5B6IA

Structure of fluorinase from streptomyces sp. ma37
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
292
structure length
292
Chain Sequence
b'RPIIAFMSDLGTTDDSVAQCKGLMHSICPGVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIRQAAKGGARGQWAGSGDGFERADGSYIYIAPNNGLLTTVLEEHGYIEAYEVTSTKVIPANPEPTFYSREMVAIPSAHLAAGFPLAEVGRRLDDSEIVRFHRPAVEISGEALSGVVTAIDHPFGNIWTNIHRTDLEKAGIGQGKHLKIILDDVLPFEAPLTPTFADAGAIGNIAFYLNSRGYLSLARNAASLAYPYNLKAGLKVRVEAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluorinase
molecule tags Transferase
source organism Streptomyces sp. ma37
publication title Directed Evolution of a Fluorinase for Improved Fluorination Efficiency with a Non-native Substrate
pubmed doi rcsb
total genus 83
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 5b6iA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 5b6iA01
2C5HA 2C2WA 2ZBUA 2CW5A 2CBXA 4CQJA 2C5BA 5B6IA 1RQPA 2V7XA 1WU8A 2ZBVA 2V7UA 2Q6LA 2C4TA 1RQRA 2C4UA 2WR8A 2Q6OA 2V7WA 5LMZA 2V7TA 2CC2A 2Q6IA 2Q6KA 2F4NA 5FIUA 2V7VA
chains in the Genus database with same CATH superfamily
1W96A 1MVNA 3CNOA 5ALSA 1E5QA 1T4GA 2JFWA 4DQLA 1OXXK 2C07A 2IDJA 3FI9A 3I5XA 3UV6A 2QLLA 1IUPA 1NVAA 1UZNA 2ZSIA 3AL2A 3CLRC 3R5FA 4L72A 4OQNA 3J80A 3K0KA 3O91A 3K6SA 4GI2A 2D2VA 2ADOA 3WE7A 5ECYA 2I8LA 4RW0A 1TF5A 2M6SA 3RV4A 4KAFA 2GEKA 3OIYA 4E2YA 3O4IA 4FGSA 1WUKS 3WNBA 5DCYA 3L40A 4C0WA 1QYRA 1T9HA 2AN9A 3N2KB 1DDOA 5I7AA 3K2QA 4YJ3A 2QVXX 5EJEA 1H2ZA 2JGMA 4OLFA 4E1AA 3CN7A 3UAOA 2QG9A 5AW9A 4QODA 3VAYA 1I4EB 2C96A 1NB9A 3GMSA 1GDHA 1J23A 3KXIA 3KR2A 1EJ2A 1IOZA 1T36A 4L0CA 4OIMA 4RJ2A 2F43B 3NDBB 2OHOA 2F1MA 4ALLA 4G5HA 3FCEA 3KQVA 5E6RA 4NCBA 3EODA 3OIVA 1UD4A 3JQCA 2CN1A 5C53B 3NXSA 5JI2E 2VPWA 3IERA 3U3DA 3AHJA 2QRNA 1GVHA 2WKPA 1SD2A 5B57C 3E53A 1BYUA 1L4NA 3UGQA 4AI6A 4IFIA 2OCKA 4G84A 2GETA 1XRNA 2YXEA 3PD7A 4KX5A 4IHJA 3FCUB 4QELA 2MR6A 4YH1A 4YCCA 2D5CA 2HY7A 5AK5A 2JGJA 1JSZA 5I3CA 1E32A 1CVIA 1RI4A 4R71A 3HV2A 5L7WA 4OLAA 1Q22A 1RDFA 1ZGJA 2FN9A 3HNOA 3HWSA 3KSDO 3QBEA 4FYJA 3AZPA 4G0WA 2HXYA 1SCDA 3LBYA 1L4UA 1IPFA 3AB3A 1KSGA 1LXCA 3CVJA 4PG5A 5L95A 1G17A 3ME5A 1JTEA 4UTVA 5KYNA 2FSSA 3QNMA 1ZXBA 3CMMA 5K01A 4MUFA 1NR7A 4E4RA 1LTHR 2NM0A 4ISCA 3BIXA 4MVJG 3IQHX 3LP8A 1PV4A 1AK2A 5A3SA 2XNJA 1ABFA 2PKYX 4KBFA 5DLDA 1H8HA 2XWSA 2W37A 1KJQA 2CXSA 2E37A 1DV2A 4JDPA 3UMBA 2C2OA 2B69A 2X2PA 4AWAA 3NPAA 1JE1A 4TSFA 1CIVA 2N1BA 5EZ6B 5ALFA 2OT3B 1XALA 1I24A 1QF7A 3JWIA 4JP3A 1U8EA 4RZ2A 3W04A 2UVPA 1ETHA 1KI6A 3EAGA 1E8MA 4C78A 4C03A 1I3MA 1JJAA 5C81A 2IFTA 1V4NA 4KLZA 3GLRA 3GIRA 3N2NA 4XPZA 3FMOB 5IBRA 3FTFA 1QS0B 3DMTC 3ZCTA 4Q7MB 2PUAA 5T4EA 1G8FA 2AWNA 3L4KA 4QHSA 1B14A 1H2WA 3WAGA 1C2YA 1S2GA 1U7WA 2CLHB 1ZI8A 4Y30A 1DKMA 2Q3EA 5A4FS 1G9SA 3AVVA 2CT8A 3BERA 1P73A 4N3GA 1C3VA 2WU3A 4DLRA 2AW3A 4HVLA 4WZKA 4P3NA 3VZCA 3OPNA 4CM7A 4XFKA 5K0GA 3RK4A 1DPGA 2FR1A 3I9MA 3RQSA 2AEMA 1K4KA 1LX6A 2H5JA 1O96A 2HCRA 2OV2A 2H92A 4MQFB 1EXWA 3NAGA 3KTAB 2G0TA 3OM1A 1KOJA 4ZANA 3RVOA 4KVFA 4OQZA 1K7EB 3KDSE 3LD9A 4CPDA 1RZ3A 3GV0A 2IP4A 3EWNA 1Y89A 5IT9A 1O0BA 1YRQA 2Q0HA 5H0IA 1ZG3A 4D0LB 1QQ7A 1Q12A 3OCZA 1LCIA 1E2HA 4Q7EA 1Q3HA 4OGWA 2D7DA 3GROA 2JFNA 2X1VA 2ZSAA 4K0KB 2Q45A 5K9ZA 1QGAA 1SHZA 1OLXA 3LCVB 3PHLA 5A0FA 5TNXA 2A5DA 1TX4B 1KC1A 5C7OO 3PPXA 3TRDA 5LQJA 4IY1A 3ETGA 3QYFA 3SSNA 4DLVA 3T94A 4B3BA 1C1DA 5ANRB 4TUYB 5CXUA 5LNK1 1JWLA 3BXGA 4BV3A 1R9JA 5KHLB 3LI2A 3R6JA 3DEKA 3FTEA 1R4MA 3OJ0A 2HD4A 3NDRA 2GPYA 5EXTA 3OWXA 1MIOA 2D2EA 4BNDA 4DUPA 1E9BA 1GUAA 1F8YA 2DTXA 3TCNA 3QXHA 3PHBE 2HHLA 3HVUA 2BUCA 1QK5A 3BKXA 4L5AA 4L75A 3W1VA 4CQMA 5JU6A 2B1GA 1L7NA 1DO2A 1NBOA 4QRIA 3HKEA 3BRWA 1IY9A 2JH9A 1WVMA 2JCXA 4TXHA 3MHTA 3JYHA 1A76A 2IHKA 4ZT6A 1NUSA 2OHVA 4A6PA 3FWHA 4A8JC 4R69A 4GZLA 4JJ8A 1CDOA 1MAUA 1O6GA 2IHVA 2F59A 2WZNA 4QARA 5EWJB 5EUCA 4IZHA 4RUKA 4FIDA 3N0TA 1GZHB 1Y0RA 4BBJA 1HZZC 1RU3A 2AXPA 4HMOA 1M7GA 3SHVA 4F9GA 5FYDA 3WOVA 5FOQA 2JHFA 5JFOA 1MO2A 5BW8A 3PA2A 1JVBA 3SXUB 4HDKB 4MTCA 2FQWA 1DAIA 2HK8A 1WP9A 1MB3A 2QT0A 2QZZA 2DHQA 5AVQA 4UNIA 2IBTA 3OJXA 5E8JA 1QP7A 1UPXA 2ZYWX 4I55A 3C1TA 3DZBA 2QX8A 1M1ZA 4QA9A 4EEZA 1PCXA 4MUMA 4R3WA 3SBXA 1JX6A 4R4JA 4WOBA 4ZDKA 4ENWA 3QSYA 4RPLA 1X19A 1CSEE 1J1UA 1DFIA 4M7OA 3K1TA 2B1JA 3GU3A 4L7VA 4PLTA 4XTRA 2OFFA 3JQ8B 2O7QA 3GPDG 5CH3A 5G3ZA 3NM4A 4BVBA 1J5EB 1JFFA 1OWOA 4D8XA 1CR1A 4I9FA 3Q7SA 1PZMA 5LWQA 3VR6D 3AKZA 3CRNA 3O3NB 1YX2A 2JGEA 1X1EA 4A1FA 3KX2A 4N3BA 3JQ8A 1COWA 4LPKA 3DXXA 2NVUB 5JNRA 2GCNA 3C97A 5GZ1A 1I3LA 1XV5A 3B82A 3AEKB 1M2VB 1M7BA 3HUEA 3PFFA 3ZEAA 1QO7A 2O3UA 3PJGA 1GPH1 1HDIA 2C5HA 5JS6A 1Z0JA 2R6JA 3U4IA 1M6EX 3TTTA 2AIRA 3EX7C 4ACAA 1TCBA 5FUMA 4G24A 4L50A 4DRZA 2WJ3A 5LOVA 2GFIA 2GDZA 5AM0A 2H1SA 2B4YA 4RZSA 2QHXA 2WIJA 3L6DA 1M8PA 3BRCA 2E85A 1RCFA 2WMDA 3Q9UA 3WWZA 2V58A 4XLAA 3BMQA 3AB8A 3OQOA 2HQSA 3VR3A 4HZUA 1QR2A 5DXJA 3ON5A 3ZK7A 3DHWC 3SHTA 2XXJA 5ALTA 1NBIA 4KAAA 4DILA 2R1ZA 3LVFO 1YL6A 2P4EA 1YF3A 4ZO9A 5C32A 2NXNA 3TRHA 5DI3A 2AFIA 2I2XB 1D0VA 3EC7A 5EJAA 3T35A 4C7BA 5JYCA 4D43A 3U44A 4XN3A 5E0KB 2NVOA 1CVRA 