1EWYA

Anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
303
structure length
303
Chain Sequence
TQAKAKHADVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title Crystallographic studies of the interaction between the ferredoxin-NADP+ reductase and ferredoxin from the cyanobacterium Anabaena: looking for the elusive ferredoxin molecule.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 77
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2000-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ewyA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1ewyA02
2EFGA 3FJOA 3P27A 1ZM2A 5H59A 4Y9RA 1H85A 4RD4A 1DDGA 3U6KA 3PENA 1N0UA 1ZM9A 3AVUA 4MYUA 1E63A 4RD6A 3V76A 1YI2B 1ZM3A 3OJXA 1KJZA 2VZLA 1FDRA 2YWGA 1BX1A 4MYTA 1SM4A 3J81k 1EFUA 1QGYA 4HE5A 4TMXA 4YAOA 4J0QA 1JNYA 1K9MD 1YHQB 1DARA 4RD0A 2XEXA 2C77A 1GVHA 1QUFA 5TR9A 4PC7A 1IB0A 1FNDA 1YJNB 2QTLA 3I1FA 2DY1A 1YJ9B 4FK8A 3CCVB 3CC4B 3W5UA 1D1NA 3QSYA 3CD6B 1XE1A 1U2RA 1D8TA 1ZUNB 4FWTA 1OGIA 4UAJA 2CRVA 2VNJA 4B43A 3CB4A 3WNCA 1FNBA 4ZCLA 1YJWB 1B23P 2HMAA 2BVNA 4RCYA 2RC6A 1TVCA 3OZVA 2BM1A 3E20A 4B48A 1S72B 1JA1A 2BPOA 3VO2A 3CCQB 4NCNA 1W35A 1VQ7B 1KC8D 1B2RA 3MHPA 4C43A 3OW2B 1GAQA 1QGZA 4B44A 1AIPA 3AVXA 4TMVA 4AC9A 3W5VA 4G1VA 1BX0A 3QFRA 4LC0A 3CCUB 4QHYA 1VQ5B 2OK8A 1ZM4A 2PLFA 1YIJB 1VQLB 2E1RA 3AGQA 1KTVA 5THXA 4LBWA 3W2FA 1KRHA 4YHBA 4YALA 1R5OA 3WBKA 3ZBTA 1VQ4B 1H42A 2AHOA 5KSWB 3VO1A 4M4SA 1Q81D 3QFSA 1OGJA 1EP1B 2QEXB 1EWYA 2C78A 1VQ6B 2D74A 4M1KA 3VMFA 2YWHA 1QH0A 1N8RD 3G71B 3CRZA 4H9GA 3G4SB 1W87A 4TN1A 1W34A 4BPRA 4LBYA 4DQKA 3CMAB 1EFCA 2B7CA 2QA4B 3U2QA 2YWFA 1VQMB 1I7PA 4YAUA 1N0VC 3W2GA 2HDNB 4ZCIA 2VNHA 4G1BA 3W2IA 3FPKA 1GJRA 1ELOA 4ZGQB 1EFTA 4PC1A 4ZCMA 3AVWA 1QVFB 5GV7A 1GR1A 3OZUA 4C0SA 4PC3A 1IJFA 1BJKA 3ZZUA 1F20A 4PC6A 1Q82D 2BMWA 4PGOA 4RD2A 4Y7CA 1KK3A 1VQ8B 1KK1A 1QG0A 4TMTA 5TY0A 2B7BA 2BN4A 3W5HA 4N3GA 1JJ2B 1WDTA 4QFMA 4AF7A 1SKQA 5JBQA 1VQ9B 1DDIA 4P3YA 1G7TA 2QTZA 3ZZ0A 1F60A 3ZC3A 1VQKB 1KQSB 3CPWB 1W2BB 1S0UA 4B47A 1XB2A 3MMPA 3B8HA 5AN9A 1K73D 5DSZA 4U9UA 4YAFA 2OTLB 4RJLA 4R71A 3W2HA 3QE2A 3QFTA 3CC7B 1Q86D 1QUEA 2CNDA 2DCUA 4G5GA 3CC2B 3CCSB 2BF4A 1TLLA 2QN6A 2PMDA 2XNJA 2BV3A 3CW2A 1A8PA 3OJWA 1KK2A 1NDHA 3LO8A 1J9ZA 3MCAA 2OTJB 1OB5A 4ACAA 1VQNB 4RD1A 4M2LA 1G7SA 3AVTA 2BM0A 2PIAA 1KK0A 1QGAA 4M0LA 1EP3B 4P6VF 1AMOA 1DG1G 1VQOB 2FX3A 4LBVA 4AF6A 1FRQA 3WXMA 3ZZTA 1QVGB 4B4DA 1CNFA 3G6EB 3P26A 4ZGNB 4ACBA 3WBJA 3CCEB 3WY9A 3CCJB 3LRXA 4LBZA 2VNIA 1FNCA 3CMEB 1M90D 2BGJA 4WQMA 2GQFA 3WNDA 3SJZA 1OB2A 1E62A 3I55B 1JB9A 1Q7YD 4K1XA 5EMNA 4PC2A 4F7DA 2QMUA 3OZWA 4Y9UA 1GAWA 2DERA 3B82A 1QX4A 1BQEA 1CQXA 1JA0A 4TMZA 2J7KA 2NPFA 3VNVA 1HA3A 1FNMA 2HCJB 1GO2A 3W2EA 1QFJA 2ZITA 1KD1D 1D2EA 2BSAA 2RC5A 3U6BA 1M1KD 2VYQA 4RCZA 2DETA 2OK7A 4HE6A 2GPJA 5HXBA 1EXMA 4Q7JB 3I56B 4TMWA 4EH1A 2EIXA 4NBSA 3CXCB 1QFYA 2XNCA 5GV8A 3WNBA 4ZV4A 1K8AD 4FN5A 4N3NA 3LYUA 1UMKA 1YITB 1QFZA 3AVYA 1G7RA 1G7CA 5H5JA 3B78A 3JQQA 3LVBA 3E1YE 1TUIA 4B3XA 1R5NA 3CCMB 3WYAA 1IJEA 4IW3B 3A1FA 3AGPA 3JQRA 3AVVA 2R6HA 4M53A 2BGIA 1E64A 1NJID 2DEUA 4YAWA 1VQPB 2VNKA 3CCLB 3CCRB 2X3UA 1FRNA 2QDXA 3ZBUA 4RD3A 3ES9A 2YWEA 4DQLA 2B5OA 5FA6A 1CNEA 3VNUA 1TTTA 1EP2B 1R5BA 3JQPA 5TV2A 3QFCA
chains in the Genus database with same CATH superfamily
4Q4CA 4QOEA 2H5LA 4JI0B 5IS2A 4MKHA 1ZIXA 3DLCA 5JSHA 1Z4NA 3UXHA 1J1IA 1TC1A 4MR9B 4BAUA 2GESA 2VXYA 4YK7A 4X1YA 1YZTA 1Z17A 4AN4A 4J49A 1DDGA 1CZRA 1CRWG 3CO0S 3GEHA 4J3FA 1JWAB 2FFJA 4WT7A 5CLLA 4IWYA 3R9IA 4AY6A 1SUAA 3HDVA 3IQXA 5TEVA 4II2A 1CE8A 1WCXA 2DHQA 4H7HA 1ZM9A 1P0MA 3BHMA 3L2OB 5CIYA 3AR7A 4GIBA 2QDKA 5FI5A 1XZJA 1T9GS 3OZXA 4Q9IA 3C6MA 4XKWA 6ABPA 1ZAKA 3D3EA 1YZYA 1JAZA 4HLDA 1FZTA 2B78A 1E9VA 4FYIA 5BXYA 4DKXA 1E3WB 1XWWA 1KJNA 3JQ8A 2Z1DA 3KWFA 3ZW7A 4B6QA 3OQOA 2YRWA 3A14A 4I9GA 1VM6A 3R5KA 3G89A 4CMIA 1N36B 5AOCA 3WQZA 2YN0A 2W71A 3K05A 3K0AB 1EE2A 1II8A 1L5QA 4MW2A 4Y6GB 1NMSA 4Z1OA 4V02A 4KR0A 2F1OA 1A9ZA 2NVOA 4KGXA 4LSGA 1JKJA 1KU0A 1T0HB 3RRJA 3TW8A 1FTYA 4LDRA 3K92A 4EWLA 4F3NA 5B57C 4CVNA 2ZKIA 1UUFA 9LDTA 5EKUA 3FCEA 5DM70 1E1KA 1BRTA 1VB5A 3BJIC 3HHPA 5EKSA 5FBZA 5SYMA 3RK0A 5J4HA 3VV2A 2BTOA 5LPNA 3T9FA 4QYIA 3AETA 3C3KA 3BCHA 3T9BA 3IL2A 2VPTA 1JQDA 3VNBA 1JXAA 3M1YA 1ONSA 3OLZA 5LSAA 4QBTA 3VKWA 5C18A 1H05A 4QXRA 4FNGA 3T7EA 2Q0SA 3EYAA 3LGAA 2JVKA 2QPOA 2ZXEA 4O2AA 4Q24A 3ZDCA 2DY1A 2MU1A 5F3RA 2EFEB 2DTEA 2F7SA 1FJ2A 2HO5A 4MV5A 1L5KA 4GYWA 1HYHA 3ORQA 2O7VA 2P6MA 3NBFA 3PUZA 3REGA 3BRWA 1G2QA 1YI8A 5J40A 3OQVA 3VR1A 1LF0A 1CR0A 2FSPA 1BFUA 4OPVA 4RKWA 1UQTA 5C53B 1A1SA 1MBZA 2PY6A 4QM7A 4UEOA 4R2KA 3QENA 1CY1A 4EP1A 5BR1A 4AQ7A 1DWOA 4NFHA 1XAHA 2D1FA 1Z82A 3V1KA 1E3SA 1RQLA 3F8WA 4U6NA 1M75A 5BV0A 1Y81A 2EG5A 4AP9A 2KYRA 3CR3C 3ZG6A 4JU8A 2IW3A 3TQQA 3A6PC 1CK4A 3BY1A 2BOVA 1K4MA 4UVHA 4DDKA 1PFWA 4X84A 4ZU1X 5I9LA 4ZCLA 2P2YA 1EVYA 3C4VA 2MYPA 2OORC 3OVMA 1B23P 3JQ6A 1US8B 1HEUA 3IB3A 2PGAA 4CPDA 4PONA 2UU9B 3M33A 4N7JA 1JLRA 4K7JA 1DO0A 3DEIA 3M2PA 3N8DA 4OK3A 3I28A 4PIMA 1P29A 