1OGIA

Ferredoxin:nadp+ reductase mutant with thr 155 replaced by gly and ala 160 replaced by thr (t155g-a160t)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP+ REDUCTASE
publication title Involvement of the Pyrophosphate and the 2'-Phosphate Binding Regions of Ferredoxin-Nadp+ Reductase in Coenzyme Specificity.
pubmed doi rcsb
source organism Anabaena sp. (strain pcc 7119)
molecule tags Oxidoreductase
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ogiA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1ogiA02
2HMAA 3WNBA 1DDIA 2DERA 1QGAA 4RD3A 4RCYA 1KK3A 3CCQB 3W2GA 2QDXA 4RD0A 3B78A 4RD6A 1YI2B 4ZCLA 1H85A 3OZWA 3ZBUA 1Q7YD 4MYTA 1YJNB 3CC7B 1GAWA 1TVCA 2J7KA 3ZC3A 1Q86D 1Q81D 4BPRA 3CCMB 2BGJA 2QN6A 2VNKA 1QFJA 1D8TA 4QFMA 1WDTA 1EFTA 2YWFA 4AF7A 3CCVB 1JA1A 1J9ZA 1W35A 3LYUA 1D2EA 1GO2A 3CCLB 3CMAB 2OTJB 1VQ9B 1KJZA 1QFYA 4ACBA 1FDRA 2YWEA 2CRVA 4B43A 4AF6A 4RCZA 4G5GA 4TN1A 5THXA 1ZM4A 3U6BA 1S0UA 1D1NA 3J81k 1E62A 1VQOB 4YAUA 3U6KA 3G71B 2QEXB 3CCRB 2C78A 4TMVA 4J0QA 5TY0A 4RD4A 1H42A 3E20A 3LRXA 1DG1G 2XEXA 1KQSB 3LO8A 1SM4A 4NBSA 2DCUA 2NPFA 4RD2A 1FRQA 1VQ8B 4B3XA 3OZUA 4C43A 4TMWA 4YAOA 2VNJA 4M4SA 5DSZA 4M53A 3VNUA 1AIPA 4C0SA 3ZZTA 2GPJA 2EIXA 4Y7CA 2PIAA 2QTLA 2B7BA 1FNMA 2VNHA 3LVBA 1DARA 1Q82D 3JQRA 4N3NA 1BX0A 3OJXA 1GR1A 4P6VF 1GVHA 4TMXA 4ZV4A 2BGIA 3CD6B 1EP2B 2VZLA 2AHOA 1VQKB 2BF4A 4ZGNB 5GV7A 4YALA 1HA3A 4M1KA 4DQKA 4FK8A 1QH0A 1R5BA 3AVUA 4WQMA 4ZCMA 3W5HA 4HE6A 1NDHA 1QVGB 3CCJB 1G7CA 4Y9UA 4H9GA 1ZUNB 3VMFA 1OGJA 2XNCA 1W87A 1VQ5B 1OB5A 1GJRA 2E1RA 3CPWB 1BJKA 1BQEA 3AVYA 3W2EA 2OK7A 4K1XA 1KK1A 5H59A 3CCUB 3U2QA 1ELOA 1UMKA 3AGQA 4Q7JB 1TUIA 1QFZA 1K8AD 1F20A 2HCJB 4YAWA 4ZGQB 3B82A 1QGYA 4U9UA 2DEUA 1EWYA 4TMZA 1KC8D 5TV2A 1QUFA 3W2IA 3VO2A 1K9MD 1DDGA 3MCAA 3I1FA 3AVTA 2BN4A 1JB9A 3B8HA 1KD1D 4DQLA 3G4SB 1VQ6B 1CQXA 1YJ9B 1VQ4B 2BSAA 5AN9A 4UAJA 3JQQA 4PC3A 3V76A 1KK2A 2B7CA 4P3YA 2YWGA 2BMWA 5EMNA 4ACAA 1QX4A 3WYAA 4Y9RA 4R71A 3VO1A 3WY9A 2BPOA 1TTTA 3QFTA 2HDNB 4RJLA 3CCEB 4TMTA 3PENA 1BX1A 4FN5A 3A1FA 3MMPA 3CCSB 5HXBA 3QE2A 3SJZA 2DETA 3QFSA 2R6HA 3P26A 1VQMB 5KSWB 3OW2B 1OGIA 1CNFA 4MYUA 2X3UA 1JJ2B 1KTVA 3WBKA 3ZZ0A 2BM1A 1XE1A 2RC6A 1QUEA 1W2BB 1N0VC 1U2RA 2FX3A 1EFCA 3CC2B 4LBVA 4M0LA 4YAFA 3AVVA 1VQLB 3QSYA 1IJEA 1CNEA 2OK8A 1VQNB 1I7PA 2EFGA 2VNIA 4PC1A 5FA6A 1W34A 4B47A 3VNVA 1ZM2A 1E63A 2D74A 2VYQA 2XNJA 3OJWA 1YITB 4LBYA 5H5JA 4N3GA 4G1BA 4LBZA 4PC7A 1FRNA 3MHPA 2BM0A 3P27A 1OB2A 2BV3A 1G7SA 4QHYA 3AGPA 2OTLB 1KK0A 3QFRA 1B23P 3G6EB 4PC6A 1N8RD 1EXMA 2GQFA 1FNCA 4IW3B 1FNDA 1TLLA 2RC5A 1R5OA 1JNYA 4PC2A 1JA0A 1VQ7B 1AMOA 4HE5A 3CB4A 1QVFB 3CRZA 1IB0A 2DY1A 3ZZUA 1EFUA 4FWTA 1R5NA 1QGZA 5GV8A 1YIJB 1B2RA 1QG0A 3CW2A 2QMUA 4AC9A 1GAQA 1SKQA 2CNDA 3ES9A 4B44A 5TR9A 2YWHA 1N0UA 4RD1A 4B48A 3AVWA 3ZBTA 1YHQB 1EP3B 3FJOA 3W2FA 1E64A 1G7RA 2QTZA 1KRHA 3E1YE 1G7TA 2ZITA 1XB2A 2QA4B 3JQPA 4M2LA 3W5VA 3CC4B 4YHBA 2PLFA 3CMEB 4NCNA 3WBJA 4EH1A 1VQPB 2PMDA 1M90D 3WXMA 3QFCA 1S72B 4B4DA 4PGOA 1ZM9A 3W2HA 3WNDA 1ZM3A 3I55B 1NJID 4ZCIA 1EP1B 2C77A 3OZVA 1YJWB 2B5OA 1K73D 4LC0A 5JBQA 3I56B 2BVNA 1IJFA 3FPKA 1M1KD 3CXCB 1FNBA 3WNCA 3AVXA 4LBWA 4F7DA 1A8PA 3W5UA 4G1VA 1F60A
chains in the Genus database with same CATH superfamily
1YK1A 4RJ2A 2C4TA 1DEAA 2HV8A 3BT7A 1W59A 4DS3A 4RD3A 1F17A 1H9BA 2PQ0A 4ISBA 1G6KA 1AF4A 2I33A 1TF7A 3HADA 5K8LA 4IL5A 5K05A 1VYUA 2UYQA 2FRVA 5EVCA 4GYJA 3ZD8A 4YO7A 3T5PA 4MYSA 4YRIA 1WB5A 3PHCA 4RQBA 4BP9A 2P2GA 3WGGA 1C1HA 1P2DA 4MS3A 2PUCA 4ZC1A 1U8FO 1U9JA 1UBKS 1NXTA 1ZCJA 2J08A 3K0BA 1SVUA 1YR9A 4GFDA 1GSAA 1L4BA 4WCFA 5CH3A 5B1DA 3ZK7A 4HB0A 2Q2QA 3KHTA 4LYFA 3QGMA 3WSTA 4FZJA 4IXWA 4M99A 4PLVA 1ZD8A 5TJ9A 1XTJA 5JD5A 5ICFA 1TA4A 3O8CA 1E3ZA 4FEGA 3HYCA 1KP9A 4PRKA 1X8LA 3GHYA 4EBFA 1PR1A 2ZSDA 3RHSA 1T3HA 1CZHA 1XQYA 3Q98A 4HXFB 4EBBA 3O2JA 3HKDA 4GKVA 4LJ5A 2IA5A 1V16B 2JLRA 4BO8A 2JRCA 1NLYA 4Y0NA 1JU3A 1MGOA 4GEKA 4UDXX 1Q3KA 3IT1A 3R6DA 3F3KA 5CU7A 3N87A 4EDFA 4EJSA 2N9UA 1GU0A 3ABIA 1S2MA 2JFNA 1X77A 4LY3A 1DBIA 4D8TA 4ZYYA 1VYVA 2XUKA 5AD1A 2PK3A 1EUDB 4TSFA 2DTEA 3QHPA 2D5LA 3OVMA 4WEOA 5LZ9A 2CBZA 4FDTA 1B41A 1EM8B 2C42A 2YWEA 3UUWA 4BO0A 1GG8A 1NJSA 3HZRA 3RAJA 5REQB 4GUDA 5T6MA 3BZBA 1O03A 4ZREA 1II8A 2JGJA 1M2WA 3PXBA 4AZVA 3FCAA 2BMDA 4OBEA 1U7ZA 3QEBZ 3CWCA 1UFVA 4OEHA 3W8DA 1HL3A 3SDSA 4YCMA 2ZBDA 3ONUA 1MN6A 5CAEA 3UMYA 4ZHQF 3SZ3A 1O97C 2MYUA 4P1VA 2LV8A 1YB5A 4JBHA 3C74A 3J81k 3OT4A 4R9UC 5JSZB 2I2CA 3MXOA 1TJ4A 4W5OA 3TI7A 1KFCB 4F3RA 6LDHA 1Y37A 3BC1A 3FX2A 4OHWA 3DL0A 2DYKA 5BSVA 3GYBA 4IOMA 4J0QA 3DMHA 5TX7A 3EXHB 5E1BA 3VH3A 1XWWA 2HPVA 1H42A 1EVYA 1OV6A 2AFHA 3C3DA 3KEOA 3Q3JB 4FYHA 4KKXB 4L0DA 3SOZA 2W58A 4RIGA 3F67A 2OCXA 2H5IA 3EEBA 3JPWA 3EFEA 1M2HA 2AH5A 1FP1D 4RV5A 4ES6A 5MN6A 2H4YA 5HOQA 2PUAA 4NBSA 4HLQB 2I91A 4KFCA 3ORQA 1TUBA 3T5CA 3HY6A 3LNNA 3AHIA 3GNTA 3C15C 1JG3A 2P2ZA 1QC5B 1GCUA 4G0MA 4WOKA 3A04A 3T15A 3ZJUA 4EW2A 3GB9A 4NOMA 4CF6A 1IH8A 2OCYC 2QF7A 1U2GA 1YVUA 1ORVA 5BSXA 1E9EA 2RJOA 3BDVA 3FBTA 4IFEA 2F59A 5DM70 