1QGYA

Ferredoxin:nadp+ reductase mutant with lys 75 replaced by glu (k75e)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEELRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin--NADP+ reductase
publication title Structural analysis of interactions for complex formation between Ferredoxin-NADP+ reductase and its protein partners
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
total genus 90
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qgyA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qgyA02
2DERA 4M4SA 3OZWA 3CCLB 2OTJB 5THXA 1YIJB 4HE5A 4RD3A 2B7BA 2BM1A 2BSAA 1EFUA 1YI2B 2CNDA 1EXMA 3OJWA 3QFRA 5HXBA 1G7TA 2XNCA 2DETA 4ZCIA 4LBZA 3I1FA 1FRQA 1N0UA 1N0VC 2B5OA 2PLFA 1FNMA 1KQSB 1EP2B 4P3YA 1KRHA 1E63A 1GO2A 3U6BA 4ZV4A 3OZUA 2YWGA 1U2RA 2HDNB 3G6EB 3AGQA 4RD2A 1S0UA 1QH0A 5EMNA 2D74A 4M1KA 4K1XA 4H9GA 1VQLB 1ZM2A 3WYAA 4LBVA 4Y7CA 4PC6A 3CCVB 1KK0A 4B3XA 4TN1A 3QFTA 4AF7A 2BMWA 4WQMA 1YHQB 1Q86D 3MCAA 4FK8A 5TR9A 1JJ2B 1DDIA 2QTZA 1QGAA 4RD6A 3CMEB 1QGYA 1A8PA 4RCZA 1CNEA 2PIAA 1KD1D 2QEXB 4N3NA 3MHPA 1VQ7B 2VNIA 2B7CA 4B44A 2OK8A 3SJZA 3G71B 1YJNB 1EFCA 2GQFA 1OGIA 1I7PA 4M0LA 1GR1A 4YALA 1IJEA 2C78A 1NDHA 4NBSA 4TMVA 1BQEA 1Q7YD 2DCUA 5H5JA 3AVXA 1D2EA 4MYUA 3JQPA 4YAOA 4YHBA 1FNDA 1KK1A 2RC5A 4LBYA 4F7DA 2GPJA 2VNKA 5GV7A 1VQKB 1KK2A 3WXMA 3LVBA 2BV3A 2QN6A 1EP3B 3MMPA 4TMXA 2VYQA 2E1RA 3WBJA 4IW3B 1KK3A 1CNFA 1YITB 1KC8D 4G5GA 4Q7JB 4C43A 5AN9A 1QVGB 2HMAA 1QUEA 2NPFA 3W2EA 1ELOA 2C77A 1R5OA 3LO8A 3WNCA 1R5BA 1W35A 4TMZA 4YAUA 1ZM4A 1H42A 1BX0A 4TMTA 2VNHA 1VQ5B 1W2BB 1KTVA 3QFCA 3CRZA 3OJXA 3ZZTA 3QFSA 1GVHA 4B4DA 3AVWA 5GV8A 1M90D 1W34A 1EWYA 3CCJB 1K8AD 1N8RD 2OK7A 4ZCLA 1NJID 3CCEB 4B48A 4P6VF 4PC1A 3ZZUA 4R71A 3AGPA 2R6HA 1IB0A 1WDTA 5H59A 3CC4B 1G7SA 3A1FA 3CCQB 1JA0A 4MYTA 1FNBA 1OB5A 3VO2A 1QGZA 2XEXA 3OW2B 4PGOA 2YWEA 2YWHA 4ZGQB 3LYUA 3FJOA 4U9UA 5JBQA 1Q82D 3WBKA 3QE2A 1AMOA 4M53A 3PENA 2FX3A 1QFJA 2QDXA 2EFGA 4G1VA 1QVFB 1K9MD 3AVTA 1CQXA 1VQNB 1VQ8B 4PC2A 1DARA 2J7KA 4ACBA 3WNBA 4HE6A 1TUIA 4EH1A 3G4SB 2HCJB 1YJWB 3W2IA 1TTTA 1D8TA 4PC7A 4YAFA 3CC7B 3ZC3A 1G7CA 4QHYA 1VQ4B 4NCNA 3ZBTA 2EIXA 4Y9RA 5TV2A 1JB9A 1Q81D 3JQQA 1B23P 1S72B 2BGIA 1QFZA 4RJLA 3CC2B 1GAQA 4N3GA 2X3UA 1ZM9A 1FDRA 4AC9A 4DQLA 3JQRA 1QG0A 1TLLA 4YAWA 1AIPA 1VQ9B 4FWTA 1XB2A 1FNCA 3CXCB 5FA6A 2XNJA 1B2RA 1SKQA 5DSZA 1QUFA 4G1BA 1BJKA 1K73D 1KJZA 1JA1A 1HA3A 1ZUNB 3W5VA 2BPOA 1XE1A 3OZVA 1R5NA 2QA4B 3CPWB 3VMFA 3W2FA 1E62A 4DQKA 1QFYA 3ES9A 2AHOA 1SM4A 3CB4A 1VQ6B 2BF4A 2BVNA 2DY1A 4C0SA 3LRXA 1EFTA 1JNYA 4B43A 3U2QA 1ZM3A 3WNDA 1UMKA 1F20A 3W2GA 4TMWA 2CRVA 1VQMB 3VNVA 1G7RA 4BPRA 1TVCA 3W5HA 4Y9UA 3E1YE 1VQPB 3CCMB 4J0QA 3W2HA 3VNUA 4LC0A 3E20A 3WY9A 2BN4A 3CCSB 2VZLA 3J81k 1E64A 4M2LA 4QFMA 3ZZ0A 2ZITA 4RCYA 1F60A 2BGJA 2BM0A 3CMAB 3AVUA 2RC6A 1GAWA 2QMUA 3QSYA 3B78A 1M1KD 1W87A 3ZBUA 4RD0A 3CW2A 3U6KA 1BX1A 3W5UA 3AVYA 1DDGA 4LBWA 4UAJA 2PMDA 3FPKA 2YWFA 4ACAA 1EP1B 4RD4A 3I56B 1IJFA 4FN5A 3CCUB 1QX4A 3CD6B 3P27A 2DEUA 1DG1G 4ZCMA 5KSWB 1VQOB 2OTLB 1J9ZA 1YJ9B 3AVVA 1OB2A 4AF6A 3B8HA 3CCRB 3I55B 2QTLA 1D1NA 4ZGNB 1OGJA 1H85A 2VNJA 1GJRA 4B47A 3V76A 4PC3A 4RD1A 1FRNA 3VO1A 3P26A 5TY0A 3B82A
chains in the Genus database with same CATH superfamily
2QRKA 3D7LA 2CEKA 4ZV7A 5B64A 3LQ2A 3GRKA 3MTAA 4RD3A 4G0XA 4REOA 2R1TB 3NPAA 4JJ4A 1QPGA 4RC9A 4RYLA 2P79A 3R7DA 3VR4A 2IGTA 3OZXA 4R84A 1BG6A 4M0DA 1G0OA 5JRZA 4EJSA 4GWGA 4YV0A 3MJDA 4KK3A 2JK0A 3LZ6A 3T1YB 3WDLA 1R5JA 3MLAA 4FGSA 1L7BA 4A2QA 2PUEA 3O2QB 3SF8B 4AUEA 4F5ZA 2FQXA 1Z2DA 3LT0A 5K20A 3P9CA 3QX8A 1JDSA 2YVUA 4JEMA 4WFQA 4C76A 3TG8A 1VE6A 4I50F 3OPXA 5EHGA 2D2VA 3EUFA 4MUXA 3GEIA 4OP3A 4AG3A 4F85A 2X15A 3PGJA 5ALFA 1KZGB 5JNUA 1H4QA 1Y82A 4EW6A 2ZXEA 2E37A 1RWPA 1UOQA 3TMYA 1QCDA 3ZGZA 4AG6A 1SC4A 3OFNA 3DE6X 1DG3A 2I7CA 5FTLA 2JAOA 2Q99A 3PQEA 4AYWA 1VLJA 2F64A 1NUAA 1BW9B 3KJNA 4K9QA 1Y8ZA 4A5OA 1TW2A 3T7EA 2C7BA 3M1IA 2RB4A 3CUVA 3ISXA 2Q2WA 1Z16A 1DC5A 3HXQA 3D3KA 4BB5A 1YCFA 1EQAA 1PJ3A 1W581 2I6TA 1WVIA 4NE9A 3Q9LA 3KHUA 3AL0C 1XEXB 2F8LA 1BSVA 2V97A 4MW7A 3ZVMA 3WZLA 2B6HA 2OWEA 4LOHA 3UW3A 1JFSA 3DMDA 1P75A 2V7TA 4QICA 3ZHZA 3ZIAD 2IBSA 1QH0A 2G63A 4KV7A 4TOIA 1QLHA 4Z4SA 1YB7A 4K1XA 1OBFO 2OQVA 3T9CA 3MOGA 8OHMA 1GGHA 4KE7A 1JHUA 1GG2A 2DFPA 5JCOA 3RVLA 2DHRA 2JFFA 4WPGA 1TIPA 3K73O 5K6TA 1QLJA 2VWHA 3AF2A 4ZGGA 3Q39A 4PSCA 4RPCA 1SKMA 1WP9A 2EFYA 4LZOA 4OPOA 1BA2A 1L2TA 2AJCA 4NKRA 2GZMA 4UDYX 2Z2KA 3EWNA 3VAYA 2D2FA 3EIFA 2WKSA 2PWAA 3K5IA 4UXHA 3R24A 3GUYA 4OGLA 2I4TA 1T6ZA 1WNTA 5EIWA 3HJGA 3K2QA 1HX7A 4BNDB 4JP5A 1W2WB 5CMLA 1PS9A 5D86A 5JOQA 4RCZA 1F0YA 3LK7A 4D45A 1JECA 1R0LA 3FXAA 4OIMA 3CCFA 2I7XA 3A6JA 1GGJA 3OFSA 4FR5A 1HF3A 4QATA 1KEUA 2O3UA 2WPNA 4IF4A 3RC2A 3ZCUA 2ZZFA 1JQAA 2Z6AA 1GM5A 3TKAA 1HT3A 1SA0A 3K30A 3HYRA 4Q1AA 1AF7A 1XZQA 1CUJA 4R16A 3PHHA 3EDYA 5CHYA 2IDMA 3GCGA 2P78A 3UJ7A 2AW3A 2ZUSA 3KPYA 3KR2A 4H4DA 3MB8A 1YR1A 4MPRA 2PL3A 2B21A 2MOKA 2C5EA 2C83A 1I24A 2DQZA 3B6ZA 3P4XA 1XALA 3MPUA 1JQLB 4MVJH 4EF6A 4X1OA 4EJSB 