3JQPA

Crystal structure of the h286l mutant of ferredoxin-nadp+ reductase from plasmodium falciparum with 2'p-amp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
312
structure length
266
Chain Sequence
b'NFINLYTVKNPLKCKIVDKINLVRPNSPNEVYHLEINHNGLFKYLEGHTCGIIPYYNKQRCARLYSISSSNNMENLSVAIKIHKYEQTNYGYCSGFIKNLKINDDIYLTGAHGYFNLPNDAIQKNTNFIFIATGTGISPYISFLKKLFAYDKNNLRNSNYTGYITIYYGVYNEDSILYLNELEYFQKMYPNNINIHYVFSYKQNSDATSFYVQDEIYKRKTEFLNLFNNYKCELYICGLKSIRYKVMDILKSHDEKKKKRVHVEVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin NADP reductase
publication title Plasmodium falciparum ferredoxin-NADP+ reductase His286 plays a dual role in NADP(H) binding and catalysis
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 69
structure length 266
sequence length 312
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2009-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3jqpA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3jqpA02
4RD4A 1ZM3A 4LBYA 3AVTA 3AGQA 2BMWA 1QGZA 3CCEB 1QFYA 5HXBA 3VO2A 3LRXA 3FJOA 3B8HA 3G6EB 1G7CA 1BJKA 3W2FA 2PIAA 3I55B 1BX0A 3AVUA 1VQ8B 4C43A 2CRVA 3V76A 2AHOA 4ZCMA 5EMNA 3CXCB 1ZM9A 4N3GA 1VQ6B 3AVYA 4PC6A 4LC0A 1OB5A 4YAWA 1CNFA 1WDTA 4G1VA 1QUFA 1YIJB 4TMZA 1FNCA 3CC2B 1EXMA 2E1RA 3CC7B 1QX4A 4PGOA 3VNUA 1OB2A 1JNYA 1GAWA 3I56B 1ELOA 3LVBA 2B5OA 4TMVA 2DETA 4RJLA 1QGAA 2X3UA 3QFSA 3CMAB 3QSYA 1YJWB 1BX1A 2C77A 3W5UA 1J9ZA 4PC1A 3CCMB 1GAQA 1QFJA 5GV8A 1KJZA 1TLLA 1TTTA 2XNCA 2QEXB 3VNVA 1ZM2A 1UMKA 3CRZA 3MCAA 2RC6A 1VQOB 4QHYA 4PC2A 3CCSB 1EP2B 2NPFA 2HMAA 1F60A 4RD3A 1EFTA 1SKQA 2OK7A 2BN4A 4PC7A 1D2EA 1Q82D 4AF6A 5FA6A 3OW2B 1G7TA 2BV3A 4AC9A 2QTLA 4NBSA 1QVFB 4C0SA 4G5GA 1IJEA 4H9GA 4B3XA 2QA4B 1TVCA 4B47A 3JQQA 4WQMA 5DSZA 1H85A 1GO2A 2QN6A 1B2RA 3PENA 1FNMA 4IW3B 2BM0A 4TMWA 1VQ4B 3WBKA 3ZZTA 2VNKA 4P3YA 1KC8D 3G71B 1W2BB 1FRQA 4Y9UA 1DG1G 2BGIA 4MYTA 3B78A 3W2EA 2B7BA 1QFZA 4HE6A 3I1FA 1AIPA 2YWEA 4K1XA 3QFCA 3CPWB 1QH0A 4J0QA 5H59A 4MYUA 3AGPA 3ZZ0A 1KQSB 3ES9A 1JB9A 4RD1A 4DQKA 2EFGA 1XE1A 3MHPA 4FWTA 4DQLA 4FN5A 2GQFA 2B7CA 3P27A 5TY0A 3LYUA 3ZBUA 2GPJA 1R5NA 2EIXA 2QTZA 1KK0A 2BM1A 4HE5A 3W2IA 5TR9A 3WBJA 2DCUA 3W2GA 1OGIA 2BF4A 1B23P 3VMFA 3LO8A 1EFCA 3OZWA 3OZUA 1N0UA 1JA1A 4TN1A 4TMTA 2DERA 4RCYA 2RC5A 1QVGB 1KD1D 2FX3A 3WY9A 4LBVA 5AN9A 2XEXA 1KK1A 1EP3B 1K73D 1DARA 4FK8A 3CCJB 2BVNA 3WNDA 4ZCLA 3CCVB 1GVHA 1EWYA 4ACBA 1ZUNB 2HCJB 1NDHA 4YAFA 1JA0A 1VQLB 3JQRA 4N3NA 1FRNA 2PLFA 3FPKA 1IB0A 2OTLB 2VNIA 4ZCIA 2DY1A 1YJ9B 3AVWA 3P26A 4Y7CA 5TV2A 1QUEA 3ZBTA 1VQ5B 2C78A 1N8RD 2VNJA 2XNJA 1W34A 1AMOA 3G4SB 1XB2A 4ZV4A 1R5BA 4YAUA 3U2QA 4AF7A 3CCUB 4R71A 3OZVA 3U6KA 2ZITA 4YHBA 3MMPA 1BQEA 3B82A 3CCRB 1HA3A 2OK8A 4B4DA 4M4SA 1Q81D 1VQMB 4TMXA 1S72B 2QDXA 3OJXA 3ZC3A 1Q7YD 1A8PA 4YAOA 3CB4A 3JQPA 4M2LA 1NJID 2DEUA 1SM4A 4RCZA 5THXA 1VQNB 1QG0A 4QFMA 1VQ9B 2OTJB 1M90D 3CCQB 1U2RA 4YALA 1YI2B 4UAJA 3VO1A 4ZGQB 1E63A 4RD0A 1K8AD 1W87A 4NCNA 5H5JA 2J7KA 4M53A 3QE2A 1W35A 1YJNB 1CNEA 3CW2A 2D74A 5KSWB 1K9MD 4Q7JB 1E62A 3OJWA 3E1YE 3SJZA 4B43A 5JBQA 2CNDA 1EP1B 5GV7A 3AVXA 1D8TA 3CCLB 1JJ2B 4LBZA 4B48A 2VYQA 4RD6A 2VNHA 4M0LA 2YWHA 3E20A 1KK3A 1OGJA 1QGYA 3WNBA 1DDGA 1E64A 4M1KA 3W5HA 3QFTA 3AVVA 1R5OA 1DDIA 1VQKB 4BPRA 1Q86D 3CC4B 1EFUA 1VQPB 1D1NA 1FDRA 1ZM4A 1GJRA 1KTVA 3CMEB 1KRHA 1KK2A 3W2HA 2VZLA 4ZGNB 4PC3A 2BSAA 1YITB 2PMDA 1G7RA 4U9UA 1VQ7B 1YHQB 4EH1A 3WYAA 1G7SA 3W5VA 1N0VC 1GR1A 1TUIA 2R6HA 4G1BA 4P6VF 1F20A 2BPOA 2HDNB 2YWGA 4LBWA 2QMUA 4ACAA 1S0UA 3CD6B 3WNCA 3WXMA 1FNDA 1H42A 2YWFA 3QFRA 4RD2A 4B44A 1CQXA 4Y9RA 3A1FA 3U6BA 2BGJA 1FNBA 4F7DA 3ZZUA 1IJFA 1I7PA 1M1KD 3J81k
chains in the Genus database with same CATH superfamily
1K4MA 3PFIA 4AN1A 1TF5A 1HSZA 3QVXA 4PG7A 1HWYA 4UTOA 5JJLA 1KAHA 4JOBA 4P80A 3G2KA 4U2CA 3DOEA 4EPTA 1ANKA 5EOVA 3UK0A 1VSVA 3LGAA 3KT8A 3PC6A 3QU4A 4KIJA 3WKDA 3ZXIA 3UHPA 1AKYA 3I3SR 1QFYA 1G3RA 4FONA 4FT4A 5DGIA 4Z53A 3P52A 2V6MA 1II8B 4MKFA 1G2QA 4BGIA 5ICCA 2LZJA 1GILA 1HVXA 1S3SA 3STXA 1WRBA 4DLRA 4OYHA 4F85A 2E6UX 1Y4DE 2AI1A 5HF8A 4DV1B 2CRVA 1FZQA 1H5QA 3K31A 3VNSA 1TO1E 3MHTA 3MQFA 3TQOA 1COZA 4CM3A 4BO0A 4EDHA 3CX3A 5FTLA 1U3UA 1DP4A 3M5CA 1MABA 2GF2A 2IYYA 2PNFA 3OFND 1ZA1A 2G82A 3R24A 1X7WB 2QLNA 2VJMA 3DT9A 3WYEA 3ZWAA 4BGUA 1OU4A 5BNWA 4M3NA 4IGAA 1SPXA 5JNLA 2FMFA 3JAMA 1E18A 1WHSB 5C37A 3V3TA 1RQ2A 4MUMA 2IRWA 4B4WA 3VSEA 2E1BA 2MHCA 5B1IA 3PUVA 2J48A 5H9VA 4BKUA 4C76A 2P2YA 3P0FA 4MQFB 4YAWA 1WDTA 3I5UA 1X9HA 1GV0A 3H4IA 3L2OB 3IP6A 1N1EA 4J2TA 3V9PA 3EXHB 3WIDA 1G9XA 2JJ1D 1R0CA 2VH2A 3KSUA 3RRYA 3PFCA 4NK5A 1G16A 1KO5A 2HNAA 3AR3A 2VDJA 1PQUA 3D2AA 3GYGA 2VJAA 3ND6A 3KPWA 4GC5A 2JFGA 5FI0B 3T15A 3T7KA 3VVBA 2QX7A 2QZPA 4LJKA 4BVLA 4HAZA 1I6KA 1BRMA 4P25A 5J2TA 3VXKA 2B5OA 4E2WA 3BSSA 2DETA 4FOTA 5ARDA 3ZWDA 4GWKA 1GUAA 2DR3A 2O0LA 4TTAA 5AP9A 3TRDA 5L45A 3SQXA 2QUKA 1X94A 2FR0A 3ADCA 1K7FB 4PR3A 2IXTA 1YJWB 3ZHZA 1BX1A 3AU8A 5CT9A 1CT9A 2OLEA 1W8IA 1T9GR 1Y8QB 2WWVD 1IQ0A 4KI0A 2GXAA 1CIJA 4RM2A 2WYOA 4TTSA 3HNPA 4MW4A 1RAGA 4AS1A 3LHKA 3DM5A 3ER8A 4KO3S 2XBMA 1LLCA 1JAHA 3G9TA 