4P22A

Crystal structure of n-terminal fragments of e1
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
381
structure length
370
Chain Sequence
IDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTPLEDQLRVGEFCHNRGIKLVVADTRGLFGQLFCDFGEEMILTDSPLSAMVSMVTKDNPGVVTCLDRHGFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLVASLAEPDFVKFSRPAQLHIGFQALHQFCAQHGRPPRPRNDEDAAELVALAQAVNARALPAVQQNNLDEDLIRKLAYVAAGDLAPINAFIGGLAAQEVMKACSGKFMPIMQWLYFDALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression, purification, and crystal structure of N-terminal domains of human ubiquitin-activating enzyme (E1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-like modifier-activating enzyme 1
total genus 105
structure length 370
sequence length 381
chains with identical sequence B
ec nomenclature ec 6.2.1.45: E1 ubiquitin-activating enzyme.
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16190 E1_FCCH Ubiquitin-activating enzyme E1 FCCH domain
A PF16191 E1_4HB Ubiquitin-activating enzyme E1 four-helix bundle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.180 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4p22A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4p22A01
3ADPA 1P1KA 3WQRA 4BVAA 3L9XA 2POQX 1NVTA 3V1YA 2O3SA 1EK6A 2W2KB 3DBRA 4TZTA 4BGIA 2O7QA 5AQ1A 3EW7A 4UUOA 3KZVA 5U9CA 3L4SO 1E3JA 1R4MA 1N2SA 3I52A 1JVBA 5FI5A 5JCJD 4J6FA 4CV0A 4NJMA 4EUFA 3NTRA 1HT0A 3MOGA 3EK2A 2UV8A 5A02A 4D44A 2Z95A 4M54A 4J43A 4DMMA 1AN9A 4UEKA 4R5MA 2CSUA 1PIWA 5I7EA 3NJ4A 4Z0TA 3UVEA 5FI3A 3OJFA 4L4RA 2X8LA 4RQUA 4P4NA 5TQVA 1YQDA 1NQ5A 4I5GA 5IFLA 4KZPA 1C0LA 4K26A 1JAXA 4GKBA 3OIFA 3DZJA 4ID9A 3D5QA 2EKLA 3TSCA 4FC7A 1I32A 3RAJA 1DHRA 1X1EA 4JCOA 4CMBA 4R68A 4BB5A 4R3NA 2JAPA 1NWCA 1NR7A 3VH4A 1M6WA 1XGKA 2ZTVA 3QWIA 3V2UA 2GUGA 4RVHA 3OECA 4WK6A 3AY7A 3VKVA 1HTBA 1R15A 1RYDA 5JDCA 4J4HA 3ASVA 4XIJA 1ONOA 4BNNA 2GCGA 1K3TA 1GYRA 4XKJA 2R00A 1EEHA 1Z82A 4WLEA 4ZQBA 3S2IA 4CLRB 4UVDA 4O5OA 2VHWA 1YVEI 3HUDA 4ZQGA 1VJTA 5IZ4A 3DEYX 5TGDA 3A14A 1ZIDA 2DBVO 4PIVA 3WWZA 4QFCA 5HTOA 5TJHA 3PI7A 3HNPA 1HKUA 1HYHA 2DKNA 3AUAA 3PWSA 3U49A 2WEKA 4DLAA 2Y1FA 1M66A 2B36A 3RC1A 2GN8A 1I36A 4IZIA 1DFIA 4BO8A 1EDOA 2DUWA 1XQ6A 2D59A 1H6CA 1UAGA 2YY7A 4W4TA 4HXYA 3ROQA 3B1JA 4CQMB 5B4TA 3UCXA 4IS3A 4Y9DA 1WDMA 1C3VA 3FD8A 1CETA 1YRLA 3C7DB 1U3VA 2NTNA 2V6GA 2VWHA 2VHVA 3DAPA 3JQAB 3ULKA 4JJIA 2IEDA 4BS9A 3FTNA 5FWNA 3GDOA 3OM9A 3IL2A 4ALNA 1GQYA 4IS2A 4IXTA 4J3FA 4RL6A 5I9NA 4L0QA 1HDZA 1UP4A 3AM4A 3MJCA 2EHDA 2Y68A 4DBVO 2IXAA 2GN4A 4IQ8A 3RUHA 1NQTA 5BR7A 1J49A 1NP3A 2HMVA 3KYCA 3DAGA 3FWNA 3G3EA 4I8XA 3S2EA 3RI3A 3C24A 2AW5A 3DZGA 4W6ZA 2ZQYA 3OF2A 3JQ8B 3F5QA 4NZ9A 1H6BA 3MJ4A 2V65A 1AHHA 3K9QO 3FRJA 2PH3A 1TT5A 3WG9A 1H6DA 1Q7GA 3KYDB 4Z9FA 1AHIA 5BT9A 2PV7A 2CF5A 4IZHA 4GAEA 5I7VA 3A9WA 1N8KA 3DBLB 1U4OA 4XX0A 4AFNA 2AE2A 4U8GA 3KEOA 4IBOA 3CIFA 1E7YA 1U7TA 2UUOA 3W4JA 4DPLA 3V2GA 3X2FA 1Q2XA 1GUZA 1RPNA 2NU7A 2VWGA 3HQ4O 3AOGA 2G5CA 3AK4A 2V6MA 4PGFA 1G1AA 1GDHA 4PLVA 3PQFA 5F5LA 4GX2A 1HDYA 4JJGA 5GZ3A 4GVLA 5JDIA 1OAAA 5DN9A 2DTEA 4XZ3A 1NX6A 2IODA 2VRCA 1UDBA 4WCFB 3GVCA 1FJHA 1ZK1A 3WBFA 2I67A 4TRMA 1S7CA 3WR5A 4BNVA 2J5RA 5KJFA 1E7WA 1ISGA 1P31A 3DBHB 3D1LA 5F1OA 3B1FA 4J1TA 3EUWA 3FI9A 3LT2A 1Y81A 2NU9A 2WE7A 4Q3NA 3UGKA 2P4HX 5KVSA 3PHIA 4MINA 4YAIA 3SLKA 5IXYA 1U5AA 5LC1A 4QO7A 1WPQA 3DTTA 3JD0A 4R41A 1I3NA 2GF2A 3PJFA 1KS9A 4MVJM 1G6KA 3I6IA 4K6FA 2BFPA 1GCUA 1N7GA 1WDLA 2Q3EA 2IXBA 2DTXA 4LK3A 1U3UA 4PZCA 1OMOA 2NNLD 1I2ZA 3BIOA 3GMDA 3H5NA 4RZHA 1KY5A 2C5EA 4CQMA 1LBEA 2VT3A 5T5QA 1B14A 2Y1DA 3WTCA 4YT8A 3CTMA 3EYWA 1FF9A 2Y05A 9LDTA 5IAAA 2C2YA 1NQOA 2X86A 2NUAA 2IDZA 1LNQA 3V2HA 4YAEA 5ICSA 3DMTA 4IGEA 5JYEA 2VYVA 2G17A 1VKNA 2B5WA 1I5RA 1PL7A 3VDQA 3VVBA 1EBUA 1I8TA 1PZFA 2CDBA 3DOCA 4E5MA 4CM9D 1SBYA 3ASUA 4INAA 4NJOA 4GMGA 1EUCA 1PQWA 3JD2A 2VUUA 1R16A 3IC5A 2E37A 3C85A 1X14A 5CEJA 3FTPA 4TSKA 2WMDA 2VHYA 3JYNA 1PEDA 1XEAA 4EUEA 4XEHA 4BNIA 2JKVA 3TRIA 4KQWA 4CV2A 3JYLA 2B69A 2X58A 1HE2A 1HZZA 3VH3A 5EPOA 3Q11A 3NYWA 3VZQA 3RWBA 3WMWA 4JQCA 2RBEA 5KJ1A 1LRJA 1MA0A 4RLSA 4RVFA 1BDMA 3OEYA 4BB6A 1M2WA 1ZFNA 3GA0A 1GU7A 3ROPA 4DWVA 1PTJA 5I9MA 4WLNA 4OSOA 3IP1A 3CMCO 3ANLA 3ICPA 3PP8A 3PJGA 5HRUA 1UUFA 2HK9A 5TLSA 4LMPA 3L6DA 3H9QA 3I23A 4OGWA 4A26A 1GZ4A 2NQ8A 3GUYA 2PZJA 2ILTA 1PS8A 4AVYA 2PKQO 1P9LA 3ZNPA 2P9CA 5ITWA 2VUSA 3LF1A 2BI7A 1GYPA 4LW8A 4Q3DA 4MVJP 5KKAA 5ENDA 4BNZA 4CMHA 3ZZNA 4II2A 2C20A 3GDGA 2P4QA 1A5ZA 3BTVA 3S8MA 1SB9A 4ND5A 2W4QA 3GY0A 4TMFA 3P2OA 4DUPA 4UREA 1NBOA 4CM6A 5C5IA 3KYDA 3BMQA 3PK0A 3GHYA 5L3ZA 5G4KA 3NTQA 1MG0A 1OZAA 1DB3A 1XCBA 3NTOA 3UICA 2Y67A 3ZU2A 3B20A 3QJ5A 1PGJA 2Q1WA 4OQYA 3GNQA 3R3SA 4HNHA 4FPXA 3W6ZA 1F8GA 3EVNA 2BFMA 4XQ9A 1EQUA 5A3VA 2YV2A 5JAZA 2BGKA 3DOOA 4EITA 4FR5A 2HMWA 3PDUA 1RM3A 5CG1A 3DFZA 4CM4A 1V8BA 5CDUA 2B0JA 1KEUA 3GGGA 2C82A 4UULA 1SOWA 3QVXA 3DONA 5EESA 1Z74A 2RIRA 3I83A 1WVGA 3ZI0A 3A06A 2PD4A 5CAEA 3DZIA 1CQJA 1P1HA 4MKZA 4RVDA 2XXJA 3O26A 5IDQA 3T4EA 4XQEA 1ZZEA 1Q0QA 4IJKA 3NRCA 1T26A 4CLEA 3W8DA 2Q1SA 3F1KA 2V6BA 2RCYA 3JYQA 4TRRA 