5B6IA

Structure of fluorinase from streptomyces sp. ma37
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
292
structure length
292
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMHSICPGVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIRQAAKGGARGQWAGSGDGFERADGSYIYIAPNNGLLTTVLEEHGYIEAYEVTSTKVIPANPEPTFYSREMVAIPSAHLAAGFPLAEVGRRLDDSEIVRFHRPAVEISGEALSGVVTAIDHPFGNIWTNIHRTDLEKAGIGQGKHLKIILDDVLPFEAPLTPTFADAGAIGNIAFYLNSRGYLSLARNAASLAYPYNLKAGLKVRVEAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed Evolution of a Fluorinase for Improved Fluorination Efficiency with a Non-native Substrate
pubmed doi rcsb
source organism Streptomyces sp. ma37
molecule tags Transferase
molecule keywords Fluorinase
total genus 83
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 5b6iA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 5b6iA01
2CC2A 2ZBUA 5B6IA 5LMZA 2C2WA 2V7WA 2WR8A 2CBXA 2F4NA 1RQRA 5FIUA 2V7XA 2C5BA 2CW5A 2Q6KA 2V7VA 2Q6OA 2V7UA 1WU8A 2ZBVA 2Q6LA 1RQPA 2V7TA 2Q6IA 4CQJA 2C4TA 2C5HA 2C4UA
chains in the Genus database with same CATH superfamily
4XVCA 3VYSB 5HEKA 4GI2A 1GTRA 1E9AA 2PA3A 3E2IA 4DCNA 1KPGA 4A2PA 1ECGA 1KDRA 1PZNA 5TGDA 3RTAA 3QUBA 4RSHA 1Z5OA 2YYAA 2B4AA 2QXYA 2RC5A 5ALWA 3TJRA 4F84A 1U6IA 5A9SA 2QR3A 3QLEA 3D31A 5TRTA 5C2JB 1RLJA 4N5IX 3TTYA 1RYNA 3QEOA 5JS6A 2V7XA 4BVHA 3M6WA 2V7VA 1L4HA 4RHFA 1Y5LA 3PUVA 4DVJA 5L51A 3BCSA 3VMFA 3LYLA 1YVRA 1G16A 2GLUA 1BFKA 1NLMA 4REQA 1ESMA 2CB0A 2F8LA 3BWBA 3NCHA 5HK8A 3B6KA 5GZ3A 5F52A 1J09A 3MIIA 1XRMA 3K9LA 3FTNA 1MJGA 1ONSA 4PYNA 2X76A 3LHSA 3V46A 2OO5C 3M5DA 1Y9DA 4LRQA 1N3BA 4LJ6A 1FYFA 1KXZA 1RBQA 1TZ2A 3OJ0A 4G9EA 3Q3IA 2X4GA 2JK1A 1SKQA 5LXTF 1DADA 1GUFA 2CMKA 3W6OA 4EA6A 4DEYA 4U7JA 4GZ6A 4EZEA 1YU9A 3CONA 3EYAA 1GV0A 2DUWA 3WIBA 5D3MB 3K9BA 3MBOA 1KI3A 4GX0A 2ERXA 2OWDA 3D81A 3TE7A 1VM6A 4CQMD 3ED5A 1LC0A 3K0EA 5EJAA 1XVTA 1MO6A 3HG7A 3KL4A 2VZ9A 3JD0A 2ARKA 3ELYA 3PD1A 3R09A 3ZIAA 2TMDA 1O96A 2NNWB 4MUEA 1AB5A 3N76A 5TY0A 2AT1A 4X1YB 3RKRA 1NUHA 1Z34A 1PWZA 4QYWA 1TAHA 4OGKA 4RELA 5ARBA 4V0LA 4BV2A 1UOEA 2XVMA 2I7VA 3B2EA 3LCVB 3LPNA 2OAEA 4Z4QA 4MIYA 2ZSKA 4R6XA 5TEWA 3OA0A 1VPTA 1BS9A 4OATA 3G8DA 1EVZA 4CR6A 2GZ3A 4M1QA 2D59A 3C87A 4ALKA 1DNPA 4QT4A 3Q5GA 3MJ4A 3VR4H 1ZW1A 1JFFA 4B8ZA 1M6WA 5AW1A 4KPYA 2V31A 2FWIA 2RIRA 5EE0A 3A28A 1W5AA 3N2GB 4F2WA 1TECE 1MPTA 2X3FA 3WBBA 1QB7A 1W0CA 2EERA 2WJAA 1B8PA 1NL3A 4EFKA 3DWEX 3GFSA 4LIPD 3N2KA 1NJID 4AUEA 4EDFA 4GYWA 1XN4A 1XZLA 2DBVO 1KEZA 1Q1NA 2ZBEA 4JB0A 4AX8A 4AN4A 4YRSA 1LI7A 3DUFB 4Y9TA 3WNZA 2J6IA 3K31A 5T7BA 2Z04A 1HO3A 2GA9A 1NV9A 1U02A 4WZZA 1Y9ZA 4PWZA 1KO4A 1UC5B 5BMVB 3GDWA 3IULA 4NP6A 4R9RA 4UXHA 5EIWA 1O0BA 2NXCA 2AFHB 3ZR4B 4U2EA 1O03A 1NX9A 3CZAA 1WAMA 1Z5GA 1FUKA 3S2YA 2A4KA 1JKMA 2C9YA 2FZGA 2WAYA 4ZGGA 1J56A 3A1NA 3LA8A 4CM5A 3KQQA 3BWCA 3BCDA 1G3IA 5DHRA 3OWHA 2ZFUA 5I9IA 2I6TA 1AX9A 5TJ9A 5J1SB 4FMCB 3I30X 4HH0A 5JAMA 2YIJA 3DBLB 4ZT4A 3O8BA 4K87A 5ALLA 5JPIA 4AP6A 1A3CA 1T1GA 4EJSC 1KEWA 2VJIA 1QHHB 1FVOA 1TO2E 2I3AA 3A3YA 4ODIA 3REQA 4ZHQF 3U37A 2MSNA 3VR0A 5CD9A 1U3WA 3B9BA 4FYPA 1Q19A 1PUXA 2A9OA 5F64A 2I62A 1F06A 1VRVA 3BOSA 3PQ7A 2Z4SA 2I34A 2R6JA 1JJBA 1T9KA 2GHIA 2ZROA 3BILA 3FZQA 3OX2A 4N0PA 4DMGA 1W8IA 3ZDBA 3MHPA 2GJSA 4KRFA 3L1UA 2J5KA 5JDCC 2O2HA 3H3FA 1MQSA 3X1MA 1C14A 3FHOA 3SZMA 2MYNA 1FSFA 2Z30A 3DL0A 2IL1A 2R6R1 3IEKA 3LU1A 4FILA 3BYZA 3OO1A 4RH0A 2NPIA 3RIMA 3ZCUA 3H6GA 3LUPA 2XCUA 3WZ2A 3SSMA 3I61A 2M98A 3ESXA 1Q95A 1QDEA 1NVXQ 1RE1A 2YBDA 2QRZA 2IUYA 3G2NA 3IYLW 3PC7A 5CVJA 3N58A 5LOVB 3PXUA 3ACDA 1VLOA 1GUBA 1I5EA 4HDQB 3JVUA 1ZZEA 3RHZA 1N0UA 4MR7A 4CMAA 5AQ1A 1NBEA 2PWAA 4X7DA 2P9GA 3NP9A 3EFOA 4IQGA 4QQFA 1WBJB 3A36A 4YROA 2GM3A 4IKPA 1NMXA 1H5QA 1OZAA 3R3VA 4KAAA 3IL2A 1T2DA 2JNWA 3DBVO 1D4AA 3DDZX 2MDTA 3DL2A 4G81A 4TRNA 1BOFA 3ORFA 3F7OA 3NEYA 1ZI6A 3AERA 3NT5A 5K8TA 4G4SO 1RU3A 3LUAA 5DK4A 4AY2A 2JRCA 2NO5A 3H3JA 1ECLA 3BFPA 5L46A 2LBPA 3I2KA 5GM1A 1BWSA 4F5EA 4ZN6A 3CJRA 1AU9A 3ONNA 2C8LA 4FYMA 3T7AA 4CHGA 3AFMA 5KVVA 4X41A 3UAZA 3GSIA 1WCIB 1JG3A 2FSGA 4ARAA 1ACJA 1RPJA 2OFPA 1JFFB 1XRJA 3KLBA 2V45A 3OFNA 1QCDA 5CP8A 3ZX5A 2GYVA 2XMCA 1AHHA 2FGJA 2FR8A 3TLCA 4C5AA 2OLKA 1LPBB 1I7SB 1CQWA 3HA5A 3K0AA 4F8YA 3P9KA 1QRSA 3L7LA 4GP7A 2A9VA 2ZXHA 2UYYA 1YB5A 3GXBA 3AR5A 1WULS 4HAUA 2VBGA 1T3ZA 5CM8B 1Q7GA 1ZK3A 3IV7A 3ZWPA 3A6ZA 4X91A 4QOIA 1JHUA 3WLPA 3GQVA 4O08A 4EMBA 1YJ5A 2ZXUA 1S2MA 2H51A 1WE2A 2DKNA 5EQJB 1WPXA 2Q4RA 3NUGA 4RA6B 4JUBA 1WCYA 4FTWA 4MIEA 4ZTBA 5I9MA 5IYZF 4QLBA 1J6UA 5A71A 1EWYA 1YA4A 1ZD1A 2P3QA 2KX7A 5HP4A 4OKSA 4X97A 1WDWB 1TU3A 4QXRA 5NULA 1Z73A 4MIOA 4NULA 3V1LA 3KYJB 3L02A 4ZZ3A 1KEPA 3LQQA 1Q0SA 1LPSA 5K0SA 3HM2A 3PDIB 4J0GA 2AFVA 2YJTD 3ER6A 4PZPA 4WJLA 1KMQA 4F97A 3EARA 3NTLA 4TOIA 2QJWA 2JFUA 5A5VA 3I34X 4OYLA 4PCVA 3CEAA 3OKAA 4B81A 1O5IA 2R6AA 3CYFA 4ZI7B 3V80A 2FUEA 2ZT8A 2ID8A 3GEEA 1E8DA 2BAGA 4DAOA 5JEEA 3A1FA 1KFEB 3VZRA 4O8ZA 4AQDA 3UAXA 1QX4A 3EY4A 5I9SA 3RSHA 4C7OA 3PRKE 2A78A 3AHFA 3OCWA 4KO8A 4ZZ2A 1FUIA 2XGOA 1A88A 3AESB 2DR2A 3H2SA 4ACBA 1CLUA 5JSQA 