2C5HA

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with 2'deoxy-adenosine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
291
structure length
291
Chain Sequence
b'RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
molecule tags Transferase
source organism Streptomyces cattleya
publication title Substrates and Inhibitors of the Fluorinase from Streptomyces Cattleya
rcsb
total genus 78
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2c5hA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2c5hA01
5FIUA 2V7WA 1RQPA 2ZBUA 2C4TA 1RQRA 1WU8A 2CBXA 2V7VA 5B6IA 2Q6LA 2C5HA 5LMZA 2Q6IA 2C4UA 2V7XA 2V7UA 2C5BA 2F4NA 2Q6OA 2CC2A 2V7TA 4CQJA 2Q6KA 2C2WA 2CW5A 2ZBVA 2WR8A
chains in the Genus database with same CATH superfamily
3OU2A 5EHQA 3OCVA 2A5GA 1VHOA 3UK7A 2QA5A 4MHOA 2A0UA 4R0VA 2DG2A 2GZHA 4J3JA 4YUAA 1E3IA 1HTWA 2JNWA 3TQFA 4BMNA 2I4OA 3WIDA 1Q0TA 1R8SA 5G1PA 1KBOA 4NBTA 4IJQA 2DECA 1UKVY 3PWKA 4AN1A 1GZ5A 1DKLA 4BMYA 3A8IA 3CF6R 4KNYA 1JHQA 5GVRA 1NNSA 4TMKA 1AGXA 1YDHA 2QKYA 2R79A 3OM8A 4YWHA 3V76A 3W9UA 4QREA 2C4VA 2X3FA 3HY4A 2D4HA 2F62A 3AU8A 2FR8C 3N6VA 1AUPA 5ANRB 2I7CA 3BRSA 1OI4A 1PO7A 3KYCA 5IANA 2J6BA 2I3ZA 3V5NA 1BMQA 4QUJA 3SYTA 2QNIA 4LF7B 2BFMA 3RS9A 4JI0B 2V1XA 2JHAA 3W3AH 2VBVA 5JCOC 5GIOE 1YASA 3IKLA 1G3UA 4YLGA 2OFXA 1X1BA 2PU5A 3R9XA 4MEJA 4FW9A 4L02A 1U2ZA 2FQXA 2IKSA 3ENZA 4F5DA 4G0QA 2G5CA 2BMJA 5ALLA 1FYXA 3PQ3A 1TI7A 5ALXA 5I9SA 3ZCQA 1EUQA 1SWWA 3FMIA 2IS4A 3AHHA 3GVCA 3Q0TA 4HGPA 5BSWA 3IB6A 4QO8A 2HX1A 3GPCA 2ZJ3A 2PAAA 4NZZA 1TQ6A 4HBGA 3BERA 3QVGA 5BMVB 1XPJA 4BFTA 3PFNA 5SYMA 2CDAA 2F8SA 2FPKA 4FFBB 1USWA 1YA4A 2Q3FA 4LQDA 4YRPA 4F1WA 2ZXIA 1MW9X 2PX3A 2UXDB 5FTWA 3DZFA 4P93A 2X5KO 2V0GA 1D1QA 1QPZA 5DOVA 1NT4A 2I65A 3W78A 1EVKA 4RTLA 5MGBA 4ZTBA 3JTEA 4KMMA 4M8IA 4QFDA 1SCUB 3SKYA 2O2YA 1FTQA 2BLLA 3ET4A 4LZNA 1JR3D 1X39A 1LSSA 1OXVA 1IL0A 1W35A 1TYAE 2EHDA 4E5UA 3SEJA 5EPOA 1TADA 3SLDA 3PFHA 1OVGA 3D2CA 3QF4B 4EW6A 2ARKA 1NLMA 2IYAA 3KYIB 4YQZA 3CLSC 1G291 1F12A 5B2ZA 3LYAA 1LC0A 2VQDA 2WK1A 2JFVA 4CG3A 2Q3DA 4PQFA 3H4TA 4OQMA 4Y1FA 4N9WA 3ASRA 1BQEA 1UC4B 4TPKA 5E6RA 1RLMA 2AMLA 2Z2XA 5HCIA 1ZCZA 4E31A 1RRCA 6REQA 4EEKA 5JO0A 4JELA 1P2BA 1FDIA 1QTRA 1X6VA 1Y5MA 4L5IA 4RCYA 3S1AA 2YL2A 4FHEA 3C8UA 4K86A 3AINA 3STYA 3M9XA 5IH3A 1B6RA 3TI7A 4D4JA 2J30A 1E98A 1DC7A 4J0KA 4JT2A 1O87A 3MJVA 1WOMA 4P12A 2JFZA 4MYHA 5J47A 1E5VA 1EDEA 4FFNA 3S5UA 3OE4A 4ITVA 3EVNA 5DYYA 3SIPA 5FBHA 4CEHA 3UANA 2IIBA 2J0SA 2C9DA 4RQUA 1JI0A 4JYPA 1HYEA 2QEQA 2VHXA 2R7LA 1AZSC 4L5JA 3L6CA 3I9FA 4XJTA 3SQOA 3PQFA 4PYLA 3GLFB 5H5JA 1X1AA 3P9IA 5CGQB 4K3UA 3WRYC 3WLHA 2ZYDA 1ZITA 1INLA 4A27A 1LLCA 2X8KA 1M2EA 1ISGA 4XLAA 1GU7A 5LPNA 1YR2A 4HRVA 2IZOA 2H57A 2ZDHA 1DO8A 2ZJ0A 2GN6A 4L0MA 4MLDA 1N8KA 2H3HA 1IHOA 1JR2A 3R6TA 3TL2A 1N07A 4NHEA 3TH5A 1Q86D 4EJ2A 5J4KA 1L9XA 4Z8XA 2I55A 4CM6A 1AKTA 3DGFC 1TVCA 4DJJA 1XF1A 1VKNA 4C4TA 1S5PA 3CB4A 1YZYA 2HEIA 4U2CA 1T2NA 4ZVSA 1L5HB 2YHIA 2XXJA 4D4KA 5LQJA 4JN6B 2OZLA 4H60A 4TQAA 2WR8A 3LU1A 4C7JA 1C7IA 1CQIB 3HYCA 4HB3A 1ORDA 1H5NA 1KVQA 4FT2A 2ZS7A 4AO8A 1N77A 3AY6A 3AC0A 4KQ6A 2Z5LA 3F9IA 4FE3A 2Z58A 4FFBA 2OPHA 3V2UA 5AQ1A 3U44B 4B7UA 5EPEA 5KSZA 1W73A 2BIFA 4YYZA 3I4FA 5HIAA 1SC3A 1QF6A 1FXWA 4MARA 1T5HX 3A25A 2CYAA 3DDSA 5L6MB 2IEBA 2R8RA 3ICCA 1Y63A 3L18A 5AN9A 2W98A 3CE6A 1LI4A 3WB1A 4F1KA 1QQ7A 1RLUA 4JBXA 4CEIA 2HU7A 2RGBA 2GVDC 3WNCA 3AUUA 5JH7A 1NBME 3I4LA 4U3JA 2Y1FA 2JK0A 4C2AA 4EPRA 4OVKA 3L6UA 2WWIA 1IY1A 4WLEA 3P9ZA 4LCBA 3ENNA 3SJPA 1E9SA 2A58A 1M34B 2B8WA 2W8ZA 2XJ9A 3W9YA 4YUXA 1TAHA 3EAFA 3R3VA 4HX9A 4AI6A 4ZC1A 4D4GA 5K3BA 1YI8A 2BUBA 4BRSA 3QITA 3I9V6 3I5YA 5DX8A 2BE7A 2OOKA 4WCVA 3CMAB 5CFPA 3T0FA 4ITRC 2JFPA 2HBRA 3EIOA 3EPKA 5LXTF 4CIAA 2PL5A 2BSQA 2C94A 2PQ2A 2RGUA 5FHQA 3DMRA 5FWAA 2QX6A 3KYJB 3DD1A 1ZJZA 4U7GA 1YK1A 1VQ1A 4AMBA 1IOLA 3EZGA 5E6TA 4BNLA 4C6TB 3AKDA 2XMZA 3EIQA 1EBFA 3K9HA 1ZGCA 4AYWA 4ZYLA 1KAMA 4UCXA 1NJFA 4Y30A 3KPYA 1IY2A 4BFSA 4PWZA 1FTSA 1ZIPA 4JODA 2VBFA 5G4KA 5ALEA 1WXGA 1K89A 2PLAA 5TMBA 3EQ6A 1ZSNA 2UYQA 2JGDA 3ZUPA 2Q2NA 5HBGA 4CIWA 4TS9A 2ZROA 1DAGA 1ICIA 1BWPA 2C3PA 5IVIA 4TKLA 5LR6A 3HU5A 1C14A 2KX7A 4AUKA 4B76A 1RBQA 3E9NA 1IG0A 3NHMA 1O94C 2D1QA 2IGBA 3EXAA 4YCDA 2OYCA 5DHTA 1EGAA 3RRJA 4EGJA 1JIQA 2DCMA 4GR5A 4XN3A 5EYPB 3V1LA 1T6NA 3ZHUA 5JXIA 1CDZA 2QVGA 4LJYA 4Y2RA 4TTTS 3AU9A 3EF1A 3NBKA 3CV3A 4FGJA 3ZHQA 4BV9A 2ANBA 3F5FA 4LJ4A 3ZWDA 2GO1A 2A9OA 3DBRB 4G3XA 4F5WA 3IS3A 1Z73A 3OWXA 1E1KA 1XKLA 3CIFA 4AZ0B 2PUFA 1XC7A 1GNVA 3C3AA 5IEBA 3G0CA 3RM3A 3H42B 4YMSA 1NFFA 3PT5A 3K6SB 2HHAA 3A0RB 4J0DA 1GCOA 1R0XA 1NJ1A 5FXMA 3ICEA 3AKCA 2JJ1A 3T3PB 5BQPA 1Z38A 1UKAA 4PCAA 1MOQA 1XZEA 4D74A 4TV8F 3CH4B 3WZMA 1HL7A 1JZTA 2IODA 4UXIA 5AI6A 3RSFA 1A04A 1Y6QA 5ERXA 5LQUA 4BKRA 4X7FA 2IZ6A 2O3UA 2Q45A 2QD4A 4JJ4A 3PR3A 1FQKA 1O95D 4DVJA 2VSYA 3K4HA 4OP2A 1U2EA 2WQ6A 1Z4LA 1OH6A 3VH4A 3QPAA 5BNIA 4KZPA 4K9PA 1NI4B 2CK3A 1C9YA 1MAAA 1MRZA 2GHIA 5KNBD 2VJYA 4I55B 2P4SA 3CZQA 1ZUWA 1W87A 3HCAA 4YAWA 4LX8A 4MVJE 