5B6IA

Structure of fluorinase from streptomyces sp. ma37
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
292
structure length
292
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMHSICPGVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIRQAAKGGARGQWAGSGDGFERADGSYIYIAPNNGLLTTVLEEHGYIEAYEVTSTKVIPANPEPTFYSREMVAIPSAHLAAGFPLAEVGRRLDDSEIVRFHRPAVEISGEALSGVVTAIDHPFGNIWTNIHRTDLEKAGIGQGKHLKIILDDVLPFEAPLTPTFADAGAIGNIAFYLNSRGYLSLARNAASLAYPYNLKAGLKVRVEAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluorinase
publication title Directed Evolution of a Fluorinase for Improved Fluorination Efficiency with a Non-native Substrate
pubmed doi rcsb
source organism Streptomyces sp. ma37
molecule tags Transferase
total genus 83
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 5b6iA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 5b6iA01
2V7XA 2V7WA 2CBXA 2Q6KA 2ZBUA 2V7UA 1RQPA 2Q6IA 2CW5A 2V7VA 2C4UA 2F4NA 1RQRA 5B6IA 5FIUA 5LMZA 2WR8A 4CQJA 2Q6OA 2V7TA 2C2WA 2C4TA 2C5BA 1WU8A 2Q6LA 2CC2A 2C5HA 2ZBVA
chains in the Genus database with same CATH superfamily
3GAMA 3ROQA 3LLUA 4LI0A 1WRBA 3WK5A 1VFPA 3UB4A 4G36A 1VE5A 3CWZA 3HJTA 5IYZB 4H1UA 3UUGA 3F7MA 1ESEA 2C7VA 3AUUA 4D6XA 2D3TA 2F9MA 4Y6LA 2NN3C 2P2ZA 1HK7A 4JLSA 2DFPA 4NCHA 4CMBA 4KTVE 1RQNA 2RGYA 3V8MA 3DTVD 3BHMA 1WNFA 2DH5A 4MRNA 3HN2A 4RK7A 1RYEA 3OEHA 2B99A 4PHTA 4DNFA 4DR7B 4EHJA 4DC0A 3EDOA 1RPAA 1E2BA 1TVCA 3OTOB 2IV2X 1QVRA 3QITA 2EG9A 3H1BA 3QBTA 4IH1A 3IPCA 2BJHA 5IEJA 4ARVA 4Y98A 1QDEA 3ACCA 3DKKA 5CJJA 3O2JA 3LC1O 1YK0A 1Z0UA 1TC1A 1TYAE 5F9HA 3OOWA 2CLMB 1AHHA 2W37A 3P9RA 5DRYA 3D3EA 3BJEA 4LJ6A 3SY8A 4BY9E 1RWWA 1QYCA 5ICGA 1HA3A 1GAJA 1P18A 1G2OA 1ZGCA 3KTOA 2PMKA 3OZRA 1DZ3A 2BGIA 2GFIA 4F91B 1Y4ZA 3ZW7A 5LXTB 2R7KA 1CUUA 4F3YA 1XJ0A 2CWDA 1XQ9A 1KDOA 2QPLA 3QYPA 4AVYA 4PXSA 5C51B 1AHNA 4LBVA 4JBYA 5HDBB 3TIVA 3VI3B 1W29A 2Q2NA 4O2AF 3TNYA 5KYUA 1INLA 2GNOA 1ZJWA 3S5UA 4DILA 3K09C 1UBLS 3BXPA 1I3OA 4O2BB 3H0CA 1CZOA 3MAAC 4ENUA 1SIOA 4NBKA 4BCCA 1QUFA 4PPFA 2CDBA 4QWMA 2DSNA 2Q1UA 3SFTA 2IEGA 5K6AC 1HNWB 5F9FA 4WD3A 2PU5A 2H9IA 2P8SA 4EMBA 3NEPX 2IX3A 3VKHA 3S1LA 2FUG6 2VAVA 2VA8A 3IUQA 5DTJA 3QFCA 2V7BA 2O3TA 2XB6A 3RBZA 1KSJA 1UFQA 3ICWA 4H0NA 3LRXA 1M66A 2QLLA 5DNDA 5IJXA 4B6QA 4ZVMA 4B3BA 3LC0A 1N5MA 1DAKA 2TMKA 3EXHA 4W9NC 1YR9A 1E98A 3C5HA 5DBIA 2IUUA 1GEEA 2NU8B 2R5WA 4NZ9A 3RRZA 1QB7A 4QPZA 5THXA 5G02A 2PQMA 2G4LA 2Y1CA 3ET5A 2XY4A 3EY9A 3MIZA 5F4OA 3JAWA 1YQ9A 4EO9A 1LK7A 1H2WA 4Q1AA 5A6SB 3DLIA 1DDGA 4QFBA 4TL8A 2OV1A 3VAZA 4EIWA 4QQFA 3G9UA 1WB9A 3FGOA 2K7ZA 3V7FA 1KBZA 2JBWA 2YMQA 1XLUA 2ZXEA 3DTTA 3PC8A 4HXFB 1Y0BA 3KT0A 1YACA 5AVXA 4I08A 4G26A 4IMRA 3VAAA 1VJRA 2XMRA 3P0IA 4KXFB 5HQTA 3EXEB 4UJ5A 1ZIOA 2L0XA 3VYRB 4MYTA 2IPAB 2ISQA 4CMAA 3DQZA 3IP3A 3TLAA 4MICA 3PEYA 4JP1A 5HX7A 1XDSA 4Q1FA 3K5PA 1L6IA 2DRIA 4AVZA 2VJMA 1DBPA 2Z8ZA 5K6RA 1EX1A 1PVOA 5CFLA 3NH6A 2OBBA 1PQYA 3KLNA 4WNIA 5DCUA 5BMVB 1ABBA 4YJ3A 1V45E 3M49A 4CR6A 2HC9A 1A5SB 1HTWA 3MRTA 1BWRA 2KQUA 5HS4A 3NYIA 1QO7A 5EP3A 2V9ZA 5LVAA 1O0BA 4Z4GA 2J0UA 2JAQA 1QFJA 2GK3A 5I7EA 1KZGB 1VPTA 2XUAA 3AVPA 4PTLA 2X0FA 2BWJA 1U2GC 5BSRA 1KI3A 4XWOA 4M8KA 1VJTA 1OH6A 4X3CA 1ATZA 3ELDA 1KO1A 3UYKA 3TKYA 1S5PA 3KKPA 1HF3A 1QNFA 4EY5A 621PA 2AVDA 1RHRA 3A28A 4I1OA 4IX9A 4MV5A 2FMXA 3ZJ5A 3IESA 1KAQA 2ALJA 4PYOA 3FPLA 4E11A 1WMDA 4EI9A 3BB3A 4RD1A 3Q1KA 2KPOA 3EARA 4PPGA 4AMGA 5TNXA 4MKFA 5DKFA 4MUIA 3F78A 3ZWWA 1T0JB 2JW5A 5H3CA 2IV7A 4R2IA 1O2DA 3SBDA 1JQJC 4OJNA 4KG7A 4YRDA 1V6CA 1N6PA 1EFPA 4YP5A 2GESA 5KJFA 4FKZA 5LYYA 5FWDA 2X15A 1F9AA 2Z1MA 1L4GA 1ZGGA 1Y8RB 1N9ZA 2FR1A 1U81A 1MH1A 4P3IA 1U2TA 1M0WA 2C7RA 1J90A 3BK2A 3MUNA 4PFQA 2H63A 1LK5A 2H31A 4J6EA 1NMYA 1ZXXA 1B14A 1QB8A 2I66A 4GAEA 2C57A 1ZK0A 4JD5A 5KVSA 2PUGA 4C2UA 4QDJA 1G42A 1XLWA 2JCVA 1XQWA 4KRYA 4AO8A 3P94A 1IBRA 1E3DA 1GJRA 2MU1A 3Q72A 3ND5A 1KEEB 3P45A 4U8HA 4BZQA 3JATA 2QE6A 3OEHD 2VRWA 4LRWA 1BQ3A 1USKA 2X6YA 3LMKA 3NEYA 3T7IA 4G56A 4DTCA 5A06A 1K9MD 1DKPA 5FLXA 5ALKA 1WZNA 2QTMA 5JPDA 1U5CA 4NP6A 2WSLA 1Y1RA 3WRXA 1DIHA 1ZAYA 4JI3B 1D09A 2DU8A 3HR7A 3RU2A 4EQ6B 3ZCSA 2F00A 4I3HA 5EERA 5HFNA 1R2QA 3CEHA 4R7TA 4MWZA 2GETA 1JQ3A 2YHIA 2UYGA 5LJLA 2ZWPA 5EOVA 3RTCA 4XUGB 4HDRA 4CKCA 4M0KA 3I5UA 4PAAA 1YJWB 3D6VA 4F93B 2FF7A 4UULA 3D0QA 3W1VA 4ACBA 3IAUA 4URFA 9GPBA 2K2WA 1RCTE 2QVGA 5I9NA 4XVRA 2WNSA 4URWR 3F0TA 1W44A 1T9DA 1K8QA 1W9XA 1KEUA 1Z2OX 2IPLA 2R9VA 1FVFA 2VAPA 1EDBA 1ONBA 3L0CA 4WBSA 4EEXA 4RELA 2QG9A 5BN4B 1G6HA 4U5QA 1NI3A 3R3YA 4Q9NA 2BKEA 3PXGA 4G1CA 4URXR 1M6HA 3HKBB 2BJWA 4GOKA 2IW1A 3ENWA 1M1ZA 2H4FA 2H85A 2YUIA 1ELOA 1O94A 2PE3A 3EZ6A 2RK4A 4ZVPA 1T4DA 3NHRA 4W5WA 4G0ZA 1V3VA 3A04A 4GYYA 5F33A 2B8TA 2WEKA 4M1QA 4RF3A 1YZFA 3T3NA 3RYTC 1COWA 2ZVJA 2C2ZA 2X5XA 1VPLA 5FPHA 3I76A 2P9ZA 3OU7A 4B7CA 5CXSA 1Q50A 2QS9A 2JASA 5ALPA 3AR6A 4LE2A 3MMXA 1G8PA 1TU3A 2CV2A 2ZUCA 2BM8A 1EXMA 2KLBA 2PMWB 1CY7A 1M6YA 1OWLA 2EXXA 3BWXA 2I55A 3G59A 2HA4A 4P98A 1U1DA 1E9BA 1WDMA 1KC1A 3IH5A 2XMGA 2OZVA 4NQZA 4UNNA 5EKSA 3NM4A 3WR5A 2VK4A 2ZS8A 4V03A 4XWTA 