA 5IDWA 2YDYA 5DZSA 1DRVA 2FPIA 5KVQA 2R00A 4BB6A 3DAPA 1C1XB 1BRMA 5U1PA 2Q99A 5FEUA 3RU9A 5ICMA 4NJMB 1IZ0A 1NASA 2ZB7A 3ASVA 2PWZA 3GNTA 4NG5A 4HKTA 2D2IA 4Y8VA 3KETA 2Q49A 1PZGA 4E5NA 4J7UA 3NDJA 3ZHYA 1T1RA 3F5QA 3K8ZA 2I66A 4ZRNA 4CV0A 1XKQA 2VOEA 3GG9A 1AUPA 1K3TA 3QY9A 2Y66A 3I9MA 3JYLA 3STHA 5G0WA 1RJWA 3GNSA 3ZV3A 4QQRA 3GRPA 5JCXA 4XDZA 2P5YA 1H0KA 1XCBA 3WGZA 3OIDA 4NFHA 1N1EA 5F1KA 4N5NA 1BXGB 1K0UA 1QKIA 3ZW8A 2R2GA 2D1YA 3OETA 1LDBA 1NVMB 2C7VA 3DZGA 1J5PA 1GYPA 1TXGA 4J1NA 5KWEA 1PEDA 2CF5A 1LLCA 2OP1A 5GZ3A 1I0ZA 3JYPA 2P4QA 2IYOA 3OICA 2B5VA 4JJIA 1YONA 4DBZA 4CM6A 4Q3EA 1R4MA 1NFRA 2PGDA 3I6IA 4TZTA 4WCDA 2D4AA 1LSUA 4R16A 3AUSA 1NFFA 4J91A 4OM8A 4ZQGA 4RGBA 2VUSA 3QW2A 3VVBA 3ZNQA 5JYDA 2BELA 4BNXA 5CEFA 3UN1A 3OA0A 1SZJG 3ADPA 3GDOA 4CMGA 1LQTA 3JD2A 1GTMA 4BNTA 3JD3A 2VRCA 4GKVA 5GMOA 4YRAA 1AXGA 3HADA 3UCFA 1IULA 2EERA 1IUKA 4XZ3A 4YWJA 2ZCUA 5JO9A 1DHTA 1Z7EA 3G0OA 2GCGA 4OIMA 3DZJA 2GLXA 3JQAA 3KLPX 4LSWA 1F8GA 2O7SA 1O0SA 3U49A 2O3JA 3WWYA 5JC8A 4FJ2A 1I33A 5T57A 4ONEA 1JWBB 2YFQA 4FN4A 1EMDA 2AQKA 5COBA 2P9GA 1T25A 5AXBA 2NUAA 3DBVO 2QIOA 5T8KC 3TDKA 1R6DA 1U3UA 4I5FA 1LDEA 2DT5A 1FDWA 1LRLA 2E4AA 2VCYA 1TI7A 3M1LA 3UICA 4BNWA 2EEZA 3DTTA 2QYSA 4YJFA 4CL3A 1C1DA 3HWRA 4BKUA 2DUWA 4FJ1A 1PJ3A 1KS9A 1GQ2A 2X0IA 2NWQA 3OSUA 5GZ6A 1AN9A 3DHEA 1DAOA 4AFNA 2B5WA 4M54A 3ULKA 1PQUA 1ADCA 3V8BA 1PR3A 2BHLA 4XJSA 2J5QA 2NADA 3WSWA 3RUCA 4R1UA 4ITUA 3L4SO 3MJEA 3RIHA 4AJ2A 3QWHA 4CLRA 3GLQA 1YXMA 1I01A 1P33A 4Q3BA 1PS9A 2DBVO 4JJFA 1SB8A 3GH3A 4EDFA 1K5HA 3KTDA 4PGFA 2WSBA 1ENZA 3ZW9A 3IJPA 2W4QA 2GR9A 1NFQA 1VKOA 1I30A 3RJ9A 1X1TA 3DO5A 5JYEA 1P44A 4HV4A 3ROKA 3UW3A 4I5EA 4PLWA 2HKIA 3RFXA 2QZZA 4A5OA 1G0NA 5L7WA 1P1IA 2UVDA 3I9KA 3S2IA 1N2SA 5TSDA 4H7PA 4BQRA 1WZEA 2Q1TA 5F21A 1PGQA 2X5JO 1EVZA 4JLWA 4B7CA 1B7GO 2WE8A 3L4BC 1GADO 4XGNA 1YOVA 5F1PA 2OXIA 4IGEA 3M2TA 3E9NA 5CPBA 2WD7B 2W2LD 2HU2A 1DPGA 4R5HA 2CVQA 3ONEA 1Y5RA 2XXJA 3BTOA 4HADA 3GK3A 1NVGA 2C59A 4J16A 1V3TA 4DL9A 1KYQA 1XU9A 3Q2IA 3CKYA 4XQGA 2HMTA 2V65A 5T8KA 4U6SA 2W98A 2JHFA 3CSDA 4Z3DA 4Z6KA 1VI2A 1Z73A 3C85A 3AY7A 1UDAA 1HDYA 4J43A 4D3DA 4HFMA 4J7XA 1XG5A 5L45A 1ZSNA 5IDQA 4Q39A 5KVVA 1UXKA 1Y1PA 3P19A 1IL0A 1WAMA 2J3JA 3BMOA 4L74A 3WS7A 3FNFA 3K30A 1GDHA 2EV9A 1R0KA 4LCEA 4E0BA 4EUEA 3TZCA 2PTGA 2TMDA 4Y67A 4R54A 1EUZA 3H4VA 2CF6A 3RROA 2C54A 1PJQA 2NSDA 2JCVA 1NPTO 3DR3A 4W7HA 4DLAA 1SAYA 4ND2A 3GAZA 5AXCA 3O26A 3E03A 1JVSA 3GVCA 3ZU2A 3RC7A 2Y67A 1UUFA 4BO2A 1HRDA 4P8RA 1HYHA 1QRRA 4JBHA 1QXSA 5DBGA 1I32A 4R4JA 2OUIA 2X9NA 4IIVA 4QXMA 1PJ4A 2V7PA 4IDCA 5KCZA 4PLGA 4N7RA 3VTFA 1YRLA 2EGGA 4B7UA 3NT2A 4J7CA 3OH8A 1ZK4A 5AVOA 4R3WA 1U4SA 4E6PA 1A4UA 3JQ7B 3TPCA 3F1LA 1GV1A 1TT7A 3GEMA 5EQFA 1W73A 3DBRB 1E7RA 3NAQA 1BXZA 5KIAA 2P91A 1X1EA 3HFSA 3VH1A 4E4YA 1NWCA 4U5QA 2G5CA 2D5CA 1WVGA 4DBVO 2Z1NA 2GYYA 2HRZA 2HK7A 4FDAA 3ZU5A 1O95A 5JBIA 4UEKA 5DP1A 5B37A 1PWXA 2EKQA 1U28A 3I1JA 1ZBQA 1HSOA 2VN8A 4R68A 3S55A 3ZI0A 2IXBA 1KEWA 3BMCB 1VJ1A 4DYDA 4UEJA 1UXIA 1HDCA 2G0TA 2ZJ1A 4U0JA 1LU9A 3OHSX 4ZQHA 2QG4A 1DFHA 1LSSA 1LXCA 1GQYA 2HK8A 1V3UA 4WKGA 3S2FA 3RCBA 1T2FA 2RAFA 1DC5A 1PJSA 1GZ4A 2A9FA 4JJGA 1QORA 3ROPA 1PL7A 4BNHA 1VRWA 3VH4A 1I3KA 1LRJA 4PLYA 3PJFA 1CRWG 3DMTA 3H3FA 5DBFA 5KJ6A 1DAPA 1M6HA 3OECA 3PHLA 5A9RA 2J8ZA 3PEFA 2CDCA 1ZJZA 2RCYA 5L7YA 2VRCD 5ITWA 1PZHA 5HA5A 3DDNA 1UR5A 3ZU4A 3TOXA 3ZWOA 1Z6ZA 1KEPA 3AJRA 2X86A 3B20A 5G4KA 1A4IA 1ORRA 3PGJA 4DPKA 4PZEA 3OMLA 3ADOA 1YWGO 1Q0HA 1UZLA 3PXXA 5JC1A 4BNUA 1JKIA 3D3WA 1I3NA 3AWDA 2C2YA 1N1GA 2DBZA 1PGPA 3BMQB 1BW9A 5EMHA 1KC1A 2VT3A 2DKNA 1AHHA 4G65A 2XAAA 2WD8A 1D3AA 2D8AA 1YBMA 1CQJA 3TFOA 1VSUA 1HETA 2G1UA 4TMFA 5T64A 1ISHA 3DAGA 3OBBA 2ZYAA 5TIIA 1YVEI 2VWQA 4K6CA 2Q46A 4W7IA 1A7AA 4FSHA 1B0AA 2NVUB 4K1LA 4ALKA 3CTMA 3VZSA 3OQBA 3PZRA 3HB5X 4IGFA 5FFFA 4S3MA 4CUJA 1Y8QB 1LLUA 4IJWA 4CMAA 2I9PA 4GWGA 1C3VA 4D46A 3ROQA 4YJHA 5TF4A 1GPDG 2I65A 2VWGA 3BZUA 2PFGA 5CG2A 4NBVA 2PV7A 3SEFA 2AEMA 3M1AA 4WCFA 5COAA 4BHTA 4KUGA 2BRUA 4OHUA 3L4BA 3DZFA 1LUAA 3F47A 2Z5LA 3DZBA 3PYLA 1UXHA 4K26A 5KKCA 3MTJA 1B15A 4OYRA 4DLLA 2YV1A 4CV2A 1NNUA 2X0RA 3PQFA 3JTMA 2DFDA 3JCZA 1BVUA 4CUKA 1JAXA 1OZAA 1Q2XA 4ZQBA 3CMCO 4H16A 4AJKA 5EPOA 1X7HA 5FYDA 1CQIA 3BXXA 2FR8A 5L9AA 