3ZBTA

Ferredoxin-nadp reductase mutant with ser 59 replaced by ala (s59a)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQAIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Hydrogen Bond Network in the Active Site of Anabaena Ferredoxin-Nadp(+) Reductase Modulates its Catalytic Efficiency.
pubmed doi rcsb
source organism Nostoc sp. pcc7119
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP REDUCTASE
total genus 94
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3zbtA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3zbtA02
1I7PA 3JQQA 5JBQA 3G71B 1F60A 4B4DA 1QFYA 3WNBA 3MCAA 4LBYA 4PGOA 4ZGNB 4Y9UA 2RC6A 3G4SB 1JA0A 4G1BA 1XB2A 1GVHA 3AVXA 4RD3A 3ZZ0A 4Q7JB 1G7TA 3CC7B 3CB4A 2B7CA 4PC1A 1VQLB 2DETA 2CNDA 1YIJB 1Q81D 3ZZTA 1S0UA 1E62A 1SKQA 4U9UA 4H9GA 4RD1A 1B23P 3W2EA 3G6EB 3VNUA 4TMTA 1R5NA 2EIXA 4M2LA 1Q7YD 4WQMA 4QHYA 4RD6A 5DSZA 4TMZA 1QH0A 4M4SA 1W2BB 3QSYA 2BSAA 1XE1A 1W34A 4AF6A 2D74A 1OB5A 4C43A 3QFTA 3AVWA 3ES9A 4RD2A 2QEXB 3W5VA 3VO1A 4AF7A 1GO2A 4LBZA 4RCYA 3WYAA 3E1YE 3PENA 3ZBUA 3QFRA 2QDXA 1S72B 3AVTA 2VNJA 2BMWA 3AVVA 1VQNB 4R71A 5AN9A 1AIPA 1ZM9A 4ZCMA 1E63A 3ZC3A 4P3YA 1HA3A 3QE2A 4NBSA 1QFZA 3CC2B 3MHPA 3LRXA 1DDIA 3AVYA 1D1NA 1KK3A 1JJ2B 4TN1A 3W5UA 3A1FA 1KRHA 3B82A 4J0QA 1EFTA 3I56B 1CNEA 3OZUA 1EFCA 1ZUNB 5KSWB 3I55B 1N0VC 2VZLA 1KC8D 2QTZA 5EMNA 2VNIA 2CRVA 3CCLB 1ZM4A 1TUIA 4K1XA 1F20A 4RCZA 1FNBA 4G5GA 3LYUA 1YJWB 2PMDA 3B78A 4LBVA 1K8AD 1QG0A 1KD1D 3W2GA 2AHOA 2X3UA 1VQPB 3CCVB 2HCJB 3J81k 2PLFA 1R5OA 3CRZA 4MYTA 2GQFA 1IB0A 5GV8A 2NPFA 3CMAB 3JQRA 1B2RA 4PC3A 4ZV4A 2HMAA 2BF4A 4N3NA 2YWHA 4B3XA 1JNYA 2RC5A 2B5OA 1NDHA 4PC6A 1SM4A 1VQ6B 4RD4A 5H59A 1EFUA 1QFJA 1FNCA 4N3GA 3E20A 1EXMA 1G7RA 1YHQB 3W2HA 3I1FA 1IJFA 2J7KA 2VNKA 1N0UA 2VNHA 1OGJA 1R5BA 2DY1A 3LO8A 4HE5A 4YAUA 1YITB 1KQSB 1A8PA 1K73D 1EP2B 4TMWA 4B47A 3AGPA 1FNMA 3VNVA 4LBWA 3FPKA 3CPWB 4P6VF 2PIAA 1KK1A 1GAWA 1TLLA 4LC0A 3WY9A 3CCSB 3CC4B 5H5JA 1DG1G 2YWGA 1KK2A 1WDTA 2DERA 2DCUA 5TV2A 2HDNB 3CCQB 4FWTA 4ACBA 1DARA 4RJLA 2BGJA 1EP3B 1FRNA 4YALA 3WNDA 3OJWA 2OTJB 1TVCA 1GR1A 3P26A 1IJEA 1VQ8B 2B7BA 1EP1B 3WBKA 2BGIA 4M0LA 4PC2A 4ACAA 4M1KA 1BJKA 4F7DA 5FA6A 1CQXA 4NCNA 4Y7CA 1ELOA 1UMKA 1QX4A 1TTTA 4YAWA 2C77A 3SJZA 3AVUA 1KTVA 3W2FA 3CXCB 4FK8A 4YAFA 1EWYA 1W87A 1YI2B 5GV7A 1M90D 3WBJA 1QVFB 3JQPA 1VQ7B 1VQ4B 4G1VA 1BX1A 2YWFA 3MMPA 1QGAA 3FJOA 3P27A 2XEXA 5TY0A 1H85A 1H42A 3OZVA 3AGQA 1VQKB 2YWEA 2XNJA 3CCRB 1DDGA 3U2QA 1Q82D 1GJRA 1G7CA 3CCUB 4ZCIA 4YHBA 4EH1A 1GAQA 4TMVA 1VQ5B 1W35A 1KK0A 3U6BA 1QUFA 5THXA 1CNFA 3CD6B 4PC7A 1FDRA 3U6KA 1VQOB 4BPRA 2BVNA 3LVBA 4B48A 3OJXA 4QFMA 1G7SA 2BV3A 2OK7A 4YAOA 2ZITA 1YJNB 1M1KD 1KJZA 4Y9RA 2OK8A 1BQEA 2VYQA 3VO2A 1AMOA 2FX3A 2GPJA 1QGZA 2XNCA 4HE6A 2QA4B 2QN6A 2BM0A 1YJ9B 1FRQA 3OZWA 2R6HA 1VQ9B 2E1RA 1QUEA 4AC9A 1ZM3A 4MYUA 3W5HA 3W2IA 3CCJB 5HXBA 5TR9A 1D2EA 3CW2A 1E64A 1N8RD 2BPOA 3ZBTA 2QMUA 1Q86D 1D8TA 4C0SA 2OTLB 2BM1A 1K9MD 2DEUA 4UAJA 1OGIA 2C78A 3CMEB 1BX0A 3V76A 1U2RA 2BN4A 1ZM2A 3QFCA 4ZCLA 1QGYA 3VMFA 3QFSA 3ZZUA 1FNDA 4RD0A 4IW3B 1VQMB 4FN5A 3OW2B 4B44A 4TMXA 3CCEB 2EFGA 4M53A 1OB2A 1JA1A 4DQKA 4DQLA 3CCMB 3WNCA 4ZGQB 1JB9A 3B8HA 3WXMA 1QVGB 4B43A 1J9ZA 2QTLA 1NJID
chains in the Genus database with same CATH superfamily