3WL7A 5JS1A 1MO6A 1VRVA 5C0OE 2QKYA 1JHQA 2IGTA 3W7AA 2WPNA 2Q3LA 2VPIA 4GPAA 1IOVA 4BRWA 1DTWB 2UZIR 4JR1A 2GHQA 4V0RA 3PZRA 3KQTA 3BA6A 3PC3A 5HJ5A 4JQOA 2EV9A 2GN6A 3KG2A 4CODB 1SN7A 1Y63A 3FSEA 3VYTB 5DLYA 5CFMA 5HJ2A 7AT1A 4LFBB 4R0MA 4QO7A 2Z2KA 3AHHA 4H0FA 3GJZA 4JK3A 4NFSA 5K20A 2BBTA 4J1QA 4RSGA 2VBTA 1O87A 2GDZA 4BFZA 3OHMA 5GZ1A 3CRRA 1A1SA 2WUGA 2QU8A 1L5WA 3B36A 3CLHA 1ZK2A 5K9ZA 1A4XA 2W8BA 3KAJA 1WBBA 3FFWA 3IPAA 1QWOA 4KGVA 1EX9A 3RC8A 3HZZA 1U7OA 4TLEA 4PCLA 3WL6A 2OPHA 1F2VA 1KO5A 3U3MA 4EEKA 4R16A 4EECA 3D8BA 3HDQA 4RTOA 4M1TA 4Z86A 4YRNA 1FVOA 2QY6A 3LT4A 3LU1A 1R64A 5G40A 2C95A 1R0CA 2XUIA 3GWZA 3MCUA 3WSWA 4J3FA 1NJ8A 4H7PA 2XGJA 3ZVLA 2B8JA 4XGKA 1TE2A 2W2KA 1I8DA 3PUNA 4NARA 5BVGB 3SZ3A 2WM3A 4D0SA 1CJVC 2Z3WA 3B1FA 4MMXB 1U80A 4XSGA 3SR3A 5KVAA 4BJHB 2HFKA 4XOPA 2W22A 5DEOA 3ZUPA 1GGFA 4TLMB 3WK8A 4PXYA 3WDMA 4PO8A 2MSDB 4TT3A 1OU4A 3G88A 4V0NA 5SZIA 3KL9A 1OJ7A 1ZK4A 4IGAA 4WDQA 4RCZA 4YMTA 1GNQA 3OFVA 3J81A 6CHYA 3RS0A 2GHTA 5IH7A 2X9VA 1WPCA 4C03A 4Q3NA 2DQZA 1P3JA 4UFNA 1R0RE 1K9VF 1A9QA 1P5FA 1P3Y1 5C7LO 4FE4A 1ZVVA 4R8KA 1VKNA 3DFMA 2QVZX 3MB8A 4HC4A 1NF3A 5AR1A 4EFKA 4J0QA 3BMNA 4HX9A 1SCUA 3SSMA 1V35A 3ZWXA 2DT8A 2KLHA 2ZTNA 4DA4A 2HBQA 2NXWA 2YV5A 4UUQA 3G68A 1QYXA 5ILQA 3DZ8A 4CGYA 2REXB 1W6UA 1VM6A 5FUVA 3C3EA 4NENA 4AY5A 2O8VA 3EH1A 4XUCA 4FNGA 2G07A 4CL2A 1RQ2A 3VKFA 5G1OA 3EZXA 3DPIA 2WSYB 3IA7A 3SS9X 4R31A 4OHWA 3K4HA 4UE2A 3AHGA 4G6IA 4UTZA 1B42A 2YFHA 3F7NA 3GQBB 4RA9B 1G66A 1SG9A 1G3MA 2IP2A 1A5ZA 2WC1A 1ZITA 3KL4A 3OZEA 1JAZA 2QQGA 4TTJA 3W9BA 4B2YA 1ZW6A 5TMPA 5KHLB 5J2TB 1KIMA 4XYEA 2BLNA 2VUIB 1GU7A 4LBWA 2QT0A 3DP9A 3LP6A 1N3YA 1OVMA 1PJ8A 3II6X 4H3HB 1AUQA 4M49A 2DYIA 1NN0A 3I9MA 3N2EA 5J5VA 2OCAA 4ZOEA 2O7VA 4BO7A 3GA0A 1QG6A 1IUNA 1T4GA 2CKDA 2CLIB 2XMCA 2A94A 4XQ0A 4K2AA 1GZ3A 3O9ZA 4OM7A 4IJMA 3FWHA 1JHVA 5IJ9A 2R7NA 3HN7A 2ZR8A 1FXWA 4ZXPA 3VPGA 3ENVA 8AT1A 3S2GA 3TLYA 3C0KA 5AH0A 3EZ2A 4HKTA 4GMHA 3CCRB 4ICIA 4ZARA 4BNVA 2GCOB 3BGSA 3NYRA 4BLTA 4PC3A 1RJEA 2EG5A 2FW6A 3C5VA 5CX1B 3U1TA 3V1KA 3EPKA 1Y0YA 1VP3A 2XVAA 1ONNA 2GZ2A 3MUFA 4DV3B 3QEKA 3T99A 1M1UA 4F6LA 4DV0B 2EOAA 1SK8A 2YV4A 1A2KC 2ZYSA 2C2WA 2HFJA 4QFMA 3FTQA 3HYSA 3LJKA 3N07A 1D1SA 3QKRA 3A35A 4QL3A 1E9FA 3SHFA 3FMOB 5D85A 4C20A 2QXTA 2IT1A 2X2FA 1GG2A 2O8BA 1T2AA 3HJNA 5DCWA 3GFVA 1UK9A 4LBZA 2PCLA 4DQXA 2C98A 3W7VA 5M7EA 2W6JA 3IEPA 3N0RA 5FNVA 1O94D 3FDFA 1GGHA 2RG7A 3U17A 1DQRA 1RJDA 1THMA 2LRHA 2Z9CA 1QYWA 1Y5NA 5U9CA 3OEYA 1JDUA 2F6RA 1TPZA 4WASA 4KQMA 1IRIA 5EA2A 3I1JA 3NKFA 1JL3A 2ZETA 1H85A 1G2PA 1N8KA 1XDWA 1YJCA 1SIUA 3B6MA 4KQCA 4TLBA 3TSAA 4ZVUA 2B34A 3IB6A 3QIAA 4MOWA 4CM9D 4YPFA 2D3NA 4YWHA 3UWKA 2B7CA 1ZUNA 3KLOA 1V41E 4X00A 1QPGA 3C3AA 2F2TA 4CBVA 1NASA 2E48A 4H15A 2PKRA 2YN4A 3I9LA 4CTKA 3CNQS 2PRYA 5SYAA 5BSKA 1J97A 4II2A 4EB6A 2AB0A 3K1TA 3SYTA 3WYNA 1C0PA 1AKTA 1CZHA 1W85B 5AUQA 3T3HA 3SZOA 3GT0A 1OLSA 4BU1A 3N5CA 2J3LA 1VYVA 1L4YA 1KARA 5CVUA 1LZLA 2CXTA 4HGPA 2F1IA 3OE5A 2F1JA 4URZR 4X7RA 4ARZB 4MWCA 4U02A 1VGVA 2CB0A 3EGXA 4N5IX 1BO6A 5JZBA 3I56B 5KX5A 4AK9A 1KS9A 1PR2A 1E18A 1LRLA 4GI7A 2N9UA 2WHYA 3GNSA 4CZ2A 3T4PA 3JASA 4ABTA 4G9BA 1J6UA 4MRRA 5JAPA 2UUBB 4PIVA 1L0BA 4R2HA 1ML3A 1H5QA 3U4HA 1GG9A 1IJFA 3VR4A 3Q3GE 1I4DD 1PR3A 3HB5X 5HZHA 1BA3A 4JYPA 5J5AA 1JW9B 1QLJA 2CZGA 5AOCA 4Q4AB 5CB4B 2WMYA 3C70A 1JR6A 2JB9A 4DW8A 1RRGA 4WWVA 3JYNA 3GLGA 3ZJVA 3IOCA 2OFFA 2IOQA 4O4HB 2AG0A 1TJPB 1EWYA 1MJGA 4M53A 2C3UA 3KKQA 1XMQB 3RSZA 3KUDA 1FYVA 4HNAA 5CT6A 3R7SA 4ZZ2A 2XYHA 2PNJA 2X3YA 4JJ8A 1QHEA 1GHTA 2IOHA 1ADCA 5TGZA 1JFVA 4Z4VA 1VG9B 3CQ9A 5LC1A 5BT8A 3DCYA 4LZZA 1KL7A 2WYUA 3E7WA 4XJVA 1P1HA 1BGVA 5FOWA 3FGNA 5F64A 3BREA 3EULA 4EYGA 4WLNA 4G41A 5FAXA 4L7VA 4RMHA 5JSUA 3WO0A 1JZTA 2PWBA 3M1YA 3Q3IA 2O06A 1VG8A 2CF6A 4DCCA 1JX6A 4GKVA 1GGEA 4JZYA 3GYGA 4IIXA 2ENUA 4OOVA 3WKDA 4M7OA 3AGPA 4EF4A 1A3CA 5LZ8A 4AB1A 4CXMA 4YUWA 1DMRA 1JT2A 4HDNA 1CR1A 1H5UA 1DJPA 2IGBA 3AIMA 3N39C 2EKBA 2WT4A 1QX4A 4P38A 1ADYA 4M89A 3ONYA 4BFUA 2OESA 2J9FB 4JLOA 4PR0A 5G0SA 1AB5A 1D5CA 1JTEA 3SU8A 4Q9DA 1NXVA 3ZDAA 3G6WA 4ME6A 1M1NA 1AMOA 4E88A 1BCRB 1GZUA 1J49A 1IY9A 1YKGA 2YC4C 4QVAA 4WK0B 1X3LA 3R8CA 1XNJA 5J4VA 1UM9A 4PAOA 5FHRA 4LGCA 5CITA 2YBEA 1KSHA 2HA7A 2JPDA 3BSSA 4B17A 1GAWA 2ZIXA 1DC3A 4DSUA 1YQXA 3OY7A 2JD1A 3VVLA 4Q48A 1V7ZA 3FPGA 2Q8PA 2VRBA 3I6IA 4H1HA 1KYXA 2VOEA 4Z0TA 1Y1QA 2EL9A 4D8UA 4DAEA 3A6PC 4HE5A 5DW3A 3L43A 4CMEA 4NF2A 3KLPX 2DOGA 3T4XA 2OBRA 4OHKA 2B94A 4YRSA 1H3EA 4PN3A 1R0WA 4ZJYA 1WEHA 3EFHA 3DLTA 3BWVA 1L2TA 4R1LA 2JVJA 2VBIA 1G4UR 1Y8QA 4NONA 1YB4A 3OECA 1IIBA 3TQRA 4JLVA 3C14C 3ONEA 3IP9A 3L7KA 1IXRC 1XJ5A 4DNRB 5JCOC 3K0BA 4ALKA 2RI1A 3TECE 4BNLA 1BQEA 1DBRA 3FY4A 5BN3B 2W71A 3T53B 4HFJA 4A6DA 4AP6A 1VYHA 1XTKA 2ARKA 5GINE 3V7WA 3ITNA 1KY2A 3A14A 3NDJA 3P97A 3HBAA 4IF6A 4NG4A 3TUJC 3F49S 5FA8A 4ARBA 4Z4CA 2ZM5A 2XNDA 4L4YA 4CT5A 5I9LA 1IULA 1M8FA 1XA3A 5JEEA 3M6UA 2CL6X 2Q3BA 4ZI7B 4C21A 2W6NA 3L1IA 4DM4A 3VHLB 2W6JD 2OUKA 3UPDA 3AILA 4NCJA 1ZD8A 1IY1A 1G20E 2BUAA 4QEKA 5D87A 5EP1A 3WLQA 4PLFA 5KQLA 1YMVA 1RAEA 