4XOIA 3DKRA 3GDOA 3T7IA 1U5AA 3EGDA 3EUWA 4RTRA 5BVHA 4GL2A 5D5HA 3LM8A 2EW1A 1ZCJA 1KEUA 1PSDA 3GFOA 4PU0A 4BZXA 1C80A 2J8ZA 5FOXA 1O9GA 3AIMA 3LX4A 1U1DA 2JFYA 4C14A 4HB0A 5ALKA 4GG1A 3Q72A 1A3CA 1D2HA 2WIFA 3KKZA 5TEWA 3EISA 3AIIA 2C4KA 1CUGA 1ORIA 2COEA 3B52X 3FF1A 3KKNA 1F51E 4P2GA 5CVEA 2F3UA 2A59A 2MMGA 2RI0A 3C5WP 3NDJA 2V5AA 2D3NA 1NJ8A 1PGJA 5B1IA 3VRHA 4RA9B 3N0RA 3TTXA 1DIBA 4WDRA 3AFMA 3E53A 1P2SA 1P9RA 1KI6A 1FSFA 1LPOA 1RAGA 2A5GA 2B2NA 2BE7A 2JIQA 3C6KA 4ZAGA 3OEHD 5BQ3A 3FMVA 1M2WA 1R3UA 3AVXA 4NULA 4B76A 3UW1A 4P7KA 1THTA 3ABZA 1GLNA 2DBZA 2VOJA 4FDVA 2BCJQ 1RLTA 5JXHA 3SYRA 3W5VA 2P3LA 2PTHA 4ZDWA 5IKMA 3AV0B 4KR9A 4PFJA 4XPIA 1A95A 4C87A 1UXHA 2OHVA 2QP9X 4S1WA 4I08A 2NO1A 3RFTA 3FOZA 4HV4A 4MUBA 4Z51A 2PKQP 1NXWA 3ANXA 3TG8A 1PZMA 2VWQA 3M3DA 4CG2A 4RMHA 4S12A 4MXDA 3T41A 1VPEA 1PFVA 5TMPA 1FMLA 3ZD7A 3OPYI 3CN9A 3T7JA 1SEPA 1C9DB 5L7TA 3IURA 1RKBA 4RVGA 1YR1A 5EEGA 3UK1A 5CCBA 2H63A 3K30A 3EZGA 3MW8A 3SBOA 2YZ2A 1E1LA 5K6AA 2Y1LA 4IH1A 1M1XB 4DQDA 5IDQA 2TRSB 1PJBA 3O73A 1E9EA 4NWIA 1G8JA 5IC6A 3KQKA 4YFYA 3SQWA 2Y77A 1E9FA 4HH4A 4L0MA 2JCYA 2KQUA 4HJXA 4M4SA 3TINA 4DF3A 4E12A 3IJPA 1ESNA 1EXVA 1A7JA 3WSVA 1NQUA 1BDMA 1RAHA 2WYWA 4OQLA 1A9SA 1NUUA 2IDZA 2YWCA 1I1NA 3OCCA 4NJEB 4YDQA 3GYGA 5ABPA 3JD2A 1OAKA 2WKWA 3M6XA 1HDCA 1CDZA 2Q2WA 5B2EA 5D5PA 2JIDA 4FGLA 4YP1A 3JWIA 3IIKA 1QH0A 4N5LA 4OHCA 4JX8A 3FTNA 3DB1A 3UMBA 4D42A 3N86A 3EGVA 3E7DA 3FI9A 3HRIA 3PFBA 1U4NA 3H84A 1PJ2A 1UIRA 5KQGA 5L7WA 5K4HA 1XXHA 4XEUA 2VYFA 5E9QA 1VKOA 1XMSA 1YFKA 1OZFA 1YL6A 4HG2A 4BNTA 1QYIA 3IUQA 3SE7A 4D9MA 5L3SA 2ZRFA 1R9JA 4V0QA 4KO4S 4RPBA 1JDZA 3KQUA 3SKVA 2A0UA 4NICA 2KM1A 5TMDA 3MA0A 3O4FA 3KQWA 5FI1B 3NATA 5HHTA 5FQNA 1I4WA 3E82A 3BXOA 3OUZA 1C3OA 1R27A 3L18A 2EKLA 1JDBC 5FI3A 3A9TA 1XD9A 4E22A 1N2SA 3GT4A 3X43A 2VNHA 4Y0AA 4Z0TA 4BCCA 5HUHA 2GXSA 4YR9A 2YL2A 3DD5A 3EGWA 2QGNA 4L28A 1RXYA 3QTLA 4Q1VA 1NURA 5A9SA 2DM6A 3GWGA 2VF8A 4XI9A 3RU3A 3UJNA 2ORIA 3NHBA 3Q4GA 2JBAB 4G2NA 2XCTB 3FFBA 3W05A 4MRNA 1RKVA 2ZWOA 3SZMA 2YX1A 1JE0A 1I4TD 1UXGA 1XTVA 1LFAA 4YMWA 4LWZA 4DA0A 4ZVTA 4NZPA 2IEDA 3FCOA 3SSNA 1X9IA 1V26A 1KMHA 1JNXX 1J56A 3IR6A 3N9IA 1I18A 1YKSA 1Z2CA 3ESAA 4QJIA 1EZ1A 4KQWA 2PRSA 2VDVE 1KZGB 1IHUA 3PD1A 5AOBA 2WIBA 5JZ9A 3WK5A 2HLDA 421PA 3ZJUA 4YT4A 1AS3A 5GOZA 2RGBA 1SOVA 4TMTA 3ZD8A 4JQCA 1ENYA 2B7BA 2BN4A 4GSKA 4IOMA 4WN9A 3BILA 4DLZA 3CSUA 1DEHA 3KAJA 4BFTA 2W98A 1JT9A 3AHDA 3GJ4A 3OZFA 3CH7A 1KDTA 3DTTA 4HXEB 5K0GA 3JU3A 3NO4A 1XAGA 4UREA 3PE4A 4IDBA 5FORA 1E6LA 3LBIA 4RTQA 5FWXB 4LXIA 3EOBI 3WQSB 4GOOD 5I7UA 1MRNA 2GERA 3HVJA 1RRPA 1V45E 2G4CA 1LKZA 2E5LB 1WXFA 3UMVA 3H11B 4DHWA 2BFOA 2RIRA 5IJ0B 3B6KA 2YNMA 2ZDQA 3E27A 1HDXA 1GA4A 4O4JA 1Q91A 2W22A 4ZVLA 3WQHA 4KPEC 1TM7E 3IUEA 2R1UA 4Z4HA 2XB9A 4E4TA 2AEEA 2DSTA 4PRZA 4WZKA 3B6ZA 1S0UA 1S7CA 3BH6A 4JT8A 4XJTA 4YT8A 1HI9A 2P75A 3HL4A 4IJVA 2JK1A 2XD4A 2ZSAA 4RKYA 3CEPB 1BQ4A 3QEMB 4ERXA 5BSXA 5AT1A 4E5KA 3AR9A 1ESZA 2PA0A 4UBKA 3L0DA 3W2HA 1UXOA 1XZKA 2X6WA 2AOUB 3EMVA 1V37A 1KPHA 4LHEA 5KSYA 4TSKA 5SZIA 1FBTA 3DE3X 1Z33A 2ECPA 4WZ6A 1NC1A 1Q19A 1K98A 4QYTA 2C92A 1ABBA 1CZKA 1ZA1A 2O3JA 3MZ0A 2CLHB 1UZAA 2CNDA 3ZEIA 1R6DA 3R3UA 3RJ9A 2JGFA 1KFCB 5CLGA 1BXZA 3V80A 1H0SA 4POAA 3G82C 2XUFA 4Y6RA 5KVSA 3P32A 1C1XB 1Z38A 2QMEA 2SCUA 3LLCA 1DT5A 3MS7A 4J1NA 1PG0A 3EC2A 3CH6A 4U7WA 2H52A 3NTVA 3ASYA 3HM2A 1IDN1 4IGIA 4OU4A 4F5YA 2OXEA 2I91A 2RE8A 3SHTA 4BY9E 1SU7A 4XWAA 4HT3B 3O8CA 4KBGA 2IYEA 3HCFA 5FUXA 1WULS 1J9ZA 2FZ5A 4UUMA 3U09A 4GKKB 1T43A 1CETA 2WIDA 1KOFA 1Y3BE 3VHXB 2G09A 1ZITA 3JD1A 5FX2A 1T5EA 1E9AA 5JDIA 1Z6GA 1K4YA 1HDOA 1WZUA 5EKTA 3SYLA 5LUBA 4K6FA 4PYQA 1TLFA 4RZSA 3U7RA 3ISTA 5TF0A 1MUUA 1D3AA 1OILA 2C61A 2FX3A 4CIWA 3NT2A 2VH1A 3KU1A 1SQSA 2FMHA 4Z49A 3M89A 2XGSA 3I2IA 4C0KA 1PGQA 5ER9A 4IEFB 5B4TA 1C7RA 1J42A 1U9IC 2GAFA 1B42A 4EB3A 1WTCA 2OHOA 1A9OA 5B4VA 1XIVA 3LVFO 1EX6A 3IJEB 3EZ9A 2J4CA 1A8QA 4CLEA 4CTOA 4DMRA 1LJUA 1GAEO 3WJ1A 1ZK3A 1Y1LA 1LTHR 2EJWA 2XADA 3LKBA 4B3CA 4E5SA 4D5EA 1WX1A 2R2AA 5C1IA 5E3JA 4R54A 3H5NA 3JQAB 4IFBA 4XSVA 2JIRA 5ADUS 4R1NA 5E1BA 4QULA 3KEOA 3LS2A 1ULSA 4KYIB 3PT5A 3R5SA 4B71A 1RBMA 2ECQA 3CHYA 3TSWA 3B9BA 3TZ6A 3WXBA 2XUIA 4R6WA 1OREA 2Y71A 1K8QA 2ZR0A 4RTSA 3TSAA 4HGYA 5GGXA 4IWNA 1QX3A 1Z28A 3HHEA 3LCVB 3NBXX 4OJMX 3HKBB 1PL7A 3OZWA 1W4ZA 4XVQA 4B3JA 2PUEA 3AG6A 1RRVA 1YRQA 3NHYA 4OKIA 3ULKA 1IOWA 1R0BA 2W6NA 3FPLA 4U9IS 2BL4A 4GMDA 1XZEA 5ALFA 5IJ9A 1K06A 3Q7EA 4H0FA 3KEFA 1ZKDA 4LQCA 4MUXA 5DHAA 2OXTA 2ZULA 2PXHA 2WFMA 1OSNA 1HA3A 2QMOA 4LS3A 2C7GA 4RFSA 4KR6A 5CNJA 4JLNA 1GO2A 2CVZA 2J3LA 4XW2A 1PYGA 3SIWA 2QNRA 3C5EA 1ZD1A 3P9YA 1JQJC 2FETA 1G5TA 1J1ZA 1MQAA 3NEPX 2HNAA 4N54A 2HK8A 3S8MA 1W36D 4WACA 1IHMA 5H0IA 2NSJA 1SBIA 3KHKA 1YQ9A 2A5LA 2YJ3A 4FDMA 4F11A 2ZT6A 1CQPA 2IBMA 3H65A 4AX4A 1ATZA 1DZ3A 2IHVA 3TL6A 3VJMA 3HXOA 3MILA 3R24A 4AKHA 1I4OA 4X7EA 2R97A 1N6KA 1Y0BA 3I45A 7REQA 2JI7A 3BKXA 2C1XA 2DULA 3VTFA 3AERA 2XTJA 4F7WA 4BO5A 3TFQA 9MHTA 4J94A 3W04A 4Q03A 3UIEA 2GK3A 2VZ9A 4W5RA 1Z6ZA 2Q8PA 