1EWYA

Anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
303
structure length
303
Chain Sequence
TQAKAKHADVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of the interaction between the ferredoxin-NADP+ reductase and ferredoxin from the cyanobacterium Anabaena: looking for the elusive ferredoxin molecule.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP REDUCTASE
total genus 77
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2000-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ewyA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1ewyA02
3W5UA 4H9GA 4Y9UA 1S72B 1CNFA 4FK8A 4RJLA 4WQMA 3ZC3A 1VQ7B 3WXMA 4AF7A 1AIPA 4ZCMA 3VNUA 1M90D 3AGPA 4ACBA 1JA0A 1ZM3A 1FRQA 4TMVA 4ZCLA 1GO2A 4QHYA 3ZZUA 2PLFA 3LO8A 1YJ9B 2HDNB 2FX3A 3WBJA 1YITB 1CNEA 2C78A 2GQFA 4RD4A 3ZZTA 2E1RA 4ZGNB 4N3GA 1G7SA 1YJWB 3P27A 3AVYA 3VNVA 2C77A 2OK8A 3QFSA 1F20A 4B44A 3U6KA 1GAWA 1KQSB 2BM0A 4BPRA 2CRVA 4RD0A 3CRZA 1VQ4B 3CC2B 4TMZA 4G1BA 4PC1A 3AVVA 2BVNA 1EP2B 4RD2A 1BQEA 4AC9A 2QA4B 4B3XA 1QVFB 5KSWB 1R5NA 1TLLA 4QFMA 2QDXA 1VQ8B 3E20A 2PMDA 3I1FA 4M1KA 4MYTA 1Q86D 2HCJB 4LBZA 3FPKA 4IW3B 2DY1A 1QUEA 5TY0A 2BSAA 3AVTA 4ZCIA 3CMEB 3CC4B 3AVUA 1BX0A 1JNYA 5DSZA 3LYUA 5EMNA 4LBYA 1YIJB 3CB4A 1FNDA 3CCUB 2QN6A 2DEUA 4DQLA 3OJWA 5H59A 3W2HA 3G71B 1QGAA 1QVGB 2BGIA 2BV3A 1KTVA 1W2BB 1KK0A 2RC6A 3VO1A 3B82A 1KJZA 4FWTA 4U9UA 4LBVA 1FDRA 4HE5A 4G1VA 1VQ9B 1QX4A 1QFZA 1D8TA 2HMAA 3JQQA 4UAJA 4M2LA 3U2QA 1KK1A 5GV7A 1YJNB 4RD1A 2XNJA 4NCNA 1FRNA 1M1KD 3CW2A 3FJOA 4YAWA 3AVWA 5THXA 4YAOA 1KK2A 1A8PA 2VYQA 3CCVB 1VQ6B 3OW2B 3I55B 3CXCB 1OGIA 1XE1A 3CCEB 3W2EA 4MYUA 4B43A 4G5GA 1VQNB 3QE2A 1YHQB 1H42A 1EWYA 1R5BA 4P3YA 1QFYA 3CCMB 3JQPA 1KK3A 1EP1B 1G7RA 3QFTA 1IJFA 2QTZA 2BPOA 1I7PA 3V76A 2VZLA 1EFUA 2R6HA 4RD6A 2QMUA 2YWGA 4M4SA 3OZVA 3ZBUA 3CCLB 1Q81D 4M53A 1OGJA 1OB2A 5H5JA 2OK7A 2VNIA 1QFJA 1EXMA 2XNCA 1W34A 3W5HA 3MHPA 1H85A 1VQ5B 4TMXA 1OB5A 4TMTA 3PENA 1AMOA 1S0UA 3OZWA 1B2RA 5TR9A 4YHBA 4ZGQB 3CC7B 4Y9RA 1EFTA 1ZM4A 1GAQA 1DDIA 1YI2B 4TN1A 1FNCA 1U2RA 4C0SA 4FN5A 2NPFA 1K8AD 2YWHA 2VNJA 1ZUNB 3WNCA 4ACAA 2AHOA 5GV8A 1NDHA 2EIXA 3VMFA 4RCYA 3CD6B 1NJID 2PIAA 3WNDA 4R71A 2J7KA 1E62A 3QSYA 2OTLB 1TVCA 1HA3A 1JB9A 1QH0A 1EFCA 2YWEA 3CMAB 2OTJB 1XB2A 1VQLB 1QGYA 3AGQA 2VNKA 1B23P 2BM1A 4N3NA 1QGZA 1SKQA 2QTLA 3P26A 2DETA 4AF6A 2GPJA 1E63A 3W2FA 3U6BA 1J9ZA 4J0QA 1BX1A 3ES9A 1KRHA 3OJXA 1N0VC 1N0UA 4F7DA 4K1XA 3LRXA 1R5OA 1FNBA 1W87A 1D2EA 3WY9A 3E1YE 2BGJA 2XEXA 1BJKA 3W2GA 1ELOA 4B48A 3I56B 4EH1A 1EP3B 1JA1A 1D1NA 2DERA 1G7CA 3WNBA 2EFGA 3CCQB 2X3UA 5HXBA 3QFRA 3W2IA 4YAFA 1CQXA 3J81k 2QEXB 1W35A 3WYAA 1QUFA 1TTTA 1GR1A 2VNHA 3VO2A 1E64A 2B7CA 4PGOA 1DDGA 1K9MD 3ZBTA 4M0LA 3CCSB 1TUIA 1KC8D 3A1FA 1VQMB 1VQPB 4PC3A 2BF4A 1UMKA 5FA6A 2BMWA 2ZITA 3OZUA 3LVBA 3G4SB 4YAUA 1SM4A 2BN4A 4TMWA 5TV2A 1QG0A 4RCZA 5JBQA 1IB0A 3CPWB 2D74A 4PC2A 3CCJB 4RD3A 1VQOB 1IJEA 5AN9A 1DARA 4B47A 4Q7JB 3QFCA 1Q7YD 4C43A 1WDTA 2B7BA 3AVXA 1ZM2A 4PC7A 2DCUA 4NBSA 3CCRB 2B5OA 4LC0A 1VQKB 4Y7CA 1G7TA 1GVHA 2CNDA 3ZZ0A 4ZV4A 1DG1G 3B78A 3SJZA 3W5VA 1Q82D 1KD1D 4LBWA 3G6EB 1JJ2B 4P6VF 3WBKA 1K73D 2RC5A 1F60A 4YALA 1ZM9A 2YWFA 1N8RD 4PC6A 3B8HA 4DQKA 1GJRA 3MCAA 4B4DA 4HE6A 3MMPA 3JQRA 1FNMA
chains in the Genus database with same CATH superfamily
1RCTE 1GZSA 1K06A 1TQ4A 4RSGA 3AF0A 3RAPR 5MFPA 4G5SA 3PXDA 2IV7A 4PVCA 4ABTA 3ZZMA 2G40A 4NZMA 2IXAA 3H2GA 4LX8A 2FOLA 5P21A 4CMJA 3BXHA 1G8HA 4GO1A 1ML4A 4GBED 4H7DA 3BY2A 3KDPA 1PJZA 2N46A 3WXMA 3LSTA 3OSZA 4UM7A 1KOGA 1UC8A 4HEA1 4Q1BA 4CKCB 5FEUA 4F4FA 1K8RA 1D3AA 4ACBA 1O77A 2DWQA 3P9CA 2HJSA 4HH0A 4Y6PA 5G53C 1CF9A 4AP6A 2JLUA 3IC5A 2HIMA 1H2WA 1WPQA 3LQYA 5LOVA 4YRGA 4WVLA 4BRSA 1TK2A 2AMVA 2FRDC 1P5ZB 4KXXA 4N40A 3I45A 5COQA 4C6TB 4UZFA 2YYSA 1QDLB 1YKGA 5K4AA 4V0KA 1SZPA 1X92A 3MVEA 4DE5A 1YZTA 3M5PA 3BWEA 3ODGA 5EXTA 5JZBA 5EI5A 4YWHA 3THSA 3WLSA 3GZTB 1KGDA 2HWXA 2RH8A 1SXPA 4B3RB 1K8XB 2OCLA 4ESEA 1ZUD1 3O4RA 1J2YA 3TCKA 4CZ2A 4DIEA 5AD1A 3IJPA 3Q7SA 4XLLA 3KZOA 1YGPA 3AZOA 1XP5A 4XVHA 4COKA 4PXYA 3NM4A 5CTAA 3OQ6A 3D4PA 3QPVA 3TTWA 3P27A 4C2AA 1FFHA 1WQ3A 2ZL6A 4RLZA 2R8OA 3P96A 3QSGA 5EJIA 3WRYA 1Z5ZA 4KR0A 2WHXA 1O7JA 2FUNB 4ZAXA 4CTNA 5A02A 3L1VA 2OGZA 3OQBA 2OK8A 1GPH1 3O4FA 4F71A 2X8LA 2H9IA 4J3JA 4MR7B 2NUAB 4RHFA 3G2PA 3HV0A 3KAJA 4RY8A 2ZTLA 3DL0A 4NU0A 1Q1AA 4AL4A 1L5ZA 1VLLA 3BY1A 1BFDA 4LIPD 2PMWB 1KP3A 4DJEC 4F3KA 3QU9A 4UHBA 4FE7A 3M6MD 2WWRA 4X7RA 5JRDS 3EA0A 4WKOA 3TQQA 1YH3A 1UEJA 4XOTA 2JCXA 3V8PA 3AXSA 4BMVA 4OF4A 1JFVA 1SIBE 3MGGA 3ZBPA 1E2UA 1YBAA 2Q49A 5TMDA 4CMKA 2ZZFA 4BTVA 1KO8A 3E5NA 2VATA 2CK3D 4LHZA 4P9NA 2ZWAA 2ST1A 4PN7A 3D5QA 3EQ7A 4TTSA 3SYTA 4J1QA 2GK3A 1L5FA 2X1HA 2YXNA 1EVKA 3PV0A 3AVVA 5FUVA 3BBLA 1DVRA 2PN1A 4OHVA 1XDDA 3H0CA 5KYYB 1Q0QA 2V97A 1NBAA 1SXJA 1EVIA 1YBVA 3DDZX 3QENA 5ICEA 1IEVA 3NXSA 3KUKA 1K7SN 1YACA 2R4UA 2X0JA 3QJYA 1YNOA 2PRZA 3C8DA 3E2MA 1I33A 1U0SY 4H3VA 2K2QB 4E5NA 5DCWA 5SY6A 4NFLA 4XKWA 1VQ8B 3SEQA 2P0EA 2WV9A 1ZFNA 4QA9A 4R2WA 1T9HA 3KKOA 1XNGA 1VL5A 