1LTHR 3RD5A 1X7DA 4J9UE 1SC6A 2VTEA 1YL7A 3AUTA 4TVBA 2VOJA 2Y1GA 1A7KA 1ENPA 4CLDA 2HRBA 2VZ9A 1T2CA 1CEQA 1CF2O 1T4DA 2B83A 4MVJA 4ZHSA 4BO7A 4CQLA 2HCTA 1EFKA 3CSDA 3JD1A 1CQIA 4CLHA 3C7AA 4YQYA 1UXGA 4XQGA 2C54A 1GPDG 2VRBA 4I5DA 3GEGA 1I2CA 1P0CA 4R4JA 1BG6A 1KEWA 1LLUA 2WYUA 1UR5A 3NGXA 1H9AA 4JBIA 1NAIA 1ARZA 1B8UA 3H5RA 1PX0A 1L1FA 2HRZA 3DZFA 4A10A 3E9QA 4TWRA 1B15A 2EXXA 4MOWA 1UP6A 1E5LA 3GGOA 1ENOA 1E3LA 1SB8A 1Q1NA 2P68A 5JCXA 3M2TA 3ZHZA 4YXFA 3PJDA 4Q3EA 3BMCB 3SBOA 2QHXA 5C7IO 1EMDA 4J1QA 2VYVD 4K6CA 1YXMA 2W2KA 4FFPA 1TT7A 2DAPA 3DO5A 6LDHA 2VN8A 1B2LA 1N9GB 3LK7A 2B4RO 3JYPA 5T64A 1ZSNA 2FWMX 4LISA 4JP2A 5ER6A 1ZXBA 3T7CA 4DC0A 3AI3A 4FFLA 1HDOA 4AJNA 4B4VA 4F6CA 1E3WB 1X15A 1ZEMA 3ABIA 3QHAA 4MIOA 5F21A 5CDYA 3IJPA 1O0SA 1K5HA 1BGVA 4TKMA 2Q1UA 1PS0A 2J3IA 1SPXA 2W2LA 4RF4A 5AVOA 5IDXA 3RBVA 4CMKA 4XR4A 3V8BA 4OJNA 3PYMA 3UN1A 2NQTA 4B4UA 1I3LA 1C1XA 5I8ZA 5BNTA 2BI8A 1JA9A 2B4TO 1K6IA 3IDSA 1DC5A 1DDOA 3G17A 1HXHA 4YACA 2Q2WA 3NDIA 4M86A 4XDZA 1UZMA 2J3KA 1L7EA 3UCEA 3GF4A 4AL4A 3AOEC 3K92A 4CM9A 5KJEA 4F46A 1YONA 3PZBA 1YDWA 1DLJA 1IE3A 2PGLA 1Y9EA 2P9EA 3RFVA 3TZCA 4PG6A 2Q99A 1OC2A 1YB5A 3I6QA 1WW8A 4ZRNA 3R0IA 3F6YA 1ENZA 4YWJA 1T2FA 4Z3KA 3IS3A 1CDOA 1YH3A 5CDSA 4PLGA 3RU7A 3RJ5A 3VC7A 3C1OA 5TX7A 1D1SA 4ZJUA 5DZSA 4IDCA 2YDXA 2HJRA 2PKQP 2VT2A 4IM7A 4OXNA 3WS7A 4HBGA 4AICA 5JY6A 4NI5A 3L6OO 4QO8A 5CDGA 4WEOA 3PWZA 1FXSA 3FPCA 4GSKA 4YTEA 4IGFA 3B70A 5L7TA 3MJTA 3DTYA 4MVJE 1KETA 3H6KA 3TFQA 4ZA2A 3H4VA 3LC2O 4E13A 1HE3A 3HZZA 3VKUA 1U8XX 1LU9A 2O2YA 5KVVA 3I9NA 1N9GA 1R0LA 5EERA 3D4PA 2VZ8A 5JAMA 4I9UA 5A04A 1JW9B 4UEOA 4Y67A 3W6UA 4A2CA 2VTDA 1QKIA 4UVHA 2CUKA 5EIOA 1QLHA 4HKTA 1NPTO 1NHGA 4LN1A 2EGHA 5K6AC 3HDQA 1LLQA 2WWRA 4KP7A 1PZGA 5A5FA 2P5YA 3KTDA 4FFMA 1V35A 1U9JA 1VJ0A 2GN9A 4RPLA 5AXBA 5CG2A 3KHUA 1XWFA 2OHXA 5F5NA 1E77A 2OZPA 1NFRA 1ONPA 1RKXA 1IUKA 3MWDB 5U1PA 1QG6A 5CFZA 3QA9A 2X5OA 4J7UA 1TXGA 4IJVA 3UH1A 1YOVB 4BNMA 5H83A 4CMAA 2B4QA 4CQLB 1ADFA 4EEXA 3TWOA 4E32A 3ANMA 4GSLA 3WGTA 3L0DA 1LRLA 3HFGA 2YFHA 2GZ2A 3AUSA 3GGPA 3DMTC 4YRDA 5BNFA 1Y8RA 2YHIB 2YQ5A 1UDCA 1ZJZA 5EINA 4FB5A 5JBIA 1I0ZA 4R51A 5CP8A 1F17A 3DMYA 3WNQA 1VJ1A 4XCVA 4F45A 1VE9A 3QWAA 3GFGA 1ZK4A 3E18A 2CY0A 5AXAA 5JYDA 1LDMA 4NK5A 5DOVA 4Z6KA 3EHEA 1P1RA 4B4WA 5L9AA 2VUTA 5AYVA 2O7SA 5T8KC 1LUAA 4N5LA 4GVXA 4BOYA 2P5UA 4BHTA 2BHLA 5EQDA 1FDUA 4M49A 3FSRA 4FQ8A 3F46A 1R0KA 4ZVVA 4PVDA 2X5JO 5JFOA 4CR6A 1ISIA 1X7GA 1ZSYA 3TL3A 2VRCD 2ZATA 1ONNA 4EJ6A 1XYGA 3X2EA 1E3SA 2JHGA 2W2LD 4MP3A 1CERA 4YA6A 3H9EO 1CJCA 2CDAA 2IZZA 4BNLA 3GOHA 2FSVA 4HNGA 4LSWA 1NFQA 4QX6A 3L77A 3Q6IA 4BQRA 2P9GA 3ZWCA 3CZRA 4XRRA 8LDHA 4ZN6A 1HE5A 2VNSA 3SEFA 4Y8VA 1HYGA 4DIFA 1KVQA 4PLHA 5IF3A 4LSMA 5CEEA 2H6EA 2D5CA 1P33A 3D4OA 3DDNA 5JO0A 1W4ZA 3AFNA 4IINA 1EVZA 3VH1A 3HWRA 4WCFC 3ZN2A 4XR9A 1D1TA 5TJ9A 5ILOA 2WYWA 1H5QA 4KDFA 5T57A 4IQGA 1VLLA 3CEAA 3JQDA 4I9HA 3ADOA 4EJ0A 4CL8A 3TQHA 2NV6A 4WCDA 4DVJA 5DCYA 4D3DA 3RC9A 5G0TA 4MKXA 3INTA 3VZRA 2P2SA 4IDBA 4IDGA 2FSSA 1YBMA 3W4KA 1TEHA 3PJEA 3ETDA 2WD7A 1YB1A 3ITDA 5DBFA 3P19A 1Z73A 3K2EA 1SAYA 2VZ0A 4BNHA 2DTDA 3QE3A 4JBGA 5A05A 1B8VA 4GMFA 3GDFA 1GV1A 1W6UA 5HA5A 3CPSA 3IIEA 3O9ZA 3OJLA 1UH5A 3M2PA 4RO0A 1JKJA 2D4AA 2Q4EA 3ZWPA 4BNTA 4E2WA 4QSMA 4YJHA 3I5MA 2BKAA 3LT4A 2RAFA 4R54A 5HM8A 1BXKA 1V3UA 1NASA 3SJUA 1R4MB 1GUFA 1NQAO 2Y99A 4B7XA 1XIVA 3E6AA 5THKA 4CM8A 1XHLA 2PTGA 2O3JA 4XYGA 1NR1A 2DFDA 4ALIA 4P22A 4YYZA 1X7HA 1Y7TA 3V5NA 4YVFA 4R5HA 4YT5A 2PFGA 3KYBA 2FR8A 4J16A 5KTKA 1E7SA 2X9NA 5TF4A 1LC3A 4K9DA 4MO2A 2GZ1A 2NADA 4KQXA 2FHSA 3GUCA 4CM1A 2WTBA 1XU9A 1Y9AA 5JO9A 4E0BA 2GLXA 4E2XA 1AE1A 5TNXA 3VPSA 1NYTA 3KVOA 3PIDA 3R3JA 3ZWYA 1W0CA 4DIOA 1FK8A 3U4DA 1DC6A 2VWPA 3NV9A 2A92A 2DPHA 4YCAA 2D1YA 4BV8A 1QXSA 1LSUA 3AOEA 4E4YA 5B1YA 1AUPA 4UAGA 5ILGA 2Q49A 1N1EA 1EFLA 3E9NA 3ZWBA 3AU8A 1MV8A 4PLCA 1CYDA 4M87A 4OO3A 2QYTA 2I3AA 3I4CA 5I7SA 3GFBA 1SCUA 4L8VA 2G0TA 2C59A 2IYPA 3H2SA 4GL4A 1XG5A 2GERA 2G76A 2X0IA 4BNGA 1PJQA 4YPOA 1H6AA 3RUCA 4JP3A 1BW9B 2X7HA 4J2HA 3WGHA 5F1PA 4Q9NA 4D41A 1EZ4A 2ZCUA 3D64A 4BMNA 1XU7A 2PGJA 1HWYA 4RQTA 2FPGA 3P5SA 1OI7A 3JQFA 2X6TA 1IULA 5G0UA 1V3VA 1P1JA 3GRKA 2O2SA 1JLLA 2PD6A 3DBVO 4P4LA 4ZRMA 3WJAA 2C7GA 4IJWA 4EDFA 1ID1A 2QQ5A 2UUPA 3GZNA 2BLLA 4FOSA 4AJLA 3ETEA 4YR9A 4FS3A 3KBOA 3WFIA 3PLRA 3ORFA 4Q3CA 2B5VA 4BMSA 2PR2A 4K1LA 1ISJA 4O0LA 1YQXA 1H93A 3I9KA 2ZTMA 4AJ1A 2Z1NA 3JQ9A 3AI2A 4F3YA 2EERA 1XSEA 3RROA 1UXJA 2X0NA 1K0UA 5HS6A 3OETA 4N5NA 3ZV3A 3R1IA 1PQPA 3KRTA 3RIHA 2GZ3A 3WB9A 1DO8A 1GZ3A 1HSOA 2GSDA 3R6DA 1ZKMA 4IDFA 4I5FA 3U4CA 4CR8A 5CDTA 3C1AA 3D3WA 3H2ZA 3OFSA 1Z7BA 4XYEA 4UVGA 2HDHA 3IMFA 5ENVA 4RPKA 1HETA 2YFQA 1VL6A 1YOVA 3C1TA 1GQQA 3PFFA 1P44A 3GZNB 3AJRA 4OAQA 2ZKLA 3KM0A 5G0WA 1F14A 5A5EA 1G0OA 3QP9A 1QV6A 5IN4A 3WMXA 3I1JA 4A7PA 1ZBQA 1JDJA 2HU2A 1R4NB 4S1VA 3ZWXA 4Z9YA 1M76A 1U28A 2XPCA 1T2AA 3DFUA 3OEWA 2EIHA 4RGBA 1K6XA 3JQFC 4R1NA 3WGZA 1Q7BA 3MEQA 4TKLA 3O4RA 2J3JA 1UXIA 3PGXA 5L95A 1LLCA 3JQ6A 1V6AA 2GYYA 1D7OA 4GI2A 1PJ4A 4BO0A 1ADCA 3MWEB 1GY8A 4J90A 3NAQA 1A9ZA 1Z75A 4GKVA 2ZB7A 3WOHA 2V6FA 