1OGIA

Ferredoxin:nadp+ reductase mutant with thr 155 replaced by gly and ala 160 replaced by thr (t155g-a160t)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP+ REDUCTASE
molecule tags Oxidoreductase
source organism Anabaena sp. (strain pcc 7119)
publication title Involvement of the Pyrophosphate and the 2'-Phosphate Binding Regions of Ferredoxin-Nadp+ Reductase in Coenzyme Specificity.
pubmed doi rcsb
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ogiA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1ogiA02
4MYUA 3OJWA 1YIJB 1VQ9B 2FX3A 1OB2A 2BVNA 3WBJA 2C77A 4ZCLA 1K73D 1VQ7B 4RD0A 1EFTA 2OTJB 4TMVA 1GAQA 1QFZA 2DERA 1ZM4A 1D1NA 1KQSB 2GQFA 2CRVA 4LC0A 4EH1A 2QTLA 4YAWA 3G4SB 1K9MD 1H85A 3OW2B 1KK3A 3AVTA 1E62A 2BM1A 1JA0A 2BM0A 2VNKA 1G7RA 3WNDA 2QA4B 4IW3B 5THXA 4WQMA 4ZCMA 4FN5A 3OZUA 4AF7A 4ZV4A 1N0UA 3FJOA 1W87A 5TY0A 3CC7B 3CCVB 4UAJA 3PENA 2BV3A 3ZZUA 1YJWB 3AGPA 2EIXA 1DDGA 1VQMB 1GJRA 1FNDA 1YITB 2BPOA 2XNCA 3W2GA 1M90D 4F7DA 2VYQA 4TMTA 1FNMA 4PGOA 4ACAA 4TMXA 1S0UA 3CCLB 1G7CA 5GV8A 3G71B 3U2QA 3AGQA 1K8AD 1HA3A 1E63A 1QGAA 1GR1A 3MHPA 3AVUA 2VNHA 1GAWA 2ZITA 1SKQA 4M2LA 4LBZA 1FRNA 1B2RA 1H42A 3SJZA 4YAFA 3I1FA 4RJLA 2VNIA 2BGIA 2GPJA 1DARA 3A1FA 2QN6A 3U6KA 1XE1A 2PMDA 1J9ZA 2QDXA 2R6HA 5H59A 1G7SA 4BPRA 3VNVA 1Q82D 3P27A 1JNYA 5DSZA 1GVHA 1R5OA 1W34A 1XB2A 1JJ2B 3AVXA 3OZVA 1G7TA 1DDIA 4PC6A 3WBKA 2YWEA 3I55B 4HE5A 3W5UA 4RD4A 1KD1D 4Y9UA 2CNDA 1E64A 2VZLA 1FRQA 2RC6A 4K1XA 3ZBTA 3AVYA 1YJ9B 4P6VF 4U9UA 3W5VA 4Y9RA 1FDRA 3CD6B 1TVCA 3WXMA 1VQ5B 3ES9A 4NCNA 1JA1A 3LRXA 1ZM9A 1R5BA 2X3UA 5H5JA 1YHQB 3ZC3A 1WDTA 3CRZA 4H9GA 1B23P 4B47A 1QX4A 1QH0A 3MMPA 1QUEA 4QHYA 1FNCA 4YHBA 1W35A 2PLFA 1A8PA 1KK2A 1CNEA 3VO2A 1NDHA 2PIAA 3JQQA 3W2FA 2HCJB 1D2EA 1F20A 2YWGA 3VMFA 4TMWA 3J81k 2C78A 5KSWB 1ZUNB 3B8HA 2DEUA 1YI2B 1EFCA 1W2BB 1VQ4B 3B78A 3OZWA 4M1KA 2DETA 1SM4A 5HXBA 1QVGB 4PC2A 3WY9A 5TR9A 1Q81D 4RCZA 1VQPB 2OK7A 3U6BA 3ZBUA 3MCAA 3WNBA 1KRHA 4LBVA 2BN4A 3CB4A 3CW2A 1AMOA 1Q7YD 1CQXA 3JQPA 1NJID 4M4SA 1DG1G 4B48A 4FWTA 4LBWA 1BQEA 4B4DA 1N8RD 4M53A 1BX1A 3W5HA 2E1RA 4Y7CA 4RD1A 1CNFA 4AC9A 3QFTA 2QMUA 4PC1A 1QVFB 4RD2A 1QGZA 2J7KA 5JBQA 4YALA 3QFRA 4FK8A 3W2EA 1ZM2A 1F60A 4TMZA 2HMAA 1YJNB 2AHOA 2BGJA 4DQKA 1I7PA 4PC7A 4RD6A 4YAUA 4Q7JB 2B5OA 5TV2A 1OGJA 1UMKA 1VQ8B 1S72B 1FNBA 2OTLB 1EFUA 1TUIA 4C0SA 2BMWA 4RD3A 3FPKA 1KC8D 3W2HA 2DY1A 4B44A 1ZM3A 2BF4A 3VO1A 1R5NA 3CC4B 3JQRA 2YWFA 2EFGA 1IJEA 4J0QA 1OGIA 4B3XA 4QFMA 4TN1A 1EWYA 1VQOB 4DQLA 4G1VA 1ELOA 4LBYA 4NBSA 1QG0A 3CC2B 3E1YE 1KJZA 1QFYA 3CCJB 2XEXA 4ACBA 4AF6A 3QFCA 3CCQB 2HDNB 3I56B 5FA6A 4RCYA 4ZCIA 3CMEB 1VQLB 1U2RA 1IJFA 4B43A 3CPWB 1KTVA 3CCEB 1GO2A 3LYUA 4ZGQB 3W2IA 1BJKA 4N3NA 3AVVA 3LVBA 1EP3B 4G1BA 4G5GA 1Q86D 3G6EB 4HE6A 3WYAA 3ZZTA 1VQKB 3QE2A 1BX0A 2DCUA 2RC5A 3LO8A 3WNCA 4YAOA 3OJXA 1KK1A 2B7CA 3QSYA 2OK8A 2NPFA 1D8TA 4M0LA 3AVWA 1EXMA 2XNJA 3CCRB 3CCMB 3ZZ0A 1TTTA 2VNJA 3P26A 1TLLA 1AIPA 1QFJA 2BSAA 3CCUB 1IB0A 4N3GA 3B82A 3V76A 4R71A 1N0VC 3CCSB 3CMAB 5GV7A 1OB5A 2QEXB 1JB9A 1EP2B 4ZGNB 4P3YA 3VNUA 1M1KD 2QTZA 1QGYA 3CXCB 1EP1B 2B7BA 5EMNA 2D74A 1QUFA 3QFSA 3E20A 4MYTA 1VQNB 1KK0A 2YWHA 1VQ6B 5AN9A 4C43A 4PC3A
chains in the Genus database with same CATH superfamily
1YZLA 2ZIEA 4PHCA 4QDJA 5F52A 3OJWA 4RH3A 3C6ZA 1HLGA 1JDTA 3IIJA 4G25A 1OX4B 5K3EA 3DLCA 4OCZA 1A9PA 3FYUC 3EY4A 5J35A 1K73D 4UVHA 2ZE5A 2L82A 4KSBA 1QYCA 4OPSA 1JKJA 3ER8A 3E53A 4Q3CA 3S70A 3D1VA 3UICA 1JRLA 4RSMA 4HATA 3C5WP 4UQOA 3CURA 5K0CA 3A1CA 3BFXA 4CEJB 3EXHA 5FWYA 3RTCA 5AIBA 2FZCA 4O4HB 1KO7A 3T5AA 2QXUA 5DW0A 3GFOA 3OO0A 1ZM4A 2XNDA 2HRQA 3KJFA 5K6AC 1KYWA 1FYWA 5JAIA 2QTLA 4TT3A 1WKVA 1TCUA 1SD5A 4HPXB 5H4HA 1GITA 3FCXA 3RU7A 3VHLB 3RC7A 4I4TF 5KU1A 3N28A 3IDZA 3IV6A 1J70A 3SVZA 1P2SA 4ERNA 1PJTA 3CQ9A 2F1OA 2JK0A 2NAFA 4YAIA 1NQXA 3O4JA 1L7XA 1JXMA 1WABA 2XVYA 4HGNA 2WK1A 2J5XA 5A0FA 3GB9A 2BFCA 3A2KA 1E5QA 2XCIA 1EKXA 2NLOA 4X05A 2D2FA 3MLBA 4PRYA 1OROA 5CW2A 2BGRA 1ZN2A 4D4HA 2QBYA 3WGKA 2J9FB 4BAUA 4LUCA 3EZ2A 1M2NA 1B4DA 1ZH4A 3PHLA 1MW8X 3I6YA 4M1ZA 4U7TB 1NRKA 5KWSA 3TXXA 1VB5A 3CC7B 3GRUA 1XGKA 4S1WA 1PRYA 4BO0A 2CV1A 1YUMA 2OXIA 4BFXA 3NHMA 4OBEA 4M1TA 5F2OA 1NVGA 4DNXA 2FOXA 2V03A 5COQA 1PJ3A 4DLRA 5TE9A 4QXQA 3IL2A 3UAWA 2NV2B 2QK4A 3SZ3A 1FW6A 5IF9A 1QZXA 2Y2VA 2XNCA 1TO2E 4B2LA 4F7WA 1VC2A 3NBMA 3I0NA 4LJSA 1AVTA 1TQDA 1FNMA 3I1IA 1O0BA 4EHFA 1DGQA 4CGZA 3N5CA 3VAZA 2BKAA 1OJ7A 3VJKA 2QAJA 5B3JA 2PGXA 4G37A 4TMXA 1HYHA 2FZ5A 5HDQA 1UF9A 2X40A 3WNZA 2C88A 3JR7A 4LY6A 5EE0A 3SMQA 4D0SA 1HDEA 4LOIA 5KTRA 5C8XA 3CKYA 3G71B 4JI3B 3ZCSA 2DLNA 1JR3A 4TKZA 1QVAA 3NOOA 5LMNB 1KVUA 2GYUA 5CAEB 3QX3A 3FSEA 4K6CA 3NTLA 3UK2A 4ESEA 5K7SA 2ZUEA 1NVFA 4LF8B 4FMDF 4INZA 4TZTA 1U3VA 4O3MA 1KYIA 2QJFA 4PPGA 3PFFA 4U2KA 3A70A 1XKQA 1ACMA 1ABEA 4OHOA 5DN6A 1ND5A 4XUCA 2A3NA 3SZUA 2BHLA 4MUNA 1SKQA 4IOLA 4IMIB 2GILA 1KOFA 3EZGA 4JQYA 4B7CA 5M7EA 4DMFA 4OA8A 2OPBA 2G06A 3EXFB 1LRKA 1E7SA 4YAFA 3D6AA 5HFJA 3AUAA 4MMYB 1YUNA 1RMYA 1YBAA 1CRZA 2IF2A 3D64A 4X8HA 