3VNVA 4NONA 4YCDA 5EKDA 4ER7A 2PS3A 2TMDA 5FL7A 3G68A 3CRZA 1MAAA 3B5IA 1R9NA 3VR3D 2A58A 2RC6A 5GIPE 1UKCA 4OMCA 5D2CA 5E6RA 3U3DA 1QKKA 5BWOA 3VA7A 2ZK7A 1G9TA 3IDZA 3RGGA 2NPFA 4JFAA 5JY1A 5JS1A 4AKHA 2GT1A 3R6LA 4HNAA 4LXIA 4RD3A 2XDQB 1RXVA 1H2RS 1R18A 3IC5A 1D1QA 3I4CA 1VBFA 3OLZA 2Y1CA 2VBFA 5K8IA 4J3NA 2X77A 2YMMA 3A1CA 5IYZB 1YDEA 3PNSA 1KEUA 2FSHA 2GETA 1AGRA 3PHJA 2WY2D 1OAOC 4YLYA 3FHJA 1JPJA 2YV5A 4L85A 1QYXA 1X1SA 3KB6A 1N1MA 4O33A 1P4RA 3VC2A 4XD7A 2C5HA 1LDGA 5M3BA 3TXYA 2QVZX 5IAJA 3W3AA 3C0KA 2SHKA 1KXJA 1KNXA 4KQWA 2GEUA 2IE0A 3U0VA 4AFNA 3WL3A 2WWWA 1DJQA 2X3FA 3PX3A 4Q3EA 1O3YA 3BXGA 5KHAA 2DPHA 5LZ2A 4BWYA 1C80A 4AMYA 4BTLA 5KYNA 3OFSA 2OOKA 2QB5A 4HFRA 1MQ9A 3S6JA 1Z0ZA 4HH0A 4EKDA 4H9GA 1U1FA 2GCOB 4KR0A 2QAIA 4ECEA 5EIBC 3H1FA 2GILA 4AUKA 2VHQA 2WWTA 1L7DA 2PGIA 3HNOA 4ZALA 1ID8A 1HBJA 2E0IA 3PICA 5JC8A 2ID9A 3QOYA 1AOXA 1P4GA 3OTGA 4NZMA 4LK2A 5BSRA 2AIRA 2ISCA 4RLZA 2QL9A 3O2QB 3OA2A 1Z4NA 1QCCA 5EJGA 3VKVA 2CHUA 1DZIA 5KYWA 1M2KA 4I19A 2O3RA 4WI1A 5C8ZA 4W9NC 1KPHA 1KQ3A 4R01A 4HVAA 5EPUA 3W6OA 4JHXA 4RNDB 2AX3A 3E9QA 5KCZA 4IMRA 4YRZA 1EFVA 4OLJA 5SY6A 3M3HA 4W8HA 5L9AA 5FBRB 3COZA 1RIIA 3RODA 3VPSA 4MV0A 3TRHA 5HRUA 3DQZA 4DNTB 3VPCA 3JYHA 1R9JA 2R48A 3T52A 3A6HA 1J2UA 2B7BA 3BY1A 5CBKA 2Q07A 5C7LO 2HSGA 4IQ4A 1A5SB 2WHRA 1IJKA 1PT6A 1V25A 3FIUA 3ITKA 4S2EA 1WBBA 3GR6A 4L27A 2FSGA 4QBFA 2VA9A 3LYLA 3NT2A 3ZX4A 3LWZA 4CGYA 2V7BA 5EHQA 3SS7X 1ACLA 3H9EO 2PUGA 4MYUA 2JZOA 2CXXA 5K6TA 2YW9A 4KAAA 3U1BA 4GM0A 2AXEA 4IVNA 4C3OB 5B7PA 5EERA 2C31A 1XMQB 1JB9A 3FCYA 5LBUA 4OKSA 1X8KA 4PYLA 4BFLA 1BZYA 4EHIA 2PL9A 1HQDA 3WDLA 3CP8A 2K87A 2Y1FA 1P7PA 4LRWA 4QARA 4QUGA 4WXYB 3UT0A 2P68A 4MROA 3RFUA 2FPSA 1U63A 4RW0A 2LXNA 2ET6A 4JR1A 3FTPA 1JEQB 4F3NA 3ZCUA 1T6BY 1A4XA 3BRQA 2ZIWB 2FMUA 3S27A 3J7AC 2P3QA 2G9QA 2R85A 4F56A 1SELA 1I6LA 1UBKS 2BI8A 4DBVO 4BQEA 3IDAA 1OWOA 4Q7EA 1L3BA 1W30A 1RJ9A 2ATCA 2FLWA 1RHKA 4LHXA 1B6GA 4KWEA 4XM1A 1OXBB 4GYKA 1WCWA 3V7WA 2CXPA 3IIMA 4C06A 1UK8A 4Y2QA 5AMXA 3D6VA 2WMDA 3NOQA 4G1EB 2X8WA 1E4YA 4AICA 4O2AB 4EHFA 4U02A 1TKBA 4JXXA 1E5TA 3KVNA 4KVFA 5HX7A 3OE7A 2OHGA 5IBCA 4LFBB 1PHPA 1U1IA 5AVVA 3ADPA 4BEBA 3AKDA 2CLKB 3AF3A 1FUUA 1GPKA 1Z56C 4GR9A 3KZOA 3O8OB 4B6SA 4COKA 9ATCA 1W2WB 4R2IA 4R54A 1BROA 1HKUA 2PTGA 2VHXA 3RC2A 2C7QA 2WUEA 2Q45A 4Z7QB 1L4EA 2NSYA 3FSGD 3BQNB 4O4HF 4RACA 3NHLA 4X1KB 1XLTC 4L3WA 1DKUA 2Y92A 3FTCA 3L6CA 4CKBB 1KK1A 3SLGA 5A06A 3EIHA 3LQEA 1Z5UA 1TO2E 4WN9B 1M83A 2OGZA 1KU0A 1UJ2A 1V6SA 1R4MA 3K0HA 1VHOA 4X94A 1PP4A 4DLTA 2BVNA 3DAGA 4L4YA 4EJSA 3DDNA 1GUYA 2C5FA 4EUNA 5KQPA 4YMUA 3V4FA 1NYRA 2GPSA 3TSCA 3R7WB 1OBVA 1GG2A 2HO5A 1NVFA 3UAWA 1GNPA 4E5UA 1AJEA 2JL1A 2OHJA 4A6DA 2EWVA 2BHLA 3FCCA 4MARA 3P0RA 3U4MA 2YUIA 3EPJA 1PZGA 3HGMA 1NGSA 5HDBB 2P2LA 3IBFA 3IKTA 2A1IA 4RVFA 5IKMA 5ITWA 1CYEA 121PA 2OY0A 2Y1WA 3U37A 3VH2A 3T51B 5K3FA 3UEOA 4A6EA 3TFQA 4J4TA 1DC6A 2JFYA 3GLUA 1ZSYA 4L6CA 4ZC8A 4KR9A 5K0GA 1AUPA 3NOVA 4QDUA 4NAHA 5DMHA 3D3JA 4ZC1A 3WYBA 4UEQA 4WMLA 1NW6A 1NXOA 3OC0A 3NUQA 1U7PA 3IAS6 4Q9HA 3T56B 1IOVA 2PMBA 4GPBA 5FEMA 3TUIC 4CM4A 3LQRA 2ZZQA 2C7RA 3O92A 2GHQA 4HDCA 5DYWA 1N75A 2WJIA 1XVUA 3A0UA 1P7ZA 1U3CA 2ECOA 3N2ZB 1CUBA 4HQOA 3PB3A 5DISB 1E6EA 5BW8A 5C46F 2VNJA 4M1TA 1K75A 2R8XA 4Q21A 4X7FA 1ZAKA 2R4UA 4WNAA 5TF4A 3G85A 3ZEAA 1PDVA 2D7JA 4LSMA 5NULA 2I87A 3OLXA 5HSGA 1LRKA 4D45A 4QPZA 4FC7A 4RA6B 5T7BA 2HTEA 1T5OA 2NAPA 2Z1NA 3HABA 3KDSE 4LK3A 5KTOA 1E6UA 2IIPA 1CTQA 1MOSA 2W6PA 3C5EA 1GGHA 3M4ZA 2Q3LA 4DA7A 3NW9A 5JNVA 4QJBA 1QH8B 2XYQA 3BGOS 1P1JA 1XJCA 3OIWA 1WUIS 2JEZA 2ZITA 3IDFA 4I5DA 1SU8A 3GZTB 4ND7A 1UZAA 4UQOA 1U2DC 1N9ZA 3B82A 4QGBA 1OBCA 1LLDA 4PYMA 1L8XA 4WZ6A 3ASZA 2J0UB 2FZ4A 2JGIA 3Q7QA 1JQEA 1XCBA 1N6NA 2ZBQA 3Q9UA 3LW7A 5F2OA 5FOQA 4JLSA 1V1RB 3ZI0A 5EQTA 4R8SA 2PX3A 3T34A 1RYDA 3WGJA 1K98A 4R2KA 3WLMA 2FEKA 2HHAA 5ER9A 5CEFA 2HQRA 4V0NA 1JEDA 2QRQA 3EXIB 3IAFA 3MINA 4NPHA 1KXZA 3FSJX 3FVVA 2V7UA 1JB1A 3FCXA 3DH0A 3KHSA 2D1TA 2V4ZA 3GGPA 2ANCA 2VF8A 3WV4A 3BE4A 1IHUA 2EC5A 4DCNA 4EKNB 2QZJA 1E0SA 4ZVVA 4ZQBA 1EE9A 1VQNB 4YP0A 4LHYA 4M89A 3B38A 3RWOA 1I4EB 1KH2A 2ZANA 1ZW6A 1CEEA 4IUCS 4DBZA 2ZJYA 2CWWA 2FRDC 3O9VA 1JKIA 2BSXA 4X95A 1LBHA 3AONB 4CBVA 4LNAA 1E0KA 1IY1A 2G71A 2MSCB 4JOQA 3A8JA 3PHLA 4EKYA 4ALNA 1ZJWA 2CXNA 2PS1A 3BFXA 3HCBA 3LWDA 3G2MA 1QF9A 1GU0A 4IJMA 3T95A 4CN8A 1H94A 1YIAA 2J87A 3Q5EA 4U3JB 3GGDA 5ARCA 4DSAA 5JARA 5LQMA 1PTJA 5BSUA 1YJXA 4N1AA 4TLEA 1ABEA 3DVAA 2D74A 2UZ3A 1U9YA 2Q5EA 4JC5A 1DPFA 1QH9A 3OO0A 4RFVA 3H9BA 3KKEA 1YRHA 3SQLA 4OJKA 1BMTA 4R40A 4KFRA 3GH3A 2NYRA 4YUWA 1E3XA 4B3IA 3UGQA 1TEXA 3HY6A 4XQ9A 3X2SA 3UK1A 4ND2A 3L8FA 4N8SA 4HEA1 1NBAA 1RXUA 5ES4B 4GM1A 1TRKA 1S2OA 4NEHB 2XE6A 2JC3A 1CEQA 3CB2A 2QTVB 2VNHA 1PJ6A 4JDUA 4PCVA 2ZJ5A 3S40A 4C2UA 3M1AA 5FH9A 1P0PA 5CDGA 1T9CA 5KQLA 1C1XB 2X1LA 1QV7A 2E6KA 4R1NA 3SJAA 2OKCA 4BXOA 1Z4JA 3KG2A 3WNBA 5E4FA 2HBRA 1JG2A 2EBUA 1D07A 1CCWA 1FDVA 3O74A 1RLMA 2Q50A 4NG5A 5EAIA 2LPMA 1IONA 2NZ8A 3QFTA 3FHLA 5JS8A 2NSLA 2FY8A 2G5CA 1HFKA 2WILA 4LHSA 5JCOA 1QGOA 3UK2A 4LRSB 1V8DA 2JFBA 3T4PA 