3R5FA 1Z74A 1M3SA 2PCLA 4IUCS 4PYJA 3GUVA 1N32B 4B79A 2DECA 3PUVA 2LD4A 2VJMB 1HORA 1T2UA 4IVQA 1N0WA 2QQ0A 3RUEA 4Q7QA 1UKAA 5MGBA 1BS1A 1P4RA 2I6FA 3LX8A 1JXMA 1Z0ZA 2I78A 2Z5FA 3VR2A 1QFZA 4N7BA 5T41A 1T6BY 1WCIA 5C35A 1TTPB 1COWD 4FCWA 1G7RA 4UOZA 1EM8B 3DV0A 1MORA 4L0CA 3WWDA 5E6RB 1Q0ZA 3U3KA 5KX5B 3O8OB 1MJNA 2H1FA 2RAFA 3NUQA 1GNRA 1NBOA 3S55A 1UP6A 1OUMA 1TTQB 2H11A 3JAWA 3JWPA 3P9RA 3CT6A 5TLSA 2WD9A 3RG8A 5BMVA 1PFGA 4OMUA 5FTWA 1T5OA 3RT9A 3DZGA 4LF8B 1OR8A 3H83A 3HFSA 3PFHA 4LX8A 4ZO9A 4AYTA 2ROQA 4CIBA 3FSGD 1CSEE 5A6VA 1RTTA 1UPBA 2W2TA 3VU1A 4ABTA 1O1YA 1XTRA 2PUHA 3P9SA 3ZU5A 1LLFA 1KYVA 4JL5A 3KFXA 2HW8A 5KNBD 1WSDA 4EABA 5D86A 2DEUA 1AUQA 3EFHA 1W581 4FYYA 4DOMA 1VQPB 2FEWB 3D2BA 3ECCA 5EIOA 5F73A 3PU6A 5JSKA 5AW9A 3RPEA 4F5EA 5C5CA 3OIVA 2FR0A 1HV8A 1P7WA 2PKRA 3DD1A 4JD5A 4N5HX 4DDVA 3ZHYA 1VYVA 2HH9A 4IY1A 3K6SA 3ES9A 2FF7A 2QB5A 4I9NA 1GRQA 2MYNA 1DDOA 5JLJA 2WJGA 4BFVA 1A69A 2B5OA 3C4JA 2YRXA 3WVNA 4MPRA 3TH5A 1R5BA 2BBSA 5J2UA 5G4KA 3A4VA 4JNCA 1MAUA 3UTCA 2M6KA 2XT6A 4US1R 4UVGA 5FNZA 4XX0B 3M82A 4RZ3A 2XWPA 3TS1A 4D99A 5AVVA 1V5EA 5JCXA 4X7PA 3MTAA 2XWJI 3B1WA 4C1NA 4KGZA 2H8KA 2WDZA 3WNQA 4RLHA 1PJ3A 1MXHA 1DQRA 1YRBA 1JI0A 5DN9A 1GTL1 3K9FC 2FGJA 2VJBA 2AVDA 3MCWA 3ND7A 4NEHB 1RLIA 2E2WA 3H2IA 4U9HS 4ZPJA 2V0GA 3WRXA 4YUXA 1ST3A 1TM5E 1OE0A 1FDOA 4M7OA 4Z9BA 2VI5A 4OQMA 5CIQA 2G9VA 3WL6A 3Q7PA 4D4HA 1PNQA 2RG7A 1O95C 3L8GA 5C3UA 1YI2B 2VBGA 1OC4A 2C99A 1E18A 3QNWA 2VHZA 4LJKA 4UMEA 4YWJA 3SIRA 5E8RA 3OEED 3V7NA 1QGUB 1I6MA 5CFNA 4L51A 4H1HA 1YONA 1I01A 4B0OA 1IHPA 1GCOA 3G5LA 3FYUB 1TEZA 1ZNWA 4CKZA 3DOHA 2OV3A 2H9AA 4PLWA 1DJPA 4ETWA 3S4YA 2VR1A 1ORRA 4YCSA 3IFSA 1T3LA 2HIHA 2PWPA 3CUKA 3ELBA 3PX7A 1RI3A 1O54A 1QHEA 3G2QA 1MRSA 4YAOA 1H5NA 3ENNA 3ICPA 2FWJA 1U2PA 3Q15C 3NW9A 3NHUA 5E6UA 3JWHA 3NPMA 4F06A 2Z2KA 4K6KA 4B4WA 1IFXA 1NQ5A 1VE1A 4EMSA 1ZGGA 1WHSB 2HU7A 1T2VA 5C8XA 1U1EA 3T53B 5LFAA 2QLJA 1G1MA 2G1AA 1TU0A 1F0YA 121PA 1CC1S 1TYCA 3K9HA 4H1TA 5IM4A 3V9AA 5A88A 3RUHA 1GRNA 4RTKA 2QL7A 1LU9A 2ZUVA 3PC8A 4TTSA 1UDXA 2BEWB 2VA9A 4GOXA 1KXZA 5EIHA 5KI6A 3WIEA 2PUDA 2Q3FA 1IB0A 1KEZA 2WDPA 2DQYA 1H1LA 2Z83A 1UZNA 3SDSA 3LUDA 4OFXA 2PO5A 2QSYA 3HVUA 3ESZA 2V59A 3ZHXA 4TTTS 3ZV3A 1WMBA 4MINA 3VTKA 3WWOA 1IPHA 3WAKA 2QK4A 4UAVA 4AY2A 1C3VA 2QUKA 1ZD2P 2BI7A 3TB4A 1M2NA 3WIBA 1SOAA 3PGMA 5YASA 5JQGF 4RFVA 5AYVA 2AFIB 4ZCQA 4A8HA 3ZQJA 3UJ8A 1CG6A 5ALJA 1UBGA 3LH5A 2QLLA 4RH3A 1W46A 1M5TA 2RKBA 2IKSA 5FLYA 3QVOA 4C5BA 2DPGA 5K0LA 2NTEA 3AJEA 2PQ0A 2G9NA 1MW8X 1ESMA 4U00A 3EHDA 4OQFA 3U4HA 4MVJM 1E7SA 3GFGA 4I81A 2J0EA 4HDSB 1NF2A 2RHTA 3MGGA 4NNOA 4Q1FA 1UZUA 3FZEA 4GECA 1Q14A 1UBFA 4QJBA 3OTOB 5CDFE 3T1YB 3C3YA 2V3VA 1XHEA 3DGFC 4OOVA 2O3SA 1XALA 2VK4A 1T8SA 2HLHA 3BCSA 3EJ6A 3N8GA 4LJ9A 1BWSA 1JMYA 4PYKA 1RACA 1T24A 4NOJA 5BWOA 5CX4A 1PG2A 4FFNA 1SK9A 1EK0A 3EW9A 4LSWA 2KW5A 3E84A 3FZGA 1QRUA 3OUUA 2EKPA 2FV8A 1AQNA 3SBEA 2FLVA 1GZ5A 2GRAA 3G8BA 2FK7A 1W4RA 3D3WB 4JC5A 1HG1A 4O5OA 2WY2D 2FOLA 3ILSA 5IYQA 1YULA 2BBWA 3L84A 3NC1C 2YMLA 1Y98A 4OSOA 5KYUB 1CUEA 1OI3A 2C5LA 4EJ6A 2J9ZB 1HOXA 1O5OA 1V5FA 1XZBA 3ICWA 4ZOLB 1XPUA 1YZQA 2KWIA 3BQMB 3PPVA 2XBUA 1KHTA 1UWKA 4IKOA 3ZNNA 4G1VA 3OZDA 3MAJA 3RYFB 1C7JA 1CEXA 2VEOA 4ZRMA 3PFKA 4RU1A 2EX0A 5G1NA 3E9NA 1BKYA 2F1MA 2H59A 2ZUBA 5LNK6 3WZ2A 2D0IA 4UFOA 5D87A 5D84A 3UT6A 3HYCA 5I8PA 4QZVA 2JAXA 4CF3A 1P9WA 3PCRB 4OJKA 1U9YA 5DU2A 3ELDA 4W8OA 5BSTA 3CPSA 4BNWA 2G71A 4CM9D 2W2MA 1ATIA 1DAMA 2W6IA 4CWAA 3B36A 2F4VB 1XZQA 3LZ6A 3OMLA 4IHJB 5KOHA 4IRUB 3L4BC 2LVBA 2WWFA 3JCZA 4JQSA 3UH0A 2IDKA 2ID7A 1W8IA 3IJRA 2F8MA 2BC9A 2JFUA 3BHNA 1R0KA 3FCYA 3MCZA 2PGIA 3P9QA 4RJKA 1QB7A 2VDOB 4LGYA 1SJ9A 1T1EA 2E87A 1E1MA 4Y6SA 2ZUCA 5IPFA 5JHHB 3L7DA 2HK7A 1VJ1A 3NLLA 5CW2A 4AWBA 5EZ5A 1KZLA 1M73E 3GOQA 3LPDA 3QVKA 4EVSA 2CC2A 3CVYA 1MDBA 4M37A 4DNFA 5ERXA 3Q88A 2C78A 3UOGA 3IV7A 3PA2A 3N2KB 5HSGA 4M6WB 2YWHA 3E70C 2ZK7A 1IY8A 1G0NA 1FW6A 4XL9A 3G71B 3F9CA 3CRZA 4H9GA 1CUDA 2RONA 4IS2A 1UEIA 4NXMB 2QP4A 1SIBE 2IWHA 5MF6A 4WEQA 4W9MC 5CD1A 3ZE2B 2GR9A 4AN1A 1BEEA 2CZGA 4MW5A 1GTRA 3R0IA 1GUBA 1AUVA 1VA4A 3PUJA 2WJVA 1TD9A 4HAIA 4L50A 4URWR 5LXTA 2BFDB 3QELA 4LHZA 3OD5A 1Z5PA 3K7EA 3MC1A 4UCQA 4WMLA 1FA9A 4JBWA 4DWVA 2X40A 5JAHA 1TM1E 3LTEA 1IAVA 3ICEA 3TN7A 4QVKA 2AFIE 4XWWA 1QQBA 2YFHA 1KVSA 3D64A 6LDHA 2BKXA 2IITA 5GY7A 2ZDHA 5I7EA 3RAFC 1XZLA 3NBKA 3MN1A 4G1BA 5EMHA 3EG9B 1AGRA 2J9YB 4IMJB 1Q74A 3UCFA 1PK8A 3KD3A 4HGOA 1SVNA 1UKVY 3TAHA 1XRLA 3THYA 4BO9A 4URVR 5IG2A 2O2JA 1T36B 4YJ3F 5AM3A 4K9NA 2Y9MB 3FPKA 1V8BA 4O1MA 3WL4A 3MJHA 4DUZB 4E7PA 5IKXA 5ALSA 4NONA 4OMFG 4PXYA 1C2YA 1KARA 1KH3A 2YXNA 3EULA 3L02A 4DM4A 4Z6KA 1EBBA 2ZJBA 5TQ2B 2R7LA 1P1JA 1F1JA 4FHCA 2Q9AA 4M89A 2CBXA 2YIVX 5DGIA 4C7BA 5DYNA 3ADPA 3AR8A 5K8VA 2AN3A 4PW0A 2FMTA 1SVUA 2NUBA 3H8VA 5KWVA 3QYAA 2HFKA 1XEWY 2HUPA 1O57A 2XNKA 4CT4B 1LPBB 1HLFA 3F9IA 1SIUA 4MGYR 1YBAA 3FHTA 5AOVA 3QEOA 4YXWD 3EFBA 4MEAA 2JD1A 2V8BA 1GG5A 3MWFA 1KZ4A 4MGZR 4IIJA 3R6TA 4XLCA 4HNTA 1L8QA 1V16B 5A4FS 1VCIA 2VJKA 4M76B 2I65A 