3JQPA

Crystal structure of the h286l mutant of ferredoxin-nadp+ reductase from plasmodium falciparum with 2'p-amp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
312
structure length
266
Chain Sequence
b'NFINLYTVKNPLKCKIVDKINLVRPNSPNEVYHLEINHNGLFKYLEGHTCGIIPYYNKQRCARLYSISSSNNMENLSVAIKIHKYEQTNYGYCSGFIKNLKINDDIYLTGAHGYFNLPNDAIQKNTNFIFIATGTGISPYISFLKKLFAYDKNNLRNSNYTGYITIYYGVYNEDSILYLNELEYFQKMYPNNINIHYVFSYKQNSDATSFYVQDEIYKRKTEFLNLFNNYKCELYICGLKSIRYKVMDILKSHDEKKKKRVHVEVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin NADP reductase
molecule tags Oxidoreductase
source organism Plasmodium falciparum
publication title Plasmodium falciparum ferredoxin-NADP+ reductase His286 plays a dual role in NADP(H) binding and catalysis
pubmed doi rcsb
total genus 69
structure length 266
sequence length 312
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2009-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3jqpA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3jqpA02
1KK2A 1ZM2A 3QE2A 4N3NA 1SKQA 3ZC3A 1Q81D 3OW2B 1ZM4A 4N3GA 1R5NA 4UAJA 5GV7A 4EH1A 2B5OA 1ZM3A 4TMZA 2BV3A 3U2QA 1JA0A 1H42A 1D1NA 1K73D 1NDHA 1IJEA 3MMPA 2HMAA 1CNFA 5AN9A 4AC9A 2PLFA 1CNEA 2VNJA 1QFJA 2GPJA 3V76A 1H85A 5EMNA 2XNJA 1U2RA 2QA4B 1N8RD 4ZGNB 2CRVA 3J81k 3VNVA 2BM0A 1W35A 1EP2B 3LRXA 3OZVA 2AHOA 2BGJA 3W2EA 1VQ5B 4LBVA 3ZZ0A 1VQKB 3JQQA 4LBYA 1KRHA 3LVBA 1K9MD 1E63A 4RD2A 3AVYA 2X3UA 1YJNB 4FWTA 3I55B 3CPWB 4FN5A 5KSWB 2GQFA 4MYUA 3ZBUA 2OK8A 1QUFA 4Y9UA 1M90D 1QH0A 2NPFA 4M2LA 5TV2A 3VNUA 3WNBA 4NCNA 4PGOA 2FX3A 3WNDA 4TMTA 1I7PA 1G7CA 3W2GA 1TLLA 2J7KA 4PC6A 4U9UA 4ZCMA 1SM4A 1EFTA 1GAQA 3CCJB 3G6EB 2PIAA 3ZZTA 1QUEA 2B7CA 1BX1A 1GJRA 1G7SA 4M4SA 2BN4A 4G1VA 4WQMA 5JBQA 3I56B 3CCMB 3CCQB 1J9ZA 3B8HA 3AVTA 1FNBA 2YWEA 1XB2A 3WY9A 4HE6A 3QSYA 4TMWA 1CQXA 3U6KA 3CCRB 4LBZA 1BQEA 1FNDA 1HA3A 3WXMA 2BSAA 3JQRA 2QN6A 2BMWA 4FK8A 1EP3B 3G71B 4LC0A 1KJZA 3QFTA 3P27A 3CCVB 2C77A 1EWYA 4C43A 4YALA 1Q82D 3OJWA 2BVNA 1BJKA 1EP1B 1ELOA 3CMEB 2VYQA 1QGZA 1N0VC 5THXA 3QFCA 3ZZUA 1E64A 1OGIA 2B7BA 1D2EA 2R6HA 3AGQA 1DDGA 5H5JA 3LO8A 4ZV4A 2D74A 2PMDA 3OZUA 1K8AD 3CC2B 4YHBA 1ZM9A 4B4DA 4B43A 4MYTA 5HXBA 1IB0A 2CNDA 2ZITA 1B2RA 4PC3A 1DDIA 4IW3B 1YJ9B 2RC5A 1VQ6B 2VNHA 3MHPA 4RCZA 1QVGB 1G7TA 4LBWA 2QEXB 2VZLA 2DCUA 1FNCA 4Y7CA 1VQ4B 5GV8A 1GAWA 4PC2A 4YAOA 1VQMB 1Q86D 3CXCB 1D8TA 4HE5A 3E20A 1YHQB 4TMXA 1DARA 4TMVA 4NBSA 3W5HA 2DY1A 3VO1A 3QFRA 3W2HA 3OJXA 1FDRA 1R5OA 3CMAB 1F60A 2QMUA 3B82A 1JNYA 4H9GA 1VQOB 1OB5A 1G7RA 1KC8D 5H59A 4Y9RA 2DERA 1KK3A 4Q7JB 1WDTA 1W87A 2OK7A 3P26A 1YIJB 1GO2A 4ZGQB 1UMKA 1W34A 4C0SA 2HDNB 2BF4A 1QGAA 3CC7B 3A1FA 3AVUA 4G5GA 3QFSA 5FA6A 4AF6A 3W2FA 2XNCA 1QGYA 3W5VA 3OZWA 1OB2A 4B3XA 3CCEB 3WNCA 3W2IA 1VQ8B 4M1KA 2YWHA 4TN1A 2YWFA 3AVVA 1KK0A 1KD1D 3AVWA 3CC4B 2VNIA 3AGPA 3AVXA 5TY0A 4G1BA 3FJOA 2BM1A 1EXMA 4BPRA 1VQNB 4ZCLA 4R71A 2YWGA 4QFMA 3LYUA 1VQPB 3CD6B 1AMOA 1JA1A 1OGJA 1R5BA 1TTTA 1QFZA 2QDXA 4B47A 2DEUA 4DQKA 2EFGA 4RD4A 4ZCIA 4M0LA 1VQ9B 3PENA 3WYAA 1QX4A 5TR9A 1YITB 4YAFA 1EFCA 1W2BB 4ACAA 2DETA 1KQSB 3WBJA 1JB9A 4ACBA 3VO2A 1S0UA 4AF7A 4P6VF 3U6BA 3ES9A 4J0QA 4B44A 4RCYA 2EIXA 3SJZA 1QVFB 2RC6A 2QTLA 4RD1A 1FRNA 4RJLA 1KTVA 1N0UA 3ZBTA 2HCJB 3CRZA 4M53A 1YJWB 1A8PA 1KK1A 3JQPA 2VNKA 2BPOA 4RD3A 1XE1A 3CW2A 1FNMA 1NJID 2OTLB 1VQLB 3FPKA 3B78A 4P3YA 1TUIA 4B48A 4YAWA 1IJFA 3W5UA 1GVHA 2OTJB 2XEXA 3CCSB 4PC7A 1YI2B 1Q7YD 2QTZA 1F20A 4DQLA 3MCAA 4RD0A 3VMFA 3E1YE 1DG1G 3CCLB 3CCUB 1JJ2B 4YAUA 1GR1A 1AIPA 2E1RA 2BGIA 3G4SB 4PC1A 3CB4A 2C78A 1M1KD 1ZUNB 1EFUA 1QG0A 4K1XA 1S72B 4QHYA 4F7DA 1BX0A 3I1FA 5DSZA 1TVCA 3WBKA 1QFYA 1E62A 4RD6A 1FRQA 1B23P 1VQ7B
chains in the Genus database with same CATH superfamily
1KK2A 1E94E 3K09A 1GU7A 2VUUA 3HDYA 3LUJA 3EGDA 2P7IA 4GUDA 1SIWA 7MDHA 1OFGA 3FOZA 2A9PA 2AYXA 2Z5LA 1U80A 3D4BA 4RQUA 2REOA 3RVBA 3WRYA 4ZAWA 2I55A 3FDZA 3ZGYA 1MO6A 3EGXA 3TRIA 4UTPA 4YRKA 2O59A 1V6AA 2BV3A 4KKSA 3QMVA 4W5JA 2HDWA 3FFTA 3PPIA 3HVKA 3OWHA 1YJ8A 2H4ZA 2O7NA 4M0UA 2GJPA 1ACMA 2A9JA 2I3DA 1C1HA 1HFJA 2VEOA 4Z86A 3K71B 2BYTA 1IJEA 3EUFA 3F6BX 4D2IA 4RHYA 2Q1WA 4F5YA 1Q3HA 1EIZA 2IOFK 2O14A 2I8AA 1QVRA 3S28A 4EB6A 3JQAD 5KC8A 3PC8C 3PHIA 4CI0B 4XD7A 3CNLA 4BVBA 3CXRA 2VPZA 2VNJA 5KNDD 2QB5A 2IYAA 4HGQA 5BSXA 2QPAA 1HNZB 3V2GA 3VPAA 5EMNA 1H1DA 3SZMA 3ORYA 3QBTA 4JI6B 4FIZA 2QM7A 3HNOA 1P7ZA 1LW6E 4TWZA 1CZHA 1ML3A 3P0HA 1IONA 3ZWBA 3PDIA 3CVVA 1KVQA 5CX1B 3ODGA 4L8VA 1N6PA 4GQIA 3X1ZA 3IOCA 2FMTA 1Z12A 1GQRA 3DT6A 4C4XA 2JD0A 2ZSUA 5AW0A 4XEHA 2J5KA 2XOXA 4I55A 1LVUA 2WMDA 2ZR7A 2OHVA 3GGCA 1JEYB 1JJIA 1MENA 4KTVE 2H5IA 3F9CA 1XGKA 1ZNZA 1ZN8A 2UZ1A 3OE7A 2VI5A 2HCFA 3CCBA 1IH8A 1P4AA 1SBYA 4NPAA 4BQIA 3U61B 3L40A 1ZAYA 2A9FA 4FZ5A 1XRSB 2IUTA 3I62A 4MAAA 4QTZA 2D7CA 2X3UA 1YJNB 2AEEA 3ASUA 1RLJA 4PAAA 1YIAA 1TM1E 4N41A 1IQRA 4FJ1A 4DIBA 1J24A 3UMFA 1O94A 3V46A 5IKPA 4Q1FA 3A10A 1RHRA 1G64A 2IZ5A 1AS0A 4O0LA 2ZJZA 3I9V1 5T4FA 1L1FA 1WB4A 4EHIA 1M74A 2BFOA 1E7YA 2R65A 3EZ7A 1NOKA 1M90D 1D2AA 1PS0A 1RYFA 3GRKA 3NV7A 4O2AB 5AVTA 3G8YA 2ACVA 3T1QA 2VT7A 