1EWYA

Anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
303
structure length
303
Chain Sequence
TQAKAKHADVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title Crystallographic studies of the interaction between the ferredoxin-NADP+ reductase and ferredoxin from the cyanobacterium Anabaena: looking for the elusive ferredoxin molecule.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 77
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2000-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ewyA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1ewyA02
2DETA 4B43A 3P26A 1ZM3A 3CCQB 3B78A 3WYAA 1DG1G 3QSYA 3QFTA 4G1BA 1Q82D 4H9GA 1A8PA 4F7DA 1BQEA 2DEUA 2BF4A 4M53A 1BX1A 4PGOA 3V76A 3LO8A 3U6KA 1XE1A 3CC2B 5JBQA 1OB5A 3AVTA 1D1NA 1H42A 1D8TA 1BJKA 4Y9RA 4B4DA 1AIPA 3WXMA 3CXCB 2HCJB 4N3NA 1N0VC 2BM1A 1KK2A 1IJEA 3OW2B 1YIJB 1VQNB 4TMVA 1QGAA 1HA3A 1EFUA 4RD1A 3LRXA 1GAWA 4PC7A 2X3UA 2EIXA 4J0QA 2YWGA 1GJRA 3ZZTA 3P27A 1DARA 1W34A 4QHYA 2NPFA 4P3YA 4U9UA 4FN5A 5HXBA 1G7CA 4C43A 1F60A 3AVYA 3OJWA 4ZCIA 2QTZA 1U2RA 3G71B 3G6EB 4PC6A 1BX0A 1R5BA 4LC0A 3WNDA 1YJ9B 1G7RA 4RCYA 3SJZA 4ACBA 1YITB 3A1FA 3CCLB 1KK0A 3AVXA 1S72B 4MYUA 4ZV4A 1OB2A 5FA6A 2FX3A 1CNFA 2B7CA 3CCJB 4P6VF 1VQ7B 4DQLA 1E63A 1FDRA 3JQRA 4HE6A 1S0UA 4LBYA 2BM0A 1KK1A 1B2RA 1IB0A 4YAFA 3I55B 2OK8A 1WDTA 3OJXA 3ZZUA 1E62A 2OTJB 1G7TA 1ZUNB 3MCAA 1EP1B 1NJID 2VNKA 3CMEB 1QGZA 1K73D 3WY9A 4DQKA 3QFRA 3CRZA 1Q86D 4QFMA 1VQ9B 1KJZA 2BGJA 2VYQA 1FRQA 2YWHA 5H59A 4PC3A 3G4SB 4UAJA 4B44A 1YJWB 1JA0A 4LBZA 2BGIA 4B47A 2VZLA 4K1XA 1EFTA 4FK8A 4R71A 2B5OA 2YWEA 5H5JA 1TLLA 2XEXA 4LBVA 2D74A 1D2EA 2BV3A 4RD0A 2QTLA 4YAWA 1NDHA 3E1YE 3AGPA 1M90D 1UMKA 1KK3A 4Y9UA 3JQPA 5GV7A 1JJ2B 3W2GA 5EMNA 1QUEA 4G1VA 4M1KA 1N8RD 4ZGNB 1Q81D 3FJOA 1QFZA 1XB2A 1ELOA 4TMZA 5DSZA 1K9MD 1DDIA 1FNCA 5TY0A 1FNMA 3AVWA 1CQXA 3VO2A 2QDXA 4ZGQB 3JQQA 2CNDA 3WBJA 3CCUB 5THXA 1G7SA 1VQMB 1QH0A 3MHPA 4PC2A 1B23P 1AMOA 4RD6A 1I7PA 4PC1A 3AGQA 2DERA 5KSWB 4C0SA 1FRNA 2ZITA 1J9ZA 1K8AD 4YAOA 3WNCA 4EH1A 3U2QA 4NBSA 1VQ8B 3W2EA 1CNEA 3I56B 1FNDA 2GPJA 3AVVA 1QVFB 1KQSB 1GO2A 3CPWB 4IW3B 4G5GA 4TMTA 1SKQA 4M2LA 2R6HA 1EFCA 1FNBA 3E20A 1QGYA 3I1FA 2XNJA 4Y7CA 2PIAA 3VNUA 3OZVA 1QFJA 3CW2A 3CCRB 1QUFA 3MMPA 3LYUA 5TV2A 1QFYA 3ES9A 1N0UA 1KD1D 3WNBA 3CCEB 4Q7JB 3B82A 1ZM9A 3W2FA 4AC9A 3CCVB 3B8HA 3QE2A 3W2HA 2VNHA 1W2BB 2DY1A 3CCSB 3CC7B 2RC6A 1VQKB 1SM4A 4NCNA 1Q7YD 3J81k 4YHBA 2QN6A 2C78A 1EP2B 1JNYA 3CMAB 1ZM4A 1VQOB 1QVGB 4M4SA 1OGIA 3VO1A 5TR9A 4YAUA 4WQMA 3ZC3A 2PLFA 3CC4B 4RJLA 1QX4A 2AHOA 2HDNB 4HE5A 2VNJA 3W5VA 1IJFA 1YJNB 3PENA 1VQPB 2VNIA 1VQLB 4AF7A 1KTVA 2BMWA 3CD6B 2RC5A 2CRVA 4ZCMA 4B3XA 4B48A 1YI2B 1JA1A 4ZCLA 1VQ5B 2PMDA 1W35A 2BPOA 2OTLB 2B7BA 1OGJA 2C77A 4RD4A 3VMFA 1EP3B 3AVUA 3QFSA 1EXMA 3QFCA 1GR1A 1QG0A 4MYTA 3CB4A 1E64A 4TMWA 1TVCA 1KRHA 4TN1A 2E1RA 1VQ6B 1R5NA 2GQFA 2QMUA 1JB9A 3OZWA 4ACAA 5AN9A 1EWYA 4YALA 1H85A 2BSAA 1YHQB 3WBKA 1GAQA 2XNCA 4N3GA 4FWTA 1KC8D 1VQ4B 3ZZ0A 3CCMB 4M0LA 3FPKA 3ZBTA 3VNVA 1TTTA 1R5OA 4AF6A 4RCZA 4TMXA 1DDGA 3LVBA 4RD3A 2EFGA 3ZBUA 3W5HA 4RD2A 1GVHA 3W5UA 2HMAA 1F20A 2J7KA 1M1KD 2YWFA 3W2IA 2QEXB 2OK7A 1TUIA 4BPRA 2DCUA 1ZM2A 2QA4B 3U6BA 2BVNA 3OZUA 5GV8A 1W87A 4LBWA 2BN4A
chains in the Genus database with same CATH superfamily
2VHTA 5L3ZA 3L0YA 5AVRA 1WDKA 1K63A 3WGYA 4ANFA 2HKIA 1GCAA 4JLBA 4R1PA 3RAPR 5AVYA 3DJYA 1Z15A 1O95A 2QM7A 2C7RA 4FZRA 1I3LA 3SICE 1V8FA 2A57A 4WAUA 1YKGA 2X2OA 2Z04A 4MUHA 4K2HA 4QAQA 4H9GA 4R1LA 2CB0A 1A8PA 2H4WA 4QUZA 2YH2A 4I5IA 5IJAA 3VZCA 4UOQA 2A5LA 2O2IA 4K9QA 3UJ7A 2REQB 3WRXC 4MB2A 2LPMA 3PGKA 2VXYA 5ENDA 3ZZ1A 2NUTA 3AZQA 4O0MA 2HA2A 3LHIA 3ROMA 3TN7A 1C2TA 2HSZA 2OCYC 2PUFA 2VTEA 4PONA 2O4UX 2OBMA 3DMPA 1CY1A 1G17A 1M1ZA 3E9RA 3PA6A 2OSBA 1PZEA 1ZCFA 2IHNA 5AESA 2D1YA 3U6KA 1TYEB 4XWGA 2ASEA 4CKYA 1PDVA 1U0JA 3A3KA 3MQ2A 4OY3A 1CG6A 4YC7A 1HYEA 1PT8A 1V6AA 2P6NA 3R5HA 4M46A 3GMSA 1KE2A 4E22A 3CC2B 1QG6A 2X40A 3GMTA 5K8UA 1XNJA 3V4SA 4HVAA 5AK6A 4BP1A 3CZMA 1GCIA 3PDHA 5JO0A 3HB7A 3BMCA 3ANTA 4EF4A 1KMHB 2B1JA 2XQVA 4BTEA 4IV8A 2HU8A 2X8WA 4H7KA 1SBCA 5JY6A 4RTQA 1UODA 4A8JC 1KRWA 3PJDA 4ETMA 1RWPA 1UPTA 5B5SA 3NAMA 4Q7EA 3G0GA 5CA1B 3ZLJA 5ALQA 3UH1A 1JEJA 4J90A 5ALRA 4O4IB 1EFRA 1DG3A 2Q3DA 3VPSA 2Z6AA 3PEEA 1KI2A 1XEWY 1V4VA 3SHFA 5AM0A 3A6LA 1XHLA 3A9RA 2O7SA 3VYSB 4OF4A 5IUKC 4DIKA 3QX7A 4FKBA 4UULA 3I76A 3LIPA 4ZVVA 2JFFA 3TAHA 2JI6A 5BSMA 3PR2B 1K9VF 3VZQA 4RZQA 5EMLA 2ZJ2A 2ZJAA 2JJ1A 1P0FA 3JTEA 3VU1A 2VRCA 3PITA 4U9UA 2IXEA 5DM0A 4C2AA 1R4AA 4KPFC 2ZK7A 1PNQA 4EHNA 2RIRA 4KBGA 5BUSA 4HQ0A 4NV1A 1ZD8A 1TI7A 1DBVO 1M0TA 1ZCBA 2DPYA 2ZSJA 3L0DA 3X0DA 4LI3X 3R0QA 4F4CA 3D5EA 3GNTA 2YWBA 2VO1A 2I2XB 1XYVA 1R18A 3BJMA 3ETNA 3SE0A 1AGYA 3G71B 2HN9A 3B89A 4NBTA 5DI9A 3AJRA 4NJEA 2B9VA 5JWOA 2ZJ6A 3WDLA 3UYLA 2YRXA 2NQ8A 3TFOA 1SN7A 1DTEA 2WM8A 5FJIA 3LPAA 1KJNA 3D31A 3TLJA 4RCYA 2DUWA 4HDSB 1JWAB 4Q0MA 3RIXA 2GEKA 3T7TA 5LDGA 2X76A 1LLDA 5ICMA 1DO8A 5J47A 3LE8A 2EP5A 3UPTA 1OB2A 2QVCA 1WCIB 2QNBA 1WDWB 