4B44A 2MSNA 1KA9H 4D9JA 1IVNA 1KYZA 4KXWA 2JFQA 1H2XA 4A8JA 1P0CA 4ND8A 1K7EB 3HWWA 1PJZA 3AONB 1LEHA 3T5BA 2XADA 1IJKA 2MINB 2WYOA 3QVKA 4RVNA 2VN8A 3KKOA 4PZPA 4YI3A 5DYNA 4F4IA 2ZAMA 1RLTA 1GR1A 1E1CA 1K7FB 2O1EA 4KWHA 4RY0A 1R8XA 3DZJA 3VUFA 4D3XA 3FNFA 4PNPA 1CY2A 4M38A 1ENZA 1N2OA 4J16C 2PS0A 5DIFA 1SXJE 3PHGA 3TLXA 4MUYA 1N33B 2CLSA 1FU4A 4MQMA 3T7SA 3EIOA 4J6FA 2IYRA 2DH5A 4HQOA 1ZSYA 3QBVA 4CCYA 2WD7A 4C0LA 4TS1A 1QAMA 1FXWF 2ZAOA 3EXG2 3F96A 4ZT7A 1RNLA 2VDVE 3KL2A 5EPEA 4MYUA 3RIMA 4MS3B 2XMSA 4O4JA 5EE5B 1GG5A 2ZJAA 3E3LA 1B3BA 3PQ4A 1N5MA 4B85A 1T0BA 1KK1A 5ULLA 3UKJA 1X6VA 1X2EA 4X92A 1VQKB 3A04A 1YLOA 2I0FA 3B2NA 2Y77A 1QV6A 3TEMA 1BU8A 1EP3B 2J3KA 2NUPA 3NB0A 3RUCA 2BWJA 2IYQA 3UKOA 1I4EB 4LRWA 4BP8A 1DIOB 3UMJA 4BC0A 3GDOA 4FHZA 3T7JA 4BNTA 2X5JO 4BEJA 4ZI2A 1PFKA 4RIHA 4RWEA 2C29D 2BW0A 2JFOA 1EUQA 2Q0HA 1G20B 4ZVUA 4I4NA 4YRMA 7REQA 4M99A 4K9SA 1RXSA 2VNSA 3KVNA 4BNWA 4BTVA 4KQ6A 2Q7OE 2QG6A 1CEQA 2SECE 2P2NA 1L4YA 1TD1A 2VQ6A 3DT8A 4IGAA 4RHTA 5F33A 1HE1C 3WKCA 2Z6QA 1OAOC 2VP5A 3JD2A 1RI2A 3HP1A 4OX9Y 3KPWA 2X23A 5IF3A 4LDZA 3GT7A 3H9NA 2ZYIA 3NAZA 5EKSA 4WUVA 4S05A 3FPFA 4NMMA 1WEKA 2X8JA 1CY6A 3IILA 3G5LA 2ID8A 3CS3A 3OPVA 2WF9A 3PITA 3R0XA 4FOOA 2OVBA 2OYCA 2H29A 4NK5A 5FA5A 4RE5A 4DLYA 2ZVQX 4L72A 1I8TA 1BS2A 1GZVA 1SCBA 5KYKA 1AOXA 5EIAA 3HWSA 5DYYA 9ABPA 1DT3A 2XBUA 3SLDA 2ZIZA 3PR2B 4KN5A 2Q6VA 3OIWA 1D4OA 3SXUA 5HIAA 5K0FA 2PEZA 3M8KA 3REGA 2QTGA 3CUYA 1YDGA 1KTVA 4P12A 4RLSA 1C1DA 1J99A 1JFLA 2NQ2C 4CKXA 1V71A 3ROKA 3FPLA 2QQEA 2C2HA 4XKVA 1QHNA 2OO3A 2W2LA 2DSNA 2W6NA 4I4IA 4DMHA 4MR9B 1S9HA 4O6VA 1N06A 4ND8B 1L4UA 2FCRA 1IM2A 4MYCA 2OZPA 1NVTA 2IH2A 2ZIEA 4B71A 2IBTA 3UUFA 3P2JA 3VBCA 4ZCQA 1SC6A 1A9QA 1LNZA 2Q2OA 3Q7QA 3UGKA 2JVIA 2B94A 1B8OA 1E1CB 3QY0A 3VZQA 4MUMA 3ZJVA 4BLRA 1J33A 1Q22A 1C7QA 2AKAB 1CP2A 4G0OA 1G8YA 2XWPA 2VJYA 4YPOA 1GZ7A 1Q77A 1YBVA 2YRXA 2FQ1A 3ACBA 3TH5A 4BLVA 2XIJA 1G66A 3PIIA 2RJOA 1UPUA 4KLRA 2VL7A 4D56A 3OJOA 1MVLA 1RRMA 3BSFA 3FOCA 2Q9AA 4N0DA 2WD7B 5IYPA 2DJ5A 2QENA 3QIVA 4Z9XA 3OTOB 1N2JA 1Z7EA 2ZE7A 1L5SA 2HU8A 3FUUA 1Y9JA 4NNOA 4O4JB 4KJXA 4Y9SA 3O8RA 3SNKA 5CA1B 3OHMA 5BWBA 2MTBA 2ZJ1A 1U3CA 1Q84A 1YU6A 2KQUA 3BK1A 4JT9A 2FCAA 4GWLA 3MWGA 3ZVRA 3G8AA 4JLJA 1IXYA 1X7ZB 3EC1A 3Q6MA 4BCDA 2OA0A 1NN0A 3PC8A 5IJZA 1BHSA 1YSCA 1TZBA 2PTGA 3DMYA 5ICMA 1DQNA 4A0GA 3THWA 3WKBA 3P5BA 4CLOA 4W7SA 4NJEA 4EEKA 2QMEA 4OQQA 3HNRA 3E84A 2G83A 1G8JA 1L5NA 2LZ0A 1NJ6A 1L1RA 3G5UA 2XOKA 7REQB 3DBRB 3ASUA 4QX6A 3FI0A 2OO5C 3NU1A 3JPYA 2VHVA 1TL7C 5L46A 4B17A 2CHQA 3R3ZA 1JQJC 1VKZA 3HJTA 3L8EA 5DISB 3TZQA 5TEVA 3UB3A 1TIBA 5B4VA 4AU1A 1ZEMA 4JLKA 3RC9A 4L3VA 4S2EA 3WS7A 3HSYA 4KQKA 3TGLA 4KI7A 1U0BB 4IIEA 2VAVA 1CUYA 1T8WA 3JQ7A 1NW3A 5F4BA 1T5OA 1XAGA 1XLWA 2GGSA 4ZN6A 1XNJA 4ECEA 2G0TA 1E1NA 3TUJC 3SXUB 2TMDA 3GGGA 5F1KA 1DUVG 4Q6BA 4V0RA 1SU7A 3DFUA 3DMRA 5DFAA 4CQMD 3ASSA 5CT5A 5IRCD 2DWPA 2Y9PB 3WZMA 1LI5A 1RSZA 1Y3FE 4GEKA 4UAVA 1NRWA 1T36A 4KO1S 4B6JA 1M5RA 4JFAA 1G2QA 4L28A 1P0PA 2L18A 2HJWA 1VE7A 2X8BA 1EXNA 4Y9RA 2IYTA 3WLHA 4R8RA 1JKFA 2IXEA 2H07A 2WKQA 2VXBA 3D0OA 3HR4A 3OTHA 1SQGA 5DF1A 5AKXA 3QITA 1HEIA 1U7OA 3GIWA 9MHTA 1Y7PA 3CZQA 3F8WA 2PXAA 1E1DA 4Y1RB 1AY0A 2NO0A 4B4VA 1LSOA 3T4XA 4XLTA 5HZGA 3NIGB 3I2FA 4F2GA 2NO9A 5BSXA 3OWOA 2MSDB 2ZP1A 3ZNNA 3TLMA 5E6UB 2XODA 4YRLA 3JPWA 4KMOA 3VFDA 4F5DA 3FB1A 1FFWA 2BLNA 2BHNA 4HB0A 5ESWA 2ECQA 5AK5A 3G1UA 2BMAA 4GYKA 4KAAA 2WHPA 3ASQA 5LBTA 1NASA 3KKQA 1H5QA 4ZREA 2INGX 3RVDA 1V26A 1DO2A 3TRJA 1BE6A 4U9IS 1GD1O 3KXDA 5I4KA 5CJ2A 1JJVA 1K73D 1DSSG 2OV2A 3P5SA 4HXFB 10MHA 2W00A 3B6KA 1NZDA 4IMRA 3MLBA 2O5CA 4H16A 5HYVA 1SBQA 4HY3A 1K88A 2XJ9A 1UKZA 1YZKA 3DDHA 3H1BA 1CU1A 4P1ZA 4BO2A 4OHYA 3IEXA 3H3FA 4G26A 4YV1A 2XGSA 1EE9A 3JZFA 3RTAA 1MGOA 4R7GA 2PX2A 3KV3O 4CLOB 1UM8A 3QX9A 3HN2A 3C3WA 1U5BA 3QHAA 3M49A 2XWSA 3ETCA 3WIVA 4TKVA 1C9JA 1DELA 4LJ5A 4HEA6 5TXGA 4RVSA 3CPWB 2FW6A 1L7QA 1RKVA 1TE2A 2NU6A 4PLHA 3BD6A 4U3JA 5LXTF 1CUDA 3RJ5A 3ZHQA 3CF2A 4EO4A 4MDEA 2I3DA 3A6EA 1SELA 1ZU5A 2FMXA 1F9AA 3BHIA 4E5MA 3ZWAA 2FXVA 1ORVA 4YK7A 3KSMA 4D4HA 3B5EA 4RZUA 3AHFA 2P91A 3TIXB 2PA3A 5DNUA 1NF9A 3U2QA 3VR6A 2FPPB 3HKEA 4I4CA 1ZM3A 1OBOA 3QNWA 2X6XA 3KSDO 3MJVA 3WNDA 3HY3A 4Q16A 1K3UB 3L18A 2E4XA 1EXDA 4ZZ2A 1N8KA 4ASUA 1KJYA 3TSYA 4HNUA 2CRVA 2EBFX 3PPIA 4OGGA 3SDZA 5TRTA 5B2EA 4G63A 1KSFX 2IIQA 3IGFA 4FZ3A 1RKUA 3R3HA 4W8HA 4JEUA 4WFJA 5AP9A 5HUQA 1E61A 1EP9A 3UWPA 3NNNA 5H16A 5FOTA 1T36B 4F91B 1WCWA 1N2BA 5JWHA 4TS4A 1X9HA 3VNUA 1Y1TA 1I9CA 1R0ZA 4AURA 1GKUB 4ZT5A 1U7UA 2BN4A 2DR0A 3U62A 3Q2OA 5JROA 2R62A 2VZLA 5K8VA 3FVVA 2EAUA 4Y0NA 1N92A 2IEYA 3GK3A 1COWD 2IPLA 4D3FA 5FL7A 2XUPA 4BRSA 4EB0A 2PGXA 5GP1A 1IL0A 3AR6A 1TVEA 1YQTA 2PX5A 1UQUA 4GRIA 5C8YB 3RS5A 1AKUA 4DWVA 2JAQA 1DCFA 2X6RA 1NHWA 4JI7B 1E20A 3RC8A 4AWBA 5EAIA 3HDHA 3OUZA 4AFNA 3N39C 2ZUEA 2X4GA 2WHPB 4LNHA 2XAAA 2OAQ1 3TYXA 3VZBA 5BYKA 2CMKA 1C7JA 1PW5A 1W5EA 1M8PA 1WMAA 1FP1D 3H1GA 1EJ6A 1JDBC 1WPQA 2Y8EA 3B78A 3I9NA 4QLOA 2V3CC 2FUNB 3Q1LA 1DT5A 4L9SA 3GNQA 