4P22A

Crystal structure of n-terminal fragments of e1
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
381
structure length
370
Chain Sequence
IDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTPLEDQLRVGEFCHNRGIKLVVADTRGLFGQLFCDFGEEMILTDSPLSAMVSMVTKDNPGVVTCLDRHGFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLVASLAEPDFVKFSRPAQLHIGFQALHQFCAQHGRPPRPRNDEDAAELVALAQAVNARALPAVQQNNLDEDLIRKLAYVAAGDLAPINAFIGGLAAQEVMKACSGKFMPIMQWLYFDALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like modifier-activating enzyme 1
publication title Expression, purification, and crystal structure of N-terminal domains of human ubiquitin-activating enzyme (E1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 105
structure length 370
sequence length 381
chains with identical sequence B
ec nomenclature ec 6.2.1.45: E1 ubiquitin-activating enzyme.
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16190 E1_FCCH Ubiquitin-activating enzyme E1 FCCH domain
A PF16191 E1_4HB Ubiquitin-activating enzyme E1 four-helix bundle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.180 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4p22A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4p22A01
1C14A 2R6JA 3DMTC 4GH5A 2EEZA 4LSMA 4KTTE 2CMDA 5JC1A 3DTYA 1YONA 1CERA 4FFMA 4ZQGA 5TX7A 3AM5A 1DC6A 4J16A 4RO0A 4Y9DA 5HWSA 3JQBC 3JYOA 2V31A 1ORRA 2A9FA 4DQVA 4ND3A 1HDGO 1KVSA 3KSDO 4J3FA 1KERA 4QO8A 3NTOA 5C37A 3WX0A 1AXGA 5H82A 1Q0QA 4MKZA 5BNFA 3RC7A 1A27A 3ZNPA 4BKPA 1VSVA 4FC6A 4MPDA 4YWJA 1PS8A 2O4UX 2VHYA 1HSZA 1ULSA 5CPBA 3U0BA 3BYZA 4OSOA 2FY8A 3RKUA 4Q3AA 3U62A 2CVZA 3GT0A 2DFVA 5GY7A 1X7DA 1EUCA 2NU6A 1HSOA 2VUUA 4ZA2A 1UP6A 4R1TA 5G4KB 3E5RA 9LDBA 2W8ZA 4J4TA 4XR4A 4H7PA 1TT5A 1D4FA 1HDOA 5L51A 3DZGA 4YJDA 1N5DA 2HKIA 3PGJA 3ZV4A 4IBOA 4YJHB 5BT9A 4CLOB 1UP7A 4GX5A 4NFYA 4P4GA 2P5UA 5AXCA 4B8ZA 2EERA 1HKUA 5COBA 3GZNA 3F1KA 4D42A 4B7UA 5KTKA 4LN1A 1T2FA 4WEOA 1NQ5A 4CMCA 2X0RA 1F12A 3EAGA 2X8LA 2B69A 2GUGA 3B70A 1F17A 3JYNA 4E5NA 4FOSA 2I76A 5KJCA 3H5NA 3A9WA 3OQ1A 3ANLA 3MEQA 4GGOA 1JVBA 1IPFA 3GUYA 3VPGA 1BXGB 4RVSA 1EUDA 4PRKA 5F21A 4ESOA 1HYHA 1V3UA 1ZSYA 1QR6A 1C3VA 5G0TA 1XU7A 3L6DA 5CPFA 1B15A 2Y0CA 5AYVA 1I0ZA 3HSKA 3H8VA 4MIYA 1GQQA 1C0PA 1H6AA 2OGUA 5G2OA 2DFDA 4XYGA 1JA9A 3ZNQA 5I7EA 1TB4A 2C2YA 3E8XA 5CEEA 2NU8A 5THQA 4MDHA 2G5CA 1BVUA 4LRTB 3X2EA 2P9GA 2EP5A 3QSGA 5IZCA 1ADGA 5JDCC 1SAYA 1I3NA 1ONOA 3LC7O 4G2NA 4AJNA 1H6BA 1PJQA 1M6HA 4FSHA 4DLBA 3WGOA 3DMTA 4GSKA 4RF3A 4NU5A 2BHLA 4X54A 1NVTA 1LLQA 3ONEA 1WMAA 3HN2A 4DQUA 2HRZA 2Y1EA 5BNTA 1I8TA 1X7GA 5CG2A 3H65A 4J7CA 1P1FA 1JDJA 3TFQA 4Z6KA 3VPHA 3JQBA 4DYDA 3HHPA 2OORA 1QP8A 1A9ZA 1KEUA 3H5AA 5T6BA 2EV9A 4Z0TA 3WGYA 5ENVA 2D3TA 1KETA 1EZ4A 1A7KA 2O2YA 3EW7A 1GYPA 3LC1O 4PG6A 4I5DA 4D41A 1LQUA 1EFLA 5COAA 1R4NB 1EVIA 3LZ6A 3S8MA 4AJOA 3JSAA 3OMLA 4OYRA 4BGIA 5L7YA 3I23A 3VZSA 3N58A 3JD2A 4LCJA 1C1XB 1RJWA 2UUOA 5KJ6A 4Q9NA 1K6JA 2GDZA 4WLOA 3JQ8A 5BQFA 2UVDA 4JNKA 3UH1A 1FDVA 2B5WA 4PLFA 1E6UA 1I5RA 2EIHA 1RYDA 3L9XA 3WWZA 1E7WA 1I10A 5MDHA 5CFZA 1K0UA 1R6DA 4O1MA 4CR7A 3EC7A 2VWPA 4XYEA 5GMOA 3GPIA 1PSDA 2NQ8A 3ONDA 3T7CA 3F47A 5A04A 5JE8A 2GSDA 4F6LA 2GD1O 3A28A 3QW2A 2BFAA 3WDSA 3F5QA 1QSGA 4UUPA 4I08A 2XPCA 4DXHA 3WG9A 2NLOA 3I6IA 2P4QA 3VH2A 1YBAA 3I9JA 5HS6A 3UCXA 3S2FA 3ZU3A 4U6QA 2YHIA 2Z1NA 2IYOA 3U4HA 4EZBA 3C85A 3IP3A 4GGPA 1M76A 1HZJA 1PGNA 3NT4A 3JQAD 4O6VA 4TROA 1E77A 1E92A 5KCZA 4KUGA 3K92A 3UGKA 3DZBA 3ETGA 4UREA 4NQZA 5DULA 1NASA 4MOWA 2I3GA 4R54A 3IJPA 1P9LA 2E6UX 5T57A 5F5LA 5A02A 1ZSVA 4CQMB 5A5EA 4EDFA 1U8XX 4GI2A 4TVBA 4AJHA 5JDCA 5K0ZA 3LU1A 3S55A 3WXBA 5JAMA 3WNQA 4ZN6A 4WGGA 4WOJA 4DBVO 2BGKA 4A27A 1P33A 3I9OA 1E3JA 1GUFA 3CZRA 2OFPA 1GAEO 3DZIA 2NTJA 4Z9XA 2NWQA 3OJOA 1U3TA 4RL6A 1DRVA 4WCFC 3JD1A 1QYCA 4QT0A 4MVJM 4TMFA 1A72A 1LI4A 3RUAA 3HFGA 3ZN2A 2I5PO 1ZNQO 3ETDA 1ZUD1 6LDHA 4IDAA 2YV3A 3TOXA 1Y6JA 5EJ2A 2VWGA 3U5TA 3GF4A 2DPHA 4B79A 1Y81A 3D64A 3P5SA 4MVJH 1ZK4A 2PZJA 3SXPA 3IMFA 2IEBA 5I9LA 1H9AA 1TA4A 1ZK0A 4ZRNA 1F0YA 1YGYA 4R01A 2I65A 4PLHA 1N9GA 2A35A 4U5QA 1B7GO 3WWYA 4YTEA 1VLLA 2DTXA 3PZBA 4EI2A 1HDXA 2CVQA 1Y7TA 1VL8A 2LZJA 3PXXA 4L4XA 3NJ8A 2Q2VA 4YEDA 4Z0PA 5C3MA 3EGOA 4H15A 3GDOA 3KSZO 1KEWA 3GFGA 4GKBA 1OI7A 1WDKA 2YZ7A 3IAHA 4TRNA 1DRWA 1R37A 2E49A 4RV9A 1A4IA 3PRJA 4GL4A 5JS6A 4JBIA 2JFGA 3U4CA 1YB4A 2BRUA 2VOJA 3G79A 3VZQA 4L4RA 5GZ6A 3NEPX 3GNQA 3KLPX 3PJEA 4JQCA 4MVJA 4TWRA 4GLLA 4RLSA 2J5QA 5K6AC 3IL2A 4CM7A 4YB8A 3DBLB 3DAFA 5IFLA 1PR9A 1WLYA 2YW9A 3PFWO 5IAAA 2PGLA 3K6JA 4RDIA 4Y98A 4TRMA 2YJZA 2HAEA 3H9UA 3NRCA 4FGWA 1RPNA 2GZ2A 2DKNA 1Z6ZA 1EFKA 1YE3A 2BF7A 2F1KA 2O3SA 4L76A 5CG1A 3JQ7A 3ZV6A 3P7MA 1P77A 4Z9YA 1Z7BA 2PZMA 4FGSA 3DQPA 3QVWA 5A5FA 1IE3A 5KJFA 3B1KA 3IIEA 3L0DA 3PFFA 2V7PA 2WD7A 5DP2A 1R0SA 4CMJA 3SEFA 1ZK2A 1H0KA 4CPDA 2EW2A 4IY1A 1I2CA 3PHGA 3LT1A 1B8VA 1XGKA 1MG5A 4B4VA 3TDKA 4KDFA 1JWAB 2VYND 3BMCB 3E48A 3GHYA 3HDYA 3L6EA 3V2UA 1I3LA 4F6CA 3ZH2A 4J7UA 1UDAA 4CMIA 2I67A 4RQTA 1EVZA 1P1KA 3VOSA 5JY6A 4ND5A 2DT5A 1ENPA 3FBTA 4R3NA 2O3QA 2C54A 1Y8QA 3I52A 5TLSA 2ZB4A 4F3YA 