3U0VA 3HMQA 1Z4LA 2A0KA 3DDUA 4P5PA 1N2CE 3TEJA 1NXSA 2Q8PA 3TLEA 2LIVA 3DJYA 1PVVA 4P7JA 1DKOA 3QFCA 1N2ZA 1U98A 4FDMA 4QGHA 3GPIA 2PBZA 4RDCA 1HXHA 4OKNA 1YUNA 3O8LA 3MTDA 2HRCA 2PKXA 3AJAA 4LKOA 1JG4A 1I10A 4GECA 3W5SA 1Q0TA 2FJ0A 4E13A 4MQMA 1FZQA 1YI1A 2BEWA 1FDUA 2FF7A 2FX2A 1JDPA 1DC8A 3HU1A 4IIUA 4B87A 4NICA 1L9XA 4FEEA 2YWCA 2JC3A 2CXOA 5EXPA 2WFMA 1I5RA 2IWHA 1VIDA 5DOVA 2XYGA 1FCJA 2R1VA 3EXHC 3PWTA 4WRRA 4X1OA 3OE1A 1T0IA 1ZCAA 1NMXA 3PGJA 4XWTA 3UJPA 3O1LA 1PR9A 4TL6A 2NV2B 1YAHA 1B6RA 4EWLA 2R1VB 3ZXIA 2R8XA 2YHAA 3FTNA 1O08A 1VCNA 2H52A 3OQ1A 4JLOA 4MINA 5FWXA 3WXBA 2FWIA 4G0XA 2P0EA 3KWJA 1D1QA 2PMWB 2BZGA 1BMQA 1FJ2A 3D02A 3DTYA 1E1RD 5FKJA 5AK6A 2K6GA 4Q93A 4CCWA 1WMAA 4CTOA 1HE8B 1J25A 2P6MA 2O8BB 1C9EA 1OW3B 3F5MA 3CM0A 1AUVA 4X7EA 1N2OA 2G06A 2I7XA 2RGBA 5EJ2A 3TK1A 4ZFNA 1BX3A 2C78A 2I3AA 1E9EA 4HYYA 3BAFA 1UOOA 3MBOA 4X8LA 1RABA 5KMGA 1H0RA 3G59A 2CLLB 4HLCA 1L7EA 2DHEA 4O4IF 3HLKA 3DGFC 3CRZA 5B1EA 1YCDA 4FW8A 2YDXA 3B3GA 2OEPA 2ZM5A 3JASB 2IS4A 5HBRA 2JIPA 2V9CA 3NHWA 1V1MA 2KJQA 4MV4A 3VHXB 1EZ4A 1NBEA 4DS3A 2BAGA 5C7IO 2IPNA 1ZK0A 5AJUA 5IULC 2EZ8A 4E1VA 1T15A 4CR7A 2J3KA 2JASA 2ON6A 3HP4A 4QGBA 4WT7A 3DCJA 2RAFA 5F5NA 5JALA 2XQKA 4HGOA 1GM5A 2YW2A 4K9RA 2ZT5A 4KXQA 1D2CA 2B8JA 5DIFA 3NO4A 5IYQA 1E3SA 3U7EB 3P1JA 1N6LA 4DREA 4MROA 1YRAA 3LGXA 4KLAA 5FV7A 5JYEA 1RAEA 3ZWYA 4DV0B 3U13A 1X42A 3DVAA 1POXA 1BS1A 1L4MA 1GLNA 1B26A 3PUJA 4JR0A 5KYUA 1OXBB 3EA0A 3COJA 4HN4B 1YUBA 3PFCA 1HE5A 3CC8A 2C4TA 1PQPA 4D9IA 4OOSA 1RXIA 3CCLB 1H2BA 4H15A 3A1WA 1K8YB 3CEJA 3LRXA 2YQZA 3VZDA 3HDHA 3OTWA 3FWYA 1D09A 1M7HA 1QYVA 4XJXA 2BFCA 3RTDA 4KWCA 3HM2A 1JMYA 1OLUB 4P5EA 1N6RA 2FSPA 1UBSB 2HCTA 3TLZA 1F6BA 3EZNA 2C2WA 2R8BA 3AKYA 3JQFA 4IHAA 4MV6A 5CLLA 2Y4NA 2FZKA 2NV0A 5EJIA 5K4GA 3I92A 3DVQX 5KWSA 1RPZA 1OXKB 2VA9A 3AR3A 1P44A 1AKWA 2WMYA 4DC1A 1HMYA 1YULA 3H5VA 4W99A 3PEVA 1G2IA 4FFNA 4HX9A 5C3UA 2PX5A 3PGA1 3DWFA 4NEHB 2W6PA 2DR2A 2NSYA 4FUQA 1NJ8A 4JV5B 1S3SA 3EEQA 4QICA 4O33A 1NNI1 3B1KA 4TZ0A 1Z0IA 1LNSA 1JEQA 3EGDA 3PV0A 4FLFA 3WLAA 2I1LA 3RC8A 4R9RA 1OAOA 4KG7A 5KW9A 4UXIA 3D0KA 1YBHA 3VR5D 1Q1QA 1I14A 1YKSA 4Q7KA 3ANTA 3ZHYA 1M0SA 3L1JA 3RV3A 3T5DA 2FNAA 4S35A 5F4JA 4R1NA 3L6OO 1BCSA 3U7JA 5KDLA 4Z4FA 2Z04A 4UVHA 1TVKA 4GM0A 2H4JA 4KPGA 1EUQA 5CVUA 4DF3A 1PN3A 2OV1A 5HR5A 2Z6VA 2VJYA 4ODIA 4ZYTA 2XEXA 1TVKB 5DBEX 2C7OA 2ZS7A 3QKRB 1E9FA 1I7DA 4TV9A 5KKCA 4UZSA 4GQAA 1ZSYA 3NHLA 5LQAA 4PGFA 1E60A 2X8BA 4AMVA 3CLVA 4YROA 3VU9A 1GPKA 2O2XA 1P2UA 1AKUA 1WPQA 5EKTA 4GOLD 4TV9B 4NYIR 1Q19A 4OP7A 2YRWA 3EHEA 1PJAA 2OUIA 1NLZA 4IZIA 3HK2A 4BECA 4LJ4A 3EH2A 2MYPA 2WU0A 4F9TA 4Y0NA 3VC3A 4OHWA 4B75A 1QYDA 3NAQA 3RC1A 4JI4B 2HXSA 3JARA 3D64A 2WIBA 3FH0A 2X0KA 2AF4C 1B00A 4IEFB 3E3NA 3A3KA 1ZMOA 2WWYA 2PKCA 4RANA 3WZ2A 2BHTA 1YZNA 4PZEA 4V0RA 4C4XA 1I4LD 4ZI7F 2VCYA 3M83A 4H7PA 3RGWS 4FGLA 2C4MA 3AYZB 1WVIA 3DCYA 2ZDHA 1PJ5A 4B7XA 3C43A 3DZDA 4KNWA 1IJKA 4GHWA 1GGNA 3ADPA 4RIEA 1M2OB 1O5IA 1RRVA 2YXNA 3M6AA 2OCDA 4Q4CA 5JYDA 5FWNA 1O57A 1SOVA 3OSZA 4PXAA 5BV2P 3FFTA 1P4GA 5J63A 3U7IA 1J06A 5JRZA 5CNJA 3RHTA 2FLVA 3O9VA 3CCCA 3QV1A 3FW1A 5E9JA 2H51A 1J33A 2X0RA 4N7BA 4KQHA 4QXOA 5C2JB 3NYQA 4AZTA 4GI3A 3KOMA 2OHJA 5DNWA 1OXMA 4I1PA 4LY9A 4MRPA 1RBZA 3RKRA 1X7WB 4F7DA 1H5NA 2VHTA 3EZ6A 2FV8A 4QZVA 5HIKA 3VDXA 3KAPA 4E3WA 4UU1A 3OLZA 5F7OA 7YASA 2FX3A 3EOAI 5I01A 2YV5A 1E2PA 3JQGB 3TLBA 1G2QA 1AQLA 1WMBA 2VJQA 4N0EA 4JYAB 3U3ZA 1Q9SA 5J3OA 2IVZA 2XDQB 4HN2A 1NXVA 2PPLA 3CISA 1TJPB 4WCFB 1KEUA 4BB0A 4FS3A 4UBLA 2HHHB 2QY6A 1VA4A 3HFJA 3VYRB 3RIEA 5H4HA 2UZIR 3W2GA 2WU4A 2JAQA 3AI1A 3T5PA 3ZV3A 3PQ3A 4PS1A 4M55A 4EX6A 1N6HA 4KE9A 2YOGA 4OBEA 3OAAA 2EAUA 4AF8A 2X14A 1WX1A 1RWMA 3AUFA 2YX1A 2EKZA 1SHJA 1UBFA 4XYBA 3UWMA 5C34B 1J2YA 4NONA 4DARA 1PF7E 1N1EA 4OYLA 5IDXA 3P2KA 5KWIA 1H8HD 2WD9A 1CY4A 1QH1A 4P6YA 2IPMA 2VVTA 1NR1A 5KU7A 1W46A 3AF3A 1NFRA 3KKOA 5JXIA 2Q50A 3LTEA 4HSGA 4I08A 2HRBA 1NUTA 2QUIA 5JAPA 4J16A 2I62A 3WIBA 4YIKA 4GS5A 2EFYA 2G4LA 3NBMA 4IHJF 1Y98A 3U16A 1QRDA 4J91A 3ZD7A 5DSTA 3EYAA 2ZI9A 3O8RA 3F8TA 3IEXA 3R0ZA 4MR9A 4XL9A 3DEJA 1Y3FE 3LY9A 2NSHA 4FWBA 4J16C 3EVFA 5FAXA 1IXYA 4UUQA 3Q3HA 1PJQA 4DIFA 1C30A 2DWCA 3NT4A 4DYHA 3DA8A 2GF0A 2B2XA 2PGOA 4I9UA 4JEIA 4L8VA 3S99A 3NC1C 3W2IA 3SC2B 1YQWA 2D2IA 1E2LA 4PZUA 4H1WA 4OHMA 2BI8A 3V8PA 2QMYA 5TVKA 1L5LA 2EZUA 1C8BA 1NDHA 5BWCA 2P4HX 4MS3B 4LHEA 1M10A 1PT5A 4OU5A 2H0AA 3IQEA 5KI6A 4ECEA 4YAWA 3R3SA 2O7SA 1KZ9A 4URFA 4ZAWA 5HKBA 1E4EB 5JDIA 4W9NC 1AKMA 2LXNA 3T0FA 4D57A 1PZNA 2FP4B 5JUWA 5AW0A 3GBPA 1QB7A 4F85A 1RYYA 2B83A 2GARA 4YALA 1RI1A 2R4QA 1NW7A 4FKBA 4Q4HB 2C1XA 4BGUA 1C30B 3RUIA 1X77A 2W0MA 1VJCA 3H5LA 3OAAD 2NT4A 3BXHA 2EW1A 5HGJA 5TARA 3THWA 1XYVA 1ZD4A 2FW6A 2NAPA 3VPCA 1G21A 4PAMA 5KTNA 4G0QA 2P62A 2P6NA 3BY1A 2XRYA 4UD6A 4D4KA 5C8VA 2Z6QA 2OQVA 4EL5A 4QD3A 4FB4A 2V7QD 2G88A 4CEJA 3ZJVA 4MWDA 1OAKA 2WTAA 4BFWA 1IFXA 1W0JD 3QKSB 4KXNA 4QJ4A 4EOGA 1JALA 2YIMA 3DFKA 1K88A 2D5LA 3R3XA 2B2CA 4X65B 1P4HA 1QRUA 4DRXA 4Z4IA 4LJLA 2AOXA 421PA 2WVAA 1XE3A 4P08A 5DW0A 4DV7B 1AS2A 4G26A 1N2HA 