1VL0A 3C24A 4XGIA 4PG7A 4BKRA 3GPDG 4JNKA 1PQPA 3PYMA 5F5NA 4CM1A 2ZQZA 1I5RA 4DPLA 3CE6A 2GPTA 4FD3A 4ND1A 4ALNA 2CVOA 4R01A 1Y6JA 4J3FA 4PRLA 1TA4A 4DYVA 4YAIA 5JS6A 4WLEA 3S1LA 3MJTA 4BOYA 1NQTA 4NMHA 1CEQA 3Q9UA 3DHYA 3H6KA 3L9XA 3JV7A 1FXSA 4E12A 1GEGA 1XELA 1YH3A 4ZA2A 1V3VA 1EK5A 4CMIA 1GU7A 5CEJA 3KYDA 2PGJA 3I23A 3OJEA 1Z74A 3JQFA 1U3VA 1HDZA 4OSPA 4EITA 5IXYA 4O1MA 3ZWBA 1EZ4A 3W4KA 4ZQFA 1U7HA 2FZWA 3VZQA 1RYEA 1EE9A 4Z0HO 1NAIA 4J4TA 5LC1A 1ZSYA 4UUMA 2OBNA 4Z0TA 2D0IA 3GA0A 1U7TA 4AJPA 3C8MA 3R1IA 4EGFA 4RDIA 4CM3A 5BSFA 1U4OA 4DUPA 1EDOA 3OF2A 1DRUA 4N54A 4ILKA 1KEUA 1W0CA 1A5ZA 1PGOA 5CHEA 4GL4A 1BWSA 1SOVA 3LLSA 1YO6A 3GGGA 3Q2KA 4PLVA 9LDBA 4IJUA 1X0VA 4NBWA 4INAA 2PD6A 1HE2A 3P5SA 3U4DA 2YQ5A 1ZCJA 2IEBA 1QYVA 2O2YA 2W2KB 2OO5A 2GSDA 3GVIA 1P77A 4E31A 3ENNA 5JLAA 2YZ7A 3NTQA 3GDGA 4NR0A 4RVSA 4JBGA 4OH1A 2FMUA 3SLKA 1GUZA 4BNIA 2Y1FA 1ARZA 4PFJA 2PH3A 4WNCA 3GUCA 4JCOA 3H5AA 3KXDA 4MDHA 2B4RO 1YGYA 2UUOA 1QYXA 3CUKA 8ADHA 2B0JA 2FSVA 4MVJG 4D7AA 4EYEA 5FWNA 4HFJA 2QRLA 1X7DA 4J90A 4WLNA 4XQEA 3GZ4A 4BKPA 3DZKA 1NR1A 2FPGA 4FFNA 2AMFA 3DQPA 1PTJA 5CEEA 3KYDB 1BXKA 1I2ZA 2PY6A 4CMIB 4EEXA 1ISJA 1HYEA 2QW8A 4J6FA 3HFGA 3WGTA 4LW8A 1E1NA 2CDAA 3NDIA 4DMMA 3TWOA 3NUGA 2X9GA 3FBGA 1RKXA 4CM4B 1F12A 4R9SA 3OEYA 3DBLA 3Q6IA 3NEPX 3DOCA 3EC7A 3LDHA 2GNAA 4LVUA 3A06A 4BNNA 3WLEA 1Z82A 4PG4A 3RUFA 3S2EA 2JD2A 4LMPA 1R4NB 2ILTA 3HDYA 2RIRA 2W8ZA 5L53A 4I1IA 2AW5A 2ZYDA 4B3HA 2FSSA 4ZHSA 3U4CA 1T2DA 3RWBA 1FK8A 2DU8A 1D4FA 1TB4A 1JVBA 4W82A 2X5KO 1VL8A 4RV9A 4Z9YA 4R1NA 3WGQA 3AW9A 2HO5A 5AYVA 2O3UA 3KUXA 4XYBA 4II2A 1ZK0A 1RM4A 2IZ1A 2ZIZA 3RD5A 2ET6A 3KHUA 1YB4A 4L8VA 3ZWWA 4A27A 2RHRA 5C7IO 3TF5A 3FRJA 3W8DA 1K89A 1NHGA 1OOEA 4D3FA 5ES3A 2JD1A 2X8LA 1MGOA 5ILOA 4N5LA 1HLDA 3HE3A 1NPDA 3NKLA 3QV1A 4ZJUA 2BGMA 3GFGA 2QYTA 1HTBA 4OSOA 5CFZA 2B4QA 1HDXA 4XGKA 4IQ8A 1DC6A 1UP4A 2FRDA 3QIVA 5LDGA 5THKA 4AJLA 1ZXBA 4BNVA 1JKFA 4DPMA 4KUEA 1DRWA 4FR5A 4BO6A 3GQVA 2HAEA 4XA8A 3COSA 1I2BA 3MJ4A 4D44A 3TL2A 2WWRA 4U0KA 1P74A 1ZH8A 2GASA 2B37A 4WJZA 4PG6A 4B4VA 2FR0A 3FSRA 2Y1DA 3B70A 2UAGA 1T1SA 3E48A 1ZIDA 4XCVA 1BGVA 2VHVA 4IZHA 4LMRA 4ALLA 4DREA 2ZK7A 3AU8A 1DC4A 1NYTA 5DN9A 1OFGA 5CDSA 5I7SA 4ND3A 5A4DA 5KTKA 1H5QA 2X9VA 1KOLA 4BNJA 2Q3EA 2J3KA 4FBGA 4IY1A 4RLHA 3GPIA 5A5FA 3FR7A 1T2AA 5G4KB 1CWUA 1GQQA 1RWBA 1GEEA 4PLTA 1LQUA 4D41A 3D4NA 2PZMA 3UF0A 1DC3A 4NJOA 3PVZA 4F46A 3KOUA 5A03A 1MG5A 1NTOA 1VPDA 3FHLA 3WBFA 1EVIA 2I6TA 1J4AA 4AJIA 4MOWA 4QX6A 1GV0A 1RPNA 3NJ8A 7MDHA 1XHLA 3AM3A 1HDOA 4O5OA 4XKJA 3GN2A 1GCUA 2Q2VA 3L9WA 3PFWO 4EBFA 4CMEC 3WICA 5IZ4A 1RM0A 3AM5A 4Y9DA 4CMBA 4ZICA 5JCJA 5TGDA 2VRBA 3LT2A 4P4LA 2PZKA 1NQOA 2EP5A 1C0PA 1XDWA 3VHRA 5JCJD 5TT0A 3ITKA 3MTGA 3I9NA 4XRRA 2VYNA 3LZ6A 5JMPA 4FFRA 1AXEA 3V2UA 4MVJF 1LDNA 1XIVA 3ANMA 4NIMA 1Q7GA 4HNGA 3PDUA 1JW9B 4TRMA 1U8FO 3F6YA 4I9NA 1K6IA 3DWFA 4YT4A 3HN7A 1SEVA 4IS2A 5IF3A 3G1UA 3ENKA 5IXSA 3I6QA 1ISGA 4RF4A 4OKNA 3U62A 5A1TA 2VTDA 3NGXA 2HK9A 5L7TA 4ND5A 3OJLA 1KVRA 1MX3A 4WNIA 3VKUA 1Q0QA 1P31A 3TOZA 3D3EA 1GCOA 4QUKA 3QE3A 5F1OA 5K6AA 3Q1LA 4WK6A 1R0LA 1P9LA 3PHHA 3E9MA 3T7EA 3DTYA 2NTVA 1OBFO 3QHAA 4DA9A 3H8VA 3LLVA 1XQ6A 2BI7A 2QRJA 3RQSA 5HM8A 5U9CA 1ZJYA 2HMUA 1GFSA 1OC4A 1W6UA 3FNGA 4P4NA 4YEDA 1EFKA 2WE7A 4IDAA 4XYMA 4EEZA 4F45A 1VLLA 2H63A 4O6VA 4PZDA 2E6UX 1EUCA 3VPSA 3LF2A 2X22A 5B4VA 5TS3A 1LNQA 4JIGA 4JP2A 4GGPA 2DBRA 3X2FA 1MG0A 1N92A 3LF1A 3NV9A 4BO8A 4DMLA 4EUFA 1PJBA 2VZ9A 3ZWCA 3DFUA 2CVZA 3P2YA 2HLPA 3VTZA 4BNZA 1N9GB 3CXRA 3PIDA 2GGSA 3PWSA 4XYGA 3WYBA 3E8XA 4E21A 3LC2O 1GD1O 2B4TO 3HUDA 4OXNA 3ZN2A 3EZLA 3JQGB 4CV3A 3QA9A 4QO8A 2V6MA 4B3JA 1LC0A 4GMFA 1F0YA 1TVEA 1D1SA 3OIFA 1Z45A 4CMHA 3R3SA 3QWIA 2C29D 1WW8A 4DTIA 3H5RA 2B83A 4D3SA 1DIAA 2WD7A 1SO8A 5JW6A 3FN4A 2EIHA 1YOVB 2P2SA 4RVFA 2WYUA 4AJ1A 3ZWNA 1N7GA 3D0OA 4GSLA 4IPTA 3UKOA 1I24A 1KY4A 4J4BA 1C0LA 4RCVA 4YQYA 4E13A 4KQXA 3BIOA 2UDPA 3E6AA 1DB3A 3G79A 4PZCA 3GHYA 4RQTA 3QJ5A 1D7OA 3IMFA 2GN8A 1FDSA 2ZTLA 3AUTA 4RORA 3MOGA 3G49A 2JJYA 4HXYA 3WQSB 3ZHXA 3ZV5A 1VKNA 4QFDA 1PR9A 2DVMA 2ZQYA 4A2CA 3TRIA 5KJEA 5C7OO 3H65A 4N5MA 3L77A 4IDGA 5CAEA 5BQFA 3EMKA 2WEKA 1ZKMA 4EZBA 3RFVA 2YV2A 3EHEA 3PJDA 4WE3A 2D59A 4QFCA 1OI7A 1IE3A 5MGBA 1XGKA 2XF8A 3DZHA 2J5KA 4CUZA 