4ID9A 3NKLA 3GLQA 3ASVA 3Q9UA 2IE0A 4WCFA 1ZH8A 2DTDA 1J5PA 3D1LA 4Y8VA 4BNJA 3I1JA 4IZIA 4E21A 2O23A 4GKVA 4FDAA 3VDRA 5BSEA 2DAPA 5KVSA 3PK0A 4DREA 4BO6A 3AWDA 4BNLA 1FJHA 4WOKA 1V3VA 4JJGA 1BTOA 3U3XA 2WE7A 3L4BC 2A92A 2WSBA 5T8KC 3RUHA 1YH3A 3TZ6A 5CDGA 4TVOA 3ANMA 2B4TO 4ALKA 1DHTA 4E5YA 1T2AA 1Y1PA 3E1KA 4ZVVA 3PQFA 4J0FA 3TOZA 3VKVA 1X0VA 3JTMA 3V8BA 1YL7A 2OBYA 1O95A 3CH6A 4FJ2A 4JK3A 1WZIA 4CMKA 1LLDA 3OJFA 1PEDA 3PPIA 1AUPA 1L1FA 4L4SA 2BH9A 2EHDA 2XOXA 4IXTA 3WSVA 4U7WA 3JCZA 4AICA 4PRLA 5JY1A 2FPPA 1DJNA 1UR5A 3INTA 4OQZA 4JCOA 1LTHR 1NTOA 4BKUA 1ZKMA 3F9IA 1MC4A 3GHHA 5IDWA 4IDDA 3OJ0A 4OGWA 1IB6A 4YVFA 4E31A 2EP7A 2JCVA 4IS2A 3ZU5A 3OJEA 4CM8A 5BSFA 5K6AA 5TF4A 1NFFA 1LSUA 4TSKA 2VT2A 4D44A 1CYDA 2EJVA 3WGTA 4YA6A 3OIGA 2XXJA 1F8GA 2ZTUA 4DLLA 2Y1CA 1LDYA 1U4OA 4OSPA 1HE5A 4CM5A 4R9RA 3RUIA 4GVXA 4JGBA 4YAGA 2PGJA 3UUWA 2HCTA 3Q9NA 2VZ0A 2RBEA 4E2XA 1XQ6A 3H9QA 4I9UA 3GZNB 5KJ1A 4J9VA 3QWAA 5JBIA 2D5CA 1RKXA 4LMPA 1DC5A 1YQDA 4RPLA 4URFA 4BB6A 1GCOA 1J49A 1U7HA 1PS9A 2GR9A 1L7EA 5FEUA 4C7KA 1OZAA 5H83A 3RI3A 4A73A 4IQ8A 4M8SA 3B6ZA 2WDZA 2B4RO 2CZCA 1UUFA 2ZCVA 3HDJA 4WLFA 1DBVO 4ZRMA 2ZKLA 2JCYA 4DIOA 4HWKA 4NI5A 2X7HA 3WGHA 4I5GA 1I24A 5G4LA 3NUGA 4OOFA 1CRWG 1A71A 3LK7A 4I5EA 3ROPA 3O4RA 2DC1A 1ZIDA 4YT4A 2X58A 1MFPA 5JSFA 1K3TA 4M89A 1QYVA 2WTBA 4DGSA 4D45A 1B16A 3EVNA 3C7DB 2CDCA 4XA8A 1YOVA 3L4BA 4BNKA 3ROQA 3VVBA 4XR9A 5EQFA 5T8KA 1KVQA 4A7PA 3ZWCA 3RROA 1BW9A 1QMGA 1UXHA 5T64A 3VDQA 4R51A 1XCBA 3O9ZA 4BNMA 1DIAA 1NWCA 5IZ4A 1KYQA 3DOOA 3NYWA 2JKVA 3CMMA 5EMHA 2UDPA 5KWEA 1YJQA 3JQFC 1H6CA 1CQJA 3DHNA 3M2TA 1T2CA 3NDJA 5B4VA 3INRA 4NBTA 4II3A 2J3JA 2VHXA 2Q3EA 4PGFA 2NV6A 1ZW1A 4YXFA 4J6FA 1VPDA 3GDGA 1D3AA 2POQX 1HDRA 4E13A 2I3AA 3FSRA 4RPKA 3PI7A 1XIVA 1QKIA 3DAPA 3VZRA 3ZZNA 3FF4A 2VT3A 1NAIA 1Q7GA 2EWMA 2F00A 2X4GA 4R69A 5U1PA 3R1IA 4HADA 3WQQA 1GYRA 1WXDA 4XCVA 4IUYA 5FI3A 4AJ2A 1QYDA 1B3RA 1VM6A 3QV1A 4OJNA 3ROKA 4BNGA 4MVJI 1P31A 3C1TA 4NBWA 4DMLA 2I9PA 4BKOA 2HMVA 4Q3CA 2NVBA 4CV2A 3LSYA 1K89A 3UF0A 3VZPA 5ILGA 1GU7A 1Q2XA 3ZU4A 3AUUA 4H3VA 2B0JA 3H9EO 4JBGA 1UAGA 3JQ9C 1NBOA 2YFQA 1O9BA 5JPIA 1VJTA 1PL7A 2C82A 3PIIA 3JD0A 3Q6IA 1CEQA 2DUUA 3GN1A 3GEMA 3PHHA 3D7LA 5CHEA 4BGVA 4K6FA 4UUOA 3C1AA 1CETA 3JQEA 2Y99A 3OSUA 4CQLA 4HX5A 1SCUA 1O6ZA 4R1SA 1TEHA 3DBHB 4IGEA 1IHXA 4EEXA 3A14A 1U4SA 4OOEA 4KMSA 2FR0A 4WUVA 2E4AA 4DBZA 4NHEA 3D5QA 1KEVA 3VH1A 4Z3DA 3GEGA 4WLNA 4YBZA 1F8FA 2NNLD 1BGVA 1YB5A 3WYEA 4A5OA 2QRJA 4MP8A 1PJCA 4BL5A 1BVRA 1PJTA 2C59A 4N5MA 4BMNA 4L9RA 5B4UA 2W2KB 3DEYX 1PL6A 5CDUA 2AQKA 3LLSA 4PVDA 4UVHA 3O8QB 1KIFA 1V0JA 4RDHA 1PGPA 5JLAA 4UAGA 2UUPA 3I5MA 1RM4A 1O94A 2JAHA 3KHUA 3A06A 1XSEA 5L4LA 4KOAA 2NUAA 2SCUA 1DC4A 1ZO8A 4R1UA 3TZKA 4YRBA 4ZQEA 5DNAA 2FR1A 2JD0A 3KTDA 3S2GA 2YYYA 3KXDA 1F14A 1Z73A 1PZGA 3BMOA 3JQFA 3VPXA 1L7DA 3FNEA 4CV1A 2IZ0A 5C5IA 4W4TA 1XA0A 3CZMA 1GADO 3FHLA 4CLRB 1UXKA 5I7FA 1EUZA 3WYCA 4YDRA 3CEAA 5CDSA 1AHIA 1M2WA 3HNPA 4FQ8A 3FRJA 3DL2A 4PVCA 1P0CA 4NBVA 4MVJF 4BO3A 4CM1A 3JQAB 4BNTA 3GRKA 4M55A 1HDCA 1IULA 4PN3A 1HE2A 1B2LA 3PJDA 3QIVA 1FDSA 1N9GB 3LVFO 4P8RA 5FYDA 2VWHA 3NJ4A 1HE4A 3AY3A 1I32A 4J1QA 1N2SA 4QTZA 2GGSA 4QEDA 2PWZA 3ZWYA 3SBOA 5IG2A 5TC4A 1HETA 4XWYA 1KEPA 5L7TA 4B4WA 2HMSA 4FPXA 1QORA 1UZLA 4R1NA 5KIAA 2WD8A 2JL1A 1QLJA 3JQ9A 1W6UA 3JD3A 4K9DA 4NFSA 2GZ3A 3ENNA 4IPTA 3GNTA 1HL3A 2AE2A 4XDYA 2DBRA 2VCYA 2J6IA 5JNLA 1C0LA 1NR1A 1ONNA 3NTRA 1DFGA 3PZRA 4IM7A 3R3SA 2Q45A 1Y5RA 2ZJ0A 2ZB8A 3TQHA 1Y5MA 1NR7A 1ZJYA 5T67A 2OXIA 1LA2A 3MJSA 1IZ9A 1FDUA 2QZ9A 1T24A 3G0OA 1Q0HA 3M1LA 1HYEA 4YPOA 1B0AA 1E3WA 3STHA 3Q2KA 2GN6A 3OFSA 5B37A 4XYLA 1QYXA 2JHFA 4JN6B 4K1LA 1VKNA 1JKFA 2EKLA 4UVDA 3ZV5A 2ILTA 3K73O 3OH8A 1KY5A 1CQIA 2G1UA 4OXKA 1TVEA 4N7RA 1LLUA 3PYXA 4PG7A 1NPYA 2IEDA 2YQ5A 4JLWA 3H7AA 1GEEA 2VRCA 2QIOA 2X0IA 2AHRA 4RF2A 4RVUA 3DBRA 4WK6A 4Z0HO 4CM6A 4CMIB 4UEKA 3ZGYA 5A05A 4DC1A 5AXAA 5JAIA 5JO0A 4O5OA 3W1VA 3G3EA 4ALIA 3MJVA 5IF3A 3QP9A 2W98A 3U4IA 3QJ5A 1C1DA 5BSGA 4OXNA 5A3VA 3H2SA 3PHJA 4FJ1A 4WCFB 2J5RA 3UN1A 4YACA 2C7VA 1ZMTA 2Z5LA 4ITUA 4Q3DA 3W4JA 1P1JA 1P1HA 4ZICA 5L95A 4BO9A 3E9QA 1BWSA 2IYPA 1NM5A 2OL4A 2ZB3A 1PGOA 2X5OA 3OETA 3DZHA 1ZVMA 3JQGA 2C2XA 5F1OA 4HV4A 1U3UA 4P22A 3PGXA 3UXYA 4AJLA 1SOVA 2OZPA 1NHGA 5DCYA 3RCBA 3WIDA 3AK4A 4CMGA 3HB4X 2QX7A 1SEPA 4S3MA 3I9LA 4LCEA 3VAZA 4W6ZA 1I01A 4NJOA 1LSOA 3QWBA 2Y67A 1FXSA 3PHIA 4ALLA 3ADOA 2EGHA 4GBJA 4E2ZA 1UJMA 2PNFA 2I99A 2YV2A 2ZYAA 4GSLA 4J4BA 2X5KO 2OO5A 1DC3A 3EY4A 4BKQA 2QRKA 4BHTA 4TKMA 5AXBA 1NXQA 1YBMA 5JC8A 4DMMA 1GQ2A 5COQA 4JX8A 4TZKA 3PLRA 2HRBA 1LRJA 3CSDA 1LC0A 1VSUA 3ZI0A 3AUAA 1IHYA 3AM4A 3PWKA 1N7GA 2VHWA 4QECA 3ICCA 5KVCA 1V6AA 3GA0A 3RD5A 1LC3A 1RM5A 3Q0EA 1Z75A 1IOLA 1R0KA 3KM0A 3WJ7A 3M6IA 4CUZA 1UXJA 2VRBA 4J43A 4BO5A 3K9QO 4EBFA 4HP8A 4ZU3A 1GD1O 1KVUA 4QQRA 3DAGA 3MWEB 4IIVA 1V3TA 3FTPA 1BMDA 5TT0A 1ENYA 3ZHXA 2X23A 4Q39A 1EDOA 2EF1A 2O48X 2XF8A 3BTOA 2AE1A 2AEJA 4E5MA 4HUJA 3KB6A 1Q1NA 5DT9A 2I66A 2C20A 4YT2A 4PLCA 4QXMA 2VNSA 4PLZA 2Z95A 3NGLA 2NU9A 1BXKA 5G0VA 3U49A 3VKUA 2FSSA 3EZYA 1YVEI 1WAMA 3AW9A 3EK2A 4OH1A 3W8DA 