2WR8A 2JKVA 2HLNA 1UDXA 4BBZA 2I1QA 5EXEA 1JF8A 4UVHA 3RSSA 2Y0BA 3PIIA 4DRXA 3DVLA 1E2BA 1SBCA 3NTUA 5D3KA 2ONZA 3CMEB 2H1WA 1EE2A 2HIHA 2J4CA 1N3YA 3L06A 1ZR2A 2RGYA 4ZGNB 1NOKA 2BSAA 1NM5C 2ZYIA 4HH3C 4JYBA 3TMAA 3FLAA 1KZ9A 1H2XA 1UBSB 4GSYA 4C6TA 5U9CA 4D6PA 4J1TC 1WW8A 1VG0B 2FQXA 3ZDXB 3JQFC 1VQ7B 1JLLB 1YZHA 3Q8KA 3OP4A 4DUZB 3O7MA 2GLXA 2W6JA 3L4BA 2CFIA 1FU4A 1MAWA 3DXXA 3PGJA 1UEJA 1HE8B 2QTCA 2SCUB 3V8RA 4IV5A 3TZCA 5J4YA 1EYZA 4AROA 4R9NA 3W04A 3ER9A 5DW0A 3CTAA 1XXLA 2ZYHA 3KUUA 2JS7A 4HEHA 4X7BA 5E95A 1HM5A 4TKUA 1OPXA 4PPQA 2ZULA 4BKOA 4UTPA 3VO8A 4G1BA 3VZQA 4M1OA 5FBVB 4U0JA 4F9TA 4PFQA 1HDOA 4HWTA 2BPOA 1Q1ZA 1RZ3A 2PT5A 1JI3A 1YR2A 2B5VA 1SBHA 3S8MA 2NSJA 1QV6A 3M4YA 1LY1A 4MI6A 4RQTA 1DQRA 2YCBA 1P2SA 4Q03A 3T7TA 3N6VA 2GN9A 3ROGA 3EPHA 1SXJE 2FOLA 5EQDA 2FE4A 4BKMA 1T2AA 2QUAA 1YOVB 3ZXUB 1VPLA 3FZEA 4TV8A 1VOTA 1Y1QA 3K0EA 4FEYA 4ZAXA 4MUKA 3ZHCA 3KQHA 5FLXA 3FYUB 4WFKA 5F7JA 4DMUB 3P8ZA 4DT1B 4GF5A 3O93A 4QGHA 2XXBA 1DJPA 3PXDA 3IV9A 3ZJ4A 4BCCA 1B0ZA 3K1TA 3M6AA 5KJEA 5KNCH 4DV5B 3QF4A 1ZM3A 2AKAB 1VL5A 1BA3A 1J20A 2VBGA 5KVSA 1S02A 4NFYA 3EC2A 3AVTA 3J80A 2UZAA 2VNAA 1LA2A 3Q7IA 1DWUA 1JR4A 1I3OA 1Z2AA 2WU3A 5AOBA 3A27A 3VAAA 3U5ZB 3KSZO 2GUWA 5F52A 4BX8A 3LRXA 2WLSA 3MK31 2O3SA 1ZITA 1ZRHA 2WD7B 4MWZA 1QHNA 3RSLA 1S1CA 3B2QA 5AHXA 2W9XA 4JUBA 1BX0A 3CNLA 1L3CA 3CX7A 2P4QA 2VHTA 5CA1B 4TXJA 2BKAA 3EIEA 1LEHA 3EN0A 4D6XA 1OTXA 2IL1A 4ENUA 2QWXA 2RONA 4HUQB 1J8YF 1NW3A 3T61A 3ZLBA 5DHFA 1B43A 2WMOB 3MWFA 2CBGA 4E88A 1AT1A 4N12A 3KR2A 2AHOA 3UB2A 1DRVA 1QIGA 4K86A 4WCFB 3T5CA 3CXCB 3UM9A 2V0GA 2GJPA 4DHEA 2O1XA 5IKEA 1VLMA 4YRQA 3K71B 1D1TA 1DJOA 3STWA 5I8WA 4JITA 2BGRA 4D79A 2J07A 2OFPA 1V35A 3PJDA 4HMQA 2Q3HA 4OD0A 1MR3F 3FTQA 2F1JA 4UARA 3LUHA 4KKXB 3IP3A 4U7FA 4XOIA 2NT4A 3JWEA 1JZSA 3CKYA 2P4UA 4GECA 5H1YA 5C7YA 3OEYA 5IEJA 4GPD1 4YWJA 1O95C 1T9GS 4FT2A 3KEOA 4QVGA 1UPTA 1CQIA 3C4QA 3CH7A 5ERXA 1ESZA 4ZGWA 2OUKA 3AZOA 1NVKA 1DCFA 4EUHA 5C81A 3MTEA 1JNYA 2PIDA 1GAWA 2P0EA 3A2NA 3C8HA 4RTRA 4TMVA 3E8MA 3PF8A 3K20A 1W47A 4HAOA 3VX3A 3SR4A 3CMAB 3C7DB 3EC7A 3FDZB 5AVQA 1T8UA 4L6IA 2WOOA 3GEIA 3NASA 4YRIA 5DHAA 2D2FA 2DPGA 2IDKA 2I80A 3LBFA 3DEKA 5E3HA 4Z9AA 4GP7A 3GK3A 3TXAA 4KV7A 1QB7A 1YQEA 1FUKA 2C5BA 1T3TA 3VPAA 3DOUA 2EJUA 3P9IA 5IP5A 4XIFA 2Q6TA 3PD0A 4OBXA 4FLMA 5F98A 4P3KA 4R8KA 4OHBA 5ALEA 3X1MA 2JIQA 1K3UB 1H93A 4FDAA 2VAPA 3C1UA 4RKYA 4DIKA 4DUYB 2HSDA 1N2BA 1O0SA 1H6CA 3K8QA 3OU7A 2IUTA 1DFGA 1NVBA 2B34A 4CJXA 4PRLA 2ZL6A 1UZUA 2XDWA 3FB4A 3IO3A 1ISHA 1Q16A 2FETA 2QIOA 3O2NA 4XLFA 3FKJA 4FYPA 3GG2A 4MV8A 4F72A 2BN4A 4PC7A 1D2EA 2P6MA 4G8DA 4NE7A 1FSSA 1N2IA 4JCCA 4XB1A 1KOGA 1ZL0A 1KKLA 1FU7A 4A1OA 2EZTA 1DE0A 2BCEA 3PFHA 2QY9A 3BEOA 4PG8A 3GPBA 3KUCA 4E5KA 4Q4JA 1FP4A 2CVFA 3R3VA 2QTGA 3A9TA 5A9SB 3D8BA 2UVDA 3N8IA 1M6NA 5JD4A 5KNBA 4IQGA 1W5FA 4G65A 2WAMA 5CFOA 2M1XA 5CFZA 3ZJTA 3LUKA 2ZIVB 5CUQA 4RTJA 1OLUB 4PG6A 3A3KA 3FDFA 1S3IA 4MVJG 5EIWA 3MA0A 2P91A 1JHOA 4MNTA 5FUXA 3WWEA 5MGNA 3QXSA 3MCVA 1XZLA 3JQQA 1KSHA 2JJ8A 3EISA 2IPNA 5AVTA 1VRVA 4CCSA 5ANRB 4LY0A 4CHGA 4DKJA 4CCYB 2VQ6A 3G9QA 4RA9B 3RUPA 3NEYA 4JXKA 2GJ8A 2J9YB 5EINA 1E3SA 1RM5A 2O9JA 1E2GA 1XC7A 1ZMXA 4KO1S 4WESA 1II0A 3WK4A 1C3OA 4BOYA 4DDWA 5BV7A 4V24A 2NO4A 1QKJA 3WBKA 3IDSA 3AIOA 1UPFA 2VNKA 4P3YA 3O7WA 2AFIE 1A88A 2PTHA 2I2FA 3COYA 3N2LA 4RTPA 1RC8A 1XGKA 5ALWA 3D2LA 1G1MA 3AEQA 3NDJA 4G8CA 4UEJA 1XAGA 3U49A 1A9ZA 3DT8A 2Z95A 3Q39A 4K3VA 3F98A 3AJAA 4NV3A 3PX2A 4JP1A 1G21E 6NULA 3SHVA 4A73A 2RE8A 4E2XA 1V7CA 3ODGA 2E5WA 4M0MA 1WXWA 1G4AE 1T43A 5TMBA 4FEAA 4BMZA 3SZGA 3U7IA 821PA 2D1YA 3P2OA 2ZJZA 3RWMB 3AGPA 1PBNA 3ZZ0A 1U9IA 3GAMA 2VRCD 2ZZNA 3Q2KA 2ECQA 1KYWA 1LPBB 4TLCA 4IDEA 3KQNA 4A2CA 2CFCA 4R0NA 4CEJB 2VXOA 1YZ3A 2Y68A 2WPNA 3C1OA 4LKRA 5JZSA 2FLVA 2REQB 2VVTA 4J0HA 1VIVA 5BMVA 2QPAA 2ZZEA 4OI4A 4BZQA 4BX9A 3U80A 4F91B 2CWDA 3EC1A 5IDYA 3R7FA 2EIXA 3IO5A 2HMUA 4HE5A 1PDOA 4NCHA 3Q6NA 1NBWB 2A67A 2VBIA 4AN4A 2HJ9A 5B6JA 2WIGA 4G67A 4BQSA 3UQYS 5FI5A 2RGGA 5IM4F 5ALPA 4TWJA 2Y6VA 1JIVA 3EFEA 3DB1A 1OAAA 2CZQA 2AOUA 2X8JA 1ZNXA 3B1KA 4OAOA 3N87A 2CB0A 1CUCA 2DSNA 1B23P 1D9XA 3EW7A 4XGNA 3MFYA 2NQ2C 4K1LA 3T12A 4D9FA 3D3QA 3TLZA 4Z2AA 5LZ9A 2XHZA 4Z1OA 1VJRA 4TN1A 3FETA 4EI8A 4TMTA 3G6WA 4KOAA 4OSPA 4RCYA 4W5TA 1HTWA 3AETB 4UM9D 4O4JB 2EQAA 2YRFA 4BLSA 1ZONA 3AY6A 5TSDA 4I1YA 1V16B 1J8MF 5I4CA 1CR6A 2YINC 2Z2XA 4PZCA 2X4GA 3AM5A 1JDTA 2OGUA 4MQ6A 3GHHA 3TAXA 4FLEA 1A8QA 2FZEA 3AYZB 2NPIA 4DNQA 2WUFA 2IEAA 3CU5A 5JXGA 2C96A 4M21A 5KB3A 1LGYA 4HNGA 2CE2X 3B6ZA 3OQ6A 5ESWA 1LWNA 3ORFA 5H0IA 4IVQA 3C8UA 4TKMA 4CG2A 1BLIA 2JAHA 1J8DA 5B1DA 5I9NA 2BY4A 1GVHA 2CFSA 2FWRA 1P81A 3QUAA 1EVZA 2H57A 4JH0A 3ESCA 4HGQA 5H83A 4D97A 3DE1X 4CMJA 3EZ7A 3ZHOA 1FQJA 4RHUA 1YE8A 1WAMA 4J76A 1EB8A 3ILXA 5IYQA 2ZYWX 2QJTA 2ZWPA 2RGNA 4KTVE 1KTIA 5FOSA 2NSHA 1JFFA 1MO6A 1GR0A 1ZM7A 1W2HA 2FN8A 2VH1A 4RESA 3U4DA 2OZPA 3CPSA 3WQBA 4LXUA 1NA5A 4BP3A 2VYCA 5TXGA 5HZMA 2DM6A 5DI9A 5HYVA 4M0KA 4UZFA 3IRVA 2ZT7A 3LTEA 3JQCA 4KK4A 1SQ0A 3DPSA 3F3KA 2VNIA 5JXIA 4BO1A 2D3LA 2F00A 3C48A 4JU9A 