4CWAA 4IEFB 3Q5DA 3C3CA 3AYXB 5B7GA 2O8DB 2NU8A 4E6EA 1C0PA 4N8EA 2FJ0A 3C6KA 2QTNA 1M2NA 1YZKA 1BRMA 4IVRA 4F92B 1Z88A 4UE6A 4RY2A 2DLCX 4CM7A 1W25A 3N6RA 4QYMA 4XWWA 2QRQA 3ITNA 2QN7A 3HZRA 4AO7A 2WHPA 5IBRA 1R00A 3CZPA 5IVHA 2ZIFA 3PCRB 4FCTA 4L28A 3HRIA 1F1BA 3GLFE 3MT7A 3OSZA 1GLNA 3IAEA 1XRQA 5K7SA 4JT8A 3BXZA 5KSPA 4N47A 2PH7A 5CFNA 3QVLA 3RTCA 5MN4A 2OAEA 5HKOA 4TYYA 4OHOA 1JVBA 2JZCA 3FKQA 2X2FA 1XZAA 2QMYA 2BGKA 4CQMB 3CH5A 5DGIA 1HETA 3DB1A 3RVJA 4GYYA 2QP3A 4PE5B 5JD3A 4RMIA 3HNRA 3W4KA 1TVEA 3A1WA 3M6WA 3W04A 5BVGA 4QELA 4MR9A 1IB0A 1UKBA 2G4CA 4IJVA 5DYGA 2XCRB 2WSBA 2EXXA 4M0UA 1YKGA 3HI6A 4G4SO 4MQ6A 4HADA 3VISA 2DPLA 4N18A 1JHYA 1GARA 2V96A 2Y0DA 5AWFC 1YHZA 1Z18A 2X7HA 2B1GA 5AHKA 3A2LA 3HR4A 3PZRA 3AHJA 2C04A 1QHHB 2VLIA 2QZSA 1FBTA 3H84A 3I9KA 4RADA 3SS9X 1BDJA 3GLKA 1HSOA 3IA2A 421PA 1QRAA 2PKXA 2HMTA 3K4QA 5H83A 4AF7A 3UUEA 3ZE2B 1BN6A 2G83A 3EH1A 4M6WB 3DLIA 3WS7A 1PGOA 3IPRA 3WWDA 5BNZA 2X1MA 4LRTB 3AGQA 3EW9A 3WC4A 5B1EA 5KOJA 3R5FA 1O95A 3KHKA 3U19A 4XRRA 2PT9A 1A2KC 1WDMA 4RFVA 5D87A 5E3JA 2XXBA 4NRDA 5FOUA 2AG5A 5IYZB 4BUJA 4L8LA 2NZ2A 1CDEA 1XWWA 5JUWA 4AX4A 4M0DA 1AHHA 4C2TA 2WOJA 3E58A 3I6MA 3TNFA 1N2EA 1Z0JA 1LX7A 3BPSA 4JLJA 2UYYA 4KQCA 5LB2A 3S2ZA 5K0TA 4LJRA 1Z5OA 1JG3A 2H63A 3IERA 3H18A 3FKSA 4PY2A 4E3WA 4EB6B 2NYUA 5BPFA 2OPBA 3UMGA 4QLBA 5I48A 2ODEA 2W2QA 3SEFA 3X1KA 1YACA 2NG1A 3GFVA 1HZZC 3EVBA 2GZSA 3P9KA 2PA3A 4EOGA 3Q7RA 1HE3A 3MPUA 2J3MA 2X6TA 2BM9A 4MKFA 4C7XA 3JASA 1G6Q1 2GXSA 2YXLA 4C87A 16PKA 3VJKA 3EIFA 3NIDB 3F73A 1P1FA 4IOKA 1ATIA 4JBIA 1G2PA 1WRBA 3ESBA 2JGLA 3BWBA 5B2EA 3GRCA 2D2IA 2G4VA 3AL3A 4NSNA 3RYHA 1P1CA 3C74A 3D7NA 1W7AA 3R3WA 2ZCUA 1HQYE 1KK0A 4BO5A 1KJYA 3LE8A 3TTXA 3DLPX 2KVOA 3MWYW 3WYBA 1MO4A 2FI1A 1XROA 4NU6A 3CT4A 4KTTE 4OJQA 5DHQA 2BF7A 2HTFA 1VF7A 2B4AA 4K03A 5SZKB 3ZWWA 1GTRA 4JLNA 1QAQA 2I71A 3ROTA 3WA6A 1JHAA 1KYTA 4DA7A 3F9RA 4JX9A 1BCRA 5LQNA 2ADFA 2MYNA 3BS4A 2C7VA 4HB2A 1LVGA 1PQYA 1J8VA 4MA4A 3TB6A 1SB8A 2VNAA 1U9JA 5KWVA 5FBVB 4OHBA 2WKRA 3I39X 3PHCA 4PHGA 4E4YA 5BSEA 1O89A 2ZB3A 5GV8A 3L8YA 1H4QA 1YZQA 3O2QB 3VPGA 4LJSA 4BNJA 3F8SA 4MPTA 3TG8A 3I1YA 1RQNA 2JCGA 2LR0A 4N0MA 4P5DA 3BJIC 1JGTA 1U2RA 2C84A 1OU0A 3W2EA 5L7YA 2P9GA 1WL8A 4ZDJA 3N74A 3E61A 3SY8A 1JVSA 4HVCA 2EQBA 2QM8A 4MWCA 2CL0X 2HUPA 4O2BF 3PXBA 4M8NE 2VT3A 2H4HA 4LOLA 2B9EA 1GQOA 5C7LO 3USES 4K6KA 5F1YA 1O4VA 1ULAA 3VDXA 4EJ6A 4Z4EA 3F8TA 2HJSA 4Q15A 4UDOA 4X20A 4TSFA 4D0SA 3TZCA 1I2BA 5HCUA 3FKSD 4PNHA 2NNLD 5DNDA 3VKWA 3BM5A 4P4NA 4MWEA 3K8OE 1XLTC 1QIKA 1TX4B 2JFXA 1IONA 2VDJA 1PEDA 3CNLA 1GPBA 3U31A 1PGNA 3DB2A 4R2IA 2QLFA 4A5OA 4ARVA 2W43A 3H5OA 2LXNA 4X7EA 5JI3E 1XAGA 3DEHA 2EBFX 2W6MA 3A1NA 3GWZA 3KEOA 1SU7A 2QU8A 3RARA 2ZG6A 4Y6SA 1TEZA 2SBTA 2ZIUB 3IILA 2J09A 3T99A 1TJYA 1ZD9A 2X4GA 5IYRA 1I4DD 5DVZA 2ZJOA 3O73A 1SCBA 2C99A 3TX6A 1VCMA 1VHEA 4PABA 1DG9A 2QT1A 3QFFA 3G79A 2QRVA 1NIJA 2TMYA 4QGGA 4L1KA 4K1XA 1Z13A 5COAA 1ODLA 4FXUA 2Q6TA 4NYJR 2IZ1A 4FDAA 1WULS 3NKLA 2JVIA 4MIEA 1VJDA 2C8JA 1HEIA 1FQJA 1MIHA 1RWNA 3PE4A 3RFFA 1MIOA 1JLRA 4C89A 5AJZA 2C5EA 3NWBA 3KYDA 2ATIA 5HKBA 1CYEA 4RJKA 2QRVB 1OBHA 4HUQB 1RT9A 2GZ2A 1E6WA 3JAWA 1OZ0A 4R69A 3UXYA 4U2GA 1N8SA 2P69A 4F6RB 2VDQB 4EVRA 1J56A 1Y5NA 4FDUA 5C4MA 3F5DA 4EYOA 1SZDA 4LQLA 2CEKA 1SGWA 2G04A 4BAGA 2FWAA 3V3TA 1U1DA 4LZWA 4PXAA 4WT7A 2XYVA 5E6SB 1ULBA 2QT0A 2ZUBA 1CZKA 3H8WA 1AB6A 4YTEA 4YP1A 3WWCA 4WN9A 5AXBA 2WU4A 3GLVA 5AQEA 1E6CA 4HSGA 2B20A 1RIFA 1WZIA 3JD2A 4WINA 1XDGA 3G6EB 2VJKA 3HA3A 3UJHA 5KZMB 5AM0A 1E0AA 3OMLA 3C98A 2X58A 4MW2A 2QSUA 3FTCA 4ALLA 3KKMA 2OBTA 1UBRS 2FG6C 3NJ4A 3R7AA 3VKGA 3L4KA 2XUAA 4GL4A 3KZOA 4PZ0A 4AUEA 5LJIA 4LFCB 3WGNA 3PSAA 1Q0PA 2EU8A 1G64A 2O3TA 3JZDA 4DJTA 4RPLA 1NURA 4UE2A 4G9GA 1X74A 4RY8A 3VXKA 5FB3A 3A1CA 4I1SA 4MS4A 1ZMXA 3GUYA 1TO2E 3NUZA 1CR2A 1E7QA 5BT8A 5BWOA 1OX5A 3O8LA 4C43A 2DM6A 1R6BX 3QKSA 1L5MA 1XD2B 5E4YA 4LOJA 4O4JA 2R87A 3FETA 1EFHA 1HKUA 2ZTUA 3NDJA 5K4GA 3QMWA 1QNFA 1NUPA 2IE8A 2AN9A 3KWFA 4GUAA 2Q2VA 2QHXA 1EGQA 5I7WA 4DCNA 3M3PA 4C5AA 2ZQZA 2DPGA 121PA 3BWCA 1GGKA 4UU8A 3KFLA 1PKEA 3A3KA 1FSZA 1R9GA 2FMUA 2X7JA 3KEQA 4GPEA 2J7KA 2I4MA 3COVA 1M1NB 5K45A 2NVWA 3K9WA 4HQRA 4D8UA 3EGXB 1I2DA 3ETHA 4DXHA 2B8NA 4G4IA 2NUTB 3UW3A 5ESXA 5JTTA 3IEPA 4J9UE 4XWOA 3DEKA 2I4LA 3VTZA 3UH0A 5I7EA 2AWOA 2F6RA 3RR2A 5LZ2A 1WY5A 4O4IB 4LECA 2Z56A 1OREA 3IBYA 3ND9A 3NTQA 4CL2A 3HXOA 5C1PA 2OV3A 1NF9A 3ZDXB 2CSUA 3T34A 2OXRA 4OYYA 2VTBB 2VQ6A 1UAAA 4LHSA 5L53A 3NBFA 4IILA 4E30A 4M0FA 3SPXA 4RTRA 2Q5JA 4KAFA 2AX3A 1KEPA 2MSEB 1C0LA 1XTSA 4WD3A 4KYTA 2RGEA 2JZNA 2DQSA 5GOZA 3GRKA 2H0AA 4CM1A 1MJFA 2EL9A 1JJ7A 4JLMA 1KZYC 3D8TA 3AM1A 2XTAA 1KOGA 1CW2B 4HAYA 4V1CB 1YQTA 1MVOA 4KVFA 3SXJA 5HZHA 1V43A 2OAGA 4MS3B 5G4LA 1OH8A 1RR6A 5FD8A 1CK4A 1BAPA 3IAHA 2H85A 2HAEA 5KVCA 1ENOA 3A4TA 2OWDA 1C3JA 1AA6A 3I73A 4LQCA 1QGUB 4KFCA 2J3JA 3LPDA 2BBOA 1U2TA 5ALOA 3VPBA 4D1YA 4HRXA 4RZSA 2Z9CA 4JK3A 1BSVA 4PZCA 1BQ4A 1GDHA 4ZXPA 1PLLA 1YULA 1CDDA 2A1IA 2YNMC 3KB1A 1UPXA 3PP8A 4P34A 1FIUA 3NFRA 