1QGYA

Ferredoxin:nadp+ reductase mutant with lys 75 replaced by glu (k75e)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEELRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferredoxin--NADP+ reductase
publication title Structural analysis of interactions for complex formation between Ferredoxin-NADP+ reductase and its protein partners
pubmed doi rcsb
source organism Nostoc sp.
total genus 90
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qgyA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qgyA02
1NJID 3VO1A 3W2FA 2AHOA 4TN1A 3CCEB 2EIXA 2OTLB 5AN9A 3CC4B 3W5HA 4YALA 1DG1G 3ZC3A 4J0QA 4U9UA 1EXMA 4PC6A 2NPFA 1TTTA 4B44A 2OTJB 3I55B 3CPWB 4RD2A 4ACAA 3W2GA 2QTZA 4LBVA 3MHPA 3ZZTA 3P26A 1KK3A 2BM1A 1EWYA 2OK8A 3QE2A 1VQOB 1S0UA 1F60A 2DCUA 4M53A 2HMAA 1DARA 3CCLB 3ZZ0A 1K9MD 2DERA 3WY9A 4NCNA 3LVBA 2E1RA 1VQ7B 1N0VC 5GV7A 3ZZUA 2DEUA 1QVGB 4RD4A 1F20A 1EP2B 5H5JA 1FNBA 1QUEA 2QDXA 4YAFA 2XNCA 3AVUA 1JNYA 1D2EA 2QTLA 1BJKA 1A8PA 5HXBA 4ZGQB 3W5UA 1KRHA 3G4SB 3OZWA 3PENA 3AVTA 2D74A 1QGYA 2BF4A 2BSAA 1ELOA 3CMEB 3CCMB 1KQSB 1EP1B 2BM0A 3CW2A 5GV8A 1HA3A 1FRNA 3LRXA 2BVNA 4RCYA 1BX0A 1QUFA 3FJOA 3CCUB 1EFTA 2HCJB 1VQ8B 4P6VF 2GQFA 2GPJA 2VZLA 3V76A 1J9ZA 1BQEA 3CXCB 3ZBTA 3E20A 3CD6B 4NBSA 4YAOA 4EH1A 1JA0A 3AVVA 3P27A 3E1YE 4P3YA 4B43A 3MCAA 1W87A 1YITB 4ZCMA 1VQ5B 2XEXA 1S72B 2QN6A 4YHBA 5TY0A 5FA6A 2YWEA 3QSYA 2J7KA 3WYAA 4BPRA 4YAWA 2PMDA 2C77A 1KD1D 3W5VA 4G1BA 2FX3A 3AVYA 3ES9A 4Y9RA 4AC9A 1TVCA 4Y9UA 4Q7JB 3OW2B 1N8RD 4AF6A 1R5BA 1DDGA 2BGIA 1QGZA 3QFRA 2B7CA 3AGQA 1H42A 4FN5A 4F7DA 4C43A 1SM4A 1B23P 3OZUA 1CQXA 4G5GA 2DETA 1K73D 4AF7A 4ZV4A 1JJ2B 4ZCIA 5EMNA 1QH0A 1FNMA 3WNCA 4Y7CA 4LBZA 1EFCA 2C78A 2BV3A 1EP3B 1VQPB 1G7CA 2CNDA 3A1FA 1W35A 3QFTA 1CNFA 4N3GA 2PIAA 1GR1A 3WBKA 3FPKA 4PC7A 2X3UA 3W2EA 4R71A 3U6BA 1QFZA 1OB2A 1CNEA 1QG0A 1ZM3A 2ZITA 4YAUA 2VNKA 4RD6A 5DSZA 1EFUA 3MMPA 4WQMA 5JBQA 2EFGA 1KK0A 3W2HA 4TMWA 1YJWB 3LO8A 3QFSA 3CCVB 3J81k 1AMOA 1Q86D 5THXA 2YWHA 2B5OA 1M1KD 3CC7B 2DY1A 3WNDA 1YJNB 3CC2B 2HDNB 1W2BB 4MYTA 4FK8A 3ZBUA 1VQNB 1KK2A 2YWFA 1KK1A 2RC6A 3WNBA 1QVFB 2CRVA 4DQLA 1GVHA 3I56B 4G1VA 3LYUA 3CRZA 1SKQA 4DQKA 1OGJA 5H59A 4RJLA 3W2IA 1GAWA 2QEXB 1GJRA 1B2RA 1XB2A 2VYQA 3JQPA 4FWTA 4M2LA 4B4DA 1ZM2A 1YJ9B 1AIPA 3CCSB 3AGPA 1IJEA 1IJFA 4ZCLA 1FRQA 1G7SA 1R5NA 3OJWA 1Q81D 4LBWA 3WBJA 1M90D 1QGAA 4B47A 4TMXA 3QFCA 2BMWA 3VO2A 1H85A 1FNCA 1YI2B 1GO2A 3CMAB 1D8TA 1YHQB 1QFJA 4K1XA 4PC3A 2OK7A 1GAQA 1TLLA 4H9GA 3G6EB 1R5OA 4C0SA 1G7RA 1QFYA 4HE6A 3VMFA 2VNIA 1Q7YD 4B48A 3CB4A 1N0UA 1ZM4A 1VQ9B 4TMZA 1G7TA 1VQLB 2VNHA 4TMVA 2RC5A 1XE1A 1ZUNB 1JA1A 2BGJA 1KC8D 1Q82D 3SJZA 3OJXA 4PC1A 2QMUA 4N3NA 4ZGNB 1D1NA 1FNDA 5TR9A 1DDIA 3AVWA 4MYUA 3AVXA 3WXMA 1JB9A 3B82A 1I7PA 4LC0A 1OB5A 2B7BA 1BX1A 4PC2A 4ACBA 2QA4B 1E62A 4LBYA 1NDHA 2BN4A 1K8AD 3I1FA 1IB0A 3VNVA 4RD3A 3CCJB 4RCZA 1UMKA 2BPOA 1QX4A 4B3XA 1E64A 4IW3B 1VQKB 1WDTA 1FDRA 3OZVA 3VNUA 4HE5A 3B78A 2PLFA 2R6HA 1W34A 4QHYA 3B8HA 4M1KA 4QFMA 1U2RA 1OGIA 1KJZA 1TUIA 2VNJA 3CCQB 1YIJB 4RD0A 1VQ4B 1E63A 2XNJA 1VQMB 3JQQA 1KTVA 3JQRA 2YWGA 4M4SA 4TMTA 4UAJA 3U6KA 3U2QA 4M0LA 1ZM9A 4PGOA 5KSWB 3CCRB 5TV2A 4RD1A 1VQ6B 3G71B
chains in the Genus database with same CATH superfamily
1JDZA 1KSFX 1NRJB 1OLSB 3BSFA 1T34A 2VZ9A 4FQ7A 4UZFA 1AS3A 1F14A 2CV0A 5KYXA 3DZFA 5DGHA 2CL5A 3VYRB 4IS2A 3ZX5A 4NMXB 4HT3B 2XCQA 4MX8A 1L5NA 3KHKA 3TGWA 4LGMA 3S44A 5HIAA 4BQIA 2JAQA 3EOZA 1YZ3A 1NN0A 1GN8A 3AI1A 5JAQA 1QVAA 4FHZA 2IYTA 3RUFA 4MGHA 1AM4D 1BCSB 4DM3A 2P78A 3ODPA 3VR6A 1RFLA 3QY9A 3R0XA 4K8RB 5JALA 4HNAA 4HTAA 1M1ZA 1UKBA 4R2MA 3QE3A 3EUAA 3AI7A 3PR3A 4D3DA 2Q3CA 3UMSA 2FQXA 1Z6YA 3LWDA 4RV4A 4HS4A 2QAGA 2IRWA 1ABEA 3T51B 3D6MA 3WY9A 3UH0A 1SQGA 4BVBA 4MEBA 5LZ7A 5CT6A 2ZXIA 1E1LA 1HT2E 1P7WA 3CF2A 2HYIC 3OZSA 2AFHB 2VEDA 4BRZA 2HTFA 2QVBA 2M32A 2RB4A 4KN6A 3EGDA 2CB0A 4KBGA 3EW9A 3HA3A 5K1ZA 1FP7A 2Y6UA 5ENDA 5C4MA 1ORWA 4DLYA 5J43A 5CK4A 1M5TA 4WPGA 1IJBA 4MUMA 3AFMA 1KJQA 1QHNA 3PEUA 4ON9A 1GV0A 4DM4A 3QOYA 5CFMA 2QDXA 5E8JA 2IH4A 1BKDR 4IZOA 1SELA 3DEZA 4WKOA 1EFVB 3GLGE 3CLKA 4AQYB 4G7WA 2OYRA 1WP6A 2ZBEA 1DQSA 4PHTA 1GPDG 1I5EA 1YS6A 1OYYA 3NOXA 4AN0A 4PG8A 5IJWA 1JTVA 2WIJA 4MROA 3TSAA 3N2LA 3UMJA 5DOVA 4LZJA 3IT0A 3IDQA 4XAQA 3D8NA 1PNTA 2ODNA 1W9HA 3A9SA 1YR8A 1Z88A 3LF2A 1M1YB 2UZ0A 4KKXB 3KKQA 4Y3UA 5B1HA 3ZWPA 4NFHA 3KPUA 3PJDA 3A3GA 1PQUA 3GU3A 4HFRA 2ZXEA 1FYDA 2XMCA 1OU0A 3G02A 3M5PA 1KQSB 1YOVA 1VLOA 3RNLA 2FUCA 1JHXA 2PPLA 5B4TA 3RVNA 1DEOA 2M9MA 3GZTB 2CVFA 4BOYA 2DFNA 1BS2A 2GEBA 3U7HB 2C5SA 2NTYC 2IZ1A 5LP6B 1ETUA 4OLAA 1BD3A 2O3QA 4MRMA 1QRRA 1CQJB 1Q2XA 2H2AA 4QYTA 1EU1A 2WC1A 2QTMA 3ADOA 4WBNB 4QDJA 1ENYA 3CCUB 4R8KA 3K2BA 2PAAA 4EK9A 4CIAA 5CR9A 3ETJA 2VZLA 4AMGA 4PABA 1UJ4A 2QMHA 1HT1E 1TGYA 5IU6A 5D8DA 4JSYA 5LOVB 2XQVA 2F4VB 2I7CA 1GNPA 3H6HA 4D8WA 3KTAB 3DZGA 5CDSA 1OKKD 3PFKA 4NOJA 5BQ3A 2H7VA 4KXUA 1G8AA 1KAEA 1CUEA 4R3UC 5EMLA 1HETA 1KFKB 3FUVA 1T1GA 1R37A 4RO0A 3JVUA 2AJTA 2P5YA 5E4YA 4F8EA 3KYBA 2V59A 1LW6E 1RXUA 