4NFYA 1XTZA 4BEVA 2A9OA 3A3NA 3H1GA 3WXBA 3QKTA 4PX9A 5KWSA 3EUFA 3RCBA 3DULA 1PK8A 2IXEA 4RFSA 1QIGA 1F20A 4MVJE 2ZEJA 2HA3A 3EH2A 2B0JA 5CYOA 4DM7A 4YQFA 1F8FA 4ZYWA 2YR0A 2LBPA 3V76A 3KB2A 5FLYA 1KK0A 2GEKA 4G25A 4BBPA 4EHFA 2NUAA 5GZ3A 2QAJA 3CMEB 1J33A 1KP9A 1SRRA 4QULA 3OAAA 4R68A 4RS4A 2BGGA 5L4NA 1KYWA 1DWPA 3CX3A 2KBEA 2L42A 4OA8A 5JFTA 3FKSA 3CJTA 2IPXA 4MGHA 1CUWA 5GPBA 3ZD8A 1E6KA 3QJGA 2HT1A 2DT5A 1AUXA 4GI5A 3TJZA 1ZNQO 3L6UA 5HOEA 3GVCA 2ASVA 2YJGA 4R71A 3H99A 4ID9A 4BN4A 4X94A 3ZWBA 2B69A 3ZQ6A 4MLDA 3GJYA 3LHIA 4HNUA 1DT3A 1KKUA 2X7JA 1BOOA 1YDGA 1PFWA 3INYA 3N7AA 3O4JA 5DN9A 4UCFA 5DHFA 4GWLA 5JAMA 3BICA 3FRHA 3FI9A 1OV4A 5L3SA 3C8HA 3G17A 16PKA 4HQ0A 4Q01A 2WYHA 1K28D 1W73A 3CU5A 4JI7B 4L5AA 1Q0PA 4DLNA 3U49A 4R83A 1I13A 2GCPA 5IP5A 2W9XA 1W2HA 3NRBA 1F48A 3RTDA 3C8ZA 2EFGA 4D9IA 2IYRA 3S0JA 1R0YA 4B4UA 3GT3A 4HS4A 1LBIA 3NKVA 4HAUA 1KDYA 3GR6A 1WY5A 4HGOA 4K6KA 5I7RA 4DY6A 2WABA 3OKXA 3A58B 5K51A 3F6YA 4AJ1A 1Q57A 1W1WA 3LUHA 5JXIA 3JVEA 5HIIA 4D43A 1D07A 3P1JA 3QY0A 5ALDA 3ZCVA 3SLRA 4HI0E 3NW9A 1K8AD 4AKSA 5HZKA 1DTEA 3VHQA 5LA6F 3T1QA 1YBVA 4WFJA 2UDPA 3PNMA 5JCPA 4OXKA 4Z2YA 1PZGA 4N0MA 1PNVA 1Y3IA 5TPWB 1BKDR 4AW9A 4JUDX 1C80A 3EXIA 3GPLA 1YA6A 3GFTA 3JAKA 3K1JA 2SNIE 4D4JA 3QVGA 2IC5A 5H1YA 1CIVA 5IASA 2XMBA 5AHOA 4TM8A 4QTZA 1D7OA 2C77A 4ZAYA 5DLQC 4P83A 1K08A 1EWKA 2NU7A 4LJKA 5HQ3A 2WAMA 4KODA 1L5NA 2FZWA 3R3VA 4XWYA 2N3ZA 4FT4A 3RD5A 2BH2A 2HSJA 2PFGA 3FPCA 1KU0A 1GUDA 2IXBA 3CX7A 2QI9C 1PFKA 1ZK1A 3W9YA 3JRXA 2F1MA 1MB3A 1ZJJA 4W5HA 1EUQA 4O4JF 1JQBA 4HPWA 4WK4B 1D4OA 1OWOA 3OTGA 3PGLA 1C4KA 2Q5CA 3I3SR 3IQGX 1TD9A 2NTEA 1Z17A 3AY6A 1QH8A 3R5HA 1QWSA 1JSCA 3T9BA 4JVNA 4E3ZA 3PTZA 3ROEA 2UXDB 1XFAA 5JBIA 4Q4JA 1DGQA 3PDCA 4Y7DA 5JNVA 4L0MA 4HBZA 3DBLA 3UK0A 1KY4A 3E5MA 4RDIA 2ZDGA 3IODA 3KB8A 3VHRA 1DVRA 1HG0A 1UPTA 3BMOA 4BX0A 3AOEC 4DPLA 4RENA 1QE0A 3P4UA 1TM7E 5K4GA 2P3QA 4TZKA 1L5RA 3NGLA 3L0YA 4IL5A 4BKUA 3V8QA 1MAUA 5TJ9A 4ECEA 3HCRA 1C8LA 5CM2Z 3ZI0A 4RKEA 5BQFA 2XQFA 3CIFA 1P33A 4QE3A 3WOHA 3O8CA 1CZRA 1JXAA 3AFMA 3MQ4A 3KJFA 2J41A 3QBJA 1A72A 1A8UA 5D8DA 1E4EB 2ZYUX 2GGSA 2HEGA 1WW2A 4PG4A 1KQ3A 4ZYZA 2OB2A 2ID9A 2RCYA 2MYNA 4LZPA 3ZWCA 5CA1F 1DBVO 4HQLA 2LUOA 2HCFA 3HA5A 1C7JA 3DVRX 3GLRA 4UM7A 3MHPA 3RVLA 4BMYA 4YV1A 5KWVA 1Q1EA 5M3BA 2PX8A 1SC1A 3PFKA 5EQJB 2ZSBA 2J45A 1JHOA 1T6XA 1SD1A 3AJRA 4C0SA 3QG5A 4H16A 3SR4A 4URVR 2UVQA 4W6ZA 4ZMBA 3FNIA 5BWBA 3ND8A 2VNHA 3C87A 5IM4F 3AFHA 3JD3A 3FCUB 4E09A 5MN4A 4QX6A 1EJ0A 2YNMC 3W5IA 4FYYA 1TM5E 4P4UA 2NVUA 2PVSA 4PX3A 1KE1A 1JDSA 1QLHA 3IO3A 3JVVA 3SHTA 3U37A 3OOCA 3PHIA 4FVTA 3HPQA 3VKGA 2Z9BA 5J9FA 1OY1A 2A86A 2FSHA 4DLPA 5L4SA 4REOA 4XDGA 4NPCA 1PDOA 1L7BA 4IWYA 3HH8A 1X9GA 3DOFA 4V24A 3FKSD 3W4JA 1XMPA 4E51A 2OB1A 3KCQA 4GMGA 2I03A 4JGGA 4N5MA 2RE8A 3CCVB 1KIAA 2W11A 2YZMA 6REQA 1MOPA 3N0WA 1QV7A 3FYHA 3DA8A 1SVMA 3ITDA 3PZBA 2CHVA 4HDOB 1AXGA 3ZNOA 2GN0A 5C4IA 3A1DA 5TC4A 4WL0A 3U62A 5IF3A 3F7OA 4EA9A 5K01A 1OFUA 1RC1A 4C4YA 4NXMB 4N65A 1G7CA 1PX0A 5BOSA 5DM4A 1CY1A 3MBOA 1T8TA 3HVJA 3I5MA 3JVDA 1K89A 2XGMA 3DNPA 2QN2A 3AHCA 3EZ9A 3GFFA 1T35A 2DYKA 4BKPA 1WR8A 1VDZA 4M76B 4ERXA 1VZ2A 1OXXK 5DHRA 1Z4PX 2J5BA 3TVYA 5EIXA 1GKUB 3AJ8A 5AVSA 2DH6A 4FC7A 4CG0A 2QN6A 3T1YB 3CRZA 3COYA 3UTDA 2K5UA 3HC7A 3VPCA 2PUWA 3BDAA 2MINA 3B2EA 1J8DA 2XZTA 3ADOA 2G0NA 4LC9A 3OHPA 3GJ4A 4DN6A 5AKLA 5IZCC 4YAKA 1G3IA 3VM6A 1NFQA 3ZE2B 4YK7A 2XTZA 3FF1A 2DEUA 1PKVA 1EQUA 2C03A 6Q21A 4EA8A 2X6WA 1HEUA 3BULA 3AOGA 4L5YA 1E1QD 1OLUA 1UXOA 2FX2A 3TF5A 1DC4A 4ZT4A 3H8VA 3IV7A 3Q10A 1VJ1A 4Y2GA 1TQDA 1RJFA 1TW3A 2WU0A 2VZ8A 4UM5A 3N2GB 4LJ9A 4Z9AA 4NYIR 3ES9A 1MV5A 3PHLA 4P54A 4A2QA 1XZMA 1M75A 2WWFA 4RVDA 1CIJA 1T2DA 1XLTC 1GRQA 4O4IA 3V5NA 2CLEB 2IBTA 3UPTA 4I81A 4L75A 1J9EA 3LQYA 4IYRA 4LJ8A 5FPKA 1K0FA 3GFRA 4OK5A 2YMLA 1UBCA 1RMTA 4PW0A 1AX9A 5E6SA 3VTFA 5JUWA 1OH8A 1KO8A 3ZYZA 4UUNA 2P7HA 3DVLA 2NNLD 4GWKA 4C5AA 4CLHA 4J0CA 3CZCA 1KC3A 2HMYB 5I9MA 1N33B 5LIPA 5DNCA 1N4AA 4JI8B 2JFHA 5HOQA 1I7DA 3E8SA 2R8PA 3B20A 3R5KA 4IEIA 3L7NA 3GEEA 2CRVA 2VT2A 2ANBA 2VT6A 5JEDA 1HT3A 5GV7A 1FEZA 2BGMA 1F3LA 4BFTA 4G1VA 4W1QA 5MDHA 3TLZA 1HE1C 1ECLA 3A06A 5HNKA 2O0LA 3C6ZA 3U3XA 1NZJA 2OXEA 3CLVA 1YI0A 2X14A 3L0BA 2J8ZA 3DF7A 5LFAA 2NMVA 2CE7A 3TXXA 1F3OA 4IDQA 4ZZ1A 4IH4A 3Q11A 2ZL6A 1H1LA 4GLJA 3OMLA 4ZOLF 1CT9A 5GJCA 3VNBA 5JT1A 2QZZA 3NTOA 1XTRA 5TRDA 2ZYVX 3IHKA 3EGWA 4U7JA 2GK7A 2QZ4A 3HBNA 1Z82A 4DTIA 1O6FA 2P0EA 4B4KA 2NVOA 2NSJA 3E3OA 3T94A 2FQQA 2XIJA 4D02A 3IV6A 2OO5C 1CEYA 2VC2B 4QFCA 4XH9B 4DKJA 2O1WA 3UJBA 3L49A 4UDOA 3QLTA 2P3MA 5AVJA 1W4BA 2RH5A 1GZ5A 1U2QA 4GI3A 1O8BA 1YIOA 4O63O 5EJEA 3F6PA 4GZLA 5CVJA 1JFTA 5CDUA 3CLTC 3V42A 3J80A 2RHCA 2QX7A 2V98A 3KOOA 1AQ6A 3PWTA 3UKOA 2H7YA 1O95A 2WYWA 3ESAA 4AYWA 4Q02A 1BDIA 4YIKA 3TK1A 3QMWA 2UYOA 3PQ6A 4LF7B 3MSCA 1RTKA 4BWYA 1RVV1 5L7YA 1NVTA 4ENQA 2HSGA 3KOMA 2NXCA 1KY3A 2R6JA 4P82A 2QTNA 2B9EA 3HSSA 3AEQA 3IEXA 4CF7A 1ZOOA 4DSNA 3Q6MA 1BCSA 1Z06A 1EESA 4HDKA 3QEOA 3LV8A 4Q9KA 2VZLA 1EP3B 2OBXA 3OC6A 4YROA 4HJXA 2H18A 3CRMA 3PK0A 4UOEA 5J4LA 3LRPA 