1OGIA

Ferredoxin:nadp+ reductase mutant with thr 155 replaced by gly and ala 160 replaced by thr (t155g-a160t)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FERREDOXIN--NADP+ REDUCTASE
publication title Involvement of the Pyrophosphate and the 2'-Phosphate Binding Regions of Ferredoxin-Nadp+ Reductase in Coenzyme Specificity.
pubmed doi rcsb
source organism Anabaena sp. (strain pcc 7119)
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ogiA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1ogiA02
2XEXA 4M53A 3ZBUA 2QA4B 4AF6A 1AMOA 4M1KA 4R71A 5GV8A 3OZVA 4HE6A 3U2QA 1ZM2A 1B2RA 3CCLB 3W2EA 1EFUA 1S0UA 4Q7JB 4QFMA 3CXCB 1JNYA 3CCUB 4QHYA 2XNCA 1GO2A 3CCJB 1ZUNB 3OW2B 2B7CA 1K73D 2BVNA 1KRHA 1KC8D 4RD0A 3I55B 1WDTA 5EMNA 3E20A 3FJOA 4PC7A 4NCNA 1FNBA 1GVHA 4G1BA 4M2LA 3CRZA 5H5JA 1W35A 2VYQA 4H9GA 4FWTA 1VQOB 1DDIA 3ZZUA 4TN1A 1SKQA 1EP3B 4LC0A 1QH0A 1M1KD 3AVUA 1M90D 2QTZA 3JQQA 2PMDA 4AC9A 4RD1A 3CC4B 1R5OA 1J9ZA 4K1XA 3QFTA 4ZCMA 2DCUA 3WNDA 4N3NA 3CCMB 3SJZA 3G71B 1KJZA 2BM0A 3ZZ0A 4RD6A 1W2BB 1DARA 3AGPA 3V76A 2HDNB 1KK1A 1YI2B 1TUIA 1D2EA 1G7CA 1N0UA 4TMXA 2PLFA 2QMUA 3JQPA 2QTLA 3I56B 3CCRB 1ELOA 4M0LA 1D1NA 3MMPA 4PC3A 1DDGA 4YAFA 5AN9A 1XE1A 5TR9A 3LYUA 1GR1A 2BN4A 2EIXA 3QFRA 1YJNB 1TVCA 5JBQA 4IW3B 1YIJB 1VQ8B 1QGYA 2QDXA 5FA6A 4PC1A 1G7TA 1YHQB 1QUEA 3FPKA 2YWEA 4Y9RA 1VQKB 4P3YA 1QGAA 3VNUA 5DSZA 2E1RA 1JA1A 5H59A 1DG1G 3U6KA 2BSAA 3G4SB 4YALA 1IJEA 3QFCA 2HMAA 3I1FA 2YWHA 3AVXA 2C77A 2AHOA 4LBZA 1K8AD 1KD1D 1AIPA 4DQLA 3VMFA 2ZITA 1QGZA 2VZLA 4B44A 4LBYA 1Q82D 2R6HA 1E62A 1BJKA 3P26A 4ACAA 3AVYA 3WBJA 4LBWA 3AVVA 1CQXA 2BMWA 1GAQA 1EWYA 1QFYA 4Y7CA 2QN6A 4YAUA 3VNVA 4ZGNB 4FN5A 2RC6A 2CRVA 1EFCA 1TTTA 4ZCIA 2HCJB 1E63A 1G7SA 3LVBA 3VO1A 1Q7YD 1VQ9B 1VQNB 3MCAA 1N8RD 2BGJA 4MYTA 1I7PA 1Q86D 1EFTA 4U9UA 1H85A 4AF7A 1D8TA 4RCYA 1OB5A 2NPFA 3WY9A 1ZM9A 3B8HA 4TMZA 2GPJA 1W34A 1SM4A 4G5GA 3JQRA 4MYUA 1FNCA 3CD6B 3QSYA 2D74A 4C0SA 4G1VA 1CNEA 3QFSA 1VQ4B 3W2FA 3LRXA 4B48A 4ZGQB 1JA0A 5TV2A 4DQKA 1BX0A 5TY0A 1KK3A 1VQPB 1H42A 1QVGB 1KK0A 1NJID 3WBKA 1KK2A 1G7RA 4ZCLA 4F7DA 4P6VF 4UAJA 2BV3A 1YJWB 3CMAB 1VQMB 3CCSB 1JB9A 1Q81D 4TMWA 2FX3A 1NDHA 4RJLA 2B5OA 4YAWA 2DY1A 1QX4A 4BPRA 3ES9A 2OTJB 3P27A 1TLLA 1KTVA 1VQ6B 3WXMA 4YHBA 4M4SA 2RC5A 2OK8A 3CC2B 1FNDA 2CNDA 4ZV4A 2VNJA 1FRNA 2VNKA 4TMTA 3W2IA 1QG0A 1UMKA 4ACBA 4B3XA 1VQ5B 4EH1A 4B47A 5KSWB 3CMEB 1YITB 1CNFA 1IB0A 2J7KA 4C43A 1FRQA 3CCEB 1QUFA 4FK8A 2GQFA 4NBSA 3W2HA 4RD3A 2X3UA 1BX1A 5THXA 3OZUA 4N3GA 1W87A 3MHPA 3CCQB 3ZC3A 2DETA 1F20A 2QEXB 2DERA 3OJWA 2VNHA 1EXMA 4HE5A 3PENA 3CW2A 3J81k 1ZM3A 1E64A 2BGIA 2EFGA 4Y9UA 3AVTA 2BPOA 1VQ7B 1XB2A 3W2GA 1KQSB 3CB4A 2VNIA 3A1FA 2PIAA 1EP2B 1QVFB 1S72B 2B7BA 3ZZTA 1U2RA 1FNMA 1A8PA 4J0QA 3CC7B 1R5NA 4PC2A 1F60A 1R5BA 1GJRA 3B82A 1OGIA 3LO8A 4WQMA 3E1YE 4PGOA 1OGJA 3W5UA 2OK7A 3AGQA 1N0VC 3QE2A 3W5HA 4RD2A 1JJ2B 4RCZA 1BQEA 1FDRA 1GAWA 1QFZA 3VO2A 4YAOA 4B4DA 2YWFA 5GV7A 1VQLB 1IJFA 1QFJA 3AVWA 3OZWA 2C78A 3WNCA 3WYAA 3B78A 3OJXA 4LBVA 1YJ9B 2YWGA 3G6EB 1HA3A 1K9MD 4TMVA 3W5VA 3CPWB 3U6BA 2XNJA 2OTLB 1ZM4A 1EP1B 2DEUA 1OB2A 1B23P 5HXBA 4B43A 3ZBTA 4PC6A 4RD4A 3WNBA 3CCVB 2BF4A 2BM1A
chains in the Genus database with same CATH superfamily
3OC6A 2R5FA 3DOUA 1DIAA 5TRTA 3V4OA 4CDMA 4IIDA 5JTUA 3UGKA 1EX9A 2JRCA 1MT0A 2Z98A 1IOLA 3ONUA 3CWCA 4EKDA 2YMLA 1UM9A 4GMXA 4B3IA 1ESMA 4Z86A 3ELYA 1SMKA 2IEBA 3V1YA 4BMSA 3WLLA 3OE1A 3EIEA 4KNVA 3PC6A 4JLSA 2SECE 3CWQA 4UEKA 2HBQA 4UPDA 3W3AH 1DWQA 1JLSA 3OCVA 3FHOA 5LFAA 3EGDA 3I5UA 3ZTYA 4OOVA 4UPVA 1TTQB 1WSAA 4RA9B 5ILGA 3IAM6 4M0KA 2J45A 4XDGA 2HA7A 4ZVKA 4HADA 2JAQA 3PJFA 4P9NA 1GZUA 3CCJB 1RMYA 1U3CA 1ZUNB 2R4QA 4YA6A 5CDSA 5L45A 2AKEA 1N08A 2IXDA 5AP9A 1T1GA 5DHPA 2LBPA 1EP9A 3C3PA 5ENZA 4C0XA 3BDAA 3WGGA 2VA9A 5LPNA 1EXVA 2VQ3A 4KQIA 1KDPA 2V1XA 4UM9D 4JI7B 2YWJA 3IPAA 4G25A 5BUZA 1OJLA 2HSGA 1CJMA 1FLAA 3E20A 3WQQA 1NRIA 4FGKA 4FT2A 1L5GB 4KFCA 2PQMA 4CT0A 4YRDA 5I45A 3P9RA 3N0XA 3X1MA 4PC7A 1K92A 3ML1A 4PHCA 1W4ZA 2WQ6A 1J25A 5BN5A 2QL7A 4J4HA 3MINB 5IYQA 2YMQA 1QP0A 4UULA 1WDLA 4IO0A 4EUEA 1N05A 4UDYX 4FDLA 1RLIA 3Q3GE 3QTBA 4US1R 2HRCA 3D81A 3OPYB 4KAAA 4PFKA 1VIYA 1JQLB 4N7BA 4RS4A 1FYXA 4HQKA 1VQOB 1IJKA 4CTJA 3LCUA 1BE8A 4DV6B 5LWQA 5CT4A 3H3XA 3HUUA 4U7FA 1QH0A 3WADA 4MCIA 4GWGA 5JALA 1IQPA 5HIIA 1IDN1 5H68A 4JUCA 1D5WA 3RC2A 4DDKA 5IYZF 4HBZA 4OPMA 1U3TA 1PKVA 4BX2A 5IJZA 1POXA 1AV6A 4JI3B 3S2EA 2JLAA 3QPBA 4V0OA 1AGPA 2CZQA 2A67A 3U3DA 1JSCA 2GYYA 5ICFA 1T6YA 2R7LA 3SXUB 4LSMA 2J30A 3TW0A 2J31A 2D1SA 3I6QA 4JMPA 3ZUPA 3DB2A 4TTPA 4FDVA 4HF7A 3OLCX 4MJ7A 4XYGA 2W2OA 3M5WA 3SX0A 1J7JA 1CUUA 3ZIUA 2GETA 1ZITA 2B8EA 4HNQA 4BV2A 1UANA 2W00A 3A8JA 1PS8A 3BZUA 5B1EA 1IN6A 3CSSA 1Q1QA 3Q9NA 3RS9A 1WOOA 1FY2A 4E2YA 7AT1A 2HDNB 5TF0A 2D0OB 1XCOA 1ZNQO 4KMOA 4YCBA 1KK1A 3Q6NA 4H31A 5THKA 3ZH9B 2ASVA 1ISGA 4C08A 1IXZA 3EDMA 5JS7A 4OMUA 2H2DA 2CLEB 5A0VA 1U5BB 3O7WA 1Y7LA 2LUOA 2H5EA 1M34B 4LHSA 1E1KA 2ODEA 3SEFA 5JAOA 1MJHA 1XRJA 1U2PA 3NGXA 1AUXA 3N58A 4RM0A 2RH9B 