2BFMA 4CM3A 4I6GA 1PVDA 1Z0FA 3EARA 1HQDA 2C95A 2IY7A 3CF6R 2G9QA 1P8AA 4ARVA 4UBNA 3TGLA 4Q01A 3S2EA 1GZ3A 3Q6QA 4NKRA 1J6UA 1BA2A 1U7DA 1EQAA 4DK0A 2F90A 4JUFA 4XM1A 4DCNA 2G9ZA 1MQ8B 3E9CA 4JI5B 2GCOA 2Q3FA 3HKCA 2VTKA 4OEHA 5EE3A 1EUZA 1YZFA 4IIXA 4BX2A 3SIRA 2DSNA 1R5OA 3OM0A 4OB8A 2ZRBA 5BMVA 3V1KA 1FTYA 1XHLA 4R2HA 1WXDA 4CMHA 2PYZA 5A7FA 3W5UA 3T54A 1TVMA 2JIMA 1W8DA 1TYCA 3U56A 2GWHA 1URPA 3MGAA 1JEEA 2AWOA 3F90A 1SXIA 4JNKA 1WDTA 3QEAZ 3ASZA 3B1FA 4ZQGA 5E2AA 4RTQA 3QYJA 3UJ6A 3BE5A 2P4SA 3DFIA 1FRQA 3S0JA 1VM6A 2CMHA 2Y93A 2BF4A 5KJFA 2FWNA 1JL3A 3RVJA 1R4AA 4B44A 1ONPA 5CT4A 3H4MA 4ZZ3A 3GH1A 1PLKA 3UATA 3EDCA 5DGCA 1DQPA 2W2MA 4KLRA 1KH3A 2H2IA 1EBFA 4BAZA 3QG5A 2IHZA 2FUG1 4KE7A 1XK6A 1UP6A 1XN1A 1Q7YD 2QROA 1BU8A 3H7IA 4I50A 3HGTA 3SS9X 4HBGA 1COWD 3DYBA 4AQDA 2UYGA 3HR7A 1UBCA 3RRXA 4YBZA 3TRFA 1CY7A 3TPCA 4RM3A 2QRJA 4W5TA 2SKEA 3PWKA 1XZKA 3AHIA 1IOVA 3H0CA 5E6SB 1N4DA 1TPZA 4GZ6A 4WV3A 3ZVNA 1KO4A 4IS3A 4RF4A 4XDZA 4C01A 3T9FA 2ZT7A 5DEIA 3G2HA 1FFBA 1WDKA 4XIJA 4R3UC 2LCQA 3FM9A 3T3MB 1ZINA 1E77A 2H5IA 1M1KD 1WF3A 4ZCSA 1WB4A 4PAWA 2SNIE 2JJ1A 3EPRA 4J2TA 5HILA 4EVQA 4CFSA 2RI0A 1NL3A 2KW5A 1BD3A 2PNJA 1CR4A 1BRMA 2X8JB 5JNSA 4OQXA 4QXPA 1IM5A 5JAQA 3FYTA 4XORA 3ZIDA 4OQQA 3N0XA 5JZSA 1B6GA 1QNLA 1DP4A 3IUEA 4FDAA 4LXXA 5E7MA 2YWBA 4WTOA 4EJ2A 1E7WA 3P9SA 1W5TA 4FSDA 2RHHA 4N9WA 3EIFA 5DNVA 4ZARA 2PT7A 4HRYA 3FRJA 4LNAA 1ZCJA 2IEIA 4WECA 1N2XA 5HIAA 2ZRKA 1SQFA 3OFSA 3PUXA 3PJEA 3LFUA 3DDWA 2AG8A 3BTUA 2NVWA 2NXWA 4P0TA 4CN9A 2AYYA 3CXRA 3E35A 1GOTA 3KXPA 4Y2GA 2BGJA 2FMUA 2EFCB 2C5BA 1E9RA 5EIFA 1CR6A 5TSDA 3U7RA 4TXLA 4ZN6A 4RO0A 3SZRA 3WSVA 5J4VA 1XTVA 1W5SA 3FYUB 2OBTA 3SKXA 1XN4A 4GP9A 4G5RA 3VTFA 5AW2A 1ZSNA 4AO7A 3VMFA 5KJ1A 2IODA 5BY2A 2CHUA 1I4OA 2WNSA 3QX9A 3UW1A 2VYFA 2EFGA 1I1NA 3CKKA 3F1LA 3G2IA 4NMWA 4A2QA 4DLPA 3PA8A 3F78A 3FAKA 4DBLE 3K9CA 1H3NA 5LP6B 2J9YB 4JUIA 4JCCA 4WACA 1E3LA 4URXR 1JIXA 3EF3A 2QLFA 1BDMA 2PMFA 2ZE5A 5COBA 1H93A 3TOCA 4QRDA 2ANBA 2IXDA 2D62A 4EARA 4EVRA 1KI2A 2ZWMA 4PHGA 3U4HA 2FP3A 3UXMA 4DCGA 3DT6A 3LDUA 3TWOA 3IMKA 1NASA 5BV1A 4AP5A 5T4FA 1EFDN 1BTOA 4V39A 1VLJA 3VSAA 3FPFA 1QIIA 1I2AA 2EP8A 3O21A 3TXXA 2IYOA 1GNQA 2G40A 1R5BA 4XASA 2B1QA 3LKDA 1V41E 1A2OA 2XNDA 4DNRB 4QVIA 1RHUA 4QJIA 3SJPA 1TQ4A 3OJWA 3LDHA 3PDHA 4XUGB 5KCMA 2X76A 3AR9A 4LBVA 1FYDA 2DX7A 2HNAA 2QYOA 2CHVA 3RRMA 2GF2A 5T64A 3ZV7A 5LPNA 4IKOA 2VCHA 3PIDA 4B40A 5JSQA 3N1UA 4DG8A 3OU7A 1HV8A 4JLWA 1G21E 4TTAA 4ZODA 2NW6A 3IVCA 5ES3A 2XQFA 4C04A 1PZGA 3OFND 4OMUA 2CV0A 3H9NA 1PGQA 2VPTA 3KFXA 3FCCA 4PNZA 4WLEA 3HBNA 4QPNA 1KOGA 2JLWA 1VQ5B 3GJZA 3ROEA 1YJQA 2PUFA 1ORHA 1CUGA 1B8VA 2RK3A 4W1RA 1NMZA 2H2AA 4ZCIA 3B1VA 2HWKA 4QGGA 4TRRA 1XMOB 1JWBB 1RLOA 3VSBA 1W2HA 4Q3NA 1Y3DE 4K9PA 3PI6A 2O5VA 1S0UA 2BM0A 3ABZA 4EL0A 3FRHA 2PTGA 3A6DA 2VSNA 2PHZA 3O8DA 4Y9TA 5KPDA 4OB7A 1EE9A 2ADMA 3EAFA 4HDNA 5M3BA 5BYKA 1V6AA 3SC3A 1M1NA 2QUAA 3M4ZA 4QM6A 2JJ8A 1EEHA 3DP9A 1IQPA 4XNFA 3G0GA 1U7OA 4OSPA 5LQSA 1RQLA 4U7JA 5KPJA 1EIZA 1SXQA 1ZGZA 2XKBA 2IYSA 1W88B 3GZ4A 5EJ6A 1K4MA 1GTRA 1T2VA 4Q18A 4MKHA 2EJVA 3ZGXA 4D8VA 5BRJA 1RHRA 2CNLA 3QEKA 3PTAA 1UIRA 3ICCA 3CUVA 3RAFC 2IYQA 2SHKA 2A0YA 2QE6A 2HCFA 3PNYA 3R8FA 2XLBA 1U31A 3HYRA 4L0QA 1KDZA 4ZGGA 1G291 4BVFA 4JJZA 3E9NA 3RYIB 1XBTA 4Y9DA 3VZSA 2OZLA 1NV9A 4X6LA 2Z9CA 3RWOA 2C8VA 5K8UA 1ORRA 4MYTA 1VKHA 3PE3A 1LEHA 3PHIA 2JHPA 4BTLA 5D1HA 2CKMA 1A77A 1IEXA 1RI3A 1D1SA 3REFA 4PZPA 1Y9ZA 1TO1E 2EDCA 4DNOA 1LQUA 2HPZA 1K08A 4UZFA 2NN3C 4LOHA 3KKQA 5F2OA 4BEBA 2F1KA 2BY4A 3DKIA 1HYBA 2PIAA 3C5VA 4DA0A 3P27A 2C7VA 2E2WA 4UC0A 4AP6A 4RQTA 1BKSB 3FF1A 4XKVA 2IUTA 1FMLA 3IYLW 2R00C 2IJGX 1AQNA 5AJZA 4K6GA 4M9ZA 2AW5A 2XH8A 3CRVA 4Y1GA 1ZM2A 3FR7A 4I3GA 4G0UA 1IOLA 2J48A 3WLFA 4CRWB 1LF5A 1HE1C 1QOZA 2XWBF 3GJXC 4HPWA 3SF8B 3V9AA 1W75A 3E48A 3GXOA 1XRRA 4H6XA 3ETEA 2HUNA 1CNMA 5AOBA 5EGSA 4Q47A 3L8FA 2IDMA 4JI7B 2BM8A 1YK1A 7AT1A 3EZYA 4RXUA 2Z5VA 3NM6B 3CRQA 1H2RS 2NUTB 5K0EA 2B99A 3H04A 3AEUB 4G5OA 1ESNA 4ETWA 3N76A 4S1PA 1UP4A 1T26A 3HKEB 3SGLA 3S44A 5K3DA 2WAMA 3N53A 2OP1A 3L6BA 1XU7A 3MUOA 4BL5A 2JFXA 3CGGA 2JCYA 4CN8A 4LVUA 3L8YA 2VL7A 2XQGA 2IEAA 4TMZA 4OJTA 5IH3A 1MNQA 4F1JA 3BFVA 1GCIA 1T5HX 3DZFA 1P0PA 3T7TA 2O6HA 4B0OA 5JYBA 2HRZA 4FGUA 2WA2A 1KNXA 2Q2QA 3DE1X 5LLDA 1SC9A 2ZTSA 1SK8A 1X8KA 3QV2A 1KTIA 2LNDA 2C5EA 3TL6A 1GT91 3FNQA 4CLRB 2BT4A 1FUYB 1K6JA 4OYYA 3K32A 5CDFA 3QWAA 2I7DA 1QQTA 2VJLA 2SECE 1W8IA 2PD3A 3K0SA 1I8TA 2C5SA 3HB9A 4DJJA 4YDHB 1Y42X 3C3PA 1J99A 4A6DA 1VC2A 5CFRA 2YHUA 4XSGA 3O2SB 3ZYZA 4X63A 3SAJA 3W2TA 4G0ZA 1ZVVA 4N48A 1VIAA 4J1TC 3DZIA 4P38A 1N9GB 1XCOA 1E5DA 9LDTA 3PEEA 4F4DA 2RGWA 1N0WA 2EFDB 3PNVA 4GRDA 4Z9XA 2YHSA 3HI4A 3ZGOA 3GC6A 5KYWB 1WUTA 3Q88A 4RY9A 2CF5A 3L01A 3G7SA 5HQ3A 2C0PA 1AO3A 2GF9A 3TG2A 4WA8A 5JWHA 1QGZA 1ZUNB 2J3IA 5CCXA 3H5RA 5SZKB 4U0KA 4TMWA 4NG5A 5L7YA 3KCQA 5TF0A 2OB2A 4ZIRB 4E5MA 1K6MA 1K0UA 2VOEA 5IAGA 1OB0A 1HZZA 3VI3B 2IK8A 1ODLA 4EG3A 2DLDA 2YZMA 2NTNA 3C3XA 3PUNA 1KE1A 3RYHA 4D44A 1D4ZA 1YGPA 2GO1A 4KACA 2FSGA 4L85A 3KXLA 4LE0A 4HDAA 4BX3A 