5GJBA 1WLYA 2JPDA 3GLFE 5JBQA 4TTPA 4RIHA 1TEXA 4W4TA 3VH3A 3IPYA 2NTJA 1KERA 1EK5A 4AJOA 3ITNA 1BEUB 3ZX4A 5AVUA 1QE5A 2WF5A 5FBRB 4HX5A 1IJBA 5ESRA 3CVXA 4TM8A 1C7QA 4X85A 3TDNA 4QATA 1SC3A 2OAGA 4H60A 1P9RA 1WP4A 2NU6B 3KJIA 5HQ3A 4UVHA 1JHVA 2SKEA 2Y8EA 3PF8A 4MR7B 2IYTA 4ZCSA 1D2HA 5SY6A 4A8JC 4MYHA 2FG5A 4M37A 4LMRA 4OP3A 3VBEA 2BFWA 2XH8A 4N47A 4M8NE 2RGNC 1Z8NA 4JASB 4BS9A 1I0ZA 1MU0A 5ENZA 3NTQA 3AR8A 4L5IA 1SMKA 2WUDA 4ZYUA 3KUDA 1TKBA 4AYXA 4X90A 4KWCA 4RTMA 7YASA 2FW6A 3G0BA 5HJ5A 3LLCA 2OKGA 3LECA 3T0GA 2HUNA 2G9NA 1SOAA 3H11A 2OO7A 4GGOA 1L7QA 5J4VA 2IEBA 1RYNA 4P93A 1YC5A 4EZBA 2ATXA 2C95A 2P11A 2WUFA 3A1VA 3QUAA 1RI4A 2FKAA 4U3JA 1NKSA 5K3BA 3QGMA 3ZE1B 1XHFA 4C0JA 1YIJB 2IZ5A 1F38A 4BE7B 4ZOQI 5CCEA 1F0KA 2ZI6A 2E4YA 3JWIA 3SIXA 4G5OA 4QQNA 3R7WA 1IUPA 1YS9A 3BT7A 4C4PA 1R6UA 2RHTA 4CMHA 2ZE5A 4OQNA 2OO5C 2X4GA 3V7UA 4MVJI 2Y71A 2Q3BA 5DASA 2NSLA 3HDHA 3DNMA 1GQOA 4CM8A 3EULA 4PICA 4P08A 3QXHA 4RTKA 2R62A 3LCCA 3OZRA 3R6JA 1BAPA 5BSHA 3E7WA 1N2GA 1BD3A 2GCPA 5F23A 1TF2A 1B4DA 3JQBA 1QHYA 4PG4A 2G5GX 5HR5A 4US0R 4XVUA 1AA6A 2B34A 3RK4A 3GPLA 4RD6A 1Z2PX 2ASVA 2HSDA 2HA4A 2XYVA 3MEQA 5HCIA 2B61A 3NASA 3FE2A 5KMGB 3L2OB 1V25A 1R8JA 3EBLA 1C3OB 4Q5IA 2OV8A 1H1LB 1X3LA 1YDGA 3H6GA 4C3UA 1UM8A 4EAAA 3WIBA 1RXEA 3V8NA 5D01A 3IQDB 4RJIA 4AIRA 1R15A 3ETJA 4GG1A 3QKRB 4CLEA 3BRWA 1Z5OA 4C43A 4LWQA 2G06A 2IGBA 3M6UA 4PXAA 1NP3A 3UAWA 5LJLA 4A10A 4EBBA 4DV7B 4DV2B 1O6BA 3OZXA 1VFNA 2GA8A 3GRUA 2ZZFA 3ZK8A 4I8XA 3A36A 4OHWA 5LYJA 2ISCA 1GU0A 1JR6A 2RHOA 3FSGD 5AVKA 2VBTA 4UATA 2CFOA 1BWPA 4QD3A 4JP8A 4YEJA 2A5JA 2Y1CA 5AKKA 4CVNA 1RJFA 3NHUA 4X00A 3SHVA 2IIQA 4NNPA 1VJGA 3KQLA 4GUAA 1C80A 1Q0UA 4XMYA 4QQFA 2IT1A 3N3AC 1IM8A 2EEPA 2JAPA 2BFEB 2ONZA 2QRPA 3A2NA 2QZ9A 5HK9A 4C2UA 2C20A 1IUOA 1JHQA 2GAFA 3A31A 4HNAB 3HQ4O 4QUAA 4ZHQF 2A1UA 2DH6A 1EDEA 4MIEA 4Z9XA 3QUTA 3LHSA 1MJFA 4C06A 5JRDS 5A02A 1O6FA 1Y1RA 3KB1A 3CC2B 1INLA 4KV9A 5E4YA 5EZQA 1SVMA 4TT3D 1PK9A 3V42A 3I2JA 2JLZA 5JJLA 1SQGA 3M33A 3Q4GA 5E6SB 3JPYA 1T8PA 4LSZA 4R2JA 1D1NA 1LV8A 1BQ4A 1MX5A 1YJXA 5ERXA 1GG9A 2WHPB 2LKCA 4G5SA 1JJ2B 1ZZGA 4HNAA 4YA6A 2I7VA 5ILOA 3R0IA 2ZU6A 2WU1A 1CS0B 3C5EA 3KAQA 4NL4H 5F4MA 1GDHA 4ZQCB 4JODA 4RE6A 2C0PA 4GKBA 5GJWC 4KO1S 4WBNA 4MQLA 2VA9A 3OUZA 4MV8A 2XSZA 5KYUB 2XYPA 2WD7A 4ZQEA 5L7TA 3PL1A 2XV1A 3DTVD 2CFRA 2DSTA 1EFCA 2IC5A 1FU7A 1N0VC 2QJOA 3SEZA 4BNXA 3HNRA 2W42A 4NONA 5KNBD 2FUG6 1Q3KA 4Q4CA 4D9KA 1CXZA 2JEZA 2IX9A 3BE5A 3JRWA 3L8DA 5EMNA 1ZL2A 3KHTA 5ERYA 3TAXA 5JI2E 2LCFA 4MCHA 4ERXA 1Z6ZA 4A27A 2HV8A 3H9CA 4I6GA 5CFNA 2XPCA 3AI2A 4R0NA 1E6LA 2HTEA 8MHTA 3LVFO 1MG0A 4RH1A 2H1RA 1NUQA 4DPMA 1UDCA 3IP6A 4ZMSA 2FRDA 2JC3A 3M3HA 5K3AA 2CD9A 5BV1A 3WGIA 1LPAB 4B82A 4KR7A 4D3ZA 1L8QA 1ZXXA 2VDKB 1LY1A 1UODA 1V8PA 2ZCUA 1EFRD 2P5UA 1ZW6A 1F2DA 2O2ZA 3DHYA 5AI9A 4NEQA 3QHAA 2VTBB 2QJFA 4A4DA 1OV6A 4WZLA 4DZTA 1VQPB 3CCVB 2EG5A 5IBPA 5L3QB 1JBQA 2VK1A 4YJ2A 4IIJB 3T99A 2PUDA 4M0PA 2QRHA 4QWMA 4DLNA 2Q1UA 1WUHS 4MVJP 4PYNA 3LQRA 2QW1A 1I9GA 4D4JA 4P31A 4IS3A 1DOAA 4KXWA 3NTRA 1OB0A 4YRBA 3TM4A 3X43A 3GJ8A 2GRJA 3AYXB 2EVWX 4UD2A 2I2AA 4AMYA 4LYYA 3DVAA 1K3UB 1P1BA 1E66A 1D1SA 3DQPA 1P2BA 2AMYA 4OVKA 3RC9A 1SCKA 4O5OA 4YQYA 1XRQA 3D02A 5AYVA 4B32A 3FKSA 1B0PA 4C7MA 4LNAA 1H93A 1NUHA 3CMCO 3VUFA 2XB6A 5CD9A 5CXUA 1NDQA 4P1ZA 1JKFA 4W5WA 4A1FA 4EHHA 1XTPA 1V35A 2CLHB 5ALKA 2LGJA 5DK6A 3WWOA 3G0HA 3E20A 4PSCA 5C8VA 2FPGB 8OHMA 3NEYA 4AKIA 3FY4A 1DINA 2NGRA 4NOMA 4YN3A 5A7HA 5JNWA 2ZUEA 3I1FA 4TYNA 3GI1A 3KOXA 3WLMA 2NP7A 1WEKA 2HHJA 2UKDA 1CULC 4HN9A 1W581 4YRGA 3EVTA 3L1KA 1H4SA 3UHPA 1X3SA 1MTZA 1TO1E 1B6SA 3WOHA 3OX2A 4NBKA 4BNKA 3IEXA 3CJRA 1GKUB 1YOVA 3A4MA 4LYGA 4PN7A 4CKWA 5KSPA 4GM1A 4XL9A 1UPCA 1BGXT 5DBGA 2Q6KA 5J2TF 3CE9A 1DQNA 1DQSA 3VU9A 4UNQA 4A2PA 1NJ5A 3ON5A 1EP2B 1NJGA 3FRHA 3D7MA 4KDCA 3SX2A 3RS0A 1SVUA 5M7EA 3HCFA 2PZMA 1ABEA 3Q11A 2GJAA 4EYGA 1J8QA 1GTL1 1L1QA 2HFKA 4KQFA 4FIDA 5DP1A 3H8VA 3HDGA 3KKPA 1NIPA 2JI7A 4KTVE 4RL4A 5DWVA 2WZCA 1T36A 2HHAA 4KNYA 2BGRA 4V2IA 2JB9A 2R9VA 4NABA 5J2UA 1WHTB 4B8WA 4HLDA 3L9WA 5IJ9A 1G38A 