2A9PA 5HVNA 1QQBA 3EH1A 2IE0A 3IFSA 3RE1A 3PEUA 3JQ7B 3PXUA 5ENDA 5TC4A 3G8CA 3BB3A 3C70A 3M6AA 3P2OA 3PF9A 3WDMA 4EFDA 4DQDA 4BKUA 1V41E 3L77A 4F3NA 4UTXA 5EIEA 3OLZA 3D5TA 1QP7A 1US8A 4NU0A 2ISCA 2NQ2C 1UK6A 1OF1A 5MFPA 3CLTD 1GL7A 2NO4A 3ROZA 4E11A 5BRJA 3BTSA 2HSZA 3H2JA 3CYFA 3H2GA 4M99A 4MVWA 5AVYA 1OI7A 3BXXA 2ECPA 1L4HA 3AFHA 1NUTA 1F17A 5C37A 2FEOA 4RHCA 4O2AF 3WC4A 4WADA 3CNNA 2O2ZA 1NWCA 3MTBA 3FUWA 1W9XA 4B31A 2WFAA 1KORA 2QLBA 3H2YA 2FSIA 4PYOA 2C2WA 4AI6A 1ZUHA 4H1UA 3IA2A 3ACDA 2ZE8A 1O94A 3IXLA 4ZO6A 4CTNA 2WHPA 3V32A 1P5RA 3UJ9A 3HYNA 2GJAA 3OETA 4I08A 4ZO7A 2QZZA 1DHTA 1GV0A 1ZMOA 3EZYA 3L6EA 4JA2A 4PRLA 5TNXA 3TQRA 5TQ0A 1MG5A 1I33A 1UMBB 1BVRA 2HIMA 2CDBA 2LDBA 1G8YA 2NSLA 3BVPA 3NRCA 5FR2A 1ZJWA 2H18A 2VDNB 3L7LA 4BV8A 2HIHA 4UASA 2MJLA 3CUKA 4WNAA 4RD4A 4RPIA 3SHQA 3COVA 3IE0A 3RHFA 2X5NA 5HDBB 2JLVA 4LDQA 4NIMA 1CY0A 3ICOA 1H69A 2W2KB 1WUHS 1PR4A 2MYTA 1THTA 1ZMTA 4N7RA 5H8WA 4WESB 5J2UB 1UEXC 1D5CA 1HE1C 4FMPA 4UOZA 3IT2A 1VDZA 4BLRA 4RTRA 5TF0A 2R96A 3PJFA 2X8LA 4KH0A 1UBRS 1P4JA 3VA7A 3LVQE 1C4OA 4BCDA 5L4NA 3BIOA 1VJCA 2DU8A 1Y6GA 2ARKA 5AM4A 3RS5A 1DX4A 4D3YA 3LCVB 3KKEA 3OQPA 1XRQA 1W94A 3DD5A 3IAXA 1H94A 3UWDA 2BI8A 3EVDA 2F9LA 1E2PA 3WAJA 5JS1A 1C5KA 5TT0A 1JDBB 3VI4B 3EOAI 5K8IA 1R4NA 5DB4A 2ZSIA 2ZVPX 4DR3B 3BD7A 3RVPA 2C1XA 3ROEA 4JUAA 4QREA 3U3DA 2AW5A 5CM8B 2IYWA 3EHEA 2I2AA 1AY0A 3MMPA 3LTEA 2E0IA 5CGZA 5A0VA 3FUUA 3VNBA 5L6MB 4FD2A 1EGVB 3LG2A 4Z4RA 3NVAA 4XW2A 4RNDB 1MV5A 5IFLA 1V1RA 2FMHA 2Q4DA 5AVRA 2YJTD 4FD3A 2AN9A 1F4PA 2VBSA 1SU6A 4RK1A 4J6EA 4AURA 2P62A 4YV2A 4N6GA 3DAHA 3QOFA 3GGJA 1EK5A 4KRFA 2E4XA 4Y2PA 4XN0A 4HS4A 4RKYA 4TRNA 2JPDA 3WLRA 1CDOA 2HK6A 6ABPA 3G68A 2CFIA 3HJBA 3OURA 1QHYA 4L5AA 4R1SA 5IKPA 3JASB 5IKMA 2HHCA 5GZ3A 4DCTA 1ADYA 1X8XA 1QQTA 4NEGA 2OCPA 4Y1EA 1X42A 5C7YA 4RQAA 1TJPB 3EEYA 3PQEA 5CK4A 3B6ZA 1WUTA 2JH3A 1MEEA 1KVTA 4CTMA 4TS1A 1IWBB 4MRVA 3FKJA 2XUDA 1VE5A 4FEEA 3RWOA 1RNLA 5AI8A 1WMAA 1KU0A 1NI5A 5J9FA 4JI1B 3SS8A 4R8SA 5TRTA 5LSAA 1Q0TA 3AOEC 4NTZA 4Q18A 3CTAA 3MQ4A 4XPIB 4DRXA 1XD9A 1ZLYA 2INGX 4FMDB 1MJGA 2HA4A 1F0PA 2WKWA 2A0KA 4RCZA 3OOEA 4H4DA 3W8RA 4Z3OA 1Z4KA 4I8XA 3DCNA 3PYXA 4BVHA 3JVVA 3DOCA 4C06A 2VEDA 4E33A 3CEHA 4JZYA 4JSYA 2VDPB 1G6OA 1Q1GA 2DPMA 3IIMA 5CXXA 5F5XA 4X7DA 3A1UA 1Q7YD 4NS1A 3RG2A 4WESA 4XIIA 3GJ7A 4WCVA 4D9FA 3PGA1 2GTIA 5CA0B 1SZDA 4XX1A 4WZ6A 1YMUA 3K70C 2Q3BA 1P1IA 4R2LA 1IQPA 4MJLA 5JLAA 5JZBA 4DJFC 3FY4A 2D1QA 4ZO4A 4QM7A 2XUOA 4MYHA 4FS8A 4UJ3A 4Q24A 4DLSA 1BQEA 3AFMA 1GPMA 2W5UA 4MS3B 3RARA 5J2UA 3FYSA 4JKIA 4OOSA 3WS7A 5EJEA 1BS2A 3KLPX 3OSZA 4EJ6A 5LLTA 3AL3A 1YZTA 3C3YA 1IXYA 1HDRA 3LPCA 1RYYA 4HX9A 1E3XA 1GTZA 4TKLA 1JR2A 3ROGA 1UJ4A 2EIHA 3SY8A 2HUPA 3KOUA 2BOVA 3K16A 3GGCA 2PUCA 4ZODA 1EZ1A 1GTL1 1C41A 3DZGA 4A73A 5HF6A 1ORVA 3LFUA 1PJ4A 5A4FS 1LDEA 4JJFA 4P4NA 4UEOA 2X1MA 5ER9A 1J8DA 1IATA 4P12A 2CSUA 3BBLA 1ZMXA 5DEIA 2P2DA 4UZUA 1Z74A 5T4EA 5LP6F 4N6NA 1WOPA 2V4UA 1GRNA 4BCCA 4GP7A 4MHTA 1ONPA 3C3JA 1X74A 3ACCA 4B3JA 1JIKA 1Z28A 2P68A 1E1KA 2YFYA 4XLAA 1MQAA 2ETXA 2HA3A 3EOBI 3GJ0A 3KQPA 4IGKA 1LUAA 4PLCA 4ENPA 4X6UA 1IVNA 5JBIA 5LIPA 3V80A 1ECCA 3NC0C 3TIIA 4NU8X 4N8DA 1BVUA 4NZPA 5C2JB 5JH7A 3Q1LA 4DK1A 4GOOD 1G66A 2JCVA 3L5KA 4TKUB 2AX4A 3E48A 3P2MA 1ZI8A 2YICA 5IJXA 1GT91 4IJ5A 1PJBA 3D6MA 3FPBA 5JMPA 4W9NA 3IHLA 1NBIA 2P9CA 3WK4A 2XWBF 3OHSX 3SBDA 2EV9A 2PLRA 4OKSA 1OJLA 2DPLA 1E8DA 1TVKA 3QX8A 1PI3A 2NVBA 1O89A 4ALLA 1PHRA 1KSHA 2MSKA 2JL1A 3M2PA 5EWLB 4B17A 3KTFA 4UHCA 4MUXA 1L7EA 2Z2ZA 1HDGO 1SEVA 3M1LA 4EOGA 5ED4A 2QD4A 1KQPA 1R0LA 3MGAA 3UB3A 1HR0B 1JG3A 4BP1A 4KI0A 1DKMA 2Q0SA 3ANXA 1SOUA 3VTAA 2W6MA 3PWTA 2RH8A 3ZJ5A 1MW9X 4LJLA 4XXHA 4F4JA 5BYJA 1WMBA 1E3QA 4ENVA 2DWPA 1K1EA 1RDFA 3H8JA 4PPQA 3ASUA 3DVQX 3TSWA 1P2UA 2H0RA 3GLHB 3KT8A 3EARA 3ND9A 1KDVA 4A2CA 1PYDA 3DWGA 3IHWA 3ENNA 1Q1EA 3NI2A 3TSYA 4S24A 4BO4A 1AK2A 4F2DA 3S2GA 5SICE 1PS9A 1SQSA 1YR1A 1ND6A 3Q7PA 4YP1A 2ZRMA 4JYMA 4CKEB 1BRTA 2IXFA 2JAHA 4I1YA 4RZSA 3W8DA 1KH2A 4BP8A 3PDJA 1T4DA 1TYBE 3JVIA 4G4SO 3U60B 4AJKA 3FZNA 3ITEA 1XPRA 1DWOA 2X9GA 5COAA 1L5QA 2XEXA 2GSWA 3IVGA 3W6UA 2P1RA 3DXZA 4V0LA 1VJDA 4PZ9A 5C1PA 2H07A 2R4UA 1BVHA 2RI6A 5FA6A 1I4LD 4X7CA 1OLOA 1TC1A 2QUKA 1JSCA 1Z6GA 4GMGA 3ZWMA 4LGMA 4LDJA 3L1JA 2QZSA 2YZMA 1XTJA 1BEEA 4DUYB 3I9V6 5M5BA 2IS4A 4E4TA 4ALIA 1T8PA 3ZHRA 3DWFA 2FEWB 4Y2QA 1KTVA 4JBYA 4KYUA 4RVSA 1FUEA 2PU5A 1YRHA 1K0UA 1ULUA 2FN7A 3PQ2A 4C4ZA 1VM6A 621PA 4E6EA 1G0NA 1X70A 2V7UA 1DAGA 1PS0A 2ZRIA 3L3BA 2AOVA 3SHWA 2ERCA 1VHWA 4NBUA 4GM4A 1T6NA 1W36B 4D4IA 3FH0A 3FRIA 4MK4A 3VO8A 1LFAA 1NRXA 2J6HA 4XD7A 1OYVA 1BPLA 3G2HA 4TSKA 1YDMA 3LSYA 4MWEA 3RRYA 2WOOA 1OZGA 2DQYA 3PFHA 4JT9A 5EJ9A 2KJQA 2P9BA 3IKVA 2BDTA 5LQDA 7YASA 1IM8A 5TS3A 4H16A 2Q7XA 3FAKA 5FNVB 4N49A 2FPMA 3E3AA 3RABA 3ZU2A 1BNCA 4R3NA 2PEYA 2QLNA 1JE1A 3R3YA 3R6WA 1G8GA 1TTTA 4JR2A 3R4VA 3I45A 1SWVA 4QD3A 4FE4A 3T7CA 1GFWA 4B81A 1XDUA 4O02B 3OOCA 1TUBA 3H2IA 1JHZA 4GP9A 4TRMA 1J2EA 5B7PA 1DC8A 2WAXA 2VZ8A 2P2GA 1YUBA 2WTAA 1IZ7A 1NVAA 1QOPB 