2Y4NA 3B13B 3LZ6A 4URHA 5A4JA 3LFUA 5HZHA 4QV2A 4QTUB 5JBIA 5LXTA 4QT0A 2H65A 1ZGAA 3FIJA 3EPLA 4G26A 1ZR4A 1WEHA 3S8MA 2PNJA 1ZDMA 2FR0A 1RW4A 3CS3A 3SXJA 3HVHA 3EUEA 2FN8A 3MINA 5FUYA 3TUJC 4B8YA 4P54A 1L7OA 4S3MA 1AGPA 4K6OA 3WC4A 3Q5GA 2FPKA 4HJRA 1YZLA 4I5DA 2Q4OA 2YMQA 3DC7A 4F3RA 4HQ6A 5IT9A 1FW8A 1QH8A 1TJ5A 4XX1A 4LYGA 1Y9AA 2P2NA 1I4DD 4Z0NA 3HB4X 3OH8A 3Q3JB 3BGIA 5C5CA 4JOCA 3U26A 1NFRA 1HQKA 2ZREA 2W48A 4P2GA 2ZB4A 4UUMA 4M0PA 4JOSA 1GL3A 3A10A 5TQ0B 1KKUA 1WHTA 1E2KA 2GNOA 2ZRPA 3GV0A 5CA0A 2AEMA 1MX9A 5HTKA 1C9MA 1M8FA 3RAEC 2YMMA 2ZG6A 3IUMA 4JI4B 1IQRA 4LSGA 2AOVA 4RL6A 3QEAZ 4G24A 4CTOA 3A04A 4N9WA 3ENZA 3BRCA 1XHLA 3UVEA 1M2EA 2J33A 1VRWA 2C2HA 2YV2A 3K94A 1S7GA 5ER9A 3HXQA 1XDZA 2DM6A 3P0HA 1B0PA 1W4AA 1Y1LA 2EKDA 4EJ6A 5FH9A 3H97A 2I6UA 3HFSA 2SICE 2HMAA 5HKAA 1UAGA 2OFOA 2GJPA 3BHJA 3GIDA 4KRFA 3R7WA 5KYXA 4GRDA 1PQUA 1VL8A 4GS5A 2DGDA 2HSEA 4LCBA 3N6XA 1PWEA 3PQ7A 2ZVQX 1H6DA 1RYEA 1PFQA 1YMUA 1J25A 2CHUA 2D5CA 4Q21A 1J1IA 4Z7QB 1F0NA 1SC3A 4BMPB 3FRIA 2D2VA 1KC3A 2VKQA 3EZNA 4KQWA 3K0SA 2HA3A 4YAWA 5KSZA 5AKGA 2M98A 4XSHA 2NAFA 3P2OA 4RKRA 4HPXB 2IKQA 3N59A 5ITSA 1YD7A 3VR6A 1DV1A 1BKSB 3V3TA 1HLGA 1TT7A 4IDCA 2YHAA 3HO8A 1A04A 5P8WA 4F5ZA 5LSAA 3CXCB 1T4DA 2ACEA 2N42A 4M1ZA 4ZYVA 4PZ9A 3U16A 3HFJA 2I7VA 2JL1A 3VKUA 4U4AA 8ADHA 1LUAA 4ZI3A 1TC1A 2HLHA 4D9JA 5EHQA 3ODPA 3PLAE 3KNZA 4X07A 2VH5R 2ZB8A 5HDBB 1EWYA 1PTJA 4DIMA 1FS4A 4RTPA 4IDAA 4YRDA 3NAQA 3H13A 2GI4A 3F6RA 3M6VA 4NENA 4JBGA 2H51A 2ZUVA 2CD9A 3S8EA 3SNKA 3VGPA 2CUZA 1FSPA 3TTXA 2WFLA 2EG5A 3MTGA 4TN5A 3AETA 5GZ3A 1O0BA 1OX4A 4GPIB 1JSZA 2FUCA 2NWQA 3DDHA 4L76A 3CKMA 4WWVA 1WAMA 4FYVA 4OREX 3EPHA 1I7PA 1VM6A 4LDJA 4Z2AA 3PYLA 4XPZA 4GM4A 2EXXA 4G8BA 1GKYA 1GRRA 3PHIA 1COWD 1WSBA 1NMYA 3QKSB 5HXAA 2JBAA 3ZBUA 2UKDA 1VE6A 3B1YA 3BJMA 4PYIA 5C8YA 4GKVA 4BNDB 4G0VA 1Q81D 3IP3A 4M3NA 3K8OE 2F1RA 3I72A 4CIAA 5FBZA 5HJ7A 1RJ9A 4QYIA 1RYNA 1VHQA 2OK7A 4IVNA 1DP4A 2AKYA 1B73A 2FEMA 4L0DA 2GARA 1HH4A 4BNLA 1IQPA 1E79A 1YIOA 3KL4A 1FQWA 1NMZA 4H3HB 2OTCA 2C8VA 1T5EA 4KFTA 5DIZA 1RIFA 3L4KA 1ORDA 2X19A 1IHXA 3U37A 2P11A 3PK0A 4NP6A 4PSAA 5FUWA 4JBLA 4ND4A 4AS3A 3GUHA 3R0VA 4WLVA 5K8LA 3L7CA 2HEGA 4ZVOA 1RCUA 2QP9X 4HHEA 4Y1RB 4K88A 5EIBD 4M89A 4C89A 2NZWA 2XVXA 4R5HA 3DMRA 4BVBA 5JANA 4NYMQ 3GFOA 1R4MB 4GX1A 3TKAA 4M87A 4KO2S 4U7PB 3AM3A 3G9QA 2QU8A 3NHBA 2AFHE 4OBBA 4GF5A 4WA7A 3HLYA 2FJ0A 3ZLJA 1XYYA 4YY3B 1B6GA 5EWMA 1ZD4A 1ZZEA 4IH1A 3V7WA 2RHCA 3W3AA 1E18A 3B2NA 3H4IA 1RXCA 3OZIA 2VI5A 3KCNA 1Q22A 3NT5A 4OG2A 1U9CA 4I6EA 1DXOA 2GZSA 2ZQ5A 3FF4A 2PBRA 4LY3A 1NVFA 1AHIA 1AS3A 4HNAA 1PJSA 2EWVA 2H8GA 1JQ5A 3X2SA 1IAQA 4GOOD 2FFJA 2R1ZA 3BC9A 3ANTA 4EHKA 5IJWA 1LVGA 1BVYF 3V48A 3QXXA 3H9EO 3P0RA 4KXWA 3TVYA 4RVFA 4ILEA 4M1EA 4C3ZA 3ZHSA 3B8EA 1IHUA 3I6YA 3A9VA 1ISSA 4PQEA 2OWEA 1RMYA 2PYDA 2I4RA 4MJ7A 3JW8A 1QJ4A 3DVAB 2X0RA 1OAKA 3TRJA 2WIJA 4OIFA 4ENPA 5T64A 5JAHA 1CRLA 1XG5A 4B85A 1DEKA 3D8UA 1E2GA 1H6AA 3C3KA 1OI3A 3DMGA 4OATA 4UTRA 3LLUA 3HB9A 3WLJA 4BDTA 4WCFA 5F98A 3Q7IA 1WHSA 2WJ3A 4XGIA 1J23A 2VF4X 2C5AA 2ZYRA 4I4LA 1PT8A 3GD7A 4X71A 1L8OA 5F21A 2F00A 3MGKA 1GXSA 1FP1D 2WAAA 4I9UA 2IHVA 3T12A 1NN3A 3BCUA 4AWXA 2O0KA 1NPDA 2CXQA 3HP1A 4EMTA 2IX3A 4DK1A 5B36A 1CVRA 1WY5A 1UFVA 2QZPA 1RQPA 4N3NA 2CYBA 1NOJA 2XB6A 3KYIB 2WG2A 4P22A 4X62B 3TPFA 5EZQA 1JHYA 4PZUA 2X4IA 4ZVSA 3W2FA 1J8FA 4RLSA 3VZSA 1X3LA 1YC5A 5KYTA 2FYTA 2BCEA 3OM1A 4IS3A 3PSAA 4UVGA 3ZH2A 4XLFA 3BB4A 1NJ8A 3MT7A 3TRFA 4DLTA 4I36A 4E03A 5C9ZA 1S7CA 4KSBA 4A8JB 3GJ0A 3PHJA 1EVLA 4RPIA 3ZHZA 1GT91 3K6SB 3GROA 1NN1A 1L7VC 1LBEA 2HPVA 4WKGA 4GZ3A 2HA4A 4EFDA 4NIMA 3DWEX 4Q6WA 1W9XA 2P27A 3IUPA 1M8PA 3NTVA 4IIUA 4CDGA 4YCMA 3IBFA 4K03A 3CVUA 1KS9A 1V5WA 3TJRA 1G8PA 4FR0A 1U8EA 3EQ9A 1XP8A 1DO0A 4US0R 5ILQA 5IWAB 4GMGA 4HO1X 2A9RA 2ZTNA 4CCYB 4UATA 5T8KA 4TKOB 2BKLA 4I5FA 2EGHA 5FPTA 5M2QA 1YCDA 3Q9NA 2ZS9A 3TQCA 1S2OA 3HJNA 3TXXA 1W9HA 3K0FB 4OGWA 2JIRA 5IW8A 1EP3B 3E2IA 3MTJA 3KE9A 3ROGA 2G80A 3VTAA 16PKA 1GHTA 4DDKA 1A1SA 3FE2A 3GOHA 4ZJUA 2RAVA 5IYWA 5C4MA 4OA5A 4QUBA 2F1LA 4E2ZA 1HQCA 2HT1A 4FIDA 3DCIA 1UMBA 1ORVA 3RTEA 1L4LA 3H6GA 3R7BA 1M2OB 1N9GA 3D8NA 4BO6A 4F2GA 2WP0A 2VQDA 4H4DA 1Y6QA 3IPXA 5KMGB 3WWCA 2ZB3A 4TTQA 2PNFA 4HVCA 2J48A 3JWJA 2QRJA 3GEGA 2EW1A 3KX2A 4OI4A 5FL7A 2PKXA 3DSRA 5CIYA 2Q9AA 4X3OA 4I9HA 3U4HA 1WD5A 1ZBDA 2W6OA 4HDRA 4KGXA 221PA 2IHZA 4L3VA 4NH4A 3CVYA 4XIFA 1T5BA 2VBUA 3R9XA 2C07A 4FKMA 1L2TA 1ZU4A 2OLEA 4W9NA 2QTVA 4IKEA 3LXXA 4FFNA 1ZC3A 1D0SA 3NBXX 2BMFA 3HVKA 1XF9A 1CSEE 1CR6A 1KZYC 3OPQA 5JLJA 3UB3A 4YAUA 5BUQA 1R66A 2P1RA 2N3ZA 1A8UA 4ES6A 3Q5EA 4EJFA 1SVLA 1D2CA 1VKHA 1ZGBA 3HCEA 3JVEA 3RK4A 2AE1A 4RTJA 4S1OA 5E8JA 1F8GA 1VJ1A 5KC8A 2MYUA 1T1SA 3SQMA 1IJEA 1UBMS 4KH0A 4U0JA 5T41A 1TJNA 4KN9S 1N2SA 3JY6A 2QRVA 1DIOB 3C3CA 3FYHA 1ECPA 2W6NA 2C00A 3V4SA 2NYRA 2OP0A 2PKWA 1Q9SA 4EBBA 5I4IA 1QRTA 3DVAA 1VDMA 5I7WA 4WLEA 2XT6A 1BU5A 4Y7DA 2FQ1A 1MC5A 4H6VA 3BG5A 1OXXK 2PU7A 4RC9A 5BN4B 2QENA 3PDHA 5CK5A 1PW5A 2ETVA 3H18A 3OFND 4U5XA 2R87A 2IQ5A 5HK8A 3OOWA 