2H1SA 1S2NA 2NZXA 3T1TA 5CD9A 4IUDS 4IDAA 3SC2A 3Q6NA 4CIWA 3H6GA 2EW8A 3QOXA 5AXDA 3SHTA 3ET4A 2UZ1A 1ZHFA 3CLSC 1V37A 5IJAA 2C07A 3UG7A 1JAIA 2XTAA 3CLKA 1FXUA 1NVKA 2IYYA 1ZIXA 2PPLA 4HQ6A 3HH8A 3A6LA 3THXB 2QIPA 3GQBB 4OQNA 4ISCA 4ALJA 2BZGA 2BRUC 4FZRA 3GFTA 3ZWOA 5CNMA 1Y98A 1SOVA 4QTZA 1FS4A 3G17A 2J6CA 1UK6A 1OI4A 4FS3A 4XDHA 3SYRA 1Q82D 1KTIA 4UCWA 1U0JA 2VQDA 2OUIA 2XVAA 3WFIA 1L5GB 2PKCA 2Q46A 3ESXA 3C16C 5T67A 5FOXA 4BVAA 4FGKA 1X0XA 4M88A 3OC0A 1T91A 4XYBA 4J4HA 5B7GA 1V1MB 1VTKA 2VRCD 3NHPA 3UAXA 9MHTA 5HTOA 7GPBA 4HSEA 4IJVA 1ABFA 3A70A 5K8VA 1XDGA 2ZK7A 2VG8A 2BLLA 2G63A 3UXMA 3A1TA 1M6YA 4RIHA 1PJCA 3GDWA 5IKEA 3HY4A 1UZMA 3A9VA 2NWQA 2V6MA 3HUFA 2IXBA 3IB3A 3KSRA 3T7RA 3NZEA 1J21A 3DXZA 1ZPDA 2X6QA 2IPMA 1VL5A 1SCUB 2EATA 3DT6A 5K3AA 5T5QA 2DM6A 2O4UX 4TKMA 4B73A 2VCEA 3EB9A 1BVYF 3EISA 3JASA 3OJOA 2PR7A 1GR0A 1WP4A 2CNOA 1E7WA 1QO9A 3OBIA 3FWPA 1BEUB 3QFFA 3ZGNA 4M1WA 4B8YA 4ZOCA 3RUHA 1F0PA 1PBTA 3LW7A 1XAHA 5BSEA 2JEZA 4QDKA 2XZDA 3K4HA 4RFSB 1R1DA 1PT5A 2FEWB 1FTNA 1UDRA 4G8JA 4F71A 3P96A 2Z57A 4NEGA 4ZVKA 3JAWA 2V98A 1W87A 1XDWA 4WNYA 3DCIA 3OT1B 1ZD5A 2OZLB 3ANMA 4IFTA 1YJCA 2NUPA 2Q49A 2YFHA 2JGAA 4KCGA 1HY3A 4FFVA 2EBHX 1GGFA 1FUEA 3DAPA 3RASA 4HDQB 4QGFA 4OGLA 3W2EA 2BFBB 4JI4B 1DG3A 2FWRA 3G85A 4RQUA 4UPDA 1P62B 5JRZA 5KYWA 4YP1A 3JS5A 5TE9A 4ILKA 3T3HA 1CY0A 3ZU2A 1UMKA 1PAUA 2DGDA 2CLHB 4K6GA 2DBQA 4XTRA 4Y6GB 4BIMA 3L0BA 5LM3A 3ICOA 7MDHA 2RGWA 1GV1A 2HFKA 2IEAA 1HT2E 4ZOQI 4IJWA 4OI1A 4H17A 4X7CA 3NHJA 2HJGA 2ORED 4QRDA 3B12A 4LNHA 3MJDA 3NHWA 1RXVA 2PJZA 5HIJA 2DEUA 1EEHA 2E4YA 2W6MA 3R8CA 1PTJA 2X8LA 1V35A 3WHPA 5CFLA 1QE5A 3ZXUB 2PX4A 3MN1A 4O29A 3O8OB 5DHQA 3NVKI 2VH2A 3CEAA 1NU6A 3GEIA 3LBFA 5FKJA 2H48A 3PFFA 1I18A 4MQMA 4MWGA 2QNIA 3J81A 3OTIA 4B45A 3AVTA 4X7PA 1YDFA 4BJ1A 5D86A 3ONDA 2QAGA 3DZFA 2PRYA 3FOWA 5IANA 3DO6A 1ZNYA 4LY9A 3BB3A 2I1QA 4B3DA 2GTHA 1SU4A 5KOIA 5LKRA 1Y6QA 1W4AA 4X62B 1SMKA 2QRUA 4OXNA 5ED0A 2CDRA 5DYGA 5EKDA 3AHJA 5LC1A 4AS2A 4D7AA 3UT0A 1QZXA 1UXGA 1Z5GA 2C8JA 2P3OA 4IPTA 4Q9JA 3SVLA 4NJOA 3WLOA 1IUNA 2Q3DA 2W98A 3IEUA 5SZKB 3HV2A 3QHQA 8ADHA 4QFBA 1UBTS 4WNCA 5TDHA 2IEBA 3W1WA 4B7AA 3T3DA 4MW0A 3BD8A 1MW8X 2YS7A 4OQPA 1P91A 5EMNA 1FEZA 4RDKA 4ACAA 4FYMA 3RS3A 3ZY3A 1PT6A 1JZQA 2EBWA 4IUBS 3WYAA 5F33A 5I3CA 1TFUA 5JARA 4D96A 1SELA 4KQHA 2ZTLA 5M34A 1TIKA 1SOAA 5BW5A 4WN3A 3FZQA 2JGIA 2GNPA 2OO5A 1REQA 3ZWXA 2P3MA 3QWBA 3CRVA 1ISHA 1OC4A 3HXMA 2JLQA 2VQFB 1Y6FA 1VI6A 1TA9A 2OFXA 4M1MA 2XRMA 4RSGA 3CUKA 5JY1A 1E79A 1LBTA 2AXPA 3QUBA 3QU2A 4URHA 3VTAA 5AJWA 1Y8CA 1I0LA 3HS3A 4Z9YA 5I45A 2NZ8A 4Y2XA 1P2SA 1QF9A 1K27A 1KMCA 1QONA 1RI2A 1E3EA 4RJIA 3VHXB 5BR8B 2UKDA 2PZBA 5C1DA 3CVXA 2C4HA 2HSWA 3KAKA 3QKSB 5SZHB 3P26A 3B7WA 4Z0TA 1VPVA 4HXEB 1LLDA 1EFPA 2YJNA 4DBLC 2GZSA 4KR7A 1N3BA 1T3LA 1SVWA 4GXNA 5D85A 3EXFB 1LJ8A 1KYWA 3TLBA 4Q7LA 1H22A 3PHIA 3W8NA 1Q12A 5U1PA 3RNOA 4YRGA 2ERYA 4FFPA 2CHVA 4UNQA 4X8OA 3WLRA 1VSUA 5EXDA 1X3SA 1KAMA 4G65A 5CM8B 4D3DA 2VYCA 2R97A 3M1YA 3IQGX 1K8QA 3BB4A 4M22A 4RV4A 2ZXUA 1HDCA 4IH1A 4MS4B 4JI1B 4DEYA 5HF5A 1TZBA 2OZPA 1NMQA 2JGDA 3DEFA 2Z4SA 3L1VA 2XCSB 1HT1E 1R6VA 4YAFA 3AG5A 4R41A 4MKXA 3RWMB 3UW1A 2W83A 1XOIA 3CXUA 1I2ZA 3AKEA 3AOEA 3T4PA 5A5DA 2VJOA 2X14A 1CUSA 3B1XA 3U44B 1MOPA 2WYWA 4P4TA 3KOOA 2NZWA 3RS0A 2UUCB 1SWWA 4PC1A 1XV5A 4ZU1X 3H9UA 4HAIA 1X87A 4NV1A 3QE9Y 5KIAA 4PBRA 2GAFA 4JMLA 3IAAA 2XV1A 3LT4A 3CR3C 5HKOA 5KVVA 1FE8A 3C3PA 4FOSA 4NICA 1XBTA 3ITKA 4OOVA 4UEQA 1OJLA 3DTNA 4TZTA 5T6BA 1JVNA 3SQXA 2ZRDA 1VSBA 1YHNA 5DVZA 4K0RA 4HY3A 4RS3A 3RT1A 1L7VC 4CJXA 5I47A 1BNCA 1RACA 3UUEA 5IH7A 3RTGA 3CN7A 1C30A 1NF8A 1OY1A 2I7CA 4TMFA 1X1QA 3DULA 2J9YB 3RIHA 3MJ4A 1GEGA 1FLDA 2JN9A 3IMCA 2WOOA 1WXQA 1A2KC 1QBGA 1VZ3A 4NULA 4JL6A 4EZBA 2OTLB 4DLWA 5KWJA 4KO8A 4J2HA 4YLYA 4G7WA 5AXAA 2CF6A 3NM5A 3GEDA 5A2QA 3SZLA 1ENYA 4JOCA 1F4PA 1XDZA 3A36A 3CEPB 3DEIA 1J42A 4U2EA 5AM1A 2SECE 3VNBA 4EDHA 2VP2A 2O8BA 4CMBA 2RMKA 1Z12A 4QQKA 1KOJA 1AO0A 1WMFA 5ALOA 3KPWA 3EIXA 4RZIA 4RLHA 2ZT7A 1F12A 3CSDA 2D2IA 4ZQIA 2Q27A 4V1CA 4EX6A 2G17A 4N1AA 4YXWD 1JA0A 1VHLA 1M2JA 2O2YA 3EXIB 3PU6A 4IINA 3RC7A 5BPHA 2AYZA 1EH5A 1IXKA 4UU0A 3RV3A 2UUPA 3KXDA 5CJPA 2KB0A 1BXRA 4JGBA 3PD1A 4BQNA 3OE7A 2KVOA 3OOCA 2A3RA 5JC1A 5FADA 3UTDA 5ELXA 3DDZX 4CLEA 3LZCA 5IWAB 3ICWA 5FA5A 5ADVA 1X14A 1QK3A 1EG2A 2J5RA 4OPSA 2QRZA 4RORA 4S1OA 1FP4A 3KT6A 4QXRA 3ZXXA 1FLAA 1KEPA 2VDVE 3ILXA 3CP2A 1JYEA 1SBTA 1FB5A 4NBVA 4B5KA 3BCFA 2FSGA 4A6EA 4CM1A 2G9UA 1SOWA 3EGIA 3TD2A 5A4DA 6GPBA 4JEHA 1XFOA 2HJ9A 1B8VA 3G6KA 1RXEA 1FFWA 2GS9A 4MVJI 4HNVA 3ZVLA 5J2TF 3S8MA 3H04A 1QOQB 1NRWA 5E7IA 3WR5A 1O9GA 3L1KA 2HC9A 4IO0A 3O4VA 4D46A 2R8ZA 5HKAA 2JBHA 3WK8A 4PN7A 4MPJA 3LXUX 3P71T 4MWBA 4H1UA 4LF6B 2O8EA 2LRHA 5L45A 3W4IA 1KFBB 2GKGA 1DE0A 1C1YA 1V5FA 5LQAA 4DV0B 2QVYX 4ICIA 2D0PB 3REOA 3ZX4A 4E4RA 1FX0B 3EEFA 4A16A 4NZOA 4Q3LA 3VDMA 4HUJA 2FLKA 5HZAA 3BHNA 1ZL0A 4F9FA 3IVGA 5JNSA 3N6RA 3X1ZA 2ZUFA 1Z18A 3S2FA 3NONA 5EJIA 3ZXYA 4DGSA 2FFAA 5I7OA 4PXAA 2QA4B 3AINA 1ECPA 2IH4A 