4ZGWA 1CWUA 1R4MA 2DVMA 3H3JA 2NVUA 4M87A 4OL9A 3ZW8A 1R66A 3BMQA 1T1SA 2P68A 5KNLA 3ON5A 3GFBA 4NJMA 4LGVA 5DOVA 5ICMA 3SC6A 2TMDA 4UEOA 1GR0A 5TIIA 1QG6A 5DZSA 3GAZA 4WPGA 1PJ2A 3C1OA 3MTJA 1LSJA 2FRDA 3I83A 1QV6A 4HFNA 4M54A 2Q49A 5L7WA 3KUXA 2DQ4A 4RORA 5IDYA 3DC2A 4QO7A 3UHAA 4YRAA 4B7XA 4BMSA 1C0IA 1ISIA 1U8FO 3HZZA 3ITDA 3QE3A 2AW5A 5HRUA 4MVJD 1UP4A 4P38A 4BB5A 3UCEA 2NADA 1AXEA 4ALMA 4PIVA 5B1YA 4FB5A 1P0FA 5HTOA 1HYGA 3D4NA 1J6UA 4RVDA 3WR5A 4D0SA 5TQVA 4YAJA 4JP2A 3MTGA 4E33A 4FFOA 2QW8A 3I4FA 1BXZA 1W8DA 1B14A 1D8AA 5DCWA 2PY6A 4YAIA 2HK7A 3SJUA 4YQZA 4YJGB 2D5AA 4U0JA 4BNHA 1E6EA 4FS3A 4DQXA 1PZFA 4K6CA 4YAKA 4AJJA 1LDEA 4PLYA 4IQGA 3NDIA 2O3RA 4YJFB 2GZ1A 4BO1A 4UUNA 1XG5A 2NQTA 1PIWA 4HKTA 5FF9A 1AGNA 3WYBA 3ZCXA 1ISHA 4DWVA 3C3XA 1BG6A 4UVEA 3MOGA 3O38A 3V1UA 1B8PA 2IRWA 2GN4A 3RIHA 1GEGA 2ZTLA 4MIOA 4MO2A 4UUMA 4DPMA 3RBZA 4ALJA 1MP0A 1LBEA 3HDHA 1LDBA 4MVJP 3RFTA 3V2HA 3T4EA 4U6SA 3G49A 2WYVA 1O89A 4B7CA 3VTZA 5A9SB 1E5LA 4XQCA 1FMCA 3B1JA 3M1AA 5KKAA 1WPQA 2WWRA 4XYMA 3PEFA 5JYDA 1MUUA 4CM4B 3BHJA 2EJWA 4W7IA 2OP1A 3RC2A 1U5CA 6ADHA 3ADPA 5ITWA 3VHRA 1E7SA 3AOEC 4PFJA 4BNUA 1ADFA 4R41A 4F46A 5JW6A 3TZHA 4CQLB 2B37A 5JMWA 2GN8A 4MVJE 1E1LA 4RCVA 3LYLA 5DBGA 2WMDA 5LDGA 1RWBA 4PZDA 1XHLA 5L53A 1X0XA 1D1SA 1T2DA 3SLKA 4YJHA 3ST7A 1OMOA 4EW6A 3I3OA 1DIRA 4DPKA 2O50A 4CLOA 2EW8A 1T4BA 5CEFA 5HA5A 1Y8RB 1DDOA 3VTFA 2YV1A 4N18A 2VNAA 4E30A 3JQCA 4IQ0A 4J1NA 5I7SA 1U2GA 4BGEA 2DBQA 4IJUA 1WW8A 2P4HX 3I9KA 3WIEA 4EJMA 2VHZA 4INAA 1GPDG 1ID1A 4A03A 3D3WA 5B12A 1GV0A 2ZK7A 3O03A 1Z82A 1CDOA 2A94A 3UFXA 3HADA 3GMSA 3OEWA 3FBGA 1JTVA 1E3IA 5DF1A 4AJPA 3QY9A 1MX3A 4J2OA 4R68A 3F1LA 4IDBA 5JCJD 1AE1A 2W4QA 1EK5A 4LRSB 3DOCA 2X86A 3LQFA 2FPIA 2PV7A 2E82A 3H6KA 3MJ4A 2CY0A 4OKIA 2B36A 4RF4A 2BLLA 1JW9B 3L77A 4IZHA 4BO2A 1NVMB 3F3SA 1ZSNA 4DA9A 3RAJA 3DHYA 4W82A 1JU9A 2NU7A 5TJ9A 1ARZA 3TRIA 4XB1A 1NYTA 4CMEC 2DBVO 1LLCA 4I5FA 4YAEA 5B4TA 4J2HA 3ORFA 3LF2A 3R3JA 4YT8A 3RUDA 5JAQA 2ZTVA 1M6WA 2P9EA 1MGOA 1VE9A 1PJLA 3C24A 2C0CA 1NX6A 1FF9A 3EDMA 2OUIA 3CTMA 4XJTA 3JYQA 5F1PA 3FTNA 2X9GA 2O4CA 1YO6A 4GPD1 2HMUA 3TL2A 5A9RA 2VUTA 4XJSA 3UAGA 4BNNA 3TZQA 3ETEA 4RGBA 1EEHA 4WECA 2HMWA 4RZIA 3SLGA 2ZATA 3FPCA 5HBRA 3RASA 1DIGA 3WFJA 1UDCA 5JCJA 1WWKA 4R4JA 4XIYA 3WB9A 2D8AA 1V9LA 5JYEA 3H5RA 1TT5B 3GNSA 3EHEA 3G1TA 3D5TA 3Q2IA 1HZZA 2Y66A 1X14A 3GQVA 3JQ6A 2Y05A 3AOEA 2PH5A 4MKRA 4QFCA 3OA0A 2PKQP 1C1XA 3GR6A 3PP8A 3ZWAA 3GVCA 1DEHA 2PD4A 3AY6A 4LK3A 3RUEA 3DTTA 3SVTA 2J5KA 4OIMA 4ND4A 1VI2A 5T5QA 1E3WB 3P2YA 5TSDA 3RJ9A 3R0IA 1PR3A 2JCXA 3P19A 2YY7A 3BHMA 1SOWA 3ZWPA 2ZQYA 3AI1A 4EJ0A 3HDQA 3FCOA 1DFIA 1ISGA 4IJVA 3WOHA 1JKJA 3I9NA 4BO7A 3RBXA 4EITA 5EN4A 3ZWXA 4NFHA 2Y93A 1E7MA 4Q3BA 4K28A 1V35A 3DBRB 4HFMA 1H6DA 4NU6A 3X2FA 2B83A 3IUSA 4D0RA 4Y6RA 7MDHA 3PIDA 2GASA 3PYLA 1ISJA 4FD3A 1IUKA 5L4SA 4D7AA 3A1NA 2IXBA 2VOEA 4CM9D 3M2PA 2H6EA 1E0DA 3OA2A 5KOIA 3L07A 2AG8A 3T7EA 1SMKA 2OP0A 3H9JA 3IDSA 3SX2A 5L9AA 2D2IA 1M75A 4FCCA 3FWNA 4ZD6A 4E5PA 3HB5X 5GZ3A 4FFRA 4DTIA 3NT5A 4J1TA 3TWOA 1QRRA 2X0JA 4A2CA 3KYCA 4QUKA 5J23A 1JKIA 4GX1A 4BGUA 4DC0A 1OC4A 3GEDA 4CQMA 1XYGA 4BS9A 5THKA 8ADHA 1SPXA 4WLEA 4CMEA 5L45A 1KS9A 1SC6A 3H9GA 1B3BA 4Q3NA 1V8BA 1SEVA 2CSUA 3GAFA 4W9NC 4Y6PA 2O7QA 4J1SA 1ENZA 1K6IA 4W99A 5DN9A 1J0XO 1H9BA 3LC2O 2J3HA 2PTGA 1P45A 5I8WA 1NHWA 2O7SA 2RH8A 2PD6A 1YKFA 2QQ5A 2NACA 1YL6A 1DLJA 2PA3A 4DRYA 2BFPA 2EKPA 3UW3A 5JDIC 4XRGA 1S7CA 4NBUA 5DDIP 5F5NA 5I8ZA 4PLVA 4XKJA 3ZHZA 3JV7A 4XQEA 4IMPA 1DRUA 1F06A 4IJWA 5IN5A 1ADCA 4CJXA 1A7AA 2FN7A 4J4HA 4CM9A 4I9NA 3OF2A 4XX0A 3JQ8B 2VZ9A 1GY8A 4YRDA 3C7AA 3RFVA 4PG4A 2AG5A 1H94A 1AHHA 1PZHA 4MP3A 1LUAA 4FFPA 1EMDA 2G76A 3AM3A 2BD0A 4KUEA 3HE3A 4HY3A 2DM6A 3EUWA 2GNAA 5TGDA 2IDZA 3B20A 3W4KA 4DUPA 4QX6A 4GWKA 3CINA 1GFSA 4KQWA 3WTCA 1PJBA 4CV0A 2GYYA 5AOVA 1CIVA 1LNQA 1DXYA 2G0TA 3GOHA 4R3WA 4E12A 1G0OA 2GCGA 1WDMA 3CUKA 1HT0A 3EMKA 3VC7A 5JAZA 1YDEA 2QG4A 3F4LA 5EQDA 4YR9A 1QV7A 3DBLA 4FBGA 3ONFA 3WJAA 4GMGA 3D0OA 3DZJA 3KBOA 2Y1FA 1X13A 2YHIB 1ZCJA 3WLEA 3IQDB 1MC5A 3INGA 4Y67A 3ZWNA 2NVUB 5CEJA 1Z45A 4RPGA 1MA0A 2HJRA 1IYZA 4LVCA 5DP1A 2BFMA 1CJCA 3K2EA 4WNIA 4A26A 4XGIA 3EZLA 4WE3A 1XWFA 2OHXA 3RU9A 5LDHA 3K31A 4HNHA 3KYDA 1M66A 2DLDA 3B1FA 2R00C 4FN4A 3AUTA 2WEKA 4XDZA 3RFXA 1JAXA 5JCXA 4WJZA 2Q1UA 5ILOA 4HNGA 4RF5A 1VRWA 1X15A 1NQAO 1X7HA 4RPJA 2NSDA 4ND2A 5G0UA 2Y0DA 4CR6A 1U5AA 3FNFA 2AQHA 2NM0A 2IXAA 3RUCA 2ET6A 2ZCUA 2GO1A 3FN4A 5L40A 1XELA 2Q46A 4NK4A 3S2IA 1B8UA 5IDXA 3BMCA 3WSWA 2CVOA 1ZMOA 2PH3A 2WJPA 3CKYA 4GAEA 4NIMA 1D7OA 3MJCA 4W9NA 4BNXA 3OECA 1WVGA 4J91A 1PJ4A 4JIGA 1OOEA 1DSSG 4NG5A 3WBBA 3PJFA 5TJHA 2VZ8A 4HFJA 2C29D 1SO8A 3S1LA 2W90A 3CXRA 2X6TA 4E32A 3W6UA 4EEZA 3GMDA 1E7QA 3IJRA 3H3FA 5TNXA 1Q7BA 2D0IA 5JDIA 3ULKA 1MG0A 1PQWA 4IGFA 5ITVA 3SC4A 3RWBA 2VQ3A 5JXWA 1KY4A 2Q1WA 1I3MA 1EVJA 1Y9AA 3BXXA 3NDRA 4TZTA 1GV1A 2Q99A 1LRLA 2VYVA 4MKXA 3ZWBA 1H2BA 2BMAA 2J8ZA 5BNIA 2PGDA 2Q1SA 1XR3A 1PWZA 2VRCD 1ZK3A 4OHUA 4EYEA 1LDGA 2YUTA 1HDZA 5F1KA 3GVIA 1HWYA 2GN9A 2ZYDA 2HK9A 1W4ZA 4N5NA 3OIDA 3K8ZA 3ZV3A 1NFQA 4BNIA 3WMWA 1PGQA 1EQ2A 