1V8DA 1JDVA 4MP6A 4MPJA 4PR0A 3OWOA 2JGEA 3A6EA 4OB8A 5K51A 5FFMA 3ZIDA 3CONA 3WJ2A 5F77A 2P1DA 2W90A 1YBFA 4RZIA 4J7XA 1HDGO 2OORA 4Q37A 1ZI9A 2ZT5A 4HFJA 4G89A 4IJMA 4QODA 3REQA 4YIKA 1J8QA 1ZGGA 1T2CA 3MTEA 3PGLA 5EJ2A 1WETA 5CDFE 1GCOA 1WEKA 3OLQA 2ZZMA 4RUKA 1YR6A 3O31A 4TLCA 3E1KA 4EO9A 1QP0A 1NX6A 4YDRA 3TNLA 2J30A 2YXDA 3QVGB 3RFUA 3UB2A 2B83A 1TF7A 3WBKA 1TKBA 3E4CA 2EG9A 3R6WA 3RT9A 1W8IA 4PGAA 1H5UA 3C98A 3NGMA 1TT5B 1ZWLA 3KOUA 1JILA 3B53X 1XZQA 4FOSA 4Q9IA 2QVCA 2ZR9A 5JSYA 4UCQA 1OA1A 1Z5GA 4TV9A 1ZVQA 5B12A 2LXNA 1KY4A 1TEXA 3CRRA 3Q15C 4HWKA 4NESA 3TSAA 4R2JA 1TU4A 3GRKA 1Z88A 3QHPA 3GU3A 2GK4A 3DB2A 3S2FA 2QG6A 1B15A 3VR5A 2PD6A 1QSGA 5C46F 5JLAA 5IZCA 2QN8A 4N48A 4RMHA 1FZTA 3NTQA 3L5KA 4UTZA 4IFBA 4WLNA 1FFSA 2XB9A 3OFVA 1K9VF 5HKBA 1Z35A 4C30A 2A1TR 4YBRA 2B5WA 1KU6A 2XVYA 3K7EA 2J3IA 3EW7A 1PFKA 4GLOA 1L7QA 2GCIA 3STHA 1XDGA 3OQPA 1MQAA 4RZUA 3F49S 3D3WA 4NV3A 4XM2A 5EVCA 1CUZA 2FW9A 1WBDA 3L8DA 2QYOA 2D1QA 1Z34A 5CTJA 3GDFA 3RNOA 4DJDC 1KA9H 1KEEA 3DVSX 4KI0A 5EESA 4Q1CA 5JS6A 2V9ZA 2BT4A 3SX4A 1P18A 1W36D 1YCFA 5E8RA 3IPYA 3EMDA 2QYTA 3WLOA 4XD7D 4NK4A 1RQ7A 3P0JA 4G4IA 4MI9A 3OQOA 4PCLA 4M8KA 2QWXA 3LPNA 2ZRKA 4HWSA 4NE9A 4EJMA 5L7TA 4RTRA 4QRHA 1DZIA 2XY4A 5EZYA 13PKA 3CG0A 3CIFA 2PBLA 1E0DA 4LYDA 2X41A 3IHKA 2QRVB 1RIIA 2RAPA 4YJGB 4AJ9A 2REQB 4QQNA 1SMKA 3IULA 4L8GA 4G97A 4K87A 2C96A 1PKEA 1Z0AA 4Q12A 4ZVNA 3IKLA 3EXHA 2VSYA 3GGJA 4ABYA 4EA9A 2XZTA 4JS0A 4R2HA 4HB0A 1Z6TA 1CD5A 2PUAA 4N41A 2WU3A 4P5EA 1V2GA 4QOIA 3CUTA 2BW0A 3MUFA 3P9QA 4H31A 4RVSA 5IDXA 1NQ5A 1YWGO 4CV2A 4MRMA 1FTSA 4PQYA 1RHKA 4WZAE 4PHFA 2MU1A 4P38A 2XWQA 3C6QA 4F2WA 3EGDB 3O91A 3AOEA 2AXEA 5E6SB 2VJBA 3RAGA 1F20A 1P1RA 3N8HA 1GUAA 3KKPA 4FXOA 3W6ZA 5FTLA 2XQJA 1YZFA 4D3FA 3DXZA 3U6KA 3VU9B 4XLTA 1WP4A 1GDTA 2FH5B 4IDEA 3DTTA 3ROEA 4EKYA 5AW8A 4Q9KA 3QWBA 1E6KA 1WCV1 2AK3A 2V55B 3TCNA 2E9SA 3ENQA 2OXRA 4R05A 1DKMA 3K9QO 4CM4A 4AMYA 3VVMA 3L1HA 3HU3A 4XLCA 1IDN1 3ORSA 4LG1A 4R2LA 5CT9A 5I9MA 1V45E 5HCIA 3CRZA 2MINA 1G3MA 1K88A 1XMXA 1C30B 3EJ6A 4UHHA 4HNTA 3NYRA 1SG6A 2ZR7A 3NALA 4V0ME 2W8BA 1BGXT 3UAYA 3S4YA 1EX9A 1TEVA 1XVUA 2DHCA 4Q4AB 1GUDA 2OV4A 2H4ZA 1Y1TA 4PAWA 1BMFD 3WLLA 1NV8A 3EFEA 3IQFA 5CNKA 3L79A 4JUCA 4RHYA 4QFMA 2BSQA 2PGOA 5DM60 1CIPA 4MDFA 1Q57A 1P4GA 2AW3A 3T7KA 1W85A 1YFZA 2DPXA 3AM4A 1EE2A 5GVRA 3BH7A 2P5TB 4E12A 2IZ1A 5C53B 1TCCA 2HSZA 1OVMA 1Q16A 2HTFA 4MQEA 4WESB 3H0KA 3R9WA 4E2XA 2WJYA 5GJWC 5TY0A 4HNSA 1JS1X 2OUKA 4CGYA 3A6PC 1KETA 1SURA 1KSFX 5H82A 2WD9A 2AQ8A 2VJLA 2WWYA 1NNEA 2L18A 1G3RA 3W9UA 4ZJYA 1QTQA 4NFHA 1GSIA 4IDDA 5BR1A 5KREA 4G56A 1DKPA 2VYFA 3D0QA 3MJTA 4PSDA 1A5AB 1OIWA 3NORA 4Q48A 3TLJA 1F3LA 4NECA 2IEDA 1HEIA 1GXSB 2R65A 1D2RA 2P40A 3QF4A 4HDSB 3CB4A 2JH9A 5KHAA 3H7AA 3UWPA 1Y6FA 3MJFA 4JB3A 4BJHB 5IT4A 3GAAA 4RQTA 5B58C 2B20A 2XKJE 1A69A 1EWVA 1H05A 1GA4A 1KVUA 3FZNA 2WK1A 4GR9A 5DT2A 2DQSA 2PT9A 4L3OA 1S8OA 2NUBA 2V4DA 4BLRA 1L5LA 4QLOA 2EFEB 3MJCA 2OCDA 3JWIA 3E9NA 4HH3C 4BS9A 4E33A 3NR2A 4MVJE 3WGTA 1ZKDA 1ZZGA 2VTBB 4V0OA 3QVJA 3ER8A 3RWOA 2VXOA 4KPUA 3AO0B 3TGWA 4WXYB 4JVNA 1X39A 4FB5A 4BNMA 4FCWA 3QWIA 4QT4A 1EK0A 3IQIX 1DQZA 2LZ0A 1IY8A 3K1ZA 4MQ4A 4UQOA 5ALGA 8ATCA 1E6EA 1ONNA 1VYVA 2LKCA 1E6LA 1Z26A 3Q3CA 5JQWA 4TWRA 4BMYA 1OROA 1VCOA 3W4JA 5L6LB 1ZD1A 5I7EA 4EQZA 4HNQA 5CNJA 2QUHA 3G0BA 4FHDA 1JJFA 3D4OA 2R2AA 3WZ2A 1LH0A 1UIRA 4ERNA 4AY2A 5NLLA 2GYUA 1ICIA 1JPNA 4A23A 2H5LA 2NU8B 4YXWD 2PX2A 3D0KA 2WM9B 5MN4A 2PH3A 1W0JA 1FRNA 2WSSA 2WD7B 2IOFA 2WKQA 2YICA 3MSCA 5IXJA 1QV6A 1OZAA 3DDYA 1RQXA 5D6NA 4RPDA 1J00A 2BFMA 5JD4A 5EQTA 3C1AA 2HF7A 2DFNA 4DCGA 2Q3EA 3DEJA 2RGRA 1YMVA 2Y1LA 1PJ7A 5KDOA 3WL3A 3IQDB 4DNRB 3QW2A 3R40A 2P90A 3Q6IA 1JT2A 3PHCA 4XOUA 1KFEB 1XQWA 4BXOB 3OM0A 4L5YA 3QU4A 5AVOA 1Y5RA 1QGUA 4TL6A 1HYGA 3QEJA 4RKEA 3KD3A 3FCSB 3CP8A 2QT1A 3SFVA 5FTWA 3FPSA 4B3TB 1H6CA 3FNBA 5ADHA 1DJNA 1WXQA 2EFJA 4M9ZA 1VJ5A 1ZUWA 4OGFA 3JXEA 2YNMC 3DE5X 4BQSA 5FP0A 3VPCA 1UODA 3A2KA 4N5NA 1RYMA 3C6KA 3QITA 4P53A 2X5NA 3RE1A 1F5NA 3AEKA 1M75A 4PLYA 4AMBA 4CKEB 1RWPA 4IDPA 2HWWA 3I52A 1RRCA 3F0TA 2IYTA 2CY0A 3C3EA 4WEQA 3VNSA 2CXRA 3M6UA 4I55A 3O93A 1BNCA 4XB6B 3VDQA 2BZSA 2GM5A 4JUAA 5F1OA 4WY2A 2TMKA 1E9SA 4F5DA 4HAIA 1WCXA 4MAFA 4FC6A 1R8JA 1P2UA 1XDWA 3LBFA 4K0KB 2QRUA 2CL0X 1H2EA 4NDAA 4IQFA 1U3DA 4UVHA 3RSGA 4DYDA 3HDJA 4TYMA 5K3DA 4EY4A 4MMZB 5ABPA 3RS5A 3CCLB 3GUZA 5H4GA 3WHIA 4DRZA 4LEIA 2H7XA 1C7RA 4QOEA 2H2FA 1GPNA 2Z98A 3GBPA 4P6YA 3LL4A 3N8GA 5LYYA 3E84A 3OPYA 1D09A 5HGJA 3T7IA 5EGNA 1KZLA 5H5JA 5AH0A 1JLRA 5EKSA 5IYZA 4QYWA 3EIEA 2VPIA 4ZK2A 2CFOA 5DM4A 4RESA 3OWHA 4AMVA 4DV3B 2YX1A 3W5HA 2ZIZA 2WPDD 1X7WA 3B5JA 5LJIA 4L73A 4G8CA 3X1KA 1B3RA 2JAQA 2FUEA 2JJ8A 4RH1A 3JD3A 2OUIA 1YJQA 1ZEJA 4PANA 3MPOA 5AESA 4TT8A 1NBMD 2VDWA 3D0RA 4C7XA 1NB0A 2BHSA 3A05A 4PBTA 3T3NA 2GASA 4NEQA 4FFSA 3ZWYA 3VAZA 2YKGA 3VHXB 3OZTA 2VP4A 2JBWA 5J5CA 1B2RA 4BB9A 3RVDA 3FOZA 1P6XA 1Z62A 4U7JA 2FPGA 2F4VB 2FW6A 1LI5A 3IEVA 1DFGA 5I9LA 3RJZA 4L74A 2ZDGA 4KQHA 3TGPA 2R3SA 3GGCA 4E32A 3F4BA 2BELA 