1EWYA

Anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
303
structure length
303
Chain Sequence
TQAKAKHADVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title Crystallographic studies of the interaction between the ferredoxin-NADP+ reductase and ferredoxin from the cyanobacterium Anabaena: looking for the elusive ferredoxin molecule.
pubmed doi rcsb
total genus 77
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2000-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ewyA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1ewyA02
3WXMA 3W2EA 3QFCA 3QE2A 1W87A 1ZM3A 2QDXA 1VQOB 1VQMB 2VNIA 2GPJA 1EXMA 2BN4A 4C0SA 4LBZA 2C77A 1EP1B 1ZM2A 3VMFA 1XE1A 4B48A 4YAOA 1CQXA 3WNDA 1QUEA 2XNCA 1KK0A 1BQEA 4ZGNB 4PGOA 1IB0A 1QG0A 3CD6B 4RD4A 1QGAA 3E1YE 5EMNA 2NPFA 4RD3A 1Q82D 4PC3A 1NDHA 4BPRA 1QGZA 2BGIA 4Y9UA 2GQFA 3JQQA 3I1FA 3U2QA 3AGQA 1VQ4B 3W2HA 5H59A 2VNKA 4NCNA 4PC1A 3WNBA 3PENA 1OGIA 3CCQB 1Q7YD 3B78A 4RD1A 2B7BA 1FNDA 2BGJA 1KD1D 2EIXA 2OK8A 4ACAA 4TMTA 1OB5A 1VQNB 2RC5A 3VNUA 3WNCA 2XEXA 2FX3A 4DQLA 1VQPB 1Q81D 1R5BA 4F7DA 3LVBA 3G6EB 2HCJB 4K1XA 4IW3B 2PIAA 2QTLA 4RCZA 1E62A 1G7CA 2PMDA 2PLFA 5AN9A 4PC7A 1EFTA 1N0UA 1FNCA 3CC7B 4NBSA 1K8AD 4PC6A 1F60A 5DSZA 1VQ6B 3J81k 2B5OA 3OZWA 2CNDA 1VQ8B 4LBYA 4AF6A 4UAJA 3CRZA 3AVXA 1QH0A 3CCJB 1AMOA 2QMUA 4M53A 5HXBA 1FNMA 2X3UA 1YJ9B 3AVYA 4TMWA 1IJEA 1TVCA 1D1NA 1FRQA 3VO2A 3WY9A 3SJZA 4PC2A 3ZZUA 4MYUA 3G71B 3P26A 5GV7A 2QN6A 2YWEA 4FN5A 2ZITA 2BM1A 3CCMB 2OK7A 3W2GA 2RC6A 3AGPA 3W5UA 4DQKA 3LRXA 4P6VF 1DG1G 1HA3A 3CMEB 4M0LA 4QFMA 2BPOA 3AVVA 1GAWA 1EP2B 4RCYA 1M90D 4AC9A 1BX0A 4B3XA 3U6KA 2C78A 3VO1A 4RD6A 1R5NA 1S72B 3CMAB 3MCAA 3CXCB 1VQKB 3OJXA 2D74A 4QHYA 4P3YA 1A8PA 3ZBTA 4YHBA 1KJZA 1UMKA 3CCUB 1OB2A 2BM0A 2YWGA 1ZUNB 3WBJA 5TY0A 1ZM4A 1K9MD 2YWHA 3QFRA 1EP3B 4RJLA 2BSAA 3ZZ0A 4TMXA 2DETA 1G7TA 1D2EA 3AVUA 2QEXB 1N8RD 4TMVA 1CNEA 4TMZA 4B43A 3JQPA 1BX1A 4ZCMA 3OJWA 1QVGB 2OTJB 4ZCIA 1JNYA 4LC0A 4EH1A 4FWTA 2XNJA 4G1BA 2DY1A 3CCRB 2BV3A 1KK2A 1FNBA 1VQ5B 2HMAA 1DDGA 5GV8A 4AF7A 3CW2A 1W35A 1QFZA 3G4SB 5H5JA 1Q86D 3AVWA 3E20A 5THXA 1YJWB 1GR1A 1DDIA 1AIPA 5JBQA 2B7CA 3WYAA 1QGYA 4U9UA 1KK3A 1GVHA 1W2BB 3ZC3A 1KQSB 4MYTA 5FA6A 1CNFA 1JB9A 4RD0A 1FDRA 2QTZA 5TV2A 3VNVA 1ZM9A 1KK1A 3CB4A 1W34A 1R5OA 4B44A 1EWYA 3ZZTA 4HE5A 1QUFA 3OZUA 1QVFB 1JA0A 3QFSA 4HE6A 2J7KA 3JQRA 3P27A 3W2FA 3B82A 4YAUA 3V76A 4ZCLA 1G7RA 3B8HA 4YALA 3A1FA 3LO8A 3CCVB 2OTLB 4YAFA 4N3NA 2BF4A 1B23P 1EFCA 4G1VA 3CPWB 3AVTA 1J9ZA 1H42A 2DEUA 1JJ2B 1QFYA 2R6HA 4G5GA 4N3GA 2YWFA 4ZV4A 3W2IA 1TTTA 2AHOA 1E63A 1H85A 5KSWB 3CC4B 1VQ7B 1GJRA 1BJKA 1OGJA 2EFGA 1D8TA 1XB2A 4M2LA 1YITB 3LYUA 1F20A 1QX4A 1TUIA 4M4SA 1TLLA 4C43A 1YHQB 1JA1A 4LBVA 1GO2A 3FJOA 3WBKA 4TN1A 2E1RA 1FRNA 1VQ9B 1WDTA 3MMPA 4R71A 3QFTA 1IJFA 1B2RA 4ZGQB 1SKQA 1DARA 1QFJA 1YIJB 2DCUA 4J0QA 4Y7CA 1SM4A 3CC2B 3ES9A 3CCLB 1E64A 1KTVA 3I56B 3OZVA 1NJID 4Y9RA 4H9GA 4M1KA 1VQLB 3U6BA 1G7SA 5TR9A 1KRHA 2VNHA 3W5HA 4RD2A 1U2RA 1YI2B 2CRVA 3FPKA 4LBWA 3QSYA 4B4DA 2VYQA 2BVNA 2HDNB 4YAWA 1YJNB 2QA4B 2DERA 1ELOA 3W5VA 4Q7JB 4ACBA 3I55B 1N0VC 1EFUA 2VNJA 2VZLA 4B47A 3ZBUA 1K73D 3OW2B 1I7PA 3CCSB 4WQMA 4FK8A 3CCEB 1GAQA 1M1KD 1S0UA 2BMWA 1KC8D 3MHPA
chains in the Genus database with same CATH superfamily
2WMOB 2BJVA 2XXBA 1N5DA 2WD9A 3WV4A 1ZCZA 5THQA 2VQEB 2B5VA 1F0NA 3N58A 1EVKA 1RHUA 3B6ZA 2IODA 5ENZA 1KSFX 4C7OB 3LUJA 1P7ZA 1Y6GA 4DLBA 3U80A 2H07A 1Y6ZA 2AL7A 4OJMX 4Y6SA 1Z13A 5TSDA 3VSDA 4XB1A 3PLRA 3I09A 2EL7A 2O2DA 3QJGA 3OFND 4IJ5A 2I4RA 3D7MA 5J2TB 1Z08A 2W00A 3IS3A 4BXOB 1OLOA 3TQIA 1ZRMA 2HNAA 1OVGA 3CKYA 3X1WA 2ZBUA 4YAOA 1T8SA 2JFUA 1CQXA 4M83A 5BVHB 2DT5A 1RXWA 1U1EA 3F6BX 4EENA 1A77A 1L5QA 2X58A 2H1IA 4IHJB 1OT3A 1ZI8A 2WQ6A 4I5EA 2O5RA 5JZMA 1VE7A 3CD6B 1S2GA 3WQQA 5CM2Z 1G1AA 3ZNNA 5FI1B 1BCSA 1RXUA 4YAKA 5AW6A 3PUHA 3MTGA 3HVKA 4UASA 4QELA 1GAJA 1GZUA 1B93A 1U2TA 2JCBA 2JLAA 2WYVA 1QMPA 4JXJA 4US1R 5PGMA 3UICA 3H5AA 3SX0A 4KB5A 3MGKA 2IY9A 2QR5A 3EA5A 2BY4A 3O83A 5BQXA 4B87A 2WD8A 5AQ1A 4Q1AA 1VPVA 4KG7A 2A9RA 3UK1A 3T35A 2BOVA 1MP0A 1X7YB 1O4VA 2WTNA 2WAAA 4EBBA 1AO0A 5H59A 3IO5A 8GPBA 3GFRA 5EIFA 1QC5A 2XCSB 2OV1A 2VNKA 1M34E 1ZOOA 3OKPA 4ZTZB 1J6UA 5CJ2A 3TG2A 3CKLA 3FCXA 4TL8A 1TT5B 1W75A 2ZIGA 5EUCA 2IYQA 1BXKA 2G9ZA 2QTFA 3G6KA 2D7JA 1N06A 2MOKA 4ISCA 2FMTA 2YBEA 1H4VB 4O4IF 4G5FA 1C0KA 4KXWA 2RARA 3MWFA 2JIRA 3AESB 2VH5R 4KE6A 4ARCA 2PS3A 3VO9A 1HZJA 2DFDA 4G5OA 5CLHA 4AK9A 3TDKA 1U6IA 3TVDA 2QENA 3FUCA 4WOCA 4TYNA 4HVTA 4EVIA 4H0FA 4D3YA 4ANFA 4OGWA 1NXVA 5IABA 5JWRA 5J23A 4OGKA 2GZRA 4GI7A 5FPSA 4O4JB 3M6FA 5CVCA 3T34A 3SP1A 4YCLA 1BH2A 2H5IA 2XEXA 2FX3A 1M1YA 3FCOA 4DG8A 2PGOA 3V32A 4HDKA 4I19A 2BFFA 2NZUG 4LC1A 5JO9A 1PJ3A 5B37A 1CNMA 3SHQA 5J58A 2WFLB 3F6PA 3DOCA 3GNSA 3UXEA 5L95A 2YASA 4UATA 4EHFA 4EARA 2FPLA 2IZ0A 1AGPA 4PYKA 5JPCA 3HUDA 4JLDA 5AVWA 1FNSA 3NTLA 4K1XA 2DR2A 1WTCA 3GJ6A 4KWHA 5IAGA 3VVBA 4MGYR 4OQZA 3FYUB 4MR7A 3GCGA 4ZDJA 1HURA 2PMDA 3RS7A 2HXYA 1Z0ZA 3OZEA 1NF3A 4TQUS 1IXZA 2O8FA 1EFVA 1VI5A 