1VJ0A 2XOXA 3JQGA 3LYLA 5TRTA 5A3JA 3QWAA 1KVTA 3V1UA 4D45A 1Q7BA 1C1DB 3WIDA 4JN6B 1N9GA 2HJSA 4W9NC 1ZW1A 6LDHA 1ZK2A 2JFGA 3H2ZA 4HFRA 4UVIA 1GUYA 1W4ZA 4HNHA 1HE5A 1YB1A 1LLQA 3ONDA 2EP7A 2OGUA 5ER6A 3FCOA 3GNQA 2Z95A 3NDRA 1TLTA 2H5LA 2Y93A 3AY3A 3K5PA 4J9UE 3JYOA 1YL5A 2B35A 3VPGA 3O03A 2IZZA 4A10A 4IJVA 4X54A 5DCYA 2O3TA 4I9UA 2H9IA 1EQUA 4BIIA 4DIBA 3ITDA 3U4IA 4GQAA 2VZ0A 2AG8A 4RPHA 3LC1O 3A28A 4UUOA 1EE2A 1KC3A 2AA3A 4BO7A 1UP6A 2AHRA 3V1TC 1XYGA 1VJTA 2PGLA 3RFTA 3ON5A 4YXFA 3O38A 5CDGA 1YBAA 4P22A 3QQPA 3IQDB 3KV3O 1P3DA 2VHWA 3PHIA 2HQ1A 4IQ0A 4YB8A 4R9RA 2QX7A 1NXQA 1SEPA 3MWDB 4GI2A 3WMXA 2YUTA 4RF2A 3F46A 3DOJA 1UXJA 3RAJA 1HL3A 4YDRA 3IP3A 1JTVA 4ZN6A 1LEHA 3RKUA 1R4MB 1I3LA 4GX0A 3ST7A 4BV9A 3WGYA 1BMDA 3H2SA 1PJTA 2VOJA 1E7YA 4Z9FA 2H6EA 4QTZA 4CM9A 3G1TA 4E2XA 3PPIA 4UVEA 2Q4EA 1GY8A 3TNLA 4RVGA 4EW6A 1BXGA 1IB6A 2IE0A 2X0NA 3KSZO 4XIJA 3HG7A 4C4OA 4DVJA 2AE1A 1KVSA 1FJHA 1NHWA 3ZU3A 5JAIA 3P2OA 5JY6A 3GN1A 3FD8A 1LDMA 3IIEA 2VUTA 4XJTA 4CM7A 3AY6A 1FDTA 8LDHA 3HHPA 3GOHA 5EERA 4UREA 4FW8A 4B3IA 2VUUA 1ADGA 2QQ5A 5DDIP 3JSAA 1SMKA 4P4GA 4Y98A 3WFIA 5F3RA 2BLLA 4IMRA 1QLJA 1ENPA 2AQIA 1WMAA 4NJMA 2VYND 5L40A 4FB5A 4BO0A 4NQZA 5IZCA 1C1XA 2OFPA 3EZYA 4PCVA 4YRBA 4TVBA 4E5YA 1ISMA 4RO0A 1ZFNA 2Y0CA 1E7SA 1YL6A 5I9NA 4MKXA 4RQUA 3U3XA 4MVJM 1LC3A 3PWZA 4IDDA 4RPKA 5IDXA 2HRBA 4TWRA 3TZ6A 4PLPA 4WEQA 4ZGWA 2A92A 4BGUA 5ILGA 3IUPA 4BNGA 4J1SA 3C1AA 4Q3CA 3DZIA 2ZB4A 1F17A 3ZWAA 2PH5A 3FF4A 1ZSVA 4MINA 4RLSA 5TC4A 4KMSA 5BT9A 2Q2QA 1XSEA 2NV6A 1PZFA 3I4FA 5DOVA 3JQ6A 4L73A 4I9HA 1EK6A 1Y81A 4JBIA 2UUPA 4GBJA 1NX6A 3NTOA 4HX5A 3I9LA 4QO7A 3K73O 4XRGA 1B14A 4Q3DA 3ZDFA 4DGSA 1MFZA 1ADBA 2X4GA 2YW9A 2Q2WA 3AK4A 2PLAA 1Q7CA 4ALMA 2NVBA 3A4VA 3S8MA 2I99A 1EUDA 5K6AC 2JL1A 4LSMA 1DDOA 1HLPA 1DBVO 2IZ0A 4O0LA 1E1KA 2JHGA 2NLOA 5I9MA 3AOGA 4NBRA 1DFIA 4WECA 4BB5A 1HE3A 4E32A 2QRKA 3K96A 2GD1O 2EJWA 1CF2O 1FF9A 5A9SA 1E3WA 1DIRA 3UFXA 4YAJA 1LA2A 2AQ8A 4MP6A 1LDYA 4WGGA 3BTSA 1MC4A 3UGKA 5I7VA 5IFLA 4TROA 1U5AA 3AFNA 2Q45A 3EGOA 2VZ8A 4GVXA 3LK7A 3UAGA 3PK0A 4XYEA 3UCEA 1C0KA 1R4NA 3JQFC 5I8WA 5IN4A 4BVAA 3W6UA 4ZU3A 1LSJA 4R51A 1F8FA 5DF1A 4YAGA 1WPQA 5HTOA 1A7KA 3DBLB 5AQ1A 2DAPA 5EESA 1KY5A 2X1HA 4CM4A 1E5LA 3KB6A 5C7LO 2Y0DA 5HRUA 1IOLA 1U5CA 2UYYA 1ADFA 3ASUA 1B3BA 4YJGB 4UULA 1UDCA 4BO5A 4E30A 3BA1A 5B4UA 1XLTA 1O5IA 2B69A 2OP0A 3WBBA 3UXYA 1CETA 2OBYA 2GZ2A 4RVDA 3OM9A 5I7FA 3WTCA 4HY3A 3IJRA 4TRRA 3GAFA 4Z0PA 3FBTA 3RC9A 3ZNOA 4YT8A 1SOWA 3GF4A 1GL3A 3RKRA 3KSDO 4H15A 3DB2A 1H9AA 3KYCB 5H82A 4WEOA 2ZJ0A 5A3VA 1IZ9A 2GZ3A 2O2SA 3JQEA 5KKAA 3TN7A 1HKUA 3GMDA 4AJJA 1TT5B 5KJFA 3OIGA 3WNVA 1ENOA 1EDZA 4BUCA 3KM0A 1GAEO 2BFOA 2W2KA 4IQGA 3KSUA 4ND4A 5JDIC 1V8BA 1NAHA 3CIFA 1CERA 4CLHA 5B12A 5C5IA 1BHSA 1K6JA 4BMNA 4KDEA 4XB1A 2A94A 3A14A 3S2GA 4C7JA 3CPSA 5BNFA 5JSFA 1X14A 3WSVA 4YA6A 4PRKA 4LRTB 3H9JA 1PWZA 2JFFA 1DEHA 1QMGA 3WXBA 5CPFA 1QV6A 3JD0A 5ENVA 5U4QA 1LJ8A 2FN7A 1YQXA 2J6IA 2WM3A 3INTA 3QVSA 3WB9A 4BS9A 4CM9D 1BDMA 2YJZA 4MVJP 3VKVA 2VWHA 5EINA 5CDTA 4MIOA 3QVTA 5CDYA 3SX2A 2ZYGA 2X23A 2C20A 3WQQA 4CLDA 4NZ9A 4RF3A 4WUVA 7ADHA 3FTPA 2PR2A 4QT0A 5TJHA 2Q50A 2LDBA 5L51A 4XQCA 1MUUA 4EUHA 4BO3A 2C5AA 4FS3A 3RBZA 4MVJI 4FC6A 1ML3A 1CJCA 5HS6A 3PFFA 2Z1MA 4DIOA 4Z9XA 3JYNA 2DTXA 3ETDA 4HP8A 2EKPA 4LGVA 4OQYA 2OORA 4M8SA 4UEOA 4BQPA 4ZRMA 1LX6A 2JAHA 4B8WA 1IHXA 5JAZA 4K28A 2YFHA 4TKMA 3R6DA 4W99A 3HNPA 4J49A 3ZCXA 3IOYA 3Q3CA 4YPOA 3GT0A 1I8TA 3VPXA 4UUNA 2JD0A 1HF3A 4PVDA 3TJRA 4NH4A 4DIFA 4E5KA 2YDXA 1A72A 4FCCA 3VDQA 5C3MA 3K92A 4J2HA 2PKQO 3WFJA 3GR6A 4FGSA 5A5EA 1U1IA 1GZ6A 3VPHA 2YHUA 1NR7A 3L0DA 5JDCC 3U0BA 1XU7A 1YB5A 5JO0A 1JQBA 4WCFB 1NM5A 3W4IA 4BMSA 5CP8A 4OXKA 4WCFC 2PD3A 4GMGA 4MJLA 5JMWA 4M55A 1WDMA 2XXBA 3NX4A 3EDMA 4GX2A 3INGA 4YJHB 3B1FA 5TQVA 1X7GA 3ZWMA 1HEUA 3E5MA 1N7HA 3V2GA 2NU7A 3IP1A 4WOKA 1Y8QA 3NTRA 4ALIA 3U9LA 3D4PA 4A03A 1XR3A 1L7EA 1D8AA 1YBVA 4LISA 4NFYA 3T4EA 4JP3A 3V2HA 1PS8A 3C7CB 5TJ9A 3FWNA 3WOHA 2IEDA 2NVUA 1QYWA 2O23A 5I7EA 2EJVA 4EJ6A 1P1JA 1IYZA 1ISFA 3RBXA 3W8EA 3EW7A 3BTVA 4U7WA 5ITVA 3I52A 1KVUA 2EW2A 3WYEA 4LCJA 5AXAA 5JNLA 3C1OA 4XDYA 1GPJA 1BW9B 4QECA 2W2LA 3BMQA 4L75A 4GLOA 3D3WB 2X6TA 1WWKA 2NACA 5GY7A 3QWBA 3VC7A 5IJZA 2DC1A 2ZB3A 1DIBA 