1QGYA

Ferredoxin:nadp+ reductase mutant with lys 75 replaced by glu (k75e)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEELRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin--NADP+ reductase
molecule tags Oxidoreductase
source organism Nostoc sp.
publication title Structural analysis of interactions for complex formation between Ferredoxin-NADP+ reductase and its protein partners
pubmed doi rcsb
total genus 90
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qgyA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qgyA02
2HMAA 1E63A 4PGOA 4ACBA 3W2IA 1HA3A 3AVXA 1J9ZA 1QFYA 1QFJA 3CCLB 3CCMB 1VQ4B 1D1NA 1JA0A 3CB4A 5TV2A 1ZM2A 1DDGA 4Y7CA 1VQPB 4ZV4A 3I56B 3W5UA 3OJWA 4ACAA 1S72B 1XE1A 2VNIA 4C0SA 1EP3B 4MYUA 1Q86D 3PENA 3W5HA 4K1XA 1EP2B 2QN6A 2VYQA 4PC7A 1K9MD 1GO2A 2B7BA 3OW2B 3OZWA 1N0VC 1XB2A 3JQPA 2RC5A 3AVWA 1BX1A 4TN1A 3WYAA 1CNEA 1BJKA 4RCYA 2GQFA 1NDHA 1GJRA 2E1RA 3CCSB 1NJID 1QGAA 5EMNA 2EFGA 3CRZA 2QEXB 2BV3A 4J0QA 4LC0A 1QUFA 3FPKA 1QH0A 4B3XA 3AVVA 2CNDA 3A1FA 2VNHA 1VQ9B 1D2EA 2PMDA 3ZC3A 3W5VA 3LYUA 4F7DA 4RJLA 3CW2A 3I55B 4TMVA 4LBYA 4ZGQB 3W2EA 1JA1A 2BGJA 3B78A 3P27A 3ZZUA 1I7PA 2VZLA 4QFMA 3ES9A 5KSWB 3VNVA 4ZCMA 1VQ5B 2BM1A 3QFRA 4P3YA 3ZZTA 1VQMB 1UMKA 2BMWA 3OZUA 1QVGB 1QGYA 2C77A 2YWEA 1IJEA 1D8TA 2YWFA 2DY1A 1G7TA 3SJZA 2XNCA 3QE2A 1N8RD 4B44A 3VO2A 1ZM4A 4RD4A 1GAWA 1SKQA 2YWGA 4PC2A 3J81k 1QG0A 2BSAA 1E62A 1F60A 3G71B 2J7KA 2XNJA 4BPRA 1YJWB 1ZM3A 1QX4A 3OZVA 3V76A 4N3GA 4B43A 2OK7A 3WXMA 1DG1G 4NBSA 1B2RA 2VNJA 1AMOA 2BPOA 3E20A 3ZZ0A 1VQ8B 2DEUA 4Y9RA 1ZM9A 1QFZA 5GV8A 3VO1A 4FN5A 1R5OA 3W2HA 4M1KA 1BQEA 1DARA 3WNCA 1Q81D 1BX0A 5JBQA 4TMWA 1S0UA 3E1YE 1TUIA 1OB5A 3QFCA 5AN9A 3AVYA 3JQRA 2C78A 1TLLA 2GPJA 4M4SA 1GVHA 1KK2A 3LRXA 2B7CA 1E64A 1ZUNB 4N3NA 4DQKA 1EP1B 4LBWA 4B48A 5H5JA 1AIPA 1DDIA 1FRNA 4ZCIA 4IW3B 2OK8A 1WDTA 4RD6A 1EFTA 4YAFA 1YHQB 4P6VF 1W34A 1KJZA 2FX3A 4QHYA 1TVCA 1U2RA 4LBZA 1FNCA 2PIAA 3G4SB 1CNFA 3ZBUA 4Y9UA 4AF6A 4B4DA 4Q7JB 2NPFA 2DETA 3VMFA 1EWYA 1M90D 2BF4A 1FNMA 1VQLB 4R71A 2EIXA 3CMEB 3CC7B 2QTZA 1N0UA 3B82A 1Q82D 4ZGNB 2B5OA 2RC6A 3CPWB 1KTVA 4HE6A 4C43A 3P26A 4YAWA 3MCAA 5DSZA 2BVNA 1JB9A 3B8HA 1YJ9B 4M53A 2QA4B 4WQMA 3CCVB 4NCNA 4PC6A 5GV7A 1FDRA 1G7CA 5THXA 2VNKA 3CC2B 2BGIA 2QDXA 3W2GA 1IB0A 4TMZA 4H9GA 3CXCB 1QUEA 4PC1A 3JQQA 2OTLB 1JNYA 1KRHA 3QFTA 1FNBA 3VNUA 1VQNB 3WNDA 3CC4B 1OGJA 3WBJA 4YHBA 4EH1A 5H59A 1KK1A 1YIJB 1VQ7B 3CD6B 4RD3A 1H42A 2YWHA 1JJ2B 1OB2A 1W87A 1GAQA 1F20A 3WNBA 3QSYA 2DERA 1KK0A 1EFCA 1M1KD 3OJXA 3AGPA 1KQSB 4G1BA 3U6BA 2OTJB 1ELOA 2DCUA 3WBKA 3CCJB 2QMUA 4TMTA 3AVTA 3CCUB 4RD1A 3AGQA 4UAJA 1G7SA 3ZBTA 2X3UA 4TMXA 1B23P 4M2LA 4HE5A 1OGIA 4RD2A 1YITB 2R6HA 3U2QA 4AF7A 1K8AD 3AVUA 4G5GA 3MMPA 3CCQB 3CCEB 1K73D 4DQLA 2XEXA 2BM0A 4M0LA 3FJOA 1VQOB 1EFUA 1W2BB 4U9UA 4YAOA 1VQKB 2HDNB 2D74A 3CCRB 4AC9A 1IJFA 4ZCLA 1KD1D 1GR1A 1H85A 2BN4A 3U6KA 4RCZA 3QFSA 5HXBA 3I1FA 1QVFB 2HCJB 2QTLA 5TR9A 1QGZA 2ZITA 1A8PA 1W35A 1YI2B 3G6EB 1EXMA 2AHOA 1Q7YD 4FWTA 1R5NA 4RD0A 4B47A 1VQ6B 4FK8A 3CMAB 1R5BA 1FNDA 4LBVA 4G1VA 1KK3A 1FRQA 1SM4A 4MYTA 4YALA 1CQXA 4YAUA 1YJNB 3MHPA 2PLFA 3LVBA 5TY0A 3W2FA 3WY9A 1TTTA 4PC3A 5FA6A 3LO8A 1KC8D 2CRVA 1G7RA
chains in the Genus database with same CATH superfamily
1VSVA 3ET5A 1KO5A 2NZUG 3CRRA 1F2UB 3OT1B 3RKSA 5L8VA 1UWKA 3N2ZB 4LAFA 1I36A 2GVNA 2OXFA 1XDUA 1WZNA 5I6DA 5JSFA 2J32A 3AFHA 1ZNQO 1HNXB 1P18A 3T3GA 3GZJA 4IR7A 2AFRA 1WOSA 4TT8A 1YS7A 4ND7A 4V0RA 1L5FA 5B7GA 2N1BA 3GBVA 3MERA 3UK1A 1C29B 3WIUA 2ZIUB 4YMWA 3B3FA 2VCYA 3AJRA 1QYCA 4MEJA 5AM4A 1L8XA 1ZM2A 4UUNA 1Z35A 2PWZA 4ER0A 1EFHA 3FZYA 4KVFA 2C58A 5DYGA 4PIMA 4X1KB 5FUWA 3TDMA 1LTQA 4ACAA 1AN0A 2HLPA 3LCVB 1DIRA 3OBBA 3X1XA 2YJ6A 4X06A 1W4LA 4NOJA 4RA6B 3PEUA 4GWKA 5T67A 3RGGA 4HMQA 4CLOB 5FBHA 4YT5A 4O4HF 4CV0A 5L6MB 5LQRA 3LM8A 4JBIA 2G77B 5FWDA 5I7VA 2X6TA 5P21A 3MJHA 3IT0A 4G0QA 5AJZA 3P97A 2F48A 3K1JA 4E33A 2I8LA 3DEYX 3FF4A 4DJAA 1NP7A 2X4LA 4F3NA 5AP9A 4AMZA 3HDQA 3L7CA 4FW8A 4J90A 3A9WA 1WZCA 5HZKA 1MJ5A 2ZATA 1ZI9A 4EG1A 1T36B 2NUAB 3JVIA 1E9SA 4G5HA 2IXTA 3AB7A 5ADUS 2IV7A 2E89A 4OYHA 4IFIA 2I7VA 4LJLA 4E3ZA 5C81A 1KC3A 1V41E 2XB6A 1ZH6A 3GHYA 2X3FA 4B74A 4HAYA 3R8CA 1VOTA 1N6PA 5FUMA 5I4CA 1RM4A 1TT5B 1Z07A 4N7RA 2RCYA 3L4SO 3V8QA 3HJFA 3JQBA 1RAHA 3Q6QA 5EE9A 1HYEA 3WWDA 3RB8A 3WLJA 3GLHB 1R0BA 4O02B 1DCMA 2D2XA 3BMCB 1S8OA 4OI1A 1FYDA 2VATA 4FX2A 1QH1A 2F3QA 1QAOA 1YI1A 5EQJB 2Z95A 3UG7A 4NH4A 2I2BA 3NATA 4MS4A 5LYJF 5K4AA 2P0AA 3MSCA 4OFWA 1VIDA 2CUTA 1N33B 3HJNA 2X0FA 2ACEA 4WY5A 4M7PA 3R7WB 4FYKA 1WHTA 3KTAA 4Y18A 4FYYA 4BEBA 5A3SA 3L7AA 3HUFA 4DMLA 4OPMA 5EVCA 2PMDA 1PFQA 3GT3A 1TKRA 2FRVA 3W5VA 1JG1A 1O6BA 3N2GB 4S1PA 4UM7A 4FNGA 3U3JA 1K7YA 4DVJA 4WNCA 2QMHA 3WYBA 3O31A 4JX8A 1UFKA 3I52A 4ARZA 4DY4A 1TGVA 2GXQA 2R6R1 1RLTA 2YV1A 1L7MA 1SWVA 2V7GA 2WABA 3I8XA 3RFVA 4JI0B 2ZVPX 3O4FA 3I6ZA 2BHNA 4J6FA 4AJJA 4Z4WA 4RDXA 4ZVRA 2BKEA 4NYMQ 3K35A 2FXIA 3OO0A 4Y2UA 1UBKS 1K28D 4OB7A 3SDSA 3ES9A 4FDMA 4FZ3A 1EZ1A 2ZVDA 3OM1A 1HFWA 