4EYOA 3AHGA 1PS9A 1JA1A 4RXTA 3I32A 4GZ5A 3H1AA 4UHBA 3T9FA 3B9QA 2W6ZA 4YMSA 2GFIA 1Y8AA 2PWPA 4N9QA 1T25A 4W8GA 2Q7DA 1FJXA 1S7CA 3R9KA 3Q7PA 3GJ5A 3RLIA 2PJRA 4KIFA 4UTPA 4MKRA 1LNSA 1Y9JA 1GLNA 2JFHA 3OMLA 2BFBA 4KBYA 5BWMA 4P25A 1ULUA 2J3HA 5AKEA 4UOQA 3MWDA 2AR0A 3TL3A 3DPIA 4WBXC 5FWXB 4OLHA 3U0VA 1YAHA 5HQJA 4B32A 1OJLA 4B3JA 4PAMA 4XIGS 2LVBA 3DEJA 1SCUB 2CB9A 4QNNA 4YRRA 3WI7A 5HQTA 1OMOA 2W43A 2G9ZA 3T3EA 5GJCA 4P54A 3OZAA 5IUNC 5KYVA 1U1EA 3UFBA 2X7JA 2WUVA 2HHHB 2WFAA 1QP0A 3K16A 3R3HA 2FFRA 3AH8A 3FFBA 3FMPB 3RC7A 3RHSA 1FFSA 2ATEA 3EGWA 5LD2C 3WIVA 1X38A 4B4DA 4ZDIA 2B4TO 3DD5A 4E5KA 1XMSA 5DT9A 1QCZA 2WZBA 3D3EA 4KO4S 3EGXB 4KQMA 4Q15A 1VHDA 4D8YA 4F4DA 5I51A 4CM3A 3EDOA 2XMRA 3EHDA 1I3OA 4FKBA 4RF4A 4WTOA 2D6FA 3F4KA 5F4BA 2YIVX 4YT4A 4ZRNA 3FPGA 5ADVA 2G83A 2WG2A 4GOLD 2EJWA 4NAHA 3KJFA 1M1UA 1N2CB 2W2QA 4FFNA 3LXMA 1RBZA 1KL7A 1POXA 3DE1X 3GO4A 4UJ3A 1NXSA 1PS0A 3C7KA 4RS3A 1NBIA 1Q0LA 3DV9A 4UULA 1OFTA 4PBTA 4ZV7A 3GLHE 3KKQA 2C3MA 2V0NA 4FIZA 3R0ZA 1XLVA 3DAFA 1FFGA 1G20A 3O7WA 4G09A 2QD5A 4MKGA 3IKJA 4YI5A 1PQPA 3HUUA 4ML3A 4Q48A 2SICE 3U7QB 3UMMA 3OC0A 2XKBA 1PW7A 5FBRB 1S02A 2JGRA 4KV9A 3WWDA 1JNYA 3BTSA 1JE1A 3GIWA 4ZC8A 3RB8A 1JB1A 5TT0A 3GGPA 5EI5A 1HE5A 5IMBA 2NLOA 1GQFA 3IA2A 1F0NA 4RVHA 3AL3A 4H77A 3OZBA 2QTLA 2VCYA 1JIIA 2CLFB 2P27A 3E6AA 3O1HB 2Y1WA 5JWHA 2C96A 1GZDA 4RHCA 4AJNA 4BX8A 2GEBA 4F6CA 1C9DB 4INZA 3E18A 3QG1A 2AR9A 4IPTA 4RH1A 5LNK1 1Z39A 2Q5LA 4C7OB 3AJRA 1GUZA 4F93B 1N3IA 2V59A 2D2IA 3GGJA 1O5OA 4K9QA 4Y2GA 1XNGA 2IPLA 1BE6A 1H6CA 4I9FA 1KJYA 2G63A 2K87A 3LGAA 3A25A 4RFSB 4XX0A 5ES3A 4EB8A 4AZ3B 2H08A 1FFXA 5BSGA 4IFBA 2OSBA 3RWBA 3O93A 2YNMD 4K28A 3C1UA 3U7FB 1BWRA 1FIUA 3H0CA 3L0OA 5E8JA 3U9TA 4EPVA 3V7AA 1DG9A 1GPNA 3E70C 4DT1B 4GNKA 1YFKA 4C88A 1SU4A 1V2HE 3FBWA 4TL7A 3T0GA 2XNDD 2G4VA 5LZ2A 3QX9A 1BDMA 2DFPA 2REXB 2XNHA 2B4QA 4F6RB 1HDIA 1G291 1I33A 4GOMD 1AF4A 4PYMA 3TIVA 1MDBA 1PSZA 1W76A 1SVOA 1W88A 1X1TA 2D3TA 1RWWA 5FL7A 1DE0A 2ZB4A 3ZLVA 7ABPA 3H1GA 1ZKMA 4QTZA 2EZ9A 4BQPA 3LBFA 1YQTA 4ER7A 4Y2JA 3QOXA 1X39A 1NQTA 3MHTA 5CFLA 2ACWA 3RS3A 2Q1WA 4AO8A 3SY8A 1NMEA 3CRW1 4IGKA 3ETLA 2FUKA 3NCTA 2VDPB 4PYLA 4AUMA 4X1KA 4YLEA 1EUDA 2YMLA 1R10A 1FXSA 1WZIA 2P7IA 2C5AA 3JTEA 3HU1A 4WNIA 5G3ZA 1JTFA 3SIXA 4EQZA 1T5OA 1Y0RA 2R86A 2XQIA 4JQOA 1SZPA 3RC2A 4JB2A 4N3BA 4MI1A 4EUHA 2GJKA 1XHFA 8LDHA 3VISA 2O3QA 5I6DA 2J0SA 1J5XA 4JS0A 1CQJB 4UMVA 1WS6A 5EESA 5J2TA 1WB5A 4YP5A 3FPBA 3E61A 2A3NA 3TCNA 1E18A 4NDZA 1KJ9A 1AXEA 4IX9A 1E2KA 4C0SA 1XZGA 4C5BA 4K6MA 4QDJA 3DV2A 4L1KA 1MO4A 4PBRA 3UJ3X 4X7MA 5HDQA 1A9SA 2Z6BD 1Y1PA 1E94E 2JLBA 3NNNA 3DDCA 2CYAA 4XWYA 1YCDA 2UZAA 3O8QA 3CB2A 4B3RB 4RD4A 1JEYB 1MJHA 2A0KA 3UMGA 2P4HX 3OC6A 4QEZA 1ZVQA 3EGOA 3DV0A 4DB4A 4G6IA 1AMOA 3IP7A 3GLGB 1DHTA 2W83A 3B89A 2C42A 4CMGA 1DDGA 3FPHA 3PSAA 4YAEA 4TYYA 4EPTA 4MHOA 5A3RA 3NDRA 1OH5A 3ETDA 2RGCA 1ONBA 3G5UA 2FWPA 1ZK4A 2BWJA 2X8AA 1N3LA 3ZE7A 1K6MA 1SCJA 3IAEA 4DHEA 4ZEVA 2ZR8A 2QTNA 1VBNA 3RNLA 1SG0A 4PVDA 5CYFA 4WZ6A 3PL1A 5DK6A 1GZHB 5IBPA 4DWWA 2PX2A 3WYGA 4C7XA 2FP4B 4X71A 1MV8A 1ZUWA 4QPZA 5I8PA 1HNZB 3W5VA 1IY2A 3BF8A 2Y4OA 1L3CA 1N7HA 4K9PA 1E4YA 5EJMA 1Y80A 3WISA 2DPYA 2GQFA 1EVYA 1ONOA 1NW7A 3QU7A 4JL6A 1M6NA 2PR2A 2D8MA 9ATCA 2CUZA 3C6BA 2GPYA 2H2DA 5KYWB 4TKUA 3QLJA 4L8GA 3ZDAA 1VG9B 3MD0A 3ZGYA 4PLZA 3DEZA 5BQ3A 1YFJA 2YXPX 3EIOA 5JNTA 2PYDA 5LFAA 1TNDA 3E0QA 2VR1A 1KWGA 1H9BA 1CVLA 4W7IA 5CLFA 3EXAA 1HBJA 4L08A 5CNJA 4DUYB 3UQYS 3DGFC 3QIVA 5LB2A 4AG3A 4ARIA 1RXVA 3TKLA 4AURA 4OQMA 5BSWA 1AKVA 3KSBC 4XTCS 3FVWA 1ZOPA 1HDYA 4TQ9A 3R7BA 1NYLA 4K6FA 2BDEA 4ZA2A 3BNWA 4P33A 1NF2A 2C7BA 5HFJA 4DUGA 1E2UA 3SZGA 5HQ3B 2GF2A 5HJ2A 2HV8A 3KAQA 2QTAA 3HXLA 1Q57A 3CLUC 4NMXB 4KXLA 3CUUA 3SSNA 4IKEA 3P9SA 4P3NA 3ZS8A 4N5DA 4BX2A 5LL6P 2CXSA 4V0NA 3F5MA 4ZC1A 2NUPA 3JCZA 3KHTA 4CG1A 1WLYA 5BNTA 4HYTA 5JS1A 3KV3O 3OZTA 5FR1A 2JGKA 4EG4A 4BB6A 3QP9A 3ZBQA 1E5QA 1GPMA 1ZIYA 4ZJPA 2LV8A 4LTDA 1DDOA 2COUA 3AUYA 5F9MA 2FXVA 3KPJA 1JQAA 4CIBA 1HQYE 4XPZA 2RGNA 4E4RA 4QARA 3TZCA 1Q1EA 2J59A 4PGHA 2ES4A 3BWYA 3OUUA 4DLPA 2BHLA 2PLWA 1X8KA 3OU6A 1FDSA 4AJEA 3I64A 5LZ9A 4YPFA 2P91A 1AZLA 3CGWA 1YR2A 3NGMA 1NBOA 4X92A 5H8WA 1C3OA 2F9MA 1ULHA 3UAWA 1B43A 4II7A 4IX1A 3U7EB 1I4LD 3IQZA 2B21A 5MHTA 5AJWA 3E3LA 2C97A 2PUDA 4TTRA 3R8CA 1DC3A 1CX9B 4LOKA 2QW0X 4IQ8A 2DU8A 2PS0A 3CRNA 4D8UA 1VHLA 4WKNA 5I9TA 3ZE6A 5LR6A 4KQ6A 1SBZA 1K75A 1PBNA 1VKRA 3NH9A 3PHIA 1UZNA 4FQ5A 4DOMA 2IZ1A 2Y0DA 2ATIA 1P44A 3LCJA 1Y1LA 1KAGA 5C80A 1QXSA 3W2HA 2FRVA 2ZRGA 2ZSEA 3COZA 4FONA 4MH0R 1M76A 4NKRA 1NP3A 1MO2A 3HDVA 3RT9A 1GFIA 4PX9A 3R9XB 1E0AA 1DARA 3E3MA 3L6BA 3STXA 5E95A 5KQGA 1X1EA 5F7OA 4CT4B 3IOCA 3SLGA 3LL4A 3S2UA 2I6FA 1S9DA 3S70A 2EKLA 1YDHA 4F45A 2BGTA 1CB7A 2VF7A 3OFND 1ZBQA 2RJNA 2X1LA 3EWIA 3M3DA 4OQZA 3A9RA 3U31A 4GBJA 4LJKA 4TRJA 2PCJA 5ITWA 3BXOA 3ONVA 1GG9A 5I4KA 1NN3A 2WSMA 3K0HA 1VQ5B 1I13A 1YR8A 1R7RA 1TVEA 4N18A 2M6RA 2DSNA 3D8NA 1K2VN 1C0KA 4BXOB 2AWOA 1XCPA 3L7MA 4MKFA 4MS4B 2G6BA 3UXEA 4UAUA 4AWXA 3OT1B 4CU2A 2P9YA 3LBNA 2NZUG 1HT3A 1XJQA 3CLSC 