3JQPA

Crystal structure of the h286l mutant of ferredoxin-nadp+ reductase from plasmodium falciparum with 2'p-amp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
312
structure length
266
Chain Sequence
NFINLYTVKNPLKCKIVDKINLVRPNSPNEVYHLEINHNGLFKYLEGHTCGIIPYYNKQRCARLYSISSSNNMENLSVAIKIHKYEQTNYGYCSGFIKNLKINDDIYLTGAHGYFNLPNDAIQKNTNFIFIATGTGISPYISFLKKLFAYDKNNLRNSNYTGYITIYYGVYNEDSILYLNELEYFQKMYPNNINIHYVFSYKQNSDATSFYVQDEIYKRKTEFLNLFNNYKCELYICGLKSIRYKVMDILKSHDEKKKKRVHVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin NADP reductase
publication title Plasmodium falciparum ferredoxin-NADP+ reductase His286 plays a dual role in NADP(H) binding and catalysis
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 69
structure length 266
sequence length 312
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2009-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3jqpA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3jqpA02
3VNUA 3A1FA 3CXCB 1H42A 2VZLA 1HA3A 3MHPA 3VO2A 2HCJB 1D8TA 4K1XA 1DDGA 1Q7YD 4ZV4A 1K8AD 1EWYA 1TVCA 4Y9UA 1KK1A 4AF7A 4M0LA 4TMXA 2BVNA 2QEXB 1QUFA 4Y9RA 3I1FA 3ZBUA 3OJWA 5H59A 1GAQA 4YAWA 4NCNA 1F20A 3U6KA 2DEUA 3AVXA 3CMEB 4M4SA 1FNCA 3QSYA 3AVVA 3MCAA 1KK2A 1H85A 3CCUB 2GQFA 1G7SA 2QTZA 4MYTA 5KSWB 4WQMA 2B5OA 1XB2A 1N0UA 3G4SB 3LRXA 3WYAA 1FRQA 2BGIA 1QFZA 1S72B 4ACAA 2XNCA 1TLLA 1VQPB 3E20A 4ZCLA 4RJLA 1KQSB 2VNIA 2C77A 3J81k 4LC0A 1OB2A 3W2EA 1EXMA 1VQKB 1VQ5B 3CW2A 1W34A 2GPJA 2CRVA 1VQ9B 1BJKA 3OZVA 1DARA 2BGJA 2X3UA 4N3GA 4M53A 4LBYA 3W2FA 1VQOB 3W5VA 2DY1A 1ZUNB 2PMDA 3P27A 4QHYA 3OZUA 4Y7CA 1QX4A 2QMUA 2QN6A 1YJWB 3WBKA 1W2BB 4LBWA 1OGIA 2B7CA 4ZGNB 3CCVB 2BMWA 3V76A 4PC3A 2YWEA 3WNDA 1GJRA 1QGZA 1FRNA 3W2GA 1BQEA 1IB0A 3AVTA 2DERA 2DETA 1EP2B 1FNBA 1D2EA 1JNYA 2YWFA 1EFTA 2DCUA 1B2RA 3G71B 2BN4A 1VQ4B 3B8HA 3CD6B 1GO2A 3QFTA 1KD1D 4PC6A 2RC6A 5EMNA 4RD0A 3FJOA 4QFMA 2C78A 3W5UA 3WNBA 2CNDA 1N8RD 5AN9A 1IJFA 2HDNB 4FK8A 1QH0A 3W5HA 4ACBA 4Q7JB 1A8PA 1KRHA 3JQRA 1YI2B 1JA1A 2ZITA 2VNJA 4HE5A 3CC4B 3B82A 1VQLB 4G1BA 1VQ7B 2OK7A 1VQ6B 1TUIA 4C43A 3ZZ0A 3AGPA 4IW3B 1DDIA 3JQQA 1JA0A 2BF4A 1Q81D 4AF6A 4HE6A 4FWTA 1S0UA 1ZM3A 1R5BA 2FX3A 4BPRA 4RCZA 2B7BA 3FPKA 1NJID 3ES9A 3VO1A 3CC7B 3E1YE 4DQLA 2AHOA 1GR1A 3LVBA 2XEXA 1QGYA 3G6EB 4RCYA 1EP3B 1Q86D 1AIPA 3CPWB 2VYQA 3LO8A 1EFUA 2QDXA 3CCEB 1EP1B 1WDTA 4B43A 3AVWA 2HMAA 1KTVA 2RC5A 1B23P 4J0QA 5THXA 1M90D 4ZCMA 3QE2A 3WBJA 1YJ9B 4ZCIA 1U2RA 4B4DA 2OK8A 4B3XA 3ZZTA 2XNJA 2PIAA 1IJEA 1K73D 1ZM9A 5FA6A 5DSZA 1SM4A 5TY0A 3B78A 3CB4A 4LBVA 4M2LA 2NPFA 2BM0A 3WY9A 2BV3A 3U2QA 4RD2A 2BSAA 3QFCA 3U6BA 1I7PA 4R71A 1W87A 4P3YA 4YHBA 3VMFA 1ELOA 1SKQA 5HXBA 1AMOA 3QFRA 2BM1A 2J7KA 3CCLB 4H9GA 3AGQA 1M1KD 3CMAB 4TMZA 4FN5A 4M1KA 1BX1A 4TMWA 1BX0A 2D74A 3SJZA 1YITB 1NDHA 4YAOA 1VQNB 3WXMA 4PC2A 1F60A 5TR9A 3W2HA 1N0VC 1G7CA 4YAFA 1KK0A 5GV7A 1EFCA 2E1RA 1R5NA 4TN1A 1GVHA 3I55B 1CQXA 1FNMA 4RD3A 1D1NA 4RD4A 1W35A 1R5OA 1ZM2A 5JBQA 3CCQB 1Q82D 4PC7A 4B44A 4C0SA 1OB5A 1YIJB 3OZWA 4MYUA 1ZM4A 5TV2A 3ZZUA 1G7RA 5GV8A 2OTJB 1K9MD 3P26A 3PENA 4YALA 3QFSA 3WNCA 1TTTA 4NBSA 2EFGA 3OJXA 1JB9A 4PGOA 1KK3A 3CCSB 1XE1A 3CRZA 4ZGQB 2VNKA 2QTLA 4DQKA 2QA4B 1CNFA 3CC2B 1G7TA 1KJZA 2OTLB 4LBZA 4F7DA 2PLFA 4TMVA 1UMKA 2YWGA 1FDRA 1DG1G 3I56B 3CCMB 1CNEA 3CCJB 4B48A 2YWHA 3OW2B 1JJ2B 1QFYA 3VNVA 1QVFB 3LYUA 2R6HA 1QVGB 4RD1A 1E62A 5H5JA 4B47A 4G1VA 3W2IA 4RD6A 4YAUA 4AC9A 4U9UA 3ZBTA 1QG0A 1GAWA 2VNHA 1VQMB 1VQ8B 4EH1A 4N3NA 2EIXA 1E64A 1YJNB 3AVUA 1E63A 3ZC3A 1QGAA 3JQPA 4TMTA 1YHQB 1OGJA 1QFJA 2BPOA 4P6VF 1FNDA 3AVYA 1J9ZA 4UAJA 3CCRB 4G5GA 1KC8D 3MMPA 1QUEA 4PC1A
chains in the Genus database with same CATH superfamily
4KPYA 2QTNA 3VNUA 1B26A 4GBMA 5EN4A 3W5IA 1CUFA 1Z4QA 1A5BB 2GN9A 2O48X 4DBLC 4LF5B 5J35A 2XXAB 4HQLA 1A98A 5KKAA 3UGKA 4JP5A 4QXAA 1D8TA 2CLIB 4A6XA 3KJEA 4TWZA 1SUEA 4UZFA 1IUPA 4K1XA 5EA2A 1FUYB 1J2UA 2QPOA 2P35A 4KMSA 3VYSB 2A9VA 3ZLUA 1SIOA 3ORHA 4L4UA 2YMPA 5EP4A 1C3VA 3MWLA 4HQ0A 8LDHA 1NC3A 1WG8A 3U9LA 4AF7A 2FJ0A 1L4HA 3UKJA 5EGNA 2Z1MA 3TW8B 4EJSB 5FLKA 3JZDA 2EP5A 2MYPA 3BQNB 4NATA 2XCSB 1JJBA 1V8BA 5EJ7A 4QGFA 3GJZA 2VA8A 1YR1A 2AK2A 4X7FA 4RIIA 1GGKA 4RM3A 4X7MA 3D8RA 3EFBA 5KTNA 4YMSA 5C52B 4DPKA 2WK1A 3HC7A 3ANTA 4JH0A 4XLLA 4YYEA 4YQYA 3HJBA 3ZKWA 4YAWA 1VBNA 3LU1A 5BSFA 4BCCA 2F4NA 3WGZA 3UKOA 1QS0B 3JVIA 4AJ9A 2XUQA 5A3JA 5BYKA 1D03A 2C98A 3AVVA 1QYWA 3QU4A 4QUZA 1XXHE 2QBYA 5LR6A 1MO6A 4YI5A 1W49A 2GARA 2X6XA 5CT9A 2GS9A 4DMLA 1C4WA 3U3MA 1S3FA 1OYOA 2XMCA 4LQ4A 3ZHBA 1M6VB 4CEJA 3LDHA 1O94A 3CJTA 3L7AA 2YJZA 1JR3A 2XTMA 2WSSA 4Z1MA 1DX6A 1HZJA 1NB0A 2J59A 2X41A 3EE6A 2I1LA 3LRXA 3PUJA 4TROA 3KKEA 3ZI7A 1U3WA 3EBOA 5K7SA 2ZE7A 3VPGA 5HFJA 1MGPA 2K7ZA 3R6TA 4JP1A 5EY5B 3TVDA 5TLSA 2VUIB 5PNTA 5HEKA 3DOHA 5JQGB 4O2BA 4LOIA 1E96A 1KDPA 1X7ZA 1K08A 2DOGA 1Q5PA 3PI6A 1VE6A 4N5LA 4NJMB 2EJBA 2IYUA 1F4PA 3HHPA 3ZWCA 4C4XA 1C7EA 1R4MA 1ZGHA 2FUNB 4OGGA 2F3QA 4REQA 2PSDA 3QXXA 2REQB 4O1IA 2BH9A 4MRAA 1CY4A 4KO3S 5CYFA 1XHFA 4IXWA 4OSOA 4AY5A 2EF0A 5FOTA 4MPJA 4FCWA 2KLHA 1TA0A 1SUFA 1UFVA 4A1FA 