1QGYA

Ferredoxin:nadp+ reductase mutant with lys 75 replaced by glu (k75e)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEELRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of interactions for complex formation between Ferredoxin-NADP+ reductase and its protein partners
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
molecule keywords Ferredoxin--NADP+ reductase
total genus 90
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qgyA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qgyA02
2C78A 1FNMA 3W5VA 4B3XA 1EFUA 1KK3A 3P27A 3MMPA 1ZUNB 3CCUB 1QVFB 1ZM2A 3AVTA 1K73D 1KC8D 2PLFA 1AMOA 3ZZ0A 1QFJA 1HA3A 3SJZA 1QX4A 1SM4A 1JNYA 1JA1A 1VQ5B 1BX0A 1F20A 1F60A 3U6BA 3CB4A 1YIJB 5EMNA 1R5OA 1EP2B 3B8HA 4U9UA 3VNVA 1YITB 3QFCA 5DSZA 4RD1A 1YJWB 3CD6B 1EXMA 1VQ6B 1IB0A 4M53A 1JB9A 4ZGNB 3ZZTA 4QHYA 4G1BA 2BPOA 4H9GA 1YJNB 3I56B 1CNFA 2XNCA 1GAQA 1W87A 4YAWA 1JA0A 1ZM9A 1WDTA 1ZM4A 4LBZA 1YHQB 1H85A 2HCJB 1I7PA 2HMAA 1OB2A 1DDIA 4M2LA 2GQFA 1VQLB 3CCMB 2QDXA 1D2EA 1GAWA 2BSAA 1OB5A 2HDNB 1E64A 1QUEA 2VZLA 1QGZA 2OK8A 1JJ2B 3JQQA 3OZUA 4EH1A 1FRNA 3WYAA 1B2RA 4AF6A 1FNCA 1VQOB 1W34A 5H5JA 2OK7A 2CNDA 1VQKB 2QEXB 3ZC3A 4FN5A 1W35A 1NJID 3AVUA 3W2EA 2YWGA 2ZITA 3CCQB 4B44A 5TV2A 1TLLA 2B7BA 3E1YE 3A1FA 1ELOA 4G5GA 4RD3A 5TY0A 3G71B 4N3NA 2DERA 3LO8A 4B47A 3QFSA 1VQNB 4LBVA 3CCLB 5GV7A 1DDGA 1E62A 4NBSA 3CC4B 1G7TA 2VNKA 1CQXA 3CCRB 5GV8A 3LYUA 3CRZA 1Q86D 3QFRA 1VQMB 4PGOA 1U2RA 1EP1B 1KD1D 4YAFA 1XB2A 1ZM3A 4ZCIA 4Y7CA 1GO2A 1R5NA 4RD6A 1VQ4B 3G6EB 3VMFA 1GR1A 1FRQA 3JQPA 4Y9UA 1J9ZA 4IW3B 3WBKA 4YHBA 2BM0A 3CMEB 3OW2B 2VNHA 3AVXA 4P6VF 1QGAA 2X3UA 5HXBA 3ZZUA 4ZCMA 3CCVB 2OTJB 3JQRA 4AF7A 1G7CA 4ZV4A 4M1KA 1Q82D 1K9MD 3VO2A 1DARA 3W2FA 1FNBA 2PIAA 3WY9A 1D1NA 4LC0A 4RCZA 3OZWA 2YWFA 4MYTA 2BGJA 5KSWB 3CW2A 4TMVA 1H42A 4TMZA 4DQLA 1GVHA 2VNIA 2E1RA 3VO1A 2XNJA 2QA4B 4BPRA 3AGQA 4HE5A 4B4DA 1B23P 2QTLA 3WBJA 3PENA 2DEUA 3VNUA 3AVYA 3P26A 3WXMA 1EP3B 2RC5A 5TR9A 3WNCA 3CCSB 4M0LA 2BN4A 4J0QA 1VQ8B 3MCAA 4B48A 3AGPA 3FPKA 4PC7A 2GPJA 3B82A 1S72B 3CC2B 2AHOA 3AVWA 3I1FA 2BGIA 4PC6A 5H59A 4RJLA 1N8RD 3U2QA 5FA6A 1Q81D 1GJRA 2EIXA 4C0SA 2VNJA 2NPFA 2BVNA 5AN9A 1TTTA 1QFZA 1UMKA 3E20A 1BX1A 2QTZA 2D74A 1SKQA 4B43A 2BMWA 4QFMA 2BV3A 1FDRA 3W5HA 1QH0A 4TMXA 2PMDA 2YWEA 3QSYA 3ZBUA 3I55B 3CCEB 4LBYA 1N0VC 4Q7JB 1IJEA 4ZGQB 1W2BB 4FWTA 3LVBA 2R6HA 3CXCB 1KJZA 1KK0A 4MYUA 4ZCLA 4P3YA 2B7CA 2RC6A 1OGJA 4FK8A 4M4SA 1EFTA 2OTLB 4UAJA 1A8PA 1QUFA 2CRVA 1QFYA 3CC7B 2XEXA 3LRXA 1EFCA 5THXA 3WNDA 4PC1A 4TMWA 2BF4A 4G1VA 3QE2A 2VYQA 2BM1A 2DY1A 4PC2A 4TMTA 4Y9RA 1KRHA 4NCNA 3ES9A 4YAUA 2DETA 4N3GA 1IJFA 2YWHA 2QN6A 1QG0A 4HE6A 4TN1A 3W2IA 3OZVA 4LBWA 1KK2A 1G7RA 1QVGB 1M90D 4YALA 3OJWA 1Q7YD 3MHPA 1TUIA 3ZBTA 3CMAB 1BQEA 4RD4A 3CCJB 1YI2B 1QGYA 1KK1A 3AVVA 3QFTA 4F7DA 2FX3A 3W2HA 4PC3A 1VQ9B 1TVCA 4AC9A 1FNDA 1E63A 1CNEA 3W2GA 2DCUA 4ACBA 1KQSB 2QMUA 4ACAA 1D8TA 1OGIA 1EWYA 5JBQA 1DG1G 1YJ9B 4DQKA 1M1KD 3B78A 3FJOA 3CPWB 2B5OA 1G7SA 1AIPA 1N0UA 4YAOA 3W5UA 3G4SB 4RD2A 1NDHA 1BJKA 4RD0A 2EFGA 3WNBA 4K1XA 1VQ7B 3U6KA 1K8AD 3J81k 1S0UA 1KTVA 2J7KA 4RCYA 3V76A 3OJXA 1R5BA 4C43A 1VQPB 2C77A 1XE1A 4R71A 4WQMA
chains in the Genus database with same CATH superfamily
3CZ5A 4S2EA 4MGHA 3DFZA 1YZFA 2HQRA 2VDVE 1V16B 4Q02A 2G9ZA 2YASA 3TJRA 2QGFA 4HDOB 5EIEA 4PONA 3C97A 4MH0R 5EWMB 3WMXA 5M5BA 1MT3A 3CCUB 1OI2A 1GFIA 2CLDX 1TYDE 4JAVC 3RROA 2QNIA 3LUJA 1LZLA 2PX8A 2G80A 4BJ3A 2BTQB 3ELWA 3NCTA 3TLXA 4X7DA 1PJ5A 3NDIA 2AS0A 1VZ3A 2FN9A 5AKZA 1IDOA 4KBYA 1O95C 2F59A 3WQZA 5TPWA 2YZNA 1IUNA 1Z5UA 3K7EA 3KKNA 4RIIA 2ID8A 3U3KA 4WZ6A 4WW0A 1ENPA 1NGSA 5HIKA 1QQAA 2E55A 2FFJA 2C1XA 4FYVA 2SBTA 4R68A 3EH1A 4U3JB 3AT1A 5EC8A 2Y1DA 3JTEA 2JF0A 3CB4A 1JTVA 4BZZA 4OOFA 2BR3A 4J75A 3UOWA 2FP4B 1JKXA 2QL5A 3DZBA 2LD4A 5AM2A 1EAYA 3B8HA 3H5IA 2HMSA 4QOFA 4RSMA 5EXPA 4U9UA 3D0KA 4QDKA 3P0IA 4C0XA 1I18A 1M6NA 2VQ6A 1SRQA 2TMYA 2ZBRA 3I8SA 1IBKB 2QZ9A 5JTTA 4AP5A 3H1BA 4NNPA 2CKDA 3HFGA 3TCXB 2NTEA 2R48A 4K9QA 3OQIB 1C0IA 4PHTA 3WHLA 3GELA 2HYDA 3VGJA 3OFVA 3FKJA 1YU9A 2VRCD 2AMLA 1GEEA 3D3WA 3NHAA 4OLBA 2ZT6A 3LDFA 3TL2A 3OECA 3SKXA 1FU8A 3T7IA 3TE6A 2QLJA 1XJ0A 4PANA 4MCIA 1P4AA 2P9GA 5K0GA 2FB9A 1SVIA 1R37A 1S8NA 2OQRA 4Z7JA 2VBIA 1PN3A 2AOTB 1H94A 3TIXB 1J2TA 3ZV5A 1WD5A 2Y9PB 3QU9A 2X23A 4RH1A 3T61A 4AKEA 4JLBA 5KCMA 5FO0A 2O5EA 2ILVA 3KL9A 1WXHA 3HEAA 1T5TA 3IFSA 2YQZA 4ND8B 1O57A 3WO1A 4F2GA 3O31A 4B40A 1RXUA 1H1LA 4AS1A 4FDUA 1DNPA 1Y80A 1QFXA 2CVPA 2QLBA 4PYKA 1VPWA 3ND7A 4WDQA 2E89A 1DDIA 2BR4A 5EA2A 4WXHA 3GDOA 3R8XA 2GQFA 1SBZA 1VMEA 4EK9A 3ZW7A 1VQLB 5CA0B 2G5TA 1ZO8A 3C5EA 1H5QA 3N2EA 4IFIA 3NJRA 4H1UA 3NWBA 1DXHA 3C3WA 3VDQA 5KQSA 2YWRA 3GCGA 5I3CA 5AM3A 1I7LA 4UZUA 5I9SA 2GBPA 5BWBA 4Q0MA 1T1SA 4LK2A 4LHZA 1N08A 3JSAA 3T7SA 1RNLA 3A4TA 2L2QA 1NRJB 2FZLA 1UKEA 2LIPA 3JD1A 2YFYA 3K53A 3NYIA 1S3FA 5ED0A 3ST7A 4TYPA 2F1LA 4I14A 3H2IA 3H5TA 1G8FA 4AMUA 1H2XA 1NX6A 2FJPA 4RK6A 3IALA 2BKAA 4XJTA 4RPBA 2OA0A 3VR5D 4IXWA 1A69A 4TKMA 4CM6A 2X0IA 4DMRA 