2WDPA 2ZUDA 3FWNA 4QASA 4N3BA 3VSDA 4JQSA 2BM1A 4QYXA 1KETA 6CHYA 2CV2A 1ZHHA 3GXOA 1ZRSA 4EKIA 2N75A 3UA4A 1C0EA 1UOQA 2ZPAA 1VQMB 4C3VA 1L7EA 3GU3A 5TEWA 5K6AC 2IKQA 4BO9A 4O0LA 2ZE7A 2NT4A 3HJUA 1DKLA 3N75A 2ARKA 1SC3A 2IELA 4F45A 1YA6A 2A67A 4L74A 2OYSA 2BEWB 1G21A 2JFYA 3BG5A 3CP2A 4TOIA 3V4LA 3M2TA 4PYKA 4LYEA 2JLVA 1NBME 4HWOA 3EVZA 4F71A 4LX0A 4ZJZA 4KK3A 5KZMB 2QN2A 3B6KA 3EDQA 2IYTA 3BRSA 2W9XA 2C5HA 1TUBA 3N2IA 5CFMA 5ECDA 2BGWA 3QBJA 1B43A 4ZT3A 1FJ2A 4X71A 3DVSX 5LA6B 4GF5A 1YGYA 2B37A 2XLCA 4INPA 3COYA 3W3AD 5C3MA 4YMGA 5T57A 3DFUA 3Q2IA 3BCFA 1NXOA 1NP6A 3L8HA 3TR6A 1NWCA 1YQEA 3AB8A 1ONSA 3DP9A 3GI1A 3KWLA 2G9VA 1GA6A 3R5JA 4J7AA 1BKYA 4RK7A 2XNJA 4ZEXA 5H02A 3VBEA 3WV5A 4CUZA 5LP1A 1XLWA 4C6HA 4IQFA 5EQDA 1BCRA 3MHTA 2F1LA 3Q11A 1SXGA 2GERA 4BZZA 2MYPA 3DOCA 4LTNA 3GZTB 4MS1A 1PJBA 2GHTA 4RACA 4H4DA 2JASA 3NONA 1ILEA 1DCFA 1LK7A 1D7AA 1FDWA 1NPDA 2EVWX 4C0XA 1N5KA 3R4VA 1EFDN 3I1JA 4IIDA 1VPEA 3E0QA 3E20A 1HYHA 2ZBPA 3EPKA 2AWOA 2CHVA 2CYBA 4JSRA 3SSMA 4CUJA 1G8AA 2ZZKA 1J7KA 4J8PA 3O2JA 3DH0A 3V4OA 1JS1X 2VQ6A 3ABZA 1HE1C 5FPPA 2FEKA 5D5PA 4DNQA 3AEUB 3A1TA 4EPXA 4I3GA 4U2FA 1GUZA 5GJVC 1UXHA 5JAHA 3D0QA 4QXOA 2ZR8A 1O5OA 2V4DA 1R6VA 2AC4A 3R3ZA 3FI0A 1NVFA 4H0FA 3PTAA 2ZXHA 1MC5A 1ZGZA 3IMFA 2VQEB 4I5FA 1H2WA 1Z6PA 5FULA 3Q2OA 5F1PA 4NU6A 3QIAA 1H5NA 3KJFA 4I9FA 4QEKA 2I03A 1DVRA 3Q1LA 3Q15C 1D1PA 3QU5A 4RDJA 5K8IA 1KERA 3P9CA 5JLAA 5EWLB 1B3RA 2E4XA 1DBIA 1L8AA 2OORA 2XNSA 3FG9A 4KREA 2DR3A 5ESXA 1U7ZA 2C78A 2QJTA 2JHGA 4MQMA 1EBFA 1Z18A 3CISA 3W5CA 5E8RA 2FYTA 3F74A 3NBXX 3BC9A 3E2PA 4JS0A 1F0PA 3PUYA 2PH3A 2P6RA 2PMBA 3AF6A 3GH1A 3JTEA 2HHHB 3H0CA 2DUJA 4ZANA 5A9TA 2C2GA 5K8TA 4OUDA 4QC2A 3S8MA 4YREA 4DLVA 3NHPA 3P8ZA 3WDKA 1WP9A 3K2QA 5H68A 1KGDA 2H9AA 2YNMD 221PA 4CLOA 3MRTA 1AA6A 1D2NA 3EGDB 2QDKA 2AG8A 4IRXA 4IUYA 4POAA 2E6UX 3VNBA 4BVHA 2QJFA 3I04A 4RZIA 1GTRA 2SICE 1WKBA 1C8VB 2AR0A 2C3MA 4OMCA 3L3BA 3K4HA 2ZBUA 1EFTA 2XYHA 2X13A 3NBZC 1N08A 2P2SA 2RKBA 4URYR 5H4HA 3RC3A 1T29A 1VB3A 2EJVA 2XZOA 4LRSB 3WK5A 1XLVA 4PQRA 3ZTWA 4XEUA 1GPLA 4YV0A 4RIHA 2QBYB 3VRHA 2GILA 4L4RA 1XRLA 1DC4A 1Z88A 2ZBGA 5LL6P 3ZY6A 4I8IA 4LBZA 1M5TA 1ONPA 1X74A 1PNOA 3KQMA 3IX7A 1P8AA 1QVZA 1VRCA 2H31A 4TVBA 2QTMA 3DTVB 3MIIA 3BICA 4IXNA 4MO9A 4I1SA 1U3FA 2IZOA 3IEXA 4TKVB 1B16A 3SOZA 4H35A 4RZ3A 3BXGA 3FCAA 3JQ6A 4FJ1A 3ZV6A 1FMFA 2A78A 1WSWA 2RSLA 5HK8A 3EW7A 4KPGA 4PG8A 1NB0A 2GAOA 4AZ0A 4F72A 1EA5A 3KSUA 1DRKA 3HXLA 4BN0A 1PL7A 5A71A 3HKCA 1IZ0A 1XAJA 1CETA 2VSXA 1BTOA 3E82A 3OC6A 3L7NA 4REOA 3W78A 2A0YA 1Z4JA 3ITDA 1L8LA 4FHCA 4R71A 1AF7A 3EBLA 3QA3E 4W5JA 5F2EA 3RNOA 3L6DA 1WCIA 4V0NA 4LYHA 2BH9A 2G04A 1NUTA 2GEKA 4L9RA 4RH1A 3W04A 2HC9A 1K2VN 4DTIA 3KDSE 4XYMA 4FMCF 1DADA 3R0VA 4DCMA 2QZJA 2JI9A 5CLQA 1FNNA 1NYRA 2QTZA 2CJYA 2P4HX 3EASA 3K0CA 4OQEA 4I8XA 1CKEA 3UFXB 2F6RA 1JSCA 4ID9A 3OFND 5JJLA 3JD3A 2VBUA 3FYCA 4WZ6A 1D1SA 4PLFA 3UMRA 2WICA 3MCAA 5DSZA 3AR5A 1X3SA 2WHPB 3ZNQA 5EXPA 1T8UA 4I4TB 4OI4A 4QQKA 1ZR4A 1S2OA 5IFKA 1KSJA 4B2YA 5KTTA 5JEDA 2HK8A 2QA4B 2C5FA 4R41A 3AMVA 2E18A 3CJQA 3EY4A 2JGEA 3L0IB 4FYHA 2NUTA 4CUKA 1DAIA 4CEJB 3DL7A 2HTEA 2IODA 2P2CA 1FDRA 2XA1A 3AERB 3V7FA 1BJTA 3GW8A 1XT6A 4ZOBA 1KY2A 3H2KA 3A0UA 1UFOA 2Z2YA 2DT5A 2BGIA 3DE3X 3MGAA 2X6XA 1XN1A 3INRA 3N8HA 1D4OA 1XU4A 1NFFA 4WHMA 3HO6A 3IP5A 1KXJA 5JAQA 3T7AA 5JFGA 2E4WA 3U9LA 1A4IA 1K7XB 4AULA 1Q14A 2V6GA 4X9XA 4P5EA 4XVHA 5DHRA 1ADFA 2HHAA 2OO7A 4RH3A 2QN7A 3RJZA 4E21A 2F3SA 2QM0A 4GL4A 5IARA 5F73A 4LI3X 1H4VB 2QLMA 3B1WA 1M6YA 1Z6XA 2FQWA 1UWLA 3WK8A 1RLOA 1R0YA 2PS0A 3GNTA 3F7NA 1WZUA 3LLVA 4ICIA 4LMBA 5E7IA 5KW9A 2PCLA 4IWYA 1OFTA 4TMKA 4ALIA 1EGQA 4HN9A 4Q1DA 1T2EA 1OGJA 3WBJA 2QPAA 1GFWA 2VTKA 4J4BA 5FF9A 3WLRA 3L9XA 4KIJA 5JNSA 3X1MA 4IO1A 4DY6A 1OFUA 3GLFE 3TH5A 3HZRA 1XRQA 2GLUA 4JI3B 1YASA 2C96A 1ODSA 2X0DA 4JWKA 5BR4A 1GZHB 3GZNB 3P2JA 4U7DA 3PVCA 5H82A 2OPHA 1XGKA 1FFDA 2ZJAA 2NO1A 5DTMA 3ZJ5A 4HQLA 5KVSA 2XE7A 4LYYA 1F7UA 1WW3A 3H1PA 3EXEB 4MV7A 1PL8A 1FBNA 3G59A 1BH2A 3E9DA 3SC3A 4AIIA 2JCXA 3R3WA 3ONNA 4LVNA 4RGBA 1FCJA 1T2CA 4W8HA 1UD8A 1IEWA 2YZKA 4PO1A 1EUYA 1P60A 3CW8X 5ALZA 2BKXA 3E1KA 3FMIA 4TKMA 1E1CB 2J33A 4GHWA 3MT0A 4FYPA 2WSMA 2BMAA 3D3KA 4PIPA 5D2CA 2G8LA 4MO2A 4OBEA 3E3AA 1YL6A 4OLAA 3UJNA 2G4VA 3Q3CA 1M7HA 2VXOA 3BXFA 3C15C 5HA5A 2IU0A 1IZ8A 4MRSA 2WA1A 4BO4A 1RWMA 4G24A 1OGIA 4WXPA 1E98A 1L2TA 4RD2A 3KT0A 4ZT2A 3ZZNA 2XOXA 1PNTA 3HR4A 4RADA 3T5MA 4UAVA 1QGDA 4ND5A 3UA3A 5BNTA 4UMDA 1E6WA 2J6BA 3ND8A 1FRFS 1GARA 1Z37A 4M1TA 3AVUA 5SY6A 3Q7SA 6NULA 1UAGA 1DC8A 2DFLA 2PRJA 4GRDA 1Z62A 4I5IA 2H2AA 2QQEA 3SJAA 4BJHB 5LMNB 1MPXA 4MUKA 4IGIA 1NHWA 4KEAA 5FDFA 2MOKA 3MUOA 1Z16A 1U2ZA 2ZS9A 4LX8A 3ROGA 3AXTA 4C0BA 3OE7D 5CTJA 1LSOA 3ROFA 4NFHA 1J1ZA 3WDMA 5K51A 1L5RA 2YYSA 4B32A 3A8KA 2FPGA 2I6TA 3A9CA 1KZ9A 2DTEA 3NH6A 4W9RA 2XEXA 2ZT6A 1QIKA 2HFKA 2VTDA 3WS7A 1T25A 4B3JA 5MN4A 4TYYA 1C3OB 1NY6A 3PT9A 5K3SA 5B2EA 2XT6A 2R4TA 3FSGD 4GAEA 1F48A 1E3MA 4KGDA 4R9NA 3M1AA 2P5SA 3A6PC 1AS2A 3IUJA 4X20A 4OOFA 5IG2A 2D1SA 2HH9A 