2BGKA 2Q1XA 5TMEA 4AFNA 3PZRA 5HDBB 2JLSA 3PS9A 1IJKA 4KXFB 4C07A 2V3CC 1U8UA 1M7HA 1T3GA 4F91B 3HADA 1T3TA 4NNJA 3ICWA 2YHIB 1PLJA 3QEJA 4J9UE 1MZVA 3QVSA 1GRNA 13PKA 4YH1A 2OGTA 3K9NA 1VMIA 4LNHA 3TNDA 1MU0A 4Q47A 3LQEA 2AS0A 4ZKDA 3HB5X 2Z83A 1Z6QA 2E4VA 2C4KA 5ALFA 1PGJA 1W34A 4H27A 4PWYA 5F7JA 2H54A 4IG9A 2HBRA 5K05A 3OZVA 2Z2YA 4DCVA 3CUEF 2B9EA 1QQAA 4KK3A 5B30A 5CA0F 3IKTA 4WZEA 1WMFA 2R8BA 4R8MA 2BCEA 2FMKA 2F1JA 4OQZA 4RSGA 3V2UA 1U31A 4WXMA 1JWLA 4AAYA 5ALHA 3VHRA 3A70A 4FYKA 4G25A 1ZA1A 1BDHA 1RM0A 2RG7A 1IU9A 3P0FA 1UPXA 4BRUA 3A9VA 1QX3A 1VMAA 3NAGA 3T52A 4HNUA 2FF5A 4OFZA 4OKIA 5KSPA 3HE3A 5BN3B 2ATEA 1ND5A 1L4NA 3SVLA 1TVKB 3LC2O 3PKZA 1JYEA 2V8OA 2B83A 1SG0A 2V4ZA 5JSQA 1G5QA 4NZZA 4TSFD 2L0XA 4BU1A 2CMHA 2JJ8A 3C3PA 3H75A 3ZDEA 1II8B 4BFLA 3ER8A 1NJFA 2Y77A 1Z0ZA 4RLHA 5DM2A 5E3IA 3P97A 1SXHA 1YVPA 1SG9A 3CKKA 4J75A 1V7ZA 3KZNA 2AN1A 2VBCA 5JZMA 3QUQA 3W0LB 2O6LA 3H2KA 1IRXA 2J9ZB 2V6JA 2BTQB 2ZBFA 3QBDA 2H63A 1K27A 5JRZA 3RC3A 2Z4SA 4JBHA 2PZMA 4U9HS 1JNYA 2Q49A 2NVBA 3AWDA 1WCIA 4BATA 3LIIA 4O3FA 3PC6A 1JQLB 2NVOA 3K1JA 3T5BA 3U37A 1Q7RA 2BE9A 2CFCA 3ZU3A 1VQ4B 2IP4A 4Z9FA 4P0QB 2XCOA 4YEDA 4PZYA 3VH4A 1EMDA 2A1IA 2LD4A 3QPUA 4CMIA 2OC4A 4GEGA 5A4FS 2YXDA 2GFIA 4ETMA 2RC6A 3RFVA 1BW9B 5DRTA 2ZYVX 2NU7A 4H1TA 2HY7A 2XMPA 4PINA 2HN9A 3TBKA 1Q15A 1DT3A 4KE8A 5EFZA 4MJLA 4MDEA 1USIA 1EZ1A 2ICAA 3ABQB 7GPBA 3EGIA 2QU7A 2VDKB 3L40A 1FTGA 1XD2A 4TWAA 4ZT3A 1M2VA 2JATA 3Q0IA 2XOKD 4HKTA 5IJ0A 4I6EA 4OEHA 4MAAA 3EH2A 4C6SA 4BXOA 3A4TA 2C4TA 3HUFA 1QZUA 4KQEA 3KL4A 3I3OA 4J2TA 4WZBB 3WLHA 1ZMOA 5AXAA 2YUIA 2HDNB 2FY8A 3JD1A 2V9PA 4OQDA 4BJHB 4JBIA 3KCNA 2A5GA 4ED9A 4V1CI 5ICCA 3ADCA 1P74A 5A4KA 4DL9A 5I47A 2CNLA 4ZC8A 4MB6A 3HNPA 3JQRA 2IXDA 1YI2B 1NYLA 2ZYIA 3FI9A 3R7DA 2GHRA 2OHOA 1NIPA 3GARA 3L93A 4I50F 3GLHA 3JRWA 4U6SA 4W63A 4AJ4A 3OLYA 4LCEA 4B3SB 2LPMA 5AJTA 1T9ZA 3HUTA 1Q16A 4ZV9A 5T41A 4F5DA 4B2PA 4MS4B 3A9TA 1T8SA 1YTLA 1C8LA 4LY9A 1RVDA 4FYVA 6PFKA 2G0TA 4L5AA 2YV1A 2PCLA 2VPQA 1Z2PX 3A05A 3EXG2 1R6BX 3O38A 3ZHOA 5KYYB 4LNUA 3CLKA 5CGZA 2BMDA 4JLNA 5IC5A 5K3EA 1MOSA 4XGIA 4K6HA 3HDYA 3N8KA 4EI8A 3G9ZA 4AX4A 4H15A 1MOPA 1NBMD 1WTHD 2VXYA 4FXOA 4NENB 4Z4RA 1UKAA 3RAEC 3IE0A 1SHTX 5TVKA 4XCQA 2ZL5A 1IN5A 2C1XA 4DE5A 2OD9A 2O8EA 1DJMA 5YASA 5EIHA 2AHOA 4J6EA 3IMGA 4BZZA 2YYSA 4BJ6A 3I12A 3ZGLA 3I72A 1B6SA 1G1MA 2FZKA 2FPSA 1FYEA 1PTJC 2ATCA 2XD4A 3OBIA 3SYMA 4TSKA 4YV1A 3OZ7A 4TTRA 4Z53A 3JRXA 3KEFA 4OD0A 1LNZA 2YMMA 4C7OB 1C2TA 2XCUA 3NWBA 1A9XB 5ARCA 1PJAA 3RWOA 2D3NA 1XAGA 3P9CA 2NNLD 3C4QA 3PNQA 3FFXA 5B1IA 2I55A 4ARBA 3VVCA 1G0NA 5F2OA 2FWRA 2V03A 5FKJA 5ICEA 4DV3B 1RAIA 2E85A 4BDTA 4ZOQI 2OFWA 1RZVA 3T7RA 1PZHA 2RD2A 1E6EA 3OCVA 4B3DA 5CTJA 5AKKA 3VU9B 3WZ2A 4L08A 2EFEB 4KOAA 2Q1WA 3OMLA 5KTPA 1WXFA 3WBJA 1V37A 1YJ9B 2QQFA 1P2VA 1SK9A 1PFKA 4L3VA 4OHWA 5CLIA 4ZCQA 2HK9A 2VDWA 1GGEA 3DR5A 3LOUA 1KDVA 1S2IA 4YP6A 3EC2A 1ZW6A 4Y2GA 1AKUA 4RZ2A 3ZR4B 4UBKA 3HU3A 3LQ2A 2QGFA 3HXKA 3VV3A 1YASA 2AX4A 2RAFA 2ETVA 3E61A 3IUMA 3OLWA 4KREA 4I14A 1VHJA 1GZ6A 3ZZNA 1XJWA 1SC9A 4Q3DA 1IFXA 3EIWA 4YUWA 2OP0A 3IAM1 3DB1A 3IYLW 1JZQA 2GBLA 3L43A 3OEWA 1ZDMA 5L4NA 1KEEB 3T3DA 4V38A 5BXYA 3CRVA 1AKQA 2QM0A 3KZOA 4ZI7F 4ESEA 4UM9D 1CUGA 5FUQA 1WHTA 5LUBA 2AFRA 3RHSA 3GNQA 4FBGA 4JBGA 1WPGA 1M2OB 4LBVA 1TKAA 2XYRA 3AL2A 4M2LA 4XGQA 3WLMA 2RHBA 1NATA 1UEIA 4LXXA 1PDWA 2XCQA 3IHWA 4ZDKA 1NR7A 3A0UA 1MBZA 4OQXA 2HF9A 1A9RA 3C98A 3E9RA 5ICFA 1UMCA 3IPLA 4N5MA 4CHGA 2XOEA 5C1BA 3PUNA 3H9JA 1AGRA 3D7LA 1NSYA 1UPAA 3FAKA 4QYXA 2GCIA 5IUKC 4NZYA 1A8SA 4A91A 3L5KA 4ER7A 5JSZA 1EK0A 3WB0A 3S5UA 1YMVA 3C74A 4HAZA 3VA7A 1Z6GA 4EJMA 1D5WA 3IP7A 3K0CA 5FUBA 5TMPA 1X80A 2J0QA 1RXSA 2C88A 2A5LA 2VJAA 4OJNA 1SKQA 3QF7A 1BKSB 1Z7GA 5G3ZA 2AMVA 2OOKA 3WRXC 5GMOA 5DOVA 1TVEA 1GZDA 2MINA 3EC7A 1G38A 4N8DA 3ETHA 4CTKA 5HKOA 1MJFA 4LTDA 3A0RB 4OHFA 3AESA 3R8FA 3AO0B 1RYZA 2HD4A 1XMSA 3QWBA 2UVQA 3I3SR 1RMQA 2ZT8A 1KZ1A 3PHIA 4I19A 2CMDA 4XN3A 4JITA 2LZJA 4NBNA 3VR0A 3P5SA 2GD6A 3IPYA 3QTLA 2EOAA 4GHWA 4F11A 3W5CA 3DEIA 4I3GA 3EA5A 2MSLA 4M60A 1DEAA 1H4VB 3ZHVA 1ZZGA 3HWSA 4URYR 1U28C 4L85A 1X1AA 3UQZA 1KY2A 1NUTA 1X8LA 2GNAA 1ESDA 1Y3AA 2EWWA 3H5WA 3IUSA 3OQMA 4DIBA 1DUSA 3W2HA 4F21A 5JDCA 2DUWA 4E2XA 2QTMA 1QORA 3H9BA 4AY6A 3UKDA 1ECFA 4KFUA 5K0BA 2JFQA 2Q3JA 1HZEA 3JATB 2CMKA 2HU7A 1IWOA 5IFLA 2B35A 3PTAA 5IC6A 4S1NA 2IWHA 5CDTA 2XYQA 4J0JA 4FMDB 4OQQA 5ULLA 5B2EA 5LOVB 1M0SA 4DR6B 2GJRA 1NVUQ 2ZI6A 3IURA 1CQXA 2LDXA 2ZIEA 3UH0A 4RD3A 2EWMA 3TRDA 2ZTVA 1R5OA 1KI7A 1O6ZA 4X93A 5AUOB 5I7RA 1YONA 3JQAA 3EIXA 5C3MA 3VC3A 4E32A 2DH5A 3KSAC 3D3QA 1OB5A 3T1OA 4UU7A 1U65A 4EHBA 4UMDA 3IS3A 4YXWA 1XLTA 1DOAA 2AJTA 2WQZA 3B51X 3C5CA 3U7RA 4X1KB 4C9BA 5EWLB 2P5YA 3DXFA 2VPPA 4BO2A 1G3IA 1T3LA 2V6IA 4BQRA 1XZKA 4EQ6A 2ZTMA 4RDXA 2RJNA 3TM5A 4IXMA 1AQ6A 3WGOA 1TTTA 1Z5VA 4NCIA 4OTZA 4OXQA 1TW3A 4GT1A 3SZGA 1Y5MA 1JHMA 3W6NA 3D4LA 4AU1A 4DCPA 4MULA 1XVUA 4XTRA 3GVXA 2AEFA 1T6ZA 1ZUWA 5E1MA 5U9CA 4UOEA 4DB2A 2J30A 3WJAA 1G3QA 1GAEO 3ZKAA 4GECA 4JMLA 3FDZA 2W2TA 1TF5A 4JCCA 3LWNA 4DRXA 1NW3A 4DLAA 3UFXA 3I9V1 