5IG2A 1BDBA 4AJ4A 2D0IA 4L74A 4C7JA 4DBZA 2O4UX 3FR8A 4Q3BA 3F1LA 5I9LA 4YAJA 4J7CA 2GNAA 4B7CA 1ZSVA 3ITKA 3AY6A 4J4TA 5IN5A 2HMTA 4RZIA 1GPJA 3ZCXA 4UUPA 2NVUB 3PVZA 2QX7A 4O63O 1QP8A 4AJPA 3T7EA 5DCWA 5DP2A 1EDZA 3C3XA 4BL5A 5K6AA 3K5PA 4L75A 3UKOA 5ITVA 4NH4A 3K30A 1Y1PA 1B7GO 3WNVA 4AJJA 2CVOA 3PYXA 3S2FA 2CVQA 4DIBA 4URFA 1LDNA 1HYEA 1JVSA 1HE4A 1E6EA 3LU1A 1W73A 3GZ4A 3QY9A 3Q2IA 4M89A 4J0EA 1HEUA 1LLDA 5IXSA 2Y0CA 1GFSA 5ICMA 2OBNA 1JAYA 1NFFA 2O48X 3MTJA 3U9LA 2Z5LA 4AJOA 5L40A 1YE3A 1LDYA 4RVUA 2PA3A 1XQ1A 4Y98A 4RORA 3H9UA 2Y66A 1E1KA 3EAGA 4MVJD 3BTSA 1I33A 1R6DA 3FBTA 4OOFA 4U5QA 3WYEA 2XAAA 4P4GA 3ONFA 4DPMA 4ZICA 1PJTA 3GLQA 5BSEA 4GX5A 4ZQHA 4JXKA 1NPDA 4BKPA 1Z6ZA 1PWXA 4OQZA 1BMDA 4QQRA 4W82A 4DRYA 4OMUA 3TZKA 3LZ6A 2DUUA 1E0DA 1IHYA 1LQTA 2ZQZA 5A4DA 2E6UX 1VL0A 2WJPA 5JS6A 5KJ6A 4GX0A 4UEJA 2ZYGA 3WIEA 9LDBA 2ZIZA 4LMRA 3KYCB 4NBVA 5L4LA 1PJBA 2BGLA 1E7RA 5BNIA 1DFGA 4YJGB 4GGPA 3JQ7B 1L7DA 3N7UA 2W90A 1I01A 1QR6A 3BMCA 4GWGA 2DT5A 1KOLA 4BGUA 2E82A 2ZJ0A 3G79A 2W98A 4FBGA 4YAKA 5FYDA 2IEBA 1RWBA 4CMGA 4AG3A 3GEDA 3LQFA 3RKRA 4BO3A 3OA0A 4DGSA 3DQPA 2AHRA 4B7UA 2H63A 1YBVA 2FN7A 4TVOA 5DULA 4CJXA 2UAGA 2NVWA 3RUFA 1VSVA 3EMKA 3JQ8A 4NHEA 3KXDA 2ZCVA 2DPGA 4BNUA 4ZQFA 4MVJG 1PGPA 3JYOA 2O23A 4H3VA 3TZQA 5BQFA 3D4NA 4G81A 2VHZA 3QW2A 4BO4A 2I65A 1K2WA 3V1UA 3ZGYA 1PZEA 4N7RA 3PHJA 4PRLA 4OHUA 2NU8A 5JY1A 2ET6A 3TOXA 2PNFA 2X5KO 2YZ7A 3GK3A 3ZWMA 3CMMA 2GN6A 3G1TA 4YT2A 2DLDA 2DU8A 4A73A 4XGNA 5BSFA 4B79A 4OM8A 3ROKA 2AG8A 1YL5A 5KVCA 3QV1A 5A06A 4I08A 5DCUA 1PJLA 3PWKA 4Y6RA 5FFFA 4ONEA 4ALLA 1ZK3A 3KV3O 3ENNA 4L4XA 3VDRA 1DLIA 3E5RA 4NR0A 4RDIA 3VOSA 5J23A 3RSHA 4EZBA 3OICA 2WD7B 1NVMB 1U8FO 2QIOA 4YJFB 2WE8A 2VOEA 1J4AA 5DNAA 1F06A 1X0VA 1H9BA 3OA2A 4FW8A 4NFSA 3KEQA 4YJHB 3UOGA 1MC4A 3O8QA 4WPGA 2FOIA 5HS4A 5IJZA 1DIHA 2CVZA 4FGSA 2EKQA 1MC5A 4R69A 1GTMA 3AWDA 3UF0A 3IOYA 1V9LA 1TLTA 3AM3A 4PLFA 4BV9A 3SXPA 1ZK0A 3O38A 2EG9A 4ROSA 5T8KA 3FNFA 1T4BA 3A28A 1D8AA 5G0VA 1Q0LA 3COSA 3FR7A 4ALKA 4R01A 2LDXA 1WDKA 2WD8A 1P45A 1PJSA 1EUDA 3VPFA 4EI2A 4ZD6A 1MP0A 2FPPA 1SMKA 5JLAA 3RFXA 3IUPA 5A9RA 2D8AA 2X1HA 4PG5A 1N7HA 4FGWA 2JD2A 1TB4A 2I99A 4YJDA 2JFGA 3KB6A 2AMFA 4GBJA 4R9SA 4BGVA 1DSSG 3ZV6A 3GHHA 2ZB8A 1PJCA 3GN2A 1HDGO 1PGNA 4U6SA 2Q4BA 4U0KA 3ONEA 4YRAA 1I30A 1WAMA 1UZNA 2UYYA 1EE2A 1WNTA 1C14A 1PJ2A 2X22A 1HL3A 3RU9A 4DC1A 2FZWA 4HFRA 3NGLA 4WLVA 1KVRA 1NPYA 2W8ZA 5JE8A 3DZKA 5H81A 2O50A 3GVHA 1HF3A 2RH8A 3KLPX 2ZB4A 4J2OA 4LCEA 1HDRA 1WMAA 1ZVMA 1MXFA 4OKIA 1LDEA 1ZO8A 4RPHA 4D45A 1BTOA 3W8EA 4GH5A 5ADHA 4GLLA 1WXDA 3INRA 4N18A 4RCVA 4RF5A 4E5NA 2VYNA 1E6WA 3I3OA 3E5MA 4NPCA 2G1UA 4XD2A 1T1SA 2B37A 1NWHA 2TMGA 4L73A 2PZLA 3JQAD 2YV3A 3MJVA 1HDCA 2H1SA 1WLYA 2VWQA 5DDIP 4O59O 4YT4A 3IAHA 4N54A 3W4IA 3JSAA 3KUXA 2EGGA 3LSYA 3RVDA 2F00A 4Y6SA 4B3JA 2D2IA 1NM5A 3GR6A 4BQPA 3ZWWA 1XLTA 4BNXA 1Y6JA 1T2DA 3ZNNA 2CD9A 3GAFA 1PZHA 2BMAA 5A3JA 3FNGA 2J6IA 3EC7A 4XRGA 5JXWA 2AEMA 3G49A 3OP4A 5I7FA 1EUZA 1VPDA 1QLJA 3D0OA 3ZNOA 7MDHA 4DTIA 3M6IA 4EYEA 2IYOA 3PFWO 3U0BA 3HSKA 2QRJA 2AEJA 1MXHA 2PKRA 4BO2A 1GV0A 3FNHA 4CLOA 1B3RA 1H94A 1C1XB 1U2GA 3HFSA 3RBXA 3OSUA 4DL9A 1KC3A 2GO1A 4QT0A 3BMOB 4D7AA 1N1GA 4H16A 1Y8QB 4MIYA 2R2GA 3D3WB 1LDBA 3ETGA 4GGOA 3ZWVA 1FDSA 2AE1A 4UUMA 4MDHA 2CDCA 1R66A 2EW2A 4J1NA 4RDHA 3N74A 1MB4A 1O6ZA 3FHLA 2VQ3A 2RHRA 1YL6A 5T67A 2O3TA 3F9IA 4ZQEA 4AJEA 3WSVA 1QYCA 2A9FA 3NEPX 3SC6A 4E6PA 4XYLA 2YHUA 1IY8A 3SVTA 3Q9UA 1BXGB 2DC1A 3KLMX 2X9GA 4RF2A 3WGOA 1OBFO 2HQ1A 1O8CA 3LT1A 2DFVA 4JGBA 1E1LA 4JNKA 2OUIA 4FFOA 4M8SA 5MGBA 1FDVA 2Q45A 3K6JA 4RVGA 2IRWA 4PN3A 4XYBA 1DHTA 1SO8A 4R1UA 3LDHA 3VH2A 5L7WA 4H15A 3GC6A 2ZB3A 1QYXA 4JROA 1SZJG 4CL3A 1GD1O 2PH5A 1ZUD1 3DWFA 4BMVA 2EV9A 3UCFA 4E5YA 2VCYA 3IKVA 1J5PA 1CRWG 1P0FA 5H82A 1B8PA 2C29D 1T2EA 3P7MA 4GLOA 5B4VA 3K31A 3K96A 2X0RA 3C8MA 3Q1LA 4DA9A 3HDHA 3DL2A 4ESOA 4KOAA 3NX4A 3B6ZA 4HV4A 2E49A 4FDAA 4WGGA 4DYVA 3ZU3A 5HWSA 2I3GA 4WJZA 1U4SA 2DM6A 1VC2A 1WMBA 4L76A 4U0JA 3NT4A 3ZW9A 2NSDA 3T4XA 1EVJA 3H65A 4IQ0A 1AXEA 1KIFA 5FEUA 1LDGA 4M55A 3QLJA 1KY4A 1B0AA 2V31A 4EW6A 2Z1MA 4MVJI 1PGQA 1QYWA 3PYLA 4XWYA 3RQSA 4R3WA 4BIIA 5F1KA 3OHSX 4WECA 4E5KA 1WWKA 1O9BA 5L45A 1B26A 3E8XA 4N5MA 5AXDA 1ZCJA 4E2ZA 3VPXA 3TN7A 1ML3A 4B3HA 5K9ZA 2OXIA 4II3A 4MP8A 2ZK7A 4NU5A 5DF1A 3WLFA 2DQ4A 4UVEA 3ENKA 5GY7A 5CPBA 5EJ2A 4WNIA 3OMLA 4P38A 4NBUA 3RUIA 4FFNA 1PU2A 4KUHA 4AJIA 2G82A 1Q7CA 1GCOA 1PS9A 2GGSA 2JD1A 4OKNA 4YJFA 4CMCA 3E82A 1YB4A 1BXZA 1QORA 3PHLA 4PCVA 1Z7EA 4CUJA 1KVTA 4KUGA 1GYQA 3WXBA 4EJMA 4I9NA 2OBYA 2CZCA 2JAHA 2NWQA 4BNKA 3NDRA 1BHSA 3RC7A 1DBVO 1LSJA 3DOJA 3UUWA 7ADHA 3G1UA 3GPIA 2NM0A 4QEDA 3HE3A 3UHAA 1A27A 4YBZA 3CKYA 4OL9A 4Q3AA 5TRTA 2Q2QA 5KOIA 2I76A 3SLGA 3JCZA 1WP4A 1PR3A 3U09A 4IY1A 3BYZA 5DBIA 4ITUA 3STHA 1H0KA 2RH4A 3I9LA 3BXXA 4JIGA 1P1IA 4YEDA 2LZJA 3EVTA 1TVEA 2X9VA 3HJAA 1ZEJA 1ZH8A 1LQUA 3RBZA 4FOOA 3VHRA 1X1TA 3CZMA 1W8DA 4MP6A 3H3JA 3AW9A 2HK8A 2AQ8A 1U1IA 4WKGA 2WDZA 2C0CA 1IB6A 3VVCA 2CMDA 3JQGA 1O89A 1PGOA 4ALJA 5BSHA 4S3MA 4JX8A 3MJEA 2QRLA 2ZTLA 3N58A 4B8WA 3TL2A 3GRPA 3E48A 5DP1A 2HKIA 1I2BA 