1EJ6A 1XD9A 2Z9DA 5DFAA 1P5HA 10MHA 1OX4B 4YT8A 4WY5A 4QDXA 1SCJA 2WYVA 2QTGA 1TF7A 1U0NA 2QLJA 2ZJYA 1N6HA 3GT4A 3QLVA 4MWBA 2I6UA 1E1CB 4L5AA 3V3KA 1NQOA 1J70A 2CUNA 4DT1A 2GXUA 2CJWB 3GUVA 5DPMA 5FAXA 4CLOB 1WZNA 1EB9A 3WZ2A 4WOBA 4XN0A 4E0FA 3G23A 2E0IA 3FM9A 3OWOA 4J3FA 1T3TA 5E8RA 2O2XA 3MJEA 1AD2A 4HTAA 4OQFA 2X23A 3FZEA 2J6IA 2VF4X 4DRXA 4QG3A 4MVCA 3QW2A 2ZYWX 4CM5A 3HK2A 1EUCB 2FPXA 1PKVA 2XMPA 3PFCA 1C30B 1YB7A 4GBMA 3TOZA 2EV9A 2ZT8A 3MCUA 4MICA 5DS0A 2KI5A 1UZLA 2IW3A 1XTZA 1V5VA 2X0JA 2C9BA 3N7TA 3FZNA 4PLZA 4RK5A 3G9UA 2HY7A 2WWGA 4RK0A 5CXSA 3F98A 5KVAA 4YCBA 3H9QA 2XECA 3I09A 4U7PB 4UNPA 3BSWA 1NE7A 3JRNA 4R8LA 1QFJA 3WLKX 2P6RA 3RVPA 4FYVA 3ORYA 3IEVA 3NBAA 2WJJA 1LLUA 1ACJA 2C5GA 4X6UA 2O0KA 4Y2TA 1G55A 1AMOA 3D3QA 3AF0A 3EUAA 2OENG 2QDKA 3ITKA 2A1UB 3O4GA 3VZSA 1E1LA 2WPDD 2ZYVX 1RHRA 3F2VA 4RZ2A 2WIDA 5F1KA 3PPYA 3WGGA 1H9CA 2HIGA 3K71B 3A4NA 4FSHA 1IOZA 1YNOA 2IGTA 5TEVA 3I05A 1ESDA 3RYTC 2LV8A 1G2IA 4JJ8A 3SE0A 2D59A 3U4QB 4DKXA 2FSSA 4X45A 1N9KA 3ZWCA 5ARBA 3SXUA 5JNVA 4X6YA 5K3CA 4S24A 2OBFA 2ZBGA 2AZTA 4HS4A 3ZDEA 3AFOA 4WBNA 4NX2A 3E81A 4WI1A 2XMBA 1GM5A 4PRLA 4RNDB 2JBWA 3ER9A 1DI0A 3ZD8A 1E20A 2OBMA 1FUIA 2IYXA 2QX7A 5D7BA 5K05A 1FX0A 4W9NA 5JRJA 1C1YA 3CCUB 2PYDA 3U4QA 1SQGA 2BEJA 1IRIA 2X9VA 1WD7A 5LMNB 3FNEA 5GZ3A 4C4YA 3KVNA 3O4RA 4XTRA 1GQ2A 3C45A 2HKIA 1ML3A 4OLBA 3QE4A 1QGAA 4HP8A 3AJ9A 3KQWA 3EPPA 1T8YA 3KUDA 3MIZA 4LRUA 1BD4A 2CDCA 1C1XB 2HADA 2BMDA 1BE8A 2WAAA 3I0MA 1P0FA 4KQ9A 5BXYA 2W2NA 1QHIA 4ZIRB 5E4TA 1E79D 5LA6A 2EGHA 2BKEA 4OLFA 2ODAA 3C8DA 3RF7A 3C85A 4YR7A 4Z7OB 1UD4A 3SK0A 3LNNA 1LDMA 1UBEA 4PGGA 5KW9A 2R60A 2XCTB 1ULTA 3KQSA 1PFYA 2H4WA 3K6SA 2GCEA 2X19A 4JL6A 2EJBA 5HQ3B 2GPTA 2NPOA 4KV7A 5TQJA 3FUWA 7REQA 3B82A 1K4KA 3HDHA 3UV7A 1JDZA 1T8RA 2G08A 2I2CA 4GVLA 4NAUA 4BS9A 2ZYTX 4MGIR 4B8WA 2AFIB 1JE0A 1VJ5A 2Z5GA 3QJYA 4F3CA 2CKDA 2GD0A 4RK4A 3DWIA 3M3DA 1QUFA 1P91A 5REQA 3RSLA 4RNCA 4A2PA 3TKYA 1JIXA 1SBZA 2NZXA 1R8YA 3QK7A 4IAOA 2QU7A 1FUKA 3DZIA 2AFHE 3F5MA 2OZLB 4I5FA 2BFFA 1TZMA 1XLWA 4IYRA 4N8SA 4NG5A 4CKCB 1G38A 2O20A 1Q3TA 4JB3A 4MRMB 1GXSB 1Y6FA 4OOVA 4ZVMA 3TPZA 4RIGA 3U3JA 2B5OA 2BONA 3I8OA 5JVDF 1HG0A 2W22A 3RV4A 4OQYA 5AXDA 1GV1A 3SE7A 4K88A 3FR8A 3U81A 4DSZA 4EVQA 1P18A 5AW9A 1B76A 2FY8A 3BRCA 4JROA 3HL0A 1V96A 1YGPA 3AXSA 4DXDA 1XOIA 3A32A 2J3EA 1C3VA 2B7BA 1EE9A 1SHTX 3FMOB 2QBYB 4FKZA 2FZCA 4KO3S 2IYUA 3G5TA 4RV9A 1V9CA 3UAWA 1QIIA 2BFDB 3UMMA 3TLMA 2RK4A 3G0DA 4FOOA 1W0JD 4EKNB 4BXOB 4EFLA 2AEEA 3AM3A 3EULA 4XPZA 1N9ZA 2PLNA 3CXUA 4EJSA 1KFKB 2BGGA 3DFUA 4OHZA 3TOVA 3OX4A 1XZFA 3H11A 5C8YA 3TQTA 2EW2A 3GI1A 4JOQA 3WGJA 1FLDA 4LA4A 5K0ZA 4DY4A 2I67A 4NDNE 1IXRC 3MTAA 4IO1A 2Z6UA 2R7NA 3DV9A 1FEZA 1KIFA 4Y98A 1J23A 1VHJA 3RBVA 4BQNA 1LI5A 3T4XA 1AHNA 3EPLA 4LF4B 4NLLA 5JMOA 4WFKA 2R7KA 4K9QA 3VPXA 1J8QA 2AXPA 5C53B 1ENZA 3MT9A 4R1LA 3LQQA 2WKPA 4V0NA 2YHSA 4GC5A 4MCIA 3SR0A 4X1IB 2ZYRA 3IXMA 1EJ0A 3NALA 3EFHA 2PSJA 2JEOA 3PTLA 3C3JA 3GEMA 5CNIA 3TAXA 5G3YA 4OH1A 3CGWA 1DO0A 4WK2B 3QGMA 1Z75A 1TK9A 3ZCVA 1CY1A 1E0JA 3DL7A 3QX7A 5J2TA 4Q3KA 1T9HA 1UDXA 1EE1A 2V0CA 3AB7A 4XCXA 5DHAA 4HNVA 1UWCA 3KTOA 4QGFA 5CVCA 3RIMA 2A8YA 4IDEA 2VH2A 4QLOA 5HZKA 5GY7A 2VCYA 1SXJD 1QG2A 1GL3A 4B3TB 4XWKA 5B4VA 2I9KA 4J16A 2DKOA 1U2PA 1XD2A 2BKXA 2NVBA 2UDPA 4OGKA 4PGAA 5AW3A 1RWXA 2AN1A 1UOEA 4PYNA 3ZYCA 2BGUA 2X9QA 3ZE8A 1R12A 1SM4A 3DNMA 2VNJA 1YB2A 2O2SA 4BBJA 8AT1A 1K92A 1UKCA 2JIQA 4NH4A 4W1RA 5CYFA 1RWQA 1NUTA 2TYSB 3F9CA 5FTLA 3MSXA 3BORA 1A76A 1KVRA 1P19A 4CF5A 1JBEA 3LUCA 3TSWA 1WZ2A 2ZSKA 4UPDA 3Q85A 1EAYA 1NBMD 1Y6ZA 3SJZA 1N1EA 3ZZUA 4Q47A 1KDVA 4BJ6A 5IUJC 1BIFA 1J90A 5DN6A 2IHNA 1RAGA 1QK3A 3KEFA 1ZHOA 5AVSA 2YWEA 4BUZA 5D01A 4AKIA 3EIUA 4W8HA 5FWYB 4B7XA 1P6UA 3TMKA 1TRKA 3ADKA 1KO1A 3FCYA 3ISTA 4L4ZA 3H8JA 6ADHA 4RTSA 2XD4A 4CI0B 2AQKA 2GWRA 4KVAA 1YJNB 1AXEA 4F9GA 1J25A 1KL7A 1K8YB 4JOCA 3V4ZA 1MJNA 4FFSA 2DLDA 5EFZA 1KI2A 1U8XX 1KERA 1CQWA 3H9UA 2VTDA 3N8DA 4QL3A 5JHGB 5BMOA 5FOSA 2RGYA 3BAZA 1G1MA 1RBMA 2WLSA 2XOKA 4NARA 5E6RB 2XYGA 1AIPA 2C5FA 1ZK1A 3ENWA 1ZJYA 3OICA 4YLEA 1KJWA 1VLVA 4MPRA 2OWEA 4B40A 3EZ9A 1FXSA 1MOSA 1P17A 4RM3A 1TRHA 1E3EA 3UGQA 3PFWO 4EEZA 3GLIE 4O63O 4C07A 4YHBA 2EFEB 3GPDG 3MCWA 3HP7A 3W2TA 4KH0A 2PRZA 4HFRA 1DDGA 5AI9A 1QX3A 2X0NA 1J2EA 4E22A 2QTLA 1CLEA 2X13A 4U8GA 2XCSB 1MB3A 1FNCA 3ZGXA 4FS8A 3TRFA 1V9SA 3NPAA 4DNPA 2HIMA 2YYAA 3ZY4A 3E7DA 3VPAA 3HM9A 2I91A 1TZ2A 1EQUA 3QHQA 4TT8A 1QDLB 4XE5A 2DWPA 2I99A 3PHLA 2RAFA 2JLWA 4EUSA 3V4OA 4MZDA 3V80A 1Z0ZA 5LMUB 1PJRA 4BTEA 1P7YA 3T3OA 2EFDB 4JI5B 4OHCA 1R6XA 1H4TA 3QVGB 2BMAA 1CJCA 4DMHA 2PWYA 4UJ5A 2JPDA 1QJ4A 3M6VA 5AXCA 4OUDB 4CTNA 3TZEA 3THXA 2P78A 3K2IA 1XF9A 4EUFA 3SQDA 1NZFA 1TD9A 2AF4C 3DOFA 3DTTA 4KRXA 3CESA 2CXRA 1KO7A 1H69A 4EDHA 5I45A 3I53A 3B70A 3UTCA 1EGHA 1ZXXA 1KR5A 3CF4G 1NNI1 2Z3VA 1DPFA 1KIMA 1W94A 1EVLA 2QAGB 4I8XA 5DM0A 2ZCVA 5TQ2A 4CKWA 1WNTA 5K6AA 4MPDA 3HXQA 2WJIA 1PT5A 2W2LD 1WXQA 4OU4A 1L7MA 3C3BA 1FUYB 1H9AA 3DVRX 3TQOA 5BSXA 3LDAA 1KYQA 3GW8A 2PIDA 4TTVA 