3KKPA 3DM9B 3O8QB 1JJ2B 1H93A 4A8JB 4BLSA 1OLUA 3L4EA 4UD2A 1PR1A 4NDNE 4RELA 2W8BA 4F3CA 2F6RA 2YZGA 3T94A 1NL3A 3QI7A 4N6OA 1SCUB 2IIPA 3ZGVA 5KHLB 2ZRNA 1S2LA 3BCUA 4C4YA 1JVNA 4A27A 1DBVO 2BFNA 2H5EA 4K05A 2ZVJA 4CMEA 1F2VA 2YW9A 2RGUA 4Y2HA 5ADHA 2PE3A 2Z30A 3KO8A 5F5LA 1OXVA 3DNFA 3QWAA 4A0SA 3EMBA 3HB5X 4EYQA 4YRQA 1ACLA 1U2DA 2CD9A 1XF1A 2COUA 2QW0X 3HB4X 3GVIA 4RHCA 4B0PA 5J3OA 1D09A 2B98A 3B6JA 3I2HA 2QV0A 4N6GA 4NYIQ 1PCXA 4G63A 4WZBA 4A6EA 4ZK6A 4TSRA 3UT5B 4JZYA 4LWQA 4B3MB 1NN3A 3A7EA 1XB2A 2QM8A 1X9HA 1Z2DA 2Q2QA 4KKUA 4MWZA 1T4GA 3Q2KA 4Q3AA 2L19A 1OWPA 4U9UA 1U6KA 3PEVA 1QVZA 4Z2YA 2AMJA 3KFVA 4RBNA 1UEXC 2CCGA 3UMGA 2RHRA 1USVA 2DSNA 2AXQA 4KG7A 5EXSA 1H4VB 2A0KA 1U5BB 1EDEA 1T9KA 3EVNA 4J0JA 5CT9A 3S2YA 3K9BA 3NC0C 4G4GA 3SDZA 5JNSA 1VPTA 2EBWA 1IOLA 5FTJA 1NKVA 4NI5A 1E1CA 3TSZA 1VMAA 1JR3A 1FSZA 2C9DA 4ZDIA 1Z26A 3AM4A 5A6SA 3COZA 1U81A 5HQ3A 1UEJA 4CEHA 5IFKA 3SX4A 2IW1A 1E79A 2CLIB 1YJAA 2V4ZA 2VDLB 2WU0A 3JASB 3OTIA 2Q21A 4OB6A 4XQ0A 1BMFA 1JKMA 2CUKA 3OQ6A 4KUHA 3RTGA 1YA8A 3J7AC 1A8PA 2NTNA 1GXSA 2Y0DA 4DR1B 2Z04A 4EX7A 5M29A 2GVDC 2QRVB 2OBRA 1O4VA 3VR6D 3V1UA 4TX1A 4IIGA 3VO9A 1PFKA 1W2WB 4D96A 2L42A 3KVOA 1U3UA 3BGOS 3HJUA 3PJDA 1UANA 3KJQA 2GSDA 1J06A 2ZWMA 4JT2A 4KRXA 3X2FA 2ENWA 3LQKA 2FPLA 2NGRA 3OT1B 4NIMA 4Y1GA 1X1TA 3QPBA 3BMOB 4I8IA 2BFFA 4WOKA 2I4MA 2E6UX 1Z63A 2L17A 3DT8A 4DMCA 4KWIA 2CV0A 3R5TA 4NSNA 2I6GA 2Y99A 2CLSA 3PXUA 2CFCA 3BD7A 3NV7A 1UK9A 4M86A 4D8WA 4UNSA 4ARBA 1TUGA 4RQUA 2E82A 2ZWVA 3NBMA 4XB1A 5HJ7A 1QO0D 3BC1A 4R84A 2XE7A 1N2XA 3HAGA 2XDWA 3C8UA 3L7CA 4IXMA 2NU8A 1Z07A 3WYDA 3K4QA 3BH4A 1CEQA 1QGOA 4EM6A 5IABA 4LMBA 3G6EB 3M1IA 4HFNA 2ST1A 2QZ9A 5E8JA 1U7TA 3A1DA 2D4AA 1JE1A 4L4RA 1YAJA 4KN9S 4EY5A 3MT0A 5F7OA 5JATA 5P8WA 3OLVA 1EB8A 3IAM6 1LI5A 3QBTA 1DS6A 2AE2A 5LQCA 3O74A 1O89A 1EVQA 4W1PA 1AV6A 4OTZA 3ER9A 4ZTUB 2OZVA 3G6WA 5E7IA 4V0SA 1Q22A 1XE3A 2H4HA 2ZBPA 3N2YA 3A32A 1LBQA 3NALA 3TNYA 4BQPA 1H8ED 3HKCB 4GQNA 4H59A 1S7GA 1OMOA 1X1SA 4Q7MB 1C1DB 1JTVA 1IQUA 1YACA 3OO0A 1SRQA 3OY2A 2O6LA 4H7FA 3M4NA 4GQBA 4RNCA 4XFJA 1PHPA 3FB1A 3DR3A 4UBMA 1AO3A 2YKGA 4OFWA 3ONVA 1V11A 4MQLA 2F3QA 2F64A 4X24A 2QZZA 3K9QO 5I9BA 1WXHA 2RH5A 4L5CA 2QN2A 5AK0A 5IYNA 4MRPA 4AS2A 4DG9A 4H3VA 2R6DA 1QKIA 4UUBA 3AF6A 1KQ3A 3DCYA 4ISBA 5LA6F 5FXMA 3ST7A 3O4HA 5GZ1A 5AW7A 1CZHA 1NNI1 4BTLA 5F7ZA 4ZZIA 4TVKA 4FYMA 4X3CA 3R9XB 3WWCA 3VSBA 3D6TB 3TI7A 2JEOA 1UM8A 5K8UA 2W58A 4QO8A 4NMMA 5FB3A 4DLSA 1EI9A 4MW9A 4EYKA 2ZITA 2IY8A 2ZE8A 4EA9A 5COQA 5AJHA 1XCPA 1CV2A 3HS3A 4BFWA 1U0TA 3GDFA 1K7CA 1BXKA 3FHLA 2OHFA 5AHRA 5WRFA 3DL7A 3AOEA 3CEAA 4PM4A 5K03A 2EAUA 3SLNA 5GJCA 1ZMXA 1W7AA 4FX2A 4KXXA 5LQNA 3I0NA 2GZDA 1IPFA 2P90A 4GC9A 3H1PA 1NG1A 3WZMA 4O4HA 2WZDA 5I7SA 3ZDYB 2R6GA 2AC4A 5ANRB 1CUXA 4L4UA 4UM9D 3ZE0B 3A58B 1R7RA 3GT7A 5H70A 1I4DD 1UPTA 1E7YA 2QV7A 1B8UA 3VYTB 3HYNA 3KUKA 4XCVA 4CE6A 4MR7B 1MJ5A 3FKJA 3UOWA 2Z6QA 3LGXA 4HDNA 1BXRA 4LJAA 1K8AD 2WTEA 1G4UR 4HRYA 4KXWA 3TIXB 3UWSA 2G9ZA 3CTMA 3TK1A 4YMUA 2VOEA 5CB0A 1PLLA 3B6EA 4PBTA 2YHAA 3IOEA 4YIKA 1UT8A 3WMFA 1VI2A 1WZNA 5EHZA 4IKPA 1DKOA 1F14A 3WV4A 4BQSA 1SHKA 2C4MA 1WMFA 4O4IA 4X92A 4L6AA 1J5EB 2X1HA 5BOSB 2Q5FA 4Y67A 2WQZA 4WOCA 4IMRA 5KJ1A 3BWBA 5CA1B 1XLTC 5D8DA 1FMCA 1GRCA 2N3ZA 3MB5A 3RYCA 2BCGY 2YV2A 1IZ7A 4BGDA 3WE7A 3K16A 5JZMA 2W2XA 4JYPA 2BGTA 4D41A 4WJZA 2H1VA 3R77A 2WTNA 4PGGA 4IYRA 4UARA 3T52A 3L43A 4KPYA 1TCBA 1QIKA 1FFBA 1L4KA 1SVOA 3AFNA 3JYPA 4RGQA 3GRCA 4JJGA 4KV9A 5F4ZA 2ZJ1A 3F1KA 5KX5A 5IVIA 1H6CA 2J9FB 2NZJA 5D3KA 2QN1A 3PJEA 1WTHD 2Z6BD 2RGAA 5LBUA 3TUJC 4Y1FA 4DABA 2Y0CA 2XTAA 2WPDD 4F3RA 1EWRA 5B7QA 2VBTA 4NJMA 4OM7A 2X0JA 2WWIA 1XTSA 2HA4A 4RYLA 1Q1EA 2YWEA 1TVKA 2QL9A 4C6TB 2PJDA 3GLSA 1Q57A 2PU7A 2IQIA 1I3KA 2COKA 3EA0A 4ALNA 2OO5A 4CM5A 4LJ4A 1EQUA 3GPBA 1Q1GA 1NQXA 4RPGA 1O0SA 4H7PA 1CDOA 2IC5A 3H5LA 3H9EO 5I4IA 2H5IA 1N34B 2APJA 1L7EA 5CM2Z 3LOQA 3PR3A 2Q28A 3T6KA 4ER3A 3DM5A 5A06A 2REQB 2X1MA 3ORHA 4PCVA 2ZYIA 1NUAA 1CY0A 4EG6A 2ZQZA 2BDUA 1WUHS 2YRFA 2X13A 1PBTA 5EVJA 5HF5A 1N2HA 2RB4A 3TEFA 2OXRA 1GNQA 3ET4A 4BMNA 2ZTSA 1V9CA 2ZJ2A 5DOZA 3M8KA 2A4MA 1LX6A 1Z3CA 4CFYA 4MYUA 4RMIA 4BVJA 5ICCA 2BP7B 1FJHA 3MINA 1PN3A 2OC9A 3QNUA 5JNUA 1P45A 4JI4B 2NZVG 2H7YA 4OUKX 5F7JA 4DVJA 4H60A 4MV0A 1V1JA 2HF9A 1E2KA 4MQEA 5F1OA 4MYTA 4MVJA 1Z2OX 4M49A 1EFDN 5DHPA 5BV7A 2XB4A 1G55A 1YL7A 4R2WA 3RHZA 1NI4B 5G3ZA 4OBWA 5CD9A 1NXSA 5KMGB 1XZNA 2HSJA 1K27A 1K5GA 5IBQA 5CURA 3UB3A 2QPTA 1IAQA 2OHIA 3JQCA 1BAPA 3MUFA 4Q4AA 2QZSA 4D02A 4EITA 1AG9A 3UMSA 4G5YA 5FBLB 3S68A 1VTKA 4PS1A 3ZVLA 2WIAA 1YQTA 4C05A 3JQFA 2GN0A 2ODQA 2I1WA 3TR5A 2VA8A 1EFHA 1ZYUA 4BIIA 3RBZA 1DAIA 4BP8A 2PT9A 5KIAA 3M1AA 5EWJA 4DJAA 4EF5A 1NSYA 4RZIA 5ENVA 4TZ0A 3WBFA 2ZRDA 2SBTA 5BSKA 3I83A 2NMVA 1RXVA 4S35A 5BN3B 3ONYA 4RM0A 2DUJA 3KL9A 2V58A 2AN9A 3EGCA 3PGLA 3BTVA 3Q9NA 4YJHB 1K75A 3S70A 1JU9A 3MWYW 3UW3A 2G8LA 3EB9A 1AGXA 2D3LA 1ZFNA 4L74A 4DL9A 2I80A 3WS7A 5ICEA 3WSWA 1DT3A 1VIDA 1W94A 1FNDA 2C3OA 4JR2A 3B7GA 4OJYA 3AB8A 1Z22A 2GK7A 1EHIA 2CHVA 