4MV9A 4FFSA 2A84A 1IVYA 1V35A 1V1RA 2V0GA 4KQXA 1MBZA 4JKOA 3RUEA 2YHBA 4EG5A 5I4IA 3PXAA 1ECPA 2B0JA 3N8NA 4MYCA 3KD3A 3F98A 4G25A 4HF7A 3Q2OA 4CUZA 1OYYA 1OZAA 1Y3IA 2F1IA 3MWJA 5ALMA 1PKXA 3TR5A 2V5UA 5BWNA 1RXVA 3VHQA 1H42A 1ZFNA 1FNSA 5EL0A 2P2YA 3HEAA 1UC4B 3PDJA 5GAJA 1I18A 3AU8A 3WMEA 3GR6A 3E4DA 1ZNYA 2GFQA 3MS4A 1BHO1 4IMJB 3Q12A 1HE4A 2PIDA 3C7TA 4WL0A 3SX0A 3SVLA 2IYFA 3H9GA 4MUHA 2X0IA 2XMPA 1XEWX 4B4OA 3WO1A 3KOWA 3L06A 4IX9A 4RHUA 2FCAA 1JBEA 2AXNA 3SQNA 3ZKAA 3QX8A 3V7NA 2PN1A 1AK1A 1KYZA 2EGUA 2PR7A 3HZRA 5F98A 2WM8A 3SXJA 4OA8A 1P1JA 4AICA 3EZLA 3ZD6A 3WYAA 2NXCA 4S12A 1SD1A 4RYLA 1REQB 3QQPA 4YJ2F 1N1GA 1LLDA 2ZJFA 5ERGB 1Q7CA 1GR1A 4GXTA 5BN3A 1DLJA 3E03A 2L2QA 2MDTA 1T1EA 4RLFA 1OGJA 1U7TA 3LP6A 3UK1A 4A9AA 5KQMA 3KE9A 1L3BA 3M9XA 3G8YA 4X84A 5U4XA 4AY4A 5MFPA 1KEEA 1KS9A 5J2TA 3AYXB 2NADA 2FKNA 4RFSA 4KHPB 1E7QA 1JB9A 2IHJA 3GGDA 4HXFB 3BQNB 1KYIA 1O3YA 2IZ6A 2PX0A 1XHEA 1YZQA 2VHVA 1MDBA 2H11A 4FQ7A 4HWKA 4IJQA 1YONA 3S8MA 4DCSA 5TLSA 4MKRA 3A4MA 2A9JA 4XARA 1R0XA 3Q3IA 4FGWA 2EEPA 4EKNB 4ND1A 3IHWA 5LN1A 4CG2A 1ULUA 3O95A 3UG6A 3PXXA 3DT8A 4DCTA 2YJGA 3HEBA 1YIDA 2QRUA 5IKOA 2HJ9A 4YYEA 4X54A 3G2OA 1VHLA 2ZVQX 4G0NA 1Z7GA 3E8SA 4MEBA 2IA5A 1Z6ZA 4ER6A 1VCOA 1PDVA 4FIZA 4AF6A 1X9GA 2H1CA 2RHTA 2QN8A 4KK3A 4NQZA 1TK3A 3DC2A 3C6YA 1ZM4A 4FMBB 3ESZA 3R3WA 1B93A 4UAVA 3D5EA 4FOTA 1JFRA 1ARZA 4YR9A 3VR0A 2NQTA 2PD6A 5B6PA 3GGSA 4G8JA 5KTRA 1GL7A 2YJNA 5CA1A 2HHJA 4AMUA 1P2GA 1A7UA 3C5CA 1YI8A 2JAWA 2Q9UA 3FTQA 1IVNA 3G9TA 2NUAB 3RS9A 1G3UA 5BV8A 5C8YB 3AVWA 1RI5A 1RRFA 1MAWA 2OWDA 2HRQA 4BMDA 4IUBS 4WXPA 3QU4A 2OBXA 4IM7A 3OKPA 2IHUA 1JG2A 4US0R 2D5BA 3MWEA 1HEUA 1YZ3A 2P3SA 3JRWA 1XYGA 3PPWA 4WW0A 1T3TA 3GLGE 1NQ5A 2YCLA 4N5DA 5C80A 1GTMA 2GBFA 3NTOA 4N0DA 5D01A 5EMNA 1WL8A 2AE1A 2V7GA 1Q1GA 4PE5B 4S2EA 5JQGF 1BQEA 1XF9A 3VUEA 2C3UA 1H9CA 3BC9A 3F7TA 2E5FA 2Q1TA 4B6PA 5D84A 2IC5A 4IRXA 2I03A 1U0NA 2Y67A 3TBFA 4ZCQA 5F9HA 5KDOA 3CTMA 1YRBA 2LUOA 4Z4EA 5B1SA 1XMJA 2GJSA 3NATA 4OKSA 4CI9A 4BXOA 3AL0C 3D7NA 3KHTA 4L1KA 1V7CA 2CCGA 3A10A 1BXGB 1AUPA 3PT9A 1P6QA 1SXJD 2OPBA 3QF7A 5G40A 5AVVA 3HTXA 4JOCA 2JGDA 2XWJI 5AXAA 1QS0A 4CLDA 2F8TA 4Z86A 3WVNA 5K7SA 3BNWA 1UAYA 2MYTA 4N7JA 2QE7D 2Y3IA 1GUDA 1SN7A 2Z83A 3BWCA 3PSAA 2D1RA 4WGGA 2KBEA 2Y05A 1ZU4A 3AFMA 4MW9A 1FE8A 4X90A 5IUJC 5CYGA 5CX1B 1GNSA 1CJMA 1CS0B 4XH9B 3USES 1J22A 4QDOA 3LLUA 5B4UA 1NXXA 2XMCA 5JVDA 4JLPA 5JSYA 3AF0A 1XP8A 4TLEA 3HO6A 4G8BA 3OE5A 4OMCA 4B6EA 4ALNA 4QQNA 1WQ3A 1QB8A 4ZU1X 1T5OA 2C5AA 3WWCA 2DLCX 1RWVA 3A1TA 4MGHA 2J41A 4ZKEA 3GFFA 4RKFA 4QTYA 1EGQA 1Z7WA 1SB8A 4Q00A 3T1YB 2H1OA 4D82A 4D74A 4HN9A 3QWFA 3KZKA 1C7EA 3IESA 3L5KA 1U3VA 1QVAA 1JDSA 1SURA 3OBBA 5F5XA 5B7QA 2AVDA 4XWOA 2D9RA 1YL5A 3PUIA 4X5OA 1N6NA 1Z8HA 1W0JA 2V1XA 3I73A 3JQ9A 5F1OA 4CKCA 3QI2A 4DLSA 4B35A 2RHWA 3TINA 3UT5A 5BWOA 3SM3A 1NM5A 1XJCA 3R44A 2VDRB 1CEEA 1S01A 3KYDB 1GN9A 4ZEOA 1E6CA 3UOGA 4B6FA 3LS2A 5AM2A 4IQGA 3P9NA 2CWWA 4UTOA 4QAQA 4NMMA 1UDWA 3KL2A 1G6KA 1NM5C 3O3CA 2A33A 4DDKA 2PRSA 3QXCA 3V2UA 5IEJA 4Q9IA 1H4SA 1JPVA 3HGMA 2O8CB 1E2FA 1C1DB 3FETA 3IT3A 1Z2OX 3GCDA 3QXXA 4CQLA 1OXSC 5JFTA 1X7HA 3LH5A 5KBYA 1YA6A 1CEYA 1MC1A 1FK8A 2YASA 4AM8A 4NAHA 1RCTE 4UDNA 4JLMA 4C0JA 1QLHA 1ZITA 3UAGA 3MLBA 4P4TA 1DWUA 2EZTA 2JBAA 3THYA 4R9NA 1JBKA 5BT9A 1EM8A 1TM4E 1J2TA 1GSIA 2VTEA 1AKVA 3R3ZA 4DSNA 2R6AA 1UDAA 1KK0A 2P7HA 2W2NA 1R6DA 2PJZA 4N8DA 5B2EA 5BW5A 5IJ9B 5ALRA 1WA5A 1W59A 1J49A 3M1AA 3A05A 3TW8A 4YMGA 5JS1A 1YDHA 1OPXA 3KQQA 1T9AA 4BWVA 4D9BA 2W00A 1DBQA 1D2MA 2Q4EA 4TS3A 2ZYIA 2ZBFA 1DC3A 2ZBDA 1WXQA 2X2OA 1RSZA 4TGLA 2SBTA 1K9MD 1UM9B 1JAZA 1QAOA 2GEJA 3B1JA 1OAOC 1YJXA 4XLFA 5BN5A 3VJLA 4YFYA 1EZ1A 1H3FA 1D4AA 3QBDA 3O4FA 1V8FA 1ZO8A 3VYUB 2FPPA 4LNHA 4RDXA 5KYYB 5LU9A 4QTUB 3D26A 1UM9A 3D2AA 4XJVA 4F0JA 3QVKA 5I4BA 4RL6A 5KSPA 1D6MA 3GRRA 3NX4A 5GONB 2JGIA 2G09A 3U5TA 3I04M 4R1SA 3ZEIA 1M74A 4LSWA 3TVYA 2GA8A 4TVSA 2PBLA 2HZBA 2BFBB 3TSAA 4GW3A 4UBOA 1VE5A 3TQIA 1KZ7B 2DR3A 4B71A 1VTKA 3RS5A 4EG7A 3IUMA 2Y6VA 1T29A 2X4DA 1C2TA 1NUAA 2O2IA 2ACWA 2YWJA 1ISHA 3I0MA 3QFFA 3PENA 1DBWA 4KMSA 4MRVA 4DQDA 3H87A 4KPYA 2ZIUB 1TJ4A 3ER6A 1TKRA 3RG2A 2H8KA 1VPTA 1LZKA 2HJGA 3NWBA 3Q2IA 1FJHA 4KO1S 4QLAA 1LVGA 1M2FA 3IP1A 1L5NA 1USKA 3CLSD 1FYWA 3BWYA 4IL5A 3I1FA 4Z1MD 4QM7A 3JYPA 2O2YA 3HJNA 3LT4A 5F9MA 4ZV9A 3DVLA 1U7UA 2IOFA 1Z2NX 3S81A 2AJ8A 9MHTA 5JTUA 5HTKA 5DHRA 2WYVA 1NI4A 3GLTA 4C0XA 1TE2A 4DWWA 1JXAA 1E9SA 4RDLA 3QEOA 4G4GA 5KTSA 1EK6A 4ABYA 1E69A 2BKVA 5EMMA 1QUEA 5FPHA 1MG0A 4DMLA 4P86A 4B4UA 1HTTA 5JHHB 4BLPA 4EAQA 4DUZB 1YO6A 4JU8A 4GLJA 4PGOA 2YQ4A 3BE8A 5ALQA 4YBRA 4X00A 5DN9A 4S0XA 4BKOA 2CB0A 4DB2A 4NYMR 2FVYA 4KQ2A 1ZIDA 2XAAA 3OUZA 3PNLA 4IQ8A 1GG2A 3H2JA 4L8LA 4TMFA 3QKIA 2ZS9A 5EE5B 4G2NA 3FRIA 1PZEA 1XTKA 5A05A 3REGA 2VQEB 4BGDA 2FR8C 2FWMX 4S05A 5FP0A 1H2XA 4X9XA 1Q1NA 1JG6A 4LRXA 3N6VA 4Q6BA 4Q6WA 3DZJA 4H7FA 3CCMB 2I4MA 3NBUA 3T7KA 3G0OA 1EINA 3MWYW 4V38A 1NT4A 4B85A 2GTIA 5JARA 5FTJA 5HW0A 2WWXA 5THXA 1IN4A 1EK2A 4GX1A 4YJHA 1Z5OA 2QL9A 1GARA 3L6UA 4BCDA 2W6OA 3WB2A 1ISFA 1VQ1A 