3F78A 3FDJA 4O8CA 3F73A 2HPAA 3I9LA 5IK2A 1IUPA 2BD0A 2WYVA 1QMPA 4C0KA 5ECDA 3DAGA 2R2AA 3KSMA 3QG5A 3UPDA 2ZBGA 3CTAA 1P9LA 2RGBA 5EE0A 3GCWA 1O6FA 5KWSA 5JVDA 3EXAA 2FEOA 1PZHA 3DHWC 2V58A 1NVVR 4FR2A 1DAFA 1N2CE 3A1WA 3KFLA 4WFQA 5B3JA 3VDNB 3WADA 4EI9A 4L95C 4Z0HO 4RJ2A 3WGHA 1B2RA 2ZRFA 2GEBA 4N3CA 5F4BA 2NU8B 3HN7A 4YRTA 4R9UC 3FCAA 2CUNA 1TJPB 3KUCA 2EFCB 4XTCS 1UK8A 2QAGC 2FR8A 2HNBA 3ULKA 2GBIA 5HM8A 5KREA 4OI2A 3SYTA 4AMYA 3RU9A 1OZFA 1YVUA 4B81A 4CM1A 2PKQP 4KLAA 1FJGB 1O0CA 1LNSA 2DYKA 4I55B 3IHTA 2V7PA 4OGFA 2GAIA 2Q28A 1JT2A 2VLIA 3CLSC 4H1TA 4M0KA 2JBWA 4YR7A 3MXTA 3WS7A 4C21A 3H8SA 4RC9A 4DWJA 4R7GA 3HU1A 4OHZA 3WK5A 1NXPA 1HH4A 3KB6A 5DHUA 1HI9A 1AS0A 1FVFA 2V96A 1H93A 1RDFA 1UWLA 3GRKA 2QRLA 3O8RA 3FCSB 3UNXA 2OAEA 5DBGA 5DNUA 2V0NA 1KJZA 4K88A 4PYNA 3SD7A 5LOVF 1JHDA 1JFTA 2PGAA 1LY1A 1DUIA 3JV7A 2DJIA 4H1UA 1PDWA 1VFNA 3FCOA 4WGGA 5LUBA 3ZHQA 1RT9A 1OX4A 1IIBA 1YDHA 1VYVA 2OGUA 4HDKA 4D99A 3LT2A 3B52X 1J23A 4PPGA 4BAUA 3G2KA 1XKXA 3GIDA 821PA 1TGVA 4EM6A 2WKPA 4FEEA 2O14A 1DRWA 2GPNA 2CLSA 4U7GA 4HQRA 4LBZA 2C5AA 3DBHA 5DGXA 5BSGA 5ESXA 5FPHA 2ZUTA 4BFSA 4HYYA 4B3JA 1I0IA 3C3AA 1FSPA 1QF7A 2CZCA 3SJAA 1C41A 3EGDA 4ZKDA 4J03A 1DKUA 1Z29A 1R5JA 2H8KA 4H7EA 4PE5B 4KR3A 4OM8A 3IOBA 3R4VA 1SKBA 2NUPB 3B7GA 4D0SA 1M34E 3TLBA 3GEGA 3PFKA 4Q1VA 3L07A 2GLTA 4BV8A 3F6EX 3NWOA 3NJ8A 4CCSA 4EHKA 4L4SA 1N06A 3HO1A 3K0FA 5D01A 2A1IA 3LQQA 1SVMA 3PFGA 3D7NA 3DWEX 4I50A 2ZB3A 1DIHA 4INZA 4OD0A 2UYQA 3SM9A 4HFJA 2QUIA 1C7JA 4XUEA 4HAOA 4OOFA 3B3GA 4B6GA 4ZO7A 2IZOA 3LFTA 1KJYA 4JELA 3VO8A 4OAQA 1YB7A 3MUNA 3RJMA 4Y1EA 2D74A 3OOSA 1U2TA 1Y7IA 1BQ4A 2BV3A 3LX4A 3QM1A 5ALSA 4ZVRA 2VK4A 5DLPA 4WXRA 3VC2A 4JHLA 2FEAA 3LSYA 4L3WA 2JAPA 2E1PA 3DBLA 5DBHX 3AJEA 4RGQA 1E2MA 1M74A 2BCJQ 5B58T 4JSYA 3WWYA 4F91B 1E2BA 2CVFA 3OFSA 2YN0A 4X85A 1P6XA 4DA8A 1C14A 1E0KA 4HGPA 5CLQA 1Q14A 3GFBA 3UATA 4N8SA 2ZUFA 1XPOA 1Y6JA 1Y8QB 4BNFA 1QUEA 1DV2A 1XRRA 2IYUA 3DZ8A 3G6KA 4BBZA 2IHYA 1H05A 2VF8A 4ZANA 2CKDA 3TZEA 1EGMB 5FWXA 4CEIA 1SBIA 1TQ4A 3LC1O 2IUYA 4DV4B 3L8ZA 4TL8A 1KGDA 3DZFA 3T5DA 5HSGA 1FMLA 1L4BA 3A7EA 2VP9A 5ALDA 1SA0B 3DNFA 4E2YA 1JVSA 1NBAA 1UFOA 1EUCA 1Z8FA 1KI8A 1XDWA 2YQZA 4RELA 1KOGA 1YRHA 3HSKA 3C3BA 3JYOA 4EA7A 1K97A 2GVZC 3R6GA 1RE1A 3IAXA 4JZYA 3GIWA 3OX4A 8ABPA 1YI0A 3PJEA 1XD2A 3C5EA 4GLLA 3HU3A 4JQZA 3VOTA 2X8JB 1CUUA 2VXCA 1GQRA 4JJZA 4N6OA 4L9SA 5K0NA 4OXKA 1SRRA 3F5QA 1WXGA 4AU1A 1CD5A 2L17A 4IQ0A 5HS4A 5K0CA 2QDXA 2HLNA 4O4LA 4X0EA 3BWCA 3T5BA 3EH1A 3HMKA 5JH7A 2GBPA 2VT3A 3OT1B 4CLEA 1INLA 1FJ2A 3VZRA 3EVNA 4KV9A 2Q3BA 3G2MA 3N3BC 5BY2A 4KX5A 4DB2A 4R9SA 2X22A 3MWLA 4D8YA 1OFIA 3DT6A 4C5CA 4NS1A 2MOKA 5AI0A 3AI7A 3T9EA 1QTIA 5J35A 2PANA 2ROQA 4V39A 1X9HA 3F1LA 1GG2A 2C83A 3FFWA 3HA5A 3P2KA 2B35A 4CCAA 1H8HA 2OPBA 2ZUWA 4UHKA 4A0HA 3CESA 5THQA 3ZHZA 3FMVA 2F8MA 2Q2WA 3QWFA 1DOAA 2VYND 2Z1MA 4YGYA 4ZT4A 3RRZA 4Z4IA 1MJGM 3DBVO 4KR9A 1ZHOA 5JANA 4PSDA 4K46A 1UH5A 4QTUB 4RENA 4TRRA 3EPPA 3RWOA 1T2VA 4OGWA 5EJEA 2XRZA 3O4FA 3H11B 4OHPA 3D8UA 1VMIA 1QZTA 1YOVA 2JGIA 3OQIA 3ZVRA 3UFXA 4F7WA 2CW5A 3EXFA 4LXUA 4B6OA 4DGSA 2JVKA 4LDPA 4FBLA 4QO7A 4CKZA 1E2HA 4K8OA 2K87A 1UK9A 3VOBA 3SVZA 2Q0XA 4I2VA 1JHYA 2V4ZA 4CUZA 2O8FA 3EIUA 1YT5A 4GGPA 1IHPA 2IHZA 1QUFA 1MB2A 4P31A 3RIHA 2WMOB 3R3UA 4PYLA 4L50A 2VDLB 1L3BA 5HCNA 1QFYA 4LK3A 2JDIA 1W4AA 3R3HA 4JXZA 1FFEA 1NMYA 1ZMRA 2ZCUA 5ADVA 3O0DA 4ILEA 2WR8A 1X39A 2GZMA 3NC1C 4JP5A 4W1PA 2ZBRA 3G7SA 3ROZA 1VYTA 4MARA 1GG5A 1N6HA 2O3QA 4F4HA 4B40A 2GLXA 5BW4A 5JZOA 4YP7A 1SXGA 2PKRA 2OORC 2ZRGA 1ACMA 3N5KA 4LMRA 5EVJA 4L9RA 2VKQA 3WL3A 4P3XA 4I81A 5AVWA 2F3RA 1KJWA 1ZK3A 3O1HB 1JBKA 2RB5A 1PP4A 2OCXA 3LWZA 4MCIA 3BM5A 1RADA 4F9FA 2XEDA 4ZEOA 3EXHA 4PNEA 3DE1X 1ZM4A 4G67A 4JR0A 1E3WA 3M3DA 1RR6A 3MBIA 3FN4A 4EEZA 5F5LA 2H16A 4WQMA 3HYRA 4L8VA 2PLFA 1Q3KA 3RM3A 2I9KA 2UVQA 4I9NA 4UTOA 4R4JA 1QX4A 4ND8B 5E9AA 4MV3A 3WJAA 1N5JA 2A0KA 3TCKA 3VI3B 5JNUA 2B2XA 2D0OB 3PXGA 1UPAA 3U16A 1ML4A 3QYFA 1CYEA 3EZ9A 2WD8A 3ZDZB 4I1PA 4O2BA 3PENA 1U8TA 3RUIA 1V9SA 2VJAA 4DDMA 3D6NB 4DLKA 2HJSA 1MOSA 1LTQA 4D3XA 3GEMA 1N32B 3BL6A 1ISPA 4NK5A 4OHBA 5D7NA 1N78A 1YZ3A 2OBLA 3NIGB 3CXRA 1NMZA 1R8XA 1Q84A 3CX3A 2X5XA 3ANYB 4HDMB 5TQVA 3ZKWA 2XCLA 4IJ5A 5JCOC 3PDIA 1U8AA 2HRQA 3IT3A 3HSSA 3KOOA 1RYFA 4B48A 1ZRMA 2GKGA 1NW6A 2Q6LA 2YMPA 1P3Y1 2QROA 4GX1A 1X19A 3C85A 4KQHA 4EY3A 3S8EA 1H4SA 2OG1A 1JA1A 1YMVA 3ANXA 4FX5A 4X8HA 3KU1A 1X42A 3MWYW 4KXFB 2Y4NA 2XMQA 3IMGA 1N4DA 5DU2A 1ZP6A 2BMEA 3MERA 1QCDA 2OQVA 3WIOA 1OH8A 4JMLA 4UEJA 3QFSA 5EUCA 1BROA 1PUJA 4JLJA 1RJEA 1KAQA 1BOOA 1LK0A 1AO3A 1CRQA 1U7WA 4XL9A 2AD1A 2BFAA 2Q6VA 2P1DA 3DTNA 4MAMA 4PS1A 2W6PA 3WQQA 3ZHOA 4P25A 4F11A 4RNDB 2FX5A 1K3FA 5BWBA 1G8MA 2CMHA 3T5GA 5K99A 3LLSA 1UP4A 2QBYB 1D6MA 2JGAA 4ZDJA 2JFWA 4FMBB 3QU7A 4XWKA 3UK0A 1WMBA 1X9GA 1AMUA 2JI4A 4HEA1 2E1RA 2BFMA 3HEAA 2WQ7A 2DU8A 4U0KA 4GWKA 2ZTGA 3ONEA 3B5JA 1BC5A 3BOSA 5BXYA 1R16A 4X7EA 3E7FA 1OVMA 4C4ZA 1B74A 1LW7A 2IPNA 2GKOA 1R0BA 3V9AA 5IVIA 3HY3A 4EFLA 3UC9A 2Z09A 3IQIX 2ADOA 1IPHA 