4HY3A 1DPGA 5C7LO 3EZLA 1Y5MA 1ISMA 1LJ8A 3BMQB 1BRMA 4KWIA 4NMHA 3V1TC 2IZ0A 3LVFO 3GT0A 4D3SA 5JCJA 1IZ0A 2ZJ1A 3NUGA 4OOEA 4XB1A 4XYMA 5DOZA 2BRUA 3WFJA 1ISHA 3OBBA 4IDDA 4TRNA 5AOVA 3MJSA 5JAQA 4D79A 3SJ7A 1XA0A 2FPIA 3NDJA 4DQVA 1WZEA 2C7VA 2Y1OA 4TRJA 1JKIA 2YJZA 4LRTB 3CINA 3FF4A 5JAIA 3K8ZA 4L4SA 1JN0A 1UDAA 2BELA 1BXGA 3EDMA 2NVBA 3H3FA 2HK7A 1E3WA 3IP3A 4BGEA 2O4CA 5A1TA 1UJMA 2Y93A 4CM4B 1P3DA 2BH9A 4J49A 3BZUA 2E48A 1YGYA 4PLWA 3GN1A 2GD1O 1X13A 1M75A 1E5QA 3RUAA 4UVIA 1E6UA 5GZ6A 4FFRA 2O3RA 4KDEA 1QSGA 2HMSA 2HAEA 2QG4A 4J91A 5EL0A 1E1MA 3WIDA 2SCUA 1Y8RB 2YHIA 4EUHA 3VPHA 2AQKA 3WYBA 1HSZA 3HB4X 3BHIA 1DIRA 2CFCA 2XF8A 3EGOA 3WGIA 1E7QA 3CH6A 4XB2A 1R12A 1DAOA 4CM8B 4CLOB 1ULUA 1A7AA 1LC0A 1ORRA 4LVUA 1B3BA 4MPDA 4QECA 1HZJA 3GQVA 1ADGA 4PRKA 4G2NA 4MIEA 1I3MA 2PK3A 1YO6A 4ZGWA 3M1AA 3DZHA 5KVQA 4XJTA 1NXQA 4LRSB 1GR0A 2Y1EA 3PRJA 3DC2A 1UZLA 4BKRA 3WLEA 1E3EA 2LDBA 1YKFA 3TF5A 5KIAA 4KUEA 2C5AA 1LA2A 2JCYA 3DHNA 3UFXA 4YAGA 4YQZA 3H9JA 1U3WA 3RJ9A 3E9MA 1HRDA 1RM4A 3LF2A 4PLTA 2CNBA 4NDNE 4HFNA 2YV1A 3W1VA 1JWBB 4XDYA 4DQXA 5L53A 4KWHA 1ISFA 4W9NC 5A9SA 3ZW8A 1RJWA 1EVYA 5KKCA 2OP1A 3GEMA 3DHEA 3SC4A 1DIBA 3DXFA 3QWBA 4H7PA 2XXBA 2BFAA 3HB5X 3ZH2A 1BVUA 2DBRA 1OOEA 1PR9A 3JQGB 4JBHA 1VKOA 2Y0DA 4IPTA 4XGIA 5IDWA 1ZMOA 4ZU3A 1Q0HA 2X4GA 4PLYA 1XDWA 3FPLA 4XIYA 1M67A 5JDCC 4RJTA 1F8FA 2UVDA 1XR3A 5CEFA 5TSDA 2J8ZA 5L51A 2E4AA 3JD3A 4NBTA 2QRKA 4ND1A 4R16A 2GDZA 4J1SA 5G4KB 2EEZA 2IE0A 4RPJA 5COQA 1H2BA 1Y5RA 4QTZA 4NIMA 4DLLA 5L4NA 2H9IA 5TS3A 3WSWA 1GADO 4NQZA 3GG2A 5T6BA 2V7PA 3ZU4A 1PJ3A 4UUNA 2PWZA 3F4BA 1C1DA 3KSDO 1VSUA 3CXRA 4RPGA 4DYDA 2FRDA 1VM6A 4BO5A 4JK3A 3IKTA 4FD3A 4WLOA 3RKUA 1DEHA 1LXCA 1IZ9A 3GH3A 2JL1A 4HWKA 3GAZA 5U4QA 3BTOA 5A9SB 1LRKA 3JQ9C 3JQEA 3K73O 4OXKA 4RVSA 3OQ6A 4CM5A 3TOZA 3BAZA 3BMOA 2OMEA 3LLSA 5IZCC 1CIVA 4WNCA 4FJ0A 2A94A 1I24A 5HBRA 4NBRA 2AEFA 4I1IA 1DIGA 4YJGA 2X23A 2I5PO 3WWYA 3PQEA 1NVGA 3GG9A 4BKUA 5B12A 1HDXA 1JQBA 2CF6A 5LDGA 3QVSA 3TZHA 3DBHA 4IDAA 3GNTA 3IQDB 3QVOA 1ZK2A 1JWAB 1ADBA 5DBGA 2F1KA 3TJRA 1A4UA 3HDYA 4NJMB 5TC4A 3QQPA 4E31A 3KOUA 2IZ1A 4NBWA 1YWGO 2JCXA 3ZWNA 1P77A 2QZZA 4OYRA 4E5PA 2HMUA 1O5IA 4DXHA 2GPTA 4NG5A 1SEVA 3BMNA 3LC1O 6ADHA 3FWZA 4QFDA 3SX2A 5G2OA 1SNYA 4CUKA 3ZHXA 2EF1A 1NHWA 3VZSA 2B35A 2OOSA 4FSHA 4NK4A 4BO9A 4KTTE 4LVCA 4BNYA 1PQUA 3RUEA 1TT5B 3ZDFA 4CV3A 2OGUA 2O3UA 3PGJA 1LX6A 3NJ8A 4HP8A 2I6TA 4GX1A 4RLHA 4OXYA 4R1TA 4WLUA 4W7IA 1DC4A 4AJ2A 4CV1A 1T1RA 2DVMA 4GWKA 3D3EA 1U5CA 4Q39A 4E12A 4KMSA 3WTBA 1QV7A 3DB2A 3BHMA 2NLOA 5L7YA 2EKPA 5TT0A 2EP7A 1VRWA 2YQ4A 1F12A 1GEEA 3ON5A 1ENYA 1G0NA 1UXHA 2GASA 2PLAA 3PXXA 3QSGA 5IZCA 1IHXA 1GEGA 2OL4A 1DRWA 4XJSA 4CUZA 1WZIA 4A5OA 3PQDA 4U7WA 4Z9XA 3CUKA 2WYVA 4Y6PA 3AY3A 4A27A 3ZNQA 3MCVA 3O03A 4CM7A 4KTVE 4G5HA 4CLRA 2BF7A 3D5TA 3FCOA 5MDHA 4AJKA 2D3TA 1DRVA 2Q50A 4IMPA 1GAEO 1K89A 3AU9A 3AI1A 3VZPA 1Y8QA 2J3HA 3IUSA 2JFFA 3UAGA 1OC4A 3HN2A 4IJUA 3INGA 3VTZA 1K6JA 2NTVA 4IIUA 1EK5A 2EJWA 2YW9A 3JQBA 1D4FA 1YS4A 4HFMA 1YDEA 5JMPA 3HHPA 3LYLA 1N5DA 2HSDA 1U2DA 5COBA 3OJ0A 3JQCA 4F6LA 4WOKA 1PL8A 5KWEA 4EGFA 5G0SA 4CMIB 2FP4A 3VTFA 3OJEA 2DBZA 3BHJA 3E03A 3VAZA 4WASA 1C1DB 3U4HA 1EBFA 2GRAA 3I9JA 3M1LA 1C0KA 3JQBC 5C3MA 4ND2A 4MJLA 5COAA 3HADA 1U7HA 3MZ0A 2PZKA 2EP5A 3ZWOA 1A72A 3NT2A 4DMLA 2O3QA 2WM3A 4PZEA 1T25A 1MLDA 3KO8A 5DT9A 1Z45A 3IJRA 2FY8A 1O94A 4D0RA 2AQHA 1RYEA 1DJNA 5JSFA 4XA8A 4BNJA 2FR0A 4CR7A 3H8VA 4PZDA 4ND3A 1J0XO 1R4NA 2JCVA 4FJ2A 4BO1A 5G4LA 4FCCA 2WSBA 1B16A 1T24A 1ZMTA 2JJYA 5EQFA 4G65A 1D3AA 1DXYA 3I9MA 3OH8A 3EY4A 4MVJH 4OH1A 2Q2VA 1JTVA 1S6YA 2OO5A 2A4KA 5KJCA 3WGGA 5GZ1A 4GQAA 2Y0EA 1DC3A 1J6UA 4QUKA 1UP7A 2D5AA 3UW3A 4PG8A 1IPFA 4WOJA 3OQBA 2P91A 4E3ZA 3DHYA 1A9YA 4J4BA 4D0SA 2VYND 4BNFA 1GZ6A 1ZW1A 2PGDA 5GMOA 2ZYAA 5C7OO 4PG4A 1HLPA 4I5EA 5JNLA 3S55A 4JN6B 3WGYA 2I66A 2NACA 3A1NA 3S1LA 5I8WA 3WDSA 1JKFA 4CM3A 1P74A 3TNLA 1N92A 4PFJA 2NU6A 1X0XA 3NKLA 1SOVA 3ZHYA 5JDIC 1PL6A 4ILKA 3WICA 1CWUA 4M1QA 3GMSA 3KSZO 1HLDA 1KEPA 3MTGA 4D43A 3U5TA 3C7CB 3PHGA 1F0YA 4YB8A 1TI7A 1MGOA 3WGQA 3GVIA 4DLBA 2JD0A 5JW6A 3QRWA 1ZXLA 3L6EA 1I3KA 2OFPA 3F5SA 3GVPA 8ADHA 3JTMA 3TZ6A 1FDWA 2QW8A 3PHHA 4Z0HO 2DBQA 2PZMA 3H9GA 1LSOA 5F3RA 3DAFA 1R0SA 1DIAA 5THQA 2HUNA 4O1MA 4WEQA 1YJQA 3Q3CA 3TFOA 1OFGA 4OIMA 2PY6A 4IXWA 3BA1A 1SEPA 5ES3A 3QWHA 2OP0A 2EJVA 3AFMA 1IPEA 3KSUA 1V0JA 1H2HA 5A9TA 2ZYDA 3DR3A 1UAYA 4B4OA 3OQ1A 3L9WA 3W8FA 4R9RA 4CMJA 2J5KA 3HDJA 3JD4A 4CMIA 2PD3A 1O95A 3ONDA 3I9OA 3U3XA 4E2YA 2BFOA 2X0JA 3MOIA 3LLVA 5B37A 4RV9A 3RASA 3ZWAA 2JHFA 3OJOA 5ER9A 2C07A 2Q46A 2AQIA 2JFHA 1KC1A 3U4IA 4DQUA 3WYCA 5JPIA 5JC8A 4CPDA 2GR9A 2RHCA 1A71A 4E21A 4JLWA 3GNSA 3H7AA 4TZKA 5C37A 2FR1A 3P2YA 5LDHA 4C4OA 3PZRA 2YDYA 1DFHA 3Q9NA 4L9RA 5FF9A 4Z3DA 3LT0A 4E33A 4EEZA 4BKOA 1BWSA 2VNAA 3U62A 4CQMD 2UDPA 1QYVA 1IOLA 4D3FA 1E3IA 3BMNB 2AG5A 2FZEA 1BVRA 4K28A 3QIVA 3HG7A 5JMWA 1P1FA 2OORA 2R00C 3WX0A 5EMHA 1UXKA 5EN4A 2BGMA 3OIGA 3ANNA 5TIIA 4OSPA 4W7HA 3Q0EA 2HJSA 4YDRA 4DPKA 4FC6A 2J5QA 1C0PA 2FMUA 1XKQA 4XGKA 3DBRB 1LSSA 4JJFA 3FNEA 2EWMA 2QYSA 1ZJYA 3AM5A 3RC2A 1E92A 