1ID8A 1SVIA 4C87A 1Z74A 5C4GB 3U6KA 3AIOA 2PA0A 4GRAA 4KAFA 1FLVA 5B37A 2QVCA 5A3SA 1DU4A 3WFZA 4FDMA 1SUEA 3V4RA 3QKRA 2Q5OA 4C4PA 3MM4A 4BAZA 3KQOA 1CR6A 5IT9A 4C0KA 4HTFA 1NJ5A 4PX3A 1SCUA 1FTSA 4J7AA 2C4UA 2AG0A 2JFBA 1U5BB 2GK4A 3ER6A 2VS1A 4TKVB 4UJ5A 3P2MA 4V0SA 5HSGA 3RYCB 3KTOA 1V9SA 3ICWA 4WOBA 1HNWB 3I56B 3G0CA 1NQAO 2NU6B 3HLYA 1TTQB 4U3JB 4OX9B 3OT5A 2P6NA 3KKKA 4BFLA 1SMKA 5A04A 4CLDA 4CMIA 3AUFA 5A05A 3QSGA 4EW3A 5GONB 1IBLB 3FR7A 3IVMA 2FZ4A 3A10A 5KSWB 2DPMA 4G81A 4KQ9A 3R23A 5B1YA 1C7IA 4X9XA 4F8EA 1ONOA 1TD9A 5FA8A 2A84A 2PSSA 2UV8A 5LWHA 4Z4IA 5KQGA 3CINA 1PJTA 3HKEB 3NOOA 1GZSA 2JB9A 4J9UE 3ZHRA 4NBTA 4X6LA 5BSTA 3R5SA 3CCRB 3ENNA 4M6WB 1WEHA 5AXAA 1XIVA 4DIDA 3WGLA 4BIMA 1Q14A 3QI2A 3PU6A 4AP9A 4X93A 2NYRA 1H85A 4D81A 3EASA 2W6JA 4Q9HA 4DM3A 3FPGA 2HCBA 4DV2B 1RHMA 1C8KA 1FQWA 1AZLA 2EJWA 1IHUA 3IP9A 3B6MA 4LF6B 2QVXX 3ONEA 5LMNB 1Y6GA 1WVGA 2NP7A 3P26A 4X5OA 4HFRA 4G5FA 1U7ZA 2A5LA 3OLZA 3HEMA 3WWDA 1O3YA 2V6JA 2ZOSA 2P2LA 4KSCA 4X6UA 4CLXA 2XTAA 3STHA 1F12A 4DUYB 2E55A 4Z4QA 1YIJB 3BF7A 1IULA 1T0IA 2WSSD 3S1AA 4TV9B 3TK1A 1MW8X 2NO6A 2O8EA 2HF9A 5FEUA 1KS9A 3B7WA 5BN5B 1EUDA 3WO0A 1N2SA 1X70A 1Z56C 3CURA 4ERXA 1YRAA 3QEAZ 2IKQA 2X8KA 2JIOA 2QPTA 4GWKA 4EKYA 4GRDA 4BLPA 3PC8C 4W5TA 2JLXA 2EKZA 1ZSNA 4GOXA 3WYCA 3UHOA 1X8KA 2I4MA 2VP9A 3ECSA 1E5DA 3IA7A 3SIRA 4C3VA 1JZSA 4US2R 5KKNB 2RG7A 3PGMA 3T6KA 3RI3A 1OBVA 1Q6YA 1A5BB 1SXHA 2AS0A 1X1EA 4JUCA 3NBUA 3RTEA 1SU8A 3S4YA 3ZYZA 2PQ2A 1NYLA 4KE9A 2VA9A 1DGQA 2RGWA 5EEHA 3NALA 1SUSA 2D0PB 3QKRB 1NRJB 4EKEA 2FEMA 2EW8A 4R8KA 1IUKA 1E2UA 1EHYA 1ETHA 2OSVA 1E7QA 4JODA 4NZOA 4N7RA 5ES3A 1G3UA 4NQZA 1YB5A 5JXWA 1BTOA 1XAHA 5CD1A 2BGGA 4UAUA 4UBMA 5GZ6A 3DD5A 4B3TB 4ZV4A 1XCBA 2QSZA 1KZ7B 4R1UA 1TF2A 3LC7O 4ZV9A 5T5QA 1YHZA 4IAOA 4JHXA 3WWZA 1U2RA 1I1HA 2ZM6B 1J39A 3AGQA 4RD2A 4BVLA 2AFVA 4JI5B 2X6QA 4BMSA 2BTOA 4CMIB 2G7ZA 2NO7A 2XQKA 2B8NA 2IHYA 4A03A 5JAQA 3IV6A 1YB4A 1M0TA 5DCWA 1HQYE 1KDZA 3F5DA 3HHPA 3ORSA 1KVSA 3RBZA 2IXTA 2DKOA 4KO3S 3TTXA 1NW5A 4E3ZA 5ISMA 1JAHA 5A5FA 5KU1A 1SVKA 2R9VA 4IP0A 1RPJA 4WASA 5G1NA 3IAUA 1EDDA 1OXUA 4BRZA 4CI9A 4Y7CA 4PC6A 5FLEX 2ZIGA 1L4KA 4OP2A 2DF8A 3UHAA 3UOAB 5A5DA 1UPTA 1ZONA 3ABRB 1XU7A 4YUZA 2DUUA 2BMWA 3SBEA 1RM5A 1K0UA 1Q86D 1IQUA 2PH3A 4FMCF 1P72A 4INJA 5CUQA 1TEXA 4LE1A 3PE6A 3PQ3A 3R7BA 1FC0A 1OVGA 1IHMA 1SUBA 1WULS 2R87A 3OT4A 4LYFA 5D51S 5HF8A 2CT8A 4G0VA 3M6FA 4O4HB 5AKGA 4UTNA 1EVIA 5DHAA 3FCXA 4AMYA 3MOSA 1GQYA 2P3SA 3KEMA 1UFVA 4N0PA 1EUYA 2AG1A 3BQMB 2HWWA 4IDOA 5FADA 1PLJA 1IXKA 1QBKC 3FNGA 4RDCA 5DYIA 1QAQA 1XQ6A 2PQMA 3I04A 3A36A 4N7BA 3VPXA 5JEEA 4YREA 1P0MA 4AKTA 1UZMA 3S1AB 1DPGA 3WADA 2ZZGA 4UULA 4HAVA 3GQBA 4EL5A 5AJTA 3TQIA 4I4TA 3CG0A 1EUDB 5IWAB 3I4CA 5G3ZA 4MGEA 1CCWA 3CZPA 1R0XA 4HNVA 2JLUA 2AFRA 3V8QA 3F5QA 1Z5PA 3Q10A 1M2VB 1V8OA 4RX1A 3OTIA 3WVNA 2DYKA 5DM1A 3C45A 4KRYA 3W5SA 4DPLA 5EWJB 3H99A 1I36A 5LQMA 3PTLA 4GI1A 4FS8A 2IZ6A 1PVVA 2L17A 1T8YA 3IP8A 4GC9A 2G6TA 1BMTA 4MB2A 3ZTWA 4M7OA 1E4EA 4MUJA 3EY9A 4JBWA 3UM9A 3LCCA 3AUYA 4JHLA 4Y6RA 4RH1A 2XHEA 2QVGA 1DX6A 2H92A 1RJFA 1Z4IA 2VHCA 1HWYA 3EULA 1YJ5A 1JKJA 2WAOA 3C7KA 3DL7A 4QBFA 3RO7A 2PQ6A 3VKHA 4IFBA 3BM5A 1L4HA 3AO0B 2VPQA 3E8MA 1YR2A 4ZYLA 2NX2A 1RLJA 1BGWA 3KOMA 2RC5A 1QPZA 1Q57A 3EARA 1IPEA 3L3BA 3O73A 5CB8A 2VPTA 4EHBA 16PKA 3PEEA 1TF7A 3RWBA 1IBRA 1N2HA 3FYDA 4TRJA 5ECGC 1Z6YA 2I7DA 4XUDA 4F8JA 2AKYA 3A7EA 4TMXA 2RI1A 2WJWA 3PX3A 3MGAA 3WBJA 1ZVQA 4GKVA 4AT1A 3F9RA 3ZXSA 4ADSG 4Z1MD 1J1UA 2QBYA 1YITB 3MD0A 2VQ3A 3C74A 5FPHA 5JTUA 1U2EA 1RIFA 1SHZA 4FD3A 2WU3A 3BJEA 1EI9A 4FUQA 4Q3CA 2C3PA 4PO1A 1XC7A 1APBA 2VJPA 3BIJA 4WN9A 4HBZA 1SB8A 5JAHA 5KVCA 2KWIA 4QDOA 1TK2A 2I33A 4QOJA 4QXPA 3OOYA 3ZDCA 1UMCA 1NR5A 2GN8A 5T7BA 3T1TA 4YVFA 4WKGA 5AXBA 5KQMA 1ONPA 3LXUX 3MT0A 3CLSD 3NH6A 1TQ8A 1GG8A 3P9NA 3ICQB 4GOLD 1JPUA 1SUIA 4YAUA 1MTZA 3ORRA 5LIPA 1ZVJA 2BZSA 4H7HA 3ZE9A 4M8LA 3D7MA 1NBEA 2QRLA 2Z5LA 1OMOA 3LDHA 3IRVA 4MVJP 1VDMA 4GZ3A 1XMJA 4FFRA 2UUBB 5HZMA 1W2BB 3DPSA 1DO0A 4PWZA 3O82A 3KZ1E 4QYIB 3GDFA 4UU8A 5JADA 3UJNA 4A26A 4AZTA 2ZRNA 1NKTA 1X3LA 3IBYA 2JCXA 2YHIB 3AVWA 2GRUA 5CFPA 1M90D 3N28A 3GJRA 1DC6A 3U4DA 3WP1B 4F3TA 2ZS8A 5DXAA 1Y3BE 1L7MA 3CCJB 1J2YA 1TECE 3LHKA 3VTKA 4ZYUA 4MCIA 3TOXA 4NBRA 4ZCLA 3AHDA 3H83A 1UZAA 4IFEA 3A4MA 4J2TA 3HABA 5DBIA 3CZ5A 3WHPA 1NPDA 4QOEA 1HOTA 3BXZA 3A4VA 1KE1A 2O9JA 4ITUA 3WAGA 1PVDA 1E6UA 5CNIA 3M0EA 3BFJA 4WIAA 3ZZUA 2R7MA 1JSCA 1XLVA 1VRWA 3N86A 1P1CA 1TEVA 2B36A 2GAIA 3LJKA 3STWA 1P0IA 2P4SA 2X19A 3MB5A 1XXLA 4M1OA 1G18A 3A3YA 1FK8A 1H2YA 3E7PA 4JI1B 4UDNA 4M0EA 3AUSA 1Z6GA 2NNWB 1UIRA 2WUDA 3NG1A 5FLYA 3AT1A 3KAKA 1ZCZA 5D3ZA 1FS5A 6GPBA 3VH2A 4N0QA 3RVNA 1MH1A 4MYTA 1L4LA 3F5MA 2X22A 2A5FA 2DAPA 3S2EA 2V4ZA 4MYSA 1NBMA 4H08A 4WBSA 4Y0VA 3UUEA 3WIDA 1EK5A 4U7PB 2BSXA 3L1VA 5AUPB 2H8KA 1A8QA 1UBGA 5KYYA 1JXAA 1SXJA 4WWVA 3GOHA 1WD5A 5T4FA 4ZVQA 4B33A 3O8CA 4OMFG 3SEFA 1WTCA 2I80A 3CP8A 2HXYA 4YGXB 2GAOA 1KWKA 3RVBA 3IBGA 4E30A 5B3KA 3WBFA 5EXXA 4KVFA 3ZOKA 3G89A 3JALB 1F2DA 2QYHA 5A6VA 