5F4BA 2NUTA 3RHSA 3U80A 1ZK3A 3PS9A 3O1JC 1L5RA 1UXOA 2A9RA 2ZVQX 1F0KA 3P94A 3C3KA 2NT4A 3DMNA 2X0EA 4LNUB 1EVZA 4TT3A 1UF9A 1A04A 2HY7A 4M7OA 5HF9A 1KZ7B 3X1ZA 3RANA 1V37A 3IXMA 4AVZA 3HI6A 1GR1A 2DUJA 5CYOA 4JI2B 1ACJA 1E2DA 1MJGA 3QFRA 4HAIA 1C7IA 4R7GA 3U9SA 4YJFA 4EIWA 3T51B 2ORWA 3WL8A 1EUCB 2A1TR 1QS0B 2CFTA 1R74A 1B6GA 3LP8A 3QQPA 4A36A 2O8CA 3CUYA 3W5CA 4KVZA 1GAJA 3LLMA 3STWA 1JYSA 2AW5A 3ANLA 1TQ8A 1QX3A 2GN1A 5C1IA 2QJRA 2HCFA 3RUFA 2IW1A 2Z6VA 2FCRA 3FFBA 4XPIB 4NNOA 5CA1B 5KTNA 2PA3A 5LMUB 1UK9A 1W0JA 1FU8A 3OBIA 2PCJA 3OZFA 4G56A 5H0IA 5SYMA 1Z12A 2G9QA 2Q5FA 3WYGA 2VZEA 1IXYA 3LNNA 4J9UE 5H59A 4YUVA 4DRYA 3QEKA 2XH8A 3BQMB 5EUMA 4AF8A 3SSAA 2C2KA 2CXUA 2OQVA 1IAQA 2P8JA 1QVWA 1K2VN 1V8PA 2TMGA 3VJKA 4UE6A 1P4JA 3QFCA 1VG1A 5EKTA 4KCGA 1BWQA 1L4FA 2C7GA 2WPDA 4LBZA 4LMBA 4LJKA 4KXNA 1RJWA 5HTKA 3VU1A 4ER5A 4TZKA 3TKAA 1DXOA 1Z8HA 1TVKB 3H2IA 2JFGA 1I0ZA 2HF8A 1NN5A 3L9WA 4AJLA 2A1IA 3I9V1 3T3EA 2DX7A 3TLBA 3V4PB 4AK9A 1T6XA 1BYIA 1CLUA 1NQVA 3HSYA 2WJPA 4M99A 5T67A 3SP1A 3VR2A 1W7AA 1UINA 2W2MA 4LJ4A 3FDFA 1ORHA 4G65A 4LBYA 1EAMA 1ZSVA 4IZOA 4UARA 4WDQA 5C52B 1C1XA 1PQWA 3LA6A 4FE3A 4KRGA 4YT5A 4RHYA 4EB8A 2ZJ3A 1QHFA 4Q1DA 5K9ZA 1V1RB 3R7BA 3OOWA 4HH0A 1TA9A 3TLEA 4ACAA 1K3TA 1LQ2A 1MO2A 1ZGAA 2DT5A 2WMNB 4MYRA 4B6PA 1LGYA 1YRBA 2J3IA 3G2MA 4BKUA 3I62A 3O4VA 4JK3A 5J1SB 3KHKA 1GAQA 2CLCX 4HGOA 1JIXA 1BS9A 3I3SR 4AY4A 2C07A 1T9HA 3NP9A 1X9HA 3V1MA 1SG9A 3X1YA 2WV7A 1VE5A 2JZOA 1LXCA 2ZIWB 1E9CA 3HFGA 2Y2VA 3NZEA 2GJSA 1G3QA 3NYRA 4G5QA 2GNPA 4OHMA 5D84A 4ZAGA 3TKLA 4EFDA 4TV9F 2GJAA 2OQRA 2AR0A 1A1SA 1TZCA 5KNBH 3GA0A 3SVZA 2JGEA 1TXGA 3G2QA 3HR8A 1E63A 3BD6A 2QRVB 3O2JA 4DNRB 4BUCA 5ENDA 1U2DC 2J3KA 2K6GA 3ZZMA 4A9AA 2IUYA 3B1YA 1EVKA 1CKEA 1OZFA 3NRJA 2IX3A 5A6SA 1UXIA 4AMVA 4QAQA 3E22A 3QHQA 4G0ZA 2YY6A 3SHWA 1PL6A 2EEPA 1WPXA 2GILA 2PWBA 1JFFA 4B6GA 2XWQA 1CC1S 3OJCA 3ZHRA 4CU2A 4ZV9A 4F2PA 1UADA 4I1RA 5AW9A 1S3SA 1PT8A 1J8DA 1ZXBA 3WDSA 2JJ2A 1MDFA 2O7QA 1BC5A 3AXSA 4E7OA 5KOJA 2D1TA 3BIFA 4Q12A 3ER9A 4D98A 3PRJA 2C2XA 4AAYA 4TYMA 5I9IA 2ZDQA 3K2IA 2PUDA 1AKRA 1M1YE 1WHTB 2F17A 3FRIA 5KAMA 1G8JA 4GS5A 1SELA 4MW0A 4CF3A 1Q7EA 2W9XA 3LPCA 5B6JA 1JHDA 2CBXA 3I58A 3M83A 5NULA 3RUAA 3TJZA 3WWCA 5KDDA 4I9HA 2V31A 2E4ZA 4FSHA 2Q7OE 4Z51A 3E84A 1PYDA 2KYRA 3PU6A 1F17A 4GE3A 4WESA 2OHFA 3RUPA 4DLBA 3MZ0A 1NRXA 3QPWA 2ZULA 4MEBA 3WIUA 4CMGA 1VGQA 5KPJA 1I6KA 1AZLA 1SA0B 3EXEB 4EZEA 1GD1O 2DJ5A 1R16A 3F3YA 2ZEJA 2IXBA 4NV1A 2XSZA 1S02A 2H3HA 3AVPA 3FKJA 1U63A 2BEWB 3RJZA 3A4LA 1AD2A 4JQYA 1QVGB 1FC0A 4N0QA 3UMMA 5EFZA 5TMPA 3VI4B 3EAFA 1RD4A 3KJNA 1U7WA 4HGPA 3WWDA 2OYNA 1CEEA 1USIA 2XWJI 2YCBA 3BGIA 3NBZC 3PPWA 3PSHA 5EIBD 3TOXA 2YUIA 1NZJA 2VXYA 1ISFA 4EDFA 1ZPDA 4BYGA 5FOSA 3VYTB 4MGKR 5DMXA 1UEIA 2GT1A 3M89A 3Q0IA 1T2NA 1L7XA 1PL0A 1DJLA 5EXEA 3VZBA 1F0YA 3HO8A 3V7AA 2ZIEA 2QTRA 1CIVA 1N07A 5LP6C 2JLZA 1J7KA 2W6ID 3SEJA 5AM5A 4BQEA 2QR2A 4YAGA 2ZJ0A 4M7PA 2O8BB 1VQ1A 4MVJF 3OFVA 3A2KA 5JLAA 1SQ6A 2Q5CA 4DSZA 4LYJA 2FUNB 3HHPA 3RBAA 1RAIA 1YVUA 1FW6A 1TTHA 4JJZA 3SC2B 4DWWA 5B7QA 1DKUA 1VHLA 2BFOA 2RGXA 5H1YA 4BJ6A 3DZ8A 3GCGA 5K45A 2WIDA 3H97A 3LT1A 2ISCA 4MV3A 5EWJA 5CA0F 1YJXA 1M6WA 2XYVA 2HQRA 1C29B 1GCGA 2XV1A 2FETA 1KYYA 3M9XA 4ND5A 1W5AA 2RHHA 4WT7A 5CLQA 3L7JA 4YCMA 1GPH1 4LHVA 4EMBA 1QANA 4NMWA 1RIFA 1U0BB 2H7VA 3VAYA 1VL8A 6NULA 3CTPA 4HQOA 2R87A 1AURA 4NXMB 3GARA 2EBHX 3G1WA 3WB9A 1GNLA 4UM7A 1G2PA 5JXJA 4MB6A 3UANA 3PITA 2VNKA 5I7RA 2Q3JA 2DUWA 3WIEA 2JZCA 4Z1MA 3DJFA 1UDBA 4PYOA 1PEAA 2HPVA 1L4UA 3GJ6A 5TS3A 1RXCA 1ZDMA 4FOPA 1Z0KA 2I99A 4EG3A 4AZTA 2QU7A 2VN8A 9LDTA 4G5HA 3THXB 4P81A 5KSPA 5KNLA 1QPZA 3ASRA 1WEKA 2ZAIA 3GGJA 3ZWCA 3GIDA 5TE9A 3KD2A 3MXTA 1QV9A 1AT1A 2HUPA 2JGDA 4K9QA 3GG9A 1U8CB 2IYFA 3UF0A 4XM1A 5AW5A 3Q87B 4H7DA 1WMSA 1BCRA 2ZIVB 2F62A 1QHHA 2AC2A 2J7PD 2BI4A 2EAUA 2Q8NA 3CZ9A 3PQ3A 3BK1A 4IEEA 5JQGF 4QFDA 5DPMA 2OZKA 5I9SA 2JIDA 1GN9A 2NQ2C 3ZC3A 5JZMA 5CLLA 2Y1EA 4LZLA 1GTL1 1F20A 1MORA 4BZPA 3AHEA 2NXWA 3R6WA 4JVMA 3GVPA 1S01A 5B7NA 1E1YA 2VUSA 1G98A 5JFGA 4I6JA 4DLTA 2BGGA 2B1GA 3QIVA 1CZLA 4MA5A 4HE5A 2NSHA 4ZANA 2CHVA 4RWZA 2B9EA 4I2NA 3RPEA 1RZVA 4TKOB 2H8KA 2BC9A 1XQWA 2YHSA 3LW8A 3PIRA 3UG6A 4PQFA 1PZFA 5A7GA 1RXEA 2H07A 3D8NA 3KKNA 5C5IA 2VSOA 4RQBA 4LE1A 3AP3A 3UXYA 2UUAB 1CETA 1CEXA 1GKLA 3G0HA 3K5WA 3P19A 3G88A 1KJWA 1XTUA 1IU9A 1I3MA 2QSJA 3RJTA 2VPQA 3NIWA 4XIJA 4IEIA 2X2FA 4JY7A 4LY0A 1KMCA 4OXYA 1EP2B 2PL9A 3F47A 5E8RA 2Z6UA 3RS3A 4MQ5A 4K9NA 3IESA 4MWTA 4B6EA 2DWOA 5FUBA 1G3MA 1H4QA 2BI7A 1E5LA 2Y9PB 4QJIA 4B3DA 5BMVF 4MB2A 3VOSA 1GQRA 3AR8A 1UK7A 2JBAA 3WWZA 3IOMA 4M1MA 5H70A 2G82A 2QUKA 3DTVA 5HKKD 2AT1A 2PT5A 3V8EA 3SVLA 3CC7B 1Y8RA 3VFDA 4EARA 3C1UA 2R6DA 4PPFA 3GZNA 1HURA 3OX4A 4I1OA 1X1DA 3E15A 5LUBA 4HGRA 3KQSA 1UL1X 2E48A 4ARIA 4OQDA 2IP1A 3SE0A 4B46A 2LVBA 3URMA 2W42A 2BFCB 2VJAA 3OFJA 2FMKA 3QBDA 1SN7A 2F2TA 3M7IA 4QRHA 4MUXA 3TZ6A 5AI0A 4CEHA 2OK7A 2MYNA 4R5HA 3TXXA 4BFCA 1QXSA 1JUDA 5AVYA 4HB4A 1Y1KE 3GRYA 4J1TC 4CG2A 2C84A 3SWWA 5EOVA 3Q40A 