3R3HA 4L51A 3MJ4A 3P9KA 1JAXA 1DE0A 1HNNA 3AEKB 4IVRA 1EB9A 1ZD5A 3VSEA 4BGVA 5JHGB 2AFHB 1J0EA 1MO6A 2W6ZA 1QO9A 1F4VA 1HRDA 3MWJA 4K9DA 1II8A 2VHTA 4HNAA 4JLKA 1Z37A 4E0FA 1UL1X 1Z8HA 3BXZA 3NTUA 3QU7A 1PWZA 1W1UA 3TX6A 2OG1A 1M1KD 2CJFA 3Q6QA 2ONYA 3TEJA 2GPBA 3UC5A 4P4GA 4YRJA 4PZYA 2WTBA 2JGRA 2DVMA 3IO5A 1XXHB 4FFSA 5IVIA 4RYDA 3A11A 4OHUA 1GZ5A 1LZKA 4C22A 3M82A 4YEJA 4FFDA 1CY2A 5IVHA 3R7BA 3SNHA 1NUUA 2AFIA 2YVAA 4V0OA 1XNHA 3A06A 1JIIA 3DFMA 2FWMX 2ZJ4A 4HAXA 1YIJB 2HLHA 2VPZA 3HYLA 2GKSA 2ZBDA 1ADJA 1JVSA 4EZBA 4WBNB 2D13A 4JB0A 1SMKA 5ALTA 1SRQA 4BBAA 4BQOA 4LJYA 2XZDA 3AYZB 2IV2X 5D51S 1RYMA 3AX6A 4TS9A 2C03A 3OMWA 3GX1A 3T1VA 4BMVA 3P9CA 5ILOA 1RYNA 4P4SB 5FOXA 5EVJA 2W70A 3H5TA 2FF5A 4JHLA 3OICA 1CLUA 1DBQA 4RPLA 4ZZ2A 3OT1A 4FC6A 1AKTA 4WZBA 4IIDA 4GQNA 1KJ9A 3IDAA 2G5CA 1KS9A 2DT8A 2BCEA 4IWNA 4PVDA 2WIFA 2ENWA 1ORDA 2FG5A 5GOZA 5TSDA 5JIBA 1BDHA 4KUEA 4YT8A 2NV6A 2VJMB 1D6MA 2IUFA 3QBEA 3H83A 1NF9A 4L95C 5K0GA 2PUJA 3ZI4A 2IBTA 3NBKA 1RAIA 4LRUA 1E9CA 1GYQA 3DE7X 3K9WA 2ATIA 4R98A 3VGJA 4G4JA 2YWBA 2VK2A 1B43A 3Q6MA 4P81A 1J2TA 4EVQA 1VMDA 3F5DA 3G2NA 2WAAA 3HEBA 3S2EA 1K7YA 5CDHA 1JLKA 1H8EA 3IUQA 2I4NA 3GFBA 3PUZA 5C5EA 1COWD 2C61A 1EE1A 2D0IA 3DMYA 2NGRA 4M1OA 3RSHA 1YF3A 4AXBA 3IALA 2C97A 4HRXA 4XQEA 4DEVA 4B6EA 4LXXA 3BTOA 3SJ7A 5HZAA 3FJOA 4HH1A 4IJMA 4DGSA 1GAJA 2NZ8A 3UWSA 3EC2A 3VYRB 4G0XA 5LJLA 1XN4A 3GRZA 3VU9A 2OBRA 3FSGA 5TY0A 1J5XA 2AIRA 1KYYA 4MWSA 4II7A 3TQSA 1GV1A 2OZLB 2WF8A 4ZKEA 4BU0A 1BX3A 1YFZA 3Q7TA 2KS6A 4M60A 3KHSA 3WL5A 4HB4A 3UPTA 2V7EA 2A0XA 1IZZA 2O8EA 3HZZA 4CM1A 2AUTA 3ESDA 5HZGA 1D2MA 3DO6A 5E95A 1GJRA 2JIOA 3NFRA 3JVDA 5CAEA 1K9VF 2Y27A 3ORRA 4RDIA 2JJQA 3RW9A 1SHTX 1ISJA 3UBMA 1U98A 3FOAA 4U39A 3GJZA 5JE8A 1Y34E 3WP1B 1VBKA 4I9GA 5JNUA 3OJLA 4P4LA 2HPHA 4X8LA 3C41J 3N70A 3TBKA 5KI6A 5IHPA 3FPCA 3HVHA 1ZRMA 1ZCAA 5U4XA 4H2DA 1RHQA 2ZRNA 1GAXA 3SAJA 4LOAA 4Y2GA 4PYQA 1CD5A 1PVDA 5EHQA 2Q1TA 8LDHA 4MR9A 1SC4A 4J2OA 4EB3A 3EQ6A 1R1DA 4J1NA 3AGQA 1VHDA 1RJ9A 2UDPA 4LYGA 1MT3A 2IK8A 4A92A 2QQFA 5J40A 1RD4A 1HA3A 4HDNA 4BB6A 1MRNA 2RAVA 4WZBE 1QGAA 3GD7A 4N5NA 2BFOA 2PV0A 3VNQA 1OI2A 1STOA 1ULBA 2VNHA 3ZWOA 1FFXA 2J67A 4IIVA 5D5HA 5E8JA 1L5OA 4KPUB 5H7XA 2FDRA 3QE0A 1LSJA 2V98A 2WKQA 1DEKA 1I0IA 4B76A 1DC3A 1GGNA 2FTKE 1IBCA 1RR6A 4JBIA 4QYWA 4XZ3A 5E9WA 3SKBA 2XB8A 2PD6A 1DIBA 1BMFA 2G1AA 1WW3A 2Z56A 3URKA 7ADHA 1EUQA 2DULA 3I28A 4IQ0A 1ATIA 2I7TA 4MVJH 2R1UA 1NUHA 1ORHA 4P7FA 1AGRA 1W47A 3K31A 4AJLA 2AJDA 5IUNC 1WBDA 4E5UA 3I34X 4Y0AA 4L9AA 4MUAA 3R24A 4CDRA 1FNSA 3L1VA 5A5FA 4PWYA 2WYWA 1XE1A 1NPYA 2NO6A 1U8ZA 1WO8A 1RIIA 1ZU4A 2ZUSA 5FWNA 1BEZA 1SHLA 4QNRA 5FPTA 1R0BA 1RWBA 2VAPA 3T1QA 1G7SA 1TEXA 3ENWA 3VOTA 1E8MA 4ND8B 4LQCA 3W5AA 1EWRA 3HVIA 2Q9CA 3QXGA 2R1TB 3DDOA 3ITDA 1Y8CA 4WJKB 1QM5A 3OE7A 3GDWA 4OLHA 4XTCS 4N39A 2R7NA 5AVQA 5JSHA 1JFTA 2XDWA 4EFKA 3OLYA 5K03A 2D54A 2WAOA 4B2IA 2VRCA 4JOCA 4I4NA 4I5EA 3UPDA 4RZXA 1Z82A 3CRNA 2P2YA 4MRMA 3TIXB 2WWHA 4OHBA 4MV0A 2PKQP 4NJEB 2O8EB 3WBKA 2ZSEA 3L4SO 3ORHA 1K5HA 4O08A 2ECQA 2HDOA 2EJCA 3C14C 3D3KA 3TQQA 3AVOA 3I2IA 4QDZA 4NNPA 3HYSA 1J33A 1ZCJA 2W0SA 1ZA1A 4U9HS 4ID9A 1C0LA 1HK7A 2Q4EA 2VZLA 4ZU3A 4DUGA 3HCRA 1FQKA 3JQ6A 5DM60 2RC6A 4N9QA 1WKCA 1KDPA 1V26A 4OL0A 2YWXA 3N6RA 2QI9F 3R6GA 1IVYA 1KYTA 3F98A 4JLJA 4RQBA 4UXIA 4KX3A 3Q3AA 1SELA 4U9UA 2Z2YA 1HZZA 4GBMA 4GSYA 2DQKA 1SRRA 1W96A 1K6MA 2IRWA 1F1JA 2C4NA 2ZAOA 3BFKA 3HHPA 3NHUA 5IC5A 4XMYA 2QPOA 3HU2A 1DBWA 4WZAB 1UBMS 4QG3A 1XTQA 2H4FA 4X44A 1VCNA 4U2GA 1X8LA 2D0PB 1CVLA 1HDCA 2IC5A 4PRZA 5K2MA 3BK7A 4IDGA 2QT0A 3P2KA 4P7KA 5TMBA 5DLEA 1CJCA 4IJWA 1HQYE 2F1JA 3T6KA 4JLOA 1VGQA 2C07A 3FCAA 4L27A 1RI3A 2C42A 5A7HA 4U02A 4JA0A 3ZCUA 2O07A 3U4QB 3GRKA 4UTVA 4REQB 4JODA 3T1NA 4BO1A 1W9HA 4N3AA 2RH5A 4M0KA 3MJEA 1Q7TA 4J29A 2FOIA 3HJAA 3I39X 4US0R 3NB0A 2ZDHA 4LSMA 3ZWCA 3RS0A 3SSOA 2D5IA 3AHIA 4BZPA 1QX4A 4P2NA 3K5WA 2I4IA 3A6ZA 3HVUA 1PTJA 1G42A 2XOXA 5I51A 1RXWA 2G71A 1CYEA 4GXRA 4D6YA 4XSGA 3RYFA 2FWRA 4KN6A 3TUJC 5AESA 1HE5A 1BCRA 4N8EA 4C3OB 4D8WA 2HJGA 1W0CA 2AZTA 4J6FA 1BJTA 1NJ8A 3JARA 4OXRA 1Z07A 4PPNA 4WLUA 3QWAA 4WMLA 2VXBA 2NVUB 2IIQA 4ZP1A 4OGLA 4F4FA 5JVDF 3WJ1A 3COJA 1R12A 5FEMA 1FF9A 2HY7A 1XZHA 2Y1FA 3GJQA 4L16A 4N41A 2EL9A 3TQOA 1XYVA 1QHXA 1QFMA 3EJWA 1UBOS 1A5AB 3H8VA 4GX2A 5EIBC 4Q7KA 2RGRA 3IEVA 4EKYA 3M81A 3V7NA 5ECGC 5EJIA 7REQA 4BXOA 2AI1A 1OWNA 3MQFA 4NAUA 1M1YE 3TPFA 4OQNA 3HYRA 5KSWB 2HMUA 4G5XA 1UJ5A 1UT8A 1WMEA 4LZNA 5K51A 5KAPA 1FFDA 3ZDXB 1EWKA 4OVKA 4AJ2A 4CCWA 1EFCA 1LDNA 2CUNA 3G5AA 4P2GA 1U9YA 1XL1A 4LJ7A 4EKNB 2OCLA 5JEEA 5E6TA 3R40A 2OCIA 2GA8A 2ZATA 3BIWA 3H0KA 3NO4A 3EK2A 4GPIB 1MT0A 3O38A 3QLVA 5EPOA 3WYNA 2QRKA 3MGGA 2HBRA 3KOXA 4JC5A 3D6NB 1UJ2A 2Q07A 1VQPB 1C4KA 3BUSA 3MD9A 2X8JA 1NFQA 1GG9A 3Q12A 4NV1A 3BFPA 3D4NA 4J07A 4UPDA 4R8RA 4ASUA 4GQIA 4QODA 3CPEA 5DYWA 4JN6B 3J81A 2AF3C 4UU0A 2E89A 4WZBB 3V1MA 1XDBA 1D2NA 4EKDA 1W2GA 2DR0A 3FE2A 3RYHB 4NDZA 4TZ6A 3H3JA 3IT1A 3M6WA 2VBGA 3N2KA 1JX6A 4F6RA 1UP7A 4M4SA 1F8GA 1HE8B 4D4JA 