5I6DA 4WN9B 5CFMA 2VP6A 4CM9A 3H04A 3WC4A 2XUGA 3QBEA 5AVWA 5I9NA 3ZLBA 3AVTA 4H0NA 1C3XA 1CUZA 3CW8X 3HUFA 1A96A 2WYHA 2HX1A 4RVGA 1VQ8B 5I3CA 2X1VA 3N6VA 1NQ5A 3LECA 4IDQA 1UD3A 1C0LA 2XD4A 4XYEA 1DARA 3TLKA 5DNVA 3O83A 1DRJA 1Y9EA 1E69A 1EINA 1OC2A 4FQ7A 4UBNA 1SVWA 1N5DA 1R00A 1TADA 2CXPA 3A7DA 4OOXA 4NCKA 4NFHA 4Q02A 3P0EA 1JQDA 4FDLA 4RO0A 3Q4GA 3TOSA 4R8LA 4BLWA 3LXXA 2CUNA 2JFXA 1OBCA 1VL0A 1PLLA 1VJTA 2EJTA 1GL7A 2VDRB 3N7TA 3R6GA 4QNMA 1DAOA 2HGSA 3VO8A 2E7ZA 3WGUA 2ATIA 1HOXA 3RUEA 5I7SA 3FVQA 3WV4A 1RQ2A 5CIYA 1R8SA 2D1SA 4LRUA 4OXKA 4EMUA 4KPGA 4L51A 2P6RA 4QHYA 5JZMA 2Y2UA 5KNCH 1X7DA 2CDBA 3RF6A 2FF5A 2NP6A 1KR5A 1IZ8A 2FMHA 5IZCA 4E4TA 1RJWA 3ZBTA 1C3OA 3DL0A 4IDCA 3IVAA 5F7ZA 4G5SA 5TSDA 1VJRA 5BSKA 1P29A 4CMBA 3FWZA 2RGCA 1GTSA 3ND7A 5A5GA 4YH1A 4OL9A 4E5UA 4EENA 5EHNA 3V3KA 4ALIA 5LQJA 2XY4A 3CE9A 2HSGA 3JYPA 1E9RA 3EMBA 3GEPA 2O19A 4PN7A 4P4SA 2H7XA 5EXTA 3U3ZA 4C3OB 2J0VA 3TQOA 3V4FA 3TLYA 1TGYA 2JLYA 1HE8B 2CLCX 1N9ZA 2ZQYA 1UAGA 4L8YA 3GVCA 4QAQA 1ZUIA 4XYBA 4DCGA 5JQGB 2YXDA 4RMIA 4XQFA 1GV1A 1LF5A 1FW8A 4CKBA 4CDNA 3TDNA 4IIDA 2G8NA 3W5JA 2YHBA 2FH5B 3WGQA 1QZTA 3IAM6 5JMPA 4F71A 1GGEA 1JQKA 2BBTA 3HA5A 3BWYA 4NZMA 3L1IA 4G9EA 4GPZA 1CE8B 2WYRA 4PTZA 2OCYC 1FBNA 1KXZA 1LKZA 1PSZA 2J3JA 1P1RA 3M6LA 2OGUA 2P4UA 2EHDA 3NIWA 4WXRA 4G84A 1C3VA 2H16A 2DY0A 3GLIB 2YC4C 3LPCA 4QVIA 1JA1A 1PG2A 2WUFA 3HE3A 4F6RA 1REQB 1UXOA 1RQPA 1ZD3A 2WWHA 2ZLBA 3K53A 4ZWNA 3PF9A 2AX4A 1G3IA 4QXAA 1W36C 2GAJA 4Q3EA 2WIFA 4X94A 3TW0A 1P2TA 4ZC8A 4JL5A 2CD9A 2V0CA 3CLUD 3H18A 4DBZA 1QE0A 4P7GA 5KNCD 2DFTA 3PEVA 4RA6A 4RZHA 4FM9A 1NOKA 2D0OB 3JATA 1TGVA 4XSVA 3PEYA 4J6EA 4KNYA 3ZZNA 3LUPA 1YH3A 4N49A 3I5YA 5BOVA 1WQ3A 5AVXA 1I5RA 2GPYA 3VNSA 1V3TA 2ZT8A 1KF0A 4Q4HB 2BVNA 2DY1A 4QUKA 3RT7A 3W8RA 2JLBA 5FUWA 1RXEA 2XA1A 4DA6A 4MDYA 2LVBA 4QDUA 1TK9A 1EHCA 1KKLA 1TZMA 1AKMA 2JAUA 4PICA 3WK9A 4JBIA 4CU2A 3W2GA 3S5JA 2JBAA 1M0WA 1O6ZA 2ID9A 4XCXA 4D8YA 1Z0AA 1KMHA 5D5PA 4KACA 5HZHA 2Q3JA 1NXVA 5AW5A 2I3BA 3SE0A 3HBJA 5ADWA 3N1UA 2QW1A 3RBAA 3VU1A 3FSGD 1J0EA 4MVJE 1M2OA 2X1LA 1D5WA 2D1TA 1YCDA 1D1TA 4V2IA 3SX4A 3RU9A 5ADUS 4UUPA 4WTOA 2QGNA 5FKJA 1XPRA 3U81A 2X6WA 1NRIA 4TLAA 2XNHA 5DWVA 2CKMA 5JAOA 2PUVA 4B2PA 5CFZA 3LA8A 4NYIR 5P8WA 1KAEA 3EGWA 1XCMA 3ADOA 4WH0A 3TW8A 4DYVA 1ZVKA 3GF4A 5GZ3A 4I46A 4DJ5X 1GDHA 1B0ZA 3A6GA 2AMFA 1QCYA 1CF4A 3CNEA 4MXDA 1ZD5A 2UZIR 4EQ6B 4W5RA 5JD5A 2J3IA 3IIKA 2CVOA 1R4NB 4FIZA 5DTEA 4QGSA 5CFNA 1ZISA 4K9RA 4RW0A 1VSBA 3I9V1 3ECAA 4FC7A 3TTUA 5FOVA 4P92A 3DTVD 3P0IA 4XGKA 3D7KA 5EMMA 4N5NA 2CXOA 4MICA 1E3WA 1XAJA 4IMJB 4H7IA 4H27A 4KV9A 4EDFA 2W70A 5AIBA 4LDNA 4O4JF 3EXAA 3DOIA 3ZBUA 1VPTA 1WHTA 2W2TA 3BMCA 3JVVA 1Z68A 4FGUA 5CA1F 2PUGA 1MTOA 3LOPA 5F3WB 2O2DA 1BX1A 5A7GA 4CM4A 4HVLA 3AVYA 3I8OA 5H3HA 2PFSA 4Q4DA 1L5YA 4C14A 5AHRA 2YS6A 1V9LA 3U4CA 4D4GA 3QMPA 1U9IA 4LC1A 3Q11A 4MUKA 5DGTA 2IYYA 4F6RB 1L7RA 1WW2A 4C1NA 1Y63A 4M1YA 4RL4A 4ZAVA 3OIFA 3I5XA 3E8XA 2DUWA 4KBYA 4M9RA 4PNHA 1DRWA 1MOZA 3HU3A 4MWBA 3RKSA 3TZCA 2NVOA 3DT6A 2C9DA 5EJMA 4JVLA 5LQSA 4TLMB 4ZAXA 2J4CA 3R09A 3CD6B 4QJ3A 4R81A 3GAFA 2ASVA 1XZLA 3GAMA 1GPMA 3Q6IA 3LC0A 1DG1G 4ZCMA 3N74A 3KU1A 4FW8A 4G5HA 1C7ZA 3U5ZB 4HB2A 2COUA 4N6OA 1TC2A 3AVVA 1WIWA 1XQYA 3BULA 4Q21A 3DZKA 4JQCA 5DMXA 5F9MA 5THKA 1WPCA 4CV0A 1KH3A 3C7CB 2GTIA 5A7HA 3N2GA 4XVCA 4DWWA 4BAGA 2MJLA 3FUVA 1SH7A 2VEOA 3I55B 3AM4A 2JBAB 5JFGA 2P1ZA 1KMHB 4C20A 4RK4A 1WXGA 3BTVA 2C5FA 2RBEA 4QAJA 3TUZC 1T9ZA 4D6YA 1GPDG 1ORWA 4IUDS 3PLAE 1KMIY 4KQEA 4KO4S 5EGSA 4BCCA 5JLJA 5IYZA 2JI8A 2ZRKA 3G23A 4PR3A 3MRTA 2V5AA 3KQTA 1P9OA 2WNIA 3R8FA 2AK2A 1A3CA 4IDGA 3KO8A 2PV0A 4ZYXA 3LKZA 4Z9YA 5ETJA 5HK8A 1IE3A 1FVFA 1KQPA 2G77B 2Q2VA 2XSZD 3ZWMA 4F5YA 4G0NA 4HOYA 2ETXA 2QUKA 2VXCA 3TB6A 5THXA 2PO7A 3F6CA 3C97A 1VP3A 1ND6A 1SCIA 1NGSA 3SP1A 3PLRA 5CNJA 4OYLA 2VLIA 3LCRA 3O91A 1UDBA 4H18A 5CVTA 1WZNA 1M2KA 4YO7A 1GA4A 3ANSA 1PUIA 2EZ4A 1G64A 4E1AA 5HEKA 4MEAA 3ON5A 4OHCA 1S2DA 2NSYA 1LLQA 3I23A 1U1DA 1YZVA 4KXMA 4N54A 3BXHA 3I0NA 1E5LA 1QBGA 3K31A 4NYJR 2MYTA 4X45A 8ATCA 3BD9A 3H5TA 1FYDA 2DPLA 3GLFB 3DFKA 1XTIA 2PX0A 4KFTA 1WHTB 3AHHA 1GKIA 3BMCB 4XN3A 3EC2A 5GM1A 4BC1A 1NQTA 1GCIA 1YJCA 1PWXA 3OQ1A 4LDPA 2EKDA 1IN7A 1FFSA 4QLAA 3VUEA 5JT1A 4CM4B 2IJGX 3Q6RA 3LHDA 3M5WA 1DKPA 1VIDA 2BAGA 2M6LA 2Q8PA 3TVTA 4F12A 2PU7A 3LPAA 2OEPA 2GSWA 2CDRA 2UYQA 3IPXA 4B83A 2A92A 5BNTA 2VJKA 5E3JA 1RZRD 6CHYA 2VP0A 2O8VA 1FPQA 4EZEA 1TYDE 4TUYB 5CIQA 3ZPNA 1KP2A 5IMSA 1GFSA 3A1CA 3DBVO 3RRYA 4U0JA 2C97A 4OA5A 2H2WA 1ZDMA 2F3RA 2RGRA 2JA2A 3JARB 1ZIOA 1JDTA 1MORA 1UFQA 5AMXA 2ZB3A 3UQYS 2I1QA 2QD3A 3DGFC 1OFGA 5CP8A 3RVJA 5KEIA 2JJ2D 2RHGB 2PGIA 1WSDA 3G8BA 1JALA 4IFIA 1RJEA 3KX2A 2I99A 4MWDA 2PNJA 2XZLA 3R9KA 3F6PA 1VJSA 4GMKA 4B5LA 1EFPA 4MV0A 5JLAA 3RIYA 5CAEA 4JDPA 1CUHA 3N2GB 2I2AA 3MT8A 3O4FA 4HD8A 1CR2A 1C0EA 3MW8A 4JUBA 4MYDA 3BNWA 5AVOA 1NLUA 2HW8A 3NW9A 4IHKA 2C2MA 1V5WA 2O14A 2EC5A 3KJFA 2ZTSA 5T6MA 2APJA 3GFGA 3H8JA 2V8OA 3LOUA 4MVJG 3WMWA 1W1WA 2AYYA 3K70D 3TQFA 1DDIA 3BC9A 4XUEA 