2ZWPA 2PLFA 3H2JA 4TYWA 1G20A 4TMVA 3IVMA 5IF3A 2BDUA 2IXEA 1WU7A 3BCHA 3QGMA 3SI7A 1NXPA 2H2AA 5ECWA 3V8MA 2FV8A 2VJQA 1XQBA 4NPHA 3SHTA 1FJ2A 1SKUA 2ZS8A 3ONUA 4B09A 1R6UA 3QV2A 4KG7A 1P45A 1IE3A 1G21A 2X8WA 3MRVA 4JI2B 4MJXA 1KH2A 1G8SA 1YZTA 4JUDX 5AJUA 4FVTA 1XCMA 4ZVOA 4EECA 4RK5A 4KKXB 1RI5A 5FXMA 2P0AA 4EG0A 4UTPA 2O05A 4IMRA 2C82A 2R6HA 1ONSA 5TSDA 3QFFA 1MAAA 3SEQA 2F1MA 1YS4A 3BMOA 5EMJA 2I9PA 4GBJA 4XWWA 4XR6A 2VJJA 2QT1A 3GJ3A 1MC8A 2QE7A 3I37X 4FT2A 4QDOA 1Q2XA 2LE0A 2WP0A 5AR1A 4NECA 4AO7A 2XCTB 2IV3A 1L5WA 1E1RD 5A89A 5K0TA 5DI3A 1IZZA 4RSHA 2BAGA 2FU5C 2D4HA 3SF8A 3O9VA 5C80A 3Q8LA 2YMQA 3VVMA 3W5JA 1BVRA 3R3WA 4AG3A 4HV4A 1K8XB 2AI2A 2W8ZA 4DCJA 1ADJA 2C2OA 3D3NA 3GLKA 1A2QA 1S02A 5BYJA 5L4SA 3DAHA 3QXSA 3V4ZA 4ZEXA 5A03A 1YJNB 4LA4A 2IYQA 3EQ8A 3L7YA 5BORA 1GA1A 4BNUA 3BQMB 2NU9B 4L74A 4B73A 4UBOA 5EWJB 3H42B 5D01A 2DFVA 1VE9A 1VZ2A 3AL3A 4PXYA 1GP2A 1HFJA 3HJGA 3LXXA 3MCZA 4F9FA 1Z07A 4O25A 1D1PA 5C8ZA 3FSGA 1I32A 5FV7A 3WICA 3G9UA 2W2MA 5BVHB 1SXPA 5CVEA 4MYHA 1EZ4A 2EZTA 2IU0A 4NV1A 4G5SA 1R6VA 5GINE 1I4TD 1XDDA 4MW6A 3N05A 5I4KA 1MXFA 3CMMA 2NTNA 3A36A 4FJ1A 1N57A 3HYNA 4WY2A 2QLBA 1D0SA 2FWIA 2WKPA 5LZ5A 4UCQA 1U2QA 3HMQA 2YWDA 1BMQA 3F8SA 3K5HA 2CHGA 3UT5B 1YH3A 3W7AA 2Q7DA 3HR7A 4WECA 4P3PA 3F78A 3BE4A 3FMOB 5FYQA 1NXTA 2BFMA 1Y7TA 1LWOA 4R1TA 3CLVA 4YGXB 1MO2A 2BR3A 4PIPA 4TSRA 1RWXA 4N0DA 4TPKA 5CPFA 3V80A 3VO2A 1JAXA 1HA3A 1WX1A 3HV0A 4X6XA 4UM7A 3R7FA 2QTVA 4IO0A 1RZRA 1H2BA 2FLKA 2GTPA 3JQ8B 4QQKA 2XCIA 1QGUB 1P7ZA 2E21A 3GAZA 1N4AA 2Q4RA 5IAKA 1IHMA 3ICCA 4KQ1A 2OWDA 3U9TA 3K9FC 4JYZA 1TKCA 1L7VC 2YFYA 4PNEA 3FVQA 2B25A 2VDQB 3GJ5A 5SZKB 3KZ1E 2V5AA 2YNMD 5I4CA 5E7JA 3K70B 5I9BA 1JHAA 1C9DB 4P3IA 1FX0A 1YMQA 2IYOA 2JS7A 2HWXA 2Q1YA 4PCUA 4OHZA 5J2UF 1O0CA 1A9PA 4QOJA 2YJ5A 2OBTA 2HU2A 1TAUA 1FMLA 1CFJA 3S1LA 2DU8A 2ZLBA 4M0EA 3REGA 5I7VA 1A8HA 5JDIA 3WA6A 2QTGA 4MW4A 1R12A 1Y8QB 3W3ZB 1TF2A 3TB4A 1Z5OA 5AH0A 1Z0DA 3EHDA 1AUXA 4IH1A 4OYYA 3FPFA 4RFSA 2V98A 1YMUA 4EDHA 3ZPNA 4DBVO 4XGKA 3PPIA 3URMA 3G2PA 2JLCA 2Z3WA 3CESA 2LCQA 3MCAA 2BHNA 5I7EA 4FMCF 3EVTA 3V9PA 3A4IA 1H85A 2NX2A 3IALA 1PWXA 3GXOA 4IHJF 3SIXA 2HMVA 5ITZA 1JQAA 2X7JA 2PDAA 2B5OA 4IXDA 5FI1B 1GHTA 3LP5A 5KNCA 4F38A 4O59O 5TEVA 4EY3A 3GJSA 4EGFA 4KPEC 2IIPA 2P5TB 2WV7A 3QVVA 4RMIA 2NQ8A 4MGZR 3EMKA 4BB6A 4DEYA 1HLPA 1XMVA 1N07A 2P91A 4QWWA 3BTOA 3LECA 7REQB 1ZJWA 1V3TA 2OYRA 4UUPA 1TLLA 3ZDRA 1YQUA 3SC6A 5K0GA 3GFVA 1BE8A 2AQKA 1UWKA 2PKCA 5T4EA 3T0GA 4E1AA 3AP3A 2CLSA 3V4LA 2W8BB 4RTNA 3MTQA 4OLFA 4Y2VA 2OWEA 3CG0A 3QELA 3GRVA 1KAGA 1A9ZA 3F4BA 2FEAA 5B2ZA 3WLRA 2UYHA 3EIEA 3ADOA 4YASA 1J8QA 3T06B 3BA1A 3Q2OA 5JRJA 3A1VA 1KI6A 3DR3A 1Z8HA 4YDHB 4Z0NA 5L3QB 1RKBA 4CIDA 1YQWA 4EFDA 4RKRA 2REOA 2TMYA 4X95A 1C7ZA 4UTRA 3HJAA 2H5IA 3O4FA 4EKEA 5HZHA 3IAHA 3CW2A 3NBXX 1WABA 4Q37A 1GPJA 1HURA 1L1RA 1WHSA 1U5BB 4L9SA 4X8LA 5E4YA 2EHDA 4DILA 2IA5A 4HT3B 4RY0A 4X84A 1CUCA 1NVKA 1Z6YA 2Y2VA 1CF4A 4ZMBA 3CN9A 1VQ9B 3KEMA 3PD0A 3NGMA 3QVUA 1BJKA 3HYCA 2JDID 5KVSA 1R18A 2EL9A 2HU5A 1GUDA 3CZMA 3DB2A 2HYDA 4BWGA 2AG1A 4TLMB 3ABSB 4CFYA 4CMJA 4ZTZB 1P1JA 3ZEIA 2J3DA 4QODA 1TAQA 3TNFA 3URKA 1ONNA 1COZA 2X1HA 3LYLA 3AX6A 1E9CA 1MRSA 2IYVA 5DYTA 3RHZA 3AW9A 3NNSA 1JEAA 2GJ4A 3TX2A 4J16C 1S2LA 2QVBA 2CXOA 4INJA 5AUPB 3GWGA 1AKTA 2Y3IA 3ZD8A 1XK6A 3VKHA 1GILA 1ZD3A 3U3ZA 2IOHA 5CD9A 1OGIA 2P68A 2YCBA 4NE9A 4S35A 1N05A 5COAA 1ZIDA 2A1UB 4ZRMA 1UBKS 3FCYA 1KF0A 3CIFA 3KHTA 3MJCA 4JBXA 2XXBA 1XTSA 4MV9A 2QLFA 5CB4A 3T3NA 5FOQA 4IVNA 5CNMA 3ZKWB 2F3UA 3D8SA 4ZDWA 1ZOSA 2ZUEA 1OWOA 1Q1AA 1KYIA 5CFLA 2ANBA 4F9GA 3BH4A 1ISSA 3OLVA 4W5OA 2H7XA 1FDWA 2CK3D 3PWKA 3T7KA 2QBYB 4G4JA 4AJEA 2BI4A 2JLWA 1IM5A 3HVUA 3JZIA 5T57A 4D8WA 3I2JA 3WLPA 5LP1A 3V32A 4PLYA 3INRA 4UD2A 4JN6B 3MS4A 1Z5NA 4BV9A 2JZCA 3Q12A 4MUMA 2RHOA 1QJCA 1YVUA 2FEPA 3N6XA 4FBMA 4MV5A 4UNIA 2DB3A 1JXMA 4GM4A 3N6RA 2B8JA 1E94E 2QTHA 3GV0A 1ORWA 1K8YB 4L95C 2IEAA 3CRRA 5K0NA 2G9VA 3G2HA 3JYNA 4HZUA 4WOJA 4E15A 2PMWB 3OE5A 1GZ7A 2Y67A 1DG3A 2BBWA 3HPQA 4HAYA 4UBIA 1EX7A 2UAGA 4JQYA 3O3CA 1SZCA 5T67A 5K45A 4DUZB 2XB6A 4Y6QA 3FJOA 1I8DA 5ERGB 4UCWA 4BYGA 2DLNA 5BW4A 1KEPA 4UW9A 1R4MB 2QNIA 1OIVA 4REQB 4JZYA 4DUPA 3PHJA 3C3XA 3KLPX 1ZCAA 1T4GA 3NWPA 5EKUA 4R2LA 5I01A 4Q00A 3GZ4A 2OC9A 3NT4A 5AVWA 1K2WA 2WIFA 2Y1XA 4MW7A 4PPNA 5DN9A 3R0XA 3O31A 4DLNA 2V4MA 1JLMA 2W2LD 1QKJA 1U2TA 1R0LA 1XTTA 1UMBA 2XYGA 4LZLA 4UDNA 1MQ9A 4EZBA 1N2EA 2NOAA 4UU0A 3MJVA 3PXUA 1H0KA 1ZZEA 1QH0A 4M6WA 1PKVA 4ACBA 4X6LA 5ALWA 4BRSA 2IX9A 2O2ZA 1W73A 4OJKA 2ZRPA 3NMUF 2YN0A 1YB1A 4PS1A 3KJIA 3REOA 2C57A 2CF4A 4AJPA 4FOTA 5LLSA 1SKYB 4RF3A 3KKNA 4UUBA 4YCNA 1V25A 1R4AA 4R9UC 1FP4A 1RQ7A 4QLOA 4W9NA 5FCDA 2AF3C 1CFZA 2A92A 3LS2A 3SZUA 4WZAA 4HB4A 2SICE 4HADA 1E6UA 3PCXA 5KO2A 3IHTA 5EJ8A 2OK7A 3D6NB 1SHJA 5EZ5A 3C85A 3I5XA 1N5MA 4P86A 1J49A 1TUIA 2GJAA 4M21A 2VNAA 1G9XA 2H1CA 2H16A 3PQCA 2NZ8A 3FDFA 2FUCA 3R6LA 1RKQA 1SQFA 4EGQA 3GZNA 5AM2A 3OC6A 3STYA 4YLEA 1QYCA 3KXLA 3T12A 1L2TA 2FEMA 3GR6A 3OOYA 4JLJA 2PX3A 3M49A 4EHLA 5FPKA 1D2AA 1PV2A 4L8WB 3AJ8A 1NJID 3HKBA 2NYRA 