3U09A 2YIVX 3GLFB 4L4YA 1DCFA 2JF0A 1UBEA 1HNXB 2WF6A 4DSNA 2C0PA 3ODGA 4JJ7A 5DHUA 1C2YA 1R0ZA 2IVFA 3DW1X 3K9QO 1XVAA 2XZTA 3D59A 3IUMA 4M0MA 3FD8A 4LHEA 2PL1A 2B3DA 1GADO 4BL5A 5T7BA 3S8YA 3LA8A 2WPDA 4Q4LA 4TV8B 2KVOA 2C3MA 1ULAA 1N8SA 4MQLA 4H15A 4TWBA 2WWVD 3O0TA 3ZWVA 3LHDA 5KOJA 3ELUA 4AC9A 3QFTA 3P71T 2QMUA 3CSUA 2WIDA 4W99A 5TVGA 3RRXA 4EPVA 1X1AA 3EC1A 2IIBA 1W9MA 3GIWA 2GX6A 4FN4A 5YASA 4KMMA 3U4GA 3T1TA 3CX6A 4BO5A 3HABA 4YTEA 3H4MA 2IYVA 3FCOA 4HK4A 5HTKA 1NF2A 4DDTA 1OLSB 1QR2A 1UKAA 2ODPA 5F77A 5CD1A 4Q9DA 2BBWA 5DOVA 5JVDA 2E6UX 1P6QA 1OILA 1G5IA 1G9SA 2O8CA 1KRWA 4R31A 1LBEA 4MAFA 4NFYA 5U9CA 4BB0A 1YTLA 2FSVC 3MGKA 4AJ1A 1GL9B 3KJQA 3GPIA 2C7PA 2WJWA 3ODPA 1V35A 1UZMA 3UJCA 4DQKA 2GEVA 3A3GA 4DNRB 2V6FA 3LT1A 4UU1A 4BQNA 2GBGA 3U3ZA 4DJEC 4PC7A 3HV2A 3WYDA 2CVZA 3VPBA 1NBMD 2LE0A 1RM3A 4MW5A 1EBFA 1SOAA 4TWIA 2WFLB 1LU9A 3EF0A 3QMMA 5JJIA 1O96A 3R74A 1S72B 4DCVA 3DA8A 5B57C 1X7YB 2ONZA 3N6VA 2D2EA 4P93A 5EIXA 1R16A 3D2AA 1P44A 1ML3A 1I5EA 1YC2A 1NBEA 1NVMB 1A7JA 1P2BA 2YN2A 2ZYGA 4WXEA 2MCFA 2ALJA 1TA4A 5FTMA 4YT4A 2BMWA 1RC1A 3OCYA 1USIA 1TQ2A 4GRIA 4CQLA 2X77A 3PQFA 2OG2A 3OIUA 5D87A 1S8AA 2BF4A 2RG7A 3LY7A 2CFRA 2JLRA 3K53A 4OXKA 4PZCA 3NC1C 5DHRA 2AD1A 1WCWA 1BKSB 1E96A 2QVYX 5AI5A 3TN7A 1TX4B 1N2BA 1UC8A 4NR0A 4P98A 5F35A 5KS2A 1BDIA 1Z5ZA 5AHOA 2GGSA 2OFXA 3IP9A 3UMGA 3V8EA 5LQNA 2LD4A 1B8VA 4C5BA 1RLJA 2CHVA 4XWAA 3AV3A 2E55A 5BWCA 3ESRA 4I55F 2ZI3A 2O0KA 3G9XA 1QG4A 3VOSA 4DS3A 3HGQA 2BEKA 1OC4A 3C4QA 2L42A 2VK1A 4MB2A 4ETMA 4H0CA 1M0TA 4GBED 5IBPA 5AICA 2CL7X 2Z1DA 4XSHA 1KXZA 1FTNA 3NV7A 4DNFA 4MI9A 3O3CA 3FHTA 3LIIA 2XZPA 1BMFD 1I3KA 1LH0A 2AEFA 4RGQA 3BA6A 4Q6BA 1IEWA 3DZHA 4QWWA 3LI2A 3SWWA 4UTNA 5ES4B 1W5BA 4EJSC 2WU0A 2J09A 1L5MA 1C0IA 5IW8A 4EUFA 2ASVA 4UZEA 3N0VA 4L28A 5B4VA 3VBCA 1RRGA 3M4NA 5KSOA 1E89A 4RA9A 1CE8B 3JAKB 5FOWA 1T0IA 1VPTA 1WRBA 3QQPA 3VBEA 4DY6A 5C1BA 3H75A 1WV1A 2G70A 1MR3F 2W8BB 3DFUA 3KLNA 4PZZA 3CLUC 4ZA2A 4CV2A 4DPLA 2QX6A 1QRTA 1PR1A 2AMFA 1CJSA 3EN0A 4NMHA 4DLKA 1M2WA 3EAFA 3ZU3A 2VXCA 4PAGA 3V4FA 1YFLA 1TU0A 2BMEA 2VJAA 4QO7A 1LPAB 2H08A 4D6PA 5L6LB 4KMSA 3ETDA 2O8CB 2GUGA 1YI1A 2BZSA 4FZ5A 5A5GA 3I8SA 4FVTA 4Z4VA 3LXRA 1UPAA 5CLQA 5BSRA 1KYQA 3OZTA 1T1IA 4BASA 3T35A 3Q38A 3UBTA 4ZVVA 2O06A 3FWYA 3RRZA 3ICEA 3PDIB 1RRMA 2FUG1 4L57A 3S68A 4A8JC 3OEHD 4NPHA 1QTIA 5BMVB 3MTIA 4B85A 2A9QA 2H3HA 1Y3AA 1XDZA 4HXFB 3N8IA 4K3UA 4TV8F 5IC6A 2X19A 3PRYA 3GJTA 4BN4A 3FAZA 4EITA 3BF8A 1UD5A 2XZLA 2NPFA 2L2QA 1D8TA 2YHAA 3QHAA 5IYRA 3HNRA 4MWCA 5HRAA 3MCZA 4JJAA 3ZXUB 2VJBA 1UP4A 1V8ZA 3FSJX 4BLOA 3FHLA 3A9SA 3W6OA 4EG1A 4GMDA 4QU5A 1VA5A 2O0MA 4HKTA 4PEVA 4V02A 4BP3A 2CD7A 3OZGA 2DTXA 1Q15A 1JIXA 3C6XA 4LRSB 4PXYA 4BTVA 3V1LA 1RBYA 4LJ5A 1ZJ6A 1PQWA 3GG9A 4UC0A 1IB0A 4B7ZA 4CMBA 2Q6VA 2QLLA 1FDUA 3BWEA 3STWA 3D2LA 1I7QB 3WLPA 3ER6A 4O4LF 4ZQHA 2UXBB 3S81A 2WU4A 2PSDA 3G5MA 3AI3A 2YIJA 1X1SA 1F06A 1F1BA 2IEYA 3O8BA 2GI4A 4NYIQ 4DYVA 4OY3A 1JMKC 1JEQA 1XG5A 2CZCA 3H2SA 1QSGA 2ET6A 3EYWA 4MDHA 3HMKA 1Y8QB 4JKOA 4M9UA 5AVWA 3PTAA 2Q2OA 1NDQA 1L8OA 3CWZA 3ZV3A 5JU6A 4N48A 1IY8A 1O4VA 1SGWA 5JROA 1Y1TA 4Q37A 2VCHA 3L05A 4QSMA 2EGHA 4OGWA 4WNIA 4G6IA 1L8LA 1SC3A 1C7IA 5J5AA 1GSHA 4W5WA 1IY2A 1W44A 2DFDA 2OGZA 3DKIA 5K0SA 2ZJ3A 4E13A 1XCLA 3F4KA 4RA6B 3ZNQA 4PC3A 1DBSA 2Z6UA 4KXYA 4TV9F 3K2BA 2G9NA 1RPZA 3EWSA 3R0XA 1BO6A 1PNOA 1IYZA 2WR8A 1N1GA 1TZBA 3RK1A 3QX9A 4AULA 2HREA 5DVZA 5KVSA 2BR4A 2DTDA 4ZVOA 1W29A 1L0BA 721PA 4DVGA 1T0HB 1GAQA 4NWIA 1F12A 4RDJA 5DXJA 4C08A 1FMCA 3Q3HA 5EWLA 3RWMB 1KAMA 1QH8A 1EFAA 1C3OA 3KX2A 4JQOA 4RIGA 2BCJQ 4LV8B 3BSSA 4ISBA 4N65A 4UTRA 2NU9A 2GQFA 2CRVA 4G3XA 5C8ZA 4CKBB 1CQPA 1OPXA 4N18A 1JJFA 1P31A 1V8BA 2FR0A 1A5SB 2X7JA 3D6HA 2R00A 4XWYA 5DJ5A 2GM4A 4D1YA 1C14A 1PUJA 3E81A 4V0MA 2EQBA 3A6DA 3TE6A 2OPHA 1XVVA 4KODA 1L8XA 3ZCQA 3EXHB 5FWYB 5FOUA 5AW8A 1UKVY 2EWWA 2OMKA 4J03A 1A4UA 2VP9A 4OREX 1H6DA 1A72A 1DQYA 1ZI6A 1WM1A 3HN6A 1ZVKA 3QKUA 4DGQA 4KV9A 1QJ4A 3M6LA 4HXGA 2REQB 3HR4A 4MYRA 2FPKA 3OFNA 3WP0A 5KAMA 1UOEA 3DLTA 1N6RA 4IW3B 1NLMA 3FSRA 4ZCMA 3KVNA 2I8CA 2UVPB 2XKAA 1NZJA 3KE8A 2DG2A 3Q5GA 2PN1A 5BQPA 4ZV4A 1AZLA 3PKJA 5DWDA 1GY8A 1W7AA 1N0UA 2F3RA 4HDAA 4ZZ3A 5KQSA 3E5RA 4FEAA 1KQFA 2HAEA 4AXXA 4MHOA 5CVCA 2SCUB 3Q0IA 1EVJA 1O03A 4UUBA 4XJSA 4C4YA 3NDJA 1GUDA 2IZZA 4Y1FA 1GZ3A 3C7TA 3EDYA 2P75A 3P9QA 4AROA 5JT1A 4K6OA 5AH0A 3EF1A 3KTAA 5B7QA 1N78A 1G98A 2QVBA 1UD2A 2CFOA 3HWWA 1LRLA 5IN5A 4BN5A 3GT7A 3KRTA 3EVNA 2YZGA 3AGPA 4MKGA 4YCLA 2ID9A 3CWCA 2WUGA 3FTQA 4ND3A 2QAIA 3AEQA 4IDHA 1CY1A 5C5DA 1M90D 1LSUA 2I7XA 4XFDA 3V7UA 4CKCA 3RVSA 2IW3A 3PUMA 1C30A 2HRRA 2XIJA 3PDWA 4I4TB 3RBZA 5JR3A 3ZH9B 5CFOA 1I3OA 2ZUDA 2YJNA 2PJZA 1T1JA 2H7XA 5GZ6A 1EFDN 1G5TA 2VBVA 2WOJA 1ZHHA 4GLBA 5E4FA 1FU7A 3HBAA 3NS7A 3QY9A 4Y2YA 4LYHA 3T1YB 2ZL5A 3KFVA 1NVXQ 5AK4A 2A1UB 2ZL6A 2OBBA 5EIFA 4MR7A 5DXAA 5DXFA 2LCFA 4Q4HA 3T34A 4DB4A 2R87A 1HF3A 2VQDA 3AJ8A 3MCUA 1OBOA 1WL8A 2WILA 4ZI7A 2GZ1A 1AKNA 2QTCA 4KUHA 4N82A 4WOJA 1WDMA 3OA2A 2OB1A 2D2IA 1BEUB 3I6ZA 