1YKSA 3STXA 4NC9A 5EHIA 3BIOA 1JQEA 3ZH2A 3EDOA 3AJDA 3JD3A 4HWSA 1FS6A 2WU8A 3K96A 4XWWA 1DKRA 1NI4B 2FFHA 4TL7A 3WHPA 4EITA 3E0QA 1XRLA 3QBTA 1KI8A 3CCSB 2C9BA 1TM5E 1W9XA 3GP3A 4CM7A 5AXAA 1L2TA 2P3OA 3OAAD 4EIWA 4J6EA 2QRLA 3ELUA 2QORA 2JLAA 1MQ9A 4MWTA 4MQUA 3G0IA 3L7AA 4M1QA 3EPKA 4YCNA 1XX6A 4K3VA 5LMCA 5DCYA 4DIBA 3CLSC 1RLUA 1MX9A 5L95A 3HR4A 3V2GA 1ZD9A 1UDXA 2R8OA 1T6NA 2HRZA 3C2QA 5DSXA 4D9MA 1K8QA 2GM9A 3EXFA 1FP2A 4Q47A 2QVLA 4TRMA 4WUVA 3F74A 4WSOA 1SHTX 2AN3A 3EEYA 2IYFA 2QVBA 3H7AA 1I2CA 3C4JA 4QKQA 4RJLA 1TM7E 1Y1SA 2H59A 2AKEA 3SBEA 4M46A 2WAOA 1T3TA 4ZAZA 3GGCA 4C6TA 3OJEA 3KM0A 2OTJB 3FTFA 1X15A 3B53X 5GPBA 5EERA 2PCLA 3P26A 5TARA 1V45E 3ONNA 5JS2A 1VQ8B 4DSZA 5F1KA 5TE9A 3EQ7A 4EQ6B 1RI1A 5A06A 3DEZA 4QNRA 1FW6A 1NULA 4YTEA 1Q2UA 4F5WA 4MPRA 4O2RA 5BR1A 1V3UA 4M1KA 3DV9A 5IDQA 1XEFA 1WHTA 4H35A 4CCWA 3F7MA 2GPTA 1P5ZB 2HADA 3NPMA 3TMKA 4YMVA 1HFEL 2JI8A 2OM2A 2ZJ4A 3CKYA 2J3EA 3HV2A 2O7VA 3GGGA 4FFVA 3LKZA 5EAIA 2AL7A 1WVGA 3CKLA 4KVZA 1DC5A 4Z2YA 1OLUA 3VZCA 3W5DA 5CIYA 3IELA 2QIPA 4M1YA 4EENA 5BNWA 1SPBS 2JFXA 3B60A 3VM6A 3V1LA 2WYWA 4DA0A 2OQVA 3PQ5A 1W25A 4GOXA 4MI1A 1R9GA 3LPNA 1T1JA 2F59A 5DM1A 1J07A 1WAMA 5FUBA 5KJEA 1ZRNA 5C4GB 3THSA 3UO8B 2Q3JA 3AG5A 3GFVA 1QCZA 3V4ZA 3RJMA 2R8XA 2GKSA 5IT9A 3NVMB 3EEIA 5IZ4A 3WMFA 3FJYA 2ZTMA 3QG5A 4JBGA 4UNRA 3N05A 2XDQA 5TQ2A 3TQHA 1X1RA 2C31A 1T5HX 5SZHB 3MMPA 2VF8A 5E8JA 3HL4A 2OLJA 4IAOA 2AR9A 3JYQA 2F43B 4IVPA 3TKLA 3NI2A 2GO1A 1AZLA 1V96A 5DYTA 1XDBA 2Z3ZA 4QGFA 2DLCX 1X8JA 3U56A 3FUTA 2VT2A 1DKMA 2O19A 2WTEA 3IR6A 1V8BA 4JVSB 4LMPA 1PTJA 4RM2A 1VQKB 3JR3A 5F64A 4BBZA 3SICE 1B8OA 1V1JA 4HFJA 3T5GA 1JI0A 4A26A 1GCOA 4LXHA 1Z0UA 4P1VA 2PR7A 3EWAA 1MFPA 1SBQA 3HA7A 4BVAA 1ICIA 1P8AA 2VXCA 1I4TD 1PUJA 2CFCA 1AX9A 3DLIA 1NQTA 1Z2OX 3IA2A 1JTFA 1HNWB 4F5EA 1ZCAA 3EVAA 3L4BA 2YY7A 3OO1A 3ORSA 4X24A 4YC7A 3UB3A 2NXEA 2X77A 3K0AA 3AR2A 4QARA 1IXKA 1JBKA 2QI9C 4XDZA 2XNSA 3PQFA 4ZU6X 1EX9A 2GYWA 4JVOA 3TXYA 3QTTA 1JNXX 2D2IA 1FXUA 3M6VA 3OD5A 4E13A 1TCBA 4BBJA 2F62A 2IKSA 2RG1A 4FKMA 4D92A 4P12A 1GKLA 1YR8A 2GPBA 4FHCA 2FFJA 5ELMA 2Q5IA 3SSMA 2IQ5A 4HEJA 1V4NA 4YDHB 2X3YA 2WW8A 1AK1A 1T3LA 3FZNA 2CXXA 4WOJA 3WA6A 4EP1A 1HDGO 1XJCA 3GCDA 1G5FA 1O1YA 2BMDA 3IBFA 1GV0A 1BQEA 1N07A 3S27A 4B7CA 4C4RA 3L84A 4IPTA 3F6EX 1Z0IA 4JJ8A 1AMOA 1OXXK 5L7WA 3GHHA 4AIIA 3IKVA 4ZYTA 1QP0A 4B3RB 3MF4A 2PD6A 4QV2A 2QN1A 3TLGA 5A4JA 1Z2CA 2QA4B 2Z98A 3DH0A 3NHFA 3PNYA 1C4KA 2LCQA 5ALFA 3RSHA 4CLRA 1F9AA 3AW8A 4CZ2A 3AR3A 2WPDD 2AC7A 1H5QA 1VQ9B 1WNTA 5CVVA 4ER5A 1YZQA 2OPBA 3EXEA 3BVPA 4HQ0A 3LBYA 1J42A 5KOHB 2WICA 1AB6A 3H83A 3NH6A 3PC2A 4L07A 3VMMA 2K5UA 5IFLA 3DMNA 3LA8A 2I1QA 1DAGA 3CCJB 4ER0A 3CYFA 5LLDA 1QAOA 3FTDA 1ULHA 1E8NA 2OZKA 4B2LA 2PKEA 2G9VA 1N2CB 4X1YB 3H1FA 4EGAA 3R24A 1OH6A 1U0LA 3VVLA 3PDHA 4CIVA 2I62A 3I9V1 2YC2C 3PWTA 5FJIA 5C52B 2XCUA 1QOQB 1DBWA 3SG0A 2WQ7A 1M34B 1QGOA 3V2UA 1QSGA 4ILKA 1SVWA 5EJIA 1WHSA 2GBGA 1CE8A 4DRXA 4TUYF 2A84A 4YB8A 4FHEA 5JV5A 1V11B 3HDVA 3V76A 4LQ4A 5DNEA 2VQFB 4KP7A 3EXHB 4OBEA 3L4KA 1JJ7A 2Y0DA 4I19A 1U2RA 3G0GA 3SYNA 4JI7B 1FNNA 3KSMA 3QWAA 1XWIA 4HDNB 2B8WA 3T52A 2JJ2A 3LFHA 4WERA 2FEMA 1FIUA 3GYGA 3NVAA 5KUTA 5FR1A 4ITRC 1F48A 2VSNA 4F7WA 1M8GA 1JHXA 4ETWA 3WGNA 1XMIA 3RO7A 1NUTA 4CMEC 4U2KA 2ID7A 3ZXIA 2J5XA 3LBAA 3TR0A 4K86A 1V9SA 1TD9A 1AXGA 2R85A 1CF4A 1ZSVA 2E55A 2LTAA 2C9MA 2W2QA 2ZR8A 3NGMA 4XB6B 4CMIB 1ZD5A 4H31A 5G53C 4MPDA 5GTDA 3QI7A 4DR6B 3QVWA 3BL5A 5CP8A 3TX2A 2H1VA 4Q7KA 4PY2A 3D7SA 4MV1A 4AQDA 4EY6A 3ZLJA 5EE5B 5ICCA 2G9UA 4JOSA 2O3SA 2FLWA 4AS2A 2BDEA 2GXQA 1Y9DA 2V7GA 4ND5A 4GQBA 2VAXA 2VCHA 3WIDA 4B43A 1C8VB 1O95D 1QYRA 2IV2X 2FDRA 4JLOA 1ETUA 3IBGA 4JMLA 