4YFVA 3BXPA 2CFSA 5DT2A 2SCUB 5EZYF 3DH0A 3JQQA 1U0NA 1LFAA 1P1JA 2W2TA 1O5TA 2QI9C 2PT5A 1W29A 1YQQA 5LZ7A 4BP8A 2ZZMA 2HLHA 3RABA 2C82A 1L5HA 3DTTA 3UGTA 1ZUIA 3CH5A 5T5QA 2X2PA 4X71A 1KO5A 2EZTA 2G8LA 2Y0PA 3K1TA 3EPRA 2IK8A 3K6RA 3LBFA 4CUKA 4F3TA 4PGFA 1QB8A 1U04A 4G56A 3BGOS 3FRIA 3PYMA 4AWBA 2OORA 4DPKA 2AG0A 3H04A 5K6AC 1OXTA 5IJXA 4EOGA 4IIFA 2P2GA 2PSJA 2VTKA 2DFTA 2YMLA 3AWIA 2WU0A 3NWOA 1KTIA 1V11B 2ZRJA 3AUTA 3SLNA 2OCBA 2ZIEA 3D6HA 4KCGA 4AJ4A 3RR2A 1JDPA 2YBEA 3CM0A 3DZIA 5DNYB 3LT5A 5T57A 4YJFB 3W7BA 4Q82A 2O1WA 2RCNA 3A58B 5K3FA 4EDHA 1L4BA 3U1TA 1GG5A 1KEPA 3OIFA 2G4VA 3EXHB 1JSRA 3TN7A 2CF5A 4Q9IA 5KHOC 2HLNA 2B35A 4K28A 3H6KA 3DT9A 5DIFA 4BDTA 2V7VA 2P41A 4F1WA 1H8ED 2IEGA 3P9YA 4I9FA 3SQMA 3T5TA 4D9FA 5EWJB 1MHTA 4YUVA 2EEZA 2MIIA 3CSDA 1UDCA 1W25A 4L0DA 1OBOA 4GLJA 4IPTA 1NY6A 1NATA 1UMCA 2VP6A 2QYHA 4XPIA 2Z6AA 1MAHA 4BN4A 4LFBB 2W6IA 1P1KA 4OHKA 4JI4B 1HLFA 2QNRA 1BHQ1 4P8RA 4P0QB 3REGA 3DEIA 1HE3A 1X7YA 3DZFA 5IUKC 5GV7A 1WKBA 1EWKA 1WOSA 2R6ZA 3A6EA 1KSHA 4TKVA 5FWXB 5M04A 4O4IB 1GEGA 1HSZA 1Z12A 3OHPA 2Q5FA 2ZS7A 3EAGA 5K03A 1I30A 1MJHA 1UBNA 5IK2A 4YBRA 5CAEB 1XYGA 1PJRA 4Z4IA 5K3SA 2A92A 4FMPA 4NPHA 2GEKA 4LJ5A 4YAFA 1QHHA 2DBRA 4M9QA 5LZ9A 2QL7A 1WORA 1M1YA 2BBTA 3M8KA 3D7KA 1PI3A 3W3AA 5KZMB 3RC8A 2HRZA 1E3XA 2A94A 4MGYR 1K88A 1ISJA 4ZCRA 2ZWAA 4JA2A 3SX4A 4O4LB 3D6UA 3DE4X 3J80A 4Z0NA 4F91B 4JJ7A 5IC5A 3S4YA 1Z5NA 4NONA 2QX9A 2BISA 2WNHA 3QJ5A 3OLQA 4QNNA 2EVWX 4Q3CA 3BE4A 1JDVA 1NTRA 1H6CA 4O8CA 1WMBA 2BMDA 3S5UA 2DQSA 2EGHA 1NJ8A 2Z2IA 1N3IA 3DB1A 1P5FA 2ZVDA 4Z54A 3CZMA 1XLVA 2WOOA 3H3XA 4ZVRA 4MS3A 3G5TA 4YELA 4Q16A 2X5OA 3ZKAA 2Y0EA 3ZIDA 2AKYA 3KJIA 5I6DA 2IYSA 1AOXA 4GHWA 4YCSA 3CONA 3LY5A 4XD7D 5B7NA 2RGNA 3D3WB 1YDHA 4YV7A 3RYCB 4DSZA 3TGPA 3MFYA 4I99A 1DBSA 3E8MA 3TSWA 3ZKWB 2RE8A 3DW3X 4Q7EA 4UNIA 3JZDA 4MUXA 1YGPA 3T1OA 3RM3A 2FLKA 1M6VB 4AF7A 1XLTC 5H81A 2Q1XA 1ZAYA 4E5NA 2PCJA 1UWVA 4YAEA 3DE7X 3PUIA 5CFLA 1GGKA 3KB1A 1MC4A 3VR5H 2WPDA 4Q05A 2PIAA 1P7WA 1YZ3A 4LC0A 4F93B 1E1DA 1GU7A 1PR6A 3EFEA 4I1OA 2XYGA 1L5MA 5KSWB 2GHQA 3NBZC 4OQYA 1DWPA 3M1IA 3JVEA 1H42A 1CS0B 4TMZA 1JJFA 2GBLA 3JZIA 3PPYA 5KNBH 2FA9A 1IOZA 1NQ5A 2RG1A 2W4QA 3UMRA 4ENTA 4JBGA 3DZKA 3DZJA 4W82A 1GFSA 1QZUA 3SQOA 3TLCA 3QLEA 2HWUA 1E2DA 5CVCA 3AL0C 2VCHA 1USGA 4U6QA 2FY8A 4C7JA 2Y0BA 1TE2A 4UVHA 2W2VA 4E0BA 3GP3A 2OUIA 2KLHA 3FWPA 1ISMA 4H1TA 1ONPA 2FW8A 5FDFA 1OXSC 3WL5A 3PU6A 4MB2A 5CXSA 2PWYA 3RSOA 2QTLA 1JHMA 1DKQA 2BEKA 3NALA 2Q46A 4PTZA 4TKLA 1RHMA 2CLOB 3I9LA 3MCTA 3ZDEA 3E9EA 3GN2A 2VXCA 4FC6A 5I4KA 3R0JA 3ZCVA 2VJCA 3L6RA 1T8UA 1GPKA 2MMGA 3LT0A 3PUNA 3AJEA 3FPGA 5LQAA 5EHIA 3WFZA 3EJ6A 1DEKA 1J8FA 1GTVA 2DYKA 2QTBA 4EGFA 2B0CA 1Y5IA 4JC0A 4E1BA 3V2HA 2B9EA 3JQCA 2P9JA 5HGJA 3CPSA 5F7XA 1TMKA 4I3FA 2ZZFA 3GLGB 2IXBA 4GBMA 5KC9A 1T2CA 1OWMA 1ZRHA 1W9MA 5KSZA 1QHGA 1C8VB 4HQ0A 1PTJC 2W0SA 5EJ9A 2DAPA 3MTQA 3RPEA 4RVCA 3HGQA 4XGNA 5DBFA 3KWMA 3PT9A 1C9KA 2RGDA 4KJZA 4RPJA 1FMTA 1QORA 3BBLA 1HY3A 2IY9A 1PGNA 1XCPA 3OOCA 2VP2A 3HL4A 5EWLB 3AUFA 1KZGB 5A2QA 1O9BA 2YR0A 1O58A 3OZ7A 5GONF 3WRVA 4BNMA 1MO3A 1WX1A 2RD2A 4KU4A 1RJWA 1YE5A 1S2IA 2VCEA 4IVPA 4I6GA 1WP4A 4P6YA 1GZ7A 1M10A 4KK4A 3WE7A 2VNJA 3EISA 5F2NA 4A2PA 4JVSB 5IJ0A 1W4ZA 4BV8A 1T9GR 2OD9A 3B3JA 4XGKA 4Z9YA 5TF0A 4EEZA 1BJTA 1EFVA 4LPSA 3DVAA 4ZQBA 2I67A 4CVNA 2QT0A 5IHPA 5WRFA 3R3SA 2Q7XA 4NULA 1YIOA 2Z56A 3CHYA 3RIYA 4U4AA 4G37A 3VV3A 2E48A 2PBLA 3V4FA 4FMDB 4B7CA 2YWEA 4BBPA 3QSYA 1Z3CA 3E9RA 3K8OE 3LQ2A 3LFUA 3UKJA 1TCAA 2D4HA 3CCEB 4M0KA 5K0CA 2H1OA 3QU2A 1KVTA 4JT8A 3X1MA 4CEJB 2EQBA 3CRQA 5JZVA 5HIMA 3L8HA 3AEKA 3CTMA 4Y2QA 3I2JA 1NW8A 4MI3A 3P97A 5TGDA 3E0XA 3MYRA 4QDXA 3V2UA 5BYJA 2EWMA 2WWXA 2ZBDA 2H7VA 3OJOA 1EG2A 2BFCA 2GJ4A 3OZXA 4MUJA 2HY7A 3STVA 4KPFC 5CVTA 2VAPA 2B4RO 3UT6A 4NENB 3KXDA 1PJLA 2GO1A 1T25A 4G0QA 3KIPA 5KQMA 3ICPA 1H3EA 3MRVA 4YMIA 4CM9D 3KC2A 3PFIA 4UFPA 1FYWA 4FXOA 4O3MA 3BTOA 1Y1RA 4DSAA 1MZPA 4EMBA 2I22A 4P92A 1EVQA 3REQA 3ASPA 5AVYA 3FDXA 1CQIA 1VJ0A 4EX6A 3FTPA 5IYZB 4TV8F 2NV6A 4D96A 2F7SA 4J4HA 5HOQA 1F9EA 5CT4A 3UAYA 3GZJA 3FOFC 1C3OB 1Y1TA 5HE8A 4O63O 5AKJA 3GLIE 1PKEA 2I03A 1E7MA 2MYPA 1DRUA 1MQ9A 3JR7A 4HVLA 5BXYA 2HA5A 2AFIB 4Q39A 2IUUA 3TBKA 2J3QA 3INYA 5D8DA 3IUEA 1RBMA 4URUR 3BRWA 3C6BA 1WG8A 3ZDCA 4LDAA 1G4AE 2BDEA 2FZEA 2DUMA 1U7UA 1UJBA 3PR3A 1YCFA 3THXA 2R6AA 1ISSA 2VWPA 2ZUFA 2R5WA 3O8QA 5K0ZA 1N33B 3UICA 2R0QC 4IWYA 4W9RA 3LPMA 4N6OA 2V9PA 1NBOA 3G82C 1BRMA 3N3BC 3VYSB 2UUAB 1G63A 2BOVA 4DRXB 1FDTA 1RAAA 3L0SA 1G9TA 2X0JA 3F98A 4P4GA 3HKDB 5IKOA 3ZDZB 3EAFA 5EQFA 4KLNA 2H51A 1ADBA 1SBCA 2XWBF 3KLBA 2PGXA 2XYQA 5FO1A 3KR2A 3WLAA 4HWOA 5E9QA 5TXGA 1HE2A 4MLZA 4YALA 1NVVQ 2QX7A 3MFQA 4HT3B 1ZIYA 5CH8A 3NNSA 3U44B 3SHVA 4BKMA 2IITA 2CHVA 5L9AA 5KNBA 3RFCA 5EOVA 1B6TA 4DTIA 1CDZA 2O3TA 1KNQA 2DP4E 2J07A 1PJ4A 3FVVA 2GETA 1XVVA 4QECA 3BIOA 1EGVB 1E96A 4QUBA 5EE1A 2C94A 4BJ6A 3FETA 2O6LA 3OU6A 5F1YA 2FEOA 1BE0A 3MSCA 4YDQA 1WMDA 2CW5A 4LSGA 1MAAA 3Q3AA 5IAEA 3L92A 4ARBA 2JGDA 5AVWA 4OHOA 1Z5WA 1QHNA 