3K6KA 1LI7A 1M72A 4CG3A 2A1IA 3RC7A 4BB9A 3LQ2A 4B0PA 3W3AA 3RJMA 3KSBC 2BL4A 1VKRA 4Q3CA 1M2GA 3LOPA 3T1VA 2PEYA 2PBFA 1B23P 2ZRHA 4AG3A 5JAZA 1IMOA 2GZMA 1FLAA 1X1AA 1L4BA 3MT8A 2PWAA 4MV7A 7ADHA 5JS8A 2JLYA 2H4YA 1FP1D 3CCBA 4PHCA 5K4HA 3AI7A 1FDVA 3FFAA 4ZAGA 5C0OE 4A2CA 5BMVF 5I9TA 3PU6A 1U9YA 2Y1FA 1ONBA 5CJJA 1UBGA 1R9MA 2IEBA 4QOIA 3AIKA 3BK2A 5EHGA 1X1SA 1GTJ1 4BFVA 4E88A 2ZEJA 2XCIA 3O9ZA 3SVZA 2GCPA 2FUKA 2EBWA 4LS3A 2GZAA 3CUYA 2J9RA 3IS3A 1KYQA 2XUGA 3K5PA 3X1XA 4ILEA 4RSHA 2P69A 1WB6A 2BFEB 5FFNA 3P94A 3RS7A 4UPEA 1VHWA 4D56A 1VZ3A 1C1YA 4EPRA 2ZJ2A 3KWLA 3LW8A 4FD3A 4KUEA 1X1BA 5HZGA 3TG8A 3A1SA 3GEEA 2OMEA 3K8YA 4HGPA 4K3VA 3MINB 4D8TA 3TMKA 1VHJA 3PGLA 3KVRA 3L82B 4G9EA 2HMVA 2I2CA 1DRJA 5GM2A 5L4LA 3Q3AA 2Q5HA 1H1TA 1RXWA 1NI5A 1N77A 4NG4A 3KJFA 2VP5A 1XDUA 5KJ6A 4KYUA 1QX3A 1W25A 2QSJA 2VXYA 1YZUA 3KJXA 3JZFA 3NVDA 3P9KA 5IANA 5CEFA 4FEAA 3KO8A 2QSYA 2VWQA 4Z2YA 3RC2A 1MV5A 5GPBA 4DFDA 1M6YA 4DVJA 1KWKA 3H11B 2JCSA 1TAUA 3DL4A 4F86A 5JDIC 4A82A 2R62A 4HMQA 4RVHA 1E0JA 5TGDA 1T5IA 5C1PA 3WGYA 1PSWA 3AETA 1V39A 2GOYA 5L4SA 4J0IA 1GGVA 1P4AA 2HTEA 4GM1A 4MUAA 4DIBA 3P7MA 1JLHA 3D8RA 1F2VA 4X91A 5HF5A 4WNAB 2I2WA 3NUQA 4Q1FA 1V7PC 2CFCA 1JAIA 3KBBA 3MD9A 3UUGA 2V1UA 3RABA 1SKAA 1W4LA 2O2CA 3JVEA 3T5CA 2AFVA 2GQ0A 5AUNB 3MMPA 2NUAA 1KO8A 2IQIA 2YUIA 4HGYA 4UOQA 2BGKA 3BGSA 3IVXA 4EUNA 3QTTA 2WK1A 3KCNA 3TQSA 3C1AA 2H2GA 4R83A 2XUPA 4PQFA 4X1KA 3M33A 3D81A 3OM9A 4ITUA 4B3SB 1U0SY 3IA7A 4E14A 4FT2A 4CMBA 4DR6B 1KPGA 3C4JA 4MA0A 1T4DA 2HSZA 1SCAA 3QQ5A 3REQB 3UB4A 3V4VB 2FJUA 2MSCB 3FIUA 2CMGA 4RVSA 1P2SA 3I6BA 5LYJB 2IHNA 3ABOB 4RJTA 4ES6A 2VKTA 1DIHA 3OFJA 4I8IA 4YV7A 4RD4A 3UWKA 4PYJA 1LPSA 1U8YA 2DPHA 4LCJA 3CF4G 2VBVA 3F0TA 3SXUA 2G6TA 3I1JA 2BRUA 3M3PA 4RA9B 1PQUA 3AHHA 5K0TA 1HSZA 1E6KA 2Y9PB 2B37A 3OA0A 1SIWA 3ES9A 5ITZB 4Q39A 4QT0A 4I66A 4ROXA 2Z3ZA 3DB2A 1EDOA 1XRLA 2FTKE 3D2LA 3HJBA 4J0JA 1OH8A 1CUXA 1PNQA 1KSHA 1JT2A 1V3VA 1L7QA 3E9QA 3N5CA 4NYMQ 1KEEB 4V0MA 1CVLA 2UVDA 3ZWOA 2HA4A 3QX7A 5CB4F 4CIYA 1S02A 3P71T 4ARSA 2AEJA 3WYNA 2QI9F 4TTVA 4LJ9A 1QCDA 2IHTA 2VBGA 3FKSD 1Y3AA 4PZCA 1FEZA 2BUBA 5IT0A 3GCGA 2UXBB 4BFSA 4DNQA 2XE7A 1ESEA 4EKYA 4CDRA 2QN6A 1XMQB 3DEFA 1QORA 1JH8A 4FLMA 3P45A 4XLTA 2VNAA 1XPUA 1NKSA 2G82A 1VHDA 3T5GA 4RK6A 3D2BA 3I04A 4EDFA 3U7FB 3DOEA 3FPLA 3EZFA 1WBJB 2VUTA 2CLKB 3PR1A 3ZR4B 4B3DA 3NG1A 4XWWA 3LQYA 2XB4A 3WWYA 2ZRGA 5EPOA 5KOHB 3FMGA 4WKNA 3R41A 2A5GA 4HSEA 4HDRB 4TL9A 1ZJ4A 1S8AA 4JQZA 1AIPA 1MCZA 1NY6A 2VK4A 2ZFUA 4HVTA 2QPOA 4LK3A 3EIXA 3MWDB 4L74A 1IZ9A 1H6AA 1ICIA 3BH7A 1VJ5A 2XUJA 6PFKA 2PZAA 5ICEA 4BIIA 1ND5A 2P8SA 3WV5A 4L2IB 3BRSA 1NW4A 1DHTA 1JKMA 2ES4A 3FYHA 5JMWA 2Q07A 1Y1RA 3E7WA 3THRA 4BFTA 2ZYVX 4W1PA 3WR5A 2YN2A 3OCCA 3T7EA 2ZE8A 3CB4A 1QONA 4DEXA 1UK7A 2C9OA 3I45A 2YZKA 3LUCA 1WXGA 2I4TA 4J0DA 4NBVA 5BSRA 1KMMA 3WSWA 3W5BA 4B6QA 1KARA 2VKQA 4YREA 3UAYA 2HADA 2ABWA 1W34A 3EQZA 3LE8A 4P4SB 4PFSA 3THSA 4ZZIA 1MD9A 5BR1A 4W5NA 2ZATA 4HH1A 2G28A 4IUDS 4DRYA 3MCWA 3C70A 4WN9B 2C4KA 3EEOA 2H85A 4RY2A 3U6BA 2LV8A 1F1JA 4A92A 1ZICA 1VQLB 2VJOA 2XZDA 1FTGA 4C0LA 2AHOA 4YAOA 1X1TA 1JR2A 3IE2A 3OPXA 3EC2A 5EJ4A 2C3OA 4IX1A 4JP8A 4DA7A 4RHXA 3LGAA 1UJ6A 1KRXA 3G71B 3ZDZB 1EX7A 4X61A 2ZRLA 3SQLA 1CUCA 5FA8A 2WJHA 4Z9FA 5J2UF 1NYRA 3GGOA 4V0NA 3ZHXA 5J4LA 1DTWB 3MRVA 4MRSA 4TKLA 5FBRB 5TS3A 2GPBA 2BBOA 3SDBA 2H4ZA 4FXPA 4I5FA 5E6TA 1G41A 2B8WA 3UT5B 5ES4B 1MLDA 1LBHA 5KYVA 1WSAA 2GSDA 4FOPA 1TAGA 2B25A 1XWIA 2H1FA 5G0TA 3TLXA 3PA6A 4G6IA 5E4YA 4E46A 2DFDA 2AJTA 4ZVLA 3ZKWB 5BVGB 4MVYA 3GEPA 1NVUQ 1U9CA 1WEKA 3DFFA 3ZGNA 1PNRA 3OZWA 4KQJA 4BNDB 2QRKA 5FJJA 3D7RA 4FGZA 3HYTA 4XA8A 5CDFE 1Z82A 3DMDA 1YJBA 4OPOA 1GKYA 4EUEA 4B3RB 4MW6A 4XDYA 3W1EA 2ANCA 3OZGA 4Q48A 3PXCX 3URMA 2ETVA 4DBLC 2RJNA 5HM6A 3VR6A 4INZA 5IYRA 3ZDRA 1HKHA 3DD5A 1QC5B 3GQBB 4MV0A 5BSEA 2Q2OA 5LYJF 1RZRD 3RK0A 3BJRA 2ZZFA 3M70A 1U7XA 3U31A 3I1YA 4OHUA 3EVGA 1MGPA 1V4BA 1R6XA 2MJLA 3BDVA 3H8JA 4XZ3A 4LMRA 5COAA 4AUNA 1QFYA 4HNUA 1QZZA 4GSKA 2Z57A 1MFZA 4TRNA 4NESA 2XZLA 4EW3A 2IYEA 3EUWA 1GPLA 1E4EA 3S40A 3WP0A 5AXBA 3VDMA 2FSVA 4HGNA 2FP4A 2H0QA 1I1QB 4UHHA 1E1CB 4R2XA 4NCNA 1MV8A 2GASA 3D7LA 4LVCA 4KSBA 5BQOA 1JV2B 3SBEA 4L15A 1U0LA 3MPOA 4TMYA 1K73D 1R6BX 3V80A 4X66B 1F0YA 3QLUA 3BC1A 2P3LA 1U9JA 4WKCA 4IH9A 4X20B 4OH1A 3DOHA 3AR7A 4MS3A 3W9SA 3THWB 2X4GA 3ZLJA 8GPBA 1BKDR 3L7YA 4LE1A 2B36A 4O0MA 1CZRA 4M46A 1PFQA 4RNDB 4WBNF 3PLAE 4MAMA 1P81A 4BQRA 1W5AA 2ZBQA 3D4NA 3T1OA 3O8BA 3T1QA 3AGPA 1QGUA 5D51S 2X5OA 1KDRA 1TQ2A 3CZAA 3O82A 4YQEA 1B8PA 2BI4A 1JLRA 2XI4A 2GJAA 2F43A 4MB2A 1LBQA 1J56A 2O7NA 4D9KA 4EZEA 5C8XA 1YB2A 1CUEA 1SCUA 3DL2A 2G83A 1N2CA 2DVMA 2CUZA 2Y0DA 4S0ZA 3LHKA 1A98A 5KSZA 3VKWA 4I5GA 1G7SA 2CJXA 1C3OA 4JS0A 4M89A 2Z6AA 3WB1A 1ODKA 5CFOA 3HU5A 2H2HA 4ZVQA 1FU8A 3NTXA 4AYXA 2H1VA 3MAJA 2OMKA 1ZL2A 2AR9A 2W6ZA 2X8AA 4NFLA 4TQGA 1Q95A 1RZRA 4PSVA 4UQOA 2DLNA 1YFZA 1VL2A 2HF2A 4RY8A 1CR2A 5BPHA 4HGQA 4DADA 2EQAA 3KU1A 5F21A 4KCGA 2D00A 2WQZA 2B0CA 3ZQ4A 1RKXA 1I7LA 1WQ1R 2R97A 3QUAA 4MAFA 1R10A 3FKQA 2A1UA 3N3BC 2VPPA 3KTDA 