2UYOA 5J2TA 4Q1DA 4DRYA 4YRAA 5FTMA 4RDIA 3CRNA 2HMTA 4MYRA 1PJLA 2N1BA 1FDIA 1U2ZA 4BLOA 1GCIA 3GFQA 2CNWD 2Q3DA 4XD7A 4AYXA 4CF4A 3A70A 2FN4A 3O2QB 4TKUA 2HY7A 5E1OA 3KQMA 5KVCA 2I5PO 3CGWA 1L8XA 3MWDB 4EJSA 3UPTA 3OFVA 5CXSA 1J2UA 1DRKA 2JJ2D 4KP7A 5AK3A 3NTQA 4EPYA 4CKWA 4NP6A 3TECE 5HKKA 1F9EA 2PVCA 4M9UA 4XOUA 2QR3A 3RIEA 2EG9A 1YTUA 5JC1A 1TW2A 3DVLA 3PUMA 2YHIA 1UT5A 3EXG1 4KLRA 5FEUA 2WHQA 4G25A 2EP7A 4AICA 2IY7A 4JWKA 3AJ9A 4RKQA 2ZRMA 2VUHB 2NZ2A 4J43A 1WVMA 2QLFA 2XAAA 2NSDA 4HGQA 4Q12A 5FEMA 4B75A 2IHZA 4C0JA 4RS3A 3ZCPA 3IQIX 5KW9A 3VO2A 1O58A 4WLEA 2I33A 3BWCA 1P9OA 2G88A 3BAFA 2WSMA 3RUFA 4F4FA 5DP1A 3EOAI 1Z8DA 3D6HA 3DPUA 1RJ9A 4KZKA 3WO0A 1BMQA 3KQVA 2VBUA 1G3RA 3ETGA 4TV9B 4JOSA 5F3DA 1YB7A 3VBEA 1WBBA 1Y1RA 1Z7EA 3E7PA 4HQKA 3KSMA 3BTOA 1G16A 3F5DA 4OP2A 1MTOA 1E8MA 4P7FA 4KQ6A 2DAPA 5TQ0B 1GOTA 3UUWA 2ZXUA 5TC4A 4W1QA 4FEAA 5ICMA 4LC0A 2P2CA 3G68A 4K9QA 4TS1A 4BFSA 1YOVB 3P9KA 2OK8A 1ZM4A 1YB1A 3ISJA 1L1RA 4MJ3A 1D1SA 5EQDA 2X0KA 3R3SA 4TQGA 2Y4OA 5EJ8A 1QZ3A 1TO1E 3LFHA 3N05A 4OHPA 2G9QA 3BSWA 5SYNA 4BDTA 1TU3A 2XF8A 4EEXA 2IXFA 5BWNA 4PHGA 1W2GA 5E3IA 5GQSA 4C29A 2R7NA 1L3CA 1L3BA 1NJFA 4GM1A 2I6QA 4WGFA 4PZLA 3KSAC 2CN1A 3W5JA 1J8VA 1HZZA 4LQLA 3UEOA 1CZLA 1E1QD 4YMLA 2FWRA 3OZBA 3E05A 3SF8B 2KBEA 2VK8A 5EHIA 2VPYA 2QSUA 2R4QA 4XMYA 4OSPA 2O2DA 1TA9A 2OLEA 4L78A 2WYOA 4LXXA 4V3CA 5FFFA 1KAHA 4GI7A 3PE3A 1E96A 4QT4A 2P41A 2D62A 4X54A 3MWEB 4ZOLF 4W9RA 4Z3OA 4FIDA 4P84A 5DT2A 4EEKA 2VQEB 1MB2A 3D6AA 4GM0A 3LUPA 4OEHA 1TVEA 1FSPA 3K09C 2HF2A 1E94E 2CY0A 3IO3A 4HAVA 3MT7A 2VN8A 3LLSA 1ZZEA 4O2BB 3OU2A 3IMCA 2Q99A 3N07A 4K86A 4NPAA 2R62A 4A8JC 4F5WA 1M6NA 3GVCA 4TN1A 3KVYA 1IZ0A 2DTDA 2OHHA 4FFLA 4P4GA 2BGKA 1NRWA 1ZY2A 4Q9JA 721PA 3LT2A 4NMHA 4K40A 4QXOA 1QYVA 3F90A 3DV2A 3L79A 3V8QA 1P6QA 1JR6A 4Z4WA 2DUUA 4B3FX 4MWEA 4XCXA 2O54A 1R1DA 5AW6A 3HI4A 2Y66A 4NATA 3UB2A 3ITNA 4B34A 3SXJA 2WMOB 1ANKA 3ENZA 6ADHA 4Z54A 2HWUA 4DNPA 2BFCB 4X44A 1X7DA 4YCLA 4C2UA 2ASVA 2NVBA 4MYSA 1KI2A 4ZAWA 4ZJPA 1PNVA 4A6DA 1YBFA 1OIVA 2JAOA 2OWDA 1L7AA 2PV0A 1Q20A 2O6HA 3IVRA 1Y6JA 3KZMA 4RXUA 4DBZA 3SEQA 1D6SA 4E09A 3NTLA 1VE6A 5I4KA 1Q15A 2YCBA 1SZDA 3KKKA 3I5XA 3AUKA 2J07A 1NAIA 4F8YA 1YVEI 2YJTD 1U2TA 5KOJA 3A28A 2O5EA 2EJTA 4ZCMA 3AVWA 2GZ3A 3QV2A 4MCJA 4TVOA 5IT4A 4HDOB 3AT1A 5ALDA 2W00A 3NHFA 2Q45A 4NU6A 2VYNA 3HJBA 1Z4QA 2B61A 3CO5A 2OXFA 3V1LA 1RQNA 4ETMA 1QYWA 1WKVA 2DUWA 3K8OE 1TNDA 3U4CA 3UV6A 4KDRA 5CAEB 4JNKA 2OECA 2GCGA 2XCOA 2O8BB 4MW0A 4V1CA 1YXMA 1ORHA 1GQRA 4PGOA 1NRJB 3R9WA 4Y6OA 3HA2A 1UZLA 1U1GA 1YB5A 1G21B 4F6CA 1D6MA 1VL0A 5FNVA 5SY4A 3RTDA 3C2QA 1U65A 4WH0A 5JZVA 1TM4E 3DEKA 1P60A 3KJNA 1FP4A 3LRPA 3GJ5A 1FQWA 5A3QA 2P9JA 5BT8A 1NX6A 4UBIA 4Z1MD 5BWMA 3TIFA 1ZN2A 4JK3A 1VQ9B 1WW2A 2O57A 2I9KA 5FJIA 4DCOA 4AZ3A 3LA6A 4ZYXA 3QOWA 4DE5A 4I55F 4AW9A 4GVPA 5T4FA 3WZLA 5LM3A 2H1CA 2NAFA 1Z5NA 3WGHA 4D9EA 5ARBA 3GVKA 3TQCA 1UBCA 4BS9A 3IXMA 1Z39A 2RCYA 3C6ZA 2ZJOA 5TDHA 1PTKA 2AYZA 2SKCA 3ZZMA 4QUEA 2YWBA 2JH9A 2IHYA 2PLNA 2NAPA 3PHJA 4F8EA 4M83A 2XKAA 2IBSA 2XITA 1JG7A 1PWHA 5DEIA 4XDHA 4KQHA 5DSZA 1FFHA 4D4JA 1DQZA 1GARA 1I5EA 1ISSA 3FCXA 1EWTA 2OTLB 1V0JA 3I5UA 1V8ZA 1FLDA 1Y7LA 1OU0A 3I8OA 4QOGA 1MH9A 3DJYA 4IDPA 4LECA 1NN1A 2F48A 2JFQA 2Q1XA 3IDSA 4LTMA 3BDVA 3DWGA 4NJOA 1HK7A 4P4TA 3BJRA 4DPKA 1EIWA 2V74B 4RVSA 4H35A 1P18A 1Q86D 2VDJA 1QUEA 3HJRA 4GPEA 1VHLA 3P0JA 4PTYA 5GAJA 3R44A 1O9BA 4KB5A 1XA4A 4RDJA 1RWKA 4H1WA 2ZJ6A 4ZIRB 4JODA 4YELA 2XNJA 3A04A 3NHSA 4ND5A 3OIYA 1TKCA 2W2KB 1EM6A 1T26A 1SU4A 4LFAB 4DN6A 3H3JA 1FTGA 5K3DA 2VAWA 2O3QA 3L49A 2Y1GA 3LV8A 1FU4A 2O23A 1XHFA 4U2EA 5CDYA 3G5MA 1JLLB 1E6KA 1Y8CA 3H0EA 2O1EA 3QP9A 4LUCA 2XCRB 1UH5A 4LF6B 1U99A 1SQ0A 3G05A 1T6NA 2B82A 4QU9A 4RD1A 1Q1BA 4FGWA 3C6XA 4LOJA 3HWRA 1GPKA 2H65A 2J5KA 3AESA 3CRMA 4FP9A 4KU4A 3FROA 3MTJA 5D5QA 1BGWA 2XGOA 3ROTA 1U8YA 1UKYA 2K87A 1NUSA 1LQ2A 1ZUHA 4FE3A 3ZD9A 2C29D 1AMOA 1E20A 2IDJA 2XYVA 4JBXA 3W06A 4GSYA 4AX8A 1Q0LA 5F4JA 3RYIB 2WSIA 2K2WA 1E9BA 2FFRA 2R00C 3ND6A 3Q87B 2V7GA 3DOCA 4X1OA 3THXA 3IDZA 4WK2B 3H17A 5BYBA 2C4HA 4QXAA 3WGJA 2OGUA 1N1EA 1TE2A 3OURA 4EHFA 2J46A 1CNFA 5B3LA 2B1IA 2CT8A 3CNQS 4OQDA 4BB6A 3P26A 4ZGNB 3HDJA 1VG9B 1LDEA 4II7A 4H4DA 1V6AA 1CIJA 2EKBA 1N6HA 3E35A 3D4BA 1NT2A 2EEZA 1XCLA 1A0OA 1OU4A 1Y6RA 2PJZA 1Z25A 1XFAA 2W2PA 2XMSA 5GPBA 4QJ4A 3SYTA 4BQEA 4LBZA 1JEYA 4YRRA 4LF9B 5I7AA 2PUTA 4QD3A 1A5TA 4BTEA 1K9VF 1T91A 3K31A 3MG9A 2GQFA 1G21E 1LJLA 3RV3A 1Q7GA 3DXFA 5D1HA 1JBEA 3OEHA 2MHCA 4AL4A 3C3WA 4HZUA 3ROEA 1WOOA 5C51B 1D6JA 1P4AA 2GCEA 3KS9A 3Q5EA 4P4SA 4TT8A 4G36A 4XQGA 3HYSA 5JI2E 3TLCA 1T3ZA 4A03A 3WHLA 4ZHQB 4P9NA 2BGNA 5BN5A 1J6UA 4D97A 3MYRA 1BA3A 5IH7A 1GN9A 2PNJA 3LSTA 4QQKA 1KE1A 3DVRX 3QVSA 4HCJA 4QUBA 4OL0A 5B4UA 2CZCA 3H9GA 4Z4EA 3ZY6A 1JSCA 3KYCB 4XWOA 3OCUA 5BV8A 3ABOB 3I73A 2YMMA 4UXHA 1RI5A 2C1EA 1M34A 4GOJA 2P9ZA 5JR3A 3HA7A 4UXJA 5KVVA 2J33A 2PL9A 2F55A 4AG3A 2HMVA 3DNPA 4IDFA 4BNDB 2VTBA 1E2LA 4GOLD 3WMEA 2LV8A 5CNIA 4PAAA 4B8YA 2AR9A 3L1KA 1R0WA 2NXEA 4XLTA 3KOUA 3O4GA 