4WUVA 4DREA 3K2BA 4CODB 4TQGA 4LGVA 2EW8A 2Y1CA 3FN4A 1QYDA 1XELA 4BUCA 3RUDA 3KETA 2YYYA 3ZV5A 1KBZA 3DZBA 3ZU5A 3WBBA 3Q2KA 1DJQA 5K0ZA 5KCZA 3JV7A 5BSGA 2AXQA 4PG7A 1NAHA 3AUUA 3ICCA 3L07A 5IDYA 3L4BA 1QRRA 4TROA 4U6QA 4CLXA 3G0OA 1KEVA 1MFPA 3OIDA 3TDKA 3UXYA 2QZ9A 3S2GA 1C0IA 1KERA 1ZNQO 3O8QB 4J0FA 1IYZA 2A35A 4FIZA 3QVTA 4HX5A 1ULSA 4A03A 4W9NA 5AXCA 1AGNA 2XOXA 2H5LA 5B4UA 2VHXA 4EBFA 1BSVA 1JU9A 4HUJA 1GQ2A 1GL3A 5L4SA 4WCFA 3PEFA 1DOHA 4YRBA 1MG5A 1I10A 1LI4A 4MKRA 4X54A 3RFTA 4NFHA 4CMEA 3JQ7A 3D7LA 4GPD1 3ZHBA 1E7MA 4NU6A 3PPIA 4WE3A 1VI2A 4WLFA 1EE9A 3QVWA 1MFZA 5CHEA 1A4IA 4HFJA 1IL0A 1YQGA 4IMRA 5CPFA 1EVIA 4BNWA 5TT1A 5LCXA 1MX3A 2NVUA 2C2XA 2ZTUA 3F47A 3TPCA 3CE6A 2HO5A 3WQQA 3BTUA 2Q1TA 5KNLA 1PSDA 3F3SA 3GPDG 1EQ2A 4P8RA 4MVJF 4LCJA 4J9VA 3A4VA 3WQSB 4PVCA 1DAPA 4ND4A 3QWFA 4O6VA 2BD0A 1BW9A 1LEHA 1DRUA 1E1NA 1M6HA 3NT5A 4FJ1A 5A03A 5JC1A 3PDJA 1YJ8A 4PLZA 3RCBA 4HADA 2I9PA 3I4FA 3ST7A 3ZV4A 4IUYA 3JQAA 1AXGA 4J7XA 1KVSA 2YUTA 3L4BC 4D42A 1GUYA 2AA3A 3H5AA 2R6JA 4BKQA 4E30A 3PTZA 4W99A 1VL8A 3ROMA 4AJHA 4B8ZA 4C7KA 1RM0A 3E1KA 1KVUA 1TA4A 3PIIA 4IDEA 2NTJA 3FBGA 4A0SA 4ALMA 4D46A 3VPGA 1PWZA 1V3TA 3GVXA 4IIVA 3DBLA 4Z0PA 4BO6A 1MUUA 4FN4A 3LC7O 4NNJA 2HLPA 1NTOA 3B1KA 4RF3A 1FMCA 3HN7A 3F4LA 3WJ7A 4B3IA 4CMEC 1R37A 1RM5A 1FDTA 4QXMA 1YBAA 4XQCA 3PLNA 1U3TA 3EZYA 1QMGA 2TMDA 4R1SA 1NNUA 1KYQA 4NFYA 4PLPA
chains in the Genus database with same CATH superfamily
3ADPA 3SP1A 1P1KA 3AF2A 1O97D 3TGWA 2O3SA 1EK6A 2HIGA 4ITVA 1BU8A 4TZTA 4QGSA 4QOJA 4BJ3A 4IICA 2BUCA 1L6IA 1K68A 3FZQA 4UUOA 1K7CA 3OD1A 1R4MA 1N2SA 2B25A 2QVXX 3WZLA 1B6GA 2AUMA 4KPFC 3NTRA 3A4IA 3T51B 3IQGX 1X1SA 3CONA 1CVLA 4QNNA 4BQOA 4M9RA 5FTWA 3FFXA 3N8DA 4D44A 2AMVA 2X15A 2PX0A 4X7CA 3T7TA 1YJBA 2EG5A 2PR7A 5CMLA 3SQOA 3EDCA 1K63A 5L6MB 1EQAA 1AN9A 1CUJA 1TE2A 4YUXA 5BMVA 1ISPA 3FYDA 1VLMA 4N4AA 3SE7A 2ZRQA 4KGDA 4PO9A 3WYEA 2C97A 3C98A 4J3JA 4L4RA 4HLUC 5BN3A 1T3GA 1RE0A 1NQ5A 4I5GA 1FLDA 2BTQB 1CEXA 5IUNC 5CXXA 2QAJA 1C0LA 3TLYA 3WZ2A 3DB1A 5IRCD 2UXDB 5IAJA 5FYQA 5CDFA 3QX3A 3FVQA 4ZEXA 1I2MA 2Y71A 3FGNA 2CWWA 3PKJA 4G1BA 2JEYA 4YFVA 3TI9A 3ZVRA 2EKLA 3T6KA 3TSCA 4FC7A 4ECAA 2R2AA 1LX7A 4Q9KA 3RAJA 4RVNA 1THTA 1JEYB 2PGAA 2AI2A 3NBZC 1TM1E 2PHZA 5LP6B 1X1EA 2ZFUA 4CMBA 1PV1A 1EDDA 3JRWA 2CVPA 3W5AA 1NR7A 1XGKA 3QWIA 1FFXB 3V2UA 1JHAA 3IEUA 3OJWA 1T8SA 2EFYA 3OEEA 3QUTA 2JAWA 2QLNA 2WNHA 5CBKA 1H4VB 4R6WA 4LJYA 4C89A 5JDCA 3EDQA 5FEMA 5AM3A 4FT4A 4GZ3A 3WMGA 1QOZA 3OZXA 5BMVB 1ONOA 4ND8A 3RSOA 3SBEA 2UYCA 5I7WA 2ADFA 3L1UA 1Z82A 3QBTA 4WLEA 3UJ8A 4UVDA 1VG1A 1PX2A 2VHWA 3FRIA 5IASA 3HUDA 3VR2A 1UD4A 3IRVA 3F7NA 4FI3C 3S6JA 2GBIA 2Z5FA 1VCNA 1E1RD 1DS6A 3A14A 2GN1A 3NFRA 4P7JA 1IZ7A 2F9LA 2DBVO 1QO0D 4X00A 3SHTA 5EUMA 3SC2B 5HTOA 2YWFA 1KI1A 2GEUA 3A0UA 2TS1A 4I4NA 4JUAA 4KVGA 4RY0A 1G21E 4ER7A 1U9CA 2W6CX 2ZSDA 2PCLA 3AUAA 2J67A 4MWTA 1EAMA 2Q3DA 4X85A 2ZYSA 2Y1FA 2HBRA 3A4LA 3LQKA 4KXVA 1ZD8A 4ZO8A 4EGAA 1Q0SA 4DZZA 2ZM5A 3I37X 1NSTA 3UJHA 4IZIA 1DFIA 4ZYUA 1EDOA 2ZSKA 3OAAD 4FR2A 1N07A 2AZTA 3ROQA 1XZLA 1FNSA 1XZPA 4IYJA 1XAGA 3ADKA 3KXIA 4Y0NA 2WNSA 3K4PA 1XD2B 3IILA 3OLVA 3BIJA 1VQOB 2QDKA 3V8PA 3R7DA 2CUZA 4X1YB 4KITB 3C7DB 2VWHA 2NTNA 5C5DA 2VHVA 4YR7A 5KX5B 4JJIA 1U2SA 3OLQA 1BYUA 4NZNA 4C03A 4H7IA 4BS9A 3GDOA 2GO7A 3BGWA 4LBZA 3BIFA 5H02A 4MI3A 4RL6A 2HF7A 3MJCA 4R2JA 4EB6B 4Z1MD 2EHDA 2OKGA 5DTEA 3VU3A 4QG3A 1IOWA 3A31A 3KXKA 2ORED 1RC0A 1AV7A 3RUHA 3E8MA 1NP3A 2WUEA 2PPLA 3TCKA 4FGLA 3FWNA 2VR1A 4HEA6 4ZGQB 1ZIXA 5B3JC 5BWOA 3C24A 2AW5A 3DZGA 3REQA 4W6ZA 1UEXC 3JQ8B 3PVCA 1H1LA 2EKDA 4B35A 2OAQ1 2P35A 4E70A 1U0TA 2I6GA 5JIBA 2X3YA 3UNXA 3Q7TA 4Z7OB 3TIXB 1XAJA 1WU8A 1MW9X 1Z6TA 3OFVA 2QT9A 4MVWA 3M6MD 4PQEA 4Y6OA 1AHIA 3ITNA 3V8VA 3T06B 2BMWA 4URXR 3A1VA 3MA0A 3RODA 4BUZA 2B1JA 2VP9A 4UE2A 5F77A 5G3ZA 4J0IA 2RHHA 4HNVA 1G7TA 3KTAB 1XB2A 4B84A 1OTXA 2CBXA 1QQ6A 3B3GA 2ONJA 4HH3C 4IBOA 4BWVA 1CUFA 1L1QA 2AC7A 3CIFA 3ZE0B 2J46A 1EK2A 1U7TA 1U2ZA 1ORIA 3G0DA 4Q9IA 5LDDC 3W4JA 4QJIA 3ZJVA 3DLCA 5EWLB 1EK0A 4XKVA 1GUZA 3G8CA 4ZC8A 1K06A 3EG9B 3HQ4O 2DFTA 1DARA 4WT7A 4RA6B 1ZA1A 1JL3A 4PGFA 4DA0A 2PIAA 1T91A 1YOBA 3N2YA 1OI3A 5FI1B 1ZGZA 3ZY2A 3SJZA 1D0VA 1RBQA 3RHSA 4RPDA 3W5DA 5GZ3A 3HM2A 2B8TA 1DJOA 1LTKA 3MGGA 2WWXA 2Y2VA 4XZ3A 3QHQA 1NX6A 1I9CA 3VV2A 4LE1A 2VRCA 2XSZA 2FCRA 3DDOA 5GJWC 2GESA 2W6ID 5HIAA 3E9YA 3U17A 4HAOA 4WCFB 4JP8A 5JJIA 4QU0A 4J0HA 4TMTA 2PXAA 1Z0AA 2I67A 3BJRA 4QYIA 4BNVA 1HG1A 4JA2A 4MW6A 1E7WA 3DBHB 5F1OA 1TUIA 3PICA 3FI9A 3HP7A 2Q3FA 1TMYA 3QZUA 3LT2A 2ATXA 4BFWA 2NU9A 5HZHA 1JHDA 1VCIA 2ODBA 1XRMA 4Q3NA 3DNFA 1E3QA 3H6HA 3KOWA 1M72A 4I2VA 1P17A 3GFRA 3PVDA 4D82A 5LD2B 1MT3A 3KZNA 4REOA 3UMMA 4K2AA 4CI0B 5FAKA 2XAUA 2PT5A 4DCJA 5IXYA 1NIPA 3K9FC 4HDRA 3DTTA 1LLFA 1KFBB 3UKDA 1PVOA 1H2YA 3R5FA 3ZOZA 4MVJM 3PJFA 3BE8A 4AX8A 1JB9A 1KYIA 1Y98A 4ENVA 2BFPA 5BN4B 4M8KA 5IU6A 1EFPB 1HQCA 3D7SA 4KO2S 3IT2A 2W6NA 1G3MA 3HJCA 2VZLA 4BMCA 2QUZA 2WIJA 1F3OA 3H18A 3THXB 3EVFA 4G0VA 4YXWD 4OQXA 3ZPXA 2YJTD 5D86A 1HTWA 3SKYA 3QKRA 2VK2A 1I2ZA 1PUXA 1SGWA 3GMDA 3O4GA 4CQMA 2C5EA 2PBRA 1FFSA 1T3SA 4XLZA 