4NK5A 1E1DA 1YB5A 3E9YA 1IN8A 5EI5A 5ALSA 4P9SA 1ZL0A 2HDHA 2LCFA 2JIRA 4LHXA 3TLKA 4DDKA 5C52B 4JXZA 4TMTA 4RHFA 3UM9A 1HKHA 2B20A 2X13A 4OL9A 2DUUA 4ARZA 2C2OA 3IKLA 4JC0A 4LXXA 4JQYA 1U8XX 3W2GA 3KS9A 2WSMA 3GJQA 1Q0LA 3P96A 4HY3A 4BP3A 3L7JA 1TM2A 4E2FA 4R0MA 4M36A 1W581 1RJEA 3MWEB 4XYGA 2Y2UA 1V8PA 1LZLA 5ALUA 3RK4A 3WJAA 5KVAA 2JC3A 2HXSA 3CUEF 2GYYA 2PIAA 3DYVA 2H18A 3KTFA 1T0IA 3D3KA 2HBYA 4JUCA 4LN1A 4EYSA 4JLSA 5FKJA 4WT7A 2FQ1A 3AUAA 1YI0A 3KQTA 3QU2A 1FMCA 3FUWA 5EVCA 4CM6A 2QL9A 4QU5A 1I3KA 2JBAB 2P4HX 3I56B 3A4IA 4R2JA 2IOFA 4JU9A 3CX8A 1Y4SA 3CCQB 2R6CA 2WHPB 1KNQA 3CTAA 3FHCB 4RK0A 4X8HA 5LIRA 3T3NA 1NQXA 1P33A 1SVUA 3IVGA 1CEQA 3LFHA 4OPSA 1NPTO 3MWFA 4HVAA 3ROGA 2UZIR 3RCBA 1XF1A 1JQBA 2LD4A 2YNMD 2IS1A 3DO8A 5C35A 2N0SA 3CCRB 3DZKA 3LUGA 5GPBA 1KVSA 4IJKA 3W5JA 3LUKA 2V31A 2BMDA 1CUVA 5DI3B 1NVFA 4LRWA 2CHQA 2WEKA 3TX2A 2BFFA 1T13A 3P2OA 1CY6A 4YLGA 3IUYA 1KVTA 1LQTA 4ERXA 4HQRA 3B3QA 1ML4A 1REQB 3EX7C 5CBPA 5BSYA 4Y0VA 5C51B 4ZC1A 3EUWA 1EPUA 3W8FA 3T7TA 1IBCA 5CDTA 1E6EA 1QJCA 4XWYA 1TF2A 4DQVA 1NU6A 2FXIA 5I8PA 3I28A 4YT8A 3OUZA 2F64A 2I4OA 3D5QA 2AHRA 5CIYA 3BF7A 1XPUA 4DNOA 2GLUA 1MO2A 1VJCA 4A0SA 3RTEA 3ZHOA 3CF0A 5DTMA 2YHAA 4BJHB 4YLYA 1WIWA 2C57A 2XCLA 3V2IA 1TA0A 4ZI7F 5IKMA 4P9NA 2P6PA 4H1HA 1E4EA 3L8MA 1VJDA 3L46A 5JD4A 3LRPA 3BB3A 3L6UA 4RK4A 1QCZA 2QQFA 4MA4A 1JVBA 1A8IA 2ZBVA 1Y0RA 5FQNA 4B6FA 5J4KA 5KTYA 3EXFB 1RVDA 5E8JA 1P6QA 1DIBA 4OOXA 2W2PA 2HWKA 3EEBA 3M4YA 3H2KA 1I3OA 1KAGA 3SFTA 4PYMA 3T0IA 1T9GR 5JH7A 1DO0A 1ZWLA 2ZE6A 4RX1A 3AEKA 4PLYA 1ENZA 1P0IA 1UFOA 4MPTA 5BUCA 4BOYA 4TLAA 3RS0A 2IU0A 4E5SA 1MFPA 5F98A 3FZYA 2VJOA 3ZCSA 3BSFA 3GPBA 1QMPA 4JB2A 4QYTA 3L1IA 3EY4A 4XJTA 1EUCB 2VDWB 3DULA 4MS3B 3QELB 1J8VA 5HS4A 1A8UA 1Q11A 4RF2A 5FHRA 2OD9A 1EWQA 5BXQC 3DW3X 5ICSA 4OI1A 5KYXA 1AHNA 5LZ8A 2Y4NA 3OPYI 3K70D 1V7PC 1E66A 1UH5A 3NOQA 2QL6A 3EYAA 4JVNA 4X7FA 4LXYA 2QJWA 3U1BA 2PH7A 1ZWKA 5KW9A 4WL0A 5DNWA 3LWNA 1VLHA 3AXSA 3JPWA 4WZEA 2XNSA 4UXIA 3RUHA 4KJXA 4ATNA 4C0JA 1YFKA 2CJPA 4MVJD 5DNDA 3TIGA 1UD5A 1N7HA 1X9HA 1AG9A 2Z98A 3Q9UA 4X95A 3RWBA 3LNCA 4Y8VA 1JBEA 3U1TA 2ZSBA 3FTPA 1WHSA 4DWWA 4DUGA 1A2OA 2R1TB 4Q1EA 1SXGA 3UJNA 2HA2A 4AZ3A 1H66A 2IYZA 3GDWA 5T6MA 3F5MA 4OU4A 5F1PA 5TMPA 2BEVB 5AJTA 5LZ7A 1NKSA 2POQX 2WQ6A 2RKBA 1J5PA 1F5SA 2B0JA 3CKLA 4MVJH 5H3HA 1E9AA 2EP8A 1XALA 4YC7A 3U1VA 5JAPA 1C81A 2VP6A 2W11A 5F5XA 3V55A 4OXYA 3UATA 3L5KA 5F1OA 4ID9A 4OQEA 2N9UA 3WIEA 2IE0A 3MTEA 3LUPA 2UYGA 3QEMB 4U39A 4X8LA 2W2MA 5K6AA 1Y1LA 3F6EX 1MDBA 2ILTA 4YAEA 3JD1A 2UVQA 3V7UA 3P5SA 2AOTB 3G68A 4CG3A 1FTQA 1NYTA 4Z4WA 1YVRA 1RZRA 3X1MA 5KOHB 5I9TA 1L4HA 3R75A 1LLFA 1OWNA 1GYRA 1U8AA 2X0JA 5JTTA 1FNCA 3RT9A 1SHKA 4AY5A 4RIHA 5GV8A 3DDHA 4ZAGA 2XA2A 7GPBA 3DMDA 1ZD9A 4DMMA 1C2TA 5IMSA 4OH7A 3OU2A 2GZRA 1TZ2A 2DPMA 2BD0A 4B3GA 3NWPA 4PLVA 1VIAA 3CLSD 4U9HS 1YHQB 2E49A 5CMLA 3NG1A 3VX4A 3ZK9A 5C8YB 3QXCA 3L6BA 3UYLA 2FZEA 3IAXA 4MLCA 4PLFA 1HDXA 1GT6A 1MT0A 3GCZA 2R6ZA 4CM3A 4KQWA 1EK2A 1NJGA 3I9JA 4LRYA 3BD8A 4V0QA 2I91A 4KODA 4AL4A 3QI7A 2J3DA 3FPCA 3QPCA 4ECAA 1JHZA 3J80A 3OQJA 2DU8A 5JJKA 4IZOA 1KZYC 4J3JA 1XP5A 4OY3A 4DAOA 2VPXA 3HXOA 1Z7GA 2PJZA 3THXB 2AEFA 5JT1A 5I9LA 1Z5GA 2BEKA 2VO1A 2EJBA 1I4WA 5IBPA 2CUKA 3SAJA 3WZ2A 1OB5A 4EJMA 1XQ1A 4CMBA 3H3FA 5GONA 4MV5A 5E4TA 1E0AA 3LCJA 4DSAA 1WCXA 3G0BA 5HRAA 2EFHB 1HE5A 2AFHB 1HYHA 2HLHA 4U2CA 4TMKA 5CVJA 4Z3KA 2VQEB 5ARCA 1QZXA 1XG5A 2E21A 1DKRA 3CSSA 2IV3A 2IV2X 1WDTA 1JIUA 1YOVB 1UBEA 3HI4A 3K8OE 3SKXA 5JATA 2ZZGA 1K89A 3FCAA 3L7NA 4HAXA 1CIJA 3JARA 2V6FA 3R7AA 4WZTA 2ZIXB 1BJRE 3HDHA 4OHMA 4NHEA 4DHEA 5B6JA 2DHQA 3JQGA 3L0PA 3AF5A 5DYGA 2WYHA 4NZMA 4AF8A 4D9MA 3WGUA 1C7QA 4WW0A 3THOA 4UM5A 3F8TA 3S5JA 2PJUA 2XDYA 4XB6B 3D5TA 3KJEA 4L7QA 5FPKA 3K1AA 2XPCA 1G9TA 4LDZA 4XD7D 1GSOA 2NPIA 4LY9A 4QVKA 5FPPA 5IAJA 3D6HA 3LLCA 4WBXC 1YCDA 2DFVA 5AKXA 1LSJA 3WNCA 4FUTA 3L7CA 3H9JA 1X7XA 4UC0A 1STOA 1IBRA 1T2CA 4AKTA 3T41A 1KY2A 2R6GA 4ALIA 4JX9A 4BRUA 3NBXX 3SFZA 4F4CA 2ID9A 1PP4A 4BY9E 3M6LA 3OFNA 3L05A 1DAFA 1Z4JA 5CVDA 4TSRA 4TQUS 3U26A 2BFEA 4GYYA 1C9KA 1N6KA 4RELA 2O5CA 3TOXA 3D3WB 2R6JA 1N8KA 2GFQA 4LZWA 5BV2P 1IY9A 4HZGA 2UUOA 2H2AA 2A8YA 3LKZA 3VXKA 4ZDJA 2FX5A 1M34A 3CR3C 4K3UA 4XSVA 4CM9D 2JLQA 1KFBB 3BKXA 4PABA 1BVUA 1P1JA 1NSYA 1SWWA 3D4LA 3WGLA 1F17A 4MCJA 3KNZA 1P5HA 1N5KA 3IKVA 4BPRA 3GLHA 4L5AA 1N2SA 4TM8A 1ZMTA 5FI5A 4DGSA 3FPBA 4ZCLA 4ZMRA 1GG2A 4LV5B 3LNTA 4Y0NA 5L7WA 2VQFB 5J59A 3SF0A 2D13A 1RXCA 5FBWB 5ICGA 2PUDA 4ND8A 3EXIB 3TJRA 3BE4A 5FTWA 4UULA 5REQB 5JO0A 4HK4A 4X8IA 2QZSA 3A8JA 1AE1A 3X1JA 3KLBA 3CD6B 1SKYB 3PGVA 3QMWA 1UKCA 4JUBA 3USCS 2RHWA 3W5DA 3I2GA 1JA1A 3D64A 4PVDA 2AZ4A 1AQLA 2VOEA 4AYTA 1A9XA 2DT8A 3DC7A 4K9LA 2WMOB 3O9MA 3E4CA 2YJ3A 4XIYA 1J06A 4Y7DA 3FVVA 1FOEB 5CDYA 1LVHA 2DF8A 5DNYB 1NWCA 5HKOA 3M4XA 1QAMA 3EIWA 3DKPA 1H94A 1P2DA 1OR8A 3P0RA 3GJRA 4DTIA 3SYRA 1FFHA 1ONPA 3QVMA 2JJ2A 4QXPA 1H6CA 2QV7A 3EZNA 3PD1A 4G5RA 4OHYA 1DJMA 4LDAA 3GY0A 1XMJA 5TR9A 5GGYA 1E2GA 1V7ZA 4ZGGA 1W2BB 3GAFA 10MHA 1I2DA 2J85A 4Q3DA 5CVCA 5AP9A 3UW3A 4FJ0A 3KJQA 4CF4A 3ZY4A 5K6RA 