4P3YA 3HPRA 3KUUA 3ZG6A 5IKOA 2C0PA 5AM4A 3ENZA 3WL4A 5TX7A 1KS2A 3BMCB 2R96A 3IEKA 1O97D 4P31A 2CMDA 1ULTA 4WZZA 2XXAA 2QTWB 4GS5A 3QNMA 4X0EA 1D9ZA 3HCCA 3BXGA 2O7VA 1UBNA 2LD4A 2XXJA 3NS7A 4YJFB 3JU4A 1L5GB 4XIGS 4MUAA 1D4ZA 2IVFA 2NT3A 3PUWA 4Z2YA 2BMEA 2OO5C 3K0AA 3ONWA 5E2BA 2F00A 2R751 2HMUA 3LCMA 5G02A 3D7KA 1K97A 3VU3A 2FX3A 1X74A 2P9YA 2I9PA 3L0CA 4B4UA 2FSFA 4TYPA 4LX8A 4OB8A 4H4EA 1KI6B 1WM1A 3E81A 5DTEA 1JVSA 1WU7A 3U0VA 4C7OB 1T9ZA 3FPCA 1YQWA 2XB6A 4ISBA 2VYNA 1XNRB 1SBIA 2OBSA 3L6UA 4K46A 4W82A 2DT5A 4XB2A 2JZCA 5IFKA 3THYB 3EEFA 3A7EA 3STYA 4HAZA 2OV1A 1ND5A 1I8DA 3HYTA 1GQRA 3PQ7A 4LRTB 1MIOA 3WO1A 1NQWA 2Q3JA 4K03A 5LQMA 4ND3A 3IBFA 1CVIA 2RK3A 3AESA 3FGNA 4BZPA 3R6KA 4C7KA 4DJJA 3EPRA 4I4TA 4PR0A 2P41A 1JPJA 4LV6A 5F7OA 3D02A 5KHOC 4NY1A 1TFUA 2QIPA 4OFWA 1ZGBA 3SYLA 4B81A 2FDCA 1ISHA 2CB9A 3TIGA 3J80A 4H3HB 1KC3A 3I28A 3JAWB 4JJ7A 3W9BA 2FEXA 2CLKB 3OZUA 4N7JA 3WV5A 1FYXA 2OESA 4I8DA 1PJ7A 2Q6OA 3KSZO 3TB4A 4FYYA 3NHYA 2VJPA 2OO5A 1T1SA 3BB4A 3FSJX 4HMPA 4C89A 4K9OA 2XZPA 2C57A 2VBCA 2ZRJA 3IMFA 2H57A 4Y2XA 1DKLA 1V3VA 2BFEB 2BDTA 3I0ZA 3OZFA 4FKBA 3FOCA 4FW8A 3RT1A 4ASUD 2WICA 2YJTD 3T9BA 1SXGA 4D92A 5IKEA 2GBIA 1GZ3A 1H6DA 3GYGA 2AB0A 4E4RA 3ZTTA 4UW9A 3G88A 2IXFA 4TZ6A 4LBZA 1Y4DE 1YRYE 3SM3A 2HW8A 1R0CA 2OXTA 5FL7A 2PKYX 5K3SA 4MB0A 3MTJA 2FV8A 2L42A 3OQIB 3TIVA 3QFTA 3BEOA 1RE0A 4YV0A 3DOUA 2CFSA 3UM9A 3KQLA 2DWCA 1GGHA 5FPHA 1F0PA 1FSSA 2RBKA 2CZGA 1U04A 1ZJWA 4MYRA 4RM2A 4PC7A 1YR7A 2A0XA 2I8LA 4BLUA 2D2IA 2IWHA 5KNDA 4ILEA 4CQMD 1QVWA 4E13A 3RODA 4B2IA 5K05A 1ZL0A 2F1MA 2YHBA 2HFJA 3L8DA 3O8QB 3QWBA 4R2IA 4WNCA 1N5MA 5H16A 1MO6A 3TG2A 1QVVA 4LOIA 3HXQA 1F0YA 2PR7A 3PEFA 4RV5A 2G0NA 4HFNA 4OU4A 5J58A 2WPDA 3MMPA 4WQMA 2MMCA 4OPVA 1FP4A 1MJHA 4NCXA 2KMLA 4RU1A 1U2DC 1GN9A 1ZU4A 2GXUA 4X61A 4XYBA 1SOVA 3WC4A 3EXEB 3F6BX 3ZY6A 4L6CA 4L50A 3U4QB 1L7QA 4WINA 3CCVB 3NDIA 4H1VA 3OF3A 3EDYA 3WISA 1Q86D 1SC3A 2HNAA 4K6FA 3WYGA 4ENQA 3BE6A 4E70A 3HJCA 2B5OA 4L8GA 1A5SB 1DBSA 1G20A 2HU8A 1YJNB 3EJWA 1W36D 2H8KA 4G97A 1KY5A 4HHEA 4P9SA 4UTZA 3CBQA 3NETA 2G40A 2DKFA 3VVBA 1KQGA 1Y1TA 2C5AA 1W2BB 4NV1A 4DLZA 4ITVA 1NNLA 2FQYA 1X38A 3SQMA 2H07A 1JKJA 3UJDA 4FC7A 3RM3A 4QJ3A 2WAXA 5EIXA 2JFFA 1QHHB 1W0JD 2ZUTA 1Z83A 1NATA 2P11A 2JGKA 3JALA 4XE5A 3CPSA 4RS4A 1STOA 3KZ1E 3DBVO 2PX5A 1MAUA 1HI9A 2MJLA 1VMEA 3MS2A 1SAYA 1X70A 4P3XA 2H6EA 3DVSX 4PQFA 4G1VA 1KSJA 3WNZA 1QTRA 3HA5A 2CDBA 4HAIA 2BHNA 2WJIA 1ZIOA 2IXAA 3F4LA 3NAZA 1CUHA 4E3WA 3X1WA 1BH6A 5BOSA 9GPBA 4YJHA 5IBCA 3ONDA 4DV2B 4Q3BA 3UNXA 3DZKA 2ZJ0A 1A98A 4XUEA 5LYJB 1M0EA 4ETNA 2P6NA 5FUMA 1ZD5A 1ZUIA 2I6GA 4YDHB 3GI1A 3ZWAA 3K32A 2Q5JA 4M1SA 4E07A 3ODGA 5CLIA 1ZOPA 1TJ5A 1QDEA 3GZNA 4HXEB 4PO9A 4LK2A 1HFKA 3V1YA 2IEYA 3VAYA 3ZDXB 3LSYA 4YJ2B 3U9TA 3L6CA 5ALIA 4CDNA 3WMWA 3LVQE 2CHUA 1ULBA 1LWNA 2V9ZA 1UANA 1M34B 3KUKA 1E98A 4FWTA 1ZCFA 4TLLB 3WGQA 5BYKA 2TS1A 1LF5A 5GJVC 1XHEA 4GGMX 1X0VA 2HMWA 4C3OB 1CRQA 5JANA 5JNLA 4ZQEA 2QMYA 4WJLA 5C8YB 1PYOA 4K6HA 4P84A 4QGSA 3H2IA 1FU7A 1X39A 5DSXA 1SCUA 2C92A 4ABTA 1RTTA 1N0IA 1YZYA 4PIPA 5BSMA 5LD2C 1M2GA 4LV5B 1P4SA 4KBFA 4OBXA 4XR6A 4UHEA 1TCBA 2RGAA 1W88B 1TYAE 2D8AA 4D9NA 5EHXA 3KOZA 4L6AA 3PTLA 1DCFA 1QJCA 2XDYA 3DWIA 5FTJA 2CLLB 3HA2A 4KQHA 4RANA 4V2UA 1BKSB 4JYPA 4ZOLA 4HVCA 2PTHA 4MHOA 4PCLA 1Q7BA 2HSGA 2P6PA 3QFCA 3BWDD 3FMPB 2E4UA 5EP1A 1JJAA 4EL0A 3SE7A 1N5IA 1NQAO 2ZQYA 3GT4A 3THXB 3LBYA 2A84A 2FWBA 1YI2B 1U3FA 1FRFS 2CMHA 3BYZA 5EC8A 5J2UB 3W6PA 3OE1A 3DBRB 3FI0A 3OEHD 1SZPA 1ANKA 3LYHA 5SYAA 4TPKA 2R00C 2NN3C 2YN2A 4RJ2A 3ADCA 5ERYA 1EA5A 1QFJA 4XM3A 1IM2A 2A9RA 4M8IA 3EDOA 4TV9F 3PHHA 2VPWA 4CWAA 3KRTA 3OCXA 3EZ2A 3A6PC 4HUJA 4P3NA 3RS8A 5EUMA 5E1BA 1Y1KE 4ZVSA 1G7RA 5KDLA 2ZTUA 1C1HA 2AUNA 1PKEA 1I32A 3I6BA 1N6NA 3OMXA 1AF7A 1G1MA 1YI8A 3AG6A 5GPBA 4DHWA 4I6JA 1MOZA 3DP9A 1TM4E 3PQ4A 4PAGA 4QELA 4F2DA 3CB4A 4ZICA 4YUVA 2W9XA 3B5EA 2AW3A 5AM5A 2JD2A 3DE1X 3QK7A 4JP1A 4NU0A 2ET6A 2HWUA 3IAUA 4OXXA 1YHZA 3R9IA 3VI3B 1P17A 3WIUA 3AEKB 4D9IA 2QUJA 4S1TA 4AB1A 3WLTA 4RPJA 1CYDA 1T5IA 3X2FA 4AKHA 3E05A 3G23A 1JR4A 3I04A 2H59A 1XLWA 2J41A 4AIIA 4DIEA 2OXEA 4HQ6A 3O7WA 1VIAA 1KQOA 2XWBF 4C21A 4ZGNB 5I7HA 2R00A 3ACDA 3MMNA 4Q1FA 3U3JA 5FR1A 3DKVA 2OE2A 1NKVA 2ZIAA 1P5FA 1X7DA 1Z8HA 1KMQA 1RI2A 4PG5A 4PXAA 5EI5A 1OZ0A 2A0KA 3ZDRA 1YKSA 3ASYA 4OK3A 5FO1A 3K0HA 2FN4A 5EHQA 2F6RA 3JQ9C 1U0OC 2VDJA 3OQHA 4CM5A 4OL0A 1NLMA 1XXHB 4HN9A 4RNCA 4HR7A 4JLUA 5JE8A 3L01A 1SIUA 3Q1LA 2BH2A 2QUHA 3Q8KA 1H8HA 1NDHA 2PWBA 5CYFA 1JEQB 2W2MA 2ESRA 3OUTA 2ZI3A 3CV3A 4NNOA 3FDZA 1Q14A 3SXUB 3F8TA 4JSRA 2A5DA 2ZJ8A 1IB0A 1JPUA 4FZ5A 3EVTA 1I4EB 4YRFA 5FAXA 1FVOA 1XOIA 4REQB 1KO5A 1TUGA 2JLCA 3OQJA 3UWSA 3WA6A 2R9VA 1U8YA 3FNEA 4KO4S 4C3ZA 4DEYA 4GXRA 2VAXA 4ZO6A 1UPCA 1OI4A 2NZWA 4EPWA 4NABA 4FBGA 3LTEA 3HCAA 2YCLA 3O31A 4LJLA 3WYBA 1I7QB 1GEEA 2AEMA 2P1RA 3GY0A 2B69A 3IUMA 3D3JA 1F2UA 4PAOA 1E1RA 3L79A 4MJLA 3UH1A 4B4VA 4HWKA 2RAVA 3N3BC 3TTVA 4AW9A 4HXFB 2AX4A 2V31A 1OX6A 1E2UA 2QZJA 2XVXA 4KFUA 2ADMA 4DSZA 3HZOA 1J09A 3HS3A 