2WHPB 3DD1A 2IZOA 3RTGA 1LBEA 1NG1A 1XTIA 1J99A 2C83A 2HA6A 4BP1A 1B14A 1M2JA 4MGIR 3GCZA 5DTMA 3EYWA 2YN0A 1E2FA 3R7AA 4JI3B 9LDTA 5IAAA 1T15A 5BOSB 1M73E 4R7TA 2X86A 2VG8A 4RBNA 3WHPA 5AVQA 1GCGA 1LNQA 2F17A 3DS8A 2GF0A 4I99A 4YAEA 2C0PA 5ICSA 4KO8A 2FWBA 2AJLI 2WQZA 3RHFA 1E1RA 1VSBA 2ISQA 2VYVA 2R79A 2FW7A 1YVRA 1V45E 2G17A 3GWGA 1I5RA 4JYPA 5DBHX 3PNPA 1A2KC 1HQDA 1I8TA 1PZFA 2AR0A 2PMCA 4E5MA 5BNWA 4RM3A 1RHJA 1SA0A 2LNDA 4INAA 4NJOA 4GMGA 1X7ZA 4FE7A 2R6FA 3OZRA 2E37A 1X14A 2A9JA 4M37A 3GAAA 1KZGB 4MSUA 4TSKA 5DJ5A 3RTBA 2VHYA 3LX4A 3TTWA 4KWEA 1XEAA 2A8YA 2LR0A 2ZAGA 3RYIA 4XEHA 5A7HA 3RIYA 1C3OA 1T9KA 2JKVA 2ZJ6A 4KQWA 1OI4A 3KOMA 3QKRB 3VNQA 5EPOA 2PGOA 4NS4A 3NYWA 4CT0A 3VZQA 1N77A 1NSFA 1DXQA 4PBSA 2IBMA 1Y3IA 1M2VA 2RBEA 1T9HA 2BJWA 2BBOA 1YMVA 4P82A 1Y89A 3ZZMA 3MQFA 1L4NA 3OEYA 1NMSA 1M2WA 2ST1A 3HEMA 3O8OA 4EZIA 1H85A 5EP2A 5I9MA 5I8PA 1USVA 5THXA 1RSZA 1H2RS 2QN8A 3ICPA 3ANLA 2HSEA 1CRQA 4O4IA 1GSIA 3UGTA 2G71A 1OLSA 2HK9A 5ALQA 1F4VA 4GFDA 3DH0A 2R6GA 4TYYA 3I9FA 1G291 4KXUA 1P6QA 3KOOA 1ZC4A 4BFTA 2JZOA 4DYHA 2HHLA 1ODKA 5DW0A 5A6SA 1D9XA 3GUYA 2PZJA 2ILTA 1E64A 3P9CA 4AVYA 1WHSB 1IY1A 3FPBA 4V0MA 3ZNPA 3O1JC 4GMXA 3T7JA 2I78A 2CJYA 2ZRDA 3LF1A 1N36B 3KNZA 2BI7A 4MUIA 4LW8A 5KKAA 4BNZA 1JH9A 3LVBA 3EIFA 3FG9A 1XMIA 2FH5B 2HH9A 3EQZA 3GDGA 3O4VA 1UBUS 1NBAA 3S8MA 1M10A 1KYXA 4ND5A 1L7QA 4KFTA 1P2FA 3ECAA 3ESCA 4LK2A 4ZV7A 4CM6A 1QHNA 3R7LA 3MG9A 2BR4A 4IP0A 1W75A 2QTBA 3G88A 3GHYA 5L3ZA 1G5PA 4M1MA 1J24A 3NTQA 5DM60 5JS1A 1DB3A 4G0YA 3RV4A 2O2CA 5AOAA 3OQNA 2Y67A 2VC2B 3Q7PA 1GJRA 2AIRA 3SJCA 3RJTA 1C50A 3QJ5A 4W1SA 5LA6A 1SKAA 3KK0A 4HNHA 3A6HA 4FPXA 3LP5A 1F8GA 1T2UA 4HNAB 2BFMA 3CRZA 2QI9F 5FNVF 2EKZA 1L3BA 2PX8A 5HZMA 3DOOA 1CUIA 4AIRA 3LHDA 1MJFA 4S1OA 1EFVA 3PDUA 3Q5EA 4NMMA 5HIIA 3TQCA 4FHFA 2A9RA 2BFBB 2FGJA 2I7VA 4NSNA 2B0JA 3GGGA 4NDZA 3VO9A 4FM9A 3WWCA 4BRZA 1DBPA 3GJTA 4IIXA 2MYTA 2XB4A 5HKLA 3BRCA 1KC8D 2SKEA 2VYQA 1RJEA 4M2LA 3I83A 2QX9A 5HVNA 5CAEA 1N33B 3NXKA 1FPMA 1YB6A 3DZIA 5CJJA 5JG7A 5KZMB 4P80A 2W2XA 3C0KA 1OXUA 5IDQA 1F2TA 2XNHA 3NBAA 4XQEA 1ZZEA 3ZVLA 3CPEA 1UWVA 3P8ZA 2Q1SA 4U7FA 2V6BA 5IVDA 3PC7A 4CLEA 1T0BA 1QIEA 1X7DA 4EATA 5LIPA 2LKDA 2H1HA 4X92A 3WLSA 2CSXA 1E6KA 2TSYB 4REMA 4BY9E 3M6LA 1TDJA 4TVBA 5KNBA 2R0QC 1UD5A 5IHPA 1J42A 2HQSA 2XH8A 4W5NA 3SSNA 4B3MB 2VZ9A 3ASQA 4C1BA 1AM4D 4KXFB 2B83A 2HCTA 1EFKA 1PD1A 1R9NA 4MUAA 3UATA 3C7AA 5C52B 5DV9A 4B6RA 1N2CB 1XRLA 2BR3A 3F6PA 3AEYA 3P0EA 1GPDG 4IH9A 4I6EA 4MWZA 1U2GC 3MTIA 7GPBA 5K3CA 3S44A 1P0CA 2ODNA 5I7UA 4P92A 4R4JA 2JFOA 3FZYA 3DEIA 2GTIA 1NYRA 2W9XA 4UPEA 3OCCA 1U7WA 1Q3KA 1IXRC 3K5IA 3Q88A 4UHEA 1D2RA 1U7PA 3ENWA 3LFUA 3DZFA 3OKXA 3COVA 3NZEA 5H9WA 5LQKA 3P9QA 2F3RA 5CA0F 1Z8HA 4RC9A 1Z63A 5A0TA 1ENOA 1VGVA 2CFSA 2P68A 3NETA 5AW7A 4US0R 1L4MA 1KOJA 4HB4A 3ZHZA 5DLYA 4Z2AA 1SKQA 5B2EA 1GZ5A 2CXRA 2QMZA 4U2KA 4ZVUA 2KE5A 4WNAA 3WLIA 4Z9BA 2W2KA 1JHMA 3T1TA 4Z4EA 2DAPA 4TV9A 2VN8A 1ZMXA 4UFPA 3VHQA 5D6OA 1E2UA 4OBWA 1TVKB 3CU5A 4DC0A 3YASA 1XYYA 3D81A 1QIFA 4B4VA 1E96A 2Y1KA 2VLIA 4HC4A 4W1PA 2JFZA 4A23A 2VIIA 3AEQA 3EOAI 2WSIA 2VDUE 4DHWA 1L4GA 2CL7X 4Q4JA 2XE6A 5KYUB 2ZM6B 3SG0A 5IDXA 1EG2A 2ATIA 3RBVA 3LV8A 3OFKA 4AO7A 3V8BA 4CIXA 3PJRA 3VJKA 2NQTA 3FCCA 3GEEA 1C1XA 5BNTA 4I19A 3W5CA 2K4MA 2B4TO 5KTOA 2OGWA 2W58A 3P9RA 4AXXA 1DC5A 3T5AA 1CUAA 1DDOA 2OMKA 1VJRA 1HXHA 1EFRA 4Y0AA 3ZE2B 4E08A 3IOEA 3NIWA 4RE5A 1DNPA 1O94C 3DYIA 3OOJA 2ODWA 4M9UA 3UCEA 3ZE9A 4BYGA 4DABA 2GPYA 2I2FA 4EO7A 1RXWA 2IELA 2R60A 4CM9A 5KJEA 4XN0A 2XOKD 4PWYA 1YDWA 3TDNA 1QRAA 2RHWA 3QFTA 3FPGA 1GNRA 2F1IA 4FILA 4K3VA 4KYUA 4PG6A 1OC2A 1YB5A 4NWIA 4WWHA 4FE4A 3GJ0A 3AH8A 4X1IA 2FEOA 3UHJA 3SYLA 3ELWA 3R0IA 3F6YA 3JARA 3CN9A 5A1JA 3OO1A 2QMEA 2FP3A 1HFKA 4YWJA 4PV7A 4Z3KA 3IS3A 1PZMA 1U0BB 1CDOA 3NO4A 5CDSA 1HDEA 3RU7A 3C1OA 1D1SA 3NORA 4YJKA 3I2IA 1KYTA 1PVVA 4TV8A 2M1ZA 1LFDB 2YDXA 4IDCA 1SIBE 1PJAA 4BWGA 3OCUA 3FCYA 4GE3A 2K7FA 3JATB 4QO8A 3NEJA 3RS4A 3UFBA 2OHFA 3PXUA 5LZ9A 5CDGA 1I7DA 1Y33E 2BUAA 4EHNA 3C5EA 5J35A 4MR9B 3BB3A 1FXSA 1FYFA 1C4WA 3K32A 2WIBA 2F4VB 3AGQA 1BMFD 3G2MA 4RHEA 5L7TA 3IODA 3P4YA 4IGFA 4GP7A 2H17A 3MJTA 3PNVA 3GCDA 3OM8A 1CS0B 3P20A 4PX9A 3H6KA 3O31A 2ZIAA 3TFQA 4HVLA 3K4HA 1KGDA 1UZAA 3LC2O 1ZAYA 4A8JC 3AF0A 2WKQA 3CLRD 2V4UA 3O0TA 4PAWA 3P26A 1VLYA 3HR4A 4EGCB 1F2VA 4KN8A 2I1QA 4RSGA 5AWFC 2O2YA 3GJRA 3VUEA 4J0JA 2QTHA 2YZKA 1BA2A 3O8BA 4C14A 3K6KA 3LXRA 1JP7A 1JW9B 1MNQA 2Z3WA 1H5UA 4OGKA 4Q4AA 4S12A 2GHIA 3RF6A 5EJ8A 3OW7A 2VF4X 3KE9A 1ZW6A 2CUKA 3NYIA 5IYZA 2IH5A 1YZTA 2N0SA 1LVHA 1NPTO 4PZYA 3PQ6A 5CJPA 2ODQA 2OV4A 3E9DA 1NHGA 2Q9CA 1RZUA 1L7XA 1X1AA 2VBIA 3SZOA 4DSOA 3HHEA 4GBED 5CDFE 3ZHOA 1PZGA 4TL9A 4D9GA 5A5FA 3LVQE 2GBFA 1WXWA 5C1DA 1OR8A 4FFMA 1V35A 4TMWA 2PLRA 5CG2A 3NNSA 1XWFA 2OHXA 1Y1QA 3PBKA 4Z4GA 2OHGA 4NE7A 2OZPA 1NFRA 2BAGA 3QXJA 5H3LA 2JH8A 3IIJA 1MA3A 4RKYA 4YIHA 3W9YA 3W5HA 1RKXA 1L7OA 2C3PA 3CG4A 3TTXA 2J7PA 4LTDA 5CFZA 4UC0A 5IULC 3SYKA 1YCHA 4MEBA 2X5OA 4J7UA 1P39A 4GT1A 5CRIA 3UH1A 4DCTA 1WXQA 1N0VC 4RHFA 5H83A 4CMAA 2B4QA 2D5IA 2YZNA 2IU4A 4NZPA 4C4RA 2VBGA 4XLLA 2PT7A 1V2GA 