3D3EA 2H54A 3B9BA 1WDKA 4GUDA 2BFBA 4QGBA 3OZTA 3ZVNA 4KAAA 1A9XA 3PSHA 4LRQA 4F5WA 1BU5A 2VO1A 3FYHA 2ZCJA 2B25A 5F1PA 1VJ1A 3FG9A 2PT9A 3CRQA 2FH5B 4R9NA 3RSFA 3UJ3X 3AW8A 3KL2A 4PYNA 4YTEA 4Q4JA 2G06A 4FEAA 3O8DA 1Z37A 4P6YA 1RQNA 5FD8A 1PFQA 2ZWAA 4LBYA 4R01A 2X0KA 1FRVA 1OIXA 3A9UA 4FQ5A 2MSNA 1NY5A 2J9FB 4D8XA 2JH8A 5DF1A 1YBVA 1BWQA 1H3FA 5HKBA 1DHRA 1SCNE 3I62A 2C04A 5FBVB 2OWEA 5CT6A 3IA2A 2QMHA 3OICA 3V6MA 2IYSA 4G07A 2X3UA 3SMQA 5K0CA 2KLBA 3LIPA 4EHKA 3SHFA 1OW3B 4JLSA 1UDWA 2CJFA 4HGNA 2PUCA 3C45A 2Z6QA 5G0WA 1J90A 1L7RA 3DVLA 3PD1A 1KOLA 3IP5A 3BH7A 5GP1A 4LMAA 2ZYGA 5EESA 1YQUA 5FRDA 3Q1KA 1D1NA 2V7BA 5K6RA 4KW7A 1P2TA 2AQKA 3PEYA 1JVBA 3WWYA 1GPH1 3H4VA 3V1KA 3M34A 4W5TA 3LK6A 3KJGA 3DGEC 2YKGA 3WY9A 3ZGZA 3FTPA 3G2JA 3VUEA 2YQ5A 3L8MA 5FOWA 3FTCA 4CCWA 1E98A 4WNAA 5ICMA 4AICA 2PGDA 4LVCA 3KPJA 3BJMA 1YS6A 3D8HA 2J5KA 1UK7A 2IH5A 4DBVO 2CSUA 2XGOA 2KYRA 4MCIA 1T5HX 1ZNXA 2BM1A 2C7VA 2BKAA 2GZMA 1QPBA 2AFHA 1XMSA 3OHMA 3FOZA 4FMCF 2NU8B 3VPXA 1KI7A 1R4MA 4DA6A 2E6UX 2IHTA 5LP6A 4ZVVA 2GILA 1GL7A 4V1CA 3FPPA 1J00A 2J3MA 1TE2A 3W4JA 4GWGA 4FYMA 4PQEA 3S2YA 5BT9A 1VG0B 3H1FA 3AP2A 3SZGA 5LZ7A 3WDLA 3AZPA 1E20A 4PBRA 2OCAA 2I6GA 2OSBA 1E2KA 4Y6LA 2X6QA 4FFSA 4X63A 1UXJA 3QU5A 3CLVA 4LY0A 1FC0A 4W7IA 3CMEB 5DLQC 5BN4A 1Z0SA 1KR5A 3FM9A 3KHTA 4PYIA 2B92A 2NLOA 2XXAB 3LLCA 1BFUA 1TO6A 1P4GA 5T4EA 3D3QA 1ONNA 2N0SA 3AVVA 5HPYB 2HO4A 3D6NB 3SDZA 1II8B 5D84A 2Z1MA 2ZAIA 4F9FA 3DPIA 1IWBB 4RKYA 4ALMA 1J8DA 1FUKA 3OEWA 4U5XA 2EERA 5MF6A 1BDMA 1F06A 3I73A 4HLUC 2WSBA 1S89A 3FUWA 3LQFA 3NCHA 4QXPA 1GGMA 3DOOA 4F4HA 1A9ZA 2XODA 1NVBA 1L5OA 3CXCB 1ZK4A 2HJVA 5ALGA 2JLXA 1G8AA 1L8QA 3OWHA 4D3XA 1XZPA 4EG3A 1GCOA 2BUAA 3FH0A 4UJ5A 5K8IA 3VC2A 1IK4A 3R44A 4HWTA 3GXOA 7YASA 4LOLA 1C9NA 3ABIA 4MVWA 5CJPA 2CF5A 3R7WB 4J1SA 4DARA 1N78A 2JEOA 4NMHA 4X92A 1BN7A 5JYEA 2JFVA 3TGLA 3RJZA 3UW3A 1E1DA 1LZKA 3GCWA 3LS2A 5TMPA 1ZUNB 2AX4A 3K72B 4UU7A 1RCUA 1Z2AA 3FY4A 4XPZA 4ZAVA 3W9SA 3UMMA 2PVCA 2C8KA 2PDAA 1DDOA 4GOLD 2LCFA 5H7XA 4IX1A 1JG6A 2VNAA 3QBTA 2NSLA 5KJ6A 3K71B 10MHA 1N2OA 1SKUA 4B6OA 4O33A 4J7UA 3BCSA 4BEBA 3N59A 3PRYA 2R8RA 3GR6A 1EG2A 2FB9A 5MHTA 4RZHA 3WGNA 1E69A 1DG3A 4JGGA 4LQDA 5HF8A 5IBRA 5K3CA 4H4CA 4BVGA 3N2YA 1KEVA 3BJRA 2D2FA 4TLMB 5D3MA 2C97A 2XOEA 3FI9A 4C4ZA 1OZ0A 1G21A 2QD4A 2HIAA 4IJKA 4R9UC 5BMVA 2X8JB 4ZPJA 5C35A 4O5AA 2O6HA 4PN3A 3DO5A 3MCUA 3CSSA 4NZYA 2ZS8A 3ORQA 1U98A 3TK1A 4RBNA 4D6YA 4ZVSA 2A4KA 5HJEA 3GFQA 4UTRA 3FTQA 3CE9A 4ZCIA 1Z6TA 2F1IA 2FG6C 1N1EA 2R9VA 4JKYA 5EJGA 1H0KA 2E82A 3TLGB 5DM2A 5EJ9A 3U4QB 4KPUB 3ZW9A 1HLFA 4FBGA 2H2DA 5E1MA 4BQSA 3MCWA 1W5TA 4YCBA 2I1LA 1VBKA 3W2TA 3ZBPA 4ZGBA 1B1CA 2FWAA 5DI9A 1E94E 1RADA 3Q6QA 1YE3A 3R6TA 3TFWA 4DTIA 3H17A 2YQZA 3MYYA 4PAAA 3DL2A 4HDOB 5FLXA 4IAOA 1ZXBA 3ZX4A 4KR2A 2IF2A 2JFHA 4BFTA 1XLVA 3M5DA 1NJ2A 3VH4A 2FLVA 5HIMA 2P8JA 2WIDA 1WBBA 1K8XB 2FE4A 5DTRA 2XUGA 3RSCA 3E20A 1LQTA 2AUNA 3BHMA 3IGFA 3LXXA 4Q18A 4RIFA 3A36A 4P54A 1LS1A 3T8YA 3WYAA 1G8MA 2E1PA 4WSOA 2OQ2A 5TC4A 4FHFA 1C0PA 4DLZA 4GVPA 3TW8B 2QJRA 3S5JA 1ZJ6A 4PY2A 4CIAA 1H6CA 2O3RA 5L53A 3NT4A 1RVDA 1QQTA 5KOIA 2JLBA 2WB4A 2HSJA 3RUEA 5KTMA 4CEHB 2X41A 3F6EX 1N2SA 4LY9A 3SLDA 5E1OA 5FUMA 3U81A 1NXOA 1W94A 4KODA 3UJAA 1ZUHA 3AL0C 2ZJ7A 1Q2UA 1Y3FE 3FI0A 4BLUA 2IYUA 4ME6A 2X4GA 2EEZA 2V7EA 1A72A 4IJQA 4WERA 5JJCA 2WIAA 3GLSA 4UPVA 1CRZA 3O73A 2X0IA 4KO3S 1Z7WA 3RYFB 5I9IA 3UGTA 1DO2A 2WZBA 4IIJB 3TQCA 3EUEA 2IEAA 2OBFA 3BZBA 3WLMA 2OBRA 1KFKB 2QI9F 3Q3JB 2VJOA 1P17A 1PZEA 2ZAGA 3QFSA 3N05A 4KK4A 1SXQA 4MV6A 2ZSAA 2NXEA 3R7SA 4F3RA 5DT2A 4MA5A 4HVCA 1VLHA 4F2GA 1P33A 4HS4A 1C3VA 1M1UA 2MU1A 4G81A 3K6SB 1BOOA 1A4IA 4KKXB 5JI3E 2IV2X 3OU6A 1HH4A 2GPTA 1GGJA 4OPOA 1TEXA 2ZI6A 5B6PA 4FFMA 1YFLA 4WH0A 3IJPA 4NBUA 1N6KA 1IH8A 3CCBA 4S3MA 3VTKA 4ZYVA 1GM5A 4ZOLB 1P4HA 3FUVA 2FSVA 5LA6F 4OB6A 2PWZA 5LOVF 1RYMA 5CNIA 2C4UA 1Z0JA 1THGA 4QJ3A 1TJ4A 5A1JA 3E8MA 1Z35A 1U0HC 4F38A 3ZPNA 1FX0A 5DRTA 5G41A 1P61B 1EYZA 2E85A 2ERXA 2VBIA 3W2IA 4H0CA 4NFHA 5DV9A 5ENVA 4ZKEA 3FTNA 1Q17A 1Z75A 1A7KA 4RVNA 4ATNA 1OFGA 1IM8A 2P6OA 4GLOA 4KKSA 1QLHA 3FPGA 1AGYA 3I28A 5IW8A 3T1OA 1YK1A 4N5IX 1H3NA 4EG8A 1KJ9A 1D8TA 2BDEA 3IT0A 3CR3C 1EGAA 3ITDA 3WA6A 5ADWA 1AKUA 1E3IA 1RAHA 3PDUA 4UAGA 1YVPA 2BBTA 3ZH9B 1QF9A 4Q4DA 1GPUA 1V9SA 4JD5A 4U2BA 3RUIA 1RABA 1II9A 5FL7D 3DTVA 4QU0A 3N07A 3C5HA 1PRYA 2O2XA 2G4CA 1VKRA 3R6WA 2AN5A 5DXAA 5AM2A 121PA 3ZV3A 1PG0A 3UJHA 3W7BA 1TC2A 1ADCA 4I55F 4AJOA 2WM2A 4BWYA 5B64A 1BWRA 1JDSA 2BCGY 4XKWA 2O4UX 5LZ8A 3E9DA 4A2CA 3ZDBA 1XCOA 1RMQA 3K0AA 2RJNA 2ZDQA 5G0VA 4YRJA 1LDMA 3X2EA 4REQB 2XB6A 4UVIA 3EW9A 4D92A 2GN9A 5HZKA 1JALA 5LNK1 3SQMA 1DIHA 4RZSA 3A9VA 2R97A 4MHOA 1I4TD 1XJ5A 2ZVPX 3WL8A 3GZNA 1IB6A 5AW1A 2ES4A 3FWPA 5DCWA 5KNBA 2QRGA 3C3AA 1YHNA 1VI2A 2IPXA 3M1LA 5KSPA 1XDDA 4DSOA 1P2VA 1WKVA 4TL6A 3T7DA 1OBOA 1TT7A 3JAWB 3JD0A 4MWZA 4TL9A 5HG0A 4BBJA 1L3BA 1KRWA 2ADOA 1H3EA 4MPJA 4Z9YA 1GNLA 3PUKA 2JVIA 2PKCA 1ZK1A 4QYXA 4XIIA 3CC2B 4NDNE 4ZOAA 1W5SA 2A0YA 4Z9AA 3ZQ4A 2AOUA 1CSEE 