1Q17A 2X4GA 2ZIZA 3D3QA 3OOSA 3QXSA 4YT5A 1IOVA 3WB2A 2H1VA 2L19A 3O94A 3GEGA 4J16A 2AN5A 2YWXA 1EFVA 4RBNA 5FYQA 2HMVA 4WBNB 1E6UA 1PL7A 5ER6A 4EB3A 1VM6A 3FOFC 4WZKA 1VHTA 1JV2B 1U80A 2Z1DA 2ABWA 2C97A 1FUIA 2JGKA 4JVSB 3OKAA 5K0TA 4I46A 3HB1A 2ZTNA 4PO1A 4ENPA 2HWUA 3QVVA 4X05A 1KIMA 1L7PA 1LVHA 3B1FA 1U5CA 3GJ8A 4TMYA 4WLVA 2EERA 1INLA 3U1TA 4BFYA 3ANSA 2Q3CA 3GRVA 4IVPA 3WNVA 4DLKA 2X9LA 5TQ0A 5KQGA 1U3UA 3G0OA 4PO3X 3AC0A 5IBQA 2EF1A 4Q3AA 3SX2A 4LPSA 5KOJA 5LP6A 1L4YA 4TTQA 5CBPB 3DTYA 4FCVA 1G8JA 1DJMA 2B83A 5CA0A 5KYUB 2D00A 3LYAA 1AUOA 221PA 3B3GA 1T1JA 4PLFA 2ZWMA 4LXXA 1WCXA 2DHQA 3FUVA 5EXXA 1CJMA 4X64B 4BNYA 1YZYA 1SOUA 5FUBA 3TQHA 3VPSA 4DV7B 3F2IA 1YOVA 1OFUX 2PXXA 4P34A 1ODIA 5AUPB 4D9EA 4DIEA 1LW6E 2FSUA 1JFVA 1HNNA 3M5CA 1XAJA 2XDWA 2N1BA 4D6YA 1CF4A 4IWYA 2BT4A 5BRNA 3T38A 1UINA 4ZYLA 3PR2B 2O19A 4GIBA 2WWGA 4KTVE 1U0HC 2WWFA 2WTUA 1CFJA 4DMUB 4I7EA 3FNIA 1A4IA 4P2NA 2B6NA 2J3MA 2ZUUA 4KUHA 2AXEA 3OEHD 4LOHA 4WESA 2FZ5A 3ROZA 4RWZA 1DCMA 2V97A 4C4OA 3VR0A 1KSFX 2YZ2A 2XMQA 3QWHA 3NALA 1XEWY 4MW7A 1IOWA 4N54A 2TECE 4CGYA 4XM3A 3IT3A 2FWMX 1EXDA 4GXTA 3AFMA 3OWOA 5BNIA 1BROA 1PR0A 3B8EA 2ACKA 4JYAB 4I1OA 1G2IA 3PFGA 4NBNA 4EUHA 3MG9A 4DCCA 4RY2A 4QTYA 4ZTUB 3O8LA 3ZD9A 3H9GA 4L8VA 2IUTA 1XNGA 2JGEA 4MI1A 5FBWB 4EM6A 2YN2A 4ZO9A 3R5TA 1YFKA 1UBMS 4HNAB 1TVCA 3HYSA 3W3AA 4RMNA 5FNVF 4KNVA 5H8WA 3WK9A 2J46A 3RJ9A 2BMAA 2Q2WA 2H31A 3KJQA 3FFAA 4QIHA 1A1SA 3BQNB 1W4ZA 5DP1A 3TGWA 3HL4A 1WTHD 3BWMA 3KLBA 4ZARA 4RA9B 2YDXA 4HBGA 2HPAA 4C4YA 1HZZA 1M7HA 3ZDRA 3LWBA 4RHEA 4WMLA 4BBPA 1NJ8A 1BKYA 3O7WA 4Q6BA 3NYWA 3K73O 3PE3A 3KZXA 1NC1A 4E22A 2HLHA 1PZXA 5KYVA 1T8TA 3CNQS 3SQOA 1DT3A 4NECA 3CLRC 5DULA 1DZIA 3LK7A 1EGHA 3F8TA 1T5SA 2DPHA 4MR9A 1YQTA 5FULA 1DKPA 2ES4A 4JI5B 5DN6D 4D4LA 4R84A 4KL8S 3PNSA 1MV5A 4X3OA 3KAPA 5F5NA 1XA0A 4GKKB 1XXLA 3M6LA 4OIMA 3WO0A 4TWJA 5JAIA 4H6WA 3VU9B 3I8OA 2EBUA 1XMQB 3G88A 4FNMA 5CDSA 2QLFA 4G5GA 4YQYA 4ZGBA 1IUOA 2QR3A 3WYGA 4HVCA 3C3YA 1O6GA 2Q3HA 4ZCPA 2B1GA 3KQUA 4P98A 4MUXA 5AVSA 2C3MA 2X58A 2JIOA 3CUWA 3RSGA 3VR5D 2ZIAA 1QPGA 3ECCA 4QUDA 3RVJA 4XWOA 1IFXA 1N6RA 1XIVA 4G25A 1HQYE 2R6GA 4RGYA 4RD4A 1MQ9A 3ZHVA 3KT0A 2IW1A 1HE5A 4FU0A 4D4JA 2AMYA 4HUQB 5AIAA 1HX7A 2EX0A 4ESVA 3TRIA 4JELA 3M4ZA 2H2AA 1N6IA 3KEMA 1LPSA 3HVUA 4J3NA 1CDDA 2B0CA 2FCAA 4EG5A 1FQKA 3E3MA 1IJBA 5SV2A 5JC8A 5DHPA 4HQRA 5A3JA 4KQ1A 5EPUA 3L1HA 3CRNA 4P0QB 2JHPA 2VDLB 5B7NA 2VOJA 5KYTA 5JAOA 3Q0EA 3NYRA 1ZBQA 1CJTC 3L82B 3SKYA 3S3TA 1U8EA 4NXNB 3B5IA 3ABSB 2GZAA 2WWXA 3QEMB 4EPYA 1YSCA 1Z4PX 1A9ZA 1G18A 5FWAA 4CMCA 3SJPA 1H1TA 1UBGA 4JLBA 3R7LA 3D6VA 1D0VA 3KQQA 3QYFA 3AEKB 1DKUA 4P58A 2OGUA 3TE7A 4Q1AA 4CL8A 1LI5A 2WHPA 3C5VA 3B3AA 3R0JA 2NVBA 4YFYA 1T24A 1KPIA 1UZLA 4ONEA 4E32A 1P5ZB 4G4IA 2XUGA 3TJRA 3VR6H 1ZMRA 1V8BA 2EF0A 4KKUA 2QB5A 2FR1A 1UM8A 1ULZA 4O4LB 4AFNA 3QK7A 5A3VA 4DQDA 5DI3A 3MIIA 5IU6A 1SWVA 4KBYA 2YS6A 2PGAA 3CPEA 4AS3A 5EKTA 4ZVLA 5H4GA 2PKQP 4MIEA 4U00A 4Y7CA 3Q7QA 5K8JB 1G98A 2IYAA 2PNFA 3O21A 3AKCA 1U2EA 1XPOA 2QQEA 6AT1A 5IXSA 4BP3A 3HDTA 3M83A 3DUFB 1B6TA 4ZTZB 1SVKA 2C0CA 2QTNA 1ANKA 2F3UA 3OZCA 3RM3A 3C45A 4DBVO 3QMMA 1ZN2A 4LFCB 3WG9A 1Z4MA 2XRFA 4M9ZA 3G68A 3HDYA 3ZOZA 6NULA 4HQFA 3T3PB 1F2TA 1JKMA 1SRQA 1EK6A 2BH9A 4OGFA 2QBYB 1L7EA 4AW9A 4OBWA 4BWFB 1ZIYA 3LO5A 3T3EA 5JANA 3ISVA 5ALZA 4Y9DA 5LU9A 3IRVA 5LXTA 4KR3A 5LJLA 2IIQA 3EGVA 1TQHA 3M9XA 5AKLA 2ZKLA 3A4NA 3EF0A 4MEJA 2YHUA 4ASUD 5JV5A 1CZUA 3L7KA 4JP8A 2G6TA 2QL5A 3QNUA 2ZVJA 3TS1A 4B40A 2ZATA 4ABYA 2ZU0C 2CFSA 2Q29A 3LQ1A 3D2CA 1QZ3A 3AR9A 5TEVA 4B76A 4YBZA 3LLSA 4HV4A 3B5JA 3GG2A 3QXHA 4Y30A 2P4HX 3IBFA 5GGXA 4QD3A 3V4OA 1KEUA 1VP3A 2OHOA 2WJ6A 3AF2A 5CK5A 2F8TA 3I9LA 1ZIOA 1UPAA 4Q1EA 3AG6A 3QYJA 1Y3CE 4F2HA 3COVA 4PZEA 4FMCF 5AVRA 1YNSA 1POWA 5DHAA 5EIEA 2UYCA 1ODJA 1PVVA 3FPPA 1PGNA 3FGNA 1HZEA 2TMYA 3A9TA 4AMYA 3WSWA 4BC1A 1IATA 2FSIA 4RPLA 4QDTA 3U2QA 4OPOA 1PKVA 3HN7A 4ZRNA 2A94A 3U7QA 2FI1A 5BN5A 1LPMA 1TW2A 3WLSA 4DUYB 3LSYA 3ZVRA 3DNMA 3HNOA 4GXRA 4R51A 4DB2A 3C5WP 4P7FA 4PFKA 4TQAA 3L0YA 5JS2A 4CL2A 3TTTA 4UHCA 2XIQA 4MW6A 2DFPA 3HO6A 1X86B 3PXDA 1RHJA 2SCUB 4IWXA 4PZLA 2WJAA 2VAXA 1B1CA 4UDYX 2D5BA 3TLGB 1Q7RA 3A1DA 4ARSA 3MELA 2WG0A 4U2KA 1XTBA 1LPBB 4GPTA 4MNTA 1Y7TA 3SQMA 5BOSA 3I04M 3EPKA 4OP1A 1E2GA 1Z0UA 3O8DA 3H4IA 5LL6P 2BD0A 2QL7A 2R44A 2JGNA 3MF4A 4HRYA 2W43A 3H16A 2G09A 3EVZA 3Q41A 4JJAA 5CURA 2PL3A 3I1FA 2ZULA 3NDPA 1XMVA 1RM4A 3FAZA 1W19A 3BMCA 1JHAA 3DOIA 5JCPA 3FFWA 2Q1WA 3BFXA 1RLIA 3JQ6A 4ANFA 2X5NA 3B6JA 3JTEA 2HXSA 5A7GA 2FWPA 2IYTA 3KYCA 1F1BA 3GD5A 1OMOA 3RI3A 5A04A 5BWMA 1N77A 3SR0A 2K5UA 2QTVB 3C5EA 2MSEB 4W5WA 4BNJA 5IT4A 1G3UA 1KC1A 3KR9A 4M7RA 1U65A 1T2AA 1JEJA 1VQ4B 2VYVD 2ZJZA 2K2WA 5IEJA 1J0BA 1I9CA 2Y68A 4QPNA 4P7JA 3F47A 1S6YA 1C9DB 1NVWQ 1Z6PA 2BTQA 1CWUA 3DW1X 3K6JA 5F35A 3X1KA 3ZU5A 4E5YA 1L4FA 3SVTA 1G8MA 4JIGA 3TKAA 1YJAA 1G8AA 2OZKA 3RK4A 3WLIA 4G84A 3HJFA 1ONNA 2J9GA 3TE6A 3VUFA 2YYAA 5EUQB 3CN9A 2QPTA 4P9NA 5JMWA 1SIWA 1HE4A 2PA0A 3DMYA 4WASA 5DCUA 1WXDA 3CZMA 5J43A 