2V5UA 5EGSA 5D5QA 2IXFA 5IJXA 3SF0A 2MYNA 3L84A 1J09A 1UZMA 3TJRA 1ZIXA 2IZ7A 4N4AA 3B9QA 1V4NA 4YTEA 5K0SA 1Q84A 2O5RA 4HEHA 1XPJA 3R5XA 2BGRA 3VKFA 4EBBA 3HFRA 4EK9A 5EG5A 4UJ5A 4RKRA 1LRKA 3NIGB 3A2KA 2C0PA 2DFVA 4C0QC 2W2MA 3JWGA 5TGZA 4IEEA 2Z08A 4AJKA 1VKJA 1H85A 2W6CX 1QDEA 3AF0A 4GUAA 4YJHA 1BJRE 1OBCA 3Q38A 2WTMA 2VS1A 2EWMA 2QYTA 4G8CA 4A92A 3IVXA 1GKLA 3MWDA 3HWX1 3T1NA 1LV8A 4KMOA 3T5DA 4JNCA 2Y66A 5DGIA 1UR5A 4MGHA 2HDWA 4WBNA 4C08A 4AKGA 1RQRA 1NQXA 3RG8A 1XQ6A 1PR9A 3MOSA 3O8BA 2O3QA 2RHTA 3GBSA 3ZK7A 1Q0ZA 3K4PA 2XXAA 1PX0A 3G02A 4AZ0B 4UZUA 1CIPA 2ZRAA 4XORA 3MJVA 3NJ8A 1JBKA 3HBMA 4IV8A 5CW1A 1DGQA 4P38A 2L2QA 3D7RA 3EMBA 1NJ8A 4FR0A 1ZBDA 1FNDA 4LWQA 1R16A 4X6YA 1A8HA 1DC5A 4UW9A 5GOZA 2B34A 4KPYA 2CUNA 1OE0A 1UPTA 2EFDB 3HDVA 4BNJA 1R37A 2PLFA 3OFNA 4P80A 1O5IA 5AK0A 1GSHA 1QK5A 2X6RA 1WW8A 4OHOA 2FXVA 4TYQA 3W6PA 3ZDRA 4R9RA 5CLHA 3UFXA 2C9ZA 2NVUA 5LWQA 1Q83A 1KDTA 1KDRA 2JFHA 2IVFA 1KIFA 2ZWAA 2ZJZA 1UMDB 3O4JA 4X3CA 2Y4OA 4J0HA 4FD3A 3KKPA 4HFNA 1Y9ZA 2PUDA 1AUVA 3LPMA 5EZSA 4E5SA 3QG5A 1B0UA 2J48A 2CE7A 5B5SA 1YO6A 4RDCA 3WA7A 1XRSB 1VBFA 2H2HA 4GXQA 2IX9A 1S1CA 1PK7A 1U81A 1EE2A 4YP7A 2VSQA 2YS7A 1E0SA 4IHAA 2JAWA 1TYCA 5HF6A 2QVCA 1B7GO 4INAA 2OAGA 1P0IA 3SVTA 4EKYA 3KSBC 4JOSA 3AETB 3EXG2 1USIA 4RUKA 1JXMA 1TMGE 4ZOLA 4QYMA 4Z9XA 3SS7X 3MB8A 4ZI7B 5JSHA 2XD4A 5TRTA 5K09A 1MEJA 2JN9A 2GPSA 3MRVA 5E1MA 3BIJA 3D4PA 4FFNA 2AXEA 3OLWA 3CVVA 1MOSA 1K5GA 4LMAA 3X44A 1FMCA 5H9VA 4U5XA 3UKJA 1QZ3A 3OMLA 2PKQP 4P26A 3LDUA 1RPAA 4YJKA 5A4JA 4QWMA 1NG1A 1HE3A 5CYFA 1UFVA 2RH9B 3FJYA 4MR8B 4U02A 3A6LA 2HCFA 1JQ3A 2ZW9A 4Q19A 1UJNA 1SB8A 3TVYA 2XA9A 4K1XA 1ZJ6A 1O9BA 2P90A 2RAFA 2GM3A 2QTHA 2SKEA 2YC2C 2ZJ0A 5TPWA 4PC7A 1QK4A 3IQEA 3VVMA 4MVJI 5F23A 1JUDA 3PL5A 1QCYA 1NQTA 1G9XA 1M73E 4B4KA 5JQWA 4RCVA 3HYLA 4CIYA 2BUBA 2E4UA 3GN2A 5FLYA 2A1TR 2ZRGA 3FXAA 3NTUA 1BWQA 1DIHA 2ZRBA 3I6IA 3B51X 2G1AA 4CV2A 4XFJA 4RTJA 3GGSA 4CVNA 1GV1A 1W4RA 1Y98A 3KYCB 4FT4A 1FL9A 2IYEA 4MTCA 4JC8A 1NRIA 2XT9A 4GE3A 3U7FB 2M98A 4X64B 2WFMA 1Y1TA 3ROQA 4Q9LA 4OSEA 2X8WA 1O87A 2PSSA 1SBTA 4XLFA 1UFRA 4MQ6A 1RBQA 4G1FA 1A69A 1U9IA 3HS3A 1F2TB 3QHAA 1MENA 4IZHA 2X3YA 4XOIA 1KNXA 4NU0A 3DLCA 1MHTA 1V25A 2DWQA 5I48A 2BR3A 4NDZA 1SBZA 3UJPA 2X6WA 4CMIB 5HBGA 3UWDA 2YZMA 3R6LA 4N18A 1WV1A 1T9BA 3VM6A 4BQNA 4F84A 2QYHA 2Q9CA 3K9WA 3AJEA 4CU2A 3RWOA 1WOMA 3QOXA 3AW9A 4OD0A 3QA9A 3BIXA 4HX2A 4TVOA 3VZBA 5KREA 3K6JA 1L3IA 2ZI4A 3DBRA 3NHRA 1RIFA 4HH4A 5DHAA 2JK1A 3V1TC 4ZQCB 2C2BA 2ZJ4A 4E6EA 4X1YB 4Y3UA 2GEUA 4DSAA 4H1WA 1GTVA 2C4KA 3BKWA 2H00A 1HMYA 4CLXA 3CW2A 4TMVA 4LBYA 4HB4A 2YWDA 4HYYA 4Q4AB 3FYUA 1MUUA 1X80A 3LU1A 1II8B 1DOHA 1MPTA 1X7GA 4B33A 1DIAA 3IIKA 4LHZA 2GA9A 2JAHA 4MWOA 1JLHA 2ODEA 1XAHA 3AV3A 4NYJR 5C4GB 3V8EA 4P33A 3WB1A 4N6GA 2NP7A 1P9RA 2AFVA 2IDKA 4UEOA 4QDTA 1I6MA 2I6QA 3R6TA 3BWEA 5EUBA 4A2CA 1U1CA 4XSVA 1F6WA 4Q1EA 1M5UA 3ZH2A 3THSA 1VHWA 1Z8FA 2ZR7A 2WJ6A 3MUEA 1AURA 4HLQB 1QZXA 1QGYA 1GNLA 1LQTA 1JIVA 1GPWB 4ID3A 1HTBA 2FW6A 4M9CA 4WFKA 5DRYA 3ZXIA 1ZAYA 2PGOA 4LE0A 2X8KA 1VL5A 3R7SA 3SJZA 3BZUA 3I6QA 1P3JA 1AZLA 3CEHA 1E1RA 1BG6A 4TZ6A 2P3OA 3IT3A 1MNQA 2YHAA 3LUDA 1PBNA 2R62A 3K72B 4PG7A 1NN3A 4RNCA 1I7LA 2Y9MB 1VJGA 4B6SA 1TMOA 5K1ZA 2FR0A 3FLAA 1AKNA 1GTL1 2W6JA 2YWGA 1SC9A 3DPSA 4DYHA 1QG0A 2HV8A 3GH3A 1EVZA 1IDN1 5E1DA 4GX1A 3OIWA 1R4NA 2H4YA 4KU4A 2IPLA 1CUHA 2IBSA 4BZQA 4CM4B 2BLNA 3K0BA 1U8YA 3FSEA 4MICA 1LPOA 2QJWA 3RRJA 2AMLA 2A7QA 1QX4A 1V96A 2B3TA 2GCPA 4Y6GB 2FPWA 2ZSFA 2Y1KA 1PQWA 3C3MA 2QW0X 3FNGA 3M6XA 2VAPA 3GFVA 4UD6A 3P52A 3SCZA 1JHAA 1QC5B 1LPSA 1L5ZA 1U2TA 2ZYSA 3NIDB 3VDXA 1N2CE 3T5BA 3V8VA 4A5OA 1JQDA 3IKVA 5AVOA 4FE3A 3ONVA 3TGWA 5CB4F 1NMZA 1HH4A 1TUGA 4Q34A 2MYUA 4PAMA 2ZXIA 1VQ8B 1F0YA 1OIXA 4DVGA 4TL7A 3U13A 4PN3A 3GRCA 4HYTA 3IAS6 3NM6B 4KTVE 3ZDDA 1SHZA 4G9EA 3EXIB 2P1RA 1M1NB 5HKOA 2PUAA 2C57A 3HP7A 2O23A 4R9VA 3MCWA 3UB3A 3UT5B 5HPYB 1VYVA 4F92B 2ZTNA 4R1MA 4AS1A 5ADWA 3TAXA 1CT9A 1MT0A 2MSCB 3PQ2A 1XTVA 5IMSA 1KH1A 1I0IA 1CY4A 5BPFA 4S1VA 3SHWA 1EG7A 2DPXA 2UVQA 3N0XA 4TL9A 1EIZA 1Z7WA 4DLLA 2WTXA 3RYIA 5CNKA 1LLQA 1VMDA 3F5SA 4ZCPA 1FDSA 2JK0A 2XTMA 4Z9YA 1UIRA 3KTDA 2GPJA 4G6ZA 4JLJA 5BSRA 3EW9A 1I1OA 2D3LA 2DX7A 3MILA 4RS4A 3GB9A 3TQTA 1VI5A 5A89A 2GN2A 2ON6A 4CTNA 2WFLB 2XUKA 4M1SA 4ZJYA 3RSCA 1RIIA 1YQUA 1E4EB 1ACLA 2O2XA 4N3NA 4DQKA 4BFCA 4LBWA 2CNWD 2GD2A 2Q21A 4LXHA 4X41A 1L7VC 4JLBA 2EKZA 2IHUA 3R8XA 1TGYA 3CZ4A 1T24A 5FJJA 1CY2A 1G5RA 1H2ZA 2A4KA 3OF5A 4N76A 2QW1A 2VJMB 2X76A 2VRCA 3G8CA 2UYYA 4GOKA 1X9IA 1U11A 3DEKA 2FCRA 3IAM6 4J0EA 4JOQA 3HM9A 4EM6A 1J23A 2PLRA 4WGFA 4ZQGA 1PR0A 1TLTA 1CRLA 1IBRA 2ZUTA 1E6LA 5JASA 4HLNA 2FX3A 3EQ9A 4UPEA 1K7CA 4HAOA 4RF2A 1M6EX 4TSRA 2H51A 4RFVA 3F47A 1RWPA 2IW1A 2Q50A 2V97A 4Y8VA 4MA5A 4DFDA 3V1MA 2FW0A 2EQBA 5BT9A 4XVCA 2DJ5A 1PZXA 4LWZA 4OTZA 4CLRA 4WVLA 1XWIA 3MMZA 1JG7A 1GNSA 4IRMA 1R8YA 2VPQA 3JD1A 5EIBD 2HO5A 5DK4A 3WR5A 5LMCA 1R6AA 3EPPA 2PKCA 3EG9B 5DFAA 1FYEA 1DMSA 1I3OA 2ESRA 2PBLA 2PWPA 3DGEC 3JRNA 4PXYA 1KDOA 4ZEWA 3V4ZA 