4HD8A 4BO6A 1SCIA 3FCAA 5ILQA 3UH0A 2FA9A 2Q3JA 4XQEA 3IOMA 5HZMA 2HC9A 4CODB 4FGUA 2YWJA 3CF4A 4L0DA 1V9LA 1PS0A 1H8HD 2OCXA 4XDGA 3ZCSA 3DHWC 1JJBA 3S40A 1CUDA 2EDCA 1FTQA 4XLFA 1W0KA 3N6XA 3MJFA 3D7KA 1ZJZA 2DX7A 1NBHA 3FWNA 4RPJA 1L7NA 3BICA 3GMDA 1EUDA 1S8NA 1XG5A 2FEMA 1E9EA 3KZCA 4JOCA 1ZOLA 3EIFA 3NPMA 3QVOA 4KXVA 4ZGWA 4RD2A 1W36D 1PNRA 2H51A 3C3WA 3L1UA 3ILVA 3SXJA 2JEZA 5G4KB 1WXEA 2VCEA 3OZGA 3B70A 5FAXA 3T1VA 2ZBEA 2QRHA 2Y2UA 4Q39A 2I4NA 3LY5A 3F8SA 3VO8A 1GWNA 2FN3A 4B3DA 1QNLA 2FPMA 3NYQA 2BVNA 3OOCA 3EARA 2ODTX 5CVVA 1BHQ1 1R9JA 4Q3AA 4AY4A 4ZAZA 3GARA 5EJ2A 3I2HA 4FR5A 5ECDA 4I8IA 1B41A 1DWUA 2VNJA 4TT8A 5EMHA 2ZTMA 5K9ZA 2ZETA 1Z82A 2XMDA 3CFYA 3GJQA 3CKKA 1QIEA 1BQ3A 4FR2A 1I8DA 1PVVA 1FYWA 1XMJA 1ODIA 3OW2B 1ENZA 3ASYA 5DLDA 4ALIA 4EA7A 1E7QA 4E7PA 7REQB 2SECE 4OXKA 1LX6A 3LGSA 5CLIA 1SIBE 1JIQA 4J0KA 1Y0YA 1ZVMA 4WLUA 1Z3IX 2D62A 1PR4A 2FGKA 4RF2A 4WE3A 3UGQA 1UBOS 2DJ5A 3H6KA 1M5TA 2QRMA 5J2UB 2HMWA 5A4KA 3BERA 1DB3A 2OAEA 5A0FA 2ODAA 5E0KB 4D8TA 4OHYA 3WL6A 3GT7A 3N0XA 3SIRA 4GPD1 4RU1A 1N2ZA 2HJGA 2VBCA 3DBHA 4MYCA 4RX1A 3GHHA 1FXSA 4IRMA 3A3GA 3RKSA 1HZEA 5ALHA 3NR2A 1GUYA 2HHCA 3PNSA 5DIZA 1G5QA 4CLOA 4EFLA 9ABPA 4TZ0A 3E81A 3NQ41 3A1EA 1SB9A 2VI5A 4P3NA 3IHLA 5BN3B 1W2HA 3GIRA 2FJPA 1AZTA 2OFPA 2PA0A 2PHZA 4TYQA 4KGVA 5C1IA 1N1MA 4EATA 4DV6B 5JASA 2JH9A 1XZKA 4ZOCA 3L49A 3HMQA 4JP1A 3VV3A 4D0SA 4OQPA 2H8GA 1U7UA 3LECA 3OZIA 1L9KA 3AIKA 1WVMA 1NBEA 4LRWA 3B12A 4PO8A 3VU9A 1QTQA 4F5ZA 4KO8A 3LCCA 4G5HA 4JN6B 2A9VA 4OHOA 5FTLA 2GKOA 3UMVA 3F7TA 4CV1A 4Y9UA 1TM2A 2PH3A 2NWQA 2QTTA 3LPCA 5ALVA 5JH7B 5JSYA 3S81A 3QIVA 3KHKA 4I6JA 3H2SA 1BCRB 3EGIA 3VU8A 4S1OA 1VCHA 2DPGA 1WUKS 3AR6A 3BRCA 6REQA 5JAUA 1CYDA 1Z6YA 1QIHA 3R09A 3E2PA 4LW8A 1D6SA 3ZYCA 4BMVA 2PMEA 5KKNB 2FPGA 2JGDA 5BR4A 2C7OA 1E7RA 1JMVA 3RIGA 3QY0A 5M7EA 1EFHA 3E22B 5AWFC 3HG7A 5L7YA 3Q8MA 2CDBA 1STOA 3CX7A 3PEUA 2ZTHA 2ZUVA 4P80A 4B81A 1Q7YD 1O6FA 2PLNA 3P4UA 2CUKA 3BMCB 5TQJA 2WNIA 2YNMC 5JEDA 4GL4A 3EPPA 4JFRA 3Q72A 5SZJA 3ELDA 1XCPA 3W8NA 3DULA 3SOPA 2VJQA 3L18A 4QECA 1X0VA 1JAHA 5WRFA 4DLPA 3WNCA 2ZXUA 3QVUA 1SQ6A 1XVIA 1N07A 3LRPA 3UWSA 1XR3A 3DVQX 5HCUA 1Z63A 1ZOSA 2KSQA 4YEDA 4DK0A 2W2KA 3L4BA 4CUJA 1R8XA 2VF2A 1OAAA 1CUAA 1SVSA 3F0TA 2C96A 3UV7A 4TS1A 1ZIYA 2J7PD 2GN6A 5A2GA 3CC8A 5KCZA 4FS8A 5HS6A 4TTPA 3Q7TA 4UC0A 5D01A 2R68A 1JQJC 1CR0A 5EXXA 4BB6A 3AG6A 4KRYA 3A3BA 1X1QA 3CCFA 3L8EA 1YA6A 1NR1A 1DAPA 1WZUA 2BFPA 3JASB 4ZJYA 2QZ4A 4OUKX 2FPUA 5F3WB 1XZMA 1OF1A 3CP2A 2P9GA 2P4QA 2WPNA 3D64A 3NXSA 4HB3A 5T4BA 1U0EA 3P0IA 1J4AA 1EB9A 1P6XA 4DE5A 1XPOA 2YJ4A 3JATB 4BBPA 2GZSA 1ICEA 3IP1A 3V7YA 4IHQA 4GWKA 4ARSA 4QO8A 4B73A 5AIBA 3MELA 1VQ6B 2O06A 1XFOA 1TZ2A 2ZJ6A 4ICIA 4Y9DA 3DB2A 4L5AA 4MR9A 3P2JA 4AJLA 4H31A 1NJ5A 2I2DA 3HRIA 3LFUA 1YFJA 1DKNA 1TLTA 2YZNA 3JAKA 3PC8A 2RGDA 4IXDA 4MUIA 2R6AA 3CRZA 4EEZA 3USZA 1GT6A 1M10A 1B3BA 4D5GA 1Z0IA 1CQPA 2ZJ0A 4C7MA 1GAXA 1XTBA 3UBMA 2IUEA 2QAGB 4LYYA 1VIAA 4XAQA 4YFYA 1YJ9B 3INGA 3ML1A 1S4QA 4TMWA 2CHFA 3ADOA 1PKVA 4FNAA 1M66A 1WHSB 1QO9A 2FG7C 4L2IA 4YAIA 1CQJA 1GNQA 4FHDA 4REQA 4YUXA 2IVFA 3SWWA 3P4YA 5C8YF 1TVCA 1ORHA 1ESDA 2I6QA 2ZRPA 4U63A 2OUKA 3WHPA 2O1EA 1E2BA 3ETHA 2C54A 4BKPA 3NAGA 1U3DA 3ENWA 2FQXA 1PLKA 4PC2A 1R0BA 3HB9A 1GUFA 3P0FA 3ZNPA 2J0UA 2CLMB 1Z18A 3EFOB 9GPBA 2PKRA 4F93B 3OUTA 3DDYA 5DJ5A 2QN6A 4Z4ZA 3K9LA 3LPLA 4YMSA 3RUAA 1TVEA 4N76A 4DNFA 4OF4A 4H1VA 2CKMA 4UUMA 3IX7A 2GRAA 5TEVA 3VDNB 4HLDA 5E0OA 4ZOQI 4AI6A 1AF7A 4IILA 2HCTA 5REQA 3QFHA 1VYVA 1QF7A 5D85A 3UK7A 1RIIA 4RLHA 1L0BA 1HNZB 4IWYA 4HPWA 3LRXA 2FMXA 3LZ6A 3ZZMA 4CXMA 1L8XA 1ZM7A 3IUPA 2YL2A 4HH1A 4CRWB 4DLNA 3GLVA 5A1TA 1D7OA 1G8FA 4Q47A 2X1LA 1YB1A 3O03A 3SY8A 1UKEA 1W5EA 5A5GA 3QU4A 3BJIC 3VYRB 2FMUA 3GLGA 3KKLA 2QQ5A 4QFMA 2ASEA 2HRBA 2JA1A 4EYEA 1EM6A 3OETA 5F4ZA 4PZ9A 3ZLVA 4HT3B 5KJCA 5AM5A 1KH1A 3K6KA 3FGOA 4CLEA 4D9GA 2CJWB 3H5TA 1E18A 2EZUA 1IC6A 3OZDA 4QPDA 4IZHA 1M90D 1Z0KA 4YI3A 5FBRB 3BULA 4YP9A 3DH0A 4UHFA 1HFEL 1SG9A 3BKXA 4BE9A 4E5SA 2LIPA 2GN1A 3I9LA 5CT8A 1S72B 3CU5A 4AJIA 5GONF 3ZOZA 5AVXA 2KHZA 1EXDA 4F3CA 2WAOA 5L9AA 5J9FA 4QICA 2D2EA 2H2HA 1OC4A 2NXWA 1KIAA 4UBJA 4WWHA 5E9AA 2QPOA 5TGDA 4Z4RA 1I9CA 2WYWA 1CR6A 4FMPA 1PZFA 4JAVC 4KJXA 3OTOB 4YI5A 3TLYA 2AEEA 4L15A 1ZH2A 4JSTA 4EA6A 1BW9A 1THZA 3CCUB 2BHTA 1K68A 3L8HA 2LCIA 4XOIA 1OH8A 4N40A 2EFDB 2BFEB 5AKXA 4ZZ0A 4LUCA 1Z36A 4Z7OB 4MQFA 4BLRA 1UINA 4UEQA 1XTIA 3PD7A 2FJ0A 4RPKA 4V2UA 1NQUA 1DUVG 4WLVA 3EG9B 4HXYA 3GJTA 4B3HA 3PNKA 2C58A 1JFFB 3QMWA 3SLRA 2CLOB 2VTBB 1T3ZA 4R4JA 4QOGA 2GXQA 2V59A 3QH4A 4UULA 2OHHA 2JIBA 1N8RD 5JDIA 2CJYA 2PS9A 4M1WA 1AHIA 4PWYA 4MGHA 1J20A 1BRTA 1SKYE 1XMVA 3PKIA 1X7WB 1SU7A 2NV2B 4IY1A 4TKZA 4ZC8A 1O87A 5CDFA 2ONZA 4ZCPA 4MQ4A 1QZZA 1RC8A 5BNWA 1XRNA 3C97A 1FS6A 3KT3A 1PNOA 1JQBA 4KWTA 1H5QA 1KMQA 4R0VA 4RQBA 4EG4A 2H7CA 1BS2A 2VYND 4K46A 2H1WA 1YJQA 4E6EA 4EUFA 3CT4A 1BHSA 1J42A 4V0LA 3TLXA 5FHQA 3FPAA 1PZHA 4IDAA 5TQ0A 1ZMXA 1NX9A 1XLUA 3CPHA 1OUMA 3HPRA 4V0MA 1PE0A 1LPNA 3B1ZA 1IM2A 4FEYA 3IXLA 4PX5A 