3AFGA 2Q5LA 3FX2A 3E1KA 1JVSA 4BVLA 3E1SA 3EVEA 2WWYA 5JRDS 4O4JF 1PEDA 4FLMA 5WRFA 2V0CA 3H4VA 3QLUA 1IBKB 1C1XB 5E3IA 1FQOA 3EBLA 3PC3A 4BNHA 2FGJA 4QDKA 1VJRA 3WIVA 3CUVA 3AP3A 2YZGA 3DMNA 2NUTB 1WXFA 4NOMA 2FWMX 1E3EA 3EVGA 4DCCA 4BX0A 3W3AD 1O0SA 3AL2A 4UAGA 4BV8A 5JOQA 1O54A 1UKYA 2FLVA 2WMYA 3BFKA 1ZD1A 3OA0A 2C0CA 1WB6A 3KBBA 4MR7A 4HMPA 5KYVA 2V0NA 3TXXA 4CM7A 4GBGA 4DQXA 2Z4SA 3M89A 5ICMA 1OQAA 4K6MA 2GCEA 3CRZA 1L4LA 3EISA 2J3MA 4G0NA 1R18A 4RHXA 4UE3S 4PR0A 4YDQA 4OPVA 3DE6X 4GLOA 4NFLA 2XUJA 5IAOA 2PVCA 4YJ3F 3BFJA 2QGGA 3OOSA 4X3PA 2VOJA 2MCFA 3O8NA 1VSUA 4WK0B 4FI3C 4XPIA 2M1ZA 4GOND 1JFRA 1V5EA 4BB0A 4MR8B 1KGSA 1MO3A 3O03A 1K6IA 2J1LA 3NKVA 1CJMA 1C1YA 3RHFA 2YJ5A 2VFAA 2RHTA 5E2IA 2LCQA 4MEBA 4HYEA 2EFCB 2GJ9A 1IOWA 4R9NA 1QP7A 2B9VA 2WWRA 2GREA 3GH3A 2P69A 3JR3A 4UUBA 3V4LA 1Q7YD 3IBYA 2F3SA 4CRWB 3EOAI 1QO0D 3FNQA 1D0IA 1YQTA 4DQLA 4RM2A 4X6LA 1TK9A 4GQBA 1GPJA 2Y6UA 2WJWA 3IH5A 2UVPB 1BVHA 4YJFA 1YZNA 4Q9NA 3U0BA 3I53A 1K9VF 3VR6D 3U4CA 2V59A 1V9CA 4NV3A 2VT3A 1JWBB 1XVTA 4HAZA 4OXRA 4R8VA 5DB4A 4BNZA 1EH5A 3L8FA 2ACEA 3CN9A 4WHMA 3VTKA 3VOBA 4NRDA 3BH6A 4E03A 4EZEA 2BGWA 4J1QA 5A0FA 4LY0A 3KOXA 2ZAMA 2ZRLA 3KKZA 3MS2A 4IXDA 2FR8A 5AMXA 4KQ1A 4OQMA 3ZUPA 4XAQA 3ZWNA 4GPIB 3QVGB 2WAAA 1U81A 4TLCA 4ZOLB 1QQ7A 2YFQA 4UZUA 2IYEA 1DL5A 3A1SA 2CCKA 1NVGA 3K96A 4G5YA 5E6SB 3ECSA 1BX3A 3P4XA 4PNPA 4YMGA 1QG0A 2PUCA 3U7JA 2P9EA 4DXAA 4XVRA 1TO1E 2I1WA 1PL8A 2YVLA 3NPAA 4L75A 1PGQA 3SSOA 4KAAA 3IE1A 2LXNA 4AWBA 3JYPA 1P29A 3LSYA 3AF0A 1GARA 5GY7A 4IDCA 4OM8A 2QEQA 1E62A 5D01A 3D0OA 5HQTA 2KHZA 4XR6A 1GRVA 2FRDA 3EGDB 4N03A 2EKZA 2OORC 3QXGA 5J63A 3ML1A 4V03A 3N5KA 4KMSA 4NV0A 3KT3A 4BLPA 4C04A 5A02A 1NQUA 3V4VB 3GVPA 1Q1EA 1NTRA 5T4HA 2ZTMA 1J99A 1ZIDA 4O1HA 5FTJA 2HLDA 3U80A 1CS0B 1OXKB 1C3LA 3ZI7A 3GFVA 2BCGY 5A4JA 4DCTA 6Q21A 4JLAA 1CBUA 1BYIA 4KVZA 1LF0A 2DFTA 1D2RA 4E5PA 4NEHB 5DX0A 4WJZA 3KDSE 1UC5B 3PIIA 1D2CA 3MIZA 1AUQA 1Y6ZA 4DDMA 4ARIA 1PZMA 1FUUA 1CF2O 1EX1A 3H9EO 3KAJA 3KUDA 4XB1A 1KDZA 3WGMA 1VE1A 5JFTA 5HQ3A 3INGA 4MQEA 5B3AA 3AVOA 3BL8A 3CX3A 3KSDO 4UOEA 4FILA 1SCKA 1QORA 4MR9B 5HDBB 3M3HA 5TEVA 2J3KA 4LY6A 3MBOA 4IG9A 4KU4A 2Y8EA 4B8ZA 5BMVA 3CX7A 5JNTA 2NUAA 3IODA 2FE4A 3TZQA 2HH9A 3EY9A 3H7IA 4EJSA 1TEZA 1ISRA 3P9PA 2JJQA 1CEEA 4A7PA 2FWBA 2DPGA 3OOHA 4RFLA 4ZYZA 1AKMA 9LDBA 2B7LA 3QHQA 2F8TA 2WYRA 3H3JA 1DAIA 2J0VA 5IP5A 2ZYGA 4TL7A 1DQZA 3MJRA 4YAKA 3NIGB 4BGVA 2ARKA 2V6IA 3WIDA 4TVSA 2NVUB 2R87A 4MVJM 3H94A 3ZK8A 4WLEA 4F7WA 1ABEA 3TLAA 2PFGA 1H1LA 1U0LA 2BGJA 2VK2A 2IFTA 3WDKA 2VDJA 4D9GA 4X62B 2X8WA 1G2OA 1JSCA 1WUJS 3MM4A 2B2NA 1OE0A 3O3NB 3A1VA 3OKXA 1VCOA 1DO2A 3OH8A 1Z36A 4B7XA 5BSHA 3LVBA 5AR1A 1SUDA 2HB6A 1K9MD 3DXZA 1UF9A 2ZUVA 1CUHA 4NX2A 1H9AA 1W85A 1EVIA 1UKEA 2O4UX 3CISA 1B6RA 3LDUA 4TV9F 2FRXA 1BW9A 2GQ0A 1PSWA 3TINA 1YNSA 2HRZA 4EX7A 3T7JA 2GXAA 3CTPA 5IKOA 1KEUA 1T9AA 1W4BA 3DMTA 3PJEA 1P44A 3UB4A 3B70A 3WI7A 4S0XA 4BFTA 5C46F 3G2MA 4RTSA 1AA9A 3FOFC 3OPQA 1QZUA 5JPIA 2BFEB 1ILEA 3VVLA 3VH1A 4LYHA 1P72A 1ZU5A 5DN6D 3W8EA 3VJRA 4MB6A 3PTLA 1Z6YA 1J9EA 3KKEA 3TKYA 1YFLA 2F43B 4R5HA 1VFNA 4X1IB 4H31A 5BPHA 2IRWA 1E2IA 3G9UA 3EIFA 2QPTA 2VH1A 3QPUA 1YLOA 1TXGA 3D8SA 2JGDA 3HCCA 1B41A 2BELA 3OVMA 2D5AA 4AYWA 1JW9B 1NW6A 2RI0A 5BYJA 1S9DA 5F7OA 3WB0A 2FFQA 3CCJB 4PW0A 1IBSA 4TYWA 1WNFA 1KOJA 1ZRSA 2IZ6A 4JFAA 4XYEA 1NA5A 4C06A 4BNJA 5BSTA 1NIPA 1R6VA 1X1SA 5EIOA 1Z63A 2P5TB 1QPZA 1ESMA 2CD9A 3TVTA 1VIYA 5LYJB 3WOVA 2CUNA 2IYLD 3CCMB 1F0KA 5BV1A 2GJRA 3NRCA 3A35A 1Q0HA 4DLUA 2B78A 4PE5B 1WVIA 1RQ2A 2HBRA 3ENVA 4OEHA 4OLJA 3TNYA 1PJCA 1I6KA 2QYSA 1RSZA 2ZSKA 3C3KA 3JWJA 3ESDA 3VPBA 2CJFA 2QUJA 4G5QA 4ZP1A 3I5XA 2D1RA 3KJIA 1YC5A 2P5YA 3BZUA 4E6PA 3WWDA 4Q9IA 1Y6QA 3FWYA 3JQFC 5AW7A 2D4HA 2YWXA 3AU8A 2OVBA 3E2PA 4IG4A 4IKOA 5A5EA 2OM6A 5FR1A 3RVDA 2V0GA 4V0NA 1B8OA 2YJ6A 4KQ2A 4AG6A 3IXLA 4BUZA 1JMVA 3EEOA 1L2TA 2BSAA 2B99A 4A6PA 3JQRA 3IUEA 5G3ZA 1LRJA 2I2WA 3IR6A 1Q0UA 1M2OA 1XTTA 2FPOA 3FWKA 3M4ZA 1E3SA 3ND5A 1GA4A 3RBXA 4UU1A 5TRDA 4I9NA 3HCFA 4H1UA 5SY9A 3QXJA 1KU6A 1TQHA 3CCVB 1MB0A 3B9PA 3RJ5A 2QI9F 2GN8A 1HDCA 3WK8A 1Z38A 1KJ8A 5JNVA 1LDBA 2W6OA 1SUCA 6LDHA 2Z8ZA 4DLTA 3SQLA 4BKMA 3OJWA 3FLMA 4ZICA 5ITZA 2WF8A 4I5DA 3UG6A 1EP1B 5EUBA 5SICE 2IYTA 2OBRA 3TGLA 4URHA 1VRCA 4MRPA 4ZFNA 4UDNA 3K53A 4NY1A 1K3FA 2XV1A 4MV3A 3OZSA 2G07A 1MCZA 2Q41A 2QP3A 4HUQB 4TS4A 1UD8A 3FIUA 2P62A 3HP7A 4FD2A 3DM9B 3TW0A 3GA7A 4EG3A 2DR2A 1H5UA 3D0KA 3F0TA 3MUOA 2BFPA 1WSBA 4L4ZA 521PA 3VR5H 4B33A 1DAMA 5HWSA 1QG2A 4FIDA 3ROKA 1XMXA 4TROA 1JV2B 2CNLA 4Z7OB 3PNVA 4NVRA 3OMLA 3A06A 1PUJA 4K2AA 4OXQA 5B1EA 1E3QA 4P84A 1WZCA 1QGED 1AV7A 1XTPA 1VLQA 4PZDA 4DCPA 4MUMA 3WQRA 2FN7A 1MAAA 2COEA 3SXUA 2Z4TA 3KP1A 2ZS8A 3GJ7A 3HEMA 3HK2A 1IXSB 4HCJA 3PB3A 1CRQA 4MYTA 2A9QA 2G08A 1G5TA 3C1AA 4HAYA 4LJ6A 2Q1UA 2VR1A 4YCBA 4GBED 1XCMA 1T6NA 3BDVA 4L3VA 4P58A 1U2DC 1JL3A 3T52A 3VNBA 1W36C 3EW7A 3G9ZA 2H7YA 3ZQ6A 1N25A 1GAJA 2CFOA 2WP8J 3EIHA 4FGLA 1WOOA 3SYNA 4L0CA 4CHGA 3A04A 3KWFA 1Y98A 2X4DA 4LJAA 4WFQA 5BUZA 2YL2A 1SXIA 4U2DA 4RVNA 1ZP6A 2FW8A 3MNFA 4RESA 4KEAA 