5K0LA 4S0XA 2CLSA 3DMPA 2Q5OA 3SN6A 1RQ7A 3M6VA 1IZYA 2X2PA 4K9RA 5HCNA 5TARA 2NTEA 3L1HA 5DM2A 4PLVA 3DOJA 1JKIA 1NNSA 4LJAA 3GVJA 4Q3CA 5F4ZA 3UFBA 2ZIAA 5A03A 1OXUA 2I65A 3P1JA 3SDZA 1V25A 4LDNA 2QVZX 2YFKA 3NHWA 3QW2A 3AOGA 2HLNA 4DC0A 3QX9A 4G8CA 4QVGA 4Y6GB 3IP9A 2ZB3A 2OD2A 4TQ9A 4RNDB 4URZR 2ON6A 4DUPA 1CJVC 5FF9A 2SKDA 3INRA 5BRJA 1JAYA 3OZWA 2JIPA 4PM4A 2W2PA 3JQDA 4XWTA 2ZIFA 2C20A 4ZQIA 4TYWA 4JR2A 3M34A 1INLA 1DAPA 1YJ9B 3CIOA 5CLIA 3RYHA 3MMXA 4G2TA 5DFAA 5JDIA 1WU8A 3ITDA 4ZMBA 4R9VA 1KS2A 3FTQA 3GV0A 4M22A 2AI1A 5AVRA 2HMVA 1E7RA 821PA 3UMRA 4XWYA 3TAHA 1QSGA 3FMVA 3GXBA 4RXTA 1I7QB 1G20B 2JRLA 1F4PA 2O7RA 2RK3A 4LYYA 4MRPA 5JJCA 2RGRA 1DIRA 3PQ4A 1CUJA 3INNA 2IIVA 1HGXA 4QHSA 4UE3S 1GDDA 1I4LD 3ICCA 3R7WA 1MO3A 4DCCA 4DCPA 1THTA 4ITRC 4L2IB 4MUMA 1HLGA 4N12A 3Q7QA 4L57A 3INGA 3QKTA 4PZCA 1YHNA 2ZDGA 3BREA 2Z04A 3AL2A 2UU9B 1TMYA 4NZNA 4M49A 4PRYA 1Q0TA 1QGUA 4LG1A 4WLOA 4H1VA 3WNBA 2X3YA 3D2CA 4A2QA 4QVAA 2OHHA 1WKBA 1SBQA 3KJEA 1NC1A 2QR5A 5KMGA 4M53A 1JKFA 4HPJB 3OP1A 5EHQA 4BB0A 4AF6A 2R00A 4KQ9A 4EG6A 1J1ZA 1RWNA 1DCMA 2QY9A 3RC9A 1CX9B 2H1CA 1JQAA 4AMYA 1XNGA 3A0UA 2HK6A 2C9YA 1EJ0A 4P6YA 1YB1A 3DL4A 5KHLB 1PX0A 1HL7A 2DQSA 1G8HA 4HDRB 3RYFA 4ECAA 3OJLA 3DS8A 4M8IA 4D4GA 3CP2A 4HYYA 4O8CA 2GA8A 2QRJA 1XQ1A 3IVXA 4IHJB 4KGZA 3GEGA 4OHPA 4ZVSA 3PQ6A 3THOA 4EI8A 5IFLA 1NC3A 3V1LA 1EE9A 2VDKB 1XAJA 2I33A 2WK1A 5H4GA 5J58A 4W5QA 4KN8A 1VCHA 4TV8F 1RXYA 4B3BA 1TA4A 1VBNA 1W8IA 3T95A 4C3OB 4LGYA 2YOFA 3GFBA 3Q7SA 1HZZC 2Z8ZA 3SS8A 1L4GA 3UW1A 5J9FA 2JFWA 4CM9D 4ZYYA 5JCZA 4YREA 1CVRA 2FZEA 1Q21A 4Z4RA 1I3KA 4MRSA 4MRVA 4DR6B 4E2ZA 3MJFA 3V5NA 3GLHE 1KC8D 2V7QD 4XWWA 4B84A 2F8TA 1XK7A 4OJKA 4HN2A 2CVHA 2ZJFA 5G1NA 2QUZA 3QKIA 4OM7A 2Q7XA 3DVAA 1AKVA 1KR2A 3KR2A 4NCHA 4PY2A 1KYZA 4XLLA 4XXHA 5IJ0B 5K99A 4Y1EA 2DQZA 1KAOA 4NBRA 1FP2A 2BJVA 3GFGA 4WBNB 2EBUA 2Z57A 3OOYA 4MS3B 4NJMA 1A71A 2CV1A 2GX6A 3LOPA 4ZRNA 1BLIA 1YDGA 4URWR 4J16C 4MTCA 4XI9A 4DLVA 1ZJWA 4C78A 3TZHA 3ZDCA 1SXHA 1D2HA 1ZCBA 2Z8XA 1NW7A 4P4SB 1OLSB 4LXXA 1FDTA 4O63O 3CLVA 3RCBA 1WVGA 1E3WB 1NJ6A 2ZRBA 1YJBA 4PO3X 4UOQA 3RS2A 3UMBA 3X1JA 4LZAA 3MB8A 4MVJM 4ER0A 2NUPA 3UAZA 1N6KA 4GLJA 3L2OB 2BI8A 3VPXA 4C7MA 3FD8A 4NAVA 1PP4A 2AX4A 1WD7A 2QS9A 3TTVA 1XQ9A 2ZTNA 2KJQA 2E49A 2V7BA 3TBKA 5LNK6 4P5DA 4ZO7A 4BKQA 1GPMA 4A03A 4BO2A 2XQIA 2VJOA 3UXEA 2PH1A 2Q2WA 3BD9A 5GINE 1GRNA 1R6TA 1IOVA 3UMYA 1BMFD 3PQ5A 2HRQA 1Y4SA 2D0PB 1UFVA 3AP2A 3KTDA 5G3ZA 4AICA 5C18A 3LV8A 4FC7A 1QG4A 4DGSA 2WABA 1E6WA 3MAJA 4G0PA 4Q1CA 1DJOA 1V6AA 4UU7A 3SSNA 3AM5A 3LCCA 2I2CA 3VO8A 1KI7A 1DZ3A 4MW2A 3TUZC 3V4FA 4RY0A 2PBRA 4RHEA 1XP5A 3MD9A 3ZNNA 1OH8A 4LXYA 4B7CA 1EKXA 1BGXT 1PTJA 1FS5A 1E9VA 2PIDA 4YFYA 1VKNA 1N6PA 4YC7A 1K97A 2Q45A 1RM3A 3NMUF 4ZDKA 2G5TA 3LP5A 2WZQA 4N54A 4OM8A 2G17A 3ETNA 3C16C 3MWKA 3RBZA 4HNVA 2JAPA 1YQEA 3AR2A 4AQ7A 4XB1A 2ZBEA 2P90A 4JT4A 4M36A 4P53A 4PLWA 4DA4A 5CVJA 3KUKA 1GYRA 1G8SA 1H2FA 2FFJA 2RHGB 4FC6A 1LA2A 4PHTA 4XH9B 3P2IA 3EF1A 1A9RA 5DEIA 2CJWB 3QV2A 3DFKA 4IXDA 4BLUA 3PX7A 4YJ2A 3D43A 1SXIA 3R0ZA 4IDCA 4RF3A 3D8SA 2COUA 2EIXA 2CE7A 2WJHA 5AHOA 4XVCA 2Z6AA 2QTTA 2JD1A 5BQPA 3UGTA 2GI4A 1I80A 5A9SA 2CYBA 4Q3DA 4NBNA 1QP7A 2OHXA 2GYUA 1T43A 1GTMA 2YMPA 1E66A 1YBFA 4EB6B 3DEZA 2P2GA 2QXTA 3V1TC 1BOFA 1EFRD 3BX1A 4N6GA 2XCSB 2ZT8A 1XWIA 3EGCA 1K88A 4H7JA 1QUEA 1JHYA 3HXTA 3UGJA 1KEUA 1YDEA 1UZLA 2PZFA 3HSSA 5EHGA 3JR3A 8AT1A 4Q4AA 1RMQA 3OCZA 3RVJA 1V4VA 3VNUA 1ZMBA 3CN7A 3Q41A 3Q2OA 1T6NA 1GNRA 1SB9A 3A4IA 1Y98A 1YQUA 4MYDA 2VWQA 2ZI7A 3A3PA 4IJMA 3OFNA 2Q5JA 2LXNA 5EJGA 2NSLA 3OICA 5FL7D 3G4SB 1QLWA 2JI7A 1NBEA 1UAYA 3I01A 2WKPA 5B3AA 1IJEA 3RG8A 4F4IA 5KC8A 4HXEB 2C2MA 2CNBA 2Q3MA 4J0JA 4MKXA 5JXIA 3QM1A 4PTYA 3KHUA 3U4HA 5DTJA 1K7CA 2PKEA 3UPTA 3PUMA 2X4GA 2YASA 4TQAA 3IPLA 3SDSA 2AJ8A 3IDZA 4YIHA 5GONF 2F3SA 3WIDA 1UBKS 3Q5DA 4KWCA 4RZHA 1C7EA 1IHOA 5HFJA 5BR7A 1W25A 3A26A 1SQGA 4UTVA 5EJEA 1E18A 1E9RA 1I5OA 1Z6QA 4CCYB 3SY8A 1RAGA 3Q0TA 3C5EA 1MOQA 4IJKA 3O95A 4LI3X 2H4ZA 4MTLA 4OQXA 2NPOA 4U4AA 2DVMA 4RZUA 3ZE7A 1MB4A 3LBYA 5FADA 2VTDA 4A15A 4NDZA 1C8LA 2NZVG 3CPHA 5JAZA 3EVZA 2X1HA 3UJHA 4TSFA 3ZS9A 2BMWA 3G89A 5IT0A 3DKPA 4EITA 1ZN9A 1WG8A 3VDMA 2BMVA 3CG4A 2YV3A 2GPWA 1Y6QA 1JFTA 3BH0A 4FN5A 1BE0A 3OIDA 4AMUA 2C98A 2W6CX 4OI1A 2EKPA 2J0UB 4JUAA 2JZNA 5FB3A 4CV0A 5D1NA 4ZKDA 4ZCIA 2R7AA 1NNI1 1G7SA 3MT7A 3M4JA 2V7TA 1KU0A 4GWKA 4N03A 2BUCA 2PKRA 4YCCA 2QN9A 4PWZA 2J0SA 1RXUA 1GUZA 3IBSA 3NOQA 4LQ4A 1KHTA 2CK3A 2J3DA 4TS4A 3UOWA 3FVTA 3I8XA 2AEMA 4G63A 3RT1A 5BMOA 2Z2JA 5JZ9A 4IIXA 3CKKA 1J49A 4AF7A 4AN1A 3QMWA 2I2XB 2OLKA 4LYFA 1N1EA 2IY8A 1NTOA 1LUAA 4MEAA 3ZZ1A 4RCYA 3KPUA 4O1MA 5EUQB 3OZTA 4R0NA 2NPFA 4WPGA 3ZLJA 4OK3A 4B71A 2GKGA 1FSZA 4WVFA 1WTHD 1C0KA 2HEIA 2X22A 3R5SA 1FK8A 4KLZA 5FOWA 4D8UA 4S1WA 4BTLA 1T5IA 3FE2A 2F9MA 3AFMA 5DOZA 4K9OA 1TRKA 5EE5B 3UG7A 4R98A 3UMCA 1A5AB 1HYHA 2AZDA 3HYTA 4GLLA 3BMOB 5L3ZA 3TXAA 1SHZA 3VR5A 2YWXA 4L22A 5CK5A 4C01A 2UXBB 1D07A 5JJKA 4LVNA 1K28D 3QSYA 1O94A 4ZREA 2OCAA 2C2ZA 4GSYA 3ABIA 