4RSMA 2QTWB 1HC7A 4ABYA 4ENVA 1ZEJA 4WZTA 4DLWA 4XUDA 3LNCA 2IUUA 2AX3A 2MSCB 3F6EX 4DLRA 4YRBA 2ZIEA 1T1SA 3BB1A 4AUNA 1SHTX 3LYLA 1GN8A 3PA6A 4F1WA 3I01A 4XTRA 4KWTA 1P3JA 5A5FA 3STTA 3D4PA 1KY2A 4YJ2F 2YC4C 5A3JA 4ZKEA 4ARAA 2XQIA 2J3KA 2QAGB 2W48A 3NDRA 3BQNB 3FNFA 5BNFA 1H5UA 1O6FA 1ULBA 4G0VA 5BN1A 5EFOA 2BGRA 1BVUA 1IUNA 1D8AA 1DC4A 3JQ9A 3JYNA 4L07A 1DBRA 3OFND 4RHEA 4TV8B 1EQAA 4KQFA 2RKOA 4KXMA 3KUXA 5K4GA 3GK3A 4EUFA 4LG1A 1M2EA 4GPTA 2NQTA 1CYEA 1YS6A 3OSUA 2F3SA 4U7FA 5K1ZA 2M32A 4X7DA 3LOPA 2DR0A 3MGAA 5M5BA 5DLQC 4MULA 3KIPA 4ZAZA 1POWA 2C4TA 4OXYA 4FN5A 2VT7A 1KQNA 3ZS8A 4ZC8A 5I3CA 2QRNA 4C30A 3EOZA 2BFBA 1ZCBA 4OF4A 1V39A 2YMQA 4PPNA 3ABRB 3JYOA 4IDCA 3VTZA 1VE7A 1LPPA 4JGIA 1KOGA 1SNYA 3TVYA 1HDIA 4NE7A 1NOIA 2GHQA 3IO5A 3PICA 3PQ7A 1Z4PX 3RRMA 1O97C 5JSFA 1BNCA 3LDGA 4YAKA 2OHXA 7ABPA 4CL2A 1RSZA 3R3YA 2IUFA 1K8RA 1QZXA 2GK4A 1XWIA 3ZCSA 3ZHRA 3AR5A 4QC2A 2F62A 5DNEA 3C3EA 2Z4SA 1AGPA 2PZBA 2CVOA 1T5IA 1XRSB 3IQWA 1QCZA 5CJ2A 2HJVA 3DE2X 2O2YA 3G79A 2IE0A 2QWXA 5A5EA 5ADVA 2FUEA 2HV9A 1GPDG 1K5PA 2WG2A 4PBSA 1MB9A 5EAIA 5JRDS 4EY8A 4UZEA 3LXMA 1U3CA 4P32A 3JU4A 2HA7A 3EK2A 2FHPA 4C7XA 1M8JA 3JV7A 4K6HA 1G20B 3C8DA 4I2NA 4URHA 5DHTA 5I7WA 2C7OA 3C48A 4HLUC 4HPWA 4S0XA 5CXUA 3IR7A 4Z4YA 3KK0A 4ZVUA 2VJJA 4S04A 1EFAA 1NIPA 3MF4A 2PKXA 4FYVA 3CGGA 5HP4A 3EMDA 2CJPA 1G4HA 2IYYA 3KWMA 4RD3A 1NYRA 5AVSA 1NJSA 4TYPA 3OCXA 5ECDA 2AG8A 3W1EA 1NN5A 2CNNA 5KHOC 2HSDA 2OG2A 3FCUB 2XSZD 1IBLB 2D4HA 3U0BA 1LS6A 3BXZA 2IYAA 5FI0B 1V0EA 1BMTA 5ITWA 2Y0PA 3CX3A 4HL6A 1FFYA 1TGVA 2XMZA 2NUTB 4CCYA 2IH4A 4S1VA 3P27A 1VECA 3JVVA 1AE1A 4OMDA 2ZFUA 3R0VA 4AVYA 4EBBA 2D59A 1P8AA 5J9FA 1PGOA 4Y9TA 5K3CA 4DLYA 1PJ4A 5D7BA 3RAEC 3KZXA 1RRFA 5ERGB 4I5IA 4ZAXA 1FRZA 1U4SA 3L0ZA 5EJ4A 5F2OA 3IOMA 3OIGA 1F3OA 4UQPA 2H6EA 5I3ZA 1DE0A 1UJNA 4O5AA 5ALYA 3QVTA 3HKEB 1J8QA 1DTSA 1E98A 2R8YA 5HZGA 1P2DA 1BX1A 2WABA 4R9VA 4O1HA 5AK5A 4EO4A 2NZ8A 1G98A 2GAOA 5HKLA 4GOKA 3OMXA 1A9XA 1PNRA 3J81k 5JNWA 4G1EB 1Z0UA 1SIOA 3VXKA 3L0PA 4UM5A 4M0FA 1JHUA 2QBYA 4INPA 4NVRA 4E4RA 3E8SA 1JZSA 2IU6A 2P6UA 3Q6RA 4K5QA 4N9WA 2BHTA 2VDNB 4HNVA 5JSUA 2BONA 3CW9A 1N2CA 1TEHA 5CFLA 4JLVA 3OY7A 3KDPA 4BKOA 1OH6A 2Z5GA 3G7SA 2WUEA 4C4AA 5CLIA 1ZR2A 4XKVA 3VR5D 3GVXA 1R16A 1M7GA 1DMRA 1YQDA 1E9RA 4PHHA 4YUVA 4EW3A 4CQNA 1E89A 1PI3A 2PGXA 3KSBC 4ZOCA 1V1MA 1UOOA 2BTQB 1DRVA 4HMOA 3DFFA 5H3CA 1GV1A 1UD6A 3ZY3A 4WJLA 1TPZA 1X7GA 1NUHA 4R05A 2ZAYA 1AA6A 1XN1A 4I9UA 4Y6QA 3ZQUA 3SM3A 3KWLA 1AQYA 1NBEA 2QQ5A 3KSRA 4JP1A 4MWOA 4QOFA 3AKYA 1GNLA 3BCFA 1WSWA 1MB0A 5C34B 4AQDA 5DM2A 3U60B 3CP8A 2GB4A 3BXPA 3DGEC 3I1FA 1LK7A 3WGLA 5KREA 3LTNC 4KNYA 2E5WA 1B14A 3INTA 1UD8A 2AXEA 2PWYA 2WUWE 5DEOA 4FK8A 3CCVB 1G2PA 1OFHA 1ZSYA 2QD4A 3ZXSA 2CK3D 1JLHA 2BFAA 3D4IA 4G5RA 2O9JA 1KEEB 1SHLA 3KHTA 1ZS9A 1TKAA 3N58A 4INJA 4NBTA 4UUQA 3KJHA 5KYTA 5AUOB 4ETNA 2ZL7A 4YMHA 5DXJA 5IRCD 4FX5A 2IU0A 3LGSA 2VQ6A 3T3GA 4AKEA 4KKTA 4FDTA 3ZU2A 4GBGA 4RORA 1LVGA 3Q0TA 4BAGA 2JRLA 4IZ6A 1Z68A 3PNLA 1H3EA 1E77A 1TI7A 1R12A 2M2IA 3FA2A 4KH1A 5DTEA 3QRWA 4CI9A 4TWBA 3C24A 3Q38A 2V8OA 3LF2A 4GSLA 2WTBA 1WB6A 3G2NA 3UBMA 2X19A 3WGGA 4PNEA 2HO4A 1SA0B 1IY0A 2BRUA 3GRRA 4LI3X 1JYSA 2I2CA 3FBGA 4MQ5A 4QATA 4F0JA 1TVCA 2RI1A 5KB3A 2Q3EA 4JDUA 2IYOA 5AVUA 2FQWA 1RWXA 3KKQA 2DBQA 1G8FA 2QLNA 2DPXA 5FOWA 1PVDA 1ZVJA 4G1CA 1HSOA 2C2YA 4RS4A 1RWBA 2I7XA 2W8ZA 3QOFA 3CNNA 3GP5A 4M0DA 5ITSA 3HA3A 4FKMA 3LYAA 4GDMA 2ZXIA 3BIJA 4BL5A 1Z8HA 2G5CA 2H2WA 3ROFA 4XWKA 5H4GA 1XTJA 4FJ0A 1XCJA 3V8VA 3W5AA 2CEAA 1PK7A 1CUHA 4M8KA 4PY2A 1FP6A 4KKVA 3C15C 3KB1A 2NNWB 2GJ4A 5DYTA 3RF6A 5I9NA 4DMKA 3M9WA 4JYBA 2OAGA 3EXFB 4I4TF 3QI2A 2QG9A 3FVVA 1Y4ZA 3NTOA 3F3MA 5AJUA 2I3ZA 1M33A 3ADKA 1J9EA 1T34A 3NHWA 5THQA 4B7AA 2NX2A 2XQJA 2G1UA 4BNLA 4ID3A 2REOA 2XIQA 2UZIR 1WU8A 1N5IA 4FQ8A 1Q92A 4NMXB 4PYNA 4CM8B 2OGZA 5JD5A 5EOVA 4ZO4A 3IIJA 3CUEF 1KAGA 4TWRA 2H2FA 3B38A 2IYZA 4MKZA 4IRMA 2FLWA 3V97A 1NV8A 5G1PA 4R8KA 1A88A 4LVCA 2AB0A 3EDCA 2OQ2A 5IU6A 1AM4D 1JTEA 5LOVF 1LK5A 1XROA 2AUTA 1H4QA 4XOTA 2HT6A 2ZAIA 4PRKA 2Y92A 3D3KA 4MIEA 4GLBA 3BJMA 4NAUA 2WLSA 4MKIA 4HPJB 2FG7C 1H0HA 3QLEA 3KYBA 1ZL2A 2G82A 2FY8A 1T1RA 4FMCF 5GJWC 3MJEA 1GL9B 2JFZA 3G2MA 7MHTA 4GXQA 3KL2A 3LQRA 2QRHA 3ED5A 5AVOA 4CMCA 3FKQA 4RH0A 4QBHA 4TMFA 2MSNA 2JCVA 1HQYE 1L4GA 4R2MA 2WJ3A 1RRGA 5EESA 3BMXA 2VJAA 1G38A 3EF3A 1WEKA 4IEEA 3D4OA 4DA9A 3P2KA 1LDNA 2OCYC 4ZZ3A 1QOQB 2I1VB 3R7NA 4G85A 4RF5A 4RDCA 4G37A 2BKAA 1UMBB 4NG4A 1GY8A 5E9JA 1Y8ZA 2I2XB 1JSRA 1YTLA 2X86A 5EVCA 5F77A 2FPIA 3QXSA 4UPVA 3TLMA 1CW2B 2G5GX 1T3GA 2JFGA 3EQZA 2AYYA 1Q7EA 3GJQA 3L01A 4P3XA 3COPA 3E2PA 3AM1A 2QA4B 1PTJC 1PKVA 3NM5A 1VQMB 1TT5B 2JGDB 3OF5A 5DWVA 4CQLB 4RHFA 2PKEA 1J07A 3WYGA 2RGYA 4HWTA 1S3SA 3BMNA 3FSGA 4RTMA 4LOHA 3CEJA 3T56B 2P5YA 4ZP1A 5BUZA 3PLRA 3VM6A 4IQGA 2DPLA 2FSGA 2DWQA 2OLJA 4G9BA 4XYGA 7ADHA 5A4KA 1U2EA 1XJ0A 4NR0A 5EZYB 3BH0A 3LZDA 1XZGA 4EYEA 2DF8A 3KSZO 3LAWA 1WZEA 4JELA 1R0LA 1NNSA 4PLGA 4QGGA 3H94A 2VLBA 3ASVA 4OHUA 2GD0A 3K96A 3F97A 2NZWA 2AV6A 3OCYA 5CW1A 