1Q7CA 2JHGA 4FFNA 1OBFO 3KETA 3CE6A 1LX6A 4DIFA 1DIHA 1DOHA 5BR7A 4KP7A 1N8KA 5HS4A 2HJSA 2WYWA 4XRRA 2BKAA 4YT5A 2EXXA 1DIBA 1ML3A 3QWFA 3ITKA 3ZU2A 1T1RA 5LCXA 4JBHA 5TT1A 1UDBA 2X1HA 3JQ7B 4E5KA 4R9SA 5A1TA 3W8EA 2PZLA 1JAYA 2E48A 3R6DA 2G82A 3GVXA 1UAYA 1G1AA 3PTZA 3BZUA 2JAPA 4M49A 3V1TC 3IKTA 1U9JA 4BO0A 3NV9A 2WD7B 1A9YA 2O2SA 4IXWA 3ZWOA 4NR0A 1EE2A 2ZTMA 4WEQA 3S2EA 2R00A 2YDYA 4N5LA 1HTBA 3GG9A 4TKLA 2FSVA 3DR3A 5LC1A 1GPJA 3OHSX 1LEHA 3RVDA 1DAOA 3L9WA 2CD9A 1PL8A 1ONPA 3HQ4O 2JFHA 1C0KA 4TQGA 4PLWA 5AXDA 1ZXBA 2HMTA 4WLVA 2H9IA 2Q50A 3WGZA 4ZJUA 3D3WB 1Y8QB 3DZFA 4LMRA 4JROA 1HRDA 2QHXA 1IY8A 2AEMA 4M86A 4JP3A 1MXHA 5GZ1A 2V65A 1RM3A 4O0LA 3KYBA 2VN8A 3IOYA 5TRTA 2FMUA 1P74A 2VTDA 2EGGA 3E5MA 3QWIA 1E5QA 5CAEA 3MJEA 2X0NA 1GTMA 1YRLA 1ZBQA 5IJZA 4FJ0A 1N92A 2E37A 2QZZA 3OP4A 3OEYA 3GY0A 1E3EA 1GUZA 1U3VA 1HLPA 2Y0EA 1AN9A 2CF6A 1T2EA 2RH4A 2FR8A 1HXHA 4BV8A 1X1EA 2EKQA 3UOGA 2V6GA 1LDMA 3ZNOA 1DB3A 1MFZA 2WM3A 4GQAA 3TSCA 2V6BA 2PR2A 5C7OO 4E3ZA 1EBFA 1JWBB 1Z7EA 5AVOA 3BTUA 1YDWA 3WQSB 2Q4BA 1XEAA 3QLJA 3UCFA 2QYTA 3GK3A 4Q3EA 3ZDFA 4RVFA 3AI3A 3LDHA 3MJTA 3K96A 3LT0A 1MV8A 4I1IA 2R2GA 1NFRA 3FD8A 1T4DA 4O63O 1IPEA 1U1IA 4CM8B 1N7HA 1MLDA 3LLVA 3I6QA 1K2WA 1EK6A 1A4UA 2CF5A 3AOGA 3QA9A 4ZQBA 2FHSA 5JFOA 3RJ5A 4CLHA 4ZQHA 2Q1TA 4CUJA 2YHUA 4BNFA 4OO3A 5CDTA 5G0SA 2PZKA 1GUYA 3W4IA 1ZXLA 3WQRA 4AG3A 4BMVA 4PG8A 2Q4EA 2V6MA 4BQPA 5C7IO 4XZ3A 1PQUA 2C5EA 4D3FA 1OC2A 3C7CB 1J4AA 1I33A 2XAAA 3PQDA 5A9TA 1NVGA 3TL3A 4D43A 1DLIA 2FWMX 2J3KA 2VTEA 3RSHA 4CL8A 3BHIA 3BA1A 2W2LD 4KUHA 5BSHA 3WGIA 5MGBA 4BNVA 1H2HA 4FW8A 2VWQA 3KO8A 3U09A 1P3DA 3AY7A 2FPGA 3NX4A 4PCVA 5HM8A 2Y1OA 4UULA 4J9UE 4KWIA 4FR5A 2HU2A 2AA3A 1ZFNA 2LDBA 1U2DA 3UKOA 4S1VA 5ENDA 5KVVA 4L73A 1OFGA 3DBHA 4XGNA 4AJKA 1H93A 3E9NA 2UV8A 4AJEA 4AJ4A 4CM3A 4TRJA 3RU7A 3NGXA 4BUCA 3KVOA 1YB1A 3GZ4A 3ICPA 4WNCA 4XB2A 3BMNA 2BGMA 1LQTA 2OBNA 2Y68A 4DLAA 3ROMA 1WNTA 3CPSA 2A4KA 1O8CA 4B4OA 5G0WA 1LSSA 4NZ9A 3SJ7A 1KVRA 1YOVB 2CUKA 3HWRA 2W2KA 3Q1LA 5L3ZA 5JO9A 1PZEA 1BW9B 2DBZA 3KYCB 3NAQA 3N7UA 4UVIA 4E4YA 3QQPA 4MIEA 1TT7A 3DO5A 3O8QA 4FC7A 1H5QA 4D3SA 4PLGA 5DBIA 1U28A 4IS3A 4P4LA 3IKVA 3G1UA 3ZWVA 2RAFA 5C7LO 4IDCA 4XQGA 3GVPA 1W73A 1YS4A 3DFZA 3GRPA 2W2LA 4DVJA 2CFCA 2JD1A 4II2A 1G0NA 4HXYA 4RLHA 1N1GA 2O3JA 1P1RA 2FZWA 2ZB7A 2FP4A 4OKNA 1ISFA 4ZHSA 5IN4A 3GPDG 4NNJA 1LXCA 4PZCA 3PQEA 2AQ8A 2XXBA 1K5HA 1Y9EA 1KOLA 3TNLA 3DHEA 4J49A 3WBFA 4CLRA 4IINA 3AU8A 5ES3A 3FNGA 4R16A 4RPHA 3DZKA 1SNYA 3E82A 3QVXA 3GGGA 3TPCA 4WASA 2PFGA 4K26A 1CF2O 4LISA 4OMUA 3OICA 2GRAA 4LW8A 4XQ9A 1B26A 2BI8A 3C8MA 3JQAA 3BTVA 1YQGA 2P2SA 3DXFA 2BI7A 2RHRA 3GH3A 1WMBA 2HO5A 3V1YA 3IUPA 2HQ1A 4CMBA 4NPCA 3L6OO 3D4PA 3EYWA 4OM8A 3VPFA 2PK3A 4CUKA 1DO8A 4DIBA 4C7JA 4J90A 2DPGA 4QSMA 4XD2A 4ILKA 3QVTA 7ADHA 1VC2A 2GPTA 3OJLA 3FR8A 3T4XA 3ZHYA 1FDWA 5G4KA 3F5SA 3U9LA 2LDXA 1KVTA 1GZ6A 1I3KA 2WYUA 4BO8A 5ADHA 3FR7A 4CLEA 4IDGA 1GZ4A 5JMPA 5IXSA 4CMAA 4BKRA 3I9MA 1ISMA 3JYPA 1T26A 3COSA 2D59A 3IC5A 2HUNA 4MJLA 1ENOA 3PWZA 4DPLA 2G17A 3GVHA 2Y1DA 3KYDB 4GMFA 4BIIA 4D3DA 4YQYA 1DJQA 3TF5A 4IDEA 2Q2QA 5EESA 1UXIA 4RZHA 4AVYA 3MWDB 4RVHA 1PS0A 3BTSA 3OQ6A 1JQBA 1P44A 4GX2A 4B8WA 2GERA 4GLOA 2TMGA 3IP1A 3AUSA 4D79A 1M67A 2V6FA 4BNZA 1BXGA 1KBZA 3K2BA 1YBVA 4CR8A 5KJEA 1NPDA 2IODA 3DONA 3NT2A 3GUCA 3BMOB 4Y6SA 1GYQA 1GDHA 2PLAA 3KZVA 2X9NA 1YXMA 3E03A 4G65A 3QVOA 2JFFA 4XGKA 2Z1MA 3HFSA 5I7VA 4DYVA 2AXQA 3O26A 2AEFA 1SB8A 2DU8A 1GZ3A 1NWHA 2B35A 5EPOA 1BSVA 4IJKA 4UEJA 4XEHA 3RC9A 2C07A 2BELA 3OQBA 1YJ8A 3ENKA 4RJTA 1I2BA 2WE8A 3TFOA 1ZJZA 3PDJA 5CP8A 3P2OA 4MP6A 4AL4A 1PGJA 1R16A 5DCUA 1K6XA 4LVUA 4BNYA 4ROSA 1NQTA 2QYSA 3AFNA 4KQXA 5I9MA 2NTVA 1WDLA 2P9CA 3HUDA 2PKRA 3BIOA 2I6TA 4G5HA 3MOIA 4BOYA 1PX0A 3N74A 2RIRA 4JJIA 3QHAA 2GF2A 5FI5A 2FZEA 1RM0A 3DMYA 4UVGA 3E9MA 4P4NA 4CLDA 5AQ1A 2HDHA 3BAZA 5EERA 1YQXA 4HFRA 4AJIA 3GGOA 4ND1A 4O59O 1I2ZA 2P91A 2NVWA 1O5IA 2ZJ1A 2ZYGA 4IMRA 3AU9A 3GC6A 5EL0A 1Q0LA 1R12A 2VYNA 4B3JA 1R4NA 3TN7A 1O0SA 1SZJG 4A10A 1GQYA 3PYMA 5H81A 4B4UA 2CDAA 3E18A 4NDNE 1DPGA 3FWZA 1HE3A 1EVYA 1ZEMA 3KSUA 3ZNNA 2ZIZA 2D4AA 4LSWA 2CNBA 4KWHA 3CIFA 2QRLA 4E0BA 4Z3KA 1DFHA 4CQMD 1DHRA 1D1TA 4U0KA 1TXGA 1LDNA 1ADBA 1EBUA 3HJAA 1MXFA 3RQSA 3OIFA 3Q3CA 4FIZA 4OAQA 4J7XA 1I30A 1PU2A 1ZZEA 1SB9A 1E1MA 4E2WA 1JN0A 4JJFA 4HBGA 3G17A 3RBVA 4DL9A 2PKQO 4KZPA 1PQPA 4I8XA 1UH5A 2NTNA 1XQ1A 1X1TA 1FDTA 3FPLA 4FOOA 3KEQA 2FOIA 3ZW9A 4AJ1A 1PTJA 2JD2A 3ANNA 4GX0A 3WLFA 1RYEA 4ALNA 2RCYA 3QRWA 4XIJA 4A0SA 1UXGA 3PVZA 4CODB 2IZZA 2HK8A 3HN7A 3WICA 1C1DB 1U3WA 1NNUA 4C4OA 3Q11A 2X5JO 3QVSA 4IDFA 4Z9FA 4E6PA 1XKQA 3W6ZA 4BVAA 4J0EA 3JD4A 1KC3A 5IDQA 1KC1A 3TJRA 5L4NA 5A4DA 4EGFA 1U7TA 3LT4A 2BGLA 3WNVA 1S6YA 1E3LA 2YFHA 2AMFA 2B5VA 1NAHA 4AFNA 4B3HA 4L0QA 1BHSA 4PZEA 3JQGB 3W8FA 2D1YA 4OXYA 3F4BA 4EJ6A 4IIUA 1QYWA 3V2GA 3WGQA 2PD3A 1JLLA 3MCVA 5CDYA 2H1SA 3V5NA 2GLXA 3EVTA 3I4CA 4MINA 2C5AA 1I36A 3WFIA 4W7HA 4YCAA 1NPTO 1N1EA 2H5LA 1DAPA 3KEOA 5IXYA 3HG7A 3WGGA 1YWGO 3VVCA 2JJYA 3LT2A 3DDNA 3DOJA 3K5PA 1T25A 3PDUA 3CMCO 3U4DA 3PJGA 4FFLA 3AI2A 3ASUA 1EQUA 2RHCA 1BDMA 1XLTA 