3Q38A 2WVHA 4OSPA 3ELUA 2AOTB 1VE6A 1DXHA 4KO1S 1WOPA 3V2HA 3QXXA 5KYYA 1NNI1 1D2NA 3Q6QA 3CPJB 2WWVD 1ENPA 3T06B 1N7IA 2J32A 3FNHA 2Z58A 1ZIPA 3M6XA 3HYRA 4PLVA 3Q39A 4PXAA 4Q7KA 3MWDA 4O5OA 1MJGM 5B5SA 1DEOA 2YASA 4N5NA 1MVLA 1K68A 2PQ0A 4ZGNB 4E33A 4K9LA 2EKDA 2XADA 4AL4A 3BQNB 2O59A 3FSJX 2LKDA 3FN4A 1ORTA 2PX2A 2WP0A 1SCKA 2IXTA 1ESZA 1LS6A 2NWQA 4EJ2A 2IU4A 2QR2A 4G2TA 1Q21A 2H8GA 2A0WA 3NV9A 5F4ZA 4D9CA 1G2QA 1VKJA 1GCUA 3BHNA 2W2QA 3WMRA 2OG1A 4GPZA 3WMXA 1LD3A 2NUTB 3T7SA 5KTPA 1JNYA 2IUEA 2XT0A 4CM4A 5GVSA 3D7KA 3OPYI 4ANFA 3WADA 5JROA 4GQNA 1HO3A 1XU4A 3Q3JB 1OZGA 1VTKA 2E4WA 4OFXA 4F46A 2HGSA 4C6HA 3LPMA 3L6DA 4FI3C 4KR9A 3TN7A 4R1TA 4IWXA 3EDQA 4AY6A 1O97D 4AG5A 3KD3A 2QL6A 4BXOB 2P5TB 5K03A 4U2GA 1JLKA 2NTYC 1NXWA 4WKOA 4AJ4A 4G4SO 1TQHA 1U8CB 2AK2A 2V7QD 3D43A 5HEKA 3EGDA 2VVTA 5JYEA 2REQA 1KSFX 1C3VA 1V8OA 2CCGA 4XIJA 1YVEI 3PI6A 3TLGA 1JVNA 2C31A 3ME5A 4H3SA 5IDYA 3V7AA 1AGNA 1I4WA 1VI2A 3EIQA 5ALRA 3EEIA 4FYIA 3QUSA 3O7WA 2BFOA 2OP1A 5KOJA 3JD2A 2Z8YA 1GNLA 2G0TA 1MA3A 2H1SA 3W79A 2H16A 4OLJA 1PVVA 4AUEA 3MQFA 4MGZR 4EYQA 3G3EA 3UJPA 4DWWA 5IYZA 1AGRA 4O4LF 1VLJA 3M83A 5HKAA 2PUFA 5FJIA 5GIPE 2CDCA 4QU0A 1PG0A 1LBHA 4MCJA 4MPDA 4Z53A 4RVGA 3SICE 1FCJA 4RL6A 1IN4A 3H84A 2R6R1 1K6XA 2P2DA 1U1IA 3K8YA 2HEIA 1L7OA 4FFRA 3W2HA 4FGWA 4XM2A 3OQPA 5E0KB 4QTXA 4MQ5A 5KNCA 5EJMA 3WIVA 1C3OB 2W2XA 4DZTA 4F4DA 3GJ7A 1ULTA 3PXXA 3CCFA 2FA9A 1XHEA 3NT2A 5DF1A 1C9DB 4P32A 3CKMA 1ETUA 4ZEXA 1WUKS 4JI1B 2JL1A 1SPBS 3EGOA 4IJVA 3DMYA 1NP6A 1L4LA 1ULUA 4KXNA 4EUHA 3RVBA 1CUBA 3WKBA 3N58A 4DCSA 4BNZA 1P0CA 4N76A 5A0TA 2OBFA 2OYNA 3RRYA 3VC2A 3L4BA 5CD1A 3W8NA 4TLDA 2HLPA 3VO9A 1X1RA 4TV9F 1GCIA 1PFGA 1U9CA 1VKOA 2C5BA 1UL1X 2X86A 3OOSA 1O4WA 4NH4A 3GSIA 1L5OA 4BKOA 2BW0A 5E4TA 2A0YA 2NO9A 3R6WA 4O2BA 5HBGA 4EW1A 3GLFE 1WG8A 1CY6A 4IHQA 1G9SA 1YRBA 3GPCA 3W05A 4PN7A 4DIKA 4HAWA 5T64A 2BF4A 4J2TA 5J5CA 2H51A 4AD8A 2WIDA 4U2BA 3KE9A 3TZKA 4FX5A 4F8EA 1E62A 2VYQA 2C20A 4YT5A 4YP7A 5KVCA 1G38A 2IH2A 2NUPB 1SVNA 4FP9A 2CVZA 3V4LA 1OW3B 3ZY2A 4A0RA 4P3XA 3DLCA 4OXQA 4RF4A 1K5GA 1U98A 1CB7A 2AMFA 4H4CA 2UUCB 1NN3A 1QG2A 1P4AA 4WLOA 5K0EA 5PGMA 4YDRA 2NU8A 1TAQA 4RPKA 1VG1A 3BQJA 2QTCA 1ZH2A 3P2KA 1O95D 4JP2A 5TT0A 1TMKA 4EHNA 5U4QA 2JH8A 3JXEA 1AV6A 4TMKA 3QF7A 1MC1A 3PNLA 3A4NA 3K1AB 5DI9A 1D2CA 3WAGA 5ETJA 2CXNA 4BJ3A 4W7SA 3THRA 5BNIA 4MRVA 3P4YA 1W48A 2NZJA 4IIJF 1X7WB 5EP4A 4AMYA 4QBGB 3B51X 4JWTA 3JWJA 3MCVA 2W6IA 5EZQA 5K3BA 2FWRA 3NAZA 4Z0HO 3FKQA 4G8CA 2EFYA 2QLFA 3K0AB 3QKSB 1WSAA 3EXEA 3MJFA 1V4VA 1XD8A 1L1FA 3ZTYA 4CW7A 2YUTA 2R8ZA 3M2PA 4E12A 3JQ9C 1J1UA 4TOIA 3DDHA 4N54A 5JI2E 3IAM1 2FSVC 1Z37A 2JI4A 3F1KA 1QR6A 1HKUA 1ZY2A 3BD8A 1SA0B 2PTHA 4NOLA 1JRLA 4DV6B 4RMIA 1E1MA 3UBMA 4F1KA 3BCRA 4KQ2A 5BMVA 1PUJA 1N2JA 3C7AA 4J0FA 3T12A 3OD1A 4Z4HA 3L1JA 1C3EA 1E1YA 3BGDA 5IDVA 3BC9A 4GX0A 1W9HA 1T0IA 2AX4A 2JANA 4P6YA 2VH2A 4J7CA 3VI4B 1PR6A 3VVMA 5KQRA 3MMPA 3V3KA 3EASA 1X1TA 1LX7A 2OWDA 2SKEA 1NAIA 4HO1X 3KQQA 2NYRA 1KNXA 4TUYF 4WBNB 2FUG1 5LBTA 3V8RA 1PJ5A 3QPDA 4DL9A 5IJZA 3EF1A 4QDOA 3B7PA 2V6BA 1N2HA 4KQFA 3GMTA 3WIBA 1EK1A 1M2JA 1MOZA 1BEZA 2ZTGA 3RJMA 4EM6A 3RBVA 4OA5A 4ZC8A 3DNFA 3LLCA 4MVCA 3N3BC 3JCZA 5FPQA 3WO1A 1T29A 4MTLA 1B7GO 3D9QX 1RI4A 4EW2A 2XUKA 3UK7A 2ERXA 1D7AA 2AN3A 4N6NA 1F17A 2X4LA 4RJJA 1OWPA 3DS8A 3ISXA 3PCRB 2WE8A 3PL1A 4WKBA 1BVRA 2YVQA 3A6JA 3NANA 3CPHA 3V2GA 3O8RA 1JJ7A 1GLNA 1NJSA 1Y8RA 2GAAA 5EIWA 2PX6A 5D5HA 2C42A 3QUBA 3W5UA 2C2HA 1TMGE 3R7BA 2YWEA 4AJKA 4FYPA 5IAJA 1Z9BA 4GUAA 5IUJC 2PPVA 1Z07A 2CJFA 4XLCA 2GEVA 1M2OA 4BEJA 2RIPA 2R5NA 4F9FA 1HFKA 1KXZA 2O57A 2J5KA 2Y05A 3IE2A 4GI2A 1M0EA 1CCWA 3JX9A 4ESVA 1LQUA 1GT91 3JQBC 4S1VA 1S3IA 1NZDA 2CNKA 3DE4X 4YA6A 3W5HA 1KEEA 1DXOA 3A8KA 3FZNA 5KOYA 1W46A 4MLCA 1E7SA 4IINA 4XLTA 4BNGA 2AKYA 2GEDA 5KNCD 2QUBA 1SQSA 4LTDA 4K2HA 4BO4A 1L1RA 1RWXA 3KE8A 1HDCA 4TTVA 1RTTA 3SVTA 4PHCA 2MIIA 2OD7A 3AR5A 4E5YA 4EMSA 2YN2A 1JR3D 2QTGA 1XVLA 2YWCA 3HCNA 4EQ6A 4F86A 3A1SA 3ZH9B 1Q84A 2GCEA 1A7UA 4ENWA 3ER8A 5FHQA 4DNOA 3K6JA 3MFYA 3NI2A 5IKMA 3SS7X 4OLHA 3EQ6A 2PS3A 1JDTA 2V5AA 4MWTA 3RSSA 1SXPA 4KREA 1RC8A 4BPRA 2FEMA 5HF8A 2GLXA 4EL5A 2A67A 3BWCA 3O90A 4Z5XA 2F7SA 1XEWY 1M2VB 1WU7A 4MEJA 4AU1A 3SHQA 2O6HA 2YIDA 2F4NA 3QXSA 4JHXA 2A5FA 1Z4NA 1RSZA 1P75A 2WUFA 4V3CA 4EVIA 1ZOSA 1F0PA 2F8MA 1VLQA 2ZL7A 3LT1A 2HREA 3LWDA 4TWAA 3ZGXA 5BXQC 1SU8A 4YMLA 4C9BA 2P9JA 1Y3BE 1IN8A 3BXGA 3HKBA 4WOCA 1KY5A 1OSNA 2FPRA 3FDZB 2E49A 2HK6A 4YPVA 4H6WA 2QJWA 3Q9NA 3SHOA 3ZHXA 5F3DA 5CT4A 5JAUA 2ROQA 2DM6A 3CRW1 2ZI5A 1RPNA 2OLKA 4PBRA 4L57A 3SYMA 4C6TB 5A4MS 3KEFA 1JAIA 5JLJA 5KNBH 1JJAA 4HP8A 3B78A 2V7XA 3M5PA 1OH5A 1YDWA 4ZJPA 3GEGA 2J59A 3BIXA 1QIFA 4L8JA 2JF0A 4PBSA 2PH5A 2C9CA 1WABA 4ZO9A 3UGKA 3URMA 1G8JA 2N46A 3N2NA 4MUMA 1P62B 3KLMX 1Q7TA 1YCFA 3VR5H 1YS4A 4O8CA 1E4OA 1SZPA 3E27A 2XRZA 2ZJ0A 3E6AA 3R7LA 4UPEA 1CP2A 1U0OC 4G84A 5GJWC 4PGFA 4IXWA 4E0BA 3PQ3A 1Z62A 5E8RA 2WU8A 4LRQA 1XYVA 3SOPA 2WY2D 1A27A 4KE9A 2BHSA 4FLMA 4OJMX 3U26A 4CKXA 3UJ8A 1JU9A 1YFZA 2ONZA 4DC9A 2FZKA 1XZGA 2W6ID 3PJFA 4UATA 3OIDA 