4IR7A 3IPRA 4H6PA 1SIWA 3RRJA 4BNKA 2IHNA 2W4QA 1RW4A 3UPDA 1E9DA 1P4HA 4I1OA 3WGGA 2IHTA 4GQBA 3IA7A 5DSTA 5G4LA 3MB8A 2AK3A 4IDNA 4TM8A 5IJXA 3VJRA 1M5UA 2DT8A 3VZBA 1JKJB 4XLZA 3H9JA 2WJWA 1C9YA 3VRHA 1LF5A 3V34A 4JBGA 4ZYWA 3KXIA 2RH8A 4DM4A 5A4KA 1PS8A 3Q41A 1G7TA 3S27A 2DUUA 4M53A 2NU9A 2QLNA 3L7AA 1FUUA 2ISSD 4Q3BA 5D2CA 1ZVKA 1M1NA 3TKAA 1T0UA 1HEYA 3AF0A 3ITDA 3LPAA 1IVYA 1E32A 1BE1A 3LVRE 4G89A 4N82A 2JKZA 1WXHA 5L4NA 1MG0A 1X92A 3GJ3A 2INGX 3PR3A 4IFIA 3WMFA 3A8KA 5BVHB 5SZJA 3H84A 1X42A 2YZ2A 1WB9A 4LZWA 1GNTA 1TVCA 2WJZB 1Q16A 1FF9A 2N3ZA 2PY6A 2RAUA 3L7BA 4IBOA 4WJZA 3ZV5A 5JH7B 2CJWB 2VAMA 3SEZA 2AYXA 2FP3A 1B3RA 4TL6A 2X6YA 1G2IA 1FL9A 3HWX1 1GG2A 1Q86D 3SYLA 1TO1E 1GYQA 3G5MA 3Q40A 4Y2HA 4J0FA 4YMVA 5JC1A 3GFQA 4LWOA 3G7SA 4QICA 1TAUA 5CB4A 4I1UA 4MPDA 3KL2A 2JLYA 2RGXA 1UD4A 4DNRB 2EEPA 2RHRA 2VSOA 2WQZA 3LF1A 2JFNA 1E7RA 3NEJA 1DTEA 5THQA 1E1RA 1WCXA 3I3OA 2FWBA 2DUMA 2JAXA 4GICA 1C7EA 4KHZA 3D6HA 1P5FA 4PTZA 3EODA 3WIDA 3RUAA 3V4ZA 1ATZA 1XZDA 4M0LA 2C2XA 4OI1A 4AKSA 4BWYA 4FMDF 3A1VA 3ZK7A 1Z06A 4HUJA 4B6GA 5HJ5A 4BP1A 3WYBA 2H2AA 5EKSA 3FFTA 4P3PA 1II0A 1JJ7A 5AHWA 3S5JA 4CN8A 1OHHD 1W2WB 2ZSUA 3ND9A 1ZW6A 1T34A 3GVPA 3INTA 1QH1B 4A27A 4DRYA 2AYYA 1GGFA 2II6A 3KO8A 1KE2A 3CLHA 4X95A 3OQIB 1FYVA 4LDAA 3GHYA 3LJKA 2ZYAA 5HS4A 1IJBA 3L01A 1NW8A 2UV8A 5K0BA 1Z08A 3CZCA 4TXNA 1KTVA 1Z7BA 2C7GA 2H1WA 5BV8A 2CV2A 1J20A 2X1HA 4Y0VA 1AN0A 3K9NA 4R9NA 1YD7A 3UOGA 4CGYA 1KJNA 3HUFA 3MWLA 3IKLA 1QP4A 2J0UA 4QXOA 1OREA 2IP1A 5JAQA 4YS6A 3PCRB 2Q8NA 3LX6A 2B1QA 3ZHOA 3VKUA 1SWWA 1OV4A 4IW3B 1YRBA 2Y0EA 3TX6A 4EBBA 2O2JA 2PMFA 2CD7A 1IY1A 1SKBA 1WLSA 3AERB 3OPYI 1DAFA 4FMBB 3VPCA 3GAAA 3OIWA 2YUIA 4CMBA 2ON6A 4H27A 1CR0A 2R4UA 3IDOA 2PSSA 2FB9A 2Y9PB 4YJ2B 3FMVA 1RC0A 3O38A 1IBSA 2WUFA 4UOEA 5KOYA 1F60A 4F6LA 3D1JA 2RKBA 4LGVA 3ZWXA 3B13B 4Z8XA 1F4PA 2AHOA 3K20A 4OQDA 5J3OA 1NJ8A 3IAM6 1QVAA 3IUSA 1TQDA 3REGA 4Q82A 4NU8X 2E4WA 3UK6A 1L5SA 1M90D 1VYTA 2BTQB 3OQHA 4ZEMA 2QN8A 2C5GA 3GDFA 1RAFA 2Z83A 5E4YA 2P75A 1ORTA 4YP9A 4RTNA 4C4TA 2XB2A 3IDAA 5FA8A 2OB2A 1UEXC 4HPJB 2CZQA 1WTHD 4ETWA 2PRZA 5BWNA 5IZ4A 4EHJA 5JMTA 3EOZA 3FNEA 3BRWD 5FOVA 1BDHA 3OKFA 1KK0A 4RD1A 3RSFA 3SEQA 1WSBA 4JUDX 4MR7B 3I53A 1EE2A 1OWPA 1E7YA 4PR0A 2EOAA 4DJDC 3LAWA 2O0KA 4JGGA 1FE8A 5F4JA 4LTNA 2Q2OA 2YZNA 3FNHA 3H9BA 3D2CA 1OX5A 2Q5HA 4L5YA 3UJDA 1RRCA 5HGJA 1GL7A 3QPUA 2BFBB 2C57A 3FUUA 4MVWA 3ABOB 1U7DA 1XTRA 2WIKA 4LMRA 3BMNB 5G2OA 1Z2CA 1QO9A 1QVGB 3H9QA 1Y8ZA 4JLUA 1E2HA 3I28A 3ZHYA 1I7PA 3BVPA 4E94A 4IRMA 2OFWA 2WJHA 2YS6A 3HU3A 1EU1A 1KQPA 3BQNB 3JVIA 3DE2X 4UTVA 3UHFA 3DBLA 3VXKA 2EL9A 3GG2A 2FJ0A 3D2AA 3A3NA 5A2GA 1V25A 2OE2A 2QAJA 2TRSB 3INGA 4FFLA 1O94D 5HNKA 2WM3A 5HRUA 2BJWA 3KVYA 4LDQA 5KYKA 3C4QA 3KKZA 2X5NA 5DGTA 3T9CA 2BGMA 4C4ZA 3TLJA 4OF4A 1INLA 4PSKA 5JXWA 1ETHA 3A9SA 4YIHA 4XWOA 1XAIA 2V5UA 4L0QA 4YRKA 3OCCA 4QG3A 2QRPA 3I1JA 4DV4B 4J0JA 8OHMA 2SKEA 3V97A 1OJ7A 3ZV7A 2HHCA 1X9IA 1W8DA 3A4LA 2Y71A 3FRHA 3H5OA 1JGTA 2QWXA 5YASA 4AQYB 2Q6LA 5KOHB 4YXFA 5MFZA 3WMGA 1F8YA 4NYMQ 4U3JB 1VJRA 3CW8X 4PQFA 4B31A 1OB2A 5A5DA 2O1XA 4RKEA 2XUOA 3QUQA 3H4IA 1QKKA 1QQ7A 2HRBA 3LDUA 4PC6A 4Y2RA 2OHFA 3AFOA 5TIIA 3VSCA 2DPXA 3OIGA 3EXHB 1T5SA 4KI7A 3JVVA 1J5PA 1N5DA 1HYGA 1MBZA 1V8PA 3BSSA 3GUUA 3I6BA 4AJ4A 2C0PA 2X3YA 4C7VA 1P8AA 3PEUA 4WOPA 3ASRA 1W44A 2ZSIA 5IXSA 4B6FA 3PL5A 4G65A 1CLEA 2WF6A 1I10A 4Q4DA 2R1VB 3ME5A 4WWHA 1YZVA 1ZOSA 1K0FA 1RAHA 4HADA 1P1FA 1GDHA 2CEKA 2DG2A 2QG9A 1AVTA 1ZJJA 4LTMA 3KTDA 3KTOA 1EH5A 2NZVG 2IBMA 5EIHA 2ZUFA 1ONNA 1IBMB 4OI0A 3QXXA 5FNVB 1M2JA 1P2SA 1X8XA 2YXBA 2VDJA 3TQFA 2CF5A 3GDHA 2MWMA 2RHBA 3HO6A 4PICA 4DILA 5EUCA 4EJMA 1M7GA 5JBIA 3KUKA 4XASA 2QX9A 5DRYA 1XMXA 2I3DA 4RC9A 1LSOA 4CQNA 3RGWS 4LF4B 2FQXA 2QG4A 2QRUA 3IP1A 3PYLA 1DKRA 1DS6A 2Q9UA 3KWFA 4JEUA 3S2EA 1T9GR 2VUUA 3O83A 3VVMA 1Y6FA 4ZYUA 3TEJA 1QZTA 1XPRA 2CWDA 1KH2A 3FOWA 2GN9A 3M5WA 5F5LA 4B43A 4OOVA 3M89A 1RABA 3L8MA 3OKPA 4U2FA 3ZLJA 5IK2A 3JYQA 5CH5A 2PZJA 3EZGA 4DIKA 2O05A 3MOSA 3NE5B 1V26A 5HIJA 1UQUA 4LX8A 1WUYA 4RFVA 2AFRA 2J5QA 1E2JA 1XZJA 5JWOA 1NY6A 2XNCA 2JC3A 4A8JC 5JD5A 2OQ2A 4B8YA 4YUXA 1FNDA 1N6KA 5E6UA 4PXAA 3A0RB 3BK1A 1JDTA 2EP7A 3DZBA 3PGVA 1C1DB 4MROA 5AJTA 1XBTA 4MWSA 2QUZA 3BD8A 3VPGA 2QNBA 2L69A 3G23A 1N2IA 3V7UA 3X1DA 2IXBA 1NJSA 3GRCA 1SC9A 2WYRA 4QUHA 2DH6A 3D3JA 2Z8YA 3QSGA 3ZDFA 1GGMA 1VHWA 4TMXA 3TECE 1UANA 4OA8A 3GFOA 3QE2A 2V6BA 3PXDA 4H3SA 3QKIA 1C7FA 1LBSA 1A2KC 2VSYA 2HI0A 3HXPA 2CVOA 3CX6A 2GEUA 1Y1QA 1GWNA 1ND6A 3K9CA 2QVLA 3Q9LA 1E1KA 4PYQA 3ANMA 1Z9BA 2DY0A 2Q46A 5LQRA 3YASA 3FTQA 3EN0A 1E2FA 2I3GA 2OL4A 1QKIA 3PQ2A 1RFGE 4OHFA 1VB3A 3NBZC 4X94A 1G20B 2V9PA 4MUMA 4CF4A 4L8FA 4AKHA 2O8FA 3KK0A 3BGOS 3TD9A 2CN1A 5A6SA 2O5VA 2Y3IA 5HX7A 2M32A 2QQ5A 2NAFA 1JZTA 4XDHA 1G5TA 2HEGA 2IOHA 1Y4DE 4F04A 1Y6RA 5KX5F 3P20A 3K5HA 4D9MA 1FU7A 2E4ZA 3C6QA 3PICA 5JAZA 4X8LA 1IH8A 2J7PA 2LCIA 2ESRA 2ASEA 2HU5A 4J3FA 5C31A 5K3EA 1JPVA 3BHNA 6ABPA 4FM9A 5EL0A 4XXHA 4DRZA 1ZKDA 5E1MA 3K09C 3PC2A 2BM1A 3IALA 4DNTB 3ISJA 2JVKA 3PR2B 3Q3AA 3AY3A 1Y7IA 2O8NA 