4PLCA 2BFWA 4FS8A 3WDSA 4IKEA 1KC8D 1Q21A 3V8NA 3A28A 5G0UA 4JI6B 4ZP1A 5CB4F 1W4CA 2IPMA 2PMWB 3AEQB 3L92A 5KQLA 3OCZA 3BRQA 5FNVF 4IGAA 1A50B 2WHPA 4YREA 1E1NA 3J7TA 3ONVA 4TOIA 4C0XA 4YUZA 5F1OA 4LDRA 3OEWA 1IUOA 2BM8A 2DUMA 2FMHA 3C97A 1FFYA 1Z88A 4ML3A 3A26A 4HEQA 2REOA 3E27A 4IIXA 2HT1A 2P6MA 2INGX 3KQYA 4EW1A 1Y4ZA 2VHJA 2YMQA 3V46A 3MLAA 1QC5A 1P0PA 2Q3LA 4EBFA 3SHQA 3ASVA 2FRXA 3K8OE 1E5LA 4EUKA 1OBCA 5B53A 4BBAA 4XDZA 1L7BA 5FI3A 5EKDA 3BIFA 4XAQA 3DEAA 4M83A 2D7JA 4QU0A 4BWGA 3KAJA 1I24A 4HR7A 2JJ2A 1L4UA 3AF3A 1Z34A 4BVBA 4RFVA 3HBFA 1KERA 2R1VA 2O3JA 1SCIA 2RAFA 2RHDA 2G9NA 4E7OA 2IUFA 5DN6A 1UKYA 4BOYA 1AQJA 3LUPA 4OPVA 3H8WA 4YELA 2DCUA 1SXIA 2BMDA 1PK8A 1LNZA 4RAOA 4BRUA 4DEVA 4EO7A 1AK2A 3SDSA 1B00A 2HOQA 4OAOA 1YQTA 1U3TA 4RK5A 3MN1A 1G41A 1IJKA 1OJLA 3PC8A 5CYOA 3TRJA 1BA2A 3IHWA 1CE8A 3LL7A 4ZVOA 4RVUA 1GD1O 1V6CA 4BGVA 3FKQA 3CCQB 4BFYA 4L07A 4PZLA 1LBEA 3WYAA 1U98A 4YUAA 5AW8A 3H9GA 2Y1KA 2ZAYA 1RRVA 1KO4A 2P2GA 4ZT7A 3MHTA 1IK4A 1YHNA 1MB9A 2V9PA 4YLEA 2VYVA 4L78A 2NYRA 4U7WA 1ZVVA 1YH3A 4FNOA 1FP7A 2ZYIA 1NWCA 3CRQA 4ZOLF 2I78A 5IRCD 1TJNA 4EG4A 3A6DA 1SUIA 2V7EA 3E8XA 1PS0A 3Q9UA 4R3UC 1E9CA 4FGLA 5BOVA 1RKQA 3HNPA 3KJEA 3OCJA 3WK8A 2F4NA 4BB0A 3LL4A 2A5GA 5HIMA 2QQFA 5E6TA 2W2KB 2VPPA 4HWRA 4P53A 4TPKA 5EINA 3AXTA 5G3ZA 1FXWA 4CQMA 5HIAA 2NXWA 3IP1A 1U99A 2J4DA 3C45A 2VSYA 2D2EA 4F21A 3T3NA 1M0SA 2JKVA 3IAAA 4FMDF 5EWLA 1WCXA 2X0EA 1AXEA 3HB5X 2W2OA 2MYUA 4DY4A 3R2JA 2BRUC 3Q8LA 2AI2A 2ESRA 2JA1A 5K3FB 1R0YA 4O4JF 1TJ5A 1D8TA 5EE3A 3O2JA 1R8JA 4CRWB 4RV4A 2QN3A 3R7SA 2VJYA 2EZ9A 3MRXA 4CR8A 4M0EA 5I7HA 1DHTA 1VF7A 3CCCA 1ZR2A 1G2QA 1BE8A 4RZIA 4DCCA 4WERA 4F2WA 4P08A 2P2YA 1Z2OX 3IELA 3AVOA 3N6XA 4H17A 2R8OA 3KOZA 3NWEA 1OYYA 3QVTA 4MZXA 3BBPA 4R40A 5TGZA 2FWIA 2PH1A 3EZGA 2E4AA 4HVLA 5CHYA 1GAWA 2EF0A 2VF2A 2Z9DA 3PDWA 4HX9A 4WOCA 4ENWA 5DBEX 1SOUA 1AKQA 3DDUA 3T7IA 1KAHA 3EZNA 3ZE6A 4TT8A 2A78A 1AE1A 5DTIA 1GRRA 3DOOA 4L3VA 2FEXA 2X58A 3PG5A 1NR1A 5TB5A 1FUYB 2ZVDA 1EM8A 4TWJA 1E2EA 4FYKA 4FPXA 3UMJA 4IIDA 3RB8A 4L51A 3E2IA 4P5EA 3DMHA 4QYXA 3GJYA 1H2YA 2E85A 4IG9A 3JARB 3IVRA 4IV0A 1SHZA 8ATCA 5ERYA 2X77A 3V1LA 4XB6B 4QPDA 2X6TA 3VVLA 4DARA 3A6PC 1XNQB 1ECGA 1Y9JA 2DQ4A 1CC1S 5A9SB 5KINB 3A6ZA 1EQUA 3TL2A 3SJZA 3W8RA 4P7BA 3CCLB 3OE5A 3GFPA 3IP5A 3HJAA 1G66A 1GNTA 1N9GA 1VGQA 4IS3A 4B33A 1RWMA 1S72B 1U0NA 4XWTA 2R60A 3WSVA 4L5JA 3L7AA 1D5CA 4PG4A 3EIFA 1I7QB 2GK6A 2AUTA 4FGJA 4BUJA 1BYUA 1HQKA 3OPVA 2Y0PA 1B6TA 4R8RA 4WV3A 3UWDA 5CH8A 3W90A 1VPVA 3TWOA 2HU7A 5KW9A 4P6VF 4EUFA 2EJBA 5A04A 2Z3ZA 4PO1A 1GDHA 4OI1A 1A9QA 3UJHA 5C3UA 4LBYA 4JJFA 3TNLA 1SUDA 4WK0B 4HNAA 4DSNA 1UXIA 1Y8AA 3MAJA 4MW5A 4RMHA 3TFWA 3RBXA 2LNDA 4B2PA 4XJVA 3FDZA 5I4CA 2H08A 1T4CB 3DPUA 4OEHA 4JCOA 1N0IA 4R9VA 3SZGA 4YRBA 1W30A 5LP6F 1DPFA 1Z6PA 3WLLA 2B1QA 5LM3A 3RS4A 5TQ0A 4JWKA 4KV7A 3LC0A 3QKWA 4M1WA 4RHCA 4TXJA 1GTMA 3TLCA 4B83A 4ZOQI 4YRFA 5JSZB 4YO8A 3A9UA 3O3MB 3D8TA 5TPWA 1UP7A 5CGQB 4NAUA 4AD8A 4EB6A 2GNAA 1MRNA 3W1EA 4CI0B 3WY9A 1E9SA 4I9FA 4RK1A 1G8FA 2Q2NA 2FH5B 4REQA 5IF9A 4U3JA 3WYFA 4EKNB 2N42A 2VK2A 3BK1A 3ZCQA 3CRZA 1C0KA 2WU8A 3C4VA 3LPMA 3N28A 4JX9A 4OQYA 4PRKA 3EGXA 5F73A 1CY6A 3GN2A 3HFGA 2BR5A 4UBKA 1AUQA 1OZHA 1Q17A 4IP0A 1NQOA 5B58C 2FKNA 1WXEA 4IIJF 2FCRA 2QGFA 3HBNA 4KIFA 2PUTA 2WI8A 4V0RA 4WNIA 1A4XA 5LIPA 1SUBA 5IKPA 2NO7A 3ZK7A 2EATA 1CUZA 3QFFA 4BQIA 4J0IA 1AH2A 4BNXA 5CBKA 2O19A 3U3MA 4PBTA 1G63A 2R87A 3U7JA 3UIEA 5KBYA 1ZUD1 2BBSA 2CNLA 3HO8A 5KVQA 3W3AA 1L9KA 1WV0A 5C5CA 1WSVA 2D59A 2W4QA 2XNHA 3L7IA 2R25B 3RKRA 2IUTA 2PKEA 3WMGA 3DZDA 3UOWA 2Q49A 1M33A 2CLOB 2XZOA 3EVDA 3KSZO 3ZCXA 5EGNA 3WLFA 3WLPA 4I19A 2ZR7A 2WOJA 3TNYA 3CLVA 3RLIA 2AKEA 3OE7A 1CZKA 1DXHA 1Z3CA 1JEAA 1BLIA 2ZULA 1RQ7A 3CHYA 5IJWA 3NCTA 3TZHA 1JHQA 2D8AA 5F9MA 3RVPA 3W6PA 4EDFA 5H5JA 2QPOA 1H6DA 1V7QA 1SOMA 3WWZA 4AO8A 4EHDA 1Y4UA 3BQ9A 2ISQA 2NZWA 2XI4A 1HKHA 4GI3A 4QE3A 5CGZA 3GUHA 1CR6A 1TVMA 1C29B 3VGPA 2RHTA 4D97A 3SKVA 4Z4TA 1TLFA 4QXMA 2ZL6A 1N6PA 4FVTA 4QYMA 4UEQA 3UJPA 5KU1A 2OQIA 2I29A 2H7YA 2QD4A 5BW8A 1O57A 3LW8A 4WKNA 3IEIA 4UVEA 2DKNA 2G9QA 4KSCA 2VQSA 1TD9A 4V24A 3UV3A 1QE3A 1RYHA 4B6RA 1AX9A 4EABA 4QDZA 1ZGHA 5J2UA 4TZ0A 4RY8A 3I0MA 3M5WA 4LXIA 1E9EA 4WNAB 1ISMA 4TTIA 5HKKA 2JEOA 3T5PA 1W44A 3LJKA 4FEAA 3FI9A 3WNQA 3CBQA 3GCXA 3AWDA 3N59A 3OX2A 4CM3A 3B1JA 1HT0A 3AZOA 1U0FA 4R2IA 3GJSA 3B53X 3QW2A 2QR5A 2K2QB 4G84A 1KSHA 1IY9A 2BMVA 1GGVA 2MIIA 5C7LO 3K9GA 1NJGA 3FG9A 4TMZA 4HB4A 3MZ0A 1R9GA 3EVGA 2K7ZA 4K6CA 1VYHA 4M9RA 2CJXA 2XAAA 2XVAA 2PMEA 4FSDA 3EF0A 5GONA 1SG6A 1RMYA 2IPLA 1USVA 4Z1MA 1P4AA 3L77A 1QLHA 1NPDA 3LYLA 1A5TA 1EEHA 4YQEA 4QWWA 4QBTA 1DTWB 2VDJA 1N2IA 3PS9A 3PYXA 3UJ3X 1F7UA 4EKGA 1DQZA 1Y5MA 2B94A 3EPLA 2C31A 2Y0CA 3Q4GA 3AK4A 1NQUA 3O9VA 4B85A 3A9TA 1UBGA 2RCNA 1W5AA 3JZDA 2WIGA 3QELA 1OIXA 3ZDCA 2L19A 2H7XA 3DAHA 3CUWA 4FLMA 3U13A 1NHWA 1IB6A 1OWMA 4GU5A 1YZUA 4RTOA 2F7SA 5DISB 3TBFA 5JAQA 4D9BA 3THXA 3ADCA 1KY4A 3E9ZA 4OVKA 3SYRA 3HJBA 4Q7KA 4RD6A 1E79D 1N6RA 2B36A 1I7PA 4Q3KA 1MJGA 1LW6E 3BGDA 