1GTG1 3X2EA 2NV6A 5K8VA 2W2XA 1XVLA 3OA0A 2PX6A 1NMSA 3EVFA 1UM9B 4G2NA 4RH3A 2FSIA 1PJ3A 1Y7HA 4AY6A 8GPBA 3D7SA 3CLRD 4FEGA 4KAXA 1T5DX 1J2TA 4Q47A 3U56A 3SHWA 1W4RA 4XIJA 4ITVA 4LJ6A 4CI9A 1EIWA 1P9WA 3JX9A 5J3OA 2RJ3A 1D6SA 1DUSA 3GJYA 3Q3AA 4PM4A 2Q41A 3NI2A 4D3DA 5DTRA 2QNRA 2KI5A 1XZFA 3R24A 5ARBA 1NSTA 3H86A 2AWOA 4Q1VA 4DR2B 1FB5A 1CYDA 4QTXA 5G3ZA 4PZEA 4OYHA 5DV9A 3RRZA 4EX7A 2UYHA 3GVKA 4QUJA 4UCWA 2NSYA 2Y2VA 1TIBA 1G1AA 1VRVA 2Y1WA 2O48X 4KREA 5KHOC 4OI2A 2NSLA 1M5RA 4CQLA 2HH9A 2UVQA 1RKVA 5ITVA 4TLMB 4RDCA 1Z73A 2OBRA 2WVAA 4PAAA 2JIOA 3O38A 2NNWB 3F98A 4RKWA 4ZIRB 3CH5A 4Z9YA 3PQ4A 4GM0A 5CT4A 3RJTA 3AR6A 3TLGB 2CNWD 4XKVA 3PXBA 1PZXA 1A5BB 2OTJB 1P4HA 3FNHA 1QYDA 3A3KA 3GJSA 3I39X 3DE7X 4V38A 3ZCXA 3ZNQA 4YUXA 3SQWA 3LVFO 3MYYA 4DJTA 2Q5JA 3UTCA 3KHTA 2RJOA 521PA 5IUJC 4F9TA 1NUAA 4R83A 5IULC 4LY6A 1N7HA 1KSHA 5I6DA 3C5CA 2ZFUA 3L9XA 3FDIA 3SKXA 4GNRA 4RV4A 3VC1A 3CVVA 4RJ2A 3OMXA 4MEAA 1EMDA 3E3MA 3L0DA 3COPA 2GJAA 5C31A 1NOKA 3AK4A 5T7BA 2C7QA 1HE5A 4Z4FA 2EP5A 4F4DA 2J5XA 4GEGA 5CCEA 3UJAA 2VDLB 1J9ZA 2WFZA 2I3GA 1UBFA 2PL9A 2SKDA 1UJBA 4D8YA 1YR1A 4YMLA 1WW3A 1PR0A 3H9NA 1VE7A 2VUIB 4DSUA 1RLJA 4DSNA 1E6CA 4HQRA 1Q0PA 1QG6A 2QTAA 1RHUA 5BRNA 3BIOA 1R5OA 1HWYA 3DFKA 2C2KA 3PFFA 1WG8A 4Y98A 2FK7A 3H65A 1OT5A 2DUJA 3BIXA 1XXHA 1UBHS 2E3JA 2DYIA 1J22A 1J07A 1F2TB 2XEXA 2PZEA 2Q9BA 1UMBB 3KLBA 3KKKA 3ON5A 1NUPA 3UMGA 2I2CA 4D74A 2V7EA 2WG0A 4GKJB 1OOEA 3PUHA 4L72A 2UYGA 3OHPA 3UAOA 4A0QA 3I3OA 4CDNA 4L5JA 2WUGA 4MW4A 3I76A 4N3BA 1LTQA 4RQAA 1FY2A 4IS2A 1P61B 1WABA 3DLAA 4FMDF 1OBHA 2F90A 4QASA 2P5YA 3X2FA 3VMMA 1NJ6A 4NCKA 3CCQB 2NPOA 4V39A 4UTXA 2KYRA 1CUYA 4Z99A 1B3BA 1JFTA 3NJ8A 3UFBA 4JJ4A 4IX1A 1ZJZA 2QEXB 1EXNA 2DR3A 3PVSA 4OY3A 2Z4RA 3OPNA 3VR4A 1DWOA 2VNHA 1LDBA 1XLWA 3FKJA 5AICA 3VO9A 1K63A 1NX9A 1T36A 1KE2A 3SCZA 3TW0A 3FOFC 1PJ5A 1I3MA 1Q0LA 2CNBA 4ZVQA 4S2UA 1TQ2A 3PUIA 5JFOA 2Z58A 4ILKA 4Q24A 4Q4HA 3CX8A 3MB5A 1TUIA 1ZNWA 4YRSA 3U3OA 4KWTA 3EG5A 3HWX1 4I1RA 4KMMA 1VPVA 3OQIA 2F55A 4B3DA 2OYNA 4UUNA 5CVCA 1JDTA 4IDGA 2GEFA 4WOBA 1BRTA 2CWDA 2EZ9A 3HY3A 5LZ8A 5FWYA 4N8EA 1RZ3A 3PQ6A 5BRAA 1RRVA 5TV2A 4TMYA 5AM2A 1QG0A 4X24A 5A5GA 5M3BA 2H63A 4URXR 1A1VA 2EJVA 5CBPB 4IDBA 2QXTA 4P5PA 4PVDA 1OX6A 1U0GA 3P1JA 5KTOA 2VJAA 4A36A 2QX8A 3SSNA 4EQ6A 2PZKA 3ABRB 1NW6A 4YRIA 5CB8A 2DBRA 3S2UA 1RI3A 5K3CA 4RJJA 1L5KA 3EIWA 1OH7A 1Y7LA 2IEIA 2B69A 2FUG1 3B3FA 4B82A 1JKMA 3RIHA 1MA0A 2Q8NA 1KTIA 1S2LA 4IO1A 2H54A 4JYZA 2OAQ1 5H7XA 1C1DA 2XXBA 3F5MA 2ZB7A 1LLUA 4G0OA 3VNRA 4WBNA 4PEVA 8AT1A 5BSXA 1YVPA 4JLAA 2DX7A 5IDYA 2QP3A 5F7JA 3PA2A 1JQAA 2QW1A 2XF2A 2PIDA 4G07A 1C3JA 5IH3A 1U0BB 2I3BA 5KJCA 4RA6B 1XALA 1XCJA 4QHSA 3MPUA 1Z4QA 4ZT3A 2Q5EA 1E61A 1JXAA 2R96A 4FGSA 3WB9A 1GNQA 4D9CA 3NYQA 4TV9B 4Q3EA 2R25B 3WZLA 3H8VA 2Q5HA 4KXMA 1RMQA 3W5VA 1SD2A 1CPYA 3DDOA 1NY6A 5DI3B 4G0WA 1PBTA 3BB1A 3I0MA 3BIWA 4P4SB 4D97A 4NZOA 3R5JA 4FGJA 1R9MA 2XEDA 5B5SA 4WOPA 1WB5A 1RXVA 4GI7A 1T6YA 1CK4A 2QE6A 3HCPA 1EZ1A 3G68A 3MMSA 1UDWA 3I5UA 4EMBA 1I36A 4LV8B 1ZM9A 3BB3A 5CDSA 1V1MA 4YP7A 2IE0A 3WYDA 3WMXA 5LIRA 4QWMA 4K1LA 3VZPA 3C8UA 1VSBA 1G63A 3WDSA 3TQRA 2J3MA 4AXBA 4ZQIA 4A0RA 5IBQA 3MOGA 4EVQA 4ZV7A 1RWNA 1W0KD 2Q46A 2XMPA 3DFMA 3Q8KA 2ADMA 3HWRA 1L5QA 2R6AA 4DIBA 2HNKA 2ZIVB 3TFWA 3WBBA 5AUPB 5KZMB 2B3TA 1CNFA 1JX6A 4ZHQA 4R51A 3AR3A 1MMFB 2Q45A 4B2PA 1Y33E 2C82A 3ILHA 2P1ZA 4EJSA 1PDWA 5KBYA 4ARCA 1EBUA 1KEZA 1QYRA 2JAUA 3NVDA 3BORA 2FFRA 1AKEA 1OXMA 2AC7A 1LU9A 5L53A 4C7OB 1ZU5A 3LU1A 4RXTA 1ZOLA 1I0IA 3UBTA 3WB1A 1SCKA 2REBA 4MS4A 1NAIA 1SXIA 4R1MA 4R8SA 4YPOA 3DBLA 1OXTA 5CXQA 3MXTA 1XMIA 4EO7A 2QD3A 3VR3A 1EVEA 2PLFA 1ZJ5A 3A4NA 1Q84A 4JT9A 1Z5PA 1DKUA 1JHMA 2BBOA 3FX2A 4IR7A 3TIVA 3WIOA 1AU9A 2RHJA 4IIGA 5FWXA 1NV9A 5CX1A 4UOEA 5U4QA 3JSXA 3K9GA 4X8MA 5FI0B 1OSNA 3GFSA 3UA3A 2IA5A 4AW9A 4GSLA 2GO7A 4C4YA 3KQMA 1Z47A 2UZ1A 1EAMA 4RIIA 1TMKA 1Z8NA 3HA3A 1LC3A 2IOYA 4UM5A 2NVBA 4NVRA 4CG3A 3TX6A 1OLUA 2B34A 2JATA 1MJ5A 4AICA 3U81A 1JJVA 2X7HA 4PICA 2NTVA 1VXRA 3IEPA 2FGJA 4W5RA 4LTNA 4Q4DA 4CFZA 1N3YA 3AVQA 3K0AB 3DHYA 2KS6A 2Y3IA 2RI0A 4LTDA 2ZM5A 1MVLA 2G0AA 2E6UX 2H57A 2H7VA 2B8JA 2IZOA 2ZPTX 3GNSA 3JQAB 4R81A 4RACA 5BP7A 4ZICA 5JAZA 3K2BA 3HMKA 1HFKA 4OYYA 2H52A 5AKHA 4B44A 2W71A 2QTGA 2GERA 4C7JA 2K87A 3JQCA 3LQKA 3OM8A 4M8NE 1L1FA 4J1SA 4NQRA 4KH1A 5TT0A 2H00A 3A6ZA 2Q6TA 3H1FA 5SYNA 3T4UA 5IXYA 4EY8A 1XFOA 1ORHA 3HJAA 1GPMA 1U7UA 2QRGA 1HV8A 2NM0A 3VU9A 4CG1A 2X77A 1E9BA 1NDQA 1ST3A 3EBPA 4U3JB 1PQWA 2P78A 3QVKA 1M5TA 4B84A 1C0EA 1GIAA 3D3KA 3WLTA 1DRUA 2DQYA 3R44A 2R6DA 2Q2NA 2BFDB 2WUEA 4TMZA 1HDYA 2AJDA 3HACA 2AN1A 1X7YA 3FDZB 3ANMA 3RPEA 2FF5A 3O84A 1KJQA 1PDVA 3PGJA 3SIWA 4A2WA 3PNBA 1M34E 3KPUA 2FZGA 3CH6A 5DNWA 4DV1B 1U1IA 1Z5UA 5MN6A 1EUCA 2QPTA 3KEQA 1YL7A 2IJGX 2QDXA 1S3GA 3FFBA 4QX6A 5CH8A 4CIVA 1XO1A 4E70A 3UJ9A 4B7UA 1I3KA 1ISHA 1CY1A 3C45A 3A4IA 5F2KA 3A9SA 5ADVA 1VHEA 3PL5A 3SX0A 2FLVA 4XTCS 2Q3JA 2ZGVA 2IL1A 4US2R 2AFVA 3KOWA 1IQUA 1BA3A 1VECA 2D2XA 4NBTA 4QAJA 4KDFA 1DIHA 1RXYA 4XJVA 4EHBA 4M9CA 