2E87A 4UMDA 1P91A 3DR5A 3NATA 2RHWA 1U7OA 1U2QA 2QTVA 2XBLA 5BR4A 3FMFA 1UK7A 3GLVA 1EVEA 3PI7A 1VJ1A 4V39A 1SCNE 1L7RA 2Z5GA 2ZAMA 5BOVA 2BD0A 4N3GA 5DNUA 3UJ7A 4WUVA 2I7DA 3E7WA 3VSBA 3I9LA 1CD5A 1XVAA 3CE9A 4HNSA 3MXTA 1DCKA 4PR3A 3RU2A 2HLNA 2AXEA 4H4EA 1AUVA 4R84A 3K2EA 4RK7A 4GS5A 3RVKA 3FGOA 4BO2A 4DN6A 3PA8A 2IF0A 4HV4A 4KGDA 5A06A 4CKWA 1ZOIA 1NQUA 1GUAA 4UC0A 1F5SA 3EZ2A 1SHZA 1Z8DA 2DF8A 2PX6A 3G89A 5K3BA 3T5PA 1E3MA 2AZMA 1K7EB 1RXEA 1ZMXA 1YRYE 3RR2A 4RDKA 2VHEA 4DA9A 1ZS9A 5KQSA 1V6CA 4YUYA 1XZCA 4WNCA 3A9TA 3V9AA 3JRWA 2B4YA 4PQEA 1MF7A 3PQ5A 3NTQA 4HNGA 4BP8A 2EJBA 1DELA 5IEJA 2HCRA 3MZ0A 3BM5A 4G8DA 2QX6A 1EHCA 3NHSA 3VNAA 2COEA 2QM8A 3KXLA 4R9SA 4LK3A 1O0CA 1NKVA 2DWCA 1G5IA 1MAUA 1DB3A 4ZOQI 2ZRJA 3AV0B 4LOIA 3ZTTA 4L73A 4AVYA 4D4JA 4YX9A 1BNCA 2G1KA 3WGJA 3ZK9A 3CD6B 1WEHA 4G5HA 3GAMA 4UU8A 5C18A 1EX1A 1ZGGA 2XB4A 1YZHA 3BJIC 5DM0A 3PX3A 3QEMB 1HLGA 1HTBA 1Q0QA 1W94A 1XZAA 3Q98A 2EZ8A 3QM1A 1E4EB 4MWZA 3MQFA 4BMZA 2OVFA 4IRXA 1JR6A 4DAEA 4NVRA 4GOKA 3GVIA 3DMRA 1ZCAA 2A14A 3F6BX 3WADA 1JDBB 2GPBA 4JBYA 1JXAA 3H2JA 1JVBA 2O50A 3HU5A 1MH9A 4JT8A 4RS4A 4NYJQ 1FRFS 1GAJA 5LBUA 1FFXB 3IELA 5DW3A 1GDTA 2FW8A 3QFSA 3KT6A 1I3MA 2FTKE 4HXGA 1I1OA 3IRVA 1WCV1 4TMKA 1KR5A 3KE8A 2YJ6A 3NBUA 3EPKA 1ZXXA 3VV3A 3B5JA 3COJA 2PT6A 3AT1A 3KJNA 1IQPA 6REQB 3EGEA 4UAVA 3ESZA 1MEEA 2PKRA 1TCBA 2XTMA 4HC4A 3IQGX 4HN9A 1DO0A 1VPVA 2RJOA 3KT8A 4CTNA 5KNCA 2PMDA 4WUTA 4GI3A 1LX6A 3WQSB 5AUOB 4RORA 3SOPA 4AY5A 3R40A 1J21A 2MSDB 4Y1EA 2IGBA 1EXDA 5G0SA 1M2NA 2PYIA 1VE7A 1TDJA 1SIUA 2WYIA 3W4IA 4BBZA 4CFYA 3PGA1 5K6AC 3PQ3A 5AW5A 4IV0A 5JNUA 1PJ5A 1V9LA 2P2GA 2RBGA 1X80B 2ZYTX 4H4DA 4UNNA 3RFUA 3KT3A 1U81A 4P2GA 5FOUA 3WTCA 4E5NA 1M1YA 4KC0A 3FFWA 3ZUPA 4Y1FA 3WC4A 3PFBA 4WE3A 1YL6A 4WV3A 5HIKA 5E3IA 5TLSA 5E6TA 4EFLA 2WWHA 3HCBA 4XRGA 4BS9A 4CIVA 2EG5A 5A8AA 1UOOA 3C7CB 2PSHA 3EY9A 2MIIA 2Z9BA 3TGPA 1P5RA 4MTLA 4ZARA 3RVRA 5BUQA 1L8QA 5C5IA 5DHQA 5DN9A 3TUZC 4YACA 4TGLA 2GBGA 4B80A 3G2IA 4NH0A 5FP0A 4LZNA 2ONCA 4HH1A 1M8PA 2UYQA 4RSRA 3E53A 2UXDB 3E0XA 1V9SA 3I58A 3OKXA 3PJRA 3DBRA 3ZIDA 2W2MA 3O7MA 3SEAA 1FLAA 2OGSA 2Q0HA 5K0NA 1HORA 4L07A 4ZP1A 5PGMA 4C07A 1B42A 1E7WA 8GPBA 3GP5A 3G0IA 3OZFA 1JIJA 1NSFA 5DLEA 2BHRA 1M2OB 2IKQA 2ZE6A 4P4LA 3AI1A 3OW7A 4Q19A 3RJMA 2TYSB 5FUWA 4CT5A 1BX3A 2FFAA 4Q05A 5DTJA 1KMCA 5B1DA 4I4CA 3V1MA 2WAMA 4HT3B 1NT4A 3R9WA 4DA0A 3WLMA 4MARA 4GL2A 3AC0A 2LDBA 4HB0A 4AO6A 5EJEA 3H87A 1PLKA 3G4SB 3BDAA 1K8AD 1C4OA 4DTCA 2AEMA 2GETA 5M2QA 1E3DA 2BMAA 3PXEA 1OTXA 1RJDA 2Q99A 4LG1A 3EF3A 2Q9BA 5ADUS 3T1TA 3ZBUA 1EZ1A 2FMKA 1ZLXA 1JECA 3L7CA 1S1MA 3SC3A 1NUSA 1KY5A 2YUTA 2HMAA 1NJGA 1KETA 2O6HA 4R1OA 5CVUA 3PFWO 5AUQA 3KQKA 4R1UA 2HU2A 4YJFA 1YE5A 1YIAA 4RVNA 4B6RA 5FT9A 3EISA 2ZBVA 5BSMA 1P9OA 3G2KA 3PGLA 3GYBA 3RFTA 3HK2A 2XNKA 4TLAA 2GZ1A 3AW9A 2OAGA 2IZOA 3VOSA 5JJIA 1US8B 4JVMA 3JQBC 3EQ2A 4JVNA 1A0OA 1K89A 4LJ5A 3FVVA 1WHSA 2VPYA 4YGYA 2PR7A 5AOCA 4AJLA 5HXBA 2E4AA 2Y1LA 5CB6A 2YWRA 4L6AA 1SA0B 2DQYA 1BXGB 3OA2A 4NONA 1UZAA 4YDHB 5CVEA 1W5SA 3V4FA 5AW3A 1GR0A 4F0JA 2H0AA 3VTFA 4UDXX 5IAJA 1VP3A 3AM1A 1KEVA 4GQNA 1PFYA 2Q4DA 3VDMA 5T4FA 2FMXA 3DT8A 3VHXB 2JLXA 5BQXA 1FMLA 3LPMA 1R12A 1P62B 1CUWA 3O6VA 5T6BA 2QUJA 5CDFE 5DI3A 3UJ8A 2C5HA 4CKCB 2YNMC 3WWCA 1W93A 4QUDA 3QE9Y 4URHA 3P2MA 3KXDA 3WL3A 3N74A 2QGNA 2VTBA 1JEAA 3RFXA 1U7HA 1Y8RB 4LQ4A 4OHKA 1Y48E 3S1AA 1H6DA 3WFIA 3CR7A 2DPMA 2I3BA 3SXUB 1G8SA 4CQMA 5I8ZA 3VNVA 2MT9A 3QXHA 1IOWA 4NDNE 4XM1A 1XYYA 3QKSB 1HQCA 1VSTA 2G70A 2XF2A 3P4YA 3SXUA 4QLOA 1DBWA 1EWQA 4MSUA 2HMWA 5JD6A 1UWVA 3C74A 3SXJA 1HFJA 3T7TA 4XQEA 1H0HA 1CJKC 1EJBA 2H5JA 4UTOA 4XQGA 2DLCX 1SVSA 1EFCA 1ESDA 1U04A 4R5MA 1V1RB 5ERYA 5EJ7A 3TF5A 2VHTA 3LX8A 2B5OA 4MWBA 3H0EA 4WSOA 3TL6A 3B82A 1VCHA 5JALA 1E1NA 3O4IA 2QPAA 3CLKA 1U31A 4D46A 1VL5A 2B2XA 2LPMA 2ZSHA 5LYJB 1D2CA 5DCYA 1KRWA 5TQVA 1U9CA 4HNRA 1E3SA 4M88A 3SQOA 1RRGA 1UM9B 4EYEA 5LIRA 1GRVA 1C80A 2IOYA 4AMBA 4HX2A 4FGZA 2YDXA 1EM6A 3PRHA 2F3QA 1PZGA 2J9FA 4UM9D 5DTRA 4ZCPA 1DAOA 4YHBA 4LYDA 5L3QA 2Y0PA 4M22A 1G98A 1NE2A 4E0FA 4XUDA 4K0KB 4KMSA 2XZTA 3DFUA 4MTCA 2R2AA 4WXHA 1XDWA 1KS9A 5PNTA 1VIDA 2C3PA 5FLYA 3MLBA 3HR8A 3JQ7B 1G2QA 1DT5A 5F4ZA 1GQSA 5CURA 4EPXA 1M75A 1XP5A 1Q7EA 3COVA 1VRCA 2ZZFA 3DTVB 5FOXA 4BU1A 4KFTA 1AHPA 5CYOA 1ULSA 4WEQA 1NSYA 3L6DA 2CBGA 3DZKA 4MICA 2IYZA 4IYRA 5DWQA 4R2MA 4MRMB 1XYVA 4G8JA 3LUBA 4WFKA 2AFHE 2OZPA 5BSFA 2JI8A 3P0JA 1APBA 2IUEA 4IIXA 4G2NA 5KYXB 1FU8A 2F59A 4NJMB 5DE3A 4L76A 2QG6A 2Z95A 3C45A 2IX9A 4XCQA 3K9FC 4RIIA 5ALTA 3K0SA 3A8IA 1A76A 3TSCA 5J43A 3FOZA 3ZDEA 3WDLA 2XGSA 1RAAA 1UDCA 4I55B 2W2XA 5FBZA 4B3BA 3GJ6A 4YC7A 5BP7A 4CF7A 1HF3A 1H66A 1R16A 3BXZA 3ZZTA 3QE0A 5TQJA 4L9AA 2EJTA 3ERCA 3MCZA 3GNLA 4QPCA 3NHKA 4D6PA 2JPDA 5J5CA 2BSQA 3Q10A 2PZ8A 1EFTA 3X1WA 3M9LA 4CUKA 4BNJA 4OFBA 3TGWA 2Z3ZA 1MD9A 4ACAA 4X8IA 4OYYA 3SEFA 3HCEA 3U1BA 4KE8A 1ZJZA 3UB4A 2J4DA 1YCGA 3UGQA 1G8HA 1JYFA 5TQ0A 3MFQA 1NRWA 2ODNA 1CHDA 2ZIXA 4RZQA 3CNHA 4QDOA 3AU9A 1E99A 3WWPA 2LRHA 4I1RA 2FVYA 4KR7A 2F62A 3MA0A 1NP7A 1XDDA 4PRKA 4AUKA 1RC8A 4BJ5A 