4IIBA 1PTJC 1OH5A 4K3UA 4L3OA 4EGQA 1G5IA 2H2HA 2ZPUA 3PQ5A 3U7JA 1Q3HA 2C1ZA 1UBMS 4GF5A 2FGKA 4YUVA 2PMEA 2XB2A 1Y8RA 1VHQA 3R8FA 4NAVA 2INGX 5JBIA 3G8BA 1I0ZA 2F48A 5CP8A 1F17A 5ICFA 3DMYA 4P9NA 2COUA 2GKGA 2AJBA 1I6LA 5EMNA 1H4QA 1YA4A 3PEWA 3K70B 1ZK4A 3GXBA 2XBMA 4L4UA 4Y1GA 3G2NA 4WXEA 3LC0A 3C14C 1JEQA 1VQNB 1WHTA 5LZ2A 2P6NA 3SVLA 4B31A 1LQ2A 2JBWA 3EXHA 3OT1A 4XD7A 4L6AA 2IPMA 5KHAA 4N5LA 5AHXA 4HQNA 3Q3AA 1KDTA 3CY6A 4M1WA 4BOYA 3SC2A 4C4ZA 1FX0B 2FMIA 2MINB 3OZUA 2XCRB 4M49A 2PNJA 4FQ8A 1W4BA 4ZVVA 1K8ZB 3EBPA 1BC5A 5A2QA 1E9RA 4Z86A 4NXMB 3RVRA 4CR6A 1X7GA 1ZSYA 3DYVA 4HF7A 4MWGA 4OVKA 1Q1AA 1Y80A 4DA4A 2VRCD 3N0RA 1TCBA 4LF8B 2ZATA 2CNKA 1V4BA 3ILSA 5D6NA 1MAHA 1UK8A 2IYWA 3DG9A 1RLMA 3Q3EA 4DDWA 4MP3A 1SQFA 2NYRA 2GI4A 3H9EO 3PR1A 1CJCA 5F4BA 3EZXA 1NXVA 2ZR0A 3TLKA 3T1QA 2CVFA 1XJQA 2QTNA 1M2FA 4P3KA 4QX6A 1H65A 3BH7A 5FUWA 3BH6A 3V4SA 4ZCSA 1WETA 1VHJA 2YASA 3L0ZA 1W30A 2PX2A 1HE5A 2VNSA 5ECWA 1YC2A 3HTXA 4FS8A 4PLHA 1XMJA 4QUZA 2O8VA 2BN4A 2IUYA 3E9CA 4UQLA 4C5CA 3IAS6 1PK8A 4B4KA 1UBHS 1KL7A 3O91A 3D4OA 4JLMA 4NNPA 4BFVA 1E2LA 2H29A 4DANA 5ED4A 3AFNA 2BGNA 4IINA 4O4JF 3VH1A 4ESVA 1N2JA 1QVRA 2YR0A 4BAZA 1NUPA 1P7ZA 1R9GA 5ILOA 5G40A 1H5QA 1VQ6B 3OM1A 4KDFA 2G80A 1KSFX 4RD6A 3CEAA 3PUYA 3ADOA 3C39A 1WD5A 1RADA 5AKZA 5LM3A 2NV6A 4YGXB 2I87A 3LX8A 5HSGA 1ONSA 4QXAA 3RC9A 1O08A 5ANRB 3CWCA 4MKXA 3VZRA 2HDWA 4BMXA 4LZNA 3MS2A 4IDGA 1S1CA 2C78A 4QPDA 3T5DA 3W6PA 3W4KA 1ESDA 1IZYA 2DMRA 1W0JD 3HEBA 3ITDA 4BEWA 5DBFA 4C7XA 2YHAA 1THGA 1Z73A 3RS7A 1CIJA 2RD2A 4N0QA 4S1TA 3WLQA 3QE3A 1QKKA 1WP6A 2XDAA 5JALA 1J2TA 2A59A 2Z3ZA 4HYTA 5HA5A 3CPSA 3O9ZA 1BCSB 4I50A 4DLXA 1K9SA 2PL5A 1UH5A 3LBIA 3ZJUA 1OPXA 4UCWA 2D4AA 3ZWPA 1PRYA 3AF1A 2XOEA 4QSMA 4IJ6A 5B1DA 3T0GA 1HQYE 4E22A 3MMPA 1DG1G 3ECSA 2BKAA 1W0KA 4AYXA 1N2ZA 3HZOA 2GBPA 3TW4A 5HM8A 5CFMA 3Q0IA 4RD0A 1MDFA 2JJ1D 1GUFA 1D2AA 3T52A 1X7YB 1L4LA 1QTIA 3E6AA 1AKQA 3D4BA 3F9CA 4Z7QB 2QPTA 4DE5A 1AGYA 2F9FA 1O57A 4HPWA 3R3WA 3OWOA 2DFDA 2OK7A 1ZRMA 4TYMA 1E4VA 1N8TA 2B82A 3G2QA 1RKVA 4V03A 1NBMD 2XB6A 1NXXA 2GJPA 3UG6A 4L27A 2G9ZA 4OXXA 1J8QA 1EZ1A 4TTQA 1E1QD 4R5HA 1MCZA 3TG2A 3W05A 1M6VA 2OHJA 2C2ZA 4KSYA 1ZI8A 1WRBA 2JGJA 2VK4A 1LC3A 4JA0A 3RY8A 2GAFA 4MUEA 4KQXA 2OBLA 1XAIA 4HMPA 1COZA 5JO9A 2G7MC 1OBHA 4M7OA 2VHQA 4E2XA 4OPMA 1FX0A 2MINA 5TNXA 4ZANA 3SCZA 1LWOA 3KVOA 4GKKB 3R3HA 3FCXA 3OQMA 1HBJA 1XF9A 1W0CA 1W44A 3CCRB 2IP4A 1FK8A 1PO7A 3NPMA 3RK0A 3V7YA 1L5HB 2DPHA 4YCAA 2OCAA 4BV8A 1GN8A 2X2PA 1EWRA 2FPLA 4N8SA 4X1KB 3A9UA 3BPSA 5CH8A 1QXSA 1LSUA 5JI2E 4EHDA 1FFXA 4DQDA 4UAGA 1T5TA 3OE4A 5ILGA 2OZKA 3E9NA 3WWEA 3VKHA 4CG2A 5SZHB 2P7IA 2V5VA 3QJYA 5L3RA 1MV8A 2JDID 1CYDA 3V55A 2O8FB 1XALA 3M34A 1DBIA 3BMXA 2Q2OA 4EA9A 1XVLA 2Q3JA 3CWQA 3BDIA 3GFBA 3JVDA 1VMAA 3HYCA 1Y1TA 4GL4A 1BA3A 3CMAB 1LF0A 3KQYA 4QUDA 1H22A 4URYR 3TLBA 4EY7A 4ENQA 2DFNA 4MHTA 3H5IA 1RHRA 4BNGA 1QCZA 1IN4A 2IWRA 4YPOA 4CL2A 1U2QA 3VVLA 2CGEA 2FOLA 3WL5A 2DX7A 3HV0A 4YP1A 2HGSA 4ZRDA 1A7UA 1GPWB 5F1PA 3GQBA 3OTGA 1GPUA 2JS7A 2J3LA 2NV0A 4BMYA 1EZ4A 1P0MA 1N34B 1K88A 4BMNA 1XU7A 4AF6A 1MN6A 4R7GA 2OFWA 5BRJA 3B9PA 4L7VA 1KZ1A 1QHFA 4ZAVA 4ZOCA 4DMFA 1EXDA 1M2NA 4LZAA 4M0KA 2UUBB 1R7RA 4JOQA 1P1JA 1JLLA 3I6YA 3F3YA 3G9XA 4HGPA 4P4LA 1I18A 4BASA 2C7GA 2J1LA 4IJWA 5HPYB 5CLJA 3D7RA 3AETA 1CRZA 1FUKA 1OZHA 1AKYA 2QUKA 3DV0A 1LPBB 3B6JA 3GFSA 3IEKA 1FFCA 5EZYB 5HDBB 4ETMA 2IW3A 4YR9A 2JFQA 1U90A 2FZ4A 4G0ZA 4FYVA 3PPXA 3WFIA 4RCZA 4A6EA 5CW2A 4F4CA 2I6SA 4ZAXA 5ICGA 4OLBA 4TLAA 5E3JA 3IQIX 2R96A 4JKIA 4O0LA 1XQBA 1H93A 2HM7A 2XZTA 3I9KA 5E2BA 4AP5A 5C1PA 1KJ8A 1A8SA 3NRBA 2Z1NA 5A5GA 3DLIA 4E46A 3D26A 1UXJA 2AHOA 1ESEA 3OETA 3M9WA 4ND6A 2V7TA 2LUOA 1AO3A 4EHAA 2Y0PA 3U4CA 3FNBA 1ZKMA 4I5FA 2PUWA 1VIAA 4X8OA 1IZZA 1RFGE 4HMQA 3EFHA 2G1PA 5H4GA 3HKBB 2EL7A 4G5SA 2HDHA 1NM5C 1VMKA 2XUPA 2XA2A 4UVGA 4WXHA 4Q6BA 4BX9A 3BK1A 4RPKA 5DNDA 2YFQA 3FOBA 4V3CA 1H3FA 2ZITA 4XARA 3M4XA 5IANA 1BYIA 4P5DA 4K1XA 1VZ3A 3SSAA 3RS5A 4J75A 4RK0A 4DDUA 5HF5A 2QL9A 3SICE 2ETXA 4FX5A 4ZQIA 2Z0MA 4MGHA 3HUTA 4HPJB 2FF5A 4R40A 5A5EA 3CW2A 3AJDA 3QP9A 3PNOA 1QV6A 1Z2AA 4C20A 4ZAWA 2FDRA 2XTNA 3VTKA 1XQVA 2RSLA 2X1MA 3I1JA 3TJMA 1Z13A 2PUAA 1WCYA 3PL1A 4KPEC 1JDJA 1QH9A 1RBMA 1R4NB 1Q7EA 3QEBZ 1WUHS 4NYIR 1JALA 1G2QA 3G2HA 4FHEA 3WKBA 4CIVA 4W5RA 4ECEA 1NJSA 1R0XA 3EPKA 1KQ3A 1T2AA 3CH7A 3K1AB 3OEWA 2EIHA 4RGBA 1K6XA 3DDSA 1E61A 3JQFC 4JIMA 1Q7BA 4R1NA 4DCPA 3J80A 4TKLA 4ZZ3A 3U56A 1HC7A 4QULA 4IJ5A 2AI1A 3LW7A 5DHFA 3QUBA 2XHZA 3D8RA 4FQ7A 4IGKA 4Q16A 2AJ8A 4JFAA 1IATA 2KLHA 2GYYA 3T7KA 4EG5A 3DVRX 4KB5A 1PJ4A 4N3BA 2A1UB 3LFTA 4BO0A 4MAMA 1GY8A 3C2QA 4DCMA 4EHFA 5HNKA 1A9ZA 3FFBA 1RVV1 1YFKA 3C3EA 3UPDA 3WOHA 2ODTX 2J9XB 1NMYA 4DCCA 5F7ZA 2X7JA 3EF0A 4AJ4A 1X9IA 4YRCA 2H2WA 2BTOA 5FORA 2PRSA 2YHBA 2EP8A 1WB6A 4PTZA 1ISSA 3CLKA 5CJ2A 1L4YA 5B1HA 2Q5FA 2PLFA 5EFZA 2O7VA 1AGPA 1CNEA 2F3PA 4N3AA 5LPNA 2WFAA 3D3QA 4TT3D 4MH0R 5BURA 5HM6A 3SJPA 2QX7A 1G19A 4LOKA 1T9GR 1XZDA 5DBEX 2RARA 1J25A 5E6UB 2P3QA 2XB8A 2MYUA 3VR5D 4A36A 2VJLA 2QT1A 4Y30A 4GOOD 3AVOA 2V9CA 3F90A 4NH4A 4EMUA 2XNCA 4E7PA 1JGTA 1W2WB 