1L3IA 3JD2A 3DVLA 1BOOA 4Q34A 3OY7A 5E6SB 2IKSA 5EYPB 1W6UA 3EWAA 3IP8A 3UYKA 2Z43A 3IEPA 3R23A 2Q7DA 1JHZA 4DPMA 2F1LA 4D4HA 4JGBA 3TIGA 1UD2A 4FOTA 2NV0A 3U9TA 1PEKE 3L92A 1R0WA 2RBEA 3GHYA 3PGLA 4GI7A 3GRCA 5I7UA 3L1JA 4HLQB 1KZ9A 1PDWA 3EBPA 4NYMR 2OUIA 2G76A 2YOGA 4D97A 3UBTA 2R1VA 4ZTUB 1RKBA 1Z8DA 4Q1VA 5E95A 2QD1A 5TXGA 3TI9A 2QLBA 4TL6A 4PNZA 4BVAA 5JNVA 5AOBA 2AW3A 4V3CA 4DMRA 1OY1A 2BFEA 4YRBA 1GXSB 2ZPUA 3F98A 4MVJD 3BZBA 5KU7A 2AE2A 5ER6A 1FYVA 1ZU4A 4HCJA 4FEEA 5CBKA 1YXMA 3JY6A 2O2EA 2YJ6A 2OYSA 3KFVA 3R5FA 2P27A 1CUZA 1ZGHA 3AF1A 2HCRA 1C0IA 1E59A 4KDRA 4PRZA 1AK9A 4W9MC 4RACA 3F7OA 2WM9B 4B82A 1UFKA 2ANCA 5FPKA 3L4BC 1Q3HA 3EZ6A 3MJDA 3ZJ4A 2JW5A 3RQSA 3B20A 3PC8A 4N8EA 4B3GA 4ETIA 5KKAA 1P9WA 5EVJA 1Z4QA 1JIQA 2FPLA 3C8MA 3HJTA 4BY9E 1WV1A 4RIIA 3Q9SA 2DLNA 5CU7A 1D5CA 4YDSA 2ZRFA 2OG2A 3CURA 3X44A 5B64A 3TJRA 1U2QA 2DFTA 2EWWA 1T1SA 3E5NA 4ID3A 2BF7A 4W7IA 3RBXA 1FNDA 1XHEA 4H3HB 2HJGA 1CSEE 5J2TB 1FZQA 1N0WA 3RKSA 4K6KA 4PCLA 1NUAA 1P7YA 4JBXA 1XYVA 2YWBA 4HFMA 4UTPA 5FTMA 1XEFA 1TUBA 2ZIUB 4Q4DA 2FV8A 4OAQA 1UDWA 5JWRA 5HHTA 3SZUA 4WKBA 3P2MA 3HR4A 3ROTA 1OYOA 3OTHA 3RVSA 4FB4A 4CL2A 3SZLA 1XEXB 3HA5A 1E3XA 2WEKA 4L15A 1N4DA 2ZSAA 1EX1A 4M83A 3R7NA 4E07A 4BFYA 2E37A 2OXFA 1J97A 5E2IA 1ZJJA 4EA9A 3LDUA 5CW2A 3AHJA 1S2GA 5ICGA 5B1IA 1SBNE 3B53X 4UZSA 3CH6A 4TTAA 5DGHA 3CMEB 2JA2A 1N2CB 1W4AA 1KS9A 1OAOA 1ECBA 1QTIA 2VNAA 2ZTHA 5F4OA 5DNDA 3SVTA 4L73A 1FRQA 2AD1A 1LLDA 1R6BX 3G59A 4OCZA 2JFXA 3FPJA 4TXNA 4YONB 4U0KA 4UDOA 2BKLA 2C3PA 4BO9A 2O9JA 3R0IA 4XORA 2CJYA 5DBOA 2B1JA 3QENA 4XFKA 2CV2A 1T3GA 3A1PA 2BGLA 1GYPA 5H83A 2GLTA 3ISJA 3KEMA 1IXSB 4EKEA 5CGZA 1TRHA 2FF5A 3KUCA 1RDFA 1IUNA 4NBLA 5E6RB 1Z0DA 2Y05A 2XNDA 1DKOA 2EJVA 1UC9A 3SLKA 5B53A 5E7QA 1YK1A 4ARCA 3PC4A 3L7MA 4HQ0A 4CHTA 1YB4A 4OXRA 4ETMA 5KNDH 1H6BA 3J81k 1PX2A 1U1EA 2WMDA 2ZAGA 5EIWA 3RTAA 4C14A 4HDMA 5BQXA 1WXXA 2PMEA 5I4BA 3GYGA 2D1FA 1WXWA 2UZAA 3I0ZA 3MGGA 2EFGA 2GUWA 4FGSA 1BPLA 3N87A 2BRUC 4Z9YA 2AG1A 2YVKA 1VQ7B 5BQ5A 1XB2A 2Y1KA 2Z4RA 3BB4A 3EG9A 4D0NA 4LRYA 3ZY6A 3W2GA 3GGGA 4MGZR 3K1TA 2P75A 5CYFA 2PNFA 1NYLA 3IO5A 3RE1A 3VNQA 3B13B 4QLBA 3FR7A 3KEFA 1XDWA 3KQTA 2BKVA 4QBHA 1X7YB 4Z99A 3N8DA 4DLZA 1IK6A 1AGRA 4M1OA 3R7AA 3LFHA 1X1EA 3NVAA 1ZD9A 1Q7GA 3NCHA 1AUPA 4IV5A 1RC0A 2QPLA 3L93A 3HCPA 3A4VA 4KXFB 5F21A 4REQB 4WA8A 4BASA 1YCFA 2PZMA 3B89A 1GT91 2YXNA 1LDYA 3DBRA 3H5NA 3RC7A 3HJGA 1Z5OA 3EOAI 3H99A 2BHRA 5AJTA 3LUGA 4YRAA 5FH9A 1NVVR 1QC5A 1ZA1A 2R6AA 1JX6A 2NGRA 5DYGA 1K5DA 1KQOA 1MFPA 1ZL2A 2EWVA 2ZLBA 3PHLA 4J0CA 4QBIA 4ZALA 1R64A 5GOZA 3TSCA 3D0KA 1OGIA 1IMJA 3RVPA 3BWDD 3L1IA 4DWJA 4R2JA 4UTZA 3WYNA 5C31A 4MR8B 3W5UA 4A6PA 3D3WB 4Z0TA 1R0ZA 2YJZA 3DBOB 4KPGA 3M1YA 1NMYA 2O7NA 3UJNA 2E82A 3ESAA 3M1AA 4L8JA 4IWXA 2B4RO 1VF7A 1CF2O 1YRWA 4ZQGA 4MPRA 4W5WA 3H6GA 1KSHA 4DDWA 1Z6PA 2ZVJA 4UXIA 3HMKA 1F6DA 1VB3A 1FP1D 2B69A 2GB4A 2OHIA 1Z62A 2IPLA 3DLTA 2XYQA 1EMDA 1P7ZA 1R3DA 2PZBA 3GQBA 1QHXA 3FHJA 4Z49A 1XZMA 3EDOA 3H17A 2PRIA 1U90A 3QBEA 1KDYA 3FSRA 5JVDB 4ZYXA 4ZT2A 2QP3A 3LSTA 1X0VA 1NVWQ 1VQLB 1HBJA 1QKKA 2CMHA 5IHPA 3HKCA 1KMQA 1PJ7A 1G18A 4JUIA 3VSBA 2G7ZA 2XXAA 4AYTA 5JS2A 3STXA 4N0PA 4S24A 1QU2A 2O2YA 3NQ41 2WVGA 1GKIA 2X77A 3O8OB 3UPDA 4TYPA 5FYDA 3HM9A 2D00A 4PYLA 3HJCA 1S89A 1T0IA 1PFWA 1VBMA 4Y67A 4YDRA 3REOA 4B85A 4IFIA 1DHTA 5LP6F 2XVZA 1X8KA 3NPAA 1EHCA 3DDYA 2P6PA 4F6CA 3EEBA 3DLCA 4QXOA 1YQTA 2FMXA 2MMGA 2A4MA 2COEA 4X7PA 4HGZA 3WLPA 1Z18A 1R9GA 2P2LA 3C3DA 3DLAA 4MRRA 1SURA 2O2DA 2FN4A 4NESA 1LK5A 1L5WA 3K9HA 4OSOA 1T36A 4RCVA 2J32A 4YMWA 3H87A 1REQB 1QE3A 5IT9A 2ZCUA 5A4AA 1FU7A 2BFBB 4X5OA 1D2RA 1XMXA 5CXXA 1ZOIA 2I1VB 2QLNA 3DMHA 1THGA 3VTZA 1MABA 2CHFA 2XTAA 2IY7A 4J7XA 1S3GA 5K8VA 2IYPA 3B7GA 1W30A 1N9ZA 2NYRA 4KXUA 1JB1A 3FVVA 2P9TA 1AMOA 4EB3A 4RDJA 2WJJA 3P7MA 3FTNA 1Z5VA 4BNTA 1Y4ZA 2ZT5A 3K1ZA 3FHLA 4ONEA 4PG6A 2FAXA 4REMA 2GXAA 3AFGA 3SMVA 3I32A 4ED9A 4FS8A 3UWOA 2HA5A 1EBFA 1KIFA 1KR5A 4UKDA 2PWYA 3RWMB 1E0JA 2CBZA 1TD1A 1H5NA 3AW9A 1MPTA 3O4GA 5IKPA 4DR2B 5AVUA 2YW9A 4OATA 3WI7A 3CXCB 2C5EA 1XQVA 1D0VA 2CC2A 4HNAA 4RMGA 3H1BA 1U1CA 1X1RA 2Y4NA 4NABA 1TADA 1MIHA 2JL1A 4PXYA 9GPBA 1BN6A 4EG1A 3LECA 2VP5A 3IRVA 2C99A 2J6HA 2WIKA 1O87A 1GPJA 3V4SA 3FPSA 3HCBA 4G4GA 5ARDA 4OF4A 5T64A 4QJ4A 1SO8A 1OA1A 1MN6A 4PCVA 2A88A 1M0SA 1UWVA 2EHJA 1DO2A 2OO5A 1BD4A 3LXUX 3ZVKA 2V4MA 4JLBA 4BVFA 4YO8A 4XWOA 4IXMA 1CZUA 1E2UA 5IZCC 4IGIA 5EIOA 3PHCA 4WADA 2GTIA 4JC5A 3ZXYA 2ZJ8A 5DLEA 3GPLA 2CNNA 3UNXA 5B1SA 1U11A 3NE5B 2UZ1A 1BA3A 3UATA 1OHHA 4HP8A 3HADA 1P17A 3K9NA 2GK6A 1F4LA 5H5JA 3CLUC 3S2ZA 2QJWA 3B70A 1VECA 2X4LA 1M1NB 4OB6A 1GDTA 4EUSA 3FSEA 1DFHA 2ZANA 4WNIA 4HWTA 1Q84A 2C9MA 3ZVLA 3P9QA 4MW7A 1EHIA 2KM1A 2VYVD 1EP3B 3PNMA 2GJKA 3W79A 4TWAA 4EA8A 2YBDA 4P93A 2KVOA 2NXCA 3NO4A 4JSYA 1FYDA 1X7ZA 4C3UA 4MQ6A 2REQA 5E6UB 2ECOA 2FUG6 1Y1RA 4RD1A 3CC4B 4U7WA 1NVAA 4QTUB 4K3UA 1XFAA 4E30A 2IXAA 3BFJA 5JDCC 2GYWA 3VAAA 1DADA 2NZJA 2A5DA 3R7LA 4BEBA 3FHTA 3O94A 1C9DB 4LSGA 3HDTA 2W6JD 3PUYA 1E3LA 3ZI4A 3LKVA 