3LTNC 1G6Q1 2CXUA 3C3BA 5G40A 1U2RA 3HHEA 3ADOA 5D6NA 5ERXA 3BWMA 2WINI 4EI2A 3NIBA 4XGRA 2G9RA 5JARA 4KSBA 1U8YA 4ZO4A 3CEPB 4B2LA 3GPDG 1VQPB 1YJ8A 3BEDA 4GG1A 1II8B 1YHQB 3HP4A 1A9XB 4NJEB 4NRDA 3LPDA 4GL4A 4E6PA 4I46A 5KSOA 3I9V6 4EHHA 4QTUB 1L5NA 4XONA 4JZKA 2HLDA 1A9XA 1V5IA 3DT9A 1AQIA 3DZGA 2HWKA 1Z6PA 1GRRA 3AK4A 3KYCB 4KV7A 4I14A 1DQZA 1MLDA 3MINA 3EIEA 3N75A 4J3NA 3T5CA 4DDKA 4RF3A 1QO7A 5FNVA 1P2FA 1R6XA 2R3SA 1E5VA 1ZK1A 2IHYA 2GD0A 2ZJYA 3DTVD 1XRPA 2DY1A 3FUVA 3MINB 5ALEA 3ZXSA 3ZHSA 1WMDA 4J6EA 4DRXA 1C50A 3ZPNA 2WU3A 2ZBQA 5CIQA 4NBLA 2ZE5A 4IF4A 2AOUB 4OJQA 5EPOA 5KQMA 1CR4A 1ZRMA 3OOEA 1DRUA 2O2CA 2VUIB 5CXXA 4PAOA 3LIPA 1RXYA 2CXPA 4K9LA 3MEQA 4OJTA 4ZALA 2OR3A 3SDSA 3T3MB 2AS0A 1Z0ZA 1GN8A 3KPYA 3TW8A 1HZZC 4C6RA 4Z1OA 3L93A 2IZ5A 5GZ6A 4KXQA 3X2EA 4DR5B 2NYUA 3FZNA 1Z4IA 3OLQA 1GGVA 4D4IA 1KTIA 3TBFA 2FW7A 2BMEA 1XNRB 5JLAA 1J0XO 3PLAE 1N6PA 1BPLA 1OXBB 3HV2A 3RKUA 1SQ0A 2TSYB 3OMWA 4DA6A 2CNKA 4E11A 2L42A 4WINA 2ECQA 2OTLB 5A5FA 1OFVA 1FJHA 1N6LA 5DNAA 1XVIA 1KI9A 5EHGA 3VH3A 5GVSA 4TSFA 5CIYA 2PU5A 3AB7A 4HS9A 3CCEB 4Q37A 1FLVA 2ZTVA 4Q1AA 4OI4A 5JCJD 3V4PB 6CHYA 4B3FX 2QZ9A 1X7ZA 3RT7A 2PS1A 4MYUA 1VQ8B 1N2BA 4JI6B 2YOHA 1WEKA 2FPGB 1QGOA 2OYCA 1FDVA 2UZ0A 4CKZA 4GRAA 4UHFA 1SKAA 1ZWKA 3CEMA 4CL2A 4ICIA 1EESA 4Q9DA 5JFOA 5L6MB 2QTFA 4GI5A 3C3CA 1IHMA 4OFXA 5AVYA 5C8ZA 3PC8A 2YXNA 3DHWC 4IDAA 1BIFA 4J91A 1AZSC 4DLZA 2BFAA 3RYHA 2IXEA 1T2EA 2GZRA 2EHDA 1A5ZA 4C2UA 1GSHA 4HG2A 5DM60 4EK9A 3G2MA 2G77B 3A2LA 3WR5A 2X2OA 3JALB 1E1CB 4HDSA 1PZXA 4MMZB 1KAOA 2OWEA 5AO9A 3BWDD 2WR8A 4FEEA 1H4SA 1CY2A 1M8JA 3PB3A 3ZJTA 1D2HA 4HQRA 3SJ7A 2PS3A 1E1CA 4KXUA 4M0FA 4LHWA 1WXXA 3MTQA 3TAXA 3FIUA 4RPIA 3CLSD 2ECFA 3WB2A 4B5LA 3TLBA 2F90A 1QS0A 3GZ4A 3WJ2A 4Z4YA 4QPNA 1H9AA 1AHNA 3GMSA 1KS2A 2JI9A 4CHTA 3R5KA 1FRNA 5KU1A 5DXJA 2AL7A 1P1CA 2H07A 2W2VA 3QNWA 4JNCA 3D3WB 4IP0A 2Y8EA 4QDZA 3SS8A 4IM7A 2DJ5A 2F1IA 1JV2B 3EUAA 4KDCA 4P5DA 1VFNA 2ZE8A 1PDWA 3IC5A 4QFBA 3STUA 4BCDA 1P0IA 3BE5A 1T4GA 1X94A 4YP7A 3UTCA 3T4PA 1X7ZB 2UYGA 2CRVA 4PF1A 5ALMA 2XOKA 1XQVA 3VAAA 3NXKA 1DAMA 4RK4A 3PXBA 3DBOB 4PHGA 2A33A 2PQ2A 4BGEA 4ZI7F 1ZUHA 5BQFA 1L4KA 2R6HA 2FMTA 4FEYA 2OQRA 3REFA 3VYUB 1XCBA 1ZGAA 3LC2O 1IVSA 4JP3A 3HNOA 1CRLA 1F0PA 2PX8A 1G21E 2G5CA 2Q3EA 3P2JA 4HN2A 3ZGXA 4V02A 4A91A 4YCNA 1AH2A 4C0WA 2VXBA 2ZVQX 4U7GA 3PU6A 3VPFA 5K0ZA 3K6SB 4IIJB 2XNDA 2WU1A 3EVBA 3DF7A 1Q1GA 4F3NA 4X93A 3JALA 4PXSA 5LCXA 1MAAA 1J90A 1ZA2A 3H75A 4KBFA 2N0SA 2DXIA 3B1YA 4KFSA 3PXAA 1ZEMA 1YHYA 3HY6A 3FCOA 2CY0A 1RR6A 3H1TA 1I36A 1LPPA 3BPSA 2FZKA 3TOVA 3JQFC 3TR0A 1HSOA 2R6DA 3P9XA 2F55A 3V00A 1RLTA 4AF8A 2HSGA 2DQZA 2XMDA 3TBKA 2J8ZA 2ILVA 5JS8A 3GRKA 4J7CA 1VOTA 3C43A 1DJNA 3GZNB 4YQYA 2V0CA 1JSLA 1KZLA 4L95C 3ROTA 1TYEB 1N9KA 1UP7A 1XJ5A 3JQ8A 4PC7A 2DWUA 1BGVA 3RUEA 4MINA 3UK2A 1CZUA 2FXIA 4XM3A 3ZDDA 4RD2A 1WR8A 1FNSA 2VP5A 2ZVPX 1V48A 2JJ1D 3H9CA 3RSOA 2ACVA 4GQAA 1XA3A 5C5EA 1VIAA 2HNAA 5HHTA 4M8KA 5TDHA 1YHNA 4BX3A 4C29A 1EGAA 5KQRA 3ZK8A 1K06A 1SRRA 2D0OB 3GLHB 621PA 3E15A 1T9HA 1TLTA 4MVJA 1UPAA 4ZMSA 1GPLA 5CW1A 1G3MA 1FBTA 4QVJA 1H94A 3R41A 1U2ZA 7REQB 3K6SA 4ZXFA 4L5AA 5AM4A 4NLLA 2OG1A 2P5TB 4RIGA 2BEWA 2PT5A 4TLLB 3FWPA 3DDSA 2OA0A 4KPUA 1DZIA 4BHTA 4YJ3F 4QYIA 1TTQB 5H9WA 2ZTMA 1N2HA 1QP8A 3RWOA 4MQMA 3GCWA 1PN3A 4M21A 3GLSA 4LQLA 1P7WA 4BQQA 3LNNA 1EB9A 1MXHA 2NO7A 2PTHA 1JBKA 2A9JA 2IOFA 3MRVA 4IHQA 1ZRSA 4F4HA 2W71A 2ZTNA 1UZLA 4R2IA 3K92A 3SYTA 3A6GA 4HN4B 4OB6A 3VU9A 3QTTA 5ENZA 4OBXA 4RA6A 4L0CA 3LYHA 5C5DA 3UV6A 2ZR9A 1JEQB 1Z0FA 4Z4FA 3UANA 3HB1A 4C4SA 1T2AA 5IFKA 2W6CX 3VBCA 4F96A 4JJEA 4XGQA 1X3SA 1L9XA 1UKVY 3ZXIA 4EG3A 2FW9A 3HC7A 2A5YB 4JLMA 4O4IA 2E1BA 1XWFA 4FX2A 5JPDA 1R2QA 3V2GA 3ADBA 3QX3A 4NOKA 4LBWA 2FEXA 2FV8A 4KVGA 4P4GA 4ZEWA 4F56A 4IVQA 1Q21A 3P2YA 1Q15A 4HWKA 1GT91 3D6NB 4XYGA 2O8DA 2ZZKA 3E9QA 4WBNA 1R00A 2ZJOA 3BSYA 3FX2A 1B16A 3I05A 4BMNA 2FWAA 3DKPA 3I4CA 2QGFA 3R20A 2F2TA 4P80A 1Z7EA 3SD7A 1Q3KA 2NT3A 2WTEA 3V2UA 4EDHA 4F4UA 1ADFA 5E6RB 2Z5LA 3MUEA 4DCJA 2X6TA 4ZFNA 2H1HA 2FOXA 1WPGA 3LT0A 5EMJA 4F4IA 5KNBH 5E6RA 4LMAA 1EWVA 3O4GA 4CLDA 1LLCA 4D2IA 5EWMB 3V6LA 5KQPA 3FW1A 1GO2A 1VP9A 3JWHA 3EIWA 4AP5A 3G8YA 2BEVA 4MMYB 1QO0A 5A5EA 4U8HA 1DTWA 1UK6A 2KHZA 1SHKA 4ZQHA 4DKXA 1V3VA 4ENSA 4KTVE 3KSDO 4FZ3A 4ZKEA 3RK4A 1ZJYA 2NTYC 2V7QD 2HUNA 3MK31 1NFRA 2PZLA 1B6RA 4OQ4A 3DAOA 2O8EB 1H4VB 3FVQA 4TMWA 2Q1UA 1CCWA 3Q7QA 3O92A 4AMYA 4DW8A 5I7FA 1F48A 4YECA 1LH0A 1V5VA 1Y7HA 4IJ5A 1Z63A 1M5RA 3HB7A 3R0VA 1URPA 4X6XA 3GN1A 4TMYA 2JZCA 5BYBA 4MB6A 3COSA 1PK7A 3BRQA 5CRIA 4MDEA 3E3AA 3K9QO 3NO4A 1QPGA 5D84A 2O8DB 4DY6A 1V4BA 1W5EA 3NBQA 3PA2A 4HK4A 5JZOA 1RWQA 1LY1A 4BB0A 2NGRA 4P8RA 2IODA 4PO9A 4RVUA 5HTOA 1MA0A 3WLRA 2FF5A 2PA0A 4MAAA 4BMOB 1GU7A 1T5IA 5IH7A 4G0XA 1H0RA 2JLUA 4RK5A 5HKOA 5HUJA 1MW8X 5EKXA 4FBMA 3BXEA 1N8SA 1RZVA 3D8BA 3LY8A 3T15A 3K9WA 1XAGA 5MGBA 5TVGA 3UFXA 3UA3A 1C9KA 2XNSA 4MVJI 4LC0A 1OXVA 2ZJ2A 1XPJA 5EIEA 1J0BA 4LC9A 1AKWA 2D1FA 4X5OA 1CYEA 4WT7A 5B4VA 3N87A 5D5HA 2VK2A 5FWYB 2ECKA 3NWBA 5CCBA 4M1SA 4P31A 3V4LA 4TKVB 1UKEA 