3NHSA 3GD5A 3OP1A 1U65A 3CPJB 4H31A 1ZUNA 4L8LA 5BVHA 1PQPA 5EE3A 2V7EA 3M5DA 4IUYA 1X7YB 1ZNZA 4Y7CA 4MQ5A 2BTOA 4FOPA 4QYTA 4DJFC 1EFPB 4RF5A 3QU2A 5H3CA 2NUPB 2M6KA 3DBRB 2PANA 4DDVA 1OUMA 3CVYA 3EDCA 4FE7A 1FA9A 1QUEA 3TKLA 3OQBA 4BNGA 2NV6A 4NQRA 4DMRA 1T4CB 5JHGB 2E2WA 4C4YA 1MP0A 2YWBA 1TTPB 2VAWA 3O21A 5AKGA 5BWLA 2FEOA 4CKWB 1DO8A 4JP2A 4LHWA 1XEXA 2EWMA 4DCPA 1L5HB 5AJUA 3HN2A 4FW8A 3EJWA 1ZGAA 3OTHA 3R3UA 1T8TA 2NIPA 5AKHA 5JMOA 4YMTA 1J07A 2RGUA 1RQRA 2VHJA 1H1LB 3ICVA 4N9QA 5CAEA 2X7XA 3VZSA 1UMBA 1YAJA 3KK0A 4KK3A 2J7PD 3I32A 3STUA 5C8DA 3QM1A 5LXTB 1I2MA 4P1ZA 4D3ZA 5TQJA 4BL5A 1ESDA 2B35A 3KYIB 2XA2A 3QBEA 3WK7A 2D1SA 2YS6A 3M89A 5ALQA 1W581 2B7LA 5IHPA 3NAQA 2YNMC 3F0TA 2QAJA 1GIAA 1PJQA 3DZKA 4QT0A 1NPTO 2X0FA 4M1SA 1G2PA 3MMPA 4RPLA 2CHEA 3U3RA 4ESEA 3WI7A 4QQRA 2FPWA 2BFPA 5AVUA 4H1TA 3HHPA 3TYXA 1Q81D 2CUTA 1EFRD 4GMDA 4YGXB 4A6PA 4I08A 2OBSA 5IWAB 4AYTA 3HZZA 1DC4A 4XFDA 1Z47A 3RE1A 3TQSA 2HGZA 3Q11A 3OG9A 4JIMA 3RUHA 4MR8A 4AZWA 3WLKX 4HRVA 3AEKB 1F6DA 1U7UA 4G5SA 2X76A 2HMVA 5CGQB 1UZNA 4Q6WA 5CVJA 2H63A 4W9MC 3ROKA 5HP4A 5KKAA 3FPFA 3BFPA 1DAKA 1Z68A 2IPMA 2WU1A 1U8ZA 3H17A 2P5TB 3WL7A 2O8BB 1EHCA 5IC5A 4CEIB 3O73A 1SXJB 3MC1A 3SIWA 1PR4A 4UFNA 4EMUA 5JBNA 4FD3A 2ZRQA 1E3LA 1JNXX 2BBWA 4KQ2A 2F1IA 4QQ8A 3RC7A 1YI2B 2ESRA 3S5JA 2ZOSA 3NVDA 2Z9DA 1E0JA 1Q15A 4EELA 5FJJA 3PNYA 4INPA 2RJ3A 1TM5E 1B73A 2FFAA 1Y5LA 2GNAA 3HP1A 1TK2A 2X9QA 2IHZA 5TEVA 2K7ZA 3RT7A 3LC0A 5ALYA 1RLJA 1QC5B 3U09A 3CW2A 5F7XA 4C3VA 5JWHA 1GDHA 2G4VA 3G0CA 2ZVJA 3ZYZA 1HE2A 4H3SA 1NXVA 3A4LA 2CCGA 4O2LA 1E4OA 4CLRA 4W5QA 5JBQA 1N5MA 3HSSA 1U7ZA 4QLBA 2G0NA 3MGAA 5HFJA 1MB3A 1AV6A 3HP4A 5K51A 5IAAA 1TAHA 3EWAA 4M8SA 3NB0A 3GUZA 4HNTA 2W7TA 3F6YA 4AQ7A 1FMLA 4N4AA 3M9XA 3N3BC 3OHMA 4EY5A 3NM4A 2F1LA 3TRJA 1IRIA 1KSFX 1KOLA 4YPOA 4ZZ1A 3HWRA 4O4LB 1V1MB 2QY6A 1RWWA 1PLJA 3B13B 3FUWA 3BZUA 2X2EA 3D8NA 1V9CA 2YIDA 1YFLA 2UZ1B 4PLZA 1L9XA 1PV4A 5AICA 2HDWA 3C6MA 4XOUA 1W9XA 4J29A 1O08A 2P2SA 4EPRA 2WSIA 5B58T 4RTKA 4YJFB 4DGQA 3KVYA 4LDPA 1ISMA 3OKXA 3EXEA 4P83A 4C3ZA 2VCEA 5JYBA 1L5GB 1OTYA 3W6PA 5BUZA 3MYRA 2Z6UA 3ST7A 3IAS1 2NVWA 4CG3A 2UU9B 1KRHA 1LD3A 1M33A 3KEGA 4DIFA 4MITA 4XX1A 3NM5A 1ZCJA 4OU5A 4CYMA 2NP6A 4F3TA 2WD8A 4H1HA 4XXHA 1HDRA 3HLKA 4TZTA 3UXYA 2GTPA 1GGJA 3AJ9A 1YZUA 4HZUA 4MJXA 1QX3A 3K05A 3PDIB 2OZVA 3QWBA 4N7BA 5EE5B 3N8HA 3TCKA 3AESB 4WDQA 3WYAA 2HLDD 1JQDA 3HKBB 1WHTA 4UJ3A 2WA2A 2WE7A 4XWKA 1NVXQ 3D3KA 2C98A 3OY7A 1V0EA 1KI2A 1CWUA 3HB1A 2C04A 1HMPA 1MAVA 1EGAA 1P2VA 1S8FA 1XQYA 3TNYA 3C3AA 2JLQA 4UNPA 5BW6B 2UYOA 3URMA 1OZ0A 1XZQA 4W1RA 4XSHA 4Y3UA 2IIBA 3QZUA 2YWGA 4HN4B 1YTUA 4RFLA 5FHRA 1FFEA 1QPBA 4QKQA 4HRAA 4UM5A 3WNCA 2GPBA 4HRYA 1H42A 2YHUA 4OHRA 3PRKE 4DABA 4DJAA 3TR6A 4FKBA 3GEEA 3WLIA 4ZHQB 5JTUA 1CQXA 2XQVA 5K0EA 3FYSA 5DNWA 1KIFA 3BRSA 2NXCA 3P4YA 4PGFA 1DQNA 5KO2A 2NVUB 5K8LA 4BCBA 2QG4A 1HDIA 4OQMA 4LXTA 1WLYA 1G3UA 5HIJA 3HRHA 4CUZA 1FS4A 1C30B 3J81k 3H99A 4RBNA 3BF8A 1EUQA 2QU7A 3EWIA 1LU9A 4WY5A 3K72B 2WYWA 4R1LA 3ICEA 2CJWB 1YBAA 2JW5A 3TLBA 3V00A 4E14A 5LJIA 1QGZA 4FEGA 4H7DA 2FVYA 2GARA 1VHDA 4PRKA 1N2OA 1P8JA 2A30A 2E3JA 1WMDA 3TPCA 3HO6A 5A4AA 4IMJB 4JI3B 3KYCA 1NN5A 3MCUA 1T2NA 4LDQA 3L1UA 2EW2A 5ED0A 4JVNA 1JT9A 3ISXA 1ZEMA 2ETXA 3EK2A 4RF3A 4RV5A 4FGZA 1YH3A 4M8IA 1ISGA 1U3FA 5A4JA 2B30A 4G85A 3FB1A 1ZNQO 1EM6A 2EU8A 3EEFA 3H2KA 1SKAA 2V7WA 2EGHA 2JEYA 2YVAA 3ABQB 2XAAA 2FV8A 3H9NA 4M37A 1JX6A 3AJDA 4ND4A 1N7HA 1R74A 3IKJA 2GX6A 4L8FA 3C14C 2FRVA 4R51A 4KE7A 4G5QA 5H80A 2D0OB 2PUCA 3Q3CA 2VP2A 4GOJA 1YR1A 5B36A 3AIKA 5AKZA 3SU8A 4KSCA 2ZWMA 3EOBI 3LQFA 2CW5A 3REOA 3PQ8A 3EMVA 3QKSB 4F7WA 1OV4A 2J9FA 1OB5A 4HEJA 2IY9A 3TLJA 5C8VA 4FYYA 2VJCA 1NZDA 4P2BA 4COOA 1HNNA 5CYPA 1NI5A 1PJ5A 4KMOA 4MKHA 2BMJA 3SHTA 3MTGA 4XGIA 3GVJA 3JWIA 4BO4A 1XDSA 3GNTA 2NU8A 1K0UA 2AFIB 2WHPA 1BXRA 4ETIA 3JVIA 3CESA 1QR6A 1RCFA 3DZJA 2B21A 3O84A 4GFDA 3SQDA 2QLLA 2MDTA 2JFXA 3BX1A 3NETA 3URKA 2EXXA 2Z4SA 2XDAA 2XBLA 4UFOA 1U0BB 2E7ZA 2VSNA 1G21B 2BH9A 5BMVF 4OHFA 1ELOA 1XZGA 1E58A 1IOWA 3MVEA 4DG5A 3WO1A 4YJ3B 4AF8A 1UKYA 4CKEB 1D2HA 2G8NA 4GMKA 1YACA 2Q7DA 1XTPA 2EDCA 4O4IA 3TZKA 3QFSA 1QZTA 1XP5A 3M8KA 2KB0A 4XWTA 3H7IA 3W1EA 1QKIA 3A1EA 4RF4A 1NB9A 2BTEA 2BTQB 2PCJA 2CFTA 3AKZA 1MDBA 2ICAA 2QTRA 3CCMB 3HLYA 5DLEA 4LJ7A 5ITZA 1TLLA 3CUKA 5FA8A 5FTKA 1QPZA 3TVYA 5DN9A 1AK2A 3OEED 2JCXA 5AXCA 2A7QA 1M0EA 4GKAA 2XMBA 3AR2A 4G36A 1CQPA 5A4KA 4RHYA 3DAOA 4ZCQA 4V0SA 3GRYA 4D8VA 3IQDB 5DOZA 5DLQC 2VQSA 4LNHA 4RPGA 4ETMA 1JHYA 1T9BA 4QHYA 3TJZA 3CEHA 4DARA 3R20A 2WQ6A 3D4IA 3F6PA 2Y1OA 3UUEA 1J33A 4MGZR 2G9VA 2K4MA 4XM2A 4J7AA 3ZWBA 3QXGA 5A0FA 5KOJB 1FLDA 4PZAA 3E8SA 1QO0A 4D0SA 1JZQA 2Y0PA 1EUYA 4ZDJA 3W6NA 1JSZA 2JH8A 1E6LA 4UNNA 3OOWA 1GA4A 3B3QA 3X1DA 4NZ9A 3FPPA 2JGMA 2AZTA 3FYUC 1JHXA 4PCUA 4GQAA 4HX2A 1C4WA 1TQHA 1JGTA 2OA0A 5C4IA 5HRCA 2JLWA 3ZPNA 3C3PA 3WGMA 4D3FA 4Q47A 1GZ5A 5I9BA 3HCRA 4KXXA 1SCIA 1FFHA 4GLLA 4MO2A 2BFFB 3VH4A 3GVIA 1IEQA 2P7HA 1USVA 4HNRA 3O4JA 2BE7A 1WZIA 5DNAA 4BEWA 4ITRC 5J63A 3FPHA 3KOXA 2JAWA 1XZFA 4P4UA 4CUKA 1X87A 1Y1TA 4ENWA 