2CFIA 1KI2A 1E2IA 4PVCA 4DDTA 4EPXA 3ZQ6A 4AVYA 1SY7A 4YT5A 3HY4A 1XDWA 3I9LA 2E4ZA 4DDHA 4DV0B 2IFTA 3AIKA 3IP3A 4GOND 4H7FA 3NORA 4QODA 2FEXA 3OPYI 2Q5FA 3ZR4B 1FFYA 1S7GA 1KQFA 4OLAA 3O2JA 1QO7A 3R3XA 2ET6A 1DFHA 3GA0A 3NP7A 4V0LA 2P7IA 1B15A 1WDMA 4XM1A 4E88A 1U28A 1MP0A 1MX1A 1K7YA 2Q6IA 5KAPA 1ZBDA 2Y76A 5C8YF 1RU3A 4FHEA 5FTKA 5AW0A 4DLZA 4DT1A 1M74A 3G71B 1L7NA 2QB5A 3K6JA 2EBHX 2GF9A 3GGCA 1OI4A 4RIEA 5AVUA 4XWWA 1Q15A 3PHCA 2PS1A 2R00C 1HE3A 3DVAA 1Q0PA 3ET4A 4G8JA 1LRLA 3VHQA 1SQ0A 2GPSA 5H68A 3UGTA 3WSTA 2FP4B 3RSFA 1H66A 1ICEA 1PR9A 2A58A 4CM7A 2YWXA 1WJGA 3JVDA 2FYTA 3OZDA 4BASA 1XVTA 2QD4A 4JEHA 2I6QA 4KN8A 2BEJA 3H0CA 2QD2A 3S3TA 1I7SB 1FNDA 1RMTA 4AJ2A 4P9SA 2EZUA 5TPZD 5LD2C 5EWLA 2G25A 1M66A 2P0EA 1VXRA 5INTA 1VF7A 1P91A 1KK2A 4XLLA 3W05A 3MPOA 3WIEA 3DW1X 3RF7A 3LVBA 4LVCA 5IAKA 4ZI3A 4IIJB 1IDOA 3C43A 4C04A 4MLZA 4RYDA 5ALDA 2PZLA 3HFSA 1ZFNA 1KS2A 4IUYA 2HT1A 1JE0A 4WOPA 1LPPA 1UIMA 5DBHX 4E32A 3G0DA 1FJHA 5DH9A 5GONF 4YELA 3KP1A 2QZZA 3C3MA 4Q7JB 3V4SA 5AN9A 2ADFA 2FR8C 3F6YA 3FHOA 4LA4A 1GITA 3UIEA 4DBVO 2ZRCA 2JW5A 1MXHA 2HLNA 2C4NA 1FSGA 1JNXX 1WXDA 2XCQA 4PYNA 1NVEA 4HDNA 2OBTA 1E58A 1NLMA 3B60A 2H4XA 3JWGA 3LP5A 5F23A 4CMHA 3PI6A 1DKUA 4DANA 1V3VA 1I1NA 2Z04A 1S2NA 3T7DA 1V6SA 2O5RA 1S8AA 4ER5A 5JC1A 2JN9A 3DB2A 4X1KA 1M3SA 1F5NA 3LQQA 4YJHA 2GSDA 2X53S 4DB2A 1GRRA 5JZVA 3EJ6A 5EJIA 1MX9A 2HWXA 4F1WA 2IYPA 4JFRA 1NU6A 4MV1A 1DAGA 3BCDA 1G3QA 1YZTA 3NM4A 4TMTA 1KEZA 4YROA 3MQ4A 4D9NA 3R0JA 3D8RA 2V0GA 3EZYA 3M1AA 5IWCA 3KVRA 5IJXA 2HMSA 5J5VA 1BWPA 3O4VA 4JLWA 2EJUA 1E1MA 4HDRB 4QT4A 1J2RA 1F0NA 4H1TA 5K4HA 5A71A 5HVNA 1TT5A 4DG8A 5ICGA 1ENOA 4Q4AA 5K03A 3A11A 2X41A 1CZLA 4A6EA 4M1SA 2P3LA 4I81A 2ZBPA 4LQ4A 1KQ3A 3W77A 2IIPA 1CEEA 3X1KA 3G2NA 1RYYA 4KUHA 2DBVO 2LIPA 4RAOA 4DSOA 4NMWA 2R8YA 4TKOB 4KC0A 5BNZA 4OKSA 1V5VA 1YUBA 2ADMA 3CFYA 3GD5A 3R5JA 4PBRA 2PVCA 5AOBA 4DPKA 1LS6A 2QAGB 2ZR9A 3L0PA 4KN9S 5BP7A 5KIAA 3CCEB 2C3OA 1ADBA 4BVFA 3HDTA 5AESA 2RD2A 4DA7A 2E21A 1Z82A 2ZDHA 4J94A 4V3BA 2BLLA 4UJ3A 5B1IA 7MDHA 2C82A 3L7CA 2Z57A 1HQKA 2HIHA 3EG9B 3HCFA 4FYKA 3RRBA 4DJAA 4B6SA 5ILOA 1RI3A 5I47A 3GN2A 3Q40A 3COSA 5LA6B 1RWVA 3ED1A 5E7MA 3ONUA 1A9OA 5HOEA 3OQJA 4O3FA 5K01A 2NVWA 2C42A 3OEHD 1X39A 4WWHA 2YV2A 3VZDA 2ZL6A 4CKZA 3CMMA 4AKEA 1JA0A 3DOFA 3RSOA 1G1AA 2RKOA 2VBCA 3K92A 1NVMB 1UJ6A 5JXJA 2XZPA 5K0CA 2VAMA 2Q9UA 1S1MA 5EJEA 3PL5A 1OB5A 3GRFA 3BZBA 4D43A 1RTKA 2ZIFA 1R64A 3T3IA 1OJ7A 3DDOA 3SZLA 1NBAA 2ICAA 3IQHX 4U2CA 2XYHA 1IZ9A 2IZ5A 2YTZA 3RU2A 3UUWA 3N0XA 4K6KA 4N3BA 2C9YA 5IM5A 3PXAA 4PPYA 3U1VA 1RWKA 3WQRA 3OQNA 2P9FA 4MUIA 4R2IA 1CEXA 2GTHA 3KJEA 1TXGA 3ZI7A 3PCXA 4W5OA 1BRTA 1KFJB 4UMDA 5EZ6B 4Z4RA 2NLOA 2W2KA 5KWJA 1N6PA 3ZJYA 3DZFA 3PWTA 4FVTA 3RK1A 1CQZA 1GPUA 3EEYA 2PLAA 1Q3HA 5AKIA 3EFHA 4L3WA 1EGHA 3QUQA 3W5BA 1N77A 4DDKA 3FFTA 1U0NA 2HMTA 2G5CA 3KPUA 1N3IA 1WXIA 1OIVA 3DBIA 5AW8A 1EFVB 4XYMA 5IM4F 4YQEA 3LO5A 4UDXX 5LP6B 4JC4A 1YS9A 2G17A 4QYWA 3QG1A 4AO8A 2XNDA 1Z0IA 1ZC4A 4GSLA 3G0HA 1RAFA 2P5YA 1TUGA 1YJWB 3KWJA 4A73A 5LOVA 3ILHA 3FR8A 5KVQA 3KVOA 4ID3A 1G2OA 2A1UB 2AJDA 4XIJA 1B0UA 4F38A 1QGED 5ALJA 2C7PA 2Y1WA 5SY4A 4I3FA 1RWQA 1DFGA 3JAKA 5JCZA 1MH9A 3NHYA 3V6MA 1SVMA 1OLXA 1TLTA 1J0DA 1J0XO 3FJ1A 1U63A 4H31A 1XQXA 1WX1A 2YQ4A 4ZARA 3DLAA 2F8MA 4D4KA 3ILYA 4XW2A 3FM9A 3VDNB 4QECA 4MS1A 3CVVA 2AZTA 5SZIA 1Q81D 2XT9A 3AHCA 4RLHA 2C5SA 2PFKA 3NBZC 3LLUA 1SHLA 4EX6A 2I6UA 3V7WA 3RRNA 1FFBA 2HHCA 4LXGA 4P58A 4XR4A 3SJUA 5C1PA 2YVAA 3TLZA 2OTCA 3CT4A 1NF2A 2I6SA 1P74A 2HFKA 1V47A 2DLDA 2PXHA 2XGGA 3JQEA 4PG7A 4XLHA 1B6TA 1QG0A 1H22A 2QR2A 4IH1A 2JI4A 5FOXA 4KBGA 3ZZ1A 3DC2A 1FNCA 3L7NA 1WA5A 2R6GA 3M3HA 4I9NA 5K8JB 1PTJA 1CY8A 3MSCA 3DOOA 3W9SA 4JU9A 4L8JA 1CR1A 3X1MA 3ZK7A 3AFHA 2GZ1A 1QUFA 4GP6A 2ZYUX 4C6SA 2EF0A 1QMGA 3I39X 3JQGA 3SZOA 2C4TA 3LQ6A 1USVA 4Z3OA 3EGCA 4ER7A 1P1HA 4V0ME 4TTVA 1IPFA 3W90A 2WU1A 5JYCA 5KYNA 3U44B 5D2CA 4L85A 4D74A 3WRVA 4DRXB 1TIKA 4X71A 4AKIA 3U3JA 1R6VA 1C80A 1LVGA 3QK7A 4ZYVA 3VVCA 4DXHA 4HXEB 4LOJA 2J4FA 2XYRA 2B69A 2CHUA 1V6AA 3KZKA 4MW0A 3SLRA 2WPDD 1U1CA 4OH1A 2GEKA 4Q34A 5A4DA 5KSOA 1DFIA 1Y4DE 1ZAKA 2SKCA 2YNMC 3HU1A 4CI0B 3ES9A 1Z33A 2VXOA 1NKSA 3HS3A 2I6GA 5ESXA 1VQ6B 4K7JA 5ALXA 2EJBA 1JNYA 2FZKA 3G7UA 5AWFC 1TJ5A 3W3ZB 1UAAA 2O8FB 1LLDA 5HRAA 4FQ5A 4R31A 2IQ5A 3BHMA 4PO3X 1GZHB 3WE7A 1LJLA 1QIMA 3NKVA 2CE2X 1U28C 3U1TA 2F8TA 1VC2A 5ELLA 2EYQA 2XT0A 1NSYA 4LGCA 2ZWVA 1W44A 3KKMA 4XA8A 4UBIA 4TMWA 4Z0TA 2FPRA 1RM4A 1RWOA 2IYOA 2WJHA 3T3NA 2QNRA 3FMOB 4ZT2A 2CCKA 5ALWA 1SUCA 2LCQA 1VKOA 4IG4A 1Z4JA 3MMXA 3WGVA 4Z2YA 2OB2A 4JLPA 2ZUCA 3EDRA 1H3EA 1JKXA 1OLXB 1JUDA 3JAWB 1PJRA 2Y1LA 1FSSA 2GH1A 4HC4A 3KKZA 4GYYA 4DJEC 2E1PA 3RJMA 1PL7A 2OSBA 1WY7A 3EWSA 2HHLA 3ZIAA 5G1PA 3B9QA 1Z2OX 3D1VA 3S2SA 2JD0A 3H9GA 3NAMA 4WEOA 4YJFB 4AZ0A 1Z2EA 4KLAA 4R2WA 3K4QA 5KHOC 2EKBA 1ZCAA 4IJUA 1F0KA 2IDZA 4MUGA 4UUAA 1ZWLA 4X20B 5U9CA 4M89A 2UUAB 1H8EA 1T24A 3E7DA 1QJ4A 4BFXA 1XFOA 2PMWB 2CLMB 4I5DA 1XDSA 4XONA 3K9LA 4CQNA 3OW7A 4OTZA 5K3CA 4YXWA 1B0AA 