3AU8A 1FRFS 1DC5A 3RYFA 4EJ6A 2BPOA 2AE1A 3CKKA 3JVEA 3NU1A 5TARA 5CVTA 2ZB8A 1JXOA 3WMFA 2HDNB 1C1XB 2DH5A 4FYJA 1NOJA 3PXEA 3F8SA 1B16A 3H11A 5KWVA 3PCXA 1RC8A 1NQWA 4FJ2A 3VPAA 2AJLI 1ADFA 3EVDA 2GYYA 3EZNA 4DLRA 1P4GA 1V5VA 1A77A 1PLLA 5FEUA 3VGJA 3A1FA 3ESAA 3NYQA 2RD2A 1RZRA 3IOBA 1J2YA 3TD6A 1IE3A 1NXWA 2XF2A 3TLMA 3UK6A 2O59A 3NBYC 2LDBA 3OMXA 4BEBA 3CSSA 1DCFA 2MYPA 1H66A 2UZ0A 1VCOA 1ACLA 2UVPB 4FLEA 4OI2A 4ZP1A 5JAPA 4NV0A 3AFNA 3M2TA 5LR6A 3V4RA 2ZYTX 3M6WA 2IQ5A 4PO8A 4EY5A 3JQ8B 5EZYA 3AVQA 4FSXA 4OKNA 3VDRA 3VSBA 4CEJB 4DIFA 5B3LA 4OH7A 4B17A 2JFFA 3CESA 1NFRA 1CC1S 2RKBA 1S2LA 1Q0RA 2BCJQ 2Z30A 3EF1A 2GESA 1CQZA 3PB3A 4GMHA 2FLVA 4ITRC 3UOWA 4R05A 5IJ9A 4QOGA 2JFZA 3I04A 4YONB 4ZODA 2OXEA 4I1YA 4RABA 3RAEC 4NPAA 2FDXA 2JA1A 2JH8A 1QUEA 1GZ6A 1NY6A 1JPJA 1VPEA 3JU4A 2LVBA 5BQOA 2R25B 1PNRA 1G6HA 2RGEA 1N0VC 4LRYA 3L7BA 1VIDA 4HWTA 4URUR 4WFJA 4XVHA 5A9SB 1T6XA 2VBGA 3TD9A 5BW8A 1JJFA 2WDZA 2XWJI 4RLQA 4RJTA 1FJXA 3RUAA 5K2OA 3M2PA 4L78A 1KETA 1DXYA 4NARA 1GA4A 5C80A 2OGSA 1MV8A 1EZZA 1Q0PA 3H7IA 1SZCA 2ZRBA 2L42A 1PZEA 3N9IA 4JYPA 4OU4A 4MGKR 3HG7A 4JN6B 4H60A 2FJPA 4ND8A 1UJ2A 2HA7A 3IB6A 1DZ3A 3N3BC 1FX1A 3BN3A 1ZGBA 1C8LA 3WKBA 3LUCA 5FA6A 4CLHA 4YCSA 3OJFA 5HRAA 4IR7A 3TNLA 2JDIA 1EG7A 4AQYB 5SYMA 3VNAA 4B74A 3GYGA 1AQJA 5BQXA 1ZFNA 2Z6AA 1NQVA 2G8LA 2P7HA 3I1IA 1Y4SA 4PC7A 2FP4B 4IGFA 4OBXA 4YREA 3JCZA 4RW0A 3EVNA 3WIVA 3W7AA 3D8NA 1JTVA 4LMPA 3HK2A 3DF7A 4YT2A 1U1EA 3E8SA 3JYQA 1KWKA 2C99A 4LJYA 5G53C 5DNWA 5CDFE 5IT5A 4A6XA 1GKYA 5AICA 5A6VA 4O08A 2BEVB 2PUVA 4KXNA 1P7YA 4EW3A 2BV3A 4EG6A 2EFHB 3ZOKA 4KRFA 2II6A 3LK6A 1HFKA 4QHYA 4YJFB 5EFZA 3UV6A 5FAXA 1A9YA 1X80B 1Z2OX 2DBYA 3GIWA 4CIXA 1KK0A 4XRGA 3NANA 5COAA 1TKAA 2ZE7A 1X13A 1FFHA 5DX1A 1ICIA 3VOAA 1NPYA 1CEXA 3QPCA 1NKSA 3V4VB 3MRVA 4X1IB 1BOOA 1V9CA 3CCBA 4A36A 4X66B 3DE0X 1RXWA 3F9IA 4M98A 1EDBA 3AM4A 4GI5A 3ZY5A 1TLLA 1WOPA 1Q57A 2C5AA 3PR1A 5DM60 2UYHA 1ZAYA 4RHYA 3RSZA 4K81B 1ODLA 2FX5A 3CUYA 3KE9A 3BWBA 5ELMA 2QR5A 4JCCA 2I62A 3R23A 3U60B 2GPYA 3NBZC 1NLUA 3GK3A 4O8ZA 4D8WA 4AURA 3LG2A 3DAHA 4EPXA 4X63A 3TQSA 1ZSYA 3M5DA 3PQFA 3TZ6A 4IXMA 4LZOA 5DNYB 1J07A 3TPFA 1BYIA 1SXQA 2CWWA 4MRMA 3E2IA 4G01B 3A31A 1CZOA 2OBFA 3IEIA 3BTVA 2QM7A 3C6XA 4HGYA 4EARA 1WMDA 1RYDA 4FWTA 1R15A 4TMKA 1OH6A 4AI6A 3N0VA 1YO6A 1E1KA 2PUJA 3AM5A 1N2BA 5DTJA 2VZEA 2J41A 4BQQA 5EJ5A 2MMGA 4CMKA 2HRZA 3GUVA 2J6BA 2ZB2A 2H17A 1BMTA 1TNDA 1RAGA 4RHCA 2FRDA 3B6ZA 3EA0A 4Q66C 3WWPA 1T0PA 3MJCA 3LVFO 2CUTA 2EL9A 4QT0A 3V4LA 5JJLA 5KHLB 2XNDD 2XMDA 3L6RA 5IJ0A 1JQAA 4NU6A 5I7WA 4P81A 2QE7D 4UOQA 1H8HA 3KZKA 2B82A 4MGZR 1I4WA 5B6JA 1YR2A 5ITVA 2BR5A 5B6IA 1RP1A 3JZAA 4M9RA 4R9SA 1RRVA 5CVVA 3E0XA 1HDGO 1SXJA 1PG0A 2Y4NA 2ZPAA 4JHLA 3T8YA 4D9NA 4AMZA 4YP7A 3ASSA 1ZN8A 1J8YF 4PYRA 1E96A 1M2VA 2OV3A 2JGMA 3KG2A 5FPYA 4BO6A 5I7HA 3Q40A 9ABPA 4DDKA 5FUMA 1E3IA 2A59A 5EP1A 3VPFA 2XF8A 2P0YA 5JCOA 2YZKA 2CXSA 5IT9A 2W6ID 1ZNWA 2CC2A 1AKVA 1TB4A 1J23A 3DBHA 3FSRA 4UUPA 5DASA 3JAKA 3F71A 4ADSG 4BV9A 3O1IC 4B85A 3NHMA 2XBMA 3ZNQA 2OV4A 3W2HA 3H87A 3RQIA 2PU7A 4P0PB 1OB0A 3DVQX 4FMDF 3GGGA 4MA4A 1GIAA 5JAMA 1XLUA 2JFBA 3GLHB 3WMWA 1QP4A 1WZUA 2QRVB 3U19A 4G07A 5EG5A 3SDZA 3GEPA 2VH5R 5J4VA 4U7DA 3B5EA 4RESA 2AMFA 3FDZB 4R98A 4WK4B 1XZJA 4YP0A 2ZRIA 1JYSA 1P7PA 3AV0B 4PFQA 4RF5A 4CTNA 3WWOA 3PNMA 4CN9A 1Y8AA 2IXTA 3K6RA 1QGED 5HIMA 3EOAI 4GZ3A 2ZAIA 5F9HA 4FT4A 4GVPA 1QS0B 2PWYA 1ZMXA 4ZJYA 3ZYZA 3TNDA 2O1SA 4CZ2A 5JTUA 1RHMA 1E69A 3TXAA 1RYNA 4UZFA 2EAUA 1G8FA 2JRLA 2PPVA 2O2IA 3PEEA 4XEHA 5F7ZA 3BH7A 1V39A 2BHNA 2QJWA 1ID1A 3FD8A 3R09A 1NYTA 3TECE 3BVPA 2GJRA 2F64A 2H4ZA 2H3EA 3I6ZA 4MICA 4EEZA 2OSBA 1XTZA 2YVKA 3ZLVA 1CB0A 1NMSA 3NPMA 2I34A 3TM5A 4BO2A 4MB6A 4XD2A 1ZR2A 2ZYRA 2YWCA 5GZ3A 4RD6A 1QNLA 2J6IA 3PP8A 2PRZA 4NE9A 3VR4D 4F7WA 1AKNA 1GAXA 2VTDA 2DY0A 1MG5A 2WUDA 3DEZA 4PRLA 3WDMA 1J8QA 2HHHB 1EINA 4PZYA 5BMOA 2J9FB 1T3ZA 1OE0A 1SC6A 5F4JA 2C3UA 3VHRA 5IYZA 3IL2A 2F4VB 1DUSA 4ESOA 4N01A 3FGZA 2PHZA 2ET6A 3I2KA 4RF3A 4DG9A 1PR3A 4ETIA 3PXUA 3LCRA 2BGJA 1T2VA 1FP6A 1QRRA 3WL8A 2QN6A 2QLNA 3CZRA 3PDCA 4AJNA 2PBRA 3LLVA 5I7SA 3FWHA 2AD5A 2LWIA 5JJBA 5KSPA 2VTBA 1UXJA 1XFDA 1YJXA 2XCIA 4HH3C 5HQ3A 1YLOA 4QYTA 5T4BA 4FT2A 2YWFA 5EEGA 1LF5A 1D7AA 2YOGA 1AKMA 3R0XA 3DHNA 5IPFA 1JA1A 5IAOA 1XP5A 4X7MA 2YQ4A 2CVZA 1C3OB 4JZYA 1US8A 3CMAB 3DLPX 3IQIX 1GUFA 1PJ2A 3JR7A 1NXQA 1CQWA 5DO9A 3RNLA 1Y1PA 4A26A 1WZ2A 1SVNA 2NNWB 3TIIA 2AE2A 5LA6A 4BZQA 2JIZD 1G1AA 3K70C 5DP2A 4ZAZA 1Z13A 4CG1A 4RTJA 4AJEA 1JPNA 2V58A 5DRYA 5DB4A 2XYHA 4N0MA 5CYPA 1JFSA 3SKVA 2ETVA 4ZALA 4EEKA 2Z04A 3NPAA 4ENRA 3ZJ5A 1WRBA 2DHEA 3GFFA 4NCIA 2CLDX 3X1WA 2EBFX 2OY0A 4RPGA 4OLAA 1JEEA 2WOJA 3HRHA 3NTLA 3USES 3QKRA 3HSYA 3CE9A 3E03A 3LWDA 1QF6A 1ZA2A 2A4MA 1TMKA 2ZL5A 3MJFA 4Y9TA 3WQBA 3OJCA 4E31A 4CKEB 3U6KA 1HYBA 1QIJA 2IS1A 3H5WA 3EZ9A 5JVDB 3G7SA 1MOSA 3PJDA 4AIRA 1UMBA 2PLNA 5CXSA 2PRJA 3Q7TA 4HQKA 2L0XA 4OA5A 5LP6F 4KXWA 4ZVSA 2CHEA 3ROEA 4DCTA 5KC9A 1XK6A 4E1AA 4CR8A 5CA0F 2IEGA 5ESRA 3BIJA 2Y6UA 5KDLA 1ODKA 