4MW1A 2WIGA 4PX3A 3SC3A 3ZW8A 2BEWA 1CY4A 1JQ5A 1XAJA 3CCCA 1KH2A 4A73A 2NSLA 1AV6A 1JHOA 4CTKA 3PFFA 1VLLA 4RYDA 4UVIA 3U7IA 5LJLA 4HDNA 3QXCA 2UUBB 3QBEA 4BVFA 1CUFA 3HJNA 4NMLA 4ML3A 2FPMA 3MIIA 4K3VA 3MYRA 5FUVA 2QLTA 4JS0A 4MPJA 1NDQA 1B15A 3LRXA 4NCNA 3VZPA 2HNAA 1R50A 3N2YA 4KDCA 4RK1A 3QVOA 3C7DB 3EDCA 4BO1A 5K2OA 2PGIA 3DFZA 4KVZA 3MQ2A 3HM2A 4C0HA 3WYFA 3PD7A 2HK6A 1TNDA 1JEYB 2GAOA 3ZGLA 3FDXA 3UICA 2PV7A 1YZNA 2ZQ5A 1KFBB 1ZJ5A 3IMFA 1NU6A 4LTNA 2IVFA 3FOFC 5D2CA 5KOHB 4BDTA 4FT4A 4XLLA 1PIWA 5JVDB 3TR0A 1V5EA 3RQSA 1OXMA 1J0AA 4FZ5A 5JALA 1D4OA 2YWGA 1F20A 1D09A 4M9QA 1Z7GA 4U6QA 4C0WA 4L3VA 1E2EA 2AZXA 3TTUA 3X44A 1JDVA 1CSEE 1Y7IA 2R1VA 3P9XA 3LT2A 4QBKA 4YRFA 3K6JA 3I2JA 4F3RA 4NEQA 3KXLA 2ABWA 5IAOA 5L3QB 2WW8A 1KGDA 1CFZA 1VYVA 3MWEB 4GAEA 3Q40A 3G2QA 2UXBB 1M2OB 4Y6LA 1NXVA 1QU2A 1X9GA 3A3GA 4C78A 5KU7A 3DEIA 1Y34E 4QDKA 3T7RA 4EYGA 3NHYA 1V1MB 2Q8NA 1H9BA 5KSYA 2RFLA 4QA9A 2GYUA 2C03A 2WHRA 3MBKA 1GRQA 1IJEA 4EW1A 1XVAA 3VR4H 2ZSFA 1T34A 1R64A 1V5GA 4YJKA 1VIDA 1YIOA 3IQWA 5FEMA 4Y67A 4IIUA 3DE5X 2GD1O 4EG7A 5GADl 3GRPA 4B5KA 4YWJA 1COWD 4W7SA 3RVRA 3NHJA 4OB7A 5HHTA 1RDFA 1MMFB 1X7DA 2P2YA 1BHJA 3EGIA 1G8JA 4J49A 4B82A 3HFJA 2TSYB 3SHQA 1W2HA 3EY9A 5CDGA 1YA8A 1ZHHA 2X5NA 4D3SA 1O0BA 4LFAB 1G8MA 3ROPA 1Y3FE 5CLIA 3SJ7A 2ZXHA 4QBTA 2C42A 2DE0X 1QMPA 1E2MA 4JQYA 3ZIDA 1JAXA 3R4CA 4Q9HA 4F4FA 2VJNA 2SECE 2WHYA 5ENVA 1QH0A 2BFEA 1XA0A 4L0DA 2WILA 4LY3A 4RDIA 4EUKA 2E1RA 4HDOB 1PR3A 4IUBS 2ZSJA 2OCYC 4TLBA 4DDMA 3OQ1A 2V0NA 4YXFA 1BMTA 3I23A 2N9UA 4NYMQ 2NU7B 2IS6A 4X07A 4PIVA 4QXRA 1RAFA 4O8CA 4F2PA 2EKPA 4OYHA 2YWHA 3I1FA 1E4EA 4Y0AA 3UHAA 1P60A 2K2WA 3G2LA 4F85A 2ZKLA 3HNPA 1CHNA 1IBMB 4DA8A 1ZMTA 1KJ9A 1ZINA 4K0RA 4OFBA 1NF3A 2D5BA 4GI2A 2IUYA 4HDQB 3BT7A 2R8YA 3DQPA 3BDIA 2BFOA 3PQ5A 4R54A 2OB1A 3ZDBA 1VE6A 3NDRA 1AA9A 3OJLA 3IAM1 2X76A 3COZA 3QXSA 3PQ2A 3I8SA 4A2WA 2ZJ2A 4UKDA 2GJ8A 1E64A 5DXFA 2II6A 4AY4A 4CMAA 5I47A 4MYTA 4GI1A 4R05A 1T9KA 4YCSA 1IAQA 2R1VB 3HN2A 5JCOA 2V3CC 3ESYA 3OU6A 4HNAB 1HBJA 3NVAA 3QU4A 3KEWA 3G0HA 3M6MD 1W9HA 2OHVA 1TT5B 1WXFA 3S40A 5KDDA 3FJYA 2HNKA 2Z04A 1XFAA 3CTPA 5IDXA 3R41A 3KSAC 3FPSA 1MB0A 1FYFA 2H4YA 4I50F 4CLDA 1FP4A 1FQOA 3EXFA 3NM4A 2IITA 2H11A 3BTVA 3RYFB 2WD8A 4DNFA 4EQ6B 1C3OA 1NP6A 3B60A 3KR9A 4HNAA 2G7ZA 2ODQA 3AG5A 5LDGA 4EY3A 3CLRC 1OBFO 5DWVA 3M5CA 2DEUA 4JMPA 3HO8A 3KVOA 3WTBA 1TT7A 3CEHA 3V4VB 2Y66A 5GJWC 3FMFA 3QJ5A 1II8A 3KUKA 3WHKA 4ES6A 5KQLA 1M6WA 1AQJA 4OI1A 1I3CA 1VIVA 4L6AA 3RUHA 3VYSB 3R09A 2AX4A 2WM3A 2FEKA 1PJTA 3M4JA 1M0EA 5T3YA 1B3BA 2WUFA 2J3HA 2ZSDA 3SEZA 1S8OA 3CU5A 3Q39A 2R1ZA 4X1OA 4EY7A 4A15A 2IHYA 4KB5A 1QU3A 3S99A 2JGIA 1RZVA 3H17A 4Z49A 3EIEA 1K97A 1NBOA 5KEIA 2IUTA 1C1DA 1NW7A 4MP6A 4N82A 1KRWA 3W1EA 4TTSA 4LPKA 1RYZA 2X4DA 4M0LA 2IPOA 3QA9A 3NHAA 4HNQA 5LSAA 1GILA 1RWPA 2VRWA 5KU1A 4OAQA 3MWKA 1QLHA 4KFRA 3NRCA 1QHXA 2G76A 3U16A 4OM8A 3PRHA 3Q3IA 4M9SA 1E66A 1U9ZA 5E7MA 3IUEA 1JBKA 4EWLA 2FCAA 2Q0SA 4HVTA 4AY2A 4CKWB 1ZVJA 2BFAA 4EMSA 3GZ4A 1IULA 1QO0A 3E7FA 1MNAA 1R1DA 1QX4A 1Q83A 4DNRB 1K9MD 1BDMA 1CJKC 3QWIA 3L1IA 5F1OA 1RJ9A 4ZCIA 4N3AA 2CSXA 2GREA 1D9XA 3HGTA 2BFBA 1NONA 3H7IA 3HCWA 3Q4GA 4EG0A 1DX9A 1TVKA 4DLVA 1VCHA 1VGVA 2HMUA 3D4IA 4LW8A 3TTWA 1VQKB 2IH2A 4TV9B 3KIPA 3F7NA 4I55A 4MV6A 3K30A 3W79A 1R4MA 1HT0A 4P4UA 4PX2A 4KREA 2F9LA 1Y5RA 3FX2A 2B9VA 2Z6BD 1P4RA 4MV0A 4V0LA 4CLXA 2ZFUA 1CUVA 4CN9A 2XDAA 3A1VA 5ILQA 5CMLA 2HJWA 3OLXA 3CUVA 4MWGA 4ZZ1A 2IKQA 1B8VA 4UZFA 2QTWB 3B6JA 3D7MA 5KNBA 1D2AA 1ZRNA 3D8NA 4FCWA 1MZPA 4OGWA 1FBNA 3BB1A 1Z2OX 3O31A 2DUNA 2UVPB 2RHLA 3E03A 3HFSA 2ZJAA 2ZWPA 5B1DA 5JBIA 1DKPA 1DC3A 2IOFA 4OUDA 4BNVA 4CEJB 1OT5A 2FZVA 2Y9MB 4X06A 2NXEA 2PEYA 4PIPA 4S0XA 2C4NA 2XH8A 3UJ3X 5GONB 3RSQA 1XNJA 1TL7C 5EEGA 4CG1A 3RT1A 4A9AA 1X92A 2LP4Y 3BTOA 2A35A 4INAA 3VI3B 5A3JA 2QLLA 2VAXA 3OE7D 2Q3MA 2X15A 4FB5A 1XZKA 2YW9A 4UTNA 1SPXA 1RPNA 2J3LA 4YCNA 4KSBA 2J41A 5ALDA 1FLNA 1D6JA 3TFWA 1YS1X 2H3EA 3KT0A 3N0TA 2AUTA 3C6YA 3KAPA 4ARZA 1OC2A 4W6ZA 4UVDA 5G53C 4B33A 2VHVA 1SQ0A 4B8YA 4ILEA 3PD1A 3DGEC 4E3ZA 3VR2A 1WTHD 3IEKA 4L08A 5JV5A 1QTIA 1YFJA 5DGTA 3HDYA 3NANA 3A10A 1Q11A 1JFVA 3G9XA 2BDEA 4ZQBA 4IL5A 1NW5A 4GWLA 2E4VA 3BK7A 4NESA 1V8PA 2WB4A 2P3LA 3G02A 2CNDA 2V55B 2W5UA 4JV5B 2GRJA 3VC2A 2X1LA 1T5SA 3BX1A 1HV8A 5L3RA 2OD2A 4K8OA 1OFIA 3PIDA 4BPBA 3ME5A 4ECEA 3ODPA 1SIUA 1GO2A 1TXGA 1SBCA 1UIRA 2YTZA 1N5KA 5BYAA 3RYCB 3PI7A 1RJFA 1SXPA 2VDKB 1ZGHA 1JNYA 4QYXA 6NULA 5LQDA 2ZRAA 2DT5A 2A4KA 3ORHA 4D4LA 5FWYA 4KN8A 5A9TA 1FDTA 1SK9A 2G0TA 4D9JA 4GMGA 3GVLA 3ROKA 3J80A 4LOHA 1JRLA 1K88A 2O8VA 3ANSA 2CXQA 4OK3A 4CEIB 2R2AA 4EI8A 2H5IA 2GXAA 4UQLA 2GBLA 3K0AA 4WVFA 4IYJA 2I78A 1VQ4B 4RWEA 3KRTA 4XM1A 1W1UA 2Y0BA 1X9HA 2WF8A 4QHYA 3V1KA 1Z36A 1QV9A 5JCXA 3O21A 2XGGA 2IZZA 3AK4A 4JOSA 3W7AA 2R6FA 4JSYA 4C7MA 4EHIA 1EQAA 1RWBA 4LTDA 1DLJA 1U5CA 2HOQA 2PBLA 4CKBA 1CXZA 2Q3JA 5KIAA 3MWLA 1W0JA 5ARDA 1WU8A 1QB7A 4QHTA 2QGNA 5F77A 3WICA 1EFVB 1JFTA 4KWCA 2CD9A 2VPTA 3HA2A 1QYRA 4ARSA 3O93A 1P8JA 5JAPA 1UP4A 4WKBA 