4Q16A 3RIYA 2WABA 2JCYA 5F9HA 2Z57A 4M9SA 1EA5A 1XNJA 4AVZA 3OPVA 4BNFA 1ITZA 3DE4X 2RARA 4HN9A 4IWXA 4P4GA 3K9GA 2B8TA 1I7NA 2FN3A 3BT7A 1JIUA 3IHWA 4B3BA 4DQ0A 1GO2A 1PGNA 4R6XA 2L19A 3RS5A 1KL7A 2VXYA 3H5LA 4MP6A 5A3SA 4CLOA 3GJXC 1IBLB 2A78A 1I9CA 4N8EA 5FL7D 3D3WA 4FHFA 4QPDA 2BGLA 2ZSIA 3OIDA 2NZJA 1CV2A 4RADA 5CURA 2IU4A 1QMGA 3FYDA 1NT2A 3ITEA 2EZ8A 3IUYA 4XIJA 3KWJA 2CDBA 4UD2A 4ZXFA 2ISQA 3ND8A 2H54A 2ZJOA 2O8FA 3HJTA 1NBIA 3GZ4A 4EUEA 4DIMA 2P0AA 2QGGA 3DLHA 4CWAA 3M83A 3KL2A 3B78A 3V7UA 4Y6RA 1BWRA 3D54D 2O52A 1FZTA 2COUA 4NCIA 4BLTA 3IILA 1IAVA 3GDFA 3VO9A 1FFXB 1J22A 1VXOA 5IYRA 2GEBA 1HTTA 4G4SP 2QPOA 4AP5A 1QNFA 1MA3A 1W5TA 4XD7D 1RRFA 2PH7A 3ND9A 3TQCA 1K7CA 2QSYA 3W3AD 1F8GA 2HRZA 1R4NA 3IOEA 4M1YA 4NHOA 4AUMA 5CT6A 4ZVQA 5B3LA 2XNHA 5FBQB 1WF3A 3ZHQA 2QD5A 1VA4A 1RHMA 5JZBA 2O5RA 1EQUA 1V5GA 1A8HA 3E5HA 1XKLA 1TO6A 4GVLA 4JBHA 3ZW9A 4EDFA 3FJ1A 3HJAA 2JKZA 1JBQA 4YJHB 4PWYA 4JI6B 2O2ZA 1P9RA 3HKCA 4AD8A 3K5PA 4MB2A 2POQX 2R9VA 1E7QA 3IVMA 3NWBA 3HHEA 1WXXA 3WJAA 3ZE1B 1CKEA 4BKRA 4L07A 3PD1A 1X38A 5TJHA 3UAYA 2DR0A 2JFHA 2Y2VA 4TV9F 3W9UA 4BNDA 3OQJA 4PO3X 2ENWA 5TR9A 4NOKA 5ALVA 4OOVA 1PQWA 6ABPA 2DB3A 3EFHA 3MN1A 3ULKA 5F1PA 4UMDA 3D5EA 3KX2A 5A5DA 1IMJA 5DX1A 1GQSA 3PA1A 2C61A 2J9GA 2PUWA 4IL5A 5AK4A 2PZMA 3QLVA 1RYFA 1UQRA 3F6RA 2TECE 3H11A 3MLBA 3WWPA 5JVDA 1W9HA 2PU5A 3Q5DA 1Z8HA 5JJBA 1ZH4A 1RPTA 4YP9A 4W1QA 4KXVA 2UUCB 3K1AB 3BEDA 3T3EA 3GFBA 1MOQA 5DLYA 3P19A 4C21A 3E23A 4HDMA 3RYCB 4Z4HA 2R7LA 3UGTA 4EAAA 4S0ZA 3AMVA 5AI0A 5FJIA 4CMEA 1CVLA 1JLRA 1GFSA 2C1ZA 2AT1A 2C4HA 2IHTA 3VNQA 4ALMA 1MO4A 4QBGB 1DHRA 3NHZA 3EAQA 1Q83A 4UNQA 5EJFA 4A23A 4LVCA 4W4TA 4BVGA 4Z4EA 3TDKA 2G1JA 2RHJA 1GRRA 2YC2C 4DUPA 3DBVO 3LQ2A 4OQYA 4FI3F 3A6DA 3IBYA 2YCLA 3ZNOA 4EP1A 1O7JA 2GLTA 5D3MB 4R16A 4LZJA 3WSVA 5C4MA 1XJWA 2HRQA 3PPWA 1KQNA 1NRWA 1O1YA 4WA8A 2H5LA 4ZOBA 4DPLA 2CD9A 3DKKA 3AF5A 3GEGA 3O8LA 3PFGA 5E4YA 4F5YA 3GJTA 3TNFA 3Q12A 1RSZA 1X15A 2C0QA 4I3HA 1BE6A 1HEUA 3AF2A 1L1FA 2EHJA 3BQ9A 3QPAA 4ACBA 2DBZA 3SYNA 4KQJA 3V8MA 3LPMA 1J2TA 3TX2A 3WLHA 1SJ9A 4YUYA 7REQA 1Z8NA 2M98A 1NP7A 4Q48A 1UINA 1V5EA 2D1QA 4A0HA 4AZ3A 4X7EA 1NJSA 4MVJF 5FAXA 3K96A 1IPEA 1PJ4A 1TIPA 4G56A 1V41E 3A3BA 2GVZC 1PFVA 2HRBA 2I2DA 1AXRA 1TW2A 3PC8C 3TDMA 4DXDA 3RK0A 2EBHX 3QF7A 2OTLB 3SP1A 3K70B 1T5BA 3ZU5A 1GV1A 1MH9A 2ERCA 2HUPA 1RE1A 5F64A 3T8YA 2RBEA 3ZGXA 3L0OA 3W77A 3NAMA 5F12A 221PA 1PX2A 5B2FA 4OUDA 1SOMA 3ZU2A 1ZW1A 4J2HA 2QMHA 4FVTA 4OXIA 3OE7D 5HF9A 5CJ2A 1M2NA 4NICA 5FNVB 5IARA 2IWHA 3TR5A 2B78A 2Y1XA 3UMCA 4O2AF 4C3UA 3R3XA 4J0FA 1D4FA 5JQGB 3FF4A 3JQAA 5KYXB 2ZJAA 1W94A 4XM0A 1MJHA 1I6WA 2H2FA 2ZE5A 1E3DA 1KS2A 4PGMA 1HOXA 4QU9A 5CXSA 3SF8A 2WTAA 2SNIE 1Y4SA 3G02A 4KWCA 2Z5FA 3RU9A 4BVEA 1ZI8A 1HT3A 4XH9B 4E2FA 3TGLA 1XZDA 2G04A 2OVFA 2VCHA 5KYWB 1VCMA 3V1YA 3EVEA 2XNJA 2DG2A 3G49A 4YMSA 3AIIA 3AUKA 3FFXA 3CEPB 1AV7A 1A96A 4Y6OA 4FCWA 4MVWA 4IFTA 1GITA 4IDOA 3W8DA 1TADA 1H66A 3EQ7A 1VMIA 3RVOA 3QTBA 2J5BA 3UUFA 2O59A 4Q34A 5J2UF 4YLGA 5EJAA 2ZIEA 1YJ5A 2FVGA 4AWAA 5HA5A 1M2WA 1P2TA 2EP5A 2GBLA 2BFCB 1E6KA 2SICE 2FSSA 1T36A 2GVNA 1FFCA 3ZBPA 4A0FA 2XF2A 1Z37A 4MGIR 2QX8A 3IUJA 3MYYA 4EUKA 2OMEA 5JC1A 4MDEA 1V11B 3RAJA 2GHTA 2WTXA 2HADA 4LDAA 3H5NA 1JSLA 1OA1A 2OK8A 3LT1A 3N5CA 1XRRA 3G2LA 4P7KA 4B4UA 3JS5A 4TTTS 4BVKA 3RBAA 1FFYA 2GZ3A 2EEPA 4EG0A 5HCIA 1ONNA 1XHFA 1L5KA 2YWXA 3A1SA 1MN6A 3MPOA 4HL6A 5HQTA 2JGDA 2Q5LA 3EDQA 4ZQIA 3VKWA 3HSYA 4Z8XA 4OB7A 1IN6A 1E3WA 1FXWA 2KLHA 2OBYA 3RJZA 5BSWA 4Q3AA 5LPNA 3GJ3A 1HT2E 4W7HA 2PWYA 2I4RA 4PAWA 2H1OA 1SIWA 1D6MA 3QW4B 2WQ7A 3U17A 3OJ0A 3ERCA 3A4YA 3IS3A 2AN3A 1JMYA 1VE7A 3UXMA 3D6FA 3KAJA 3LDUA 4DL9A 3X1JA 3L6UA 4FR2A 5FWDA 1KMMA 3V6MA 2RB4A 3DA8A 2PBZA 1W6RA 4FW9A 2GBIA 4PBSA 4OMFG 4YQZA 3LNCA 1NJ1A 5G0TA 4HDKA 1PUIA 2CNWA 4F3CA 5EKUA 2FHSA 2FDCA 2SKEA 4L5AA 4UBMA 4URVR 3C3DA 5ILGA 4N41A 1L5FA 2HDOA 1ZQ1A 3AW9A 3OQIB 3WK6A 4BC0A 4CV2A 4F6RB 1MZVA 5EHZA 2YY7A 2L0XA 3E3AA 1WOPA 3OZRA 5IBRA 3ZOZA 1CY2A 1IXKA 3M9LA 4OJYA 1YK0A 2WB2A 2R97A 5U4QA 2GKSA 2Y99A 3LOQA 1NP3A 4LHEA 1W48A 1RQ7A 1WS6A 4QNMA 4E6PA 3I39X 2Z08A 4PO1A 2E5FA 3WMRA 3W4KA 3NCHA 1EIWA 4OQFA 1HQKA 4TXLA 1OY1A 4H17A 4CFYA 2P67A 1XQVA 1M10A 1M34E 3RPEA 2JFUA 4F71A 2FH5B 2WAYA 5F5LA 5GWXA 4CMKA 4MQLA 3H8WA 4XM3A 1B3RA 3KTOA 2FPMA 1ZS9A 2WFLB 1TDJA 1KPGA 2ABWA 3BWYA 4I1RA 2Q5CA 1KGSA 4M0PA 4QRIA 4WW0A 3K7EA 1N05A 1T8PA 1B74A 2FCRA 2PGLA 2ZRFA 1PD1A 1JBEA 2BJHA 1KZHA 4KIUA 1CZHA 2XI4A 4NCXA 1BXGB 2EF1A 1SRRA 2JGLA 1YUBA 1SH7A 3IPRA 3OWXA 3OPYB 5IAOA 1UBMS 2GR9A 4Z3DA 5JADA 5FWYB 3HR4A 2OXCA 2ETVA 3L7DA 4N48A 4AZ0B 1DDGA 1REQB 3PR2B 3GLRA 4D3YA 3M6WA 3KZCA 2C9OA 2E87A 4BV2A 2C8JA 2ZRHA 1EGQA 3Q7TA 4RSRA 1P45A 3UVEA 5JATA 1FBTA 3OPYI 1W46A 3GGGA 2FW0A 3TVTA 4DMHA 5EG5A 4EG6A 4F9GA 4YT5A 4Z4QA 3CF2A 4WZZA 3E7DA 4MWEA 1V95A 4O2BB 5D8DA 1LPMA 1VKHA 1OLSA 4U7HA 4WZEA 3J7TA 4PLYA 1SBZA 5DGDA 1S9DA 3AEUA 2C4VA 4HDRA 1KTVA 4EW2A 3AF6A 2GBCA 1BRTA 2NU6A 3L8DA 4QULA 3L8GA 2VZLA 1XTBA 1T2VA 2W83A 2HMTA 2WB4A 3H0CA 4ZCPA 1BKSB 1H3FA 4ZQCB 5T4FA 5JWRA 2Z0MA 4UM7A 2DQ4A 4R8VA 