3TNLA 3PNPA 4MZXA 4CMGA 3V2HA 2H1RA 2NT4A 2OG1A 1GAWA 3BZUA 2AJTA 4WZBE 3V7UA 3NUZA 4HVTA 3FFAA 5BSRA 3MTBA 3RE1A 3K6SB 3ZDAA 3OAAA 1FU8A 2H1HA 2JGDA 3GJQA 2PFGA 1BN7A 4JITA 4MQ4A 5I7AA 5E6RA 4F8YA 1FUEA 1ZHHA 4UXJA 3SK0A 4EW2A 1GHTA 3RTDA 4ZI7A 5BUCA 3K0AA 3T06B 3HEAA 1PR3A 1IOWA 2AI3A 3C6KA 3EODA 4ER3A 3CE6A 2BGLA 1TO1E 4B8WA 2OCXA 3CX7A 3CVJA 3H9CA 1QYIA 4MV8A 4WKNA 2YX1A 3UK7A 1CJUC 1S3SA 4HR7A 4N6GA 2ISQA 2OOSA 2R8OA 3KLMX 2R6AA 4LYYA 2CL0X 3WWCA 1V4BA 2WFZA 3RYFA 3RK0A 4AUNA 1II0A 1KRXA 2XT6A 5FTMA 1HMYA 2Y1CA 4MVJM 3UEOA 4L57A 2QVBA 2XMQA 5TQ2B 5GADl 3HCAA 4YLGA 3F4KA 5JJLA 4O2LA 4V39A 3FWPA 2J41A 4MKFA 2CMHA 3C3YA 5THQA 3G2HA 4KQMA 1J9ZA 5FFMA 3CKYA 3SQMA 3AZQA 4PTYA 1SK9A 1UFKA 2FW9A 3U9TA 2GEVA 3SJAA 2PH1A 4KXQA 4L7QA 3FRHA 3L8GA 2EVWX 1Z0DA 3DFMA 3CU5A 1CR0A 1GNLA 1L3BA 1H6DA 1M0EA 4P0PB 4BO1A 3H1AA 3HB7A 1SHJA 4CKWA 3KDSE 1TA9A 2R5NA 2ATEA 3EZFA 4YP9A 4FMBB 2IH4A 2N9UA 2R8ZA 4CBVA 2IZ7A 2V7QD 1TM1E 4TLDA 4WK0B 1KVTA 4GSYA 1SZPA 5FTNA 3SYTA 2IE8A 2W37A 1V0JA 5C7IO 3LWNA 3D26A 1SZCA 3BAZA 1ATIA 1LI4A 4BUZA 4EY7A 2QP9X 5AVSA 1RYNA 1Y1KE 4KL8S 3OZWA 4AZ0B 2XUHA 3DXXA 3H4IA 3KBBA 1Z4OA 4NEHB 3RR2A 1DE0A 2OLJA 1K89A 3IUJA 2W2VA 1BN6A 5CVJA 1CUIA 4G0ZA 5BSYA 1WWKA 3KZNA 4E5SA 4INOA 1PJAA 5EJ2A 5FH9A 1KYVA 1JDJA 2Z98A 5E8JA 5EPUA 4YCCA 2RHWA 4MVJA 2MWMA 2QYOA 1GAEO 3TTTA 2P6MA 3V1MA 1E2EA 4HGNA 1BXRB 1U2QA 5JQGF 2J5RA 2Y1FA 4A92A 5A4AA 4OL0A 3QWAA 2P1RA 3DS8A 4R40A 3KFLA 3NC1C 4X63A 1G7TA 2IS2A 1KNQA 3TUIC 2C03A 3USCS 3DSRA 2YVLA 4FYMA 4HRVA 2O54A 1URPA 2XMBA 1WAMA 1E94E 3GOQA 5P21A 4HGQA 3R7WB 5KYUB 3ETNA 4XIGS 2OV8A 4GW3A 2ZATA 5E9JA 1MB9A 4O33A 1HMPA 4XN0A 4RPJA 4Y2GA 2Y93A 3W7AA 4CIDA 2AGVA 5ALHA 2LTAA 1ZHFA 2A5DA 1NC1A 1PWHA 3CR7A 4KEAA 4Z9AA 3UY4A 1BFDA 2JDID 1E63A 4AROA 4AYTA 3QELB 4ZT4A 1H23A 2JKVA 1U0RA 3P19A 5K51A 4ZOLA 4XFJA 1B42A 1T2FA 3CCBA 3DV9A 5A06A 1VCHA 1XL0A 1U9CA 3F2VA 3BFKA 2DRIA 2YWGA 4U6NA 1C9EA 1L5GB 3SZMA 2O8DA 1BLIA 1CULC 1Y8AA 1XZFA 2HSEA 1S0UA 4EPYA 5ALRA 2OXCA 4AZVA 2VA8A 4GSKA 3EBLA 3GLGE 1GGFA 2J30A 4YRPA 1E3EA 2LDBA 4BNZA 3E1KA 4I55A 3WIUA 2LBPA 5CVDA 6REQA 3RAFC 4QRHA 4XDZA 5IBRA 1NIJA 2R8XA 3CM0A 5EFZA 3MOIA 3TJRA 4DTIA 3GA5A 3AL2A 3BYZA 4OFBA 3KTDA 1Y1QA 1LQ2A 4FGLA 3X1ZA 4CF6A 5C0OE 4KTVE 2ZR7A 5JG7A 3HZRA 4DARA 3C5CA 2AJBA 4C22A 1GPJA 1ZK1A 2FWIA 3AEKB 1NX6A 1O8BA 1U3VA 5EE1A 3S2FA 1DEOA 1RZVA 2YIDA 1V7CA 4KQXA 3HFRA 1P44A 5ALMA 3S2UA 1WG8A 3L84A 3K32A 5GZ1A 3GJ8A 3OY2A 2F43A 2RK4A 5FLKA 4YWHA 4RPGA 1ES9A 1H2FA 2P6PA 4C7VA 2IUEA 3E5NA 3K1AA 3QXJA 4KHZA 1KD1D 1QS0A 5KX5A 2RHCA 2XZTA 3W79A 3BDVA 1NFRA 1RP1A 2VHWA 4AX8A 4Z0HO 5DN6D 3K1JA 1LDEA 2RGXA 1L7AA 3A4LA 1K7SN 5LSAA 4YRRA 2F4NA 4UDOA 2BP7B 3M7IA 1W5SA 4JLVA 5FBWB 4DZZA 3HN6A 2W6PA 3AFGA 2PAAA 5E3IA 5HF6A 3RV4A 1NDQA 3NCHA 1CQIA 3KC2A 1USWA 5E1MA 1M8KA 4EHIA 3W1EA 1U2DA 4RF4A 1CC1S 1G42A 1YZNA 2VHYA 4IS2A 3ZS9A 2BEUB 4CTMA 2ZQZA 5HKBA 3I28A 2YJ3A 4UUOA 1J56A 1UUFA 2P9ZA 3D1JA 2Z3VA 2ZYHA 1ZIPA 1QHXA 2XPCA 2ZIWB 3RRZA 1KPGA 4QPJC 4R54A 5IMBA 3RUDA 3EIEA 1AUXA 2QU7A 1QIJA 3NYRA 5TC4A 2RARA 4KRFA 4NP6A 1BQEA 1TMYA 2XA2A 3AU9A 4MDHA 3FPSA 2JCBA 3IUSA 4CIBA 1YJQA 1KYIA 1NX9A 2YN0A 3SIXA 4ZJZA 1F8UA 2O7SA 4A23A 1SXGA 2P2GA 3QXXA 4J7XA 1TUBA 4DCUA 4CQMA 4DMFA 3CG4A 4AI6A 1E66A 3HMKA 3OMXA 4ZOLB 1PKXA 4LBYA 2X9NA 3L6OO 4D3DA 1T6YA 3RCBA 2DE0X 5GV7A 1LBQA 4XRRA 2R6R1 8LDHA 1SXPA 3WXMA 1UMDA 3PBKA 3GN1A 1IZ7A 1YJAA 1YK0A 3A3OA 4RGQA 1JHVA 1YT5A 1JX6A 2WJZB 2YUTA 2ZRQA 1VG8A 3PE4A 1T5LA 4X7BA 5EKUA 2F3PA 2OUIA 1Z4LA 3NIFB 2Z5FA 3H17A 5T67A 4FOLA 3EF3A 1Y42X 1ABEA 3GT4A 3NXSA 4I55B 1PYOA 2WJGA 1AZTA 1WCIA 1N9GB 3RNOA 5EUCA 3GU3A 4TSRA 5IS2A 2JLVA 3T51B 2MHCA 1ESMA 4KZPA 4DCMA 3WRYC 2HSWA 4JJIA 5CCDA 1VRVA 2OZLA 3M6XA 3K96A 1FLAA 5J4LA 2C9ZA 3R0IA 2Z08A 3NBXX 1WU8A 3M6AA 2PJRA 1WUIS 1F6DA 1II9A 2OOKA 2ZE5A 4MMXB 2CB9A 1GNQA 2YMQA 1CFZA 4DR4B 1RPZA 1UANA 2NM0A 1KSJA 3O3OB 1R5BA 5E4JA 4FFOA 1UDWA 3A8TA 1E6EA 3ZV4A 2HNAA 1N2CB 4FJ0A 4R9UC 3CJRA 1LFAA 3RG8A 1AQ6A 1UMBA 1QS0B 2OFPA 2B0JA 4L0CA 1U8UA 5C2JB 2VNHA 1T4CB 3DO6A 2Q1TA 2E89A 5ELMA 4L8LA 1E3SA 4R6XA 1W9MA 3QFCA 5CU7A 5BXYA 2V7XA 3OJXA 1G5QA 2QGFA 4GXNA 5G0SA 4FINA 4QT0A 1YQEA 3U4QB 5IU6A 3TQCA 3GEBA 5FV4A 3FCUB 4R2LA 2H0AA 3B5IA 1OREA 1TZ2A 1VJ5A 4HVAA 5JCJD 3ZGNA 2IHJA 2Q5QA 5CD9A 4GI7A 3WZ2A 1A97A 4V1CA 5DTMA 2WFLA 3E15A 2OE2A 3DOHA 1ZVVA 2AC4A 2HLDD 4BDTA 5HQTA 3PDWA 4PBSA 4QNRA 4QTTB 5E38A 1T25A 3L0SA 2BEVB 3HA2A 4TSFD 3UXMA 4ZJUA 3UMMA 1N3YA 2OV3A 4YLEA 3AV3A 3N2NA 1DDOA 3QPAA 4PEVA 4R71A 4MLPA 2D5CA 2W2PA 1EZ1A 1SHTX 3OBIA 3C2QA 1XRMA 1NW9B 3OX2A 1NY6A 3CC4B 2HC9A 4TL8A 3KT0A 1DS6A 3QJ5A 3BE6A 3H65A 1RVDA 2ZI7A 2DKNA 4K28A 5IT0A 2PWBA 1YBHA 2F9FA 3IUPA 5B1EA 4KHPB 4QYMA 5IXYA 1VKNA 2FG7C 4KR9A 3DJYA 3ZNOA 2G80A 1NF3A 4G09A 4D4MA 4QPZA 5BPHA 3Q3AA 3GLHE 3GA7A 2I1LA 4DMGA 1LBIA 4GFDA 4L08A 4DV6B 4TUYF 1UMDB 3VHXB 3QOFA 1OWPA 2GD1O 4Q4LA 1NVDA 3FAZA 2OBLA 5DYTA 1DMSA 1Y1SA 1YJBA 2P8SA 4J0HA 5DV9A 4QV2A 5CBPA 1HG1A 1P4AA 1X86B 3KIPA 1COWA 5F5LA 4PLCA 4U7DA 4KR3A 1JBEA 2E0IA 4IO0A 2ZBVA 