3UJ6A 3COJA 1E3XA 5IHXA 1P4HA 3ESAA 5DE3A 1OGIA 2AQHA 4GBJA 5KINB 5H8WA 3ZVMA 1M66A 1NLZA 1NVMB 3QXXA 4R51A 3NASA 4RMHA 1EFVA 1KQ3A 2LW7A 2M6SA 1JQJC 1LWOA 3GRVA 3KAQA 5J4LA 1XMVA 1ILWA 3PVZA 4G2TA 3ZI4A 1Z5ZA 3D4PA 3EF0A 1CY0A 2AFVA 4CQLA 1YB4A 1Q1ZA 4I5DA 1CR1A 3V8VA 4O3FA 3KZ1E 3LBIA 5DI9A 1J24A 5T5QA 1T1GA 1Z39A 4HNSA 2CFOA 2R0QC 4RM0A 1GSHA 4PC1A 5YASA 1DGQA 1TTHA 5ALSA 2G1AA 3MMXA 4UZEA 3PNKA 3L0PA 4IDHA 4NZNA 4I6EA 4BCCA 4CEHB 1JDNA 3HPQA 4MJ7A 1U90A 3ZCTA 5K6RA 4I66A 1PFWA 2XMDA 3RK1A 3WTCA 4WZTA 4ED9A 4NVRA 2JFUA 1C9KA 2QN2A 5FPQA 4EF4A 2QD3A 2J59A 3VMMA 2ATEA 3B5IA 4ABTA 5D3MA 3U6BA 2QL7A 2PNJA 2QWXA 2V7QD 4GWGA 5ECYA 2OQVA 3UYLA 4HAVA 3MMPA 4XFKA 4PWYA 1TUIA 2YX1A 3JQBC 1U8AA 4PG6A 5DNUA 1N5LA 2ZE6A 4Q9KA 2BOVA 3V8NA 3W06A 4HEJA 1RP1A 3DZ8A 4MLZA 4KDEA 1QIEA 4KMSA 5D86A 2YZNA 3N53A 2WDPA 1WPQA 1ZVQA 3EUFA 1LU9A 4FMCF 2IX9A 1MO2A 2I62A 4TLEA 4DUPA 1G5RA 1PW5A 2SKCA 3M4XA 3EJWA 1PFVA 2HPAA 4GP7A 5BSKA 4O2RA 3F3SA 2IH5A 1ZXLA 2B2CA 2GM4A 3KVVA 4E09A 1MB2A 2QXTA 3Q5GA 4IKEA 3ZVKA 2FOXA 3MJCA 1XDUA 4TLAA 4IJ6A 4IIVA 3BMNB 3P7MA 1N08A 2C59A 1P9WA 1KO4A 3BD9A 3VUEA 1YR8A 1D9ZA 2QMEA 3WWZA 4EJFA 5F7XA 1N0WA 3EIXA 1SUFA 4FMBB 4DGQA 2RE8A 2XY4A 1LBHA 1I5RA 2FK7A 1JAYA 1U9IC 2Y6UA 2WJ6A 1G5TA 2OORA 2YZ2A 4UDYX 4I1PA 4YDRA 3G7UA 3QYAA 2JFHA 1YDGA 1DOHA 1NBHA 2VR1A 4I81A 4B34A 4XQFA 3AJEA 5FDFA 3UJAA 5DHRA 3IVRA 3NDBB 1XVUA 3E0XA 4G25A 3CZ4A 3SNKA 2D3TA 4XLHA 7REQB 4ND5A 2PFKA 3EFEA 4IQGA 1AGNA 5LIRA 2QAJA 2VNIA 1NNEA 4DIFA 1M90D 1B42A 4Q3DA 4JI4B 4LHWA 5H59A 4QXAA 2BKVA 1XLTA 5KSWB 2J1LA 3VTKA 1XFOA 4EAAA 1BKSB 4CCSA 4DR6B 2A3NA 3DFIA 5IJ9A 5IJXA 4HB4A 4DLKA 2QMHA 3G0BA 4MP8A 2KW5A 4AB1A 4UTOA 5EZYA 3RUIA 2B6HA 2ACEA 4LC1A 5EESA 4AQDA 1GV0A 3OLZA 2R48A 3QP9A 2OB2A 5K0EA 2GCNA 3SF8B 4OV6B 2GESA 4IXDA 1AXRA 3UMSA 4RK6A 4R8MA 1WP4A 3KD2A 4WLNA 5TJHA 3BCSA 1QSGA 1ESEA 4NS4A 3DEFA 3KELA 4Q9JA 5EXDA 1NN3A 3X1WA 4ETMA 3IE0A 1JV2B 1QHYA 4BNTA 3A6FA 2Z4RA 4OQLA 1ABEA 1RJ9B 2E4ZA 2AFRA 4L8YA 5IFLA 4WNCA 3Q6RA 3TUZC 4NV0A 1ZR2A 4YRRA 1F2TA 3UHOA 3KWLA 2JCBA 1J9GA 5CT8A 5A2QA 3BFJA 2BCJQ 2CHEA 3WXBA 4DLWA 4EP1A 1GZ3A 3MJHA 4ZRMA 1WW8A 2ZTVA 3I55B 4TXMA 4UDXX 3RKRA 2EFJA 3ZHYA 3H19A 3QI2A 3FOZA 1NRWA 1E1CA 3UENA 1XT6A 2NP7A 2CDRA 3VVBA 5IVDA 4DIKA 2EJUA 4WLFA 5FH9A 5FFFA 4OGFA 3DOUA 4WK4B 3B7PA 3PZBA 2OL4A 1V4VA 3QVXA 5U4QA 2Z30A 3KETA 2HCJB 1JJAA 1FLVA 2RGNA 5KWSA 1V4BA 3K73O 2R6HA 1IXZA 1TQ8A 1U28C 3OX1A 4C6HA 1PJQA 1S4QA 1Z47A 3KEGA 1OW3B 3IDQA 3L43A 3RNOA 3NVKI 1HLDA 1C4OA 1JAIA 2I7TA 4Y9UA 3KC2A 4BMOB 1D6SA 4IKPA 4C0BA 3G1WA 5HWSA 5F3WB 3O1HB 4E7OA 3N2ZB 3GLIA 1SIWA 3CW2A 4J0CA 2AI2A 5JJCA 3BICA 3QKRA 3A1EA 4NPCA 3RDPA 2JD2A 1DQPA 1OYWA 4CCYA 2MWMA 4RA6B 3KQTA 5K0LA 3RPEA 1EP1B 3RIGA 1UCFA 1PT6A 1BXKA 1XMJA 1ZJ4A 3CSUA 4Z4HA 3OMXA 2H2IA 4YREA 1KZHA 3FPAA 1SG6A 4ZEXA 2WYIA 4IS2A 2CLLB 2PFGA 3AR4A 1CUZA 3EXFB 4LOIA 3QFRA 4V0KA 4CVNA 1R15A 3O8DA 4YRMA 4JLOA 5A5VA 5FL7D 1H1TA 4BO3A 1Y9EA 3Q3CA 3L7LA 3PGVA 2C77A 1JLSA 2PKCA 1JEOA 3HH8A 2ISSD 3A05A 1I1QB 5CBPA 4XKWA 3ONYA 2FDCA 3GDFA 2WVAA 1BGWA 3UW1A 2JIZD 2JARA 1LSJA 5HKKA 2ID7A 1DP4A 2JD1A 3MHTA 4P5EA 1I6LA 4BEBA 2GD6A 4G0MA 1Z5UA 1Z29A 3O1JC 4LYDA 3OZSA 4Y7DA 1P6XA 4WACA 3THOA 4AS2A 3OX3A 4O4HB 2GPSA 3JATA 2FSFA 4HLUA 2EFYA 4I1IA 2Y1OA 2XOEA 3AUFA 1WG8A 3SXPA 4JHXA 4ARCA 3LBNA 1USVA 3FOAA 1M74A 2O5VA 4C3OB 1CRLA 1DV2A 1W88B 2GPYA 3SZLA 4CMCA 5AOCA 5GTDA 2PV0A 4KODA 3B3GA 4QPDA 1LPBB 2DERA 1FE8A 1ZCJA 1A9PA 2AJTA 3A1TA 3B9PA 3C4QA 2H16A 1SG9A 2CZCA 3JPYA 1ZISA 2FPWA 2WFLB 1U3WA 1VPLA 1E4YA 3TTSA 2VJJA 1JG4A 3NIGB 3RG2A 2K7ZA 1TF5A 1X3SA 1L7VC 1TC2A 1EK2A 1NF8A 3INRA 1M2FA 3LY8A 4FSXA 4M1YA 3SN6A 1UAYA 1P7WA 3ET5A 2DQZA 3F6CA 3L79A 5LBUA 4Q1CA 1GNSA 4XLFA 1ZA1A 4KXFB 1L4HA 2GK6A 4YCMA 1NQWA 3K1AB 5SYAA 2ATVA 3DNFA 3B8EA 1X70A 2YXBA 1FDOA 3D2BA 2ZI7A 4ZN6A 3JTMA 1Z63A 2JATA 4KN6A 2EBUA 3K32A 1NVVR 5FOVA 4G37A 2DR3A 4Q1FA 4R40A 1FB5A 1U4NA 1IG3A 4B3MB 3LD9A 4HSEA 5KO2A 2HNBA 3Q10A 4DY6A 1Y6GA 4Q3AA 1UWVA 2R4UA 1ZUNB 2VSNA 4J76A 3HB9A 3C14C 4OBBA 4RLSA 1FRQA 4JLPA 5F5XA 3ICQB 2B4YA 3IULA 1Q1QA 1X7YB 1U0TA 1ZICA 5ALYA 3G7NA 1ESMA 1YO6A 4B09A 3PF9A 1V7PC 4XQ0A 2EKZA 4FLEA 4R71A 1C81A 3RVNA 2OXTA 5LP6A 1I7DA 4POOA 1E9EA 5ALFA 4HNHA 2QVXX 3LI2A 4QC2A 4HAOA 4OYRA 3INYA 2HH9A 3W7BA 4YHHB 4F4DA 5BYKA 3QFSA 3PJFA 5L3QA 1KP3A 1JG2A 1RKXA 3I6QA 4WX2B 4OHYA 5AJUA 3K0BA 4R2LA 3DDZX 4RHEA 3RRZA 3L8HA 5FI1B 3B1WA 1AT1A 1HNWB 3TRKA 1TU4A 4MA0A 1U65A 1Y89A 2J3QA 1XTPA 3AHDA 2I54A 2FTKE 3VOTA 4AJIA 1KP9A 2JH9A 5AHXA 1KH1A 1SRRA 2I22A 3DOOA 1NXOA 1K3UB 3CRMA 2C0PA 2MTBA 3SBDA 4U7FA 1DX6A 4JD5A 5KYUB 5AI4A 1RWMA 1NJ6A 4Z4GA 4BVGA 1V8OA 1UFQA 4A0FA 7ABPA 1NM5C 1O5TA 3KT8A 2IU3A 4KOAA 2NVUA 3D3WA 2FPPB 2FUG1 1UBJS 1MF7A 4Z0TA 4TQUS 3BTUA 4RCVA 3R0ZA 3G4SB 2ON6A 2IRWA 4HMPA 1LPSA 1E7MA 2ZT7A 4I2VA 5JD6A 1D1SA 2A88A 3V46A 5JSFA 3GDHA 1V37A 4MR8A 4TROA 3OJXA 1F38A 2CHFA 2FN3A 4ZEVA 3FD8A 3LCMA 2GM9A 3W1WA 1YOBA 3UMFA 3JZFA 5ALWA 4ZQCB 4F04A 1BPLA 1NF2A 1PS8A 3R6LA 1PKXA 4KPUA 3VHXA 3E05A 3DDUA 1M67A 3QBVA 4R2HA 2HHLA 