1AQJA 1GXSB 4EG3A 1ZA2A 2O3UA 4RHFA 4E15A 4FM9A 1MO2A 1J0DA 3ITKA 4MUIA 1XLUA 5B7NA 5JC8A 3JR3A 2QRZA 3N3AC 3PGJA 2X0EA 3OCZA 1QLJA 1Q6ZA 1BPLA 5BYKA 2VLIA 3UCEA 4IDPA 1DKNA 4L3WA 1ESZA 1TECE 2C9DA 4MMXB 4ERNA 3AL2A 4IILA 3P7MA 1W7AA 4OOXA 1KOFA 5ITWA 1RKQA 4FQ7A 3FKJA 4P0PB 3L79A 1U98A 1C9YA 2QRVA 4ZGNB 4BO3A 2B8NA 3CPWB 2ODWA 3NHLA 4GR4A 4J0DA 2WD8A 1XZEA 4R2LA 2JBHA 3TLKA 4BASA 4D97A 4CLDA 5I7SA 3DE4X 3WQBA 3QPVA 1QTNA 1RYDA 1HURA 3WLNA 2Y76A 2XODA 5F9MA 3V4RA 5E9QA 4XUEA 4R3WA 4RK0A 2V7VA 1VZ3A 1LW6E 4P9NA 1W4BA 3TIXB 2CJWA 4KXQA 3PUNA 4GOMD 2QSZA 5HTOA 2N1MA 4TVSA 4KH1A 5ENDA 3RUAA 3A1WA 2RI1A 4D43A 1G7CA 1YB2A 4CIDA 5THXA 3ZIDA 2VNKA 1A4RA 3E0XA 1FP1D 3WBFA 1KQFA 2G0TA 3HB5X 4I36A 1EIWA 3E3OA 3FB1A 5KB3A 2W70A 3WADA 4U0JA 5L3RA 1GUFA 2A8YA 2I4NA 3OSZA 2ENWA 3KTOA 3TRJA 1DAKA 3CXCB 1QPBA 1U4NA 2W2TA 4S24A 2H4ZA 4HAUA 3QEMA 1M2VB 2DBVO 4IJKA 2P68A 3VTZA 5DM60 1O0CA 4ZALA 4FMCB 2Q0SA 3PD7A 2M32A 3DMDA 4LSGA 4UHBA 2HDOA 2OTLB 5JCPA 1QV6A 4N8DA 4D6YA 3R0QA 1U7XA 1FNBA 3WOHA 1TMKA 5G0UA 4C07A 2PSFA 3RVSA 3I5YA 3GJRA 2FWRA 1D8AA 5DBHX 4BJ3A 5ITSA 4V1CB 1K1EA 1RYEA 3UGQA 3WO1A 5LOVA 3D8RA 1NBAA 4I6EA 3WKAA 3V7UA 5GADl 1UJBA 1Y3HA 4EA7A 5F4MA 3MTJA 4WK4B 1WSAA 2ECPA 1T8RA 4NARA 4BLSA 4RTNA 1RADA 3ZHSA 1F8YA 4IZ6A 4YBRA 2COUA 2O48X 1NURA 1R0RE 1DJMA 3R8FA 3QE9Y 1AZSC 4EHBA 2ERYA 4EJ6A 1UK8A 3C7TA 1YS9A 2ZULA 1CLEA 1V3VA 4N0QA 3SJBA 3H99A 2J85A 4BRWA 2CXPA 3F3MA 4MPPA 2IYPA 2R6AA 4JOCA 3ZVRA 1Q92A 3WI7A 3BDAA 4AXBA 3PB3A 3R7FA 4DMHA 4O4JA 4ZQBA 1V3QE 1L5HA 4WY8A 2PK3A 4X65B 2GHQA 3CO5A 3MAJA 3DQZA 2Z8ZA 2C59A 3H1GA 3HCOA 4R51A 4WPGA 5ALSA 3AVQA 1M74A 2C9OA 4HDRA 4QNNA 1G98A 3N7UA 4I50A 2FOLA 4C2AA 4IFEA 3GNQA 5BWBA 2ASVA 5K0EA 1YZNA 1C5KA 4K46A 1RRCA 1VSBA 2C42A 1OFHA 3Q8XB 4NRDA 3J81A 4Q3OA 5CURA 1KO7A 2O0JA 2ZRCA 3DMGA 3M0EA 1K6EA 2WVAA 1MNAA 2CSUA 2OD9A 3R3SA 5KX5B 4H6XA 5EMKA 1JHMA 2I7CA 3TXAA 5KTSA 2G09A 3BB4A 3OTQA 1QNLA 1IG3A 3IOBA 3KJIA 1V2GA 1W5SA 2F3RA 2I6FA 2OHIA 2ZB4A 3KOYA 4RORA 1K6JA 2FEPA 1QE3A 4RLQA 3T41A 4HCJA 1XZJA 3PC4A 5E7QA 1U02A 1UKCA 1T5HX 2HOQA 4RV9A 1H1LA 4YPFA 2ZI6A 3JVEA 1DIOB 2V03A 4D79A 4DMFA 2P5TB 1SVOA 4D1YA 1ZUHA 3X2FA 1MKYA 1GZDA 2CC2A 3ZU6A 4LJSA 2WU1A 2DUUA 1GLGA 2AD1A 4DA9A 5C2JB 3BFJA 3R09A 3N6RA 4K9QA 1P1CA 3A2MA 3G9ZA 2WD7B 3DWEX 1KJYA 3O0DA 1H2RS 4KMRA 5MHTA 2ZYRA 2XVMA 3LBIA 4LRWA 3GRUA 1TJ4A 3RC7A 3TIIA 4K9SA 4OQMA 5AUQA 2WJGA 2Y1LA 1DC6A 2X5OA 2ZIVB 4MCJA 3KYJB 2RCNA 3NI2A 2IU6A 3CF0A 1QQAA 1D1TA 4EY3A 3H0KA 4JWTA 1X92A 2ECFA 3WGJA 3L7LA 2IYZA 3QBDA 4H60A 4PPYA 4BNYA 1D6SA 1Q17A 1YDMA 2XVXA 5FBQB 3KUKA 5IU6A 4BMYA 4X54A 1FUIA 1VTKA 4U63A 5KWEA 3HRIA 4BN4A 1XFAA 4GM0A 2Q2OA 3SQDA 1NKTA 4EO7A 1T9CA 1K0FA 1YR8A 3F49S 4B4VA 2LUOA 2ZJ5A 4D9HA 4E4TA 2OXCA 3D0KA 3K05A 2JZCA 4DIDA 3U80A 2HDNB 4ZTUB 3FPSA 1TKBA 1KO4A 1Z0FA 2UUCB 1L7BA 3ZI4A 3VPAA 2BW0A 1Y9JA 4RE6A 3SN6A 1KHHA 2R6FA 2PKYX 1OPRA 4RXTA 1D09A 1GLVA 1Z33A 2F3TA 2AKAB 1C1XA 2BN4A 2OV1A 3K0SA 2AUTA 5KWVA 1PWYE 5I9LA 5HXBA 1Z22A 3TSYA 3TW0A 4Q4HB 1MJNA 3Q7IA 1R4MA 2XOEA 4DWJA 3KZNA 3QLUC 1FUEA 1P6UA 2HBQA 2IHBA 3GP5A 2ZITA 1P29A 3K92A 4QYTA 4TYMA 3RADC 5CXSA 4PM4A 5FL3A 1ZHFA 3ZHRA 2OHHA 2NT3A 1E79D 4ARVA 1KYTA 3HVIA 3L8FA 2OCYC 1V0FA 1VLMA 4X6LA 1Q7YD 1GRNA 2BFCA 1CEXA 3GRYA 3OLVA 2Q4BA 4OQZA 3I09A 4DLNA 2CLHB 1TCCA 1YR6A 3U3OA 3V34A 1JG4A 1RYFA 3GG9A 3PWKA 2A1TS 2ZZGA 3H1EA 4XVQA 4ZHQB 3C3EA 3UWKA 2Z6UA 2H1WA 3BHJA 3HI4A 4ZFNA 3ICCA 4I66A 5KAPA 1EZ4A 1W1IA 5BWCA 4YAUA 3ZJTA 3IQXA 3PNKA 3PUXA 4DDWA 2ONCA 3LOPA 3F7TA 4U7HA 4KIWA 1RLMA 5T3YA 3HB4X 4OX9B 1ZK0A 4JX9A 4I81A 3ND7A 1PO7A 2CRVA 3LHIA 5JG7A 1YDFA 3V7WA 1BMFA 1YAHA 1CHDA 4B83A 4CKEA 1FLAA 4D8TA 2KJQA 3IYLW 1S7GA 2GRJA 4JLMA 3O2QB 2GJKA 3MRXA 1BEZA 3OD5A 3MWGA 1C9MA 1EK5A 2QXYA 2W6JD 3NASA 1DOAA 1Y4SA 1RTKA 3LP5A 4KN8A 4I9GA 1DQYA 3IAM1 3UAYA 1EGHA 2KMLA 2WYHA 3LCJA 2G9RA 4HNRA 4PVDA 5BSMA 1YE8A 5JIBA 4C2TA 1WPXA 3E9QA 1N2CA 3O92A 4YT4A 5ARCA 3D3QA 3BK7A 3CB4A 2LVBA 3E6AA 4BVEA 2WIBA 3ME5A 1MB4A 1T6NA 2NQ8A 1T1SA 3COZA 2OXIA 4BDSA 4B7AA 1C9EA 2PRIA 2HU8A 5JDCA 5IZCC 3DLIA 1CRWG 3G9UA 3RUDA 3T1VA 4Y7CA 1RM0A 1VQPB 3N2NA 3ND6A 4B73A 4UTNA 4DPLA 4ZV4A 1U0FA 3W5UA 4MWZA 1S72B 4KDFA 1KJQA 4EWLA 3QEMB 1QGED 3V55A 2GUGA 1ZA1A 5BORA 5LIPA 1FXSA 2BAGA 3CZ9A 1EP3B 1P62B 3CBGA 4R16A 4RELA 2MYTA 3TX6A 3GVXA 1WY5A 3V7NA 3Q6NA 2D13A 3F8SA 4AKEA 4Z6KA 4FJ2A 4C01A 1C3XA 4M49A 3FDZA 1B8PA 5BUZA 5IYZB 3R6JA 2EWWA 2YFKA 4V1CA 3GAFA 4JQZA 1ZI8A 2L19A 4DARA 4X05A 4OH1A 3D7SA 3TTWA 4PTLA 5EIHA 3OZWA 1JG2A 2GDZA 3THYA 5FNZA 4URXR 5AJVB 1U7OA 4C3OB 4YRGA 1YJ8A 4DNRB 3G8AA 3IELA 4Z4SA 3C6XA 3NC0C 3NNNA 4MHSA 3KV1A 2C8JA 3SQOA 3D6MA 2QLLA 3DULA 4FSDA 3S28A 3FOBA 3NAMA 4E7PA 1YZHA 3WL7A 4BLWA 3ELYA 1YB7A 2JIDA 3Q40A 4KSCA 1OYWA 1U0OC 3L1IA 1GJRA 2CBGA 2FWPA 1E3WB 2V6MA 1NR5A 3GJ7A 2BMDA 4AS3A 1JYEA 16PKA 1SXJB 2Q0QA 2XGSA 3LQYA 3ZHTA 3T3NA 1IHOA 3VC3A 5JNUA 4J0QA 3TLMA 1C7EA 2TMDA 3ENVA 2ODAA 1ETHA 2DFKB 3FDIA 4J0FA 2PYDA 4PFQA 5BYJA 2CMDA 3T7EA 5K3OA 1JHYA 3ZX4A 1QFMA 4LS3A 2YFYA 10MHA 5GJCA 3R9XB 5AOBA 4H4EA 