1X80A 5TDHA 2MJLA 1S4MA 2XE4A 2YXDA 1RLMA 1ZK0A 4WLFA 5E2BA 1T4CB 2DHCA 1SD1A 3SXPA 4Z4CA 2AEEA 1RHJA 2XE8A 3P4UA 4FJ1A 3DZBA 4QUDA 1CP2A 4LV8B 5H3HA 5A3SA 4CKEA 4DUYB 1JJ7A 5CRIA 2E87A 3B12A 1RJDA 4X54A 4DMLA 1F0NA 3TPFA 4ND7A 2WYUA 4WXYB 4QC2A 4DMFA 1XSEA 1YI2B 1B0AA 2ZQZA 5DHSA 2YC2C 1AQJA 2IYTA 4IH9A 1M74A 2UV8A 1XJQA 4P1ZA 4YAIA 1RWKA 3A3BA 2OCBA 2Y0EA 3FVRA 1KOLA 4II3A 3EK2A 3KYDA 1NQOA 4HTFA 4MQ4A 2OHVA 4XLAA 4DJEC 3FOEC 3HEBA 1XNJA 2AOUA 4UE2A 1YASA 4CM6A 1A9YA 1LPPA 1AGNA 2P91A 4JXJA 3U13A 4YAFA 1FA9A 1SCUB 3ZGOA 4E5MA 5AN9A 2CSXA 4KN5A 3E9RA 1RM0A 1VE3A 4GVLA 3LYUA 5C8YF 4GEGA 1ECGA 5AK5A 2WU1A 4CTOA 1XNQB 4DTCA 4WCVA 3ND7A 1HZJA 3NC1C 4KMRA 3T54A 4EVIA 1KETA 4EMSA 1VIMA 5BV2P 3GEIA 1ODIA 4WWHA 4J2HA 1YIJB 1EA5A 4N3CA 1YRQA 5HNKA 2CFCA 2JFBA 2FE1A 3O2SB 4UAUA 5LIPA 2C0QA 1TK3A 3PFKA 4P08A 2ZIGA 3K72B 1VJTA 2MINB 2GAOA 1S1MA 3ELUA 5FPPA 4DLXA 1B73A 3B3AA 4EOGA 4GEKA 3EJ6A 1W5TA 1ZUIA 2WJYA 1JJBA 3GNQA 5A4DA 4NJEB 1CVLA 1Z5WA 3FLMA 1O5TA 2BL4A 3PR2B 4WBNA 2DOGA 3DBLA 1HDCA 3ANTA 3BK7A 2FKNA 4KN6A 4WZLA 2YNMA 3B5IA 1QK4A 2P6OA 3COPA 1AC5A 1GG8A 4QU0A 2CLLB 4O4IA 1KSJA 1RAEA 3V80A 4AN4A 5T8KA 2PMFA 4P3XA 3GLVA 3I92A 4R9RA 4P3OA 5J3JA 1HQDA 1XEWX 3H9BA 4NMMA 4NARA 4TLLB 4WDRA 3DXXA 4GQIA 5CFOA 2QAJA 4QUBA 1KVTA 3MTQA 5F12A 1B6RA 3UVEA 1NUQA 4W1QA 3HB0A 1HH4A 1NR5A 1UBSB 3OOJA 2Y93A 5LWHA 2ZXUA 1YZKA 1YQ9A 1KZLA 3LCRA 1ECFA 1WU7A 2RHJA 3IV9A 4G0YA 1IK4A 5IYNA 2AZMA 1TW3A 2O48X 4HBGA 4N3AA 1BJKA 3N86A 4EABA 3C7AA 1RQXA 1H2WA 4FYWA 4J07A 1KY5A 1KI6A 1ZRHA 4AKEA 4XUGB 3HCAA 4N5MA 3OSUA 1GUAA 2HF2A 2OLJA 3IA2A 4TPKA 5U1PA 3S40A 4Q3KA 3NETA 3RS4A 2WFZA 1NF2A 2FPGA 3GDGA 3H2KA 2VUIB 3HLTA 1NQ5A 2IZZA 3IC5A 4P8RA 4QARA 3B8EA 3KSMA 4MNTA 2SKCA 1O08A 1G8MA 1BYUA 3G8YA 1MQAA 1YFKA 2G08A 3IMKA 3ZHYA 2XRMA 4JXXA 3DEKA 3OT1A 2JEOA 5EPOA 4PYQA 1Y6GA 2EF1A 4XM0A 3RT7A 3AETA 2A7QA 3EIOA 1U9IA 3NC4A 4EHNA 5KTSA 1H0RA 4BNNA 2GHIA 2W2LA 2IF0A 3HV2A 2G5PA 4YH1A 5TNXA 3NI2A 2EX1A 1WBDA 3QVXA 5P8WA 2B98A 1N8RD 2ZQ5A 4PX2A 3TR6A 3MLAA 5HILA 1IYZA 1GNQA 1XDUA 3DAGA 3HNRA 4ZOLA 3TNDA 3UXMA 5EKSA 1E4EB 1UJNA 2UYHA 1WXFA 4C21A 3K4PA 2J07A 3DE3X 3FJ1A 1LW6E 4I50B 1BMTA 2IRWA 4P3KA 2B8WA 4NYJR 1BDJA 1L5ZA 3B2NA 1P7VA 2X9GA 2X0IA 3DMTC 3Q1KA 4A0GA 3B6IA 3M3DA 4R0MA 2MTBA 4HH4A 3OMWA 1UAAA 1X86B 4QXRA 1UM9B 2DUMA 2VF5X 4LJ6A 3ZCUA 1WTCA 1RBMA 5HKOA 4DC1A 1XBTA 4KK3A 2YIMA 3V2HA 4NZOA 2QMHA 2XE7A 4AY3A 4KE8A 4TMFA 1A5SB 1MQSA 4PPGA 3R6TA 1ZD1A 5FNVB 1YULA 5EPEA 3R1IA 1CUEA 1C1DA 2AZ4A 4LQLA 4OHCA 5D5HA 4ZAYA 3ROGA 3RRJA 1UKCA 2I3DA 2YR0A 4WIAA 4EF4A 3VDQA 4NWIA 2LCIA 4OP7A 2G4VA 1J0CA 5K20A 1VE9A 2FPOA 4P7JA 4FDTA 4P4GA 1QWSA 1V47A 2R6FA 5K01A 1ML3A 4ZOQI 1XMOB 4QX6A 5BWCA 5JUWA 2F3PA 1XVVA 3HU1A 2POQX 2AUNA 4QECA 3TN7A 4CHGA 4HX5A 1X7XA 2RJ3A 3VV3A 3LT5A 1W4RA 5ALIA 3AF3A 2LW7A 2QVGA 1P7CA 1A69A 4YDHB 1G3UA 3ON5A 2P3OA 1V16A 4P3PA 1RQPA 4HLUA 3GUZA 4RANA 1XQ6A 3VR4H 4ZHQA 3AUUA 5CB6A 4PLTA 3COWA 1VKRA 4FKMA 1JWBB 4M6WA 3TUJC 5BN5B 2Z3VA 4OBWA 3EZFA 4CUJA 1O97C 1X92A 2JH9A 1XTQA 4WFJA 1LPAB 3LPAA 5CB4A 4DSNA 1UBRS 3R3VA 3IV6A 4XD2A 2FX3A 5DH9A 4YB8A 1S7CA 3QA3E 5LYYA 4RKYA 4D96A 4RC9A 1FFHA 1Z73A 3ZGVA 3ZHVA 5JAHA 1AS2A 1EVQA 4NPHA 1Y0YA 2HO4A 4TL7A 5CLGA 3WV5A 4A8PA 3EGOA 4FILA 4JQSA 4C7BA 3M0EA 2H92A 3KQPA 1YQDA 3HB1A 5BVHA 5K3OA 1A9XB 2O2HA 2QV7A 2UUPA 1CRZA 4FFBA 1EUYA 3PQ2A 1XTRA 4POOA 4PINA 4TRRA 4LHYA 4MSUA 1A2OA 1RJ9A 1Z0AA 1B0PA 2GPYA 2NN3C 3ZY2A 4L5IA 2ZYAA 3KVOA 2AI3A 1PT6A 1JR2A 5EIHA 1MCZA 2VJJA 1VKZA 1YR6A 2V0NA 1E1NA 4ZV4A 1S2NA 2WD9A 3C0KA 3F1LA 3L8CA 3P0EA 4ZPXA 4L75A 1V8FA 1DO0A 4ZQFA 3ZH2A 4AWAA 3HCRA 4EUNA 4GQAA 4PXAA 5AO9A 3ZD8A 1C1YA 3B3QA 3AUFA 2WOOA 4WSOA 1KVRA 1UXGA 4C6TA 1ZOLA 5CM9C 1QG0A 2IYOA 4UQPA 3ZJUA 2H52A 4L51A 3JSXA 2G72A 1ORWA 1GL3A 3T1HB 3JPWA 1B6SA 2I7DA 2ECQA 2XT0A 3SKYA 1FQOA 2VHWA 3QSGA 4QYIA 2JGAA 3S1SA 2R11A 2A0YA 2X4DA 1V3TA 4RLFA 2FF7A 3VKGA 3GBSA 1P1HA 2C1XA 5TJHA 4BNVA 3OJ0A 1CZKA 3KKEA 3U1BA 2NUTB 3FOWA 1TMOA 2R8PA 4ZDIA 4U7PB 2FW7A 4BRZA 4N0EA 5C1BA 2YC4C 2XTMA 4TTIA 2ATVA 3DSRA 4N0DA 4N3BA 3QWAA 3U3JA 3CR7A 5E3HA 1XVLA 1BJRE 5EZQA 1B0UA 3IE0A 5GQSA 4N3GA 1D8AA 4E4RA 1WMDA 2JIZA 3MHPA 1J33A 2ID4A 3AEUA 2B2XA 2WJZB 3A27A 3BB3A 2CXTA 3X3HA 5FI5A 4DLRA 4YJFB 3KLBA 4E5KA 4P0TA 2ZYTX 2D7JA 4KKUA 1F3OA 1B43A 3K35A 4JBWA 3D5EA 1PD1A 3I76A 3LDFA 1OROA 1YR7A 3KHSA 3ORRA 5CH8A 4X61A 5E1DA 6ADHA 2V3CC 4K7JA 1CY8A 4CT5A 4ZYTA 1SFRA 1NRKA 2ZTSA 3PXEA 4EI9A 2MMCA 1EGHA 1AUVA 2H7CA 4WI1A 1EUDA 2FEPA 3ZCQA 5IUJC 4D81A 2O1SA 1IXRC 2ASEA 1E1QD 3A1FA 4OA8A 2J48A 3IDAA 3PL1A 4K1LA 1MV8A 2WA1A 2IT1A 3LIPA 1NBIA 3EGIA 5AVOA 2SCUA 5A5GA 2H2HA 4QGHA 4LK3A 3CGGA 2YQ5A 4OJTA 5DCUA 4MPJA 2CNWD 3E1SA 5K6TA 5J4LA 1LNQA 2JEYA 4OBEA 5DNYB 2HHHB 4J0QA 1KJNA 3TOSA 3PVSA 3DP9A 1ZI6A 4QEZA 4ZEMA 2JHAA 2RAPA 1F5SA 1KL7A 1CR0A 2KB0A 1C1XB 1D6MA 1B7GO 4MA4A 5D3KA 4GMGA 4ZEWA 1T5EA 2YHUA 1PVVA 2Q6TA 8GPBA 1K4KA 2YS6A 3PE4A 2QQEA 4U8HA 4N5DA 4XMYA 4FCVA 3FPGA 3W06A 1LTHR 3FTDA 3Q15C 1Y3FE 4DV4B 1D6SA 4Z4FA 2Q07A 1U2ZA 4IQGA 2MDTA 4NDAA 3LHFA 