1SIBE 2NO0A 2ONJA 4L8WB 3BKXA 3KFLA 5E1BA 1NXPA 2OL4A 4QOEA 4RKWA 2D0PB 4AIRA 3VSBA 2WD7B 1VPVA 3IPXA 1NUHA 2GAIA 5TQJA 1L5GB 1URPA 3WX0A 4JHLA 3F96A 3L0SA 4HGZA 5LBIA 1CV2A 3I8XA 3ZHBA 4RIFA 4BNMA 5JOQA 4REQB 3RS5A 3FVQA 1NG9A 1BE0A 3IHWA 1B00A 1O6CA 4YALA 3LX8A 4Z2AA 4QNMA 3U3JA 2Y67A 1JEJA 1RMYA 4XLLA 1A9ZA 2G0AA 4MPRA 1KSGA 5CDHA 1M1YB 3G85A 4RHEA 2HGZA 3F7TA 1ANKA 4Z3KA 2YZNA 3L1HA 4RM0A 1GUYA 3QOXA 2BM1A 1S01A 1SHKA 2OV2A 4QODA 3AP1A 4B40A 3A1PA 2H7XA 3LYLA 3S55A 1RAIA 1R4NA 1TEHA 3T7EA 4MUAA 3T1OA 1GRRA 4UQOA 2GK6A 1D0IA 2P2GA 4J1TA 5BVGA 4YT2A 2ZYTX 5C34B 2AQHA 1TFRA 4B81A 3KT6A 1CB0A 4TMVA 1OBOA 1ZLXA 1RZ3A 2G72A 2PZEA 2X3FA 3AV3A 5HIJA 4CU2A 1UD6A 1RWMA 3FVRA 1O5IA 2DKOA 3C6QA 4AWAA 4PYJA 3OTQA 3A3BA 3WRYC 2JIRA 3Q2OA 3QUQA 4L07A 5IANA 1ZSYA 2JIPA 2PXHA 1M3SA 1P0QA 3QA9A 1IRXA 1OVGA 3K20A 3QFFA 3WLTA 4DFDA 3GDFA 3Q8WA 1DC5A 5EWLB 4X60A 4ZK6A 4TS3A 2XHEA 4FQ8A 1ST3A 2MYTA 2Z2IA 4H7FA 5HRCA 1JXMA 2WKWA 3ECSA 1DHRA 3FZYA 3ZZ0A 2Z1NA 2QJRA 2O7SA 1I6MA 3EXG2 4HQKA 4XIIA 2MSWA 4MB0A 3I9V1 4D80A 4OREX 3Q7SA 3V4OA 1V4BA 3NGMA 1REQB 1J23A 2G6TA 3OIUA 5HBRA 4QLOA 1K73D 1EDZA 3LO5A 1OX5A 2I2BA 5K05A 3RC2A 1SKMA 3WHPA 3TLJA 5FFFA 1O7JA 5AW3A 3F6CA 4OP1A 3I9OA 2XB9A 1RXWA 2Q1WA 5K7SA 4URUR 4C0WA 3W2GA 4YJHB 3GQBA 2IYFA 3PA8A 3CR7A 4PZDA 4RA9A 5F2OA 1W19A 3D1JA 4GR9A 4URHA 4N48A 2OYCA 4DLUA 3M6AA 5EYPB 5J2TA 5ALMA 3MIIA 3PXBA 2IK8A 3LUBA 3QBEA 4RA6B 4LJYA 3RREA 4HAYA 3CG4A 4YJ2F 3CEMA 4N82A 3P9SA 4QVIA 2YYAA 1XEFA 3BD6A 1JG6A 5JWHA 5K3AA 3WGVA 1TEZA 5GONB 3M4XA 3QU7A 3A05A 2DWOA 2ZJ5A 1QCZA 2PSFA 4V38A 5E9JA 2PRKA 2EX4A 1J0DA 1DJMA 3U7FB 4IYJA 4U0JA 2OP0A 2W2TA 2ZE8A 4DLVA 3EC2A 1CUDA 1I5OA 1ZGJA 4GMDA 2NAFA 5D3QA 2FJ0A 4HYTA 1XAIA 5BUCA 1DBSA 4ZYYA 2X85A 2X2PA 4I8XA 1FRVA 5DCLA 1PL0A 2QMZA 1KZLA 2XNJA 4XR6A 4XEUA 5HE9A 2C2OA 3UMBA 2A0FA 1T5SA 1GDHA 1PJLA 2M9MA 3AG6A 4FHZA 3QUCA 2VNAA 4N41A 1QMGA 3NORA 1VGRA 3E7PA 5IKPA 1Z6ZA 2I8AA 2XMQA 4EYKA 4NAVA 4YUVA 3TW8A 1FBNA 5C80A 1UD8A 2QTAA 3PGVA 1AK2A 4X41A 5SV2A 2FR8C 2VDJA 3DXXA 4KVGA 5LMNB 2G71A 2ACVA 2HIMA 4TKUB 2AR9A 4B3IA 4BVKA 4YRGA 4HG2A 3ZS9A 2R87A 3HY4A 4MS4B 3CR8A 4MUYA 4Q9AA 2I3AA 1QF9A 1TRHA 5F4JA 1OZHA 1W30A 2XQJA 4WVFA 1ECBA 2XNCA 1VE3A 1XZAA 1NQOA 2XHZA 2YW9A 2PEYA 4JFRA 4X7PA 3RF7A 3T4UA 5K0CA 2QRVB 2BFBB 1S8AA 1T8SA 3CF4G 5I4IA 4JVOA 2CJWB 4UDXX 3W6UA 3KWFA 4EBBA 5AN9A 4IDFA 1QGUB 1R00A 2I4NA 5G0TA 3VFDA 1HYBA 3R23A 1CW2B 4GGMX 3CPSA 4KW7A 3GGPA 2PFKA 1F14A 2OFOA 1YH3A 1IQUA 2RC6A 3E9EA 4NMHA 1G8YA 1QP7A 3PHJA 3CKKA 3NJRA 1Z35A 1GIAA 4CUZA 2JBHA 2Y1GA 2WFAA 1GTRA 4MMYB 3VDRA 1VQ5B 2LXNA 4XIFA 3SBOA 2GR9A 3MYRA 4S0ZA 1JBKA 3MCAA 1F1BA 4L8GA 5TQVA 3KL2A 1L7VC 1W85A 3QX9A 1KRXA 5LDGA 4L4UA 1RXSA 1VQ9B 2Q2QA 4QRDA 4DLAA 1RAGA 5FF9A 1KPIA 4P84A 1GP2A 4ARZA 1FTYA 4ZN6A 1HV8A 4MQEB 3ZWDA 3HTXA 2FUEA 3IX7A 2B4QA 4IXMA 1VBKA 3T3OA 4ITUA 1H2XA 2YWRA 4QHSA 5E9QA 1MJHA 1P7ZA 4Q6BA 1SVUA 4RYDA 4KQWA 5AM0A 3MWYW 1QRSA 4QXRA 5DN6D 1RLIA 4LF6B 1NTOA 2B1JA 4QO8A 4E5SA 5DNUA 3OX2A 2WMDA 4UBMA 1MTOA 5CYPA 1X0VA 3AGQA 1AQUA 4BS9A 4PAMA 5CCDA 1KZ9A 2V5VA 2G88A 3N6XA 2WYRA 5DYTA 5B2EA 3LLVA 5CB4A 4Q4AA 1J7KA 1U2GA 3VR0A 1WEKA 4ZPXA 3GY0A 3F5MA 4RD2A 3L40A 4JU9A 4AULA 3A36A 3C3XA 2NZWA 2VHTA 3FJ1A 1L7DA 2PS0A 2PSEA 1Z68A 3CRVA 4D41A 3CNNA 3I55B 4M60A 2FXIA 3AI2A 3U3DA 5ALQA 3HCPA 5JLAA 1JPUA 3TINA 1TZCA 3MMNA 1DU4A 2P30A 1NHWA 3M4YA 3CC2B 4YR7A 4NLLA 5LSAA 2OXRA 2P0AA 4PX5A 1G21A 1YB5A 3B1ZA 5FR1A 2A30A 3QQ5A 2FKNA 5HK8A 1S6YA 3SQDA 2SKCA 3NDBB 2DY1A 2XGOA 1D3AA 1VHTA 4ZPJA 5EAIA 5BWOA 2D54A 3AX6A 4OI1A 4N8EA 2JKZA 1TQ2A 1WLSA 1ZRNA 4KIFA 4TXNA 4JJ6A 4FB4A 4JXXA 4OOSA 4XL9A 3ZGNA 3U44A 3GT4A 4LCJA 2C83A 4OB7A 4F96A 5HP4A 2WKRA 2CY0A 1R18A 4H7DA 4UHKA 4B0PA 5DNAA 1KYTA 5A7GA 3VPBA 3RTBA 3IL2A 1R15A 2JIZA 2NSYA 1W581 2QGFA 2CFSA 3Q3CA 5G3YA 2OHVA 2QX9A 3GLUA 5HVNA 2J3MA 3ZEIA 3GJ0A 5IK2A 1O58A 3CONA 1PN3A 4KX5A 2CXUA 3G7NA 4I1IA 5FOVA 4YLEA 1UOPA 2ZBVA 2C94A 4EG1A 1ZH6A 2J9FA 5K4HA 1RR6A 4WXMA 2JCXA 4DZZA 2O2YA 1BCRA 4BMDA 5KIAA 4EPTA 3DLAA 4M1KA 1C0LA 1XCMA 4N47A 5BN1A 1M6EX 1OUMA 2XAUA 4OKSA 3LQEA 4WN3A 2C59A 4LXTA 3A7DA 3VR5A 4F1JA 1Z45A 1XEWX 1PDVA 2D5AA 2QD1A 3KQWA 4CJXA 1T8RA 2NTVA 1CRWG 3YASA 1XU9A 4AJOA 1CDZA 2R8EA 3A11A 4R3UC 4F2HA 3R24A 3EAGA 4Q7JB 3KAKA 1NDQA 4OXYA 4P9NA 3TJMA 3GFSA 3BIOA 2MYUA 3WICA 4CTNA 2GZAA 4MSUA 2W98A 4RQBA 3O4FA 4WNYA 5EXTA 1FOEB 3OOJA 5C8DA 5B58T 3VZPA 1RBZA 5ESDA 5IF9A 1LJLA 1PLKA 3U3KA 4E4YA 2ZJAA 5BN3A 2PIDA 1NVFA 4LMAA 5C5IA 3U09A 2EWVA 1EWQA 1DIOB 1Y1SA 3UK6A 2O8DB 1LTHR 2ZIZA 2NU6B 4V0QA 5J59A 1E7MA 2IHBA 3ODGA 1XK7A 1ZI6A 1B23P 3IB3A 4LSZA 3DWEX 3HRIA 1DLIA 4YJGB 5FB3A 4ZI7A 2H00A 4CFSA 3VMMA 2X41A 1XMJA 4CDGA 5AJWA 1JXQA 2CNLA 5DM60 1SQ0A 2OZKA 5A4JA 1TK3A 2F1KA 5BSTA 1HDYA 1JQAA 1LS1A 1I6WA 2CF4A 1KVSA 1ZWLA 2IJGX 2R11A 3CUWA 8OHMA 4ZI3A 3KXPA 2AF4C 3JYHA 1KETA 3WGJA 4U6SA 2F17A 1NMXA 1UMBB 1Z83A 3BAFA 2QL9A 3ETEA 1LVUA 1O1YA 3EVNA 2IUTA 3OOYA 4G23A 4MV6A 3UAOA 3ENQA 4QICA 3QEAZ 4NJMB 3QE4A 2PRIA 5K8CA 1G6OA 3AW9A 1YVDA 4CNBA 1KPHA 1ZBDA 1OBFO 1C3JA 1JIXA 2A33A 4F71A 2GXSA 4F9TA 4U7FA 