4HPJB 3EQ7A 4B7ZA 1GG8A 4O33A 4PPNA 1Z6QA 1UQUA 1O96A 3NAZA 1ZOPA 2NQ2C 1XIVA 1S2NA 4YO8A 4PHTA 4EUHA 2X9GA 1YBAA 4IQ8A 4LJ6A 1XK7A 2MOKA 2WUEA 3BA1A 4XVRA 4E5NA 4ZOLA 2NO0A 2PCLA 3F4BA 4P2BA 2ALJA 4P26A 2XZLA 3OUTA 1CRQA 3ZIUA 4KDRA 1Z62A 5I3ZA 3SFZA 1P4GA 7YASA 2OGUA 3C43A 3R0JA 3O8CA 3AESB 3C41J 4NXNB 4OOSA 3C3XA 1AQLA 4LS3A 6YASA 2CJPA 2IXFA 3N8NA 4ND3A 4NABA 4IW3B 5JDIC 4BQFA 1LQTA 4YAGA 5JI2E 1U0HC 3G9TA 3LY9A 4ZT3A 3EN0A 3LVRE 1KDYA 4ZTZB 4G4GA 3NAQA 2ZL7A 3LNTA 1Q1BA 1PEKE 4G67A 3OF2A 4MQLA 1RLTA 1EU1A 4WN9B 3VR3A 2H07A 3W9SA 1XVVA 1IRXA 4KR0A 4XPIB 5EJIA 2FR8A 5EIOA 1ZL0A 3B6IA 2CHUA 3GNQA 3KQPA 4D97A 5KOHA 2VZLA 4TVOA 1PT8A 1YDEA 3LPNA 1GPYA 4DAOA 5JATA 1OGYA 4BATA 3BGOS 2E6KA 5I5GA 5LVAA 4AJ1A 4U2DA 4XYMA 4OTZA 4E21A 1YR1A 4LBWA 2VK2A 3GFQA 3PL5A 5IAEA 2E87A 1U0SY 3IIEA 3MVEA 9LDBA 1RMQA 2IELA 3KJIA 2IX3A 1C7JA 3C1UA 3ZI7A 2BZSA 5M5BA 2OVFA 3PQ7A 4ZVOA 3W8FA 2DUWA 2JIDA 3KYDB 1QH8B 3SLKA 3AI7A 3OQIA 1H23A 1MABB 4B83A 5IKOA 4LJ5A 3DTVA 2AZ4A 3WGTA 4JJAA 2XWJI 1NHGA 4PVCA 1T0UA 4RD4A 2XCQA 1L4EA 1SVWA 2ORED 3C1OA 4OL9A 2Y1KA 1Z0SA 4QUAA 2WPNA 1L7PA 3D3WB 1QNLA 2XITA 3NC4A 3V8RA 3C6XA 4D46A 3HKEA 1DWUA 1YUMA 3EHEA 1A9RA 1TW3A 1U6JA 2P4QA 3IPYA 4EHJA 2PUTA 2FDRA 1YZGA 4DTIA 4XRGA 2C20A 4BWFB 1KJJA 2Q62A 1YBMA 3UOAB 2A5LA 1ZJ6A 3R6DA 2JLUA 3I62A 3UV6A 1ND5A 1Z3IX 1X7XB 1PYGA 1S2DA 1Z17A 2C97A 4G65A 4HATA 1D0SA 3FWYA 5ALTA 4G0UA 2ZRLA 4PO1A 2C5AA 1RQ2A 4JJ7A 4MYSA 4GQNA 2YVQA 2ZP1A 1KRHA 3GK3A 3TZKA 2PGLA 4R98A 4BNWA 1JIVA 3SIRA 3OOEA 4K9LA 1FY2A 5JFOA 5EIXA 1PS0A 1C9JA 4FNAA 2G1JA 1RAEA 3EQ9A 2HK7A 3D6TB 2GLUA 4A6DA 1ZU5A 5IU6A 4EZIA 4RVDA 4YV7A 3CEMA 3ZGNA 3KJHA 2YV1A 1GUFA 4B5LA 4RA9A 1LV7A 1NUAA 3NUQA 3OCZA 1NL3A 1DHTA 1NV9A 3G05A 2GX6A 2XVYA 2E82A 2HMAA 4AYXA 3A3BA 5TGTA 1M10A 4DR1B 4LKRA 4ZMSA 2B1QA 1KY3A 2H4ZA 1BJTA 4BV2A 2I34A 4I7EA 2JLBA 1SD2A 2QW1A 4FS3A 2Q0XA 4M53A 2GKGA 1IDOA 2Z3WA 5AJVB 2QR3A 3DXXA 4L75A 1KXZA 4ROSA 1G7TA 4ZT7A 1LNSA 4AURA 1UP6A 5FIUA 1UEIA 1UJNA 3GWGA 2ZUUA 1VE5A 1SXJA 5CXUA 4FEAA 4C20A 3AVPA 2ZK7A 4YO7A 4Q16A 2FZWA 1Z45A 2P2SA 2ZWOA 2VNHA 1TCAA 1LK7A 1M6VB 3C48A 4KQMA 2FOIA 3BFXA 2W2KA 4P08A 1HKHA 3A2NA 4TSFD 1GKIA 3EWIA 4QTUB 3FPCA 1T5IA 4KL8S 2TMDA 3P32A 5JE8A 1LK0A 3H4VA 1TFUA 3GMTA 1ES9A 2C54A 5T4EA 2H92A 3VQTA 3ON5A 5HCNA 1EFRD 4LZZA 3HB1A 2OGTA 3OZRA 1IZ7A 3TTTA 4UAJA 1OI7A 4FR2A 5JD5A 2GEVA 4YP7A 1XWIA 1VE3A 3LWDA 1T3GA 1P29A 3ZK9A 4MDEA 1H5UA 4RVFA 4TKVB 4ZU1X 3SP1A 4U0JA 5CRIA 3GU3A 3SICE 4RABA 1HDRA 2FFAA 2E18A 2RJNA 1SOAA 3DKRA 1TKRA 5AVTA 4IOJA 3QOWA 1UXHA 4G1CA 2O3SA 2X53S 4RPKA 5HYVA 5HM6A 1Z15A 2W7TA 3AXTA 3VC3A 3ADBA 4IR7A 2VA8A 1IBRA 1L5SA 3OCJA 4XB1A 2QQ5A 1ST3A 2D0OB 1Z33A 1VYHA 2FQYA 3O0TA 3U3DA 4CR6A 2PZJA 1Y4AE 3DTYA 4QODA 2FP4A 1YHNA 3HUDA 1TU0A 3ZEIA 2XRFA 4WCFA 5JJLA 4DUGA 3DL0A 3HBNA 5ESWA 2XMGA 3I61A 1N2GA 1VMIA 4I14A 2DBQA 2L42A 4BECA 2Z9BA 1CR0A 4EFKA 1VKRA 5AW2A 1IEXA 3REOA 2E4YA 2EG9A 2RHJA 2GWHA 2GZRA 2VYNA 3CWCA 3QV2A 4M1TA 5LB4A 3HCPA 4PZDA 4DCUA 2QOEA 2Q8PA 2ACKA 1TM4E 3EMDA 3EBPA 4RSMA 2PIAA 3QUQA 3TMAA 3ZS9A 5I01A 5J4VA 3QPWA 3OFVA 2ANCA 3LH5A 2RGRA 3WVNA 4URWR 1FNMA 3KJEA 2HWKA 3GLHA 4J9VA 3AGPA 1FDSA 2CF6A 2FPUA 2XRYA 1HMYA 3OT1B 1WWKA 4B48A 1VPEA 1PSWA 3RIHA 5C80A 2Q3CA 5IKEA 1YBFA 1G8SA 2F1OA 1FDUA 2R8EA 2G9QA 1S7GA 3ZZ0A 2EKQA 3I9V1 1E77A 5GQSA 4E5YA 5K03A 3NTVA 4UFPA 3R6GA 1TZBA 2W6QA 3DWFA 3UMYA 3P2MA 3BFPA 2SCUA 2O1SA 4PM4A 1BHQ1 3PI6A 1L8OA 2RHDA 3KOOA 3C15C 2HRQA 4QYSA 1R4AA 1FTWA 1H1LA 5COQA 1KVUA 3SD7A 4BKPA 3HZOA 4GGOA 4DYDA 2YXPX 2HM7A 3AM4A 1NQAO 1PJZA 1MH9A 3II6X 5T6MA 1W34A 3FVRA 2X41A 2VUUA 3QBDA 1DJNA 5L9AA 1MEOA 3VPFA 1LVUA 4H6WA 1H42A 5LA6B 1Q92A 5LFAA 4PGMA 3KXDA 3F6RA 3ID6C 2CUZA 1D1NA 1JYSA 2XX3A 4BNDA 4PAAA 2ACWA 3DHYA 1QIHA 4IHAA 5DW3A 4EHNA 3AIMA 1J1UA 2W6ID 2CXHA 3A1DA 2QP9X 3EA0A 3F7TA 2HSZA 5AVRA 3GOQA 1BYIA 4CMHA 2BM8A 4ND8B 4MI1A 1WKVA 3CNNA 1IJBA 1W5TA 2VOJA 3BRWA 4RVCA 3REFA 2PZGA 4EVSA 2EF1A 4PZZA 4BVJA 2B0CA 1FX0B 1YR6A 1TE2A 2IPMA 2I1LA 5U9CA 5JASA 1A8UA 5IC6A 2NSHA 2XXAA 4KU4A 5EUCA 1NPTO 4G63A 4EVIA 3GFSA 3GXBA 3SBXA 3H0CA 3K9FC 1K4YA 2M32A 2OKCA 2COEA 4NFSA 3U3OA 1YT5A 2YJ5A 5JAUA 3K70D 2AOWA 2BT4A 1N7IA 5COBA 4R6WA 4MV5A 1YRLA 2X8AA 2GSDA 1ZH2A 4B73A 4BLWA 1DJMA 4B0OA 3JD3A 1Y82A 2ZRPA 2FP3A 1C0EA 2UYCA 1PR0A 2LDBA 2VXBA 2J7PA 5DISB 2W2PA 2AQIA 3BD6A 4KXYA 3GJ5A 3SF0A 1ZH8A 2QD2A 5KTPA 4TWZA 4Q3LA 3HJFA 4LMPA 4FLFA 4AU1A 1P0QA 3DONA 2W71A 3QBJA 2C58A 1ZGBA 2DHQA 4GIBA 1XZHA 1YS2X 3DS8A 5FTKA 4F3NA 1PD0A 2VLBA 3OCWA 3AL0C 1KK1A 1R8JA 1UJ2A 1JYFA 5G41A 4NIMA 3WWOA 3U1TA 4FK8A 4WJZA 4DPMA 1X86B 5I9TA 4FJ0A 5HMMA 5JWRA 4KEAA 3IXQA 5CJ2A 2QGZA 4JI1B 1G3IA 1P0CA 3D0OA 3QU7A 3KS9A 4LGYA 4MUAA 5GPBA 3TINA 3S2SA 4DZTA 5A62A 4XNFA 3FTPA 2WP8J 2YC4C 4LMBA 5C1OA 5B7NA 4OSEA 1O6BA 1SBNE 1ZFNA 4B75A 5KWIA 1VL0A 2OBXA 1L7DA 1Y1PA 2IHBA 3HUFA 4NZ9A 4TSRA 2KLBA 2R6ZA 3HZHA 2JH8A 3GLGB 3EGEA 2C0QA 4CM8B 4Y2PA 5FULA 1DCMA 2VBUA 1NVEA 2ZYGA 3EIWA 2X6QA 5EHIA 5C31A 1Z5PA 1O6FA 2BGNA 4UZSA 2KYRA 3LUJA 4INZA 1KJIA 2AJBA 1SUAA 2JG3A 