4KLNA 4R1SA 4ARUA 1UEXC 3ABOB 1RFLA 2AW3A 2YFKA 3EVEA 3DSRA 3ONEA 4ICIA 1TTQB 1X7YA 1CD5A 4WRRA 4QM6A 1N3IA 5JSUA 4ZANA 4CN9A 5KMGA 1U2EA 3BZBA 1ISMA 3RDPA 1MHTA 1T2UA 3DTVA 3NHZA 1B14A 1WE2A 2FK8A 2TECE 2X8WA 1MC5A 3E8SA 4GP9A 3RJ9A 1LUAA 1YRLA 3BMQB 4DSAA 1WMBA 2JLVA 5FOSA 5G1NA 3TLXA 1UFRA 2E6UX 1QP7A 2BFMA 4O0LA 5D7NA 1VJ0A 1ISSA 5BORA 1MQAA 2C88A 1KR5A 1GDDA 1V16A 2IU3A 1GCGA 5IM4A 2FKNA 2H18A 4WEOA 5CUQA 1BIFA 1NQWA 1Z34A 1TQDA 3KLBA 3IILA 3U16A 2TMKA 3ASZA 3LTEA 5E6TA 1LFDB 4OOXA 1NMZA 3MINA 4B8ZA 1NY6A 3E3NA 3C7KA 2QYTA 2GZSA 2XWJI 4ITVA 1J2UA 3ANTA 1P0MA 4FKBA 5AQEA 1A8IA 2JHCA 4RXTA 3DVLA 4HVLA 4AY2A 2YNMC 2JJ1A 3AQIA 4P92A 1SG0A 4MS4A 1NU8A 2J4CA 3F9RA 2BR3A 3ND7A 3FCAA 3PE4A 4JQCA 1QH1B 1SQ0A 1J1ZA 2VP2A 1PFVA 3GW8A 2GN8A 1KJJA 3E2PA 4HUQB 3RCBA 3GJTA 3WWDA 2LWIA 1VGVA 4BO3A 5MN5A 1UKAA 5FNVF 2JLXA 2EX0A 4B84A 4U9UA 1USUA 4BFUA 1XCMA 1Y3DE 2HBZA 2WJ4A 4PHFA 1C2YA 1G5QA 3M6XA 4IQ8A 3V33A 1KXZA 2P9CA 3RUFA 4C2TA 1OIVA 1DIGA 3RREA 2G4LA 5P8WA 3CB2A 4HEA1 4BO6A 1CR1A 3P5BA 3KSZO 1JAXA 3DQZA 1P2VA 4E12A 1PWEA 1P4GA 1U28A 3LDGA 4OXYA 1KO4A 3E9DA 4GU5A 3WMXA 3GD7A 4FHZA 5F5NA 3IJPA 3KCQA 1EIWA 4U4AA 1KRWA 3BQNB 1ZO8A 1F4VA 2D7CA 1EBUA 3WHIA 5IH7A 1RWKA 4QVKA 2IYOA 4N40A 2AJLI 5FUWA 4Z3DA 3PDIA 5IN4A 5CLJA 4B7UA 1RIFA 1AURA 1RYYA 3GEBA 4MQBA 2DJIA 2VHEA 4MB2A 4BWGA 8ADHA 3PR3A 1H6AA 2WYHA 4L2IA 1S8FA 3W5VA 1UOEA 1ZHFA 5HOQA 1WBJB 1G9SA 2ATIA 4FB5A 1E3XA 4PO1A 1DJPA 1UJ4A 3C6QA 4BJ5A 4LBZA 4AVZA 4CDGA 3EGXB 1MD9A 1ZNWA 2NADA 3BK2A 3S7ZA 4ER3A 1HKHA 1S72B 1ZEMA 4HDKB 4O2BA 3CVVA 2IWHA 4IZHA 2XXAB 1GPUA 1R4AA 2ERCA 1CUYA 3A14A 3THYA 1TRHA 4EB0A 5T3UA 3VDQA 1ZP6A 4RSRA 1PLKA 1FUIA 5AKHA 3VFDA 3KFLA 6NULA 5LDDC 1MO3A 4IV0A 1IDOA 5TF4A 4Q9NA 2WFMA 3CUVA 1C9MA 3G88A 1PZFA 4U2EA 4EW6A 2NNLD 2I5PO 3SQOA 3UYKA 1HA3A 4GSLA 3U7FB 1SXJD 4DLAA 3NZEA 2J6BA 3GNSA 3KAPA 1MAWA 3K6SA 4GM4A 3I9FA 4O4JF 1BCSB 1XNHA 2JIDA 3MHPA 4YCJA 3FNRA 3DE3X 2W2NA 4IOLA 2W4IA 3MBKA 3UG7A 3DL2A 3B6EA 5AI5A 3ANLA 2NXJA 5EKSA 1DFHA 4JC4A 1POXA 4CYMA 4IXNA 2X14A 1BG6A 2H8GA 621PA 1X19A 2Z6BD 3COJA 3DWIA 3RIXA 5CEEA 5EGSA 3S29A 4KQWA 2O5CA 1UEIA 1CUJA 1E6WA 1VJCA 2H2IA 2Q99A 4IDEA 2W2MA 4LQCA 4FNMA 1KRHA 4OXKA 5DIZA 3ETDA 1K86A 3MJCA 3TD6A 4BJ6A 4S0ZA 2AK3A 3GBSA 4MITA 4YQFA 5I7UA 1FUYB 4GC5A 1CNEA 1NURA 1VJ1A 2YS7A 4MWSA 1Z07A 1TU0A 3K9GA 5EXXA 4B6SA 3DF9A 5AESA 5FDFA 3PJDA 5JARA 5A5VA 3V7WA 4YAKA 2QTZA 1M2NA 3UF0A 2QLNA 1CY1A 4FIZA 3GDOA 1HEIA 2VNIA 4BB0A 2CRVA 2FTKE 2P4EA 2RGRA 1IEQA 3LHDA 3QXGA 2FF5A 4TQUS 2AJTA 4ZODA 4B6GA 4PAOA 1FLNA 5JH7F 1O8BA 4GLBA 4QXMA 1F20A 2AC4A 3RNLA 3CVWA 4O1MA 3SYKA 2ZJ2A 3CURA 1E3SA 2GCNA 1BWRA 1ICEA 1XP5A 2Q2WA 3JSXA 4HQOA 4RVGA 5IAEA 1IMOA 3WP1B 4RA6A 4BB5A 5K3OA 2OZLB 3UKDA 1DKQA 3V8PA 4ZQGA 2GK6A 1ULUA 4JIMA 2V6JA 2F1IA 4ND2A 1DJQA 3W2GA 2VSOA 3JAKA 5IYZF 2X3UA 3SEJA 3WLHA 1CTQA 4AMGA 4X1YA 5H80A 4QPDA 4C1BA 1GU1A 2YIJA 3LUCA 3LQ4A 1LW6E 1CUGA 4WFQA 5AHWA 3AETB 2PQ6A 4IHJA 4WL0A 3EZ2A 4RZXA 4J7UA 5DK4A 1KYQA 3RRBA 2C3OA 1JR2A 4JELA 3M3DA 3Q72A 3ZIDA 1EX7A 1UP7A 2NZ8A 3V80A 3KL4A 1O2DA 1YZKA 2Q2OA 4M1SA 3UFXA 2J3IA 4QECA 1M6NA 1SHZA 4GIBA 3EX7C 2BELA 1RW4A 2PMEA 2WWHA 4RBNA 4DQ0A 4JI3B 1KORA 3EMDA 4YRFA 5EJAA 4PSUA 5ITVA 1I5OA 5H59A 5IKMA 2EX4A 4PVCA 1ZL0A 1SVNA 5ALMA 4C5BA 2IK8A 1EFUA 4CF3A 1PX2A 1QYWA 1JSCA 3V1UA 1Z6YA 1HI9A 4WXYB 2BFEA 4FOTA 2F3RA 4GI7A 4QOFA 1FDVA 1RRFA 3LI2A 5DCWA 1NFQA 4OHYA 3G0DA 4BNJA 1QV9A 1S2GA 1VPEA 3QA3E 2QLFA 1XYGA 4MA0A 1C7ZA 3GPBA 4O2LA 2IOHA 1UH5A 3RT1A 2WJYA 4BAGA 1N0UA 4C04A 1WZCA 5K01A 4R9NA 5K6TA 5F7XA 3NTOA 1M1YB 3F3KA 2DECA 1OFUA 4EYKA 2WJIA 1SZJG 1JEEA 2ZUWA 3FRIA 3T41A 3QM1A 3UG6A 5IM4F 2XOEA 4CM9D 3UM9A 3M1LA 3GUYA 4NOJA 