4GRDA 3IBCA 2Y0PA 1XCBA 2WB2A 3H9QA 2NACA 2IE8A 4U7WA 4W9RA 4DWVA 3F3MA 1P73A 2XMSA 3H6GA 5ALWA 1N1MA 4X1YB 5CG2A 4HTAA 5FXMA 1MDFA 2WYVA 2ZCJA 2QROA 4MB2A 4QUDA 1TYCA 4ZRDA 4ZO7A 3W3AH 2IIBA 3WGZA 4EY7A 1N57A 4L6CA 5DTRA 1CQIB 1CVIA 3Q8LA 2I6SA 1QK3A 1DOHA 2B25A 3CSDA 3P2MA 4DT1B 3STUA 1UXJA 4LRTB 1VQKB 2YQ4A 1QZXA 4MQLA 3T61A 2GQ0A 1UBHS 4BFCA 3G6KA 4OJKA 4EW6A 4D57A 4LW8A 4S0XA 3MCTA 1R74A 2GNAA 2R25B 1BYUA 2WJIA 3NTRA 4X7BA 5T8KC 3IPYA 3QVTA 5CG1A 3KOXA 2P5YA 5FCDA 1UFRA 2BMVA 3I58A 4ZCMA 2I3DA 2JGDB 3HWWA 4FDAA 4AUKA 2C9OA 5FAKA 2QQFA 3O3NB 1YJNB 1BHQ1 4NBSA 1Q0QA 2QQEA 2REOA 3BB4A 1PJSA 3FW1A 1NVVR 3HY6A 3OPYB 4M0MA 4P92A 3U6BA 1X3SA 3OZSA 1WMSA 1KOFA 2ASEA 1R8YA 1FSFA 1C1HA 1HKHA 1Z5NA 2HA6A 3KC2A 2GZDA 4IRXA 1T5OA 2O7RA 3M7IA 2DSTA 1Y3HA 3TOVA 3T1VA 2Q3EA 1WMEA 1NNSA 2LGJA 2Q50A 2D8AA 2FE1A 2YZKA 5J43A 4HXEB 1FW6A 3EXG1 2Q6VA 1LGYA 1BKSB 1N8SA 3KELA 3NUQA 4O0MA 1EXVA 2NO7A 2QAGC 1E0SA 3OTIA 5FOUA 2UUPA 1NBEA 4QOSA 3RC1A 3RFUA 3ZS8A 1R6DA 3ZU5A 4Y9DA 4Z3OA 2ONYA 5TPWA 2F55A 2EZTA 1XPJA 3V4ZA 4B45A 3J7AC 2CEKA 4XNFA 3KUCA 4PGGA 3NUZA 4XOIA 3VJMA 1VSBA 2HYIC 1NXSA 1SVKA 1ZRMA 2DPYA 1F7VA 3DHEA 2JLQA 3IOBA 1IZ9A 3UFBA 1IUOA 1GU1A 1RWKA 1ZVKA 1WDTA 2RHMA 3ABRB 2D8MA 4ML3A 3W9SA 4EG0A 3U56A 4BWVA 1DPGA 5IXYA 3PC4A 5K5EA 4XFDA 2JIZD 2QMYA 3IVXA 4OMDA 2OMKA 4MYCA 1H42A 4JENA 4PNZA 4YAIA 5H02A 5IK2D 1HE2A 1WOOA 1Z6TA 5AQEA 3LI2A 3A3YA 1OX4B 1QZTA 2CYCA 1JH9A 1PSDA 1WCXA 3LXXA 4HYEA 4XLFA 1LDNA 2BZ0A 3LWNA 1R6TA 1CR6A 3OUUA 5KNBD 1Q92A 1U94A 2GM9A 4RM2A 1DKNA 1RVDA 1KHTA 3ZU2A 1XGKA 4GBGA 3E81A 2FEWB 2QA4B 5J58A 3ANSA 3CVXA 3OX4A 1R3DA 2C78A 4TXLA 4NI5A 3IQFA 1ZESA 5DHAA 3VR5D 2YN0A 1IDN1 1JDZA 1YR1A 3CZAA 3LLSA 4RK6A 3MWLA 1G6KA 3TW0A 2DBQA 3RRBA 1PBNA 3CNLA 3L0IB 3ZCTA 1KQOA 1NYTA 4LNUB 3CVUA 3CUYA 1I8TA 2VCHA 5I3CA 1O5TA 3M3HA 2QTZA 1S2MA 1C14A 3Q7IA 4XX0B 4Q1DA 3AEYA 3RGWS 3UIEA 4YRKA 5AHKA 4KH1A 4C4RA 5BURA 4JVLA 3V8PA 4JC4A 4WXHA 1RKBA 3KJEA 4D96A 3PENA 2HQSA 1KMHB 3LBFA 4LAFA 2ZR0A 3U4DA 4LY0A 4E0FA 1DB3A 2Q41A 3ZXXA 2PV0A 1NRJB 4BE7B 1I2MA 2OG2A 5ALZA 3QBDA 5K0ZA 1C81A 2YOHA 4CQLB 3UH1A 1E4EA 4EUEA 4IFBA 3MJRA 2XCTB 3Q0TA 4O3FA 1JEDA 5JU6A 4G0OA 1RWOA 1AU9A 1DPFA 4JXKA 3ZGVA 1J9GA 1QO0A 2P3LA 6YASA 1N5KA 2WIGA 2I4LA 1AZSC 4C01A 3WYAA 3GLHE 2BHNA 2C3MA 3FROA 3M9XA 3P9ZA 5DASA 2HF8A 3AF6A 4NXNB 3FDJA 2ZREA 2HI0A 2W2VA 2HCTA 4CKBB 4B3JA 4J0DA 4BZPA 4WZAB 5EESA 2IIPA 3GOQA 1IUPA 3L07A 1CJBA 2JLAA 3H97A 3PLNA 1FVXA 1NLMA 3PB3A 3W9UA 1UBUS 3PWZA 4Y2VA 3ZHCA 1SUPA 3NTXA 2FYTA 2ZRQA 4LOHA 4OV6B 4D9HA 3SQXA 5F98A 3F6SA 4CG3A 2O0KA 1GTJ1 3SJAA 5A6VA 5FDFA 2ZBUA 4FZJA 5ERGB 5T57A 2WUDA 3NDPA 1T5DX 3TEJA 2Q4OA 3RROA 2ZWAA 4B4WA 5I3ZA 2Q8QA 1UJ2A 2Z4RA 4HLUA 2E1RA 2Y68A 1SZCA 3EQ7A 3OQ6A 4LJ7A 4MW9A 3VBCA 3GD5A 3PEWA 3RAEC 1F4VA 2YZGA 4KQKA 1JMVA 2ZAMA 2BR4A 4H17A 5LQNA 1YIJB 1GTZA 1GU0A 1OU0A 3LDGA 3LZ6A 3LDFA 4YEJA 1RHQA 1WU8A 2XVZA 3K0FB 2GCIA 2I33A 3O47A 3QEJA 1PLJA 5AJYA 4A5OA 1JSRA 4CRWB 4P0QB 3HNRA 1CRZA 5T6BA 4WKNA 4N5DA 5LXTA 3NM5A 4JKOA 3IEMA 4Q12A 2W6CX 2YIJA 3DV2A 2V8BA 2JATA 1RWVA 2ZVQX 4FYJA 1P4MA 4IFEA 3CB4A 2J48A 4D44A 1FJHA 1KP2A 1DAMA 1VBNA 1WZIA 2IRWA 3I9FA 4HWPA 1K3TA 2ENWA 3HDYA 1GRVA 1WZUA 4YP9A 3MB5A 4EA7A 3K0CC 4M3NA 4WGGA 5H8WA 1NDHA 2VP6A 1JHAA 1UPBA 2FI1A 1JG1A 4OI2A 4R8LA 1US8B 1X8KA 1UKBA 3AU8A 3G5UA 4GM0A 2FUCA 4XVQA 4KFCA 3SG0A 3ZR4B 1ND5A 1T5EA 1MB2A 4D4LA 1Y9DA 5ULLA 3IR5A 1JB1A 2ZI4A 4A92A 2UYHA 4R8SA 1H69A 1BS2A 1ZXLA 1FP6A 4I8IA 5FO1A 3ZXYA 1E5TA 3I2YX 4X6YA 3ZQUA 2JLUA 2V6JA 4QIHA 3UAYA 1W9MA 1YV9A 2DZDA 4MGIR 2IYZA 2QRZA 5EIFA 5FI1B 3U3RA 1R66A 3N2GA 1RP7A 3DOHA 2QLMA 1TM4E 3EIOA 4KITB 1P9OA 1Z6AA 2BFWA 5DFAA 2PRZA 1FDIA 3Q7QA 3FBWA 4K6GA 3KB6A 1LKZA 1MOSA 4P33A 3ZLTA 4HRVA 4QPDA 3GZNB 3LC7O 2Z5LA 3D64A 3W34A 1EZ4A 1XZKA 2OO3A 4I19A 4X7MA 3FWPA 1V8ZA 1L3BA 1UDRA 4QOHA 2NT3A 2Y71A 4FOOA 4G2NA 3F74A 1HE5A 4DPKA 1EGHA 2B1RA 4G6ZA 5JANA 13PKA 4JX8A 1A77A 4FHGA 1EE2A 2VJPA 4YWJA 3ISJA 2PH1A 3RVPA 3HS3A 1YBAA 1G17A 2XVYA 3PHCA 3FBTA 1ESCA 5SY9A 3E84A 4R51A 4UTRA 5HPYB 3QX7A 4PQFA 5D3ZA 3J81k 3LQRA 5GIOE 5BPHA 2B35A 4X63A 2Q9BA 3ZGZA 1XXHE 4BQNA 1TL7C 2JAWA 4IG4A 3W78A 4FN4A 3JVIA 1MPXA 1H0RA 2FW1A 4Q3EA 4Q4CA 1Z2EA 2FQXA 4A16A 4ARUA 4BN0A 3QTBA 4M98A 4XPZA 4W99A 4HDAA 3N5KA 3FGPA 1ZJZA 1SXGA 2XGSA 2Q4EA 3USES 2A35A 3EGVA 2BKLA 1E1KA 3U7JA 2OQ2A 2OHXA 1RMQA 4B2PA 4L5IA 3NOXA 3LT2A 3WIUA 3M6WA 4G1FA 4BQFA 2WA2A 4BB6A 4HX5A 1U3WA 1NULA 2B4AA 1B76A 2A8YA 2XZPA 4RZ3A 3W3AA 5JH7F 3E0QA 3OZWA 1BW9A 4QBFA 1AF7A 5EGSA 4B2LA 4BC1A 2A1TR 5JE8A 4LEIA 1E2UA 5I47A 4AY2A 5DS0A 4UTXA 3TQQA 3QLJA 2REBA 1N0WA 1GLVA 2C00A 3FYSA 5L6MB 1A1VA 1YLOA 4JC0A 2SHKA 1E94E 4A82A 2FFQA 4A10A 5J3JA 4CNQA 1YGYA 1Z4MA 3AKCA 3A6LA 1AUVA 2HSEA 2IZ6A 2CXHA 1QO0D 1P81A 4YP6A 3OCUA 4K9DA 2R6DA 2CNNA 2GJRA 2HZ7A 4B3SB 2JZCA 4N3BA 1Q1NA 5DNVA 4CQMB 2HJHA 3GJQA 1FFBA 2ZYHA 5ALGA 1I7SB 4KR7A 1CR4A 1PS8A 2CZQA 3AY7A 3EPRA 3K9GA 4O6VA 4DCTA 2BI4A 1XMIA 2OBMA 3FSGA 1VIVA 4DEXA 5A1TA 1U2EA 2ZGVA 4MA5A 5IVIA 5BUSA 1HFJA 3AO0B 1TECE 2AOTA 3K2BA 4GLFA 4RCVA 3R2JA 4YTEA 3ZH2A 4D9BA 2C7OA 