3BGIA 4M88A 4Q3CA 4DDUA 3V1NA 4RQBA 4FFBA 5LZ4A 1DPFA 3PUMA 1DRJA 3GJXC 4KW7A 5LUAA 2ZL7A 1HDYA 1RZRA 4FCVA 4QNRA 5AHKA 1YGPA 4RFSB 1AV7A 4W5WA 3HFGA 1GUYA 3OOYA 2Q2WA 1JZQA 5ELMA 2Y8EA 2FLWA 1GU1A 3C70A 1W5EA 3JTMA 3LZ6A 3FCXA 3SC6A 4OF4A 4ZQHA 4KRXA 3BF7A 4M9ZA 3OY2A 5A0FA 2QZ9A 4E70A 3L1VA 3Q3AA 1UBCA 4WXRA 1KJ9A 2FQQA 1WVGA 3PF8A 4HAXA 2WUFA 2ZSKA 4HZUB 2DKFA 2HRQA 4KNVA 1AY0A 1MIOA 4JGBA 3P27A 3ZZUA 1FTQA 1YB4A 5JS1A 2VN8A 1F17A 1V6AA 3B3JA 4P53A 3VI3B 3WLMA 3WWYA 4ND2A 4C6TB 2JFUA 1Q12A 2P9GA 1PRYA 3HWSA 1TLFA 1NNI1 3IDZA 1F6DA 1YKSA 1VLOA 3PI7A 3QFRA 3ABIA 3H65A 2JH8A 3NG1A 1YCGA 4KDEA 5J58A 2HIHA 2P4EA 3AXSA 3R5SA 4JVNA 2G70A 3NX4A 1FXWA 4LZZA 5EVJA 5T4FA 1UXIA 1XF9A 4LCEA 2Q4DA 5KYUB 1JT2A 4KE9A 2OE2A 3K8QA 3S29A 2P9QA 5FYDA 2J7PA 2UVPA 3I58A 4XCXA 1D8TA 2ATEA 6LDHA 5A62A 1ENOA 4RPJA 3CO0S 3TLZA 5BW8A 5CB0A 1WP4A 1RQXA 3BHNA 2R1TA 1GL7A 1RKBA 2AC7A 2GCIA 3ABSB 3AY0A 1CEEA 5E6UA 5JZOA 4PCUA 5D1HA 1ZLYA 3HV0A 5KTYA 2OV8A 1Z68A 3CPHA 4ZKDA 2YFQA 2FRDA 3DE6X 3JATA 3ZHVA 4X6XA 1Y6FA 1RJDA 1SZDA 1KAQA 1W1WA 1WJGA 3N5CA 3SE0A 1ZK1A 1Q50A 3TG8A 1NW4A 3VZDA 2JBAB 2LBPA 4JLOA 5DGTA 4EGJA 4EY6A 2BKVA 2P9FA 1OHHA 3A2LA 4GSLA 1NF8A 1I9GA 1YJWB 2BEVB 2FGKA 3AR2A 1FYVA 4IV0A 4MPJA 4WA8A 3AU9A 2OHVA 3VVCA 5JNVA 1AVTA 5FHQA 1Q9SA 3OZVA 4B5KA 1J8YF 4BDTA 5AM1A 4OL0A 3C97A 1WY7A 1OV6A 3AFMA 1PLJA 2WI8A 3LUJA 3TZLA 1ZX1A 3I04M 5A8AA 2IIPA 1Z9BA 4GZ3A 4RF5A 2BPOA 2AYZA 4Y1GA 2WJVA 4DEYA 1IUOA 2H85A 4C4SA 1R3UA 1PS8A 1TM3E 4UUPA 1CY8A 3PEWA 2H63A 3EIWA 4WOKA 4RTSA 1A27A 3GEHA 3NYWA 4LXYA 4U2GA 2PWAA 1BGXT 4I3FA 1L4LA 4MV0A 4YNBA 4AO7A 3MUFA 1B73A 3QUSA 4YI3A 1S9DA 3TFQA 3UCFA 2VTVA 4NENB 3O94A 3F71A 2VK8A 5LD2C 3CZQA 4Y2QA 2P77A 5SY4A 2QP3A 2XZLA 1TVEA 4NOKA 4LGMA 4QVAA 4M55A 4I3HA 1IQ0A 4BB9A 1C1YA 3S8YA 2VTBA 2GYVA 1E77A 2SCUB 1QKJA 3DKPA 5JAPA 5BSXA 4X0EA 1B42A 2NTNA 2QV0A 3OFVA 4XQGA 5F5NA 4FIDA 2IQIA 3V9PA 4BWYA 5EKSA 2C83A 3PPVA 2FW9A 5AESA 4HGQA 3F9CA 2JGLA 3L0ZA 4HH1A 5SICE 1JDVA 4BMPB 5ALFA 4WZAA 2QP4A 1VGVA 3ZXXA 3ETCA 3U17A 3QXJA 4DBLC 2XKKA 1BD4A 1E7SA 1P3Y1 4P08A 4A2WA 1GGEA 1ZD2P 4E12A 2ZUEA 4D9FA 1A9ZA 1GG9A 3RI3A 3IJRA 1H94A 1OYVA 3A6EA 3CE9A 1WIWA 5IEJA 2OZPA 2R48A 1ONBA 421PA 5BOSA 4KQFA 1BXZA 1UC5B 3FLBA 3JR7A 2Y05A 4H0CA 2JAPA 4OHVA 5T4HA 3W9BA 2IUSA 4YRCA 5F1OA 3AR8A 5CDHA 3E8MA 3MINA 3I5UA 4ZI3A 1JDPA 1J24A 4TSFD 2XH8A 4NBKA 1OWNA 2Y1GA 3LRPA 5B3AA 2OPBA 5CT6A 4PN7A 1E6UA 2QS9A 4OGGA 2EX0A 1CR2A 5JMWA 1YU9A 5ICSA 2GBGA 4BGEA 1ZW1A 2Z9DA 2C4UA 1F5SA 3QENA 4JLVA 1JQBA 1AMNA 4A6DA 1BW9A 4P7KA 4NXMB 1VPLA 2FGJA 3TQOA 4RKEA 2OXEA 4R6XA 2GB4A 5CB4B 1R0WA 2RGXA 2HSDA 2HSEA 1IN4A 3VMMA 1M34B 1M2WA 1XTIA 2GXSA 2PT9A 4PRLA 1C1DA 2QAGA 2QZ4A 4U4AA 1LI7A 1LDMA 4U3JA 2JGDB 1ZMXA 2P3QA 2DUMA 3DBHA 2FAXA 1Q7GA 1BCSB 1ISPA 2Q27A 4D4LA 2DWPA 2OOSA 2C1ZA 3IIEA 4GR5A 4YY3B 1UQUA 4FDVA 2NYAA 3E4DA 4J07A 4CDNA 3LC2O 5DU2A 4MW0A 4ZVKA 1Q57A 3WOVA 4Q15A 3WLFA 1MQ9A 4F5EA 4KI7A 4F5DA 1PJSA 4YDQA 2CDBA 5ECGC 1J0AA 3VHRA 4H6WA 4NG5A 4AY2A 5JPDA 2EWVA 4LYDA 1Q82D 4AJ1A 3TFWA 4Z2AA 3U60B 5LQUA 1IE3A 3P26A 1YC5A 3V97A 3G5UA 4EQ6A 3THXA 4ZZ1A 1USWA 2IJGX 2P5YA 3S1AB 3W2TA 4TV8A 3KSDO 4YPVA 4W9MC 4ZIRB 2BVNA 3VDNB 1TADA 1SCDA 1JEJA 3KEQA 2IUTA 2JD2A 2YY5A 2D2IA 4YP0A 5HG0A 4X95A 5P8WA 1Y8CA 5H3HA 3NOVA 1CIVA 3AF5A 3ZOZA 4UBNA 2QVYX 5BN4A 4K0RA 1M9NA 4J6EA 3RYHB 2I7XA 4I1VA 3CCVB 3QPBA 3ZU5A 4YYZA 2O7RA 3AI2A 3KR1A 2AMFA 1ZOIA 1WD5A 2H4WA 1BMFD 4P0QB 1GTSA 1UINA 5ES3A 1ULBA 1QHNA 3AVOA 2HNKA 1UAAA 1WG8A 2G63A 1DX9A 3ILHA 4DCOA 4DM4A 4EKNB 3A14A 4MPTA 3STVA 2HCBA 1U2DA 2IRWA 2C5SA 4LISA 2GS9A 4W7HA 1MAAA 4LIPD 4KBGA 1JKMA 3WQHA 4G3XA 5IUJC 2HK9A 2FZCA 3ZU3A 1BVUA 1CVIA 1B41A 3ICPA 4MGYR 1CUFA 4C7BA 1V2HE 2B61A 2QZPA 4I9UA 3CLTC 1PV4A 3G82C 4IH1A 1SZPA 3IH5A 2OECA 3PRHA 2VOJA 3QYAA 4R2MA 4ZCQA 3DUFA 1PF7E 1DTEA 2ZDHA 2QAGC 3HPQA 2AFHA 1FP7A 1G2IA 2YNMC 2YQZA 2PUWA 1YIJB 1DBSA 5EHIA 5HFAA 2NSLA 1OA0A 4KTTE 1UK7A 1T8WA 3OI7A 2ZI9A 1A7AA 4FUQA 2VRCD 4EKGA 4L4YA 2GZ2A 1BX3A 2XUDA 5FH9A 1BE6A 1WUJS 2XRYA 1LLDA 1V8PA 1GAXA 4GLJA 2NV6A 1THGA 2DIEA 1EFCA 3IL2A 2C20A 1K8ZB 3BH0A 3K96A 4RQAA 4DZRA 4FPXA 1PV1A 2PFGA 4ZKEA 1BMQA 3VDMA 5BVGA 5GIPE 1W2HA 5AHRA 4CT4B 4LZPA 5ALDA 3K30A 1NMYA 1DJOA 3WWCA 3K0AA 1YJQA 3DFKA 4RY2A 3HP4A 1ZVVA 4AWBA 1QWSA 3DC7A 4HDCA 4J3JA 4UEQA 3BEOA 1F9AA 4LDJA 2GEDA 3AVTA 4TQGA 4X20B 3OU2A 4E5YA 3IPYA 4RAQA 3UMBA 1Y33E 2W11A 4FKMA 5IAAA 3T15A 1GQFA 3IMKA 4R7ZA 4BAUA 1OGYA 1A9YA 5AKXA 5DI3A 2JDIA 1TZKA 3I3OA 3SHQA 3GLIB 3A1DA 4OHUA 4M2LA 1E6MA 4NJOA 5CX1A 3E7FA 5IASA 3U40A 4GOLD 5LZ8A 4C7JA 1NN0A 1B3BA 2ERCA 4WAUA 1D4AA 4LUCA 3NGXA 2NQTA 1CYDA 1X7XA 3F7MA 5IKOA 3NHKA 2BD0A 3GRZA 2EG9A 3E9MA 1Y6RA 1JDZA 1MMFB 4DZTA 3OOHA 3A4YA 1O8CA 4LJ6A 1NF3A 3SR4A 4JQOA 1JEEA 1K3TA 3CCEB 5MFPA 3MWDB 1V43A 3CTAA 2R8YA 4V2IA 3DXZA 2IOQA 3ISJA 1FP2A 3AESB 2PPLA 4WH0A 5HZGA 4Y67A 3KV3O 2HA6A 4S1TA 3X1ZA 3IPLA 1IIBA 2C3PA 5IN5A 3ULKA 3TE7A 2IOFA 3ANLA 4JMQA 2I6UA 5DNDA 4BMNA 4HTFA 2VK2A 4NBRA 4E2YA 1CV2A 1XKQA 4M6WB 4DR2B 2J9YB 3B6IA 3UAGA 1FFCA 1KZ4A 