1FRVA 1MP0A 3HKDA 4GPAA 1A4XA 1A98A 1E2FA 5A5DA 3UTCA 3NDBB 1KYXA 2YMPA 3JZAA 3A9WA 3ER6A 4TL8A 1X0VA 2C2BA 3RM3A 3WWYA 2LP4Y 1J39A 1X92A 3CG4A 5EWMB 2BHSA 4Z4SA 2IYAA 3MUEA 3REFA 2Q3LA 3ZK9A 5I47A 3ZDDA 1FFAA 1N2IA 4E14A 2AF3C 4UZFA 1XO1A 5A7GA 1GQRA 2H7YA 3C8ZA 2JLCA 1G8KA 1QVWA 1YH3A 1SH7A 4X20B 3WGTA 1RRCA 2LZJA 4P0PB 4POAA 5AJVB 1HQDA 1FDTA 5BSRA 3PKJA 3CBQA 5GGXA 2C1XA 4LJRA 2DR3A 2G72A 2VAWA 1XMPA 2VDVE 2QUAA 5K3CA 5SZJA 3MCWA 2ACWA 3UK7A 1PFGA 1B73A 3UGJA 1V2HE 5BNFA 2GZDA 3D6TB 2RI6A 3ZZMA 1NKTA 4ZO8A 2X6XA 1U3FA 3ITDA 5CFOA 3D0QA 4RSGA 3WQHA 3QIAA 4GRDA 1C29B 2VKTA 2FW8A 3GGJA 4YRQA 1UBSB 4BZPA 1GUBA 2ERXA 1ZFNA 1RR6A 2C7BA 2J32A 3HG7A 3QXJA 4HDRB 5GADl 5JNRA 1R37A 4ON9A 2D62A 4MUHA 2M5SA 4J49A 4Q1AA 2X13A 3GJ0A 3QEKA 1UK9A 1NQXA 2QRNA 2DCUA 4KN8A 2PUVA 2QTWB 1DC8A 4IWNA 3GT7A 1U5CA 3BXGA 2ZIAA 3VOAA 1V8DA 1VZ2A 3D4PA 2BGTA 5IJ0A 5KIAA 2VP0A 5K09A 1UKCA 1EBBA 4X7BA 1IHDA 4DEVA 3VI3B 4ZI2A 4D99A 3PIIA 1IWOA 2W22A 4EG5A 4IIEA 5JRJA 1A3CA 3LUAA 2KLHA 3L7KA 3X2FA 3GFGA 4U00A 5B30A 5FPKA 5C3UA 1Y6GA 1XCJA 2O14A 4OB8A 4G37A 3WXBA 3S40A 3ZQJA 2HTFA 4X60A 3VPSA 3GEPA 3OEEA 2DC1A 6CHYA 1N2OA 3FHTA 2VXBA 1XTTA 2BR4A 5TB5A 2ZUTA 4WN3A 4AWAA 2UUAB 3AOEC 1SKBA 3GNQA 2B9VA 4ZT2A 1WOOA 5BUZA 5K6AA 3SQXA 1Z28A 4FYXA 2Z9BA 1EIZA 2HJGA 3DOIA 1TTTA 1QGUA 3UWMA 4MVXA 4HUJA 3PA8A 1KTVA 4JB2A 2GLTA 2FH5B 2N3ZA 3BMOA 4IV5A 4YRNA 2HK7A 3OQVA 5E4FA 1I5EA 4LRQA 4DCJA 3ZDYB 5ALNA 4M55A 5THQA 5C31A 4UU1A 5DW0A 4ZGGA 5I9TA 2PX4A 5CH8A 2QZSA 1KYIA 1E9CA 1H2BA 1K0UA 3GEDA 3FVVA 1Q83A 1M90D 3BIWA 4UOEA 3Q2OA 4OHOA 5LMZA 5E4TA 4BNUA 2FHPA 3H9QA 3IVMA 4U0JA 1Y8CA 1PDVA 1X7XB 4ZOLA 1YCDA 3TOZA 4UBLA 2R6ZA 2X4IA 2OCKA 4J1TA 5DT9A 2DQSA 4KWIA 4C0KA 1X1AA 1UKBA 5DRTA 1N8KA 2VRCD 2GCIA 1JEOA 4CDRA 2HQSA 2FZKA 5LSAA 2QX6A 3IR5A 4WEQA 3QOWA 2FPKA 2XEXA 1T9DA 2C7GA 4JI4B 1C5KA 2V5AA 3L92A 5KKAA 2B4YA 3RIEA 1ZQ1A 3LUHA 3PGJA 3AGQA 4D4GA 3UV3A 2XKJE 4DR7B 4N01A 4F9TA 2QJTA 3A0RB 4WDQA 3RJTA 4Z3KA 4WNYA 4P8RA 1XU9A 5B1IA 3CWCA 1VYVA 2ZRDA 3NWBA 4YO8A 5ALYA 5HSGA 3R9WA 2I2BA 2W4QA 1R50A 1UMDA 2WJAA 1JRLA 1L8OA 3L0OA 3N0VA 4BBAA 2A2ZA 4DXDA 5MHTA 5G40A 2QX8A 2EG9A 1EFPB 2FW0A 2IIVA 3ILSA 3INGA 4EKIA 4ZTUB 1T10A 1Z6PA 3BMXA 3CESA 3HCOA 3QX7A 4DLTA 1EGMB 2V9PA 4EI8A 4H0NA 4LSMA 1PT7A 3ZHRA 5C8YB 1VQOB 3VR5A 2HNKA 2CKDA 1O9HA 4OMDA 1LXCA 1NLFA 1UBJS 4YI3A 5TMPA 4KQMA 1QIKA 4OJYA 4F4DA 2BV3A 1Q20A 4FMDF 4UASA 3GFBA 2J30A 1DWQA 4OPSA 2QU7A 1HNZB 2VEOA 1FMTA 4HQRA 1OU0A 9LDTA 3W04A 5I4KA 5IT4A 4PX9A 1AUQA 4E03A 2JGAA 1QLJA 2C4VA 3JPWA 1TYBE 4LY9A 4P4NA 3GDGA 4GP7A 1VF7A 3IJ5A 3AF5A 4NH0A 2GPJA 1X80B 4TM7A 1YVEI 1UT8A 3ZXSA 2ZIXA 3PD0A 4X6UA 2OYSA 2Y4NA 4R3UC 3RC1A 5BY2A 4CL2A 1A2OA 1IUNA 2Q9UA 1WW8A 2H16A 2HSEA 1FX1A 4IGFA 4LHVA 5LLSA 3WOVA 3OE5A 4E2YA 4BGEA 1V0JA 2JGRA 1TLFA 3G1TA 1XZ8A 5GIPE 4DWOA 4AC9A 2R79A 1NI3A 4IIXA 1W0CA 3RLFA 4EJ2A 4E6EA 4I8IA 5ALZA 1H9AA 4OU5A 4EY7A 5BWOA 3C3BA 3OFNA 1A4IA 1K5DA 1L7PA 1US8B 4CKXA 1ISJA 4B2PA 4DRYA 2JGFA 4NNOA 1SXIA 4U39A 4I2NA 4K2AA 3QYPA 1E64A 2IW1A 2PZAA 2R6GA 2VP3A 3IAXA 4GWKA 1D8TA 2FLVA 4O2AF 4PIMA 3A1DA 4J0IA 2LDBA 6Q21A 1N0WA 1NNEA 2GYUA 2AYZA 3TRHA 1L5QA 5L4LA 1CZHA 3O8NA 3NOOA 4BE4A 1Z2DA 3S2UA 4JP1A 3SBOA 2XW6A 4I4TF 5EE9A 5EWMA 1IHPA 2FPXA 3T4EA 5CBKA 3E53A 5AHOA 5GM1A 1DU4A 1YBHA 3ZW7A 4B3HA 3UAXA 2GLXA 4DBLC 4FDLA 4TZTA 3AF1A 5DHQA 3NHKA 3SJPA 2QNRA 4Q21A 5JSKA 1MGOA 4AMBA 4C7VA 4EG0A 1K6IA 1KJWA 3L6DA 1ZJ5A 1J2JA 3CINA 4JT8A 4N48A 2EP5A 3W1WA 4YBZA 2WTNA 2J7PA 3W3AD 3M6MD 5F9MA 5L4NA 3FI0A 2VBSA 1IEWA 1T0IA 1Z0FA 4D44A 4F8EA 1KBZA 2G09A 4L0DA 4MP8A 1WTAA 4V0SA 2WLTA 1ZRHA 4QUHA 4G0WA 3GJYA 1JEDA 2QAGA 2VZEA 1BFKA 1MB3A 1QIDA 4YP1A 2FXVA 2DQ4A 4TWBA 