4CMEA 1PJCA 1YS4A 4MVJH 3RC2A 1JAYA 4OKIA 1N5DA 2O4UX 4YQZA 4BV8A 1YDEA 4AJOA 1DOHA 1ID1A 3MCVA 3DMTC 4J2OA 2BGLA 1NWHA 1E3SA 1Y9EA 4J1TA 1EBFA 2DM6A 1B16A 2H1SA 1DJNA 4MVJE 3NJ4A 4WASA 4XB2A 2P9EA 4CQLA 1YQGA 3N7UA 2EKLA 4GLLA 1GZ3A 4GX5A 4FQ8A 4KZPA 3ZV4A 1VC2A 4CLEA 3QVWA 4E5MA 4B4WA 1K6XA 1KETA 1EVYA 4RVUA 2P5UA 2D3TA 3BMCA 1PGNA 5DBIA 3TZKA 3QLJA 3VVCA 4XR9A 1B8PA 2Q1SA 2V31A 1WZIA 2CFCA 4JGBA 1VSVA 3GGOA 4KTTE 4YACA 4CR8A 1EVJA 1H2HA 4WLFA 1O8CA 3N74A 1T24A 3TSCA 2AE2A 5TX7A 4I08A 4RL6A 5EL0A 3VH2A 3IC5A 3DFZA 3ZHZA 4NBTA 5H81A 5ENDA 4CMJA 3D4OA 3KO8A 3DBRA 3SBOA 3ZHBA 1RM3A 1ZK3A 1Y5MA 2AEJA 2GO1A 3JQ7A 4WPGA 3MJSA 5KJ1A 1OMOA 1FMCA 2PA3A 3D5TA 4LRSB 3FNHA 4NDNE 1O9BA 4R1SA 4WOJA 3WIEA 3JQ8A 2AG5A 3VOSA 4EI2A 3SC4A 1WDLA 5EQDA 3HJAA 1KERA 3ETGA 4BGIA 3UVEA 4WLOA 2GF2A 2B36A 2OZPA 3DMYA 3OP4A 1X0XA 4FIZA 4BNFA 2BD0A 2RBEA 2PD4A 3GVXA 3HDJA 2NU8A 1AE1A 3HSKA 1DSSG 2CY0A 2DBQA 3FPLA 2P9CA 4IJKA 2YQ4A 4L76A 4JK3A 4B4OA 1ZNQO 3AUUA 4R1TA 4TRJA 3CEAA 2P4HX 1SPXA 4TVOA 5A05A 3Q9NA 3FWZA 4UVHA 3BMOB 3EY4A 3JD4A 3KYBA 5F5LA 4Y6RA 4FFPA 1SC6A 1JLLA 3RJ5A 3BTUA 4B8ZA 2BFMA 3C7DB 2HJRA 2X58A 2ZKLA 4GPD1 4J4HA 4NFSA 3U5TA 4KWHA 5BR7A 1M2WA 5IN5A 2ZTMA 4OOFA 2GUGA 2V6FA 3DBHB 3BHMA 4XYLA 1V6AA 4ID9A 3O8QB 2O50A 1MLDA 1YE3A 5HS4A 1S6YA 4CLOB 1QSGA 2FP4A 1ZUD1 2I5PO 2JKVA 3GY0A 4OO3A 5JE8A 1U8XX 1XWFA 4O59O 4IBOA 5BSHA 4DLBA 5TNXA 2ZCVA 1UP7A 1O94A 1H6CA 4L9RA 4RZHA 3JQBA 1KVQA 3GDFA 3WGOA 5A06A 3SJUA 4L4XA 3O9ZA 4MKZA 1OAAA 4PLHA 2C82A 3E5RA 4CR7A 1EQ2A 2X5OA 2YYYA 1OC2A 2Y1GA 1V35A 3OJ0A 3H9UA 2BMAA 3OJFA 1C0IA 1T4BA 2WMDA 4JQCA 1T2CA 2YHIA 5A02A 4IM7A 2DQ4A 1M75A 3JQ9A 3JQAD 3Q11A 4IS3A 4A0SA 1WP4A 2HSDA 4FGWA 2NM0A 1UH5A 4FFOA 2EXXA 2NNLD 2PZJA 1ZEJA 4LVCA 2Y1OA 3MWEB 2EG9A 1E6UA 3B1KA 3KRTA 4CLRB 1LI4A 4IDFA 5DNAA 1EBUA 1ZMOA 2O3RA 3AOEC 1V0JA 2HUNA 3G3EA 4HWKA 5B4TA 1LTHR 4XX0A 4YCAA 1M6WA 4K6FA 4DQUA 1E3LA 3AU9A 3RUDA 4MIEA 3PQDA 4E2ZA 2ZTVA 1EFLA 1Z7BA 3L6OO 3ZZNA 1MA0A 2PKRA 1MXFA 1HXHA 4KOAA 2NU9A 3K31A 1EEHA 4FC7A 4YJFB 3I4CA 4FOOA 1DXYA 4EJ0A 3E82A 3D64A 2AEFA 3QP9A 4Q3AA 1J0XO 4CQMB 1NBOA 4FFLA 3ROMA 1R37A 3BMNB 4MO2A 1E3JA 3ANNA 1RYDA 3BHJA 1MV8A 3H9GA 3IL2A 2HMWA 4W6ZA 2IRWA 3WG9A 4P38A 2FR1A 4XWYA 3H7AA 1ONPA 4L0QA
chains in the Genus database with same CATH superfamily
4YYZA 1ZH4A 4Q1CA 3JQAB 3FMGA 3L0PA 4FKBA 4JENA 5DOZA 5IZCC 2WYVA 5GZ1A 2NQ8A 4FINA 3WZ2A 1ZNZA 4MAAA 1KIFA 5EKUA 5A7GA 5HILA 4A7PA 1FTSA 1RLIA 1TD9A 5THQA 9ATCA 1MCZA 1MFPA 1KBZA 3OX2A 3VPAA 4DLWA 3CO0S 3VR6D 2IOYA 3L92A 1GVHA 3UMJA 2FJ0A 2TMYA 4E3WA 1GPBA 1LSOA 3C41J 3L01A 4IMPA 4I1PA 2EKZA 1GILA 1S2MA 1NL3A 4UBMA 5IVIA 1G8AA 3D8TA 1DXQA 4F6RA 2UUAB 2IUFA 3SXPA 3SYRA 1OPXA 2VYVD 3PWKA 3VAZA 4ZI7B 1JQ3A 4RPGA 1JVNA 4H1WA 1JIJA 2QUKA 4M22A 1OTYA 1P2SA 1ZD1A 2EJTA 2GJ4A 3D2LA 2E49A 2RG1A 1SZDA 2B8TA 3MSXA 2QNIA 1HTWA 4OQMA 5JNRA 2PSSA 4DV1B 3AI2A 4IDEA 3AV0B 2Y9MB 3KBOA 3N2LA 1TIKA 1T8YA 4NSNA 1FFAA 1F4VA 5A9TA 1ZA2A 5LYYA 2GJRA 2YMQA 2J09A 4JGIA 4K6KA 3AOEA 3DAOA 3EY9A 5FI1B 1E5QA 3E7WA 1H8EA 1FPMA 2XT9A 3V4LA 2NZUG 4O2AF 4E7PA 5A8AA 1BDHA 2ZBEA 2FQ1A 5EZQA 2P9TA 4DMFA 4ABTA 1O89A 2AT1A 3AVVA 1V7CA 3E8SA 4X05A 4PQGA 3ABIA 3SOPA 3V4VB 3GRZA 2AOTA 3D7LA 3OZ7A 4XAQA 3R9IA 2DUNA 4KXYA 2ZYTX 4IICA 4R8VA 4JDPA 4OQLA 3KJEA 5CLGA 5JATA 4R2JA 3UB2A 5AFSA 3IAEA 2YCBA 3B6ZA 3VPFA 5HQ3B 3F1KA 1BN7A 4W8GA 5MHTA 4N47A 3PLNA 5AXDA 3A3YA 4ZCMA 2X14A 5KOJB 3THYB 4FJ0A 4V0LA 1EFHA 2PZBA 3AF5A 3I2YX 2JI8A 4GMKA 1U0HC 1SB9A 3PDJA 2CXNA 2JAQA 4II3A 4ZWNA 4CEIB 4FX5A 1UD4A 3ZVKA 4F21A 2H59A 3LQ1A 3IMKA 2ZULA 1QHSA 1G21A 3BXEA 3BWCA 3H75A 1RRFA 3V7AA 2NIPA 3I58A 3HVUA 4HDNA 3VSBA 1LW6E 5IVHA 1PNOA 3OO0A 1CJMA 1MXHA 5B57C 3K9WA 2Q6TA 2GAOA 4KPGA 3UT5A 1G4HA 4C4RA 4DRZA 1O0BA 3ZZ1A 2JBHA 3P9YA 3K6JA 2DKOA 2Y0PA 5ANRB 4C2BA 2JB9A 1M7BA 2QWXA 4IVRA 4OLJA 1ZA1A 4LN1A 3GLTA 1P2BA 2HXGA 3WMWA 1YR2A 3CLRD 4PNZA 3AB3A 3THSA 1YFJA 5HZHA 1F5NA 3LP6A 1YC5A 4BNKA 1D1NA 3ZJTA 3ER6A 3HDQA 2ZBUA 3ZV6A 4M7OA 3KAPA 1Q7RA 5A7FA 1HWYA 3BSWA 3UAWA 3HC7A 3PFKA 1VE1A 2WWWA 3JRWA 4TL8A 4UC0A 2C9OA 3LUKA 4BRZA 2GD2A 2W42A 1O4WA 1NVDA 4ERXA 3O8QA 4CL2A 4N76A 4KPFC 3DBHA 4GECA 2KBEA 1U2GA 2QXYA 2IV7A 5TV2A 2OC4A 1QCCA 1IXZA 2Z2XA 4M8IA 2JAPA 1E6EA 3BN3A 5ALDA 4CJXA 1X7XA 3H87A 4FHGA 