3MQ4A 3FBGA 4LJYA 1KHHA 4C21A 2XRZA 3NKVA 4LMBA 2JJYA 4GDFA 1L6IA 3ZWAA 1Z15A 3CMMA 4X07A 6GPBA 3S6JA 3NHJA 3MC1A 2ZIZA 1KY2A 2G0AA 3WGMA 3UKDA 1FXWA 1O0SA 1DT3A 2E85A 2QVCA 4HJRA 2GVDC 4MS1A 1JILA 3VGJA 4MUFA 3DZJA 4X3CA 3ZKWA 2FZCA 4NE7A 1GTVA 1Q7YD 4DA7A 4PO8A 2ORED 3KZNA 4WNAA 2JGMA 3MPUA 4I3HA 3VU3A 4GMGA 4J2OA 1EK1A 4O4HB 4IF6A 5CB8A 2YFKA 2DWQA 4MWEA 4POAA 5JAOA 3G8AA 3T7IA 3ZBPA 4CJXA 4D9KA 3ZZ0A 2YINC 1F8FA 4O4JF 1DLIA 3BAZA 3DL4A 1YOVB 4DDUA 1LVGA 4WKPA 5DLQC 1K8XB 3MN1A 4MZDA 3VNUA 1CJSA 2QRKA 3JAKB 4FJ2A 3SE7A 1QHSA 2BUAA 5AKKA 1N9GB 3QXCA 4MO2A 1QFZA 4UPEA 2GM9A 2W2KB 3IT0A 3SQMA 2O14A 1I2BA 4Q34A 4YDSA 3T34A 1MHTA 2X5JO 3KKEA 4CNBA 3FWKA 3BJMA 3HA2A 3MTDA 3IT2A 4EHNA 1ISHA 4G4SP 4ND6A 2YFQA 3QKRB 3SN6A 3OF2A 4KSYA 1EDZA 1YDWA 2BY4A 5FO0A 4H15A 4QWWA 1MC4A 3LOUA 3GGDA 1X1CA 4UTXA 3OZUA 5J23A 4L72A 1WX1A 3B3JA 3R6JA 3PJEA 1CY1A 1FNBA 1N1DA 1B76A 2ACKA 2A1TR 2Y92A 1QOPB 4DMLA 2YWCA 5JT1A 1XL1A 4MCAA 5KPDA 3MCTA 3D6UA 3LQ4A 4TUYB 4ZODA 3HXQA 2O4CA 1PQWA 3K70D 3EPJA 2H57A 2ORWA 4DNPA 4RZSA 4BLVA 1J1UA 3WK4A 1R0CA 4FIDA 4LVOA 1EA7A 1SCDA 3GCZA 1TO6A 3KXKA 1EJ6A 4NCNA 5CPBA 3HBMA 1US8A 3DOJA 5DFAA 1G59A 4NPAA 2QRQA 2VRCD 1EBFA 2RSLA 1HDZA 2I33A 4N5LA 2OP0A 2XZDA 3KR1A 4PXYA 1FU4A 4G4GA 5B36A 1WY7A 3H9EO 2LXNA 2PUVA 4B79A 3L0DA 3PUZA 2HJHA 3JAKA 4LWZA 4H1TA 4HR7A 3UVEA 4I3FA 4XB1A 3G71B 1ZN2A 3LPLA 3U48A 1WOMA 1QOQB 4YRIA 4EG5A 3O73A 1I32A 3PVZA 1QDLB 4NBRA 1FDRA 2FUG1 4JROA 4Y1RA 3ZGNA 4DZZA 3R0QA 4C87A 1QIHA 1Z0UA 5G3YA 4KWTA 1ACLA 4TZ6A 3DE0X 1JKJA 1ND5A 2XE7A 5TS3A 4OAPA 4FDAA 4WLFA 1RMQA 3LX5A 2ZBPA 3OIUA 4E21A 2ZRDA 1X87A 1WKBA 5DBIA 2IU0A 2AOVA 4YCJA 2C4WA 3AUAA 3DVAA 5CX4A 2PDAA 4Z54A 2I03A 3SQDA 3U3ZA 3VKWA 1RRPA 1H5NA 2YCLA 4OHUA 4ZPJA 4IJWA 3JQAB 5JC8A 3A0UA 1S7GA 4OQXA 4X05A 1TUBA 3C1OA 1Q77A 4ARZB 4OP7A 2H4YA 2VDNB 3EXEB 4MUYA 4GZ3A 4ONEA 4S3MA 2W2KA 4EF4A 3DYBA 3N2EA 2H1CA 5HZKA 4S0XA 4NWIA 1BEEA 4ZOEA 1V3QE 1EHIA 2FK7A 2Q07A 2QQ0A 4P7KA 5FXMA 1FA9A 4Y67A 3R6DA 4R8MA 2I4TA 1WXDA 3RG2A 5BV7A 3DMHA 5HIAA 3CUTA 4F86A 3UEOA 2Q6OA 4D0SA 4HGYA 3U4GA 1D09A 2CLOB 2MMGA 1G8MA 1PP4A 4H7IA 1QYVA 3R6KA 1MEOA 4JA0A 3HVRA 4EKEA 5EJ5A 3RVOA 3BRWA 3OU7A 4BMDA 2GJRA 3CRRA 4REOA 4CG2A 4MRPA 5FHRA 3ZLTA 1JSZA 4WCDA 1BZYA 3AG5A 4FYVA 1L6RA 3HLKA 2ZT7A 4CUJA 4KMOA 4H9GA 4A36A 1N34B 1TQ8A 2Z3WA 1IUPA 2J9XB 5JCXA 4WK6A 1TM1E 4BP3A 5HQ3A 3ICCA 4KRXA 2OFOA 3RCBA 1NR5A 4CGZA 3I6IA 4XUCA 3T3PB 4DA8A 3Q15C 3SKBA 1GL9B 4EAQA 4QGHA 1N5MA 4AG6A 3MBIA 4CPDA 1IK6A 3GLIE 2R7AA 2FWRA 4BFLA 4AK9A 2XCIA 2LKCA 1ZY2A 1ZNXA 2PUEA 5JTUA 3BRCA 3HMQA 2O5EA 2OCPA 2O5CA 2M6KA 1LGYA 4ZANA 5EFZA 1GA4A 2ZUUA 3F1LA 2IYVA 3HSKA 3ZU4A 5HM6A 2VF5X 1N78A 4LHEA 3G85A 4QOSA 3P0EA 4CM8B 3V33A 4DXHA 4YNBA 2C2ZA 4ZQCB 1VQLB 4FNOA 5GMOA 1GFZA 2IY8A 3LWZA 5G0VA 4YREA 2QVBA 4W6ZA 3ZI4A 2KI5A 4RY0A 4IUBS 3IKTA 2GM5A 3C8ZA 5EGSA 2QGZA 3EJ6A 3KJHA 2KBFA 5AW4A 2C0QA 1UH5A 1B3BA 2V96A 3E3OA 2Q6TA 3L07A 2MSEB 4LYFA 4OK6A 4TTIA 3ZW8A 3M7IA 4QYMA 2OFXA 2WAOA 1BVUA 4HDRB 3AILA 3WQBA 3QJGA 2RGRA 1KKMA 1MJNA 1NTRA 2R7NA 5KOJB 3ZWCA 1FXUA 3IFSA 1T5DX 4Q7MB 2VAXA 3KG2A 3FR8A 5KJCA 1GZUA 4W4TA 3W0LB 3TZEA 5JFGA 1QIJA 1RJ9B 5CAEB 1XQYA 1M2VB 1T36A 1RI3A 1WSAA 4RDLA 1PCXA 3AVYA 1WKVA 3JYLA 3WIUA 4QELA 1K7FB 1EJ2A 1VHJA 2GILA 3QEBZ 4IUYA 4L02A 5D01A 4YMTA 1KARA 3F9RA 5BR7A 3B7PA 3I04M 1E1RD 4D8TA 1Y4ZA 1OC4A 1W0JA 2X8KA 2DKFA 4PLFA 1QVRA 4Z0HO 3T12A 4DJAA 4OKNA 4H7HA 4KH0A 2KPOA 2V3VA 4EUSA 3ZWDA 5JADA 2WD9A 2QN6A 4FXOA 4I1VA 3WG9A 3CR3C 4N6OA 3OPQA 2OY0A 2WIAA 3GEIA 4BATA 1ORVA 2WZCA 4QSMA 5ALHA 1ZN9A 4TN1A 1GL6A 1UFRA 1XO1A 3GAZA 1QUEA 4RZUA 1CR2A 3HN2A 3CU5A 4E3WA 4EPRA 1TPZA 1JEOA 3MB5A 3TEFA 1BDJA 1Z45A 2NXNA 1ENOA 1FS5A 2YJ4A 3RS5A 1JIXA 3SAJA 4BFXA 4EWLA 2RG7A 3WLIA 3NI2A 4YCCA 1UOPA 1Z2AA 4A82A 3FCEA 5E7QA 3RS0A 2BFNA 1SUIA 3OT1A 4OP2A 4CEJA 5GV7A 4DWOA 2J5RA 5HZAA 3F46A 4BC0A 5BVGB 1YKFA 2OOSA 4PFJA 5K2OA 5DDIP 4JJAA 1M54A 1QMPA 3AIMA 3LBHA 5FPPA 1X0VA 3C7AA 1QCCA 4EHDA 3MM4A 1L8XA 3GUCA 4ENRA 1XZHA 2UKDA 3AUFA 2NVWA 2EFHB 2Q41A 4FPXA 4JENA 4N8SA 3O4VA 4O1IA 4UU1A 3TW8B 4L0DA 4Z0NA 1WU7A 2QP4A 3DFIA 1WV1A 2EIHA 4UZSA 3ILSA 1CVIA 2R84A 1DKQA 3N8KA 4X3PA 1BHO1 3ANSA 4UPDA 1SKYE 1E6WA 2P6MA 1NDHA 2ZB8A 4TROA 4DB2A 2HREA 4ZGWA 1J2EA 3BMNA 1ZI9A 5TMBA 2J3KA 3GA7A 4KQWA 5DVZA 3P9QA 4HAVA 2B8EA 4I6EA 4KLAA 2FFBA 3V9PA 2OTJB 2Q3CA 1XPUA 1YT5A 1EVKA 1M8KA 3KSAC 1SMKA 3E9DA 4LYAA 4U7PB 5AXCA 2VH1A 1I6LA 5IJZA 4KMRA 2DHEA 5CA1A 1ZSYA 2NQTA 3K70B 3JYOA 4CLRB 3RKSA 2FCAA 5TV2A 1KF0A 3DHYA 1C1XA 1Y9EA 2FPGA 3A7EA 1P73A 1P8JA 5E9QA 4DLYA 3ZCXA 4ZYXA 3DC2A 1WNTA 2ZIFA 2YR0A 2IV7A 5BYKA 4JN6B 1HFWA 2QUBA 4NSNA 5ALKA 3STYA 4RY2A 2FVGA 4XLFA 1UUFA 2C9MA 5EEHA 3WNVA 4EX6A 4QUIA 2ODPA 3GJ8A 4I5EA 4PNHA 3CPJB 2H7CA 2EP5A 1W9HA 3E2PA 3ICEA 2EX0A 3B1JA 1T5EA 1N3YA 2E5FA 3Q2KA 4IGAA 2M2IA 1GG8A 2OCYC 4Z4EA 1XB2A 3CTAA 4HHEA 4DLSA 3JQAD 2PYZA 4OQEA 3NC1C 1PD0A 4IDHA 3LT2A 1E6MA 4FINA 4B83A 5B3KA 3FDXA 2FLWA 5EZSA 3S4YA 3FPAA 5B3AA 3HVKA 5D8DA 4WFQA 4I4LA 3COPA 2XUDA 4QAJA 2C7OA 2FZ5A 4JJ8A 4JUIA 4XQCA 2F43A 2TMKA 5KYUA 3KLPX 3I52A 2W6QA 