2P1DA 3FFBA 4FI3C 4MUYA 4Q82A 5F21A 4C3OB 3RFVA 2QV7A 4CI0B 3IS3A 3H7IA 2W93A 3LBFA 3LSYA 4L57A 1V26A 3O03A 3D8SA 3C3KA 2H2FA 2CLMB 3T15A 2ZE6A 2JFFA 2AEFA 4B5KA 1RC1A 1U1DA 2HF7A 3WNCA 4MCIA 4AZ0A 3VJRA 1BS2A 3WDSA 2H11A 1QVGB 3ZWWA 3P8ZA 2C82A 1ZYUA 3CNEA 3LT2A 3UK6A 1U5AA 4DLSA 4J2TA 4WIAA 2BTOA 1W5EA 2X2EA 3GUHA 4K03A 3ASPA 4W9NA 1XD8A 1DT3A 1B6TA 4BP3A 3MTJA 1NY5A 2ZANA 1DPFA 3K2IA 1QC5B 4PNHA 1VB5A 1X86B 1SA0A 2EFDB 3LF1A 2B9EA 1RVV1 4B6OA 1PRYA 1OXKB 4LCJA 2G88A 2YMMA 5KJ6A 4B9EA 1FTWA 3ZWYA 3U0BA 4RV5A 3NB0A 2WMOB 4YP6A 2DXIA 3JWEA 1UZAA 3OQPA 1RQNA 3W5CA 4MOWA 3DLPX 1V0EA 2LIPA 2NYUA 4FFRA 3L0IB 4ND4A 4A6XA 1OKKD 2DR0A 1R6DA 4NAUA 3RVRA 5FWYA 4Q7JB 1J0AA 4G2NA 4XN3A 1G7TA 4CIAA 4MAFA 4N5MA 4UEKA 3FDJA 3W9UA 4EG6A 2VHQA 3HY3A 2AYXA 1N08A 4A15A 3PP8A 5KTMA 3B6KA 4E22A 3CV3A 2ZJYA 1GXSB 4BNHA 3MWKA 3V46A 3HB9A 3FYTA 3DV2A 3LUFA 4MEAA 4D9EA 3RNOA 1RC8A 3GHYA 2W98A 4S2EA 5LMUB 2NN3C 1C0KA 1K75A 2Q0QA 1Y3FE 1WF3A 3KJGA 3W4KA 4EHBA 2JEYA 3ZQ4A 4YPOA 3IFSA 1Q81D 3LY9A 3AK4A 1CDOA 1LI7A 1MV5A 2OZVA 4XJTA 5D3QA 4FN4A 4WJKB 2ZBEA 1XEWY 1ACJA 1GPNA 4XYMA 2OB1A 3DFFA 4WI1A 1M7BA 4KKUA 1G59A 2RHCA 1MA0A 4MHSA 1KO1A 4RK0A 2A30A 1G291 1PW5A 1PV2A 2HMTA 3K9WA 4IIHA 4ZA2A 5T5QA 3TQSA 2QR5A 4HD8A 3NP9A 4F2WA 4IKPA 1Q7YD 1JPUA 3OP4A 1PGOA 1QIGA 1UJ6A 1RHQA 2HREA 2O1EA 3ADKA 3EDRA 4QODA 2BBOA 13PKA 3NAMA 5I9IA 3R7DA 4IIDA 3ZV6A 3C3JA 3PVZA 5EOVA 5ALJA 1R6BX 1DAPA 3B6IA 4EI7A 1FEZA 3HFSA 3R3XA 2XSZD 4ZPJA 1OWNA 1S4QA 1TIKA 3CR8A 4AK9A 5BVHA 4Z7NB 3SM9A 4RVDA 2Q2VA 4I9GA 4PGFA 3LJKA 1U4NA 1AU9A 2YVUA 3ES9A 3CPHA 3DD1A 2CCKA 3LT5A 5D8DA 3SF8B 1NKVA 3WNQA 1P1HA 3ZHYA 3ADCA 3D8NA 4UUPA 1PG0A 3U1VA 1TW3A 2QQEA 3QVSA 3LUJA 4RZUA 1ZONA 3RAJA 4DNFA 3WLIA 2KLBA 1YI1A 2COEA 4HXFB 1J70A 3KQTA 3WYAA 5IAJA 3E1YE 1PGJA 4E32A 3QFRA 3M1AA 4RLFA 4MW7A 4BFZA 1VQNB 3H3XA 2BFBA 4ZQHA 1F8UA 4P7JA 4ALJA 1MEJA 3DAFA 3SOZA 5EXTA 1CR4A 1MCZA 2GK4A 5G0TA 4FWBA 1CK4A 3THXB 3E03A 3E9MA 5MGNA 3GLIA 2Y1WA 4L8YA 3I2YX 4R5MA 3Q8LA 4P3YA 4GC9A 2JGEA 2IPNA 4AJEA 1E1QA 1W6UA 1PL6A 3QUQA 4NBSA 2HK9A 3PDJA 5J59A 1RT9A 1OAAA 2ZTHA 4FZ3A 5BMOA 3TUIC 3MGCA 3ZPXA 3DQQA 2ZRLA 2JAWA 4WXEA 5CJPA 5JS6A 4M7OA 1SVOA 2VJBA 2W6IA 3T1YB 3L0SA 1V47A 1YJQA 4V0OA 4WGFA 2Z30A 3AX6A 4ABYA 4RF5A 4B87A 4OMFG 5BPFA 4CXMA 2A33A 4I1YA 5IDYA 2YN2A 1PGPA 2AN5A 5LA6B 1SU6A 4EOGA 1ATIA 4ZVPA 2QBYA 3RVQA 2O4CA 5A4FS 2NO1A 4Q9JA 2VHJA 1T1GA 3HBNA 2XZPA 1N7JA 2JFGA 3H5IA 3NH9A 4IHQA 1FBNA 1JVNA 3OUTA 1DBSA 4DMCA 4P5EA 2A1IA 3U26A 4IIGA 2XCSB 2ZYHA 3OQMA 2R6FA 3RG8A 1MLDA 5JS8A 3LW7A 1PZNA 3P2OA 5CPFA 1GQFA 5HBGA 1IIRA 3SHWA 1NVVQ 2V54A 1JWAB 1YKFA 3AR6A 5BVGB 1RAFA 4P3IA 2YHBA 3HB5X 3KTFA 1J23A 3NDPA 3U62A 4D6YA 3HB7A 1D1TA 1QVZA 4CV3A 1BKSB 1J1UA 2XKAA 3T0FA 4C7KA 2WQ6A 1VL0A 1AMNA 3EGDB 1SUCA 3I6MA 1WJGA 1TPZA 3MXTA 1PT9A 1PDOA 4QTUB 4JL8A 1OC4A 1NU6A 3BAFA 4C07A 3ZCVA 4HLNA 2C4TA 3TVTA 5ADVA 2XB2A 3ETCA 2Q2NA 1P3DA 4JC5A 4TXHA 3GGOA 2F00A 2I4LA 3KEWA 1CZOA 3GJXC 3KKLA 2QUKA 1QG0A 4KYVA 3G8CA 4XQGA 4BNDA 1RXIA 5DEOA 4H4CA 5T57A 1EGVB 1PCXA 4HMQA 2OBXA 4PS0A 4ZK2A 1C3EA 3CRZA 4PAAA 3CRRA 3MGKA 3PUHA 3HVJA 2VJLA 3U37A 2GHQA 4CKBB 3ENVA 1GEEA 1W75A 2HV9A 1ODSA 5HXAA 6ABPA 4GKVA 1AGNA 4V03A 4IJQA 3IP1A 3LT4A 4QBKA 5FOUA 5F9FA 3IB3A 1RHKA 1LJLA 4F46A 1DX4A 1TGVA 1C9KA 1EVLA 3CLRD 4PC6A 1PHRA 4BATA 2GRAA 1YQQA 1G8SA 5DYWA 1L5HA 1N5KA 4LXIA 3C3CA 4NG5A 4FKZA 3F2VA 1ZMRA 3O4FA 5KX5F 1W8IA 3IXLA 4UNIA 2B6NA 3LUBA 4X1IA 3E3AA 1DIAA 1Z6AA 3I6QA 3TZLA 3DZGA 3TRDA 1E99A 2PZFA 3LXUX 1F12A 5BYBA 1N3YA 4F2DA 2D54A 5CCBA 3MXOA 3AR5A 2J5QA 2P8SA 4BQNA 2ZWAA 5IMBA 4BVKA 4BN0A 2QTTA 5F35A 2DPGA 1KZ9A 4TROA 1NBMA 2CZQA 3TSWA 2ZETA 3JVUA 1KZGB 4HGRA 3CO5A 3M83A 