3IJEB 3FHTA 3ZQ4A 3UKOA 5CDUA 1MA3A 1UBEA 2AG6A 2HKIA 2HRRA 3SHTA 3U7QB 3ZLTA 1V8OA 3Q3EA 5HA5A 1G21B 1GRVA 1KH2A 2VF8A 3H5LA 3EXHC 3MTDA 5FHQA 1YJCA 4Q9HA 3MQFA 3RS0A 3QNMA 2PRYA 4P84A 4NOMA 1A95A 1ZA1A 1L1RA 821PA 1US8A 3NOOA 1EFHA 1QIGA 1IVNA 3WWPA 1IM8A 1UEIA 3PDJA 1ZUHA 3FVTA 1HETA 4NEHB 1L4YA 4CEHA 2HMYB 4JELA 1YL5A 1QOZA 1Z18A 3LF2A 2RIRA 5KWSA 3O8OA 2GPYA 4C7VA 3KHSA 1C0KA 1GADO 3Q40A 4IQ4A 4C1NA 3C5HA 1ACJA 3WGZA 1EVYA 1HQYE 5IBPA 2RHMA 3PC7A 3GFFA 2WU8A 3HVJA 3P2EA 3TTTA 5FTNA 5LP6C 5CT6A 1FDRA 3DGEC 3VDXA 5KYNA 4JAVC 1OVGA 4F1WA 5ENDA 4D4HA 2BHLA 2GAJA 1X3SA 2HSGA 5ED0A 4X6YA 2P5UA 1EDDA 4RA9A 2V6GA 3QVSA 4G1EB 5KYWB 3EGEA 4HATA 4W63A 2D4AA 1QNLA 1JVSA 3DB1A 4N76A 1VB5A 3U4AA 3P0FA 4V1CI 4K5QA 3DMDA 5HM6A 1CE8B 1TDJA 5E2AA 4HK4A 1U9JA 1RE0A 1MP0A 3BJZA 2PKCA 1VKNA 2PBFA 2HWYA 2ZXEA 3DV9A 2G5GX 4RD1A 3IRVA 5HG0A 2PSFA 3JARA 4IV0A 2ARKA 1JSRA 2I9PA 2BL4A 1J9GA 1QRRA 3ESZA 1MB2A 3GFBA 5D01A 3PXGA 5CYPA 5BV1A 2LR0A 5ADWA 3LOQA 3RVMA 1OTXA 3G0CA 1PGJA 2W7TA 4HN2A 4X1YB 1DRVA 4OA8A 4ARSA 3VOSA 2FMTA 3EUFA 4MUIA 3W05A 1YS2X 3OM9A 4LE1A 3D6HA 2G88A 4D6YA 4EHNA 2QW0X 3O8BA 3U3MA 4YMHA 5IAOA 2YW2A 4K6MA 1EWKA 3RR2A 5IANA 3OZAA 4GECA 5A03A 1CVIA 1FTWA 1ZRHA 4MHOA 3D02A 3HCAA 1H8ED 4HT3B 3BIFA 1EWRA 2P4EA 4R9RA 2D1YA 1XD2B 3M3HA 5F64A 1Z0IA 2P4QA 5K8CA 1ABBA 2ZAYA 1B8UA 4RXUA 1VQNB 1E1DA 2HTEA 5KTKA 3L7KA 1R6DA 5JXGA 4DG8A 4IO0A 5CR9A 1IN8A 3EDYA 4BFSA 3HJFA 4FZ3A 3G1UA 4BVAA 5DGDA 4WESA 3W4IA 3HJCA 1E5LA 1WDKA 1MGOA 2I4TA 5LNK6 2HADA 3MHTA 3JR3A 2WI8A 5EJ5A 1QFSA 2X9VA 4ME6A 2HA0A 1IUNA 1G7RA 1FP4B 1M10A 1PBNA 3RTBA 1ZCZA 3KZMA 3A9UA 1N0HA 3CF0A 2VXBA 3TZQA 4BKPA 5HX7A 2GN8A 2PZ8A 2BIFA 2HRQA 3L7IA 4BHTA 2BEVA 4RLQA 1U8FO 4P1ZA 5DE3A 4NZNA 1V3TA 2QMUA 2B4AA 3BWCA 3L6OO 1B00A 3QVOA 4LOAA 4AKEA 4HH1A 5EXEA 4CF3A 4F4IA 2NUPA 4BGUA 3GNTA 3HO6A 4BQPA 2CC2A 1VCNA 3NDRA 1UBGA 5C7YA 3O2JA 4NQZA 1GCAA 3TVTA 3LQRA 2R8ZA 1U31A 2EERA 1Y9ZA 5IARA 4IYRA 1Y3AA 2BKAA 2XKAA 4L08A 3H83A 3K70B 1EXMA 1HFJA 2D00A 4BFVA 1AURA 3KAQA 4OPOA 1T4BA 2P9HA 2MSLA 3FZYA 4BP3A 1U2DC 3B7GA 4K6GA 4KDCA 4L15A 1NXXA 3E3NA 1EP9A 1IE3A 1E7WA 2G1AA 3F1KA 5CXXA 4UM9B 1SAYA 1U8CB 2PR7A 2QR5A 2Z3ZA 1FPQA 1RI4A 4ALJA 5J35A 1FDVA 4DMLA 2G67A 2JFVA 3DAHA 1PL6A 4RHCA 3CLUC 2ACKA 1E2QA 2C8KA 3PFCA 3MQ2A 5B4VA 2JJ1A 2PWPA 3AHEA 4P12A 4N5DA 3AF4A 3JQ7A 4RA6A 1PL8A 3ANLA 2FRVA 1H9CA 2WKSA 2WVGA 1RWWA 2HWUA 3D3NA 4OX9B 3KCQA 2YY6A 3WWOA 5BN3B 2WIGA 3IE2A 1L1QA 4IVQA 3DHNA 4RPHA 2EKBA 4ZALA 2VP3A 5C3UA 3GT7A 2CE7A 1U5BB 2MTBA 2P7IA 3VVCA 1AQIA 4IIFA 1G2PA 2DULA 4LQ4A 3UV3A 1KKMA 1Q3KA 4YNBA 3PYMA 4WKNA 1V1RA 3HU5A 5F3RA 3Q87B 1TPZA 4EW1A 4MKXA 1V1MB 4X1YA 2IBMA 2VJKA 2OV1A 3O1HB 4LZNA 3EBLA 4YRMA 2VT6A 4KE6A 2QUAA 4NICA 2OHOA 1WB9A 1ESNA 2KB0A 2A4MA 4H3SA 1N0IA 3NDPA 3NOQA 4ZT6A 4GUDA 1E6UA 2NO9A 1XQXA 1YO6A 2PIAA 2C8LA 1CE8A 1PF7E 2Y0DA 5DYGA 1J2JA 4MULA 1CQJA 4QXRA 3H2BA 5FJJA 4AYXA 2BFBA 4YYEA 3CE9A 3E48A 1N25A 2WP8J 3ISXA 3M4XA 1DUIA 2GRJA 2DCMA 3KOZA 4JNKA 2B8TA 5JAUA 3PI7A 4W82A 4TXLA 1AK9A 4YJFA 1GNLA 2BFDA 2R6R1 3H05A 4G9BA 1K8YB 1ZJ4A 5AW6A 4HDMB 4DNPA 3KFLA 2DUNA 3PL1A 5EN4A 3S2ZA 5K03A 1MDFA 3GVPA 1S6YA 3QEMA 4O1MA 1JUDA 4YT8A 4WEOA 2ZRDA 3AKDA 4BFZA 2AMFA 2X58A 2GJ9A 1SA0B 3BPSA 3FCUB 4IF6A 4MKFA 5IZCC 4QYTA 2WYUA 3I83A 1O4WA 4B33A 3RC1A 1BXZA 3NBAA 4OL9A 3SYMA 4AO7A 5J43A 4K3UA 1SXJC 4O33A 1U1FA 5DZSA 5E2IA 4YAEA 4CW7A 4DKXA 1XEXB 3T3MB 2O6LA 1ZOSA 5B6PA 4ALIA 1N34B 1Q7CA 3C3JA 2AR7A 3DEHA 3IESA 3RSZA 4X0CA 4RZQA 3OOCA 4Z3OA 4K2AA 5I9TA 1U0TA 3T7EA 1YZQA 3PFBA 2Z2ZA 4GGOA 2XGJA 4UPVA 1G21A 3GR6A 3I42A 2YZ2A 1U3TA 3F6EX 4PFJA 4YH1A 4ND2A 3RSCA 1SN7A 4YDHB 1FNBA 2B36A 3LUKA 1SOVA 2XUZA 3EWNA 3N0XA 1Q0SA 1YBMA 3X1MA 2VK2A 2FP4B 2FQWA 4QO7A 1AQNA 3EC1A 4XQCA 3QTTA 4QVKA 4UZUA 3Q6MA 1QGED 3QMPA 5I01A 1RHJA 4MGKR 5DULA 3U3DA 4EJSC 2I1VB 5J4LA 5LQAA 3I58A 1M1UA 3CF4G 2HQOA 4H35A 1ZK0A 2OPBA 5GONB 4H7KA 3WNQA 4ZO7A 1OKKA 3FFXA 5JDCA 1PGPA 1Y7IA 2YBDA 3FDJA 1ZUIA 2EIHA 2P9EA 4JLMA 2ZWOA 1FUUA 3JQDA 4Z3DA 4MINA 2KQUA 4EOGA 3B85A 4RBNA 1NQVA 1XEAA 1M5UA 1T5TA 2MJLA 1OFIA 4HAVA 4WCFC 1RBMA 1DL5A 1B43A 1XBTA 1CQXA 2EARA 2VLIA 1YE5A 3GVIA 1T2EA 5JO0A 4BBZA 2YJ3A 2GD6A 1JR3D 4MQ5A 1V0FA 2VQ3A 3IAM6 3WK5A 3R6LA 2CLOB 3CG4A 2VYVD 3UMJA 1LPPA 2LE0A 3FKSA 1YHZA 3L8FA 1D1SA 1WOYA 2QORA 5DHFA 1KEPA 2H92A 4PLPA 4Z51A 3LFTA 1ZLYA 1N2JA 2OGWA 3DDSA 5GMOA 3IHWA 3W6UA 4AZSA 4BRWA 1DWUA 1H5QA 3B89A 1E92A 3ZBTA 4B3JA 1WULS 1ZC4A 3F5QA 1SIOA 4CV3A 3PXUA 5K0GA 3BK7A 3OKAA 2R8YA 3EEQA 3LY8A 1VQMB 2AYYA 1FFAA 2QAGC 2XUKA 3M6LA 4S35A 1L5HB 2DPYA 2G07A 4PYOA 3ZLVA 1IPHA 1YZHA 1DKOA 1OPRA 1SHJA 1MV8A 5DS0A 2IU3A 3GC6A 1ZRSA 2GVDC 4TTAA 4DYVA 3HP4A 1UEXC 4ND7A 4PWZA 2PUEA 1YRHA 2H1LA 2BMAA 2FPIA 4MDEA 1FCJA 1F0PA 2H0QA 2R7MA 2W2LD 4GQAA 2XZDA 5L4LA 1VI6A 2C9DA 4JBYA 3R9KA 5BO5A 1OXKB 1C1XA 1CF2O 5HEKA 1QQ7A 2C3YA 4MRVA 4V0NA 2IYOA 1G19A 1HDXA 5D5HA 3O75A 2ZBPA 3ZBQA 1T0BA 2P3QA 3KALA 4WZLA 2C99A 4M86A 3U62A 5KKCA 5FLXA 5CEFA 5DXJA 4MW5A 1QZXA 1FU7A 4EAAA 4MZXA 5CX1B 1PL0A 1A7KA 4Q7JB 3ME5A 3LA6A 5HKLA 1NW9B 