1HGXA 5E1OA 1WCIB 3SLNA 1LZKA 1EVLA 2XNKA 3LX8A 5J59A 3NWEA 4OHFA 4E94A 1XO1A 1UK7A 3VC7A 4BNIA 2X77A 4P22A 5J3OA 4RMGA 4EGSA 2MSCB 2VT3A 4JZYA 4B80A 3SG0A 2OZLB 1I18A 2OP1A 5E4FA 1W49A 4RIGA 3TR6A 3K15A 1K9MD 1SUAA 4B7ZA 4LPKA 1FP2A 1J22A 1JZTA 5SICE 2B83A 2OBNA 5ALOA 4ZU6X 2CCJA 3KUDA 1JHXA 4CG1A 2WT9A 4QEZA 1B6SA 5I4IA 1IB6A 2V6FA 4QBGB 4EH1A 4TYWA 3G4SB 2R6FA 5IYZF 3K1YA 4RDJA 4E6PA 1MB0A 1J5XA 3AYZB 3TXYA 3AJAA 3ZC3A 1UBUS 2HKIA 2J1LA 4N39A 5AI9A 4Q7LA 1M6NA 3B1ZA 1YDEA 3R3JA 2ZJ6A 4IYJA 1HETA 2EERA 4PE5B 4X7MA 1MOQA 3H1FA 4X61A 2P3QA 2XUKA 4B7AA 3QM1A 2X0EA 2IUTA 2R751 5AXCA 4NCNA 2ECOA 1N5IA 1XQVA 1Z0JA 2AK3A 2OCLA 1P4MA 1CZRA 2HK6A 3DOUA 3IO5A 3JYLA 4QIHA 4TTAA 4ZXFA 2WFLB 1KETA 2IC5A 5EOVA 2NU9B 2QMZA 2BKVA 4O2RA 3RKUA 3DEIA 2NTYC 3KKLA 2GYUA 4G4SO 5TMBA 4KQFA 4O0LA 2N3ZA 5L3SB 2AMVA 4HMOA 4W4TA 4C7MA 4Y6GB 1U8YA 4N3GA 1Z28A 3H84A 3TVYA 4MHTA 2ZJFA 4EGCB 3ZKWB 1SOVA 1PV2A 3HJCA 2VBGA 1ZM9A 1QIKA 2VJAA 2IU4A 3DMHA 1ISGA 1IY2A 3E1SA 4MKZA 5DU2A 4R1SA 2PD6A 2CK3A 3A4YA 1VHDA 1AN9A 3A1UA 2JG3A 1JDNA 4M9QA 1US8A 1WPXA 1X1SA 3KWLA 4OUDA 2REBA 2KVOA 4CF3A 5JS8A 1NVGA 1XB2A 2DUJA 4P2GA 1M2FA 2B20A 1VKJA 2FG6C 2HZ7A 1MQ8B 1KEPA 1G5HA 1VSQA 2BGWA 2QUZA 1FDSA 4ZJYA 2FN8A 4YV2A 1B2RA 2PH7A 3F8TA 5D8DA 1ZR2A 1TOAA 2P9QA 1P5HA 5J3JA 4UPDA 2ZREA 1E0KA 3D6MA 4YHHB 1RQNA 2FMFA 3JQCA 4U2DA 4UFPA 3G6WA 3A8IA 3SSMA 4BFVA 1EBUA 2F00A 2WKWA 3HY6A 1ZOSA 5L53A 3SGLA 1NTRA 3GGSA 1RP7A 4IIJF 4OXQA 3FFXA 5JO0A 5CBPB 1QRTA 4BLSA 4Q5IA 4N8SA 4UM8B 3EA0A 5IVHA 1PU2A 2B2CA 3D3WB 2VJQA 2QV7A 3K7EA 4KFSA 3LT1A 5ERGB 3U17A 3H1EA 4KN6A 4L5JA 4DLSA 3U09A 4I1OA 4HUJA 4ESOA 2JVJA 3OZCA 2H4FA 2WT4A 1D2HA 1PDVA 1GPBA 1T5IA 3O0TA 2H57A 2KYRA 4B0PA 2SBTA 4WY2A 4HL6A 5JNSA 4NXNB 3OTWA 1OIWA 3PR3A 4UTXA 5IN5A 3N5KA 3S68A 4X65B 1U8CB 1P62B 2X7XA 3ORHA 3Q7EA 1JLLA 2G0AA 1WV0A 2JJYA 4F4UA 1WF6A 4RZ3A 5G3YA 4BLUA 4P3KA 5BSMA 2QL5A 1ZJ5A 2V9CA 4G89A 2ZUTA 5CEFA 3I83A 3EMVA 1T1EA 4IIGA 3L0DA 2GS9A 4I7EA 4J1TA 4LHVA 2C4WA 1IATA 3CONA 4EGFA 1VBFA 2K4MA 3RS8A 4PHGA 3ONWA 1B1CA 3DEJA 2QN9A 2J0UA 3BERA 1W1IA 1OXTA 4B7CA 3B2EA 4TLLB 1A9SA 1T6BY 1ZN2A 3LLVA 3EBOA 4C7JA 3HVRA 1ONBA 3AIMA 4NECA 2AOXA 4YECA 5DRTA 1P6XA 4AMVA 3TQHA 4BKUA 4E07A 4YRKA 1E2BA 3JWIA 1M8JA 4GVLA 2NT3A 1L8LA 1D7AA 3C3KA 1IOLA 1Z75A 3PKIA 2RCYA 3K2EA 5HCNA 2PUCA 3ZDZB 2F9LA 1MJHA 3EGEA 3LYHA 3TLJA 3SYRA 4XNFA 1F17A 1L4BA 2XE7A 2GFIA 4HS4A 2BC9A 4QWMA 1QHSA 2RH5A 2WYWA 3N70A 3EHDA 4OAPA 4G85A 4AJ1A 1ONSA 4CT5A 2I4LA 1FFEA 1P7YA 5I8ZA 4DIKA 4Q9IA 3IEMA 4HHEA 3A70A 3G05A 1R4MA 3CGGA 3M1YA 4B3HA 5BSHA 2BFDA 2O4UX 2P8JA 2WI8A 3DEZA 1JIUA 4WNYA 5F2OA 3B9RA 5FI3A 4ND7A 4IIYA 3QVVA 4RXTA 4ARVA 2JLWA 5T4EA 2AV6A 4XASA 1JG1A 1M2EA 2A33A 3MLEA 1HDZA 4P7FA 3R7NA 4KYVA 1S02A 1P17A 1US8B 4HDAA 4RA9A 5K2OA 4IDPA 4LTNA 4KQJA 5ICSA 2D7DA 4FXUA 2H48A 3PWSA 4B3GA 1C0PA 4S1TA 5LA6F 2F48A 1FDOA 1VJ0A 4GMHA 1OA0A 1X7YB 5I9TA 3GCZA 1QGOA 2H11A 3KU4A 4TKLA 3DZBA 4LYAA 3E27A 3QVOA 1C81A 1PK7A 2V6BA 1WXHA 2H2IA 3CNHA 3FGOA 1DKMA 1EJ2A 1NYTA 3NAQA 2IUUA 1AKRA 3BF8A 2UDPA 1SBIA 1NXOA 2YWRA 3CYFA 3FHJA 3FPKA 1M1XB 3L7IA 5PGMA 2JKZA 2R85A 2CHGA 1AK9A 1CT9A 1GQ2A 1P2DA 1I2ZA 2RHHA 4PO9A 2CW5A 1R0BA 2ZSEA 4G0YA 3SC2B 1NNEA 2ZZNA 3E58A 4OB6A 1TAHA 4WADA 2O8FA 4IJQA 5JSKA 2PS3A 2FW8A 4TWZA 3O9ZA 2DWOA 3LWZA 3Q7PA 3TOZA 1FJ2A 1Y9DA 3EXEB 5E8RA 3IO3A 5CH8A 5CEEA 1JLLB 2GLTA 3QEMA 4BDSA 1VHEA 4V0MA 1JTEA 1WMBA 3D6HA 5HZAA 1ATZA 3AJ9A 4I19A 4Q3BA 1O2DA 3Q41A 3STUA 4QVGA 4EOGA 5MDHA 4Z53A 1VE3A 3FNIA 2I3AA 3JTMA 2HZBA 5LP6F 2GXAA 3KG2A 5C4MA 2UUOA 1PEKE 1KI7A 2BR4A 2POQX 3DUFB 4LHXA 4PLGA 1ORDA 4WVLA 4J2OA 5AHOA 4ZGNB 1IHXA 4YONB 1T2DA 1CWUA 1VFNA 3T4UA 4BEBA 1Y98A 5J23A 5SZJA 5FEMA 1JIIA 4FMDB 2DR2A 1SHKA 4CMCA 3A3PA 1H6AA 4QG7A 1N4DA 4QASA 4ZMRA 2EKQA 4YCSA 1A9PA 1G6Q1 3SHTA 5BUQA 5J1SB 1XMVA 3WGIA 3KQNA 1R6XA 2JAXA 5DDIP 3GWZA 2Q3CA 4BEVA 4I6JA 5DLPA 1LV8A 2C2WA 1AO3A 1YQUA 2H2FA 2P2CA 1AV7A 5JDCC 5JWRA 4AZ3A 1W36B 2EDCA 4NCIA 1JL3A 4IJWA 5ALVA 1KJ8A 1WO8A 2G4CA 4BZQA 1NC3A 5A5EA 1NI5A 1XZDA 3T9DA 4EGAA 3TJMA 3ROGA 4YP5A 2BKXA 3VR4D 2HEGA 5FWYB 4Y2RA 4Z1MA 3RGGA 1AJEA 2AH5A 5KUTA 1W9XA 1D2AA 2X1MA 4LNUA 4UHFA 2C7OA 1ILWA 3KUXA 3RRXA 4RDKA 4NBKA 4PLVA 4L5IA 7ADHA 2PGLA 3W8FA 2BMDA 3GD7A 1YI2B 1T4DA 1XTPA 2CD7A 2GRJA 2G9UA 3GLQA 5DTJA 4YR9A 1ORHA 3I6YA 1DUSA 4L0MA 3T3GA 2X2PA 2FRVA 3LNTA 5B36A 3H2JA 2QZ9A 2Q07A 3HXPA 4K6GA 2C7GA 4FKZA 3B2QA 4JUIA 3B1VA 1GT91 3V9PA 5AK3A 4JLOA 5IUNC 3LK6A 4ZCIA 1UC9A 4OSPA 5ER6A 1HDOA 3BT7A 4CMAA 3NFRA 3I34X 3ZE2B 1F8GA 1OX6A 3MMNA 1CRPA 4HQ0A 2AXQA 4RKRA 5A4IS 5CYGA 5IPFA 2ZWMA 1NQVA 2GHQA 4MAFA 2R8PA 2JHPA 4GYJA 2YASA 3BWBA 1EP2B 1KRHA 1CX9B 4INPA 1FMFA 2REOA 4MLDA 2EJCA 1B4DA 4E5YA 3OOCA 5KKAA 4R05A 3NVAA 4KK4A 5CH3A 2IF0A 1HRKA 2ZT5A 2I1VB 5DTQA 5BNFA 5AVYA 5LMCA 4QXQA 3L49A 3U6BA 2CBZA 3QLTA 5BNIA 3U7GA 5ECDA 1WOYA 2NV4A 4G2TA 1X15A 4WZBA 2MU1A 4UC0A 3NTRA 3TPZA 3OLCX 4W9NA 5CXUA 2WAMA 2OCBA 3WL7A 1NAHA 5LZ4A 4NU6A 4EHHA 2XECA 1QQTA 3QEMB 2RI6A 1VQLB 5EMJA 4TGLA 1VBNA 2CV2A 4OI0A 1IUOA 2PXCA 2QLMA 