1O94A 1WUYA 2PFGA 4UEOA 2CK3A 3ZY4A 4MLPA 3E8MA 3OKPA 3ROXA 1P75A 2BISA 3H4MA 1W94A 3I9JA 3ICPA 3N74A 4NENB 4RMNA 1C3XA 4KGVA 1OPXA 1KP2A 3AYXB 3ONWA 3PLNA 1FA9A 2EZ8A 1EXNA 3OQ1A 4QQFA 3C15C 1HDOA 2POQX 3IESA 4F2PA 4PZ9A 2ZXHA 1KVQA 2DFKB 1U7PA 1KJIA 2J3EA 4NBSA 3TW8A 2QP9X 1Z0ZA 1ZSVA 2Z5FA 3I56B 3S8YA 4H3SA 2HSEA 1COWA 4D9JA 2Z6QA 4P0PB 2EP7A 4Z51A 4S0ZA 1QP8A 2CEAA 2PGLA 3UY4A 1GO2A 4EZIA 3ZWCA 1DO2A 1OLSB 1UKCA 3H1EA 3RJ5A 2I87A 2ZYDA 1MTOA 4KNVA 4ND6A 3ET4A 4YFVA 4KP7A 4BIMA 5T7BA 1T13A 1C30B 3GLGE 1YDEA 3EBPA 3C3WA 4DLPA 1ZL2A 5HFNA 5JEEA 4N6GA 1PSWA 1XNGA 4R05A 5TX7A 4IDPA 2ZWIA 2WY2D 3ZHTA 2ZRIA 1H4QA 2QPTA 1R0KA 2Y1OA 3ELYA 5EHQA 5DOZA 2D54A 1C8LA 1E3JA 1VL1A 3FWPA 1TUGA 2I1QA 4KWTA 4FI3F 3CCRB 5JYEA 3H3JA 4DTCA 3MMPA 4MI6A 3G7UA 4PYKA 2HPVA 1XU7A 3NHFA 4TKUB 4FGKA 2I1LA 3MJCA 4JBWA 3ZBPA 1X86B 4RSMA 3SHOA 3WNBA 2O7QA 3R7NA 1M9NA 1RJ9B 5JO9A 5GIPE 2W2NA 4LRWA 3D3QA 2W6QA 5K8VA 4HLQB 3KKNA 4F93B 3HCCA 1HE4A 4YPOA 1KBOA 3W2HA 3KUUA 1XPJA 3QMVA 2BFDA 3AOEC 2QTNA 3WNZA 4V1CB 3T3HA 1IHUA 4J0CA 4X1KA 3ZJYA 4YMUA 4DNTB 3K0BA 5I9BA 2GBLA 5L8VA 4IGKA 4MUIA 1Q7YD 2ZJBA 1V5IA 3LI2A 2A94A 3J81k 3DEJA 4YEJA 3A14A 2GK4A 4LGVA 5K09A 2Z9BA 1EZ1A 2IFTA 3CV3A 3IEMA 4OSOA 3UO8B 1Y37A 4AXXA 5CCBA 3ZD8A 1KVRA 1QH8B 3UAZA 4W5RA 1BCRB 1QTRA 4KTVE 3GYBA 5HKBA 1JEYA 5TVKA 3EEOA 1I5RA 1PS9A 4BVKA 3WHKA 5D8DA 5TRTA 4HE5A 8LDHA 1L4HA 2VDRB 4HXGA 2YOFA 3NDJA 3MMSA 1TK2A 4KN6A 1P61B 2GAAA 2IYAA 2GN6A 3LVRE 4UBNA 5TMBA 3SHTA 4D1YA 3N8IA 4RIFA 2VNIA 1T35A 3C4JA 4Z0TA 2DBVO 4TRJA 2IZ6A 1O5TA 1KTVA 1KY2A 1G3QA 1YZNA 2GESA 1NBMD 2H0RA 3LQ4A 1HDXA 4QPCA 2ATXA 1OX5A 2YWXA 3BWXA 3HP4A 2DWOA 3OZDA 1LJ8A 5FLYA 4F4DA 2DR0A 2PU7A 1ZGAA 1WWKA 4XWWA 3KPWA 4LNAA 4PHCA 3B60A 4UBOA 4ENSA 1Y8ZA 3I83A 4JI2B 4E13A 4II7A 2HNAA 4BFLA 3BE6A 1T2NA 1NKTA 1Y8RA 3DTVD 1J2RA 2ORED 2V4UA 1Q0PA 5FPTA 5CYGA 4W6ZA 1DXQA 2BIFA 1NSFA 4V0SA 1CW2B 4DV0B 2N1MA 3D3NA 3N7AA 4NBUA 2R65A 4I4LA 3O8QA 3N2KA 1RXWA 3ZDBA 1J06A 1TM1E 2C77A 2WU4A 2NUTB 3Q98A 4GC5A 3ND9A 2YDYA 4MRSA 3IMKA 2AH5A 2FEWB 2W83A 3BHMA 4YBRA 3RC7A 2V45A 3UMRA 4A8PA 4BMNA 3UUEA 1W8IA 4OHCA 1FDVA 2XSZA 1Y6GA 1TUBA 1C1XA 1UBFA 4HDOB 4AJIA 1GZUA 5BV7A 3KETA 2OD2A 2VJPA 3HXOA 3EIWA 3AB3A 2HGZA 1XE3A 3TLZA 3U7EB 3QXJA 5ALHA 5HK8A 1NIPA 1JKJA 4BCCA 3B8EA 5IW8A 3TE6A 1GIAA 1M1UA 1V3QE 1E1QD 2OUKA 2WG0A 3R4CA 1K5DA 1ONBA 4LJ6A 3W79A 3WTCA 3BMCB 3LUGA 2ODNA 4CBVA 4N5NA 5HA5A 5J5CA 4PX5A 3ZUPA 4KWIA 2QN1A 1USWA 3FUCA 4E94A 4AY5A 2GM4A 4OHYA 1P1JA 1PR0A 4HF7A 3FBTA 3EVZA 3SM3A 3TZKA 3UG6A 1HZEA 4EBBA 3JYQA 3ZE7A 2EL7A 5JLAA 3KJXA 2F43A 2ZPUA 3FFAA 3T9AA 4D4MA 4DA9A 5LQJA 3QVUA 1G8GA 3IUSA 2KPOA 1DJLA 3MS2A 1VL2A 1YA8A 2O2SA 3I2JA 2FE4A 3LW7A 3TB4A 1VL8A 3ZCPA 1XDDA 5F23A 1E5XA 4JQYA 1U0SY 1WD5A 3ISTA 1UOEA 3KQWA 1GARA 2Y9MB 2NZ2A 5I3ZA 4DB4A 2DHQA 3LGSA 1ZWKA 3IVXA 3KYIB 5HZBA 2QU8A 4ZVLA 1PR5A 3T56B 2H1CA 4UCFA 4MW6A 3NDBB 5DEOA 4ZVMA 1BW9A 4N0EA 3IE1A 1KP9A 4GSYA 4OHVA 5I4BA 5IFKA 2K4MA 3EGEA 3AM5A 4XLEA 3G89A 3JRNA 3QH4A 1Q1EA 3NXSA 1GU1A 3D7LA 4J91A 4JQOA 4QUHA 5P21A 2HMAA 4L8JA 1MJ5A 2AK2A 5C8YF 3BBLA 3V6LA 4NJEB 1AKRA 2ANBA 4D9IA 4IJ6A 3W2IA 1LS1A 3GLIE 1ENYA 2WNSA 3F6BX 2QB5A 4RK0A 3TW6A 1A8SA 4BLPA 1BDMA 3L6EA 1RXUA 5F3DA 4KGXA 5G4LA 2HJGA 1C5KA 1WHSB 1YDWA 1ZVKA 3WBBA 4B4OA 5AM3A 3SFTA 3VVCA 4LTDA 4BU1A 1CQWA 2CDBA 3L41A 5CXUA 5KTSA 2JZNA 2FMFA 5CA0A 5HE8A 2H00A 3ZJ5A 1D04A 2FUEA 3IBYA 1KMIY 1SK9A 2V6FA 3N58A 3VKHA 1H94A 1II0A 1R8YA 3IOEA 3P94A 3PL5A 3PPYA 3PSAA 2HI0A 5JVDB 1K4MA 1S8FA 3PSHA 2JATA 4QDOA 5B30A 5JJIA 3MYYA 5J63A 1NHGA 1VMEA 4F7DA 2G77B 3GFRA 3IB3A 2A3RA 3B9RA 5KKCA 4KAFA 4AYXA 1VLVA 3HEMA 4MVJG 1NQXA 4OFXA 3BKXA 4FUQA 2NZYA 2QYHA 4CM7A 2DF8A 1KFKB 2Q7OE 1JR4A 5ILGA 3A04A 1QYRA 1PWXA 1IN5A 1Q0TA 1J0BA 3M9XA 4BDTA 1Z0UA 2IE8A 3BD8A 2IU3A 1UZUA 2WWFA 1T5IA 3CYFA 4BLRA 5EVCA 2H1FA 2XUAA 3R3XA 1J0DA 4B45A 4X7FA 3R0XA 4OU5A 4TYWA 1Q0LA 1J56A 3H2ZA 3AHEA 1VP9A 4FFLA 1C3EA 3DG9A 3K6SA 1W5FA 1PV1A 3FNQA 2GD6A 1B8NA 4ZI5A 4F8YA 5LN1A 5HRAA 2PLAA 4GSLA 4IY1A 4QNRA 3NNSA 2IS4A 3LF2A 4CU2A 4L15A 1D03A 4RSGA 3AUFA 3NRJA 4HDKB 1XVIA 1SULA 3TPZA 1M6WA 2ZTNA 3BWDD 1AV7A 3AF4A 3NLLA 5LBTA 4ZQCB 4C2BA 4KVGA 4H4DA 3DDOA 3W9BA 2MJLA 4GOXA 3KVNA 4XDGA 1GNQA 4XN0A 5FR2A 3PDJA 3DBHB 3Q5DA 2X3UA 1DDOA 2ATIA 4WLVA 6Q21A 4FGWA 4IGIA 5EWJA 3HEBA 1GCOA 3FSRA 1PJAA 3ZZTA 5KJCA 3HR4A 4OP1A 4H16A 4B7AA 2CL7X 1UK7A 1YBHA 4YGXB 3ZCUA 4DHEA 2ZT8A 2FSIA 3GA5A 3I39X 1OUMA 1G7CA 4R8LA 5EIWA 3H9JA 3JWGA 1WB6A 3K0FB 3K32A 3AONB 1ZJ4A 4I50B 2X7JA 1R0CA 2AN4A 1TZMA 2J85A 4ES6A 2CKMA 2QP3A 1E99A 4ISCA 4NE2A 1TW3A 4DSUA 7MHTA 5CYFA 3VDMA 4E07A 2P9FA 3KV3O 4RY2A 5IU6A 2I3AA 4RDJA 2GAOA 3EUWA 2WJWA 4PAMA 3H17A 4KK4A 4KQMA 3OKCA 3EC7A 2RD2A 2ZSIA 3FIJA 5FPQA 1RLIA 3I92A 2NV0A 2SBTA 4GXTA 5EA2A 3T0IA 4KVAA 2Y2VA 2Y0BA 2WIDA 3DBLB 3VPHA 5ER6A 3WFIA 2YJGA 5KO2A 1ST2A 3IT2A 2XLCA 4KKUA 4RXUA 3ZHVA 4UNRA 4JEHA 2OAGA 3KHKA 4Y30A 5G1NA 3FRIA 5GY7A 3RS7A 2AS0A 4D92A 2WB2A 1PQUA 3IEKA 5IJ0A 4Q93A 3PQEA 2QK4A 3PNOA 4JKYA 3R76A 4ASUD 4KH1A 4C3VA 5JSFA 3QHPA 1C4WA 