2JK0A 3OM8A 3PXDA 1E63A 4ZT4A 3W2GA 4DSNA 3D5QA 3PFFA 3W5BA 2VZEA 3GH3A 2V65A 3G2MA 1ZJWA 3M4XA 1BA3A 3FOEC 2DTDA 1Y8CA 2O2IA 3BA1A 2LVBA 5HMMA 2BMAA 1XZCA 3CBQA 2WKWA 4G81A 3KU4A 3OU7A 2Z5VA 4MQ4A 2PV7A 2RKWA 5JAIA 4CIDA 3BJRA 3LXRA 1DCKA 3PRHA 4C08A 5GADl 3BVPA 3GA0A 2ZIZA 2Z57A 5JPDA 2N0SA 4QX6A 3UV6A 1TO2E 2ZS9A 1Q0QA 4AG6A 2HRBA 1YF3A 3Q2IA 2QR5A 1P2FA 3WRWA 3EB9A 5EIWA 3S2EA 1I32A 5E8RA 1N2CB 3BWXA 4MROA 4Q48A 3RKSA 4WLEA 4G0NA 1MDFA 5I7AA 2NO6A 1GPBA 4L57A 4C4ZA 3F7TA 4Q3KA 5CU7A 4A27A 1TADA 3DQPA 4QG7A 1I4EB 2OHFA 4Q6WA 4LX8A 5C0OE 4EO4A 1QQBA 5G1NA 1GD1O 5DASA 1KFCB 1UZAA 4FYJA 5JH7B 3C4QA 4HCJA 3WLFA 3K9BA 1V7PC 2KMLA 2KI5A 3FI9A 3EEBA 1PO7A 4KI0A 1J8VA 3C45A 4BRUA 1FTNA 4O59O 3WJ2A 1Z8NA 4WESA 5L7YA 5EE9A 5C8YA 1MGPA 4ED9A 2XOKA 4C14A 4C43A 2IUSA 5I51A 3UW3A 1C9EA 3AJDA 3QEOA 2BKVA 2ZB8A 4DJTA 3A9CA 2EF1A 1Z74A 2AT1A 1R0XA 5IJ0B 3PXUA 3O4GA 3UJ3X 4AD8A 1NFQA 4U7WA 1DL5A 1UC8A 2AEMA 2AH5A 1TNDA 4M9SA 4RTMA 1FQOA 2Z2XA 4XAQA 1YE3A 4JJ8A 4EKEA 4EIWA 1ZUNB 3SMQA 3NH6A 4MVJA 3HP1A 2HREA 3N59A 4JDUA 1TYCA 6ABPA 3E48A 4EBBA 1HM5A 4URYR 4TTIA 2V97A 5A1TA 1NVVR 5I9LA 2FFBA 2OBYA 1T4CB 1KVRA 1HA3A 2D0PB 5CK5A 1SM4A 13PKA 1EGMB 1J0DA 2HJHA 2XPCA 2NU7B 2IF2A 2YZ7A 4PLFA 4Q1CA 4OQXA 5EGSA 4W5NA 2WM3A 4NATA 3F5SA 4X91A 2UVQA 2FN7A 1DBRA 1V16A 5GZ6A 1BZYA 2H06A 1A4IA 4KQEA 1Y63A 4V0MA 3I5UA 4U0JA 3QVLA 3LDUA 3TW6A 4NJEA 1OQAA 1EXDA 1U81A 4X7FA 1Q3TA 3ADDA 4FBLA 1SC1A 3N8HA 3OPVA 2BWJA 1CJKC 2R6FA 1ZR4A 1W36D 3KKQA 4O1HA 4LF5B 2HT6A 1SUEA 4LSWA 3VDXA 5F3WB 1VP9A 4KIWA 2FZWA 4FLEA 4O0LA 4W1RA 1ZD5A 4HEQA 5E7MA 3MIZA 4J1SA 1IUPA 4UAUA 1SBTA 2ZJ3A 5CTAA 1FP4A 2NSLA 5AJTA 4CRWB 3DLHA 2ATXA 4JYMA 3IVCA 4Y1GA 3NQ41 5K4GA 1RRKA 4E22A 2CJFA 3TKAA 4EW3A 2VUTA 4GQAA 3ZI4A 2F43A 1HF3A 5HZMA 1YI0A 2A9KA 4E2WA 3KCNA 5HFJA 4XCQA 4MYSA 2FSIA 1LSJA 2Z43A 2HJ9A 5SZIA 3QIVA 4UBIA 3GPDG 1SCIA 1GG8A 3E61A 4C1BA 3PA2A 2XAAA 4FMCB 1WPQA 2BPOA 2BEJA 5EJEA 3CUWA 2QD2A 1AD2A 1A72A 1TAQA 3F6SA 5LD2B 2EHDA 3EGOA 2J0EA 5DOZA 3PHHA 3KB2A 3SYTA 4BS9A 3V42A 4DLLA 2XTAA 1KC3A 1YR8A 2G04A 2GN1A 3IILA 4P4SB 3ZNQA 2PTHA 2DWOA 4N9WA 4QVAA 4QXMA 4UMDA 4WCVA 4UTPA 3KCQA 2OCLA 3TMYA 3A05A 4CPDA 1DX9A 5HKBA 2FK8A 4XR6A 2EBUA 1Q17A 3C3PA 3ETCA 3OY2A 2PZAA 4J0EA 4KQJA 4P98A 4CT5A 4LMRA 3KYDA 3SM3A 1MGOA 2OCGA 5DGCA 5DGDA 5ER6A 1A8HA 4LECA 5BOSB 3OSZA 4JLWA 5J4KA 2XGOA 3R5KA 1O5IA 1YVPA 5DP1A 2YUIA 1I3OA 3IMCA 3M33A 2GPNA 3HKDA 4X45A 4AKHA 3I05A 3WGHA 2OZLA 1XQVA 2Q1YA 1HRKA 1M5TA 4NDNE 1ZU5A 4YCDA 2WJZB 2G0NA 1N6HA 5FP0A 4JQZA 3MBOA 3SN6A 3WMWA 1SUIA 3IP3A 3LHIA 3PQ6A 4JBHA 3A3YA 5LYJF 3T1VA 3ACBA 2C2YA 3E1SA 3MVEA 2G71A 3C1UA 4MKRA 4WRRA 1Q0TA 4K7JA 1AZWA 4KNYA 1PJ7A 3A3OA 1KAGA 2D7DA 4JS0A 1AGNA 4J29A 3OPOA 1X39A 1YDGA 3HB7A 1XL0A 5DCYA 3RUDA 4Z1MD 3QTBA 1XZBA 1OH5A 1Z6YA 4CEHB 1NMQA 3I58A 5BW4A 4RWEA 1T24A 1UKVY 5AP9A 3OMLA 3TBHA 1FJXA 1HZZA 1B0PA 2NSDA 1U7TA 2GYVA 3NBAA 5GJWC 1FIUA 3GHHA 1K66A 2H5JA 5FQOA 4UM9B 2CNDA 4PZ9A 1M8GA 4LNAA 4C6HA 2X6TA 3A4MA 4HQFA 2I6GA 1XKLA 2DB3A 3CNHA 4PSKA 5D85A 4WVLA 2CUKA 1VI2A 2QROA 2GN2A 1PL6A 3BFVA 3QVUA 4UVGA 5DISB 3KVVA 3ZCUA 2FEPA 3K32A 5CNMA 4B80A 1V5VA 5BWCA 2W2LA 4WZBA 5LLSA 2YWGA 1PYGA 2WF8A 4K9SA 5LP6F 1ZS9A 4RQBA 2I66A 3ZU6A 4BO5A 3HKBB 1NUHA 1G5RA 2AOUB 1D2AA 2HO5A 1N57A 2Q0QA 1R8JA 3B3FA 3K9HA 4I66A 1R88A 3OU2A 4J91A 4P5DA 4RV5A 2PRZA 4XUCA 3EIFA 4B6JA 3CE6A 3GL9A 3P4UA 4Q3EA 1Z8DA 1JIQA 5PNTA 3FLMA 3SQLA 4C5CA 1Q91A 3CJQA 5IYRA 4QYTA 4PO3X 4ZEMA 3QV2A 2X2OA 4BNDB 2WWGA 2C7RA 4HVTA 4MA0A 3VPSA 5JCJD 2ETVA 2ACEA 2MSCB 2OB1A 1IEXA 3ETNA 4JLPA 5D3KA 2QTHA 3SZOA 3TB4A 4BQEA 3IHWA 3HB5X 1O03A 3ESZA 1B0ZA 4A0HA 1BU8A 1LQUA 1SKAA 4OQZA 3DL2A 4YASA 3TPZA 3QFSA 3GK3A 3LXUX 3A6DA 1SN7A 3HDVA 3CCLB 2JKZA 5DK4A 5A5VA 1FP1D 2N3ZA 2IDKA 1EJ0A 2OVBA 1N2ZA 3MCZA 5EFOA 3OFNA 4C7OA 3PNLA 1JPVA 1JFFB 1Q57A 2F17A 2DIEA 2V8BA 3KYJB 1KO1A 3M6UA 1M6VA 3BT7A 1ISIA 2P9HA 2VP9A 4R05A 3ZHUA 4DM4A 4RY0A 1STOA 2R8BA 1U0FA 2AI3A 1TU4A 1V48A 4JZYA 4TQ9A 4HY3A 3WQRA 1SHLA 2A0FA 5HK9A 2BMJA 2V7PA 5F2OA 3GLIA 5DX1A 5GJVC 4LDQA 3S68A 3GFSA 5FA8A 2OUKA 3CUTA 1IPFA 5A7FA 1CF2O 1QPGA 4D8VA 1U1FA 2CSUA 2F64A 5I8ZA 3ZU4A 3L8MA 3DMYA 4BWGA 1ZJYA 1CB0A 4Z4SA 1JLMA 4HEJA 4KGXA 4PSDA 1CZNA 4YJKA 2GHRA 1CRZA 4AJNA 1G1MA 1SOVA 1TU3A 3VYUB 2H59A 2CHQA 4J4TA 5JO0A 1K7XB 1GR1A 1W46A 5CEEA 4XM3A 3JQPA 4Y9UA 3A10A 5HE9A 4U2CA 2VR1A 3F7NA 4Q5IA 2EKQA 1B26A 3IT1A 2PFGA 4NFLA 1WVGA 3KZXA 4CM3A 4Q3OA 4FCWA 5BUZA 1ONNA 5IFKA 2G0AA 4Q4HA 5DYYA 4TL7A 1KAEA 1B4DA 1FFWA 2JRCA 3GGSA 1XFDA 4Z3KA 3V80A 5J4HA 4AN4A 1LDMA 3HCDA 5HZBA 3LLMA 4S1NA 4YRFA 4IH4A 3KQUA 1O94A 1M75A 3FVWA 1WF3A 3Q3GE 4I4TA 4ESHA 3SY8A 2XX3A 3BJMA 1PR9A 4QYIA 1PJBA 2PZMA 1F0YA 3G85A 3LQ1A 5H02A 3ZWCA 2HSJA 5JD3A 1UKZA 1LKZA 1E32A 1V45E 1XDZA 3WB1A 2C7GA 4R1MA 3ASQA 2V6BA 4P4SA 2CHFA 2UZ1B 2WHXA 4TLBA 4NTZA 3PQ2A 2JFXA 4KN8A 2EZ4A 3DW1X 4PE5B 2H1IA 4J2TA 1Z36A 4AG5A 2QRPA 2GDJA 2B4AA 4JJ4A 3EWAA 2FHPA 2KYRA 2P6MA 4TXJA 3AF2A 5F21A 5IZCC 5JS7A 4JR1A 2X0EA 1SUCA 1BC5A 1ZWKA 3PLNA 4NMMA 4IKOA 2LCFA 5CDTA 1E99A 