2DU8A 2O0MA 4INJA 3S2SA 1N0VC 1UKVY 2MOKA 1K68A 1VL1A 2B4QA 4AIRA 3GI1A 1JJ2B 2RGNA 2G9VA 1FFGA 3JALA 3AR7A 1ISIA 1BRMA 3T56B 2WDZA 1BQ3A 2AXPA 2FKAA 3GPCA 3KQMA 3WMRA 1FDRA 3VO2A 1EBUA 1X87A 1FDSA 1ZGCA 2XIJA 3DBHA 3WE7A 2VBSA 3R6JA 5AKIA 1CUHA 2H31A 2YWFA 2PXCA 3COVA 3TSYA 4US0R 5GAJA 4NZMA 1TU0A 1L5MA 2PRSA 2JFQA 3GYBA 3E22B 2XAAA 1F8UA 3C7CB 5CVUA 5C3MA 3PKIA 5DVZA 5JSUA 3RLIA 1JFFB 4DQUA 2PX2A 4MQMA 3V3KA 2IELA 2O06A 2RHMA 3OU2A 4HGNA 1WKVA 4L95C 5T5QA 4DV7B 1RMTA 1KU6A 1MKYA 3A58B 2AC7A 5A89A 1SGWA 1C30A 3PSAA 4FYHA 3ZBQA 2QMZA 3VC7A 4NS1A 5KOJB 2CF4A 4LFCB 5ALQA 4YR9A 3T9FA 1W59A 3EDRA 3IT3A 3QVLA 3R5HA 5HTOA 1HE3A 3DMGA 2WU3A 3PHIA 4L8YA 2PJRA 4D7AA 1XNRB 3K4HA 3IUNA 4D9KA 3F5DA 1JAHA 4OLFA 3DLIA 2WIAA 5KZMB 3CPJB 3KRTA 4GX0A 2PSFA 3CH5A 4HVAA 4A6XA 2R8EA 3MA0A 1TJPB 2WVJA 2JK0A 1Z5ZA 1MXFA 4WESB 1GV0A 2P2SA 1B14A 4O6VA 3EYWA 3UUFA 2GBGA 3I04M 1PGPA 5J59A 4KQHA 1P4GA 1UFOA 3T7RA 2IV3A 4KXLA 3ER6A 3JAMA 1SCNE 1J42A 4YP0A 2GM5A 1V6CA 2IXTA 2P35A 2YV5A 2WJWA 1SKBA 1U0NA 1X19A 5ICSA 4PU0A 1L4HA 1PZNA 2JAXA 1UIMA 1R7RA 2H8GA 2AFIE 1X94A 2VKQA 4IJUA 4XTRA 3MLBA 2QDKA 4W63A 1AV7A 2XEDA 1QYXA 4EFNA 4DV1B 3FFAA 1KI3A 2WF6A 2GPTA 3EMKA 1YK0A 4IOKA 3QNWA 5TT1A 2J4CA 1OZAA 3C70A 3Q1LA 4EG0A 1G66A 1F06A 3C4VA 1P60A 4R2WA 4GR5A 5GIPE 1JNYA 1XE3A 2AFVA 4LUCA 5KYKA 1TO6A 3GLIE 1XK6A 5HG0A 1P3DA 3NLLA 4B6SA 1TMGE 1HE2A 4F21A 4FCWA 3QEMB 3FZNA 2H0RA 2VIIA 2OYCA 4JL5A 4P82A 4R3WA 5KIAA 3PLAE 5E2AA 4E09A 4DMCA 3MG9A 2RHCA 3MMZA 4Z4TA 1I2CA 4NV3A 1FMCA 4XIGS 1DGQA 3PYMA 4OHKA 5K0CA 2FPSA 3G1UA 2OP1A 1PJ2A 4M37A 3O3OB 3ILXA 3TMAA 5CIYA 5EINA 1D2GA 1F7VA 3S2IA 1LJUA 2AI2A 3H5WA 3USES 5JHGB 3SQXA 1AM4D 1JDZA 1T1IA 1O77A 2R7NA 5EWJB 4IDDA 1YA6A 2DXIA 1LBHA 5HKBA 3CQ9A 1E2KA 4ZQBA 3UT5A 2VTBA 1V7CA 3K70D 1UBLS 3N39C 3GAZA 5B3JA 2NUAA 1UD5A 1YCGA 2RGAA 4IUBS 5HUQA 4LZZA 3V46A 3UAGA 2HIMA 1HTTA 2QQ0A 4UTNA 3NBAA 3ZVNA 1R0KA 4EGJA 3GEHA 4Y6PA 2DAPA 4HH3C 3OWXA 2W5UA 3CCFA 4F5DA 1XT6A 3GJZA 1JLKA 2GRUA 2BKAA 3P0JA 1SQSA 2Y68A 5LA6A 4R2IA 3ZHZA 2FSFA 1GPDG 1MOSA 3PA8A 3ASTA 2FPMA 2K5UA 4WXEA 1YRAA 1I2MA 2GN8A 2XDAA 3GXOA 4LZNA 4CMHA 3TFQA 4P0PB 2V6BA 4EQ6A 1R5OA 1WB6A 3ROEA 3ZKAA 3E82A 4DBZA 2GZHA 4EHHA 1MJNA 5CVTA 4JP8A 3T99A 2OZEA 2I66A 4F9TA 2JGDB 2WB4A 1JIUA 3IBTA 1EFAA 2COKA 3MBOA 3ZBPA 1BCRB 1ODFA 3RASA 1T4MA 3H6HA 2Q5EA 3HDJA 2Q3CA 3QF7A 5DYIA 5J47A 3H16A 1QHHB 1DB3A 4DLUA 1HYQA 2QN8A 3AX6A 1ZMOA 1ID8A 5AK0A 5L53A 3JATB 421PA 3FVWA 2IZ5A 1U98A 4D6YA 4GH5A 3CF4A 5EKUA 4QWMA 3FCCA 1EJ6A 4V0QA 2O2ZA 3NCTA 4EY6A 5CA1F 3VGPA 2DFLA 2G7MC 4G8BA 1NVKA 1NNEA 2HLDA 3GIRA 1GITA 5KX5A 2ZWMA 4QDOA 4YYEA 4JJAA 5C4IA 5AXCA 5BW5A 1RT9A 5AJYA 5AKJA 4D74A 4YCJA 5IU6A 1BFDA 2DP4E 1ELOA 1OYWA 4AI6A 3E5MA 3HNPA 1ENOA 3R6DA 3OO1A 1DDGA 3ENWA 3G2KA 4A0QA 2RI1A 4FT4A 3BFXA 4MVJE 4QLOA 3TR0A 3U4DA 1EK6A 2X2EA 3DBIA 2HIAA 3TPZA 3GDHA 3VU8A 2PVCA 1XXHE 1RYDA 3KSZO 1RP1A 3R9IA 2VT2A 1PRYA 2L2QA 5C7LO 1JR3D 5A1JA 4TWZA 2BR4A 3SFVA 4LCBA 4NBKA 3OESA 3RYIB 1WHSA 4OI4A 2PGNA 4HR7A 3KAQA 3FWNA 3B38A 1HUQA 2V1UA 1SCDA 4DIUA 2JBAB 3K0SA 1O7JA 3GX1A 2ZSUA 3INYA 3BCSA 5FT9A 2VF7A 3RLFA 1WSVA 3M6UA 3IDSA 3MXOA 3KAPA 5E7JA 4BEVA 3O8CA 1RI1A 1Y8RB 3I5YA 3LQQA 4KYUA 3CPSA 2HNKA 3GZNB 4D25A 1Y6ZA 1FW8A 1KQFA 3ADKA 2CVQA 2J87A 2WT4A 2FR0A 4XOUA 3TX6A 1WIWA 4G6IA 2HJRA 1N3YA 2V0GA 3BSSA 3O73A 3GP5A 1Q0ZA 1V2HE 1MXHA 4FHZA 4Y6RA 4IVQA 3CZ4A 4Q39A 3W1WA 1Q15A 3ZDYB 4YXFA 1U7UA 3KU4A 5DO9A 4CEHB 3CTMA 4B8ZA 4B8WA 5EQJB 1FMTA 1JSZA 2VJKA 1PUIA 2PT7A 3BPSA 3VMFA 2JA1A 2PVPA 1XTIA 2XF8A 4FMPA 4LVUA 2D2VA 1W9MA 5G53C 2UZ4A 3DV0A 1QQBA 3KEGA 3WNZA 4LE0A 2WY2D 1WPCA 4RNCA 1T8WA 3AFIA 5DGIA 4F60A 1NW9B 1CTQA 2FPIA 4AZ0A 3CVXA 3VNAA 2R6HA 4JUDX 4LA4A 1HDOA 1XCLA 4MK4A 4WY5A 5CNKA 1Z5NA 1QYVA 2PKYX 4QPZA 4LFBB 2RGDA 2D7DA 1N2IA 3G0BA 1E8NA 4B3MB 4R7ZA 1U7HA 1FLVA 1X8JA 2PTHA 4MX8A 3CF0A 2PS1A 5TC4A 2QZ4A 3RV4A 4CKBA 1I4EB 1XL0A 3E58A 2VK2A 1S7GA 2V98A 3KKKA 4K9MA 4UVHA 4OFBA 4Q01A 5GJCA 4CMEC 1QYRA 3RYHB 3BWCA 1TEZA 2IYVA 4CMCA 4RH0A 3JR7A 1WZCA 3VM6A 5DMHA 3IQEA 4OK5A 3A6DA 1CW2B 1VMAA 2ARKA 2O8FB 1PWXA 1TYDE 1DMSA 1D1PA 3MCAA 1HDRA 1KPIA 2RK6A 3LCJA 4TQGA 4YBRA 5FBLB 4JYMA 4UHCA 2X0JA 3R7WB 2MSDB 4GYWA 3WLEA 4ZGWA 5DNUA 2JS7A 4U7DA 1J23A 3BWXA 1A2QA 3X1DA 5JPDA 3LUAA 4RH1A 2CLFB 3IE2A 3NUZA 3MGKA 4P2BA 1GRQA 1NVMB 4F4JA 1M9NA 1O95D 1ZGBA 2O0JA 2M32A 4H27A 4LECA 1QGUB 1PYGA 1U28A 2ERXA 2ZROA 1VSVA 3GEEA 3JV7A 3QXSA 4MUIA 4NYIQ 5KJ6A 3WY9A 2G70A 2WSIA 2ODTX 4G09A 4QTXA 5F1PA 5KMGB 3WA7A 2R96A 2BEUA 3AOEC 2P79A 3IKLA 1Q57A 5K4HA 4MDYA 1CR1A 3DCYA 2ZYHA 1CUIA 1ZHFA 4W5JA 2WJGA 3C3AA 3VISA 4C3ZA 4M87A 4C0KA 1XD2A 2I4OA 3AZOA 1KERA 2DULA 5BO5A 2C29D 4XQ9A 1WCXA 2DWQA 5E4FA 3RYFB 3WAKA 5CJ2A 4URXR 3JZIA 4FMBB 3JQRA 1WCYA 1NI5A 1GZSA 2WFMA 2WV9A 1VI2A 4DZZA 4HJRA 1PFVA 4HWRA 3ANYB 1IWPB 2A86A 3JQAD 3EDCA 1I8TA 1PJTA 4OY3A 1U7XA 3BRQA 1XQXA 1H8HA 4ZVVA 3WGVA 3PWSA 1WLYA 5TV2A 4DQKA 4KSYA 3WSWA 4IMRA 3LQ4A 4TWRA 2J3EA 4LHXA 2OV3A 4Z2YA 4MMZB 1KY2A 5DU2A 2Q6IA 6REQB 1N7JA 1YIAA 3EGVA 2IV2X 1II8A 2QG6A 