1VF7A 5EHQA 3TDNA 4DM7A 3QI2A 2YVAA 3BK2A 3PNMA 5JYBA 1GTG1 1UMDA 2PWYA 1GLGA 5GV8A 2GZAA 4UKDA 4P9NA 4AQ7A 2DFVA 1VLOA 1ZMBA 1V6SA 3CLUD 4URWR 3U4GA 1ST2A 5A0TA 4MO2A 4BV3A 3EGWA 1R6BX 1ZMRA 2ANCA 5J4LA 3LSTA 2BZGA 3K96A 4MWDA 1ZN2A 2W2NA 5C52B 1BE0A 1KZ4A 2YHSA 4RF5A 4D9MA 4DLAA 2XB8A 3B3QA 3JQAB 4F3KA 2Q3FA 5EP4A 2REQA 4N5MA 3ZS9A 1C30B 2O0KA 3EEFA 3IPLA 3NV7A 1QG2A 1G9SA 2Q3DA 3TR6A 1ENYA 3SPXA 1DSSG 2VNSA 4RFSA 3N8NA 4XSGA 3MD0A 2JAUA 2C3UA 1S1CA 1U7TA 1VPEA 1I6WA 3R0VA 5EQJB 4GX5A 2UDPA 1P6QA 4P7JA 1GU1A 4BYMA 3RSQA 2AUMA 1Y8RA 3LHDA 4RD0A 3N28A 5DISB 3VNAA 5C1OA 5TIIA 2EW2A 2YV1A 3X1JA 1HE8B 3EZ6A 1QRUA 4JJFA 1NVTA 4NENA 2IXFA 4MVJD 4GM0A 4DT1B 2ZXFA 2WA1A 3ZDQA 2H92A 2ZE5A 1JL3A 3EAGA 1XEWY 3VPBA 1NUUA 5I8PA 4HE5A 4RPBA 1OROA 3IBFA 3WK4A 5KUTA 1KKLA 2G04A 1DJNA 3FGPA 3K73O 3P8ZA 2Y0DA 2FJUA 4YJ3A 1L5RA 4KFTA 1PS9A 2ODNA 4D0LB 3L40A 2J1LA 1DXOA 2PQMA 4GBGA 2ZXIA 4GBMA 4R8SA 2CFCA 2GJRA 3C4VA 1DADA 2RI6A 2ZUTA 3NYWA 1T4CB 2Y68A 1T9GS 1KOJA 2RHCA 4LOIA 3N75A 4OK5A 4YALA 2IBMA 5KYYA 4DV2B 4H18A 3ZWBA 2UU9B 1PWHA 2GKSA 2XE8A 3DV9A 2H1FA 4FFBB 1CS0B 4HH3C 4BATA 4A4DA 4LHSA 3C6BA 2D3NA 1SD2A 2I6UA 3I1YA 5C34B 1N4AA 2D2VA 1CY1A 4M9QA 5DSTA 4GKBA 1AHNA 1B3RA 2Q5EA 4YRIA 1O6CA 4WN9B 5KHLB 2OAP1 1GARA 4UFNA 1WMFA 4I8DA 1QANA 4ODIA 4AYXA 5KYXA 1JR6A 4MW4A 4QU8A 3VVLA 3CO0S 4MGIR 4N3GA 4U6SA 2UYCA 4IHAA 2G88A 1E99A 1K08A 2ODEA 4YAEA 4PV7A 2YC4C 2W22A 4P26A 1DT5A 3JQFA 3IV7A 3G0IA 4G4JA 3B52X 3GH1A 4M99A 3SC3A 1GPAA 1PJRA 4CCAA 4BLSA 2D5AA 1VQ7B 3G79A 5DH9A 3W1WA 1YRHA 1DPFA 2GD1O 3QE3A 4UNPA 3AY7A 2FPRA 2EGHA 3HHPA 3CVJA 1HUQA 4QLAA 2Q49A 1KQGA 2P1ZA 4D6PA 5ED4A 2IT1A 4KXFB 3G2PA 1MX5A 3PNYA 1KVSA 4JWTA 2X9LA 3S3TA 3T5TA 4BNDA 2VK2A 1OLSB 2A5DA 3IEIA 3LT4A 4WW0A 4JYAB 1PEDA 3A1UA 4M9ZA 3D3WA 4MOWA 4X85A 1KDZA 3SNKA 1J22A 5DM1A 4EB8A 1I2DA 3NEAA 4DNQA 1MB4A 3Q2OA 1J8MF 3LDUA 4W1PA 4B1FA 1F9AA 3IVCA 3ABSB 4TTAA 2HIMA 4P33A 2AI1A 1YONA 1T5IA 4AXXA 1RIFA 1U2GA 3RIHA 3H42B 3KYJB 1Y9AA 4D4LA 5TRTA 4RSGA 1U0SY 5BUSA 4Q7EA 1JQAA 4R8RA 4ZRNA 1C7ZA 3DKIA 3EVAA 2VZEA 2LKCA 1T8PA 2V4MA 3PE4A 3OPXA 3AEYA 4OQXA 3ZHOA 4O2RA 5I7UA 2RHDA 3AEXA 3WSVA 4BRSA 4DY6A 4RTNA 1WDTA 1MEEA 1CG6A 1MVOA 1KDRA 1XGKA 4NZMA 3GSIA 3RROA 1WU7A 5JZSA 1TM5E 4HR7A 2NZWA 1P1FA 4V03A 2WWXA 1PO7A 4MTLA 4MQEB 1M67A 1LDYA 1BN6A 1ZGJA 1XHLA 3GGOA 3Q2IA 4MIYA 3F5SA 3BH0A 2P30A 3WDSA 1PWXA 2NT4A 3A8TA 4FYYA 5ULLA 3ACDA 1BEEA 3VYVA 2NTJA 2FF7A 2YCBA 3MHTA 4RY8A 1BGVA 1FDIA 2FV8A 1T0BA 4OP1A 2BEUA 1K63A 1WV1A 1C1HA 3FGNA 1ORRA 2VSFA 3LLSA 3PFWO 1PJAA 2H3EA 4YWHA 1ZHOA 3ZHXA 1EJ6A 4QHTA 4LOJA 3A6HA 2X7XA 1KJWA 3F74A 3H9JA 4XUEA 1EHIA 1EK1A 2GZ3A 1ZQ1A 4P31A 4ZQBA 3W1VA 3AR7A 4AVYA 2FPKA 2I2WA 4E2WA 1LD3A 1QG6A 2QL6A 3OZ7A 2ZTLA 2Z9CA 4EGFA 2CLLB 3N70A 1PYOA 4L72A 3CB2A 3PXUA 5ESRA 4E15A 5HJ7A 2C5FA 3OX2A 4HJRA 2RGGA 1TAGA 2RGCA 4DQVA 1XE3A 2CDCA 2QGFA 1ULHA 5EUBA 1DQZA 1KXZA 5JRZA 4TTJA 3HLTA 5F51A 3ZW7A 2ZATA 3MCTA 3MMSA 4OY3A 4EAQA 1IZ0A 2UZ1B 2Y1CA 3EXEA 1O6ZA 2A59A 3JQBC 2AIRA 3PGXA 4U7GA 5EE1A 1MIOA 2JD2A 1P72A 4Q7JB 1Y9EA 2MR5A 4A9AA 4G5XA 4N8SA 3TXYA 1RC0A 5GZ3A 4H0NA 4RVDA 3ZBUA 3HUUA 3IBSA 2J45A 4R2KA 1X7XB 3CN9A 1WB6A 3UHJA 3BL8A 3KPVA 1F2UB 3IKLA 1PYGA 4QRIA 1PHRA 2WUWE 1UFRA 3OO1A 3W78A 1JEQA 2GT1A 3HUEA 4BFVA 4U7DA 1J09A 1YKGA 3ZWWA 2GF0A 3L0CA 4Y2VA 3VHXB 2GS9A 1ZCAA 3W5IA 2VJPA 3QXHA 4A23A 4RTOA 4FIZA 2BEWB 3JD1A 3KD3A 1P4SA 5DCLA 3V8QA 4OLBA 1HNWB 1TW3A 4MR8B 5D00A 1C0EA 4M8KA 4B6PA 1HLGA 1IBCA 2VNIA 1TZBA 1N08A 4HC4A 4ZU3A 4D02A 1P2FA 4CL2A 5DYNA 4LBZA 3L0ZA 1KYQA 5FWXA 4BMPB 4ETNA 5AM3A 4CM5A 1KMNA 3WLHA 3DQZA 1KYIA 1DMRA 5COAA 1BWSA 2LWIA 4Z4WA 4LKRA 4J3JA 1U9IA 4EL0A 5FEUA 5JE8A 1A4UA 3KVRA 3LXMA 1FS4A 4NECA 4U7PB 4Y6PA 5A9TA 5T41A 2FLWA 3LX6A 1U0TA 1GPBA 2BHLA 2B6HA 2G36A 5I7OA 3PQEA 3M2PA 4JC5A 1JFLA 5LLSA 3RVKA 2JJ2A 1JT9A 1E79A 3QJYA 3ZVKA 3WGKA 4MMYB 3NNDA 4G7WA 1Q9SA 1V25A 4J29A 5CGZA 4JI6B 4CIVA 4MW2A 5YASA 4ZFNA 4ZEMA 2JH3A 1BAPA 1Z6ZA 1PUIA 4MRNA 4XX0B 4RD3A 2HWUA 2D0PB 3VR6A 4RK0A 1NFFA 2YJZA 3QPWA 4B3RB 4MAAA 5I7VA 2ZJYA 4TSKA 3UWDA 1FUYB 3AVQA 3WLQA 5CLGA 1GUAA 5LBUA 1I3KA 3LOUA 3KD2A 4HK4A 3AEKA 4ZEWA 4GMGA 4P36A 3H11B 4EJ0A 2EP8A 4GQAA 4U2FA 4IV5A 3TG8A 3NDBB 3QMVA 2NXCA 3OFNA 4EY6A 1M2JA 1QMGA 2QRKA 1G5IA 1KVRA 3IE2A 4GYKA 1BE8A 1PK7A 1QV7A 1CX9B 4AM8A 1IWPB 3AETB 4JYPA 4F3NA 4PNEA 4HNHA 4WZBA 3B7PA 3MS7A 1P8AA 4Y98A 3VPFA 1RRKA 3VV2A 3KBBA 3F4KA 4S05A 2I2CA 3NH6A 4H6XA 4M76B 1RLTA 1MX1A 4H3SA 4BQNA 1ZHFA 2EKBA 2R1VA 4H1WA 2OEPA 2G72A 5AR1A 2SNIE 5JZOA 4MQ6A 5LP6F 1AGNA 1OV4A 4LJRA 3FNIA 4IVPA 4FW8A 3ROXA 3S6JA 3V9PA 4TKVA 1GRCA 4YAGA 2O2SA 1GCIA 1N5RA 1T1IA 4I1RA 2WWVD 3RB8A 4P5EA 2I33A 3WJ7A 4DIKA 1DBRA 1N5OX 4Q00A 4Q9LA 5HILA 5K3FA 1PUXA 2X8KA 4D4JA 1XNRB 4PNHA 5K05A 4UZEA 5C3UA 2X6WA 3CGGA 5FOVA 3DT6A 1AY0A 4Z4UA 1ODLA 3C8MA 3MGBA 4KXNA 4LCJA 1CP2A 3FFTA 1AJEA 1LX7A 2JAQA 2Z5LA 3NC1C 2D0OB 2NAPA 1FTNA 3ISTA 3OFVA 3R4VA 3ECSA 3DCJA 3TMAA 4FN4A 1L7DA 2WFMA 3QKRA 4XPIA 5BT8A 5CA0B 2ZT8A 4AU1A 1DUIA 1S6YA 1P81A 3EF0A 3RPEA 1I0IA 5LD2C 1JIJA 2TECE 