2PX5A 4KOEC 1IEWA 1MOPA 2RGNA 4K9KA 2HFKA 3L4SO 1F8FA 1TO2E 1Q0TA 4Y2YA 5EWMB 4N54A 3DVQX 4TKVB 4ZQBA 1NXWA 3W1WA 2A2ZA 3BMCB 1JEDA 4PC7A 2DCUA 1ZNZA 3NDJA 4BU0A 4ZI7F 1WZ2A 3UK7A 2JJ2D 3K0KA 1QQ6A 3NFRA 2PQ6A 1FYWA 3L07A 4YROA 4Z86A 3WDLA 4BE9A 2FMHA 2WHYA 3STVA 1DAOA 2QDKA 2A9JA 2SKEA 4ID3A 3OX1A 2A7QA 4KRGA 1W30A 1W4BA 2VZ9A 4TQUS 5I8WA 5JR3A 5DNVA 4QDKA 4Q7LA 4RK6A 3R0ZA 4YAGA 1QF7A 4R69A 2M6KA 2C98A 4B17A 1M6EX 1CUVA 3CLHA 5HIIA 4E1BA 3QE9Y 2V74B 4KUGA 3RC3A 4PSVA 3EA5A 2AEEA 5A3SA 3T4XA 3TG8A 1DIRA 1NIPA 4DBVO 1Z15A 2W6JD 3ABOB 1V7QA 3FLBA 3IP1A 3QVWA 4OQ4A 4Z9AA 4AECA 3H2KA 4Q3DA 4LXQA 4YALA 3BHNA 4TYQA 2JZNA 3GX1A 3MLAA 4R9VA 1KYWA 4JYBA 5HIKA 5B2EA 2PRSA 3JVVA 4MVCA 1P7ZA 3MLBA 4H4CA 2NO0A 2YVQA 3O8NA 5SY9A 5IG2A 1NRJB 4DOMA 4X7EA 4JC0A 5LBIA 3FKSD 1CV2A 3QU2A 2JLCA 2XNSA 2X9QA 4G37A 3ZD8A 4XGRA 1UDXA 5TT1A 1KZHA 2IYQA 1BFKA 4J7CA 1EKXA 5K0FA 3MWLA 1R0BA 2Z09A 3VZRA 2MWMA 3D26A 2IUUA 4AO8A 3ONUA 5FUBA 3M33A 2V5VA 1LS1A 4CQJA 2CDNA 2K6GA 2PX8A 4H7EA 2UZ0A 4X7BA 3A3NA 4EYQA 1L5MA 2UDPA 3TW6A 3LHIA 1RI1A 1BEUB 2PT6A 3AEQA 4F8JA 1U0NA 4FMBB 4YMUA 5JAIA 3VNUA 4XSVA 3WO0A 4HDAA 3AGPA 3T9BA 3JRXA 3ORYA 3Q7TA 4R2IA 1OBCA 4WK0B 3ZJ4A 2B8WA 2P77A 2XX3A 1F7VA 2P8SA 1QIKA 2WRZA 1U2GA 4U2EA 3ZE9A 4M0KA 3PNQA 2OAGA 2O8BB 1M54A 3I8OA 1X7WB 1E3SA 3ZHYA 1P1FA 4E51A 1VJDA 4DCVA 4EI8A 4I9NA 5T6BA 2M6SA 1PVOA 3DW3X 1A2OA 4HNVA 2OQ2A 4E46A 3AUAA 1KPIA 2B8EA 3OCYA 4TS3A 4M55A 1Q2XA 3M1LA 2BEKA 3NIGB 5L3VA 4QGHA 4CPDA 1YITB 4M1TA 4BTLA 4NBNA 2O2EA 1SVNA 2OG2A 3NUQA 1T4CA 3ST7A 1ADFA 3LYLA 3TAHA 5FD8A 3VR2D 4ZYUA 1BMFA 5LQSA 5EZYF 1YS6A 2MYPA 3CZMA 4AJPA 4I55F 4EKNB 2XVMA 3VBCA 4XTRA 1ISJA 3S5UA 1EJ6A 1USVA 3ZW9A 3TZBA 5CA1F 5I7RA 4M9UA 4RXMA 4E5PA 2UXCB 3SEZA 2FG6C 2I8CA 4IGEA 2HQBA 4DWOA 1FBNA 4GX5A 4PONA 3NT4A 1PD0A 5A4IS 4C7MA 4B6GA 2XYRA 1RBZA 1K8QA 1Z4IA 1XRRA 3K15A 2XW6A 3FTQA 4INJA 1AZTA 4IZ6A 3CCCA 3KUDA 3PJDA 5ARCA 4EARA 2XCQA 2I03A 3M5CA 2XECA 3BUSA 1GEGA 3LQ2A 4QDTA 2OD9A 7AT1A 4CF5A 5I7UA 1U63A 2D13A 3K8ZA 1I7LA 3H9CA 1GL7A 4P7KA 5FQNA 3ZNOA 2JLAA 1ABEA 4Z2YA 4R8MA 1E2IA 1UXHA 4CUKA 4L4SA 3U44B 4JJKA 4D5GA 2FTKE 3SJPA 3OO0A 1VSQA 2RHHA 5IRCD 1ID8A 2V7PA 4G1BA 1ZOPA 4JFAA 1E3XA 2OYCA 2PX3A 4BZZA 3K9FC 4N18A 1L7MA 3HN7A 5A06A 4GKKB 1TZJA 2XMZA 3IT0A 4JI8B 2CL6X 4BNVA 4UD2A 1Q2UA 3NGLA 4OSEA 4DCTA 2F8TA 1FOEB 2POQX 4W4TA 2WYOA 1E4OA 2FG5A 1R64A 4G3XA 1BHQ1 1F8UA 1BPLA 2K2WA 4EYKA 5ICSA 4XCVA 4F4HA 1SUFA 3FGZA 1C8KA 3G49A 3LWDA 4LBZA 1ACMA 2CYCA 4FHZA 3ROTA 1DTSA 2FPPB 1DHTA 1NBOA 3H42B 2NAPA 3O9ZA 2O7NA 3ORQA 3OT1B 1JZQA 5C1OA 1SKUA 3I12A 3LKZA 5K0LA 2XD9A 3PSHA 4FR5A 4F46A 5GADl 3AEQB 1G5PA 2XKBA 3RARA 4EHAA 3DKRA 2QE7A 1C0LA 1UZUA 2DHQA 2VH1A 2WU0A 4DLLA 4TSRA 4BFCA 3HCCA 4L6CA 3T3PB 3C5VA 3D7NA 4B87A 1VPEA 2VPTA 4MVJI 2XODA 3H1EA 4PNPA 4FGZA 5EMNA 2R62A 3O21A 4CMCA 3CGGA 1Y42X 4HLUC 4ND8B 1I3CA 3DT6A 2V7QA 2JAOA 1L8LA 2F8MA 3IVXA 3LX8A 4OHYA 3KJGA 2G36A 2O2CA 3RT7A 4DC0A 4UEKA 3L0PA 3O7WA 4HFNA 3QJGA 2C9OA 1VHTA 3BEDA 5BORA 5MGBA 1RD4A 2UUBB 1AB6A 1AF4A 4OQDA 1IFXA 2VBTA 3HP7A 4OPMA 1Z08A 2CSUA 1HQDA 4Q19A 4P80A 1RXUA 5DRYA 1K5DA 3AJAA 1AUVA 3DEKA 4LZJA 1P7CA 1YF3A 4NDNE 4GXRA 4OQLA 2XADA 5LA6A 5CA1B 3ISJA 4G86A 3D0OA 4ZOLF 5JEDA 1HEYA 3T7JA 1P3DA 5ENZA 4U9UA 4ZYZA 4LBVA 1ZIDA 2N1MA 1O58A 4QVAA 1R74A 3T7SA 3UAWA 1MAWA 1FLNA 3TIGA 5IDQA 1VF7A 3TI7A 4PWYA 4R6WA 5A6SA 1NFQA 4MP3A 2VQSA 1E2NA 4W5WA 1QX4A 1COZA 3AF1A 1H1LA 1VP9A 3NATA 4LWPA 1R0RE 1PUIA 3GEDA 4MW2A 4P26A 5ERGB 4TVSA 5JAPA 4IRUB 3PNYA 4OP7A 3U2QA 2WNIA 2A9FA 1UH5A 4HWTA 5EPUA 3IEXA 1H6BA 1I6WA 1KYQA 1TQ8A 2UVDA 1YGYA 1F4VA 3CKLA 1U0FA 2XNJA 1NVTA 3GDOA 3KK0A 4NCNA 3KYDB 1Q3HA 3KWFA 4ZO9A 2Q7DA 5AJUA 2BBSA 1CP2A 2PS0A 1QLJA 4JLJA 1BCSB 1AXRA 3EN0A 4B5LA 3I3SR 1KHTA 3ZE7A 1E66A 4H0FA 1YS9A 2AD1A 1Z0FA 2XCIA 3PDUA 3ZVRA 4BJ1A 5K5EA 1T3LA 1YLOA 3B3JA 3K96A 3ZE6A 1TF5A 3CR8A 4AJ2A 5IYRA 3OW2B 1BW9B 1TT5A 2B99A 2I22A 5WRFA 4B3BA 4AUMA 3ZWKA 4NSNA 4WBSA 4J03A 1VC2A 2TYSB 2UZ4A 1OGIA 2BFEB 4QRDA 4XLEA 4MV1A 4TXHA 1GGEA 5GM2A 5BSFA 5LN1A 2VUSA 4UHKA 4NV0A 5TVGA 5LOVB 1FP4A 5F4JA 1KIFA 2XWJI 5FKJA 4F9FA 4YCCA 2I1WA 3UUFA 4ZOAA 2WF5A 3DL7A 4G1FA 3NLLA 4ZDJA 3OOYA 5B2ZA 3K20A 2QTTA 3GLKA 2ZXHA 1E60A 1PJQA 2ZTMA 4DRXB 1U2ZA 4KYTA 1V4VA 4H0CA 1LSSA 1TRHA 4R7TA 2V98A 4JB2A 2NUPB 3COVA 1GM5A 2H5IA 3ZNPA 3F6CA 1XU9A 4TL7A 2A5DA 4EGJA 4Z9BA 3QFTA 2XLBA 3ILSA 4IMJB 4M1YA 4ZXFA 4WVFA 2AI3A 1GITA 2PY6A 2A3NA 1RNLA 3KJNA 4ZQFA 1K6IA 1G16A 1M1YA 1E7YA 2P2LA 3NBUA 3VH3A 1T3ZA 4XIGS 2HXSA 2ZWMA 4JMPA 1ZN2A 4K9SA 4CKEA 3NCHA 4M4SA 2E18A 2COUA 3ZQUA 4V2UA 3JQFC 1N8KA 2GTIA 3QP9A 1SPBS 2BWJA 2C9CA 3LKDA 3SS9X 5F4MA 1MB3A 1QK3A 3WYNA 2LCIA 1NJ2A 4AXXA 5BV8A 1P6QA 5IJ9B 4YUYA 1OGJA 4QARA 1E1QD 4NDZA 3ZU5A 3GLHB 3OU2A 5BVGA 4YK7A 4LHEA 2FMFA 3I2HA 4KYUA 1YK1A 3FHCB 3PUKA 5FQOA 4EABA 2EVWX 3RW9A 4AUKA 1JIVA 4JENA 3IKJA 2OCXA 5HBGA 3ZWCA 3ZVNA 2O2SA 2XXAB 2Q21A 3LKVA 3R0IA 1KKLA 1KZ1A 4NG4A 2V9CA 2FKNA 2WSIA 4AZTA 3I4CA 3J7TA 4N39A 4DUGA 4K9PA 5BN3A 5GJBA 1ZCFA 3EIXA 1G2IA 1O94C 5KNBA 1KO1A 1PWHA 2W2NA 