3TLBA 3W4KA 3ASSA 2NO7A 2RG7A 4C1BA 1YB7A 1DX9A 1JU3A 1PZGA 4TZTA 4C89A 2E1PA 1KOFA 5A4KA 3HUDA 1G7TA 4NV1A 1U4NA 1X15A 5C8YF 4DBZA 4Q1VA 5MFPA 2WILA 3C5CA 2C7QA 1GWNA 1A04A 1D1QA 4IKPA 5DM4A 3NW9A 3L8CA 3EQ6A 3JVVA 4FLEA 1U3UA 1NQ5A 4C7VA 3EXHC 3OQIA 5F12A 1VQ4B 2I1VB 5DISB 4DJFC 3JAWB 2NAFA 3K9BA 4L95C 5T6BA 3AERB 3OIDA 1ODFA 2FUEA 2O20A 4QYIA 4CKEB 3ZJUA 4ZCSA 1ABBA 4D02A 2PT5A 1XLVA 3QXSA 2BGUA 2H31A 4FFDA 3UV7A 2CB0A 3SC4A 3RYTC 3MMZA 2CDRA 2ZUDA 1B2LA 1TFUA 1XFAA 1YHZA 2ZL7A 4RZHA 5ESXA 1Z68A 3LPLA 4H6WA 3UN1A 1E1RA 1UBUS 3KCNA 4C7MA 4C21A 1Q50A 5L46A 1U2PA 3H2BA 5JQWA 3VO1A 3QE3A 1LBQA 3JATA 3OPYB 4WGGA 1OX4A 2Q5QA 3O1LA 1PHPA 1DRVA 4FCWA 4TX1A 3RC1A 4I14A 3MYRA 3NKLA 5D6NA 3G6WA 2HPZA 2PV0A 4G0QA 3QEBZ 3T9AA 1SVOA 1V3TA 4AUNA 4PG5A 1NBWB 4B6QA 1EB8A 3FNRA 4C7KA 2Y0DA 1L5NA 3GZTB 3T3MB 4KWIA 1E20A 4AG3A 2EWMA 4QU8A 5FAKA 3T5MA 1D4ZA 1ISSA 3CSDA 3SZLA 3JW8A 5EQDA 4F72A 3M6AA 3OF3A 3E8MA 3R7SA 2JAUA 4CMGA 4J16A 3MIIA 2O5VA 2R5FA 4B6OA 3W8RA 1HLDA 2ONZA 3GLVA 3ZJTA 3DMPA 3EWIA 5GAJA 4MUIA 4RAQA 3BSSA 4B46A 2YV2A 1DBQA 1ZD5A 1IY2A 1ULTA 1QS0A 3I9OA 4DJTA 3QFSA 3CP2A 4AF6A 4TGLA 3PWZA 5KVVA 1Y3IA 2YRWA 3KSBC 2XNCA 2FZCA 1TUGA 3W5VA 6REQB 4K28A 4UPEA 4KQKA 3LWDA 4XARA 5CX4A 3V4FA 1V5VA 1U1EA 2FMHA 1M6EX 2AE2A 3U37A 3HSSA 1LPPA 3X1KA 1L7DA 2IOQA 3LSTA 3BH7A 2PWBA 4JJ4A 3OZXA 1U04A 3W2IA 3PI6A 3X2FA 5C7IO 2BL4A 5LQAA 4OOEA 4R4JA 5TEWA 4I1OA 4CJXA 4YQYA 1MBZA 1JPUA 4H17A 1U5BB 2ADOA 3X1WA 2NTEA 1BWQA 1JE1A 1AUXA 4HWOA 4IDDA 3VHQA 2YXPX 4EG5A 1TQ6A 1Q74A 2YMPA 3CRQA 2H17A 4ZZ2A 3WRVA 3DFIA 3RUFA 4JYAB 1OZFA 1U9YA 3OFKA 5E6UA 5ES3A 2DH6A 3T5CA 1H6DA 3TFQA 1S02A 1JEYA 1WQ3A 2GJAA 1K4YA 1TT7A 3N2YA 2OYRA 4ALKA 3RQSA 3ZBPA 1Z4PX 2BI8A 1PSDA 1XRJA 3NRBA 1J8DA 1DQNA 4TQ9A 2IDKA 4P92A 1EXMA 2BTEA 4ZEXA 1Z28A 2Z2IA 2EYQA 3FROA 3Q8XB 2JFVA 4RVSA 3VOAA 5IT9A 2OHGA 1I4OA 2GKSA 1MOSA 2Q7OE 5B2EA 5CVTA 1C0KA 1KJNA 5C1IA 3GFSA 2WZBA 4IDPA 1IDOA 3ZTTA 2EF1A 5EIBD 4LJLA 4RGVA 5GJVC 5KQLA 3JD4A 4QQNA 4CN8A 3HYRA 3GRZA 4OGWA 5KX5A 5DHRA 1Z2PX 4I55B 2OSVA 1PT7A 1XMQB 2ZE8A 3DS8A 4I3FA 2I7DA 4ER6A 2VBTA 3UAVA 1TTTA 3G9XA 5A0TA 1RQNA 4QQFA 4PRKA 1QFZA 3L3BA 2FFAA 3PGXA 1FSZA 3K09C 3W5BA 1NVTA 1YJBA 4WZAA 2YXNA 4B4UA 2IH4A 4O4JB 4IWNA 3GDFA 3HCBA 3GNTA 3TLZA 3IPAA 1XMIA 2AJ8A 4RY0A 3D1VA 3K6SB 1YFZA 1B4DA 1M0TA 1SNYA 3DVAB 3S44A 3WYAA 3N8DA 1OHHA 4KKTA 3L1VA 3DOJA 3IBTA 2Y0EA 3NWOA 5I7WA 1R9MA 5CGQB 4BQQA 1YOBA 1V16B 2IGTA 1P2VA 1G6KA 2X0DA 2D7DA 5AKZA 1BNCA 4KXQA 4TLDA 4XQEA 4ZALA 4L16A 4Z9AA 3HFJA 4WZBA 4BU1A 1TZJA 5BT9A 3HCDA 5KWVA 4LJ7A 2HRBA 1XJCA 4KYIB 5HYVA 1LCIA 4D6PA 3ZX5A 1JNXX 3OI7A 1S0UA 3VR4A 3CLHA 1DEXA 2XW6A 3EN0A 2R2AA 4LWZA 3WLFA 1H0SA 1DX4A 2DAPA 2P75A 4YJ3B 1UFKA 2W2KB 2FPLA 1XKQA 4UUNA 4WZBB 4EVIA 4B2LA 4CE6A 4LYAA 1UD3A 4J0QA 2X6RA 4BV3A 5JISA 2G09A 1QC5A 2HJWA 4OK3A 1L3BA 2A1IA 3DBIA 3FA2A 1YZLA 5CUQA 5JC1A 3CVUA 1QVFB 2JAHA 2P2CA 1LBSA 4O02B 3TSWA 5A4FS 3ASPA 4MMXB 3B7PA 1YQWA 5ALDA 5NULA 1Q1QA 4N3AA 5TQ2B 2H29A 2PQ0A 5KNLA 5DRYA 1C9EA 3C8HA 2R6AA 4LEIA 5CFQA 4KFUA 1DOZA 2LUOA 2P79A 2WZDA 3DZDA 3PKIA 1GP2A 2OTLB 2ZLBA 5FNZA 4ZCQA 2FSGA 4WUVA 2JIOA 3SC6A 1V9LA 2WAOA 1I5RA 4GZ5A 4R6WA 3E8XA 3AR4A 1ZVQA 2AW5A 1GL6A 4XIJA 5BYBA 3KQOA 4C4RA 4DLWA 3H19A 4YAIA 2QM0A 2P8JA 4ESEA 2AD5A 4LMRA 1W5TA 4ENSA 5SY4A 1YS4A 4X97A 4YFYA 3GIDA 4DIOA 4IJ6A 5ELMA 2UYCA 1EE1A 2ZJBA 1U31A 3FB4A 2FE1A 3N6VA 5T41A 3YASA 1LPSA 3F2IA 3E1YE 2O8NA 1H2YA 6ADHA 2HEGA 1ZRMA 2NZJA 1U2SA 5AVOA 2Y1CA 1XJ0A 3CHYA 2FSIA 3VSEA 3WL4A 4J7AA 3ZWYA 1KWKA 1SU7A 1G0OA 2ZKLA 2UUCB 1SQ6A 1RQRA 3WGQA 4MKZA 3PQ8A 1E7RA 2YC4C 2ZJ1A 3BIWA 4FZVA 1UP6A 3IV7A 4J3NA 2P9BA 3CH4B 4PYQA 4A2CA 5AFSA 3N5CA 1RXWA 2JFUA 3DOFA 4W5HA 4ZRDA 1T3ZA 1WOYA 2Z8YA 1YK0A 3C5HA 3IP3A 4TVOA 1N6HA 4LSWA 3PEYA 1T5LA 1XU9A 1PZXA 4PINA 4PLTA 1R74A 3UJBA 6AT1A 5HEKA 1MQSA 2BT4A 2E82A 4N5MA 3DAHA 3OKFA 3UT0A 3KPVA 2DRIA 3OUTA 2AX4A 3A8TA 4UTZA 5AJUA 4C6SA 1O77A 1N7IA 1JFFB 2H65A 3OP4A 2BKVA 1WW2A 2IUYA 4MPRA 1TEVA 3I1FA 3VSCA 3NMUF 1JXQA 1YDFA 2WJ3A 4ZMBA 4F6LA 3E9QA 2Y1WA 2C7RA 2FVGA 3AF1A 1LJUA 4X54A 4RD6A 1RHKA 4MV7A 4LGYA 3KOMA 3LD9A 3UUWA 1OFVA 3U09A 1V8ZA 4IO0A 4DXHA 2OV2A 3CINA 4A2PA 3LYAA 4LQLA 4BC1A 4Z1OA 5C9ZA 3URMA 2NOAA 3LU1A 1Q1BA 4EHKA 1I7DA 3O21A 2NN3C 2XNDA 4MRMA 4G26A 1RWXA 4KLNA 5U4QA 2B3TA 3WHIA 3F6PA 3RV4A 1VL6A 1QO7A 3AYZB 3BF8A 2CNWA 3FHLA 3MD0A 4IP0A 3FF1A 4C7XA 1PL0A 3QG1A 1R8XA 5AM5A 4WLNA 3S1LA 3UWOA 4NPCA 3LX4A 5GVRA 3VKFA 2YZ2A 4PQEA 1DV1A 2BI7A 2FEPA 4QLBA 4H1WA 3ELYA 4L4XA 1W52X 2VJMB 1LA2A 5HGJA 4PTZA 1L1RA 3JSXA 3N2LA 4QHTA 3F7MA 1WZUA 3BOSA 1RLIA 1Y5LA 3NJ8A 5BVGA 4HQLA 3OPYA 1Z0JA 3IDAA 4GEKA 3RBVA 1DUVG 2IPAB 1J49A 4NCKA 4BO1A 1EUQA 1OH8A 2WUVA 2I80A 4OFXA 4W9NA 4LF9B 4I2NA 3UAWA 3OHPA 5HK8A 4QPJC 1QWSA 3CFYA 1X39A 5CEEA 3CV3A 4XWAA 2FZGA 2LDBA 2JBAA 3ISTA 3KDAA 2H1CA 4HQOA 3VR5A 4TZ0A 1U28A 5DIFA 1QXSA 1WXDA 1FFXA 2B5VA 2BWJA 1QCCA 3H2ZA 3N07A 3OLZA 4AJ9A 4EPTA 2VHVA 1PV1A 3OZAA 1REQA 1E0JA 3OCZA 4Q1DA 3FE2A 4JWKA 1ZN9A 4WERA 1LGYA 1OTYA 3PC8A 3J81k 3PEEA 3H83A 5HFNA 3VU8A 2MTBA 4EDFA 5B1HA 4CHTA 4Q9AA 3UPDA 3P2YA 4AZVA 