3U7QB 3U9LA 4BRWA 3MILA 2COKA 3A9SA 4BU0A 3ZQJA 1GSAA 1N7GA 1I10A 5BRAA 5CYGA 2QLBA 4DSOA 1Z88A 1P0CA 2GERA 1E9RA 3QUBA 5LQSA 3WP0A 4AM8A 4EOGA 4DR2B 2W4QA 1ZD1A 3GPDG 3H9GA 1X7ZA 4W6QA 4C2TA 2JJQA 3LPAA 3BWEA 2PLWA 1WPRA 1X3SA 3V1KA 1HZEA 1Z35A 4MCAA 3WLFA 3FOAA 1SHJA 4HTAA 2BFOA 3AJRA 3DO5A 3K4QA 3QEMB 2W2KA 2R6HA 2Y4OA 1C4KA 2BGKA 3TVDA 3OETA 3LFHA 2E4WA 2MSDB 5AW0A 5IASA 2X1HA 2HDNB 4A92A 4F4HA 1M6YA 4BB9A 4KPYA 1UPBA 3FUXA 3PXXA 3O75A 3QX3A 5F5NA 1KE2A 1LQUA 5JCJA 4AJIA 2BKLA 5LA6B 5C8YF 2FLKA 2HHJA 3VC7A 4AIIA 4DKXA 3JWGA 3AI2A 4ES6A 2H9AA 4CUJA 5EIEA 2H1CA 1WJGA 1S3GA 5JMTA 1VQ1A 3QWIA 5LP6B 2PXXA 5JAMA 3U6BA 2B37A 4P9SA 5FB3A 4CIXA 2VIIA 2WKPA 1TZ2A 2FG5A 4IFIA 2EJCA 2BMEA 2R8BA 3K92A 4XKJA 4BNXA 1BJRE 3F1KA 4NYMQ 2EBFX 1IM2A 3BY2A 1E7WA 2JFQA 3LDAA 1SXJC 5G2OA 4DWOA 5IUKC 1SK9A 3OE4A 2ID4A 2ZRPA 4JAVC 4H4DA 4LKOA 4HT3B 2H2GA 1XZ8A 4NE2A 1WMAA 1XZCA 3IULA 3UAVA 1R6VA 1OAOA 3AM1A 3D6UA 4P86A 3Q1KA 1NJGA 1EESA 4CQNA 4Q37A 1FYDA 3G6EB 1OCEA 4DZZA 1Z75A 2IZ0A 5GGXA 5LQKA 5DHUA 4LECA 3AVUA 1EVIA 3MUNA 2HOQA 4BAUA 2VQFB 2W6JD 4JMPA 1RI2A 2HEIA 3DV0A 2I6TA 1DEOA 1ODSA 2P78A 4QYWA 1O6BA 2VZEA 4CV1A 1CDOA 2NT3A 4ITUA 3QUCA 3DHWC 4XCQA 3PGXA 1QS0A 4F2HA 1DI0A 3DZ8A 4F12A 3N0WA 2CDRA 4ZEVA 2XLBA 1WSWA 4QYSA 3PDHA 2QP3A 1AC5A 1KH1A 2I4OA 3LK7A 1ZM9A 4N3GA 2XUZA 3UJDA 3E9DA 4EYQA 1JEOA 1OTHA 3IURA 3VISA 5A1TA 5A62A 1SUEA 2IT1A 3KJHA 2B4YA 5IBPA 1EI9A 5FNZA 1H2BA 1KEWA 1UADA 2PT6A 2B0JA 3MSXA 2D59A 2J5XA 3SKYA 2P9BA 3SG0A 2HR1A 2G4CA 4J3FA 5M2QA 4W9NA 5KSYA 3A06A 1ADYA 4G1VA 1N2SA 4B83A 4GXRA 1YIJB 2VSFA 4A8HA 4IIGA 2RK3A 4TMZA 3W6UA 3K0CC 2H48A 1R5JA 3UHAA 4AQYB 2GDJA 1GZ7A 1EXMA 4QJ3A 3O3MB 2JIDA 4QXRA 1IHMA 2QD1A 5PNTA 1MNQA 4BVFA 5I7RA 1OB2A 1AGXA 1NB0A 3PXCX 2QLJA 1MFZA 3I56B 3N07A 1WCIA 1A9SA 4B81A 3P9RA 3CX4A 4KBYA 4CM8A 2QUZA 2JLVA 1UFOA 2WJ6A 1FTSA 2W2XA 1Y3FE 3C15C 4RV4A 3NU1A 4DQDA 5MGBA 2VF2A 4C4TA 2GUGA 3U44A 4YAIA 2JANA 2R60A 4D57A 3NTOA 3ASQA 2EFEB 1T8WA 1PGPA 4ALLA 2XNCA 2ZUTA 2OLJA 1T9HA 3OURA 1PX0A 3NKFA 4INAA 4BMSA 1AQJA 1Y9DA 3U56A 1VJCA 2V4DA 3VSAA 3NONA 2G06A 3EG9B 3QSGA 4C4ZA 2Y2UA 3AZQA 5JFTA 2A9QA 2M32A 3HCPA 2QV0A 3PJEA 5DP2A 5P21A 3WGQA 1NW9B 3EY4A 4W9RA 1VQOB 1R66A 2X5KO 3H9CA 3UAZA 2YMLA 5M7EA 5L3SA 4K6FA 4RDHA 4QXOA 2WJAA 4ENVA 3NLLA 2RBKA 3FA2A 4GNKA 4BJ3A 4YRPA 4UUPA 2H6EA 3D1JA 4CGZA 1PL0A 3L92A 3MGCA 1HNWB 2OK7A 1WY5A 4DOMA 5DO9A 2W00A 2DUNA 4I4CA 1NYLA 1KVTA 4QXPA 3GLFB 1CDDA 1P33A 2Y05A 3CJQA 2PM8A 4MPTA 2QSJA 4DEXA 1XKQA 1YFJA 4CDMA 5EP3A 1VGVA 4OHWA 1G59A 4AC9A 3F4LA 5JS7A 1XD9A 3N8KA 3TTWA 1E3IA 3T3OA 3AO0B 4POAA 2W2LA 2VT2A 1ZBQA 3MS2A 1VG8A 3H1BA 3KAPA 2C5GA 1LJUA 4I9FA 1L5ZA 5J40A 3HBMA 2I3AA 2AZDA 3QU5A 1XLTA 3NAZA 4K40A 3AERA 4QUBA 4RFSB 5KVAA 5L6LB 5MN5A 2AEFA 1G8SA 4A9AA 5AW3A 1MIHA 4UBLA 1WXHA 1CRQA 4IX9A 3T1YB 5KVCA 1R88A 1Z0DA 2PZKA 2Y9MB 1E2EA 4BFCA 3VPDA 5BSKA 1ZX1A 4IDBA 1NPDA 5BSEA 4HAYA 4YI5A 4ENRA 1H85A 4FS3A 4FX5A 4P58A 1VLHA 1QSGA 2NQ8A 4AT1A 4PO8A 1ZYUA 2VBVA 5IJZA 4JI7B 2KJQA 2F3RA 3H04A 4F4IA 1HDZA 4RCVA 2OBNA 4XB2A 4XKVA 5P8WA 1NIPA 2AMLA 5T5QA 2BEUB 5JROA 1QLHA 3DHEA 4D8YA 5ERGB 3QKRB 4MWSA 4X06A 3AP3A 4HTFB 3ROTA 4P5DA 1KJNA 1Y8CA 4TZ6A 2FTKE 1IEVA 2H5IA 1V3VA 1XMJA 2ZJFA 3RVBA 4X7DA 4XPIA 1PLKA 4E5DA 4F5DA 3OZAA 3R0JA 4XL9A 1VYUA 3LG2A 4LA4A 3T53B 3RWBA 2YWJA 3DP7A 2AG0A 1NKTA 1CYDA 1A5TA 2O0KA 2PBRA 4J0CA 4HE6A 2F43B 3GDOA 1D5WA 4NCAA 2BOVA 4K1XA 2XV1A 4BP8A 5CTAA 2DVMA 3LSYA 1XG5A 2KM1A 2W93A 1JHRA 4AY3A 1YDGA 1XDZA 1GUZA 3DAYA 3L0DA 1Z28A 1LSUA 1GLNA 4HN2A 4TTJA 1G6OA 3LVRE 1EDOA 2BEJA 2O3TA 4C29A 3FRJA 1W25A 4EX7A 1LJ8A 2ZVPX 1ORWA 3AVOA 5LOVF 2VJDA 2VJJA 2VN8A 1GNSA 3QVJA 1A27A 2CLHB 2VDQB 1N2XA 3F5FA 3PA8A 3PV0A 4UE3S 5JJCA 3RFXA 5KNBD 2L69A 5KPDA 4U6SA 1ZCFA 4D44A 4G5RA 2Q5HA 2AI2A 4P22A 1AZWA 1MQAA 4JL5A 3WG9A 2BUBA 1YB7A 4CIDA 1S01A 4B87A 1EK5A 3EEQA 4XQFA 4MO9A 4H15A 2PQ6A 1M76A 1VMEA 4Z7OB 2RCYA 4JR0A 1K2VN 4V0MA 3RYIB 2QTZA 4UVGA 1ZD3A 2OCIA 1J0EA 4U7PB 2Q7XA 3FN4A 1A95A 3GJSA 2BGTA 5KDOA 4RH3A 1C7IA 3WR5A 2A9KA 3DEHA 3BREA 1TAGA 1PKXA 5FLKA 4TZ0A 6LDHA 1K63A 1LXCA 1MEOA 1NFRA 1RKXA 2D06A 2VAVA 1BVYF 1W59A 2VTVA 3NYWA 4MV6A 2IQIA 4LY6A 2ZRAA 1XN1A 3C4JA 5F2NA 3GLVA 3QVLA 3U4AA 3EVFA 1FTGA 1DXHA 4GZMA 2W0SA 2I2CA 2NTNA 1U2DA 3IDQA 5IVDA 3VC3A 2GQ0A 3DC2A 2GCEA 2P9TA 3K9WA 2VDMB 4N3BA 1JA1A 1ZD4A 2Q1YA 1UWCA 3F96A 1GQFA 2O50A 2PD6A 1JDBC 2VYVA 4P53A 5JBIA 4YVFA 4A0SA 6REQA 2RC5A 3LZCA 4YCBA 1YVUA 1GTVA 4QOHA 5LDDC 3CXUA 4MQMA 3DULA 4GBJA 4LBVA 4P4NA 5JLJA 4JUDX 2WJVA 3H3JA 1PR0A 3MW8A 1LDNA 1ZJ5A 3TNJA 2F90A 2G40A 4M0EA 5I4KA 1JI0A 3JRXA 3SBEA 1DARA 3GY0A 1ID1A 1IZZA 1GCOA 4OIFA 4R98A 2A7XA 1XBTA 1ACMA 1GTL1 4MCJA 4FFWA 4XD2A 5T8KC 4UHEA 2C54A 3DYBA 3FFTA 4C4SA 3OD1A 4EHHA 1Q91A 1IMOA 1O8BA 2CY0A 2OPBA 1ULAA 3E4DA 1IY9A 4OP1A 4CL3A 1XO1A 2R5FA 1LSJA 4ETNA 2G1PA 1CY6A 1KEEA 3JALA 1IN4A 2HCJB 5KWSA 1YRLA 4DRYA 2FRDA 3MJHA 1XLWA 3G2IA 3NHRA 3P9KA 2F3TA 1BCSA 1UODA 3JQRA 5GZ1A 1I7QB 1C4OA 3UFBA 2RBGA 4BMYA 1P2UA 1X6VA 1U0LA 2XUAA 1SAYA 2IK8A 3R0QA 3EA0A 4PNEA 3NPMA 3BGIA 3GUYA 3DJYA 3SHOA 3HCEA 9LDTA 1F2VA 2Z8YA 