3W6OA 4G0VA 1QP4A 4YP1A 2RGCA 3DVAB 4UDNA 2GOYA 3A9UA 4RZ3A 1UBUS 5DTIA 5H3CA 3RRFA 1JWAB 1MP0A 3RAEC 2VF4X 4E32A 5I7OA 1HDYA 1MZPA 1BMDA 3B2EA 1UKYA 3EXAA 4B09A 1C8VB 2PN1A 4LQCA 2IU0A 4IDFA 3AWDA 1NB9A 4NJMB 4C6SA 3HBFA 4MRNA 1H4VB 3CZAA 1AKUA 2DFDA 3H8JA 3PB3A 3N9IA 1IN7A 3QTTA 4J03A 4M9SA 3NAMA 4YRCA 2IS2A 4PAQA 3PFFA 5JW6A 2YY7A 1Y3AA 1YC5A 1N5KA 3KJZA 5AUQA 3SM3A 4F9EA 3V32A 3IULA 3FGPA 1L5QA 2FFAA 1TLLA 1IWOA 1VFNA 3UB4A 1NPDA 2CEAA 1KTVA 2VQSA 2CT8A 2A9JA 2NUPB 3OUZA 5KBYA 3VOBA 4W9NC 2I91A 3UUEA 4AIIA 3AWIA 5KC9A 3I53A 2C94A 3U4IA 3LT0A 2FPWA 3IEVA 5EMMA 3BXOA 3QUBA 1IXKA 1OXTA 2VDNB 3BSYA 3CRRA 1TF2A 3LY9A 4LE2A 1DI0A 2CFOA 5DULA 5CBPA 4DDMA 5LQRA 2WSYB 2P30A 3GCZA 1ZJ6A 4P5EA 1AS0A 2PX0A 2DH5A 3FLAA 4LF4B 1IDOA 3PEYA 4M1ZA 3L9XA 4NJOA 4N8DA 4EY7A 4PS1A 1R4MA 1FRNA 4QZVA 4R8RA 4NOJA 3ASPA 3E5HA 3WV4A 1G5TA 1LTQA 1NAIA 1QE0A 3KD3A 4QIHA 3NIGB 1F2TA 1PS0A 3AG5A 2QEQA 4R54A 3T7EA 4X6YA 1SD2A 4DLAA 1IQ0A 2QTHA 2D8AA 3QF4A 4MR7A 3ZJTA 4XLZA 1OX6A 3R41A 1SKAA 3KSRA 4P32A 2M2IA 1FNSA 1QLJA 2ZS8A 3AIMA 3QLVA 4MHSA 5A7HA 5JJLA 1RLUA 4ENPA 1LRJA 2EQAA 3R7FA 3KYCB 3P0IA 3RVKA 5CDYA 4XGRA 1NW5A 1C0PA 3QRWA 2ZCVA 4B47A 2AHRA 2FDRA 4BIIA 3UJDA 2R1TA 2V65A 3W5SA 3CCEB 1Y81A 1QUFA 1WS6A 1ZH2A 1EBBA 2NTJA 4UAGA 3IT0A 3JQEA 4A23A 2QOEA 3P0RA 1OTHA 5T41A 3TSAA 3TX2A 3L8HA 2A92A 3I73A 3O8QA 1LU9A 1SUDA 1XDDA 4Q4JB 1QIJA 5ARBA 2IZ6A 1J8VA 3A1WA 5JYEA 3BL6A 4WZAA 3WGYA 3ABOB 4XPZA 3KPWA 4RHTA 4YJ2B 3MGBA 4BOYA 4CETA 2DETA 1NKSA 4EUHA 2EW2A 4WN3A 2PLRA 5KAPA 5A9SB 2VNHA 1ZC4A 4NPAA 2FSPA 3VNBA 4I5DA 4EYSA 1BHO1 1W88A 2ZJ5A 3FJYA 2QRNA 3ICPA 4KEAA 5ECDA 3UJ3X 1U0TA 3E9ZA 3WHIA 5ISMA 5JJ5A 2WQZA 5EXPA 3O4IA 4FD3A 4FN4A 4RKRA 3BCFA 2VK4A 3BY2A 4AJ2A 3DXYA 2ROQA 1T2DA 4I9UA 2R8ZA 1DIGA 1G6KA 1PHRA 3IAFA 3NOXA 4BKRA 4Q4AB 5HKKA 4OU5A 3PTZA 4W7HA 3SEAA 4B8YA 4ZVOA 2QRKA 2W0MA 5DASA 4CCAA 16PKA 2PK3A 5I8PA 1YFJA 2B21A 1BW9A 1VXOA 1T5DX 1U3DA 4RYLA 4YK7A 5CT6A 3WMXA 1AKNA 3D4LA 1YZLA 4MRMA 3WK6A 5JCXA 1CUYA 3DOFA 1NZFA 1U2RA 3AR6A 5E6TA 5EA2A 4AKTA 3PWTA 2DPYA 4ZYLA 2NO5A 5INTA 1OBVA 3I5MA 4TMKA 4HAWA 2HM7A 3JVDA 3D3NA 1W9HA 2D13A 1O6CA 2WTEA 5FBHA 2FOIA 2VRCA 4O5AA 5IKXA 1KEVA 3R3XA 5EJIA 3T6KA 4OHXA 4KITB 3ZDXB 2GSDA 2XTZA 1DXHA 3KPYA 4FHGA 2CXPA 1BU5A 1BQ4A 4FFRA 1R5BA 2DY0A 3AMVA 3MD0A 4PAGA 5DEOA 1KNQA 4YO7A 1B0ZA 4C5CA 2VAPA 5J4YA 4LYGA 2I0FA 2IJGX 1Y4DE 5AKEA 3TVTA 2G6TA 4GKBA 1K8ZB 3HYCA 2AZXA 4KSCA 5G1OA 3E1YE 2JVKA 1DKMA 3C6QA 1ANKA 1UZAA 2ZTUA 3G7NA 3PCXA 1KJIA 4CM3A 2BZSA 1ST2A 1NMSA 2Y3IA 4DOMA 1XMPA 5FULA 2YW2A 2BHTA 4TVBA 3A9RA 2G9NA 4GMDA 1Y8QA 4GM0A 1BTOA 2WRZA 3N8HA 2JIOA 3CP8A 3ANNA 2BEKA 1ZUD1 1E1RA 3EIWA 1LD3A 1J2TA 2AC4A 3H4MA 4MP3A 4NG5A 1EQAA 3CX3A 4I99A 2VJCA 1PJ8A 4CT4B 1CULC 3MN1A 1M2JA 2C4KA 3THWA 2TMDA 3WR5A 1QCCA 1FXSA 4AX4A 1PFYA 2AUMA 1Z6GA 2DPLA 3E9DA 4N5HX 3H04A 1SIOA 5GIOE 2A0XA 4CL8A 3HWWA 2ZKLA 4QDTA 3L0ZA 3AJ9A 3WL6A 4TTJA 3EX7C 2HNBA 1K6XA 3ODPA 1NONA 4B2LA 1P1FA 1MRSA 4FFVA 5A71A 2HX1A 2FW8A 3EGEA 3OQHA 3C3MA 3C6XA 2XX3A 1I3LA 3ASSA 1JI0A 1OXBB 2X85A 3BJIC 4IHJF 4A1OA 4ASUD 4OK6A 2Q0QA 1YVRA 4CN9A 1XWFA 3QVKA 1CQPA 1CUFA 2QRUA 1LV7A 3OMLA 3UV3A 2V97A 5KINB 3OMXA 4G4SP 5KKNB 3U6BA 5A0TA 4DUZB 2A6PA 4GQNA 2HUNA 3GJ5A 4OBXA 4CUKA 2RARA 1ZM4A 2HMWA 2IVFA 5AKLA 3W6PA 1RRPA 1O2DA 3IIJA 4ND2A 4RHXA 4BNHA 2Y1WA 3F1KA 3G49A 2Q27A 4Q18A 4H1TA 4R6XA 4KFTA 3UXHA 1B23P 1T26A 2OEPA 1RC1A 2M9MA 1M6NA 1A9OA 3VX3A 3ZHXA 5ALNA 3IP7A 2GESA 2QPTA 1C4OA 5DLPA 3CRMA 2BGNA 2DR3A 4GLFA 3DKIA 5JHHB 1GU0A 1PJBA 5JFTA 1DAEA 1U3WA 2OV4A 3H3FA 1MOZA 3QPVA 1QQAA 2HA4A 3L4SO 3PUIA 2R2AA 3O91A 2ZJ1A 2YWDA 2YN4A 2H9AA 3AJEA 3MWJA 4MI6A 4I1YA 4GBGA 1B8VA 3R4VA 1B8NA 2R1VB 3H3JA 2BIFA 4BBAA 4OFXA 3SQDA 3RIEA 5AKXA 1RFLA 1TFUA 3WKBA 4ZI7F 4IHAA 1XVUA 1GPYA 2BFEB 4BN5A 4YRMA 2X41A 1Z26A 2JVJA 1Y7HA 2HTEA 4DR5B 1X3SA 4F6RA 2Z5LA 2JFZA 1ADJA 1XPRA 1W49A 1JFRA 5D51S 1M2NA 1EE2A 2CFRA 3IVMA 5J63A 1II0A 3KQQA 3OC0A 5KHAA 3OW2B 2HPAA 1SZCA 5B6PA 4AKGA 4CV3A 3CNLA 3ST7A 3VZQA 3D4IA 3IBFA 2PY6A 3UOGA 1AG9A 4KXXA 1V0FA 1JIVA 2B94A 4PSDA 1O0SA 2RGEA 5FFFA 3CMMA 3NFRA 4HI0E 2OGSA 3ZE1B 5IWAB 2BKXA 2OM6A 3WLTA 1FX0A 2PX8A 3CG0A 3V7FA 5L6MB 5AXBA 3N2YA 1KZ1A 3FJOA 3OAAA 1DRUA 1O9BA 4AP9A 5F7OA 1YIOA 2JH3A 2FW1A 4XYBA 3VH4A 4JJFA 4WZKA 3JRXA 1PT9A 3O3MB 4G1BA 4UCXA 4URFA 4V0NA 1E79D 1K6IA 4ON9A 5G3YA 5HOQA 1QF7A 3QJ5A 3EXHB 3A6GA 5JG7A 2ZR8A 3FB4A 3K5IA 3ORHA 5C7OO 1TUBB 1YB7A 5BYAA 1F6BA 2O05A 4KNWA 2QU8A 3HH8A 3RVQA 1NM5A 2I62A 2X5XA 1VHTA 4W1SA 1JHUA 4ZXFA 3AM3A 2FQXA 1N2GA 5FBVB 2ZE6A 4IG9A 2BTEA 1HLFA 1KAEA 1FVFA 2GBIA 2J85A 2X4IA 4ECEA 1M5RA 1RKVA 5ALVA 4MUKA 4U1RA 2LCFA 2RCNA 2RHOA 3PZRA 3T1NA 1HTBA 4PAAA 5AVZA 4KFRA 5EJMA 4A0HA 1UR5A 5DCYA 3DKKA 3S7ZA 1KI9A 5DBGA 1AS3A 1AJEA 1G5QA 2CYAA 2VR1A 3KDSE 4BFVA 1I4OA 3UWMA 1X8XA 5F73A 2EIHA 2X2OA 3MBIA 4E51A 3U40A 3RS7A 4BDTA 3SC4A 4FEAA 3A1NA 1UEJA 1JPUA 2XA2A 2R4TA 3X2EA 3KOUA 1TPZA 4O5OA 4DNQA 5LL6P 2Q4TA 2BM0A 1UQRA 4DL9A 4F9GA 5FLXA 1DIBA 5I7SA 5GZ6A 2Q2NA 3EFOA 4I5EA 4RD6A 2JDID 2XYHA 3E9CA 4EW1A 