3M6MD 5EN4A 5KX5B 3NIWA 3NH9A 3N2KA 4FNAA 2WSSD 3AJDA 4R0NA 2P90A 3MJDA 3QVWA 2VP3A 1PZFA 1RQGA 4B45A 2X8KA 1QOPB 2H9AA 2NPIA 3EGOA 5FRDA 3EVNA 1BX0A 2B2NA 1X87A 3CG4A 5I7HA 3G49A 4RD1A 3PNMA 4AO8A 2O7RA 1NNUA 5B37A 3RU2A 3NOQA 2PMEA 1U90A 4Y8VA 2PA3A 3ITDA 1ENOA 1FQOA 1P5ZB 4JMPA 3ZLUA 2XX3A 2Q62A 1E3EA 3QOYA 2HGSA 3RUDA 3MAAC 3FLBA 4XYEA 3IJPA 4PPFA 3UUFA 3OPQA 3KZCA 3WRXC 3ZGZA 3HKBA 3FOEC 1Z8NA 4HB4A 1UJ5A 1A9ZA 4LBWA 2DF8A 5H3LA 3PA1A 1DS6A 3NTRA 1JQ3A 1ZM7A 4TVOA 4OPMA 1U0JA 3F8SA 2YWDA 5IARA 2HPAA 2Q3LA 3M4NA 2ID9A 3GRKA 2BVNA 1LK7A 3AWDA 3HB1A 3P0JA 1YBAA 3R6WA 3DM9B 1HORA 2XW6A 4DAOA 4Z4ZA 3MTAA 4MIYA 2WV7A 1V45E 4RGQA 3OPYB 4UHBA 4EYSA 3KZXA 1DQSA 2OLJA 1RBYA 1FP7A 1GAQA 5L46A 2XQIA 4C22A 1GYPA 1MENA 2ZXFA 2D1TA 4ZJPA 2NYVA 4XD7D 3RTEA 1F8UA 4IV0A 1LRJA 3A9SA 4UZUA 3LQ6A 1HM5A 1PJRA 2HZ7A 2PAFA 1IDN1 4JUCA 5ITVA 4TQ9A 1EB8A 4NFSA 4JYCA 1DIRA 3RBXA 2VZLA 4YASA 2XNHA 2WNHA 1E5TA 1NNLA 1SKBA 1JXMA 4RIFA 1TYBE 2DQ4A 3WWDA 1A95A 2J4CA 4AC9A 2JA2A 1M90D 1SCQA 2ZUCA 3TR0A 3ROFA 1OXVA 2RB4A 3DMYA 5ESWA 3WL7A 1R5NA 4J3JA 1WW8A 3C48A 2A88A 4BFCA 5C7LO 1G5FA 4ECAA 1Q92A 3C3JA 4OV6B 2IH2A 1LDYA 1BFUA 1C14A 1DADA 1M6WA 1TM7E 5AVTA 4QU8A 1DARA 1LDNA 3OLQA 4QUAA 3CCEB 4BKUA 5J4HA 4P7FA 1PLJA 2ID8A 1SCNE 4F3KA 3JTEA 4OHRA 4DY6A 1XOIA 1BN7A 1P5HA 4U02A 3CT6A 2JDID 1XFDA 1HI9A 3FPAA 5CVVA 1AZWA 4YC7A 2V65A 2I66A 1XRPA 3MF4A 5FPYA 2EV9A 1KJJA 4YPVA 1UP7A 2D06A 1Q83A 5K5EA 4B5KA 1XTSA 3FTDA 4IUCS 2BGLA 2DWOA 1W29A 5FL7A 1N5LA 3A6LA 4LRTB 4CMKA 4NS4A 4DLWA 5AIBA 1Y8RB 4ZEVA 3L1VA 4ZRNA 1SHLA 4L9AA 4GUDA 2YQ5A 2GHIA 2QQ0A 2AMYA 5F73A 2C8KA 1IZ7A 2J5QA 3K2EA 4OF4A 3ELDA 2D1SA 5EYPB 3SD7A 4WBSA 5G0SA 1EUYA 3ZHOA 2EXXA 3NFRA 1KH1A 3KWMA 1AKRA 2JVIA 1H23A 3KT0A 3NR2A 3RPEA 5B1YA 4QLOA 2X5NA 4DLBA 2O4UX 1QG0A 1JR4A 2MSLA 5K0FA 4YAJA 2BDUA 2F2TA 4RQAA 3PUVA 4AKSA 1X7XA 4LK2A 1N25A 3BB1A 3DBIA 1IEVA 1P1KA 1H66A 1MNAA 1T8YA 2QD3A 2QQFA 2W8BB 4OM7A 5ADHA 4BATA 2R96A 4KV7A 1VJRA 3VYWA 3OPMA 2Z4SA 1CCWA 4DWVA 3UGJA 1YRHA 3H05A 1UJ2A 1DJLA 1XC7A 3VOSA 4FDVA 2XUQA 1GZ6A 5CLHA 3S55A 3E2MA 3GP8A 4G5GA 1UOEA 1RWXA 3LKBA 3VZRA 5BSFA 2DH6A 2GM9A 4R7GA 3B85A 3CCFA 4DC0A 3ZU5A 3DCIA 4E15A 4ZEXA 3I56B 1KRHA 1NPTO 1RI2A 3SJ7A 4B6JA 2QA4B 4IAOA 3H0EA 4LV8B 1B0ZA 3SLKA 4L6IA 1KQOA 4JBYA 1KK1A 3DDNA 3ADBA 2R7NA 1XAHA 2MIIA 4L5IA 3OC6A 4C5CA 1N9ZA 3C39A 3EB9A 4IF6A 2IS2A 2XODA 5G3YA 5KOJA 4ETNA 1ACJA 1UAGA 1XZMA 4D3YA 3UJ3X 4JB0A 3D3EA 3MMZA 2FOXA 3OQNA 4KR9A 2EIHA 3LYUA 4PR0A 1Q0HA 3ZG6A 4HAWA 1D2NA 2BR3A 2W6MA 4ETMA 3D6UA 4MW7A 2YIVX 3OC0A 2X0DA 3ZVRA 1SNYA 3GI1A 4NLLA 5EWJA 4XD2A 4DV3B 1HLDA 4YN3A 4EFMA 3TGWA 3N87A 3NPMA 3D8BA 4C6RA 4EFLA 1UFVA 1F7VA 1IHUA 1RYHA 3M5PA 5THKA 4E3ZA 3DWEX 1KY5A 2PGIA 4ZT2A 3RYCA 2I6XA 2WTBA 3ILVA 4QO7A 4PICA 1K8RA 1CYDA 5EIOA 5H82A 4HUQB 4D5EA 4PC1A 4U63A 4RA6B 3ZBQA 1QFZA 4PBRA 3PEUA 2VYND 2FMHA 2VNHA 3NXKA 4QEKA 3P9QA 2IS6A 3PEWA 4QV2A 2ZSUA 5AI5A 1DX9A 3I6MA 5G1PA 3FOWA 3SF8A 4S1WA 3O38A 5D5HA 1Q0SA 4HRVA 5BSMA 1BE8A 1E7MA 3RKUA 3UMYA 3TZQA 1LKZA 3PGXA 2CVZA 4AZ0A 4CTNA 5CM9C 5C9ZA 2E5LB 4WLUA 3HU3A 5ABPA 4D9NA 1BAPA 4BJ1A 3FN4A 3E23A 3W5CA 3FSRA 3G1TA 1BEEA 4AZWA 1BEZA 4OREX 3PHHA 5ADWA 1IBMB 4B3GA 1ZHHA 1TEHA 4YELA 2GN1A 3JVIA 2P9FA 4HFNA 3Q1LA 2WV9A 1RJEA 1U7PA 2QRLA 2GUGA 1XJQA 3EXHA 2RHDA 4JUBA 2QX9A 2HA3A 1SKQA 3PFNA 4HATA 4DA6A 3IDOA 2HYIC 4DA9A 1NXOA 4GDMA 1KC8D 1L8AA 3E7PA 1EJBA 3EXHB 2DQZA 1S5PA 5ITWA 3AY7A 5TJ9A 1RWKA 3FPKA 3AVUA 3U9TA 1LBEA 2ZB3A 3NLLA 4F6RB 4ZI7B 1JQAA 1SBQA 1Y9DA 5KNCD 1K7XB 4PABA 2O2SA 2ZI5A 3BL8A 4FU0A 4Q1EA 4NE9A 1MIHA 4XIYA 1FDIA 2P68A 2APJA 3HZOA 2NUTA 5A02A 1Y5IA 5LZ9A 2ZSEA 3MIIA 3IAM6 4PX5A 5BUCA 3OIGA 4H7HA 3EOBI 2OYNA 5M5BA 1TXGA 4H7JA 5K8IA 4GNKA 3IAFA 4LW8A 3QXJA 1DRKA 1KGDA 1F8GA 1TQ8A 3OCVA 4Y6SA 1GGKA 3S2FA 2XCTB 4BNJA 4DSOA 5AW7A 1FMTA 2OTJB 3VPXA 1MABB 4BMZA 2C8LA 2OHXA 3DEAA 3PEYA 4QYMA 2E9SA 1XK7A 4GOJA 3ECSA 2Q3BA 3QMMA 4F4HA 4BV2A 5FUBA 5I7WA 5HNKA 1YZYA 1DE0A 4X05A 1EWYA 3CJQA 4RMNA 1HUQA 2HIGA 2R8PA 2VA8A 3OQPA 4PIPA 1RYNA 2C4VA 2Y27A 2P2ZA 4P3XA 2JAPA 3BF8A 2HFKA 1Y6ZA 4FKZA 3PDUA 3P9PA 3GT3A 2B6NA 2ODEA 3DHNA 3DOOA 3C6XA 3LOUA 3MN1A 4QYXA 4P7GA 1FDWA 2FETA 5D85A 4LQLA 4BLRA 4NZOA 5SY4A 3B52X 1Y48E 1E92A 3GCWA 4YJHB 3VI4B 4FYYA 2NUPB 4BDTA 2WICA 3CWQA 5EQFA 1IXZA 1K2WA 3BBPA 1SIBE 5BN3B 3AI2A 1BMDA 1XPJA 4CKWA 4QDKA 4WINA 4A91A 3AW8A 1IE3A 1JKJB 1KK3A 1VL8A 2E48A 1NYQA 2R2GA 3LCJA 3PRKE 1E1LA 4FHGA 3K9NA 4Y1RA 4M8SA 5B2ZA 2V7QA 4HB0A 1P9NA 2NZXA 5FAKA 3HBAA 3PQ4A 3OW2B 4EELA 2Q6VA 2HNBA 4DR4B 3OHSX 1X38A 4R1UA 3WB0A 1QQAA 1MOPA 2C4HA 5TRDA 2P2SA 2ZJ8A 4G1EB 5D3QA 4CE6A 1P9LA 1VPEA 3DHVA 3RS2A 4ENTA 3UY4A 4BJHB 3PX7A 1ZUNA 2FGKA 3AJ9A 5D87A 5FWAA 3CPXA 1S89A 2J9XB 2Z2KA 2BWJA 2RK4A 3AR2A 3JQFC 3ABIA 1RMYA 1GSHA 5IVIA 4XX0B 1TIBA 1AGNA 5E1OA 4ZCRA 4LBZA 2AZMA 1Q86D 4M1MA 4EKDA 5LKRA 4RIIA 4CJXA 4YJ2B 2MSNA 2GVDC 2VBIA 1NQTA 4E33A 1RTTA 3L7JA 1Z4PX 3ZW9A 4GL2A 2P75A 3GQBA 1QC5A 4B82A 2OCGA 2Z5LA 2OBYA 1AQJA 2CJWB 3II6X 1CJCA 4MPDA 3P2YA 1RXEA 2LE0A 2QSUA 3IPLA 3PTZA 3FZNA 3MFQA 2VUIB 4TV8A 1XZGA 2HBYA 4TXNA 