2P9TA 2AC2A 3KLBA 5SZHB 3TNYA 1AKUA 2IUSA 1C3EA 1A7UA 5J43A 2ORWA 5IK2D 3O9VA 1XU9A 3R9WA 3NBAA 2QBYB 3OZFA 4R0MA 2ZJOA 3CX3A 3G1TA 2HF9A 4MPJA 5A62A 1N2IA 2GETA 1RLUA 3IMKA 3LC2O 3TSCA 1OT5A 2RHCA 3M9WA 3UJ8A 1AHPA 1K8XB 1RWOA 2UZ0A 5B64A 2ZZNA 1TU4A 1NNUA 2XE6A 4LY9A 1VKOA 4ZEOA 2JFWA 4F3RA 2C58A 2GRUA 4DR4B 2WEKA 2A5LA 2QDXA 1PEKE 3WGYA 1EJBA 2Y1EA 5HZKA 1E2GA 1YV9A 4OJTA 1NBME 4C7BA 4DCUA 3N9IA 3OT5A 4BMXA 5ERYA 1GQSA 4KHZA 5JPCA 4XLEA 4GW3A 3LHSA 2WYOA 3EIOA 2XDAA 4HCJA 2D59A 2O23A 4F72A 3DHEA 5CVTA 5KTMA 1UBLS 3CV3A 5A2GA 4LFBB 3ITNA 2NZXA 1LVHA 4IILA 1G2PA 2NU7B 3WZMA 4OOXA 5ALDA 1LRJA 1UBHS 3JWJA 1R74A 5CJPA 5DLQC 4L08A 3AQIA 3L0SA 2B1RA 1ODIA 3EBOA 4A0RA 5FPQA 4D97A 5AVXA 1MO2A 4PZDA 3DOJA 3QWFA 1CUSA 2R1VB 4LI3X 3WA7A 4LF9B 4WZTA 2JFYA 4QG7A 3OPYA 1JHRA 2QT9A 3ZCPA 4GXNA 1K6IA 3FFAA 4BWFB 3H94A 1Y8RB 1GGVA 2P2CA 1TUEA 1HPLA 5FAXA 4BMCA 2JA1A 3CSDA 1LS1A 2FWAA 3N7UA 821PA 3CJRA 5BT8A 5IKEA 3CZRA 3N5KA 5A9TA 4MGYR 3RPEA 1XRLA 4BQFA 3BXOA 3OF5A 3E61A 3EG9A 3PDIA 4P58A 4RGVA 4UUAA 2KE5A 3GA5A 4PG6A 1UKBA 5JCJD 1OA0A 3LFHA 1K98A 1YS9A 3R7WB 1FOEB 3IPCA 1NPDA 2HSWA 2D3WA 3GMSA 1P19A 4J0CA 1EK2A 1G3MA 1XZNA 5C8VA 2DIEA 4PQFA 4HQFA 4ZANA 2P6RA 1Y6JA 3OPXA 2G8NA 5SYMA 4Y7DA 2X1VA 1JA1A 1FK8A 2PUEA 4KNWA 4N3CA 4M1YA 3AR6A 4D5EA 2V7QD 3GVPA 2X3UA 1VPDA 4MUKA 4MIKA 4M6WA 3I61A 2V8BA 4JKYA 1Z2PX 2XMCA 2E6KA 2GASA 4XR6A 5A3QA 4H9GA 2B99A 1KWGA 4EW2A 1G55A 1NF3A 2Y68A 3GLFE 3OQJA 3NOQA 3UGTA 3HUFA 2QA5A 2XLBA 4YBRA 1P29A 2WZNA 3GJSA 1SCQA 3NG1A 3OC0A 3AY7A 4ZT5A 1CUJA 3TW8B 4K40A 4S1PA 1QKJA 5HQTA 4KR2A 1K6EA 1NQTA 2IZ5A 1VLYA 2VUHB 4IXWA 3VNSA 4EDHA 5LM3A 2I9KA 1A9XA 2GJ4A 2X1LA 1J2UA 2QPLA 2GCOA 1XZGA 1R66A 3PQ8A 3BJRA 1VP3A 1KK2A 2B6NA 1E0DA 2NUTA 3TPZA 5BV2P 2ZB3A 5HQJA 2H92A 3DYBA 1N07A 2R6R1 3L1UA 4AKEA 1XQ9A 3B9RA 1QJCA 5TPZA 3KEGA 3F3MA 3A0UA 2IV3A 3AUTA 4ON9A 2OFPA 3RS7A 4R9SA 5LLSA 3WOHA 5L9AA 3NTOA 3GJ5A 2GK7A 4FXUA 1YU9A 1M5TA 2GK3A 2VKQA 2WHRA 1GD1O 2PAAA 3COPA 1Q91A 1SBZA 3B8HA 1YA4A 4XL9A 1GCUA 3DE3X 5DYIA 2FPOA 1ISHA 2WAYA 1W2BB 4NYJQ 4XN3A 2I54A 2Z2JA 3ZQKA 4RTQA 3ZYCA 1QVGB 1T13A 3LWZA 4KFTA 3SXPA 1SCUA 1QYVA 3OJOA 4FGZA 2F90A 4QGFA 9LDBA 2Z58A 2IXTA 3UUGA 5J4LA 1M66A 4M7PA 2X0IA 4Z9BA 1RZRA 3S6JA 1Q11A 4K8RB 4KXUA 1OC2A 3JVUA 3EDMA 5JD6A 3CRRA 2FEMA 1I6LA 3RYFB 4C76A 1OWOA 3EGVA 2GLXA 3S7TA 4ZJPA 3MTGA 2GR9A 3R20A 4IVNA 1U3CA 1V5IA 4IHAA 1YONA 4OHXA 4YMTA 4KVAA 5EUMA 4ZVNA 2Q5FA 4KN5A 1T36B 3C5HA 3H6GA 3QLUA 3DL7A 1B0AA 5EERA 5HRCA 1RFLA 4H1TA 2HOQA 1YR8A 1C81A 2H5IA 1T5LA 2QDKA 5ILGA 2ODWA 1SUEA 2X5KO 4IKOA 4F45A 2MWMA 4RENA 3SCZA 2IF0A 2G9UA 1LBIA 2B5VA 3Q9NA 4IZ6A 4L76A 3MUOA 4FYJA 3QEBZ 1UPFA 1Y7IA 3TX2A 1EVIA 3OQIA 5FWXB 2NV0A 3S44A 3AESA 5I7EA 1U1IA 2UZIR 4EGFA 5ITVA 4YQEA 2PGAA 4G1CA 3V7AA 2GBFA 3CNLA 2MSWA 2OLKA 3BXPA 2AOTA 3FWZA 2AQIA 3MTQA 4RA9B 4QECA 4CVNA 8OHMA 2H0AA 3H1TA 1BG6A 3NXKA 3B8EA 5GWXA 5EHZA 4U00A 4UHDA 5E4YA 2VT3A 3Q8WA 4HPWA 5IRCD 4RJIA 4EYSA 1RC8A 1UEIA 4OYYA 3I2FA 4TKVA 1SQ6A 5JBQA 5BVHA 2BELA 4WOKA 1T4GA 5IJZA 1NW7A 3A1SA 4TSRA 3TSOA 1G8FA 1MJHA 2E1PA 3G0DA 2QAGB 1MX5A 2FV8A 3EIUA 3K09C 1HFKA 3LLVA 1NBWB 4WK0B 2WE7A 4JBXA 5HCNA 4FM9A 1JMVA 1VE7A 2O3JA 4GVXA 121PA 4UAGA 5LA6B 2B61A 2Q1XA 1C4XA 1GPYA 1YBFA 4FFBA 4Y67A 3HB9A 5AM2A 10MHA 3PQ7A 5JRJA 4G0UA 1ZGBA 4ZPXA 1XJ0A 4BX2A 1PW5A 2VSXA 4HP8A 5FV7A 5BP7A 2QP9X 1VJSA 4FGKA 5DIZA 1SJ9A 3Q98A 2OHVA 2V9ZA 2B34A 1DO0A 4X8IA 5JFTA 3N2YA 4DZRA 5KYXA 4BFUA 3PHCA 3TNFA 1CG6A 4UTOA 3VSBA 2A9RA 3KL4A 2OTLB 4MRNA 4F06A 3WKAA 2C57A 4OF4A 2PT9A 1YDEA 2B7LA 2QMHA 4GI2A 4CF7A 1XRJA 2FW1A 3NBFA 3N8DA 3OCZA 4GC9A 3LX8A 4D8YA 5HUQA 1FPQA 3V9PA 3QBTA 3VC7A 3N0RA 5I9NA 1YGPA 3GVCA 5TEWA 3FPLA 1NWHA 1PHPA 2SECE 3A6GA 1WSDA 3NGMA 4GVLA 4RZUA 4OBWA 2HO4A 3BF7A 5CGQB 3KU4A 4ZQBA 4B8YA 4QJ3A 5H1YA 4D3ZA 4JFRA 4YUVA 1QZUA 3A3OA 3I62A 3TCXB 5B58C 2HZ7A 3AHEA 1AU9A 2E48A 3EVBA 4AFNA 1QF7A 1H8HA 1I13A 4GQBA 3ASPA 1K7EB 5JDCA 3C87A 2P2LA 2FWIA 3JATA 3Q15C 1IJBA 5I7AA 4UQPA 3P9RA 2Q7OE 1NJFA 3AR3A 1YJ8A 3M9LA 1HY3A 1WPRA 4DBLC 2G0NA 3E1YE 2BE7A 3AF0A 1W8IA 4DSTA 3FOFC 1S01A 4LOLA 1FMLA 5KWVA 1COZA 3TYXA 5DOZA 1M74A 2YYYA 2PUGA 4KGDA 4Q48A 5ELXA 2UYGA 4Z7NB 2F1LA 3B1WA 1EVEA 4M8KA 1XK6A 2EG9A 5IAKA 3ZWYA 5DGDA 4LRYA 3PX2A 3AFOA 4M7RA 3KIPA 1CSEE 3P2YA 4Z3KA 3O8OB 4PX3A 2VNSA 3CZPA 1O96B 4H7KA 5ALUA 1A2KC 1LK5A 3BSFA 4HVCA 3H7AA 2OXCA 3QVOA 1Q9SA 2CY0A 1BMQA 3AR2A 5MGBA 3MJHA 2PAFA 4GZMA 1V96A 1PD1A 4AY5A 4D7AA 5B6JA 2IGBA 1MVOA 3R23A 1XCOA 1T0UA 3MN1A 3A4NA 3CCEB 5DNDA 3VKHA 1T1GA 2HN9A 1V95A 4XQGA 1LZLA 2HU2A 2P9FA 1N9KA 2G5GX 1AX9A 1MRSA 2GPNA 3E82A 3IKMB 4ZEXA 3VH2A 3CVYA 4B3IA 2E21A 4UHEA 4PZEA 5DNEA 1HSOA 3F6PA 1D7OA 1MXFA 1VSVA 1XR3A 1Q86D 3T1HB 1ODCA 1C0KA 5C8YB 2IELA 2V6JA 3ACBA 3FIUA 4TYPA 2EQAA 4X1IA 1IBLB 5AKHA 4PTYA 1XVLA 3IP6A 1GRVA 3PUIA 5KJ6A 1SD1A 2CLKB 3DUWA 3HXPA 4KU4A 5BNWA 5KNLA 1Y9DA 2GJSA 3DZJA 3HJTA 4PYRA 2X8JB 2WB4A 1NSTA 3M3PA 4UULA 2HB6A 4LHZA 3B1XA 1R6XA 4JZKA 2ZJYA 2E4VA 2UZAA 5GGXA 3NWEA 2OK8A 4WVLA 5CDGA 1ZVVA 3N2GA 3IDSA 2C84A 3GVKA 