4P08A 1F4VA 1N2XA 1CZRA 4ZYVA 1M6WA 2MINB 1R3UA 4BLWA 2XBUA 2B0CA 1K3UB 1YTLA 1S8AA 2G80A 1CZKA 4C3OB 1HLPA 3B9QA 5L3SB 1XLTC 1YD7A 2YXLA 3PFFA 1EGVB 3HQ4O 2I7CA 3TNFA 1X7YA 4MWTA 4OH1A 4HPJB 1L5LA 3TL3A 4B2YA 1E9SA 2ES4A 4DBLE 2CC2A 2JPDA 3I6BA 1XTKA 2E5LB 5DF1A 1NVDA 1E1CA 3I55B 5A3QA 1UK6A 4FHDA 5JAMA 4XVQA 4DHWA 1SEVA 3CNQS 5J2UF 2EJWA 3BC9A 1KARA 4RPGA 2CSUA 2R751 1HH4A 3H2GA 2IPXA 4MW6A 4X6XA 2HWUA 2Z4RA 4OKNA 3SM9A 3I5AA 3VR1A 3ZGVA 2ZRBA 4INZA 3OOCA 1PKEA 2YZMA 3BHJA 3A4VA 4P93A 4AJJA 3B6IA 4AROA 5KSZA 4NXMB 2ZQ5A 1GFIA 3BMOA 3CLVA 1JQ3A 1PG2A 3JQ6A 5LLSA 3RG8A 1QPGA 1E6KA 2CBZA 421PA 4C0BA 1DQRA 1ODKA 3V1UA 4H0FA 3EQZA 1DIAA 3IXMA 4U7GA 3CVXA 1VJ1A 4YUVA 4EECA 4OVKA 4MLDA 1NE2A 4DMLA 3M1IA 1VCHA 3BD6A 4IINA 3EC1A 2VJMA 1EQUA 1W8DA 1IN4A 2XUFA 1DV2A 2NU6B 2R4QA 3WAKA 3PFWO 4E5UA 1II8B 2BFDB 2QAGA 2WHRA 1V11A 4G9GA 4IJUA 1M0SA 4WKGA 3SSNA 3ZZTA 4XRGA 3JR7A 1O2DA 3N28A 1CT9A 3JWHA 4GNRA 5FJIA 2P9TA 3ANMA 1P2GA 2YN2A 1UM8A 1G7SA 2GPSA 2HCTA 2WNSA 3B13B 1MABB 3R7FA 4G1VA 5FRDA 3NQ41 3VHLB 1V5FA 3WKCA 4JB0A 1U1DA 3NBYC 3D43A 4M1QA 1GL7A 1N8SA 1LRKA 1QRAA 2G3YA 2YYZA 4P5PA 4WK6A 1NAHA 3HBLA 3K0KA 1ECGA 2AN3A 4O3FA 4HE6A 1P2SA 4TMWA 1P7WA 1FP4B 4IDOA 2DKFA 3I04A 1Y7HA 1WV0A 4A9AA 2XTZA 3TJZA 1RBYA 4EI8A 2C5GA 1MVNA 1YA4A 3DWIA 4X1YB 2VTBA 3VZDA 2NNLD 3K0EA 4XI9A 1KIAA 1VFPA 2P8SA 3N39C 1WB9A 1BYUA 1PGPA 1PJBA 1NUSA 2WG2A 2SCUA 3BK2A 4IQGA 1QIEA 2FH5B 1L5KA 1XRRA 1ZFNA 3OECA 3WLRA 2DUMA 1WCYA 4EM6A 2C1XA 3EVBA 5FUBA 3RJZA 4TKOB 4J4BA 3V00A 3A3OA 1TO6A 1EZ4A 1YRYE 2BJVA 1EVKA 1RAIA 1FU7A 4IHJB 5J58A 1KE1A 1L7XA 3OD5A 1NG1A 3GGPA 4C88A 1KAOA 1TUEA 2X58A 2VK8A 3A9WA 1PLJA 2ENWA 1V45E 1KY3A 1RYNA 4LYJA 3RM3A 3EXEB 2Z6UA 4Q1BA 1RKUA 1QVZA 2X1LA 2QAGC 2WUWE 4NYIQ 4RMIA 3S5UA 1H2XA 2EKDA 1UMDB 3O94A 3RIMA 1HT1E 2Z1NA 1J2YA 3PNPA 3TQHA 2GD6A 2WVHA 2ZPTX 1M2FA 2D3LA 4HEA6 2B2CA 2IIBA 1PAUA 4MS4B 4XX1A 3QH4A 3SJAA 2RGUA 4C6HA 3OCXA 2HSEA 1QGZA 2YOFA 1N0VC 4D0RA 1HNXB 3QVUA 3R77A 4RW0A 3A2MA 1H22A 1XYGA 3NHRA 1D5WA 1Y3BE 2B8TA 2HRCA 1OXBB 1NLFA 4N0QA 2OLJA 3BQ9A 2B7BA 3HG7A 3LY7A 2OGZA 1DT3A 2QRPA 4H18A 5AW8A 5KYTA 2XTMA 1W36B 5MDHA 2E4WA 2DECA 5KU1A 3QLJA 4MW7A 2LKDA 1R88A 4KQ9A 5AHKA 1V8OA 1PJAA 3GCWA 3THYB 2Z43A 2QR3A 3OOYA 4BE9A 4CU5A 2NVWA 4HNRA 1E9VA 3JU3A 5FV4A 4YHBA 3ZZNA 3UMRA 3QITA 4L4UA 4ZI7A 1ULBA 3KEGA 3M70A 2XVXA 3L93A 3M6MD 1CJCA 1RABA 1YRQA 4E5KA 5M34A 4QO8A 1K06A 5BY2A 4I4NA 6CHYA 4GOJA 4D3XA 4EI7A 3LKDA 5A62A 2XAUA 4BTLA 4AX8A 4X60A 2B1IA 3QPWA 3VHXA 1EIWA 4AP9A 2MU1A 2ZDHA 1QK3A 1EFHA 1M8FA 1Z0DA 3IA7A 3MJCA 4FMCB 4NF2A 4UDOA 4CL0A 2NW6A 2VBFA 3Q7RA 5IYWA 3F5QA 4UTOA 1NR5A 3BH0A 3IURA 2DJ5A 3WQZA 1MKYA 4LUCA 4EQ6A 3N2KA 1N3IA 2FJUA 2L17A 3KWJA 3R5JA 1E6MA 1JEOA 1NAIA 2YHIA 2XOKA 2O2IA 3KJXA 2K2WA 4G41A 4DADA 1G4HA 3VPCA 1IVYA 1CUWA 3V2HA 3U7FB 1HTTA 4AY2A 4L02A 1TD9A 3DHEA 2WINI 2O7QA 5EZYA 2PX0A 2YMMA 4YJ3A 4D80A 4EKYA 5EY5B 1SD1A 2O3SA 1C7RA 2X0IA 3UMCA 5F77A 4DFDA 4MK4A 5J9FA 4XFKA 3TR0A 5IF9A 5FPYA 3L5OA 4DR6B 3KYIB 5KVSA 1C30B 5K6AC 4AVYA 3DV0A 2F3RA 3KVVA 2WDZA 3QBDA 3SKYA 1Y8QB 1UPBA 3DNMA 2GH1A 5KSYA 2LKCA 4YBZA 2XVYA 4G0XA 4ZVKA 1QRRA 2FETA 5JS7A 5KX5B 2QENA 2R25B 3ONWA 2BJHA 3AB8A 3IMKA 4RMGA 4ETMA 2PSSA 3CH7A 2RGYA 3GA0A 4K05A 4CQJA 3CEMA 3PA6A 2C5LA 4P3KA 2VYVD 4AQDA 3ZHSA 2PGIA 1II8A 2QAGB 4AY3A 2B25A 4ZDWA 7REQB 1PE0A 4HH1A 2VJDA 4EW2A 3CEHA 5KBYA 4QDXA 1U8ZA 5TF0A 2P2YA 5GM2A 3SN6A 1LZKA 4I7EA 1SFRA 4FU0A 4I1UA 2NZVG 1ZU4A 1T8SA 3U3KA 1BDHA 1X0XA 1E2NA 3Q2OA 2DLDA 3SDZA 2I9KA 1DQPA 4Q7JB 2VHEA 4S12A 4EHAA 5C8DA 4FT4A 4K9NA 1UPTA 3WHKA 1UMKA 3DQQA 3F49S 2D1SA 4BZZA 1BD4A 1L7BA 1D6NA 2QOEA 5C53B 1E9BA 3F6CA 3SYLA 1YS2X 3SE7A 2OHIA 2JFQA 1JP7A 1GPAA 4X8MA 1E9RA 2CXQA 4ZOEA 3R7DA 4BTEA 5K03A 4KDCA 1E0KA 4KI7A 5ALMA 5DM60 2YZ7A 2ZZQA 2XHEA 1BWPA 3L0YA 5E6UB 2XR1A 3PP8A 1U9IA 2HMYB 3MLAA 3RU3A 5BSEA 1VL5A 3EF1A 2I2FA 1ZQ9A 2W6CX 1YR6A 4S1WA 5G0VA 4R7ZA 4W5NA 5KNDA 3N2GB 4IFEA 3G7NA 3FLAA 4UHJA 3SJPA 5F4JA 4I66A 1NP6A 2YWHA 4Q3LA 3TQFA 3L0ZA 1J33A 4BNDA 1DTEA 4J29A 2HPAA 5KDDA 1QGDA 3JZMA 5B2ZA 1Q0TA 5C4GB 2AK2A 2WIAA 3NBQA 1I01A 1S2NA 2VJLA 3DBRB 2DWQA 1MNAA 5FPSA 3CZMA 2VNIA 2YW9A 5L40A 3M5PA 5I9MA 1VMEA 1Z2EA 2PUGA 3FNGA 1P9RA 1UD6A 3N53A 4B3BA 1IM2A 1C0LA 2X4IA 4RXMA 2R3SA 5EPOA 4JCOA 3FJOA 1DLJA 1E5VA 2GBPA 2IYFA 2C9OA 2QTAA 3BIXA 3FFWA 3L0IB 3NHJA 2X5XA 4JUDX 4K7JA 5AICA 3BA6A 3ZWDA 4A8JC 2GCPA 4QUGA 3VVMA 1CJSA 2OT3B 3AKEA 3C70A 3RF7A 4M87A 3NASA 2A57A 4GOKA 5LOVA 2Q46A 3SR4A 3DHNA 1SRRA 4G86A 4F5EA 1P39A 2ZOSA 2HA6A 4TYNA 3B38A 1ORRA 2AOVA 4QM6A 3AHIA 4O0MA 1D2NA 2ZYTX 4C7BA 4MAFA 1OW3B 4YELA 2A5DA 3AO0B 2E4AA 3GFBA 4JI1B 2IVZA 4BNGA 3WWEA 5BQFA 1X7WB 4AG5A 3VSBA 2R1VB 5JZBA 2J3QA 2A35A 2W90A 3KZ1E 2EL7A 3N0VA 1ZA1A 5EWMB 4CMIB 1DC6A 2FRDC 4NU0A 1VBFA 4XIFA 4V0RA 3PUZA 4OSOA 4EENA 3RTCA 5A71A 1PUXA 5C4IA 1MEOA 5AXDA 1YO6A 2OL4A 1W44A 4BFUA 4LDRA 2X6YA 1H5QA 3GJ4A 1D1SA 1UOQA 2EFGA 1J90A 3H2JA 3IV6A 2VP2A 3PR3A 3BCUA 3BERA 4KR7A 4XMYA 2OQRA 5CM9C 2J6HA 3QEJA 4RDIA 5J2TB 2PUFA 5CVUA 3CX6A 2R7MA 4FE4A 1XRQA 4RDHA 1G8JA 4KWCA 5CLFA 3GNQA 2QGFA 3OZCA 4HQFA 4Z2AA 