3WLAA 5BW4A 4M9CA 4KKSA 1M34E 1N6LA 4DLYA 3KP1A 2V3CC 2P1DA 4KJZA 1DMSA 4DY6A 3INTA 3W79A 4CFZA 1NNI1 2M9MA 3VA7A 3WVNA 1E7YA 3OURA 4B3XA 4YYZA 3FZEA 5EL0A 1LQUA 1PJ7A 2AFIB 3HWRA 4JLKA 1ISSA 4ZAXA 4AKEA 5JI2E 1NU8A 4X6XA 2GBGA 5BMVB 4RQAA 2VXBA 2GBLC 3HVRA 3O3NB 2WZNA 1OV4A 1Z47A 4IXTA 3ZJVA 3PGA1 3U39A 1AZTA 1OLSA 4H7EA 4AXXA 2EG9A 1TTQB 2NUBA 4CKZA 3EGDB 4EVRA 3ZWVA 1SU7A 2VHTA 4YMSA 4LXHA 5KX5A 4CQNA 5TGTA 2YTZA 3PITA 4LWQA 3ZTWA 1IBRA 1TLFA 1PQPA 3B7PA 2O0LA 3EK2A 1JHXA 3AP3A 2R7NA 4LVNA 2XUDA 5ALRA 2PX0A 3F7TA 1WB4A 4EZEA 4CIAA 3ULKA 1IBSA 1WDKA 1YU6A 2PIAA 2PGOA 1NF2A 1G6OA 3NOQA 3O73A 5G0TA 3LVBA 2ARKA 1K2VN 4GRDA 1P0IA 2DBZA 3ITDA 2GZ3A 3WB9A 2DIEA 4UNSA 1ULAA 4LDAA 1XLTA 3MWLA 4KIFA 5AI6A 4C03A 3EVFA 3E3AA 4EEXA 1JBQA 4H3HB 1RJ9B 3RS5A 2BCEA 2KBFA 1J5PA 4BTLA 3AUSA 2BGLA 3JVVA 1U3WA 1XTIA 1ZJJA 4X7RA 2BGIA 1G21E 5YASA 3C2QA 4BWGA 5BR7A 4XUDA 4URXR 4PQFA 1PL0A 2B30A 3GLSA 3H84A 1Q7CA 1E3WB 5AJYA 3UWKA 4TPKA 1NBOA 4EABA 5J5VA 1CUCA 1LBIA 3VTZA 5F77A 3QVGA 1BVUA 1PO7A 3DTVA 3ZY4A 2HPHA 4BNWA 5KDOA 4YALA 2IZ0A 3G9TA 1RPTA 3RYCB 1ZK4A 4DQKA 1RPZA 3F5DA 3KU4A 1E66A 3OFKA 5L9AA 3S5UA 4A27A 2A78A 4CQMB 1XF1A 3FWZA 4Q21A 3HDVA 1M1XB 1QIEA 1D6SA 3PIRA 4KI0A 3D59A 3CCJB 2PTHA 3C3XA 2BHLA 4DJ5X 3STTA 1FUKA 4ROTA 4UEWA 5B57C 3LOQA 4MUHA 3UANA 2Q9AA 1U02A 4ZVRA 2V5VA 2C82A 3P0JA 3SD7A 4H1WA 4X0CA 1J2RA 1I10A 1IY0A 1RIIA 1ZH6A 3EEQA 1F2UA 3EDQA 3AWDA 4BYMA 2PXCA 3YASA 4YJ3B 1C9KA 3OPVA 1EESA 3Q3AA 1SU6A 5ALHA 1WUKS 1MXFA 1Q6YA 3AB7A 2F7SA 3G8DA 3SEJA 2XA2A 3GJTA 4MDHA 4UEJA 1KWGA 5A3SA 3AVYA 2YHSA 2H2DA 1IN6A 2RONA 3A27A 4K1XA 3HP7A 3IHTA 1K6EA 4ZT4A 5TLSA 2OP0A 1JKFA 4DJEC 2E37A 1GTVA 5CVUA 3S6JA 1MNQA 3CCUB 3KVRA 4X8LA 5L4NA 4YK7A 4BVHA 1P7VA 3FWYA 3WYFA 4KPUB 3N07A 2ZAOA 4J8PA 5C32A 4OX9Y 1CT9A 2ZI6A 4QTTB 3FOCA 4Q48A 4Q34A 3HYLA 3S5JA 5B2FA 2RG7A 2JCGA 4Q4JA 3OCYA 4H77A 2VSYA 5F2OA 1VLZA 5DLEA 3F6CA 2OV8A 4CV3A 3L49A 2C7RA 3AUFA 1CS4C 2XHEA 1R6BX 1MPXA 2JFQA 3KKKA 4HZIA 5AUNB 3A1NA 4TMZA 1CY8A 2JJ2A 1OWNA 2XZOA 1Q0HA 2GHTA 4ZOLA 4BFLA 3D2AA 4FHEA 1IXRC 3FNQA 4HDNA 1G3MA 3W2IA 3QA3E 1EJ6A 2QVCA 3QVKA 1TM1E 4DLUA 4GI3A 4HIZA 3DAFA 3IUNA 3HABA 4Q4LA 4B2LA 2WBLC 4TKLA 1VE1A 2BN4A 1K89A 1C50A 2JJQA 4HTFB 4F5EA 5JXHA 4X93A 1ZD4A 4M1OA 2P67A 1WB9A 2E85A 3GT7A 2YC4C 3C41J 3C70A 3G4SB 3Q7SA 4KDCA 4U7JA 4BGUA 4D9MA 3MT7A 5EVJA 3LAWA 2H1IA 5FTMA 3PPWA 1CF9A 4I1UA 1PD1A 2WHXA 5EE5B 4C06A 4KKTA 2W9XA 3AP1A 1NGSA 5C9ZA 3KJIA 4O8CA 5ERYA 3RSLA 1DQRA 1KAQA 5DSXA 4AJHA 4NZPA 4DKXA 1P77A 1PR4A 1QK5A 5CJ2A 3ILSA 1RRMA 4FI3F 1QV7A 1UBHS 4C7OA 3D02A 2Q3MA 1R64A 1GRRA 1ACMA 1OWMA 1GTMA 4H4EA 1N33B 4EY6A 2WRZA 1QE3A 2DP4E 4ZXFA 3NDBB 1YJQA 3AY3A 1LDNA 3D6FA 1R0KA 1LWOA 5AKZA 3VOSA 4AAYA 1KI8A 4H1VA 4OQEA 3PDIB 4U63A 1RYHA 3C4JA 3RAGA 4OHCA 3TLYA 3H5VA 3KVVA 4HAVA 1AVTA 4ZCRA 5E8JA 3Q6IA 4MRNA 1IMOA 5F1YA 1BX1A 1VPTA 1CZLA 5ENZA 5LXTF 5K6AA 1UAYA 3Q2KA 4CM9D 3BGDA 2VPQA 5J23A 3CCSB 2P9ZA 5EPEA 4FCCA 1ZJYA 1E8DA 1K1EA 2OPBA 4ZOBA 3ONWA 1UJBA 3JD2A 2A5FA 1EGMB 2XBUA 1WR8A 3QU4A 4M8SA 3UJHA 1K66A 3N8HA 1A98A 1EAMA 4EYSA 1NN5A 1QHGA 3LHSA 3DB1A 3FR8A 3V8RA 4HL6A 1VQMB 2QN1A 3ZKWA 2DHRA 4Y7DA 4G4JA 2VTEA 3FR7A 4TL8A 2CXXA 2JIBA 5JJCA 1ZGZA 3CVOA 2B5VA 3I9MA 4NS1A 4RL4A 5DTEA 3DDCA 3W7BA 4YJ2A 4HEA6 4M8LA 5A4KA 4WX2B 4EUFA 2BFDA 3WBKA 4UVGA 3UMJA 4LDJA 1R6TA 1NFFA 1ZH0A 3NKVA 4ZU3A 1UBRS 2Y92A 4DR2B 2GF0A 4RPCA 4G56A 1HGXA 3BL5A 4FNAA 3CLSD 2O2XA 2FVXA 1O5OA 3PGJA 1M73E 3BAZA 4L22A 1CZKA 3H9JA 4NAVA 5DWDA 5F76A 2QRQA 3DDWA 4P5DA 4YGXB 3UGKA 4IDDA 5B12A 2ZIEA 3GRRA 5D3ZA 1UD8A 2V9ZA 1DTWA 4QFDA 3NUGA 3IUMA 4BMNA 1UM9A 4KE9A 4L9RA 1OTYA 4PG7A 2V4DA 4EGAA 2QPAA 1GLNA 1VKZA 5AJXA 3RH0A 3SS9X 1WY7A 5M7EA 3U16A 4F97A 3KSBC 3D2LA 3TX2A 3VPGA 2WQZA 4W7SA 1C4WA 3T3GA 2ERXA 3W9YA 3HXPA 2VO1A 4I36A 4B47A 1GCOA 2E2WA 3HJUA 1AG9A 4WEQA 3WGYA 3EQZA 3UPUA 3N2KA 3FLMA 1L1QA 3SHOA 3IJ5A 3ASZA 1DQSA 1NVBA 4KWIA 4QAQA 4BBJA 2HDWA 3RU2A 4MQUA 3W05A 2P6NA 4MDFA 1WB6A 4IJMA 4JP5A 4UARA 3VQTA 3MYRA 5BV2P 2JNWA 1O0CA 1Z73A 4EECA 2A5LA 3K1AB 3LVRE 3FN4A 4RKQA 3DG9A 1JLRA 1C8VB 5AJZA 1ZJ4A 1ITZA 1K7SN 1QLWA 3HCAA 1L5KA 1AGXA 5KCMA 4JEMA 4Q03A 1R4MA 1V1JA 3AV3A 1YQUA 3TKLA 4Z2AA 2W00A 2B25A 1Q3TA 2OESA 5A02A 2WVHA 3HCPA 1E3TA 3KRTA 2CVHA 4I5GA 1W5BA 2AFHE 4EAQA 4C30A 3JY6A 3CF4G 5GP1A 2OYRA 2FWJA 2RGAA 2NU7B 4DDHA 4PAAA 1TFRA 1YS1X 2HMYB 4WH0A 1WE2A 4M1QA 2R00C 1UWKA 2EP8A 2RFLA 121PA 3IAS6 2Z5VA 3A1PA 2PIDA 2ZSEA 3LL7A 3GIDA 5AHKA 4D92A 4CLRB 5BYKA 1KJWA 4L75A 1H9AA 5ALFA 1JAHA 2DFKB 1N1EA 3GGPA 2CDBA 3H5NA 1ZVVA 1KDYA 2PE5A 4KPYA 1TVKB 1SVIA 3T1NA 3KTAB 4RDJA 4IMRA 3VR2A 1Y1SA 2GASA 4EO7A 4GYYA 1WSBA 2EHJA 4N8EA 4DWWA 3AJRA 1YH3A 1C7EA 2YBEA 4PE5B 4O1MA 2GO1A 4EF4A 4HGRA 2H16A 4G24A 2IXGA 4HWGA 5JEEA 1BS2A 1L5SA 3P0EA 3H99A 1XCOA 3S1LA 4W5JA 1QGZA 1YIJB 2B1JA 5DDIP 2QUIA 1YBMA 3DP9A 3ASQA 3DCNA 2QQFA 4QRIA 3V48A 1JRLA 3RSSA 4MCJA 2PUDA 1XCGB 4IDCA 4KMMA 3DV0A 4YT4A 1SKQA 2FPMA 2CNDA 1M83A 2GM3A 4PWZA 3GVKA 3TOXA 1NUSA 5K8IA 2WEKA 4CHGA 2YVQA 4BJ6A 3HKEA 1RWWA 3I2FA 1SUDA 4UJ5A 