3EAQA 3NM5A 4PFSA 5AW9A 4PABA 4DVGA 4TMXA 4EUKA 1U8UA 3I73A 3ZGVA 1AMOA 2ZJ1A 4J43A 2IFTA 2NW6A 5KYWA 1BQ4A 4MVJH 1N1EA 4L9RA 1QX3A 1X87A 1Y5NA 3OZWA 3SE7A 1ISMA 5IU6A 4WZ6A 1NUTA 1PV1A 4TKUB 5CHEA 1F2VA 2ZRMA 5DTJA 4PGMA 1GR0A 1UK6A 4LJ7A 1Z2AA 5JCZA 1R00A 3IBCA 3OX3A 5AXAA 4EELA 4BKUA 3A4YA 4TN1A 4BNFA 5IJ0A 3OT4A 1KAHA 3V42A 4GLFA 2VNAA 4QREA 3A4LA 2ORED 3DMNA 1DKNA 3NBFA 4E4YA 1SULA 4E3ZA 1JQBA 3WGGA 3AKCA 3H4VA 1XA3A 2PZLA 1OXVA 3LHDA 3KS9A 4U63A 5DX0A 4ZZ0A 1DGQA 1SCBA 4YP5A 2WSBA 2C20A 1EFPA 1USGA 3WIEA 4N9QA 4C7BA 3ESXA 2GLXA 2C5GA 1I4WA 5KI6A 1GUBA 4W5HA 5DOZA 4IFEA 5F23A 3ZWDA 4DUYB 5EE1A 3R3ZA 1XKQA 3C87A 3GRPA 4PPQA 5SYMA 1E6MA 1SHUX 2I6FA 2QJOA 3ED5A 3C85A 4BVKA 1X1QA 2P62A 1O97D 3K5WA 3FOWA 2XITA 1D9XA 4ZODA 3V3KA 4EPVA 5G4LA 2F43A 2QVZX 1CJMA 3LUJA 4KE7A 4UNSA 1T6NA 2QZSA 1X9HA 2XRFA 4HTAA 4KYVA 2ACWA 4L95C 4IDFA 4CMEA 1EBFA 1RABA 2XUAA 2ZLBA 2P4UA 3OTGA 4UAGA 2O8CA 1Z5NA 4ZOLB 2B8NA 1ZP6A 4MR8B 2D8MA 1CETA 3VPXA 3AEYA 2JFBA 2I7CA 3H2IA 5LP6A 3GJZA 1JQDA 3BSFA 3F8WA 1QRUA 4MEBA 4ZPXA 1DRWA 1PIWA 1IUPA 5E0KB 2HCFA 4AJKA 4Q7KA 3QEMB 2G9ZA 3DZBA 1OY1A 3NVMB 5TPZD 4CLDA 3EHDA 3PIRA 1YMQA 1Z75A 3ESDA 3ASYA 3FMIA 3IKVA 3OQIB 3OUZA 2AMLA 5FBQB 2B94A 3PA8A 2W6ID 4GZ5A 4Q0MA 3UHAA 4W5QA 4HDKB 3VC7A 1WY7A 3T61A 2CDBA 3H7IA 4L5CA 3RUPA 3HL4A 3WFZA 4J0QA 1B8NA 3WLIA 4QM7A 2A0KA 4ZEVA 2C4HA 5H3CA 4U1RA 2VAPA 1I18A 4MWDA 4A15A 1CS0A 4YTEA 3CT4A 2G76A 5BT9A 2PJRA 1KP9A 1JDJA 2R8BA 2C61A 1CQWA 2G3YA 4PSCA 1GL9B 3L0YA 4G81A 1EDOA 4KOAA 4MO2A 4M0MA 4MUGA 4Z4RA 5C2JB 1RYFA 1HI9A 1WMFA 4C2BA 2PPVA 3UY4A 4INPA 5KOHB 1QVAA 1VBNA 3QFFA 4ZAGA 2AUMA 3NHWA 1E79D 4ZP1A 3I53A 1D2HA 4J1NA 1F14A 3Q88A 4Y67A 3OIFA 1BE6A 2L69A 4UU8A 3UQYS 2Z95A 1RWVA 3IS3A 3PIDA 4MWBA 1EJ2A 4LNAA 4DKJA 3HKCB 2QZ4A 4FX2A 1KI7A 3UHFA 1TM2A 1JA1A 3UAGA 4GOND 3KQUA 1IAVA 3KQNA 1X8XA 4FWIB 1G7CA 4JJAA 4L57A 3RWMB 4RX1A 4NBUA 5EWLA 4DMUB 1J8DA 4CCWA 3TKLA 1HXHA 3LDGA 4E2FA 2C2XA 2VC2B 4DJFC 4OQQA 5JOQA 2NP6A 3D9QX 4P3KA 3VV2A 3E70C 3W8DA 3O3MB 4DTCA 3LXUX 2WILA 2XNKA 1W35A 1R4ZA 4PG4A 4D98A 2Z2YA 1IRIA 3MZ0A 4YUZA 3PTAA 4KLCA 4Y9SA 2FR8A 3DWIA 4UE6A 3L84A 1NQOA 3TF5A 1MFZA 1O5TA 3LRPA 2ZKLA 4FDLA 4M0EA 2X0EA 4X8HA 1E1MA 3L6DA 3QOWA 4HB4A 1H69A 2F8SA 5JYEA 3QUQA 4X5OA 1BMQA 1U7WA 3EH2A 4KDRA 4BJ3A 4AX8A 1H5NA 2ON6A 4JROA 1ECCA 1SCUA 5FWDA 3FDFA 1V48A 5HFNA 3ZEIA 2UUAB 2I33A 1P2FA 1T3GA 3T7TA 2J41A 3A70A 3EPRA 1TJPB 3L7BA 3QUAA 4TL8A 2ZZQA 1GRCA 3R8XA 2UUCB 2D0IA 3K8QA 4A82A 5DLYA 1NWHA 5CCDA 4DUPA 3E7PA 4EB8A 5CA0F 2P3SA 1WQ1R 2JIDA 4KLAA 3OF5A 3R7NA 1PNRA 1BG6A 3VKWA 3CPWB 3PQ3A 1U02A 2G17A 3HV2A 1NI3A 2I2XB 4GL2A 2REQA 4AJIA 2Q3MA 2W6IA 3UAVA 5FWYB 3E7WA 3FD8A 3AFHA 1QYWA 2QAJA 1JDBC 2D7JA 1YDEA 1M34B 3SMQA 1UJMA 3ZHVA 4GU5A 2VWGA 1WXHA 1IXSB 2C9BA 1KZGB 4NMMA 3BRSA 3DDNA 4OKSA 2PUBA 3BM5A 1AV7A 1GSAA 4KO4S 2WUDA 1JYEA 2CXUA 1CDEA 2XB4A 3HB1A 1QE0A 4E07A 5ES3A 1MR3F 3AR8A 5KU1A 3GIRA 2WW8A 3WWYA 5BSEA 4DSAA 5BWBA 5JASA 3LZCA 1SOMA 1LRLA 2RAFA 4GOXA 5CA1A 4IJKA 3EDRA 3R6KA 1XDSA 2PZFA 1XTJA 3MAGA 3NEJA 4O2BB 3VKHA 1M0WA 1MRNA 4F45A 3FTCA 3STWA 4UU0A 1SC4A 3N2GB 3PITA 2FP4A 3REOA 3D7RA 3OQMA 5HNKA 1ZX1A 3RJ5A 1OB0A 1FDUA 3SJCA 2Y1XA 1E9RA 3U7RA 1GVHA 2BMVA 4YCDA 4JI5B 3PJEA 3VUEA 3NFYA 1TAUA 3AUSA 1VLJA 3R8FA 3KVRA 4F3CA 1ZH6A 3GQBB 5H4HA 5BSKA 4LC9A 3IMCA 3Q8WA 2H1IA 4DB2A 1VLOA 1FFWA 2VP2A 1GY8A 2EZ4A 1C7QA 3F9CA 3GGDA 1PI3A 1T8TA 4DA9A 4LDZA 3ZY5A 5DI3A 5LD2C 3HYSA 1C7EA 5AHXA 1K68A 4HMOA 3FVQA 3WLAA 5PNTA 2ZBQA 5F9HA 4PPNA 2QY9A 3PF9A 4JASB 1DQNA 3EAFA 4K6HA 4M0UA 2GJ8A 4M7PA 5D87A 5G40A 5FDFA 1P5JA 5DVZA 4FGLA 3LDUA 4GLLA 4GOMD 2J7PD 4LXHA 4OCZA 4BUJA 2Q5FA 2H2GA 4BQOA 1U7PA 3K9LA 4CM4B 4HV4A 1AGYA 4RDXA 3QI2A 1AQUA 1QVRA 4AG3A 5LKRA 3FMOB 1E9EA 1JEAA 1C4OA 3UJHA 2AJCA 2ZYHA 1W76A 3IVRA 4H9GA 1O8BA 2VHJA 2EYQA 2PEYA 4WN3A 1X1RA 2OD2A 1ESDA 4IGFA 3MJSA 4QLAA 3TMKA 4AQDA 1HM5A 5FR2A 3S81A 4DA8A 2IPMA 1E43A 1UFOA 3WQZA 1YB7A 3K0BA 3KSUA 3EZ7A 1SUWA 2VWQA 3W5DA 3H5WA 3CYFA 1XTZA 1QCDA 2BR3A 1QP7A 1V6SA 1LPNA 2Z2JA 3L7AA 3QK7A 4KN5A 4O4LA 5T6MA 3T3DA 1JHDA 3QG1A 4JITA 2HNAA 2ZT7A 3A1EA 3A9WA 2A1TS 5ALPA 1LX6A 3L77A 4C4PA 2A5JA 2C0PA 2FFHA 3WTCA 1IZ7A 3ZS9A 4WNAA 3ZCUA 4CUJA 4EUNA 2O57A 2HNBA 3KQVA 2FX3A 5G02A 4INZA 4LXGA 1E3LA 3HYCA 3AFIA 1U5AA 2RD2A 3SNHA 3RU3A 1TE2A 1EHIA 1NF2A 2R1VA 1OV4A 1WXGA 2BMEA 3HJHA 2NSJA 1LV7A 3O4IA 4JD5A 2H7CA 2PGDA 1KY2A 5K45A 5TVKA 1RKQA 3T3IA 4W5NA 1MJGA 1BHSA 2B2NA 1KAEA 1WE2A 3DDWA 4G5HA 5ISMA 4BO2A 1WMBA 2IW3A 3MRVA 3I1IA 4D42A 4TKMA 3BMCA 3GJ6A 4L78A 2DTXA 2NU9B 2X5KO 3B9RA 4BNIA 5JYDA 3DOHA 2ECKA 1V39A 2O8FA 3G5UA 1XZEA 1C9YA 2W0MA 2VP5A 1E7QA 2ZPUA 1L9XA 1GV0A 3G0OA 3K1AA 1O6ZA 2NZYA 2IIPA 2C58A 2DFTA 5KQGA 4X60A 2ODTX 1R8QA 1EGMB 4JC8A 1WOOA 3EZ2A 3ZE0B 3RHZA 3SP1A 2XOXA 2HQ1A 4ZCRA 4ZGGA 1UPBA 4JSRA 3P97A 1DBWA 2RK3A 4DCCA 1QHFA 3JS5A 3SAJA 3R0XA 2WEKA 4UUAA 2ERXA 1KI3A 3I8XA 3N86A 4DLXA 5DIFA 5JNSA 4R9SA 1BW9A 5K0TA 1FSSA 3AQIA 3OCCA 4GX0A 5TGTA 4LJRA 2V7GA 4MWEA 4A2QA 2VDVE 3TR6A 1VL6A 3II6X 3AERA 1K3FA 2H11A 3O8QA 2YVAA 4PTYA 