4IGFA 5E7JA 4TL6A 2PYZA 4ZTZB 2O2IA 2B4AA 2O7NA 1MDFA 2LVBA 3KQWA 4Y8VA 4DLAA 4KR6A 2FMTA 3PWSA 3RIXA 2IYSA 3OFJA 6CHYA 2VWGA 4LYYA 1IH8A 1PO7A 2NT4A 3F1LA 4R1UA 2HA6A 1AHNA 1Q6ZA 4MVCA 4ZT6A 3NYWA 1MXHA 2NSHA 3LHFA 4GWKA 4FJ0A 2HV9A 1NUAA 4GXQA 1GDHA 5EKTA 4NLLA 4XM3A 1SXHA 3C85A 3OX3A 3PVZA 1NB9A 3SMVA 3WWDA 3U1VA 5TIIA 2IZ0A 3OF2A 3CMAB 5GV7A 1MJGM 1NM5C 2I1WA 2QZJA 2QEXB 1H2BA 1QVZA 1AUPA 2YQ5A 3P9ZA 1W88B 4HTFB 3RAJA 1BE1A 2Z30A 3I2KA 2QUBA 3JYNA 4N5DA 1KI2A 1SXQA 2RONA 2GVNA 2OV3A 4KNVA 4CZ2A 1TEVA 3U1BA 3CIFA 2GS9A 5E1OA 3TTVA 3PC4A 5ICCA 3PDUA 1OFGA 2VS1A 3LC0A 2QLJA 1GEEA 2RAUA 1OE0A 4F04A 5E9JA 2FWBA 1VL8A 2PS0A 4QTZA 3I52A 4JVLA 3FOBA 2HJHA 1WSAA 3UFXB 4C4TA 1DTEA 5HF5A 2XOEA 4E1VA 1DC4A 1QDLB 1U3FA 3EZNA 4EA6A 1E1CB 3KSAC 2FPSA 4G4SP 2E2WA 3W3AA 4IAOA 4JLAA 4EQZA 2W2XA 4OUKX 3H9JA 3WLNA 4WDQA 1VPWA 3BDVA 3O73A 3PUJA 2UUAB 1DV1A 4H77A 1LC0A 4K9SA 5KVQA 4NEHB 4HWOA 3O4IA 1U2GC 4YREA 4RE5A 4B3TB 5AJWA 1OBCA 5C81A 4I0WB 4JSRA 3DDWA 3SI7A 2N1MA 3AG5A 4RZIA 1MAVA 3ORSA 2YMMA 2O3QA 1AQUA 4L9WA 3ISJA 4W5JA 3N2NA 2G1KA 5ITZA 1UDXA 3KT3A 3N2IA 4LJ4A 3GO4A 5GTDA 1YT5A 1LPOA 1VZ3A 3OHMA 1OAOA 1S4QA 1UDCA 2HF7A 2PQMA 2QP3A 4HZUA 3DH0A 4RDHA 4RK7A 2BR5A 3GQBA 2ZXEA 3CVJA 4UM9D 1TM1E 4JCCA 2XQGA 1KXJA 3SU8A 2P6MA 1WQ1R 2G80A 2QL9A 3TKYA 3KQNA 1LJLA 3IULA 3BXHA 4Z4WA 2VTDA 2F8LA 3GMDA 2BM1A 5KTOA 1RAAA 2BM0A 1RHRA 2PXHA 1Y0RA 1K7CA 5LQSA 3ZXIA 2IV7A 4KI7A 4I55A 4YP0A 4Q1AA 4BRUA 3NBYC 2J1LA 2Q0XA 4MJ3A 3BSYA 5A02A 4MR8A 1X87A 4FYKA 2QSJA 4K28A 3HP7A 1M6HA 4KQIA 2E82A 2EGUA 4EW3A 5LZ9A 3CT4A 2V6IA 2PL3A 3PJRA 2NO1A 4IVPA 1KY3A 1B93A 1Z7WA 2I80A 1XPJA 4GLFA 1EDZA 4X20B 2ATVA 1FP7A 1YB5A 2VHCA 1KZ7B 1WHSA 3AINA 3UVEA 2VYNA 3HCEA 3KZ1E 3MW8A 4K9NA 2EEPA 4KQ2A 1WV0A 2H9AA 4NDNE 1CUVA 3QKWA 4ZICA 3FX2A 2W2QA 1AUOA 1OXSC 2Y9MB 4YDRA 4BO9A 3PFWO 2X14A 5BN3B 3KKLA 1EFRA 1JLRA 1AZSC 3VJMA 1C29B 5H3LA 1DFIA 1Y7PA 3A28A 4UNPA 1Q2UA 3HP1A 2BPOA 1HRKA 1N5DA 2GFIA 2BGKA 3P9NA 4PLHA 3HDJA 4RORA 2H2IA 1DKRA 2P6PA 3PUVA 3FYUA 1NXXA 1HNWB 4DSZA 1P3DA 4F12A 3KPUA 2ST1A 3B5EA 1P3Y1 4RO0A 1S96A 3NNNA 1DZ3A 2MHCA 4Q6WA 1V6CA 5GV8A 2VSQA 3IILA 3OLQA 1IHPA 4YT5A 2CXRA 3FSGD 2AXNA 1NMXA 2RGYA 3A4TA 1DX6A 4LVCA 4R8MA 4PU0A 4HG2A 1AXGA 3EFOA 3DZBA 4MB6A 2QTBA 5DTIA 3SYKA 4I46A 5IAGA 2PH1A 4PSDA 3IEMA 5CITA 4ZGWA 1K06A 4FFWA 4KLRA 3TCNA 4AX8A 4LZLA 2H4ZA 4NV3A 5B7GA 2GN9A 3H9GA 1W30A 3GUUA 3U5TA 4RIEA 4IM7A 1GTJ1 4AYWA 2PU7A 2WSSD 4QLAA 5FBWB 2N9UA 1YGYA 5FQOA 3EGIA 4DVJA 3UHJA 5F73A 3SJZA 3QA9A 1ULZA 1CJVC 2BBTA 1UWLA 1GPNA 2JGKA 3PCRB 4GL4A 4KPGA 4Q3KA 4UEKA 2DBYA 2JC3A 1KO5A 3GLHA 3SX2A 2D8AA 2Q2QA 3WIVA 4DRYA 3MXTA 4QU8A 1PBNA 4CIAA 5JPDA 1BH6A 5LQUA 3VZDA 5K3BA 4HAVA 2BGIA 1UH5A 1T0PA 5I9SA 3U4AA 5FUYA 3WGHA 4F21A 2YIMA 2ZI9A 1WXXA 2VJDA 4YJ2A 4MO9A 3VVBA 3C3KA 5F78A 4AP9A 1DWUA 2LPMA 3EBLA 2QG9A 5B37A 4B9EA 3MAAC 3F7NA 4HGQA 1QOZA 3TNJA 3FPGA 3GGDA 3RUAA 2DPYA 1DRJA 5B7NA 1UBGA 1ZBQA 3K35A 1J07A 5JY6A 3RS3A 1T26A 3UY4A 5L3SA 4LJ8A 4DLNA 1ZXBA 3PNVA 2UKDA 1JAZA 1KERA 2X23A 2HJSA 2IYQA 4K6FA 5ALJA 2G3YA 4AVYA 3NUQA 4FDAA 3HVRA 5KMGA 4Z2AA 5DWQA 4K9RA 4BXOB 1O0SA 3IQFA 1APBA 4CEHB 2VQ3A 4FMCF 1DFHA 3KB6A 3I6IA 4OO3A 4FOOA 4QYIA 2GDJA 2UUOA 4A6DA 4CM3A 5JASA 4MGHA 1P1RA 5E0KB 3CF0A 3LRPA 2NVWA 3QOYA 1W34A 2ZKLA 3CLVA 5E6RA 3BGOS 3NP7A 3DAFA 4WBSA 1H4QA 2GXQA 2AEJA 4I50B 3OESA 3AVXA 2ZS9A 1P0CA 5TX7A 2P30A 3DAGA 4N5MA 1J39A 1ZITA 3I1JA 3RRJA 4EHBA 1PL0A 4E03A 4X8MA 4PF1A 3P9XA 3CF4A 1PZHA 3FBWA 1QMGA 4G8DA 4L3VA 4OQZA 4OQMA 2EBFX 3WLEA 3AEKA 1NB0A 4EHIA 1QH1B 1TB4A 1YE8A 2G7ZA 3LUGA 4J7CA 1IOZA 2FP4B 5KZMB 1S89A 2FPPB 4UDXX 4IX9A 3QXSA 3DMTC 1DUVG 1GUAA 3E9ZA 5FQNA 4XQ9A 4UDOA 3GRAA 1XL0A 2AMJA 5ALOA 3W7BA 4GECA 3QG1A 2QRLA 2XTMA 1Z0JA 2NWQA 1YJ9B 1CRWG 2D1YA 4FDUA 2BSQA 5F4BA 5DTEA 3TVTA 3BIJA 4M38A 4G84A 5G1NA 3U9SA 1BRMA 4NV0A 4XGRA 4UCWA 4RH1A 1NVEA 2DH5A 3DEFA 3GC6A 3QLJA 1FTQA 3N2GB 1JG4A 4KQEA 2LIVA 4M54A 5CR9A 2NO9A 5BXYA 1KKUA 2WVGA 1HDOA 4FYXA 3HCWA 2RBKA 4YYZA 1XRSB 4GUDA 3MBOA 3MT8A 3HCCA 2OAP1 4EGJA 4ZYXA 2GHIA 2ACKA 2VF2A 3KZKA 1EESA 3HNPA 4BZZA 1NBAA 4GR9A 1C7FA 2HCRA 3QH4A 1NMYA 4R7GA 1Z6PA 2RAFA 4EPTA 5KOIA 4RLFA 4WIAA 1MA0A 2YWDA 2ZQYA 3PBKA 5DTMA 1XCBA 1PVOA 4N5IX 5GJWC 2DFPA 5AHWA 2HJRA 3KR2A 4Y6LA 3CX8A 2OBSA 4JY7A 1YFKA 2JIZD 2NUPA 1W52X 1Q0UA 2YCLA 5JXJA 3OW7A 2I65A 2JKYA 1Y81A 2ODEA 2VHXA 2XGOA 3NU1A 3NXSA 1HYEA 3OX2A 3VR1A 1V0FA 2OHOA 2XRMA 3RUHA 3VJRA 1P45A 2QVGA 4DRXB 1RFGE 1XIVA 3ILHA 4AUEA 3VO2A 2PIAA 3ASRA 4P3NA 4EY3A 4ZDIA 3TZBA 1LY1A 4Q01A 4QASA 3BT7A 1PL7A 4E5SA 5BWBA 1MB0A 3L7AA 5C46F 1N6IA 2QSUA 4RA6A 1PQYA 5B5SA 4OUDB 4YRCA 3EGXB 2PX8A 1NXPA 2WY2D 1K5PA 1Z4MA 3S2UA 2CNKA 4M89A 5BSYA 1UK7A 1PJQA 5IJ9A 2O20A 4HZIA 1Y42X 4PV7A 1KJJA 4ER3A 5JS7A 1EB8A 2XCUA 1MJFA 2YOHA 3B89A 1D6JA 3ZNNA 3NLLA 3OECA 3M0EA 2M6KA 3WLTA 4FI3C 4BTLA 2ABWA 4MP3A 5DM70 1WP6A 1QCZA 1GTG1 3GLSA 4UHBA 3JVEA 1JTFA 3W1WA 2ENUA 2I2DA 4FFLA 3RSOA 5CFRA 3U5ZB 1U9IC 2AEEA 4LBVA 2XJ4A 4TUYF 4Z4TA 3SPXA 1D3AA 1LLDA 1WPQA 3ASSA 2GZAA 3BQNB 4R9VA 5AW7A 2F3PA 