2XDQA 2G36A 5JD6A 1D2MA 5IWAB 1RIIA 2SKCA 2P4HX 4EJSA 5FWXB 4CEIB 1IOWA 1Q3TA 1RHRA 5ADWA 4WZKA 3G8CA 3EQ6A 1Y4DE 3RU3A 4FE4A 2WAAA 3QKTA 1EUCB 2RHWA 4LYFA 3NBUA 3H9CA 4GPTA 4LWZA 3OU6A 1X7WA 3RU2A 5D5PA 3G1UA 1SUPA 2B0CA 4F5ZA 2OK8A 2C9DA 5DCLA 3F6RA 2JIMA 4GGMX 1G4UR 3IUMA 4MI1A 4TM7A 3K72B 3KKLA 1E3SA 1WV1A 4C3UA 4YWHA 4KQIA 4NI5A 3NYRA 3TVYA 1PT9A 3NANA 3MCAA 1MG0A 2ZGVA 1DI0A 3VOAA 4O4LB 4D8XA 1WR8A 1ACLA 4QTYA 1BXKA 4V0ME 5JH7B 4H6XA 4Z3OA 1VG1A 2PJZA 2BEUA 4IINA 4II3A 2CXHA 5CM9C 2PQ0A 3PEWA 5F9HA 1XP8A 2R5WA 2FHPA 3HV2A 4PCAA 3SX2A 1MORA 3AF6A 1ONSA 2D1RA 2NZVG 1HDCA 1PZXA 2F2TA 2HLHA 1OXVA 3DP7A 4NMWA 4RA9A 5DHPA 5IT0A 1A4RA 1KQOA 2E4WA 1EI9A 1XLTA 2R68A 3LV8A 4RQBA 3SIRA 4AJKA 4E6EA 2G6TA 3R6LA 3T52A 3F8WA 2A0YA 4BX2A 3PD0A 3HGMA 1K8ZB 5K20A 2FJPA 1TYBE 1QHGA 4AUNA 1NVXQ 1OIVA 1CETA 4XQGA 4KRYA 2QUHA 2W93A 1Y7LA 3OQPA 1SG9A 3AUSA 4B4VA 4HNVA 2IPOA 1ZOLA 5AIAA 3N0VA 1P2BA 3O4HA 7REQA 1D4ZA 4WEQA 4HLNA 2FB9A 4QUAA 2XUHA 4R5MA 2C3OA 3E1GA 4ZGWA 1CDOA 1ESEA 4HVCA 2GRAA 3OQIB 5IKMA 4JENA 3UFXB 1AUVA 2Y05A 1Q0ZA 4KR2A 3KEQA 1XJ5A 2J3LA 4OOSA 3EXFB 4GM4A 1EFTA 4HMQA 1L4MA 4JLPA 2YKGA 4FK8A 3KHTA 2W6ID 4RGYA 2Q9BA 3ENVA 4OOVA 2GSWA 2VCYA 4UZUA 3HVHA 3D64A 3WMRA 3G1TA 3IDFA 4ZXFA 3FR8A 3WSTA 2O8FB 4Q01A 4JUBA 1DKMA 1I01A 1E4YA 3VR2D 3MBKA 1S7CA 3PT5A 4P38A 5A89A 4ZK2A 1AKWA 2DSNA 1MABA 1II9A 2C59A 1GM5A 1X38A 1XAIA 4R2MA 5E9JA 3SDBA 3UPUA 3HDTA 1E7YA 1S01A 2FZVA 4UAGA 3VTKA 3WK6A 5LXTA 9MHTA 5DTMA 4TLLB 1W85A 2O8CA 1JWLA 4RS3A 5DLQC 1W581 5B4VA 3ESYA 1YONA 4L4XA 3TKYA 3M6XA 1TC1A 2WILA 1QPBA 1J09A 1F1JA 5L3SA 1KXJA 3G5LA 4DLLA 2BGGA 5AJZA 5DKFA 5FFMA 3W2GA 1N1DA 1L3IA 1QLJA 1LSUA 2JIOA 3K1TA 1N8RD 3K4QA 3KPUA 4R2KA 2JEYA 4M21A 1OOEA 3O75A 2B92A 3PXEA 4G36A 1OAOA 2ZPAA 3EXHB 4HFRA 1A4IA 2QL7A 5AKZA 13PKA 2GEUA 3EGIA 3TOZA 3UV6A 1Z82A 3FZQA 3JPWA 3O0TA 3WISA 1E3WB 3VYVA 2NAFA 3OQNA 4X7PA 3U5ZB 3C8DA 2VYNA 1M1XB 5HJ7A 4O5OA 1U6IA 2W6MA 2OBTA 4HWPA 1QPZA 4L5BA 3NT5A 5CG2A 2QRPA 5HTKA 1YZFA 2Q5HA 1M8FA 1YULA 2YRWA 3JAWA 4XYBA 4XI9A 5K3CA 3UK2A 3R5XA 1E66A 1MX1A 2GK7A 4CHGA 1PFVA 3NMUF 1JDZA 1I6LA 3OOWA 2AFIA 4L7VA 3A06A 3EPHA 1SQ0A 3FOWA 1L7OA 3G0CA 4O2BB 5AHXA 4ALIA 1XZFA 4NOKA 2A59A 3IUBA 4JNCA 2QLBA 3ZJUA 5DM1A 2BE9A 3CH6A 4N5MA 4CZ2A 3B1VA 2B3DA 4AP5A 2FW1A 2J3IA 2VSOA 3L1KA 2WKWA 2XUIA 3DF7A 4ZYZA 2WZQA 3G23A 2WVAA 2J9YB 4MWTA 2WTNA 2XGJA 3LY5A 5CFMA 5AJTA 3FOBA 3ORFA 3W8FA 4IUDS 4X1OA 3GLSA 1OMOA 3F98A 2VZ9A 1IAVA 3NZEA 4KXNA 2H3HA 3ER8A 3E2PA 2WYHA 1UDAA 2J45A 3UKJA 1NMSA 3N1UA 5FBLB 3K7EA 2NOAA 3DMRA 4NOMA 3ZWAA 1XK6A 1S7GA 1E20A 2VCHA 3EXEA 4TTVA 1G16A 2RHOA 3VJRA 4DN6A 2X53S 2AJ8A 3KALA 3H2HA 3TZQA 2A9OA 4IJKA 1Z5OA 2FJ0A 3HKCA 3OCCA 2ZSUA 2OPHA 2ID9A 4GVLA 1DBWA 5EIXA 2XITA 3AFOA 3RFCA 3C3YA 3UAWA 4QICA 3G0OA 4PO8A 4LJYA 1WOOA 4TMTA 1G3IA 2IHKA 4CT4B 5MFPA 3RWMB 3DS8A 3QIAA 1EMDA 3S1AA 2H2WA 4R5HA 2Q7DA 1HFKA 5TS3A 2AWOA 2VP3A 4FGSA 4JUCA 1ZA2A 3MD0A 4R8MA 1Z18A 4ROTA 4RM3A 5CPBA 3DW3X 4GD3Q 2PIAA 2DX7A 1EFVA 1F38A 2COEA 1MAHA 3CC8A 1DIOB 4E7PA 1Z17A 4TLBA 1DU4A 4PSVA 2HMYB 2QZZA 5BYBA 3Q6IA 4LZJA 5AVJA 2W48A 3RC1A 2Z1NA 2F8LA 1U0BB 1TZ2A 2VJLA 2E87A 4NSNA 4ZQBA 2R7KA 1Y9EA 1KEVA 5C37A 5IJZA 5ISMA 4UM5A 4UU0A 1N3BA 4UVIA 1Z7YA 2X1VA 1RABA 5JD4A 4DYVA 1FJHA 3QLVA 3N7UA 1QZUA 4OJTA 3SSAA 3U19A 4UZSA 3ED5A 3MJRA 4PZ0A 1FVOA 2QX7A 2VPZA 3VKWA 1Q7CA 4EPYA 1UINA 2HNKA 4NCNA 1E8MA 3CJQA 4G0NA 4HBZA 2QN6A 1GAJA 3CMAB 3B48A 2GRJA 3Q7RA 1L4NA 3AM4A 1QU3A 1E69A 3BY1A 3WL7A 1U0GA 1G8AA 5EXXA 5GQSA 1BVUA 4B31A 5TR9A 3BILA 4LZNA 1PLJA 4W1QA 3RARA 1ZCAA 2P35A 3E9YA 4KSBA 4GR4A 4NBKA 3EAQA 1VZ2A 4TKLA 4EYEA 2R1VB 3EFOA 1QTQA 2ZE6A 3PLRA 5JRDS 2G04A 4ZYYA 1K08A 1Z13A 4MCAA 2J3HA 1R6AA 5EHGA 1MO4A 2BBTA 2DMRA 1DKNA 5CNIA 3THYB 1W25A 1IJFA 3KZOA 3G3EA 1S89A 1L1EA 1JE0A 3FSGD 3E15A 2UZAA 2I99A 4K28A 1NOIA 5EGSA 2AJBA 4D3FA 4F0JA 3JQEA 1VHEA 3AEUA 1F0YA 3HPQA 1ETUA 4MCJA 4BMVA 4OQLA 4XWAA 4W5OA 4YRLA 2OXRA 3HJRA 1DC3A 2FR1A 1WXXA 3QE4A 2CXSA 4LY9A 3T0FA 3HA2A 4FS3A 4BN5A 4UDXX 5FQNA 1X7HA 1E0DA 1AF7A 1PGJA 2A92A 1ICIA 3N8HA 3VGJA 3GVLA 4BQNA 2VTBB 4KPEC 2B9EA 4PZZA 2OLKA 4LX8A 3UAYA 1UFKA 4I5GA 2YCLA 1P1FA 4L4RA 2G28A 1K2VN 3LA8A 3N2YA 3TJRA 3L7BA 3Q10A 1DAHA 3QX8A 3EX7C 4ROSA 1E2KA 1GPWB 4GT1A 2L2QA 4BMYA 3P71T 4D3SA 4W1SA 4WW0A 3TXXA 3B1KA 3B1WA 1BXZA 2FPPB 5F98A 4CQMB 3MJHA 3QFCA 3UV7A 1BX3A 5A4IS 4OQ4A 1RWXA 4HIZA 4OHFA 3G02A 3A3GA 2F48A 5EWLB 2CYCA 2XZLA 2HCRA 4MJXA 4YR9A 3PNPA 2X5JO 4BZWA 1L5SA 4K6KA 5IKOA 3OZFA 4JN6B 1WE2A 2ODTX 4WVLA 4N1AA 3BRSA 1A9SA 1OAKA 1Q7EA 1SXJC 4P5PA 3U60B 3G0HA 2WSSD 5AKLA 4X60A 2QG4A 2BSAA 4ZDWA 2PQMA 2WSIA 4Q1DA 1R0ZA 1B93A 1TKAA 2OXIA 1KF0A 3C7CB 4Y8VA 4MQUA 5EMKA 4QWMA 4AG3A 4GGOA 2RBEA 4OOEA 2OCKA 3UYKA 4OYLA 1U0OC 2VUUA 2YWCA 4LOHA 3CR3C 1OZ0A 2NU6B 2DLDA 4FJ1A 5CITA 1FS5A 4M0LA 2ZTVA 4IZOA 3GOHA 1ZU5A 4N18A 2VJDA 5AT1A 4UC0A 5KVVA 1QFXA 3HVKA 4QUGA 4R8KA 1F48A 1C0LA 3BH4A 4HFMA 4BJ6A 1JAIA 2G5GX 1V8OA 3O83A 2WYIA 4KW7A 5KOJA 3Q7PA 2R84A 2NO9A 2CBXA 5DWVA 4C89A 5C1BA 5J4HA 1LF0A 1KAEA 1A3CA 1EM8B 1K6XA 