4OYRA 1PNRA 3CC7B 3QOYA 3E1YE 2O7VA 3G23A 4F1WA 3R5SA 1L5SA 3CGWA 3D54D 3IAAA 1U7WA 4YRRA 2IV7A 3OJFA 3N5KA 3SN6A 1HYBA 5FQOA 1WMDA 2BLNA 4M9ZA 2O2SA 3RRBA 4OI2A 2FPRA 4KXMA 4PR0A 4UNSA 3ROFA 2HX1A 3L1IA 2I4LA 2PD4A 3TLXA 4WBSA 1SHZA 3O93A 2GZ1A 1XNGA 1T2CA 5F7ZA 3CPWB 2CVOA 3EDQA 1GFZA 3A6ZA 3KJGA 3HH8A 4U9IS 1WP4A 3DZHA 5IYNA 4OHPA 1EFUA 5JS6A 5KHLB 3AFIA 1PSWA 1U8XX 3D64A 3W05A 4AS2A 3PF9A 3IA2A 2VAMA 3IELA 4CMBA 3H9NA 1WCIB 4D3ZA 4A0SA 1YHYA 3KD2A 4AICA 4D25A 2QU8A 3WGNA 3JWEA 2DX7A 3EXG1 1PBTA 2HKIA 3SNHA 1D6SA 2HK8A 2JHPA 3NB0A 1KSFX 1PAUA 3VH1A 3EDOA 1XMXA 1W2WB 3D4BA 4B4DA 1DWUA 1DFGA 4TT3A 2VF8A 3IEKA 3SC2A 1T5EA 4L8FA 2CE2X 2FLVA 3WGVA 2O8VA 4NV0A 4H7PA 1FS6A 2KSQA 2WWTA 2IIVA 2P2YA 3QE0A 3USES 4EYOA 2GHQA 2O7QA 4DR3B 1Q20A 4TOIA 4LXGA 3NHKA 4YCJA 4YRAA 2DXIA 1XD2B 1ISHA 3AP2A 4UTNA 1M2VB 1NJ1A 1ZIYA 4I1IA 5IJ0B 3BXZA 3H84A 3K53A 1TYZA 1TCAA 2X3YA 3N2YA 3QQ5A 4BXOB 2CKDA 1K5GA 4O3MA 3DL4A 2DTDA 3NC1C 5AW4A 1ZLYA 3A3OA 4G89A 4OGLA 3DV2A 4X7DA 5L7YA 1E9RA 1UBGA 1P61B 4HPJB 2CHEA 2X0NA 4EAQA 3O8RA 4GI7A 1X7YA 4BX0A 1FMTA 1ZHFA 1T2FA 2PJDA 1UBOS 4LZWA 5GPBA 5LP6F 4B3FX 1J0EA 3WR5A 2EVWX 4LHZA 4NJOA 5CEFA 1E3TA 2G6TA 4GGPA 1HBJA 1SQ0A 1XZIA 2OHXA 3GLHB 3NDJA 4OH1A 4ZI5A 3EEOA 3DE7X 4HBGA 5J9FA 2O5EA 1M1YB 4XJTA 2ODNA 3WQQA 5F76A 3JYPA 2FEOA 5FI3A 5FNVB 5FOVA 5CG2A 1I3LA 1Z0SA 2WG1A 3HCFA 3MWGA 4JB8A 5ALKA 1IXRC 3T34A 4AZ0A 4HLDA 5L8VA 4OP1A 5KWIA 3HK2A 1DB3A 1TM7E 4LNUB 4NFLA 1ZGGA 2B6HA 2CL0X 4PCVA 4EITA 5HXBA 4H59A 1A4XA 1Z5WA 1TQDA 3F3YA 4J0KA 2GZ3A 3ZY3A 3JQEA 3IQWA 4N41A 1WA5A 3UK7A 4B0OA 3SMQA 4ZKEA 1LKZA 4WV3A 2ZT6A 1NF2A 3EAGA 3K70D 2R4TA 3PEVA 4QVGA 4BVFA 5DWDA 5I5GA 3QLVA 4UEQA 4EY7A 2O8EB 1QH1A 3FMFA 5EERA 2G63A 3L9XA 3ONNA 5LA6F 4MYSA 4POAA 4RA6A 3STWA 5I9LA 3KHSA 3BHNA 1I2AA 4MJ3A 1Q19A 3T5AA 3WL5A 4TMWA 3LLSA 4I4IA 3OPOA 5ILGA 3WKCA 1OH8A 1MF7A 4QUIA 4XDZA 4H18A 4Z9YA 3BIOA 4O33A 4JA0A 4PZ9A 4TV9B 4O2AA 2JEOA 4WJLA 4PZLA 4R2KA 4O4LA 1EWVA 2BEVA 4YMTA 1SUBA 1ZD2P 5FV4A 4L07A 3SP1A 4B3RB 1H6BA 1MRNA 1UANA 1T5HX 1X7GA 2I0FA 3D2BA 3H05A 3MERA 1TRHA 4Q7KA 3RNLA 2VSYA 1DIRA 1HQYE 2VP5A 3IESA 3JZFA 2JFUA 3QU9A 3TRIA 1LVUA 1ZWLA 3A8TA 3JAMA 1QGED 3CBGA 1F7VA 4RGYA 1FSPA 2JFPA 2PZGA 3GEEA 2EFHB 3S2YA 1LI4A 3ZWMA 1R5NA 3FNIA 3NE5B 4ZMSA 1YCGA 4N54A 3GCWA 5G53C 4FSXA 4ONEA 1HDRA 2OQRA 2I22A 3ZGVA 5D2CA 3HBAA 2VDWB 1FMJA 1SULA 4GP6A 4IRUB 2FDXA 1WUHS 2QEQA 5HKKD 1FFXB 3B1XA 3GEBA 1VXOA 3FNGA 1T5LA 3OC0A 4S0XA 2WHXA 3CSDA 3WHIA 3WZLA 4A6EA 3CCQB 1QP7A 2ZSFA 2JLYA 1U5CA 2EF1A 1HZZC 2CLEB 3GRPA 2COKA 3FBWA 3LZCA 4P4SB 1RLUA 1TCCA 4PYNA 1PHRA 1SBNE 3PJDA 2Q9UA 2DM6A 1AV7A 2IF0A 3NP7A 1KMHA 4FDAA 4FCVA 4RCVA 1I30A 2OCAA 4ZOAA 3TLYA 4PHTA 2JF0A 3MQFA 1P9WA 5EHXA 4IJ5A 2ZJ7A 4E0BA 1WHTB 1F9AA 3WQBA 1WVGA 1LS6A 1WB9A 4YRCA 4YJDA 3CEJA 2O0MA 3ZDCA 4HPWA 4RFVA 3IAFA 4MKRA 1MFZA 4OU4A 4RPHA 2F7SA 4Q4JB 5FB3A 3UCXA 4YR9A 4J8PA 2ZYSA 3U61B 2XHZA 2VNKA 3KELA 1K5DA 2FGKA 5KTYA 1UMCB 2V0GA 4QYIB 1H05A 5EEHA 4L5BA 1XRMA 1A82A 2YIVX 2PA0A 3NDPA 2Y68A 4Y1FA 2GGSA 5JSZB 1RNLA 2XLBA 3D8TA 3M2PA 5HIAA 3FZQA 1M1UA 2QX9A 4W5WA 4FFVA 1MB3A 4QPPA 3FBTA 4WOPA 5E1BA 1VZ3A 1X80B 1XAIA 3CT4A 3E7DA 1TYCA 3O8BA 4Q5IA 2YHSA 4LDPA 3MS7A 4PN7A 2AZ4A 5CW2A 4N7RA 1XLVA 1NLUA 5IZCA 1T0JB 1WXEA 1BU5A 2Q9BA 5L46A 1JHZA 4UNNA 4ZO8A 1NVVR 2MINB 4FLEA 1P6XA 3Q2KA 1TQ6A 4PNZA 2PUDA 1M9NA 3FD8A 2WTAA 3L06A 4JI8B 3B5IA 2XDWA 3H99A 3MJRA 3ESXA 5BSMA 3JWGA 4ZHQF 4PYKA 2OCYC 5AI5A 3KPJA 4RD6A 2C5LA 1YI0A 3HA7A 4RTKA 4D4LA 5DM70 5A7GA 5ITWA 1BGXT 4D9GA 4K9SA 4EK9A 1QG4A 2WUEA 5B1YA 4S2EA 5CCBA 4WESA 3DBLB 3LDFA 3ESDA 1JH9A 1NP3A 2OILA 1ZR2A 3G2MA 1AJEA 3Q9LA 2ABWA 4MQLA 3TKAA 4RHUA 3MSCA 1RXCA 2FLWA 2HWWA 4ZPJA 4JXZA 4P0PB 2ZL7A 3UC9A 3GPLA 1HETA 2IOFA 2XGMA 4JIMA 2ZETA 4HB0A 3VKWA 1FSFA 1KI1A 5D3MA 3QWAA 1TEHA 3L01A 4WZLA 1JP7A 1MKYA 4DABA 1T35A 3R41A 3H2YA 3PUXA 4ZVVA 4H6WA 5CFNA 3X1MA 4F2WA 5K8VA 1LW6E 3P9IA 4EHFA 2PPVA 1OGJA 4O4HB 3FGNA 3RKRA 1TIKA 1U8EA 2FPGA 4J49A 3N74A 2CVPA 2DPYA 2F8LA 4HLUC 5IKEA 3FMPB 3U19A 5ES3A 1XR3A 4MRRA 1C41A 1L5VA 2FPWA 2OHVA 1UD4A 1JZSA 4ZVMA 1OTHA 3AUYA 1RSZA 2VLBA 4N8SA 4FLFA 4XJXA 3ZE7A 1QF6A 1E2PA 2J3LA 2WDPA 3OU2A 1KERA 2W6QA 2DTXA 3CW9A 1HDCA 3V7UA 4C1NA 2VTEA 4E21A 4BCDA 4ZGBA 3FNEA 1JQJC 2TMKA 2G9QA 1QUEA 4KR0A 3G8BA 1ZVQA 2B2CA 4PAAA 1AS2A 1Q0RA 2C5EA 4KYTA 3RH0A 1XZHA 1TPYA 3KOMA 4EQ6B 5MGBA 2HCJB 3R6WA 4HYQA 3AEKA 1GGNA 3PXBA 4HDNB 3ENQA 1EZZA 2WHQA 1DDGA 1T5OA 2ORYA 1NT2A 3W6ZA 3N7UA 2X5KO 3PIRA 3S40A 3AFHA 3SZOA 4JXXA 4FSDA 4QUHA 1HQDA 4YELA 3Q3AA 3RROA 1BCSB 2FRXA 3L7IA 4KIGA 4IRMA 3UENA 4U2DA 5L3SA 3DONA 1G3MA 3FNRA 1TI7A 1YC5A 1G20B 2PRZA 3JD2A 1TMOA 3LUGA 1JG1A 4QUEA 3ITEA 2VUHB 3EF0A 3G89A 3NDIA 3EXHB 1Y5NA 1RQGA 2RHTA 2UZ4A 3SR0A 3CUWA 1RJ9B 5KYVA 1M6NA 1XCGB 2PGJA 1GPH1 2LP4Y 2YW9A 4LGYA 5EVJA 5IBQA 1G21B 1FLVA 5E6UB 1YJ8A 4NCNA 2C7BA 1Y8CA 3PU6A 2WLTA 2VK1A 4LX8A 1J8FA 2GYUA 1I2ZA 4DSZA 1HDEA 3IIEA 3KYDA 2IQ5A 2Z8ZA 3OWHA 2KHZA 2A33A 3P4XA 4XX0B 2JD1A 1AUQA 3AHCA 4RMHA 4X71A 3Q9SA 1JIJA 4NZNA 3F71A 2NSYA 2OM6A 2X0IA 3OM0A 3ZDYB 4XYEA 1AA6A 4X63A 2O8BA 4MYTA 