2GTPA 4XWGA 5LCXA 2E4YA 1RQXA 2ZIXB 3UUFA 3NH6A 2NUPB 2GN9A 4EG1A 3VU1A 2OGTA 2GK7A 2FHSA 1DTEA 4Q3OA 1QB8A 5GOZA 1Z0FA 1KE1A 2ZJAA 3JWHA 3C74A 4S1NA 3MUFA 4MCJA 1YZ3A 2NU6B 4IXTA 3BFPA 3IBTA 4C3ZA 3LUHA 1M2GA 1CIVA 4LDRA 3ZEAA 5BUZA 5L95A 4MYRA 1K7SN 3COVA 2HX1A 3QOWA 2OPHA 4WFQA 3K2BA 4P0QB 3NRBA 1X8LA 4MUBA 2DT8A 1FP4A 5G0UA 2QE6A 1UM9B 5EWMB 5A2QA 3EXFB 2ZQ5A 3EYWA 4P3KA 2PIAA 1DARA 5J4LA 1WCXA 3PQEA 1IN6A 3OBIA 5D6OA 1LDGA 4ECAA 2JCYA 3TB6A 1YNOA 4HUQB 2BFEB 1HMPA 3HZZA 3REGA 1WLYA 1BE8A 2GDZA 1TZJA 4MVJD 2NYRA 1Y8RB 2IYZA 4D0NA 3GZNA 4AICA 1RQ7A 3MF4A 3SNKA 1CR0A 1B8VA 1DTWB 1BS2A 1OFVA 3AEYA 3I9V6 3IQZA 4X63A 3S28A 5JSQA 1EVKA 1GLNA 2WWGA 3DULA 3DEYX 4HGRA 2WPDA 1T2EA 2MSCB 2O3QA 4L3WA 4YCSA 5KTOA 4OLBA 1ZHHA 1UZUA 4HDAA 4D96A 2KHZA 1GQFA 1GRRA 3BERA 3EN0A 3OQ6A 1YZLA 4NYMR 3AILA 3UZUA 4Q4HA 4RDKA 4AG3A 2V54A 3F3SA 1N5LA 4CLXA 4TQ9A 1I6WA 1JWAB 1V8PA 3N05A 1LPBB 3PP8A 5B58C 1FS5A 3KUCA 2QZ9A 3ZC3A 1IHMA 3DQZA 2A67A 2J4FA 4YT5A 3INRA 3F6BX 3RSFA 3BWYA 5BURA 5I01A 2OAGA 3OU2A 3FW1A 2ZSHA 3OEWA 3OLYA 1Z3IX 1PQWA 1TM2A 2KBFA 2RBKA 2XNHA 5IEBA 1E1MA 1J23A 1UEJA 3M70A 2VNAA 4LV5B 2R7KA 4GI1A 4I3GA 3WNBA 4AECA 1RRGA 3KOMA 1LFAA 4DIKA 1C3XA 3L5OA 4UM9B 5G0TA 1NSYA 2AYYA 5KNDD 3D7NA 3DNMA 1E8NA 5CIQA 3ZJ5A 4FMBB 4U8GA 3OFJA 4P58A 2ALJA 1PR0A 3CZRA 1UBKS 1VLVA 3UMFA 1HDGO 3CB2A 1MU0A 3MG9A 5GVSA 1UKZA 4RE6A 1FTGA 1OA0A 3JQCA 3HB7A 4JB8A 1E7QA 5IG2A 3RU2A 3I3OA 3ORFA 5L4LA 1F8UA 5TY0A 4WOBA 2WU3A 4AN4A 3OZSA 1I7NA 3O1IC 2R5FA 3T3HA 1RXWA 3WJ1A 1NUPA 2W2OA 3ISTA 4BNWA 5CA0F 4UUAA 1GU1A 4DY4A 3EUEA 5JDIA 1KH2A 2QI9F 3SSNA 2BGGA 3C3XA 3D0QA 3FNEA 2Q3BA 1WMDA 4PS1A 4A2QA 5LIPA 1BG6A 4BNDA 4H6PA 3WI7A 3K70D 2NSYA 1TCBA 1XTVA 2WP8J 3B48A 5AJVB 4ITVA 4BFSA 1KS2A 2JZOA 1H93A 2PSEA 3W3ZB 1A27A 1YJNB 4LYHA 5ESXA 3IDOA 5L3QA 2V3VA 4XIFA 1V5WA 1NC3A 4IJ5A 1N1DA 4MUKA 4R3NA 5FOUA 4HVLA 4B09A 2HLHA 5K8UA 1A9SA 4OBXA 3B52X 4CDGA 4I55A 1V4VA 3LT1A 3MEQA 3ANXA 4WNAA 5HCIA 5FBZA 1BDIA 4MP8A 3UNXA 1AM4D 4B5LA 1VBNA 5EXDA 3W4JA 1DCFA 4L8YA 4O4IB 3IOMA 4FYIA 5HWSA 3ZIDA 2CXRA 4C29A 4ESVA 2GK6A 3TEJA 1CS0B 4K9LA 2NZ2A 1MB2A 1EGVB 1CDEA 1ZIXA 2AXNA 2YIDA 1D0VA 4WWVA 3AFMA 1I0LA 4YX9A 4QOHA 5IYNA 1QOPB 3RO7A 4LS3A 1K8XB 4JODA 2E48A 4CV1A 2MIIA 2Q4DA 3KJGA 5JDCA 3W9YA 3GPLA 3H5OA 3K0HA 1BKDR 1I7DA 4RPJA 3K72B 1NBMD 3DOOA 3LCJA 3S2SA 4EGAA 1OXBB 3PRKE 4ZVQA 4YH1A 5A6SA 4Y6SA 1SXQA 3GP5A 3RWOA 5CW1A 2G8NA 5IYZB 3GARA 5FUVA 1V9LA 4BZPA 4FYPA 1Z0JA 4M87A 4PGAA 1T3TA 4PZLA 5CFQA 4RVHA 3HCEA 1T43A 2CVHA 4RSGA 1I8DA 1GVNB 4Z9BA 4Q1VA 1N6IA 3LVBA 3ZBQA 2LRHA 1EUQA 3N39C 4YN3A 2WSLA 1GYQA 4XVRA 2PGOA 1JZTA 1KHTA 2FY8A 4CODB 1Z28A 4OMUA 4TQGA 4W5OA 3GCDA 4PXSA 5JPCA 1FW8A 5EMJA 1XRSB 4HTAA 1WL8A 1H6DA 2VQFB 2R6R1 2ZEJA 4S1TA 1OLUA 1R12A 1YQDA 4K6GA 4B79A 5A62A 5KDDA 2A58A 2CHQA 3F74A 1USUA 3OCJA 5EY5B 3TBFA 2EIXA 2A7QA 3GGPA 4E33A 1YHYA 2QR3A 3E18A 2BGKA 3GBPA 2JIPA 3WYGA 3VO2A 4Z8YA 2OOSA 3QZUA 3QKRB 4AZ0B 5TRDA 4Y2RA 2G36A 1H2ZA 4L4UA 2C78A 1XZCA 3MUNA 1UMBA 2VBGA 2PLRA 3FGPA 3MWFA 3TSAA 2XWQA 1E96A 1R88A 1WVMA 3JZIA 4RV5A 2C2XA 2WDPA 4C0SA 1ORWA 3HJRA 4DILA 3UHAA 1Z18A 2RARA 1P18A 2OCDA 4EKYA 4MS1B 4RKRA 2IS1A 3FIUA 2OZEA 1R8YA 3AEQB 4B3BA 2I3GA 3SVLA 3NU1A 4HHEA 3QSGA 4JXZA 1ZIYA 4EG8A 1DKLA 1OLXA 2P4EA 3DJFA 1N75A 1KKLA 4CCYB 4MA5A 4E5PA 4LC0A 3RG2A 5KHLB 1HNXB 1X8XA 3H3JA 3NDPA 3D6HA 3U4MA 2BI8A 1CEYA 3X1JA 3GFBA 3P26A 1BFKA 2H2FA 2AJBA 4UE6A 3PD1A 5AH0A 2RH5A 2V4ZA 3QTTA 4JNCA 2IYSA 2ZJ3A 5KTTA 4BCBA 4M1KA 1RCTE 4F4JA 4D80A 2AZ4A 3OZWA 1E7MA 4UAUA 4BB0A 4EQZA 3BG5A 2C7OA 2EZ9A 3CLHA 1JIUA 4RESA 4AMUA 3CMMA 1A71A 4OHOA 1IG0A 1UZAA 1MVNA 3CB4A 2OLKA 1KSFX 2BGRA 5BW6B 4ARCA 3SHWA 1U9IA 1XVUA 1ZP6A 2JLVA 3UKDA 4ED9A 3V7NA 3EASA 1S8FA 2LV8A 2QY6A 4MS4B 5I7HA 3IEMA 5K05A 2QB5A 2YOGA 6REQA 2BEUB 3IVCA 4PWYA 4M86A 1FQWA 3KE8A 4HWSA 2OD2A 5MFZA 1V1RA 1X2BA 2H7VA 3CZAA 1SRQA 3VZPA 4PZ0A 5DHTA 3H2BA 4YP0A 1PT7A 2QORA 4MQ5A 4GE0A 1NNSA 3BYZA 1JQDA 2QL5A 1R0SA 1IY2A 4Q15A 1IFXA 2BAGA 4QV2A 1VQPB 1JEAA 1DAKA 1PJAA 3AF4A 4PIVA 4ZV7A 4BMVA 3OESA 3OC6A 3PJGA 4FOSA 4GGOA 4IIUA 1TAGA 4U6QA 1DAMA 3ETHA 3SDZA 2W6JD 1I6LA 2XLBA 5BOSB 5IH7A 4ZT2A 1FE8A 1L7OA 3H86A 5J4VA 2X3FA 4BRSA 5JH7B 4H7HA 4ARAA 4DLRA 2I62A 2I6GA 4Z4VA 1XRJA 3GGCA 3VGJA 1A1SA 5ADVA 