1DRUA 3PJRA 3IQHX 3F5SA 4M99A 5KQRA 2I80A 3AJEA 4ID9A 4RF4A 1E9EA 4QLBA 4FOPA 2LRHA 3FYHA 2Y99A 3NYRA 4XCVA 2CHGA 2IEIA 2MSDB 4Y6RA 3ZU5A 2L18A 4MUGA 3W7AA 4ZXPA 4EYSA 3UT5A 2VEDA 3D7LA 4YPFA 4ZU3A 3ZV4A 2VYFA 2JVIA 2VQSA 3PHJA 4OFXA 1UANA 2XT0A 1BVHA 1Y9ZA 3B2NA 4RVHA 2HJRA 2AXQA 4Z8YA 2OORA 3MWJA 3TN7A 9ATCA 3K0FB 4FILA 4DIFA 2P6RA 2G04A 4FLMA 5JCXA 1LKZA 3NPAA 1NSFA 1W46A 4ZVOA 4TYYA 3N0RA 2FG6C 4DUYB 1KEWA 4IMPA 2GT1A 3RVPA 1I30A 2V59A 4AP5A 4UARA 1NYRA 3ZI7A 4CDMA 2JFPA 2Q1SA 2WJHA 3WVNA 3U7EB 2F1KA 3C39A 3OIGA 3GCXA 2YMQA 3CSDA 5BOVA 1G18A 1NE7A 3H2HA 4GPZA 4OH1A 5BW6B 4RFSA 1EMDA 1X2EA 4BNWA 1KK1A 5HEKA 2J33A 3B1VA 2XMCA 2IE0A 3NVDA 4D9CA 3VC2A 5FI3A 2F8TA 1X1QA 3TCNA 4JVNA 4RIGA 1Z6GA 2UXCB 3RUPA 1NQVA 2YWGA 1KK2A 2QR3A 4DZRA 1K9SA 3D9QX 4L0CA 1AO0A 1QM5A 2ZL5A 4YCBA 2EKQA 1WHSB 5HILA 4C1NA 2J0QA 3AWDA 3PUKA 4LZOA 3ZLVA 4KBYA 4N54A 4AUNA 4FT2A 5JYEA 2OGWA 4ZVQA 1U8XX 1N8SA 1XL1A 3OM8A 1GRRA 1DXHA 5AKGA 1VSBA 4I3GA 9LDBA 2JGDA 1A2KC 2BJWA 3DE1X 4LIPD 1AKMA 2EW8A 1T9HA 2A5LA 3L18A 4GPIB 1FVHA 3T7KA 5LOVB 2O8FA 3GYBA 2RBKA 4MIOA 5TLSA 3FGPA 3R0JA 2R7LA 4PLWA 4RJKA 4BKOA 4Z9FA 1PJTA 4LF4B 4HQKA 1JG7A 3OJWA 4KK3A 4TZKA 1A77A 3PSHA 1GR1A 1P5JA 1HKUA 3I04A 3KP1A 4R7GA 3RAFC 4KIJA 4LA4A 3UMMA 2CWWA 3EQZA 4JNKA 2H8KA 5E4JA 4IGAA 1D9ZA 1PR2A 3MFQA 1KFKB 3CUKA 5K0CA 4FBMA 1OZGA 3OC0A 2O8FB 2C2MA 3K32A 1JFLA 4YYEA 2JHGA 4HNQA 1RYZA 4X95A 4OK5A 5IYPA 1HDCA 3GH1A 4AJPA 4BVGA 2JIZD 1CRLA 4D80A 3AVUA 1Z4QA 2XVAA 1CYEA 1E6UA 1KWKA 3LQEA 2YJ6A 1Q6YA 4E5NA 4XD2A 2RGBA 5E0OA 1J0DA 3ND5A 4BZZA 1BWQA 1MV8A 1HMYA 2FRDC 2D5BA 3B52X 1VXRA 2ZXEA 3PBKA 4JLNA 5EWLA 4NZNA 1HMPA 1PYDA 3ZE0B 4Q1DA 4QUDA 1ZWKA 2IPLA 1IM5A 1KBOA 1JF8A 4PS1A 3D3NA 3UWDA 2KW5A 1HE2A 2QP9X 1NN1A 4I4IA 3BF7A 1WM1A 4HH1A 5DOVA 1YI2B 3LV8A 3HXQA 4D96A 4TLMB 3IVAA 1KH2A 2YYAA 4DV1B 3N7AA 821PA 3G1WA 4XA8A 1TD1A 4ZT5A 2JFHA 3CW9A 2BGKA 4BX9A 3OJFA 2REOA 1PEYA 1JDSA 3AEYA 4NE2A 1KAHA 1ATZA 3EWSA 4DLUA 4WE3A 2CL6X 3CRW1 2JJMA 3O0TA 3BD6A 4QUJA 4RQUA 5ULLA 3A3KA 4LYDA 5KYXA 5C51B 5GGYA 4YP9A 4CM9A 1EK6A 1J8FA 4U8HA 1EK0A 1RVDA 4Z9AA 1EX1A 4FR2A 5IVKA 2G5TA 2C5HA 1E2KA 3KWJA 3LY5A 4I1OA 4Y2TA 3ITEA 4BLUA 1DDGA 1EWRA 4LVNA 4KITB 1UWKA 3ZUGA 4JR1A 1TF7A 3RTBA 3NMUF 1KJYA 1ZEJA 3FLEA 2EQBA 2V4ZA 1PAUA 1CQZA 3DD5A 1B15A 3HR8A 4FWIB 4LVOA 1Y4AE 4TGLA 4TKLA 3WB2A 4U2FA 4BLSA 3BHNA 3ORFA 3S6JA 4E3WA 1NI5A 2YC4C 4K26A 3KX2A 2GWRA 1KK0A 1YB7A 3CCBA 5J1SB 3UOWA 1EVEA 3DTTA 2GAOA 4OI4A 3G5AA 1ZGCA 3FUCA 4M9SA 3FDXA 2YHSA 1CJUC 3VC7A 2PSDA 4WVLA 4GMGA 1UD8A 1G7SA 4JJ7A 2RAVA 2A0YA 3PJFA 4HO1X 5BRJA 2B21A 5DJ5A 4JLVA 3VPDA 2H92A 2UYHA 3WC4A 1THGA 2ZR0A 3P32A 2AZXA 3BWXA 3IUSA 1EQAA 2H7CA 4ND8A 2FQWA 3FPHA 2XX3A 1AZSC 4GYYA 1F2UA 2CXPA 2PUJA 4G36A 4LOKA 4E4RA 4EQZA 2R60A 2AR0A 3C6ZA 2BL4A 2D3WA 3QF7A 4UMVA 4EX7A 5BNZA 3FBGA 1ISFA 2FEOA 3VOSA 4EGSA 1RYMA 2CMHA 3SAJA 4JV5B 4B3JA 1EDZA 1P45A 5E2BA 1Q0TA 4R81A 3J7AC 3EGOA 3KFXA 4NYMR 2JDIA 1Y3AA 4YAJA 5JATA 3Q7PA 1MJ5A 3OSZA 3ITKA 1G41A 2AQHA 2X9QA 4G6ZA 4PEVA 3WDMA 1QGUB 4YXFA 3MILA 3CEHA 5D5HA 3ELWA 2BFFB 1V5GA 1X8LA 1QWSA 1NJFA 2EGUA 4L95C 4ALIA 4DV6B 2YZGA 1E89A 1SO8A 4K9QA 5C34B 3T54A 1JU4A 2VHXA 2W6JD 5JNTA 3GCWA 1RWQA 3QK7A 4DMHA 4ZN6A 1K7SN 4UBOA 4DBLE 4UCXA 4GECA 4CMJA 5A03A 5J1TB 4RHCA 3EXEB 1J2RA 1XWWA 4HAXA 3QVTA 4MP6A 3DE7X 3I0NA 1P5FA 1YB1A 1NR1A 4H7JA 1MOPA 3BD7A 4BMCA 3O1HB 3TB6A 3L06A 2CDNA 1BCSA 5H4GA 4M1TA 4ISCA 5CXSA 4KJXA 4Q0MA 5IS2A 1Z18A 4OQPA 5JLAA 1LJUA 4KQGA 3PD7A 3ZNPA 1EZZA 4J7XA 4L8GA 2WA2A 3B6MA 3QFSA 2QRZA 3OCWA 4OGGA 5ECYA 1G8MA 3CISA 4BVEA 3P9NA 1HDXA 3FVRA 3ZTTA 2Q62A 1MO6A 2JH9A 2QLLA 3QU2A 1RJEA 3H2YA 5IYWA 1P33A 4KYTA 3K05A 1JLRA 4TMXA 3O4HA 5T4HA 3T7TA 