3ZWQA 4JCOA 3TTYA 2F8TA 2RHTA 1R0LA 1X7GA 1ECCA 5DVZA 5AXAA 3K94A 4L22A 2IWHA 4E5MA 3V8NA 5CDTA 3VAYA 3UG7A 2PMFA 1EZ1A 3A9WA 2X1MA 4M98A 2O0HA 4Y6QA 4ES6A 1RWWA 1E6KA 5H9VA 4H17A 1VDZA 1GQRA 2I29A 5L4LA 2FMFA 3DTNA 2XB4A 1RWQA 5FH9A 2FSGA 1EJ2A 3RK1A 3W4KA 2WD7B 2ECOA 3ZIAD 2CMGA 3GQVA 5FUVA 4JP5A 2WTUA 1F4LA 3DPUA 4FS3A 3ZWNA 4EKYA 4JENA 1FDOA 3ESZA 3SF8B 1FFDA 4LGYA 2QRUA 4H16A 1R0RE 1Y4SA 1YZTA 5L4SA 4QTYA 4V02A 1QH0A 1R00A 5D86A 2V4ZA 4MKIA 4X7PA 2C20A 3HCDA 3O6VA 1KAEA 4TXLA 3FUTA 1FTWA 4B3GA 3L93A 4LYAA 5BNTA 1AQNA 3G68A 2PUWA 1DMSA 4Y8VA 1IOZA 3T61A 4BFLA 1XK7A 4XGNA 5BMVF 2PUEA 1EXWA 3A2KA 1ZD2P 1I5OA 1QYXA 2ZXEA 3KQSA 3MAGA 4OQLA 2JCGA 1OLUB 2TMGA 3HVRA 3BSYA 4ZHQB 3M1YA 3O92A 5T3UA 2PL3A 3VR4D 4KFCA 2X9GA 3QOYA 1M7BA 2GJKA 2Z5FA 1HE1C 3T9DA 1GTZA 1HG1A 3DEHA 3ONUA 4FIDA 4XFDA 2ALJA 1I4OA 2ZREA 3EBPA 3QVGA 3H7AA 3GEEA 1C8VB 2CD9A 4KUEA 1RRMA 3PHHA 3U19A 1PJTA 2Q3HA 2QX9A 5AESA 2XMRA 2ZIFA 2W8BA 4XCQA 2J6BA 1G17A 1K6EA 2Z8YA 3MS2A 3C98A 1E89A 4HFJA 4YV7A 4FDVA 2NO9A 2HXSA 5AW5A 3EA4A 3U3KA 1NNSA 1UUFA 2V97A 5KYWB 3THYA 1TADA 1F4PA 1BJRE 1ZD3A 4JUCA 1TU0A 4HAOA 3W8EA 4HAZA 2CXNA 5ERYA 2QIOA 4JDUA 1BKDR 1TGYA 3ABZA 2Q9AA 3SS8A 5AD1A 3ZGVA 4TOIA 1T29A 1E8MA 1XRPA 3OPNA 2Z08A 3QPDA 4UTXA 2QVBA 4Y2YA 5KTPA 2VK8A 4F7WA 2CZQA 1JB1A 2HIHA 2LCQA 3BE6A 4JEMA 1FTYA 3WLKX 3RTCA 1K3UB 4C0QC 1R4AA 4ZVKA 2W2TA 3L06A 5CFOA 5HRAA 4MPPA 5CPBA 2P6PA 4GKAA 2XUPA 3C4JA 4GR5A 3M89A 5BR1A 3DD1A 1IMOA 1KKMA 2C59A 3D4IA 2OMEA 2BGKA 2YJ5A 3IFSA 3MGGA 4QUHA 5FADA 3SJAA 1OWOA 5BSUA 1SULA 4QYIB 4GGOA 3UNXA 1QP0A 4NMWA 1YR3A 1XNQB 3PJRA 1GEEA 2YX1A 4LA4A 1QHYA 1SUSA 1YZGA 4KQ9A 2GAJA 5DP2A 4ZD6A 2I0FA 5EMJA 3WS7A 3V7NA 1L5HB 5EJ5A 2QE7A 1TKCA 2HFKA 3FVQA 1RHMA 2B6NA 4C6HA 2QUHA 3EASA 1MTOA 1DAHA 1ZM4A 1K9MD 5DT9A 4AZVA 3A6FA 1JSLA 3UB2A 3G2QA 3NHWA 4MS4A 1DGQA 3UW1A 4NNPA 4M0KA 1K4YA 3K1AB 5D8DA 4DMUB 2K5UA 4D9HA 3A6JA 4AJHA 1D4OA 1KDTA 2C95A 3C3MA 4D0GA 1KQOA 4XJXA 3RAJA 2XWSA 2O3SA 2R2GA 3LDGA 1WMDA 3LT1A 3HPQA 3NNSA 1YIDA 1NW6A 5AW7A 3QOFA 1ZH4A 3D6JA 3PGA1 5D3QA 3BZUA 2JRCA 4FYPA 2CFSA 3F49S 3CX8A 3LC0A 3EN0A 4HWOA 2AD5A 2C2WA 3FMIA 4AJ9A 3G5MA 4DCCA 3LOQA 3OJ0A 1BZYA 2BFWA 5KKCA 1SBCA 3O84A 1DJQA 2A3NA 4BNTA 1Z4LA 3GA0A 1PKEA 2PYIA 3KAPA 3R7NA 3ZS8A 2BZSA 2J85A 3KUXA 4NS1A 5IXJA 3IMEA 3V2HA 2IY7A 1RBQA 3ZZ1A 2PWBA 5HTKA 3PI6A 4KTVE 3SEQA 3UC9A 1ENOA 3FA2A 5CG1A 2O2GA 4RNCA 5GQSA 3RD5A 3VPHA 4Q37A 2P2NA 2PFSA 5KNCA 3CW2A 1Y5IA 2XMCA 3HYSA 4HNGA 3TKYA 1JSZA 1COWD 3UMYA 5JD3A 3G02A 1KI8A 3GJ0A 5GZ6A 4Q9KA 1YZHA 2A5YB 2H5LA 3QEMA 4TMKA 5AXCA 4ZXFA 1BU8A 1QOZA 4OXYA 4B8WA 4D4MA 4F5EA 5D1NA 2MSEB 1DDIA 1MVLA 1XXHE 4MH0R 2FW9A 3OCCA 3G5TA 2R7KA 4LXXA 1MW8X 2PRYA 4YRLA 3MCZA 3QM1A 3B8EA 2FKAA 1KEEB 1TYEB 4FDMA 3BL5A 3SC2B 5HNKA 1QIIA 2BMAA 1ISIA 1KK3A 1XKTA 3ESDA 3NTVA 1QU2A 1GGFA 2MSWA 3HDTA 5DLYA 3Q3AA 4Q1VA 3P4XA 3S1AB 4DEVA 4PG5A 2WF7A 4YRTA 2P9QA 4A10A 5AK6A 2ZZFA 5HJ5A 2QU8A 1NN5A 3NHBA 4INPA 2ZIVB 3QE0A 1FDRA 3C14C 3E9CA 1J8FA 4DQXA 1FJXA 4FSDA 4V24A 3UF0A 4UTVA 4XVUA 1ZKMA 2JFXA 2VJBA 2YZKA 1WDWB 3GEIA 4N3BA 2F3UA 5LWHA 4J75A 2ECQA 1VRWA 2HX1A 2UYYA 3QVVA 4RDKA 4WLFA 4A7PA 3ZHBA 1JIXA 4JVNA 5T57A 4DBLC 3TYXA 3NI2A 3SVLA 3FZYA 1NP7A 3WQHA 4BP9A 4ZICA 1OZHA 1ZSNA 2GN0A 1J56A 3AWDA 3KKQA 1V3QE 3M83A 3UAYA 4DUZB 5C7YA 2XDYA 2CLCX 3THWA 4ZT4A 1B6TA 3PUMA 4GZ5A 2EXXA 1QZ3A 4KNWA 4F0JA 3PU6A 4QLOA 3OQ1A 5K1ZA 3GUHA 4G0NA 2VN8A 4DM3A 5BN5B 2HI0A 3V76A 1O9GA 1XTTA 2YJ3A 2DSTA 3JD4A 4J7CA 5T8KC 3RU2A 1REQA 2XQGA 4H1UA 4BNGA 4DDTA 3IEVA 3WO0A 2FUCA 2NYRA 4F6RB 1YZFA 2VPZA 1XAHA 1YT5A 3I04M 4UEWA 3ZN2A 1EXNA 2W6NA 3TMKA 4ZMSA 4XXHA 2O1SA 1P2UA 4R9VA 1YDHA 3DYBA 3PR1A 4Q9JA 2W6ID 1EDBA 1MR3F 1ZITA 3W77A 1D0SA 2BFFB 4JGBA 1RYNA 4TYPA 4CTJA 4J16C 5I9MA 5A6VA 1J9ZA 2D9RA 1OMOA 3W5JA 5CB8A 4I1SA 3ETCA 3BIFA 3DBVO 3DR5A 3GLHE 5LQRA 2A86A 3U5TA 1AKQA 4OFBA 4PIMA 3P20A 1TTTA 1H0HA 1NLZA 1LW6E 2O4CA 3DAGA 3E8XA 4L28A 5HRCA 1ENPA 2N1MA 2D5BA 1V8OA 2VS1A 1OX4B 4I1IA 4B6QA 4DF3A 2O8FB 1EFVB 1QHNA 2D5CA 3DVSX 1YZUA 2YV4A 3ORFA 5CB6A 3INTA 3ISXA 1QAQA 2UUBB 4BHTA 1C9KA 1TKBA 2VDVE 2CT8A 4JMQA 4UBLA 3FMOB 3RNOA 2IYEA 3R0QA 1WSRA 3WNQA 5B7NA 4EJSA 1AQ6A 4G36A 4XIGS 2Q5IA 3T9BA 4TZ6A 2QUAA 3RREA 3AILA 2Y1LA 1TM7E 5KKAA 5BUZA 3IVGA 4TKMA 4CT4B 4AY6A 2K7FA 1U0OC 5I7HA 3L6RA 3REQB 1Z68A 2Q7DA 1VI6A 3LBNA 4R05A 4NEHB 3HI6A 4O1HA 2A0KA 1GILA 4MUAA 4OK6A 1QO7A 1Z7GA 5FV7A 5HBRA 2PSJA 4BUZA 3HEMA 5K8JB 3BH6A 4G56A 4ZTUB 4B46A 2XAAA 2IYYA 3LQRA 2A84A 3NIDB 1TMKA 3DFIA 3RSSA 3L4JA 1Z4MA 1PDVA 4QTXA 5KIAA 1N2HA 1DRVA 1GSHA 1K75A 4JIGA 2DU8A 4TL7A 4CPDA 4ZHSA 5CGQB 1SPXA 2X5JO 2B37A 4PYRA 4C6TB 1N9GA 2NU6A 2WHXA 4Z99A 3KP1A 1LC0A 4CKEA 2K4MA 2JN9A 3FOWA 4Z49A 4KLRA 4G25A 4G0QA 4KQGA 4KQ1A 1VXRA 4F12A 3RS3A 3HR7A 5B4UA 1SKBA 1QPZA 8MHTA 3S2FA 3UBTA 1E4YA 3I4LA 5FL7A 3OWOA 3R7DA 5KAMA 1AD2A 2VYVA 3C3XA 5DNDA 3TEMA 4EJ6A 2DZDA 1YB4A 4JJ8A 2O5VA 1R4MB 1TAQA 3IPCA 5DCYA 1RKUA 1XAJA 2JLCA 2YVLA 1KWKA 3JQGB 2X1VA 2QD2A 4AN0A 5TF0A 1AH2A 5GPBA 1V8FA 5H8WA 3KCNA 3NBMA 1QOQB 2QYHA 2NPOA 2XQFA 