3CVVA 4C20A 4HN4B 1JLMA 1UC4B 3CWCA 3WNVA 1WMAA 1DWQA 3Q88A 3SS7X 3BDIA 2RH8A 3LQ2A 3PKZA 5IT9A 2PM8A 4PX3A 4PAQA 4ARSA 4EQ6A 3BY2A 4JSRA 1CQIA 1P9WA 3OEHD 3W9YA 6ABPA 2BJVA 1RTTA 5AW5A 4X6YA 2ZJ5A 4AVYA 1C50A 4DR2B 2O54A 1N0WA 3DLTA 2G0TA 4YRZA 3JD2A 4Q4DA 1U0RA 1IONA 1EP9A 1W59A 1AKMA 1OWOA 2I1VB 4RXTA 4UVHA 3EZLA 1TM3E 5F21A 4B7XA 4GI5A 4PG6A 4PV7A 1I4OA 1C1DA 2QA4B 3M49A 1C2YA 4YPFA 3FTEA 4YPVA 4WCFA 3LQFA 1HBJA 3CZPA 1N9GB 2NG1A 3ZN2A 3ACCA 2A58A 1QAOA 1RI4A 1XRJA 5K51A 2PLRA 5BSUA 2RBGA 4TL7A 1FFGA 3NKLA 5HOQA 5LOVA 1J39A 5FO0A 4U7TB 1MHPA 1VJTA 3P9KA 5KNBD 5AHRA 2DTEA 5EESA 2CV2A 4XIJA 2GASA 2Z8YA 3K31A 4D80A 3Q5EA 1RM0A 2ZYAA 4UHBA 4E5MA 2HBQA 1ODKA 1DG1G 2WJ3A 3CM0A 4LGMA 4LV6A 3GPIA 3H5IA 4RTSA 5IHPA 3ILXA 2Z95A 3OPOA 4HWSA 1HTWA 1H8ED 1SUWA 3JQ9A 4HNAB 4YDSA 5LBUA 1XAGA 1OFVA 2BMJA 2HV8A 1UZAA 3EXG2 3NBYC 4PQRA 3FDZB 5GM1A 4DVGA 1Z35A 1SOAA 3T15A 4DR5B 1FTYA 1MB3A 1KP3A 1NGSA 2YZ7A 3EH2A 4Y6RA 2HTEA 4O3FA 4B5LA 5K05A 3HJFA 8OHMA 3F71A 2JGJA 1IBRA 4K9PA 3VX4A 4JJ4A 5CG1A 4G0VA 2Y71A 4HZUB 5TPWB 2JLVA 2F1RA 3AUXA 4X6XA 3WIUA 3I01A 4Z4EA 2H1OA 5LLDA 3PI7A 4REQB 1R6XA 4FYYA 2XTAA 1LBHA 5K8LA 1M6YA 2Y9PB 3T1OA 4U3JB 1KAOA 3NO4A 3AR5A 3C0KA 3A32A 4KTTE 2DQZA 1VYUA 5C31A 1P2FA 3EGXB 1PF7E 4IOKA 1H1LA 3VVBA 2DSTA 3Q9LA 3G5TA 3TPCA 3UHJA 1OZAA 5DNAA 4Y9RA 3A37A 3OHMA 4ARUA 1X3LA 2ODEA 4LJSA 1E1LA 2QJWA 5IN5A 5HK9A 1EH5A 5FQOA 3BWBA 4QU9A 4FD2A 4WOKA 1N0VC 1L5KA 4RKRA 5B1YA 3L43A 4RTPA 5FBKA 1BSVA 3NTUA 4CM8B 4D9KA 2R4UA 4DREA 1CEEA 3W5DA 2FWPA 2ZQYA 1IBMB 1LLQA 2AC4A 1EK0A 2J9FA 3A58B 3IOCA 3MJSA 3O47A 3RHFA 5HPYB 2Q3HA 5K4GA 3GZ4A 1THMA 3CZ9A 5U1PA 5IC5A 5A4KA 4OIFA 4AY6A 1KTIA 3O92A 1TAQA 1YB2A 4AJ9A 3HJUA 1GGKA 4I36A 2HRZA 5M5BA 2VUSA 4QXRA 3TSWA 4HRYA 4IXMA 3M8KA 1ZU4A 2PJUA 3M2PA 3HJTA 3NNNA 2AN3A 4BEWA 2VHCA 3A4VA 5FOQA 3ZWWA 4N5LA 4P3YA 1IVNA 1GILA 1SKUA 4E33A 3AI3A 4PGGA 2QLMA 2GMWA 1F1BA 4TGLA 1K8QA 2QRGA 4C2TA 3SS8A 2YV2A 5FI0B 1WCV1 2AGVA 2I6SA 3WX0A 4M1QA 3RTCA 3QF4B 2FAXA 2WSLA 3SSNA 1CF9A 4GSKA 3UCEA 5EJ5A 1E6CA 4NOLA 3AY3A 3ZGZA 3G0BA 1IVYA 3VU3A 5AIBA 5JS7A 1A9XA 2IT1A 4Z9FA 3ZDYB 4AY3A 4NICA 4I8XA 1V0FA 4JA0A 5WRFA 3BX1A 4IFTA 3NXKA 1PWHA 1ZN9A 3L7CA 3FNIA 4EG3A 3P0FA 5IABA 3IT1A 4KODA 4EMTA 2AEFA 1QE0A 1Y1SA 3F3MA 1KMMA 2RH5A 2Z43A 1YR2A 3G59A 4UMVA 3DOJA 3I2GA 2GM3A 2J3DA 2QRNA 2QT9A 5IAEA 1GSIA 3QA3E 3BE8A 2B7CA 4JOSA 3SLRA 4DZTA 1N36B 4PSKA 2H2IA 4LZZA 1QP4A 4AULA 2R3SA 1RCTE 5DMXA 5B37A 5KTYA 1ZHHA 1ZYUA 4U7PB 1EVIA 1OAOC 5DX8A 4A2CA 2CLHB 4DQLA 1QX3A 2M1XA 2BGTA 3GUUA 2FEKA 5H3LA 3TQOA 3T1HB 1R37A 3CZCA 1AQYA 2JIZA 4MUJA 1E5QA 1W9HA 3HZHA 2IP1A 3T7SA 5AW4A 5JAZA 4I7EA 3IAM6 3V2HA 2BH9A 3SC3A 2YMLA 1I1QB 1HEIA 3A3PA 1XMXA 3L7KA 5KQSA 1RBZA 4D4IA 1TUEA 4ZMRA 2XB2A 2M6RA 4LRSB 3MJ4A 2AXNA 3Q3EA 5GONB 5LMNB 2JI8A 3QPVA 4FCCA 3S5JA 3PD7A 1BEZA 4L0CA 3NS7A 4XVRA 3WFZA 2PLNA 2ZW9A 3PLAE 1E2IA 1F6BA 3ODPA 1NJID 4X7MA 4PG7A 4BS9A 3LT0A 4KXQA 1QXSA 1SXHA 1YUBA 1W4BA 2AR9A 4BO4A 2V1UA 3GUCA 1C9EA 3QELB 4MUFA 5EP4A 2QP4A 4BQSA 5E7MA 2C57A 1NW8A 2ZM6B 3LP6A 2R6JA 3QLUA 4N7BA 3PQ3A 2P9BA 5BMVF 1DCFA 2R6CA 2R85A 4MYDA 3H4VA 5BSWA 2GGSA 4IILA 3I72A 3VC7A 3N05A 2ZE7A 1EZ4A 4IZ6A 2NTNA 1P62B 3KLBA 2YWHA 3FLMA 3K94A 1FE8A 4JY7A 4RV9A 5DIZA 1KYQA 1WW3A 5B3KA 1WEHA 4H6VA 4XD7D 1UKBA 2EIHA 2GZAA 3QVWA 4I0WB 4XCVA 3RTEA 3SQOA 2GYUA 1O97D 3QEMA 3K70C 4BO3A 4XXHA 2F17A 4JVMA 4EI8A 2YMMA 5LB2A 5A0VA 2Q5EA 1T5SA 3A6HA 1NIJA 2GBGA 3ZHYA 4BYMA 3AKCA 1KNXA 2BGIA 1U8FO 1D2CA 3KDAA 5BO5A 4KOEC 1OIWA 1LK7A 2NPOA 2NXJA 3HDJA 1U7OA 1SPXA 4UFNA 5HBGA 4X0CA 1A1VA 3QEJA 2ZZEA 4JI0B 5IYRA 1VJRA 1PWZA 4QG7A 4E4RA 2A7QA 5LQAA 4RTJA 3AVPA 5KNBH 1JHRA 1LWNA 2PXAA 3H8VA 4X3CA 3IP8A 4CMJA 3EZ7A 2QWXA 4K1XA 2IYWA 4XD2A 1GKLA 4X94A 4AIRA 5ITZA 1LH0A 1D1SA 4P2NA 5KKNB 1O6BA 2DE0X 2YV4A 4N4AA 1TM5E 3T3DA 3WL6A 4R8SA 1UKVY 1G8SA 4YA6A 2B5OA 1GFZA 3S70A 4W6QA 1H3FA 1EESA 1ZH6A 3FFBA 3IPXA 3C24A 5JAHA 1T6YA 2VPIA 2VBGA 2AOXA 3EY9A 3S5UA 3MOIA 1RRKA 1P8JA 1U8XX 2FOIA 3HVIA 4FUTA 4W82A 1TU3A 1VMDA 3T9DA 3MYRA 3RSZA 3TCNA 4CWAA 3DW1X 5L46A 3I4CA 3HLTA 2OSVA 3HM2A 5EL0A 1NDHA 1F06A 1ZL0A 1T0IA 1JIVA 3KEWA 4RPGA 2AN1A 2DPXA 4QYIA 3ZWYA 3FOEC 1PI3A 2HDOA 3QLVC 1TZBA 1QZZA 3DHYA 2RFLA 3ROGA 3CKKA 2BFDB 4INPA 3DD1A 4M86A 2X0DA 4YJGA 2X5NA 4X1KB 5EI5A 3RIEA 5K6RA 2QLNA 4B3MB 4FN4A 5IH7A 4WECA 4TTQA 1M1NB 1E79A 1EBFA 1YIDA 5EJGA 4ZDKA 5KOIA 8ADHA 1E32A 2W2QA 1I7DA 1IULA 1PTJA 4GOJA 3FOCA 5INTA 3ZVMA 2DFDA 4LVCA 2P2CA 4IIYA 4M76B 2XYRA 3H16A 5J1TB 3HAGA 4GKBA 4M9ZA 4MVJF 4TSKA 1P0CA 3EPKA 3AU8A 1BO6A 2EJTA 5KVSA 5AH0A 2CN1A 2JCXA 1YJCA 4LNUA 4OGLA 1X0XA 2JCBA 5AXBA 2A9QA 1YV9A 1ZNXA 3TJMA 1EK6A 1JEYB 4LOKA 4MMZB 1X1AA 2RBKA 3CQ9A 4LHVA 1KEWA 3OLQA 3TMKA 4BP9A 4IUCS 2AF3C 1PFYA 3KYCB 4B75A 4XR4A 1DEXA 1WVIA 4JC4A 4PGAA 3AVWA 4RE5A 5C7OO 1DBPA 2D3LA 3GMIA 4NFHA 3AFMA 3JZMA 4NMHA 2IYLD 3NONA 3ZWOA 3LPDA 5CD1A 4NNJA 3ZWKA 1JFLA 4DMCA 4DM7A 2JIPA 1AC5A 3ONUA 3CCUB 1S9HA 5THXA 1TKCA 1PNTA 3KS9A 1PR3A 1FYEA 1S9DA 4H7HA 1NE2A 5H82A 5BUCA 4PLPA 3AP1A 3PYMA 4N5HX 3W7BA 1VA4A 