4YJKA 2JIQA 3JRWA 5EXSA 2AT1A 2R6GA 1M2OA 3AEXA 4HI0E 2QVBA 4BB0A 1TGVA 3K31A 1C4KA 4R5MA 4BN0A 3FBGA 3DHEA 3FMFA 4IF4A 1RWMA 2HRZA 1NVAA 4QG7A 2A30A 2ZKIA 2QGNA 1WSWA 4TV9F 4WFJA 2ONKA 2BFEA 3HY4A 3IDFA 4L5AA 5AVKA 5LQMA 9MHTA 4JVLA 1J0CA 3P19A 4QU5A 3LY9A 3QUTA 2DOKA 1BGVA 3SFTA 5F2OA 1XRPA 4JCCA 1NASA 2VK1A 1QF6A 4R3UC 3BFVA 4DY6A 3WMGA 3FPKA 4FE4A 1WCYA 2VSOA 3KFVA 5FUMA 4Y6LA 3MCUA 5FT9A 1XZCA 4MLZA 4QBHA 1OPXA 1D2NA 1ND5A 2B82A 4CKXA 4YV1A 4IBOA 4YFYA 1ZMTA 3TG2A 5CURA 3KTFA 3M81A 2VOJA 2IU0A 1JG4A 1DC4A 4HFRA 3WK4A 1CXZA 2BMJA 3AVTA 2E5WA 5HZKA 3PA1A 1BEEA 4DNXA 2YRXA 3QKRA 1CR2A 2C95A 3N58A 4L8YA 4HG2A 3ZHBA 1SCIA 4CR7A 4CUZA 4M9XA 3L4JA 4QUAA 1SVUA 3BQJA 1U2EA 2ILTA 2HX1A 4CHTA 5BRJA 2BY4A 2IH5A 2FX2A 5IYZB 3OAAD 4EY6A 4XFKA 1QYIA 1KQOA 1X8LA 5AVVA 3S8YA 3GNQA 2O7QA 3FNRA 2P6RA 4BX2A 1DRJA 1ZIYA 4QTZA 5A4AA 1JNXX 1N77A 5D1NA 1IK4A 3DE0X 2Y2UA 1JAYA 2ZVDA 4XXHA 3ZH9B 2B9VA 4V24A 5JUWA 2Z6BD 4KQ9A 3KSMA 4YRFA 4KO1S 1JHUA 1SHZA 1N08A 3QJ5A 2OQIA 2MSDB 4Y0NA 2PAAA 5EIBC 5UKDA 1WU7A 1ZEMA 4WLFA 4E6PA 4QTYA 3LUGA 4IQ8A 1Y9EA 3EH1A 2AXPA 3MJRA 3OIVA 2HA5A 1BGWA 3PC2A 3VSEA 4DLSA 4J2HA 2QY6A 1K98A 5F5XA 4U9IS 4TSFA 1RP7A 2G7MC 4URWR 3EF0A 1VKZA 3GT3A 4DUGD 3EX7C 2ZRFA 3IIIA 3NCTA 4JLBA 5KCMA 1NPYA 2VXYA 3CO5A 2FZVA 2ZSEA 1PN3A 3DM5A 4MVJG 4RPCA 5K0EA 2MDTA 4L6IA 3EGCA 4XASA 1TYCA 3OFJA 1H4TA 4PZ0A 2PUFA 4WASA 5ECGC 2QTWB 4NZPA 1U7HA 3USES 4XM3A 1DX4A 3ANNA 4F3TA 1YJNB 1AZWA 1FRZA 2NYAA 3JV7A 4XQFA 4GOKA 3GGPA 4KWEA 1CZLA 1JRLA 1FMLA 1N7JA 4GOLD 1B41A 1RQGA 1TMGE 1XRMA 1YCGA 2FPGB 3JQ6A 1WL8A 2O0MA 2AUTA 5GGXA 3OMWA 3ZD6A 2CNLA 2GXQA 1VI5A 3N0WA 4PIMA 3HGTA 3LTEA 4BO5A 1A8PA 4TV8B 3F6BX 1B0AA 1DTEA 2J4FA 1U8TA 1FU8A 1GQYA 4A16A 4PG7A 4NFSA 1VLYA 2OORC 2HIGA 4HDCA 4RABA 1JEQA 3ZX5A 2AOTA 1KJWA 3I04M 4BB5A 4J3FA 5HVNA 1U11A 2F59A 2UVPA 3GLIE 2OFXA 3DBLB 3KSZO 3H4MA 2EQ5A 2IZ6A 4URFA 1UWLA 1XF1A 4L75A 4JI2B 1DNPA 3HCRA 4Q39A 2NGRA 4D8UA 1EWTA 4Y0VA 2NQ8A 3PYXA 5KIAA 2Q2QA 5JCOC 1A8IA 3RRXA 5AUQA 3JAWA 1H42A 2PHZA 5BWCA 5HZMA 2YWBA 1U94A 4L4XA 5F2EA 2OYSA 1E9VA 3R2JA 3E8MA 1LGYA 2LGJA 4P3YA 2QAIA 3DZFA 2OBFA 3G0IA 2A8YA 3R5KA 5DN6A 1LBIA 1R6UA 3LPCA 1KK3A 3OJOA 4BKMA 4F93B 2QL5A 3I0NA 5AHRA 3ITDA 4C5AA 4G0UA 4H1WA 4PAQA 4XRRA 1TYAE 2F4NA 1MAHA 2FMKA 4FS3A 1PR5A 1SZCA 4KNVA 4A0HA 2NZUG 3UCFA 1CUIA 4D6XA 2WJZB 2PS3A 2X40A 4I55B 3BX1A 1EUCB 2CJYA 1A50B 4MICA 3IR7A 3F67A 3M82A 2YWGA 2JFPA 5E4YA 5A7FA 4BP9A 2POCA 3VVLA 1XHFA 4FJ0A 2SHKA 4UHEA 4NCBA 1A8HA 5JVDB 1GN9A 3WB2A 1CFJA 3MA0A 3WK8A 3Q6RA 2JFOA 2OD7A 2PMKA 3D64A 2QQFA 2ZWIA 2I9KA 4JI7B 1UDBA 2X8KA 5CYOA 4GBGA 2BMDA 2C1EA 2C5EA 3OCVA 2BFNA 2DYKA 4LRQA 4NV1A 2VBVA 3FYSA 5BNTA 2ORWA 1V1JA 1SGWA 2ILVA 3LS2A 2JFXA 2FNAA 3IDAA 3PVZA 4QOGA 2WSLA 4PBSA 3EXEB 2UYCA 5JS1A 3HGQA 2YHIB 1RJFA 1J97A 5IC4A 2BEWA 1MVNA 5LP6F 4W1QA 3ICQB 3UT6A 4GPZA 2AX4A 4OU5A 1IB6A 1IHPA 3CCBA 3L1UA 4L0CA 2PMBA 4MCJA 4OB7A 3X44A 5J4YA 1D0VA 1GFZA 4R16A 3I1YA 4RFSB 4WNIA 4BQEA 2GESA 3PPIA 1W47A 3ZHXA 4EY3A 1O6BA 1AC5A 3L3BA 2EX0A 4QEZA 4RMIA 4RY9A 4JMLA 2A0XA 1D1TA 1Z45A 2GNAA 5IFKA 1TO6A 5ES4B 5EE3A 1M6HA 1EGQA 3IUEA 3V46A 2IWRA 5JJKA 1QV7A 2OL4A 4PPGA 5DBEX 4XLAA 1UCFA 4QUZA 5EP1A 2O9JA 3CX4A 3E35A 4TWBA 3RYTC 5K05A 5K6TA 3UN1A 3GVCA 1OMOA 2NV4A 2HK9A 2JFUA 3AZQA 2NPFA 3HHPA 3NASA 1CZOA 1KYTA 4IDHA 2VNJA 5JD3A 3ETDA 3ZV7A 3REQB 1JDZA 1MOZA 3F96A 4FFBB 4POAA 4RNDB 1I24A 3NRBA 2YVLA 3RYIB 5CD1A 1R16A 3H1TA 3OT1A 3UJ6A 4RU1A 4PYLA 2ZQZA 5AMXA 2CSXA 3GFPA 2R66A 5GV8A 3TW8B 3VMFA 1GGHA 1LY1A 1T3SA 4F72A 4QU9A 4IDOA 1OV6A 3P2IA 5IK2A 1YE3A 2PH7A 5EERA 3LLSA 4QDOA 1NI4B 2FAXA 2N47A 3W5SA 3THYA 2FB9A 1ENZA 2B4YA 1TMOA 4UCXA 4YI3A 4ZFNA 1UFQA 1AK2A 1GU1A 1LDGA 1U9IA 4XQGA 3ROZA 3AYZB 1Y0RA 1Z28A 2NT4A 4HCJA 3AM5A 5EP2A 1MQ9A 3G05A 1IPFA 1YVUA 3P9RA 4WK4B 5L40A 2D8AA 1UBUS 2IDJA 3HCNA 3LLMA 2Y77A 3DS8A 2PV0A 1V4BA 1BLIA 2G04A 4M46A 4UFPA 4EI2A 2QLLA 5TQ2B 1E8DA 4Q4HB 3WYBA 2QLTA 5JI2E 1PU2A 1PFWA 4MYCA 2ALJA 4K9RA 4BV9A 4F0JA 3OX4A 3R1IA 3CRVA 1U9ZA 1FC0A 3CLTC 5G0TA 4M7WA 4HUJA 3T99A 4YUVA 3AF3A 2R4QA 8OHMA 2QM0A 4PO9A 4AP9A 3N6RA 3Q8XB 2Q6LA 1E3JA 2VVTA 5EMMA 4E6EA 1QGZA 2XUHA 1HNNA 5LMZA 2KW5A 2GN0A 3O7MA 4QU0A 5CNIA 3W1VA 3PJGA 3N07A 2GPJA 4A5SA 5DMXA 3AKYA 2F3UA 3RHTA 1CJKC 2AL7A 2AC4A 1NURA 2D06A 3R5HA 4MK4A 421PA 4DXHA 3CVWA 4HADA 2Y93A 2CVQA 4RGVA 1BX1A 1MORA 1W48A 2H9AA 2PUWA 1X77A 2GTHA 3EMVA 5LXTF 5C52B 1WCIA 3NTOA 4B80A 4H7IA 3O4VA 2CLEB 1GD1O 1U6IA 3WQSB 1YZGA 5GIPE 2AI2A 1IG3A 2XE8A 3EOBI 4X7DA 2ZAIA 3SYKA 2IPOA 4ZQGA 1WTCA 5DHRA 1U8YA 3QPBA 4UTPA 3JU4A 2CEKA 4GQBA 3A6JA 1PR2A 1L7RA 1U2SA 2GEUA 5I8PA 2AFHA 4F7WA 2CNKA 3K5PA 1FYVA 3EGDA 1YA4A 1XE3A 3LP5A 5E6SA 3W06A 1UD3A 2HGZA 1F0KA 5FL7D 4LISA 3IVMA 4U8HA 2J0QA 1YFKA 2XCLA 3ETCA 3T5GA 4H17A 5KX5A 2XUDA 4FSHA 4XMYA 1L4MA 2ZIUB 3EZYA 3EXHB 4UDOA 4EAQA 1TAHA 1P74A 2HMSA 4A0SA 5JH7A 3TRIA 1CUJA 4KQCA 4RV5A 3FLAA 2O06A 4Q03A 2D1SA 2O8VA 2EFGA 2OBTA 2HXYA 4DZRA 4Z4EA 3MFQA 5HXBA 4MLPA 1UOOA 4XAQA 4ZVRA 4QOFA 1SK9A 2H48A 3KOMA 1ETUA 2VL7A 4X95A 5J2UF 2ZULA 4I4TF