4O0MA 3E3LA 2PAAA 2YMPA 4LYAA 2B34A 2HQ1A 5LMZA 1SCUB 4I5FA 3RQSA 2ATVA 1G0NA 5JZMA 1ZBDA 3V4RA 1YS1X 3X2FA 4B4DA 1XMIA 1FFDA 2HRQA 5G3ZA 4GLBA 3OPYA 1VCNA 3IP8A 1ZOOA 1NW4A 2J4DA 4M88A 3BSSA 3GLUA 4UM9D 5D51S 3ESRA 1R0SA 1LPSA 2VJYA 4R7TA 1QGUA 1T91A 2RHTA 5JFGA 4ZOLA 2JZCA 3PXGA 2RC5A 2ID9A 2B4YA 5TR9A 1RJ9B 2FSVA 1TMYA 3DAHA 2I29A 2OL4A 3KYIB 5B58C 4QEDA 1WMSA 1LD3A 3AHCA 4DIEA 4NMXB 3GNLA 1KJWA 3HY4A 4BX8A 2O0KA 4P4NA 3E7PA 3AEUB 2FK7A 1QCCA 4IINA 1JXOA 1Y5NA 2FNAA 3MUNA 4LE0A 1U6KA 3SIPA 3LOPA 4TLAA 3NATA 4AZWA 3L77A 1F0PA 2BHRA 4DBLE 2Q9BA 3DPSA 2AJ8A 4OI2A 5JISA 4A23A 4AMGA 1XTRA 3AH8A 3RWBA 1U8XX 2EBWA 4IM7A 3SHTA 1LUAA 4NBTA 1PWZA 3LW7A 1M7BA 4R54A 4AQ7A 2I6TA 4QQRA 2QORA 2VYVD 2RGRA 3EVFA 1QWOA 4UUMA 2I34A 1ZDMA 3LP5A 5F2EA 1NKTA 1U0EA 3HKBA 3JYOA 1E2LA 4EFDA 2CMKA 2GJ9A 5JXWA 1KY2A 4MVJH 1PJTA 5FR1A 1KH1A 2Y4OA 4E5VA 4W1PA 2ZE7A 4QHTA 3E9CA 3EC1A 1JIIA 3PZRA 4K9PA 4GM1A 4XGRA 2QTZA 1JKIA 2D1FA 4DMKA 3VX3A 2H11A 4K40A 3TQSA 4OLAA 5DBEX 5BYAA 2PMBA 5CLIA 4R3UC 4QTXA 1VHJA 1SIBE 2ZE6A 3F8WA 1CHNA 4PAAA 4JC8A 4QPPA 3ZY6A 1X7ZA 3DQQA 3KPYA 4X7EA 1QH0A 1JG2A 2R62A 3WKBA 4DT1B 3NIBA 3NU1A 5CB4A 1F48A 1C5KA 3OIVA 1XTSA 4X00A 3ZBUA 1M0EA 1SUBA 4UXJA 3UXYA 3D7MA 3BH7A 3GPBA 4LMBA 1RT9A 2FFAA 3PK0A 4LMAA 4QSHA 2RFLA 2WVHA 4DDMA 5IJ9B 4YV1A 5LFAA 3UK7A 4FGZA 4DILA 4LX0A 4H6XA 1XKTA 2GX6A 4PG6A 1B41A 2IHJA 3OQOA 3W6PA 3I61A 1RZUA 2WVAA 3K0EA 3OQPA 3GCZA 3MZ0A 5EE5B 4OHWA 1HNXB 3O9MA 4PG4A 4YRKA 1N5JA 1ZXLA 2X22A 3A28A 3AQIA 4PVDA 1DFIA 4TZKA 3NIDB 1AC5A 1ML3A 2YV4A 3IPAA 3THRA 4YCMA 4PZUA 5TJ9A 4UW9A 4Z86A 5CP8A 2RC6A 5DLEA 1HO3A 2YZGA 5BT8A 1EM6A 1RYHA 5CBPA 4MQUA 5EESA 1L5LA 2DWUA 1U6JA 2NU6A 4KZPA 3R7FA 1K7YA 4L9AA 2LCIA 1J2RA 4IIJB 2UV8A 1ZK2A 5LQDA 2C00A 2H18A 3AERA 3EUWA 4DUGA 2HRCA 1NZDA 3RS3A 1USKA 2AGVA 2XT9A 4Q18A 2XEXA 3W78A 2XUZA 4O4IA 2W6PA 3VYTB 4AZ3B 4EY8A 2ZEJA 3FYUC 3IVXA 4K3UA 5CM9C 3KLMX 5CB8A 1E3LA 4NBWA 4M1OA 5HQJA 1PZGA 1Z4KA 2VHUA 3NDPA 3RARA 4A82A 4DXHA 2HLDD 2W7TA 2RARA 1TM7E 3IO3A 1V3QE 2OSBA 1JLKA 4HEA6 4B35A 4C6TA 3QYFA 3G68A 1M1YB 3FOCA 3HCPA 4YS6A 5L40A 1KJ9A 3BICA 1LBEA 1YONA 4GICA 3HZZA 2P35A 2YWHA 5J2TB 2WAOA 2QN6A 3EJWA 3ENNA 5TRTA 1CJTC 2WAXA 2QSZA 4L08A 3CVJA 1C1YA 5JD6A 2XMBA 4YGXB 2VK1A 4OI4A 4GOLD 2BFPA 3NNDA 4P38A 3UPDA 3ZWOA 2O5RA 2VPQA 2BZGA 2QRJA 1BCSA 2QUBA 4NH0A 5GGYA 3T9DA 4D8UA 3HAGA 4G1FA 1XYVA 2OBBA 4RV4A 4B75A 3OJWA 3SC2B 1U7DA 3DVLA 1BE8A 2JJ2A 1TGYA 2KX7A 4CDRA 1TJ5A 1DEOA 5I7UA 4D99A 2C7QA 2Y1KA 3L4BC 1FC0A 2A5JA 2P11A 3BM5A 3MAJA 3CESA 1N2EA 2XF8A 3FSJX 3PR2B 1RADA 1N6PA 2Q3BA 5HRUA 5B4TA 1ZQ1A 2B21A 3A6LA 3K1ZA 2R4UA 1SUAA 3OLYA 3KQHA 4ZJYA 4ZV9A 2IYVA 2XQVA 3LLUA 4ROTA 2FX3A 3QVOA 5TQ0A 4ZVTA 2YCBA 1MENA 2AOVA 1CB7A 3SHFA 4BTEA 1TDJA 1X86B 1J70A 3GFRA 3L7DA 3N3AC 4QPZA 2BFEA 3ADBA 4E5PA 1Z75A 1XCGB 3FTCA 3ZWQA 2CCJA 4A0SA 1KY5A 1P45A 1DIBA 1WCIB 1Y9AA 3FUWA 4K3VA 4KGDA 3IR7A 1LBIA 2RKBA 2EX1A 4XYGA 1PFQA 2JI8A 2WG1A 4JR0A 5AUOB 1SRRA 5CFQA 1YJ9B 2PUDA 2VCYA 2VBFA 1W1IA 1Y6JA 4FFOA 3G0HA 5JCZA 4EO7A 4MTLA 3B1FA 2ZTHA 2I76A 4NZMA 3FHCB 4PLPA 4D5EA 1SVMA 4H18A 5BSVA 4I1IA 5IT5A 2Y99A 1D0IA 3FWNA 3OEYA 4DQUA 1QIDA 1HYGA 5HZHA 2QRQA 5HF5A 5C5IA 3P0RA 4Y2UA 5DK6A 1JZSA 1CJMA 1GL7A 1LVHA 1TL7C 2O0JA 3H9EO 3NAQA 2AWOA 4RHCA 4RETA 4Q4AA 3D3NA 2DPHA 3MNFA 1G2QA 2VP4A 3WIBA 1ZJ5A 3FKSA 2H0RA 2R84A 5KQPA 3KQYA 3J81k 1QIEA 2XWSA 1AHHA 1DBWA 4J2HA 2E82A 3VA7A 1QZZA 2GWHA 3NM6B 3SS9X 1KJYA 1X6VA 4G9GA 3STUA 4G0WA 1EM8B 1QHSA 1UJNA 3DNMA 4W5WA 1U4NA 2AQ8A 3RYIA 4HAWA 1XN1A 1T8SA 3B1ZA 2PWZA 3RSFA 4YP5A 4GKJB 3AM3A 3FSGA 4M38A 3SBEA 5HTOA 1KMHA 4FFBA 2Z9CA 1CHDA 3P9QA 2FN3A 2PGOA 3K09A 1WUIS 4XARA 1X7ZB 2DX7A 2J3EA 2EHJA 4RSGA 1IQUA 1F8XA 2H4YA 5DGHA 2H5LA 1K73D 3GEIA 5JAQA 2IZ0A 1SZPA 3RU2A 4DFDA 4TVSA 5C80A 5LZ2A 1DQPA 2GS9A 1VPEA 2ONZA 3CVVA 1CIVA 4ADSG 1WP9A 4P4UA 4MQ6A 2FR1A 2I33A 1B8OA 4J0CA 1SOAA 1C1DA 4J9VA 5LR6A 3SZMA 3HYNA 4WT7A 1ISGA 4AYXA 1VDZA 1EP2B 2JRLA 1E6LA 1S1CA 2X9QA 1ZNYA 1PGPA 1HTBA 1LFDB 3BKXA 1KARA 2PO5A 4JUCA 3EOZA 3FPBA 5D3MA 2P3LA 1VTKA 3USZA 4CL8A 1P0QA 1SXPA 5LU8A 1H65A 1BFDA 1VJDA 3L07A 4G8CA 2A59A 1Q1EA 1LSUA 2NO7A 3UWKA 3MQFA 3KZKA 5AI9A 3PNMA 1TCCA 1VYTA 3HM9A 4O2BB 3B7PA 4X1KB 5CYPA 1C4KA 1YR2A 3ZTTA 3VNQA 3TJMA 3VDRA 1IN1A 2GTHA 1ZKMA 3HLKA 3E2MA 3I9JA 2X4IA 5F78A 3A7EA 2RKOA 4LRTB 1JEYA 2O5CA 2BFCB 5I8PA 4PIMA 5AT1A 3EG9A 1V3TA 1ZGGA 4JASB 4BNUA 2NAPA 5CVVA 5FLKA 2X4DA 2P6PA 2H4JA 4L78A 3QUSA 4YN3A 4C0WA 4OGWA 2D13A 2ECQA 5G0VA 1Y7HA 3OE7A 4QFBA 4N1AA 2QN2A 4I9GA 1WL8A 5C8XA 3PUVA 2QXUA 3H17A 4LHXA 2ZSDA 1JS1X 4NLLA 5FQNA 1R4ZA 4I2VA 3NOVA 4U8GA 3G23A 4HXFB 4MKZA 4OL9A 5E9WA 4B0PA 2ODQA 2G1PA 1CVRA 6GPBA 1Z08A 1T6NA 3W6ZA 2FPPA 2X9NA 2WU8A 1GSIA 3BYZA 3EIXA 2IOFK 3U0BA 1KOFA 3C1TA 3S2FA 1SBHA 1VLQA 2PS9A 3IUSA 2O7QA 5BV7A 1WXIA 3GJ7A 3FIUA 1EHYA 1P9RA 1RWQA 2YWXA 3HDGA 5PGMA 2BFBA 1GKKA 2A9FA 4NI5A 4XI9A 3RS4A 4BMVA 5AM0A 5EXEA 1EYZA 1BLIA 3TECE 2PYDA 3P9SA 2VBTA 4X1YA 3ZZMA 4LXUA 3CJTA 4Z9XA 4RE5A 4U0KA 1J6UA 2JAXA 2O57A 3QTLA 1CR0A 4WK2B 4B3JA 1U0LA 