5TX7A 4R1LA 2O8NA 2OOSA 3GVJA 5J47A 4Q1AA 4DIUA 1SKYB 1IXKA 3IAM1 1RU3A 3GA7A 1HEIA 3BJZA 3NGLA 3FJ1A 4LA4A 4EPTA 4D0GA 1X7YA 5IWAB 2Z1MA 1JU4A 2YOFA 2VPQA 3F46A 4B31A 3PXGA 1MVNA 2I2DA 3MPUA 3NHMA 2IU4A 4TKZA 1MQ8B 2E85A 4ZQFA 1YS4A 4LJ6A 4DNRB 4DDWA 4N0DA 3KV3O 3FMOB 4PQGA 4KQEA 5B7NA 3OEWA 4CKEA 1SKAA 3LUFA 3D0OA 4B40A 4MDEA 1HLPA 4DK0A 5EEHA 3UMCA 2MR5A 1R4NB 1W85B 3EFOB 3G8CA 1Z34A 4UMFA 4Z9YA 3WICA 4Y8VA 5AVKA 3UCXA 5LQRA 1MO6A 1IXSB 1R9NA 3BK2A 1O95D 4MTCA 4X6XA 4HNUA 3DBHA 5ELXA 4H7IA 2R6FA 4C0LA 1SBQA 2ZI7A 4C76A 3EQ2A 1M0WA 1T5LA 2ZAMA 2A0WA 2XTMA 3VH3A 1JIKA 4H4EA 3PGKA 5B58T 4X0CA 5JMWA 4F2WA 3NKFA 5JS7A 3HYLA 2WM2A 3C7TA 1CE8B 3OEEA 4OXIA 1M1UA 1XC7A 4CLOA 4GI5A 1AKNA 3LK6A 2IP1A 3PG5A 4ZAFA 3A9CA 4Q93A 5EXPA 5CA0B 1NUTA 3AVQA 1F60A 3ZC3A 1VQKB 1DIRA 3OP4A 1KDPA 3IRUA 4XM2A 4UM8B 4WINA 4P53A 1WOSA 3JQ8B 5LDHA 3INYA 3UQZA 4X60A 2DH6A 4WNCA 3CPWB 3VNRA 1WS6A 3JRXA 1T9BA 4RXMA 2QI9F 4NENB 2QOEA 3KJIA 3ENVA 3GPDG 3IXLA 4DMHA 2C8VA 4TLAA 3PKZA 4KMOA 4RKRA 3JRWA 4P2BA 5KAMA 4LFBB 4KSYA 1JKJB 4O33A 3QE2A 3KU4A 1R0XA 3FGNA 4XQCA 1XTQA 5BSRA 3TLXA 3TW8B 4BKUA 3B85A 4P92A 3GIWA 1BZYA 3I9FA 4GKBA 3WGVA 3LBYA 4HXFB 2GILA 1NYLA 4L8WB 1W59A 1OD6A 1NWCA 2I76A 2JJ1D 1UWCA 3HUTA 3LBFA 3O9VA 4GPD1 4Q1BA 4QEDA 3EIQA 2JLZA 5JASA 5F7XA 2A2ZA 3TZKA 2ZOSA 2ZPTX 4QYIB 2Z8ZA 3ITEA 4ZOQI 1TZ2A 1F48A 4G26A 2NYRA 2REBA 5E6TA 3TTYA 5E9AA 1KORA 3EXAA 3IKMB 2NVUB 4Y2JA 5KWSA 3UUEA 4H7DA 3SQDA 2RH4A 5ED0A 2CHUA 3RUDA 2HHCA 3ACCA 3DKPA 3KYDB 4XN0A 3L7IA 3QTBA 1CRZA 4J0CA 1VSTA 1NDHA 4LDZA 1L4NA 3JAMA 1E2MA 3P7MA 3OM9A 2V0CA 4JKYA 3TE6A 3O0DA 1BCRA 2GCOA 2AR7A 3QLVC 4QQFA 2M1ZA 4P0TA 3SXUA 3H8SA 2R79A 1SXJB 3PRYA 3OKCA 3PIIA 1JUDA 3T9AA 4Q0MA 4U7GA 3OX1A 2WF5A 3GJ7A 2ZBDA 1WBJB 2DWPA 1GTJ1 1E99A 1QGAA 2QTVA 3DUFA 1EP3B 2CNKA 4EDHA 4P12A 4CDGA 1E3LA 4KUGA 2MYUA 4EI7A 2YVAA 4R7TA 3GRUA 5JJCA 2KHZA 3MRSA 3FFTA 4MMYB 2VP4A 2VPPA 2WA2A 5IVDA 5LCXA 3V3TA 1OT3A 4MIKA 4PLYA 4XAQA 5CDHA 3CM0A 4BMOB 2I22A 5HF6A 5FWAA 4EA8A 3G9XA 3OOWA 3BF8A 3GLVA 2J30A 1V9LA 3QOYA 1U0GA 4AFNA 4DSOA 2I8LA 4F71A 2QAGC 4YBZA 1XLUA 4MP8A 5CB4A 1L8LA 2IIQA 3EGDB 3HSKA 4PG4A 5GZ6A 4TL6A 4PVCA 4HAUA 2X7JA 2W9XA 4M9QA 3JARA 1AQLA 1RLMA 4JP2A 3DTYA 2F3RA 3H1AA 3CCJB 4ZA2A 3MBIA 1E2EA 1T8YA 3G0DA 1GTMA 3EFEA 5DULA 1MABA 1UD3A 4PG7A 4YR7A 1E3TA 4QDUA 1DKUA 3KD2A 4WQMA 4A2CA 1XMPA 3TNLA 4ADSG 2NO9A 4HK4A 1Z29A 4EVRA 1OBCA 1TXGA 1CR6A 2P6OA 5I9SA 2FHSA 2FE4A 3I9JA 4WXEA 4E03A 3I55B 2R4UA 3OP1A 2AXPA 2V4DA 3T4XA 4TQUS 4W8HA 3A7DA 4RK5A 3TBHA 4GGMX 1XG5A 4UHFA 1NOJA 3V2HA 3B3QA 3RBVA 5MFZA 3V6MA 1IN8A 4GICA 4HLCA 3MNFA 2TSYB 4QUZA 2C5BA 1G8GA 1MQ9A 5CU7A 3RAGA 4Q21A 3O91A 3V2IA 2X0IA 1WCWA 4GGPA 4XPIB 3NCTA 3L6CA 1SB8A 2I4LA 2ATIA 1R9GA 1BQEA 2GN1A 4OHOA 4CM9A 1CQXA 1JI3A 5KYYB 1YRAA 2V7EA 3FW1A 2B8EA 2D5CA 3LP6A 3QXJA 2FRXA 4MRMB 1EEHA 4RV4A 3SHVA 5BUQA 5C8YF 2R84A 1QGED 4GX0A 2FP3A 1RRCA 3LG2A 3MT8A 4LNHA 4U2DA 1J23A 1KD1D 1D2EA 3VSAA 3NCHA 1KKMA 3AHGA 1TQ8A 2HRZA 4OV6B 2H07A 2V7BA 4ZANA 2F00A 3OETA 3U6BA 1M1KD 1RYFA 3KKLA 1UPUA 1GPYA 3N0WA 2QNBA 4ZZ2A 5K0NA 4NESA 4BHTA 1JQ5A 2FSIA 4EPRA 1E7MA 4ZHQF 1Y63A 2CF6A 4AJIA 5K0SA 5M2QA 3GCGA 2JEYA 3PNSA 2JFXA 2CJFA 3QW4B 4Y18A 1OBFO 5HA5A 2NU9B 1J00A 2ZBVA 2WSBA 3V7WA 4I50F 3WLMA 5EJ7A 2P0YA 2V6FA 1QCCA 1W25A 4GEKA 5HILA 4NQRA 3TMAA 4QBKA 2XNCA 1W88B 2CMFA 3AFGA 1G8AA 1OBHA 2G4VA 4Y1RA 5CLHA 5AI9A 1AHNA 4AIIA 5CK5A 4DG5A 2LDXA 3Q3JB 5KDOA 1KPIA 2RDMA 1HRKA 5IKEA 1XD8A 1P7VA 4R01A 1LZKA 2YWXA 2P2NA 1XXHB 5FOTA 4P5EA 1VL2A 3AFHA 1RC0A 2WPNA 1ULHA 2GF9A 3BA6A 1GTZA 2BKVA 1JPNA 1SXJE 4LDQA 5DV9A 5LA6A 3T54A 2UUOA 2FEMA 4ZYVA 4Z4GA 3ZWYA 2PX8A 3VJLA 3BS4A 1K4KA 1NMYA 5D01A 3PA8A 1YQWA 2I1LA 2OFWA 3BE8A 3IQGX 2J6HA 3PQ3A 3K2BA 3EIUA 1WSVA 2J1LA 2EW8A 3EZ2A 3PHLA 1QDEA 5JVDA 1O0BA 3CCMB 1L5ZA 1C3XA 1Z2NX 3RS2A 4B6RA 1C1HA 1A27A 3A9SA 3C43A 3WL8A 1DRUA 3OT5A 1PWEA 3WLNA 4ARZA 4EIWA 1YRYE 1IM2A 1ZI8A 2NZYA 2ZJFA 5EPUA 1SOWA 3ZN2A 1EAMA 4JJAA 4M53A 3GB9A 4ROSA 5ITZA 3UA3A 3M6VA 1T5TA 1AQJA 4Z53A 5FR1A 4DQUA 2A84A 2AXNA 3HZZA 4KQCA 1E69A 1T8PA 1QXSA 4QFCA 3GFTA 4JIMA 2IPXA 4TTIA 3REQB 3W77A 1QTNA 2B8JA 2IIVA 2O07A 2H29A 3KFLA 3Q6NA 4YXWA 2FPSA 3DE0X 3RVJA 3X0DA 2B1GA 3EXEB 4AWAA 1B76A 1JJBA 1OAOC 5HG0A 3GPIA 4ZYWA 4EY4A 3I05A 3GLUA 1TKRA 2ZT8A 1WW3A 4E46A 3EGOA 5CHEA 2IHNA 4AT1A 4LK2A 5FA6A 1GZ4A 2F1JA 4D79A 3RNLA 2Q4RA 2CSXA 1N6NA 1K7YA 1ZUNA 3JSAA 3MS4A 4ZQIA 3BRSA 4TMKA 4ZN6A 1ZWLA 3K4HA 3C74A 3GGGA 3QWHA 4YA6A 4EA6A 1YVDA 2I99A 3ON5A 2PZGA 3ER8A 4TKMA 1JR4A 4WN9B 3T7KA 2JCXA 1NVEA 1WZIA 1D04A 2V9PA 3DE1X 1XDSA 2QRPA 5HBGA 3D1VA 2Q3HA 2P6PA 3H4MA 1JIXA 1QNFA 4MRRA 4YO8A 3SLKA 3UXMA 3ZCQA 2I62A 4MGEA 5A2GA 1YJCA 3GP3A 2CXSA 3C7AA 3ICVA 1D4FA 1N0UA 4YCCA 1P1BA 2JHFA 4ZDKA 2UYGA 3OWHA 4LVNA 4LXHA 3OEYA 1S8AA 3CXUA 4OUDA 2R6R1 4ZVOA 1E59A 2WLTA 4QLBA 5HM6A 1EVEA 1SVKA 4ZREA 5F64A 1AKMA 5D51S 1LNQA 4O4JB 3P9IA 3LZCA 3JTEA 3QJ5A 2BCEA 4F46A 4TYWA 1H6AA 2N1MA 2GOYA 2HBRA 4FLEA 3CE6A 1A4RA 3PQ6A 4O59O 4RQTA 3NVKI 4K0KB 1W5TA 1YBVA 3AR3A 3HACA 1KGSA 4HDMA 3BK1A 3L8EA 