3L7AA 1P61B 2IV7A 4JX9A 3MTEA 3O2JA 3E18A 4CR7A 2AD1A 1X13A 3G8CA 3LCUA 3N2KA 3DMHA 4ZTUB 3FR8A 1ZMXA 2R6HA 3TVTA 3FPBA 1D2NA 1N3LA 2LGJA 5FT9A 3TPCA 4I4TF 4CKWB 3QHPA 1E3ZA 1DKMA 2O2XA 3T34A 1XELA 4E2ZA 1U5AA 2EQAA 4WCFC 5TRDA 3DJYA 4KN8A 3ECSA 3H9GA 1TLTA 2WZDA 3MQ4A 1ZR2A 3NM5A 3BK1A 2I1QA 4Q12A 3RVKA 4HEA6 4UCFA 2W22A 4C6RA 1PV1A 1W2HA 5HMMA 3T7KA 2DFKB 2FPGA 2ID7A 5KWEA 2OBYA 5CHEA 2WDZA 1PGOA 4MITA 4X05A 4G7XA 5BSWA 2PRZA 3LJKA 4IHQA 4Y18A 3SN6A 5FOQA 1HNZB 2DHEA 3ITEA 4PCVA 1NP7A 2CFRA 1T36B 4GI2A 4ND1A 5IAOA 1X3SA 4CF7A 1FNNA 3DLCA 6PFKA 4GXQA 2V58A 5IFLA 5K6RA 3TCKA 1V43A 3ER8A 1D6NA 4DCMA 3H9JA 1P33A 1EGAA 3MCWA 1XAIA 3MJEA 3C7AA 3D6UA 4KDFA 2FMIA 3W78A 4DILA 1Q1BA 3LW7A 2P3QA 2IHBA 3QEMB 3CVYA 1VDZA 4P9NA 2NVUA 1NIPA 3Q85A 3RVSA 1L4NA 3KSUA 1QC5B 3IR7A 1DAHA 2H2WA 4I6GA 4J0QA 4OQQA 4WCFA 4WVLA 2BEWA 4F1WA 5FWDA 1L7PA 2NP7A 1E58A 1IFXA 1N2XA 1REQB 1XRJA 2GGSA 3GLQA 4J29A 3CPWB 4F06A 3TUZC 2JD0A 2O8DA 5K4HA 3UC5A 4UBLA 2R8XA 3HXTA 3PCXA 2OZKA 1SCQA 2FUG6 1LPPA 3RROA 2CZQA 1I33A 1S0UA 1UD6A 3TXYA 1SXPA 1LPNA 2WRZA 5EXDA 1WY7A 5I3CA 3URKA 3K6SB 3ZCRA 1Q1AA 4IAOA 3DTYA 3I9NA 5CFZA 4NCNA 2FR0A 1ZI9A 2VVTA 5M34A 2LVBA 3A31A 4O25A 2F3PA 3T3MB 4X7BA 2VNAA 4WJKB 4BLQA 3CISA 3ISXA 4P86A 2DGDA 3WNVA 1Y7TA 2CXRA 2MSWA 1Y7IA 2PXAA 1RNLA 3CEMA 5F4JA 1VI5A 3T5TA 4Q00A 4AJIA 3UV3A 4DCVA 5C1DA 4URYR 5AUQA 5ALFA 2J4DA 3KS9A 2JCGA 2YZGA 1Z4LA 4IZIA 5THKA 3WQQA 1E2PA 3Q0TA 2JLRA 1K06A 1V25A 1JE0A 3A3PA 3IDAA 4J0JA 1C7FA 3PA1A 1Y6RA 1FJHA 4LHVA 1RMTA 5CJ2A 5EJFA 3O1LA 1X6VA 3AHHA 5LFAA 1HM5A 1QS0A 3QXCA 3LZ6A 2HU7A 1GXSA 1ZEMA 4JEUA 3MOGA 1HZJA 2WYIA 1E99A 2REQB 1WUKS 3I76A 2HNKA 3P0HA 4QV2A 4JB8A 1H0HA 1KR5A 1E3TA 1P8AA 3L41A 4IJUA 1BWRA 1BMDA 4G23A 1CJSA 4B3HA 5ALLA 3B6MA 1C14A 2ZSIA 3B9RA 3CLSD 1IZ8A 3ACCA 3KPJA 4GICA 1IRXA 4H7HA 4Y0NA 3SJAA 3WL7A 4PG4A 5BMVB 2I33A 4B71A 1A8IA 4ZALA 2GEDA 2PV0A 2RAPA 4DYHA 3FCOA 1XIVA 3O4VA 2E37A 5EVJA 4MJ7A 3A0RB 5DM1A 5D84A 5AD1A 4ID3A 2EFYA 3U4HA 1VG0B 1Q7RA 1Z12A 4ECAA 5HXAA 3PQDA 1RM5A 2IE0A 1Z6PA 1NN3A 2VUHB 3FZEA 5LJIA 1QUFA 3MYRA 1M0WA 1E5VA 2B25A 4P6VF 3F6CA 3RQSA 5AW2A 5LUAA 1R4MA 1ZDMA 2IU4A 2LIPA 4MA4A 3VYTB 3M1YA 1AT1A 1J1IA 4DS3A 3L7YA 3VNRA 5KC9A 1IM8A 3TNDA 3Q3EA 2OB1A 1N8TA 2HXYA 2NPOA 3AUAA 4RJIA 4KQGA 4EUFA 5EJ7A 5IX8A 3TRDA 5ALJA 3A2MA 1AQLA 1DP4A 2O2GA 4ZDIA 1ZX1A 1R0ZA 1Z9BA 4OP7A 4KBYA 2BHLA 3P27A 2WSMA 2ZB8A 1KKLA 4JYBA 1E4VA 5TMPA 1N5LA 4OYYA 4J91A 3V9PA 1PFWA 1AQIA 3P2MA 4I6EA 4ZOLF 3WICA 3EFOB 5CVEA 4B3BA 1GPH1 5K0JA 5B2ZA 3U7RA 1P8JA 5F5XA 3TZHA 1XMQB 4LG1A 5CH5A 4OLJA 4ZAWA 5TT1A 1NONA 1M2FA 3WYAA 1J22A 5AJVB 3ZWNA 4A10A 1BIFA 3PG5A 3GPBA 4I9HA 5HKAA 3E3NA 1U98A 1AKTA 4FUTA 3KL2A 5BN4B 2JAPA 5K2MA 2I80A 3I2HA 3H0CA 3HYRA 2IXEA 2OHGA 1XRNA 3SDBA 4TWIA 1GQYA 3EWSA 4GPD1 3WYDA 3CZQA 1Y6GA 2JA2A 2Z98A 5IH3A 4W9MC 3NXSA 4Y9RA 3KT6A 5L95A 1VE1A 3VR3A 5B7GA 4R68A 1KEWA 4P33A 3IVXA 1P5ZB 4MUEA 1NTRA 4DB4A 1SC1A 2PL1A 4Y8VA 1SIWA 5JS7A 1GRNA 4AP5A 4WXYB 5AKXA 2Z3VA 2QBYA 2VQSA 2PFKA 3JXEA 3P0JA 5CCEA 1SCAA 4OLFA 2GRJA 1TA4A 1FOEB 2X77A 2X53S 4MVJD 3FVRA 5DBOA 5FJIA 3M9WA 5LZ2A 1ZOSA 3T54A 1UDRA 3ZY4A 2BISA 2W8BB 2XKAA 3BILA 1E9BA 4Z4UA 4AULA 2WTUA 4UTNA 2C7QA 2Z8YA 1O1YA 5DNEA 2VR1A 4QGAA 5IMBA 5JSUA 4I50B 2ONZA 3LBIA 4XW2A 2C2BA 2XI4A 4Q4JB 4RGYA 4N47A 1WMEA 5CEEA 1NXXA 2XMSA 1Q77A 1UMCA 4OCZA 2YV4A 2G3YA 3PXCX 3X1DA 1OYOA 4AF8A 3LY8A 1J8MF 1GPKA 1WW8A 3PFCA 4TKMA 5L3ZA 4W5RA 1L4UA 1DELA 2H1VA 5F78A 4CEIB 3Q8WA 3PV0A 1MX3A 1VM6A 3DHEA 1C9KA 4JBWA 1QH0A 4RENA 3HL0A 4CT4B 1E4EA 3KHSA 4Y7CA 2WW8A 4QBTA 3VUEA 1CEEA 4G56A 4GHWA 2C78A 1FTGA 1SHUX 1YQDA 4GX2A 4V24A 1QH9A 4R31A 4WAUA 2ZI5A 5ICFA 3FOFC 3K31A 3KLNA 4Y0AA 2IV2X 1JEYA 1LK5A 1UMDA 3PDCA 2ECQA 4LZOA 4CLHA 4G0PA 3DPUA 4K9LA 3JQ6A 4QUAA 1Z8NA 1KOGA 4KL8S 1DIBA 4BVGA 1Q44A 3ZE7A 1RIIA 1HC7A 3A27A 3GQBB 1JIIA 3HCBA 1SEPA 4TLEA 2X0DA 3ZUPA 4I5FA 3RG2A 3WBKA 1DWOA 1K7FB 3KD2A 4IXNA 1COWA 2X3UA 1QFZA 3VSCA 2A5LA 4PAQA 1FYEA 3T9EA 2J5KA 2QT0A 1Q20A 3BFJA 2F48A 4X8HA 3UKOA 4RTKA 2H8GA 1H9AA 5DHSA 1Z38A 1ZJ5A 4H16A 4A92A 1VHQA 4WBSA 1EFUA 3KWLA 4WK0B 4HUTA 5JNVA 4GPZA 4WN9A 5DLDA 4DPMA 3NHJA 3I5YA 1DVRA 4Z53A 2D2XA 2EBUA 3QUSA 5BY2A 1JXOA 4UFOA 4EG5A 3GLUA 4GX5A 4EGCB 2TMGA 3R7LA 3W9UA 4ENUA 1K4MA 4C2BA 1B3BA 4S2UA 3ZWDA 1YNSA 1R8SA 2FFQA 2FN7A 3BCUA 1CSEE 1UODA 1V9LA 3QEJA 3RTAA 3ZQ6A 1Q2UA 3WZ2A 5IYPA 1R0YA 3OEWA 2NO9A 2V98A 1XMXA 3ZI7A 2LRHA 5AM3A 1WB9A 3OJEA 2YYYA 4PLHA 1XPJA 1SVIA 1R8XA 3H7IA 3IKLA 2GJ9A 2QQ5A 4N40A 3L5OA 3LP5A 1YDFA 3E58A 2YMQA 2ONCA 3LC1O 3LUJA 4D80A 3UZUA 5E9AA 3SU8A 1DTWB 1KHHA 1O7JA 1Q0SA 3RRMA 4OVKA 1N1EA 3CRRA 1FS4A 3L4BC 5K3AA 4NCIA 4WFQA 3SQNA 5CVTA 3FUUA 3HHEA 3KXPA 5LMCA 1GDDA 1LX6A 4ND7A 1NULA 4RVOA 1V8BA 2HJ9A 4LJRA 4H6WA 2YFQA 1YR3A 3F6SA 2PX6A 2PA3A 3KQNA 5IM5A 3U3RA 2V6FA 3ZZMA 4D46A 4BQQA 3FVQA 3MINB 5ES4B 2RGCA 2EZUA 2D62A 1ZN7A 1SKQA 5IF3A 2AMJA 2NU9B 1UXHA 1ZW6A 2IS4A 3NRCA 3S81A 5TF4A 3R77A 2EV9A 3W2TA 4F3KA 4QUBA 3E22B 4F5EA 4XLLA 4WESA 3WFJA 1ZH8A 1GAWA 1ISJA 2OCYC 3UBMA 5CB6A 5E7IA 1BD4A 3I6ZA 