2Z3ZA 5DM2A 3U4HA 3L7LA 3U7QA 2X7XA 4EH1A 3LQFA 2PL1A 4XQGA 1Y4AE 2RHWA 3MTJA 4JP5A 4XX0A 1EUYA 4K1LA 2GO7A 2REQB 1WVMA 3JYNA 3UHOA 1MA0A 2Z6QA 5ES3A 3EGIA 2P90A 3SDZA 3RB8A 1WCIA 4G24A 5A6SB 3WNVA 2YKGA 1OT5A 3RKUA 5LQUA 3ZHSA 4A15A 2J08A 5REQB 4C9BA 3BXEA 5F4OA 3I45A 3ACDA 4UUBA 5IUNC 3WL4A 2WF5A 3QPDA 2QZPA 3TLGB 1TM5E 1XKQA 4JVNA 1E7SA 1ZCAA 3QM1A 4R2WA 5ALFA 5KYGA 2JAOA 2YTZA 4OBEA 3QVTA 4DRZA 4JI0B 3PXCX 5EVCA 1TA4A 4OMDA 3OPNA 1E1MA 3RHZA 3S6JA 2VQFB 4XQ9A 3T0IA 4NFSA 3K6KA 3TTVA 4GUDA 1VRCA 1YAJA 4O4JF 4OPVA 4S35A 1HG1A 5I7HA 5JPCA 2GAAA 1IE3A 4F9FA 2FI1A 2OXFA 5HQ3A 1JN0A 5TV2A 2OTCA 3PEYA 3I9V6 5BQ3A 3E7FA 3LSTA 4MKFA 5CURA 2HD4A 5FI0B 3OEHA 3AFOA 4U02A 3LS2A 5J4VA 2UUPA 2YFKA 3IURA 2FKNA 4Z7OB 4V0KA 1AK2A 1MHPA 1N3YA 4IHJB 1ZEMA 2PGDA 2LV8A 4CCSA 3HVUA 1X7XB 1XQ9A 3H83A 3E3MA 4HWPA 4RY9A 2SCUA 4JXKA 4RZSA 2WMDA 1PZXA 2VHVA 4TYMA 2FWAA 1CR1A 3WLMA 3W9UA 4M0DA 3K73O 5BNWA 2CHEA 3PLRA 3DOJA 1KAHA 2POQX 1QCZA 2G9NA 4S04A 2IEDA 4GAEA 1NR1A 3VR6A 2M32A 2JCSA 1YL5A 4XM2A 1VE3A 1Y3AA 5A5DA 3QKIA 5IF9A 2QAGC 1CR4A 5JXJA 4UXHA 5IM4A 3EQ8A 4RORA 3RU7A 2D8AA 1ECPA 3FVQA 3JRWA 4M37A 3QNWA 2WWYA 1KZHA 1DJQA 3VR3A 6ADHA 1GTRA 4GMXA 4RK4A 3AP2A 1T1RA 4D8YA 1LH0A 1FZQA 1YASA 1P2BA 3RRBA 4YAKA 2ZI9A 3AUUA 2WWIA 1GO2A 1P61B 4KQWA 2RHGB 4WY5A 1G8AA 1U3GA 5DN6D 4NYJR 2PCLA 1K8YB 1VQ4B 3OE1A 1NBAA 4IQFA 2E85A 5AO9A 4ZO9A 3R74A 1K68A 2C4VA 4WOPA 1GPWB 4U7PB 1AZTA 1YD7A 2BT4A 2Q4BA 4CE6A 4R1SA 5KSOA 3KR1A 4ETWA 4QD3A 2QVYX 5AR1A 1AKRA 1TTHA 3CKLA 1U9IA 1RYZA 2C83A 5H70A 4FSDA 2EIHA 1UFKA 1M2VA 2C61A 2BE9A 2YY6A 4MZXA 1V1RA 2OV1A 5CLLA 1IVNA 3TFQA 3U3DA 2IJGX 3OX1A 1X1DA 3QKUA 3NDBB 4R5HA 5I4BA 1HT1E 5AI5A 2X3UA 1EVKA 2N75A 1RKQA 2WBLC 3COZA 4OU5A 2XA2A 2ZXFA 3D8TA 3FB1A 4PCUA 5A6VA 1EUDA 1WVIA 2B8WA 4AI6A 1SKYE 3IAUA 4DAEA 3HUEA 1G7CA 2XXAB 1P4GA 4ZV4A 4UVEA 4ZKEA 5CAEA 1K9MD 3PFKA 4M0UA 5KI6A 1E2HA 1FYVA 1OC4A 3LCRA 4QGSA 2CLCX 4TSFD 5AK0A 1OKKD 5FH9A 1MB4A 4EITA 3CRW1 1IDN1 4M3NA 4FXUA 2J0VA 1KYVA 4YUXA 4FKMA 3U0VA 3E8XA 3IAHA 1GRRA 3QVWA 4LEIA 4RZQA 3WRYC 1H1DA 2WR8A 4XKVA 4DQLA 2NO0A 1C41A 1FTQA 3DTVD 3G02A 1DLIA 3O8OA 4GQBA 4U7HA 3ZDYB 4DG5A 3QELB 3NT2A 1HTTA 1YNOA 3JQAD 1JX6A 2ODWA 3LHDA 4FIZA 2AR0A 1KMIY 2EFJA 3AUYA 4V02A 3RHTA 4IMJB 2AG8A 5HK8A 1RPZA 2C7VA 5KX5F 1HDXA 1D6SA 1TZBA 2H2GA 4QTZA 5SZKB 3CCFA 2M6KA 4E14A 3FNQA 4DN6A 2WV7A 3A6JA 3JWGA 3I83A 4R8LA 2XB8A 5IT0A 1VB3A 6PFKA 3VNUA 1QJ4A 5DTMA 2Q49A 3UJAA 2Y71A 4CKBA 5C1BA 2VPXA 1F2UB 1G3MA 3AETB 1ZGCA 4JIMA 1DX4A 3O47A 4UAVA 4N3BA 1E6KA 4BC0A 2NWQA 4BO1A 5U1PA 3SXJA 4Y7DA 1XWWA 4ZO4A 5E7IA 4EGJA 4AJIA 5K3AA 2GESA 2KM1A 1Z28A 5H16A 4MVYA 2GMWA 3CV3A 3OIGA 1NF3A 1NLUA 3SZLA 5TT1A 3EUAA 3LT4A 3NGLA 1UXIA 2R00C 2XKAA 3CVYA 4ZA2A 2ZREA 3H5OA 3RHFA 2NGRA 1P2TA 2RH5A 1QVVA 3OFJA 5HKOA 3GX1A 4A0FA 4E32A 3KZVA 4RJLA 3ZWYA 3LXXA 1IH8A 1JE1A 1RXIA 1IK4A 2I7VA 1R74A 5BRNA 4UBOA 4PS0A 4B1FA 1MOQA 4N54A 1U5CA 4KQGA 5LZ5A 3SZRA 3V8QA 2WIGA 5CW2A 2QT9A 2JEZA 3WA6A 2D3NA 1AKNA 3IBFA 3NKFA 3Q11A 4WOKA 5JTUA 4LZPA 2PD3A 3PP8A 2NU6B 4IDPA 2JBAA 2O6HA 4C29A 1TCUA 9ATCA 5KWIA 3WRYA 1L7VC 4EGSA 1TTTA 5AN9A 1HPLA 3KKMA 3R3HA 3U3ZA 2VZ9A 4BVAA 1YIAA 1E2GA 2BH9A 5C1DA 2D74A 1R2QA 1RLUA 3R1IA 3ICWA 1LQ2A 2Z4SA 2VJKA 4K6MA 3O03A 4QXAA 4FHGA 4N5MA 1D6JA 3HR7A 1TPZA 3E9QA 2PUJA 2BBOA 1HI9A 3AR2A 3AVQA 2NO1A 2I71A 4DYVA 1XRRA 4KYVA 2R1VB 4NENA 3VDMA 3JASA 2JD2A 4YT5A 4EGAA 3GLGA 3ROKA 4MGKR 3I9KA 5JS8A 4CN8A 4JUIA 2YX1A 1XO1A 5EFZA 1T0BA 2IP1A 1JP7A 1P4SA 2OCPA 2YHUA 1YK0A 2N9UA 4YX9A 3T3IA 2DBZA 3IHLA 2AEJA 4AUNA 5DZSA 2ZIVB 2NV4A 1YQWA 2FTKE 4IHQA 2XZLA 3E1KA 1WSVA 2ZCVA 2DU8A 2PPVA 2EJUA 3UA3A 4ALJA 4CIYA 3BL8A 1FUEA 4L0CA 4FFVA 4DLWA 1CUZA 3TUZC 2P27A 4IDQA 4EPYA 2E5FA 1YS4A 3H2BA 3IAXA 3IMKA 1IHYA 3IJPA 3K0AA 1L5YA 2Y1CA 4FK8A 1PFWA 1N7HA 1B93A 1Z62A 2YYAA 2WU4A 2ZTLA 3UXEA 4JV5B 5DTEA 5CPFA 1ODCA 4DOMA 3QI7A 5IMSA 4PHCA 4DJAA 5C7YA 5K0TA 3V8NA 4K05A 4ZTZB 4C0BA 3CZAA 5CJPA 3VTFA 3P9PA 2MSKA 5KPJA 3HCBA 4HLUC 3I0NA 4G8JA 4HRXA 1XPRA 1FDSA 2CJWA 1EFCA 3O8QB 2FP3A 4NFYA 3ZUPA 1JG6A 4IF4A 4G5OA 4YMWA 1SIWA 3GD5A 3U62A 3EXG2 2C2BA 3RW9A 4E33A 1JIUA 3MXTA 1Y8RB 1ZH6A 4CL0A 4L4SA 4LRSB 1T5SA 4RF2A 5KCZA 3AR7A 5J63A 1M1ZA 1M0WA 4BLTA 3FZGA 1AZLA 2Z8ZA 3QLVA 4Y9RA 5JZSA 2JZOA 4KJXA 1Q15A 1XVUA 4X93A 2EFCB 4KLAA 4CFYA 1X74A 4E5MA 3I5XA 2W2KB 1RYFA 3LCVB 1U7HA 1ORHA 1BX3A 3RG2A 2PXXA 2GILA 4CMJA 5DTJA 2WTMA 2W6JD 3JAWB 3ONVA 4MNTA 1Y0YA 3BNWA 1ODKA 3DR3A 3SXUA 5C2JB 2IEIA 2QRUA 4PFQA 4D3YA 3OUUA 4A9AA 2JFGA 2DFVA 1MXHA 2VNSA 4XUEA 4EQ6B 3N8NA 2WJIA 4Q03A 5F7JA 1PQ4A 3MN1A 1U3UA 2B1IA 3TD9A 2Z8YA 3NNNA 3WLIA 1R12A 1C29B 2OP0A 1G7RA 4DTCA 4C0AC 5JH7F 5DHFA 5EYPA 1H0RA 1OHHD 3WSWA 2Z95A 3KUUA 4JVOA 1J4AA 4ZT6A 4K6GA 5ULLA 5DNAA 4RK5A 3F7MA 1YO6A 4P5PA 3BMOA 3LTEA 4FLMA 4ZOCA 1VJ5A 4Y6QA 3LY9A 1KETA 4URHA 2FXIA 3CCJB 1AK9A 1I2BA 2H08A 4DLTA 4LF4B 1LS6A 4ZHSA 3Q9UA 1A27A 1FJGB 1Z4LA 3UJPA 4G1EB 5CVDA 1MTOA 4DIDA 1L4HA 3QFTA 2AFIA 1E58A 1BCSB 2CXNA 1EGHA 2YW2A 4J3FA 1G5HA 2GCIA 1MAVA 1N1MA 4LJSA 3ETEA 4L4YA 4RHEA 