2GEKA 1ZVVA 3O90A 1K5GA 2WI8A 3EC1A 4ESEA 4JNKA 4OYYA 5EJ4A 3GG2A 1QCZA 2ZIZA 4JI6B 1CF9A 2YYYA 3FWZA 2QYTA 3OT4A 1R6AA 3PICA 4YRSA 3IALA 4NMHA 3LPLA 3D3EA 1XDSA 1W76A 3TWOA 1TKRA 3A1EA 4HDMB 4J0HA 1P9NA 2Z08A 2Z3ZA 1Z7YA 3W4JA 4ZKEA 1WP6A 3PC7A 3PNKA 2WHEA 3SHVA 4L5YA 2IODA 5C51B 3HU5A 1AZWA 2X40A 4GPAA 1YMQA 3LHSA 1EFVA 3HCFA 4JYBA 4RKQA 3RRXA 5JPCA 5JR3A 1QHNA 5LNK1 1WUHS 2VT3A 3I9JA 5DHAA 1QRUA 1E92A 2BMEA 3VX4A 1VGVA 4FYYA 5FA5A 1DTWA 1TL7C 1ZUNA 4IIGA 1EQUA 4ESOA 1C1HA 3BL5A 4C4ZA 2V0CA 4EPWA 1J07A 1WVIA 4ALNA 1WRBA 3T3OA 1K7YA 3OZ7A 3KLPX 1HOTA 3OOHA 4GE0A 4PCAA 2NNLD 1VE6A 1ZINA 1G7TA 2FHPA 4WFKA 2L42A 3T3NA 4JB2A 5LMZA 4IYRA 3J80A 1UP7A 5CHEA 1QC5B 3MERA 3WIBA 1A9QA 3VYWA 5I7EA 4MUEA 1B16A 1WOMA 2MSCB 1DG1G 2RIRA 4LXTA 3H0CA 3DW3X 4EP1A 2YRFA 1J9GA 4TRNA 4UHHA 2O8EA 1HM5A 1MO4A 3F7TA 3F6BX 3PFCA 5PGMA 2B25A 2X6YA 3U7HB 2V54A 4X85A 3OPYA 4UJ3A 1E2PA 1L6RA 5BN1A 3FTFA 4MJ3A 1Z4KA 3U62A 1BXZA 1AIPA 5J4HA 1C50A 5DBHX 2D0IA 3L7AA 4G9EA 2IU4A 4F38A 5JAUA 2JAHA 2PRJA 1C8KA 3NWEA 4J0KA 1LDNA 5HA5A 1NQTA 3A35A 1YAHA 1G9TA 3HUTA 2NV4A 3GQBB 3NU1A 2D8MA 4JB8A 4D56A 5LN1A 4Y6QA 1CQJA 1UFQA 3IXLA 2H0AA 4S1TA 1U5AA 2FN8A 4TTTS 4FX5A 4INOA 5M3BA 5A4KA 3HKCB 2PJDA 3IVCA 1GM5A 1SVKA 4AS1A 3SXUA 3FBGA 3U7GA 2XXAB 2JFUA 2QRPA 1KYWA 1B76A 2ODAA 3K9GA 2DZDA 3EZ7A 1GPWB 2AUTA 1FRFS 3SLNA 3PA2A 3VNVA 3MUNA 3IGFA 2X14A 1M5UA 4N01A 4CDGA 1V8ZA 1WP4A 4O4LA 1NV9A 3NVKI 3R3UA 1Q44A 4HRXA 4X7MA 3M49A 3JD0A 1U9YA 2Z8YM 4H6PA 5EIXA 4BU0A 2IH5A 5CVDA 2Y76A 1MH9A 1XZJA 5D86A 4PZ9A 3BXXA 3CLUD 1YKFA 3V8BA 2QY6A 3EPHA 3L1KA 5CG1A 2BGJA 1G4UR 1IY8A 1WE2A 1UJCA 3A2NA 4LCJA 5F7XA 1NW6A 1Q86D 1T36B 2YJGA 4G9GA 4LRTB 4IIUA 4PN3A 5BV1A 1H85A 3F49S 5HGJA 4ZMRA 4HB0A 4IFEA 3ILYA 4X1IB 4BVHA 1NF3A 4NCIA 5EJ8A 1MABB 2CDCA 4GPBA 4R2LA 1ZN8A 3TTYA 2IYRA 5FI1B 5EFOA 3BCDA 4ZTBA 1ONSA 2OZPA 2ZJOA 1UKZA 1VPTA 4GP7A 4UJ5A 3ZLVA 1PR6A 3OE7D 4U2CA 3HKBA 2F4NA 4DA7A 3V2GA 2JJ8A 5GZ3A 2C31A 1EUCA 3O38A 4P22A 3PEUA 5EL0A 3C45A 5IM4F 1IN8A 1QGOA 5H9WA 4GPTA 5ALDA 3G2OA 4MQBA 4G4SO 5K8JB 4OUDB 5ITVA 1H8EA 5LZ9A 4M54A 5GOTA 1CS4C 2P5TB 4B48A 3KALA 4HNAB 4DQXA 4EO7A 3KEOA 2L18A 4B6JA 3JQBA 1RM4A 4OLJA 4F5EA 4AUKA 1BX0A 2FGJA 4Z1OA 5JZVA 4RBNA 5C8VA 1L7PA 2H2WA 2XOXA 2GREA 2QTVA 1FXWA 5IAKA 2P6NA 3BRWD 4GI1A 4GZ5A 4LISA 1BMQA 2F1OA 2Z95A 1SB8A 3RTGA 4U7HA 4UBKA 1P8JA 2AYXA 1ISMA 3G79A 3MJ4A 4PWYA 5F2KA 2DHRA 5CLFA 3LWBA 1E43A 5DBIA 1X3LA 2ORVA 5J2TF 1RABA 1KK2A 2DTDA 4ZCLA 1P29A 2HREA 3B1WA 3E53A 3NW9A 4ZRDA 2FFBA 1IPEA 5SYAA 3HXQA 4M7WA 3T35A 4BQRA 2UZ1B 2E1PA 4A92A 3AB8A 5HZBA 2JHFA 2V6GA 4JLMA 2HQOA 4X1OA 1G4AE 3EW7A 4QDZA 1ZIXA 4UMEA 4XD7D 1VQMB 3FPHA 2QRGA 2XWSA 2VF2A 3OX3A 2P6UA 3ZWDA 1RYHA 3I34X 3KE9A 4PRKA 3NDIA 4DMMA 2AMFA 5KTYA 3U44A 3IUPA 4ALMA 1HYEA 1DRJA 2O5RA 4ESVA 1H9BA 2BFMA 3CUTA 4Z9AA 5BSMA 4U2GA 1GN8A 1SXQA 1BD3A 3ILSA 4XWAA 1DX9A 1VQ6B 2G9ZA 2O2SA 3H6KA 2XMPA 4KUEA 1HDIA 3KVYA 4B3JA 4F12A 2YX1A 1NDUA 1X7ZB 1Y0BA 1SRQA 3SXJA 2REQB 3D8TA 3V8VA 3AIOA 4LV6A 2I2BA 4GXTA 3PWZA 1H2BA 4L6CA 2ONJA 3STUA 4EQZA 1T0HB 2VQDA 3UJ6A 5C8XA 2QRVA 3IJPA 1QBGA 3LKDA 4MINA 3FMGA 3PF8A 4YMHA 2B3TA 2HJHA 4RTQA 4OLAA 4YP6A 1SVSA 3TD2A 1HPLA 4RWEA 5I3ZA 4A2WA 2XF2A 1X80B 3O83A 3ONWA 4IIVA 2FI1A 5KYYA 5E4YA 4NXNB 3GNLA 1CFZA 2OOKA 3OCJA 4QUHA 3DXZA 1PT7A 5F51A 4YJHA 4JBHA 4F4UA 5K0NA 4F1JA 4CKEB 1A72A 1VRWA 2ODNA 3RKUA 2JBHA 2PM8A 5F5NA 3TMYA 3ZDDA 1NXPA 3KQUA 2C54A 2AOXA 3B3GA 1TOAA 2BSXA 2P0EA 4C87A 1UMKA 1PS9A 3HSKA 4O2RA 3ZN2A 4U00A 4HNUA 1MNAA 1RVDA 1W9XA 2ZRNA 3PNPA 5T4BA 1SUWA 2B4YA 1NRWA 1LLCA 3IAUA 4X93A 1CWUA 2VUTA 3I0MA 5DGDA 3T4UA 3DKRA 5FTJA 3V8QA 1VHQA 3QKRB 1OFGA 4BMVA 2XJ9A 1ARZA 3CLTC 1IB0A 1UWLA 5HRCA 2JHGA 4XVRA 2GO1A 3WYDA 4JGGA 2Z9CA 5C4MA 2Y1GA 1FDIA 1BNCA 3QMMA 3M2TA 4MKGA 3V2IA 4HXYA 1B42A 2GN0A 3IHTA 3RRZA 3AF2A 1NVFA 5JADA 5I4CA 4KG7A 3OQNA 5DF1A 1L9XA 1RYYA 3DV2A 5LSAA 4PLFA 2P9QA 4JP1A 3WMGA 3ICEA 3QLEA 5BMVA 1Y1PA 5LQDA 1YO6A 2G5CA 3U19A 2QEXB 3UUGA 2C7VA 2DT8A 3I6MA 2NVOA 3K30A 2G8LA 2IYEA 4Q15A 3VSDA 4KLRA 4F5YA 4QULA 1X8LA 5AI8A 3G9TA 3BGWA 1PGNA 2OC4A 3E2PA 3F73A 2EX4A 4S2EA 3IL2A 2YZKA 2EYQA 3TTTA 3R6GA 2I6UA 2FVYA 3DOCA 1A5TA 1CDZA 1CY1A 2NPIA 2RHWA 4NE2A 1LKZA 5DGTA 4RGQA 5LXTA 4EY4A 1P19A 5BNIA 3K8QA 1PJZA 2XDYA 3COSA 3CB4A 3PTLA 3G1TA 3N2NA 2B2CA 3DBLB 3WLQA 3ZHBA 1PGQA 1CHDA 2CCGA 3AV0B 3KZ1E 3W3AA 4HX2A 1P1KA 4BGUA 4Q9HA 4CMBA 1RRKA 3F3KA 3NHSA 5AUOB 4O4IB 1G5HA 1Y34E 1N2JA 4B0PA 3OHMA 1VJCA 4DS3A 4P12A 2FW6A 1TT7A 1P0FA 1S4QA 3AR9A 2OHGA 1DVRA 4GO1A 4TKMA 3RFCA 5ES3A 3GT4A 4EBBA 3JAWA 3L7CA 1P1BA 1U2GA 2X15A 3ME5A 3GN1A 1X9GA 2VHXA 4RVSA 2CB9A 5JVDF 5KNCH 1GUBA 4PZYA 1I10A 1RWPA 3BHIA 4BMZA 1M7BA 1GAEO 3L7IA 3TQFA 2GM4A 2QV0A 5EHIA 1DBPA 3WNQA 4N47A 5F52A 2GF2A 2VI5A 5KI6A 5ED0A 1Z45A 1YTUA 4KVFA 1KI6B 3LO8A 1NNUA 1ZAKA 4KO4S 2MWMA 1JE0A 3IP5A 2ZSDA 2N9UA 5KW9A 1MG0A 1ULUA 4UBOA 3UAXA 2FZWA 1OREA 1ZNXA 4QDUA 2FPGB 1PWYE 3EULA 4U9IS 3RSOA 2ECPA 4XQCA 1UMBA 4PYMA 3SX2A 4G0UA 1R0BA 2EQ5A 1ENZA 3R77A 1N0IA 4GL2A 4QPJC 2JVIA 2ZTVA 1RW4A 1KI2A