1IIBA 4A73A 2VYQA 4NBLA 3QHQA 2RBEA 5ESDA 1Z4PX 2GHTA 4YROA 1WMBA 1R00A 4U7TB 3SICE 3BFPA 3OLXA 3L9XA 5BQXA 1T8RA 4FE3A 1P4GA 4ISCA 3RLFA 1EA7A 1YJ8A 3OBIA 4KR0A 3G5LA 4LQLA 2AHRA 3L4BA 1NUAA 5E9QA 2MSNA 3WBFA 4PYRA 5BYJA 4PY2A 2OBNA 3O47A 2XMRA 4KO8A 3CZPA 2FOLA 2NACA 3ZCSA 3HGTA 1UWLA 3WGUA 5JZ9A 4A26A 5JTUA 1JBEA 3VAAA 4KNWA 2Z2XA 3AKYA 5TJHA 3SAJA 4TTPA 4D8UA 5CB0A 5IXSA 2HCRA 3WBJA 3GGGA 2OZPA 2QN2A 4B3IA 5KTYA 1NVVQ 2BFMA 3OOWA 5EZ6B 3EMDA 4B47A 2O8BB 2O1WA 3H1TA 5DBHX 2RGYA 3ISJA 2DPLA 2Y4OA 4MUNA 3TZCA 5BVGA 4JUFA 2VYFA 4DNTB 4LXQA 2EFHB 3LQFA 1XF1A 1ZS9A 1T4CB 2C2HA 2JL1A 3BGVA 3QBDA 1PD0A 4JDUA 3GEGA 3M9LA 3TLGA 4D8YA 2IPOA 3S2GA 4Y6QA 2BR5A 1H85A 4PG6A 4Z9AA 5J3JA 5AW5A 4FS3A 1PZFA 4P98A 1B0AA 1RCUA 5SY9A 3UBTA 3AJ9A 1FFSA 3I72A 4GI1A 2I3ZA 1JILA 4ZVVA 4ZKDA 4BCDA 1T15A 2P9HA 1L5ZA 2G9VA 2ZTHA 3KK0A 3ZWOA 3SK0A 1TLLA 2VCYA 4H9GA 2SECE 2BEUB 3H6GA 4JJ4A 4LY0A 5JCOC 2L82A 4MV3A 3PD0A 3HH8A 4H7PA 4NMMA 3HBAA 3ROXA 2HI0A 4EG8A 1W30A 3K0SA 3ADDA 4BFVA 5JI3E 3D4PA 5BV0A 3DVLA 3COWA 3F5DA 2JIZA 3ZEAA 9ABPA 5JRZA 3DV0A 1AZSC 4Q05A 5FLYA 1QO0A 4DXDA 3OE7D 2G36A 1CEXA 1CZUA 3IUPA 4LYEA 4NE9A 5HBRA 2CK3D 1WSWA 3UMGA 2CT8A 1NA5A 3CKLA 3HB5X 3VMMA 3AIOA 5GONA 3URMA 4XWGA 2JCSA 4IMIB 1TYCA 3GXOA 4FT2A 5AJXA 4EA9A 5BN3A 4DC9A 3QM1A 1FX0A 4RQAA 5GZ3A 1QMGA 1T9HA 5KVQA 3TBHA 4EG6A 3SJZA 1MU0A 1OPRA 1PQYA 4IIBA 4DDMA 2ZXFA 2PUFA 2FW1A 1NW4A 3IAS6 5ARBA 2FPIA 3HKEB 3N58A 4BZZA 2I4OA 2QQFA 1C41A 3THWB 1ZN9A 1GPLA 3O93A 1W5TA 4UUPA 5H8WA 5JCOA 4GDFA 4V38A 1EUDB 1I14A 4UMVA 4ENPA 1UC8A 2FAXA 1M0TA 3OMLA 3W3ZB 3ZS9A 1TKCA 4I08A 1OCEA 4GSKA 3SIRA 4GI7A 3UB3A 1RQ7A 1XLTC 4MKGA 2GJSA 3FPLA 1J23A 1TU4A 2CZCA 2LNDA 1E62A 1VL0A 4Y2PA 2BGWA 3X3HA 2WF8A 2PZGA 3VA7A 4P4GA 2CFIA 4B3JA 1ENPA 4PSCA 3VKWA 1NSTA 3JQDA 3PDIA 2LCIA 3GA0A 3I1FA 3TSYA 2YXBA 1Q83A 2P7HA 2XB9A 3B2NA 3ENKA 3NGMA 4MUXA 3VH4A 5A4DA 4LE1A 2ZYGA 1ZAKA 2H4WA 3FWPA 4BZWA 1E2HA 1YULA 4DCGA 2XUQA 4OYLA 4NJEA 4NBTA 1HDYA 1QKJA 1VE7A 5EJ2A 3BIXA 4KPFC 1NP3A 2Z2IA 4YO8A 4LF9B 3L9WA 4ZI5A 1N25A 1I7SB 3HNPA 1GUFA 3UOGA 1Y3CE 3QTBA 2VDQB 1GGEA 4NRDA 1SBQA 4N54A 1FF9A 3WRWA 3RIGA 3QUQA 4C7MA 1J99A 2B35A 2PD6A 3AUYA 2WSSD 3S8YA 2TRSB 4BEVA 1PGPA 2IHTA 1E3SA 4CM4A 2XDWA 1G0OA 2VH2A 1H6AA 4OHVA 3IUQA 3AINA 2V5VA 1ZR4A 3LY9A 5DN6A 2IX3A 1QQ5A 1E20A 3HACA 5EXPA 3H2GA 4NQZA 3IEMA 4E5DA 4HVLA 3V8RA 1MGPA 4HEQA 2YS6A 1MC1A 4JI3B 2PLFA 3LLMA 3SE0A 4ZGGA 4CIBA 1QZZA 1RHJA 1XVLA 4P3PA 5EA2A 4EUKA 5KKNB 5JXIA 4EX6A 1NZDA 1U0SY 3OQNA 1KJZA 3ZH2A 4CL2A 3RABA 5I5GA 1BYUA 1IMJA 3D7RA 4JVMA 1Z17A 2HMSA 3OQPA 4EPRA 5KW9A 2R85A 1K5DA 1U4OA 3AL3A 3OSZA 3MJVA 1JS1X 1TYEB 3ILXA 3ZKWB 1UZNA 4QTTB 2D0DA 5JWRA 2BFBB 3O4GA 4LNHA 1XD2B 1DBWA 1X87A 1Z6ZA 3QWIA 4K05A 4NESA 4QU5A 2NWQA 2JJMA 3B85A 4ZI7B 1LUAA 1ZCBA 5EEHA 3HXPA 4YELA 1MO3A 3PTZA 2NUAB 3ZD7A 4S12A 4M4SA 2D9RA 2WZQA 3CNLA 3FD8A 3HKBB 3V4OA 2WFZA 4UEKA 3GLGA 2DBZA 3KEOA 1I3MA 4O4JA 2XOEA 4RIEA 2OB2A 2RARA 1MO2A 3KAKA 3HAGA 3CCBA 1GRRA 4RTRA 2EWWA 3M4XA 1YZFA 1JHMA 3EXAA 4GG1A 1L7VC 2G77B 3ASPA 2W0SA 3ABOB 2COEA 1LJLA 6REQA 4TMKA 5B6JA 1VJSA 4BX9A 5T7BA 1HDOA 1WF6A 4US2R 5K8JB 3ASRA 4MKFA 5TIIA 4YJKA 3X0DA 3CX6A 3F98A 1GHTA 3VPXA 3LZDA 3TZEA 1WVMA 4XTRA 4QWWA 3TW8B 2DP4E 2NPFA 1OZHA 1UXJA 4JJEA 1JQAA 4DT1B 3ASVA 3EZ7A 3PPWA 4IX1A 3PX3A 1WPGA 3QI7A 1CRLA 4YECA 4BNFA 1P29A 4LBVA 1DJNA 2E4ZA 4JKIA 1T2VA 1J8QA 1QYCA 1UBKS 3ZIUA 4OHYA 1Z5PA 3TD6A 4AM8A 4D0RA 1CUDA 4NVRA 1MJGA 2Z5VA 3E23A 5AVTA 3G1WA 4X00A 3H8SA 3V4ZA 3HDYA 2ZJ7A 4R0MA 4ZDJA 3N53A 4QAJA 3PYLA 4Q5IA 3HYSA 4LJ7A 4NARA 2J9FA 4G24A 4RA6A 1P45A 3SHVA 1O9HA 3LFUA 1C0IA 4TWZA 4BQRA 4MVJI 4ZI3A 3ASQA 1WQ1R 2A0YA 3NNDA 4EJSC 1WX1A 2C5EA 1C1XB 1LLFA 3TWOA 5ELMA 2BLLA 4REMA 2W48A 2NTNA 5T64A 1F20A 3QF4B 2PZKA 3KDPA 3KQYA 2JJ2D 1DS6A 3L6OO 2JI6A 4JB3A 1FDTA 1P0CA 1D2MA 2NPIA 2W43A 1K9SA 1RM0A 1UBGA 2P9BA 2Y2UA 3E82A 1QIIA 3GFSA 3IH5A 5CVUA 5K3BA 1JU4A 3QMMA 4J3JA 5EJEA 1YZHA 1JQJC 4NFYA 5FA8A 1BHO1 4DWJA 4EHIA 2HUPA 1CEYA 2C04A 4L3VA 4RDHA 3NOQA 4BFSA 2WHRA 3SOPA 1TZCA 3H2HA 4G8BA 1CJVC 4X6UA 1EAYA 3KT3A 3T0GA 1UT5A 3GRFA 4FYXA 1HSOA 621PA 5IZCC 3RVRA 4N8SA 2WV9A 1NF8A 3FTPA 4EJFA 3DMNA 2QN8A 1GR0A 4O2AA 3OTWA 1UFKA 3WQRA 3TLXA 1TM7E 1JRLA 3BUSA 5B7NA 3ESZA 1SBTA 3ENVA 5DLQC 3LD9A 4K5QA 4M1TA 2VSOA 3ZV6A 3NWOA 3ZE1B 1PHRA 2A58A 3GW8A 1X7WB 3P20A 4EJSA 1HA3A 3VC7A 4QPCA 3DHNA 3DPIA 1OV6A 2JHAA 5BPFA 1BXGA 3MT7A 3FKSD 4DCCA 2FRVA 1AZTA 1N2OA 4EY8A 3AB8A 1FFAA 1OZFA 1DI0A 2JEYA 1KVRA 4JVOA 4MTLA 5A1JA 1EIWA 1ZO8A 3AR5A 1DKOA 1CUSA 1JIQA 2QY9A 3QKRB 4MW4A 4KDRA 4OHWA 3CLUC 3ZEIA 3HDJA 2H1FA 3I2IA 5FA5A 1CS4C 4CYMA 3DF7A 1HMPA 3DAYA 2IUYA 2O7RA 3DCYA 3TLJA 1HBJA 5C8VA 1UBMS 1YZKA 5K51A 3JRNA 4MQUA 2VATA 3IOYA 3UMRA 4RTLA 1ZW1A 4KGXA 3IVCA 3ORFA 2J9XB 5IZCA 1TTQB 2VJBA 5GOZA 4Z51A 5K8TA 3AVVA 1AGYA 2AH5A 4JLOA 1RPNA 3I9OA 5GJBA 2G7MC 1SC4A 2DFVA 3F9RA 2H2IA 2IW3A 2Q0HA 5M3BA 1D2HA 4R2HA 3K4HA 2OV6A 4L07A 1A04A 2J3KA 3R5TA 1I3LA 3IEIA 4UQOA 4WTOA 2W70A 5GMOA 1D03A 2R79A 4TWBA 4JBLA 4ZQFA 5IBQA 3DT6A 5B64A 5FO0A 