1DBIA 1KAQA 3OF3A 4M60A 4YQZA 2VJCA 4TUYB 1X3SA 5JU6A 3PZRA 4WOJA 4QJ5A 5LMCA 1QQ6A 5GVSA 4NARA 3F7TA 5DIFA 3ZU3A 3SMVA 1F2UB 1PE0A 2HSGA 4LJLA 1JNYA 5IZCA 1O6ZA 1XQ6A 2Y0BA 4GMXA 5K0FA 4MICA 4KXNA 3B1YA 3MQFA 4IF4A 1JFSA 3F98A 3AR6A 1X94A 3OIDA 3ZXIA 4DXHA 2JDID 4WX2B 1SURA 3B13B 3OBIA 4R1QA 4NDAA 5EN4A 3JZAA 5HM8A 1GCAA 3MYYA 2TMDA 3EXIB 4REQA 4CU5A 2X3YA 1FXUA 3AQIA 1WB4A 1ECFA 4EGAA 3GC6A 4AS1A 3DFKA 4HFMA 1PR5A 3VR6A 2IH5A 3GFPA 2R48A 2QX9A 3L7JA 3SY8A 3PITA 4ID9A 2GM4A 4UCWA 2ZCJA 3CWCA 1HM5A 1EQ2A 4AROA 4PE5B 2WIGA 4QEKA 2D00A 3U62A 2O2HA 1F6DA 4AAYA 3LQ6A 1STOA 3A3NA 5HOQA 2XJ9A 1QZUA 4F6RB 3DT9A 5K2OA 1OLSA 4J6FA 5KTMA 1OI2A 3NNDA 3ZIDA 1M8GA 2ZSKA 1YB6A 2D1QA 4QV2A 2PX5A 4RE6A 4A2PA 3DXXA 2P2SA 1G3MA 5ILQA 4A92A 1KDOA 4UAJA 2Z43A 1OYVA 2XUJA 4XGRA 5IJZA 5JCJA 2VNJA 4I5DA 5EYPB 3Q0EA 4OJQA 5E7JA 1MJGM 3R0QA 1WXGA 5B1HA 2Q07A 2PMBA 4ALKA 2SKDA 1PD1A 1AKYA 1O94C 1HYGA 2EFDB 3MFYA 5ALZA 2NTYC 5K3SA 3H97A 1Z36A 1Z7WA 2R8PA 3Q9LA 5KO2A 3VX3A 3I5YA 2G0NA 3QPAA 2J6CA 1Z0KA 4X8MA 4ATNA 2QUIA 3FPPA 1JEDA 4JA0A 4B48A 1XYYA 1WPGA 3KXLA 2I6SA 4L3OA 3QBDA 4P58A 2QTRA 1Y7PA 3QVVA 2HK9A 3E9CA 3D81A 3VPBA 3WJ2A 4WBNF 1H8EA 1XLVA 4IJKA 2R1TB 3NTXA 1UMCA 3KUUA 4B2PA 1QGDA 5FWNA 3O3OB 1U2GC 3S1AA 1LV7A 4JJ7A 1RPZA 4IVPA 4PLCA 1A7AA 4XIIA 3RHTA 4ND4A 3KALA 4KXLA 2B99A 1DV2A 4F38A 5LC1A 3PHHA 3DEJA 5JPIA 3ZWKA 5KPDA 3AHIA 1VLZA 2QUJA 3O4IA 4RV9A 3BKWA 1PR3A 3U3OA 1XZCA 4FJ1A 3SFTA 3ILYA 5IF9A 3KQTA 3TEJA 2LUOA 2PH1A 3OX3A 2OO3A 5REQA 4IXNA 1OV4A 1S3GA 5HZAA 1KP3A 1KY4A 4D6XA 1C0KA 2WAOA 3H0CA 4G65A 2UZAA 13PKA 2VP6A 2YCLA 4K9KA 4WZAA 3T1OA 3QX3A 5KYGA 4HNSA 4IIUA 2X5KO 1N9GA 4QHYA 1CY2A 4J7CA 3TZHA 2VRNA 4MR8A 1ODFA 1ZONA 4MMXB 2AFHA 3T5DA 2E1RA 3OM0A 4CG0A 3BIXA 4PQEA 3DHYA 4AF8A 2YYZA 1CVRA 4J0KA 4PHFA 3RJTA 3UGKA 3U7HB 4TVBA 5KNCD 3B1ZA 3W4IA 3IRVA 2P9EA 3CVUA 4DAEA 4Q9DA 2D1RA 5FLEX 2YY6A 5DCUA 4UOEA 2XLCA 3URKA 2GF0A 4FFMA 1AHIA 2GPBA 4JGGA 4MMZB 3GEEA 3IV9A 4Z4UA 1ORVA 3EBPA 4KJXA 2X4GA 5KJCA 2ZM6B 3DVAB 4JB8A 1AB6A 2UAGA 4R1SA 4XNFA 5J43A 2PK3A 1KWKA 1XAJA 5A7GA 1A7UA 3KUCA 3N70A 1DXOA 4NMWA 6CHYA 4OFBA 2XYGA 5A05A 3KP1A 3NJ4A 1L7PA 4BP1A 3AERB 3IT1A 4RGYA 5FV4A 3WA7A 3ZGZA 2AKYA 2AG1A 4QPNA 3HKDB 3BRWD 1KKLA 4WNAA 5EI5A 3BSYA 2UUBB 1NI3A 1VQ6B 1KI8A 4EJ0A 3K5WA 2XTZA 3KTOA 4G8BA 4EKIA 4U2BA 1B43A 4KAJA 1UJ2A 4QARA 3S40A 1CR4A 2D0PB 2DFDA 3IUJA 3UA4A 1W87A 2F59A 4X7BA 5FOUA 3K1ZA 1HSZA 5ER6A 4S1OA 1XVTA 3JPWA 2YICA 1DCFA 1WCIB 3L0BA 3MLEA 4XKJA 1RDFA 2FEXA 1QFSA 3ILHA 4LYFA 1AX9A 1DBPA 4RM2A 4EUNA 2WKQA 3DZCA 3N7UA 3MRTA 1VYUA 1R18A 4U4AA 3KOMA 4W5HA 3N8IA 1F5NA 3GJ6A 1PBNA 1M66A 4JB2A 3ZE8A 2WNSA 2X5JO 3C14C 4HX5A 2EX1A 4BRUA 3WX0A 3AEYA 3AO0B 4DG8A 2X53S 2JA2A 1YQEA 3CNBA 1JAYA 4N65A 4TQAA 3WBBA 2BTEA 3C7CB 4JBYA 4NV0A 3SKBA 4Z7OB 5GINE 1KYTA 1U1FA 2J0UA 1MG0A 2WPDA 1RCFA 2R8OA 2PKCA 2G83A 2WC1A 3B5IA 3DO5A 2PL5A 1NY6A 3FWKA 3OE4A 4M1OA 4ZV9A 5HRCA 3IQDB 4B3SB 3BZBA 1ELOA 1Z56C 2MINA 5ICSA 1V7PC 3RVBA 4N8EA 3GO4A 4OX9B 2JCSA 4EF6A 3I72A 4M0MA 1G0OA 2EXXA 5AH0A 4EVIA 5CDTA 3TB6A 1AZTA 4OHYA 5C8ZA 1IJFA 2AJCA 3A4NA 2ZSFA 1IZ8A 2FN7A 3LUCA 2HLPA 5CRIA 4N48A 1XEWX 2HA6A 5J2UB 3ZWBA 1J1UA 2GJ9A 1QOPB 4HFRA 1NT4A 1LVHA 4DVGA 1VE5A 1PR2A 4KN5A 4LYAA 3ZWOA 1N1MA 3WGUA 1YL5A 4U8HA 2P9HA 1R6AA 2ZS8A 2HKIA 2PHZA 3K35A 5EZYF 1JVBA 4P2NA 3D9QX 3RS0A 1GIAA 2FMUA 1AZLA 5EGSA 1SXJC 5J5CA 1MX5A 3SHOA 3BBLA 4XX1A 1H0RA 1LLQA 4EL5A 3IEXA 1TEXA 4Q7KA 3UPDA 4C4PA 1O7JA 5KTTA 1SOMA 1X86B 5EQTA 4R2LA 2X14A 3L1HA 2X6RA 3L1UA 3RM3A 3GLIA 4C7OB 3M4XA 3SP1A 3GBVA 4JLSA 2WM3A 1BDHA 1KYYA 4RF2A 3TRFA 3HSYA 1VBFA 1AN0A 1E5TA 3FYSA 2QMZA 2DCMA 3GUCA 3JSXA 5C0OE 4BJHB 3OUTA 2EL9A 3HCEA 4FFVA 3FPGA 2JN9A 3EMKA 3ESYA 5G2OA 5C8DA 4XQ9A 3SC2B 3R7BA 1EDOA 4QU0A 3TCXB 5IYWA 3UMRA 5AQ1A 5LZ4A 4A1OA 3C1AA 4UFNA 3HLKA 3OKPA 4LWOA 3ERCA 2HRQA 2O14A 4X63A 4ZXPA 1YF3A 5E6UB 2ZM5A 1AV7A 3FMIA 4TWZA 4RVOA 4BO2A 2G72A 3OPMA 1F7UA 3P96A 4MDHA 1PWYE 4KK3A 1MP0A 1UWLA 1VPDA 1YR9A 5GWXA 1CB7A 4DJDC 4WESB 3G1WA 3SZLA 1TCVA 2W6ZA 1OXUA 2OR3A 1Y6FA 2OAP1 2XXJA 2B4YA 5HWSA 1MIOB 4FHEA 4LGMA 2GRJA 1U6JA 1YNSA 2ZIXA 2R5NA 3AEQA 2OPBA 2XMGA 4PXAA 3TI9A 2PMDA 3FDZA 3RI3A 1R8XA 3HO8A 1CS4C 5L46A 1UKCA 2QJWA 3T1TA 2GK6A 1DAGA 5JSZA 1HDYA 3HU2A 3OC0A 3JATB 4ZWNA 3CUWA 2WAMA 1H1LB 3PV0A 2C7RA 3SG0A 4HVLA 4BYMA 1CJMA 3WIVA 2YOHA 4Z99A 2JGEA 2K5UA 4DM3A 3OCVA 2BEUB 1SR8A 2JJ2A 3ONEA 4NMLA 2Z6UA 1F9AA 3MTIA 4JFRA 5EQJB 3CUTA 3NETA 4KZPA 5TARA 2Z3VA 4M0LA 4AUEA 1YMVA 2FSFA 3OESA 4EQ6A 3ZVMA 3V4FA 3E18A 2A0FA 3MOIA 1HFEL 5HMMA 1EB9A 2FPPA 3TLYA 2PVSA 4JLDA 2A67A 1DJOA 1PX0A 3KJXA 3T7RA 4IEIA 1IY9A 5ED4A 1T35A 4B17A 1NE2A 1I3CA 4HYQA 4P8RA 3RK1A 3TDMA 3WWEA 4U63A 2OBTA 3VU8A 3FIUA 2HLDD 3PQ2A 2LCIA 4HNAA 3ZDZB 4EHKA 1QAMA 3OPYA 4Z9FA 2FEOA 2PGDA 4F3YA 1RBQA 2CD7A 2ZI5A 3F2VA 3I04M 5K0TA 2J3IA 1FUIA 2C0QA 3P2JA 4X8IA 3FLEA 2D7JA 4FONA 3DDSA 3UT0A 3KLOA 1SC1A 1WHTA 3ETNA 4XR4A 3HNPA 5H3HA 4LN1A 4O2AF 4A5OA 4E21A 3EAGA 3KR9A 4LYHA 2I03A 5B1YA 2FEPA 4NFYA 5EP3A 1FNCA 1O6GA 1YWGO 5L3QA 4KREA 2K6GA 3DMRA