5DLYA 1WOPA 3TXYA 5J1SB 1LQ2A 2J0SA 4ZWNA 1ZRNA 1TJ3A 3CZMA 3HYNA 4H4DA 3GHHA 4XYMA 1E8NA 2ISCA 5F7JA 4ENQA 3TFOA 1J0BA 1UKVY 2PGLA 1VP3A 3ZHSA 4B4WA 3N2ZB 1NMYA 2PXHA 1G8MA 3ZDBA 1N5RA 3QEMA 3LZDA 4QYIA 4A73A 1S3FA 1X94A 2PUHA 3T1TA 2V7WA 2WOOA 1FA9A 1V3UA 1OV6A 2FX5A 3EIHA 2BW0A 3M6XA 1Y6RA 2ZWIA 3OEWA 1HNZB 4EY5A 1GZ5A 1V2HE 2ID7A 4CU5A 3F6PA 5ALUA 3V4SA 4JEUA 4QX6A 3FTPA 3U4QA 4XN0A 1MDFA 2F00A 1JSLA 1PYGA 3IX7A 1RZVA 4NU0A 1F8FA 4B5LA 3DQPA 1PTJC 4X44A 1EPUA 3WICA 4C06A 2PFSA 1NLMA 3GGPA 3GEIA 3PHGA 5J1TB 1R0BA 3RSGA 1E64A 1T2EA 2WYHA 2CE7A 3R7BA 1PQ4A 2Q3MA 3DKKA 4FBLA 1GO2A 5A5EA 2G1KA 1PEDA 3DBLB 4QPCA 4J4TA 5EQTA 3D4PA 3WJ2A 2BPOA 4HRAA 4O3FA 4R6XA 3WA6A 2DCUA 4BLWA 3MT7A 3X43A 4D02A 3MG9A 4DV5B 2VXBA 3N39C 3LT1A 4MITA 2OGUA 2JFYA 4YS6A 4W5QA 1WMEA 4G5YA 3GZNB 4UEKA 4EUFA 3IEVA 1Z39A 1OZFA 3MJSA 1WP4A 3ZGVA 1DQNA 1QHEA 4BP8A 4A7PA 2OORA 3R3JA 4FHDA 4PWYA 3D4OA 4DPMA 3N74A 1GNPA 4M1OA 2CFRA 3EVZA 4AJ1A 3AV3A 3I28A 5CMLA 4PBSA 3HUTA 4PEVA 3GJ3A 3V8EA 4NH4A 1N5OX 1OBVA 4NX2A 5KVVA 1CLEA 4LV5B 4QBHA 2OORC 1KETA 4MQFA 1S2OA 4N40A 2FMIA 4FI3F 1H2EA 1JA1A 5LQUA 4TPKA 5FWYB 4JXZA 2W71A 1PFGA 1JJIA 2GNOA 2AMJA 2ISQA 1CF9A 1MO6A 2XYQA 3UCFA 5M34A 3ZW8A 4KSCA 4ZO4A 1JHQA 5IM4A 1J8FA 5EY5B 5FPPA 4YRJA 4B3JA 4RD3A 5GJCA 5AW4A 5CDSA 1YFKA 2UYYA 3PRHA 1H9BA 5HMMA 3I37X 3AUKA 4JCOA 1GJRA 1JGTA 3INYA 2XHEA 2IELA 3AKDA 2VATA 4RU1A 3U62A 4LGCA 1P72A 1BDBA 5DT9A 4LX0A 2JK0A 4CCAA 2RGRA 3RSSA 2WYUA 4D45A 3KSRA 1CG6A 3H1EA 3ENNA 2GQFA 5D86A 1FVOA 3EGXA 1HSOA 1PJLA 1A27A 1XR3A 2BGRA 2WLSA 3RIYA 4AVZA 3WIDA 1E3IA 1XUOA 4TN1A 4M9UA 4YPFA 4FILA 3IAXA 4AN4A 5JJCA 3Q40A 3GYBA 2JGDB 4GM4A 4IFBA 4AWXA 4Y9UA 2JFOA 4RHCA 4PAQA 4HYQA 2ZIXB 3TQCA 4BTEA 4Q05A 4PZ0A 2OE2A 3HFSA 3D6FA 4EMTA 1PR2A 5CB6A 3V55A 4FHCA 1DCKA 2G17A 1IK4A 1G0OA 1OX6A 3NFYA 5FI0B 2JDIA 121PA 1ZNWA 3WRYA 3AUXA 4E94A 4II7A 3GLIB 4BCBA 1XEWY 3TRJA 4Y9RA 2CFTA 2W4MA 4II3A 3OZBA 2GPJA 1FLDA 1RXCA 3SFTA 3K70D 4NEQA 1ATZA 2GD1O 1NBWB 4DT1A 3GZTB 4O29A 4TSRA 3WRYC 4YMVA 4PZZA 4RABA 3WV4A 1WXFA 3F7MA 3M2TA 3A9UA 3LCMA 2AX3A 3TRKA 4NOJA 5JO0A 1H94A 1E5XA 4UTRA 4LC0A 1T34A 3JQEA 4EJFA 1T5BA 1TD1A 5IN5A 3V2GA 5AUQA 5GGYA 3ZDDA 3W06A 2J4FA 1DC7A 1W9HA 2B3DA 4TWJA 3VXKA 1F0KA 1F3OA 3UFBA 1HO3A 1GIAA 2EW2A 2FQ1A 2G76A 4LGVA 4P4NA 5HSGA 4G4JA 3WGQA 3BMXA 2CVHA 3A8TA 1C4XA 2ZL5A 3E9DA 5JD3A 2DKOA 5TPWB 4W9NA 3UJ8A 4BYMA 1N78A 1I2DA 2C4WA 1QK4A 4ARZA 4LHVA 4LYEA 3QFRA 5DWDA 3K70C 1Q7TA 2JGKA 4Y1FA 1RQPA 1NVWQ 2FPWA 3KLOA 2M2IA 4ZOLF 3SIXA 2VHYA 5JD6A 4WHMA 2NYUA 2RH5A 3W8DA 1DUVG 2GEDA 4GIBA 2ZYAA 3AJEA 2YWFA 1CPYA 2OV6A 1EX9A 3A2MA 3QSGA 4AJOA 2CV1A 3KR1A 1WIWA 1TADA 1U7HA 1O97C 3SHQA 1M1YA 2VP9A 1S7CA 4A15A 2AFHA 1I80A 2QRPA 2FW9A 2CL5A 1KP2A 3M82A 1YQXA 4HCJA 3WRXA 2PX8A 2ZUTA 2OGSA 1IJFA 2Z56A 1XAGA 4TN5A 4BO9A 1NTOA 1XTBA 2BJVA 4TYWA 2NZ8A 5EEGA 2WSSA 1M1YE 2G77B 4LDJA 4NYIQ 4QUGA 3TRIA 4Z4HA 1T8TA 2HMYB 1UBHS 2FPPB 3FBTA 3JZDA 5KYYA 4F5ZA 5DFAA 1NLUA 3QF4A 1EEXB 2VWPA 1TMYA 2A5LA 4ND8B 4Z9BA 4DEYA 1EXNA 1NONA 2GBLA 4GXRA 4OP3A 4TSFD 4DLUA 4IOKA 2QAIA 4WI1A 1PFVA 5JAOA 3BJZA 2NPFA 3IP8A 1SFRA 3OZUA 1W73A 1ZL0A 2PX4A 4WUVA 4Y2QA 4B2LA 3WK5A 1QO0A 3K6JA 1VQOB 2BKAA 1DELA 3ND9A 4JWKA 5E2BA 1FX1A 3I23A 1QKKA 4LDNA 1RQXA 4ENUA 1JEDA 1K92A 3PX3A 3Q5DA 3W90A 4CM4A 4P98A 4WCDA 4XLHA 3BXFA 4FZJA 4MGKR 3IQWA 1R6AA 3ZBTA 3O31A 4ZREA 3R6DA 3RSCA 5AD1A 1OBCA 3NUZA 3Q0IA 3OOWA 3HWRA 3RVSA 1G8PA 1QV6A 1IYZA 2Q8NA 5ICFA 1V0EA 5BQ3A 2BKXA 5CLQA 2QZSA 4M1SA 2BFNA 1FW8A 2IH5A 1E7SA 3DAPA 3IT2A 3VO8A 3LXRA 3J7TA 3FMVA 1WS6A 3DV9A 3ZDQA 5L4NA 2OFWA 1NI4B 2WF9A 1I9CA 3H5WA 1DVRA 2DZDA 4DNTB 4G65A 3G02A 3O90A 3PUYA 3U19A 4P4UA 5K0BA 3NVKI 4P4LA 1FYEA 3LLMA 5E9QA 2GPSA 2PVSA 2R1TB 2W2TA 3ASRA 1SIUA 3EEBA 3HH8A 4K6OA 4KTTE 4N8SA 521PA 3RJ5A 3RYCB 5HKKA 1EFVB 3BH4A 1C9KA 4UUPA 4C5AA 3O8QB 4HQ6A 4RPGA 2C7QA 1MQAA 3FMIA 2Q5JA 2WM2A 1VMIA 4KGXA 3TZHA 2F1LA 1P29A 3GFVA 3VSCA 5HPYB 1BCSB 3LQ4A 1EIWA 3G5AA 4UFOA 1OKKA 5AI8A 1RRKA 3CZQA 3TZKA 1Q20A 1JN0A 1Y1QA 5AVSA 5E6SA 1MB4A 5IKMA 2H5EA 2G0AA 1LD3A 1L7DA 4W7IA 2K87A 5KNBA 3Q8KA 2XNDD 2F3QA 3CE6A 3EG9A 1X3SA 3PQ6A 4JKIA 1X3LA 4DYVA 5BOVA 1DAKA 4KPUB 3P26A 5I7RA 1DT3A 2IEYA 2O6LA 3UW3A 1I30A 2UYOA 2CXTA 2FG6C 1VE7A 1TA0A 2ZKIA 4HAXA 1YC5A 4ITVA 2DUUA 5B1HA 4CQNA 3BWEA 4X0CA 1CS4C 3DFMA 3F6YA 4LZLA 1MABA 1QM5A 3IBYA 3LVQE 1I33A 2IYPA 1UXJA 2QK4A 1D1PA 2WVGA 1YHQB 4B6OA 2B7LA 3NEYA 1TZCA 3D7MA 4E7OA 2O8FA 1BGVA 3LNCA 1XZPA 4JLDA 3L0PA 3IMFA 5EINA 4X6XA 4D1YA 3CRW1 2PKRA 3OKCA 1XZLA 3OT1B 4N49A 4EPYA 5JROA 3PKIA 4HK4A 2NO4A 1ESMA 4QUEA 2Z2JA 2K7FA 2C61A 4KODA 4M87A 5J40A 4XR9A 4B6SA 3HA5A 1JDJA 2QVZX 2VT7A 2IEDA 4QU5A 5I47A 2A7QA 2X5XA 2W5UA 1NVTA 2BGUA 4EFNA 1YBVA 1YOVB 1FYXA 1ZH6A 4H7DA 3NM5A 1Y81A 4PYLA 1LK5A 5HJ7A 1L5QA 5CFLA 1ADCA 4IG9A 4D92A 2B35A 3SCZA 1KR5A 4EG1A 4EJ0A 4HNAA 4CNQA 1RYMA 3QXSA 1ZMXA 5LA6F 3IQIX 2Y2UA 5B3JA 3VKVA 5HMLA 1FNBA 4KGDA 3QW2A 4CM1A 1DRUA 3MS2A 3LY8A 3C6MA 3CT4A 3NTUA 1WSBA 4WXHA 2O0MA 3KL4A 3OO0A 4LFAB 1RBQA 1A69A 5H68A 4ZTBA 1QWOA 3GRFA 1KI1A 1SOAA 1E6EA 2DECA 1FJGB 3GJ8A 4KB5A 