1UD6A 2FZKA 1M73E 1N06A 1QRRA 2XBLA 3E6AA 4IVPA 3SEQA 2F3PA 3KDAA 1E8NA 3KL4A 2CF5A 2I4RA 2P77A 3LBHA 1JBQA 1S9HA 2UU9B 1SBQA 1XRLA 4DV1B 4EKGA 1O3YA 1O08A 1XDWA 4NZMA 1HQCA 3O4HA 3ADOA 4JP5A 4K9MA 5CLJA 2IOYA 4F93B 4OI0A 4KAJA 4OFZA 2QVCA 2CLIB 5IJWA 4J4HA 3VZDA 1C5KA 2XQFA 3B1FA 4HDCA 4CG2A 4F72A 1GLGA 2FXIA 2AYYA 1TKBA 2J4DA 2H29A 1T5DX 3L41A 5J23A 2V7GA 4XGRA 3LVBA 2QE7A 1R9NA 5FR2A 3ROGA 2J9XB 5EZYF 6AT1A 5IJ9B 4ARZB 1XD8A 1EK1A 4OLAA 3SYKA 1PJ5A 1Q0HA 3GEDA 2GRUA 4CHGA 4EHDA 2H5EA 5F9FA 3FF1A 3D54D 2V7EA 2BGWA 1WSWA 3JY6A 3O5AA 1QIDA 4D79A 1GA4A 1P0IA 3TBKA 1EXMA 3VU9A 3HACA 2CXNA 1KEEB 3ZOZA 3TGPA 3HVHA 1LBTA 2FRDC 3VJMA 2Q46A 1U6IA 2WA2A 1Q3KA 3KLOA 5C8ZA 5IT9A 2Z3ZA 1JQKA 3USCS 1U2GA 3B13B 3Q12A 2AN4A 3LJKA 5FOXA 2RGGA 3LUAA 4KBFA 2I2AA 4MVJF 3VYTB 4F12A 3E9DA 3L7OA 4XGKA 2VP4A 3PEWA 4AKHA 2WYRA 5JC8A 3UOWA 2CYCA 1KZ6A 4JLBA 4KE7A 3B85A 4PXYA 5DXJA 1JSCA 1R9MA 1WXHA 3W6UA 3UIEA 521PA 5DH9A 3E70C 3K0HA 3NBQA 3H13A 4LY6A 1LUAA 4YBZA 4UHEA 5E8JA 3P2OA 5AW5A 4NBNA 3I52A 4XEUA 4L0QA 1RM3A 3GN1A 4KOEC 1H93A 2Q7XA 1V7CA 3K09A 1E32A 2FZLA 3O8QA 4DZRA 3UUWA 5TPZD 2YMQA 2E5FA 5DU2A 4F71A 1ISFA 4IZOA 4PYIA 4X71A 4NC9A 4G89A 3I6BA 2JLAA 1OTHA 4IIDA 2WZDA 2YUTA 1V26A 1RM0A 2OILA 4HPXB 4Y6OA 5BOSB 4MLPA 3TM5A 2C3OA 4V1CA 2OC4A 4RVGA 3K5PA 3NATA 1J97A 1K9VF 1QZTA 3AOGA 4XLTA 2N75A 3JD1A 2GVZC 4D2IA 4DZZA 1JFFB 5HKAA 4KG7A 3T6KA 1IU9A 4LTMA 4LISA 3STUA 4MW9A 1I80A 4H1HA 3TIFA 3EDQA 1KSGA 3HCFA 4GI5A 3EDMA 4EG8A 1ID8A 5C5CA 4XLEA 2GF2A 3L8FA 1X1RA 2K5UA 4G5HA 4ND2A 4WEQA 2VYVA 3V00A 3ASUA 3H04A 4QFMA 2WNHA 4LK2A 2ZTHA 1HE8B 3W3AD 2YV2A 1XN4A 4D80A 1W46A 2DTXA 1HLPA 3DZGA 1EVJA 1KZ4A 4QARA 2CNWD 2W2MA 3GF4A 3NQ41 2QPAA 2NYAA 3PGLA 3ZDYB 3AP1A 1XXLA 3K0FA 3PJEA 1ETHA 1Y1QA 3LXMA 2BFNA 3N2EA 4REMA 3E9EA 1DAHA 2NO9A 1E79A 2VP2A 3B48A 1WW3A 3DCNA 5IAJA 2F1LA 4MMXB 5BW8A 3CONA 3QVMA 4PBSA 4UNIA 3ZK8A 3IV6A 2E6UX 5EIEA 4BNDB 4M99A 2DRIA 3T1TA 2DWOA 2PDAA 4XQGA 1E69A 4KWTA 1Z8FA 2AR0A 1GTL1 5AJXA 3AFHA 3B1ZA 4LVOA 2VF7A 5TR9A 1DCFA 3F4KA 4PYMA 4CQLB 3EARA 2P8JA 1URPA 2IOQA 3BE6A 1UT8A 3M82A 2P11A 3R8XA 5IDYA 4C21A 2FWPA 1TM1E 2YMPA 4J0GA 4BVHA 3TTVA 2WJWA 2VUTA 2PRKA 2WF6A 4P83A 5EJEA 4X8IA 3ZJVA 2YWRA 2YASA 4OJYA 1TM7E 3IAS6 4D3YA 1QKKA 4HAXA 1PVDA 2DFTA 3WIEA 1ZH0A 4YGYA 2QRKA 3DHVA 2VVTA 4KAXA 3F3KA 2ZL6A 4BNYA 4I50A 4CT0A 2QA4B 4DHEA 5KNBH 4HYTA 1BVYF 1QPGA 5T4BA 3S8MA 3TZQA 4C3ZA 3V2GA 3PIRA 1DMSA 3JQ6A 2IXAA 2NU6B 4N1AA 4J2OA 4ZOBA 1NOKA 1QAOA 1E59A 1CQPA 3HEMA 1GUAA 4KLZA 3GFRA 5JD4A 1D2RA 5DWQA 3RASA 1NR1A 1KPIA 1TZCA 2JIRA 1AKVA 4OY3A 1DV1A 2BHLA 3ACDA 1SBHA 3IUBA 2YS6A 5EMKA 5BN5B 1N5IA 1DO2A 1N1MA 1ZGGA 2FW8A 3L8ZA 3L7IA 4RHYA 5DEOA 4U0KA 4X20B 3UKOA 5L51A 1G2OA 1YZ3A 3EYAA 3PGJA 1CIVA 4AVZA 4XWYA 2PMDA 3OBBA 5E4JA 4QDUA 1UZNA 5EGSA 4A26A 4HG2A 3AVVA 2WTBA 2DR2A 3GRRA 4Z9XA 5DGDA 2I6FA 3NC1C 1U1CA 2JLRA 3MOGA 4G0PA 2Q8QA 1O96B 2H8GA 1XLUA 4FHGA 4KQKA 2X22A 3B20A 5FPSA 1ENPA 4UM5A 4D4MA 1CUWA 2JFNA 4YAFA 1M83A 2OYNA 2BGMA 2OQ2A 5CVUA 2CNOA 1T25A 2W0MA 1X1QA 3BIFA 3TXAA 1WTCA 3KOMA 1V11B 1N2HA 5CK4A 2XUZA 2X3UA 3B12A 5FYDA 3NKVA 2C92A 2AE1A 3NDPA 5ALIA 3ZDFA 1M1UA 2Z1MA 4WKGA 3C24A 3PE3A 4TWBA 4YT5A 1AHIA 2C7OA 3W2HA 5A4FS 3F71A 5F4MA 1PGQA 4P82A 1YQQA 2FVGA 3PCXA 4WK6A 4Y1GA 3LK7A 5EIFA 2VUHB 3H5VA 5HIMA 2Z4SA 1BCSA 2CVHA 2WYOA 4ZYWA 3O2NA 2ZRDA 2C7PA 4J1SA 2YJ3A 1DAIA 3QELB 1G9XA 2ZB7A 1S72B 1WCYA 3U9TA 4WOPA 4Z4VA 4XUGB 4L50A 3K16A 2FA9A 2ICAA 4G1FA 1FSGA 2CCKA 2I80A 3OG9A 5JROA 2BCEA 4IFEA 2QD5A 4KK4A 2FG5A 3I42A 4DB4A 5TF0A 1RJEA 2UVPA 1L9KA 1Q6ZA 1N3LA 2XDQA 1V1MA 4U2FA 2HGSA 4DCJA 2WA1A 3L46A 3RV3A 4K46A 1OYVA 4BVBA 3HG7A 2XBUA 5AW7A 1Y4ZA 1GA6A 5IVKA 4Q4JA 2JW5A 5UKDA 3FOEC 2D2XA 5K4AA 3QWAA 1V3VA 4O1MA 4X63A 1TO6A 3NWPA 1N2ZA 3MCTA 1AGPA 1WV0A 2RH8A 4WJKB 2GUGA 1LPPA 2HJHA 3GJ0A 3KM0A 1M2VA 1GGJA 3CR8A 5EY5B 3ZE7A 4DQVA 5LYJF 5CCXA 1RWWA 3VRHA 1B0ZA 2EX4A 2Y1LA 3NHLA 1JAZA 1XA3A 2QSJA 5EL0A 3UM9A 1QS0B 2DAPA 2QN1A 4UREA 2H2WA 1KOJA 4V1CI 2HU2A 4LJLA 4AN0A 2YXNA 1MORA 4EPVA 3HXLA 1DB3A 1YAJA 1ODFA 2BFBB 2NU7A 2QG9A 5BSMA 4MSUA 3OFND 2B1IA 4FD2A 1JEYA 4IF6A 4IVQA 2GQ0A 3DOHA 2AEFA 1OFTA 3MOIA 2Y1EA 3CNQS 2XUFA 3K1AA 2YJGA 5AK5A 1GUZA 4D98A 5JR3A 2OLKA 4GDFA 1FCJA 5HJ2A 1PS9A 5DYIA 3T1QA 3UBTA 1E99A 7MHTA 1HX7A 3G6WA 4XH9B 2H1WA 4AZTA 5K6AC 3JR3A 2NX2A 3AW9A 4EI7A 5CDSA 2H1RA 3NU1A 2ZB4A 3Q0EA 4Z54A 1ZAKA 2W4QA 4FOPA 2QP4A 5IUKC 4D3XA 5BRAA 4UFOA 4QRHA 4EKEA 3ELUA 3OH8A 2X6WA 4HUJA 1ECCA 2G6BA 3UPUA 2H1HA 3REGA 3SC2A 4HDNB 2XDWA 5KTKA 4OHFA 3FF4A 4J7XA 3HCCA 2EDAA 1X8KA 1P2VA 2F3TA 1QQ5A 2XSZD 3DMFA 2IU0A 3ZWQA 4CUKA 2DFNA 4IHJB 3TCKA 4E5MA 3HJBA 1SZCA 4ZCRA 4F4JA 3E5RA 1N6KA 2EL7A 3GJTA 3GL9A 1ZW1A 5JU6A 1IPEA 5KCZA 2NSYA 4QBHA 5E3HA 1VPDA 1UF9A 5CEJA 1O95C 5DHFA 5AKZA 3S4YA 2OV6A 3CVVA 1YJWB 3HSSA 1Y3IA 4X95A 1V45E 3DOCA 1WLYA 2Y1DA 2WHPB 3EOZA 3OPXA 4FMPA 3VR4A 4OMDA 4B7AA 2J45A 1Q0QA 1T4DA 4WUVA 3KOZA 1G9TA 4F2DA 1DMRA 2Z8YM 4PTYA 3UA3A 1C3OB 3KUXA 2C07A 4NJEB 3RAEC 4OJKA 1S3GA 4ZJYA 1SVLA 3RLIA 1X3LA 1UPBA 2A94A 2NLOA 