2QRNA 4TV8F 4YK7A 1MTOA 2VF2A 1QF7A 3CIOA 3V4PB 1T9AA 2QX8A 1Q3TA 3H5NA 3NETA 1KJ9A 3LX8A 1H9BA 1K98A 4OHRA 3CLTD 4QXOA 2XB6A 2IODA 3IIMA 4LECA 2O6LA 3A4TA 2GPSA 3SYTA 1VQ8B 2PQ2A 1YR1A 1XA4A 4AURA 3GW8A 1VL6A 4YJGA 1T9GS 3B6MA 2CWDA 2FUKA 1YI2B 4F8EA 2PJRA 2PT5A 2WTBA 4G23A 4KDCA 2XDQA 3FPBA 3JQBC 3W78A 3RVBA 5FULA 1SU8A 5G0VA 2VHZA 4TLMB 3NO4A 1CUFA 4JH0A 2FFHA 3CC2B 4JD5A 1JIIA 3KXPA 2VXCA 4MUMA 4EB3A 1MZPA 3ZX4A 4HSGA 3RU7A 4JVLA 4FSDA 4DCSA 2PX5A 1ZJ6A 2NV2B 4M1QA 3ERCA 5EHZA 3D6MA 1HC7A 2V55B 3ETEA 1NB0A 5I3ZA 3LO8A 3FTNA 2VCHA 1DEXA 3C1TA 4DDMA 5KYXB 3W8NA 4JX9A 4GIBA 1A9OA 3UC5A 4MV0A 1VLMA 1Z62A 3A0RB 4PXAA 5I4IA 3EK2A 1Y48E 3AT1A 1MT3A 3OX4A 1SZCA 5A9SB 4L02A 2DSTA 1WNTA 3WQRA 2SECE 1EGHA 2CVPA 5K3CA 2CNKA 4X1KB 1M8FA 1VJGA 5AW7A 2JGRA 4PQFA 5BUSA 4AJ4A 5D5PA 5KVCA 1IM5A 3WO0A 3CN9A 5BSGA 5KYWB 2AXEA 4F8JA 3ICWA 4MDYA 5J2TB 2FVYA 2IYXA 5KJCA 4L4SA 2JLYA 1P4JA 4HZUB 3WLIA 1ZH2A 1SA0B 2G07A 1Q0LA 1J24A 2JNWA 3FCUB 3LT4A 4RIGA 5I4KA 5DEIA 2O0JA 2HQSA 2JIRA 2QGFA 1PO7A 1YJAA 1XZQA 5EXPA 4DQXA 4AVYA 3H13A 3ZNNA 3P1JA 2PV0A 3FROA 5E1OA 4BC0A 4G0VA 5J59A 1A77A 3OHMA 2PRIA 1GUBA 3PRYA 1MW9X 4NY1A 5FPTA 3UXMA 2GM5A 1QP7A 2FAXA 3NBFA 3EVTA 3I2GA 4HQNA 4ML3A 4RSMA 3H9EO 5MDHA 4RZUA 2DKFA 4DQVA 3TE7A 2K87A 4G5FA 3WWDA 4BU0A 5JD4A 1X86B 3DUFB 4EVRA 1ZDMA 3ZUGA 1W19A 3SK0A 4I5DA 5C37A 3WLFA 4P25A 3ILSA 5AOAA 1IVYA 3BKWA 4TWZA 4IIYA 3ZJ4A 2IKQA 3IKLA 4K03A 4P32A 2B2CA 2WJJA 1KQFA 3PA1A 1OIVA 3W6PA 4RMHA 1M10A 3VNUA 1QRUA 1O8BA 2WFLA 3MWYW 4N8DA 5BRNA 5TEVA 4BVEA 1VMKA 1U7DA 2DPHA 4LJ6A 2F48A 4ENQA 4XM2A 2VHXA 2FPPA 1KP2A 4ZYXA 1A50B 1KPIA 1YS9A 2Z2JA 1HLFA 2B8WA 1MJ5A 3MTIA 4NMWA 3ZKWB 4H3KB 4LBYA 3O95A 3FWHA 3PTLA 5CBPB 1VE3A 1TTQB 2OXFA 3KOZA 4P12A 3A9TA 4B43A 4S0ZA 4GAEA 2D0OB 3W7BA 3ANSA 3M6WA 1WSVA 1QVVA 4ND8A 1YUMA 2Q3CA 2CZQA 2ZRBA 2HQBA 2I34A 3HZOA 5B1IA 5CA0A 1E0KA 4AO7A 2OBXA 2CT8A 3LT5A 2BW0A 4EVIA 5J58A 1LK0A 2L17A 2NUBA 2HZ7A 2Q99A 3IVRA 2WA1A 1VZ2A 4IEIA 1QKKA 4JC8A 5FEUA 3V00A 4M1OA 5ICMA 4JYCA 4NJMB 5CBKA 2ZS7A 1XHFA 3ASVA 3M6LA 3OOYA 1WXHA 1DELA 3WBJA 1C7FA 1E0JA 2D2IA 1JIVA 1JMYA 3HYSA 4OBWA 4Q12A 4E5NA 4J7UA 4KAJA 3TIXB 4YAUA 4WRRA 4AP9A 1T1RA 4O1IA 1G3UA 2FB9A 1TCUA 3UXEA 3KSBC 1XKQA 5HIIA 4L07A 4PCLA 3GG9A 1QRSA 1AUPA 4H18A 3M5PA 3QY9A 5GONA 3ZS9A 3FVWA 3M6XA 1KO7A 1GPWB 3QOFA 4X8IA 4U3JA 4IKPA 3ZV3A 3U0BA 1YQEA 1ZVVA 4PX2A 1BMTA 2QTLA 5BN5A 2RGWA 1C7IA 2P5YA 4XDZA 3A8KA 1RXVA 2MHCA 3JZAA 3PUXA 5LBUA 1OAOC 3G5LA 1XCBA 2C5SA 3G4SB 2AI3A 3A9VA 3OIDA 1N2EA 4NFHA 1N1EA 4E6EA 4L3VA 4N5NA 2FFBA 1XK6A 1PR1A 3I01A 1FXWF 2D2XA 2X8JB 1LDBA 1NVMB 3HABA 3U48A 4CU5A 4OA8A 1BCRA 1VB5A 1GYPA 1TXGA 3V9AA 4GG1A 4HT3B 3FHTA 1M73E 4J1NA 1UKYA 4RZ3A 1ZVQA 1LLCA 4W6QA 2OP1A 1Q84A 5GZ3A 2CCKA 1H65A 3DVSX 1Z63A 5DM2A 3K1TA 2P0EA 2IYOA 3OZRA 2YJ5A 1JDUA 3OICA 4DUGA 1JIQA 3BCDA 5SYNA 2AH5A 1R4MA 1NFRA 1Y1LA 2PUFA 4XLCA 1KI6B 3FVRA 5CYFA 4D74A 4DCGA 1CX9B 3DBOB 2FXVA 3K6SA 4PXYA 5AVRA 4Q1FA 3AUSA 3AXTA 3G8YA 4INJA 2NP7A 3T34A 5LNK6 3KAQA 5TF0A 5CEFA 3UN1A 3A6GA 3KLOA 4HL6A 1PK7A 4YIHA 1KAMA 1YIAA 4WL0A 4FU0A 1SZJG 3ADPA 3IOCA 2RGCA 3NKFA 4HB4A 2SCUB 4PNEA 3JD2A 1GTMA 4W5HA 3JD3A 3RTDA 4GKVA 5IAKA 3UV6A 4D6YA 3P0HA 5KPDA 4RNCA 1IULA 1PUXA 2V7TA 2JS7A 1VRVA 3BD9A 2EERA 1IUKA 4U7FA 2I91A 3EJ6A 4XZ3A 1SXGA 1NYRA 1TYZA 1JEQB 2ZJFA 3KL9A 4QYSA 3N28A 1DHTA 4DV5B 4MYCA 5EYPB 1D2GA 4Z51A 5KTNA 2JGLA 3DZJA 2GLXA 3U49A 2WF9A 2O3JA 2X1MA 3NHFA 4M1TA 4UU1A 5BSUA 3TW4A 5JC8A 2JCSA 3TVYA 3CW9A 4D4JA 4ZEXA 5DGTA 2VJBA 5KWSA 1IBCA 4ZCTA 1RHRA 1OIXA 3RYIA 2ZPUA 1RSZA 1D03A 3U61B 1S9HA 1N0WA 4C0QC 5F9FA 5JNSA 4I5FA 3BJMA 2DT5A 2XRZA 1FDWA 1NJ6A 4R2XA 1OUMA 2OKGA 4IOMA 3NDBB 3VU0A 3ZBTA 4DRYA 3EQ7A 4TXNA 2V0NA 5K3AA 1C1DA 3QXSA 4HGPA 5KYVA 5FUQA 4ZYZA 4KYTA 4GOXA 4YP5A 2IHKA 1I5OA 2WWIA 4FJ1A 2ZR8A 2X0IA 1OXMA 2NWQA 1PNRA 2HJVA 2W6IA 1DAOA 3RPEA 1J8VA 2O8DA 1W9HA 2RKBA 4GOKA 1UIMA 1R9MA 4MH0R 4MI1A 4Q0MA 4Q5IA 2C8KA 4NCAA 3ZXIA 2Y4NA 3M7IA 3AUJB 2IFTA 2YUIA 3KDSE 1VIYA 4RZSA 3BWDD 4RTKA 3A6HA 3E1YE 3QWHA 1DC8A 2XE6A 4U2KA 1RZ3A 1Z4LA 1Q57A 1UBRS 1YXMA 3EW9A 1P33A 1N77A 1JS1X 4U7JA 4UFOA 2G6BA 2ZJYA 2DBVO 3P97A 3FYHA 4GDMA 1G9TA 3THXA 1SB8A 2OK8A 3AMVA 4XASA 2N75A 1KHHA 3HJFA 2G09A 2Z43A 2DZDA 4QUIA 2QM0A 1PFWA 1U0RA 4GXQA 4PGFA 2INGX 