1UZAA 2RHLA 2WOJA 3L8FA 4NC9A 3S2FA 4KR7A 1OWMA 3GCDA 4LYGA 3U80A 1KR2A 1KU6A 1U7OA 2CJWA 2ZKLA 1C4WA 3KKNA 3CM0A 1SC6A 1WBDA 3QW4B 2X9GA 5KCZA 1UZLA 1ZQ9A 4I55A 1M1NA 3PITA 7ADHA 5KTKA 1JYEA 1HSZA 2OLKA 3LPMA 4ZEXA 4EI8A 1NMSA 1IB6A 3AY6A 1LPSA 3OLQA 1QGDA 2NVOA 3SBXA 4BUJA 1CR2A 1W0KD 5DGIA 4ZC8A 1FFDA 3HEAA 3TDMA 3LBHA 4BLVA 3A4MA 5MN4A 1RPZA 4MLZA 3TN7A 3A6GA 2XOKA 1TIKA 3RT7A 4D7AA 1E3LA 3SBDA 1Y81A 1RWXA 1TECE 5FYDA 1XHLA 1W0CA 4TT3D 2OV2A 4BLRA 4F0JA 2YOHA 4XVRA 5E3HA 1WSRA 1JQDA 1YS4A 3E53A 4L28A 3VPSA 5KOYA 3GP8A 2H92A 3KKZA 5AP9A 2O3RA 1N1DA 5TEWA 3CZ9A 4M1OA 4AZ0B 2J5QA 2IYNA 3GJ7A 1MT3A 4MKXA 1XP8A 3LOPA 4L85A 5GONF 2HBZA 2OUKA 3BPSA 3UV6A 1TEZA 3OWXA 2VBSA 4UPVA 1X94A 4DABA 4DIDA 3OICA 2P5UA 4ZVMA 3WGZA 3C3JA 1OLXB 3HI6A 3DDNA 1C30B 1A0OA 3P45A 1FQOA 1HKHA 1KVUA 4OA8A 2FA9A 1Y5MA 3IA7A 2WUEA 3DFIA 3GGDA 3IV9A 2Z5FA 4LSZA 2WJAA 3GGPA 3LQRA 4N6GA 5HFNA 3SX2A 2O5VA 8OHMA 4AF7A 4W5HA 4RBNA 1QHSA 3AXSA 3A8IA 3F5SA 5KVVA 2GN6A 4EYOA 4TV9B 2LXNA 4Z7QB 2OHXA 3NUZA 1HH4A 3HUDA 3O3OB 1Y1SA 4RH3A 3ZWVA 4BMPB 4MEJA 1LPOA 1UDAA 1XAHA 4XARA 4BMYA 4LZZA 5DFAA 2WKQA 2Z08A 1G60A 3N6XA 2J31A 2J6CA 3A1EA 4BC0A 1N2IA 2AZMA 3K30A 4Y2SA 5KQSA 2SKEA 3BQ9A 3SKYA 1NBAA 1PL6A 2IEZA 1VJCA 1HL3A 1I2DA 3LVFO 4LWPA 1JQ5A 1YMVA 2XQJA 1XD8A 5DNAA 3M1IA 4DLLA 1ODLA 2GESA 3H99A 1PR9A 4LYFA 4LYAA 1WU8A 2R5WA 1VLQA 3HUEA 3PWTA 3W2EA 1OB2A 1T8TA 2SBTA 1JEEA 3I92A 3ZCTA 1L4EA 4MRMB 4GI5A 4M49A 4FE7A 3AKEA 3GVPA 4BMVA 3DFUA 3F90A 1VJ0A 3GDOA 4RKYA 2AJBA 4AX4A 4GR4A 4J75A 4FUQA 4ZJUA 3OJ0A 4PSVA 2QTHA 4CODB 1TADA 1YA8A 2FU5C 1AVTA 1JX6A 1RCTE 1UWCA 1S8FA 2VT2A 3GEBA 2R4QA 4LHYA 4Q21A 1Q3KA 2J3LA 1E5TA 2GT1A 1KAHA 2ONYA 1P1BA 2QUZA 2DY0A 1XEWX 2J1LA 1LSOA 4BLSA 2QIOA 3FNHA 3HE3A 4CKCA 3WL5A 3BBLA 3AR8A 1ODJA 1G6HA 2XTAA 1XCBA 2DY1A 1J2YA 1F48A 3WX0A 3C6QA 3FB1A 3TE7A 5DVZA 4Q03A 1C7QA 3K2QA 2WT8A 2HT6A 3EASA 4R1OA 3FYCA 5FLEX 5JZSA 2QLMA 2VHJA 5CCBA 3VKGA 4FB4A 2CF4A 1HDXA 5AXCA 3P97A 4MARA 2P9EA 3GHHA 2JGMA 1ZCAA 5KNDD 3R7SA 6CHYA 2Q5OA 1MNQA 2QYSA 4RUKA 1C0EA 2OPBA 1IHXA 1O5IA 4PQEA 3LXMA 1FTNA 2VXCA 2YWFA 3FW1A 2VTVA 3UW1A 3SHQA 1UBRS 3VR2A 2Q28A 3LKBA 3PC7A 4MQLA 3H4IA 1U3VA 1QVFB 4MYHA 4POAA 1TGVA 1GVHA 1WCIB 4G41A 3NONA 3WGIA 3I56B 1FDWA 3FMFA 3JWEA 4LQ4A 4Q3AA 3ONFA 2ZETA 1SBNE 5AJYA 5I48A 1R6UA 1CF2O 5CM8B 2ZTLA 3MT9A 4F9TA 4R3NA 2BCEA 1IDN1 2B4AA 1NNUA 3A6HA 5JYEA 4XVCA 4O4JF 1UQRA 4ANFA 2W71A 1BW9A 3RVBA 3PT5A 1QO9A 1X7ZB 1RWQA 1EFLA 1WPQA 2M1ZA 3NHFA 3NAMA 4KZKA 4F4DA 4YMHA 3KB2A 1MB0A 1EFKA 4CQLB 3AESB 1LZLA 1R10A 1MB2A 5D85A 1JQ3A 2CUZA 3MT8A 3TL2A 1EUQA 2G63A 4NMLA 3DVQX 3N86A 1BDMA 5FWAA 4M9QA 4Z5XA 5BMOA 3WLFA 1CUFA 1XEXA 3O2SB 1UM8A 3ZDZB 1I01A 3V8NA 1QU3A 4YV7A 2P35A 5AQ1A 2NW6A 3OM1A 2FK7A 2A35A 4OOEA 3SMQA 1RDFA 2GEUA 3K5WA 1ZUD1 1J39A 2QRPA 2R6FA 3HFGA 1IJFA 4HRXA 4CI9A 1GZ5A 4RK0A 1FS5A 1OC4A 3NTVA 1R9NA 4DMUB 1TCVA 4HSGA 3S4YA 1QP7A 3DT8A 3RYIA 1GCAA 2EJBA 2HOQA 1RVV1 3E8MA 1CJBA 2JHFA 3PQ6A 2OP0A 4XD2A 3U7GA 3A1WA 3A58B 1HYBA 2AFHE 4YWHA 5EG5A 2IYSA 2WAAA 2GVNA 3CZMA 5L6MB 1P5RA 1M67A 2NNLD 5FWXB 5ESWA 4DB2A 1CLUA 2R1TB 4TV8A 5LQSA 1KRWA 1UPTA 4XSGA 1QTQA 3FKQA 4C4RA 4AKIA 3RVPA 1CS0A 4KG7A 5JZMA 3RSCA 4WKPA 4Z0HO 2YDXA 4L5YA 1N0WA 2D7JA 1WUIS 2FW9A 4L02A 3SS9X 2CJFA 3V80A 4EKEA 1XFAA 2IUFA 1LDYA 1EWVA 3EVFA 4GZMA 5GVRA 2ZRIA 3A1VA 4E4TA 2EFJA 3F3MA 5BP7A 4F21A 5JLJA 3BIFA 3O84A 3NG1A 1ZH0A 4V02A 5CDFE 3TJMA 1DZ3A 1P0PA 2AK3A 4FWIB 4XM2A 4BXOB 3R0QA 1Q1EA 5IBPA 2I55A 3T3OA 4DDTA 1ULAA 4BLOA 1KJIA 4CVNA 3EIFA 2CXUA 4UXHA 1H5NA 4QL3A 3BGWA 3OTHA 4MUKA 4O2AF 2POCA 4QEDA 3F3YA 3TXXA 1ZGZA 4TSFA 2FH5B 3Q3AA 1DLJA 3DBOB 3LLCA 3DB2A 4MR7A 3SHWA 1PR2A 4MMZB 2XBMA 4C03A 3O5AA 4XDZA 4BMNA 1DIOB 1UAGA 3ZD8A 1UH5A 5G0TA 3V7FA 1RQ2A 2HU5A 2UV8A 4OPSA 3UCXA 3ZWXA 4FM9A 3BCSA 2RC5A 2V3WA 1E7QA 1HLPA 2Q1TA 3VPDA 1F1BA 5JIBA 1EE2A 5KS2A 3OWOA 3RVOA 4QZVA 3NPMA 1NNI1 4IBOA 3SSNA 5A7FA 1TI7A 2LIVA 4RABA 2E85A 4DVJA 5JVDA 3DNPA 4YBZA 4N3NA 1Z2PX 3GPIA 4NYIQ 2QP9X 4EBBA 4XVHA 1F5NA 1SXJD 2XUDA 4I9UA 4QPPA 4WUVA 3MC1A 4QHTA 4WY2A 3UT5A 1I2ZA 1E8NA 2WVAA 2GNPA 3ICWA 2YVAA 4BECA 3I58A 3E0XA 3A6KA 2DPMA 4KQCA 2NUTA 4LC0A 3DEJA 4OGGA 3RTDA 2PKQP 3DM9B 5REQA 5BOSB 1XQ6A 1IZ9A 1Y0RA 2YR0A 4P7GA 2CNLA 4YJHB 4L75A 5E6RA 5LNK6 5KTNA 4IR7A 2PU5A 3G5AA 1NF3A 3CU5A 4UHBA 1BLIA 2JEOA 2NYAA 4U3JA 3CLTC 3RREA 3A3NA 3T4PA 3QXXA 3BN3A 1N9GA 3H3XA 4AYXA 4G0ZA 4BNVA 4UDOA 2O4UX 4KGDA 4YRKA 1ULUA 1QF7A 1CG6A 1NI4B 1NMQA 1UPXA 3GZNB 3LUGA 1SXIA 5NULA 5HZBA 2VDWA 3ZV7A 4JVNA 1NJSA 2WMYA 4G0MA 1JE1A 3QMPA 1KYXA 4I55F 2ATXA 4C05A 5L4SA 4I99A 1UMKA 3AX6A 3ADBA 4R1MA 4OXKA 2ZRNA 1P1IA 2QPLA 3NHAA 3PIDA 4L4UA 3WJAA 3ILVA 3ZQJA 1L7XA 5JSQA 1WOSA 4H0NA 2QM0A 1RYEA 4KVGA 4IDQA 5CM9C 1F4PA 1IQPA 5D7BA 1U7DA 1XTKA 4F4UA 1SCUB 3P9NA 5BRJA 4QFDA 1WUHS 1JIJA 1RXEA 1TT7A 3DQQA 2Z5GA 1RACA 4M9UA 4BN4A 1PNQA 4EI9A 2YQ5A 3GOHA 1XVIA 2V7TA 4YPFA 4LVUA 1LQ2A 2ZPUA 1XCMA 4RZ2A 3EC2A 1JDJA 1Z6GA 1PTJC 2WFMA 4J2HA 3KPWA 1O6BA 4TZTA 1G5IA 1UAYA 4MOWA 1I8TA 3A2KA 1T3ZA 4DQVA 3KFLA 4IVQA 2NV0A 