3RFXA 4YB8A 3ZBQA 2ZZGA 4WA8A 4RYLA 3RBXA 4IJUA 5ITZA 5FQOA 3VMFA 2FN4A 3VZQA 1UMKA 3ZYZA 4WFQA 3FUXA 1WPCA 1HZZA 5H4HA 2D1TA 3ZDRA 3C1TA 1O77A 1H0KA 4D99A 4WPGA 4E1VA 3ELBA 5ALQA 2XHEA 2QN3A 1S0UA 4DS3A 4UNNA 3DAYA 4A36A 2IYPA 3UCXA 3HJHA 3FOWA 1BG6A 1GRNA 3FLMA 1H0HA 1PUXA 3UMBA 2D74A 1M33A 1RAHA 3FWKA 5HPYB 4J3NA 4Q01A 4RLQA 1L3IA 4H7EA 1PJCA 2XIQA 3JARB 1KEKA 3LWZA 1KYZA 5E2BA 1YFLA 3JWPA 4M0EA 4U9HS 3RKSA 1SNYA 1WBBA 1O7JA 4MYCA 3HA5A 2AXEA 4HIZA 1T1IA 4W9NC 5NLLA 4YUYA 3GD5A 1GT91 1XRPA 1VKOA 3EEBA 1NX6A 1JPJA 4S1PA 3GVHA 2CKMA 2WIAA 4C0XA 2CGEA 2OQIA 4RIIA 3ESXA 4WASA 3F6EX 2PBRA 2YOGA 1MX1A 2EG5A 3K5HA 2VIIA 4QASA 1NVVQ 4UC0A 5I9MA 1CEYA 1LTKA 4K1LA 3C5EA 4QPPA 3AFIA 5IC5A 3RB8A 4PF1A 4HLNA 4AZ3B 1BJRE 3JQPA 3OLCX 1KC3A 1GKYA 1PFKA 2PUBA 1EM8B 2PD4A 1HEUA 3BH6A 1Z83A 2XE8A 3A6DA 2H6EA 4JNCA 3U3ZA 1R0WA 5IARA 4AG5A 3UY4A 5G4KB 1RC8A 1F3LA 1K5PA 3WRVA 5LZ5A 3CN7A 3A6LA 4O2LA 3NWOA 2XAUA 2BVNA 3C4VA 2GF0A 3UF0A 2QX4A 1VHWA 4D5EA 1E2BA 5F33A 2W4MA 3LLCA 4EABA 1XNHA 3AUYA 1QH1B 2O4UX 2IV7A 2QB5A 2BBWA 4G6ZA 3GG2A 1ORWA 3UATA 3P27A 4JUCA 4JI3B 2PU7A 3ZE6A 4G07A 4DQUA 2H9YA 3DHNA 1ZS9A 3WAGA 1XE1A 1RHUA 5E9QA 3GJZA 5HRAA 3MBIA 3FDZA 1CNEA 5JANA 1T8PA 1TMYA 1F4PA 1ACLA 1H4VB 1ZUNA 3BC1A 3H65A 4M3NA 2H52A 4IEIA 3QPVA 2AH5A 3HWX1 2D1FA 5JCZA 5HTKA 4EO9A 4JXJA 3IE1A 3PXXA 4L5BA 4JVNA 1YVPA 1RQXA 3RTGA 1BZYA 4N5DA 3FH0A 3KPVA 3S8EA 5DSTA 3N3AC 3ROZA 4KKUA 1FVFA 3PRYA 3WGOA 4CUZA 4YJHB 3L2OB 4FB4A 5I7OA 2RHGB 1GDDA 1PCXA 4G09A 5IX8A 2FFBA 2BRUC 1WR8A 2VPYA 3P94A 2CZQA 5IDVA 5JAOA 1W52X 4F3YA 1WQ4A 3RY8A 1EDZA 1PR4A 1Y1RA 4BCBA 4CGZA 2IXDA 2ZUSA 3A11A 1U2QA 4R3UC 4R3NA 3E1SA 4WZ6A 3NT2A 4YRQA 2HQRA 3BJRA 1XZDA 1FSPA 3OSUA 2AI1A 4KQGA 5JISA 2IPXA 2VHEA 2V98A 5DJ5A 1YQGA 1T13A 2Y76A 3FUVA 3M1AA 1I0IA 1ORTA 4HR7A 4OAOA 5B1IA 1DQNA 2FJUA 3K0FB 2PSSA 1QLWA 5B3LA 1Y3AA 1JJVA 1K2VN 4HWOA 3E9CA 3H1EA 4ZOCA 5ELLA 4FINA 1I14A 3AX6A 3BQJA 1JDBB 4FE4A 4H7FA 4JI6B 4QYTA 4Z0PA 1TD1A 2O8BA 1PG0A 4EYSA 3NYQA 1M6EX 1THMA 5AT1A 4P33A 3TQSA 5JYEA 4RKEA 3ILXA 4QGBA 3KWMA 3DPUA 3EXHA 3KL9A 3HCNA 2X0EA 3VYVA 1W5SA 1F4LA 3RH0A 3IV7A 4QYIB 4CMIA 2PKQO 5C8VA 3LKDA 4D3DA 2BEWB 1LKZA 1YBHA 2HQBA 1BXGA 5I7VA 1ODCA 3RSCA 1DRKA 2DWQA 3ZXSA 4HQFA 4OHWA 4BX0A 4NS1A 1A3CA 3IJRA 3CO0S 4MRNA 3ZH9B 4CTMA 4J0HA 3D3EA 3DUFB 2OSBA 2EYUA 5CBPB 1DFGA 4BPRA 1H2BA 1L4KA 3HQ4O 4E07A 3B5EA 4DUYB 4HNRA 4MB6A 3UEOA 2PAFA 1SXIA 3FOBA 4UUMA 5IYZA 2ZWAA 4M1SA 2D7JA 2LZ0A 4Y2XA 1NJSA 4AD8A 1FPMA 1YCDA 1UK9A 3VPHA 2VBIA 4IX1A 1KP2A 2P3OA 2ZRBA 4OQZA 3F7OA 3HR8A 5ETJA 2P5SA 5C7OO 1PE0A 4JUFA 4RZXA 5HF9A 3VZBA 4AJPA 5KNCA 5M04A 1E1YA 3EVGA 3SMVA 3ESRA 3VA7A 3NTUA 1E1DA 2QM7A 3E53A 3FCCA 3M9WA 1H3FA 3AB8A 3O0DA 3RTBA 1NQXA 2B2XA 1R0KA 3PFBA 3DOIA 2A3RA 1ESZA 1GY8A 2JCSA 1Z22A 3PUIA 4J75A 1VBMA 1OF1A 1KHTA 3M49A 2YVKA 4PSAA 1BYUA 3JQRA 1J0XO 2EP8A 4GPIB 3OZFA 1ZC4A 3STXA 3GXOA 1N5MA 3MQFA 3OMWA 4DCPA 2MR6A 4LRXA 3GT3A 3I9LA 3L7YA 1YMQA 5B2FA 1DKRA 3OEED 3LUGA 4HDAA 3D7LA 4Q7LA 5IMSA 4GX5A 1VIAA 4EHFA 1L5YA 1VYTA 2JFYA 1IVNA 4XWAA 2DC1A 2H1IA 3S2UA 3W8DA 3R3YA 4N76A 1NSTA 1YAHA 2AHOA 3RBAA 4LC0A 1TCVA 3BXFA 4JLUA 4L9WA 2GO7A 1NUHA 3F1LA 2D5AA 3PEYA 1W4RA 3KOXA 3CZRA 1HDXA 5AIBA 5KQSA 4X6LA 3RYIA 4FHZA 4NP6A 2JGAA 4QPJC 3NIBA 4O4HA 1ZIYA 3EGVA 3K5IA 1ADJA 5AESA 1WPRA 5B6IA 1KSJA 1RVV1 3FZYA 3PWTA 2X1VA 4IDPA 2JIZA 1B6TA 5CLGA 2IS1A 1JKXA 2BFDA 1N1GA 5ALRA 2O50A 3AEQA 3U4DA 1RZUA 2R11A 2Q4DA 4P81A 3OIFA 2SNIE 1GPNA 1YRBA 2R1TB 5DM1A 3LLSA 3JQ9A 4NBUA 4D4HA 4LI0A 3K0AB 4EZEA 1W0KD 4WGFA 3PFGA 3UUFA 4EG5A 4IJWA 1BJKA 4GLBA 4BNMA 1TO1E 3KO8A 4EPXA 1EFCA 4XIFA 2NU8B 1GGNA 2Z1DA 4GLJA 2VATA 1IZZA 3H4IA 3U48A 3L6DA 5KJCA 2P35A 4B35A 2P2ZA 2PL9A 4Y2VA 5KPDA 4ND1A 3WGUA 4RM2A 3A14A 2GEKA 2DR0A 2WJZB 3A04A 4TYPA 3GLGA 1KSHA 1IXYA 2CJYA 2A5FA 3IO5A 1O0CA 1W8IA 2V7VA 1PDWA 2JA1A 4WWVA 3J7TA 3KTDA 3LIPA 1VZ2A 3NPMA 4FNMA 4QAJA 4Z2AA 5C8YB 3CMMA 4W82A 3FHLA 3GP5A 1QYIA 3OQVA 2VBSA 1Z6TA 4E2YA 3DWEX 3QKRB 4ZARA 5EVCA 3WADA 5JRDS 1I7PA 3DBLB 2PKQP 3HSKA 3LCVB 4FGSA 4KWIA 1HC7A 5D5PA 4JUDX 2RHHA 3O4IA 1QC5B 3KZXA 3U56A 1ZJJA 1EBBA 2C8KA 2QL5A 4ZDKA 4QBIA 1R5JA 2YYZA 4QDTA 2NAFA 3UWPA 2AW5A 3IP8A 2VRNA 2HW8A 2RI1A 3LOQA 1V47A 3ETNA 1VG0B 1YVRA 3T1VA 1BXRB 1NLFA 1R7RA 3ZNOA 3N0RA 1E4OA 4WCDA 5JSZA 1F2UB 1CJMA 1T5LA 3RABA 5FORA 1HE1C 3CKKA 4MI3A 3I9JA 3K96A 3KG2A 5G0VA 5ALMA 4CXMA 2EEZA 4YRAA 1NUQA 2CDNA 3P9SA 3AFNA 3GLHE 4R68A 4TQ9A 1SMKA 5KYNA 4JJGA 3NAGA 4MCJA 5DEIA 4AJEA 4CN8A 2FWJA 1YZLA 1IWPB 1OZGA 1XNGA 3RW9A 4EA7A 2UZ4A 1EH5A 3G49A 5ICMA 4ZKDA 2CMFA 1UPFA 3EXG2 5H0IA 2VHCA 2REQA 2UYGA 5C34B 4A8JA 4HDRA 1HRKA 4S0ZA 3EVCA 5GONA 2G9VA 3DLCA 2AA3A 3AFMA 1BE1A 4J7UA 3BSFA 5DOZA 3NO4A 5ELXA 3JALA 1KAGA 1QTQA 2IZ7A 1Q5PA 1D2MA 2JFWA 2FE4A 2HMWA 1SCAA 1BDBA 1DWQA 4JC5A 3CRVA 3AY3A 1XMXA 3PXGA 5HQ3A 2EKBA 1GP2A 3RFUA 3WFIA 2O05A 5IZ4A 2XXAB 3CPJB 1XJQA 2J6CA 1VJ0A 4LGCA 5C32A 4H7DA 1YJQA 2CFCA 4MIOA 1APBA 2PSEA 3R3ZA 3M9LA 1I2CA 5AJHA 2CFRA 4Z7QB 2R4TA 1NW9B 2PR2A 2XB6A 3OE7A 2DKFA 4EGCB 4TX1A 3AUTA 1M2GA