5EZYB 1Z88A 1EXDA 4RL4A 5IMBA 2JFZA 1H1LA 3SFZA 4C6TB 3BIFA 4EA9A 4D98A 1QQ6A 4HB3A 3I61A 2ZTMA 1E2IA 1PS9A 4JR2A 1PL6A 1YZKA 2WIGA 2G08A 4TRMA 1PX0A 4IHQA 1CS0A 1Y5RA 5GTDA 1XVTA 4FMDB 3AR6A 1WETA 4L5JA 1T0JB 4NSNA 2GO7A 1ZEMA 4X7PA 3IRUA 2VDJA 2DEUA 1GSAA 1JIVA 3G8AA 2J32A 1EGAA 4PZ9A 1A1VA 4M1YA 3RVQA 1ZESA 3OZFA 3KJQA 4WWHA 1SRRA 3G88A 3EWSA 2UUCB 3UMMA 1XZAA 2I7VA 1QGYA 3DCNA 3IAS6 4S1NA 1N5DA 1W85A 1FRFS 1P7YA 4K6FA 2V8OA 3TW0A 1K97A 4LVNA 4F8EA 1PGNA 1F51E 1MJHA 4HDSB 2YL2A 1ZJWA 3DXFA 1MXFA 2FFRA 4IXMA 4GI1A 1V71A 3NT5A 1V0FA 3R0VA 4MVJI 4UHCA 4JI3B 4B76A 4YUYA 4YHHB 4EITA 1A4UA 4B1FA 1OLUA 3CWZA 3CZCA 1BZYA 1UBOS 1B0PA 3ANYB 1DTEA 4OXQA 4XFDA 1E5LA 3BEDA 5A88A 4EG6A 1NSTA 3U7QA 3FPPA 4NY1A 5JRJA 3EGWA 3DUFB 3FNEA 1QV9A 4J9UE 4B7ZA 2F8SA 1QFJA 4FOOA 2EZ9A 2EFJA 2BTQA 2JFGA 2Z8YM 2AFHB 1KAQA 1A50B 4ZCPA 3PF8A 1C3XA 3STVA 1KY2A 5J58A 3HYSA 3RVNA 1MH1A 1BWRA 1UDRA 1VMAA 3CBGA 1U4NA 3DUFA 3O8OA 2PYIA 2ZIGA 4AWBA 1P5FA 2BTQB 3LA6A 1CB7A 1DAMA 3QENA 3FB4A 3PEFA 4C21A 3TTVA 3PT5A 2J59A 3D31A 3H4VA 4RIGA 5FPTA 5TQ0B 4CM6A 2V7VA 2KS6A 4UM8B 3CGWA 4YWJA 1KJYA 5AVZA 2IUFA 5A4AA 3HJHA 2PG3A 4LPSA 1ATIA 1QRAA 1VJGA 4U3JB 4CIXA 4FK8A 2RI1A 4G2TA 1SZDA 5KNCA 1CRWG 1J9ZA 3C16C 1G8SA 3CLTD 5IT5A 3AQ4A 1L7XA 3FOCA 2L82A 4RD6A 1FFDA 1LX7A 4KNVA 4YEDA 5IF3A 3T1HB 1OGIA 3MBKA 4GT1A 5DJ5A 4M9SA 4QATA 4MKIA 2H1HA 2GEBA 3B9QA 5LFAA 1CULC 1GY8A 1HE3A 1L0BA 2QKYA 2ZRJA 3N0RA 3NT2A 4MGEA 4QG7A 2G7ZA 4QOEA 2JGAA 1Y8QB 1Z5NA 1MZVA 2ZIEA 1ZK1A 4LJSA 5FOVA 1PJZA 2BCGY 3BWBA 2VFAA 3A6FA 2IXBA 3AUUA 5ULLA 2UZ3A 3S7TA 4TWAA 1EE2A 4AXBA 3SDZA 3T4PA 4L5CA 1BYIA 1XNGA 2FEKA 4JJ6A 2PLNA 4OQYA 4R01A 1IWOA 3ZWAA 3TSCA 3VJMA 1WOOA 1V8DA 2O2HA 1II8A 3LXMA 5HIJA 4WZLA 2VAWA 3OG9A 5ALLA 1CF4A 4U0JA 4QXQA 3I34X 5IK2D 1P1HA 3SF0A 2X1HA 4QFBA 5LBIA 4G1FA 3WDKA 1E1NA 2VG8A 3KUKA 4LHXA 4RF3A 4YRRA 4NAUA 3QBTA 2BFBA 1XD8A 3IPRA 2HLHA 2NVUA 3DHEA 2IWRA 2Q5EA 3KAKA 3ENWA 4LTMA 1GFWA 2OXEA 3NHPA 5ALPA 5F3DA 1MF7A 5SZHB 3ZQUA 2V7TA 2AT1A 4M1TA 1RQNA 4W7SA 1SUCA 1A0OA 1CY6A 2XWPA 2ZTLA 3GWGA 3L6CA 4NBKA 3WKCA 2YIJA 4RZ3A 2KB0A 4JC4A 1Q0QA 1S1CA 1MJGM 4CVNA 1JECA 3UV3A 2A78A 1ZD5A 1ZNXA 3NC4A 1Z4JA 2WI8A 3GWZA 1P17A 4ZHQB 3NIFB 4ESHA 2XUAA 5A3QA 4C89A 2XEDA 1JR3E 1YBFA 4OAOA 4QTTB 5JE8A 1AO0A 3SEJA 2H06A 3N9IA 3P52A 1AQ6A 5BSUA 3BSWA 3KQUA 3O2JA 3F97A 3L8ZA 4NPCA 1J20A 5J3JA 3RQIA 3L7AA 4LJKA 3K4PA 4GPTA 4MDEA 3FNRA 2YYAA 4CNBA 4CT0A 2R6DA 4FMPA 5DYNA 2WU8A 3AL3A 3SY8A 3ABRB 1OT3A 4JEMA 2GILA 2QUZA 3ZBUA 4HDMA 5EMHA 2IXTA 4QBTA 5T6MA 4WDRA 3UOAB 1W6RA 1X8LA 2R8RA 5ICSA 1RPAA 1JQKA 1A97A 2X0EA 5H59A 3KKNA 3LKZA 3IDSA 2WABA 5IK2A 4RE5A 1CEXA 2CDAA 2PLAA 5J5CA 3NQ41 1Y3CE 4ZI5A 5K6TA 4B2YA 1KVRA 2F9LA 1QDLB 3JYNA 4MCIA 3SIWA 2GJ9A 3T6KA 1NHGA 3LQRA 4H0NA 4V2UA 5BQPA 4BS9A 3ENQA 4MULA 4IIJA 3OZAA 5AJXA 1VF7A 2JIDA 2P5SA 4CXMA 1WCWA 1N3IA 3CH4B 1R8YA 2EJCA 3M3DA 3HKDA 2IGTA 1P7ZA 1VKJA 2B4AA 3BAZA 5H4GA 3FF4A 1BW9A 4Q4AB 3VU0A 1XSEA 1E2BA 2C83A 3LA8A 3ZD9A 3EGEA 2AE2A 2FPIA 2PZJA 5UKDA 1VLMA 4PX2A 1L8QA 2GI4A 4Z0NA 2OGWA 4N3CA 4LJ6A 1NJ2A 4JJ7A 1N57A 4W8GA 3KEQA 1A5SB 4KQ6A 4MKGA 3S6JA 1CD5A 2P1ZA 1E59A 2QGZA 1AHNA 1L5RA 3W1WA 4XDHA 1EUDA 4KOAA 1ZSVA 2CLOB 2DG2A 3UA3A 4Z4YA 2Q2WA 5IS2A 5I4KA 3VZPA 3WBBA 3A8IA 4JC8A 3KT3A 1ABBA 4TMVA 1MX1A 5A6SA 4I1OA 1DMRA 1Z33A 4AURA 2H1IA 4FCWA 2D4AA 4HDCA 1IUNA 1A9YA 4KYTA 4CL3A 2QEQA 4V0QA 4RXMA 4R2MA 5AQ1A 2O8CA 1NVMB 2NO1A 4H3SA 5FUYA 4JENA 4V3BA 1M5RA 2BDTA 2AG0A 5E7QA 3QBVA 4ZQIA 5CT8A 4KFUA 5AUPB 3LWBA 5KYUB 2IIBA 2WUWE 5IU6A 4O5OA 3ESQA 4EHIA 4IJMA 4ND2A 4D6PA 1Q77A 4TLDA 5GGXA 3RSZA 2XHZA 4K05A 4OHOA 3WMRA 2C94A 5ER9A 2JF0A 2ZITA 3HFGA 1G7CA 2E21A 2HU5A 3U26A 3DTTA 5TT1A 1P1IA 4MGIR 4FHFA 4UBJA 3DPIA 2YNMD 2AJBA 3T7DA 3PD1A 3HB5X 3L8EA 5E7IA 2RHCA 1CUDA 2AR7A 1V8OA 4OXNA 1EK0A 2ATXA 2IV3A 2J5KA 1BJTA 3HKCB 3IUQA 4OP1A 4UNSA 3VTZA 4RJJA 1SXJA 2RK6A 3TTUA 4O4LF 1OYVA 1Z2PX 3MHPA 2QPTA 4BNWA 4D9GA 1YFLA 1BC5A 3DMRA 2LGJA 2ZJAA 3S27A 2J7PA 3C15C 1U5AA 3EIOA 1VE6A 4WSOA 2CCKA 3IP5A 4AO6A 3IOYA 2ACEA 3CCQB 4TMTA 1SXJC 1XCLA 3D8NA 1UODA 2QMQA 2R44A 4D42A 4OJKA 3V8MA 3JD1A 2DJ5A 1ZIXA 2YNMC 4IDQA 3B60A 3W9UA 2VJCA 1YS6A 3NOXA 4RCZA 1C3OB 2QTZA 1TJ5A 2GGSA 4MV3A 1T2UA 13PKA 5THQA 4YCSA 1SR8A 1BE6A 3V3KA 4BXOB 3A2LA 4WXYB 3GDHA 5C1IA 3I55B 2GD2A 1XRSB 4C0BA 1W87A 2PU5A 2I22A 3WGLA 2XDWA 4Y7DA 1F60A 4C7OA 3JTMA 2O1SA 1T0UA 3N86A 1TAHA 3RDPA 4Q9LA 4V2IA 2VDQB 4M0DA 4B2PA 5FWXB 3LO5A 4UUMA 2JLAA 4KN5A 4YLEA 1AXGA 4OXIA 1LW6E 5EMLA 5IW8A 3LX5A 3QJGA 4MOWA 2NGRA 5DNYB 2QQ5A 1HDXA 3CTPA 2I4LA 3Q8XB 2UUBB 3AERB 2G9UA 4MQ5A 4Z49A 3ZPXA 5H9WA 2A0FA 2W2OA 1T1SA 1EBUA 2INGX 3A32A 3DBVO 4IF4A 4Y98A 1DQZA 4GP7A 4F06A 2VDWB 1UC9A 1B8UA 1J9GA 3HSKA 3OP4A 4H6VA 2FEPA 2CNBA 1KEWA 1F4LA 4G89A 2QLTA 5HA5A 4QIHA 3V1UA 3RUAA 3ONYA 2Z5GA 1MVOA 3DM5A 1L4YA 2YS6A 2ZIWB 5IT4A 4LHZA 3VX3A 6GPBA 2EZ4A 2BMFA 5E6RB 2HPHA 2X1LA 3HN6A 5I9LA 1BJKA 1D4OA 1R50A 2DKFA 4D3DA 1FTWA 1SQ5A 3NHRA 5CIYA 3CH7A 1R4NA 5M29A 3HCNA 1TT5B 1HZJA 3AT1A 3GCXA 4F91B 2QYHA 1OZGA 4G41A 3G13A 2DH5A 1J7KA 3JPWA 5E6UA 2A86A 2H5LA 2YW9A