1ZK0A 4OJYA 4EVRA 4H7IA 3SF8B 4TQGA 5GIPE 4BPBA 1O58A 5J2TF 1YBFA 4ND7A 4B6JA 2CJWA 5H9WA 3KDAA 1UZAA 3N8DA 2GEBA 3MWFA 4IDPA 4RHEA 1D9XA 5LMNB 4XI9A 1GTVA 2PSFA 1PNQA 5IMBA 3V4SA 3CZ4A 3F2IA 3Q7QA 2C7OA 3DFZA 3TLCA 5DASA 2FK8A 1N2GA 3Q41A 4R16A 1G59A 4RJLA 2QRGA 4QV2A 3PL5A 2H1FA 4TLAA 4MXDA 2ZI3A 3DVQX 1QB8A 4K8RB 3TZCA 2CCJA 3RE1A 1K9SA 4OUKX 3ZE1B 1DAPA 4GLOA 4RXUA 3ZK8A 1G5PA 3I61A 3DEKA 5AOAA 2D0DA 3GHHA 4DC1A 2O8CB 2MTBA 1W36C 2IIBA 3A2KA 3W8FA 2E5LB 3S2EA 1NKSA 4QELA 2X0KA 1MT0A 3HEAA 5JNVA 3UJHA 3PTLA 4B74A 3DVSX 3M3HA 2WB4A 3SAJA 1K7FB 1JDVA 4XR9A 1VQ5B 3GMTA 1JEJA 4E0FA 1NLMA 2P27A 2VK8A 3V8BA 5A2GA 1RAAA 4GF5A 1H0HA 1G60A 1E1YA 3DE2X 4J7AA 4WRRA 1BJTA 3KO8A 4W8GA 1CLUA 2HADA 4B76A 3GXBA 5KPJA 2YRWA 3F6RA 3QOXA 1H2WA 3M6LA 1JW9B 2XJ9A 3AVOA 3JQ9C 2VF5X 2QTVB 3G0GA 2YZMA 1HDZA 8AT1A 4XQFA 1AGPA 3RRMA 2X2EA 2XUDA 2ZU6A 2ZRQA 3BG5A 4U7FA 1HEIA 3L9WA 4KPFC 3EZFA 2OA0A 3RVNA 1CP3A 4DM4A 1JPUA 4ENSA 3FVVA 3TJZA 2W37A 2HO5A 4A1OA 3HCAA 1JQDA 3DHEA 4MX8A 4IQ4A 4QHYA 5KZMB 1GR0A 5D3KA 1QX4A 3G59A 1FX0B 4CF4A 2QMUA 1V16A 2BFFB 4DNRB 5EL0A 1XSEA 3E53A 2NTEA 3RFCA 3T4PA 4JVOA 3ZDXB 4C0WA 5AJYA 4JLKA 1AQYA 2KPOA 2OVBA 1C3JA 2P4SA 3V33A 4ZYLA 1DTEA 4JI0B 2BHSA 5JLJA 3CCVB 2VRCA 4PSKA 5HNKA 3HU2A 4UPEA 5LZ2A 2WUDA 3N86A 3A6EA 3EVCA 3WWEA 1Q3KA 2XUAA 2PD6A 3UOGA 2H3EA 3VR3A 3TVYA 4F5EA 2IU3A 4ND6A 2CUNA 1BQEA 4TQUS 5CCXA 2AYXA 1EP2B 1WS6A 4HK4A 1FK8A 3LBYA 1KYYA 2ACWA 4EZEA 3Q9UA 4L4SA 5HM8A 3B6IA 5ITZB 2HL6A 3G7UA 2C04A 3FR7A 2BIFA 2XUGA 1KI2A 3TDNA 4B3HA 2ODAA 1ULTA 2PX8A 2QUKA 1OIWA 3KR1A 4S2UA 3WTCA 4BN0A 2GKSA 3DOOA 4G8CA 3JYHA 4YUVA 2EJVA 3FYUC 3M9XA 3D5EA 4ADSG 2GBFA 2G1KA 2QYOA 3H04A 1MJGA 4DWOA 4PG8A 3V7FA 3IUEA 1P62B 2ONZA 5CK4A 4D8YA 5EJ9A 2I4IA 4PZ0A 1RQ2A 1ZIPA 1SCDA 1Y33E 3L6CA 3TSAA 1L9XA 4MVJD 3UWMA 3L0DA 2Y92A 2NZ2A 3OCXA 5ARDA 4ZK2A 2V6BA 3DMFA 1ORRA 1B1CA 3QELB 1MT3A 4IO1A 4MCAA 3ZWDA 4GL2A 3NS7A 4IOKA 5KTRA 1KSHA 2MT9A 3PP8A 3QNUA 3ZV6A 3RV3A 1S2GA 1EUZA 1KI6B 1NM5C 4Q3CA 3OAAD 3CN7A 3C6BA 2BCGY 3L7NA 2I1VB 3J7TA 3C5WP 3R3UA 3OD5A 4KE7A 4LXQA 2VWPA 4MS3A 3JY6A 4UHDA 5DISB 4F84A 2C3OA 1CK4A 4AKHA 1Z17A 2R8EA 3NYIA 1VI5A 3QYAA 4N5HX 1DIBA 3OTOB 2X5NA 4F4IA 4C05A 1A5TA 2W2KA 3HBJA 2ZAMA 3MOSA 5T8KC 3ICPA 4HFNA 4LJ4A 4V0LA 4XLZA 1N34B 1VQ1A 3NTVA 2ZXUA 5JD5A 4MAFA 5EJFA 4L7QA 4D57A 2A1TR 3GT7A 3ZWOA 4UE3S 1UAAA 1K06A 1OTXA 1S3IA 5EE0A 1JWAB 3K20A 4BNGA 3D02A 4LFBB 3ZZ0A 5E4TA 3AGPA 2G40A 2DR2A 1ZRNA 5LXTB 4BO8A 2OBRA 4H1VA 4F46A 1ZM3A 1IUOA 2P3MA 2AYZA 2HQSA 2FW7A 3CLUC 3E6AA 3L0BA 2F9MA 2HPAA 3P2EA 3VR5A 5GM2A 1UD2A 4LZJA 5DLDA 1ZI6A 4B4OA 4HX9A 1QAOA 2B7BA 1V1MB 4US2R 3VO1A 4JLPA 5FBQB 4Y0VA 1QO0A 3OICA 3NM5A 3PRYA 3DTYA 2E2WA 3VV2A 2XEXA 5M29A 1OWPA 4RX1A 2CKMA 4RH3A 4X44A 2VDOB 3K8YA 5CB4B 4D42A 4PZPA 2CD7A 2O2XA 4DDUA 1CC1S 2EIHA 3IQFA 4ALKA 1Z29A 1J24A 4I36A 5ERXA 5A6VA 2I9KA 3VYRB 2GFQA 2NUTA 1M7GA 4YV7A 2VEOA 3K0BA 5DDIP 1JHQA 2O9JA 3P2YA 3WNQA 4CF6A 3UMMA 2Y8EA 3LHSA 1AGNA 1JDTA 4XEUA 3A06A 2QDKA 4ZQFA 1E7YA 4RADA 1IIBA 1X8XA 3L8GA 2QQEA 1LRJA 3R44A 1WDTA 2Y27A 3LK6A 5EMKA 5LP6C 5JI3E 5KNDD 2X7XA 4QECA 4B6OA 1PK9A 3HCOA 1PWHA 5EIBC 5HFAA 2IH5A 4WY8A 4EYSA 1M90D 1Y4DE 1G18A 2GAFA 4KIJA 4D3XA 4TVKA 4MQFB 3FW1A 2GPTA 2WZBA 4R5HA 3M9WA 1XK7A 1UBSB 1ZVKA 2RGYA 4HZUB 2WJ6A 4ZQGA 1G6Q1 1QLHA 2PD3A 1RYFA 4QHTA 2VSOA 2BP7A 3MJHA 1FYVA 1ONPA 5DTMA 3VI4B 1EGMB 1VIMA 1GL7A 1FW6A 2X6WA 3KVRA 2JFHA 3FNBA 4ZCTA 2I71A 1XZBA 4P32A 4EFKA 1WV1A 4FDLA 1ZUHA 3F90A 3MT9A 4A5SA 2CZQA 5LQUA 2C9MA 3LQFA 3WJ7A 2JJ2A 1QOPB 3E81A 3HZOA 4RPBA 3I2GA 5BPHA 3TK1A 1A96A 1AS3A 3QKRB 5K3FA 1UMBB 3VSAA 3IOBA 1IQRA 1LV7A 2CB9A 2VDMB 3FB4A 4IGEA 4R9SA 4YFYA 4M6WB 4GZMA 1A72A 4G2TA 4L5IA 2J32A 1B3RA 1E3QA 1NVBA 3DF7A 4NDZA 5B58T 3W4IA 4CUJA 2LV8A 4LS3A 4CV0A 4MGKR 1G2OA 1H4QA 5A5FA 1UZLA 5DHRA 3SIRA 1G41A 4BUZA 4CM5A 3H1BA 1FP4B 3MN1A 3NAMA 4QOFA 4BWVA 4E5VA 1QU3A 4ENTA 2PT5A 4WZAB 1Z22A 1YQ9A 1AE1A 4B0PA 3E8XA 1QC5A 2XE4A 1JVNA 4I9NA 4H2DA 2A57A 2PANA 3B6MA 4OHOA 4E13A 3LVFO 1GADO 1FU8A 4HGPA 3PX7A 3VGPA 5I7HA 1NMSA 3AVPA 1SXJD 3TTWA 1NYQA 2XI4A 1RKXA 3A3PA 2G25A 3MTBA 3KT0A 3RLIA 1OH5A 1RT9A 4LJSA 4ZVLA 2RGWA 1EXWA 3AK4A 4B4WA 4YRGA 1Z4MA 4KWIA 5T3UA 1J56A 3K71B 1BXGA 1JZTA 1G8FA 2BFDA 2W2QA 3IP1A 4AP5A 4G0YA 1KEKA 1P0CA 4B6GA 4BLTA 1HEYA 1VCOA 1X7XA 2IXGA 3HKBB 4EUSA 1NBME 2C4UA 3DA8A 4J76A 1W47A 3AG5A 3LPDA 3FTFA 3DLHA 1PFWA 4Q15A 3RGGA 1LJLA 4NLLA 1IY2A 2O8DA 2QM7A 4I4NA 4BZXA 4S1TA 4FM9A 3AR7A 3ECAA 3MJSA 1YB2A 4WA7A 4I9GA 3M5DA 4BVKA 1P44A 4B6PA 2H8KA 5DW3A 4CMAA 3RANA 1PWYE 2D74A 2O59A 3IIIA 1L5FA 1RU3A 2G07A 1URPA 3IBGA 1T0IA 3TQFA 3DDOA 3PL1A 3WXMA 1Y1PA 4UEKA 5A3VA 4GX2A 5CNIA 5K8UA 1V71A 1FP2A 1X13A 3CX3A 3QWIA 4E6PA 1TU3A 3G0OA 3KTAA 1W9XA 1Y81A 4A8HA 4KO2S 4FOPA 3B9PA 3EZLA 5TPWB 5DK4A 1SU8A 1VF7A 5GV7A 3ZDDA 3AY7A 2E1RA 3FUTA 3F3KA 2GASA 1UBUS 5AK4A 4WJKB 4YR7A 3L02A 4TGLA 1AB6A 1PT8A 3H5RA 3WMEA 1D1NA 1RM5A 5HX7A 3Q39A 1F14A 2G80A 3B3GA 3V5NA 4BNVA 3ZZMA 4XUGB 1G8MA 2G9RA 3OF5A 2BR5A 4ZC1A 3C3EA 1U4NA 2P62A 1P0FA 4KIFA 3SFZA 4OI0A 3OQPA 1LC3A 2QUBA 1JAYA 1KY5A 1NRJB 2OXFA 1M67A 