4J1SA 2PMBA 3DLHA 4D26A 4ZOLB 1GDHA 3MAJA 3R76A 3NHLA 2O0MA 4QJ5A 1Q92A 1PR1A 4LVNA 3IS3A 1WHSA 1Z7GA 2X9QA 3IKVA 1KF0A 3B9BA 2AQ8A 2JBHA 5H3CA 1PYDA 4QQKA 5AESA 2X2FA 3DQPA 3S29A 4RHYA 4F1KA 3C3DA 3TEFA 2WE7A 1U9IC 2HC9A 2GCNA 2Z2KA 1TF2A 1Z0SA 3F5MA 3H83A 3JASA 3C4QA 3MOIA 1M5UA 3P2OA 3P9CA 1ENOA 1K27A 4IYJA 1VQMB 1W47A 3K09C 4LDQA 3DHYA 1KEUA 1Z82A 4LNUA 5ECWA 3V1NA 3UHAA 4UU0A 1O03A 1S3SA 2C29D 2E9SA 4N3AA 1WG8A 1ZYUA 3DOJA 3T7DA 1CT9A 3HGMA 2YN0A 5DNCA 1WDLA 1D2RA 5LD2B 4ZHSA 1JDBC 1WW3A 2O7QA 3EHEA 4OK5A 1PTJA 4ZZ3A 1BFDA 3EZXA 1E0JA 2AUTA 3DL0A 1GKYA 2P3SA 4NOKA 3K1ZA 4Q6BA 3KR0A 2OENG 2XYGA 4RSRA 4YCAA 4TN1A 1NVUQ 3L1JA 3WQSB 3HN7A 3BF7A 4KKTA 2R86A 2PL3A 1RPAA 3W1WA 3T1TA 1IZZA 1VHLA 5BYBA 5F21A 4OOVA 3LC0A 4G2TA 4CQJA 4CL8A 5DCYA 2OSBA 1J24A 1XZQA 3WDKA 1D1PA 2ECOA 5K3CA 3LLSA 3R7DA 4W8HA 3R0VA 2Q3FA 2QQEA 4HL6A 1MAHA 3M3PA 1W85A 4RD2A 3OX1A 4KSYA 2FCRA 5DDIP 5G0WA 5EIEA 3B36A 4OA5A 2G9UA 1X9GA 2MSKA 1Z13A 1U9IA 4XM0A 3P26A 1IEQA 4Y6RA 5CPBA 4DTCA 4CV0A 2II6A 4JUDX 2YFHA 3ZCPA 5K0LA 2I6XA 3K09A 4CNQA 3OX4A 3ESQA 3KHUA 4EYKA 1BVRA 3QYJA 1CUZA 2ORWA 3GFOA 3OX3A 4H7IA 4HCJA 4JJKA 4YUWA 3R8FA 2PGLA 1E59A 1VQ7B 2YVUA 3S55A 1VZ2A 1R8JA 3DVAB 5JY6A 1RRKA 1YZVA 1EUCA 3VPCA 1Z33A 5C5IA 3HDQA 3TOSA 1YTUA 3TMYA 4JLMA 3RYFA 2V7EA 3FDZB 4S35A 1B16A 2FR1A 4YRTA 2FPOA 2YY5A 4DCOA 3KB1A 3JVEA 2JGNA 5FOVA 5F7ZA 3GJ8A 3EGWA 2WVHA 4JGIA 3G9TA 1YMQA 4L0MA 1MQ8B 3AF0A 1M6WA 2P1ZA 5E95A 5EJ5A 1DHTA 1IEXA 3FPGA 1T4DA 4XJSA 5JAMA 4PGAA 1EI9A 2GCEA 1SH7A 5BN1A 4N5HX 4YB8A 2BMAA 2OC9A 4JYZA 2FP3A 3K7EA 4JJGA 1EKXA 1IUPA 2VYVD 3I42A 1GQSA 1F2UB 1GT91 5IWCA 1TL7C 1EXDA 5LZ8A 3T12A 4MAMA 3KYCB 4CF3A 1E6CA 1DOAA 1MKYA 2B78A 1BVHA 2BFPA 2BI7A 4NMHA 1B6SA 1QIEA 3AM4A 3D54D 1RXIA 2OWEA 1E6LA 4IWXA 5BNZA 1JMYA 2XMPA 2EGGA 4UZSA 4E0FA 2FPSA 2WJWA 3LDFA 4ZO7A 2ENUA 3RYCA 3B20A 1UD3A 4KE8A 1J7KA 1ZK2A 3ZNOA 1RRGA 1OF1A 5C8DA 3AEYA 1W46A 3EJ6A 4UUBA 5CVVA 4YN3A 4F60A 1KU0A 2GEFA 2Z4SA 4IIHA 4BO1A 3WWOA 1XYYA 4F5DA 3MGGA 3C8HA 2OFFA 3ZHYA 5BUQA 1AX9A 4J7XA 1OZAA 1T2AA 1M2WA 2P9ZA 3COYA 3OCWA 1KO4A 2GHIA 3GD5A 4I36A 4ZEOA 4WLEA 3Q88A 3OU7A 2X9LA 1CK4A 3I32A 3WLMA 1KKUA 1XTUA 1BQEA 1PK9A 2PKCA 2OBMA 4AK9A 5C52B 2VAVA 3A6FA 2PS3A 3MCVA 1NDUA 2PSEA 1GU1A 2R5NA 4IDPA 4J49A 4YAOA 4DC1A 2J3IA 1T0BA 1XNHA 2P4UA 3CESA 3CKKA 2EWMA 3C1OA 4ODIA 2Q5HA 1AC5A 1NRWA 2R84A 1T3SA 2R8EA 4DJEC 4MV0A 5KKAA 2Z30A 2O5EA 1A76A 4TV8F 5C7YA 1NLFA 3HJGA 1W87A 1RZRD 1X86B 4C6TB 1T24A 2ASEA 2QLTA 3MWKA 2A3NA 4Y1FA 2EVWX 1NPDA 5A03A 1T1JA 1SVOA 3QPAA 2PZMA 3DUFB 1T9GR 3VC2A 1OWOA 3W6NA 2HHLA 2WY2D 1U3UA 5FBHA 1TK3A 2NVUB 2Y71A 3DNFA 4ZT7A 4NYMQ 3FPFA 4WCFB 2J7KA 4PZUA 1ZXBA 1M2VA 1FCJA 3DE4X 4ND5A 2FZVA 2UZ1A 3ZLBA 4YT4A 1XG5A 2ZSKA 3EY4A 4A36A 2GYWA 1H2WA 1NUUA 1UKZA 3H0EA 4MJ3A 2Y0EA 5A71A 2IP4A 1YE5A 1VXOA 4DUZB 2J5BA 5SYNA 4EMTA 1JG6A 4QATA 2YHIB 1M66A 4C1NA 5AMXA 5IVIA 4RE5A 3OEED 4MYDA 4EW1A 3DZHA 5EYPA 3GZJA 3VR6D 1RYMA 3D2CA 4Y9UA 1LVGA 1QR2A 2ZJBA 1DMRA 4LRXA 2XGSA 4ZV7A 1KIAA 1KJ9A 1TJNA 3CTPA 4IG4A 4UQPA 1R5BA 1EJ0A 1XQXA 5ERXA 2O6LA 5DPMA 2NV6A 4LWQA 4Y6GB 4CKZA 4ZO8A 1J20A 1Y3AA 3A25A 4XN0A 4J94A 1QHGA 2IPXA 3L05A 1K98A 3M83A 2HLDA 3DL7A 1J1ZA 1US8A 2H7YA 4JENA 1KMIY 3LWZA 2B34A 3D0KA 5JC1A 5LZ5A 2WVGA 3ZHOA 3C5HA 2VBUA 4JQOA 3FY4A 1BS9A 3H04A 4N3CA 5JVDF 4Z4YA 2NO7A 4ENSA 3B2QA 2I4RA 4YLYA 3K16A 4IUYA 5HK9A 1JH8A 2AKEA 1MFZA 2EHJA 2BEVB 2NQ8A 1TOAA 1YMUA 4XCQA 1C9YA 2XMGA 1FZQA 2PM8A 4R6WA 5L9AA 3ZDDA 3FYSA 5B53A 2XKBA 2XAUA 4E7OA 3I62A 3EEIA 3HB1A 1GXSB 4M0UA 5IDVA 4U9HS 5KWIA 4LJ5A 1HOXA 3B1ZA 4FOTA 1RQGA 4PRYA 3HG7A 1B0UA 2I6QA 2BV3A 1IXSB 2ODPA 2DF8A 3H2ZA 4JGGA 4ALKA 2H3EA 4RK1A 5WRFA 4XYLA 3CVOA 1T1EA 4Q1BA 4PIMA 3AFOA 1IWBB 2A1UB 5EIFA 1FY2A 1PS0A 4RIGA 3UUWA 2WHEA 5ELLA 1MJ5A 1XR3A 4BKMA 4H4CA 4QDTA 1KY2A 2FUEA 3CZRA 4JT2A 5CURA 2GPTA 4ETWA 4DRYA 1SKAA 5MF6A 4KJXA 3TR5A 5K8CA 3D81A 4WNAA 1T2NA 1EQ2A 3EQ2A 1EVZA 3EVBA 4IMRA 4FFSA 5JO0A 1YWGO 4GRIA 1FP2A 1WOPA 3IBCA 3A4IA 1C3LA 4XFJA 4ABYA 4YAUA 4AIRA 1G3QA 2VNKA 1JZQA 4B31A 2IEIA 2FPWA 5AW0A 3M4ZA 5ALDA 4PWZA 2OHOA 4HNUA 3G5MA 1KJNA 1YQEA 2G76A 4J8PA 3H18A 3S27A 3LO8A 2FGJA 2ZKIA 4JQCA 5FBWB 1TCUA 1U99A 1AKEA 2C54A 5TSDA 2QSJA 1HRDA 4EG3A 4PXSA 2FLVA 3TMKA 2WM9B 3I5AA 3AUFA 3M4NA 1NVMB 3GNTA 2BH9A 1FFCA 3Q7EA 4MS1A 1P2BA 1Q0UA 4ZQCB 5A05A 3KVOA 4D97A 5HRCA 2XUPA 3WLJA 3IVMA 2F8MA 3GFQA 3E7DA 4US0R 1RBYA 3K0BA 3R3WA 1FW6A 1GTJ1 3CF0A 4H2DA 3EDRA 4IKPA 2IOFK 4R6XA 8GPBA 1M6HA 3HCRA 5TQ0A 1VHEA 1VQ1A 2VWQA 3U7JA 1GRCA 3JD2A 6ADHA 2YN4A 1LFAA 3C85A 4HDAA 3PVZA 2HREA 3BHMA 4FMDF 2D00A 4P1VA 2DU8A 4UNSA 1FFXB 5TGTA 3VM6A 1E1CA 3TTTA 1Z28A 3NDJA 3GROA 1G19A 2OAP1 3L46A 4LSWA 1A27A 3VZBA 3T6KA 2JAXA 4Z9YA 1GILA 4YQEA 4UKDA 3BTSA 2XZTA 4IHJA 1MDBA 3W9SA 2BGKA 4BQNA 4V3CA 3NVKI 4UOQA 2GASA 1JIKA 2P3LA 3ESRA 4A0HA 1EE1A 2VSQA 3RT9A 1USKA 3V1MA 5K3FA 2D0OB 4WI1A 5JD3A 1H9BA 2RHRA 3AY7A 4B45A 1I3NA 4BFXA 1B8VA 1Z2EA 1JQKA 4HOYA 5DO9A 2AYXA 2HNBA 1I9GA 2HYDA 2PSJA 3PGVA 1LVUA 3HN2A 1TQDA 2WF7A 2QEXB 4I9GA 4TMYA 5MFZA 1ZH6A 