1QQ6A 4JKOA 5GGXA 1ENZA 3RU3A 2R5NA 3B6JA 1FLNA 2W4QA 3IJPA 1SBIA 1BVYF 3PRHA 5DLYA 5EE1A 4RDXA 4D8VA 2CYCA 2G9NA 1HNWB 1FDIA 2JFNA 3ROKA 4DSTA 1KZHA 3CVOA 4RY8A 2P3MA 4PLWA 4WKOA 4M36A 2HKIA 5ICEA 3RFXA 4YRFA 4QRIA 2UVDA 3S2IA 4OHKA 4KSBA 1YTLA 5TSDA 1EXNA 4ETWA 5HXAA 3E1GA 3IHWA 2B2NA 2VDWA 1L8XA 1BFUA 4B7CA 2QLBA 2WE8A 3L4BC 2GJPA 1KBOA 4TV9B 4BLTA 5F1PA 3BIWA 2O0KA 1QBGA 4FGKA 3SBEA 3M2TA 1P19A 3N53A 5H7XA 5CPBA 2GF0A 5K0SA 4PPYA 1DPGA 2RG7A 4CF3A 4R5HA 1ZHFA 2CVQA 4EG3A 4TTQA 2PVCA 3DE1X 4JLKA 3WRXA 4DMRA 5JZVA 4HADA 1Z35A 2H1LA 1PT8A 3BTOA 1L1QA 5K0LA 4O5AA 4J16A 3U1VA 3SICE 1V3TA 1XU9A 3H4IA 2PLNA 3Q2IA 4FWIB 4XQGA 3CX6A 2RK4A 3L4EA 3H7AA 4TM7A 4U6SA 2JHFA 3HCRA 4X91A 4CF5A 3GFFA 4CG0A 2BFNA 1SGWA 1Y37A 3K5WA 1OE0A 3FUXA 3F3YA 3OZXA 5AHWA 2VNKA 2REXB 2ACWA 4I1VA 4OLHA 1G6OA 2GEFA 1EDEA 2GFIA 2M6SA 2WMNB 4D3DA 1WU8A 4JLVA 3R5XA 4PO3X 2Z5FA 4LHXA 5CCEA 3EDCA 3AR5A 1H9CA 1L3BA 3GGSA 5IDQA 5TDHA 1J70A 1UXKA 4K88A 3P0JA 4RCYA 5IRCD 1Y1PA 3LL4A 3EGDB 4O2AA 1SVIA 7REQA 5KDOA 5GADl 2D2VA 2P6RA 5GP1A 2GX6A 4LV8B 3K1AA 3C5CA 3TRJA 3FNFA 4PZDA 5DN6A 1CZOA 2J46A 2IIPA 2ORWA 2WT4A 4GNKA 1Z22A 3LPMA 1JHAA 4P53A 2QZ4A 2HR1A 2TMDA 1XVVA 4MPJA 4Y67A 1YS2X 3D26A 2AVDA 2EKBA 3G85A 3H8JA 3VU9A 2ZZQA 3H4VA 3ASYA 3KTAB 4YCBA 1KYIA 3O8OB 4E46A 4KFCA 4WH0A 1Q92A 1CZLA 3R7NA 1O95C 2VJOA 1NPTO 1VQLB 2OHJA 3C15C 3O7MA 1VHWA 5EWLB 2QG9A 1YQTA 4JJ6A 4UMVA 5FBLB 5J1TB 1SAYA 4R7ZA 3ZYCA 2R6AA 1VL1A 3GAZA 4LQ4A 2YY6A 4D9KA 1K27A 4B3GA 1UWVA 3GVCA 3M34A 2F1HA 4FGZA 3UWPA 2XCTB 2Y67A 3R4VA 4MLPA 5KU1A 1HYHA 4FN5A 4JBHA 3IE2A 5EZ6B 2IUSA 5DBGA 2W58A 1I32A 4R4JA 4RJ2A 4CNQA 2JLUA 2ZDGA 2B0CA 2YN0A 3RYHA 1KEZA 2CXXA 4HQOA 4IDCA 1CXZA 3ESBA 2HWUA 4GZMA 3VTFA 2CEAA 3PGMA 4B7UA 4KO4S 3B9QA 3I01M 1J22A 1QH8A 1Z39A 2VQDA 2VP3A 2BFDA 4Q21A 4R3WA 1SUEA 4E6PA 2IQ5A 5DS0A 1X7YA 4AT1A 2FSGA 2P9FA 5DHUA 3SQLA 1E7RA 2J85A 2MOKA 4TL7A 1Y6FA 4UJ5A 2H2AA 1PYOA 2QR5A 1GQOA 3CWQA 3DS8A 3T53B 4TV8A 4W8HA 2W6JA 1TKCA 5E7JA 4Q7KA 4YRPA 3V1NA 2G5CA 3MQFA 4UFPA 4AUNA 1L7MA 2Z1NA 2EVWX 2QN1A 2GYYA 3PDWA 2X41A 2IOFK 5J47A 2HSWA 1GPH1 1OT5A 2C2KA 4H7DA 2Y2UA 4M8LA 2C4TA 3N87A 1CJVC 2W93A 4P4SA 4UHDA 5B37A 3GP8A 3PPYA 4E1BA 2Q28A 4DCOA 2VN8A 4QOSA 1WEHA 5BORA 2YN4A 1SZPA 5EWJB 2QRGA 3PUVA 1RDFA 1HDCA 3OI7A 2XYQA 1RQLA 3KT3A 3AVWA 3CCCA 4FYKA 3BWXA 4ZZ3A 1GQYA 2FG6C 3IE1A 1N3LA 1TVKA 3K9FC 1DC5A 2K7FA 1JLRA 1GZ4A 2ZRAA 1TPZA 4GMHA 4RAQA 3ROPA 1RJFA 4N65A 1MEOA 1IY1A 4C78A 1VRWA 2QX6A 1F4PA 3A2NA 3VH4A 4DSOA 1KIAA 4E70A 3DFIA 1K8RA 4OGKA 1DQSA 2XVZA 1CRWG 5I47A 3H3FA 3M9WA 4GI3A 1AC5A 5KJ6A 1CY4A 1M6HA 3PHLA 4X7PA 3OEHD 5KYUA 2RCYA 4DEXA 2P4UA 2YWBA 2YWHA 2VRCD 4REQB 3TS1A 2EC5A 2MSDB 4G85A 4FDTA 1MOZA 5ICCA 3DFFA 3SZ3A 2XA9A 2VT6A 2L42A 4C0XA 1W4BA 5I6DA 3A3NA 1DWOA 3KDAA 2R7AA 5G4KA 5IF9A 4C4PA 3EGVA 2RHWA 2P6UA 4JYBA 1YWGO 2E5LB 4WJKB 3A1CA 5EQJB 1I3NA 5K0NA 2DBZA 1TX4B 2F6RA 1KAHA 4RGVA 1C3OA 3NTXA 2ZUFA 2VT3A 5A3SA 1R6XA 2WD8A 4IJMA 3QIAA 3INNA 4E5UA 2BV3A 4XCQA 2VF5X 5GGYA 1QQ7A 2IYUA 3L6CA 5P8WA 2Q27A 4YRZA 4NOMA 5A4MS 4EB8A 2JEZA 1G3QA 1Y6ZA 2CXPA 3OOSA 4IG9A 2ATVA 1RI5A 4QOEA 3PNVA 2SHKA 1Z38A 2WAYA 5T64A 1AZLA 4D3YA 5AHKA 2QBYA 1W88A 5FLEX 2JF0A 1NT2A 4BIMA 4W7IA 4EF6A 3NYIA 1A7AA 3DUWA 1Q3HA 3HJNA 2BDEA 2BGTA 2WU4A 3SX4A 4FZRA 3QI2A 3EQ9A 5AKEA 1S72B 3F97A 3KPYA 1R64A 1CUJA 16PKA 3HB5X 1SKAA 2WTAA 3I8SA 4HEHA 5CJJA 1NQWA 4KKUA 3LRTA 4CUJA 2WF5A 3PLAE 3FNBA 4IJWA 2P77A 1VQOB 1BJTA 1C3VA 3GJ7A 2OCXA 1XJ0A 1PEAA 2OTCA 3RYCB 1QIIA 1GPDG 1EM8B 4LI0A 3I61A 3U7EB 1FUEA 2J9YB 1QGED 1KD1D 1TECE 2IXDA 2P40A 2QN7A 3LDFA 3PDCA 4DCTA 4DDWA 3R9WA 3HY4A 3M1AA 2GETA 2QQGA 4CHTA 1DO2A 4JZYA 3V7WA 2BRUA 4OHUA 4F3RA 1G41A 2TRSB 1MEJA 1W581 1TUBB 3PYLA 1M8JA 4OK3A 2H4YA 4IIJF 4DLLA 1BU5A 4X6YA 2FKAA 1NNUA 2JC3A 3ZI7A 4PRZA 1DJMA 4EG0A 3JCZA 2IYQA 1Q0SA 1JEDA 1T4CB 3DP7A 4CUKA 3T3PB 4C4SA 1JAXA 4ZQBA 1Q2XA 4H16A 2Z4SA 4UBIA 4JVMA 1Q7TA 4AJKA 2R6HA 3G05A 2ATCA 1TZBA 1SWWA 2IPAB 1O96A 4W7SA 1D6JA 1J2UA 3VNBA 5L9AA 1DWPA 1VL0A 1XWIA 4TSRA 4XGIA 1N2CB 3SFTA 4JNKA 3HCWA 2IEIA 4LSGA 4JDUA 4O0MA 4HJXA 2PS0A 5F5NA 4CF6A 2I87A 2ZQZA 4CM1A 3HXMA 3CE6A 3AHCA 1UBEA 2GPTA 4R01A 4B3XA 1W6RA 3A2MA 4HCJA 4KDRA 4CKYA 5AT1A 3WADA 1TA4A 1QU2A 1USWA 1NU6A 5AKLA 2ERCA 1YHNA 2BEKA 1TAUA 