3MB5A 2XYVA 1D09A 4FR5A 3DP9A 4QOIA 1ZNWA 4IVRA 2G08A 3H0CA 5DXAA 1CFJA 1IEWA 3W34A 4Z1OA 3RYTC 1Y8RB 5C52B 1UPBA 3O8OA 1NUTA 3VZBA 3KJIA 5CB4A 4QHSA 1AZTA 3GEHA 1JQLB 4IFEA 3A4NA 4NAVA 5FNVA 2WDZA 1YUMA 2A30A 4CLOA 4XRGA 2UXDB 1XFDA 4Z99A 3GGCA 4X84A 4AMBA 4FQ5A 4JYZA 3TK1A 3STTA 2KLBA 3O8QB 1OHHD 3N2KB 5CLFA 2LBPA 5EZ5A 1EWRA 1LDGA 1CRZA 2N3ZA 5HQJA 1CNEA 2Q5LA 3HHPA 3KAPA 4WK6A 5U4XA 2WYOA 5AVZA 3KV1A 2O52A 1J0XO 4OFZA 4OH7A 4XQEA 1YAJA 3W5BA 3GBPA 1TUBB 1OH7A 2YZNA 2RAPA 3RUPA 1NV8A 3FNGA 5IKEA 1UBNA 3OT4A 1P1IA 5DK6A 2ALJA 1U3WA 1YR1A 3OKFA 4J7AA 4EGAA 2FF5A 2IYSA 2P77A 2PUWA 2XMGA 3O4JA 5ALKA 4V0LA 2JFOA 3N53A 1DC6A 1RQPA 1DKRA 5A4MS 2QMOA 3J81A 1S2MA 2PVCA 2O8BA 4CGZA 1Z28A 1VG8A 1QFJA 3Q85A 5GAJA 3BCDA 3VU0A 2XT0A 3NBMA 2CXOA 2AN9A 3DNMA 3H1PA 4KAJA 3C6QA 3F3KA 3VBEA 5I7VA 1U1IA 3PPWA 1JDPA 4GRIA 3AFGA 1W9MA 2X1MA 2CVZA 2NGRA 1RYMA 3R7LA 5HKLA 2WWVD 1GGMA 2HREA 4M0UA 4R81A 3CCEB 5AJVB 5G1OA 1O6ZA 1EGVB 3A9WA 4G89A 1IJBA 4P2BA 2F43B 5EXSA 3SXJA 1FEZA 4F71A 3F90A 3W2FA 4AC9A 5GADl 1NBMA 4AZWA 2BHRA 3LOUA 1VKJA 4Q9HA 3LDAA 3SF8A 2QR3A 2N9UA 3UAVA 5JD5A 2CHQA 1YE5A 1PVVA 3CC7B 4JUAA 5I8ZA 5MN6A 2A86A 1UFRA 4DTIA 4Q3BA 4XLHA 4D3YA 5ADUS 3DTVA 1AY0A 5KNCA 3RAEC 3BB1A 2BFFA 5C1PA 2X1LA 2XGGA 4ZOLA 3O03A 3W4KA 3DR3A 2HXYA 1A9YA 1H4VB 4OQFA 4LZOA 3Q3GE 4PLZA 2BM9A 4H3KB 4P8RA 5AKXA 3TLAA 2FHSA 2F3PA 3UG7A 3V1UA 4CQLA 2PWYA 1KWKA 3CC4B 2BHLA 2IUEA 3DH0A 3PJFA 4E4YA 5FCDA 5K8TA 3BULA 1EVLA 1PEYA 4HNTA 2JGFA 4YT4A 1PWEA 5DCYA 2VNJA 1PZFA 1E3TA 3BMOA 3EISA 5IBQA 5EXEA 5AW3A 3OTQA 3S2GA 5KDDA 3EOZA 1LBIA 3CLTD 3MFQA 4WCFC 4KFRA 5DXJA 4AM8A 1YJNB 4OB6A 3ENQA 3AY7A 1XRLA 4AF7A 3RC9A 4O2AF 2WIJA 4O4JA 1UWVA 1E1QA 5LQRA 2Q6OA 4S1VA 1MFPA 5CA0B 2OCAA 3PNVA 3HCWA 5D86A 2OBYA 3H2GA 1X94A 2ENWA 1X7XA 4UBMA 2Q4BA 3THOA 2ZWMA 4BZPA 5LQDA 1TQ6A 3OD5A 2IH4A 2AC2A 4E14A 2EFDB 1BS2A 3ICCA 5AKJA 2R7MA 3WKAA 3RDPA 5I7AA 1HVXA 3ASUA 3LHKA 1C9DB 3HWWA 5F7JA 3JQ9C 1KYWA 2D2XA 1NJ2A 4BFTA 2X14A 2PX6A 4BE9A 2ZSEA 1NVEA 3C5HA 1ZIPA 3D7SA 3O95A 5REQA 4D45A 2IODA 1Q11A 1W1UA 4KO4S 3FXAA 5EJAA 3F49S 1FFXA 4B84A 4XVCA 5BWMA 2B99A 1ULTA 2OAP1 3AUAA 4O4HF 4BLSA 1Z4PX 2KE5A 5LQUA 5I9NA 2VH1A 4TLDA 4YEDA 2CBGA 3ZDAA 3WZMA 1TCCA 3WP1B 1MX5A 3U0BA 1WEKA 3T54A 3WLJA 2H4ZA 2I22A 1JIKA 3CEAA 4HH1A 3G05A 1BHO1 4QGFA 1FDSA 4GQBA 3FWZA 2C2OA 5CLJA 5H7XA 3TRFA 2P3SA 1IZ0A 1PU2A 3BXZA 4IPTA 2VS1A 3K6SB 2PQ2A 4DA6A 5JYCA 2B5WA 4O6VA 2JIBA 2IVZA 5HDBB 3IRUA 1FP6A 3OU2A 1GQYA 5LKAA 4YRRA 4PM4A 4P86A 1M8PA 4QU5A 1MIOB 4G01B 5JDIA 4ZQIA 4A26A 4HPWA 5FI5A 3ZZ0A 1GNLA 4IG4A 1I8TA 1TF5A 4ME6A 3U26A 1JHMA 3RS5A 2VSFA 2Q4EA 4G0PA 3ESZA 2G5TA 4WFJA 4YNBA 2NXCA 4IDHA 4IZHA 3GAMA 3PJGA 5HF8A 3ASRA 5BSEA 3GLFB 4EY4A 1HNXB 3LLCA 3K6RA 2HPZA 3T95A 4NHOA 1TTTA 3MJFA 5EWJB 4BGEA 1W36D 1E89A 1VGRA 2ONKA 1LKZA 4BNYA 1MX9A 3OIGA 4H0FA 4D8WA 4S3MA 2QY9A 3R6JA 1KJ9A 5EZYF 2COKA 4N48A 1BZYA 4HN9A 3Q6QA 3H9UA 4QPZA 2E0IA 4F9GA 3W5HA 2EGHA 5HZGA 2IIBA 5CTAA 3P9ZA 4H7PA 4CODB 1UQTA 1V4BA 2FDXA 3ISXA 1G291 3ZQ4A 4ZYTA 1XDGA 1O0SA 3IQZA 4GOLD 5LP6A 1E4EA 3FTQA 4G0MA 1F20A 4YH1A 3ZXIA 1USIA 1L5RA 3E82A 4D57A 5KTNA 4AZSA 2R44A 2YHIA 2QTAA 2GN0A 3PX3A 5FAKA 1XWFA 2A0UA 4O1IA 4H4EA 4D81A 3R6DA 4KJZA 2JS7A 1ZISA 1DX6A 3VJMA 4CKWA 1VE5A 4DK1A 2O5CA 1RACA 4KZPA 2CB9A 4JYBA 3R9IA 2V7VA 5A0FA 5I5EA 1SIOA 2PL1A 4KO3S 3UUWA 3AFHA 1LFAA 3MXOA 4HC4A 1CLEA 2UZ3A 2F1HA 4XYMA 1Z75A 1X15A 1JILA 1RIFA 2WFLA 4JBGA 3RNOA 1M66A 5KIAA 4Y2XA 4IIJA 5M2QA 2JJMA 4HADA 4RVCA 5FA8A 2COUA 4DA0A 3KQNA 3QYPA 1K6MA 2OZKA 1EPUA 4INOA 4EJSB 2C1XA 3SJPA 4Q7MB 4IGEA 5JPCA 1NF3A 1BWRA 2ACEA 3GQVA 2AFHE 3E3OA 3MF4A 3VSEA 3DE6X 4O63O 5E7JA 1NG9A 5G4KA 1FQOA 3TTSA 5A6SA 2HJHA 2M5SA 4WT7A 1X7WB 3KUXA 5JAUA 4R31A 3L8CA 2VDVE 2I54A 3S8MA 1NM5C 1V11A 4M0PA 1SKMA 5F4MA 4RO0A 4NBRA 3C7KA 2C2KA 4ARBA 5IM4F 2AQHA 1Z12A 2HU5A 5JMTA 2WIAA 4JJ8A 3I1YA 4EKDA 4L76A 3L4JA 4CKBA 1Q9SA 4MWZA 3DTYA 5TMDA 3SX4A 4BMSA 2O0HA 1TE2A 1YJ5A 5A3SA 5IEBA 3QLUC 2QEQA 1NQVA 2BEUB 5IVKA 2YC4C 4FKMA 1R6DA 4HQFA 4F85A 1Q0RA 1ZC3A 1SUAA 3AUKA 1G20A 3CO5A 4L8LA 4JL5A 2MYNA 1D4AA 4OBEA 5KSPA 1Y8CA 4CKEA 3GROA 3NCHA 1M73E 4RLHA 4W63A 4DAOA 4IXTA 2HD4A 4FGZA 4RA9B 3W04A 3AC0A 3IBFA 1KO7A 1LWOA 2VOEA 4H7DA 5HZMA 4G4GA 3EWNA 6CHYA 4K6HA 5J4VA 5JNVA 1Q1BA 3U3JA 4RZUA 5LQCA 3FR7A 1OT3A 3ELDA 4HLDA 4G0UA 3RBAA 2G80A 5E4FA 3K0CA 5EZQA 4YHHB 3MAAC 4M60A 4RD1A 4QIHA 2P0AA 2QA5A 2I7DA 3RKSA 4YUXA 5JATA 2HLDD 3G8AA 4U6SA 2YWGA 2VXOA 1GGHA 4ASUA 4FXPA 3B9QA 4W9MC 3OOEA 5K45A 2WJAA 3PKJA 2W2XA 2D9RA 2ZS7A 4QHYA 4C4AA 5IDVA 1P2TA 3RODA 4WPGA 4RHFA 4FN5A 2NQTA 2Y0EA 1BXGA 2FR0A 3KLMX 3KB1A 5CIYA 1UZMA 2RAVA 2JD1A 3F97A 1U8ZA 2J6HA 1KO1A 4Y2HA 3ODGA 3T3GA 2E3JA 1H65A 4QUDA 4GI1A 1BU5A 5LL6P 2CD7A 4LF9B 1MABB 1Y98A 1NZFA 1DQRA 1SURA 4KE6A 3NEAA 2GCIA 1ECCA 2CL0X 3QU2A 1G7RA 3PXAA 4O02B 5LXTB 2PSDA 2QZPA 1W85B 3AUYA 2O8CB 4POOA 4OMDA 4PANA 2Q0SA 4C5AA 4DNQA 4UPEA 2WM9B 2XZDA 2ZRMA 3BB3A 1R6UA 1CR1A 1T34A 2PZ8A 3CZRA 3VJKA 1JBEA 1SQFA 2VR1A 2XB8A 3H9BA 4PX2A 5L3SB 2JJYA 2GAFA 3R7BA 4RZSA 3N39C 3TG2A 