2PMEA 4JOBA 4K9QA 2A5FA 5TMBA 3UK7A 1EDZA 4JOQA 4P25A 1NRXA 1ZLXA 3FYUC 3L7LA 3P9IA 3RQIA 3SS8A 3OPOA 4CRWB 1HPLA 2I2XB 3D8SA 2V8OA 3GT7A 1NSYA 1K88A 3COZA 3L0OA 4TRRA 4XCVA 3PRYA 4I4NA 2JFXA 3ANYB 1MXFA 3AHIA 1SRQA 1AIPA 1H65A 4XKWA 3SC2A 1YAHA 1WTHD 4KPUB 2FSVC 4Q4LA 1PZXA 4RDCA 2OGSA 2CVOA 4GGOA 4MLDA 4P36A 4UNQA 3O9ZA 1OKKA 2GBPA 1G7SA 3DEHA 4BRUA 1Q0TA 3JRWA 4DDKA 3IJEB 3D6JA 3KT0A 2DFPA 1RJGA 1IY9A 2AI1A 2G07A 5JD5A 2YYZA 3B3JA 2JJ8A 2R6CA 2GRAA 4DK1A 4Q39A 3RKSA 1JEYB 4OLBA 1UMDB 4RKQA 2ACWA 4X1YA 2DG2A 2J59A 1VMIA 3I0NA 2F3UA 3ZVLA 5BWOA 3N8KA 5GY7A 4IGFA 1N5KA 3CNQS 4WVFA 5FL7D 4GXNA 2O54A 1AS0A 5J4HA 4UHCA 3RRBA 3LWNA 3BA1A 2IHJA 3FYUA 1EGMB 1UP7A 4KHPB 1DCMA 3EDMA 8MHTA 3C8DA 3SPXA 1F8YA 1K68A 2P62A 2XUFA 4M9ZA 4MYCA 4W9NC 4WLOA 3TLAA 2ZXHA 1OFUX 3PUYA 4TS3A 1SHKA 2ZWMA 2WK1A 3OZDA 2BYTA 3VRHA 3BMNA 2MINA 4GP9A 4EYQA 1ZONA 1ZK4A 5KYGA 2FSVA 1F06A 1QU2A 1PBNA 1IHOA 5JSZB 2HR1A 3AC0A 1N7JA 4OXIA 1OIXA 2WPDD 1L7EA 3DMYA 3RVLA 4B48A 3CEAA 2NT4A 3G49A 1PWHA 4N7MA 3TTUA 2CLIB 1E60A 1W5EA 4QBHA 1YK0A 3SLNA 1TQHA 1I7LA 2QI9C 3EDQA 3B1FA 2NXCA 1ZK0A 2G88A 2IOFA 2WP8J 3D4IA 4FGLA 5SZHB 5JRDS 1NJ5A 1R16A 2JI9A 4D3XA 1G6KA 3RJ5A 1ZKDA 2HHAA 3W9YA 3CN9A 3KL4A 1ZUNB 5IZ4A 1JA1A 3MSXA 1MOQA 1OAKA 1M1UA 1UKEA 2RI6A 3EOAI 4X8MA 4QARA 1K3UB 3PLRA 3VSEA 2V8BA 1UFQA 3RS2A 2WILA 1PJAA 2GF9A 1YKGA 1QIGA 2YDYA 3GCXA 4M0DA 4Q4AA 2B4KA 5CVJA 5AKKA 4RM3A 1Q84A 5JXWA 2GF2A 2V7QD 2Z1MA 4KO3S 2VHEA 5C51B 1GKLA 2G5PA 1CFJA 4ASUA 1R50A 3EXIA 4WZKA 3WXMA 1D4AA 3RUDA 4F8JA 3GVHA 1U6JA 1YL7A 2WYOA 4ARVA 2WZCA 1E3EA 1DC7A 3L7KA 4DPLA 2VQDA 4P35A 4QSMA 2M6KA 3UGKA 2G71A 5EN4A 3HCDA 1RAGA 1G9SA 1R6BX 5EE5B 1U5BA 3SHOA 1D8AA 3H5RA 1LBTA 3MMZA 1ZJ6A 1W36C 2WIBA 4PGMA 2HH9A 1RLTA 4ZAVA 1YH3A 2M98A 4NJMA 4WESB 1XC7A 5FPYA 13PKA 2XA1A 4AKTA 1UAAA 3GX1A 1H05A 2I2BA 4H7JA 2FZLA 4Q4HB 1K28D 2GB4A 5GADl 3BM5A 4EAQA 1P4RA 3NTOA 5AUNB 3WIEA 4N4AA 3HLYA 4UHDA 5AI4A 2VPZA 3HYNA 5T6BA 2XH8A 5CBPB 1FP6A 1SIBE 3N2YA 3L0IB 3CZ5A 5LP1A 4D3SA 3KYDA 4CEJA 3K9CA 3LRTA 2EP5A 2Z57A 1SHZA 2RHCA 1RJ9B 1LI7A 2V7GA 4E5UA 3ZW8A 1QBKC 2AV6A 3R3HA 1V7CA 4MPRA 1UKCA 2ZYWX 4OQYA 4P81A 3NIDB 4Q15A 4HZIA 5MGNA 4UATA 4A0GA 2C8VA 1VA5A 1UL1X 3PYMA 5LLTA 1RJDA 2C20A 4MZDA 1XJ0A 1KZLA 4FB5A 1SD2A 2XADA 2IYXA 3A1SA 3OQ1A 1QHFA 5J2TB 1LLCA 5EE0A 1RBMA 1XRMA 3CR7A 3EODA 2JVJA 3N76A 5FBQB 4EHAA 2C5HA 2D8MA 3NGLA 4UHKA 5B5SA 4I4CA 2HZBA 2KI5A 4BWGA 3FTDA 5I9SA 2BHTA 2I5PO 3MWGA 2GD6A 3NBQA 4QFCA 1KVTA 2V0NA 4K3UA 3KSBC 4ARIA 4GOKA 1DOHA 2X58A 1XTRA 3DXYA 4MVJM 5ALGA 2PRYA 1QH8B 3L06A 3ZXSA 4Q3OA 4NBWA 1W0JA 4YBRA 4OKNA 5CA1A 4LAFA 2PZ8A 3VZSA 4OI0A 3F5QA 4GOMD 4RL6A 1N6IA 4Y30A 3L0PA 5ANRB 3GEDA 2Q62A 3LIPA 2W42A 2AUMA 1J8YF 2C31A 2JFQA 4RFSA 5JCPA 1QTIA 3A9RA 3BMQB 3CUSA 1RI4A 3CBGA 5CNIA 4V39A 2XR1A 5EHNA 1E2MA 5A7GA 4C7XA 1KYQA 5CG2A 4U0KA 1HG1A 1YKFA 4AJ1A 2WWFA 1A9TA 2REOA 2PSDA 5ARDA 1FB5A 3I6IA 3LNTA 2QRLA 4QYIA 2ZJFA 5AK0A 4R1TA 1YCFA 5B7QA 5BXYA 3BJZA 3F46A 1JI3A 4PSAA 3SY8A 2ISSD 4ED9A 4UUOA 4D4LA 1VQ6B 2QX9A 1JHUA 1ZOOA 1QGUA 2OBFA 5ALYA 1SCBA 3QU9A 5C7LO 2J3DA 1R7RA 3R20A 3W90A 1HY3A 4NJOA 4AN4A 3GEEA 1S8OA 2MYNA 4ARZA 4AVYA 2PKRA 3JZMA 3X2EA 2CLDX 1XJCA 2HK8A 1LLUA 1ISMA 3ME5A 2FW6A 2X6WA 3FLAA 4I1RA 2P3MA 3A3YA 5M2QA 3PGJA 3G0DA 2I9KA 4QYSA 1X1BA 5A88A 3E5NA 3OG9A 4ZVLA 3GDHA 4IGIA 4W5JA 3Q0IA 1PJ6A 5B6IA 4MB2A 1PFGA 5G0VA 2QE6A 3TAHA 1NC1A 2PEZA 5AJWA 3ZIAD 4EGAA 2P2NA 4G8DA 4Q3EA 3VUFA 3H2JA 4MQEB 2Q50A 1PSWA 2BM1A 2QSYA 1EWYA 1VLZA 2ID4A 4PNZA 4WFIA 3ZJTA 1QG4A 3K6RA 4S1PA 1A2QA 4Z3KA 2V1UA 3VU9B 3OP4A 1DXOA 5B30A 4EGQA 1KFEB 2BFFA 3NT5A 3HABA 4Q19A 3T1NA 1SUIA 3KJZA 1B6GA 3T5MA 3RRJA 4KFRA 4KN5A 4M0KA 4YEDA 1OQAA 1OHHD 1LBQA 1UDCA 2GN9A 2W37A 4IUBS 5B1SA 5U4XA 3OPYB 2P6RA 1FDSA 3JR3A 1H8HD 3NKFA 1BMTA 5HF8A 2IGTA 1V8FA 3GFRA 3ZWQA 3ZYZA 1K2WA 4B1FA 3HM9A 4Y6PA 5T8KC 2HF7A 4E31A 1KA9H 1JGTA 2W2PA 5K0EA 5AXDA 3MCZA 4JLAA 2OQRA 2QRVB 4PYIA 2W6CX 3VNBA 3L5KA 5LIPA 2CHFA 2A92A 2Q6IA 1VIYA 1QAOA 4MW6A 2XHZA 2IUEA 5J1TB 5JCZA 5TQVA 2C7BA 2FJ0A 4MV9A 3FVWA 3T7IA 1T0IA 4IHJF 3BDIA 2X6YA 4GM0A 2XMQA 4WKCA 4BLTA 4YRBA 4O3MA 2CVQA 2WE8A 4DNXA 3BK7A 4HZUB 4YCBA 4CM4B 1PT9A 2EKQA 3PL1A 5HDBB 3TKLA 1J5EB 5FBRB 3A9CA 3ONNA 3KQKA 3D1JA 1P75A 1IHDA 4B74A 4CM3A 3LA8A 4M0PA 4N1AA 2Q9AA 5A9SB 1B76A 2P4QA 4P0QB 3MBOA 4FZJA 3P9PA 1TFRA 2AOUB 1QF9A 3CX4A 4WUTA 1G8JA 4L4SA 4CHTA 4XVUA 1J25A 4WZBB 1O54A 4EW2A 4YJDA 1VCIA 4F3NA 1QFXA 2IITA 2ALJA 2JGDA 3OPXA 4MULA 1V1MB 4UU8A 1KAGA 5FBLB 4C5AA 1O6FA 1KOLA 2NYRA 4M9RA 5T8KA 1Q0QA 5GWXA 4O2LA 4YRDA 5IC5A 4FWBA 3U5TA 2VQEB 5HIMA 4BWVA 1S89A 3UJ6A 4A03A 3QEBZ 3O92A 4KQXA 1PK7A 1OR8A 3AY0A 1VI2A 3DWGA 4J4HA 2BY4A 4UVEA 3RHSA 1TU3A 1UOEA 4OV6B 2XVAA 3BICA 3K9NA 3NWJA 1I0IA 4F85A 4Z1OA 3T06B 3G0IA 2G9RA 2VP4A 2C4NA 2AL7A 2GBFA 2JVKA 2K4MA 5PNTA 4D79A 2JLVA 2V65A 4C20A 1F6BA 2DFTA 2F67A 1AKRA 2FSPA 3JWJA 4OL9A 1U7WA 1VCOA 3IP3A 3U17A 5EE3A 3C74A 3CW9A 2C0CA 2ACEA 3GA7A 1T8UA 2IZZA 1U0LA 1Z06A 2JCYA 5G4KB 5A6SB 3RVJA 3K9HA 3TYXA 4PRLA 4C5CA 1GITA 3WAKA 1D0IA 