2GJ4A 3ILYA 3RQIA 4HPJB 4LHSA 2OV6A 4IKPA 4XFJA 3MAGA 1QAQA 1SNYA 5CCXA 1U7HA 1P1KA 1ISRA 2X6XA 1U6KA 1CF4A 1YQWA 3K9BA 4C4AA 4R5MA 2C2GA 3QJYA 3F9IA 1Q91A 3GYBA 1PNQA 3W6PA 1NVXQ 2CEAA 4H7KA 5D5QA 4IY1A 2N75A 3IAEA 4N7JA 2Q7XA 4RIIA 4LA4A 5BSVA 1Y34E 1U3VA 3UHPA 5CHEA 1VQ6B 4Q1BA 3ZJYA 4CEIB 4WHMA 2JFPA 1WV0A 2AOXA 1NLYA 1QHIA 2D2XA 3BGWA 3IR6A 1MB4A 3UH0A 3PDWA 2LKCA 4MDYA 5CCBA 2NUTA 2GUGA 3GLKA 5IARA 1M73E 3N0TA 3S28A 1UPCA 3HDJA 4HUJA 3G13A 4ZYXA 5KNLA 3I8SA 4HZIA 4X92A 1K4YA 4DMFA 1H6AA 2QGZA 4I7EA 4K88A 2Y1KA 1XU7A 4R98A 2JZNA 3TDMA 3T7JA 4EZBA 5KKNB 1HOXA 1ZJ4A 1PL6A 3R0ZA 1U11A 3QFHA 2PL9A 4P58A 4K40A 2OCDA 2CD9A 2CNBA 2ZTLA 4MKXA 5EXXA 2PHZA 4RIEA 5A7FA 2BMJA 2EGHA 2W2MA 4YCJA 3I6YA 2WQ6A 1W2BB 3UCFA 4GOXA 2QRHA 1RHKA 3K8ZA 4BXOA 3OF3A 1ZINA 3KR2A 1A7KA 3SAJA 4EYSA 4GKBA 2QAGB 3BF8A 3LUGA 3U7EB 3DWGA 3VOSA 3U1BA 2DKFA 4RF5A 3UZUA 3NHAA 1CXZA 1A9PA 1I24A 2PD3A 2Q4TA 3IHLA 3LWBA 1OXKB 2DAPA 2X0JA 4HQOA 3S4YA 5TMDA 2FPKA 1LC0A 7YASA 1K6MA 3NWEA 3ZY6A 4KN8A 2WM9B 3L7IA 4GU5A 4LGMA 1KDZA 1N1DA 1V5IA 4P35A 1FDOA 5BQXA 1LFDB 5DULA 3EVEA 3PR2B 4MS1B 4EJMA 4JQZA 1XVUA 2HPZA 2ACKA 3EEYA 3PWSA 3IE1A 2ZSJA 4LJAA 2G36A 2C97A 2Q1YA 2JAHA 2WZQA 3G4SB 3TMAA 1MNAA 3HU5A 1X1EA 2AUNA 4EYOA 1BTOA 2HWXA 3AHJA 1JG4A 1OD6A 3P2JA 4ON9A 4JN6B 2GAOA 4DRXB 4IVQA 3BCDA 3PUZA 5U1PA 5HGJA 1NRIA 5FBKA 1E3XA 1V8BA 1E5VA 1D5WA 1F8YA 1KBOA 5TB5A 4CG1A 4CCSA 4Z7OB 1TZKA 1XCLA 1KI8A 4QJ3A 1QIIA 1PW5A 1JZSA 2V5UA 3EZ7A 4MWEA 3U3OA 2NUBA 2GYVA 3WGLA 5J4YA 1HNXB 5EIBD 1YR6A 3DMPA 1MFPA 2KYRA 1HVXA 1YVRA 3TFWA 3W06A 5ALVA 5LP6F 4CLRB 3RAGA 1MQ8B 1ZM4A 2Q62A 3K9LA 2H57A 2CF5A 4L76A 2ZYWX 2PH7A 4X97A 2RB4A 3IOYA 1IDOA 3WLNA 4D4MA 2HV9A 5AVOA 3HVHA 1W76A 2JLVA 1BS9A 3PF9A 1J22A 3R5TA 2JLYA 3RARA 1WQ1R 2HAEA 4FE3A 4NOMA 3EXHC 1E2DA 1V4NA 4LKRA 1ZC4A 3ICPA 1W5AA 1YZGA 3SOZA 3WWPA 3BFVA 5IJWA 2J3JA 5TIIA 4FSDA 1E0DA 3E5HA 2OGSA 1L4FA 4KI7A 2JFXA 1U0GA 4K8OA 3LQ2A 5AKGA 5EQTA 1UBSB 2QDKA 4FXPA 3LXUX 4L0CA 3W3AD 1E1CB 5F3WB 3V9AA 5AKJA 4EKYA 2YWFA 4EITA 4CLEA 4IDOA 1UKEA 4BIIA 2NUPA 4J4HA 3IAFA 3VNAA 3ACDA 2EDCA 2OE2A 2ZVPX 1CS4C 2P9YA 3EWIA 4KB5A 4XPIB 4AF8A 1I4LD 3QVXA 4ZVOA 1FNDA 4AZWA 2VPWA 4UAVA 3OFSA 4B7UA 2YJNA 3ABOB 3V7UA 3CA8A 1TQ6A 1ZRHA 4FEYA 4LISA 3VR2A 3RANA 3RSLA 1WLYA 1K88A 1WSBA 4JSRA 2ERCA 3V1LA 5L3QB 5DU2A 1XMOB 3IP6A 2WTUA 2XJ4A 3WLFA 3ETHA 2CHEA 2RG1A 3G8YA 3KPJA 3MGCA 3WKAA 3KLBA 3K1AA 3JSAA 4ZVNA 1NY5A 1E3SA 2QVLA 2YNMA 5LN1A 1PK9A 1VHOA 2IHUA 3HV0A 3S68A 4X64B 1IIRA 2EP5A 1EK6A 2E7ZA 4L8VA 4O02B 4RBNA 1X7WA 2FSPA 4TKOB 3H94A 2DBRA 1OA1A 4IQFA 3UICA 4L95C 3A6KA 5IVHA 3FSGD 3LGXA 1V5FA 3K0AA 3QKSA 1ZGHA 3F1LA 2M6KA 5J47A 3EFOB 4X7DA 3H5TA 4Q00A 1ZGBA 2QXUA 3L2OB 3FX2A 3O4IA 4KNVA 3PXUA 1EVYA 4LOLA 2HCJB 1J42A 3G2KA 3I1YA 4KGDA 2ZIWB 3VR1A 5DGIA 1PU2A 3T9AA 5KQGA 4DMUB 2HCBA 4QYSA 1ZD4A 1Y5IA 3FJYA 3WISA 2ZZQA 5KQPA 2I1WA 3C45A 3DEKA 4ZYTA 3TWOA 1W35A 1UKCA 2N0SA 1L5VA 2DFVA 2EARA 4QXPA 1CPYA 1VIDA 4S1TA 4FMCF 2OUIA 2YMPA 4BNTA 1FL9A 1F4LA 2FLVA 3X1KA 5TVGA 3C1AA 4MW1A 1X7ZB 1C41A 4UU8A 2II6A 2JD0A 2BSQA 4ZAZA 1JDNA 2QF7A 3ZV5A 1GPUA 1ZR2A 2NZYA 5SZJA 1Y5RA 4J0IA 3EQ2A 1V11B 2EW1A 1PQUA 1E63A 4R7ZA 3U81A 5BV8A 4BO3A 4WBNA 4RKQA 1AH2A 1YTUA 1VL6A 3GIWA 1ZL2A 2GK4A 5THKA 3ZHUA 2GAFA 2XYPA 3AESB 1Y37A 2EHDA 3LPNA 4RGYA 3VH4A 4I5FA 4H31A 5IZCA 3S1SA 1K9SA 3PT9A 4RHFA 3PD1A 2H1RA 1CKEA 2PDAA 2R8YA 3GRAA 3QTTA 4WXRA 4JL5A 4MVJM 2HLDA 1XT6A 2W4MA 4PX2A 1WBJB 4CU5A 2BEVB 3CIOA 3R7DA 4CV3A 4CVNA 2L18A 3MOGA 4P3PA 2ZL5A 3COVA 1VB5A 2R96A 1Y6RA 3KXKA 4YMIA 1EVKA 4QUHA 2JAXA 3DTVB 1CUIA 1CYDA 4J2OA 3TSZA 1TIBA 1RM4A 2KMLA 3ZY4A 3TFQA 1DS6A 3OURA 1O96B 1D0VA 1PK7A 2FVXA 3NWPA 4NCXA 4RAOA 4YAEA 4F3CA 1RZRA 3BWDD 1E3JA 2BMDA 3Q3HA 1NRKA 1XQ1A 1JEQB 5CT8A 3EAFA 3W5AA 1FXSA 1U0FA 5HF6A 3R7NA 5CFPA 1LBQA 2W2NA 3MEQA 3NV7A 4MQFB 1DEXA 1NKSA 5MGNA 1TT5A 2I7CA 3P71T 4GQBA 1GNPA 3WRXC 4JBHA 1NVUQ 4X20A 1II9A 5KVVA 1QYRA 4HSGA 2XA9A 5C5CA 1VSQA 3TTVA 5ARDA 1UT5A 3AHEA 5A1JA 3C3WA 5DGDA 1N6IA 4O4JB 5A5EA 3I53A 1B0UA 2GYWA 3BCSA 1NOIA 1UFOA 1UCFA 4JP5A 2C9YA 5JQWA 5A4IS 1LRKA 3VR6H 4FWBA 4Z4TA 2HQBA 4OQDA 4TKMA 4YJDA 5ICEA 2PGIA 4GR4A 3NIBA 3P0FA 1E5DA 1ZK3A 1PYOA 2EZ4A 3CO5A 3LRTA 4JLDA 3T8YA 1EP2B 3VPAA 4LY3A 1ZEMA 4YRLA 5BW4A 4DA0A 3R1IA 3E3MA 3GNLA 2RJ3A 4RTRA 1PV4A 1A5AB 1ENOA 2AFIE 2GZHA 5AW2A 1IXZA 2NPFA 1QCDA 3IIJA 4A5SA 4CL8A 4FXOA 2GKGA 5EE5B 1Q1GA 2JLXA 3ZHVA 1M34E 2RKBA 4PVDA 4FGUA 3JPWA 1NA5A 2VYNA 4WZEA 3ZZUA 1EGQA 1HOTA 1NQTA 3OMWA 4W5TA 1ADJA 1MG5A 1O94C 3TOCA 1GN8A 2BZ1A 3OLXA 2BBOA 2JC3A 5JPIA 4E4TA 5B12A 3TTUA 2IDZA 4OL0A 3K70D 3DYIA 2FG6C 4L4ZA 3MJHA 2DWCA 2EFHB 1YVUA 3LAWA 4UUPA 2IF0A 1U3TA 2VYVA 1M2VA 2WU4A 3KKMA 4LI3X 4PRYA 2YFYA 4H1VA 4LJRA 3PGA1 3PXCX 2BP7A 3HYLA 4JODA 3F2VA 4L85A 1XBTA 4V0ME 1GYPA 1MG0A 1PT6A 1U31A 1MEJA 1SOVA 3N86A 4KOAA 1QHHB 4NBVA 2OM6A 1DKQA 2HM7A 2OO5A 4PS1A 3UWPA 4X6XA 3F73A 4JYBA 2VQDA 3FDZA 5ILGA 1VKRA 2IOFK 1NSFA 1QIJA 2IUYA 3IAAA 1THGA 4D92A 3NC4A 1DC6A 3BHJA 4C6TA 3TLCA 1HTTA 2IW3A 5JJCA 2PR2A 2ZSKA 1U4NA 2I3ZA 4YONB 2HL6A 2XWSA 1ZM7A 2RAVA 3LP8A 3ZDCA 