1K3FA 3CWQA 3IR5A 3TEJA 5I7FA 2H3EA 4NE9A 3X1DA 4EGCB 2NXJA 2UZ1A 4FILA 3TTTA 5JEEA 5E6UB 4IVRA 5BORA 3NYWA 2BCGY 4DIBA 3HQ4O 4TQGA 3CLUC 5KOJA 1EJ6A 2Q99A 2HJRA 4JC4A 4GWKA 4BCDA 4B6GA 1A98A 5K8TA 4MW7A 1W5BA 2TRSB 4RC9A 3ZLTA 1UC5B 3SU8A 4D25A 3VRHA 5KOIA 1Z22A 1AIPA 2FOIA 3AJAA 4KE7A 4GO1A 1HX7A 3URKA 4MAAA 2QTVB 3HK2A 2XQGA 4M0EA 4RJ2A 4ER6A 1Z8HA 2N42A 2R1ZA 1LX6A 3R77A 3D81A 4X7RA 4INOA 2AJCA 2C4HA 4JGBA 4QQ8A 4TLDA 4UTVA 3V3TA 2CCKA 3GDHA 1U1IA 2QJTA 1B15A 1ODFA 3MW8A 1NW5A 4F3YA 4GW3A 4ZI3A 4AZSA 1PDWA 2YIMA 4ZP1A 4ZDJA 1AQNA 2ZCUA 4BO7A 4TYYA 4XWYA 3LYLA 3WKCA 1K8AD 1YDFA 4KWHA 5FBLB 3QE9Y 4G0OA 4MUYA 1WW2A 4X06A 1ZXBA 2EKLA 3B3QA 3CIOA 3CO0S 2R25B 2NPIA 3L7CA 3B1XA 3OLWA 4FU0A 1YZYA 1K4MA 4HH3C 3OJXA 1VGRA 3GJ3A 3SEAA 3CMMA 3KXPA 4D42A 3ZVMA 1C8BA 2YXEA 1AUPA 5EIXA 3OC6A 1Z45A 2ZYRA 4UCFA 4EEKA 4ENWA 4CQLB 3T9FA 1QDLB 2OXTA 4HDQB 3GPIA 4CQMD 1VG9B 5ICMA 1M2NA 2GQ0A 5KDOA 4I4CA 3PNPA 2V31A 3DOEA 2WSIA 3F47A 3R3WA 3BRSA 3Q7TA 221PA 3OTOB 1DXYA 1YVRA 1OROA 3AJ8A 3DLCA 3MTAA 2FETA 2PEYA 4F56A 4DY4A 3L8ZA 1KBZA 1SC9A 1PDVA 1PJ6A 2O20A 3JARB 3EG9B 3LKZA 4F11A 3SNHA 2GHIA 2OP1A 2EKDA 3N0VA 4O4HA 3RC9A 2NM0A 1NHWA 3MRTA 3SJZA 4TXNA 1QX4A 2BEWA 3AI7A 2AN9A 1RLTA 3RYIB 1YJAA 3ZG6A 4CW7A 1J5EB 1QYXA 4Y2GA 3AF4A 1ECBA 4L9SA 2VDOB 3I12A 2ZZNA 4P81A 1KMHB 2NUTB 4KQ2A 5KDLA 3TOVA 3LNTA 3H2ZA 2OCIA 4EHIA 1E3DA 2LRHA 2WUDA 4O4LF 2NO4A 3C6QA 1Y4ZA 4AUMA 1NBIA 4AUEA 1G9XA 4OQNA 5L3RA 4QVKA 5AKKA 2I87A 3GN1A 4RACA 1DOZA 4RESA 5SYAA 3HN2A 3THWB 1EQ2A 5KJCA 4DUYB 1MRNA 1J7JA 4BX3A 4Y6RA 1QFMA 4LQCA 4RZHA 4YRTA 3QFCA 3S7ZA 1HQYE 1SOWA 2WYVA 5D5HA 3QPAA 4HI0E 2QYOA 3GU3A 1WDMA 1CUXA 1PEDA 3OQ6A 1OIWA 5TMDA 1GFZA 3RF6A 2RHLA 3SEQA 5AW3A 4JLDA 3UV7A 3V00A 4CF3A 1H9BA 4UEQA 3SC4A 3S8YA 5BV0A 1IB0A 4LY6A 5AOBA 4DBZA 1ACLA 4ZICA 2OESA 2Q1SA 2R6CA 4CIAA 4M53A 1X13A 1NB9A 4YPOA 1ZR2A 5F4JA 3HP4A 4TRRA 2V7UA 4DCOA 4IZOA 1V4VA 2OQVA 4DVGA 4D8WA 2B36A 4IGEA 5JNVA 4DV2B 5IXSA 4IQ0A 2FLVA 2AEEA 2NO5A 1SAYA 2K2WA 2OV6A 4NBVA 4C03A 5C53B 1XU4A 3DHEA 2YIVX 1GAQA 2C4TA 2VH5R 2XUQA 3KQPA 2AV6A 3EXHA 2Q5JA 2XMDA 3AF3A 3HE3A 3M89A 4XL9A 2H0QA 4DIUA 1E0KA 4JDPA 4R3WA 4LE2A 4UEWA 4GZ3A 5F3RA 2ZRIA 5LDGA 3FIJA 4PBRA 1PR4A 3T8YA 4CR8A 4D9CA 5DMHA 1JEDA 4IIJA 4WA8A 1P6XA 1RM4A 3GNTA 3A8TA 4HH0A 3CP8A 2BSXA 1N75A 2IY7A 2JANA 3K8QA 2XDWA 1JEAA 3W34A 5KNDD 4BMNA 3TCNA 1IC6A 4QGFA 4AXXA 3LX8A 1U2TA 2IP4A 4D3DA 5A4IS 3TAXA 1WHTB 3E7XA 1L2TA 3H7AA 5KB3A 1BN6A 1Z5GA 1PKVA 1QK4A 3CNLA 1F0KA 4ZK6A 3WKDA 4XB6B 2VZLA 1YAHA 4GLFA 2EQ5A 4Q3AA 2A57A 1U3FA 4KL8S 4MV0A 3U4IA 4OKNA 1ENZA 3QKRA 2C3PA 3EGEA 1CFJA 1QLWA 5C4MA 1N5OX 1K27A 4FCVA 3K1YA 5JAPA 3PC8A 1C3VA 1HE8B 2HMVA 1N6OA 1ZIPA 2ZQZA 1NKSA 5JNRA 1V4NA 3W6NA 2UUCB 4OX9B 3HZHA 2VHQA 1JIKA 1U1GA 4Y2RA 3K20A 4JL8A 4XM0A 3WYAA 3H9BA 2B92A 1JI3A 3TNLA 3G5MA 1RC0A 1BEUB 2AFIE 3ZXXA 3BBPA 3V8VA 4O2RA 3VZPA 1CEXA 1JHZA 2ID4A 3ZXYA 4B79A 3M4YA 1Y9DA 4TROA 3LNCA 2P4QA 3T38A 3ANXA 2QPOA 1VQKB 5JFOA 1L5WA 1T5IA 3RTCA 1F1BA 4PFKA 4UARA 1EFPB 3NHWA 2ERXA 3OPYI 2GARA 4YH1A 3D4BA 5F5LA 4E6PA 1JKMA 3ZC3A 2I8CA 1YB1A 3ZBQA 1Y4UA 2IL1A 4DYDA 4JJAA 4FEAA 4LZOA 2NYVA 1XNQB 1D09A 1U4OA 2QXYA 4UNSA 5F52A 1FFXB 1TT5B 4YRGA 3D6AA 1VA5A 1B00A 2JGRA 1AT1A 1CG6A 3O1IC 2YRFA 4OQLA 3EWNA 5CA0F 4RDHA 4IO1A 1T8WA 1P0PA 3EFHA 4AM8A 3GQBB 4FC7A 4EJSB 1NDQA 1YA8A 3NRBA 5JSYA 2UXBB 3TLGA 2XUFA 2V74B 1RI5A 3RAJA 5F1KA 3TQCA 3ZE1B 4GKVA 5ALKA 3IUYA 4CKEB 1KO4A 4ZN6A 4GPBA 3MMSA 1OC2A 4NZZA 2GEBA 4FIDA 2IGTA 3CH4B 4XEHA 3G71B 4GPTA 2P9FA 2F1HA 2RHBA 1IOWA 1ZW6A 3G6WA 4NJMB 4F6LA 3ROTA 3GFPA 2FR8A 4F04A 1HE4A 1KEVA 2QLLA 4O6VA 4B74A 1DC8A 2PG3A 3H11A 4B7AA 1KS9A 2E37A 2FUNB 3OPMA 4RK0A 1LU9A 5JRJA 1XI2A 4PQYA 1QWSA 3DBLA 2B25A 4DLUA 1KMCA 3SYLA 2GBCA 1FTGA 2ZUUA 3OMXA 3MIIA 3URMA 4DJDC 4QAQA 4K2AA 1T43A 1WCYA 2EU8A 5CT6A 1C7RA 2PUEA 3IEPA 1DELA 1RQ2A 2A9OA 1BE1A 5C1IA 3W1EA 1U2RA 2F9LA 1HYHA 4RHFA 1IVSA 2BH2A 3WGOA 4BUCA 4F7WA 5EKUA 3T1QA 4DLPA 1LV7A 1TIBA 4KNVA 3UWMA 2HU7A 5KVCA 1GILA 1HKUA 5FL3A 3FNFA 3RE1A 2GASA 1RCUA 2WVJA 1EHCA 2XMSA 2BFMA 2ZJ7A 3WAGA 1ST2A 2HLPA 3RYHA 4GMHA 5B36A 4WLUA 4JI3B 5KX5B 1TQ6A 3R09A 1KQOA 4HGYA 1E6WA 2NSJA 1V5WA 3UJ8A 1QYIA 7GPBA 3KOXA 3OCZA 3PRJA 2UUOA 3VNRA 3K1AB 4PZCA 1HE1C 2HF2A 3IQEA 4TSKA 3ZH9B 4F6RB 2BRUC 4GYWA 3VYWA 4TVOA 1IQRA 1XZIA 3L0BA 3IPLA 1LNQA 5C37A 2HK7A 1OXBB 3NTQA 1CZOA 5JECA 3FHOA 4IJ6A 4UZEA 1C3EA 2GFHA 4MCJA 1YU6A 4NU5A 4WWHA 5T4EA 5KNDH 5BUQA 2C5HA 1DEAA 2B3TA 3ILXA 2LGJA 2YDXA 2IU4A 2WQ6A 1NULA 4ZVUA 4RDJA 1OZGA 5FEUA 1LBHA 4P3IA 5DXAA 3T5CA 3P0JA 3AM4A 5CB6A 3GGOA 2I2XB 1DBPA 3A27A 3FYSA 1T9HA 2PRYA 3HVKA 2B6NA 3BQNB 1CDOA 4B6PA 3ZGVA 3WY9A 2I5PO 1JJ7A 1E79D 4IR7A 3TZKA 4WERA 4DA8A 4MYTA 1BS1A 3FNBA 3IPYA 1QE0A 2FG6C 3PVDA 3S29A 3SFZA 1RYNA 2QV0A 1JMVA 3P2EA 1PJCA 4KE6A 1NRKA 3INGA 5T67A 3LM8A 2BI8A 3BWYA 4YQYA 4AZTA 3IOEA 3QEKA 5JV5A 2ZZKA 1NF8A 3DVSX 2EFEB 2FFHA 3EWSA 3OD5A 3FNHA 3TO5A 3DA8A 1SXHA 1MABA 3BZUA 3UAZA 1TYEB 2EX0A 5DM1A 2NNLD 1NN0A 1COZA 1UZNA 4N47A 1UD5A 1ECCA 1KOLA 1ZESA 2H8GA 5F5NA 