1T1SA 2ZJ3A 4CRWB 4LG1A 5GV8A 1QO9A 3PLRA 5ED4A 1GFIA 1ZD8A 3IE2A 3P9SA 4J3JA 3WNCA 5AI9A 4CYMA 4CIAA 2ZXIA 1IULA 3VTKA 4MI9A 1CRPA 2SHKA 4E5KA 4PGOA 1K8QA 4IUDS 3N9IA 5AVKA 1NW8A 4JEUA 1TAGA 1I7DA 4ER6A 1O9HA 2D7CA 1V5FA 1SC6A 5FBKA 3KD3A 1G7TA 1O95C 5EQFA 2VVTA 2NO0A 4KNWA 4FMPA 5B3JC 1GDHA 4TRMA 2MDTA 1FDRA 2BHLA 2QTAA 4JVLA 1DG1G 1LI5A 2GN6A 3I9NA 3PQ2A 4AZ0B 5JU6A 4UUMA 2QTBA 3KDSE 4JVNA 2HHHB 3UH1A 4WADA 1ACJA 3G5UA 3OJ0A 2XX3A 1HKUA 3PRHA 1TKRA 1YQQA 3CUTA 2QE6A 1FDTA 1H0RA 4BZQA 3BE5A 1G4UR 2D5AA 4FUQA 5KYXA 1W93A 4DLKA 3E3OA 1BVHA 2E9SA 4ZODA 2BOVA 1YIAA 5EXPA 1KRXA 1PU2A 4C2TA 3AEZA 4GSKA 1TUBA 5T3YA 2JBAA 1RW4A 1QH1B 4Y9TA 1TUGA 2VJLA 3DDCA 1B43A 4RA6B 3UV7A 2BEUA 1AKEA 2GD2A 4YAUA 4EHHA 4KXLA 3SZ3A 3WBBA 3DO5A 1JMYA 3NP9A 5FWNA 1Q1QA 1UXGA 1HT3A 3MCUA 2XBUA 3GRAA 3O4VA 4JLMA 1VQMB 1YL6A 1U81A 5CVUA 3J80A 1QZTA 4IEFB 2ZTNA 1WF3A 4RPCA 1TC2A 5EMMA 4UULA 2EX4A 2CXTA 3B6ZA 2WJYA 3LT4A 3GZJA 1AK1A 2QL5A 3MT7A 3OOWA 4AZWA 3CHYA 3RASA 4DMCA 5EHGA 1ZC4A 3ZC3A 4EI9A 3W79A 5K0FA 3JQPA 3LNNA 1IHUA 2XMGA 3JSXA 4QTUB 5HRCA 4TMTA 3HDQA 3O1IC 4FHEA 2JI8A 5ALUA 1PQWA 2PZJA 3L7BA 2BTOA 3NTRA 3QUTA 4ZFNA 4UOZA 2XB9A 3KUXA 4X6UA 1SB8A 2HGZA 2NZWA 4NG5A 1AV6A 5KIAA 2QG4A 4ZDJA 3R9XB 2P4UA 1G42A 4G6ZA 1T4MA 2D2VA 1JDBB 3D2CA 1U7PA 1J9ZA 3N3AC 4F85A 3H8VA 4KO8A 2X13A 4FGWA 4DCUA 2WF5A 2ZYUX 4KQXA 4ZOLA 4LWOA 3SYTA 4L50A 1Q21A 5IT4A 1EJ6A 1KMHB 2B8EA 2EFJA 2UZIR 1D1TA 4MYRA 4JKYA 3GRUA 1N2ZA 1RM3A 1DKQA 1LTHR 1NVTA 2CXPA 2VYVD 3ASTA 2DP4E 3BCSA 3QNMA 1XVVA 2QT9A 5TGZA 2PKEA 1EVIA 1RWPA 3CNEA 2ZUBA 3EULA 2FPUA 1XRNA 4UVIA 1W48A 3OG9A 1A69A 3C7DB 3FY4A 3N39C 1RJGA 1COWD 1W1IA 4DPMA 9ATCA 2ZB2A 3B1KA 3D8UA 4B40A 1QHHA 1JEEA 3QHPA 4JR0A 4DGQA 2V7UA 1V6CA 2PX6A 3NZEA 1CTQA 2FOIA 5JSKA 4BWFB 4A92A 4A36A 4XWOA 2FVYA 2JH9A 3MGGA 2ZZFA 1ADYA 2VR1A 2X7HA 3NEYA 2I3ZA 3KYJB 3A31A 4ETIA 1E9SA 5SZIA 2YQ5A 3MXTA 5TJ9A 4DA4A 1GKYA 1GUYA 1HE4A 5CD1A 3MINA 2J9FA 4PBSA 5HQJA 1L5OA 1QSGA 5FPQA 3L8FA 4R1SA 3QKSA 4Z99A 1U7UA 1S8AA 5J4YA 4DLUA 3VTZA 3DCJA 4J3NA 4YDSA 3ROMA 5B3KA 4ECEA 3KT8A 1NSFA 3CMEB 4H0CA 4M4SA 3M1IA 3FDIA 4N6OA 4EA8A 3GLIE 2Q29A 3E7XA 3KB1A 1Z08A 2IBMA 1YQXA 4PLTA 4F56A 1Y98A 5CFMA 3OO1A 2IDZA 3QZUA 2AQ8A 2XKJE 2ECFA 4B81A 4DA9A 3C5EA 2HHLA 1O97D 2HSZA 2PFSA 3D31A 3L7DA 1UBFA 4BMCA 4JT9A 4M1ZA 4Q9HA 4OBBA 5CIYA 1UFQA 4WK0B 3R3VA 2XQFA 4N01A 2HA3A 2YC4C 3LFHA 2ECOA 1FRQA 5JCJA 3OPMA 4MA5A 5ICGA 4RTRA 1UK8A 2BM9A 5FUXA 4CL8A 3L0CA 1GV1A 2HFKA 2AOWA 2XNCA 4GOKA 4AO8A 3U44A 2FA9A 2WKQA 4BQOA 2JIQA 1KMIY 2QQGA 5EYPB 1AHPA 4X00A 2D1SA 5K0LA 1JDSA 3T3HA 3CVYA 2R6ZA 3E9QA 2GF9A 1ADGA 3PHGA 1S1CA 4CODB 3S8EA 4DSTA 3FUVA 1KZHA 1RRPA 1ZOOA 2OHFA 1NW7A 4WI1A 4CM1A 2NV2B 2FMUA 4MO9A 2GKOA 4BJ1A 3J81k 2WV9A 4RZHA 3UUWA 4LC0A 2C31A 4E70A 1OB2A 4JP2A 5D00A 2FPGB 2PLAA 1SC4A 4Z1OA 4ZVSA 3THYB 1QMPA 1S2MA 2JLXA 1GPUA 1A7AA 4X8OA 3WHKA 1RPTA 4GMDA 4URHA 4BGIA 4BLPA 1TUEA 4DG9A 1AK2A 1YA4A 2OD7A 1RAGA 4TS3A 4O63O 2R1UA 4Y1RA 4I4TA 3MOGA 3HAGA 2PJZA 4YP1A 5IJXA 3TI7A 3X1DA 1LDEA 1OLXA 5DLEA 1QR6A 2F43B 1HLFA 2YCLA 5ARBA 1JKFA 3ADDA 1OYYA 2WJAA 2OAGA 4IDQA 1ZBDA 3PUZA 2MCFA 1T24A 4RHXA 2Q4BA 4JUAA 1ZNYA 1J6UA 3BIXA 1MGOA 1PFVA 1A9SA 1NSTA 1SIBE 1X77A 1ZCJA 2ZRLA 2ZTHA 3AHEA 3MJFA 4HGQA 4XKVA 4AQDA 3NV7A 4J2HA 3OOJA 3WMXA 2IS2A 4TV8F 1LK5A 4KN5A 1YDGA 1MABA 4IDEA 4N6NA 2VH1A 3R74A 1X7WA 3UN1A 1WD7A 2WC1A 3WA7A 4U6NA 3I04M 4XX1A 4MRMA 5L3SB 1DRVA 3H0KA 4QGGA 5HS6A 1KMCA 3GK3A 2PQ6A 4OGWA 4YREA 2CVQA 4DDHA 4D56A 1U9YA 2OO7A 1HG1A 3STUA 5ABPA 4LBWA 1M72A 3OP1A 1WY5A 2VO1A 5JZ9A 2J3QA 4Y6SA 3S70A 4X0CA 2JRCA 3I2IA 4PRZA 2ZYHA 2HA0A 1I3KA 2P9TA 5H81A 3VJLA 3D3JA 5B1EA 2O4CA 1EEXB 2FFQA 1BCRB 1EQUA 4CE6A 4KDFA 4LEIA 3W2GA 1N8NA 5JVDF 1V5EA 3KYDB 3LQKA 1N06A 1MOZA 3C4JA 1QBKC 2A9QA 2JB9A 5H68A 4DDKA 4EHJA 1PK8A 5KNDA 4DUGA 1M2HA 3PJRA 1GDDA 5E6TA 1FNBA 5G0VA 1A8IA 5TDHA 5FAXA 1P6UA 2O8BB 4AMVA 3GFBA 5EQTA 1V6SA 5FHRA 2Q8NA 3KSRA 1UWVA 4KLCA 4D9KA 2Q0HA 3ZCXA 1ZEMA 3M6WA 3MC1A 2GUGA 3ZWVA 3MT8A 3B8HA 4NC9A 1S3SA 3N8HA 3U3KA 3B3FA 3KL9A 4JQSA 1OH7A 3JQFC 1R4ZA 3AHHA 3QXGA 4BLWA 1PWEA 1ORTA 3PFIA 1AQLA 4ERXA 2I67A 5L6LB 4XZ3A 1HE3A 2F2TA 3GLTA 4LJRA 1SVKA 4LRYA 2PS9A 4OK6A 2ZWIA 4EW1A 2B2XA 4RPIA 5BSYA 4ND4A 2VT2A 2ZSIA 4QOSA 1QOQB 1U0JA 4UE6A 1MJHA 3RSHA 4ZVUA 1U4OA 4G1FA 4QUDA 3BYZA 3R7WB 1K6IA 3UG6A 3EG9B 4L27A 4MV7A 3RNOA 1R8JA 3BT7A 1X1QA 4H6VA 1XZQA 1QDEA 1I6WA 5AN9A 4K7JA 3O2QB 1JB1A 1A04A 1JG3A 3BE6A 3GAFA 1E89A 3GA5A 3ID6C 3U62A 3UT6A 3VOSA 1A8PA 2CWDA 1EVQA 3PNSA 3QY0A 4UNQA 4KEAA 1CJCA 4UNPA 3TL2A 5M5BA 2UUCB 5DXAA 2VATA 3PIIA 1U94A 3GJ8A 1VJSA 1RWOA 1EFPA 4PAOA 2IDKA 1N3BA 4MPRA 1DKPA 2C9OA 1G5IA 1YQDA 5D5HA 1NIJA 1U3DA 1T0PA 3CH4B 4BNXA 4Y7DA 1ZH0A 5I48A 3HKEB 4L6IA 2AJ8A 4ZT6A 1RYYA 3L2OB 1J9EA 3K5IA 3Q3VA 3A9UA 5KCMA 1T9HA 1KQNA 2WWVD 3RS9A 3V1NA 5JQGF 1SXJA 1R8XA 3TO5A 2QAGC 1C4OA 4FJ2A 1BX3A 4FWBA 4EFMA 5BWLA 3UVEA 1DQYA 1VLYA 4GSLA 4IIJA 1UM9A 1UFRA 3FLEA 2XUOA 3LUCA 4RTPA 3BL8A 2XKAA 3ER9A 4OQEA 1NFFA 4B7XA 1NN5A 4REOA 4CHTA 4CTNA 1IIRA 1V16B 1NUPA 1II9A 1DKOA 5E7QA 2HMWA 2W4IA 1EFLA 4ZYWA 1DJPA 