3G8YA 1JAZA 1ULUA 3PQ4A 3HXKA 1DE0A 3I9MA 4YUYA 5BNWA 3AKZA 1XTRA 4Y2RA 1F0KA 1NW3A 3R7FA 4ZCQA 4MVJD 2OV3A 5BSKA 3RV3A 5JJCA 3E3MA 4IHAA 2C7PA 3LWDA 1UM8A 3VYRB 1JP7A 4L4ZA 3GVJA 5K8IA 1KK1A 2BELA 4Z4VA 1YK0A 4NATA 4Q15A 1JEQB 1CS0A 1KEEA 4MMYB 5G02A 1JJFA 4MO9A 1BN7A 1QYVA 1WDTA 4XB1A 5ECGC 5ENVA 3BK7A 3AR2A 5EJ2A 1JLHA 5T4FA 4KK3A 2H1SA 4BPBA 4EF6A 2VNKA 2VUHB 2PGDA 1L7QA 1U8YA 4J2TA 3K9CA 4UHDA 4PFSA 5ALMA 3CLSD 4NX2A 4B8YA 4EO9A 1S96A 1GFIA 1N2EA 2I2FA 1OFUX 1QYXA 4X7RA 2EKLA 1ZO8A 3RIGA 5EKSA 4HBGA 4EFNA 2R0QC 3VR2A 4ZI2A 1QIKA 3KM0A 4WCVA 4QLBA 3WLOA 4MJLA 4YB8A 3ND6A 4C7XA 2FQYA 3VV3A 1YR8A 4QQRA 1FDTA 1KIMA 4JUDX 3U31A 1DBRA 1O9HA 3HYSA 3IURA 3ZVNA 4EYSA 3QUTA 1V96A 1NU8A 3CLHA 1G6KA 2E48A 4QU8A 3ZPXA 2FV8A 2GUGA 4E5UA 1ZC4A 3EXEB 5IDQA 2BHNA 1ZOIA 1BKYA 3U39A 3V1MA 5JT1A 2JI7A 4TS9A 3V4VB 3HFSA 2FMTA 4R1QA 1QZ3A 1UD2A 2D5CA 3HKCB 4AVZA 2KYRA 2KS6A 2OFOA 3M4ZA 2MHCA 4JBXA 1EDZA 5FL3A 4TWIA 1RPZA 2ZSDA 4BIIA 2G4CA 3U1VA 5A8AA 2E49A 1LV8A 2D5BA 3DBRB 4GKJB 4RJJA 1SBYA 4HS9A 3OTOB 3SYLA 3S1AB 1T9AA 1VCMA 4WLNA 2DP4E 3DDCA 1ENOA 3RUFA 5KYWA 2Z2KA 3AUUA 2AG6A 4B1FA 2OMKA 4IVNA 4G07A 3R5SA 1UOPA 2Z2YA 3M4YA 1Z68A 4JXKA 4D25A 4AJHA 4XMYA 2HW8A 4LSMA 4WESA 1JS1X 4J07A 4A8HA 4MKGA 5LZ9A 4RD0A 3NETA 1M1YB 2O7RA 1A95A 1RU3A 1KAMA 2CNWD 2EKBA 2B8TA 4PYMA 3WL5A 1XZIA 5KX5F 5U4QA 1UXGA 1QFSA 1AM4D 4MINA 1Q6YA 4IWNA 4Q4AA 3COJA 2Y93A 3UVEA 1K68A 1FS4A 1MPXA 3DGFC 1PD1A 4QELA 4Y67A 4DLBA 5JTTA 1GV1A 4MKFA 1RFGE 3NDIA 3LX5A 3WLQA 2PKXA 1VOTA 4GYWA 5AVXA 2ZRKA 2QSYA 5J4LA 4NZNA 1Z38A 2VJCA 4DDKA 3IODA 3LUHA 2WYRA 1PG5A 3QPDA 1NVBA 1F2UA 1QAQA 2F3TA 2HYDA 3FVRA 4QDXA 3BCSA 4N01A 2HHCA 3L5KA 4ARIA 3AFNA 3ZBQA 4NFLA 3QTLA 1N2OA 4KR6A 2Q27A 1J6UA 3PIDA 4OGKA 4EYKA 1HY3A 1KZ7B 3IP3A 3H5LA 1L7PA 4D0LB 1JQDA 2XQKA 2DHCA 3WGIA 2AQIA 3EFOB 3P2OA 4LYAA 4QUIA 1EQ2A 2QZ4A 2BHTA 4I9HA 3RSCA 3P19A 4CIVA 1M6VA 1P31A 5I9SA 3DR5A 3KYDB 3FVVA 4RTKA 4HK4A 3T06B 1J99A 4YAGA 4QOEA 3ZU2A 4A8TA 3Q9NA 1CP2A 3STYA 5JUWA 5HUHA 3KXKA 1OBOA 4YIHA 1U1GA 1NT4A 1P0MA 4JKIA 1GPNA 2GRUA 3GGGA 1J5PA 4NZ9A 3MCUA 1PV4A 3P8ZA 1JGTA 1D6NA 3H1AA 3K8YA 5JROA 4D6PA 1A77A 1P0QA 1ZNYA 3TTYA 3UJ9A 2AJDA 2BSXA 2QSZA 4HTFA 4DYDA 4QEKA 4S1TA 1YK1A 4E5VA 4FT2A 1A76A 3SWWA 3ZLUA 2XE8A 4FZ5A 4Q21A 5KNLA 2YUTA 2IDJA 3C1AA 3GEDA 2F1IA 3MIIA 2GEJA 1Z7EA 2H2GA 2YZ2A 2D4HA 1WNFA 3CX8A 4OXYA 3TVDA 5DYNA 1G64A 1Z56C 2ICAA 1SJ9A 1XSEA 3I61A 1L7AA 1FBNA 2C03A 4R69A 2VPYA 4GM0A 4K6FA 2I4MA 2ZTHA 2ECKA 1MT0A 3EGOA 2R7LA 4OU4A 4WGFA 4DM3A 5JJLA 3T7AA 1OC2A 3Q7TA 4MP3A 4CV0A 2XTZA 4GPBA 4BFCA 1CQPA 5K3SA 4TZKA 3LC2O 4WK4B 4YCCA 1YQWA 2I6TA 4M2LA 1ULAA 2DT8A 1K06A 2PAAA 3DO6A 1ZI8A 5AK5A 4E4TA 1L5GB 3TLKA 1KYYA 4AICA 3W5JA 2ZUSA 2VDMB 3GLRA 2RGYA 4Y2GA 4MVJH 5M04A 1Y5LA 1UPFA 3D6VA 3INYA 1JR3D 5FUMA 4FNAA 2Q1YA 4JX8A 2LCQA 4Q1BA 4BLVA 1Z4MA 3CW2A 2ZXIA 4MV8A 5F5XA 2VC2B 4RDCA 5B12A 5JDIC 2H0QA 4GPD1 3OCYA 3SYKA 3W2TA 3MOGA 1OTHA 2SHKA 3LHSA 1I2AA 1RHKA 2A8YA 2WJZB 2PZBA 1FMJA 1I5EA 1LSOA 2G0NA 3FSGA 4RWEA 4DCOA 5C5IA 5KZMB 1UBJS 3K05A 2W2PA 4Z4CA 1YKSA 4RK7A 4WINA 1R8QA 2OKCA 1X7YA 3UMMA 3B8HA 1AQLA 4DZZA 2VNHA 1JDNA 1RNLA 2YV5A 4B6PA 5AXAA 3NB0A 1HLDA 2VYFA 2XA9A 4ISBA 5TQJA 5A5GA 9GPBA 1M10A 2C5HA 5KOJB 3ABQB 3FHJA 4BY9E 1PJZA 3GVIA 1ZD9A 3RVNA 4ENPA 1RAGA 2QX6A 4A4DA 2UZ1A 4LJAA 1PTKA 3GMDA 2NO1A 4LJ5A 1K7XB 3OESA 5HNKA 5KAMA 3PC4A 3ASYA 3ESDA 3IXQA 4CG0A 1YHZA 4P7FA 4G4SP 5JASA 1J8YF 5CH3A 2VQEB 2Y1LA 4QRIA 4EQ6B 3G0IA 3MPUA 1CQIB 3OJEA 2ZAIA 5LP6C 1NRXA 5EJ8A 1XROA 4D7AA 2HZ7A 4OHMA 2IXFA 2Q5OA 1YGYA 3GPDG 4NMXB 4MX8A 4XDYA 2NSYA 4WE3A 3EPJA 3VKGA 2YHAA 1U0TA 1QDUA 4LDAA 1NBIA 4LZAA 4PYOA 1BU8A 1GNPA 3A9VA 2H7VA 4AUMA 2ZLBA 1M6EX 4LYJA 3H5RA 2WTMA 2CMKA 3SJCA 3EW9A 3VFDA 3W6OA 2F1LA 4MS3A 3BICA 4LC9A 1C1DB 1D0VA 1MCZA 2HF8A 3EEBA 1IL0A 2NUBA 3OZXA 4HGOA 4YCJA 4L4UA 5FOXA 3VI4B 5J4KA 1BRTA 5A0TA 1CULC 2IP4A 1XDBA 2QUAA 4IVQA 6GPBA 1ZD5A 3DEFA 3TGPA 3JAKA 5LOVB 1MQAA 2D2IA 1YU6A 3EGCA 3EBLA 3HUTA 1PKVA 1HOXA 3K1AA 2XOEA 2H5LA 1U7DA 1KMCA 5A3VA 3KZCA 1FUUA 2HX1A 10MHA 2GM9A 3MCVA 1R66A 2QVLA 2GO7A 3ZHXA 3H9NA 3GCZA 2LZJA 3ROFA 2QTRA 2P0YA 2A1UA 3H9QA 1SC4A 4F1JA 1DJOA 2Q4DA 1HDYA 1OI2A 4OXXA 3OQBA 1NW5A 3QPCA 3IB6A 2FG5A 3ZY5A 1AT1A 2B7BA 5JAPA 4Q9NA 2JFUA 3D3KA 3SKBA 1Z5ZA 3THRA 1V5VA 4P9NA 3PUYA 4YMGA 2I55A 3L1HA 1DS6A 4HTAA 4XUDA 4Q3AA 1H3EA 1X7GA 1LVGA 3CB4A 4K6OA 2VK1A 4ZN6A 3EVCA 2XUQA 4XX0B 2IC5A 2O3SA 2IZ1A 3PFNA 3R0VA 1M83A 2C61A 1DJMA 3OEHA 1KI6A 1KRHA 1FTWA 1M2HA 3AUJB 2JCYA 3EVAA 4I4CA 4J75A 2NYVA 4F8JA 1B42A 1J8VA 2PKQO 4ACAA 1T6XA 4RF5A 1H1LB 4KBYA 4HDNA 2HUNA 2Y1WA 1EWYA 4H1WA 5CEJA 1UBKS 3JYLA 1YHQB 1K1EA 2O3RA 4JASB 4MRAA 3KXLA 2WB4A 4RKQA 4Y2QA 5E2BA 4AJ4A 1DOZA 2H2AA 2JC3A 2GAJA 3V1YA 3W9UA 3IV7A 4UNNA 4MS1A 3UMSA 2JBAB 4G41A 4IX1A 4RF3A 4QZVA 1K86A 1AKUA 1MO3A 2J9FB 3G8DA 1DQPA 3NI2A 4I9UA 2WU3A 3K0CC 1JVBA 4U2BA 2C0PA 5M3BA 5SZHB 3FSJX 3VYWA 2WAYA 3BJRA 5EERA 4MHTA 1T8RA 3Q72A 4EK9A 4D2IA 1EFRD 1QRTA 2XZPA 2PL9A 3T0GA 2BGUA 4IDBA 4LFCB 3UJ6A 1KY5A 3OQMA 2B8NA 3BUSA 4FYHA 3U4GA