3L4JA 4C2TA 2VBVA 5DTMA 4BPBA 3AVWA 2P8JA 2ATCA 1CVRA 2JGFA 2VJMA 1V1RA 4ROXA 2H1HA 2CL7X 2X7HA 3KFXA 3NTOA 4LGMA 4M9SA 4C5BA 2ZYIA 3FKSA 1YHQB 1V0JA 3HBLA 2G5TA 4PU0A 4V0SA 4X1OA 3SC3A 5P8WA 4FX5A 3CNEA 3ZV6A 4G0YA 4QOSA 3A2NA 5FBLB 5DSTA 4FIDA 1RXSA 2HR1A 2VRBA 5C52B 2CFRA 2RHDA 4OLBA 1D8AA 3EIOA 5BY2A 3OPYA 4DDMA 4Q1VA 2PFSA 3WOVA 1X19A 2B3DA 2FPGA 4JI6B 3VYWA 4RPBA 1RD4A 3M6XA 1I1NA 2JC3A 3E4CA 2PEZA 1XEWX 2Q9BA 3NWPA 3EHEA 4TUYA 5EFOA 3ZK8A 1E5QA 2MSKA 1VQPB 4BNTA 1NOKA 5J1SB 1BN7A 3ZDDA 2A14A 1UZNA 2F1HA 5AJTA 3BM5A 5A4IS 2JD2A 1JHYA 3AQ4A 5KINB 3ISTA 4GE0A 2HU5A 1PFUA 1E6KA 3K1JA 1QK4A 2ADFA 3S40A 3W6PA 2VDNB 1L5VA 3FFBA 2P0AA 3IBSA 2QD1A 2AUMA 5AVZA 4GKBA 5FHQA 5KSOA 5L7WA 4ZRMA 1FFAA 3P2EA 5G0VA 3URKA 2EQBA 5K45A 4UTVA 2E4WA 4C4SA 1U63A 2OILA 2FYTA 2WG1A 2H92A 5JROA 4K28A 4HPXB 2FE4A 2VDMB 1ZNQO 1PS9A 1IHUA 1SKAA 1DC6A 2D0OB 5CP8A 4C6RA 5A7FA 2X9NA 2WE8A 2GF9A 4BRSA 4D4MA 2D1RA 1FQJA 3HNRA 2WJZB 1VSTA 1U2PA 2ZRFA 4OB7A 1SA0B 4MYHA 1KAGA 1U3VA 1UKBA 5G3YA 4HYYA 4HDSB 2IOYA 3NDJA 4KRYA 4R31A 1IU9A 4UE3S 4N5HX 3V46A 4XN0A 1A8PA 4ZRDA 3K5HA 5BV0A 3K70B 2V1XA 3ZGXA 4YPOA 1T5LA 2SKDA 2WYVA 3HFRA 1HLGA 2Q2NA 1OZFA 3J7TA 5FUYA 5AI9A 4BJ3A 3DDYA 3QVWA 4MXDA 4E13A 3CW9A 4XVCA 1CUAA 3IMGA 4LSMA 3UB2A 1TEHA 1S2OA 5KAMA 1YB7A 3I6BA 1QFXA 3W34A 5EA2A 3GR6A 2AYYA 2C92A 3MS4A 3KIPA 1IHDA 3C6BA 3DLHA 1PYGA 4KK3A 1YI2B 1Y6JA 1RRKA 3NO4A 4KREA 3U7JA 3PI7A 4IOJA 1YDEA 1H85A 4AU1A 4PG5A 3FM9A 2P6OA 4DUZB 4RGBA 1KO7A 3NTVA 3QVMA 1XTVA 1GSHA 5HWSA 1BAPA 1IZYA 1P2GA 2Y1KA 2XT6A 3MT0A 3UJBA 4NCXA 3BHJA 1URPA 3GGCA 5FBQB 1IXSB 5IW8A 5AM3A 4JC5A 3RIEA 2HIGA 1LEHA 3A26A 3UFXA 1UT6A 3ZLTA 3N7TA 1F5SA 1DUVG 3C7DB 2DKFA 2VK1A 3DEKA 5IDXA 4OIFA 5AVJA 1VGVA 4KO3S 5H70A 2XUOA 2XKJE 4UXIA 3B6IA 2GFQA 3DWGA 4CUKA 1WD5A 1TKBA 2G83A 4NS4A 4PPGA 4W7IA 4A03A 4CEIA 1GTZA 4TN5A 3VHQA 2E21A 3BF8A 2ZI7A 1K3FA 4BTVA 1VJDA 1L4KA 2UVDA 2Z0MA 3A6DA 3FBWA 3GCDA 3KEGA 3MWJA 3O1LA 4IRXA 3UXHA 1UBSB 4DOMA 5BSGA 4F1JA 2PZEA 2IS2A 2WABA 5K3DA 4WJZA 1D2AA 4XIFA 4EKDA 3KB8A 4EYGA 1GU1A 2C3OA 4XYMA 1AM4D 3PC3A 4P0TA 3THWB 1YZUA 2J4DA 3RVOA 1PK9A 3BQJA 1CLUA 1DC8A 3NHLA 5CFRA 1QFSA 1FU7A 2VBCA 2FHSA 2JLXA 2WWRA 3ZHYA 3EG9A 4NOKA 4DEXA 2ZS7A 1ATZA 4X95A 3K32A 2FH5B 3RBVA 1XNJA 5FB3A 2QROA 1U5BB 2Y0EA 4J7AA 5L3SA 3TFOA 1DAPA 3U4CA 4FHGA 1NQOA 1E1QA 1Q44A 4JWTA 3H97A 4RTKA 1VQOB 1E4EB 5E2IA 3UXEA 3BFKA 1Q77A 3LX8A 1DELA 1WMSA 4KQMA 3DF9A 2VHEA 1WZCA 3FVRA 4M60A 5TY0A 1I94B 4UTPA 4C08A 3A4MA 1RKUA 4RPHA 4TZKA 4UTOA 5KVSA 3C6ZA 4YP9A 1GNVA 3EOBI 4LIPD 5DNVA 3V32A 3K8QA 4J75A 1QG6A 1IN1A 2H2FA 4RIEA 1VHJA 2XEXA 1X7GA 1A3CA 1VDMA 2BBTA 1XQWA 2C96A 4JWKA 1A5BB 4OJQA 2DOGA 4H27A 3UJ8A 1IRIA 3JATA 4HX9A 4GQNA 3DCJA 4DXDA 2B8NA 2VP4A 1NATA 1YR1A 5CH8A 4WCFC 4L51A 1TTHA 4S3MA 3UG6A 2GDZA 2WV9A 4EQZA 4GPAA 4U7PB 1NTOA 4I4CA 5AW4A 2XOKD 4I50A 3TRHA 1FPMA 4M4SA 1YC2A 3FGPA 3ROKA 4G6ZA 2OV1A 1PV1A 1LPAB 1W9XA 1UQUA 4OTZA 4OK3A 2YHIA 1KYVA 1QSGA 1G4UR 1XN1A 1RQPA 4M0PA 5IM5A 3IQEA 4BU1A 2XE7A 3WIBA 1DOAA 2RHGB 5DWVA 4F6CA 4PYQA 5MF6A 4Q9IA 1W4BA 1F8FA 2GPJA 3A3GA 1M34B 1P1JA 2E1PA 1IQPA 4J0JA 4M6WA 4EJSC 1M0WA 4II3A 2JLCA 2PXHA 4GO1A 2MSLA 4ABTA 4JUAA 1HH4A 3M9WA 1DARA 3TTWA 3RWBA 5KNCA 3RC2A 2D9RA 1UFRA 3JQ9A 4LHXA 5AJHA 5TMBA 3E3OA 3GBVA 4CUJA 1GR1A 1FFDA 1NB9A 2GCEA 3PFNA 4P6VF 1R9GA 4OFZA 3U56A 3CZAA 3ELWA 5I9MA 4LC1A 3OHSX 1XXHA 2PUTA 2XA9A 3BZWA 3ROQA 1WUJS 4Z4IA 2VZLA 4O3MA 3A8IA 2HHAA 5CW2A 3B85A 2GJPA 3GH1A 1YOBA 1SBIA 1YKSA 1YGPA 1E2IA 1QQTA 4RETA 4YLEA 3GGSA 4KWCA 5AIBA 4ND5A 3ELYA 1R6UA 3L7NA 1OXVA 3IULA 5LYJF 2IPXA 5AKHA 1Q0UA 4MJ7A 3B36A 3CUEF 4XLHA 3PD0A 4Z51A 1KI9A 2QAIA 1QVGB 2OBNA 4P54A 3VC3A 4OQQA 3LC2O 4PSKA 5LA6F 4DUGD 1QHXA 1AV6A 3ZEAA 2XB9A 3K9NA 1KU6A 1NVAA 1UZUA 5C5DA 4YR7A 5F2KA 7YASA 4LDRA 4ETWA 2DYIA 1LPOA 1WXIA 1KL7A 3BTOA 4MUIA 1QKKA 1NUTA 1WCIB 4G8DA 5KQLA 1DADA 4UW9A 1P5RA 4PYJA 2JAUA 5AJVB 3LUAA 4K2AA 2E1RA 1MFZA 1QR2A 4ECAA 1JQDA 1WY5A 1Y9JA 4P2BA 1D1QA 3ZWKA 4YV2A 3WL6A 3FTEA 1HM5A 1U2GC 1ILEA 1H4TA 1MEEA 2QYSA 3PJRA 2IGTA 3F6BX 3AI1A 4N5LA 4HJXA 3JQAD 2ZYDA 2VLIA 2B9EA 3G0HA 4RY0A 4PYMA 2JA2A 4Q9LA 5EMLA 4FDVA 3TL6A 2AMJA 3W7VA 4FHDA 3ADBA 1ZGCA 8ATCA 3AGQA 3OY7A 2OBRA 5FAKA 4NFLA 3ZK9A 3TIGA 4IJ6A 4HFMA 3BMOB 1D7OA 2BR3A 2NYRA 2Y05A 3B82A 2X22A 2QG6A 3HKCB 5FCDA 3WWEA 2IIVA 4A73A 1B2LA 2R47A 3AEUB 2V96A 1LV8A 1W0KD 3ZIUA 4HFNA 3G9ZA 5JPCA 2PSJA 4GGOA 3GP8A 3P2YA 3WYEA 3F97A 3UENA 3EXG1 3VR5H 1HT0A 2INGX 1ZH8A 3Q10A 4JBXA 1TC2A 3RUEA 3RIXA 3HRIA 4CM5A 1P0FA 3A2KA 3LKBA 2RHWA 3V2UA 5ALUA 1JNXX 3HN2A 1KNXA 2WZCA 5EEHA 1XMOB 3T3OA 4KQ9A 1SQ5A 3H3XA 2W7TA 1H1LA 4ML3A 2B21A 3CLRD 5KX5F 4HFRA 2HXYA 1NXSA 4GLFA 1BQ3A 2BSAA 1BGWA 2IKQA 4A8JB 4MIOA 1P6XA 5TRDA 2IX3A 4L6AA 4R5MA 2GM4A 1IMJA 1L9XA 4UTXA 5JUWA 3D1JA 1BPLA 1VLOA 2YYZA 3K8ZA 1OLXB 4HAXA 1H4SA 1UFQA 4C0KA 3L7DA 1XZGA 4BECA 1W1WA 1NVUQ 3RYTC 2C9ZA 1N9GA 1SHZA 3B1JA 5TEWA 5JJIA 1SXPA 5EE3A 1UJ5A 2XDQA 3GO4A 3VR3A 3D5TA 3SQLA 4ZU6X 5JE8A 4BLVA 3BRCA 2WJGA 5K0JA 3R75A 1MC4A 3TSOA 3MRTA 4DADA 3T56B 2VAVA 