1VKOA 3GN2A 2YQ4A 4YJGA 1HLDA 5A3JA 3DBVO 1YL5A 2ZQZA 2O3TA 1PJ3A 1Z74A 3FNHA 3KV3O 4L75A 4TRRA 3WTBA 4WLUA 3VH4A 5U9CA 4BQRA 2C7GA 4YJFA 5FWNA 5EINA 3AFMA 5A03A 4N54A 3RKRA 4E2YA 3NTQA 3K30A 1GL3A 2VUSA 1E7YA 4G81A 3DB2A 1ZEJA 4MVJG 1LRKA 2Q2WA 5DBFA 5ER6A 3L4SO 3MZ0A 3KOUA 4BNWA 3ZWWA 3H2ZA 4CLXA 5ICSA 3VH3A 1UZMA 1QLHA 4RVGA 3VPSA 1FK8A 1GCUA 1MB4A 2UAGA 1EDZA 2B4QA 1TI7A 4OQYA 3JQDA 5U4QA 4JXKA 2YDXA 4I9HA 1IL0A 4F45A 2J3IA 5A06A 1PWXA 2DUWA 3WMXA 4BO4A 5A9SA 1WZEA 2HLPA 1R4MB 4NMHA 5ER9A 3A4VA 4PG5A 5TS3A 3E6AA 3QWHA 3BMQB 3UVEA 5KKCA 3PLNA 4KTVE 4CMHA 3OM9A 4CM4A 3LF1A 4NJMB 4M1QA 4ZQFA 2AQIA 2O3UA 3JYLA 4EUHA 3D3EA 3FI9A 1BRMA 2EG9A 4R5HA 1HEUA 2UYYA 1OAAA 1E3SA 2P5YA 4NH4A 4NK5A 3RC1A 1HDYA 4WKGA 2VYVD 3AJRA 4B3IA 3OBBA 1VL6A 5F3RA 1E1KA 4CL3A 3GDFA 3RUFA 4CV3A 1G6KA 2X9VA 1W0CA 5K9ZA 4PLPA 4D46A 1PJSA 4BV9A 3D4OA 4H16A 4GVLA 3BMNB 1XDWA 1UZNA 1WP4A 2DTEA 5I9NA 2H63A 4R5MA 1Y8RA 3DFUA 3ABIA 3GG2A 4XYBA 1LU9A 2CDBA 4RQUA 1VJ0A 1VJ1A 3PWSA 3ZHBA 2X22A 3H4VA 1E1NA 4L8VA 3IS3A 1R0LA 4U8GA 1SBYA 2BFOA 9LDTA 1ZK1A 4L74A 3DWFA 3KRTA 1HF3A 4EUFA 4GWGA 1NQOA 4NBRA 1E7RA 1NP3A 5DOZA 3TZCA 4EUEA 3GGPA 2HSDA 3ZWMA 1BDBA 1ULUA 2OOSA 8LDHA 3KLMX 3PHLA 1A5ZA 1JVSA 3WS7A 1IZ0A 4ONEA 1P1IA 5KVQA 3UICA 2IZ1A 1XU9A 2Y1GA 1R15A 1TLTA 4KDEA 4QFDA 5FFFA 1VL0A 4YYZA 3F6YA 2VHVA 5EIOA 5IZCC 4PLTA 1LJ8A 1EE9A 2OMEA 4WCDA 3F46A 1QXSA 1E6WA
chains in the Genus database with same CATH superfamily
1C14A 2R6JA 3CNOA 3DMTC 2IYUA 3R3ZA 4GH5A 3CCLB 4LSMA 4ZVMA 4FYMA 5DIZA 3NWJA 1CD5A 2PJUA 3WWCA 2OZLA 2FK7A 5KQMA 1YONA 4JLAA 2IL1A 2OV2A 4LJAA 4QYXA 5TX7A 3UJDA 3LV8A 3ZHQA 3PITA 1PR0A 3KZOA 3Q3EA 1KE2A 3LUGA 1ZNZA 4Q18A 3V7UA 3JYOA 1YFLA 4XWKA 2HHCA 3Q6QA 3E1YE 1D6JA 2XTNA 3OEHD 1HDGO 3LHSA 4RACA 3NTOA 1PEYA 1AXGA 2SKDA 5H82A 1V47A 5KDLA 3ZNPA 1V5FA 4Z4IA 4L1KA 1N6PA 2X19A 2FZKA 4ZP1A 3EZ9A 4FIDA 2EZUA 4V0SA 2WPDA 1HG1A 3A2NA 3D9QX 3KEFA 4HPWA 4QNMA 1ULSA 4NBLA 5CPBA 3OE7D 4KFSA 3BYZA 2VHCA 3Q8XB 3UUGA 1I14A 1QMPA 4OSOA 1BCRB 2Q3DA 2FY8A 1T8YA 2Z6VA 3PL5A 4Q3AA 3U62A 2JFOA 2V9CA 4GPBA 2UYCA 3GT0A 3FDZA 3KJGA 1F0PA 2DFVA 3TI7A 1EUYA 3ANSA 3PNYA 4ZA2A 3U1BA 2WWVD 1UP6A 1GG9A 5G4KB 5DIFA 5FOUA 4XR4A 2GILA 4H7PA 2CW5A 2QMHA 3H7IA 1VRCA 3EQ2A 4E4TA 3WDKA 4R84A 4EB6A 3OKXA 4IBOA 4YJHB 1A5SB 4RHCA 4YWHA 4LFCB 4CIDA 4G0WA 3GO4A 2P0YA 1P5RA 5HPYB 2JFXA 1GN9A 4B8ZA 1HKUA 4PO9A 4QATA 5COBA 3F1KA 2A9OA 5BN3B 2B3DA 2GCEA 4LN1A 3RB8A 1KFJB 4EKEA 5I7UA 1QFYA 1NQ5A 1FFWA 3CP2A 3NQ41 1F12A 4HL6A 5SICE 4CMCA 1DTSA 2DY0A 2NSLA 1NRWA 1UJBA 3B70A 4JLPA 1WPGA 2F1HA 4QWMA 5CX1B 3IVXA 4FW9A 3N59A 1Y7PA 3BEDA 3IIMA 2I76A 4M7OA 4TT3D 1G20A 4P83A 3HMQA 1XTVA 1KYZA 5IU6A 4GGOA 1TQ8A 3DP9A 2DBYA 3MUOA 4H6PA 4IIJF 4LYJA 4MS4B 4UNSA 4LZLA 4RXMA 2JEOA 1V71A 2X2PA 4U6NA 1USKA 1C9KA 2X5XA 2XMPA 1OPXA 3QENA 3EZXA 3QU9A 1TJ3A 4JUAA 4TZ6A 4PRKA 1IIBA 4FILA 1V3UA 1QR6A 4ZT2A 2WUWE 2Y0CA 4J94A 3OZCA 1I0ZA 3PEWA 2XMRA 3H8VA 2VJNA 3C6BA 3NOQA 4TXMA 1JL3A 2OGUA 2VDJA 3T52A 4Z4QA 4R1MA 2W6JD 5JVDF 1WNFA 2PDAA 3OZIA 2C2YA 5A3SA 2OCXA 1ZICA 3E8XA 2NU8A 4CKYA 5KTSA 2W6ZA 4FYVA 3WRWA 5LQKA 3C7KA 4D4LA 1P2BA 1VBNA 3BIXA 3NTXA 4FFSA 3PD7A 2ZT7A 1BVUA 3A3BA 3EDQA 3IQEA 2FW8A 2QJFA 4MWOA 2FPSA 4KBGA 2FKAA 4AZSA 3Q88A 3QSGA 1K06A 4MQ5A 3LLMA 4JSYA 5TMBA 4DT1B 5KQGA 1YVUA 1QU2A 3ZCSA 1FP1D 4S35A 1NBEA 1N6KA 2FAXA 4CQNA 4FSHA 3WGOA 3VHQA 4LWZA 2QN1A 3HCAA 4YUVA 4IEFB 2NAPA 3OIVA 4MQLA 1E2LA 4NU5A 4B8YA 1YZFA 2CT8A 3KC2A 3ZCQA 2BHLA 3VXKA 1NVTA 1SC9A 3G2PA 5A5GA 4C4ZA 1UF9A 5KWVA 3BA6A 4B84A 5HXBA 1CZHA 4GI3A 1I8TA 3CF4G 2XE6A 5J2UB 4BFZA 4GMXA 3VO9A 2WG0A 1KK1A 1P1FA 4H7JA 1JDJA 1EB9A 3TFQA 1G8PA 3JQBA 4XFKA 5CCXA 1NV8A 2H9AA 3CNBA 3HHPA 4OMCA 3FI0A 3HVRA 3HK2A 1FTYA 4MEBA 4I4CA 2FEAA 5LXTA 4M88A 4JI5B 1XT6A 5T6BA 4JXZA 2EV9A 2R1TB 3DWIA 3H0EA 3P9QA 3B9QA 1WXXA 4ETMA 3WYDA 1A7KA 3PUJA 4TYYA 1YIJB 2O2YA 3CUUA 3LC1O 3O47A 4D41A 3A70A 2JCBA 2RHMA 1G9TA 2EG5A 3LHIA 3V42A 3ZXIA 1RAHA 1OU4A 5LQJA 1EVIA 3LZ6A 4P1VA 2A9JA 2IH5A 4M37A 5LJLA 3DMHA 3CLVA 1TCBA 4B3BA 1ICIA 3I23A 3VZSA 1JPNA 3N58A 4KX3A 1SUDA 2PKXA 1K6JA 3OLZA 3VBCA 2GDZA 2HSZA 5AVJA 1XCPA 3EGDA 3JQ8A 5BQFA 3BGWA 4JBWA 3UJ6A 2G4LA 4PLFA 5ICEA 1E6UA 1F9AA 3W2HA 1Z0FA 1Z0JA 3FMOB 2X2OA 5FD8A 1DWUA 2DCMA 2EIHA 4A6PA 2QA5A 1N57A 1CW2B 3FCAA 3PI6A 1I4WA 3L9XA 4C0AC 2XGSA 3WWZA 4EZIA 1OYVA 4P5EA 4QHYA 1NJGA 1DJMA 4KZKA 1IN7A 4O1MA 3GZTB 3RRNA 5GMOA 1Q91A 4F7WA 3G02A 1PSDA 2J0VA 3GPIA 1N7IA 4C4PA 2FWPA 2GSDA 1QB7A 5BRNA 4ZGBA 3L8DA 2GD1O 1M2VB 1DS6A 3DLCA 4EM6A 1QRUA 1QSGA 3GVKA 2P65A 2X4IA 4URWR 1MVOA 4BBAA 1XZGA 2PQ2A 2F3TA 4IH9A 5BMVB 4LF4B 1YBAA 2YTZA 1SD1A 4E0FA 3B1XA 3MAJA 5HS6A 4DB2A 2ABWA 4O8CA 1QQ6A 1T8SA 4U6QA 3TG8A 5SY4A 3TLCA 4HDOB 3DXZA 3U4HA 4EZBA 1EFAA 5KYTA 1PGNA 1WOPA 2VUHB 1WXQA 1TTPB 4MYCA 1DBPA 3NT4A 1XVVA 1L5HA 1Y0YA 1OLSB 1E92A 2I4LA 1C9EA 5KCZA 1SKMA 3FNQA 3Q1KA 3UQZA 1T5IA 4UREA 3CCCA 2ACKA 3HR8A 3LL7A 4NS1A 4R54A 1LZKA 3IJPA 1P9LA 4MV9A 5T57A 5I47A 5IK2D 2WAMA 3SIPA 2IYXA 3Q87B 1V26A 2OYSA 1LF0A 3B85A 2R6CA 1U8XX 3FCUB 3BQMB 4G5RA 1CNFA 3KU1A 4HUQB 1EI9A 4L5YA 3WK8A 2EKBA 5B2FA 3N2KA 5JAMA 5JDCA 3WKEA 4Z4FA 