4YRSA 4AUEA 2PSHA 1J2RA 2OD2A 2OV8A 3BGOS 2EWVA 3IOYA 4FLMA 4B75A 1T9GR 4EZIA 1R10A 4FDMA 1T6BY 4G4IA 4HBZA 1UXKA 4LOKA 4NZPA 1TQ4A 3QFHA 4K2HA 5T4HA 4C5AA 4YRMA 5KQPA 1LLFA 1NRWA 1YRQA 4MP6A 2HQRA 3UM9A 1Y9AA 1EP3B 4MQUA 2WTMA 3EVNA 3EGXA 2HSGA 3AF1A 3O2JA 1TMGE 3ZE0B 3ZVRA 4LDNA 4IFBA 4CLEA 4DVJA 3B48A 3N0RA 3ZWBA 3UW3A 2ENWA 2B61A 1KJQA 2CSXA 4MCJA 5T4FA 2JFOA 4A3SA 2FWMX 1IXKA 3I30X 3LHFA 3PGKA 1TOAA 4RVNA 3W3AD 4M76B 5F52A 3RTDA 3RT1A 9ABPA 2ZVPX 5HIMA 2NSDA 2ZAOA 4YAGA 5KQMA 2Y0PA 1IVNA 2ZPAA 5F4JA 2YVAA 4LF9B 4MKZA 1JXAA 1GZ5A 1RLTA 1C9JA 3MAGA 1QZXA 3R6GA 2JL1A 5CDFA 1W9HA 2JCSA 3NHWA 1EDDA 1ONBA 3RBAA 2IUYA 1ZNQO 2O07A 1UD6A 3R8CA 1IN6A 4KI0A 3AHGA 5A4AA 2J6HA 4B6QA 2O2YA 2GDJA 4GYWA 5JASA 1NYTA 1JH8A 3UGJA 3AZQA 4BB5A 2AXQA 3PC8A 3KM0A 2I6GA 1IM2A 4EABA 4HUTA 2J09A 1ISMA 2P3SA 3VJRA 1K73D 2AN5A 2JJMA 2POQX 3EW7A 3K9GA 4NU5A 4HEA6 5KTKA 3GVLA 1H0SA 2C07A 1V39A 4ZTBA 1T25A 2A78A 3OZIA 2B9VA 3I64A 2FR8A 4Y6OA 3FXAA 4HO1X 3CB4A 1YAHA 4JQCA 5DFAA 3GLFA 1PWZA 1VOTA 2PUVA 4WL0A 3CFYA 4CLOA 5KYNA 3EZ9A 3OQVA 5CA0B 1CY2A 2NT3A 1RD4A 1GQ2A 3WRYA 2E48A 2XYVA 3BWEA 3HA5A 721PA 3VNQA 2XKKA 1XNRB 1IEXA 1OWLA 1SVSA 3OT1A 3AWIA 3QFCA 2R7NA 5DTIA 2IITA 2HWYA 1YZQA 2C8VA 3UXEA 1K7XB 3LNCA 5TF4A 3PXGA 4EMSA 4QULA 3U3DA 3ANXA 2C4MA 4ZYUA 3KWLA 2PBRA 4IMPA 5DNUA 4QPZA 1NVAA 1U02A 5K3AA 3UPTA 1AMOA 3CKLA 4I2VA 4EB0A 1L7AA 1GPMA 3DLTA 1GNPA 2PUBA 4LUCA 4C01A 2PXXA 4RVSA 4ZAWA 1XZFA 2BEWA 4RTQA 3EEBA 5CFQA 5LKRA 3L4BC 4KUHA 3CMAB 1Y3BE 4DY6A 4TXLA 1C8BA 1OBFO 2ON6A 2LWIA 1EG7A 4X94A 4DV1B 3FGPA 3PA8A 3WLQA 4HL6A 4LOLA 1PX0A 1IZ7A 3JAWA 1G5HA 1B74A 1TMYA 3IB3A 4PRYA 2WZCA 3M7IA 2P2LA 1EEHA 2NUTB 3HGMA 4J7UA 1SBIA 1JGTA 1I18A 2WU1A 5EHZA 3GLVA 1UJBA 1F60A 1VSVA 3AERA 4QOEA 5J4HA 2RHDA 2Z1NA 4XUDA 3RSLA 4C0KA 4M9UA 3MF4A 1USGA 2FFRA 2R7MA 4EPYA 5I9IA 2DYKA 2VHTA 3DWEX 1HLDA 2O3RA 1ZL2A 4K88A 5IAEA 2XIQA 4GPIB 4C0QC 3VSCA 3ZIUA 3D7MA 4NOLA 2QRUA 3E23A 1E8NA 1I3MA 3OPYA 1PSZA 5FUMA 3IHKA 2BISA 3G6WA 2Y0CA 4NFHA 2ZI7A 3OI7A 4QRDA 4YT8A 3UJ9A 1Z0FA 4OFXA 4BNDA 3EF1A 3K9QO 2ZR8A 1M6YA 1NV9A 3R0JA 2NN3C 2PU5A 1D07A 3TKLA 3ZCRA 2XUZA 4XYMA 3H1EA 3I5AA 4QFDA 1UK7A 2H52A 1JIUA 2BP7B 2WMOB 4QYMA 1JIXA 5D6NA 4RHTA 4PC7A 4RHFA 4BNZA 3ACCA 4R8LA 4P26A 1E77A 1VCMA 1DBPA 1CW2B 1GITA 4WHMA 1RJEA 3ZZ1A 5IRCD 3R4CA 2K2WA 2FOXA 2HK7A 3K0AB 1H2AS 1CUWA 4P4UA 4AT1A 4WBNA 4XFKA 2CFTA 2FJPA 4OVKA 4DQVA 1GU0A 1XPOA 4DBZA 3L6DA 4W8OA 4EMUA 2FSHA 1U0EA 3SS7X 1BGVA 3QH4A 5CBPA 4PPQA 3ND5A 5JY6A 3SHWA 3ZTTA 3FYTA 1EVKA 1O77A 1RWNA 1YJCA 2O2CA 5LQNA 4C3VA 1PVOA 1SEVA 1C5KA 1O7JA 1Q84A 3LPNA 3AVQA 1OB0A 1B7GO 4IKEA 1J2YA 2OTLB 3ENVA 4KR9A 4XUEA 3E4DA 3BXPA 1Q77A 1GTJ1 3K09A 4N7BA 1NR5A 2FZGA 4B85A 1QC5B 2F9LA 3PQDA 2VCEA 1Z39A 4PEVA 1OCEA 3K30A 4X66B 1DC7A 2QN8A 4G01B 2TECE 3L4EA 1UWCA 1XQ1A 5A0VA 1A77A 5BR7A 5DP2A 3DULA 3C39A 2DLDA 3LP8A 5I8ZA 3L6UA 3S1AA 1N32B 5E2IA 1U80A 4N0QA 4AZVA 2F67A 4BEVA 1IZYA 1KYXA 2BFDB 4GP9A 1FXWF 1SUDA 3KUDA 4G67A 1JSCA 5AVOA 1JG7A 4V0NA 1X7XB 3R7AA 2QG6A 2IDJA 3U39A 5EJ4A 5IHPA 4BNJA 3NW9A 2PNFA 3W2IA 1JAIA 1NQ5A 2R60A 3C97A 5F5XA 4JX9A 5MGNA 4QO8A 3RU7A 2GKGA 2AXPA 4ALJA 4MS1A 3I83A 1FCJA 1HGXA 3DAPA 3TS1A 1DRUA 3MTJA 1X38A 1NL3A 1SNYA 1IEWA 3OEHD 3U31A 3HY4A 4Q03A 4R51A 1VYTA 4F5WA 1FYDA 1PX2A 4Z51A 3DDZX 2V7WA 1CZOA 1GPLA 4RTMA 2ZJYA 1KH3A 4Q3AA 5KYWA 1PTKA 5IM4F 4BVGA 3MBOA 4UTOA 4K1LA 1VPTA 3LX8A 4INAA 4LXIA 4C89A 4DUYB 4NEGA 5ERYA 1L5GB 3QX9A 4PYJA 3KTAB 4PQYA 3TQRA 5ISMA 3UMFA 1SKBA 1K6EA 1RQXA 2WNIA 1EBFA 1PD0A 2YHUA 4FFBA 1JKMA 4OHUA 4RK0A 3GJRA 5HF5A 2RAUA 4BCBA 5JMTA 5JNWA 2A9FA 3KJFA 3UBMA 5TVGA 2QWXA 3ZXUB 1GTSA 1LVHA 1P0PA 1EXDA 2F1RA 3E5MA 1USUA 4YJ3A 5LYJA 3VYUB 1EJ2A 1YRAA 1J23A 4WOBA 1Y80A 1GL3A 4UAJA 4A0FA 4PM4A 2BFEA 1IK6A 4LF7B 1B8VA 3PK0A 3UV3A 1KJYA 3SKBA 4R54A 1LF5A 1CR6A 3IKLA 2WT8A 3T7IA 5F7XA 3G02A 3VSEA 2WIGA 4V1CA 4NTZA 3HWX1 4BQEA 1W4LA 3AJAA 1VLOA 4OXYA 3ZQ6A 2H00A 3BTSA 2GBGA 3T5GA 5JNRA 1ISFA 3OFND 2GRJA 4QRHA 1CR0A 3LC7O 4CL0A 5IXSA 3EFOB 4IUYA 2PE3A 3CVOA 4LC1A 1TVCA 2XYHA 3HLYA 1R1DA 3CG4A 5SYAA 3VHLB 3KOWA 1YR7A 4BLSA 2G71A 4HHEA 1C9MA 3CW8X 2JGKA 2EP8A 4M1WA 1JI0A 5HBGA 5LOVF 2YV3A 1OFGA 2YFHA 3GDHA 3KKZA 3LT5A 1OROA 2WD9A 1QVWA 3T9BA 4ZQBA 3PQ6A 3KEQA 1GPBA 3ZU5A 1UOQA 1EK6A 3K9BA 5B4TA 5JWRA 1ML4A 5FWXA 4JJGA 5KDLA 1NOIA 3LCJA 4R3UC 1HOXA 4G2NA 3OJWA 1PKXA 1SQSA 1ORVA 3HR8A 3I6ZA 5AO9A 4GIBA 1O08A 2UYCA 4F6RB 4UARA 3K8ZA 3LFUA 4GZ3A 3I28A 3OT5A 3ZY4A 4X8HA 1GCAA 3OEEA 1S8NA 3GT3A 5JNTA 1UD3A 1SVIA 1VJTA 2HLDA 2RGAA 3LZ6A 4NESA 1Z34A 3UPUA 1Q7TA 2UZAA 2BFCA 2WVHA 5E2BA 4PLFA 5GY7A 1T10A 3HXLA 3K1AA 3TRFA 2A84A 4I4LA 3C4VA 2JBAB 3I04A 3FB1A 4WIAA 4QFCA 5HA5A 4FEAA 5P8WA 1FNSA 1TJYA 4W6QA 3W9BA 4KHPB 1XZNA 2BEUB 2DBRA 3CNNA 3FFAA 3SYRA 1BDMA 1R0KA 3MCTA 4H35A 3DQZA 5KDOA 4XKWA 3FPAA 2GRAA 2IOYA 4TXNA 1BWRA 3VX4A 2R0QC 4L57A 1DAEA 1FJHA 4OOVA 5BMOA 3WYAA 2GPAA 4LZZA 4F72A 1FFSA 3R9WA 2BUBA 4L0QA 4UTVA 1U1DA 4L2IA 3G0CA 2Q62A 4ID9A 2P2SA 4IDGA 4KWEA 5FBHA 1V4BA 1XNQB 4QE3A 2LRHA 4D9FA 2GEUA 3LQ6A 1E3IA 4HAUA 3ONVA 1E2QA 3ESQA 2FZCA 5AVYA 3PWZA 1W4AA 2WTBA 