1JXAA 4ND7A 4V38A 7ABPA 3TOCA 5JS7A 1XAIA 2C9CA 1X7DA 3ZE8A 4BNLA 1E7MA 1K9SA 5HKKD 1D2HA 4JNKA 3HGQA 4LW8A 4PSCA 1NW7A 2JAPA 4DR6B 2XVMA 3HPRA 2ZCVA 1IBKB 1GL7A 2ODAA 1A2OA 4FN5A 1AE1A 1CHDA 1QYDA 3QUTA 4G5SA 5CFOA 2FN4A 2Z2ZA 5AP9A 1OXBB 4KDEA 3S2GA 4C22A 1AQYA 2ODEA 2WF9A 4XGKA 1D2RA 4JLDA 3KQLA 2DETA 2GTPA 3I2JA 3EPHA 2WSMA 1HSZA 1P2UA 2QT9A 1O96A 3KK0A 1EX9A 3LF1A 1QRTA 1VYTA 3JQCA 3TLJA 4FZ5A 1GOTA 2XJ9A 4H7HA 3ZQUA 2CXRA 3Q1LA 4PLTA 5TVGA 1MCZA 2AVNA 2R4QA 3DSRA 1GUAA 1GPDG 1XN4A 1SD2A 1IUPA 1MIOA 3CGGA 3PCTA 4X24A 4HDKB 5FL7A 1WSRA 1FNNA 3R6TA 5EHGA 5FOSA 4X1KB 4ZK6A 3L77A 4PG4A 4U6NA 3U3KA 5FPHA 1XPJA 1ZRMA 2EJBA 4FQ5A 2Z2KA 4QOEA 4DIDA 2WUFA 1F5NA 2X3FA 2R751 3M5PA 5G4KB 1ZGJA 5EJ2A 3GCWA 4YR9A 3S99A 1D5CA 3OKPA 1U94A 1P6QA 1SQ0A 3SXUB 2Q8NA 1T35A 1YL5A 1YBVA 1CQIB 2EU8A 5BORA 3CWZA 1EFCA 2OBTA 1UF9A 3R3JA 2QAGC 5SZIA 3OPQA 3TLAA 4KSYA 1EVEA 2I6UA 3OD5A 4JXKA 3P32A 1DXHA 4GYKA 3KQNA 5SYNA 2FCRA 1GXSA 2XA1A 3KXIA 4BNKA 3ZXSA 4B3SB 4Y1RB 4F5YA 3HP4A 5LNK6 2H08A 4ILEA 2O4CA 4DNFA 2WNSA 4Y6OA 5AK4A 1A4RA 2PFGA 2NAFA 2MINB 5FWXA 3NBKA 1OFTA 2WFMA 3PX2A 1X7YB 4K9LA 2G0AA 4ZXPA 2Q9CA 5M3BA 2D74A 1T6NA 1AN0A 3DE1X 4XD7A 4KGZA 4ZOLF 2OGTA 2PKRA 2F3PA 4JLOA 4WY5A 5JYBA 4Q24A 4IIUA 2XTZA 4N3GA 3NT5A 3F6RA 2W6CX 4L28A 4D0LB 3H2YA 1XRNA 1V7PC 4QEDA 4D97A 1P5HA 1PD0A 1Y3IA 4H0NA 5DTRA 3NHYA 3OETA 1IZ0A 2YW9A 1YTLA 2GHIA 3HHPA 1KDOA 4DNQA 4JLAA 4RDXA 1PYOA 4HQ0A 4EG0A 4YY3B 1A9SA 1XPRA 2OO5C 2ZW9A 1JT2A 4LTNA 2QTTA 2R8XA 2PA3A 4MS1B 5TS3A 1TMOA 2A9VA 2Q3FA 4OSPA 4HZGA 3R1IA 2XQVA 5JRDS 3IP1A 1CUYA 2D8MA 4G41A 5TGZA 4K3UA 1BE6A 3GJ0A 2QW8A 4EJSB 3UHPA 1U31A 4MLPA 4PC6A 2V7UA 1N8RD 5FTKA 3T41A 1ZW6A 5HUHA 3T1OA 3TXYA 3M3DA 7REQB 1MG0A 3KSUA 1Y9AA 3NWJA 3O7MA 1P1RA 4YNBA 3U7GA 3H6HA 3TW4A 2WV7A 4OAOA 5ELLA 1DOZA 5JQGB 1U0FA 2CEAA 1XZHA 4QXOA 5TQ2A 2ISQA 1CY7A 2QL6A 3F1KA 3LCVB 2OC9A 1E99A 2XYGA 2R8PA 3NS7A 4B75A 4BFSA 2I7XA 5EMKA 3GFRA 3CRZA 5J35A 5E1MA 4G36A 5C8ZA 1N2CB 2PDAA 4MW5A 4DRZA 4E88A 2AEJA 1MO2A 2VQ3A 1SKBA 3LPMA 3IV9A 5LZ7A 4CV1A 2B4QA 1TT7A 2PSFA 2G71A 2GB4A 3PTZA 5EXEA 2B94A 4CCAA 4KXVA 2X0FA 2GBPA 4PAWA 1CJUC 2OT3B 4DLLA 5KDDA 1HDXA 1Z0DA 1E4YA 1ST2A 3LCJA 1C8KA 4DWJA 1UBCA 1UJ6A 2ACWA 2PGJA 3AOEC 4HG2A 1THZA 5DEIA 1VLHA 4AP5A 1FW6A 3R3VA 4DCGA 4DNXA 1ECFA 1S89A 1YTUA 4N5NA 3LUKA 3QKWA 1SOMA 4U6QA 2A7XA 1WDMA 1RLOA 2BR4A 2CNWA 5J59A 1ECLA 1ABEA 2QV7A 4TKZA 4TLEA 5HDQA 2GTIA 3CRQA 4YJ2F 4UTRA 1JAYA 4W9MC 4TZ0A 3DEYX 1GRCA 4B32A 1LDBA 2YWHA 4DQVA 4FYVA 3SZMA 3EULA 4ON9A 2V8BA 3PDUA 1OHHA 2J67A 4GR5A 1TXGA 3I5AA 4QVKA 4EY8A 3A3KA 1M5UA 3LLCA 4OSEA 1C9EA 3ENNA 5FUQA 3Q8MA 1T1RA 4ZMBA 1IWPB 1E0DA 2B6HA 2W90A 3Q8XB 4LHSA 4R2IA 3UMCA 1NY5A 5KUTA 3MRSA 4EKNB 4I1PA 3VO8A 2HLDD 3WK4A 2VF8A 1KMIY 3CONA 3FCYA 5BN3B 4L9AA 1JHQA 1IULA 3U9TA 1ULHA 1X7XB 4LC9A 5HZGA 3R7BA 3CMEB 1TAQA 2OVBA 2PGLA 3DHVA 1TYAE 2BUCA 4EH1A 1XZCA 2JGLA 5HK9A 4WDRA 2Y0BA 4OXRA 4C7JA 1HRDA 4WINA 5SYAA 3P52A 3V8EA 4IMPA 4FFBA 1H3FA 4ZD6A 3RVBA 4XEUA 3ONNA 2PBZA 5EIFA 1M1ZA 1U9YA 1WORA 4AKTA 4ZDIA 4R1SA 5EIHA 2W2QA 1P4JA 3NVDA 4RMIA 4CKBA 1F2VA 3ZLBA 3QBEA 2VF4X 3AR2A 4KQCA 4QODA 1ZM3A 1KKMA 1KI3A 2FR8A 3ESQA 2PSEA 3Q3VA 4OM8A 1EP1B 1L5HB 5F5LA 2HREA 3CVJA 5C8YA 1WL8A 2NU8A 4B9EA 4BX9A 1A95A 2B5OA 4FEAA 5F7OA 2DBVO 1KQPA 1JYFA 2CBGA 1KXJA 2E55A 3HB4X 1Z9BA 2JI9A 2OMEA 2Y27A 2O3RA 4BAGA 4FCWA 1O6BA 5LZ5A 3GRUA 5IVDA 3AXSA 4N0EA 1VP9A 4INJA 4ZO8A 4GM4A 2Z08A 1K06A 2X4DA 4R1QA 1KJQA 4LVCA 2QL9A 3UFBA 3AHCA 1VXRA 4RY8A 5EUCA 3HSKA 4NKRA 3OIFA 4DJDC 3ACDA 5LWQA 4H08A 3WWDA 1B42A 3O1JC 1MP0A 5FRDA 2CWDA 5CRIA 2OAGA 3F90A 2C1XA 5EP4A 2R1UA 3UJCA 5AKEA 3UW3A 1LSUA 1T5EA 3WNBA 1U8ZA 5EIOA 1LTQA 4D6XA 1DDIA 1EHIA 1DFIA 1FBNA 1N3YA 3RTCA 3ZQJA 3OTOB 1P29A 2UAGA 2CMHA 3TW8A 1N3IA 4F60A 5F3WB 4URVR 3OCUA 3CCQB 5AH0A 1WCV1 2IX9A 2Z2JA 2ZRKA 3AEQB 5KTSA 3AJAA 2YFYA 1EX1A 4XM1A 2V6FA 3ZIAD 2QY9A 3PEFA 1JBKA 1E2JA 2OXFA 4LOIA 4UU1A 1TEVA 3KJNA 5D7NA 5EY5B 4TYPA 1I4TD 3ZU6A 1I4DD 4L72A 1NR7A 3VAZA 3AI2A 1Q7YD 1YD7A 1YJNB 1GZVA 1OSNA 2PWBA 3DV9A 2QENA 2B1RA 1JJIA 3GLVA 4HWOA 1QGDA 2I0FA 2QZ9A 4YMUA 2TS1A 3E0QA 2O2SA 1PFWA 2GWHA 4QOJA 4XLAA 3KYBA 3PI6A 4M21A 1XZNA 4V0NA 2XCQA 1M74A 1SB8A 2HADA 4BVGA 2X5KO 4CIBA 1NJFA 1V6CA 2AI1A 1JG1A 2IPAB 2O57A 2XECA 3MFYA 3IQXA 3OPNA 2Q0SA 1SUSA 4JUFA 5JQWA 1VKHA 3BZUA 1GTSA 3OQIB 5HM6A 3CMMA 1RI4A 2PEYA 3AKDA 4NNOA 1FUUA 5J4LA 1YRLA 2F1LA 3VZCA 4O4JA 5JFOA 4F5DA 2ICAA 1RC0A 4G0WA 2XLBA 1JQBA 3EBPA 5EN4A 1J22A 3LPDA 3S1AB 4Z7JA 1L8AA 2DU8A 1D2EA 4E1BA 1LH0A 3A1VA 3UWMA 2V7QA 1QH1A 1BMFD 1U9IA 3M6UA 4YAJA 3WP0A 1JFTA 5LP6C 2O3JA 2W2OA 1CG6A 4ZO7A 4TYMA 1Z4JA 3L8DA 5D3MA 4EGSA 3COPA 4R2XA 2CUZA 2HSJA 3M4YA 4TUYF 3SFZA 5I4KA 2YHAA 4NFSA 2HPZA 5BN4B 1FDOA 3Q6MA 2CYAA 5FHRA 2ZWPA 4LVUA 1XVTA 4XYLA 4H35A 3W8RA 1OH8A 4OP3A 2IH5A 1T3TA 2RHLA 3ESBA 2X42A 4I5DA 1FW8A 2H51A 3AIOA 1EE9A 4JASB 4YAIA 4QSMA 1LBHA 2XMBA 2I1LA 3HV0A 2ZJFA 3QQPA 4IIBA 5IBRA 4X9XA 4ARZB 5C5EA 3PL5A 2XITA 2NZUG 4KHPB 2FSVA 3QLVA 2OZEA 4IDQA 3V5NA 3LBAA 1YFLA 5JS6A 1NW9B 2NNLD 4KIGA 