1O94D 3F47A 4P84A 5FBHA 1Z2AA 4YMSA 3RRMA 3WFJA 3QZUA 2B0CA 1MMFB 3LMKA 1EZZA 2WSBA 4JI2B 1P5JA 4DR5B 4DG9A 4CMIA 4LBWA 3SLDA 2QN7A 3H18A 3NIDB 2ZTNA 3TM4A 5JH7F 2PGIA 1QC5A 4JUIA 3THYA 5IYZF 2VZ0A 5IBRA 3KTOA 3UNXA 3VYSB 3ETEA 1SURA 3T3OA 2H0QA 2ZTHA 1BIFA 2CEAA 4R51A 5HJ2A 5KYNA 4PAWA 4AQDA 3RY8A 4ZRDA 2C29D 1SKAA 3VR3A 1JPJA 4E7PA 2O7SA 2PMWB 1C0EA 3SQDA 1D1TA 1EHCA 3K9FC 4IDEA 2VH1A 5KSPA 4FFBB 3LCUA 4UUMA 3WZLA 3M2TA 3WR5A 2RMKA 3THYB 1QGZA 1Z5UA 1XTRA 2Y6UA 4MW0A 1KFKB 2BGLA 1OASA 3VZQA 4WJLA 4OATA 4Y30A 5DGIA 2XRZA 2CLOB 4TV8A 4KKXB 1JYSA 2CJYA 3PIDA 1J2YA 1UK8A 3RVOA 5HZHA 3GZNA 4JROA 4JENA 4Q3NA 1KIAA 3V2IA 1JQKA 3D8NA 1XCJA 4P83A 4RTJA 4FFMA 4N5LA 2W43A 2AHOA 2BGJA 3D8BA 3QP9A 2BEJA 2ZYSA 4QRIA 3B70A 2P8JA 3T5GA 1WOYA 2B9EA 3W5BA 3EISA 3JQAB 3A2MA 3GLIE 1Z4QA 3USZA 4Z7QB 4IDAA 3K1AB 3REQB 3B7WA 1OXUA 1DS6A 3CINA 3SXUB 4TRRA 3O4FA 3CCCA 4Q1DA 3VKGA 2SKEA 3MQ2A 4NF2A 1FJ2A 4C4RA 1F5SA 5DFAA 4O29A 3IERA 1FNBA 4OJQA 4QYXA 4XDZA 3VR4A 4ZTUB 2V1XA 1JIJA 1NP7A 2YYSA 4MVJD 2VT2A 3OQIB 4C0QC 5HKKA 3WADA 1PNVA 4C0SA 4IFTA 4UNQA 3TIVA 3DBVO 2EAUA 1XK7A 5CB0A 1NDUA 2JIPA 4M0EA 3DLAA 5HX7A 3TI9A 2DRIA 1ZM3A 4OP1A 3QE9Y 5BV7A 4Q4JA 3NDBB 4DJJA 1A2BA 3I9NA 4IUCS 1HT3A 3VPHA 1TZKA 4BWVA 2IYTA 4OPMA 1YDHA 4ALNA 3GNLA 5TF4A 1GTVA 2BY4A 2OGTA 1FY2A 3VU0A 2ZRFA 3F9RA 4FYPA 3U7JA 5ICEA 2GZMA 3L8DA 4QPNA 2W2MA 5ILQA 4RHTA 1OXXK 1RTTA 2DHCA 3E5NA 3B60A 3DWIA 4A1OA 3DG9A 4TTRA 5AFSA 5LZ4A 3K3PA 3MMSA 3DLHA 1U1CA 1S4MA 3OTGA 3EXIA 1IRIA 4AS1A 2XVMA 3I8OA 3ZE7A 4UUPA 3RVRA 3JD4A 3L46A 2WJJA 4XUGB 1PLJA 3ENKA 4UBNA 4L1KA 3R5FA 3RKSA 1LS6A 1RCUA 3NASA 1Q83A 2OFWA 3ESZA 3CCQB 1FRVA 1W4LA 5SZJA 5AIAA 2HDNB 2R97A 4JUFA 4MQFA 4NZZA 4K3VA 1FP2A 3U40A 4ZCIA 2V9CA 2APJA 1KY5A 3DC7A 3KZOA 3G0CA 4AJNA 1DG9A 1Y4SA 1ZHFA 1WB9A 2GNOA 3UKJA 1E6LA 3KOZA 4G0YA 4YASA 2PPLA 4BKOA 5BQ5A 1ZEJA 2EDAA 4OXNA 1HDYA 4MHSA 4RQUA 3G05A 1L7VC 1M33A 1Q0ZA 2CYBA 5AI9A 3KALA 5CNJA 2X0RA 1G8MA 3O4VA 1H3EA 2RHDA 2QYOA 3H1EA 5CRIA 3TO5A 3PGJA 4BLWA 3G0HA 4H7JA 1FUKA 4KE6A 1XELA 2ODQA 2XVAA 4X92A 3JZAA 2CKDA 4OHCA 1K86A 1ZM7A 2W2LA 2WUEA 3BK2A 3SEAA 2R44A 1GAEO 1SCKA 4OQPA 1AQYA 1WSWA 4PGGA 3TNLA 3LUKA 5KQPA 5J59A 1GG8A 4LC1A 5C34B 3HO6A 3PUYA 3SXUA 2B94A 2HO5A 4XKVA 3VVCA 3VJLA 2XHEA 4I3HA 4LDPA 3L8EA 4AP5A 2BKEA 1YVUA 1D8AA 3RGWS 5FPKA 3PD7A 5A89A 2HYDA 5J2TB 2H51A 2YZKA 3PQDA 2ZUVA 3EQ8A 5I5EA 4XAQA 4CDGA 4CN9A 1OXKB 3QPBA 1IIBA 2C9MA 2QVZX 2XQVA 1KSFX 3ORYA 3VNRA 2Q3EA 2RKBA 1K88A 4OH7A 4INPA 1T3GA 2C20A 3DGFC 3OKCA 5IMBA 3UMCA 1M1UA 3AVWA 3OQOA 4OGGA 1D0VA 3TQCA 2Q2NA 1SVKA 3E18A 3OOWA 5ES3A 4PZUA 4HAOA 4DW8A 3FVQA 3D7LA 5A7FA 4RTMA 1VL6A 2VNJA 2FQQA 2UZ3A 1UWKA 2PUVA 3PG5A 1MEOA 3TAUA 3M8KA 2HIAA 1YZFA 4FYVA 3EVGA 1DADA 1T8TA 3ASVA 1POXA 3GOQA 4E5DA 3OEED 3G49A 4IO0A 4IYJA 1WOSA 2FWPA 1XWIA 3LUPA 2C9OA 4H6XA 2HI0A 4BJHB 3QPCA 3ONUA 4BFVA 1P7CA 3LOQA 1XD2B 4F3YA 4A03A 3UYLA 3EIWA 3QJYA 3E7DA 4FX5A 3UHPA 3AP3A 2XKBA 1MGOA 5E1DA 5AW3A 3ZLJA 3QPAA 2ZXHA 3E8XA 4PHFA 1KPHA 2YNMC 4CTOA 3KWLA 4G0PA 1BZYA 4R81A 3U7FB 3EQ7A 3K9GA 3BJIC 2H9YA 3ZDDA 3G0GA 4EG0A 4ENTA 2DSNA 3HKBA 3ONEA 4RWEA 1R6VA 2A1TR 3G82C 1J5PA 5EMNA 2QVCA 3UG7A 1JT2A 5DSXA 1NN0A 3E20A 3THWB 3QBDA 1B1AA 4K9KA 4C0BA 4O0LA 1E32A 3LCMA 4TS4A 1N3BA 3LT4A 2EATA 4A0QA 3KJNA 1GTMA 4C43A 2XGJA 1ODKA 4L4SA 4EF6A 2CZQA 1E8NA 3GH1A 1GUZA 4Q47A 1MAAA 5EJ8A 2AZDA 4P4SA 3SZLA 4BNLA 1JXOA 2VA8A 2VYVA 4H59A 3W79A 4OQLA 2Q6OA 2C77A 1X0VA 4MWZA 4MVYA 3VSDA 3EMKA 4RD0A 4YFYA 1L5HB 4AMVA 2B4RO 1SKYB 1DT3A 1XWWA 1P9NA 3IRUA 5IJ0B 1IVSA 1QFZA 3A10A 4DT1B 4QJBA 1C8KA 1HWYA 3QEKA 1EG2A 5EHIA 2GTHA 1CQJB 3D4PA 4DSOA 1FYVA 2ZJAA 2E4UA 2IFTA 2J0UA 2OD7A 1GQRA 2YV1A 4IKEA 4U7GA 3VR6A 2W2VA 4DUZB 1OKKD 3NH9A 4HX2A 4K88A 3TTTA 2CB0A 2NADA 3AILA 2BMDA 4FSXA 3HO8A 2XXBA 4REMA 4UBJA 3SXJA 3ABSB 1TPZA 4XVQA 3G6WA 1HH4A 1VJRA 3VHRA 4UZFA 3MINA 1RYDA 1DTWB 1GNLA 3GRPA 4HWPA 2OSVA 2AOWA 1SCIA 5IJ0A 5EAIA 4F6CA 1SC1A 1EP9A 1KK3A 1CRQA 2WUVA 2QG6A 5KX5B 4JH0A 1K9SA 1JPVA 2FMXA 1P0PA 2CNLA 2G1JA 2JHAA 2YS7A 1YNOA 3HJRA 3KYCA 3LA6A 1F5NA 1JEDA 3H5AA 3KQQA 3HU1A 2BBSA 3B1ZA 5EMLA 5KX5F 1OH8A 4KK3A 2C9BA 2LW7A 3UFXA 2OZLA 3BMNB 3L6RA 2L18A 1XN1A 4BS9A 2X6XA 3I76A 5J3OA 4AF7A 3N86A 4II2A 4RFVA 4PHGA 2C8KA 1KEKA 1O77A 2H1RA 3FHOA 3FOCA 1UBKS 2X3FA 3HFRA 1TUBB 4KYTA 1O7JA 1MOPA 3FWPA 4L6IA 4FGWA 1X8JA 3F7TA 4U0KA 3HB0A 4MS4A 4LC9A 2YX1A 1RPJA 3KL2A 3QTBA 2JKZA 4YCDA 4RSRA 1UM9B 2G8LA 5A2QA 3FJ1A 1NUQA 2Z2IA 2SKDA 3AJEA 3DULA 4HOYA 5IT9A 4O2BF 5EHNA 3P0RA 1VCHA 3GZNB 1Y4DE 4WRRA 5UKDA 3QVTA 3BPSA 4NSNA 4Z8YA 1YITB 4HRYA 2H5EA 2O3RA 4N7JA 1E9AA 1IOVA 1N7JA 3CC8A 4GQAA 4MS3A 4LRQA 3K0KA 2MR6A 4DPMA 3QX7A 3AWIA 2VYVD 2VI5A 2ZR8A 4JSTA 2PZJA 4XARA 4F9FA 4BTEA 3NEYA 3NHFA 4RTKA 2XUFA 3W6PA 3O03A 4CT0A 3O94A 5EE1A 1P9LA 4CFSA 3JTMA 5MN6A 3AUUA 2X4DA 5LL6P 2I03A 4FFVA 3O3OB 4DHWA 5AMXA 4ND6A 1L7AA 3U4DA 3ZGOA 3PCTA 5FOSA 2X22A 4OAPA 4C7VA 3SR0A 2PLNA 3INNA 2XUGA 2Y1LA 3MHPA 3L07A 1RVDA 2XE8A 1ZD1A 2H52A 1JH8A 4KN9S 4KXXA 1XNQB 3F9CA 3HUDA 1UDRA 4XQ0A 1PJ7A 1HE2A 4GP6A 