2R48A 3TSYA 4HAUA 2WU3A 3SNHA 3NIFB 1JEEA 4L5JA 3NVKI 4LJ9A 2IX3A 4DZTA 2QYTA 3IT3A 1NV8A 2GESA 4HEQA 4RMHA 1G42A 2I62A 3I6YA 3UNXA 4DBLC 5IPFA 3AIKA 3T4XA 3A32A 1DKUA 4FLFA 2YKGA 4K6GA 4GL2A 3LPAA 2I34A 2QPLA 1VE6A 2QPOA 4OMUA 3MT0A 1R66A 3ZH9B 1S6YA 5IAAA 3NEYA 4N0PA 4JH0A 3JQ7B 3EZ9A 1HMYA 1MPTA 5CBKA 5CYOA 4PFQA 5KTNA 1IY1A 1XU4A 1RXSA 4R83A 1BU8A 2GR9A 2BLLA 3LXUX 2FK8A 3OLCX 4MR8A 2HCJB 1CJUC 2HGSA 1YZKA 3ITNA 2RARA 5K8CA 1FU8A 3IQGX 3X44A 5JS6A 1I7LA 1T36B 2RI1A 3SS8A 4Z3DA 1MRSA 1FLNA 5KHOC 2DTEA 1TX4B 4BO3A 2HHHB 3AY0A 3TBKA 4BUJA 4K0KB 4XOPA 4CN9A 1K7XB 3BWYA 3OZTA 3N05A 4IIBA 1WA5A 3FWPA 3SJUA 3AF3A 1X3LA 3ZCVA 1PD1A 2I2DA 1T5SA 3C16C 3PQ3A 4KMMA 3RYIB 4EG0A 1OAAA 2O57A 2PV7A 2JARA 2CZGA 2PANA 2VUTA 3UJDA 4A26A 1MU0A 4IIFA 3IDZA 1FRZA 1UBTS 3RVMA 5KDLA 4GPZA 4QDZA 1H5NA 5IJXA 2JHAA 4ITVA 3T1OA 3FR7A 5CH3A 3SYMA 4AWAA 2HV8A 4BNWA 1O08A 2QWXA 4DZZA 1MX5A 1Y1TA 2IYUA 5KTKA 4GRAA 5JBIA 2VWPA 3C3WA 1ZO8A 1R0XA 2FPGA 5CA1B 1V7CA 3EEFA 2KWIA 5KQMA 1GA1A 3ZLTA 3GYBA 2XB2A 3JCZA 1OFIA 4WACA 4MWBA 3ZDQA 5AH0A 3FMGA 5TMBA 4RGQA 3HEAA 4L9SA 5A5FA 3EF0A 3G4SB 1UT8A 3AB3A 4U9IS 5EPEA 2V5VA 5IC6A 2Y93A 5I7VA 3CB4A 3QKRB 1E5TA 4KFRA 3K5IA 4PPFA 1KY4A 3IMCA 1RJWA 2E4UA 2ZYDA 2BM8A 3EHDA 1XRLA 2YV1A 1YHYA 1UQUA 2O2CA 2VAVA 2JJYA 4YFVA 2A1UA 2GYWA 2NADA 4NHOA 1V3UA 1SC6A 2GCOB 3BQJA 3GZNB 4V38A 3ZHYA 3PITA 3NI2A 4JJFA 4BXOB 1T8PA 2NTNA 5DSZA 1QAQA 4HH0A 3WNZA 5FFNA 3N1UA 5KYUB 4BFLA 3HO1A 1DXOA 2XT9A 4Z4IA 3DGEC 3P9RA 4Y6GB 3P9QA 1T8YA 4LZNA 5E3JA 3VTZA 2DR3A 3DEAA 2FJPA 4B79A 5IBCA 2YASA 3GJZA 3QLVC 4JGGA 5E6RB 3VPSA 5J5AA 3BWXA 2N3ZA 1VQ7B 5HTKA 2YY6A 3A58B 3PRYA 4Q4JA 5DP1A 2FOLA 1MC8A 1F0PA 2QX8A 3DEZA 3UXEA 3K05A 4HMQA 4MQUA 1Y8RA 1EGQA 4DV2B 1ZM4A 1Z82A 3KJFA 5LWQA 3VYTB 3I9KA 2I3AA 2QN2A 2AEJA 1WPQA 1E1NA 1ESZA 5CYGA 1UM9B 4RLHA 1ZM3A 4R7GA 4TMZA 1SCUB 2EC5A 3EGCA 3FKSD 3X43A 3W6ZA 4DLNA 4DK0A 3ILXA 5THQA 1IHYA 3M1YA 1ONOA 4NBNA 3T3HA 2EZ4A 2JGDB 2I6TA 3HLTA 4J1TC 5LCXA 3V7NA 1R0CA 3T8YA 4F85A 1NDHA 1YB2A 4NBTA 3ROMA 5CH8A 4MDEA 1GNTA 1QYCA 2XQGA 1CZLA 2A3RA 5K5EA 1JFTA 1E3MA 2WKQA 3C1UA 1KZ6A 3D7KA 2UKDA 2VHXA 4RVGA 2BKXA 4DT1B 4U2EA 3B1FA 1QKIA 3II6X 4RL4A 4NNJA 1IAQA 2R6FA 3UZUA 4CG0A 1JH8A 1HG1A 5JC8A 4PFSA 1OGYA 3E03A 4KC0A 5L3RA 4O2BA 3GJ6A 2QA4B 5FQOA 5IUNC 4BQPA 3VU3A 1C7EA 2B36A 5BSMA 4FFOA 5KYGA 4X41A 2P2ZA 2OXCA 2FCAA 4J0DA 1AQNA 3Q3GE 1KJQA 2XCUA 3ADOA 1WW3A 5G1OA 5JQGA 2J48A 2FN4A 2YHIB 1AD2A 4JT8A 3TD6A 1U0FA 1IOLA 4DQUA 3R7LA 1UOOA 2B1QA 4GZ6A 2J6BA 1G19A 4Q9LA 4DYVA 1QNLA 2Z95A 1FFBA 1DCMA 1F8FA 1NUPA 2VEDA 4Y2UA 2OCYC 4DN6A 1P5JA 4JYZA 2CLOB 3ACCA 3FWNA 3HPQA 1GDDA 2VXOA 5BVHA 3KYDB 3ND9A 2B30A 2W6QA 3B1JA 4A36A 1W5EA 1QJ4A 1ZA2A 3P9ZA 1KY5A 4KE7A 4LG1A 4BWYA 3WYNA 2HSJA 1WD5A 3NORA 4BKQA 1RJ9A 1MO5A 1XE3A 4LXTA 1E1QD 3ZWAA 1DS6A 4FN5A 3PE4A 3OETA 4L8WB 2ODNA 3IIJA 4UXHA 2W70A 2OUIA 2QRUA 5DHUA 2EW8A 4XX0A 3MVEA 3MMNA 1Y81A 4Y9UA 2P0EA 4J1TA 4NEGA 4WX2B 5F2EA 4KPGA 5TV2A 5D1HA 5A7FA 3IGFA 4IIXA 4AURA 2FMIA 1QU3A 4PBTA 2VDNB 2C97A 2G9RA 3WNBA 1WKCA 3L49A 4FFNA 3W3AA 4B32A 4L8JA 1RFGE 1RHUA 4JQOA 5JD3A 1I7PA 1PR3A 2GPWA 1KMQA 2FSHA 2J7KA 2J5BA 4NBWA 3O91A 3I3OA 2UYHA 4BVJA 4J03A 1G20A 4JVLA 4PCVA 2JFWA 3AHGA 2P90A 1C7JA 1RXIA 1TRKA 2P9YA 3PEUA 2H3HA 4EJSB 1IBMB 1O7JA 4GOMD 2RHDA 4IOLA 2F8MA 4TRRA 1GQ2A 3G23A 3CWZA 4N8SA 3HDTA 2JEYA 5CNIA 1RXYA 3C48A 5DBHX 1XQWA 4E09A 1M73E 4EHBA 3JASB 4J6FA 5CAEB 1SVNA 3AF2A 3RYCA 2QGZA 1HQDA 2VVTA 4D42A 3O73A 3LY9A 4DCMA 1R5JA 4ZAVA 1T4CB 1QF7A 1MAHA 3BD9A 2I5PO 3FJ1A 3TE7A 3AJAA 4BAGA 1MG5A 4D9HA 3K6KA 1D1TA 2BDUA 1SXJE 4XLTA 4GUAA 2NSYA 4PAQA 1T5TA 1VE7A 2QLMA 3UMJA 1NFRA 1G2QA 1WZNA 1UXKA 2QROA 5D5QA 3R3HA 2FZLA 1RPTA 4UCFA 2AEMA 4D6YA 1Z5ZA 1WP4A 4MGIR 1YMVA 1J4AA 3DT8A 5D3KA 4HVLA 4BFWA 1GN8A 2I3GA 4B85A 2XGOA 1Z75A 2P1ZA 3QYPA 2GT1A 4I5EA 1INLA 4U8GA 4D9BA 3BT7A 3LS2A 4RK7A 1VE3A 4CEIA 1JUDA 3RTBA 2WU0A 3DH0A 1J2UA 4ENUA 3NAGA 1AS3A 3L0BA 3N70A 1H2ZA 4B3RB 2Q6VA 3LYHA 4KE8A 1NN5A 4A1FA 2BRUA 1EWYA 3V4OA 3D6JA 5LB2A 4K46A 4OXIA 4XOTA 4HWRA 3DKIA 4FP9A 4XKWA 2R8YA 4OP1A 4C20A 1S8FA 1G8SA 1NVWQ 3BB4A 1QYVA 5K1ZA 1WM1A 2QXTA 2X53S 3RT1A 1E3JA 2OC9A 5HM8A 4GYJA 1USUA 1X2BA 1EDBA 3A3YA 4H7IA 2WFMA 4KPFC 3DVLA 4JI4B 7ADHA 4B73A 2WUFA 3STUA 1CP3A 4KK4A 3G7UA 4BFVA 1UDBA 4OLHA 2PRJA 4PV7A 3R9IA 3KZMA 5TPZD 3HY4A 2O1EA 1QLHA 1AT1A 1POWA 3LX5A 2UVPA 3P97A 3PHCA 3EZ6A 1FYVA 5FF9A 1PT9A 4MVJE 5K3FB 1V1JA 2GM5A 5H5JA 3C87A 3WAGA 2QW0X 2SBTA 1U9JA 3W5AA 3PF9A 1OHHD 2HU5A 3C4JA 2TS1A 1R7RA 2CW5A 3RREA 4JLOA 3VR0A 5J2TA 3W3ZB 3H05A 3AC0A 4PTYA 4XUCA 5LQRA 1W2GA 3I0ZA 2QTVB 1VJ0A 3T3PB 1Z0IA 2V3VA 4EPXA 5JXGA 3ASZA 4HRVA 4DTCA 5HA5A 1U0HC 1VPEA 4FWBA 3TL2A 3TOZA 4BNUA 5GP1A 1KOGA 3FNHA 2GEJA 4YJ2F 4RF5A 2H1IA 3ZDRA 3TUZC 5K20A 4C9BA 3AG6A 4HB2A 1UWCA 4N65A 3TLGA 2R1VA 3K30A 2ZL6A 3IHLA 3DOOA 4FFLA 4CEIB 4IIJF 1IY8A 1A98A 4UBLA 2WWIA 1VHWA 4E33A 2OE2A 4C01A 5CLJA 5JYDA 4BKPA 3KVYA 3PPYA 3GC6A 1YBAA 4XM2A 1ULZA 2W4QA 3A31A 3MHPA 2X7JA 4TKVB 3EGVA 1SG9A 2CJWB 2MR5A 4GOXA 4MTLA 5JH7B 4X00A 2PNJA 2ZRKA 1Q5PA 2SNIE 1DAPA 5AVUA 4L4SA 1MX1A 4U6QA 