3I8XA 4JI8B 3FNFA 4B76A 1ECGA 2FR0A 1PFUA 1YQWA 1R4ZA 4Q1CA 4YDSA 2B4RO 2NZXA 1E6EA 2G9UA 1YI2B 1US8A 2VRNA 3RFFA 2C9ZA 4JV5B 3FPKA 5CLLA 3A3NA 4RAOA 3T7CA 2R0QC 4LG1A 4Z0NA 1H93A 2I62A 4GC9A 1R5JA 4JJ6A 2XQJA 2IU0A 4HO1X 3I01M 3ZJVA 5IZCA 2WUGA 2G07A 4YUZA 4PPFA 3EQZA 3GO4A 4CMIA 2BELA 2ZUBA 1X8XA 4NYJQ 1ULZA 1E9RA 1J1IA 4UEKA 4CV0A 1MC1A 1X92A 3BFVA 1KOFA 2BT4A 3AJ9A 3OTQA 3HHEA 3GF4A 3QYPA 2ZULA 4JVMA 3MTBA 2ST1A 3IELA 1X7ZB 4DG5A 2M9MA 3WGYA 2VHVA 5CYPA 4BNZA 4RPGA 4CLXA 5FIUA 5JARA 3A2LA 3CRW1 4YECA 2W58A 2IGBA 3WK9A 5E6SA 1SWWA 1UKBA 3ZIDA 3RS2A 3WKBA 5JXIA 1CVIA 3WXMA 2F43B 2JGKA 3TW6A 4EW6A 2V6IA 3ELYA 3BMQB 2OD7A 3QE2A 4RWEA 1QIJA 2EZ9A 1FUEA 1P0IA 2QZPA 3R5JA 4WIAA 3V97A 3ZWPA 2XB2A 1ZGBA 1H2AS 1QRSA 1QH9A 1G8GA 2GUWA 2C4WA 2KW5A 3F9IA 3JR7A 1G5PA 3KJFA 4RA6A 5FJIA 2ATXA 2WAYA 5CDGA 4MEBA 1SU8A 2QVGA 2KPOA 3ESRA 5NULA 2JL1A 2Q45A 5DGCA 2MSCB 3OLYA 4W5RA 2UXDB 3HCPA 2Q5JA 5AVJA 1RWPA 5A8AA 2R7MA 5FFFA 2C03A 2CFRA 1D3AA 3CMMA 1MTZA 2OQIA 1X2EA 3NHMA 3HM2A 4NMMA 5D3MB 5CAEB 5TMDA 1ZEMA 3ZCQA 4D4KA 4AP9A 3VNQA 4DCMA 1CDOA 2JI9A 2IGTA 3TIXB 4G67A 2RK6A 1F9EA 1R74A 1IPEA 2P9ZA 2JNWA 2YYYA 3D54D 2Y0CA 3GD7A 4H7PA 3PDIB 3WSTA 5LB2A 2NSJA 1W85B 1E5VA 1MXFA 5FOTA 3W7AA 5K0GA 3AV0B 1IB0A 2C8VA 4K40A 1H2HA 2V5UA 2AXNA 1QIGA 4NJEB 1THTA 3E1YE 1OTXA 1PAUA 2ORIA 1VCIA 3H1BA 3O91A 1TFRA 1NJ1A 4MKZA 2F8SA 4FWBA 3ZCVA 4Q15A 4ARZB 5BSVA 4MYDA 4URYR 1OZAA 3A6DA 4I9GA 1VHTA 2NSDA 2XCOA 3NDPA 1E7WA 1GG8A 2PD4A 3U7IA 4B2YA 1DC6A 5ALRA 4YRBA 1YZKA 3M4NA 4UEJA 4X06A 1QIKA 2ZU0C 3U4DA 1LTQA 3HCWA 1PBNA 3GVLA 4YCJA 3CTMA 5EINA 1EIZA 4ZQIA 5AJHA 3OG9A 1K5PA 3MUNA 4S12A 2DKNA 4YJHB 4RUKA 3W2HA 1BG6A 3V2GA 5CVEA 2VRWA 5I48A 1WBDA 2Q0HA 4MLDA 3CLRC 4N39A 1PG2A 3BDVA 4RE5A 1V7PC 3K15A 1OI7A 3PUNA 1ZO8A 4OGLA 2BZ0A 4QASA 3AYZB 3CA8A 1EVLA 3OWXA 1CR4A 1TZKA 2GRJA 2Q3MA 4ZALA 1L1EA 1VA5A 4WX2B 5LP6C 2VQFB 2ATVA 4ARVA 5ICCA 1ZI6A 4WD3A 4LZLA 2CBGA 5C2JB 4BKUA 5KNLA 1ECLA 2PSEA 2RONA 5COQA 1LEHA 5TMEA 4HGOA 1ONSA 3HFSA 4E09A 2UYHA 2DOKA 3BYZA 4F6LA 2I55A 3DAHA 3I42A 1IXKA 1GYRA 1XZ8A 1ZD8A 3H2ZA 3D2CA 3BWEA 4XIYA 1CHNA 3F8WA 4JITA 4KMMA 2IJGX 4U2KA 3CRRA 1GRNA 2IXTA 3TUJC 3VAAA 4D57A 3U48A 1XF9A 2AOTA 2CWDA 4DHEA 5JS6A 1AGRA 1EX1A 1NN1A 1R27A 4FDTA 1P80A 3QVXA 4LIPD 1A0OA 1E2JA 3I6ZA 3EVTA 4NDAA 3WP1B 1JWAB 4DA8A 2BWJA 4D43A 3PE6A 4PAWA 9MHTA 3NOOA 1CZUA 1KY2A 2FVYA 4DEXA 1ZD9A 1ES9A 4LZPA 2B82A 4IW3B 1XNGA 4X90A 5DGIA 1HE5A 3HCEA 5F7OA 2H1CA 3MN1A 4JJGA 3X2FA 2JLRA 3DKPA 4XTCS 3R20A 1JI0A 4KR3A 4KFRA 4L07A 2W6ZA 4PG4A 1YQDA 2ZJ3A 2BUCA 4ID3A 3TE6A 3DMPA 4BQPA 4PC6A 3NT2A 3RIYA 4KL8S 1M34A 2AZ4A 2O20A 1UZMA 3MUEA 2JS7A 1X1BA 2XF8A 5FYDA 1UDAA 1P60A 1ZMTA 3CPJB 4XM3A 1D04A 3GEBA 3KEGA 1PQWA 4OA5A 3W79A 4CMHA 3SMVA 4QPJC 1YNOA 1V47A 1X1DA 5DYTA 3A7DA 4JUFA 2ZBGA 1N3IA 5LL6P 5KTOA 4YDRA 1UBMS 1NHWA 5CEJA 1N2CA 2CNKA 4U0KA 4ZQCB 1DKRA 2ZIWB 1GZ4A 1NMZA 2BAGA 2O0JA 3CPSA 4Q93A 3KR9A 3L7DA 3T5GA 3DDWA 3WL4A 4QUEA 4YUAA 2J7PA 4CETA 3MB8A 4LVUA 4JI1B 5HXBA 1CZRA 1MO6A 1S2NA 4YMGA 1HSOA 4WXRA 3WB0A 5K99A 1GPDG 4WT7A 3IULA 1LDGA 5EMKA 1IN5A 2H4YA 1LNSA 1AN9A 2VHCA 3N6VA 4IMJB 3VR6H 3NRJA 5D3KA 3BSSA 3SXUB 3WICA 3FOFC 3PIIA 3P9KA 5IASA 4P1VA 4FXPA 1YTLA 4NZOA 4PCAA 4FW9A 5DTJA 3H5LA 2WHPA 4L50A 4KXYA 4NV3A 1C7RA 5FBHA 2N46A 3DDSA 3FPCA 4V38A 2G4LA 3I92A 5DRYA 1OWLA 2IV7A 3RGGA 2OZLB 3ZDDA 2LZJA 1RRGA 1WO8A 4IQGA 2AZMA 2JLSA 2XNHA 4I1UA 1AQJA 2WK1A 4CGYA 2YWEA 2QSUA 4KNYA 4F6CA 1TEHA 1XZAA 2H17A 2FR8A 3BD7A 4EIWA 1QXSA 2OK7A 3CX3A 2AX3A 5B57C 5KW9A 3OFSA 4QEKA 2V7UA 4BO0A 5A5EA 3M6WA 4QEZA 2GTPA 2QQFA 1SC1A 4L85A 5BOSB 4Y2HA 3OJCA 1YMVA 4K6KA 3FJYA 1SKAA 1UC5B 1EXVA 2Y05A 3STVA 3S2UA 4L78A 2NV0A 4FMDB 4RMIA 1PL7A 3ESQA 1NL3A 3LE8A 1UD6A 3MWLA 4ALKA 2RHJA 2AMVA 2O0MA 5ALOA 5FXMA 1PJ5A 4P8RA 2R47A 4OHCA 1UJ4A 1GAWA 3UVEA 4EK9A 2EJTA 3A9TA 3QX8A 3A6ZA 5KX5A 4BX9A 3DAOA 3T54A 1HV8A 3HACA 4WUTA 2FFQA 3BFPA 4KH0A 2PSDA 5F5NA 1JS1X 4LY6A 2H5EA 4NU0A 4M60A 5ARBA 2UYOA 1UDCA 2QRZA 3U6KA 2FZGA 2VBFA 3KTFA 3LWNA 5DK4A 3VKWA 3H1AA 2LNDA 4Z8XA 3WLFA 3AFIA 2CGEA 1JRLA 1T1JA 2A5JA 3RVNA 1FLNA 4RYDA 1KBQA 1FXUA 2P5SA 3CUUA 3EVEA 5FBWB 3WGJA 1M0WA 3ZXUB 3I2FA 4QL3A 4P3YA 5BSXA 2Z3VA 1L8AA 1QFSA 4G9GA 3HZRA 1N6RA 2WZDA 4LOKA 2ZYRA 4YJ3F 4LV8B 2LXNA 5P21A 1E5LA 5GIPE 4Q34A 2X8LA 4AWBA 3OPYA 1UZUA 1GIAA 3REGA 3ASTA 1DIOB 1JDVA 3WWCA 4GLBA 1IPHA 1BYIA 1D2GA 1Q74A 1V8BA 5JALA 1YBHA 2YWGA 4P7FA 5JNRA 4Y1RA 1OOEA 3C15C 2NQ8A 2O7SA 3BAFA 4JBYA 4OSEA 4LEIA 2OD2A 3BORA 5H16A 4FHEA 4HNTA 5B12A 5CLFA 1SEPA 5CNKA 3AO0B 4YRGA 4L57A 3RVMA 1T5TA 1SUCA 3GRPA 2FSVC 4B33A 1U80A 2ZRDA 2YJNA 4YK7A 3BXPA 1BDBA 5L46A 4IVQA 3FOEC 2PUBA 5A3QA 1KC3A 2PUTA 1VL1A 4HMPA 1PJBA 4X1IA 1IBRA 2M1ZA 5ADVA 2D6FA 1GPYA 3E05A 3BILA 2P7HA 1P7CA 3QX9A 5CB0A 2K7ZA 1FFHA 2FSIA 3ENNA 4GPAA 4L9SA 3LCVB 5B1IA 3B1JA 3U7JA 5A71A 2AR9A 2WSLA 1BS9A 1IOWA 1VGQA 2ZRNA 3ETJA 3PWTA 5I7RA 5TS3A 3KOOA 2X5OA 1QSGA 1M5UA 4N65A 4LZOA 3ZGYA 2HHAA 3KTAB 5TRDA 3U4CA 1TA0A 5CB4A 1N32B 2AV6A 1I24A 3L3BA 3CLSD 1N3LA 1N7JA 3RFVA 3RTGA 2DY1A 