4OBEA 1P9NA 4N5IX 4PYRA 4U3JA 3A9SA 3VU9B 4JH0A 4WOJA 2HD4A 1H8HD 4U7HA 3I9OA 2FSIA 3GLUA 4XSVA 3CZRA 1H42A 4QXAA 3TOSA 1GAEO 3PGLA 2NTJA 4AUMA 4RTRA 3CZCA 2R7AA 3GPBA 2GCNA 3D0KA 2JFYA 1RI1A 3REQB 5I51A 5C53B 1QF9A 3A3OA 3AF6A 1KZHA 1IUNA 3UC5A 3BCSA 5K03A 2YZKA 4XVUA 3RUAA 1QUEA 3F9CA 3CNEA 2XNSA 4QIHA 3AHIA 5AKXA 3ESYA 1UM9A 1GTJ1 1YVRA 4HWGA 2C58A 3C3KA 5EKDA 3VR4D 4IDAA 5EKXA 3TOXA 1QZXA 2LW7A 3AFIA 4JLDA 4YMSA 3VX4A 3SEZA 4B79A 4NJEB 1Y81A 3KJHA 4KLAA 3D64A 3V4PB 4LHEA 4URYR 1OHHD 3W6OA 2R8PA 4BE9A 1H4VB 1DC8A 2WWWA 2ODTX 4JNCA 3S7TA 4LCBA 1N2BA 3QNUA 3P96A 3NH9A 2WF6A 3O8BA 1ZK0A 4O4HF 1P1CA 2QQFA 1AB5A 3FMIA 3KJNA 3TNDA 4Z51A 2I65A 1J25A 1V16B 3LGXA 1V1JA 1N9GA 5E9WA 2A35A 1B7GO 2PMWB 2Z9DA 1O95C 3GCWA 4QNNA 1TVKA 4R2HA 1WQ3A 5ESDA 4C08A 5JALA 1ZJJA 3QI2A 3PZBA 2G0AA 4FYPA 4KQGA 3VJMA 4L4XA 4BV9A 4EI2A 1U7OA 2LZJA 1XTIA 2Y0PA 3L7CA 4Z0PA 4IF6A 3CKMA 1Q16A 3PFNA 3EGOA 4EA8A 2HCJB 3GDOA 3MMXA 1Z83A 5E4TA 2C0PA 4LYFA 2CCJA 3GEBA 1WDKA 2D7JA 5E8RA 2B8WA 4FR2A 4CU2A 4TRNA 1R37A 4BZXA 4Y6GB 3USZA 4DVGA 4I4LA 4CWAA 3SHQA 4JBIA 4MWSA 2XQIA 4BNDB 2ZGVA 3R6LA 5GM1A 1XTBA 3A1UA 3A1DA 3VZQA 1VKJA 2RC6A 5GZ6A 5MN5A 3S2UA 2QJRA 3GNQA 4XD7A 5J40A 4TWRA 1CUHA 1S3FA 3EXG1 3NLLA 1Y6GA 1SZCA 3DBLB 3T9EA 3PFWO 5IAAA 5DNWA 1KZ4A 4FE7A 4B81A 3B13B 3DMRA 4K9OA 2ZSBA 4KXLA 4LZOA 3UAVA 4TRMA 4Q7QA 2X53S 5LP6F 4MWCA 1RPNA 3UWDA 1GGNA 3AILA 2DKNA 7MHTA 1CFJA 1VKHA 4O33A 2P3MA 1EFKA 4I1UA 2YWBA 3R7WB 4L76A 3INYA 1X94A 4WA8A 3PFHA 3U7EB 3ZV7A 3TLGA 4N03A 4Z9YA 1FFXB 2PZMA 4FGSA 4S1WA 2POCA 5KMGB 1MB0A 1H2RS 1P0QA 4UPEA 2IUSA 1R00A 5EXSA 1Z56C 3T3MB 2AMLA 4DA0A 2RK6A 3T3IA 1L9XA 2JCSA 5LLTA 1JLKA 1UWVA 3NBAA 4PHHA 5AK5A 1K0FA 1Q20A 1R0SA 1N08A 4D3YA 4NYMR 4C3UA 2BMWA 1FYEA 2ECPA 4PGHA 2VXBA 2X2FA 4UFOA 5HZHA 1XLWA 2B5OA 2Y8EA 4JLOA 4CDNA 1I2CA 3B60A 5BV0A 1MO6A 1ULAA 1WTAA 1QAOA 1MG5A 3KHKA 4B4VA 4KDFA 3TSZA 3NANA 2K7FA 4JR1A 3VGJA 1MX1A 2E7ZA 2H59A 4QSHA 1GAJA 1KI6A 3HDYA 4Q9IA 1E63A 1GUAA 5ARCA 3CX4A 3BC9A 3GVJA 2MINB 4Z4TA 4A8PA 5AESA 3HGMA 4Q9JA 1P1KA 1TVMA 2AKAB 3C43A 3NM6B 5JQWA 3GLFB 3K15A 4Y7DA 3RADC 4IDHA 1AK2A 4D81A 4H4EA 4DNRB 1DAEA 2C54A 4PR0A 4Y0NA 4F3YA 4Q4JA 3CVYA 1KJQA 5FIUA 5C31A 3C5WP 1J9EA 2IE0A 5B58C 1A9RA 1J5PA 3D1LA 5IANA 4BNJA 1YDHA 1QO7A 3I1JA 4AIRA 5B30A 3EUAA 5IAKA 1JFFB 4P6VF 1TQ2A 2YYSA 4QBFA 4HRVA 1C8BA 3AJDA 3AP3A 4FDAA 4NCNA 4G8JA 2H0RA 4A2WA 3TXXA 5BSWA 2E4XA 2WHPA 4DLYA 3F6CA 2IT1A 3D7KA 2WQ7A 4BNLA 3UXMA 4F91B 1VHEA 1V96A 4HK4A 3X44A 1RRPA 3A1CA 1NJ6A 2RAPA 4DRZA 2Z4SA 2QRMA 4EMSA 3OTWA 4RS3A 1ECPA 1G3IA 1YH3A 1BXRA 1OF1A 3TZ6A 1VP9A 5CDGA 4RJ2A 4ALKA 5C80A 4CL2A 3RTEA 4PRZA 2ENWA 2GJAA 2AR0A 4J0FA 1YZ3A 3T7TA 1X0VA 3VKVA 1TL7C 1PV4A 4CEIB 1FZQA 2OBYA 3CH6A 3FF1A 1QM5A 1AKYA 3ORRA 3WHLA 4FJ2A 3WP1B 3ZKWB 4CMKA 1VDZA 4Q1EA 3OJFA 1PEDA 3H1PA 4KKSA 2YIJA 3PPIA 3JQRA 3R3UA 3GUHA 4IXTA 1HUQA 1U1FA 4AICA 1XNHA 2XWQA 1OWOA 1J70A 2WAOA 4PRLA 2G1KA 4C20A 1UD4A 2FPPA 3B9PA 5ANRB 1DJNA 3INTA 4DCGA 1TYBE 1LTHR 3NHBA 3UW1A 4OF4A 1MC4A 3EDCA 3GHHA 4UE3S 3CH7A 1S5PA 3R0JA 2XGMA 4MPRA 1CR6A 2D3NA 2EC5A 3QU4A 4YAUA 1IB6A 2O8VA 2XTJA 4OGWA 4U7JA 5CVEA 4I50A 2EP7A 4ZV9A 3ZU5A 4ES6A 5L3QB 2XBUA 2AN1A 4P98A 5K6AA 3A3PA 5TF4A 2CNDA 2J0SA 1TAUA 2W4IA 2VT2A 1J21A 2NO5A 2OCBA 1G291 4U7GA 4UC0A 2Q27A 4DY4A 1SPBS 3CTAA 1FP2A 3QLTA 3CISA 4CZ2A 4KVFA 3NE5B 2Y1CA 1J8QA 3PUWA 5AI9A 1U4OA 5ENZA 1WB5A 4CM5A 5K8TA 1MRNA 1XE1A 2JLUA 2E55A 4HNVA 3O4JA 4KWTA 4X6XA 1YUNA 3F2VA 1G7RA 3MWEA 4LNUB 4ND8A 4U00A 4UD6A 3PRKE 3LUHA 1FOEB 3PQ2A 1WSBA 3M8KA 3AB7A 4A6DA 2Q2OA 1N2JA 1YMVA 4WT7A 2QR2A 2I1VB 5ARBA 5B64A 3DAYA 5JBIA 1RKXA 4LMPA 4BEJA 3IE1A 4PZ9A 1SG9A 1NXWA 2FWJA 3CW9A 4YMLA 4YJ3F 1AQLA 5C1DA 1IXYA 1P8JA 1U7HA 2DWOA 2IEGA 3T41A 3ZOKA 4QD3A 4MQFA 1GPYA 1M5TA 2O8NA 4Q48A 1H0SA 2GNOA 1KAQA 2X6WA 3WKBA 4A73A 4AYXA 1HVXA 2HPZA 2I71A 4M8SA 3ASQA 3PB3A 2W5UA 4ZAFA 2PAAA 3R44A 2CZCA 2ZCVA 3HDJA 5I4IA 4REMA 1E8DA 4NCAA 4OOSA 1UQUA 2Q3MA 4DIOA 1N5IA 2EZ8A 4PSCA 1VIVA 2QIPA 2WF8A 3TR0A 2IX9A 4C2UA 1D6SA 2XQKA 1CR0A 4WRRA 4E15A 3GLIB 2PYDA 2H8KA 4JKOA 5AW2A 1ZIDA 3BZWA 1H2EA 1KYIA 2Z57A 1QP0A 2FOXA 1MFPA 2HLDA 1SU7A 2F90A 1GR1A 2ADMA 2NZJA 2XMSA 3BBPA 4X71A 3RVMA 1FVXA 1Y3HA 2J6HA 1UIRA 4JP1A 5JROA 4H35A 4D45A 4F2WA 3IQFA 2B9EA 4M1ZA 1GILA 2G1JA 2XCQA 4WI1A 4DXDA 2HIMA 1M0EA 2CJXA 4QU5A 5EQFA 1C0EA 2ONZA 2FFRA 1QMGA 2XDQA 3CUEF 5CT5A 3HKBA 2RGBA 3F7OA 4PO1A 1U0FA 4R6WA 3O9ZA 4R51A 3D8RA 2TMYA 5DXAA 2W93A 3WSTA 3QX3A 2MSWA 5HQ3A 2I54A 3CMMA 2JKVA 2L69A 2IUTA 2OMKA 3NIGB 4CIAA 2VSXA 1RC8A 4UAJA 3IPLA 5CDFE 4DCPA 3QELB 5CM2Z 1MX9A 3DHNA 3M2TA 1GDDA 3NDJA 2PSEA 3INRA 3OCVA 4KOEC 3GFPA 4W8HA 3B1YA 2Q3EA 1K9VF 4A2PA 1CUDA 4K9PA 3GDGA 3REGA 2O5CA 1S7GA 4KV9A 4D9CA 1NQWA 5F4MA 4K9SA 4CDMA 3HO1A 4RW0A 3D4LA 4I1PA 5KTRA 3LECA 3FOBA 2NZXA 3C6YA 3PI7A 1YBHA 1VE5A 1WV0A 3QVMA 4FHFA 4FLEA 3X1DA 4L8YA 4EVRA 4PC6A 1LPBB 2OFXA 5KYWB 2VT3A 3ZCTA 1NAIA 1O6CA 1Q7GA 2YL2A 1U0LA 3FPHA 4TV9A 4WGFA 2WP8J 5CYPA 4C6SA 4MDEA 1VCNA 3ICEA 2PSFA 4IUYA 3AG6A 1QYDA 3HO8A 3P9XA 4MVJI 4KQ9A 4BX8A 1ORHA 2A2ZA 2XB9A 2JIRA 3SYNA 4BKOA 3B1ZA 1MNAA 5H8WA 1PP4A 1WMFA 2QGGA 1N6IA 