1Q0RA 4GP6A 1KF0A 1QORA 4KXMA 4RZSA 4E0BA 4CV3A 1M34B 1CG6A 3F6BX 3GJZA 5KVQA 4PLFA 1L7RA 1NF9A 1X7XB 1RHJA 2A9PA 4N01A 1DQZA 1WB9A 3IOMA 4D9BA 1W4RA 3VZBA 3ZY5A 1UBNA 3TXXA 3KYDB 1KYVA 3W7BA 3PE3A 4QEDA 2YV2A 3CM0A 2O7NA 2QZ4A 4Q66C 4YTEA 1UKAA 2A8YA 1I1HA 4PNHA 4EG4A 4BGDA 5JNSA 4Z7NB 1KKMA 2XB8A 3CRVA 2M6LA 2UZ0A 3P1JA 4I4TB 4LDZA 5LQNA 2O2JA 2VH5R 3FWHA 1JP7A 5E3IA 4P38A 4TT3A 4BIMA 4D9KA 1WSRA 4FB5A 1MX3A 4AUEA 3STHA 2AW3A 4FYIA 2UYGA 1VDZA 1A7JA 4ARZB 3WAJA 1XB2A 4XYEA 2A86A 5A6SB 1R5BA 1OKKA 1YT5A 4ZK6A 3EIUA 5LZ4A 3AFIA 3PIRA 4EFKA 2HMSA 1CB7A 4QO7A 3LPNA 2GYYA 3KJGA 4ER3A 5B12A 3T9DA 4D4IA 3A1DA 5DE3A 2UDPA 5IABA 1BDIA 3SD7A 2GHRA 1J0AA 2F8LA 3OZXA 5B4VA 2BEWB 2QRVB 1SMKA 3R3YA 1AHHA 2AQHA 2AZ4A 2BI7A 2GMWA 3UMJA 1NM5A 3EEBA 4C7KA 1HRDA 1TJ4A 3ANLA 3QVGA 4TLLB 3ACBA 1ORIA 4M4SA 1VLZA 3MJRA 4J1TA 4RLFA 4L7VA 4G0XA 1MW8X 4EO7A 3GFOA 1ML3A 2Y27A 1VP9A 2FZGA 3BRCA 1HLGA 4BQQA 4M22A 4DMKA 3ZC3A 1B3BA 2GF9A 4GG1A 1UANA 3T3PB 3OAAA 1T1GA 1AUXA 1AXGA 1E6CA 4ZEWA 3S5UA 3D7KA 2Z2ZA 3JQPA 1IHDA 3P2JA 5SZJA 4LE2A 3G0DA 4G2TA 4UPVA 2DY0A 3OLWA 1DBQA 4ZYLA 2XCOA 1SXGA 3WFIA 5JSQA 3A36A 2JATA 5JMPA 2R1VA 3PA2A 2X4IA 4RO0A 3ZQUA 2P79A 3ZJ5A 1VJSA 3Q72A 4JENA 2FW6A 4X1YB 5LLTA 2OWDA 1Z6YA 2QUJA 4YT8A 4IILA 7ADHA 1D0SA 2DWPA 4UAJA 3LY7A 1WCYA 3A4MA 4KV9A 1OX4B 3ROEA 5B1EA 2LUOA 4XWOA 3GARA 2CNNA 1C9JA 1PU2A 2B4QA 2IOHA 2QAGC 1AHIA 3I6YA 3RNLA 1M8GA 2CZGA 1X14A 3P9XA 4RETA 2HF8A 4U1RA 2O3JA 3T9CA 1VJ0A 2HT1A 3FOWA 4FOLA 4MAAA 4X1IA 4NAUA 3C1AA 2OLKA 4TPKA 3E18A 1GAXA 1XF1A 3ADOA 3K09C 2FPLA 3OJWA 3YASA 3AWDA 4LCJA 4D6YA 1WMEA 3IKMB 4NPAA 4FMCB 1VSTA 3GBSA 2VUIB 3VUFA 4OGWA 1D8TA 1DINA 3FVQA 1N6LA 4LSZA 4NYJQ 3RVPA 5H4GA 3K70C 4MP8A 1NYTA 2ODWA 5GTDA 1M5RA 3KZXA 3P5SA 3NOOA 1KMHB 1QRRA 2E89A 1ADGA 3H1EA 2C2WA 1NHGA 4KXQA 2UXDB 2OVBA 2WFMA 1DX9A 4EX6A 1JDSA 1YQXA 4TYWA 2GM3A 1WVIA 4PZDA 4WKNA 1K5PA 2PMKA 1O96B 1V5IA 3IKLA 4KIWA 5BO5A 2HF2A 2CSUA 3SZMA 3LHSA 2DFPA 1A7KA 3PYXA 4RKRA 3GPLA 4JGBA 1Y7TA 3IEUA 3TW8A 4JCOA 3TSWA 1D1NA 4X7CA 1FDRA 1WDMA 2IQ5A 3V4VB 4X0CA 3KBOA 4AKIA 3S2SA 4QTYA 1XTIA 3THYA 1IHYA 3ET4A 2X23A 2O8BA 3SFZA 4NATA 4L3VA 1YQWA 3B3GA 1A5BB 2DKOA 1M0TA 1VFNA 2C7OA 2QG6A 3PNPA 1PKEA 4IXTA 2GNOA 4WWHA 1C1YA 4YCJA 5FF9A 3VGJA 4YMVA 1O95A 3UFXB 1YITB 2X5NA 2X42A 1JN0A 1KEPA 3H05A 5BQ5A 1GQRA 3UWOA 2JHPA 1KO8A 1SVIA 2IW3A 1K6EA 4QJ4A 4OQEA 3AEYA 4Z4ZA 3ZGZA 2I4LA 1FYFA 4XLZA 4CLEA 4DGSA 4JT4A 5KDDA 4WLVA 1I01A 3UKJA 3NH9A 3K0FB 3JASA 5IN5A 1BHJA 4AQDA 2V65A 3OTQA 1W0JA 1TU3A 2JGAA 4FNAA 4L28A 3DMPA 4IF6A 1P7YA 1WZEA 1P1FA 1W85A 2WVHA 4NEGA 4XIYA 5HDQA 3UJ6A 2ZYTX 3PJFA 3VTAA 1ABBA 2O8DA 3MQ2A 3NFYA 4J0EA 3ADBA 5T4HA 4PONA 5IKXA 4Q7LA 1CE8B 3AK4A 4WLUA 4YAGA 2A94A 1DC5A 1UJCA 3CLUD 3WXMA 1P2FA 4RZXA 1N1DA 2L17A 1CUYA 1EHIA 1OYYA 3D6MA 3HY4A 5B2ZA 4EGCB 2CDNA 4Q5IA 1H2FA 4G37A 1IN1A 1UL1X 4HX9A 2OKGA 3MRVA 1BOFA 4O3FA 9GPBA 4I4NA 2BJVA 1T9ZA 1EVJA 2CCJA 5DW3A 3HXMA 4JK3A 2ZIXB 4GGOA 3QEAZ 1SVLA 5EY5B 1BYUA 1TD1A 3WOHA 2OHVA 4OU4A 2H4WA 4NOJA 3RM3A 4UOEA 2QT9A 4JELA 1ZCBA 3D8TA 5CCBA 3NYRA 1UBGA 3ZWVA 3BH6A 1J8QA 4US2R 1RD4A 3QYJA 4CKCA 3I34X 3FCUB 2A14A 4RABA 3TOZA 2OCLA 4P5PA 2ZRBA 1M9NA 4OL9A 2OFOA 4S2UA 1IZ8A 1P0MA 3W1WA 4Z49A 1BJKA 2PZFA 4X20B 3A1PA 1YFKA 5CXXA 4X6XA 3ZYCA 4CM6A 2XGGA 3A9WA 4TT8A 4AY2A 2EW1A 2YS7A 3PQ2A 2VP3A 1XPRA 2Z8YM 5FX2A 5JSFA 1KVRA 3LIPA 1WXDA 2F3QA 3RIHA 3ICWA 4P3IA 2HZ7A 4RPKA 1LK7A 3HKEB 4CT5A 2G5GX 4TQ9A 1W44A 5ALHA 1OGYA 4G0ZA 5KTTA 5F3RA 1L8LA 2XW6A 4L6AA 1GADO 3E6AA 3S99A 3W8NA 4D4MA 1D2MA 1S8NA 4ZT6A 1PK8A 4KBGA 3RSHA 4DJDC 1Y6ZA 4H2DA 1RFGE 3O9ZA 3MS4A 1Z8DA 1BXZA 1CY1A 2IHBA 3VOTA 4FQ5A 1X74A 2ZRNA 2QRPA 1PRYA 1L5YA 3D6NB 4QNRA 3DLCA 1QHHB 1GTSA 4P31A 1X80B 4OMDA 3B51X 4ILKA 2HU7A 4MDFA 4LI0A 3RRBA 2XCSB 5EIOA 1VCNA 4XX0B 1VSBA 3WSWA 1W5SA 1KJJA 1Z7EA 1CPYA 3I8SA 5ALOA 4KI7A 3WVNA 1PEAA 4MUJA 2FPPA 5EKTA 3C1TA 1TJYA 2ZRLA 1T2DA 3HRKA 13PKA 1WHSA 4IYJA 4QBKA 4XVQA 2O5VA 4PHHA 4PO9A 5LLSA 4AY5A 1BAPA 1DMRA 2ZJ7A 3PR1A 2G9RA 2XWBF 3KEFA 2OV8A 1M8PA 2J3QA 2XE7A 3DC7A 4MQFA 1O6GA 4I55F 2QW1A 1R8JA 2PA3A 4EF4A 1BEZA 3UAXA 1WKVA 4WBNB 1ZFNA 3EXHA 4WFQA 3RK1A 3ZD8A 3OOCA 1DKLA 3X1XA 4D46A 4RHCA 16PKA 4OHZA 3ENZA 1J5EB 1ZR4A 1YQDA 4YC7A 3AOGA 1TI7A 3RVKA 4NZOA 4PC1A 1YQQA 3HYSA 4PQGA 4QOJA 3T5DA 3U7RA 5EJ4A 3CVUA 3PX7A 1LX7A 1NMSA 2VO1A 1XQ9A 4EZEA 2YMPA 4P36A 3FKQA 4Q12A 1Y6QA 2FNAA 3R40A 1LNZA 4FP9A 2OCXA 2C0PA 4HB3A 3S2EA 5K0JA 1PKVA 5C0OE 2C29D 2YZGA 2XQFA 1YB1A 1XZIA 2QXYA 2ZRIA 1Y98A 4GBGA 1USKA 3EX7C 1ZM2A 1BOOA 1PFUA 1PZNA 3QY9A 1GT91 2XLCA 5JY6A 1FDWA 5DT9A 1NW7A 1C9MA 3SSOA 1X1RA 4GH5A 2VA8A 1IY2A 4PLPA 3GFGA 4TX1A 3RB8A 3RVLA 1Y8QA 4YDSA 3RS2A 3V8QA 4AG5A 5LOVA 4P35A 3ZE6A 1ZOLA 2DWCA 3BB1A 3GYBA 3ILSA 4B5KA 3MMNA 4EABA 2IXEA 3OMLA 1IVYA 4O1IA 4B0PA 4DMMA 2JVJA 3C45A 4JEIA 5HZHA 3ZXXA 3OH8A 1SKQA 1LRJA 1P5RA 4JLAA 4ZDIA 1OJLA 2EGGA 4FWBA 4MHOA 4JOSA 4JZYA 4PN7A 2B1JA 5KW9A 3MJEA 5KJ1A 2ZJ2A 3I2IA 1U02A 4HXYA 3WKEA 1R6XA 5CB8A 3S81A 3VBCA 3S7TA 3VU0A 3UMMA 3ETNA 2CGEA 5DM4A 5ALLA 4KQ9A 5FOVA 1Q0ZA 2IXAA 3QVVA 3MTQA 3UC5A 2QTLA 2XDQA 