3FHTA 1UBEA 3VDRA 1RFGE 1UOEA 2XB9A 3TSZA 3QELB 2QUJA 1L6RA 4R9SA 1U3FA 5JBIA 4LY3A 2CC2A 3S0JA 1V16A 4CWAA 4GKJB 3U4MA 4XYLA 2CNOA 3OPVA 1V5WA 2HMAA 1F5SA 1NVDA 2MINA 2QYOA 2WUFA 5IC6A 4CR7A 5LDDC 1XD2B 3EJ6A 2ACWA 3E23A 2AJBA 1SVUA 1UKZA 3TRFA 3AJRA 1YKSA 5AUOB 4YGYA 1CQWA 3HK2A 4KEAA 3U7FB 2DCMA 5HP4A 1USVA 1M2EA 4ZVUA 2XJ9A 4IZOA 4JJ4A 4NU5A 1YZNA 3V2IA 8LDHA 5DI3B 1M1ZA 1YDFA 5GOTA 2LGJA 2FR1A 1T2NA 4AMZA 4D46A 2B7CA 3Q4GA 1L7OA 4C06A 4QZVA 1G8HA 3K2QA 4OXQA 5MN5A 3ND7A 1WB9A 1SHJA 3M82A 1BDIA 2PFKA 3UKDA 1NVEA 3TCKA 2VYNA 3K09A 3UYKA 3HKDA 3OTHA 4Q3CA 3FMFA 5A05A 3GRVA 5SICE 3PR3A 2VIIA 3WSWA 1GXSA 1Y6FA 2ZUDA 1EVIA 1Y37A 3PXAA 3Q7PA 4BMZA 1IZZA 3PQ7A 4BMYA 4L5BA 3AIOA 2GDJA 4AMUA 4ECEA 5JDCA 1IY8A 5IG2A 5LVAA 2O8BB 3CB4A 5ICGA 1OXUA 4ESVA 3U31A 4PZEA 1GL6A 1AXEA 3SKBA 2IXBA 4IKOA 3BY1A 1GZ3A 2AN4A 4KZPA 4CM8B 1Q21A 4I5FA 3IQIX 3CZPA 4UXHA 3K5WA 5ALTA 4BLQA 1H2FA 1NI4B 2XCTB 5IVKA 1WSWA 5DN6A 1Y8AA 5AYVA 2JBAA 3GUYA 4LJ9A 3L41A 2P7IA 2G3YA 3U0VA 3G2LA 1MBZA 3SX4A 1KO8A 3H5NA 3P27A 3GT3A 4GMKA 5HF9A 4WADA 3M49A 4J07A 4YAUA 3S5UA 5A7FA 3IP9A 4H77A 2E0IA 4PF1A 1QGED 4YT8A 3NBKA 2F62A 3NTUA 5IDVA 3SBDA 2ONYA 3VR1A 2DOGA 1D4FA 1TM3E 2IZOA 3ESCA 3OM8A 1EHYA 4OHBA 2AMLA 3PUIA 1O5TA 1YUBA 2HRRA 1C50A 3DOEA 4JNKA 1W0CA 1AO3A 4HRYA 4TM8A 2X3YA 5TE9A 3GEGA 1SUWA 2DR3A 2IF0A 3WIEA 1OTYA 4QUJA 3ZQKA 5CPFA 2P2LA 5KOYA 1A8IA 1O77A 3JQ7B 1Y80A 4IICA 2Q62A 4OFZA 3A10A 1TPYA 2DM6A 3B1KA 4C0KA 3GV0A 1EZZA 2VSNA 2FY8A 1B16A 2X2EA 3CH5A 4MVJA 2CMKA 1AUPA 3GPCA 3W9UA 4WECA 4ZV4A 4FMBB 3R9XB 4F1WA 1KVTA 1FYXA 3VC3A 4GI1A 1Q7CA 1TI7A 1M2GA 2ZWOA 4M0CA 4Y2TA 1NNEA 5IBCA 5FUWA 5E6UA 2HSDA 2RHHA 3V6LA 3H1TA 4K9PA 1TQ8A 1INLA 4GZ3A 1ZJJA 3HV0A 3ONDA 3H8SA 5E7MA 4ZTBA 3T52A 3NVKI 1N75A 1UC9A 1YJXA 4ARUA 3NAQA 4PWZA 3FPLA 1A50B 3B20A 2E55A 4CIBA 3OJFA 4DXHA 4HNAA 3W5DA 2KBEA 3KFLA 2GM9A 1AN0A 4UMEA 3ZGOA 1EVJA 1OA0A 4TV8B 1ODCA 3H6HA 4JLMA 4OXNA 1ADYA 5ALJA 5C1DA 5KNCH 2B8EA 1O95D 4PYMA 4XR9A 4CFSA 2AZTA 2ZB4A 4ZGGA 1KZ9A 2G63A 3NWEA 4V0SA 3U9SA 1TLLA 2ID8A 1JJFA 1JEEA 3HKBA 4NKRA 5K6TA 4Z4EA 1EHCA 1A1VA 1G8PA 1NKVA 5JANA 5FI3A 1XTKA 4QDJA 1ZS9A 1RQ2A 2C7RA 3I9NA 1CUBA 3DDCA 1GQ2A 1PV1A 3FJOA 2Z3ZA 3IURA 2O8EA 3LVFO 1EK2A 2JCSA 1Z8NA 2I4IA 1Q6YA 1C1XB 1TIPA 4L2IB 2WWIA 5LYJB 2ZWPA 1CQJB 2J32A 3KJXA 4GOND 4ESEA 2CXUA 2AF3C 2YJ6A 2AW5A 4RSHA 4HTFA 4UUAA 1WZ2A 3LMKA 1ZN7A 3RARA 1Q1GA 3AF1A 1M8PA 1NOIA 4WCDA 1UKVY 3MMZA 3BT7A 3JWGA 3V1TC 3OT4A 2X2PA 3WYNA 3PI7A 4R3NA 3TZLA 1QJ4A 3AOEA 1N25A 2YFHA 4GM1A 1B42A 2J0UB 2BR3A 3G2IA 1GZVA 1I6MA 3KLPX 1UBRS 5AVQA 3ES9A 3AF3A 2GYYA 4XW2A 1WMEA 3JWJA 5DASA 4UFOA 3MWGA 1RSZA 2XMPA 3EQ9A 2D8AA 3EVNA 3MUOA 1Z0DA 4XQ9A 2Y77A 3PLAE 4A0HA 3T5MA 3EXAA 3B3GA 3TSCA 4G0WA 4JCCA 4IUDS 5J43A 4PHTA 4LS3A 3B6IA 2H0AA 2FW1A 2FWPA 1MJ5A 3ETEA 4I50A 5CT5A 4CVNA 3IVRA 1EM8B 3RODA 1I7NA 4WESB 2Y3IA 1WM1A 5BW5A 3OQMA 2JDIA 1SXIA 1Q91A 3LWDA 3W3AA 5BQFA 4B34A 2H00A 3LNCA 2K87A 3QP9A 1U2RA 5D5HA 5JSQA 3QKSB 4MCAA 1I33A 3FCSB 4LJ8A 1YZQA 4PQFA 4XVRA 4Z9BA 1R50A 3USES 1IBKB 1J7KA 2HRQA 1GV1A 4Q9AA 1HYQA 3EMDA 3AB7A 1F2DA 3GYGA 1NASA 4AQYB 1RZRD 4JL8A 1TFUA 1NYRA 2I8CA 2HDOA 4R8KA 5DMXA 4D42A 4K81B 2MHCA 2P4UA 1GKUB 2QRNA 4RIIA 3ZK7A 2FQYA 1XKXA 1LVGA 3OEED 1N9KA 3NHYA 3KUUA 1IBSA 1ZMOA 2DLNA 2OAQ1 3ME5A 1CPYA 3L4BC 4DZRA 5I3ZA 2FU5C 1LQUA 3UWOA 1WSVA 3I45A 3PXBA 3OX3A 4ZYUA 4I1PA 3EIOA 3DOUA 3RYHB 2XDQB 3KT0A 5EHIA 3WAGA 4G2TA 3DE0X 3LWZA 4E7OA 1SVKA 1VHWA 3BE5A 3O1JC 1BW9B 2RGNA 2TSYB 2X4IA 4QUIA 2JI4A 2GNAA 2AEMA 2FRVA 2E4AA 3IDSA 4AUMA 5KMGA 2KM1A 5AKGA 1Y5MA 3RADC 1YRAA 2JFWA 1GQFA 1FMJA 1GOTA 3GP5A 2PXHA 1YULA 1VCNA 1E8NA 4OXRA 4XLEA 1BD3A 1CEQA 1GTMA 1X1RA 4H3HB 1U2QA 4N47A 3OQNA 3ERCA 1PP4A 3R4CA 3U4IA 3U4AA 2P5UA 2YWRA 1G6OA 4UFPA 3HBAA 1EA5A 4LSWA 3E9NA 4R0MA 3ZHVA 3B89A 3PC8C 3JV7A 3TZBA 2XYVA 3N2GA 5K4AA 5EYPA 3FNBA 5L7WA 1ZBDA 2ZFUA 4JQOA 3EB9A 3QNWA 3NEYA 2NZJA 4BVKA 1LPOA 1P31A 1ZPDA 4KXUA 5I4BA 1EIWA 3NGLA 3B2EA 3P71T 1Z4PX 3K35A 4BV2A 2PMCA 3A8JA 2YCLA 2OCPA 3FDXA 3HTXA 3GDGA 3LBYA 2HGSA 1Q15A 1WWKA 2AK2A 2BJHA 4IDDA 4N0DA 1W5FA 1W46A 4PONA 1F6WA 5CHEA 2Z0MA 5ED0A 5T67A 4DCTA 5JYDA 1AA9A 1R6DA 2G77B 2ZL6A 3DG9A 5EJFA 2CVPA 1VKOA 1X8KA 3R3HA 4D44A 3KHUA 2JAXA 4N0EA 1RKVA 5CXSA 1RAIA 1HQCA 3HB4X 2D3WA 2HU5A 6GPBA 2P90A 6ABPA 1OX5A 4NYIR 1V5EA 1QRAA 4HZGA 3P2KA 4HGPA 3C6YA 2ACVA 3DNPA 2VDNB 3KYDB 3O7WA 4UDOA 2EATA 5TDHA 3IBTA 2PH1A 3ZU6A 1X38A 1AQLA 4WASA 4UJ3A 5ES3A 5JAIA 2ZIXA 4BJ1A 2DBZA 3IH5A 4R81A 2Z2IA 1SQSA 2C00A 2FQ1A 4BCDA 4PYJA 1JKXA 2OECA 3IHTA 4LHVA 2Z3WA 3RRBA 5KOJA 1O97D 2RGEA 2YN0A 3IBYA 4B79A 5BV0A 1X7DA 4URUR 2H2IA 1PGJA 1TF2A 3P9RA 4QIHA 5GIOE 1IBLB 4D74A 3D8UA 1LVUA 2DWOA 1E32A 2C5EA 2PKQO 1XZBA 3LX8A 4OREX 3GG2A 2MIIA 3GA5A 1DCFA 3BCHA 2VL7A 3EIWA 3A4LA 2QVYX 2YHIA 3ANXA 3IEPA 3DBLA 4EA9A 1YOVB 1GN9A 1JG2A 1I2AA 4B75A 5MFZA 4NENB 4KQ6A 4ND7A 4DQLA 1GZHB 3KAKA 4H60A 4NPAA 4QO7A 3U5ZB 2WP8J 4KI7A 4S1NA 3CUEF 1IXRC 3K05A 4NEQA 5LQUA 4N0MA 1ZWLA 3RVPA 9ATCA 4MI1A 1EVYA 4TTVA 5CFQA 1VC2A 3PX7A 2HCJB 4ZI7B 1X15A 