5L46A 3E4CA 3HXTA 4FHFA 5CCEA 1PNRA 1AUQA 2JFFA 3PE3A 1G66A 2VDKB 3FDJA 4RZ3A 2Q9CA 1A8UA 2WWHA 3B7GA 3HB4X 3PE6A 4TTTS 4JC5A 4TLMB 4WA7A 3VZBA 5CYGA 3LCJA 3EDMA 1A7JA 1UD8A 3TNFA 4JNKA 2YINC 3DPUA 4REQA 1FSPA 1Z17A 1EP3B 5D86A 3WNCA 1T8RA 1O94D 2IXAA 2VG8A 4GWLA 5DHUA 5H82A 4M0LA 1V0FA 1Y0RA 2HV9A 1WPRA 2CB9A 3H0CA 3N0WA 3EGXB 3T51B 2R8ZA 3MCAA 1YXMA 2HSDA 1B8NA 4WZKA 1V39A 1GKUB 1KGDA 2GI4A 3HR8A 5HYVA 3FLBA 4ZU6X 4RDLA 1JGTA 4I5GA 1P4MA 3CC2B 1A3CA 4X7CA 1UBJS 3L3BA 4DDWA 4RANA 1VJCA 2WUWE 4JJEA 4M8KA 3CX7A 1YQUA 3NVDA 2HIHA 4C5BA 4KXYA 2J9FA 4C0LA 1WB9A 3W8RA 5LQKA 1VIMA 4DCUA 3D7NA 3D7LA 1BWSA 1CD5A 1XE3A 4IP0A 3P2JA 4FFRA 3T3PB 2YQ4A 2VF8A 3C15C 1UPAA 3B5JA 4CIWA 1FFXA 1TJPB 1XYYA 1NR5A 4E21A 4KR2A 4Q4LA 5CVEA 1Y9JA 3FPAA 1Z0KA 4M1YA 3T99A 4QUDA 5GZ3A 3EW9A 1Z18A 4G0YA 2OBFA 4LCJA 5H83A 4YMUA 1YNSA 2NPFA 2PJZA 2XUJA 3L6DA 4FYHA 2IV7A 3OTHA 5CITA 5JNTA 1J07A 4OSEA 5KKCA 4NYMQ 1TYAE 3GFQA 3EXG1 4DLKA 1N5LA 1HNZB 4XWOA 1ESEA 3FY4A 5KWVA 1B0UA 5IVIA 3ZWXA 2OT3B 3D43A 4IEEA 3VKWA 1NQWA 4RYDA 4TKUA 2ZBVA 2ETXA 3WG9A 3DTNA 3JVVA 4ITVA 4M9UA 4MIEA 1F8UA 4CU2A 1F4LA 5IBCA 2ASEA 1DINA 1U5BB 3B7WA 3AVOA 4HPJB 1WKVA 1WZEA 4OIFA 4ZT2A 1A9PA 2OD2A 5KJFA 3D2BA 3SP1A 1SBIA 2QRKA 4D4HA 5HIAA 4TTQA 5DEIA 4OTZA 1JQJC 4Q7JB 1EFDN 2BFWA 2W2KA 4TKVB 3WZLA 2C29D 2IUEA 2YJ6A 3GCDA 1PYOA 1UKYA 2YMQA 2H3HA 2P2DA 2YNMA 1LPNA 1WEKA 3HC7A 4M9RA 3RNLA 4BOYA 4BWYA 2AF3C 3H2KA 3AR8A 4OVKA 5FA5A 3VVCA 3NTOA 3QBEA 3NZEA 4DK1A 1G5FA 2Q27A 3O82A 4BLUA 4PNEA 3GLHB 1GZ4A 2IF0A 1AQJA 1KI4A 1ORRA 1PBTA 2QGGA 2P75A 3PEEA 2CVZA 3LE8A 1IQ0A 1K75A 1ZGJA 2PT9A 4BUJA 5KTRA 4EHJA 1GN9A 2ZRNA 4X8HA 3NHBA 1OFVA 5MFPA 1EFTA 2X3FA 3Q7SA 3IOYA 1LX7A 4UAJA 1KZ9A 3C85A 3GGJA 4QUHA 4CDNA 2BC9A 3T7AA 4D0LB 4O4LA 3P5SA 4MVWA 4UUAA 2R68A 3SIWA 2CRVA 3H19A 1UDWA 2WT4A 3EXAA 5EN4A 1SXJB 2OCKA 3CC7B 1XJCA 2VPIA 1BTOA 1C80A 4WNYA 2X8LA 3LRXA 4IXTA 1RRVA 2R11A 1SUWA 3F9IA 4CL2A 4CLDA 5T64A 5ELLA 3RUFA 1MB2A 2C42A 4ZQIA 1XA0A 3FROA 3SKYA 1KYQA 3G9ZA 3EOBI 3PEUA 1U6IA 2Q9AA 5FWDA 2IODA 2BF4A 4YV0A 1MXFA 4DPMA 1A9XB 1MR3F 3OOHA 4H7PA 4U7FA 4A2QA 5CVJA 1JPJA 2ZFUA 4KRGA 2JAUA 1J23A 1ZGZA 4XNFA 1ZJ4A 3D6VA 2GJSA 3K2EA 4YNBA 5F33A 1EBUA 3LBAA 4YDRA 3VX4A 1VHQA 1KGSA 4JOBA 4OLHA 1KRHA 1GGJA 2ZRHA 3LQ4A 5BV8A 1BDHA 4YRSA 1N0WA 1B1AA 5FNVB 3F9RA 1IJFA 2ZIUB 1BMQA 4Y30A 5DHTA 4BL5A 5K8JB 2Z6BD 2GTPA 1DKLA 4KO4S 1JW9B 3ESBA 4X6YA 4CLRB 4Z4ZA 1TZKA 2QTMA 5JHHB 1EVIA 1NNLA 1Y7LA 1Z6AA 3QEMB 1QG0A 3VU0A 5AYVA 2QZSA 3SX2A 2Q8QA 2VYCA 2O8BA 4O2BF 1IZZA 3C14C 4WBNB 2RJNA 4MRRA 1KK2A 2RSLA 4FMCF 3NUZA 4B2YA 1VJ1A 1E9CA 1R9JA 2ZSBA 3DDNA 1PBNA 1ZN9A 2W00A 4QUAA 3MHPA 1TUIA 4LHSA 1G3UA 2EC5A 4FYPA 3FUUA 4C20A 5B3JC 3N8DA 1VBMA 3AHJA 1LV8A 3GW8A 3CU5A 1EIWA 2AE1A 4X20B 2JS7A 3OLCX 4Z9BA 4IG9A 4YRQA 4PYQA 4H4CA 1GG2A 2FFRA 2GYYA 4FQ7A 4XDGA 1XCLA 4MWSA 4HK4A 3MJRA 3SG0A 1VQ1A 4YYEA 3C6XA 2HNAA 4EF4A 1AURA 1N8SA 4I08A 3KWLA 4LZZA 4TGLA 4ZTUB 1FNDA 4X92A 1KXZA 4WFKA 4CMKA 3L1HA 2J0UB 3UO8B 3R6GA 5KYWA 2C84A 1NFFA 2EW1A 3HG7A 3IHTA 3V2GA 3U09A 1LC3A 1D8TA 1T6YA 1C7JA 4BFCA 3TRDA 2QTRA 5AK3A 1FFHA 3A32A 3WLOA 1XXHB 4Z4VA 4UULA 3UKOA 3DDHA 3BZBA 4XVRA 4DQ0A 5ESRA 1KJJA 1MJ5A 3WAJA 5J1TB 4WKPA 5KBYA 3WICA 1AUXA 1MJNA 1M2GA 3H9UA 4ZDIA 3Q3IA 1MF7A 3FOWA 1I1NA 3DEYX 5IBRA 3DP7A 1H3FA 1Q7BA 2JFUA 1BWQA 3IX7A 3QE4A 4YUYA 2MOKA 3FLEA 2CXQA 4OAOA 4YPFA 3PXXA 4UHFA 1ZH4A 2CL7X 2FWMX 4ZQGA 2A33A 1NVUQ 5JAHA 1Q0UA 1NMYA 4LZAA 4ZYUA 4GSKA 4C89A 4V0LA 3EVBA 4JLMA 2JLRA 4G2TA 1UWCA 1K2WA 1QHYA 5KTYA 1JMKC 4IMPA 4R2LA 1L7EA 2NT3A 3EIWA 2IBSA 4N48A 1JLRA 1V25A 5JZBA 5K6RA 4QUIA 3BC9A 2QPAA 2W6MA 5AXBA 2QPLA 4AZ0A 2EYUA 3U16A 3AFGA 2VF2A 1XCJA 5IP5A 2OFXA 1Q83A 3GRVA 4R71A 3KYDB 4IMIB 1CJVC 3TOSA 4XLHA 1NBMA 1QH9A 3B5IA 4IMRA 2GYWA 1R4MA 5KTOA 4KPEC 1O97D 1TB4A 2B8EA 1KK3A 1R18A 2GNOA 2QX4A 4IXMA 1TI7A 2JHCA 2OMKA 2CXXA 4JB3A 5L3QA 1T5EA 1W9XA 1QVFB 1YH3A 1V4BA 4EB0A 5FI5A 1WDLA 1EESA 2BUCA 2FUCA 4V0RA 4MYRA 4F12A 4XB1A 1PL7A 2AYYA 2XIJA 3TXYA 5NLLA 1KAOA 1NPTO 4R7ZA 1DIHA 1IPHA 4FI3C 2QAGA 3ABRB 1GXSB 1JYSA 1VCMA 4DNOA 1ZVVA 3FPHA 3TRJA 1A95A 2MT9A 3WGLA 5BQOA 2P67A 2FXVA 2WKRA 3I6MA 5FTJA 2JLZA 1Z5ZA 2DPGA 1RKXA 4Q66C 3I6YA 4QJ5A 5TVGA 2J8ZA 4ZMSA 3PD0A 4TXLA 3L0DA 2C58A 2VJMB 1Z06A 3A9SA 4OUDB 2JGAA 4F97A 2X42A 1X94A 2FPOA 2BYTA 4B5KA 2C5BA 3GA7A 2R6R1 1KEEB 3WIVA 1ZL2A 2PTGA 2VSYA 1YRBA 1U7WA 3AB3A 3L7YA 3QZUA 4NZYA 1YITB 1L4YA 2C88A 5U4XA 4RD1A 2X9VA 2ZJOA 2CYCA 4Y2XA 4GI1A 1NE7A 2YVAA 4X3CA 1TD1A 1EE2A 4KDEA 5EE0A 4Y3UA 1CQIB 2ISCA 2FQ1A 3DULA 1LLFA 3LZCA 4FFWA 4R83A 4BASA 5A5EA 3DAOA 1YOVB 2QY6A 1EVLA 2JIDA 2QRVA 4FGJA 3SIRA 3DJYA 3OJEA 1K3TA 3K2QA 3B85A 4CXMA 4QREA 3S7TA 2E0IA 3CLTD 3DLTA 5J2TF 4G1BA 1ZK1A 2HA7A 5TJHA 1N9ZA 3VMMA 4EGQA 5KVQA 4CMEA 1RWMA 3RYTC 2A1UA 1AK1A 2PT6A 2QRGA 2AN3A 2C7PA 2NXWA 2JIZA 1FTSA 3OZDA 4P9NA 3Q6QA 5AVJA 2ZYSA 3RVSA 2DC1A 2J3KA 3DO6A 4GYYA 4KRYA 5DULA 2A7XA 5G0UA 3N0TA 1FE8A 2VOEA 3PGKA 2F4VB 1P2UA 2YQ5A 3H5LA 2ORYA 1T3ZA 3BQJA 3TCKA 3TM4A 5BN1A 4X97A 4V24A 1RJGA 2OGSA 3FUTA 3H05A 