1XZKA 1WCWA 1KDRA 2II6A 3AUUA 4H3VA 4HX9A 3K8YA 2XXAA 2RG7A 3UV7A 5CCDA 3RTDA 5DEOA 1EGAA 4JBGA 1UDWA 2HPHA 1XU4A 1WU8A 2P2YA 5D01A 4J07A 1NBOA 2BGIA 1TZJA 4UHJA 1PR4A 3DVSX 1CUSA 3LTNC 1FLVA 4FCWA 4F21A 1W36C 2I9KA 1XD8A 3K4PA 3TQOA 5C18A 3M89A 1JR2A 3AF1A 3Q6IA 2B1IA 2E3JA 4FDVA 2H2AA 3G23A 1JHVA 2Q9CA 3GN1A 1AOXA 3FJ1A 1E0JA 1JLHA 2GBGA 1ZIYA 1O96B 2BGUA 3K7EA 3MTEA 4YJKA 4BGVA 4D25A 3JQEA 1XZFA 3MWFA 2Y99A 3ND6A 1G59A 4G41A 4HX5A 4DE5A 4D8TA 1QDUA 4MGIR 2C9MA 5I6DA 4KMSA 3N8KA 2FR0A 2E4AA 5J63A 5FADA 4C9BA 4DBZA 3WV4A 2YOGA 4NHEA 2IPLA 1VMDA 2ZBDA 1XZEA 3V80A 9LDBA 4TLEA 2CF4A 1CRZA 3Q41A 4G36A 4KIUA 4MWEA 3Q3AA 2H29A 3HL0A 4NABA 4K81B 3A1FA 3AHCA 4MP8A 5CYOA 1CCWA 1PJTA 1YIDA 2RHHA 3KR0A 4LS3A 1PD1A 4Q00A 5DBHX 1IEXA 5B4UA 2BEVA 1R74A 1SD5A 3DEYX 2QD1A 1XD9A 3IR7A 4ZEVA 4EF4A 3MMZA 2XE8A 3ZR4B 1U04A 1YAJA 3TKLA 4B6QA 2BBTA 3O1LA 1J06A 4KLNA 4D8YA 4DJAA 3IGFA 2UUPA 4X41A 1KF0A 4DANA 4MAFA 1SJ9A 2JAHA 2DMRA 2C7BA 2PGIA 1TK3A 1ZO8A 4P12A 4KFRA 3FHOA 5DNAA 1IHOA 2MWMA 1VHJA 2HF8A 2YYYA 1SM4A 4HEHA 4XVHA 2JASA 1YVDA 1Z73A 3JQFA 4L28A 4QUIA 1L7DA 3VPXA 4DQDA 1KK0A 4UOEA 3KOOA 4J0QA 4CV1A 5K99A 2YWHA 1FSSA 4H7FA 1I7DA 2I6SA 1PBTA 4DIEA 3L1KA 4HLCA 4LGYA 4O3MA 2H06A 1K7SN 4V0RA 1S3IA 4EGQA 1DCKA 4HAYA 5TQ2A 1GADO 3FHLA 1E89A 4CLRB 1UXKA 4YV1A 5ESRA 5AKJA 3WYCA 4YDRA 1FMJA 1X3LA 1AHIA 4FHGA 1VECA 4PFQA 1VQLB 1RPZA 1GO2A 3FRJA 4O4IB 3HV2A 1P0CA 4PVCA 2QRZA 4NBVA 1NOIA 4GE0A 4H27A 3KEWA 4LC0A 1MIOB 4MVJF 4YRJA 4BO3A 5FTLA 5IAOA 4OQPA 2UZ1A 3BSWA 4PN3A 5EIHA 3KV1A 2XVYA 3QIVA 4E07A 5CA0A 2XMBA 3V8EA 4JC5A 5CJ2A 1UANA 3AY3A 3P9NA 3MM4A 5LU8A 1N2SA 5CVUA 5HZKA 2PWZA 4F4DA 2DFNA 2YCLA 4BB0A 2I8AA 2WKRA 1U99A 5BP7A 5HJ7A 2GVZC 3IIJA 2F1IA 3N05A 4JJZA 4KCGA 4WFQA 2X8JB 4DLUA 1NBAA 5DTMA 5E4JA 1RU3A 2XITA 1VL2A 3MF4A 5BO5A 2HMSA 3CONA 1WS6A 3KSBC 2O8EA 3R0ZA 4XKWA 1DBWA 1UZLA 3B6MA 4I8DA 4R1NA 2ORED 3T5GA 5K0TA 1K2VN 3JD3A 2GFIA 1KI7A 1Y63A 2A67A 1E5VA 1CNMA 2ZIAA 3ENNA 4JJ4A 1VQ8B 4NFSA 4ZVKA 1PSZA 2JGLA 4DY6A 1HL3A 4X0CA 3GCGA 3VR2A 1ES9A 2FZCA 5JNLA 1AF4A 1JR6A 3AESA 4AK9A 4MITA 3NTRA 1DFGA 4UCWA 4LOIA 4UW9A 4PAWA 3G6KA 4W1PA 2V1UA 1Y5RA 1JG4A 2D13A 4GRIA 4MWGA 4MW4A 4TQUS 2BSXA 2PGOA 4EF6A 1X8KA 5DNVA 1PZXA 2PZGA 3QX8A 3KYJB 4UQOA 2Q28A 3RANA 3A1WA 4POOA 1TZMA 1T24A 3G0OA 1BVHA 2IIVA 3M1LA 4HQ6A 4JT4A 2WV7A 5FAKA 3L46A 3UTCA 3KP1A 3VAAA 1B0AA 3G8BA 4BTLA 1MRSA 2W2PA 2QYOA 1DBSA 1KY3A 2GN6A 3OFSA 3UJCA 1SQFA 4EPRA 4FGLA 3MNFA 4WDQA 5KHLB 2ES4A 3QLVA 2WF9A 3COYA 4JN6B 1HLGA 1XTTA 2CKDA 4IHQA 4K1LA 3FPAA 1XRLA 2HV9A 1VKNA 5FULA 2FQQA 3G0CA 4UVDA 3DKIA 4HLUA 2QBYB 3C6MA 3PBKA 5HP4A 1QIHA 2ILTA 4I2NA 1SOMA 2G1UA 1E1RA 1QP7A 3U17A 4N7RA 1AZLA 3GARA 1NPYA 2OYNA 3GLGB 2Q7XA 3Q72A 4K03A 4R7ZA 3H7AA 1GEEA 2SICE 5DO9A 2HTEA 3DBRA 3RYHA 3CPHA 2BISA 3WO0A 3K1AA 5A05A 1KDPA 1U8CB 3BOSA 1W5SA 5JAIA 4O5OA 1SUEA 1GQFA 2GEDA 4S1TA 1Y5NA 5JPDA 4H31A 3QP9A 2CJWA 2GHQA 4G1UC 5MFZA 3NR2A 3OZTA 4N0DA 5BSGA 1Q1ZA 4KN6A 1CKEA 3H2SA 3PHJA 4FJ1A 1OE0A 1LK0A 3BE8A 4V0LA 5ALDA 3UN1A 1GKUB 1WPXA 1IATA 5JYBA 3DCJA 3DYVA 1KI8A 2JF0A 1ZH2A 1J99A 1A5TA 2C83A 4WZ6A 3W4JA 2ZBPA 2QSUA 1ZONA 1P1HA 1XQ9A 3DEFA 3DT8A 4WW0A 3QXSA 4N3GA 1RWKA 1SIOA 1UMCB 2C4KA 2WINI 2YN2A 3FA2A 3I28A 4HQFA 1BWSA 2IYPA 2V5UA 3BWDD 3OQIB 3OETA 1KXZA 2GBFA 5HJ2A 4KHPB 1F48A 2XE4A 4YJ2F 3UWOA 1U7DA 3U7GA 1E2JA 2G04A 3JQGA 3K3PA 3PEEA 3ZWKA 2Y1WA 1ZG3A 1NW7A 3EISA 3PS9A 1W4AA 2PH1A 4YRRA 3QEMA 4CMGA 2R6R1 3WIDA 1WEHA 3GRUA 5F7XA 2LIPA 1JEYA 1KH1A 2QX7A 4NARA 1IXRC 3T7DA 3WA6A 3IJ5A 1I01A 2OZVA 4JU9A 4IWNA 1FXSA 3PHIA 3QA3E 3SYKA 4ALLA 3KAQA 3PC4A 5FL7A 1UJMA 2PNFA 2ZYAA 3FB4A 3R3WA 4D8UA 5M2QA 2DIEA 2KVOA 3QEOA 2HK6A 2ZJFA 3FAKA 4GSLA 4HJRA 2IYTA 2X5KO 3PE3A 2YQZA 2OO5A 1DC3A 4YUWA 3EWSA 1XA4A 1QAMA 2ANBA 3PPXA 1WD7A 3R6WA 4PR3A 2B2XA 5JC8A 1P3JA 1XF9A 2MTBA 2H11A 4NQRA 1GQ2A 4Q01A 1F51E 4NTZA 5AT1A 1UZUA 3PLRA 4XOIA 1A8QA 1LC0A 1P81A 1SWWA 4FWIB 2C97A 3ZI0A 4JDPA 5E2IA 3PWKA 4YK7A 4LF9B 4OI4A 4BJ5A 1Y3DE 2HJGA 3A8KA 4C5AA 4GD3Q 3RD5A 4JWTA 1TECE 1LC3A 4LMBA 4X44A 4F85A 3DNFA 3LUAA 2GAOA 3E22B 4OA8A 4CUZA 2IYYA 2VRBA 3CMAB 4CG2A 2AKYA 3I12A 3DV9A 4ZU3A 3THYB 1KVUA 4QQRA 3SDBA 1EFRA 4LDJA 1QJCA 2C0QA 2X8BA 4I3FA 1WUJS 4LEIA 3KQMA 5G1NA 3IT2A 3P0HA 1CQWA 1OD6A 4U9HS 3BGOS 4PO8A 1QE3A 4EB8A 3JWPA 4LV8B 3KB6A 3E8SA 1T0IA 2IW1A 2I66A 2ZZGA 2Y3IA 3F73A 3PNPA 2Z9CA 4LJ5A 2YC2C 3MWGA 4PQEA 5DTIA 4G4IA 3SGLA 2VFAA 4UNQA 4PLZA 1TRHA 1XTJA 1P5JA 2NYRA 3AIIA 3SS7X 3ZK8A 1M34A 2QGZA 1T29A 4CXMA 3VU8A 4I46A 3NAMA 2OVFA 4JOBA 2PSDA 1YF3A 4OH1A 4X3PA 2R6ZA 4B31A 3MT9A 1V5WA 3G5AA 5JARA 2CHUA 4M87A 5FX2A 1OGYA 2JGRA 5LB2A 1UMDB 3HY4A 3OESA 1R7RA 2I03A 4HRYA 1OXUA 3WKCA 4M1YA 3CX3A 3N86A 1KXJA 2Q5OA 5ICMA 1IVSA 1GU1A 4QU0A 3WRYC 3OFNA 1W29A 3UANA 3GAZA 3GCZA 4F7DA 3C1OA 4AXBA 2P3QA 4LAFA 2J6CA 4FNAA 5K45A 2IZOA 5K4HA 1SBCA 3N9IA 5CR9A 1PQ4A 2ZBRA 4WIAA 5D3MB 2XKAA 3BDVA 2OG1A 4TKUA 5KAPA 1VGVA 4QPDA 5DBOA 3CN9A 2NXJA 2Q49A 1Q44A 2AUTA 3C3AA 2QAGC 2NMVA 5IDYA 3DC2A 4TKZA 3BORA 4NPHA 3GW8A 4NAHA 1GSOA 3RGWS 3QNWA 4KK4A 4ND6A 4WUTA 1ISIA 3QE3A 2QXTA 1DQPA 1W9HA 1ST2A 2HU7A 1E1CB 3TE7A 1L3CA 