2IKSA 3L8GA 2NADA 2CLEB 3Q3VA 3MHTA 4C06A 1VQ5B 2WJ3A 3UEOA 2DRIA 3BJIC 1MPXA 3LK7A 3ZXYA 5JMWA 2DHRA 4IDHA 3SNHA 5TY0A 2D1FA 3D4NA 4NHOA 3ECCA 3Q3JB 1ECLA 5AW9A 2FMKA 2GTHA 4QVAA 3Q9SA 3NXKA 1IULA 1D07A 1C4KA 2GKSA 2ZTGA 3TFWA 4DIOA 1E43A 2V3VA 3IEXA 2OM2A 1EGQA 4PLFA 3QBVA 3I01A 4BHTA 1NBWB 3NT2A 2OEPA 4ENTA 3MWDA 2PKQO 4DUGD 1UINA 5EXEA 5KINB 1X3LA 3OURA 5K0GA 1QOZA 3C4JA 3U61B 2J0SA 4P93A 2JFNA 3Q87B 3N7AA 1M76A 4KLCA 3ZE6A 2OTCA 3Q3IA 1M8FA 1YC5A 1HE4A 5HJ7A 3AT1A 4XX0B 4DQXA 3NLLA 2DJ5A 4ZIRB 1Y80A 2DE0X 3KWJA 1Z39A 4FS8A 1YT5A 2OM6A 1EK2A 2UVPA 2ZTMA 4RA6B 4YV1A 3IP5A 2QXYA 2H1OA 3CWQA 2Y0CA 4NBNA 5JXJA 1ZVVA 2PUDA 3HCNA 5C8XA 4I1PA 3U4CA 1UC4B 5FFFA 1K8RA 4E5KA 4R5HA 3STXA 3AGQA 3HKCA 4HAUA 1H42A 1Y9EA 3JQGA 4YMLA 5BPHA 2WT4A 3EF1A 4AYWA 1DADA 3PVDA 1P2UA 3JQEA 3MEQA 1C9MA 3Q9LA 2BFCB 3FRIA 3QZUA 3R6TA 1CKEA 4LZAA 4W9RA 1PT6A 4DRXA 1YFKA 1XA4A 3B3GA 4YGYA 2BONA 4YFYA 5K8VA 1LK0A 3T53B 1VJGA 3QELB 3IBYA 5KYUA 4OGKA 3NJ4A 5EWJB 4BVEA 4YRNA 3B48A 2IV3A 421PA 4RTNA 1WY5A 1IL0A 3UGTA 2AJDA 4K40A 4ZVNA 3W06A 3K9WA 4HFJA 4S1WA 3WRXC 4W1QA 3P7MA 2J6HA 3OFVA 2DM6A 2GVDC 3D4OA 1BG6A 1TMOA 4M1EA 4O2AB 1XNQB 2R97A 1JJIA 2V03A 4KP7A 4HAYA 4MDFA 2BSXA 1CR0A 2O8NA 2DZDA 2QI9F 1T4BA 2IU6A 2WU3A 4G81A 5JW6A 3U7IA 3UPUA 1EZ4A 3IP7A 3O8OB 4EJSB 1OLSA 3BRQA 2ZIEA 2JAUA 1JUDA 4O2RA 4C2TA 1R6XA 4DA0A 3CUYA 2PBFA 2C3UA 5IARA 3RD5A 3FNFA 2ZB2A 5DP1A 4QT4A 4YLGA 1P19A 2ZITA 3H94A 4Y2HA 4BTEA 2VJCA 3C15C 3LAWA 1UBLS 2H9IA 3QKWA 1OTHA 3RC2A 5T6MA 1QVRA 2RI0A 3S2UA 1N92A 3SLRA 3EVNA 3GMTA 1I1OA 2BJVA 2HTEA 3QPWA 3BDAA 2V5AA 3W6OA 1AGNA 1BCSA 2XE8A 1J42A 2HJRA 3EY9A 1GTRA 2K2WA 1YJWB 2ZDQA 2Y93A 4K81B 1ISFA 4LX0A 3WRXA 3DKIA 4OJQA 4GMDA 2H2HA 2PAFA 2VUIB 4W1SA 1MB9A 3BXPA 1NVXQ 3WMEA 1K7SN 3UAGA 3WVNA 3VFDA 4EHDA 4LE2A 1GPAA 4P7FA 4EVIA 3PQ5A 2H2DA 2FWIA 2E21A 4ONEA 2PH5A 2QMQA 2AFHA 2X3FA 4DUPA 4EF6A 4D4HA 3E3OA 1QYVA 2AFIB 1G3IA 3NTQA 2QNRA 3WFZA 1NJ2A 2ZPAA 4QPZA 2OV8A 4E88A 4F2HA 5LP6C 1TIBA 2CJWB 4EECA 2C7PA 3KBBA 2VRCD 4PEVA 2ZP1A 4GYYA 2J33A 1NVEA 2XQFA 4I55B 4A5SA 2NXNA 3FMIA 1KK1A 4FNOA 2MIIA 4NAVA 1H2AS 1PWZA 1TRKA 2GYVA 2VHTA 3K4QA 5LA6B 4GOXA 4X7DA 3E35A 4Y1GA 1EFVA 5IVDA 3AJ8A 3AIMA 3EPLA 4HQRA 4AO7A 2QTGA 3LNCA 4B0PA 3G2IA 4QUDA 3DQZA 2QTNA 2CBGA 3O94A 4C14A 1TM3E 2VKQA 1IZYA 2AQKA 3EBLA 1XRQA 2AMVA 3KJGA 4S05A 4D0LB 5CDFA 4IDAA 1G17A 4BZXA 2IF0A 3NIGB 2PUVA 1E3JA 4DMRA 1VBKA 2X9NA 3GNQA 4UZEA 2FX2A 3VR3D 4ARAA 5AICA 2P0EA 3ROFA 5B3JC 1LPBB 1T2EA 5JFOA 4IL5A 4OYHA 1FUUA 1OI2A 2OXCA 3OH8A 1IAQA 1B2RA 2JH3A 1X8XA 5IXJA 1TT5B 2VP3A 4RGBA 3O1HB 3QX7A 3Q5GA 2ZT8A 4HFMA 5ETJA 1AGRA 3AXTA 2XYHA 4NZOA 1L9XA 1HFJA 2ORVA 5HPYB 4JJZA 1E3XA 5LP6A 4BPBA 3BB1A 5AOBA 1F51E 3OIGA 1CQJA 4BFYA 1ZM2A 1YJ9B 1ZNWA 2BBTA 4GPBA 4REOA 2LTAA 4E08A 4WBNA 2JJQA 1W49A 2QW0X 2GWRA 1I10A 4O4IA 2J3EA 4Q66C 4TOIA 4UASA 5IULC 3T7AA 1NX9A 4M83A 1EUZA 2W6ID 3PHGA 1E0KA 3RUIA 5B4VA 5FOTA 2QG6A 3B1KA 3GJSA 2DR3A 4ERNA 5HW0A 5LOVA 3KTAA 3O4FA 2OQIA 3SR4A 4YXWD 1RQLA 4MP3A 4NYJQ 2OCGA 2PYIA 2ZRBA 1AKVA 3L8ZA 1BE6A 1KYYA 1L5YA 1E6KA 5JHHB 4R40A 4A8HA 2DLNA 1VSTA 2IIPA 2HWKA 2UVDA 3WOHA 4K0RA 2AEFA 1FQWA 2WWHA 3BMCA 3DMFA 3HM2A 3KOYA 2C9CA 2A9FA 2ZSDA 4GU5A 4HEA1 3K4PA 1KVSA 4KIWA 4BWYA 4RULA 2H17A 3E4DA 4KH0A 3PJFA 3UAVA 1Q0PA 2O2JA 1TD9A 1I4LD 3GD7A 4YJFA 1D8TA 3SYKA 3UK1A 2FFRA 3QVMA 2C9ZA 2X1MA 1E8DA 2B8TA 5L4LA 3LGSA 4FFNA 4P58A 4F96A 4ZV9A 4HADA 3G6EB 5JJBA 4HDCA 3D3QA 1GPWB 1H6CA 2QGZA 3KZOA 5TJ9A 2O8EA 4FHCA 3E2MA 3ZHRA 1Q7YD 2HA5A 3PT9A 4C7OA 1VHJA 2Y1XA 3ER9A 3V4RA 2JGJA 2XA2A 4G9BA 4PAWA 4Z4TA 5DNWA 1XKLA 1QIDA 4F4JA 4CKCB 4U5QA 1BQ4A 5DM4A 2PSHA 3RSHA 2LDXA 2QU8A 2QRZA 1B6RA 3THYA 4II3A 1E92A 5JAUA 4XWYA 2ZGVA 4M21A 3DMPA 4QT0A 4RNDB 1U7UA 3OT5A 4ITUA 2BAGA 1L2TA 3ELDA 3OOCA 3KEWA 1U7TA 4C04A 4DDWA 4JMQA 4GZLA 1QYWA 3E3AA 1L7MA 2X15A 2OYCA 5EPOA 1OWNA 5E2IA 2C9OA 2FG7C 1J2JA 2FUG1 2IYVA 3OPMA 4CLEA 2RD2A 2Q4TA 3FHTA 1NVAA 3HJHA 1HZEA 3RGGA 1QQ7A 1GGNA 1FYVA 4DAEA 2EZ9A 1MENA 3PPYA 4II2A 3QLTA 2ZZKA 1JFRA 3NAGA 4N8EA 5TGDA 3WKAA 1TQ4A 1N75A 2BFEA 4RPIA 1NVBA 4ZPJA 2E89A 2HLHA 4QWMA 1EFDN 3R24A 3AIIA 2EL9A 4L8YA 1R27A 1NMYA 1JL3A 3IQWA 1E3QA 1XO1A 2FP4B 4L8JA 2FDXA 3F7NA 2IZ5A 5CUQA 5FQNA 4MA5A 2BN4A 1ZJZA 5KVCA 1XPUA 2G70A 1P4HA 1XKXA 1C9EA 2ZW9A 3G5TA 1K8AD 2PJRA 2VP9A 3CPJB 1M8JA 3SJ7A 3GRKA 2BZ0A 1EK0A 3OQIA 3ZOKA 2H0QA 2P2ZA 3B7WA 4UE2A 4GE0A 3BWBA 4K1LA 2JASA 1ZIYA 3T1VA 5D86A 4UPEA 3T7RA 5C5CA 2QLFA 3IUJA 2ZIVB 3HTXA 3O82A 3JVIA 3DA8A 3BWEA 4UAUA 3CLRC 5IDQA 2A30A 1JAHA 4ME6A 4BV2A 2X8AA 2OOKA 3FDIA 2CD7A 3F8SA 4MMXB 1JQBA 3VV3A 3AWDA 5KNCD 1E96A 1CLEA 4OIFA 3B52X 2GH1A 3F96A 4WLVA 3NFYA 3VDMA 3CNNA 1ISPA 3HCPA 3O8QA 4KQWA 1EVEA 3AHDA 4C07A 4DSUA 5LZ9A 4JY7A 1RXCA 1W9MA 4LTMA 5HYVA 5IVKA 4X3PA 4MR8A 1VA4A 1QQTA 1WXDA 3HYCA 2ZIGA 3OLYA 3GP3A 3UKDA 2HRQA 2C3PA 2ZE5A 3VH3A 4KX5A 4CG1A 4LFAB 3HJFA 2CJXA 1YRQA 2FMUA 3VHLB 1KH3A 2D3LA 1QK4A 1AGXA 3DD5A 3BREA 3SS7X 4H60A 3H2SA 3S8MA 3U4QA 2Z0MA 1T5TA 4QQNA 2M1XA 1N36B 3KLPX 2Q99A 4Z7OB 4KNVA 1YRBA 3AHJA 2C4KA