3KKOA 4EG7A 1NQTA 2NGRA 2WSIA 1HI9A 1KI1A 4E1VA 5G1NA 3H2GA 2P2CA 4DLTA 1XT6A 4MB6A 2AOVA 1GPYA 2JHPA 3HVKA 1O7JA 1SUPA 4MCAA 3GX1A 1MO6A 4KR0A 2CE7A 4CMIA 2B98A 3WKCA 4Y9RA 1MJGA 5CEJA 3L1IA 3JR3A 3NTLA 4QLAA 2YZNA 1PTKA 4NMXB 1U3VA 4Z99A 4D82A 4OSPA 3RAGA 1T0UA 2GPBA 4O1MA 1EZ4A 3GXOA 4DSZA 1UK7A 2WSYB 2G88A 2FZWA 2CEKA 1UMCB 1UKAA 2WIGA 5AW0A 3ESZA 3VZQA 1I4TD 1RYEA 2ODTX 3RAPR 1G38A 1F6WA 4J4TA 4OTZA 1R74A 2HADA 2QD4A 2GA8A 1EWQA 2R87A 3AO0B 2AFIA 1XQVA 4KH1A 4Z4RA 3IT1A 3OY7A 3GA0A 2JJMA 4HG2A 3U7JA 4O2LA 2NO0A 1K68A 2AJCA 4LYYA 4R05A 5FWXB 4QEKA 1UK8A 4N54A 4LF7B 4RFLA 4ILKA 4LZLA 1W0CA 1DKUA 3T41A 4NTZA 1CF9A 3OUTA 1YO6A 3Q2KA 1TU3A 4RK5A 4EF5A 4YUAA 4GOND 1H4QA 3IP7A 3O3OB 3U4DA 1KRWA 3QVVA 2HPVA 4UM9D 3ASQA 3PQ5A 4CWAA 4R2IA 2GSDA 4OGGA 1P77A 4PSVA 3TX2A 3Q3AA 2P78A 3ENNA 3K9GA 2YZ7A 3M9LA 4X97A 4X7MA 4YJ2F 1OCEA 5JVDA 3NOQA 3RADC 1ZN2A 3EXEB 4PFJA 5FWXA 4MGYR 1SG0A 3P4XA 5ALWA 3HY6A 4RD4A 1XZHA 1Z6TA 2RHLA 3UMBA 1IK6A 2B4RO 3PNOA 1I7PA 3T99A 2QVBA 3VO9A 1FDRA 1YGYA 2MJLA 4P08A 1JG3A 2FSVA 2IDMA 4C0JA 3QU4A 1KMIY 4DW8A 5FWNA 1Z4IA 3UC9A 4I8IA 1ZL2A 3V4ZA 2IHUA 2OBRA 5BV2P 3ZIAA 2VEOA 1P1CA 4DVGA 3OKAA 5F7JA 2QRLA 1WUKS 5H80A 4EJSC 3SS9X 4PQEA 4B40A 1Y1RA 4HB2A 3HV2A 1K4YA 2NZ8A 1XJCA 1S1MA 1ZNYA 2XYVA 3PNLA 3QJGA 4BMZA 4HMOA 1DKQA 4X8MA 5AI0A 1XP8A 3Q8WA 4KWCA 1I2ZA 5M34A 3LXXA 5FNVB 4E0FA 5HF9A 3TNJA 4CMIB 1GPMA 3AGQA 4P0PB 1HYEA 1KKMA 1K5PA 1Y4DE 1P4RA 1DUVG 2QSJA 3G2NA 3NDIA 1J5XA 1K7EB 3JY6A 4HLCA 1LB1B 3NUGA 4S35A 4IRUB 3FBGA 1TTHA 4QFBA 1SC1A 1CZNA 1F12A 1Q91A 2EGUA 2I7TA 3DE4X 3I55B 3DB1A 3DBLA 3OOCA 2QG6A 3Q6IA 4ARVA 3EC7A 2D6FA 3A4MA 4LVUA 1GKIA 4FEEA 3DE5X 2BJWA 3D0RA 4BTLA 5AUOB 4UZUA 2ZYUX 5ARBA 2H0RA 1G3MA 2GVZC 3GELA 5JYBA 5L53A 3U44A 2I3BA 1CQWA 2AW5A 3UAYA 4B3HA 4JU8A 4ZHSA 4DNFA 3EG5A 4ZXPA 3O3CA 1A2BA 1FK8A 1Z4OA 4ZIRB 1A82A 1XDDA 3P0RA 3BEOA 4BNUA 3RH0A 2Q4RA 2X5KO 1VL8A 4RV9A 1IOWA 2V4DA 1IZ8A 1WABA 3HFJA 5AI5A 4JVOA 2JVIA 2N0SA 3KUXA 1TJ4A 2ZYVX 4H7FA 2BMDA 5LU8A 2IZ1A 3BXFA 1CK4A 4Q7EA 3RD5A 4HAUA 1RXEA 1U0TA 3LI2A 1TUBA 3OSZA 3UHOA 4L7VA 5HKLA 4ZDWA 4BYMA 3FA2A 3FVVA 1KWGA 1W5FA 4HLUC 1R5JA 3H2IA 4ZI2A 5DTEA 2PKXA 4DJTA 4W1PA 4LOHA 1FVHA 3JVIA 1L7RA 3MM4A 1P8AA 4WY2A 2A0FA 2VJYA 4JZKA 5CM9C 3QBEA 5BVHA 3KKNA 4DZRA 1HLDA 1RWPA 2DHDA 1J2YA 2YJ4A 1R6BX 3HMQA 4XFDA 2VJAA 1EGMB 4KQ2A 4PFSA 2AEEA 1L4EA 2BGMA 3GFGA 2QZJA 4KQEA 4OSOA 3ZE9A 6ABPA 2HLDA 2B4QA 1HDXA 1XPJA 3QLVC 1ELOA 4XGKA 1UP4A 2FRDA 2FGKA 3EQ2A 4KVAA 2QN2A 4J03A 5AM5A 2I8LA 5LDGA 5THKA 1KOGA 3PXCX 1S1CA 4BNVA 1NMEA 4DPMA 4GUDA 1YMVA 3IFSA 4NEQA 3MC1A 1G5RA 4Z4YA 1S9DA 2LZ0A 1M0SA 4CVNA 5AVUA 1F1JA 1FXUA 3I04M 4JR1A 3MJ4A 2QBYB 4ZAVA 4K9PA 1R8QA 4U0KA 3T0GA 1C9DB 4R8MA 1RWNA 4QODA 4PC3A 1RS0A 3OZUA 1RI2A 1P0IA 1G4AE 2FR0A 2L69A 2PAAA 1BEZA 1XQWA 3CPJB 3FSRA 3QMWA 4U2CA 1ZIDA 2KWIA 4N1AA 4N7MA 2R60A 2UZIR 1VPTA 3K0BA 5E7QA 5ALLA 4DREA 2OC9A 1GG5A 5DN9A 4EI9A 1OAOA 1RYZA 2AZMA 1EXMA 1OFGA 1M1YB 3OZEA 4N7JA 3REOA 3ZLUA 4DWWA 2P9QA 5KTKA 4RTPA 2RIPA 2ZUUA 3K09C 3FLBA 4IY1A 1OLSB 1ZYUA 3QM1A 3T1YB 1P7VA 3GPIA 5JXGA 5A5FA 1T2AA 2QEXB 3GD5A 1GQQA 2ZSFA 4GPBA 5LPNA 4I4TB 2AUNA 3TQCA 3T1NA 5BWMA 2PZMA 4ZXFA 5TMBA 3IYLW 3L7IA 2P27A 4JYPA 2C4KA 3EX7C 3I72A 4OHVA 2IPLA 4I2VA 3RC8A 1S2DA 2H4FA 2HA2A 3UQYS 2DR2A 1ZUIA 1NTOA 2HLNA 3FHLA 1NY6A 4YP1A 5TPWB 4MPTA 4WAUA 4DZTA 3PPWA 4AZSA 2XKKA 4MOWA 2ZRKA 5CUQA 2HMAA 3CG0A 1WSBA 3OPQA 1CY2A 1SHLA 1WEKA 1CUGA 4KGDA 7MDHA 3KIPA 4EYKA 2Q9CA 4IDPA 1G60A 1R0YA 4XKJA 3NVAA 2ID9A 5BOVA 2O8BA 1OILA 2FA9A 3PPVA 1TVKB 4NV1A 4F3KA 4JI5B 2CLIB 4CMEC 4QDZA 3GJ8A 4C6SA 3I42A 4RK0A 3H97A 3MN1A 4PC2A 5HOEA 4BXOB 1NE7A 5BPHA 3P9XA 1T3ZA 1NDHA 4DNXA 2FRXA 1FNCA 5LKAA 1ZOPA 1NQOA 3GEIA 1U11A 4RFSB 4W5JA 3ITKA 1FOEB 4URYR 2RJOA 5AKJA 3CT4A 3WYNA 1Z08A 4C06A 2XZLA 1V5IA 1QVAA 2REQB 1LDNA 3G9ZA 4KE7A 4WZBE 4EGJA 2GVDC 1Q7GA 3GWZA 3WLAA 4HNGA 3QE2A 5ECGC 5D1NA 1J00A 3ZTTA 3GCWA 1JW9B 5SYMA 1U8FO 1ZC3A 4I9NA 3UOAB 2BZGA 3FNRA 5JD5A 3OLXA 1K6IA 1JJ7A 5IF3A 1G2PA 1QONA 1SK9A 3B7GA 1QHGA 3F96A 2XV1A 3VO8A 1ZUWA 2BFDB 1QH8B 3QYPA 1G9XA 4J2TA 5I45A 3T3NA 3FFAA 1EK2A 3IAFA 4ND5A 2FQYA 2ZR7A 1MX3A 1SG9A 5IT9A 4CKCA 4R1QA 5J1SB 5EUQB 4CIYA 5LXTA 1ZD2P 1TRHA 1JLHA 3EZFA 4QUKA 5F1OA 3G88A 3SAJA 3TK1A 3EIWA 1R0LA 2HHAA