1B7GO 1SG0A 1XEWX 4M0FA 3UGQA 3WNVA 4AJJA 2NW6A 2WU4A 5BW4A 1M2EA 2N47A 1M1UA 2OILA 3SDSA 1QB7A 2CVOA 2GTPA 3SVZA 5K45A 3THWB 5HZGA 1ULBA 4EG4A 2CVQA 4X7PA 3RRFA 4URFA 1JVSA 1UD6A 1HE4A 4L5CA 5BV8A 4K9LA 2H48A 4ATNA 1EAYA 3GMTA 3A3BA 2CYBA 3QY9A 3AJ8A 4S05A 2MSNA 2QWXA 5JROA 1OCEA 1VMIA 3AYXB 1HEUA 3HVIA 2BY4A 3W2EA 1LLDA 1TU4A 4LV8B 2Y0CA 4M9CA 1T2VA 2W6OA 4OPVA 3T3PB 4TZ6A 5ICMA 4DHEA 1NFFA 3MTJA 2O48X 1JBQA 3NCHA 4IQFA 3FYUB 4OHOA 3PC2A 4AJOA 5EJ5A 3H2IA 2XVMA 4JSRA 1IK6A 4RORA 3H9UA 4ND7A 4MK4A 4V0KA 4KR2A 1E1KA 4B48A 3EAGA 5LZ7A 4JI7B 4U5QA 3VQTA 2DQKA 2XAAA 4FNMA 3S40A 3ZLUA 2RGCA 4ZICA 5BSEA 1W9MA 3GLQA 4GOJA 4G67A 1C4OA 1L6RA 4JXKA 4PHFA 4QHTA 1PWXA 4ZAGA 3EYAA 1BMDA 1AO0A 3EPRA 4OMUA 4OP3A 3CUUA 3DJFA 1KXJA 1IHYA 5KNCA 5FUXA 2XWPA 3R0XA 3WK4A 4I8DA 3FLEA 1VL0A 1FVOA 3P4UA 3WY9A 3TTVA 1ECPA 5JSKA 2OBMA 2BRUC 3Q3GE 2ZZFA 3FDXA 4UEJA 3RKSA 2ZIZA 3SJBA 4WCVA 4TS1A 2IQIA 1N8RD 3F71A 3BCDA 3AR2A 1FVHA 5FWYB 1ZQ1A 5L4LA 1PJBA 2BGLA 3CURA 3TLEA 2XMPA 7ABPA 4NAUA 5K2OA 3L7YA 2HNKA 4IZOA 2W90A 3QMPA 1HTTA 2I1VB 3L46A 3K53A 2G67A 1P8JA 3G79A 4QPZA 4ZVRA 2YICA 4Q19A 3RIXA 4WK4B 2YY5A 2W98A 3L92A 5FR1A 2O5VA 4CBVA 1R8JA 2GHQA 1VRVA 1RQ7A 2QQGA 4JD5A 4JB0A 1SHTX 3PXGA 1EFVB 5ALZA 3U3ZA 2AOWA 1G38A 3C3YA 1TIKA 4IDNA 4J1TC 4RKEA 4CMGA 4HUQB 4OP1A 3GEDA 4ZT7A 1QRTA 1DTWA 2H1IA 4LZWA 1R0YA 2FN7A 3ICEA 2QORA 5JD3A 3L0OA 3MFYA 2R8ZA 1NL3A 4NRDA 3NP9A 5BQ5A 3QU7A 2VP4A 3HO6A 2O1EA 3IUBA 3L84A 4W5TA 4G7WA 1Y5NA 4ZQFA 2B7BA 2P90A 1PGPA 3H94A 5EZQA 4C06A 1SKUA 5JQGF 1HA3A 1H05A 1RIIA 2O23A 3L7AA 3HPRA 3TZQA 3A6JA 1KU6A 4BO4A 3QEMA 4TL7A 3COWA 3F5DA 4QJ3A 4L2IA 4OOSA 4HVAA 1QG4A 5AJTA 5DFAA 3ZGYA 2J4DA 3HJFA 5JY1A 1IOZA 1YB7A 3QVMA 3TOXA 5B7QA 4JVOA 1WW2A 1ZQ9A 1DAHA 1KI6A 2X5KO 2Y4OA 2YZ7A 3RAEC 2JLUA 3TLAA 1RAEA 4MA5A 4X91A 3GP3A 3SWWA 1OBVA 4C5BA 2QJTA 4ETIA 4L22A 3OPQA 3MQ2A 3IBYA 1SU7A 1FFHA 3AILA 4X64B 4AZSA 2GX6A 2H85A 2XZDA 1WCXA 1FXUA 4JI5B 3TLGA 2QTTA 3WNZA 1ZNYA 2AG8A 4GPTA 5DXJA 1ZMRA 1ECJA 3DVAB 4I08A 5U4XA 2E89A 4CLXA 1PJLA 2WF6A 2C4TA 4Y6RA 4O2BF 5T4EA 3ILYA 3T3IA 4WBXC 2VQSA 1BFUA 1BJTA 1S9DA 2EJUA 2VH5R 3ENNA 4XVQA 5AVKA 3FZNA 1UINA 1W47A 3VOSA 1PLKA 2QIOA 3OQHA 3VR4D 4DC9A 4OJTA 1KDYA 3FPAA 1DI0A 2I33A 2C5SA 3HFRA 2XA1A 3UJBA 2NAFA 5B7PA 2YOGA 3CVWA 2QP4A 3DBOB 3PNBA 4IGAA 4NFSA 4XIGS 1KH2A 3O8QA 2BHTA 4MYTA 4WPGA 3BK2A 4AZ0A 4AMYA 1ZITA 5AP9A 5HQTA 2XOKA 2CVZA 2XWQA 4FGSA 2EKQA 2L42A 4H7HA 4R69A 5HF9A 1UD2A 3AFIA 4I4LA 3IELA 4FZVA 3BWBA 3A1TA 1T1EA 3GPBA 4AN4A 3UF0A 3IOYA 4L3VA 4W9RA 1VB3A 3JZIA 1J23A 1WEHA 4QYXA 1JDTA 1QJCA 3AM3A 4BV9A 2CHQA 4XX0B 3SXPA 4R7ZA 3O38A 4UM8B 2HV9A 4E88A 2BEUB 3K0HA 2GKOA 1WSDA 2P1ZA 4F60A 2G5PA 2HQBA 4GI3A 1QIJA 1MNAA 3FR7A 3H1BA 3OQPA 3ORRA 2VBSA 1J8VA 2CXOA 1PJSA 3TOVA 4IOLA 2H54A 4ETNA 1Y8CA 1CHNA 1NYQA 2FPPA 4MLPA 5C46F 3LGSA 2O20A 4LYHA 5A9RA 5E6UA 2D8AA 3TKLA 5SZKB 1P6UA 1U0FA 1TB4A 2I99A 5EHGA 1H1LB 2AG1A 2ZRAA 3MUNA 5F7XA 2FUNB 4R9SA 4BGVA 3K8YA 3CNEA 4RK6A 3W3AD 4QGHA 1HRKA 4L9WA 5K8TA 3GHHA 1LK7A 3KALA 3Q5DA 3LXMA 3GN2A 2R1TA 1D4ZA 1E89A 2R1ZA 2VVTA 3DO6A 3IGFA 2Q4BA 3A4MA 1RXIA 4U6SA 4WZ6A 1JJAA 4BFCA 1UKAA 3QOXA 4B43A 4DA6A 1I30A 3IT0A 3ESAA 3PX2A 5CLFA 2P3OA 4UBMA 1WNTA 2EU8A 4DDMA 1CY8A 2V9ZA 1BDIA 3CT4A 3PQCA 1V7QA 2R66A 1HL3A 4UM7A 5DYGA 1F20A 2ZWMA 4HFRA 4O25A 1Y4AE 2A1TS 4GE0A 3HXLA 3AYZB 5IAOA 3B9QA 4ZOAA 2C3MA 2NMVA 3T56B 4LCEA 4RGYA 3TXXA 4OKIA 1ZVMA 3CH4B 4QXPA 5HFAA 1ZO8A 1Q0RA 3F74A 3IUQA 3TTTA 4GH5A 3W8EA 3ZTTA 5ADHA 2HHJA 3INRA 5FNVB 1XVTA 2AG6A 3AHEA 3DUFB 3IVRA 4WI1A 5FA5A 4ZEWA 3H4IA 1YQWA 1V7CA 3WO0A 4X93A 1NWHA 3LK6A 2IOFK 3WWPA 3K5HA 2BKUA 1IUPA 3I55B 2DBYA 1TUBB 3MJVA 4HTFA 2QTVA 5AKEA 5DLEA 4Y2UA 1G7RA 2HL6A 2SBTA 3BK7A 3IT1A 4LYJA 3IAHA 5ALXA 1YAJA 2GHTA 4DSUA 2EGGA 3LSYA 4J03A 4QICA 3SIPA 2F00A 3U3RA 4L5BA 3I5YA 3QKSA 6NULA 1SQ6A 3JAWA 1QFSA 1MENA 1Z6AA 2P4SA 3GUZA 1KJZA 4S2UA 2ZRNA 3ZWWA 1KDPA 2ZI6A 3DKKA 3RTEA 2QS9A 4TTSA 1NP7A 4YGYA 2CHFA 2R7NA 3B9RA 2Z6UA 1PZHA 3SKBA 5A3JA 1FMLA 3FNGA 2J6IA 2XYPA 3EC7A 5JXWA 5D87A 5EJ4A 1EP2B 1QLJA 4P4SB 2IDKA 1A5AB 1Z5WA 1FE8A 4PGMA 2IF2A 3ZNOA 3JR7A 3NOQA 3O1LA 4DTIA 3M6IA 1MO3A 5DNCA 4RD4A 3B3JA 2QQEA 2WF8A 4IVQA 1RYFA 3L8YA 4YO8A 2AEJA 2NU6B 4MR7A 4QAQA 3F3KA 4AROA 3FNHA 3IXLA 4KPUB 4PSCA 1Z25A 1B3RA 4X44A 1C1XB 4W7SA 2XUIA 4DL9A 3FXAA 2CHEA 1KC3A 4BQQA 5F4JA 4BVFA 4F4DA 2GO1A 1CEYA 5LJIA 4D7AA 2X2EA 1BROA 1N1GA 2JGDA 1P81A 1Y8QB 2WA2A 2ZIUB 3HWWA 4H16A 4MIYA 3H97A 4X0EA 5E4FA 3D3WB 4DDTA 4QBFA 1NT4A 3RHTA 3TQQA 3ZDCA 3W2HA 1TECE 4ARSA 1AV6A 1FDSA 2AE1A 5BRNA 3N6VA 1H8ED 2LBPA 1R66A 3IBTA 3EWNA 1DMRA 1O6ZA 2C2MA 4DM7A 3DWEX 4E5UA 1RBYA 5AFSA 5H59A 121PA 1SCNE 1IMOA 1YL6A 3L18A 1OYYA 2WUWE 3X1JA 4M8IA 4AJEA 1W49A 4WESA 2JIPA 3NHRA 4RJJA 4B17A 5KSPA 3ZC3A 4JJ6A 1LS1A 2CMFA 4UFNA 3DTVD 2XQKA 4RKRA 3TH5A 4E6PA 4BRWA 1T10A 3MT0A 5CIWA 4JGGA 5JI3E 4UU0A 3SBDA 2LKCA 2YY6A 1YI8A 4PPQA 4AT1A 1TTQB 2BHRA 1EKXA 3S7ZA 5BSMA 2CXNA 1Z5PA 1QC5A 4I9GA 4H1WA 3V48A 2XRZA 5HGJA 4D5GA 2CZGA 1N4DA 4YJ2B 1LD3A 1PZNA 3CUTA 5BVHA 3HVRA 4LHWA 4KSCA 1KYZA 5MGBA 4ME6A 3FROA 3K6JA 4O08A 3X44A 5A6VA 5AESA 1NF3A 3CR3C 1PP4A