4ML3A 3RYTC 2YNMA 2FP4A 5LU8A 1AZWA 4ZYUA 2JLZA 3H5WA 3TCKA 5EP2A 2DULA 3PTZA 1EYZA 4G5QA 1HYGA 2G9ZA 2REOA 5F3RA 1O0BA 4ZT7A 3QSGA 4RENA 2GTHA 4UE3S 2YHUA 4XYGA 1WCXA 2O2SA 1W2BB 1C0PA 2VAWA 3ERCA 1KQ3A 2GN8A 1EHYA 4RE5A 3K6SB 2P11A 3PUKA 5FX2A 2I4IA 1PBTA 3BL5A 3GCWA 2W2KA 2OLKA 1QB7A 2HHLA 2GLTA 2LCQA 2UUAB 1VQKB 4MKZA 5T6BA 1XJCA 3SOPA 1O0SA 2DHDA 2F8MA 5FWYB 1ODTC 3GK3A 4R40A 2OFWA 1RRKA 4FDTA 4BYGA 1E3JA 1SVIA 4UXHA 4XQ0A 5B3LA 1AS0A 4M37A 1ZOPA 3WC4A 2D2FA 2PUHA 2QHXA 3P2YA 1YBFA 5T41A 1EXWA 1JMKC 2KBFA 1E6CA 3PGA1 5MGNA 3OZAA 1JPJA 2C2KA 4OJKA 2O8BA 2WYRA 1CR1A 1L1QA 3K6RA 4K1LA 4NR0A 4PZYA 2XZTA 1GPMA 2VNSA 1FY2A 2Z3VA 3OZDA 4CTKA 1FFHA 4K6FA 1AK9A 2B6HA 3TD9A 2BKAA 3T5PA 3OEYA 3IMCA 1SO8A 1RZ3A 4FK8A 2V3VA 3GLTA 5E9JA 4XWYA 4QGFA 5ADHA 7REQB 4KV9A 2C8VA 3S99A 3PA8A 4YJ3A 3IPRA 3JARA 5JADA 1BDIA 3A1NA 1QLWA 1SXJD 1QP7A 3C6BA 3M5DA 3RUFA 1EGMB 1YCDA 4E94A 3P5SA 3T06B 2FVYA 1ETUA 2ZSUA 2F1IA 3ZZ1A 5L7TA 3W2FA 4O4IF 4KR2A 2JZNA 3OICA 2BR5A 4YCBA 1EUDB 1UODA 1Z15A 3MWKA 1U8AA 1QO7A 2CB0A 3PXAA 5A06A 3RYCB 3VISA 1JJIA 1M0WA 5FOQA 1I80A 3GGPA 2FEMA 2WMYA 1DEXA 4KG7A 3A6KA 4ER7A 2HMAA 1XCPA 2GNPA 4LVCA 4EVRA 2FWMX 5DHQA 5I7UA 5CIQA 1PZGA 2I62A 2CCGA 3OPMA 4RJKA 4AJHA 5J3JA 1L1EA 1TVKA 2QR3A 3EVEA 3W5BA 2QA5A 1VG1A 3ABOB 2BUAA 1TIPA 1O3YA 2P5UA 4V2UA 2IP1A 2O2HA 3TE6A 1X13A 3KAJA 2WP8J 3PXUA 1RPNA 1ODIA 3C48A 4EEKA 5LBTA 1KQPA 2H1HA 4MGZR 4J7CA 4NX2A 2QIPA 4FGUA 2ZRIA 1Q0LA 1YB1A 3TQHA 1NMQA 1NOIA 4CDRA 4F60A 5DEOA 1J8FA 4P2BA 3N2GA 3CV3A 1G16A 3UHJA 3X1YA 1XZIA 3FLMA 1WCV1 3EC7A 1L5GB 3H5OA 3ZXYA 1TI7A 4HNQA 1HUQA 2HFJA 3H83A 3K9CA 4N03A 4P86A 3RVOA 3V32A 4DWVA 3OLZA 5H3CA 3BH7A 3FHTA 3SBDA 2Q7DA 1FUYB 3MQ4A 2QRQA 3QVMA 4OO3A 1SXPA 2G06A 3SLGA 3C3DA 1LDYA 1JFFB 1X94A 3NNDA 1U2QA 3O7WA 4G0MA 3BJMA 2J59A 8LDHA 5CT9A 1G20A 1EP2B 5M2QA 2PE3A 1SKYB 3V48A 3DZKA 4MDYA 4WKNA 1V7CA 4X1YA 3H4MA 3VH2A 1N05A 4D44A 4O3MA 2H92A 1JHUA 2CSXA 2VH1A 3DNFA 3CPSA 1LSSA 2NG1A 2FWIA 3GVCA 3WYAA 2HKIA 3KKZA 1RI5A 1U5BB 3BD7A 4GMFA 1AH2A 3DDWA 3B6MA 1HQCA 1II8A 2KPOA 3QJGA 1SKBA 1Q0TA 1XROA 3ROEA 2PR2A 1CS0B 2Q3MA 3V9AA 4KBYA 4G6IA 4MIEA 5K8VA 4KO3S 3OPQA 8ABPA 5KQPA 1PT8A 1A8IA 2D3WA 3PHGA 3W8RA 3PPWA 4DT1B 4PNEA 5K0CA 1I0LA 2ONJA 5KJCA 1X19A 2XWJI 1N6KA 1RJ9A 4UM8B 5BXQC 1ANKA 5EJ4A 5HZHA 3SWWA 1OC2A 5TGDA 1X7DA 4BO1A 1GPH1 3G1UA 2HA4A 1WX1A 2ZXEA 4K40A 1X7ZA 3V80A 2PVCA 4GVLA 4AIRA 3V6MA 1QVVA 1UAYA 2HLNA 1ZUD1 2F3UA 4LF9B 1OD6A 4MUAA 1K5DA 3AB3A 3CNBA 4YRBA 5A5VA 5LN1A 2WNHA 1MRSA 1PI3A 1SRQA 4XD7A 3L8YA 2LV8A 2NU8B 1V6CA 3ZYCA 4Q00A 2GM5A 1LJ8A 2V7EA 2QORA 2BGKA 2VI5A 2UDPA 4QUKA 4DCCA 1JIIA 3NKFA 3U3ZA 5JY1A 1W76A 1U3VA 2C7QA 2VHCA 3A9RA 3FKSA 5CJJA 1E4YA 3FWHA 3K31A 5DM4A 3QX9A 3SLKA 3NCTA 1E3DA 2OP0A 3N2KA 1FFYA 1YR3A 2WMDA 3UK0A 5CA1B 3G0GA 1X1DA 3NYRA 2W2LA 3QE0A 3CMCO 3N0WA 3MS7A 4UNQA 4BZPA 2DM6A 4HHEA 4PE5B 4F0JA 2WQ6A 1NZFA 1JQKA 4ZRDA 1JHDA 5G1OA 3C5VA 2VDJA 3FDJA 4EL0A 3WRWA 3TLXA 3JD4A 2QY9A 1H66A 1NX6A 1RVDA 4JBWA 4KXXA 5E8JA 3LZCA 5BW6B 5AW8A 4RW0A 4YAIA 1PJ8A 4MP3A 3CZPA 3SZOA 1USGA 4GFDA 1TU4A 3AQ4A 4O2BB 1XZGA 2O6LA 3H2GA 2JI7A 3ZJ4A 1QQBA 2DFTA 1EFVB 1LC0A 2CFOA 2AF3C 2OCBA 3SC2A 3ILYA 3F2IA 3U1TA 3CR8A 3G17A 3F4BA 4F1KA 1GFSA 4ND8B 4AY6A 3EZXA 3HABA 3MB5A 5GVSA 3R0JA 3KKLA 3E5MA 2RJ3A 5JLJA 1P31A 4DB4A 1UBGA 3NALA 4MQFB 4WV3A 2JNWA 5JR3A 3N8GA 4QTYA 2O6HA 3K73O 3MGCA 5CP8A 4CKWA 5FEUA 1C9DB 2RE8A 2VP5A 1A7JA 5LM3A 3ISVA 4MYRA 3OQIB 3VDRA 3ND5A 1F0KA 1EP9A 1Q91A 1A1SA 3UV7A 2B4AA 3IS3A 4GW3A 2QUIA 4C0WA 4JEIA 2AYYA 3IPCA 2EGUA 3MCVA 1Q2XA 2FUKA 1SKQA 4UNSA 3UPUA 1NMSA 1FMLA 4X61A 5K8CA 4DV3B 4FE7A 4OYYA 1P5JA 2O3TA 1E62A 4Y2TA 3C45A 2UUBB 4LZAA 4AUMA 3G71B 2PL1A 2WM8A 2MT9A 1E79A 2ZJ6A 3NTRA 2FEWB 2DKOA 4GI2A 4DKJA 4XI9A 3ZQKA 3HTXA 3ND9A 4FNAA 4A2PA 4DA7A 1C7QA 1ISFA 2WVGA 1D5CA 2FK7A 1IZYA 4GOND 3I2IA 3IBSA 3IB3A 1KNQA 3QG1A 1RAIA 3CUVA 4GMKA 4YRTA 2QPOA 3DE0X 2P6PA 3N07A 4CZ2A 4B6JA 3NBKA 5EMHA 1S2LA 2XDQB 1FJHA 2MJLA 2J3JA 2OUKA 1O6CA 3FHOA 3IXQA 4P4GA 1NVWQ 2YJZA 5CHEA 2P4UA 2O0MA 1E4EA 2JD0A 1J20A 3OKPA 3LUPA 3WZLA 4JLAA 1XIVA 3AO0B 5ITZA 4CXMA 1VKRA 2I1LA 3FYUC 3OHPA 2FPIB 4L8YA 4BJ5A 8MHTA 2MU1A 3AJ8A 2VDUE 3RW9A 4DR4B 1K63A 5IF3A 1G3RA 1R5OA 2E55A 4QT4A 4CMBA 4BFSA 3BILA 3RRXA 2ZBRA 2AG6A 3GC6A 3ONUA 3T9AA 2ZYVX 5NULA 1VHOA 2DSTA 3B52X 5ALMA 5I8PA 2C4HA 2XGGA 4DR6B 2ZYAA 3C24A 5JMPA 2XR1A 3ETHA 4XD7D 3WZ2A 2ZQ5A 1BRTA 1QV7A 4II7A 4MB6A 1VCIA 3R3VA 4YV7A 1VIVA 2ZRHA 2H4JA 3KR0A 1R9JA 2GO1A 4YJFB 1E1QA 4RVOA 3ZE2B 5JMOA 4RO0A 3KQHA 2D5AA 4IUCS 2ZZQA 4IIJA 3L5KA 4IKPA 1H1TA 4DDVA 2WYIA 5ULLA 4G97A 3OEHD 3NBFA 4ZMSA 2PO7A 3E05A 3SZRA 3DLTA 1QHHB 1BC5A 5F64A 3E48A 2CDRA 2B7CA 1NJ2A 2AUNA 5IRCD 1UZAA 4YXWA 3L7JA 3JWEA 3A4LA 2HF8A 1HLDA 4KI0A 4BE4A 2PA3A 1V5FA 1EJ0A 2FSGA 1BHJA 2H9IA 3HGQA 2VJYA 3UAVA 2YDXA 2BM9A 5CVCA 1XN4A 3RSHA 1BS1A 3MSXA 1NONA 4MXDA 5TMDA 1GAEO 1O08A 2PNFA 4GBMA 1HDCA 4N39A 2DB3A 4JA2A 1OLXB 1GPYA 3I9FA 1JQEA 2C94A 2FTKE 4R31A 1M76A 4DRYA 1KIMA 1C1HA 3AHCA 2QRUA 4IJ5A 2J7PD 1Y4DE 1HFEL 4HQNA 1N1EA 1RI3A 