1A4RA 1Z2OX 3VGJA 3K70C 3SG0A 5ANRB 2XVZA 5E6RB 1KARA 2XOXA 4FCTA 1WOSA 3ZZNA 5FX2A 1U8CB 2YY5A 3ELWA 1U7ZA 3AMVA 4RHEA 3I30X 3WYEA 1SEVA 1N3YA 4YLGA 3LKVA 2AOVA 3EUWA 1GG5A 1J5PA 1MABA 3C43A 1U7HA 3EDYA 3REOA 2WM9B 2GSDA 4AZ3A 2QGZA 3ZWAA 1NW3A 1I7QB 2GZDA 2WYIA 3DDOA 4C3VA 4CTKA 2G5PA 4D9KA 3NW9A 3OA2A 3TN7A 2VATA 4YIHA 1JQKA 1R1DA 3OQBA 2QR3A 3OBIA 5IJZA 1G20A 5A5FA 521PA 2R1UA 4L5CA 4BEJA 4X7EA 1XP5A 3BWMA 3N2LA 5HFJA 2I34A 2IKSA 2V7PA 5EC8A 1T8UA 1SGWA 3EPHA 1VJRA 2PY6A 2ZI4A 4QWWA 2ZJ4A 2O7QA 4QJ4A 3ZCXA 2P3MA 4L95C 4PBSA 2DPYA 2H1LA 4O1MA 5JDIC 2RH4A 4JUBA 2OZKA 2AXPA 2HCFA 3LYLA 3TBFA 2D54A 2EWWA 4C76A 2IOHA 3ZLJA 2ID9A 3RQSA 3S8MA 1B0AA 1YE5A 4OATA 4MW7A 3SZOA 4WLNA 1UBKS 3A1SA 3L05A 1PUJA 1Y6RA 2FQWA 2J9YB 5A3JA 1CUEA 4HLNA 1WUJS 4IXMA 4MUEA 1H5NA 3C3DA 1GFWA 3AEQA 1DEXA 4P5PA 4BGIA 5EGNA 4E5YA 3DBOB 3VPCA 4PLGA 2Q2OA 3ZIAA 4Y0NA 1A04A 4LPSA 4MGEA 4OYLA 1NDQA 1N7GA 3Q0EA 1NTOA 2BFMA 3PPWA 1M5RA 3MNFA 1ONBA 1JUDA 1QZUA 3ENZA 5ADUS 2DBYA 5J4VA 2RC6A 1DUSA 3AGPA 4D9FA 1K27A 3OLVA 4A27A 4FYKA 2VF5X 4GEGA 5IARA 2JANA 2ZSDA 3ICOA 4RH3A 2Q7XA 3FYSA 3IEXA 3WYGA 2RAPA 4LHYA 4DLTA 1P3DA 5EJ8A 1C9DB 1VL0A 3EQ7A 4DCSA 4NNOA 4EPYA 1NBAA 1A5SB 1WY5A 4BC1A 1RXVA 3ZY6A 2NXNA 1E9DA 5CIYA 1HA3A 3O8BA 3ZE6A 5L3SA 2NPIA 3PFKA 3GK3A 4O8ZA 2Z83A 3I6BA 4Z0HO 1RQLA 1YBAA 3VR4A 5JI2E 1LW7A 2I65A 2L0XA 4D8VA 3N5KA 2BEUB 3M33A 4UAVA 2CLEB 3RYTC 3R9WA 1CY0A 2H4HA 1YAJA 2UUPA 4LN1A 1VOTA 2I4OA 1V7CA 3LNNA 1E3ZA 3FPHA 4BO5A 4TYMA 3WV5A 2J5BA 1Y9ZA 3RS0A 2AFVA 2AG1A 3GUCA 3ZXYA 1DAGA 2QXYA 3AKDA 4YASA 4UNNA 4EDHA 4C04A 2O48X 3MCAA 1KZHA 3SLNA 3EGXA 3AERA 4D9IA 3MTJA 2C0CA 5H0IA 1MLDA 1R0YA 2EKPA 5A6SA 1EWRA 2ZJAA 2G8LA 1ZWKA 5CD1A 1A8PA 1D6NA 4G0MA 2CE7A 1ESEA 1VJ0A 3RLFA 2C5GA 4OP7A 4P4UA 4DJTA 1SCUA 2C9CA 4QM7A 5IC4A 1TC1A 4YQYA 1AZWA 1AQYA 4DLKA 2QP3A 2Q9UA 4JBIA 2ZYWX 1NF8A 1TU4A 3NYRA 2XT6A 1O94D 4F4CA 1N8KA 4D25A 3AFMA 1AUXA 1NT4A 2PNFA 3P2IA 3EY9A 4PNPA 3CNNA 4JP8A 2B1RA 4WOKA 3L7OA 7MDHA 4JLOA 2R6DA 2DETA 1WEHA 4B0OA 4F4DA 3IAFA 3K31A 3ZVMA 3JY6A 1HT1E 3L04A 1KSGA 2XCUA 2E5WA 1Q7TA 4JA2A 6REQB 4CI0B 4OLAA 1EGMB 4DWOA 1JEQB 1SCJA 2A14A 3VI3B 1EFPA 2ETXA 1KO5A 2HPAA 5FFNA 3RK0A 5L4NA 5BSYA 3MB5A 1OYOA 2EP5A 2ZT6A 3JQFC 4W5JA 3KXLA 1U11A 2Y8EA 3GBSA 4MX8A 1HM5A 1NW7A 2GJ4A 2C5LA 2XE4A 3W6UA 2HSGA 2UVPA 1M2OA 4GU5A 4Z9FA 4OHZA 3JARA 1E2MA 5TGTA 5J63A 1I51A 3BTUA 4LDJA 3I76A 2VF7A 1MB2A 5JCJA 2YV5A 4ERNA 1XDGA 2BV3A 4M38A 4BO2A 1ADFA 5JLAA 4RM2A 2O19A 3NFYA 5AVSA 1EAMA 1JE0A 2IBTA 1Z8DA 1TYBE 1VQ5B 2JHAA 2AMFA 3IIKA 3DEZA 2HUPA 4UHEA 4OAPA 3N2KA 3D0QA 1O3YA 5AUQA 3CWZA 3ICCA 3TQRA 1V2HE 1WQ3A 2UKDA 1CF9A 2RD2A 2KI5A 5C8XA 2BUBA 4JLJA 3DV2A 5JMPA 5F98A 1J2TA 3MWKA 3DLHA 1U2GC 1ETHA 2Z2XA 1YZVA 3FZEA 4YRFA 1ZK0A 3RH0A 3RVLA 1CIVA 2Z04A 5JNWA 2BJWA 3NWPA 1HKHA 3ZQ6A 2W6MA 2VJJA 1X1AA 3DD5A 3CUSA 3HKCA 1GVHA 3TD9A 3IUNA 4HLCA 4LTNA 2D00A 2J3EA 2XZDA 3FCUB 3WGMA 5K0BA 1RD4A 3H99A 2QBYB 3AM5A 4Q48A 4AO7A 5FA6A 3TGWA 2XUFA 4UM9D 1U7WA 5KYUA 3AEKB 4C0LA 1VJTA 4KUGA 4F9TA 5A4JA 4HATA 1ZVKA 2DPXA 3O75A 4YJ2F 2VLBA 4HYYA 2OXTA 5KDLA 3JVVA 1DKOA 2PV0A 4D0NA 1ZN8A 1CQIB 4WXHA 4HI0E 4FQ7A 4AJNA 4M1MA 4RIHA 3UAWA 2FPIB 2W6JA 1E92A 1COWA 3BSWA 4GSLA 3MFYA 3N39C 1DBSA 2IU6A 5EPUA 5G1NA 1V4BA 2M6SA 4GR4A 2ZRMA 1ZD1A 3KXKA 3Q7RA 1W88B 3C41J 3M5PA 5A4FS 3SR4A 4I81A 2H4JA 5IYZB 3KETA 4HE6A 3C8UA 3E61A 3D7LA 5H3CA 1L1FA 3QLJA 3U3DA 2QG9A 2Q1TA 3TTVA 5IX8A 1E0KA 2BCEA 1JEDA 1HDYA 1T13A 1E3DA 2D1SA 1OPRA 3EVGA 3EH2A 4FPXA 2VUSA 3DXYA 1X42A 3K0HA 4RQAA 4TRNA 4Y2SA 2Y0EA 3GFFA 5GWXA 3JS5A 8ATCA 5D6OA 4DMFA 2OKGA 1EAYA 2GEBA 3TIGA 3W05A 3M6LA 4Z1OA 4LRXA 3KBOA 4Q3EA 4C4OA 3Q88A 2AA3A 2BF4A 1DX9A 2IK8A 4S2EA 3KX2A 2CCJA 3IQXA 4KNVA 1E3MA 2I3DA 1SVWA 3E3OA 5JT1A 2KLHA 1UAAA 3P2YA 3RASA 3MOIA 1H42A 4HQ0A 5AVTA 5JVDB 2R6HA 1R0KA 3ZY5A 3QKRB 4RTPA 3ANMA 1G2QA 1ISRA 2BP7B 4TSRA 1XMXA 2PRIA 5ICSA 1JQ5A 4LTDA 3RC2A 1D8AA 1JG1A 4TVBA 1XRSB 3KIPA 3UK0A 1KE1A 5CA1B 4BU1A 3GNQA 1FDSA 2PCJA 1EEXB 2RBKA 4TQ9A 5CH3A 4AKGA 3KQTA 3DT8A 5CCDA 1RM5A 1UIMA 1I94B 2EFYA 4PSCA 2HO5A 2IUFA 4M6WA 2HQ1A 1Y4ZA 1NBMD 4RA9A 4ZYTA 1EWQA 5LQSA 2W0MA 4JOSA 1S2OA 4J6FA 4EG0A 4ZAFA 1H6BA 4L6IA 4TMFA 3WLTA 1Q7GA 3L8GA 1DXHA 3LYUA 1YITB 3HLKA 2MYUA 2VJNA 3TKLA 5IDQA 4MW6A 6ADHA 3T3OA 2VTDA 4XWYA 4ZXPA 4PFSA 3KQNA 1SOUA 3C3KA 1QS0A 1P73A 3PYLA 4KLCA 3UTCA 3MJTA 3VISA 1B8OA 3VYSB 2AE2A 4RFVA 1OV6A 1EJBA 2W6IA 2QT0A 2R3SA 1GRQA 3NTOA 3OSUA 1JHVA 4LF6B 1RWMA 2E5FA 3MWYW 2GJAA 3UT6A 4ZARA 1J21A 3TE7A 3KKPA 1D2RA 1JDPA 5KOHA 4R1TA 1K0UA 1U9IC 3RTAA 2I9KA 2AFIA 4HDMB 2V98A 3F7MA 1GKYA 1ZISA 2DH5A 2HLDD 2YOFA 4RKWA 1JFTA 4RHUA 4C6SA 5CDUA 1ISFA 2OXCA 4RJJA 4IGEA 2A1TR 3CS3A 1QK5A 3LUPA 5C1BA 3H0EA 2HF8A 5K6AA 3S8EA 3HY3A 2OHGA 3D7SA 2WJGA 3MOGA 4WJZA 4JY7A 3O8CA 4BNFA 1ZSVA 4ZGQB 3IODA 4F46A 3MT9A 4P98A 2DB3A 1XFDA 3KEMA 5HKOA 3FVWA 1KY5A 1TM1E 2PMWB 1SUBA 4JJZA 3M9XA 3EDOA 2I66A 1PDWA 5C81A 4DIMA 1YQQA 2DCUA 4EEXA 1W30A 4RTMA 1SWVA 4HXGA 3P19A 4BQFA 5LQAA 4AWXA 1A2KC 2JCYA 3ZV4A 3OCYA 1R18A 3P1JA 4UNIA 1OXSC 1PSZA