2IBMA 3AUAA 2NZXA 4IDQA 5HMLA 5KZMB 3GJ4A 2JFPA 4BNIA 1T5HX 3RS4A 2QNRA 2PVCA 3A6FA 4ZI7B 4CTMA 5IYZA 3WL5A 4ZZ0A 2AXQA 2Y0DA 1ZRMA 1K27A 2ZTSA 3JQ7B 3CKLA 1Z0FA 4TM7A 5GADl 1M1ZA 1GFWA 4DV7B 2H65A 3WGLA 2JLZA 2GEKA 4FHEA 4LZZA 2I1WA 4FMDF 4REQB 1CR4A 2YWCA 3WLNA 5ALGA 3EGEA 1EDZA 4V3BA 4UUAA 1KZ4A 3VI4B 2E18A 4L8WB 3T1OA 1NZJA 1GKKA 1TCAA 2M1ZA 1W4ZA 1Y8RA 2O0JA 2O6LA 2W8BB 2X0JA 3O47A 2V97A 3OJCA 3ASPA 5COAA 5DHSA 4DCMA 4P26A 2ORWA 3ILYA 2QM8A 3MWYW 3QJGA 2HHLA 5CVVA 3L84A 4BFVA 2CMGA 1B2RA 2H18A 2VDWA 3HYRA 2GCOA 3C7KA 5KJFA 1FNMA 1CUDA 1RQLA 1ZK2A 1FP1D 2PO5A 4HFMA 3H5OA 5FV7A 1TFRA 2YBEA 3R6GA 2AV6A 4UASA 3ZZTA 1MORA 3V4SA 2BHSA 3BILA 2QE6A 4X3PA 2RAFA 1MXFA 3JATB 2D2VA 2Q3DA 3A9CA 4Y67A 1G98A 3OJLA 4DM7A 2R86A 4UPDA 4MYTA 3I2FA 3PKIA 2B25A 2PWBA 1FFDA 1Z2NX 3QQPA 3KETA 4M0DA 1G3IA 4JYPA 2YWEA 3SEFA 3BZWA 1BW9B 2FR8C 3LYAA 3NJ8A 4NESA 4ROSA 4ZOLB 1J09A 1NXWA 5BSMA 5TVKA 2HYDA 2B83A 2WYUA 3F67A 1PL6A 4G0QA 1LBIA 4HH4A 1CJSA 1P1KA 1XPJA 2B61A 2J08A 3ABRB 3F97A 3PUXA 5CK4A 4Q02A 3LF2A 4YFYA 2Q9BA 4B6RA 3ONVA 4JYCA 3MD0A 4B7CA 4CMIB 1KQSB 1QE3A 1RKBA 1XEFA 1P75A 2P9QA 1LLUA 3FDJA 4IJVA 4JC8A 3RDPA 3UY4A 5FP0A 3SY8A 4IIUA 4YI3A 4BMXA 5LDHA 4KR3A 1E1NA 1WNFA 3IP5A 1XIVA 5FHQA 1VMDA 2PPVA 3D6JA 3JR7A 4GBED 2IITA 5IVHA 1YRAA 1C9EA 5BT9A 3N8DA 3QTLA 1YQGA 2B7CA 3P27A 5TMPA 2D3NA 1P31A 3L0PA 4HF7A 1GG5A 2XTAA 4AVYA 1YCFA 1T5DX 2FFQA 3WRXC 2PV0A 4DM4A 4MV1A 4R9RA 2PHZA 2WJWA 4PXAA 6ADHA 1CR0A 3TIIA 2ZB3A 3AUTA 1Y3DE 4WECA 1F9AA 3NEAA 2FMHA 3E2PA 3LT4A 1E61A 4RAOA 4HV4A 1V96A 5G4KB 1J56A 2HY7A 2YNMA 1TMOA 1JEQA 4ZFNA 3CN7A 4CQJA 4G3XA 5GONF 1JG1A 2DCMA 2NTJA 4I5GA 4P54A 4R1QA 1G18A 3N1UA 3GELA 2GXSA 1VL2A 2VR1A 5KX5B 1WB6A 4FE3A 2GD2A 1TQ8A 3QFHA 5J5CA 1EWKA 1JXQA 4TSFA 2PD4A 1QVGB 1EX6A 4KPUA 1XKTA 4G4JA 1ZMTA 1L3IA 1O97C 4D4JA 1G8HA 1GZ3A 5HBGA 3FCOA 4NX2A 1L9KA 3WHPA 5CFQA 1KH3A 2YIVX 3RANA 4GW3A 3NBZC 4TKOB 2ONJA 1EUDB 2QVBA 1MTOA 2PSFA 3OE1A 5BQ3A 5JYDA 1P74A 1HI9A 4HMPA 1N6IA 4YMIA 3K8YA 5CBPB 4FE4A 4EO9A 1XCPA 1X8JA 1ZHHA 3O8OA 3LOUA 5DFAA 1IL0A 4KYIB 1UEIA 5ALRA 2WSMA 2K2WA 1LBSA 3ETEA 4ALKA 1JPNA 4C2AA 5THKA 4ZCLA 1XTZA 3IH5A 3BRWA 1S2MA 3EBPA 1H4TA 2FU5C 2PNJA 3WA7A 4DLPA 3BDAA 4X1KA 2WT9A 1EFLA 1IZYA 2CYAA 3ZKAA 4CKBA 5AM3A 1CUEA 2X0RA 3CLHA 3DMTC 3EBLA 4E5SA 4P1VA 4WN9A 4JT9A 1U8EA 1PN3A 2HA0A 4UZUA 2QQ0A 2C95A 2R62A 3BOSA 3FOBA 5AVSA 2CLOB 2IH4A 2ZIZA 2C9YA 1GKIA 3HL0A 1IB0A 4QOIA 3VSCA 1GAEO 3PE6A 5TF0A 3W78A 5HS4A 1L5WA 4MKRA 2GRUA 2ZXFA 3R7WA 3WISA 2C3UA 4ZZ3A 5F4OA 1ZXXA 3B1FA 3GWGA 1TC1A 2IZ6A 4IDDA 3ROPA 4F4DA 2R0QC 1DFIA 1OOEA 3Q9LA 1QHXA 4OQDA 1L4KA 1Y9AA 1ZDMA 1SCUB 2CKDA 5TV2A 2P35A 3PFWO 4WIAA 1U2QA 4EVRA 3IEMA 5FPTA 3NWEA 4IXWA 4M88A 1YJCA 1NVTA 4NCJA 1KSJA 1PW5A 4FCCA 5EUCA 1HG0A 2DUMA 1QWOA 2OV2A 3EG5A 2IFTA 3D43A 4UULA 3INGA 5LKAA 3EF0A 4XTRA 3FNHA 4IQ0A 1SCQA 4DCGA 4DNXA 4ZJUA 1VFPA 3K1ZA 4ROXA 4XI9A 1XZEA 4FKMA 3I0NA 3VTFA 2LKCA 5EP1A 4YCCA 3MELA 3BFKA 1RYHA 4UM9B 3AY7A 3VR5A 5E6SB 1NOIA 2MWMA 4QTZA 3IHLA 4C4OA 5H8WA 3GC6A 3PGLA 4OFBA 1UFKA 6CHYA 3PC7A 1KDZA 1GAJA 3AKYA 3CLRD 3T35A 4J07A 3FMVA 3ZHVA 1X1EA 4YX9A 4ZCTA 1FQOA 1X13A 3AF0A 1UT6A 4IXNA 3L7OA 3WIEA 2Q3JA 2PX5A 1RAAA 4MW7A 4KFCA 4R71A 5EYPB 4DDHA 3ILVA 1X42A 5FFFA 3O8DA 3N0XA 4N3CA 5CRIA 1AK1A 1WZNA 2MYNA 3O3CA 3TLXA 4DY4A 1YB5A 1JR3A 3UW3A 5IC4A 2ZU6A 1KRWA 1QHYA 2OAEA 3IPAA 2FZKA 3BULA 5EUBA 4B4DA 4RA6A 1JT2A 3Q3HA 3IQWA 3THSA 1JH9A 4KLAA 5FADA 1YB4A 3U13A 2Q99A 3LC1O 3CW8X 5AW7A 3WMWA 1JFLA 2HNKA 3M6UA 4GEGA 1OAKA 2PAAA 1VIAA 2Z5LA 3IELA 2QYTA 3ZLUA 5B58C 5LJLA 1E3JA 1QH8A 3WB1A 4QO8A 1BH6A 1H1DA 4U6NA 2PAFA 5ALZA 4EKIA 4DLKA 4IWNA 1WA5A 2NTEA 3PPYA 4R6WA 1F9EA 5FWAA 1P18A 5HVNA 2WV7A 3EWNA 3JQAD 2B82A 2VJOA 5DK6A 3DTVB 5IAGA 3T3NA 4FBLA 4DMLA 5THQA 2AKEA 3TMYA 4EATA 5JQGF 2VDKB 4RCZA 3QV2A 3LTNC 2UUAB 4DAEA 1V1RA 1DZ3A 2AUTA 1VL1A 1Z0JA 3U4IA 2JHCA 3ZHXA 1MV5A 3TM4A 4UNSA 1FDOA 5LD2B 4HQ0A 3B9QA 1S2DA 3FLEA 3PQCA 4NECA 3TL3A 4DHWA 4PPFA 3EXIA 4BTEA 1L0BA 2PJZA 2VP5A 2IYSA 3R7BA 4TTIA 2FZ5A 4NCNA 3DCNA 1RJEA 4URUR 2WG1A 1L5NA 3RO7A 1PBTA 2PGOA 1GKUB 3GCDA 3N8NA 1G4HA 3NO4A 4AO6A 1UPUA 4ZQFA 2PPLA 3KPUA 1Z4PX 4PHCA 4PSUA 2I66A 3FX2A 4K6KA 1W35A 1ZGHA 3FR7A 3RT1A 3TQHA 4H27A 4NDZA 1RC0A 3LK6A 1IBMB 2ZM5A 3VOSA 4B8ZA 4F11A 2FPRA 1ENYA 1NRXA 2C2GA 2FPIB 4K2HA 3F49S 4FDLA 3R9WA 1GQQA 2D5AA 5CPBA 3ZQKA 3ONNA 2RH5A 2C2KA 4WZLA 2ZDQA 3RHTA 5KI6A 4C05A 3KJIA 3LW8A 5LP1A 4QICA 5K3BA 4U3JA 3IMGA 4KN6A 1PSDA 5JE8A 1V0FA 2JGKA 2RHBA 1HC7A 2OL4A 3S0JA 1ZWKA 1FDSA 1Y1SA 1T9AA 2QRLA 1F4PA 1UWVA 1B8VA 3LLUA 4WY2A 1ULSA 3QEJA 4GRDA 4IJQA 4BLOA 2E4XA 2V3WA 2BMDA 3SFVA 2H1RA 1RWVA 4NBTA 1O87A 4MW9A 5E1BA 1KAEA 1VHWA 3W5HA 2ZB2A 5I4BA 1AA9A 1EKXA 2DTDA 2P75A 3N2IA 3N5KA 4XGQA 5G40A 2PRKA 4JBNA 2IYUA 3IUQA 3GP5A 3C39A 3H6HA 1YL7A 4XQEA 3TS1A 2QTVA 2FP3A 2JARA 2RJOA 4C5AA 3WZMA 4JZKA 1A82A 1EFUA 1C1XA 1G20B 1ODJA 2CNWD 2Z30A 5FOXA 1JWAB 4XVRA 3CRRA 3L7KA 4IGEA 4R8LA 5I9LA 1JL3A 3HXKA 4N7MA 4QUEA 3TLKA 2BDUA 2XCQA 3DP9A 2WW8A 3IQIX 1TEHA 4FFBB 3SKVA 3BXPA 1P2BA 3A4VA 4IDPA 4KIFA 2HRRA 4MPDA 4A0GA 2Q29A 3EIFA 4X8HA