4GYKA 3FPGA 4L22A 3VPXA 4JELA 3IOMA 1EX6A 4I5DA 1SOUA 4JJAA 4TTVA 5JZ9A 1R4AA 3OJLA 4KKUA 2B69A 3I01M 3KKEA 3USES 4B2IA 3ZCQA 1E2JA 1MT3A 3HYNA 1T3SA 2MMCA 2X4GA 4QU9A 4LY0A 2GR9A 4BFZA 3CZRA 4FLMA 4G0XA 4XYBA 1M2OB 4YFVA 3TAHA 3VYSB 3IV9A 4AF6A 2CBZA 4LSMA 4CKCB 2K7FA 1W44A 4LY3A 1OH8A 1BVRA 3VMFA 1QV9A 4LDQA 3K2IA 3RQSA 5H81A 1G5TA 5A3JA 2IE0A 2PJDA 3OPYI 4RVGA 4XEHA 3BMCA 5TQ2B 3TTUA 2IS1A 2OZLB 1A9OA 1JWBB 1RPTA 2Y27A 4UTRA 5JY6A 1YU6A 2NVBA 1C7ZA 4Q3EA 3C3AA 2DECA 3BWMA 1L5NA 2CT8A 4G5YA 2D06A 1U99A 2II6A 3OLXA 4WMLA 1NU8A 2IVZA 2NLOA 1BDMA 3CLRC 2AV6A 1O6GA 3QWHA 1B4DA 1I4LD 1RACA 4B4OA 1ZBQA 4DGSA 1A9XA 1PEYA 2NO9A 1VJSA 1RQ2A 3B82A 3BWYA 3MPUA 4WUTA 3VKGA 3CLRD 3CX7A 5CDFE 2PMFA 3PC6A 2CBXA 3W7BA 2AT1A 1CQWA 4G7XA 1EE1A 1CUVA 3PITA 4O2RA 1R0SA 1BKSB 4OFZA 4RHUA 4RK4A 4WEOA 2VPYA 1PJCA 4XKJA 1WKCA 1J6UA 3R9KA 3NNSA 4FILA 1BS9A 3W5SA 3DEZA 1H5QA 1Z08A 1BFUA 4M53A 4ZVMA 1SUEA 1JJFA 1B76A 1MJGA 3C2QA 2UXBB 5IDXA 2I4OA 3U4QA 2X15A 1ZD4A 2OMEA 5D3KA 5EEGA 3KZOA 3K0FB 4K03A 3E9NA 4HNAB 1P17A 4OHMA 5CNJA 1QIDA 3T35A 1C9JA 3YASA 1X38A 2C4NA 1FE8A 1Z82A 1RMQA 3C5EA 1WB9A 2J87A 3DXYA 3TOCA 3O1JC 4AG5A 3ADKA 4UTOA 2XQJA 1OXBB 3L46A 3K20A 5A6SA 1NW7A 4FR2A 1QYWA 3QW2A 1PR6A 4RTQA 3DAPA 1K89A 2ZZNA 3RD5A 2C3OA 4BBPA 2J41A 3MTEA 3DZIA 3WYFA 1CZOA 1KRHA 2V8BA 3FI9A 1M6WA 3KM0A 1FFAA 3I39X 5AI6A 4BRZA 3C4VA 3QELA 3UWMA 4Y9TA 4XPIB 4Y6LA 3E4CA 1UIMA 3RJ9A 4ISCA 3DNPA 4O4IB 4BFVA 5BW5A 1PT6A 5ETJA 3UJHA 3M6FA 1L5QA 4W1RA 2A30A 1JLLA 4FHEA 5CIWA 2VRWA 4EH1A 4Q5IA 2ZSHA 3CD6B 4XIGS 2B25A 2RG7A 2V9CA 4NYMR 2C3YA 3MM4A 1SZJG 1OB2A 3DWGA 4NPHA 1CQIB 1AKYA 2NACA 5J2TF 1AMUA 2AZTA 1BHO1 3A8TA 1RYMA 2OGWA 5DYIA 4TT3D 2HW8A 4EHKA 1OQAA 4NDAA 2ZPUA 2V7BA 4WADA 4KLRA 2O8CB 3QYPA 1TRHA 1QTIA 3QTBA 2CXUA 3W6OA 3I2HA 4XM0A 2DWUA 5K0LA 3P94A 4GLBA 1B6GA 3CIFA 1GGHA 5D84A 5DX1A 2JARA 2JGIA 4A9AA 3S5JA 3O2SB 1ZK3A 4URHA 3SDZA 4E31A 1U2PA 3O3CA 1OWLA 4DV6B 1EEXB 5LA6F 2QMUA 4EI7A 1Z7BA 2LXNA 3HUDA 2W7TA 3ENKA 1N5IA 2PT6A 4E5UA 5CVVA 3WHIA 3FFTA 3ZHBA 1YBHA 4I6JA 3KHSA 1RM5A 1RJEA 1IHUA 1HQYE 1MF7A 2P6MA 4BP1A 3ZY4A 4B09A 3BC1A 5E3JA 5IYZF 3VYVA 6GPBA 1T4CB 3DZHA 1SU8A 3K8ZA 1Z29A 1IBSA 4YN3A 4ZWNA 1EWQA 4HWSA 4IV5A 3JALB 4LXTA 3NW9A 2C8LA 5J2TB 1YQXA 1EFPA 4GKJB 4G5GA 2AZDA 4UPDA 4XX1A 4B5LA 1PJ6A 2HSGA 4MI6A 5JNTA 3I2GA 3MWLA 4LJ5A 5E0OA 2WJIA 4L4UA 4OXQA 3RIHA 3P9PA 5BN3A 5JBNA 2O54A 1D2AA 2OCPA 3GIRA 4ANFA 1K73D 2QQGA 1Q0QA 2IHYA 2JIQA 4DMRA 4RABA 1A1VA 2WUGA 5D85A 4DQLA 2G71A 3WKCA 4EYSA 3OQPA 2H0AA 3HCNA 3BX1A 3H2JA 4ONEA 4N8EA 1B2LA 1UJ2A 4OIMA 1PZFA 1RRMA 1Y4UA 2XPCA 5ARDA 2FCAA 2WMOB 3C5WP 1QHHA 1I2CA 3H8VA 1KP2A 1DKQA 1GPAA 1U8XX 2CWDA 1NBMA 2ORED 2ZYHA 2OHXA 3E23A 4E22A 3ZU2A 1ARZA 1Y48E 3MJSA 4TLBA 3GGCA 1OLSA 4B6EA 1X7HA 2XOKA 5H3LA 1V1RA 1QK3A 4AKIA 3KXKA 3PPXA 5DSXA 4K3VA 4MS3B 2H65A 4XJVA 2FSPA 3O8LA 3A04A 2Q41A 3PXCX 1DXQA 2I3AA 4KBFA 4LJYA 5EP1A 5EJ2A 4I5EA 3CF6R 1W52X 4KQXA 2ORVA 2F4VB 1HZZA 4P25A 3N8NA 4AC9A 1QH9A 2AXQA 1KVRA 1W4AA 2ZJFA 1DAPA 1KR2A 1TC2A 1T15A 4Z0HO 3TQRA 4CR7A 2PWYA 3ELWA 1YWGO 3RE1A 2BEUA 1TRKA 2F1OA 1W0CA 1TCUA 1C2YA 4ZYZA 5KHOC 2B20A 4HVAA 1OI3A 3MWEA 5F9HA 5DTQA 4OXKA 4TKVA 1U7PA 1LB1B 2JCYA 3UTCA 4D0SA 3C8HA 3NTQA 4A1FA 1UPCA 3LXMA 1GQSA 2PY6A 4WZBE 3EPHA 5JCJD 2YN4A 5DTJA 4MRMB 4BFXA 5EMLA 1NT2A 2HA5A 3ZV5A 3UJDA 3GUYA 3HY4A 1TZBA 4JUAA 4ARUA 4BVGA 2QD1A 3DD5A 3VZQA 1W581 4NZYA 2JCVA 3FJ1A 2C4TA 1E3QA 1T6ZA 1M1XB 1N2ZA 3R5KA 1WSRA 5FB3A 3UV3A 3WGGA 2OTCA 4IDGA 5FTMA 2VJLA 4D4JA 3H5NA 3H4TA 2OBTA 2JIOA 1TZ2A 2PGXA 1L4YA 4KN9S 1KGSA 3W4JA 5AXCA 3QVGA 1TYEB 3GVLA 2W2XA 2WPDD 3HA3A 1RHMA 1SVSA 1VE6A 1DELA 3BJZA 3A3YA 4XVRA 3ADBA 2XWBF 5E6RA 3BNWA 4PGOA 2F1HA 4EFMA 3VUFA 3UMMA 2VUIB 4MH0R 1N77A 2I33A 4FXOA 5FWXA 3TSCA 1I94B 4I4TA 5ALJA 1SKAA 1V7ZA 4HX5A 2QLTA 1NFQA 1ORRA 4JBYA 4HAIA 5AJHA 5JROA 3U4QB 2C0QA 4O33A 5A1JA 1M1YA 1NI5A 1YMQA 5CYPA 4CF4A 3DFFA 1R6TA 1T1JA 3NBMA 4DC0A 4EHLA 4F86A 4XARA 1IOWA 2LGJA 1V8OA 4AJ9A 3I64A 3V2UA 4AMVA 2MR5A 1GGMA 1DDGA 3TXXA 1HZZC 4QGSA 1WPRA 4NU8X 2JHCA 4HDQB 5H8WA 3NEAA 3IUEA 3NT2A 5BSHA 1LNZA 3RG2A 1XK7A 2IEIA 3RNLA 3PJGA 1ZY2A 1BLIA 4UCXA 5CLGA 4UMFA 1PD0A 5KVAA 3EJ6A 1EVJA 3PIIA 4FGJA 4RMGA 1AO0A 1CE8B 4MUMA 3MCZA 4XGRA 1UQTA 2VYQA 5JNWA 2NUPA 1O5TA 3MK31 2XMDA 1KFBB 3PVSA 4JVOA 3P2OA 3ZVKA 3HO1A 2XZPA 3I9NA 1EUCA 4CF7A 3TQQA 4P7JA 1SOWA 2VWHA 1ZNYA 5MFZA 1H0SA 2OB2A 4GEGA 1RXCA 3H94A 1L8QA 1UZUA 2I8CA 3FCSB 4FNOA 4ND4A 5FPHA 2DC1A 1BQ3A 3MTGA 5BURA 1YF3A 1LBEA 2QUBA 2P9HA 4OXXA 4NXNB 1GYQA 4B76A 5B30A 3TNFA 3REOA 4KFUA 4JB3A 4WT7A 4P83A 2H1IA 3N86A 4AY4A 4BX0A 2ZL6A 5JARA 5EMNA 1TPYA 4A8HA 4XFDA 1JSXA 2O2JA 1NZDA 3LCUA 3MAAC 5K5EA 4C7XA 3TW8A 2FI1A 1H4TA 1PDOA 2Z5FA 2FVGA 3CRQA 3KT6A 3PC7A 1M33A 4EW2A 4XLZA 5KNDA 3FZGA 3ROTA 1XDBA 4LQCA 4BKMA 3V8PA 3PJFA 1W88A 2FU5C 3E8XA 2VNHA 3HM2A 4P22A 3WAKA 1U7WA 3ZWBA 1L7NA 1ZIDA 2I65A 3CZMA 1NYQA 1INLA 4FMDB 3S44A 3WLOA 3FOWA 1S2IA 3OD1A 1XX6A 4G9BA 5ICEA 1AHHA 3R6GA 3A70A 3IT2A 2C04A 2H0QA 3GUUA 5BP7A 4P4UA 3O8CA 4LMPA 1XMXA 3E53A 