2AJLI 4Q3DA 5ECWA 3ROXA 3X1YA 3GJYA 3IEMA 2HN9A 4RMHA 4YP1A 3LTEA 1EXMA 1ZGHA 1JJAA 2CNWD 4G84A 5AI6A 2EX1A 5KJFA 5FFMA 5KTTA 1NN1A 3CS3A 3HTXA 1C7JA 4FCVA 4CIXA 4ZQBA 1XJ0A 2AOTA 2HQ1A 3AONB 1XQBA 1O7JA 3LRTA 3IBSA 1BVYF 1TUEA 2C1XA 3PUIA 3QLUA 4YBZA 3REOA 2V5VA 3V1KA 1NUAA 2HRDA 4BIIA 1GZSA 5C4IA 1KYYA 3ZU5A 3TUJC 4M60A 2JI4A 3ZUGA 1OXMA 1XQ9A 1WA5A 2RARA 3C3XA 5DEOA 5JWRA 3R6LA 4BDTA 4DQDA 2YY7A 1E2DA 3VHQA 5KSPA 1FSPA 3PVCA 2X0NA 2OK8A 3OCJA 1ZL2A 3DB1A 3PUYA 3CRMA 2JGLA 3KYIB 4YXWA 3RQIA 4PZEA 1NVDA 1JPUA 4ZCMA 4BVBA 1NRIA 3V32A 1D2RA 4KKUA 1IHDA 3CVUA 1Z22A 2RHOA 6NULA 1NLYA 4W1RA 4Q7EA 3ODGA 4IQ4A 5CK4A 1Q83A 2AWNA 3ZE8A 3LT5A 2O8FB 1GNRA 2ZZEA 1V5FA 1Z13A 4V0ME 3GLTA 5EHNA 2VHJA 3FNGA 5KYGA 1IY9A 3P2EA 1VYVA 3CZ9A 4BBPA 4FGJA 1C4KA 2OZEA 1VJTA 3BT7A 2NV4A 1Z0DA 3E1GA 2NU6A 4LJ8A 2R85A 1UFQA 4QATA 3DYIA 5SZHB 3H8SA 3A6FA 5TT1A 2QRHA 2YN0A 5JS7A 1SIOA 3R5FA 4FT2A 2AD1A 4Q7KA 4ND8B 1YR6A 3KKMA 2CNDA 1T3LA 3T3NA 2C4VA 2I76A 1QORA 1OWNA 1RFLA 1JHAA 3WOHA 5EJ4A 4FYHA 2DSTA 1EFHA 2OYNA 2ZTSA 3B2NA 4LKOA 1UL1X 5DISB 4P4SA 4LNHA 5FDFA 2XYRA 2ZU6A 4L51A 3ZYZA 4U63A 1QFXA 2CCKA 2FEKA 1Y6ZA 1R6DA 2G67A 4BO4A 1BH2A 4B76A 3M82A 2VQEB 3I2HA 3SEJA 1L4MA 4WNYA 3R75A 5KNBD 4Y9UA 2WNSA 3X2FA 4CG0A 4BIMA 4G1CA 5B7PA 5HKKD 3UICA 3TM4A 1KHTA 1XMPA 1O58A 2LIPA 1JJVA 2QS9A 2AN1A 2D06A 3IHLA 2HPHA 4A5OA 1BRMA 2GN0A 3BHJA 1OCEA 3SICE 3E9ZA 1A4IA 1AV7A 4KPUB 4A0HA 5FPHA 5AVXA 2WILA 4RVDA 4UVIA 3N6RA 4W5HA 5B1YA 3VVLA 4MV8A 4II3A 3ZOKA 5IN4A 2G80A 3E9EA 2HBYA 1TU0A 2VOJA 5SYMA 3JD3A 4NOMA 4BNHA 1AKUA 1ZICA 3SFTA 1XVLA 3SX2A 1IHPA 5BQ5A 1N4DA 1GOTA 5KNCD 2E6UX 4K7JA 4QIHA 4DLNA 1D7OA 1W48A 2BYTA 4UUAA 2XDWA 4K40A 4R7GA 1U7XA 2JI7A 4ATNA 4X3OA 3A8JA 3T8YA 1L5OA 2VP6A 1DJOA 2ZREA 4N5HX 3OBIA 4ARUA 3TH5A 1D9XA 2IYRA 5I3CA 1KDZA 1FQWA 4PRYA 2W6NA 1OBVA 5A4IS 1CS4C 1E9CA 2WSBA 4DBVO 2G08A 2PUBA 3WE7A 4I4TF 3WIOA 2WEKA 1IQ0A 1J33A 3I9OA 1JB9A 2WHXA 1KZ6A 1DHRA 1FQJA 1XRSB 4XVHA 1U9IA 2P3MA 2JIBA 3KC2A 1XNJA 3NV7A 2FG6C 1SVWA 5ERGB 4KPFC 3T06B 5JDCA 2QF7A 3IUJA 3MJHA 4Q1BA 4YAGA 4BX9A 2I78A 1QAMA 4Y2UA 3IP5A 2A0FA 5DP2A 3O8DA 4GFDA 4GUDA 1ZITA 4WZBB 4R31A 1UD5A 4Z4WA 1RAEA 3A10A 3HVUA 4BC1A 1WVIA 4RL4A 3IT1A 2E89A 4CMIA 1P2TA 2W6OA 1YZYA 2AEEA 1P31A 1PUIA 2QHXA 3KHKA 1FFCA 3ZEAA 1SU6A 4BQFA 4F72A 1RQNA 3MGKA 4S0ZA 1QHYA 2I54A 4JBNA 3B1FA 4JYPA 1NIJA 1HLDA 4JYCA 2GN2A 1DV1A 3R7FA 2ZXIA 5H70A 1VBMA 5FI0B 5LMZA 2EFYA 4KNVA 3T7SA 3RSZA 2PU7A 4Z51A 6LDHA 4OO3A 3D7LA 4DUPA 3I9KA 2PG3A 1YMQA 4K6CA 5EYPB 1WORA 4V3BA 2HU8A 2C9DA 3NTUA 3M6MD 2PZBA 3DEIA 4DIEA 2IBTA 1IEQA 4XGNA 5K0CA 3C85A 4RCZA 1KKLA 1VL6A 4B6EA 2OHIA 3LUFA 4O4LB 1UKYA 4EITA 4UAJA 3ZD7A 3RSCA 2MMCA 3MOGA 3I9NA 2ZRCA 1SVLA 4X7EA 3I92A 1X3LA 5B30A 4B2IA 4FXUA 2ZGVA 1MKYA 4OLAA 3ICPA 4QU8A 4H31A 2XIJA 2UYOA 2GEVA 1H2EA 3DB2A 3RW9A 3BXFA 3O21A 2A57A 2Z8XA 2GBIA 1P4GA 3H3XA 4HY3A 1M2GA 1O9GA 1TA4A 1IONA 1KH1A 5F5NA 4DIDA 2G9UA 2PSJA 3K73O 2IYYA 1RHJA 2D0DA 3AHJA 1HLFA 5IF9A 1VKZA 1OZ0A 4KODA 2Y1DA 3FTCA 3OTIA 3MT7A 4BCCA 1N6HA 3HUEA 5LLSA 1TMKA 1MENA 1PGJA 2QMQA 3D4IA 5CJJA 3QVXA 1KEUA 1Z2DA 5DXAA 3WYDA 4WKGA 1FNCA 3EA0A 5JUWA 1LDMA 1OH6A 1JFTA 4AN0A 1UCFA 2P6RA 4MWOA 2H2HA 3VC7A 2CBZA 2IUFA 2TECE 4Q93A 5INTA 1YR9A 4ZCTA 2PSDA 3WMEA 2CDAA 3ZZUA 2D1YA 3LZCA 1PYDA 4OLJA 1CIVA 1BD4A 4KLCA 4AJHA 2FRDA 2GSDA 3I2FA 3ZY5A 4FE3A 1JWAB 3FKJA 3VAZA 3NBXX 4FGKA 3ZE9A 4QDXA 2XUHA 4BO1A 4DA4A 3NP7A 3EVAA 1E3JA 1UT8A 3A1WA 4JEIA 1FK8A 3U7HB 2BUBA 2IGTA 3UJAA 3H2YA 4UATA 1MV5A 3L0ZA 3LFHA 3EDYA 4HBZA 1PR1A 1TM7E 4AQ7A 1ZZGA 2BHTA 2VUTA 5HZBA 4B40A 1DUSA 1NLZA 2VDKB 3WBKA 1GZ3A 1PNVA 1DAPA 1UJMA 3KWLA 5IAKA 4HB4A 2ZJ7A 1GAEO 2VJCA 3HHPA 3RRFA 4ZHQA 4OHWA 2UYCA 2D0PB 4DWJA 3FYHA 1KAMA 5LJIA 1ZH6A 2JFWA 3KSRA 1O4VA 4FKMA 3A6DA 4JJ7A 3MCUA 1EP1B 1WPCA 1AGXA 1QHFA 5LQSA 2YYZA 3DWGA 3SC2B 1NN5A 2DRIA 3KCNA 3A35A 3MMSA 4CF3A 2GBCA 4M8SA 3BB1A 1XI2A 3LX4A 2X58A 3ELUA 2VHVA 1K5DA 3IUEA 1VE3A 1QU3A 3M4YA 1JDUA 1QCYA 1TZMA 3LH5A 3QMWA 1I4WA 2G9NA 2X8BA 2W6IA 3NORA 5L95A 2RHTA 1QQ5A 4MP3A 2HRRA 2EGGA 3EB9A 4HGRA 3UCEA 3WGZA 3SXPA 2JLSA 3IXMA 4HNVA 2ZT6A 1YRAA 3FZGA 3OMXA 3KKPA 2X6RA 3UOAB 1QF9A 1PTKA 3Q7SA 3TRHA 4Y6RA 2PKQP 1TT7A 2IXAA 2VBFA 2Y76A 3QHPA 4QHSA 5C8XA 3HCNA 5CG2A 2HXGA 4KREA 3P0RA 3DNPA 4KWEA 1YI2B 4OLFA 3TI7A 2Q4EA 4E1BA 1EX7A 1GCGA 2CNBA 1E5DA 5A0VA 1FB5A 3DT6A 3I1YA 2OORC 4RJTA 3IPAA 1G2PA 2ZI5A 1PK9A 1PYOA 1SFRA 3JWGA 1GVHA 1BC5A 4KWHA 4UARA 2C4NA 2VVTA 2GKSA 1B15A 4QC2A 4LXTA 4QTYA 5ELLA 1W2BB 5FJJA 3K94A 4HE5A 1CFZA 2ZT5A 2FF7A 3FPEA 1RYEA 1QF6A 2BGUA 3TLYA 1XCJA 4HVAA 5FNVF 5JYEA 4ZI3A 1M9NA 2GPSA 3I4LA 2MSWA 4M1WA 2LCFA 2VP4A 3PWSA 1U2GA 2GK7A 2Z1NA 4QG7A 1XCMA 2RGAA 3ZXYA 4K9OA 2F8MA 4UUOA 1EVIA 1YRQA 2CJWA 1Z74A 3EDRA 3MJDA 4OGFA 4OUKX 1FOEB 3TQTA 4A9AA 4G1VA 4ND1A 1P75A 2J32A 4JUAA 4UTRA 1IXYA 4RIEA 3C6ZA 4MPRA 1EUCB 2AIRA 2OVBA 4G85A 4MEJA 4C30A 5KMGB 4CTJA 3PI6A 3HCRA 4Y2TA 5LQAA 3EVDA 2OHHA 1EGQA 2XQJA 4ALNA 3URKA 4BGVA 1ZR2A 9MHTA 4I5DA 3NYIA 4HCJA 1U0HC 3KSMA 4QOGA 4FJ0A 5FTKA 2WAAA 1KGSA 5EMMA 3BDVA 3GIDA 2WW8A 3RSLA 3ECAA 3KAJA 3H97A 