1H4SA 4S35A 2WWIA 2ZTUA 4QYMA 4UHCA 1UQTA 1N32B 1XRPA 4OIMA 3H11B 4N3AA 3VR2D 3FPFA 2G9QA 2OCXA 4HATA 4S12A 3ZCPA 4HVLA 4ZDJA 3UJNA 4OSOA 4NV3A 4WSOA 4UEOA 1PT8A 2A5GA 3ACBA 3M34A 3FNRA 1OB5A 1P9NA 5AXBA 4RTMA 3GLVA 1IL0A 1KVTA 3G2QA 1U5AA 4HUQB 5JDCA 3ZVKA 2PN1A 1NE2A 4PGMA 3OP1A 4E21A 2CLOB 4BEWA 1QF7A 4JEUA 5TVKA 3OCXA 1W8IA 1Y9ZA 5K8IA 4ALLA 4NHOA 4PNHA 1V5WA 1DE0A 5J4HA 2WD7A 3W1EA 3CV3A 1F6DA 3COPA 3LOPA 4ZVLA 1CJCA 4FS3A 2P9QA 1I3LA 2P62A 3P19A 4EATA 1E2EA 1OXUA 3C8MA 5AK6A 1E4YA 4UBIA 2QUAA 3NH9A 4REQA 4D26A 1SZDA 4N7BA 1GUBA 1PJ4A 4OXXA 2BSXA 3PYXA 1GFWA 5AI4A 1XRLA 4DXAA 1UWVA 3EC1A 3PDJA 1XEXB 4PTZA 1SXJE 4BX3A 5LLTA 4FQ5A 4CUJA 1M1YA 5DBEX 2XKJE 1RU3A 4LTMA 1NURA 4ZU3A 3KBOA 1LX6A 2W0SA 5ER6A 2ZROA 3RVDA 1LVHA 2B6NA 3ZWVA 4NABA 1JKFA 3DAFA 1KP3A 1NJGA 2PXXA 1FYEA 5E7IA 1IBKB 1XE3A 3DBRB 3TX2A 2LV8A 3UJCA 1PR9A 10MHA 2F9LA 5TE9A 5ELXA 2Z3VA 4X90A 1ACMA 1AF4A 1ZKMA 4IDPA 4TN5A 4ZT7A 5C8YA 3TBFA 3UJDA 3V6LA 1LLQA 3ZCRA 4TRJA 5A4FS 2C4MA 2IH5A 2X5JO 1Z8HA 3AFOA 4MYRA 4B4DA 2Q3MA 2QTLA 2FCAA 2FWNA 2VYCA 3RS3A 1WTAA 1JHDA 2XECA 1J2EA 2AW5A 2ZSUA 1F6WA 5CHYA 1OIXA 3L8FA 3E20A 3S2EA 2IYQA 5KW9A 1M7GA 1HDOA 1FX1A 2QRGA 5LM3A 1HLDA 2F67A 1NXQA 2HMSA 2ZB8A 3WMEA 3CVWA 5EWLA 4WZ6A 5TEWA 2G5GX 5ALOA 3PFCA 4WXPA 4R8MA 3K0HA 1E0AA 1WKCA 1VIMA 2C92A 2Y0EA 3ER9A 1RZRD 1L1EA 3RUCA 5BVHB 5HIMA 2E21A 1XF9A 2QN3A 1REQA 3DFFA 2CL5A 3O26A 2Q5HA 3N53A 3ETLA 3PQ4A 4PQRA 5BRAA 3A2LA 2BKUA 1II8B 2ZRDA 2L82A 3IR7A 2CMKA 4OH1A 4OQFA 1SKBA 2PFSA 5KWEA 2RH9B 3M4NA 3U7QB 1HL7A 1JE1A 4NWIA 4YJHA 1IHPA 3GBSA 4TL9A 3TDNA 2K7FA 3CPEA 2PD4A 1HDZA 4J7UA 1YE3A 3EUAA 4ZYLA 5EYPA 5A5DA 5B2FA 2YJ4A 3E03A 5B3KA 1GTMA 2PM8A 4RA6A 4YRTA 2FMFA 4C7VA 4C6RA 5E4JA 5EXDA 2D0IA 4PPQA 3VDNB 4Y8VA 4Y2RA 3PKIA 3TVTA 1GSIA 3FG9A 1SQGA 2PTGA 2WW8A 3FHJA 3MF4A 1V5EA 2O3SA 1E6MA 5GONA 1G5HA 1LV8A 3EYAA 2LTAA 4DSOA 4Z4EA 3LUAA 3VYWA 1GNTA 1U90A 4MLZA 3GUZA 4L6IA 4BATA 3HO6A 4ZOLB 1SXIA 4H7JA 3SCZA 2IEDA 3H9BA 4Q7EA 3U39A 5C81A 1GZ7A 3T7TA 4B75A 4P26A 4MTCA 1MXHA 4QGFA 3A31A 3SEQA 3P2OA 5FL7A 4OG2A 4FFMA 4DQLA 1WDKA 2VYND 3PIRA 5FFMA 3U7GA 1A98A 5IEBA 1DG9A 4NCIA 2FZ4A 3U0BA 3UAXA 4QTUB 4WERA 2PYZA 1Z4QA 1MFZA 2R4TA 3S2ZA 3ZHTA 3SXUB 1Z34A 1X7GA 4JY7A 1NIJA 1SBYA 1ZUWA 3TOSA 4RH0A 2OILA 3NC0C 3TG8A 2MMGA 3RJTA 3DDCA 3MT0A 4TKUA 1CNMA 2PT6A 4WLUA 4HBGA 4KP7A 2WQZA 4MS4A 2FN9A 2GX6A 5AJTA 3U9TA 2FH5B 4MAFA 3V2IA 3TJRA 2BGTA 2WAXA 4N6OA 1L7PA 2F1HA 1DKRA 4EUNA 2QRVA 1U2ZA 2BFBA 3RSQA 1AKEA 1SBZA 1NNLA 3IC5A 1QRRA 2COUA 4UZUA 1QGUA 1Q17A 1T1SA 3X3HA 5HDQA 1J56A 3G6EB 3JARB 2HO5A 2GBFA 2WVJA 4HDMA 1ZMOA 1VA4A 5KTMA 2VJMB 3BRQA 5JQGB 3AI3A 2CHQA 1J5XA 1J0CA 3TVDA 3FCAA 4C4SA 4HLNA 1USGA 3ETCA 4Z9BA 1NUTA 3EDCA 1MX9A 4ISBA 4DIOA 1QS0B 5IYQA 3HEBA 4PO1A 3S7ZA 3MRSA 4E2YA 1SKQA 2O5EA 3FR7A 2X8JB 2DCUA 2Q4BA 4ZI5A 2PQ2A 3PUWA 1G8SA 2OHJA 5ECDA 1XZ8A 2XTAA 2ZKLA 3SC3A 4MQEA 2FSVA 5H4HA 1G8AA 1VCNA 3SSAA 3UOGA 3DOIA 1K97A 1M2EA 3HMQA 4DREA 5BWMA 1ZM3A 1QHYA 1G64A 2VXOA 3GH1A 3I45A 3RVMA 2OBYA 5ALSA 1D2HA 4ZQEA 5DBHX 2QENA 3KPVA 9ABPA 1I0IA 5E6RB 2MTBA 1ADFA 3PNVA 1UH5A 3AEUB 3DKIA 4UEKA 1DBQA 2EGGA 2B8EA 2H2FA 4WH0A 5JCJA 3KOWA 3GROA 4K9KA 5TGDA 3RUIA 3NZEA 4DE5A 2CVOA 1FDTA 2Q3JA 2NU9B 1G5RA 1WOSA 2XW6A 2OM2A 3VC7A 3HQ4O 3DNMA 3DMTC 3LT5A 5EJ9A 3ADBA 3E5NA 2QRQA 1LPPA 2WIBA 4E31A 1L4EA 1CJKC 4MHTA 2G5PA 3CHYA 3TR5A 3KUUA 2Q5EA 1UBNA 4D1YA 5A03A 1E3QA 6PFKA 1SVWA 3VR6A 1TI7A 2H0RA 2HXSA 2P9BA 5E2BA 2AN5A 2AMYA 3FWYA 4ZCIA 2HHHB 3CUSA 4IMPA 1CRPA 3C74A 3L7OA 4YMUA 3RYCB 2Y77A 4RXTA 2WIKA 4B7ZA 1Y1LA 2X6TA 1S3FA 4GM4A 3TKAA 3WDSA 1SG6A 4HIZA 4RESA 1TYDE 1Q7GA 1VIAA 1LK0A 4KXQA 4Y30A 3LXMA 4MEBA 4OJQA 5HK9A 4NZOA 4KYIB 2YWGA 4K9OA 2WTBA 3L4JA 4JJZA 4HN4B 4GBJA 4HTFA 4IG9A 2B2NA 3GHHA 4A36A 2WT8A 3CD6B 2ZIAA 2E1PA 2WOJA 2VJDA 4MVJF 4C2AA 1KXJA 1TCAA 3K2IA 3EA5A 4OGWA 4QGAA 5JJBA 3KQLA 4A0QA 2C99A 1U2RA 4V0OA 3BZWA 3UM9A 5EE1A 1KJ9A 1T1JA 1S0UA 4MJ7A 4UNQA 2QZ9A 4EJSC 3L18A 3BXZA 2AG1A 5CNIA 4QD3A 5KINB 4O4LB 1X1CA 2DBYA 3MERA 1Z5OA 4QBIA 3T6KA 1EQAA 1PJ3A 1ISGA 1ZR4A 1UAAA 3PQFA 4PG7A 4KUHA 3KSMA 1FDWA 4B4VA 1QFZA 4C14A 2VATA 1TU0A 2C82A 1ZHFA 4F4CA 4YAWA 3FUWA 3FWNA 4EFMA 4K5QA 1JG2A 1ECFA 5AM3A 5MF6A 4X1KB 4D9GA 1YRQA 2I6GA 2QUKA 4Y2UA 2FRVA 1YXMA 3UGTA 4CMEC 5FNVF 3OZAA 5IT5A 4GWGA 2NQTA 1UDAA 4KRXA 3FRJA 4LSMA 1BVYF 2WAOA 3PYLA 1TLLA 4JUBA 4BVJA 1DIBA 3GRKA 4YRJA 3F9CA 3OTHA 4OYYA 5KWIA 2I2DA 1YR8A 3QWIA 3UOWA 3K6SB 2D59A 1BDJA 2GYYA 2PUJA 4II3A 1QLWA 3KYJB 5F77A 3X43A 5JS6A 1B6SA 4M4SA 2C96A 5FI5A 2NSHA 3VO2A 1ZKDA 1LSJA 2ECKA 4P80A 2QORA 2G4CA 3KAQA 3OLWA 2H9YA 2VDPB 2F3PA 2VJNA 3I2FA 4TV9B 2PPLA 5J40A 3VU9B 1DO2A 1ZD3A 4O2AA 2HLNA 5AJVB 2GTHA 1OJLA 1KDPA 1EKXA 2GZ3A 4OX9B 2WD9A 3KKKA 5B55A 5FL7D 5EJ4A 5I4KA 4LDZA 4S1WA 1Z6QA 5E3IA 1QANA 3GUHA 3COJA 5B6IA 1W8DA 2IITA 2WT9A 1SKYB 2D1QA 4U0KA 4FMBB 1QVVA 4GZ3A 1T3LA 4UTNA 3QXHA 2VZ9A 2HNBA 2KVOA 1FSGA 3B7WA 4NDZA 1TMYA 2IYUA 4Y2JA 1T2UA 1ZZEA 1E6EA 3OJLA 2A5LA 3O5AA 4G0MA 5IH3A 2O8DA 3DUWA 2NU6A 2QM0A 4KU4A 4F6RB 3NVMB 2J3IA 3BRSA 4YJGA 1RT9A 3EN0A 5HIKA 2ZWOA 4CMHA 2IYNA