4P93A 2LW7A 2ZIGA 2HIMA 3II6X 4WDRA 4KLAA 1WTCA 4L3WA 1KQSB 3DOUA 2GPBA 3ENKA 4UFPA 1GQOA 2C5AA 3D8HA 1DWQA 3W1VA 3THWA 4B35A 3E1GA 1MB2A 3JCZA 4Q1BA 4V0KA 3DM9B 3W2EA 1X3LA 4Y2JA 4XWGA 2C96A 2ZB8A 1N25A 2IYXA 2PR7A 3ICVA 2FSVC 3GVJA 2IY9A 4QD3A 3I6BA 4CLDA 2C1EA 3OCUA 4WKOA 3AQIA 1P2SA 4OMFG 1ZG3A 2V7TA 5EE3A 1AMNA 1A27A 1JTFA 1R7RA 1XZCA 4OH7A 3CV3A 2AMLA 1YR9A 2XT9A 3MA0A 3TLMA 4EOGA 2JI9A 4I6GA 1M6WA 5KOHA 1VLQA 3NV9A 3P9NA 1HTWA 5REQA 2QAIA 4AJKA 1T34A 4KLNA 1F6WA 3FZNA 3DO6A 5HWSA 4ITVA 4E5UA 1GPYA 3FOAA 2DY1A 1L4UA 4LWZA 2C3MA 1QHHB 4RM2A 3RYTC 3VMMA 3LTEA 1USWA 2VQEB 1OAKA 3QVXA 3LC0A 2G1UA 3QG1A 1ECPA 2Q4OA 1P5HA 3LCMA 3EZ7A 2XQJA 2ZSEA 3FM9A 1DC8A 2N75A 2WVAA 3FMGA 3LKZA 3OESA 1EAYA 2GEFA 1Q57A 2BKXA 5GJWC 4DR1B 3K94A 3Q87B 4MHTA 3P32A 5JE8A 3MINB 1CSEE 2J9FB 1VJ5A 3KOXA 3IP6A 2HXSA 2Q8PA 3A1CA 3LE8A 3OTQA 4L6CA 4KQJA 1UZMA 1HDYA 1ZPDA 3ASVA 3QKSB 4MV4A 4DDVA 2SBTA 4NPCA 5KX5F 3Q98A 4K40A 2ZB3A 3M3PA 2PO7A 2P2CA 4JI3B 2FWPA 4QHSA 5DGDA 2CB0A 3UJBA 2AUTA 3W3AA 1JLRA 1KKLA 4EY8A 2GZMA 3S3TA 2JFYA 1U0HC 4L51A 1W4BA 1FRFS 4DSAA 1HY3A 3IVAA 1GLNA 2AOTB 2OCGA 5AKYA 4U2GA 8OHMA 4TQAA 4OJQA 3ROQA 3PVCA 3FWHA 4HLNA 2JG3A 4XD7D 3L79A 1IXSB 1UK6A 1J1ZA 2W43A 3G85A 1A88A 4GI5A 5EIFA 1U1IA 1UIMA 4YQEA 2J0UA 2HHCA 1L8QA 2NU8A 3U44B 3HI4A 1SCUA 3BWBA 4FFNA 3RBXA 4C7MA 1ODKA 3VPBA 1TJ3A 3IJEB 4DCGA 1DO8A 3ELWA 2B82A 5FF9A 1NQTA 4WZZA 1E3EA 4PFJA 3HJNA 2C78A 1YS6A 3QJYA 3A3NA 2D3TA 5C32A 2IS6A 3T1QA 3WNBA 1C0IA 1IY8A 4FMBB 2N42A 4HX2A 2EW2A 4JJKA 1U6IA 1NBEA 1XHEA 3WGQA 3RYHB 2HK6A 2XD9A 2GPNA 5DCUA 1CJMA 4L0DA 4UMFA 3LA6A 1E2DA 4X06A 3GJ6A 5AHXA 2AUMA 3C6YA 1UPTA 1RADA 3WGLA 1PVDA 4J1NA 1Y63A 3H9QA 3R6KA 1K7YA 2SKDA 4KH0A 1B00A 1LX6A 1HMPA 2GBIA 4EY6A 2DAPA 3R6JA 2H9AA 3B70A 4U0JA 4Y1RB 1OILA 1ULZA 3QBTA 1IHPA 4RZSA 5C2JB 1P0QA 1C14A 2I6XA 4F8JA 1KVUA 4PQGA 1OLXB 1M2WA 2ZRNA 4G1BA 2OE2A 4BQNA 5DZSA 5AVRA 2CBXA 2ZK7A 4BE4A 4O2LA 2IH2A 2UXCB 2J5BA 2WVGA 3B2QA 2G09A 3TLZA 5AM0A 1HTBA 3ZDFA 3NGLA 1G8HA 1R0SA 5J2UB 1NGSA 1LF0A 1F48A 1TA9A 3BIFA 3LVRE 1BEZA 1R0ZA 2I6QA 3VFDA 3A35A 2D3WA 5B55A 5HUJA 1QO7A 2QXTA 3IX7A 3KTOA 4FWTA 1YDFA 1MABB 3ILYA 2M5SA 1X7WB 2PT9A 2ZUUA 4RVHA 4HUQA 4RCZA 1YRHA 1LDBA 1QH9A 2PVSA 2WJHA 2VWHA 4JP3A 5CAEA 3AKEA 5IAGA 1SVWA 1Q1GA 4TKZA 4ER3A 1E9DA 4KTTE 3G82C 3BK7A 4Q9JA 1OLSB 2Q6KA 1CZKA 3H86A 4PZDA 1JG4A 1S3GA 4B6SA 5BUQA 5LLTA 4RHYA 2J6IA 5BW8A 4IVRA 2JKVA 4JKOA 2C9YA 2EP7A 5EP2A 2IE8A 2VP3A 3G8AA 1WXGA 2WUFA 3LDUA 1XKQA 5KOJA 5LDHA 4KZKA 2CXNA 3R0QA 1YWGO 3QMPA 1OASA 2ZVQX 1DXQA 3UUEA 1WORA 2A7XA 1YVEI 2GEKA 3HDGA 1ZBQA 1KS9A 2VTDA 2ZJ5A 4KBYA 2Q46A 1B23P 2O0LA 2VJPA 4ZO4A 3QE2A 1PZMA 1W1WA 3ETDA 5J4VA 3IUBA 4J1TA 4OLHA 5HPYB 4QAJA 1MVNA 4ZAYA 5LU9A 2GAOA 2RK6A 3U1TA 2VUTA 1H93A 2QW1A 4DXDA 1PJ7A 2PUWA 3UJ6A 4XWKA 3LX6A 5JPCA 3TKYA 2OK8A 2B6NA 2G9UA 3HY3A 3WOHA 4YRJA 5EGSA 1UJNA 1YJXA 2DMRA 2QN3A 3A6HA 4GOMD 4H17A 4JC4A 4O5OA 4I5EA 4P4GA 1RFLA 3KAJA 2V65A 2BR4A 2JHGA 5E6SA 4EUNA 2ZSBA 3DCNA 1RYNA 2ID4A 2PIAA 4NG4A 2W6JA 2FMXA 3MMNA 2ZRAA 4R1LA 3MD0A 4LJ5A 4MVJE 2A4MA 2H51A 4Y2UA 4JKIA 1H3NA 2DBQA 4HQNA 2PQMA 3HTXA 3RG8A 3ONDA 5BV1A 3E03A 4JLOA 4MLCA 4FFMA 2CXUA 4ENVA 1O54A 4J90A 2AFIB 3PHHA 1HG0A 3PE4A 1DT5A 2R751 5ADHA 4JBLA 4RVFA 1HNWB 4M1MA 3AR6A 1JJAA 5LYYA 2FPLA 3WIDA 3AY6A 5IEBA 3PA6A 3EGOA 3DFUA 1EVEA 2Z2ZA 2JVJA 3IPRA 1Q1ZA 3ZE2B 1F38A 2G5PA 4RD2A 2QL6A 3KYBA 4WNYA 4XIIA 3PPVA 4B7UA 2GREA 3CVUA 4GQAA 3TUJC 4XA8A 3I1JA 4FCTA 4WLOA 2HF7A 3EEIA 4DA6A 4EYKA 1N6OA 2FGJA 2XTAA 4O2BF 3HP1A 1O5OA 4G1CA 4OM7A 3S2FA 5BNWA 1P4SA 4FI3F 1HT1E 3PXEA 2CLOB 3M6XA 4UHFA 3U7JA 4JA2A 1TM4E 1QIJA 5EPOA 1YNOA 5HIIA 4IIJB 1UM9B 3TD2A 2B69A 1XUOA 1C1DB 3RTBA 3Q7RA 4MITA 2C4NA 2HJGA 2ZR9A 3QV1A 4JT8A 3BIWA 3D9QX 3V2GA 4HGZA 1XAHA 2QUAA 2Y05A 4Q3NA 4EHKA 1Q95A 5I5EA 4AJIA 5F78A 2AV6A 1G8JA 1PN3A 3R5TA 4X7CA 1KI8A 1XYYA 5EUBA 3X2EA 2GK6A 1M5UA 1TJ4A 3CJRA 5J5CA 2XDYA 2D8AA 1BIFA 1YR2A 4M49A 3G13A 5K0JA 1YI1A 2VK2A 2VBUA 3AT1A 3UQYS 4PF1A 2R6CA 3DV9A 4EHAA 1I3OA 1U8CB 3HDTA 1EDBA 2NO7A 3FUWA 1EDZA 2JFZA 4Q6WA 3G7NA 3UAGA 1JKIA 3M6VA 1N0VC 4G8JA 4YAFA 1DOHA 3AYXB 1SAYA 4I46A 1T8PA 4D3SA 1KK0A 5BNIA 4DTCA 2YDYA 3GH3A 1RI2A 3LG2A 3ROZA 3LSTA 3LLCA 2ECKA 4X5OA 2K4MA 3P0IA 3MG9A 4PIVA 4ALIA 3CVXA 1O0BA 3E15A 4G1MB 5B5SA 2RI1A 1W5FA 5DHPA 3V00A 3I55B 5BPFA 2VJOA 2HPZA 1FNMA 1NDUA 4RD4A 5JJLA 2ZRMA 3CZCA 4BIIA 2ZYGA 1U2DC 3EIHA 3I1YA 4KN9S 2XTNA 4KYUA 3SBDA 1ZISA 1J0AA 3WMRA 3ABOB 4JB0A 4R2WA 3B9QA 1NLFA 3EVZA 1HL7A 1KO8A 1UBEA 1ES9A 2DR0A 2F17A 4XVCA 3BWVA 1R0XA 4KYIB 4XYBA 4G09A 1DAOA 4E4RA 1EFRA 1TADA 5CCDA 5HP4A 3D26A 5ITVA 4GBGA 4RF5A 3UMCA 4FB5A 3D5QA 3P0JA 5EAIA 1P18A 2BGUA 3ML1A 4HWKA 3A9RA 3CRW1 2I2BA 3OFNA 1LBHA 2AQIA 2DWCA 3FCCA 4WKBA 1SC3A 4U7DA 4V02A 4A15A 1BHO1 1H8HD 2UYYA 2R5NA 4CLOB 4PSDA 4EG6A 4EMTA 1JT2A 3FYUB 3B1ZA 2PUJA 3ESAA 1C7QA 2VDNB 3KOYA 7ADHA 2H2DA 2WU0A 3A4MA 1AQJA 2W0MA 3CUYA 3M33A 3OT1B 1ZKMA 3TPCA 3GEIA 3T5PA 3VKFA 2IL1A 3TBFA 4AROA 3CCMB 3I56B 1VHLA 2GSWA 2WJJA 2NUAA 3EDCA 1WDWB 3ZE9A 4P1VA 2B20A 4MUYA 2AUNA 4YP0A 3SKXA 4ENUA 3RAJA 3ZJVA 3G05A 2