3K8QA 3A2LA 5M5BA 1ZM2A 3NONA 3FWHA 4BBPA 3HBNA 3SQOA 2VLBA 4FHFA 5CYPA 2EBUA 4LBVA 1V11A 3OU2A 1DXOA 1RJ9A 5I9IA 3NBQA 1TQHA 4FE4A 4RELA 3A25A 4GOKA 2VHZA 2CSXA 4XWTA 2FZVA 2HT6A 3IQFA 4HWGA 3RC7A 2DUNA 3C8ZA 3EVGA 3HRKA 1FMTA 4B35A 5KOJA 3FOZA 4BNVA 2POCA 3FGNA 2Y1GA 2G9NA 1AB5A 2PMFA 1PYGA 1UBHS 1MLDA 5H02A 4EMSA 3ECCA 4B6EA 4AZ3B 3UMYA 3DP7A 5HILA 2EF1A 4GOJA 3E3AA 4FN4A 4HRXA 3ELBA 4NI5A 5DX1A 3WGKA 1JEJA 2NZUG 2Y99A 4UCFA 2HA5A 3DKIA 2B4AA 3LDFA 3AHIA 4C0AC 2VNIA 3ORQA 4Q6WA 1M5UA 2QRVA 4IHJA 4IQGA 4ZEWA 3U4AA 2YYYA 1Z7BA 2Q49A 4GZLA 1VLOA 1XOIA 1B26A 2ZANA 4IBOA 2DHDA 4E0BA 1PT9A 3FCYA 3PCRB 1ZUHA 1XZ8A 2FSIA 1Z26A 3CT6A 3HVHA 3AERB 3OPNA 1JHRA 3TR0A 1FFDA 3BJRA 3BL5A 3FTDA 3GBPA 1WKVA 1M75A 3RS0A 2ZL5A 5FUMA 2ZUFA 4BFUA 2JJ1D 3AM1A 2IHZA 2H5IA 5JNVA 1ZKMA 1GR0A 3P2EA 1Y4AE 5ADVA 4EK9A 2CZCA 4NBSA 1Z0KA 2D54A 3UYLA 4D99A 1F7UA 2GF2A 2NGRA 3WLEA 3QVTA 1Q1EA 4I5GA 1T4BA 2ODQA 4J29A 3TDMA 3T5PA 4DXDA 1TMKA 3AF5A 5B30A 4AN0A 3MJEA 1B0PA 1YZHA 2BFWA 3LWDA 4INAA 4X85A 1EJBA 5FUBA 3CESA 1NVVR 3UT5B 1XEWY 2IGBA 3E2PA 2HIGA 4URFA 5AKEA 4BZPA 5A2GA 1YRYE 2W2MA 3AM5A 4LVOA 1WLYA 3BXPA 3CZMA 1OYWA 2OO7A 4FYJA 2HSJA 4TTPA 3ZOZA 5K9ZA 1XPOA 1GNRA 2DHEA 1OD6A 5H80A 1I2DA 5BO5A 3ZU5A 1OR8A 1UL1X 1GRCA 2B30A 1UXHA 3ZHVA 4ZRDA 1RKQA 3P1JA 3WQBA 1MUUA 4FMPA 5F3RA 1UODA 1WXQA 3C7DB 4PZEA 4AULA 2FZLA 2HXGA 3CZCA 2RKWA 3NYIA 4FFBA 1V95A 1G1MA 3ZD9A 5REQA 4PLZA 4NOKA 4P4GA 3PDHA 3QHQA 4KMRA 2V1UA 5L45A 4ODIA 2JC3A 1WZCA 2NU7B 1DHRA 4EYEA 4MKGA 1EBFA 2XQIA 2XUIA 1V11B 5CNKA 3KEFA 3ZWVA 1L3IA 2XBMA 3WL5A 1NVKA 2K2QB 3IPYA 3JVIA 3DHNA 4H3SA 4NX2A 4C7XA 1JRLA 4IVRA 1XNGA 1R7RA 3M6WA 2I78A 2UZ1A 1KQOA 3V33A 1XVAA 3WNCA 3GLGA 1W35A 3RFCA 3SHQA 3KOYA 2W83A 1RFGE 3IOEA 4G4GA 3WIOA 2PQ0A 2YUIA 1D0VA 2O0JA 4RORA 5LDHA 3L46A 4P54A 2ZBEA 4BVGA 1CJBA 1P2BA 3CEPB 5T3UA 1AS3A 3RFTA 5AW6A 5KTYA 2AL7A 5L3ZA 2FEWB 1IN4A 4HAOA 4C0HA 3CRZA 4RPKA 4LXIA 3BGIA 2P0AA 2QRVB 1K75A 2W2LD 4CHTA 5BOSA 3ZTTA 4ZHQB 2ZJ7A 3ZDDA 5EXDA 5KNCA 3LUBA 4EJ6A 3QU5A 1QF7A 1XTKA 2JA1A 4G8CA 4AF8A 4C1BA 2IOFK 1VPEA 2OK7A 2LIVA 2FZWA 4RPDA 1A9XA 2WABA 4GH5A 4YMVA 2QTNA 1DAFA 2ZUVA 4D9MA 4FDUA 4ND3A 4TN5A 3NDRA 4KRGA 3NEAA 2O2HA 4E2WA 2HJGA 3BL8A 1SKUA 3WFJA 5J1TB 3AR9A 4L0DA 3T9BA 1A7JA 1KZ4A 1E77A 1PP4A 5H59A 1X1QA 3EPPA 4DLNA 4EUKA 1SNYA 1SFRA 2IYUA 3ADDA 1FU7A 4F4JA 5ICEA 5HGJA 3BRSA 1FDTA 3H4MA 1NT2A 1RQ7A 5FI1B 5B6PA 2PSHA 5H9VA 1OLOA 1MHTA 1T5TA 2VDOB 5IKOA 2H18A 4JI8B 1HEYA 4FOSA 3FSGA 3L1UA 4IZ6A 3FPJA 4G1MB 1C2TA 1PWEA 3S2IA 4DEXA 5IHPA 1ECCA 1JYSA 5AH0A 4AY6A 1E4OA 4P0TA 3RUPA 1YXMA 5JAUA 4YJ3A 4W9RA 1CUUA 1NVUQ 1VRCA 4S0XA 1P60A 1RTTA 5KCMA 1BX3A 1AGXA 3QKUA 3UMFA 2JIDA 3QE3A 4RZXA 3RKRA 4XYLA 3G5MA 3C8HA 4XPIB 3Q85A 2B5WA 4CN8A 2FLWA 1W93A 5REQB 5J58A 1TU3A 2DPHA 3C6BA 3N2LA 2IHNA 2UXCB 1YBMA 4J43A 1FJXA 1MZPA 1TCAA 2RGNC 2PZEA 4YCBA 3UV6A 3D8NA 2QD1A 3BGOS 5JI3E 1FUYB 2DYIA 3O3MB 4MYRA 4TZ0A 2EFGA 3H11A 2M9MA 4Z49A 1B7GO 4G1VA 2PUTA 3TRFA 1UR5A 3O8OB 1PWZA 1YIOA 2CEAA 2BSQA 5I7RA 3GRVA 2AB0A 4OMUA 4TTIA 3DTVA 3B1JA 5I7FA 4NYIQ 2CXUA 4RTPA 1U3UA 2X4DA 1NYQA 4I2NA 4LZWA 4ACBA 2XKKA 1TM2A 1NE7A 3FUCA 1SOMA 4QM7A 3GLGB 1UP7A 3RS4A 3SJBA 3A6PC 2N1BA 3FDXA 1WBDA 4GVXA 3W2IA 1XKLA 2DX7A 2IYZA 1R16A 4U4AA 3A2NA 2RJ3A 1YB6A 3C3AA 3FFBA 2R1VB 1J7KA 2FR1A 3RFUA 1T4MA 2PZBA 3MUNA 3PC6A 3IKMB 2ZPTX 3DF7A 5A9SA 3HJFA 4CKEA 3GP3A 3OSZA 4JBNA 4XPZA 1EYZA 1FUUA 2BKUA 2VNAA 3TIIA 1MRZA 3CLSC 5BOSB 1O4WA 1A77A 2ID7A 2X6TA 1LK5A 1E2FA 2ZETA 4AY2A 3P97A 4CL0A 5TV2A 2CJPA 2Y4NA 3SIPA 1P5JA 4B31A 3MJCA 1P9NA 2HPAA 3U60B 3ASPA 4P9NA 4X00A 3OT1A 3PPWA 1A9XB 4MVJF 3I3OA 2UZAA 5HCUA 2NV0A 3R4VA 1JJ7A 3VR6H 3BA6A 4F4FA 3FMVA 3PICA 1HSZA 2X3UA 3KB8A 4HWOA 4BLQA 2ZRBA 4GNKA 2WIGA 2E87A 4NE7A 2VPZA 4AY4A 3EUWA 2A1TS 2ZKLA 1RWNA 1LV7A 2DOKA 2FUG1 3EXHA 4QBKA 4A2CA 4BGIA 3JYOA 3BUSA 1D1PA 1ULBA 4LY3A 1BWQA 4ETIA 2YXBA 1JE1A 4XLAA 2GJ4A 1Q6ZA 4YAWA 3PC7A 4FD2A 2ZJ2A 4W9NC 3I61A 5KOYA 2PUDA 4X44A 6Q21A 4RL6A 3LT4A 1C0IA 1DOZA 1DTEA 2QYTA 1V1RA 4RJIA 1NZJA 2YV1A 3H3XA 3K20A 3A27A 3NWJA 4BECA 3CLRD 4DIOA 3JRNA 2EG9A 4F6LA 1E6CA 2PZKA 1R18A 3AF1A 2TECE 3IVCA 4OATA 4H3HB 1JG6A 3IE0A 1XRLA 3E9RA 3LUJA 4YP0A 4ZOLF 1N4AA 5IC4A 4H17A 5CVCA 4XYGA 1ORRA 2P4EA 2V98A 2WU0A 3DWGA 4FQ8A 4YWJA 4B8YA 2R1ZA 1KYXA 4X8IA 2IZ0A 3OFKA 1QRSA 4TZTA 3MTGA 4L6CA 4OQ4A 1M1NA 1RRGA 3ZWBA 4WA7A 2GPNA 1XE1A 4GX0A 3VI4B 2FWBA 3VV3A 1UJMA 2GYYA 3OQ6A 4I55F 4BVAA 4CE6A 2H9YA 2IK8A 3GG9A 3TS1A 1Z6ZA 3AF6A 4HNSA 1N2ZA 4DLAA 3FTQA 2VUHB 4ZTZB 3G9ZA 2CVPA 5JXGA 3GLHA 2XLBA 3K9QO 4L1KA 3ZY4A 2AMYA 2M5SA 1HDYA 3FMGA 2HPHA 4NH4A 4RSRA 1G6OA 3WLTA 3JSXA 2IUFA 3JQFA 3FGPA 3VR6D 1E2PA 1Y37A 1WLSA 2HJVA 1CRZA 1WMDA 2GM9A 3IE2A 3QYJA 4GICA 5CYFA 3SU8A 2YYZA 3PZBA 5DASA 3FVWA 4UPVA 2Z0MA 3VTZA 5K8UA 4ASUD 5IDVA 5DWQA 2JD1A 3PI7A 3KE8A 2VPPA 1HTBA 5DLQC 1R10A 2IODA 4U9HS 1PD0A 3UJAA 3E53A 3WJ7A 3E1YE 1W85B 4FB4A 4TYQA 3IBTA 1ST2A 1V4VA 5CLGA 4BO0A 3PJDA 1UPBA 2BFEA 4TKUB 3S99A 3IOBA 3ZE1B 3GFPA 4NYJQ 5EXSA 4MUBA 4F93B 2O3JA 1IXZA 3E20A 1NNI1 3D6NB 2RHO