1NURA 4FNAA 3SZ3A 3VSAA 2PZAA 4HUTA 2OM6A 3RT1A 1JIVA 1L3IA 4P92A 1SIBE 3DVAB 2HA3A 1XTQA 4FR2A 3EWSA 1OROA 3G2JA 3PC3A 4E5DA 1KI6B 5EHZA 1TKRA 3E8MA 5EWLB 2XZLA 1KIMA 2JFVA 1JJFA 1W87A 2WT9A 2QI9F 3DR3A 1KI6A 3K5IA 3KELA 1JQ3A 3RBVA 5GIOE 3U3DA 3FM9A 1NAHA 3K35A 1M2VA 1BYUA 3TB6A 4BMXA 3F4LA 4XR9A 4C0XA 3CWZA 4GP9A 1FTGA 5FBVB 5DNYB 4LYGA 1YASA 3P19A 2J0VA 4ROXA 3L43A 2J31A 3M3PA 4L4XA 3UJ9A 1DRKA 1STOA 2CVFA 1NVGA 2I8AA 1HT0A 3R6TA 4I7EA 1YL5A 3SQNA 3ENZA 3TMAA 3IEVA 2I2XB 3HY3A 4PGAA 4C7BA 1MH1A 3DMTC 1VF7A 4EHLA 3BDIA 5KU7A 3THXA 5LZ4A 3BD6A 2VOEA 1IDN1 1R0YA 2K7ZA 3JRXA 4G01B 2JCSA 1IK4A 1AGNA 1WP9A 2DTXA 3HB9A 3PNOA 3P9RA 5DGXA 5J58A 5H80A 1BHSA 1DIGA 5G0UA 1QUFA 1MZPA 3RYCB 4BE4A 5HXAA 2K5UA 3N8GA 2IYNA 1GNPA 4GD3Q 4IIGA 3FROA 5EE1A 1RYZA 2PLAA 2IV2X 3R3UA 4Z7NB 1BQEA 3GJSA 4HYYA 4NY1A 1N2CE 1JNXX 1KVSA 4KZPA 3LFUA 4PLCA 5F73A 1EGMB 5FFNA 3UW1A 5DH9A 4UBMA 2IH2A 3OX1A 4I5IA 1YKSA 2NPOA 1FP4B 2EBWA 3RTCA 2QPOA 1EQUA 4P58A 4KU4A 4Y7CA 1WU8A 1JUDA 5DSXA 3THWA 1COWD 3CX3A 1C1HA 1NKTA 1JHRA 1U6JA 4WPGA 1DL5A 1BA2A 1OXSC 4WKOA 4I1YA 1RZRD 3TQRA 1AOXA 3ZZNA 1VLQA 1L1FA 4G0ZA 4UXJA 1OH7A 3UYLA 2IWRA 4LXYA 521PA 1OYWA 2FG7C 3BJZA 3OTGA 2QR2A 4OV6B 4XLCA 1ONPA 3JQDA 2VSXA 5BXYA 3RUFA 4V0MA 1YMUA 3SP1A 1J23A 1L7BA 2XMGA 1DEAA 3KEFA 5EXPA 5J63A 1YUMA 4QM7A 4LSZA 1E6LA 1SHUX 3VSEA 5TC4A 1BE8A 3PITA 4NK5A 4FC6A 4QO7A 3LP8A 1E3LA 5CLGA 4QFMA 2BTOA 5J35A 2V03A 5KTNA 1L4YA 2JEZA 1VCNA 2AX4A 5EMNA 2R8OA 4RPCA 2GF9A 1IN8A 2UVQA 3H18A 1JH9A 3UB2A 1CRZA 5AVKA 1JU4A 3G0GA 2A1IA 2OB1A 1NHWA 4FVTA 1DPFA 3Q0EA 3MQ2A 3AUJB 2Q3FA 3TFWA 3S28A 3IT3A 2B78A 2UUBB 2MSCB 1Y82A 4R2JA 1W36D 2O2EA 3AETB 1E69A 3F6CA 4BLQA 2FWMX 1PJRA 4M6WB 1J70A 2AG5A 1AKNA 1QRRA 4NMHA 4AM8A 1AM4D 2E5WA 3DWFA 3KIPA 4M3NA 4N8EA 5AICA 4B4OA 4CV1A 4RV9A 2EW2A 4MP6A 3WJAA 6YASA 3ZVLA 3NBYC 2VXCA 3B70A 3UCXA 3VHXA 1OKKD 3ADKA 1BE0A 3JQEA 4BO3A 1EFRD 1FMCA 2AK2A 5CLHA 1VPWA 4NEQA 4PQGA 2CSXA 4P2NA 2QN7A 4R16A 3T3IA 1H85A 2VJMB 1FX1A 4L2IB 4BL5A 3CC8A 4C01A 4DCMA 4FI3F 4NXMB 2IX3A 1SXJC 1XU9A 2ZIEA 5HMMA 3WVNA 2Q3BA 1YCHA 4GE0A 2FR0A 4YPOA 5CT9A 5BSKA 3CNBA 3HCPA 4TX1A 3QFHA 2OGWA 4KKTA 2QT0A 1IN7A 3KKLA 4NBVA 4O5OA 3TQHA 3UA4A 2Y68A 1K97A 3V4VB 2ADMA 4MKZA 4ESEA 1OFGA 2BVNA 4W5OA 2P30A 4KFRA 4UNRA 2H7VA 3G3EA 5L3SA 2CVQA 2GEFA 1EFUA 2OV4A 4A73A 1A9QA 2XB8A 1UBMS 3PTZA 5AKJA 4IO1A 4L6CA 4M1ZA 4UHDA 3N28A 1R0KA 1VLMA 1Z4PX 3BE8A 4QA9A 3B20A 2P4UA 4RTMA 3UENA 5F1OA 2XPCA 2X14A 4DIBA 1HXHA 3HUTA 3VOBA 1QRUA 3AZOA 3FDZA 4YN3A 3C3PA 4HAOA 5AFSA 2ZRNA 5ILOA 1IWOA 3IQDB 1XF1A 2DZDA 4C7KA 4MJ3A 1JZSA 2QJRA 3KR0A 3RYHB 4H7DA 4CKEB 5B7NA 2A0WA 4LOHA 1P1HA 2GN4A 2AKYA 2YW2A 3O8LA 4TKUB 1J9EA 3QEKA 3MELA 3GLGE 5F76A 1GA6A 1LFAA 2WAXA 5CYPA 1A5SB 5DCUA 5L3QB 3W5BA 4CM9A 1O6GA 4AAYA 4RPGA 4TV9F 2IDMA 1E61A 1P7CA 2BUCA 2ENWA 2ODWA 1NZDA 3JQBA 3WLSA 4ZDJA 1EP3B 1Z4OA 3ABRB 3AKZA 1AJEA 4B9EA 4FOTA 4L22A 3QRWA 1WPRA 3VH2A 1IE3A 4C6HA 2MR5A 4RK6A 5ADHA 4HLQB 4CF5A 3M9XA 3GC6A 4NG5A 1XIVA 1WJGA 3K0BA 4FYJA 1D2EA 5DGCA 3TRIA 5HVNA 4ZZIA 1NF9A 2FPRA 4UZUA 2I4OA 3A70A 4JI2B 3DMFA 4BEWA 2PUFA 2C9BA 2FPOA 4GNRA 4RZIA 1QIDA 2HSJA 1H4QA 4B7XA 3QITA 3ZVMA 4MNTA 5MF6A 1E2IA 2GNAA 4MQ4A 2GZMA 2ETXA 4BE9A 4QVAA 4QPJC 3R3SA 4NFYA 3JSAA 4O1HA 2A67A 2EZ4A 1N1MA 2XZPA 4TWBA 2ZL6A 5HUQA 4N0MA 2ZATA 1PFUA 1PVDA 1SRQA 1PR0A 1Y1TA 2O2XA 2RHJA 1W9XA 4IDPA 2X6WA 4LCJA 4AWAA 4BKRA 2C78A 1HMPA 1J1ZA 4W9RA 1XF9A 2I1QA 3IHTA 1M7HA 3QVWA 3J81A 2Q5OA 3P32A 3FSGD 2PFKA 4LRYA 5FPQA 1W19A 2SHKA 1H0SA 1OWMA 2JGIA 3CKLA 3RJZA 4BU0A 2R11A 1FP7A 1QZ3A 1N32B 3FYCA 4WXMA 3D64A 3IEXA 2WI8A 3LI2A 2V9ZA 4RAQA 4DCCA 4YY3B 1NJ5A 1V4VA 3EF1A 3VM6A 3WSWA 3OQIA 2F3PA 1LJ8A 3QU2A 1GA1A 1W6RA 4QUAA 5DTIA 1B7GO 4NV1A 5HUHA 1UBJS 1EFRA 2W2LA 2VHZA 4D97A 3EXIB 3ZWYA 1TZCA 2R1VA 2FW6A 3IJRA 2DBYA 5F9FA 2VC2B 3A05A 2RIPA 1NJ6A 2V3WA 3CCVB 3K5PA 4HLNA 4IJ6A 4R8VA 4ZAVA 4CIWA 5FAXA 5JMPA 2P67A 4AS1A 3M6LA 1TRHA 6PFKA 4GDMA 1IDOA 1L1QA 4WACA 2QY6A 4XH9B 1OT5A 1UD8A 4C89A 1A4RA 2EP8A 1JJIA 1BS2A 2Z2KA 3K0CA 3LUDA 1K7SN 2O7NA 2H06A 4NAVA 3U3JA 4AZVA 3SIRA 2XQGA 1T13A 3L7NA 2JGFA 1RHKA 2QL6A 4MJLA 4WZAA 1G1AA 5B2EA 4V1CA 1F2DA 4ZVQA 3R7WB 5K8IA 3F3KA 2VKQA 1VHQA 1QV9A 2PD4A 4JI5B 1UMCA 3V2HA 5ALVA 4X90A 5J2UB 1R3DA 4BNNA 1T10A 1EBBA 2M9MA 2IEGA 5FBLB 2OGTA 1VECA 3JAWB 1TJNA 3LDHA 3TCXB 2RB4A 2Q6IA 3AOGA 2KBEA 2WUEA 1PJTA 2WVJA 4HDKB 4W99A 5F2KA 4E12A 1JHXA 5D1NA 3WLNA 3TG2A 3NTRA 4GX5A 4PHHA 2C98A 2GRJA 1E4OA 4X44A 3KTAA 4A1FA 1YL7A 4HDAA 4PZ9A 2IYLD 1XDGA 3CC2B 1KFJB 1NMQA 4MW7A 5I9BA 3TX2A 4AIIA 1RWOA 3HAGA 4GKAA 4PG5A 3RFVA 2WWYA 1U8ZA 3BWEA 4PGOA 2KQUA 2H2IA 4FFMA 1ZH0A 1KYQA 5TMPA 2C2GA 3MILA 5DB4A 1KFKB 2GESA 3R9IA 5HKBA 2XSZA 1CUAA 4RPLA 2AFHA 4NBSA 3KCQA 5DPMA 4LXXA 1EK5A 1U2SA 4BVEA 4D4GA 3SZRA 5MGNA 3ML1A 1PZMA 2JHPA 4BO8A 2EFEB 2ZPTX 4DM7A 3WL7A 4E08A 2PUGA 1BJKA 4QGGA 4OPMA 1K8QA 4RY8A 3UUFA 3BJRA 5I7VA 2FSIA 3DBHA 4C0JA 1JT9A 2OPHA 1VMAA 2JFGA 1JU3A 2P9ZA 2Q5JA 3IBYA 3PJDA 1KMHA 1BMFA 1UPXA 4LDRA 4LV8B 4PYIA 4YAKA 2BM9A 2Y1CA 2G7MC 5BUZA 2ZZQA 3PX2A 2P2DA 3FPJA 5LUAA 3A11A 4GPZA