3ZVNA 3FFBA 1J21A 1TW2A 4HADA 4OEHA 4LUCA 3CLUD 5FWYB 3ZHZA 4EY5A 4FYKA 4BMXA 4F85A 4DB2A 3RLFA 4G0XA 1L7RA 1LPBB 1OFGA 3SM9A 4PAWA 2HBQA 3EZFA 2FEAA 1BGVA 4IIJF 1X2BA 4JLJA 3AU8A 5AI6A 4BRWA 3ILHA 1R00A 4XDHA 2CXRA 3GBSA 2CL6X 1LBQA 1SHJA 3JX9A 4QDTA 1U8EA 3L0YA 8GPBA 3LKVA 4RNDB 1DLJA 4P36A 2QMQA 3AHIA 1JR3E 1NI5A 2P62A 4O2BA 3KE9A 1GV1A 2PE5A 5FJIA 4LC1A 4D46A 3KAQA 1OT3A 3W5DA 2PM8A 1ZRMA 3AI3A 1XAIA 3CVWA 2ZL6A 1N1GA 4URZR 3ZD7A 1QR2A 1UXGA 1QH1B 2AN1A 1RWXA 2F1OA 3C7DB 3DVQX 5ALOA 3BD9A 3TQOA 4GL2A 1GADO 3C4VA 2OXEA 5LOVA 4XQEA 3L93A 1CY4A 1LC0A 3HEMA 3TR0A 2GAFA 1I4WA 1EU1A 3IEVA 3GROA 1QNFA 4WFJA 3RJ5A 2O8FA 4HYYA 4JKOA 5KNCH 1WWKA 4BZXA 1W0JA 4ZPXA 5KYWB 3A8KA 5B6IA 3E70C 4OHFA 4XCXA 1N2JA 3EASA 4G41A 4ZGBA 3ICOA 2WIDA 4BAZA 3ORFA 3U48A 3QMVA 3A1VA 3KKZA 2CDAA 4HQKA 3EBOA 3L8YA 1MKYA 1YC5A 3EMVA 3DOFA 1ESZA 2WDZA 4RKQA 4MW6A 4Z51A 1X7HA 1GNRA 4G5SA 3NOOA 4MI9A 4RPCA 1CUBA 1ECLA 4BJHB 2KW5A 4KX3A 4PAGA 1G8YA 4LAFA 3CCQB 4AECA 4BX2A 5JANA 3QHPA 3CIFA 5JASA 5BSWA 1W581 3AUAA 2RK3A 1XMVA 4V3CA 3COYA 4GGOA 1N6RA 3C7AA 1O8BA 5FTKA 5KYUB 4P2NA 3TDNA 2D8MA 2EJWA 4OUKX 3T12A 1U98A 1UR5A 5AD1A 1IN6A 1YB4A 5EP4A 5IN4A 5HF9A 5K01A 5TY0A 2XRYA 4ZMRA 3GDFA 5AFSA 1U3CA 4LK3A 2ADFA 4ER7A 3RUHA 2HEGA 3TTXA 1YA4A 4N3NA 1P60A 4HLNA 4MWEA 2X9GA 1ZGAA 4WKCA 5IDQA 4B47A 3JQFA 3GYGA 4FZ3A 3DEKA 4LWPA 3FDFA 4DLAA 3E5HA 1NLMA 3K5IA 4DMLA 3OUZA 4PYOA 4ENVA 5AQEA 4H1WA 3LU1A 1N2SA 4QDZA 4CUZA 2JLBA 3EODA 4EM6A 2ZU6A 1W36C 2L18A 3CCRB 1WETA 4RDKA 1N7JA 5J47A 1CU1A 2QBYB 4NQZA 3SBXA 4I3GA 2AOXA 2YV3A 2Y67A 4BVKA 1AKUA 2C99A 3QENA 5IC4A 5L6LB 1Z0ZA 4TWIA 1KD1D 2O8CA 1W9HA 5C46F 3EHDA 4ZVLA 3NWPA 3R6TA 4YMGA 1W1UA 2E4AA 1EUZA 2QAGB 3GB9A 5H7XA 5K8IA 4NL4H 1TLTA 1G4UR 4N6NA 2EL7A 5IM5A 2W6JA 4ON9A 1NJFA 4TL8A 2BEUA 2CXPA 2ZSHA 4FFPA 3OJ0A 1D4AA 5T41A 4AK9A 2V45A 3UA4A 1QGOA 1KFEB 4CI9A 4E1AA 4EFLA 1A4XA 1XHEA 3X1KA 3KVRA 5G4KA 5KPDA 1GPNA 1VKHA 1XGKA 3TRFA 1NOKA 2XVAA 3ENWA 1UC9A 5CW1A 4CM5A 3GP8A 3ZLJA 1U1DA 1ZAKA 4YFYA 4FFNA 1JSZA 2OFOA 4IW3B 1Z7EA 3HDQA 3WBKA 3QPUA 1UIMA 3FZNA 4IZIA 4R8SA 4Q3BA 5C32A 3L6OO 3CMEB 1EVEA 3U4GA 4TSFA 3VAAA 7MDHA 2WPDD 5KQRA 1MVLA 5BSMA 1ZEJA 4U6NA 4P12A 4IZ6A 2NW6A 4D3XA 2IHYA 3K4PA 5CLHA 2V6GA 2WWTA 4YP7A 2ODNA 5IZCA 3LP8A 1YOVA 4G2NA 4PN7A 3HY6A 4YECA 3P96A 4ZOAA 1Z0JA 5HXBA 1HDCA 5DNWA 3OEEA 5B2ZA 3OF5A 4MGIR 2DQ4A 2FDXA 2XUGA 1PX0A 4QM6A 3JQFC 5DCWA 1GRCA 2R8RA 1NI4B 4N6GA 1Y7PA 3JW8A 3VO2A 4RVDA 1HQCA 2WM8A 1FFCA 2YYZA 1AU9A 5DEOA 4Y6SA 3BXFA 1PV2A 4MI1A 2FU5C 3KTAB 1V71A 1V1MA 2K7ZA 2J0QA 2A67A 3N2GB 3FPJA 1NZJA 1I13A 4ZAGA 5K0BA 3OZIA 3IL2A 3LUPA 5BW6B 4HXEB 1GT6A 3OQBA 2PVCA 3TI7A 2J9FB 3ROXA 1W4CA 4IDDA 4GBED 3UG7A 2ZPTX 4WOBA 3B6EA 4PEVA 1EBBA 3MD0A 1JJAA 1QV7A 1XRQA 1P3JA 1XIVA 4WEQA 4ZIRA 1RZRD 5ESXA 5AVRA 2MU1A 2BKXA 2CFCA 2IZ6A 3MG9A 4BDSA 4N5LA 4YI3A 1G20E 3AGQA 1S9HA 3EMBA 3F4KA 4MIKA 4WNIA 5LCXA 3T54A 4AG3A 2AHRA 3OOWA 4HR7A 4Y6OA 3V1YA 4MQBA 1AGRA 3KOZA 2BL4A 2FGKA 4GKBA 4KE8A 4O2LA 4RZ2A 3P2KA 3TSAA 2NQ2C 2HZBA 1SNYA 4CODB 4X66B 5BSHA 1QYRA 1QZXA 5FTNA 5IPFA 2PGJA 4OO3A 3K5HA 3KVOA 3EPKA 5AXCA 4BGEA 3A11A 1QH8A 3WWCA 2W5UA 3ASZA 5L45A 1YRYE 2FEKA 4QJIA 3NI2A 1PV4A 1N9GA 1P2SA 1YQDA 4IQ8A 2B7LA 2D4AA 2N1MA 5EIFA 3PNBA 2Q4OA 3QKSA 1M66A 3KXKA 3UAOA 3UATA 3MS4A 1VJTA 2JJ2D 3NHFA 4LMPA 4AJ2A 2GFIA 5BWOA 3FUCA 4FT4A 1AX9A 1RM3A 3WLQA 1DWUA 1QIJA 1ZL0A 3LVFO 5FULA 3SYRA 1TT7A 3T7KA 2AHOA 2NNWB 2ZYHA 1XLUA 3AQ4A 3PX7A 4JLAA 3MILA 1ZD2P 1OBHA 4RBNA 4CMCA 2XNDD 3EDCA 3W9SA 4X62B 1NP3A 4BFTA 4OXNA 1EDEA 2EEPA 3HO8A 3MGAA 2X8WA 3L1UA 4RTLA 2VXBA 2WT8A 2ZIWB 4O29A 2RBEA 3H97A 5LP6B 1GDTA 3KQWA 3AUXA 1VIYA 4KQFA 1F7VA 1GGMA 5CNIA 4KTTE 5ELXA 3M81A 1TQHA 4GQNA 2QLMA 4ZYYA 1NYRA 2A78A 4OHXA 2F67A 2XGMA 2R7MA 1EEXB 2W2NA 3GLFA 3C24A 1UFOA 4LTDA 5HKKD 5CM2Z 4ZZ2A 3AOEC 2EP8A 1OXVA 2OFWA 2XWPA 3RRYA 3QPVA 4O02B 4MHOA 1T5LA 1SC6A 2X58A 3OW7A 3H2SA 3IELA 3MD9A 3MLEA 4IOJA 1WQ3A 3I4FA 5IKMA 4M1EA 4OOEA 5HHTA 4Y2TA 5DM4A 4EY3A 4W8HA 4UDOA 3I55B 1DU4A 2GN0A 2WQZA 4QPCA 2A6PA 4UJ5A 1JRLA 4O4JA 1NKVA 3WL7A 5I4IA 1UH5A 5D01A 2KB0A 2C3OA 3T3NA 3LVQE 3ZHOA 5EUMA 2OHOA 4QAJA 4NPCA 2R6HA 1R64A 2OHVA 1RRMA 2IOFA 3V8PA 2Y0CA 4C6RA 4EUEA 4EZIA 4CKZA 1A5AB 2GRJA 1ND5A 3KJNA 3TPFA 4G97A 2EP5A 2OO5C 4K26A 2P9ZA 5SV2A 3RDPA 3NOXA 1QPZA 4W7SA 3LX4A 4M1MA 4RABA 4CM8A 5HOEA 2F62A 2Z30A 3OEED 4MRVA 8ATCA 1WUYA 1Z7BA 4Q4JA 3W1WA 3COVA 3QA3E 1JQAA 1MORA 2Q3DA 3EC2A 3X44A 1FUIA 5B7PA 1ORDA 1PS9A 5B53A 3S8MA 3DFKA 1EQUA 2ORWA 5AVQA 4QFCA 2XITA 1SR8A 3MJ4A 4NARA 2ADOA 4LYFA 4NSNA 3EXEB 3S1AB 4HDSA 3AKZA 3EIUA 2I6XA 1E66A 1JZQA 5FOXA 5IJ9A 2A5GA 2XSZA 1I6WA 3FCEA 4WBNF 3ORHA 5HR5A 2IPAB 4RZIA 4CHGA 1CY7A 3AESB 1CPYA 2HOQA 1UBLS 2Q0HA 4Y9DA 2CV1A 3IEXA 5C34B 4M0MA 2ZBPA 3RTBA 1UWLA 3FCCA 1QGED 4KFTA 3TVDA 5FI1B 3Q0TA 4P7FA 1CF9A 1NJSA 1CR2A 1P77A 3IEIA 2XE4A 1GSHA 1RTTA 1VA4A 1U1CA 3CT4A 4IO0A 5ERYA 3T4UA 4YWJA 3D1JA 4EYSA 4F45A 2BM1A 5E4YA 4OQEA 1QIFA 1XDBA 3R41A 2Y76A 2VI5A 3PDHA 4WV3A 4NCNA 2J9RA 1LLUA 2CWDA 5IKXA 5A7GA 1L9KA 3X0DA 5FHQA