5KU7A 1VHOA 3EPJA 2HZBA 2B3DA 1RRGA 1JMYA 1CDOA 3L7IA 1DCFA 2O1SA 4XEUA 1HGXA 1P1HA 5D3QA 1TZBA 2OVFA 1SN7A 3ME5A 4ZYLA 3AEUA 2ZZEA 3BRSA 1CZOA 1SOUA 3IPCA 3OCVA 4F8YA 4KACA 4UBKA 3LPCA 1W19A 3V34A 3VH4A 4RETA 2RI6A 3U17A 3W9YA 1C9JA 4C2BA 4PC2A 3TD2A 4WLVA 3UYKA 4D9JA 5LU8A 1MIHA 2M6LA 2IS2A 3GUZA 2EOAA 4N18A 3VUEA 1X1EA 3O75A 4KIFA 4ZJUA 3CCFA 1Q6YA 1NX6A 1VHJA 2AJBA 1CQJA 2I8LA 1N2CB 2XMBA 3D8RA 3TDKA 4MULA 2DY1A 3IR5A 3D7RA 4PIMA 4PYLA 4MQMA 2Q1YA 3WV5A 1FNNA 5REQA 3T9DA 4BWGA 5FTNA 4QGBA 4II3A 1B6GA 1AO0A 1LU9A 5K9ZA 1G63A 1JAHA 4C6TB 3OJXA 1T2EA 4PYIA 3GDOA 4D92A 1CUDA 2WJZB 4OHCA 1PG0A 3MQ2A 4IGAA 1KMMA 1XTVA 4WKPA 3JVEA 3O8CA 2VBIA 3ZHRA 1ZUIA 3B1ZA 2XMCA 1DKPA 1YDEA 2C4KA 2F90A 3HXQA 2OBSA 1U0SY 3G2IA 3CVYA 3AUSA 3TCNA 1E2HA 4MAMA 4QSMA 4EABA 3L9XA 1W9MA 4BMVA 2IWRA 1PT6A 3UXYA 5BVHB 4Y9RA 5DJ5A 4ZHQA 5LQKA 5FL7A 4LQCA 3SMVA 1NBME 3M6VA 3WDLA 1QQAA 2PL9A 3PXGA 3OIYA 1YIJB 1E5QA 1ZISA 1DNPA 4NABA 3W1WA 4QRIA 3GP5A 5CFMA 3VJMA 2AFIA 2Q3HA 2VYNA 3STXA 3EBPA 1TQ8A 1N1MA 3L1UA 3Q2IA 3QXXA 1Q19A 1IK6A 4FQ8A 5LXTF 4EHHA 3KOWA 5JLAA 3LC0A 1Z0KA 3ESZA 1RI2A 4QVJA 2FR1A 1VPWA 1Z16A 3LW7A 4P3XA 3T7IA 2QYOA 3ZV3A 4QYXA 5DX8A 1JXOA 4LWPA 2PU7A 3VBCA 1XZGA 5FI0B 4LGVA 5EP4A 5ITWA 4FEYA 1VBNA 1YIOA 2WKSA 3D6FA 3VO8A 1SELA 4Z4SA 3HKEA 1JG3A 1E2DA 3GNLA 5H82A 2R62A 3TSAA 3L01A 2Z2YA 3PC4A 3DXXA 2HJ9A 2WHYA 4TLMB 4OQNA 4P0PB 1WP6A 4IHAA 4P38A 2QZPA 1O95A 1V5GA 2PO5A 1T9ZA 3GU3A 1DWPA 3OICA 4R1NA 4Y6PA 1ZK1A 1EDZA 1YKFA 3CLUC 4J4TA 4MQFA 4YGXB 1X1DA 4Q9HA 4P25A 4LHVA 2OC4A 2ZYAA 4JB8A 3TQCA 4Z4HA 1I0LA 2IYSA 1P9OA 3QEOA 4HDNA 2Z04A 1P5ZB 2PH5A 1Z25A 1G9XA 1AZSC 5IBQA 4BCCA 2BM1A 5LSAA 3GN2A 1A5SB 3QKIA 3A9TA 3B6JA 4KL8S 2QD1A 1CLUA 2C58A 3DAPA 3DEFA 3V8MA 5JALA 3GLQA 5JROA 4KI0A 2GASA 4DRXA 4R1SA 3TRFA 3N9IA 2WFZA 1K8XB 3EQ2A 3D3NA 3EC7A 3IAHA 4ZO7A 4Q05A 1E1QA 4QFDA 4JLMA 3UMMA 3AFOA 4OIFA 4MWGA 5EFOA 3RYHB 2XKJE 2Z6AA 4B5KA 2VYND 4HLCA 4K6FA 4R69A 4US2R 3LLMA 3GFGA 3HZZA 1R5BA 3GRRA 3OT1A 3QOFA 2J5QA 4M88A 4KXLA 3NWJA 4LC1A 5BQ3A 1JAXA 2PGDA 2DM6A 4C0QC 2PD3A 3R3ZA 4E7OA 4FYPA 5BW5A 4Q82A 4BQOA 3UT6A 5G4KA 1ENOA 5KVQA 2EBHX 4MW5A 2Z8XA 2O9JA 3D4PA 3HDQA 4OHBA 3C45A 3KD2A 4ID3A 4TLLB 1H4VB 3F7TA 2XCTB 3VDNB 3K35A 3TLYA 1A9YA 2I6QA 3KALA 4BL5A 3VDRA 5ITVA 2I4NA 3QIAA 2BONA 1V2GA 3MAJA 1DCTA 1M7HA 2XADA 4MGEA 4HX5A 4AMYA 4HYYA 4B6RA 4OP3A 4CLOB 5CFOA 1JPVA 5HKAA 4JR2A 4OL0A 1OXTA 3FNIA 1S3GA 5HRUA 3TLMA 4KRGA 3BNWA 3REGA 5LP6C 5LC1A 4AI6A 4DABA 5D5PA 2Q4RA 2ZIGA 2ZSEA 3T38A 2OGTA 4WZ6A 4NMLA 3DZCA 3NHKA 5D7NA 4WOBA 5A5DA 5J4YA 3SPXA 3GLUA 2ASEA 2OZPA 3SJZA 3IIMA 5LMCA 1XQ6A 2PA3A 3A6EA 5FWXB 1Z6XA 2G1AA 5I9NA 1XMOB 4DLPA 5JZMA 1NRWA 4DILA 5AKHA 3ZXIA 1W5FA 3QOYA 4BMCA 3N6RA 5CT9A 2PK3A 1Z17A 4IHKA 4B75A 4Q4DA 4EA9A 2PXHA 4C0WA 1KI7A 1ICIA 1BN6A 1NDUA 3ZHCA 3HVJA 3EK2A 2GYVA 3OEWA 2VWQA 1NJID 1AXEA 5D7BA 4A73A 2FPWA 1NUHA 1M2VB 5DM1A 1NXOA 4U2KA 5HFAA 1TUIA 2AD1A 2CLEB 2GK3A 2JLSA 3AY3A 1ZM7A 4BV9A 1EFAA 1R9NA 3HDGA 3R3UA 3ZX4A 2A5JA 2F3PA 2QMEA 1SWVA 4F97A 4MYSA 2ZUTA 3K70C 4U02A 2A7XA 4K6OA 4L7VA 2EERA 2O0LA 2EIHA 3QUSA 2FSPA 3A3BA 3MOSA 1TZCA 2J5XA 3BTSA 4JQSA 3DL4A 4GI5A 4WJLA 1PBNA 4EOGA 1RWNA 4EG1A 5KOIA 4GQAA 3NFRA 1MRNA 5COQA 3MJSA 4YAUA 3EARA 2PGXA 4N8DA 4PQYA 1WXXA 4RZ3A 2QL7A 4E5MA 5KTPA 3P2KA 4Y1RB 1OIXA 4D9EA 4PZCA 1OIWA 2Y9PB 1X74A 3RIGA 3PQDA 1FLAA 3TK1A 1SUSA 4ND3A 2DTDA 4L27A 3VV2A 3AUXA 4AWXA 1V1MA 5CB4A 1M2EA 3FG9A 4JLBA 3EXFA 1XEXA 3SHOA 1W73A 3VR5D 1EM8B 8ABPA 4YY3B 1U0GA 2BIFA 5MGNA 5KI6A 3HBMA 1XZBA 1OTHA 5B3KA 5G0UA 2H0RA 5JNWA 1LF5A 2ZTLA 3I4LA 4FOSA 3WMFA 4F7DA 3H8WA 3TSZA 1OC4A 3PVDA 1XMPA 3CW9A 1W46A 4ENRA 1VP3A 1X0VA 3A9RA 2YHUA 1Q7EA 3G1UA 3JRXA 4D56A 1IXRC 5JHGB 5LZ2A 4DUYB 4J0CA 3Q11A 4X8OA 1ZH6A 4JBLA 5DOVA 2QVBA 5IF3A 9MHTA 1X2EA 1V8BA 3ZWPA 3WZLA 1NQWA 2WFLA 2KM1A 3C6QA 5ALHA 2A94A 3Q8MA 2V7PA 3GRAA 3N2GA 3W8NA 1MNQA 5KUTA 2QRGA 3HWRA 3AI3A 2IHYA 3EVAA 1NBMA 1KEKA 4YT4A 2A5FA 3CZ4A 1VSVA 5JHHB 5IYRA 2O8BA 1Z47A 1DLIA 3UG7A 3R3WA 1G3UA 3T4PA 1TCCA 3E6AA 5LQJA 2D6FA 3C3JA 4I6EA 1IOVA 2C9CA 5CITA 2QE7A 3PA1A 2P5UA 1R0LA 4IM7A 4F2PA 3RYFA 5C37A 3C7AA 5KTRA 2OO5C 3RI3A 1WETA 1JDTA 3GJ3A 2DYKA 2A14A 1JR3A 3B9RA 3WAJA 4NNOA 2J30A 4MRMB 1YV9A 3F4LA 3QIVA 5FBHA 4RV4A 5KHLB 3GBVA 3A6FA 5JXWA 5A6VA 5K45A 3U4QA 1CFJA 1K73D 2H11A 4RK6A 1G8HA 5C5DA 2BKLA 2G1KA 2X5OA 4JSRA 1ZLXA 4HGNA 1AHIA 1Y7IA 1THGA 3G89A 3I32A 1MDFA 2P65A 3FDJA 1CNEA 1PJ5A 3IUBA 3NJRA 3QPBA 4NMWA 4WNAB 4YACA 5E9AA 1QFJA 2H06A 5EN4A 2VP0A 4K9RA 2P5SA 1H85A 2ORVA 1CK4A 1FY2A 2PD6A 1U2RA 1ZMRA 4M1WA 3UK7A 1N8RD 2HA0A 5K3BA 1OAOA 3A3NA 2BKEA 4IIHA 4HH3C 4OPMA 4MI3A 2ZXHA 3ICEA 1JVNA 2PGAA 1QMGA 5INTA 2D5BA 5DKFA 2BM0A 3PVCA 1YZFA 1W59A 1LBIA 1SG0A 3FB1A 4QOJA 2DY0A 4L2IA 1JKIA 5I7RA 3HB0A 4AJHA 1T1GA 3A2KA 4Q7EA 3L2OB 4M86A 4B84A 4IYRA 4NCAA 1YH3A 4YCMA 1G5QA 3D2CA 4O2AF 3LGSA 2KVOA 3MWJA 3ONEA 4H77A 4IDAA 4NQZA 2XMRA 4F3CA 3LLUA 1E63A 3EAQA 1DC4A 5IHPA 3VOTA 1GGMA 2V96A 4C4PA 5KCZA 3OJ0A 3HNRA 4UNIA 1ZNQO 2Q62A 4D6XA 3H5WA 4NCXA 3ZQKA 1P4HA 2E6KA 2I4TA 1Q21A 4HAWA 1GN9A 1PJLA 3MZ0A 3QTTA 3PUNA 3IV9A 