2QGFA 5DM1A 2NTEA 5GONA 3O03A 1NQXA 4KX5A 1I7DA 4QPJC 2RHCA 3NHZA 3MRXA 4HO1X 3EQ9A 1P81A 1QQ5A 3VTKA 13PKA 3UMRA 2HU8A 2H4XA 3OZEA 2AZTA 4L5CA 4WY8A 4CM8B 1HPLA 5LMNB 1GNQA 2P90A 1CSEE 3AFOA 3C8MA 5K0ZA 1W73A 3ZDYB 1XRPA 1O54A 4BMVA 4RD2A 4JVMA 2HI0A 1V3UA 2KMLA 4NJEB 4P3XA 4MP3A 2X5OA 1JU4A 3OIYA 2PUFA 4C43A 5BQFA 4REQB 3CO5A 4CF3A 3C1OA 3WLTA 2AMLA 3DZ8A 1OIVA 3E4DA 1QOPB 3U62A 3DDNA 2NM0A 3F9CA 1YE5A 1CUUA 4OAPA 3G13A 2P27A 3C1AA 2EYUA 1PK8A 4JQOA 2H1CA 5ARBA 3JRNA 1MO4A 3MJRA 1G19A 3D0OA 3ZS9A 4IGEA 4RXUA 4A5SA 3GJ3A 3SS8A 4YJHA 1HZZC 1E3LA 4WOCA 1A1VA 2C57A 1ORWA 2RIPA 5FI5A 1TM2A 4BQRA 2NLOA 1VL2A 2ASVA 3AZPA 1D04A 4UHHA 2OORA 2I7VA 1QPZA 1MJNA 4D45A 2QN2A 4P36A 1RHUA 2CSUA 3WLPA 3K9BA 1G5IA 4P93A 3GLRA 1SXHA 3U61B 2ALJA 3V1NA 4PX9A 4H3KB 5EKXA 5AFSA 1XD8A 1YZ3A 4WBSA 5F21A 1Q0SA 1U2SA 4IQ0A 2FMKA 4A0SA 1JL3A 2PX2A 1BX0A 1L1RA 2BFFA 3UK1A 3FNGA 4PWYA 4WN9A 4YXFA 3IPLA 4HB4A 1LDGA 4RHTA 2D2FA 3U31A 2A0FA 2GA9A 1I3OA 3BIXA 3KKEA 3TBFA 4MKFA 2PMKA 3OM1A 5K01A 3QYPA 2F17A 3SIXA 5HMLA 1VQKB 3ZWPA 1VKNA 1XQ6A 2FPPB 2O0KA 1PT8A 3N76A 4K6MA 4OATA 5FBHA 4IBOA 1N2GA 1LS1A 4X8HA 2BDEA 3JZDA 2KSQA 1HA3A 3NDRA 4O2AA 3VR4H 1QH0A 1R5BA 2ADMA 4KZPA 3UQZA 1LI4A 1IEQA 1KVTA 2DRIA 4HEHA 3BCRA 3ZCXA 4NOJA 2P78A 3W5HA 2Y0DA 1E89A 1T34A 2F1OA 2IY7A 3G5TA 4UCFA 1K4YA 2ZRGA 2HYDA 2WINI 5AT1A 4BO7A 4ZI7A 1UIMA 3DDHA 2FA9A 2R79A 5CA1A 3I01M 1KXZA 4IEFB 1SCAA 4CQLB 4NJMB 3IPYA 2UXDB 1K7FB 3K20A 1O5IA 1LX7A 2XKBA 1AH2A 4GG1A 4NBTA 2IV3A 5EWJB 3G2PA 1KH3A 3I52A 4LF9B 4HDMA 2O06A 3IXLA 1CDEA 1JLSA 3HB7A 1EUCA 3VMFA 1YB1A 4LXUA 1EIWA 2CXOA 2JB9A 4Z4CA 1NVEA 1XZBA 3AVPA 2PQMA 3WWZA 2F3RA 1J90A 3K6KA 3DBRA 2RH8A 4LPKA 4R7ZA 1DIHA 3BQMB 1MW9X 3LX4A 1QYRA 5LZ8A 1ODTC 5MFZA 3IEMA 5BQ3A 2OK7A 4FYPA 1KK1A 3FWKA 3CO0S 4D9BA 4L5BA 3RBXA 5K03A 3L0OA 4KVAA 4F8JA 4GX2A 4RF2A 2AI3A 1U8TA 3NETA 4I55F 5KYYA 5HJEA 3EX7C 1COZA 3SDBA 1MF7A 3PVDA 1HEYA 1M54A 5LMCA 1TUIA 1HO3A 4J49A 1JHOA 4DE5A 3OEED 4QU5A 4R2HA 3AZQA 4QOIA 1SXJE 1RMTA 4JLSA 1M8FA 1QU3A 3U4QB 2CBXA 4ZGQB 3NYIA 3S28A 5KNBA 2LP4Y 1ULSA 1UOEA 2WA2A 1ZWKA 1XZPA 3EMVA 3G2IA 4TT3D 2F1KA 1ACJA 2VH1A 1P1BA 5DX0A 4YJGB 1FSPA 1ONPA 4CTJA 2FSSA 4TQ9A 3Q7IA 2ZETA 3HDHA 1TKRA 5JCJA 2N47A 1KYIA 3MA0A 3U26A 3AUAA 4I50F 2P9EA 1U8CB 2V7EA 3I45A 1N8TA 1Q1GA 1Y4ZA 3T12A 3NTQA 2CMFA 3K9WA 2PKQO 2XUQA 4PIVA 4HH1A 2R7AA 2WU0A 3BJIC 4DV4B 2QRGA 4O4IB 2ZYHA 2XQIA 3EPLA 1EVLA 4LHEA 4R2KA 3L1UA 5E2AA 3P8ZA 4X44A 3HCBA 4UBKA 3CF4A 2GAOA 4FMPA 2BEWB 2VPXA 3ZDXB 3DE7X 4BKOA 5MDHA 2P5UA 1QU2A 4ENSA 5KYNA 1V3TA 2JIPA 3DO5A 1IZ8A 1WU8A 4WV3A 3G05A 3QVSA 1SUCA 4MGYR 3UA3A 2J5QA 4JJIA 4Y6PA 1GZSA 1C29B 4S1WA 3I01A 1OTHA 4R3NA 2GN4A 3MEQA 5JMPA 5TPZA 4BVBA 1V5WA 1K6IA 5TS2A 3UWOA 5C8XA 2EG5A 1QQBA 1J8VA 2FEMA 3PUJA 2EKQA 4AJJA 3CF6R 3GZNB 1Q50A 2H1RA 3QFTA 3ORHA 3VH2A 1YCDA 2AG5A 3ELBA 1KY3A 2ZWAA 1BU5A 1X7ZA 2DT8A 3ANXA 1WD7A 1P4AA 3K1ZA 5JAUA 5IF9A 5TQJA 3PENA 4GHWA 3DT9A 1K97A 3PT5A 1U7OA 3JZFA 4AY2A 5M04A 1NYRA 3Q0IA 2VSQA 4WWHA 4UBNA 2D5IA 4MINA 5GZ6A 2I2FA 4FDLA 4TWZA 4QUBA 2OP1A 1TZJA 2F43B 3A6ZA 4KG7A 3ZHUA 5LZ4A 3R77A 1DVRA 1IY2A 1G20A 2Z6VA 3NEPX 3N3AC 2J9XB 2OD2A 2ZSBA 2J7PD 4MVXA 3UJPA 1D3AA 1M2OA 2AOUB 2G1JA 3CVUA 2WE7A 5HFAA 4B8WA 2P6RA 1RBYA 3IH5A 4ZYZA 1KZ9A 3OW2B 1WMEA 3MT9A 2OGWA 3RARA 4IHAA 3DQQA 4TXMA 1GSOA 4EGFA 3KQWA 2Q62A 1A8QA 1N7GA 2GSDA 4I3HA 3DPSA 4EFKA 1R0RE 2ZT6A 4NWIA 1JLLB 3QU5A 3GVJA 4HX5A 1VJSA 3Q2OA 4B3BA 1LVUA 3GZTB 4OJKA 1VXOA 3S7TA 4AZ0A 2O8DB 1DRVA 4Z1MD 3L8YA 4YRQA 4RTNA 2FN7A 3C3JA 3M49A 3UPTA 4KK4A 3LNTA 5KU1A 3A6HA 1ZI9A 2AEEA 3LUBA 4JXJA 3RD5A 4B87A 5IYNA 4I9UA 4I19A 4E09A 2UXCB 4LBVA 2FQ1A 1VMIA 4UUNA 3PUMA 2VF5X 5HBRA 1QYCA 1LDYA 3L92A 4XJTA 1W4RA 1JAXA 2BKAA 3FYUB 4F56A 3QITA 2WLTA 2JLYA 2FW7A 2GCIA 3FMFA 4MVJM 3MD0A 1ZK1A 1FFSA 4FINA 3RRNA 1KZ6A 1QQ6A 2MHCA 2VTVA 4W5RA 5LD2B 3MTAA 2JBAA 3KPJA 4YAGA 3LQEA 4CPDA 3RYHA 1YITB 2G06A 3IVCA 3K5WA 2E5LB 5IKOA 3OTHA 4A23A 1MOQA 1XDDA 2VS1A 4UFOA 4R1LA 4BU0A 3V8PA 2R85A 2M6LA 3FZYA 1TW3A 1FUYB 3KQYA 4JB2A 4F2GA 4OYYA 4X00A 4MTLA 2IYRA 1AUPA 4DM7A 4WZZA 3JARA 4DN6A 2E9SA 4ZK2A 3AERA 1Z4QA 3QBTA 4XQEA 4I4IA 3ABOB 4QJ5A 1JH9A 3VBEA 2WPDD 1A8UA 4Q9KA 1FRVA 4P31A 4QEKA 4WRRA 5CH5A 4EQ6B 1PS0A 3L1JA 4OQ4A 4BASA 3M81A 3GRPA 3SFTA 4ZYXA 4RM0A 3STWA 4G4SO 2W4QA 3NUZA 3Q15C 3MB5A 1UXOA 4PSAA 4TV9A 1U6JA 2OHVA 3FYCA 4YWHA 1Q7EA 3QUSA 4JBWA 2WNIA 1IBMB 2IYXA 3AESB 2ZYAA 3PZRA 1KPHA 4R40A 2P6UA 4MV9A 3NH6A 3PLRA 2B69A 3BXHA 3OUTA 2NYUA 3P0FA 1NVFA 3JQFC 2VIIA 1PNTA 4KODA 2PYDA 4PABA 1SO8A 4QDZA 4V39A 4WLNA 1LBQA 1USWA 2O05A 3RHTA 3F5FA 1J2EA 2HCRA 4TV8B 1JNYA 1EJ0A 3Q5EA 3REQB 4YRZA 1V95A 3QI7A 2G1AA 2Y8EA 4C89A 1KSHA 1AMOA 1YBAA 3LSTA 1M2EA 4RKFA 3RRZA 1IG3A 5AVQA 4P25A 1M5RA 1QVFB 1ZNXA 2NZ2A 3V1YA 3EUAA 5TMPA 1NRKA 3H05A 1GKUB 5CCBA 1WXGA 1NVDA 5CHYA 4C1NA 2I54A 4M7OA 1JQEA 4B6GA 2WKWA 4PZAA 3D4OA 4LRTB 2WZDA 1A50B 1QH8A 2QY6A 1YJ8A 2G4VA 5FTLA 3IVXA 2KBEA 2RGYA 4QVGA 5GV8A 2JI6A 2QP3A 4OHVA 3EVEA 1EK1A 4G86A 3PA2A 2YXDA 3I76A 3HVHA 4MVJA 4PIPA 4QOFA 3ZJ4A