3U3DA 4CT0A 1QHHB 1FDOA 1UP4A 1W94A 4P38A 1E4OA 1PZMA 5KNCH 2E0IA 5EZYF 4R0VA 4FHZA 4PIVA 5CH3A 2W6PA 5EZ5A 3GJZA 1P0FA 5HTOA 4JHLA 1AKNA 5E0KB 3O93A 1HYGA 4QVKA 3T0GA 3UWSA 1GLVA 3WR5A 4A23A 3HXKA 3KR1A 2D74A 3RAFC 2WAXA 3V8MA 2B98A 4KXFB 2CXNA 3OCXA 1KI9A 4OGGA 1L7QA 1BXZA 4HGPA 1J2UA 4WZKA 4Y2HA 2ZTSA 1EZ1A 2QY9A 1VMEA 2YNMC 3NWPA 4Q0MA 1SCKA 3QV2A 2IYLD 4GBED 1FS4A 4U0JA 2GBLC 2PUVA 5IC5A 3EXHC 1PUJA 3BC1A 1M6NA 3N0WA 5JISA 4DCMA 1X7XB 4K6CA 5J3JA 3O21A 3HJNA 4OQFA 4IRXA 3LA6A 2PT9A 4EYKA 3KR9A 4AWBA 1X6VA 2V7WA 1K5GA 4L07A 5CIQA 1JV2B 2F3QA 1PIWA 2CHVA 4HKTA 4P35A 5FF9A 2GXQA 5HE9A 3HA7A 1BG6A 3L0PA 1K7EB 1RXCA 1USUA 2L2QA 3MSCA 4JBLA 5F35A 4C2TA 1IM2A 2YOFA 3VM6A 2ZAMA 4B44A 1TAHA 4LXGA 5DGIA 3OM0A 2IRWA 4CFZA 3O74A 1P7PA 2RHJA 4RD4A 4MO2A 5T7BA 4GOJA 1NUAA 1AX9A 3VNBA 2QUKA 3TUJC 2MT9A 4KGDA 1WPCA 4BB9A 1QCZA 2YXDA 4IEIA 2ZM6B 1G8AA 4HDCA 2PPLA 4B7CA 1ZAYA 3GIWA 1OFVA 4TXHA 4XQCA 1FMCA 4Q82A 1Y7LA 2XWJI 2PMBA 3DMDA 3M1AA 4FMCF 4K88A 4LXIA 2J7PD 5CIWA 1YK0A 4FDUA 1RD4A 2CSXA 4G2TA 4NF2A 3QMMA 1BCRA 2PXXA 3QPUA 3JU4A 4W7IA 3RC2A 9MHTA 2WZQA 1PJ5A 5FPSA 9ATCA 4BO2A 2GB4A 3AOEC 3WL3A 1G21E 4F46A 5ITWA 3PFBA 4EPTA 3BRWD 2QROA 5I7AA 3SDSA 1ECJA 5JSQA 3LYLA 1KE1A 3R9IA 3ESAA 1QX3A 2C2MA 4OSEA 5DBGA 3QKWA 3U56A 2HREA 3IRVA 4YP1A 1YHQB 1RYZA 2M6SA 5LDGA 5GTDA 1RWBA 2OFOA 5EHXA 4RTOA 3IVAA 1D1SA 1F2VA 1NVUQ 1O95D 2L82A 4V38A 4YJHA 1SG0A 2Q6KA 2O0JA 3ST7A 1Z6YA 1DIRA 3VDNB 2ORIA 1R9GA 1S3GA 2FRVA 3AUJB 3LBFA 3S2ZA 4OHFA 1Y8RB 4NSNA 1MC8A 1IXKA 3JQCA 5BN3A 2UXBB 4J1NA 3SKBA 1IN4A 4RKWA 1JB1A 1M8GA 1XFOA 1Y3FE 3TNFA 3OPMA 1GT91 5IH7A 2XRFA 1GPDG 1A9PA 1KARA 5CX1A 1BN7A 4QYMA 1F5SA 1XAHA 5JNTA 2ZK7A 1ACLA 3QIAA 13PKA 2PGAA 4R9NA 2PNJA 4DG8A 2QTVB 2UZ3A 1DJLA 1OLXB 2HSJA 2QU8A 1DXHA 3GMSA 2ORVA 3PSAA 1OA1A 2HDWA 4MUGA 4JDUA 4AVZA 2WIGA 3ETLA 1JTVA 3QVLA 1QHEA 2PGXA 5DM4A 3ICWA 3QY9A 4PYQA 1MX3A 3RIMA 1UBEA 2HGSA 3ZLTA 3EXIB 4IDBA 1OH6A 1SBNE 2IKSA 5EG5A 4FDTA 1EK5A 4A6EA 3MMPA 2Q3LA 3ASZA 1RKVA 3LQFA 3WLHA 5EJ6A 2PV7A 3KCQA 4YCNA 4C43A 5DWDA 3SJCA 1HQKA 3SNHA 2BLNA 2YHAA 1Z5WA 2F55A 4J0DA 2X1MA 2ZSDA 4J1TC 2A5LA 2BLLA 2QLBA 4CRWB 1JW9B 1NI4B 3L77A 1PWEA 1P7CA 2HDOA 2QM7A 3RAJA 1M1XB 3B82A 1JU9A 1JLMA 5JS2A 3S5JA 3W6PA 4JT9A 2OK8A 5EJIA 4DT1A 3COWA 3MQFA 2C7RA 3WYGA 1LLCA 3BE5A 5HOQA 3LBAA 5KB3A 2PJRA 1FNDA 4L27A 1XRPA 2RARA 2LV8A 5L3SB 2BP7B 2ZTVA 2J3MA 1T1GA 1XOIA 2B92A 3AFHA 3E4CA 4G9GA 5K4AA 2Q5JA 1VE9A 4F6RB 4C21A 2AOVA 2F17A 2LXNA 3L7KA 3C24A 4ARBA 2C0CA 1OASA 3OPVA 1JKMA 1WZ2A 1ST3A 3I5UA 2HBYA 5DYNA 2OUIA 3MCAA 3CTMA 5J2UA 3A1SA 2VDRB 3JYQA 1VGQA 5FFMA 3FTNA 2PX2A 2X9GA 3CCBA 3PE4A 4LBVA 2W48A 2HMUA 1VHDA 5A9RA 1M83A 5LA6A 4K1XA 3BZBA 4XJSA 1A2OA 4IOJA 4LK2A 3SJPA 2BR3A 2G6BA 2HMWA 3F3KA 3SLGA 2QXYA 1EUCB 3P2IA 3FPCA 2NU6B 3CLSC 5HBRA 3ZHUA 4FU0A 5JYEA 4KLZA 1LWNA 3G7SA 4R4JA 4P84A 2I29A 2L0XA 3H5RA 3HJRA 2QAJA 4PXSA 3FUUA 1TT5B 1VBKA 3NEJA 2JGDB 3EHEA 4WJLA 2Y66A 4Z4YA 1V11B 4URXR 1X14A 2GPAA 2OKCA 2ZG6A 4ZOLB 1XFAA 3ESZA 4BCBA 2QE7A 5F51A 3OA0A 2PKQP 4GYJA 3P2MA 3GVCA 1DCTA 3NTUA 1L8XA 2PD4A 3U44B 5JI3E 1KOGA 3SVTA 4PGGA 5LVAA 1NNSA 1CHNA 2QPTA 2XE7A 1Z8FA 2ZTNA 1P9OA 4P3NA 5DX0A 3I37X 5EUBA 3T5MA 1RFGE 1O0CA 3HY3A 5T5QA 1SELA 3P2YA 1CV2A 4C0BA 5CBPB 3NC4A 1PR3A 4HQNA 1XBTA 4OHYA 5JU6A 4XGRA 4KU4A 1H05A 4M9ZA 5IJWA 4F11A 1EAYA 2BMVA 5HGJA 2Q8QA 4H1WA 2GVNA 5C1OA 1FYXA 3FFAA 5ERXA 1ISGA 4WERA 3RFCA 5A88A 4N12A 3WOHA 4L6IA 3SR0A 3I9NA 2OHOA 3AM1A 3GEPA 5D3QA 3RBXA 4EITA 1EUDB 3S0JA 4DMUB 3PV0A 4WKBA 1JAHA 1R6XA 1T5HX 4NFHA 2FXIA 3ER9A 4K9LA 1NJID 4Q3BA 1N2IA 4NU6A 1JZSA 1K6MA 5BMVA 4RK5A 4WZAB 3KKLA 5K05A 1GCGA 2DKFA 4B3XA 3BH0A 4D0RA 4Y6RA 3KDPA 5DHTA 1NW5A 4G0YA 2RDMA 3PYLA 1NUQA 1ISJA 4FD3A 4R3UC 2GZDA 1KI4A 4YLGA 4ZT7A 1EFPA 3VYRB 4YJ3B 2IEZA 3FHTA 5JAHA 4GM1A 3A1NA 2IXBA 4CM9D 4TTIA 3KT3A 2R8RA 3M2PA 3F96A 3QKTA 5KOIA 2V5AA 2C4HA 1SMKA 5DSXA 3IDSA 3SX2A 4NAVA 4LNHA 4ZICA 1WOOA 4LTNA 5L9AA 4LBWA 3D2BA 4H4CA 3FWNA 4ZD6A 1CUBA 4JC8A 5JEDA 4DTIA 3TWOA 2B9VA 1IK6A 1QRRA 4KKUA 2FN3A 3KYCA 1JEQB 3CZ9A 3W7BA 1JKIA 4GX1A 1OJ7A 1DRKA 3GEDA 3FWHA 2D1FA 5FJIA 3NBKA 3MK31 4CMEA 1H85A 1D7AA 3BM5A 4HUQA 3RRBA 5KYUB 2EQBA 2PUFA 1TO6A 4ZCQA 2UYOA 4M0CA 2ZRFA 1P9WA 3VU9A 3AKCA 4DLTA 3ER8A 2GA9A 3WHIA 2RHGB 5DNUA 3UK0A 1E9DA 3DEIA 1EP2B 4ZI3A 2XBLA 5DN9A 5HEKA 3PTAA 3A8JA 1WOYA 2CNLA 3A6LA 3WZMA 3IA7A 1H9BA 4DEXA 3THWB 3KBBA 2OCKA 2PL3A 2GXAA 3ONUA 1KEEB 1I9CA 2O7SA 5FLEX 5CFRA 1QNFA 2IDJA 2IHYA 5IT4A 1OBOA 2PA3A 5DEIA 4EA6A 3UW3A 2A0WA 3T4PA 4RFLA 3C16C 4XRGA 5KDOA 2OHVA 5F5NA 5DDIP 4RTSA 1T36B 1AKRA 2B34A 3H19A 4TQ9A 4XKJA 4IMPA 5IP5A 3T1HB 5GGXA 1X8LA 1O87A 1Q92A 1LH0A 3BKWA 5IN5A 3ZY2A 4B6JA 5I9IA 4J4HA 3CPEA 4KN9S 5DNCA 3FGZA 5TPWB 4D56A 3LO5A 3BF7A 2D3WA 5IRCD 4YRDA 4P93A 3WI7A 4PG4A 3FVRA 1WB9A 3CRMA 2C9DA 4LQCA 1AHHA 3OP1A 3PDCA 1MJFA 4MP3A 5FOTA 2G76A 4M1TA 3Q12A 4QFBA 3PUVA 1QIJA 3AM3A 3IBFA 4LNAA 4KUEA 3D3JA 1RYHA 3HE3A 4LTDA 4G8BA 2DM6A 2QD3A 2IDZA 4DUPA 4S0ZA 4QX6A 4GWKA 3AR4A 1GFSA 3AVVA 2R5NA 1PJBA 3FDJA 5KCMA 3V4VB 4CV0A 2GYYA 4N9WA 5IM4F 2XZDA 1CIVA 4E12A 3EOAI 2G0TA 3R7BA 5KQLA 3IEVA 1G0OA 1U5BB 1ZA2A