5DLEA 3COPA 2H1VA 2JLCA 2P2GA 3DAOA 4IL5A 5DMXA 1ETUA 1M34B 4GMHA 3OD1A 4KIGA 2OK8A 5I45A 5CT6A 1EX6A 2W2NA 3LZCA 2JI4A 5HMMA 1QUFA 4F86A 5A9SB 5DLDA 2I2XB 1FL9A 4NULA 2V4DA 5EA2A 1F6BA 5BSWA 3D0RA 1WO8A 3ETCA 1HNNA 1NQTA 1HMPA 3H1PA 2J0UA 4PCAA 4V39A 1RRVA 3TLEA 2CV0A 5LR6A 3GRVA 8OHMA 1RYMA 5FBZA 1IRXA 2CHGA 1MJFA 4PM4A 1N92A 3E0QA 4BC0A 2QX9A 1T43A 1KSJA 2RHBA 4X6YA 4X7BA 3NVMB 5A05A 3BDIA 4QZVA 2YR0A 1IJBA 3HJBA 5D3MB 3S2FA 1E2LA 5EKSA 4HO1X 1KOLA 5A7HA 8ATCA 5J5CA 3M6XA 4NOKA 4UM7A 5SYMA 2IS4A 1FX0A 3ER6A 4LNUA 4JLJA 2YVQA 3EOZA 6YASA 1FMTA 2XMPA 3PXCX 3TSOA 4ND1A 5HX7A 3CLUD 2GETA 1FFWA 2REBA 1I2CA 4FBMA 3OQOA 1GCAA 3PNOA 3DUWA 4H27A 4XNFA 1Z6PA 2IIVA 3BJZA 2UXCB 1FYEA 1L8LA 1Q3KA 1KMNA 1U1FA 2FFRA 2CL6X 4KLCA 3ZLVA 5H9WA 1G55A 2YFKA 2NGRA 2O1WA 1XB2A 2JS7A 1JSXA 4OPOA 1XDDA 2ZRFA 3OTOB 5LZ5A 3Q72A 3ZIDA 5AVXA 4JI2B 2SKEA 2WJ6A 3FZNA 3IJ5A 1J0DA 1RJDA 1S3SA 3OFJA 2HUPA 4LMPA 2VJAA 3KKQA 2AOTA 2B4RO 3GMSA 3RSHA 1NATA 3HABA 1A3CA 4ZI7B 1F9EA 2DFPA 4DNQA 1MAVA 3M9XA 4CI9A 1SU8A 3HZHA 3I5MA 4C1NA 2HIMA 1XZAA 2W00A 3DO6A 4BZXA 3EULA 1Y63A 4Z4YA 3THYA 4IKEA 4ZEOA 5JXIA 4H4DA 4JI3B 4I2VA 4R7TA 5L45A 3QA9A 4Z9BA 1BE8A 3UW1A 5IN5A 3ZE1B 4YPVA 2RK4A 3I52A 1TAQA 1RMTA 3B3FA 4CCYA 1WCIA 4PGFA 4BGDA 4LF8B 3A6ZA 1SZJG 3PUHA 1F7UA 1TOAA 3ISJA 4IQ4A 4XL9A 5JCOA 3REFA 2C77A 4X7PA 2GEVA 3IPXA 3H5IA 3O4JA 4DIUA 5BRJA 1SH7A 3GCGA 2D3WA 4X7EA 4OBWA 4TKLA 4DV7B 1OX5A 4BECA 1VCIA 4UE2A 2O06A 1H3EA 4NPHA 3M81A 2MYTA 2QT1A 4QBIA 3WA6A 1FA9A 2H1LA 3EGOA 2JFXA 2ZXFA 5FI1B 1W4AA 3GT3A 4DAEA 3AYXB 5JDIC 4E70A 2VYQA 1GCUA 3OW7A 1RQGA 2CK3D 2PRSA 2W8BA 3ACDA 3NUZA 4L6IA 1TL7C 2FJ0A 2VP5A 3SVZA 3UJHA 3ASQA 2H4FA 1XRNA 4EPYA 3BEDA 3PGMA 5EJ2A 1ESEA 1JEQB 1QLJA 1S9HA 1XUOA 2ZIVB 4IZ6A 4XCQA 3V9PA 2I66A 2FWAA 3HADA 3C4QA 3BMCB 5BW8A 2Q0SA 3GUCA 4KR3A 1PFWA 3E2IA 3BGWA 1VSTA 3WE7A 3CR7A 3PKZA 5CCDA 3GX1A 1ZHHA 2KYRA 4RPKA 1X9GA 3FSGD 3CC2B 3PDUA 2Q3JA 1Y42X 4JOQA 4MJLA 1GADO 1UMBB 5SZKB 1J5EB 4FNMA 2IHNA 2NU6A 5EIFA 4K1LA 1BHQ1 5HXBA 4JGBA 3UTCA 4EGSA 5B3LA 3ZDBA 2D0PB 4R8MA 2GRJA 3ZKAA 3ZIAA 2OA0A 1W85B 2ZITA 2JJ8A 2L42A 4RBNA 4M54A 2ZJ2A 2WB2A 1BGXT 3IEUA 2WF7A 3DAGA 3Q6RA 1F48A 4PSKA 2JZNA 3PI7A 1XAHA 4OHXA 4E30A 1Y3DE 3UWPA 4XWKA 1SUAA 4GVPA 3U3XA 4QLOA 4JJ6A 2IQIA 1VGRA 1VGVA 1Q1GA 4JC8A 5FL7D 4HGZA 1M6HA 1O03A 3GGDA 4DV5B 1H2WA 1I2BA 3OIVA 4ND6A 1JTEA 4P4SA 3NDJA 2VNHA 1XCPA 1LTKA 1TECE 3KAPA 3KWMA 1U1CA 2AI1A 1PVVA 4ND4A 4Q7KA 4CLOA 5FBLB 2RBEA 3JD0A 1Y1SA 2HEIA 2P3SA 2WP0A 4N4AA 1GTRA 1KKMA 2P9HA 1Y5IA 3G2OA 2VDOB 1DKQA 3FVWA 2NX2A 4Z9FA 1JR6A 1T4DA 4LE1A 2W4IA 2Z2KA 3ND6A 4RM0A 1X8KA 2ZKIA 3O90A 4Q48A 5B3JA 2JGFA 1KEVA 4PQRA 4EB3A 3O84A 1PEAA 3KR0A 4O29A 1DKLA 1DJLA 4R84A 2FW0A 3FBGA 4TL9A 1II0A 1ZMXA 4X92A 4CXMA 2JI7A 4XWGA 3ZE2B 4D8YA 3WLLA 5F73A 2IH2A 1TVKA 2YJGA 1AKYA 1M6YA 1NL3A 3C7KA 4RACA 4RVDA 5CLQA 3T9FA 4REQA 4BWVA 2WWWA 3EQ7A 2W6ID 5JWOA 3ZDAA 4LF7B 4X07A 3AK4A 3KKKA 3Q39A 1XCBA 3KQMA 3MTIA 3A1NA 2H59A 3LDAA 3KPWA 4MPPA 5ALGA 1JG2A 1WLYA 4MIEA 4MW4A 1I0ZA 1X1BA 1GU0A 5EKDA 5EKXA 1U02A 3SLKA 3W5IA 4EUFA 1I32A 3NBAA 1FW8A 3OQVA 5HGXA 1F60A 4EYKA 1T1SA 5AQEA 5FP0A 3GQBA 3E58A 3OEYA 5LXTB 4H9GA 1EAYA 1VQOB 4GYKA 3G5MA 2XUZA 3P94A 4CMIA 1OVGA 1TD1A 1TJ5A 1GRRA 5GTDA 1NASA 1P45A 4YRGA 3JYHA 3SHWA 3LTNC 4YCNA 3AP2A 3IDOA 2CVHA 1M6NA 3IVRA 2BH9A 2F1HA 3LH5A 3QJYA 2NU7B 4J90A 1NLYA 4B9AA 1JBKA 1NNI1 4Q7MB 4DGQA 4ENTA 4XLCA 3DL2A 1J9GA 4JI0B 1HORA 4ZODA 3OMWA 5EMMA 1FDOA 2ZBPA 4LJ8A 1DG9A 3Q6IA 4GOLD 4LIPD 4WCDA 1O8BA 2BI4A 3CMMA 2CD7A 1PNOA 1FJGB 1JALA 4RWEA 3ZU6A 2JD1A 3OF5A 4WMLA 1Z62A 4FZRA 4MI1A 4ZVTA 1YZQA 2FUG1 3PDWA 1KDTA 3HHPA 4LA4A 2O0KA 4QEZA 3K9WA 1B3RA 2QRJA 3S1AB 4FM9A 3ZGXA 1XEXB 3R41A 4I8XA 4RKRA 4I5FA 4REQB 2Q21A 5BV7A 2P7HA 2J7PA 1VGQA 2HQBA 1ANKA 1SK9A 1KSGA 4OQLA 3AM1A 1WU7A 4WVLA 5K0EA 4F93B 3MYYA 3VR6H 1QOPB 1OBCA 4RZSA 3GLFB 2VJNA 1VHTA 3QW2A 5EYPA 3QKTA 3U3MA 3HYTA 4E08A 2Y0PA 1T2FA 4CM5A 3DNPA 5U9CA 1FMLA 4CBVA 2C94A 1W88B 4YT5A 1X7ZA 2EFDB 1C7FA 3FUVA 3G79A 4TXJA 3C5WP 4WESB 4QOFA 1B43A 1X19A 1NLMA 1WF3A 4XGQA 1YR7A 3B2NA 4ZU1X 2AIRA 3IUNA 2AI3A 4GNKA 3KFLA 3RVOA 2XVMA 3QVTA 4HNGA 4PPYA 1RMQA 3U7QB 4MYRA 4GWKA 3RBAA 3IC5A 4BZWA 4C5BA 4EATA 3KQLA 2VIIA 2CV2A 4K87A 2QT0A 4GPBA 3B6KA 3M49A 2H2GA 3HY6A 3VO9A 4EGJA 2JIMA 2WOOA 1ENPA 1X1QA 2EL9A 3DZHA 2TSYB 2W2LD 1UT5A 5FO1A 4J4HA 4C0AC 1I2AA 2IUUA 5M5BA 1F3OA 4MO9A 5AI5A 4DNXA 1NXXA 2MSKA 4ITRC 4TPKA 3LG2A 3FLEA 1XROA 2ZATA 4RFVA 4GDFA 1D1PA 221PA 2ESRA 3C3EA 3QFFA 3F67A 5CX1A 3E61A 5HZHA 1N2EA 1FLDA 1X42A 2W6JA 3B5IA 2AG5A 3RSZA 3PC7A 5AK3A 4ECEA 4CIBA 1I24A 4MUFA 2NSJA 2UYYA 3ZCUA 3G9TA 4B87A 1JWLA 3QE0A 2R9VA 3AY6A 3KU1A 1TVMA 1U2GC 1AZTA 4KQCA 5FJJA 2A0WA 4TWBA 3HB4X 2PH3A 4ZHSA 1ZYUA 2OHFA 4DR4B 5TQVA 1EE2A 5L9AA 2CZQA 4G3XA 3IXQA 5FR2A 2PIDA 4OBBA 2JCGA 4N39A 3TIFA 2GYUA 2P4QA 4ZVRA 5JCJA 1ZCBA 2C3YA 3UKJA 4D45A 1DXYA 1QU2A 4AKIA 3IP6A 4JI5B 1EEHA 2ANBA 3ZNQA 2CT8A 3TG2A 3LX8A 1GTL1 4E2YA 1VDMA 3NM6B 2JH8A 5H16A 3VAAA 4ER7A 2POCA 2O3QA 3G49A 1AKUA 3WL7A 3GW8A 2EHDA 3KXIA 5FI3A 5J4LA 5JVDF 4Z5XA 1N0IA 2GM9A 3GAAA 4P34A 2ZG6A