4EJFA 2XT6A 4HAWA 1XFOA 5JBNA 3T3EA 3I1FA 4FCWA 2IHBA 4X20A 2AG0A 2HPZA 2GYWA 2FR1A 2IOFK 3VMMA 3SEQA 4UEWA 1WCV1 3FVTA 1NNI1 4GZLA 4Z4SA 2GN0A 1LX7A 5KDDA 2YMPA 5CD9A 2Z4SA 2VF4X 4M36A 1JFVA 2QN6A 2I91A 1J49A 3QE4A 1Y5RA 4Y2TA 2J87A 3WJ7A 5DLPA 1PJ6A 1RBMA 5B6IA 1IG0A 3HG7A 4AIIA 4LHVA 4XX0A 4CMEC 1TCBA 4YV0A 4C0AC 1QVWA 4XYGA 4BJ5A 3BL8A 2XDYA 1EVQA 4CCAA 3BMQA 1V16B 2FB9A 3GUYA 2WD7B 3OIGA 3T38A 3UFBA 4BVAA 2BYTA 4MVXA 4UE6A 4WA8A 3O4RA 4J0IA 2WT9A 1P7PA 4XCXA 2I7DA 1A50B 1Q95A 2PBLA 3IIEA 3W05A 5ECDA 1X7ZA 2E5FA 5AUPB 2GN4A 2HPVA 1P7YA 4E12A 7REQB 5DSZA 2I6XA 5FOVA 2B37A 1GPH1 2E5WA 3F7OA 3GLTA 1TKAA 4LS3A 1OR8A 2OBLA 5DM2A 2WJ4A 3WKDA 4D43A 5CB4A 3W5DA 3V00A 3OH8A 2CNWA 2OV6A 3U19A 4UBMA 1NVVR 2V97A 4DWVA 1DDIA 4V0ME 5LP6B 4BC0A 4BIMA 3U4HA 1XEAA 5FDFA 1VHQA 2F1HA 1GOTA 3FMIA 4UTPA 3L5OA 4XR9A 4HNUA 4RTPA 3SLRA 2ZU6A 3V7WA 2XTNA 5HWSA 3L0IB 4O59O 4CEIB 4H60A 4FDMA 2XX3A 5H82A 3IO3A 3IV9A 3ADCA 3HCDA 5L4SA 1XMXA 3U13A 4KZPA 4G0OA 4KH1A 1DRVA 1MP0A 3B1KA 3B36A 4G9GA 5B1IA 5FO0A 2XA1A 1IN1A 3IT0A 4R2IA 4EPXA 4D8UA 3GL9A 3K9LA 2HTFA 3CD6B 3IDQA 2OBYA 5AI6A 2C7RA 2EYUA 2CKMA 1CZRA 1DC5A 1NJ2A 1XYYA 3K6KA 2OXEA 5FIUA 2UAGA 3KSRA 4NCIA 1XZLA 1BA3A 1CW2B 2QRUA 3LX4A 4NG5A 4RV9A 2TRSB 1EXWA 2VQEB 4B6GA 1OLXA 1EHYA 4JLSA 2CL5A 3CS3A 3OY7A 2Z5VA 4X7RA 1NGSA 5T4FA 5EWJA 3RIYA 4ARIA 4POOA 3U4MA 2CUKA 1UXHA 2PJRA 5BV8A 4O2LA 4LZAA 3TRDA 1U5CA 4NZNA 2AN1A 2VSFA 3W8FA 3BG5A 3QUBA 4B47A 2C9CA 1QQ7A 1TYEB 4FJ2A 3SEFA 2YDXA 2AUNA 4NICA 1M6WA 3IAM6 4LQLA 1C30B 4R01A 5DHFA 3R7DA 1QR6A 3RD5A 5A05A 5JZ9A 1ZU5A 3CLSD 1NBHA 2DJIA 2ZRJA 3Q11A 4LA4A 4NX2A 2WJVA 2ZBQA 4E5PA 1S6YA 3RV4A 5B6PA 2PMBA 1Q7GA 5TQ0B 1FS5A 2IXBA 1HBJA 3D02A 3QKSA 2MSDB 1WIWA 2FSHA 3A1VA 3HWX1 4KKVA 4OV6B 4PYNA 1K7XB 1Z0SA 1PNTA 4QV2A 2CVQA 3HGMA 4JMPA 1ZH6A 4PCVA 2W22A 1N2OA 3E5MA 4XR4A 4XWTA 1SBTA 1T8UA 3N7AA 3PL5A 3RKRA 1AUQA 2IS2A 4R54A 1GR0A 1D07A 1TYZA 2ZB8A 2HU5A 4MIOA 5F1PA 2BD0A 3JAKA 4WXHA 3V46A 2BGTA 3K0SA 1ISPA 1AO3A 3H97A 3ZJUA 2JIBA 1M2EA 1VLZA 1W8DA 2H85A 3A6LA 3INRA 4L6AA 2XYHA 4TKUA 4AJOA 5LFAA 4YRBA 1QG2A 2AR7A 2H2AA 3H16A 4JGBA 3V33A 4DCJA 4QU9A 2VF8A 2GAIA 5K8CA 4E46A 3EXFA 5FI3A 1TCVA 1EX1A 2ZJ2A 1VQ4B 1OFHA 3RADC 1J25A 1IUNA 4XOUA 4XNFA 2FUNB 1P7VA 3D3EA 4FKZA 4IDDA 3IE1A 1EINA 1VJGA 5I4IA 3GVJA 1GEGA 1Q7RA 4B2YA 6ADHA 1I7SB 2F2TA 2H65A 4X1KB 1LI7A 2V55B 3AO0B 3I9MA 4M9CA 2AOUA 1ZVQA 1T9KA 3IVCA 4HNHA 5JG7A 3Q8LA 2HZBA 1WZNA 1YK0A 4I8IA 1I8DA 2CFCA 3K73O 5HJEA 1NVVQ 4DC0A 4HQNA 4MW2A 2BJVA 1WX1A 1PG2A 1SN7A 1ZOPA 5EVCA 5G53C 1NM5A 2HT1A 5GZ1A 1D4FA 4JP1A 5HGJA 5IMSA 3KEOA 3TAXA 3LPDA 4NRDA 2JZNA 4HDRB 4WAUA 2EF0A 3H1PA 1GGFA 3EGEA 5EZ5A 1W5EA 4ZOLB 3QHPA 5JRZA 1H2ZA 1R6BX 5EN4A 1ZIOA 3F78A 5G02A 4U6NA 2FPIB 5BN4B 2A33A 1CEYA 4FLMA 5CVUA 2R1ZA 3FRJA 5ANRB 2I6SA 3RDPA 3IAUA 4F5WA 5BN1A 5FBZA 4FGSA 4R1MA 1P0MA 3UAGA 3CB2A 1IPEA 4FILA 2QRJA 2VDWA 5E6SA 4M88A 5FLKA 3ZGXA 1MDBA 3D8RA 1R9JA 4QRHA 3KEQA 1ITZA 5JZVA 3ILSA 1N08A 1IBKB 5DS0A 4W1QA 3AVPA 4O4JA 1SOVA 3ZWAA 1JHXA 4J2HA 1E6CA 2NTNA 4TKOB 3DOOA 3K4QA 3K8YA 5KQMA 4RM2A 1ZBDA 3ZJYA 3J7AC 1Z38A 2JFGA 3FKQA 4ZCSA 3WGGA 3F9IA 1Z3CA 3MBKA 3SN6A 1OHHD 5I8WA 1JALA 3KXKA 5IZCC 2HBZA 1KDZA 1K27A 3BZWA 5LMCA 4C6TA 4GRDA 2IU0A 4XPIA 3DMRA 1V0JA 2IYUA 2X5OA 2UZ4A 1RXVA 3VZBA 5FUBA 1YL5A 4N0MA 3DXFA 3V97A 4C4XA 1QRUA 1E1LA 3GPDG 4M22A 2BZ0A 2YUTA 3OEWA 1ABFA 3WGMA 2JI4A 1GFZA 3ZD6A 3OPYI 5DNWA 2IP2A 1L5VA 3X1XA 1NNSA 1IDOA 1YJ5A 1I7PA 1CV2A 3GEPA 3W8NA 1X13A 1Z0UA 1QGOA 4IQ8A 1EUDB 1Z9BA 2Q3CA 4MNTA 3D8SA 1PL8A 1YCGA 2NUBA 1DOHA 5TV2A 3VU9B 1U2QA 4X1IB 4ZVTA 3W5CA 1O6GA 4YI3A 3IP3A 1CR1A 1VQ8B 1ZUD1 1Y37A 4L8GA 1XLTC 3FW1A 4J4TA 2XYPA 3T7KA 4DG8A 3FA2A 4IIJF 1ZSNA 4HD8A 3T7AA 4JYAB 2JFHA 2EZTA 3L49A 4DIMA 1TUIA 5K3OA 5FD8A 1E5XA 3FR8A 4M49A 1T2CA 1FRFS 3QNUA 3NKVA 1RE0A 4CI0B 2C4MA 1P2VA 4A2PA 4V03A 1ZNXA 2O2EA 2A59A 2P7IA 4NK4A 3EAQA 2HLPA 5IAEA 2C04A 3W4KA 1CJMA 1E2EA 5AW5A 1CY8A 4RJJA 2B0JA 1QIGA 3DMGA 2PX5A 4YPOA 4WKGA 1I80A 4E4YA 1FMTA 3D8TA 2IYYA 2IDJA 3PC3A 3QEMA 3LLUA 2FPGB 1P4HA 2GUWA 1QX3A 4MR8B 3CEPB 2VKTA 4Y2JA 5EEHA 4CMJA 5I01A 2XB4A 2ZIXB 4GSKA 4IV8A 1XZKA 2FFJA 5FULA 3OAAA 2VIIA 4ARCA 1FDTA 3DQQA 1QG0A 4RDLA 1I10A 3VUEA 1BS1A 4HUTA 1QRDA 4ILKA 4RVGA 1NTRA 4ZQEA 4BNXA 4BKMA 1IQRA 4B83A 1A96A 1R0KA 4YXFA 1UDAA 2FYTA 3BE6A 3V5NA 2WJGA 5AUOB 2IZ1A 4HDNB 4BJ1A 4XRRA 4CKZA 1K89A 4B3HA 4FTWA 2XMBA 4IEFB 4CJXA 3ZZNA 1G8JA 3LXXA 3N2LA 3QVXA 2PKXA 2VAVA 1GCAA 1DQSA 1TVKB 2D3NA 1KBZA 1YQXA 3GBSA 4FE7A 4LX0A 1VQLB 2XEDA 3I6QA 3ZE6A 5BPHA 4LF4B 1SUPA 2CL0X 3OEHA 2QTGA 5IEBA 4WK4B 4R8KA 1H2YA 2CF4A 1EU1A 3CNQS 4I5IA 1XU7A 1G3RA 4O1MA 1PV1A 4Q7MB 3HL4A 4EENA 5BSWA 3I9LA 3SC2A 4RULA 1IEQA 3H8SA 3MWDB 2PZMA 3GLUA 1OX6A 4KE7A 1E4EA 3QEJA 1O5OA 2CCKA 3OJFA 4BFSA 2Y1XA 3LWNA 1KL7A 1TKCA 4D9JA 2COUA 2JJ1D 4MW9A 4BMSA 4MZXA 4LE1A 4ZO8A 6AT1A 4HDKA 4UBKA 1XU4A 2J59A 2Z2KA 4P4TA 1I5OA 4WK2B 4GNKA 4EA7A 2NT3A 3U3MA 1X2BA 5I8ZA 1EP3B 4O4LA 5FLEX 1J56A 4M55A 3ZS9A 4HLDA 1V0EA 2WHYA 5K4HA 3QE2A 1R4AA 3NCHA 4EI2A 2ECOA 3K94A