4R8LA 2R1TB 1JEQA 1T0UA 2C3UA 4PZZA 4EL5A 4XYLA 4YV1A 1DWOA 2X2FA 4JH0A 2V4ZA 4PQFA 4PLYA 1KBQA 1YZKA 1L6RA 1OFIA 3A1EA 3EY9A 3MELA 3EC2A 3PSAA 4X1IB 4F7DA 4YMSA 2GF0A 5IZCA 4H7EA 2GK3A 5JO9A 4KQMA 2BFMA 3WYNA 4EF4A 1OZ0A 4KJZA 1KEKA 3C3YA 1TEXA 4LFBB 3BL8A 4ZI2A 4WUVA 4I1PA 1CUJA 4ETMA 4EUHA 2HHCA 1Y0YA 2AEEA 2Y71A 5D7BA 3QWAA 5KTKA 1I7PA 2XRZA 3EAFA 2VZLA 2ZR9A 4MQ4A 2IS2A 2CEKA 3GUHA 5KYKA 3IHLA 4TM7A 5EE0A 2DGDA 1SQ0A 4C30A 1VQ5B 1L5YA 3AK4A 5HYVA 1GSOA 5IEBA 4WZKA 3BXPA 4JBHA 4UAGA 4P3YA 3QE4A 4EY4A 3F6YA 4B9AA 4WLNA 1YV9A 2JJ2D 3U3RA 4L2IA 4Z7NB 2YN0A 3REQB 2CCJA 4DUPA 1ZH2A 3KXDA 1FP4A 5DIZA 2MSLA 5C34B 3SDBA 2CJXA 3IE2A 2P9BA 4M0DA 3L6CA 4Z0NA 3W0LB 1C3VA 5FBWB 3K5IA 5C80A 4PYMA 4OSOA 2VOEA 1P0PA 3Q5DA 5L46A 2FJ0A 1N2OA 2PS9A 1SUSA 5AJTA 3ZDCA 1DFGA 1SUAA 3V1KA 3KS9A 4EBFA 4L5CA 3M8KA 2W83A 1MO4A 1JG6A 1E1YA 3JQ8B 2VO1A 3MLBA 1T6XA 3UZUA 3E35A 3O8QA 3ORHA 1GLNA 4I19A 4L9WA 2VA8A 2PJUA 4NI5A 1L4KA 5IBQA 5KEIA 1R74A 3AR4A 4FOLA 4WJKB 3D3WB 2FMFA 2GCEA 2RKWA 2BSAA 5ECYA 1Y82A 1E3SA 3RC9A 1NW8A 3UGJA 3EIUA 1YSCA 3EARA 3T52A 1I1QB 3BXXA 3GA7A 1K06A 3VTAA 5JJCA 4BIIA 1KI9A 2JLBA 4CIWA 4TPKA 2O3RA 2ZIEA 3DMHA 4QQNA 1GWNA 1USVA 2VPXA 2NSJA 5DNEA 5LA6A 3IILA 5HW0A 3QF7A 4OJTA 2HA7A 1YR1A 3GD5A 4LHXA 1NJ1A 3RR2A 5EY5B 3TKYA 1KU6A 1Q3KA 1Z2OX 2O1EA 4PYRA 5KNBD 2JLSA 3WJ1A 2H48A 5IJAA 2V58A 1P7ZA 3I9MA 3P9QA 2XUIA 1ZM9A 3QKUA 4JR1A 4LA4A 3UAOA 3O8DA 3GYGA 2AZ4A 3P9YA 3WLPA 4FMBB 3R6KA 5HF9A 1DZ3A 3HEMA 3KEGA 1K8QA 4L5BA 4N7BA 2BEKA 4WWVA 4Y0AA 1FB5A 1V11A 2R79A 4B17A 3ZY3A 1MX3A 1ML4A 4LNHA 2Y0DA 3AW8A 3EZNA 3WMEA 2WF6A 2N46A 1L5LA 1BQEA 2Q5HA 1U80A 1ZYUA 2FW7A 2DH5A 1KMHA 2NXEA 1QF9A 2UZ0A 1VL8A 3RF6A 4BNZA 3U5ZB 3PXDA 1FF9A 1O96A 5ER9A 5KYXB 3NKVA 1I32A 4ZPXA 3PZBA 2K2WA 3VFDA 1EVKA 3OQMA 3PGXA 3TD2A 2XVYA 2XYVA 5FUXA 3RWMB 4L8LA 1H6BA 4CQMA 3AL3A 1VP9A 3DOIA 2PUEA 2Q5CA 3B48A 4LDRA 5I7RA 2OY0A 1ADYA 3AETA 2ZAMA 1YRYE 2NU7B 3TL3A 1W5TA 3KCQA 2ZIZA 3QOWA 1I2AA 1PR5A 2WJ3A 1YVPA 2YYZA 2AOXA 3G7NA 4D41A 3N3BC 4U3JB 4ZVUA 3ZS8A 3E22B 4XCQA 2F8SA 4GE0A 2XB4A 4J7UA 4EZIA 2ZCJA 2FRDC 1ZUNB 3ZIUA 2Y1FA 2Y1CA 2QD5A 2BFWA 2Y1OA 4EUSA 3QU9A 2E48A 1P75A 4F06A 1GCUA 1EE9A 1VRVA 3ZHQA 2A5JA 2OK8A 1OT3A 1C8KA 2R9VA 3VQTA 1Y7LA 2WU0A 2WSBA 3T94A 1KPHA 1NVEA 1EFRD 4EJSC 1PG0A 1PTJA 1S5PA 1WDLA 2ZRDA 3S0JA 3FRHA 4DQ0A 3MAGA 3I0ZA 1VRWA 3KVVA 4JGGA 4ALJA 3ZD6A 5CM8B 2UYHA 3T53B 1W73A 2Y0CA 3MTBA 4DB2A 4BAGA 4MVJP 5CGQB 3F6SA 3GNLA 3O83A 3LBAA 5C7YA 4Q6BA 2Z8YA 3R0IA 1YDGA 4OXYA 4AN4A 3ZCSA 3GJSA 3TRIA 2PIAA 1P2DA 2BFBB 4MKIA 821PA 1FXWF 3DBOB 3HEBA 4N65A 1JDNA 1RWNA 1SFRA 1DSSG 3O1IC 4X44A 2JLYA 1HV8A 2QVBA 2ZI7A 3W9UA 1H05A 2VP2A 3EGXA 3T54A 1DNPA 1R0XA 4B4DA 2EJUA 1RCUA 1UD2A 1PJTA 1UUFA 3JQ7B 5EC8A 4K9RA 1TAHA 3QUQA 3ETDA 4LXGA 4UTZA 5IJ0A 3GGGA 4BKOA 1FNMA 1X86B 2JAXA 2OGUA 3L7DA 4PABA 3VPFA 2W6NA 2P8SA 3H17A 1UDWA 4YFYA 5JXGA 3D59A 4BVFA 2Q9UA 4QBKA 3K1AA 3TPFA 3M5PA 3T4XA 5B58C 2M6LA 1KFEB 4QUJA 4WA7A 4HI0E 2NWQA 4BNXA 1X42A 5KC8A 5ANRB 4MRVA 4P2NA 2YL2A 3PSHA 2Q5OA 4BNDA 1SA0A 2VJCA 1VJ1A 2YJNA 2VK4A 3P4UA 3L6RA 3RYFB 2NIPA 2ZTGA 3HU2A 1XDGA 2RBGA 1HX7A 5AVXA 3NVKI 1OLUB 4DQXA 3SIPA 1P2UA 2PGAA 3ENQA 3TQFA 1G63A 5JS7A 3FYDA 2O4CA 1W30A 1ZL0A 5FPKA 1DT5A 1GGNA 1OV4A 2D9RA 3D6TB 2JFWA 4P2GA 4PC6A 5B57C 2FHPA 2XWSA 1RSZA 4DLAA 4HXGA 4UEWA 3CC2B 3AHHA 5IM5A 2GAJA 1N2GA 1SUBA 1T5OA 2Q9AA 5HE8A 5KTMA 4H7FA 1IBMB 3CLVA 2FWJA 3MOGA 5K0ZA 2RD2A 2P3MA 2N0SA 4BV3A 4DSUA 2R68A 2J0VA 1A8SA 1YBMA 3QBTA 2AN1A 1FLVA 4G0ZA 2PANA 5A4DA 1SBIA 1LU9A 1CDDA 2WHYA 3GEIA 1NVKA 3ZHYA 1KY3A 3JQQA 2HMUA 1NVTA 2CLOB 2EG5A 4ZTBA 4IZIA 5B1IA 3WMWA 4RZXA 3AZOA 2PL3A 3O74A 4KB5A 1UPBA 2I3GA 1T13A 4AJ2A 1NVUQ 4R1SA 5K7SA 1US8A 4LHVA 1A5TA 1WDMA 5JTTA 4QV2A 1PJRA 4Y1RA 4D3SA 4DIOA 4YHBA 2HF9A 4EZEA 4BFYA 1QTQA 2XRFA 2P2GA 3WWOA 3C7AA 5CT8A 1U8ZA 2B4KA 3MEQA 3QEBZ 3ZWOA 1NIPA 2ZAYA 2NO4A 1MBZA 2ZRKA 3LK7A 1V47A 2ZRQA 1WSBA 4KK4A 4P1VA 3D4IA 4L08A 4WI1A 4YRDA 3VZSA 4LJRA 2I66A 1HT2E 4XDZA 1XVIA 4MQEB 2YYYA 1U28C 1EFRA 4PCVA 5D6NA 5EJ5A 3PLNA 4JVMA 1KVQA 1PHPA 4QUDA 4X8HA 4A82A 4OPOA 2YZGA 3H11A 3CG4A 1M0EA 3ZGOA 4R1UA 3CF2A 1Z36A 1E9BA 4U8HA 4MIYA 1VBMA 3FKSD 3M89A 4P82A 1IZ7A 3NVDA 4IDQA 4QFBA 1Y81A 3KHTA 5DLPA 4D0RA 1I3CA 4RSRA 4DYVA 3FPAA 3MTDA 4FMPA 2HMTA 3SHVA 4O4LB 3VR3A 4XN0A 2C2YA 2D2EA 3ZXUB 5K9ZA 2OV6A 1MORA 5K0TA 2R6DA 3FNBA 1N8NA 4UBJA 2GBLC 1NV9A 2R6CA 1X1SA 1XJQA 3AT1A 3FF1A 4N8SA 2QR2A 4BNHA 4EZBA 2WKRA 1VMEA 3FAKA 4XDHA 4EVQA 4MLZA 4RTKA 4KMMA 1O95D 4HBZA 1JMYA 1G7SA 2NXNA 3BXZA 2UKDA 3CUUA 2PZ8A 1GZVA 3PNOA 4M9QA 4E46A 4EKEA 3DOUA 5EZYF 1KI6A 1OTYA 1IWOA 1WXQA 2NPOA 2E4AA 4YB8A 1PJQA 3BJRA 4KPUB 1M2GA 4LXXA 3RBXA 4MSUA 4MYCA 1ISRA 5KIAA 2ASEA 3BCDA 1K8AD 2OG2A 4KKXB 1NP3A 3P4YA 2I4TA 2I2XB 2OP1A 3CLHA 3NP9A 4REMA 3TMYA 1JHZA 3VKVA 5JZBA 2ATXA 3ZJUA 1JV2B 3ZWMA 4PFJA 5L51A 4R7TA 1P0FA 2DRIA 2QTTA 4NEHB 3WJ7A 1ESNA 5LPNA 3L7OA 2WZCA 5JD5A 4NCBA 3KVYA 3DC2A 3TAUA 4YO8A 1U1DA 1RYHA 2PRYA 2DG2A 1JP7A 3CXRA 1NAIA 3P9IA 2M9MA 5EZ5A 2EXXA 4TXNA 1D6NA 3G2OA 4G56A 2A0UA