1V5EA 4EEKA 4MDFA 4AY5A 2MSKA 2OUKA 5DNUA 1GCUA 3TM5A 2ABWA 3UJ7A 4OUDA 1ZOIA 5K5EA 1O4WA 1K6EA 2R6AA 2VRCA 2FETA 2GJ4A 4XQCA 2VWQA 4KW7A 1JA1A 3LX6A 5EPUA 3R7NA 1R8XA 3M6LA 4KVGA 1KP3A 1VHLA 4MWBA 4L5CA 2C4MA 4CIBA 2HJVA 4FFBB 5JYBA 2WI8A 1FL9A 2CMGA 3L8FA 2W6ID 1YO6A 3AESA 1SBNE 2ZRIA 1U8ZA 4ZGBA 1DXYA 4NDZA 3T7CA 5A7FA 4AS1A 4XLLA 4JC0A 4D4HA 4XYGA 2A57A 3IHWA 1I7PA 2Y93A 4Z53A 5FYQA 3RYFA 2R5FA 5FB3A 1FFSA 3HP1A 4Q4JB 4S1NA 5FULA 3U19A 1TC2A 4CKZA 4IKOA 4DIUA 2IEDA 2WYVA 2PZKA 2RGGA 4KLRA 2FF7A 1F60A 3EW9A 4RPIA 4E08A 1B00A 4GT1A 4IZ6A 1S7GA 5BT9A 2WWVD 2VK2A 1E9BA 3M5CA 4KQ2A 5EKXA 2FUKA 2BP7B 2JZNA 4DLZA 2O0LA 3MC1A 4MUMA 3CIFA 4BMPB 5I01A 1UADA 2VWGA 4DLVA 5I8PA 2YY6A 5ESDA 4JGBA 1GVHA 4YMTA 4YAGA 3QOYA 1K7YA 4I7EA 4L0QA 2ZTLA 3PUJA 4MWCA 4AXXA 2ZT5A 5KTKA 3AP3A 5HOEA 3DA8A 1FW8A 3PQ3A 1E9FA 4WVFA 1T4BA 3Q3GE 3NJRA 3T7JA 3I4FA 2JG3A 3Q3IA 1Y5LA 3VV3A 3PC4A 3EVDA 2WKSA 1Y8RA 4M0FA 3T4XA 4Z2AA 1DEKA 1ESNA 4PW0A 1V95A 2Y4OA 2Z1DA 3JR7A 3FLMA 4RY8A 4P3XA 4YRPA 2HF9A 4I55F 5LNK1 3WA7A 4G7XA 2J9YB 4K7JA 1PT5A 7GPBA 1HZZC 2OGSA 2PH3A 3FIJA 2IHTA 1IBRA 4UHHA 1XF9A 3SYTA 5JJKA 2GN6A 2ZI7A 5TEWA 1N75A 2NV2B 3T3EA 2AFIE 3DJFA 2DETA 3L4BC 1B0AA 3D8UA 3HYTA 2HLHA 4P4LA 2QPOA 4WA7A 4W63A 3RU7A 2GZHA 2ZJ6A 1N9KA 1O96A 3MINB 1J9EA 1EG2A 1T9AA 2WSMA 3E1KA 4XX0B 5FORA 2H29A 1A2BA 5FQNA 1GSAA 4RIEA 3KEFA 1RACA 3O4IA 2FWBA 3PGA1 3AB3A 4DAOA 2GPNA 4NYJQ 2MYNA 3LLVA 1CY2A 1OHHD 4OD0A 4AJKA 3PC7A 4UHCA 3RYFB 3W2EA 1V5WA 2V6IA 1WS6A 5BUQA 1TGYA 4BQSA 3KLPX 3NV9A 4XCQA 3W5AA 4NBNA 4J4HA 2EIXA 4LAFA 4R41A 1DJNA 3P4XA 3P5SA 3G02A 4OH7A 4Z9BA 4XQFA 1T8YA 4F12A 4FGUA 2CNLA 5AQ1A 4WQMA 3N8NA 1PNVA 1TNDA 3M4NA 2W6MA 5FPYA 4L6CA 1T4GA 4JX9A 3ZYZA 2VXYA 2PWZA 1PTJC 2P0AA 5FBVB 7ADHA 2C2XA 4RDKA 1F6DA 2FZEA 1GRVA 2G9ZA 3D2LA 5A4KA 1ZHOA 1WUTA 2XMDA 4YXWD 1TPYA 1PBTA 2PRIA 2D74A 4JLDA 2L0XA 2ZB3A 4JLAA 1JSZA 3D8BA 2VK4A 2WF6A 2WQZA 1VSUA 3E9CA 4MGKR 3ZQ6A 4HNUA 1SBYA 1ZK0A 2FZGA 2J3MA 4QDTA 3VO1A 5EIBC 1ESZA 3ZNNA 2X15A 1T2EA 1BKDR 3DV0B 1XDUA 3OHSX 2XE6A 3AEQB 3V4SA 5TGTA 1RJ9B 3H9JA 3N2EA 4DJAA 1JHYA 4I5IA 1AGPA 2ZGVA 3B1KA 3OCVA 3SFTA 4N5LA 2H52A 2R3SA 1EUCA 1LSJA 2RB5A 1H2WA 2V7QD 3KBOA 4TSFD 4ZRNA 4F3RA 2B98A 3AY7A 3IUBA 4V1CB 2DBZA 4IMRA 1Y6QA 3SI7A 1TKCA 2AQIA 4AP6A 3K0BA 3R3ZA 5E7IA 3BN3A 2ZJOA 3I3SR 1U9ZA 4XRRA 2W43A 3K0KA 3ZC3A 1KFCB 3F7TA 4EGJA 1M2JA 4FFNA 4OHZA 5B4VA 5KHLB 4S04A 3ISVA 5LFAA 2A7XA 2GH1A 2PSEA 1BQ3A 4CU2A 1IXSB 2Y1KA 2ZI4A 5E0KB 1W4ZA 2QEQA 5LB4A 1QPBA 3ZY3A 5HMMA 1EGHA 2B37A 4AY3A 4NCKA 4E5PA 4YAIA 1Q0LA 3OVMA 3PUZA 4LJ4A 2PGJA 1R9NA 4HZIA 2IOYA 2G17A 2A3RA 4GHWA 5AOBA 1Q9SA 1IOVA 1VL6A 3W8DA 4YDQA 5AVSA 2Y0CA 2AKAB 3ASQA 2P4QA 4DDTA 4L9WA 1SCDA 2ZTGA 1TDJA 1G6HA 1VP3A 3B1YA 4EFLA 3CZ4A 1GPAA 1KAEA 3UMRA 4PHGA 4OXIA 4LDJA 5JQWA 2V7TA 1AUVA 2II6A 1YU6A 5U1PA 1JYEA 4L78A 2IE8A 3C8DA 4EVRA 1ZIYA 1JAHA 3PYMA 3T7EA 1M73E 3NWPA 3TRFA 1F6WA 2RHDA 3FPLA 2QR2A 2R8BA 3M8KA 4NCJA 4Z1MD 2YHUA 2VZLA 3C8MA 4EMSA 3PEWA 5IVIA 5K3FA 2HMSA 3FKSD 1SUBA 4XH9B 1OE0A 2WAXA 2UV8A 1T3ZA 2W8BB 1J22A 3JD1A 3TTYA 3ZY6A 5EJ9A 3CF6R 1CSEE 1L7MA 2FEWB 1QHGA 2I7DA 3HUUA 5IDVA 4BUCA 5HGXA 2CLSA 4TS9A 3I01A 4ZCRA 1FNBA 2QM8A 5CLLA 3G5UA 3AV3A 3K4QA 2HK8A 3BY2A 4RVUA 1MVNA 1KEEA 3ICQB 3KWFA 2LV8A 4I1VA 5K8IA 3UJ3X 1ZNYA 4XLZA 5DHTA 1XZDA 4BNTA 3X1ZA 4GH5A 3RAEC 1GEGA 3O1IC 4CN8A 4EHNA 1BHJA 3GLFA 3GLUA 1L5RA 1I1QB 2WWXA 3L01A 2ZVQX 2DRIA 4GXNA 4MINA 1JILA 1UBHS 3ILXA 3U7QB 1ZD2P 3ONDA 2G70A 3OX3A 2RHHA 2JIZA 3GLHB 3NYWA 1IZYA 3GCZA 4RK7A 4OTZA 4B3CA 2OLKA 3SOPA 2Y05A 2BSQA 1P72A 3ORQA 2ZP1A 2DIEA 1BCRA 2R65A 1EZ1A 4K87A 1XVIA 5KNDH 3KAKA 4EO7A 1JG3A 3A4TA 3TRJA 4YUXA 4IEFB 4QEDA 4WESB 1R0KA 3HU5A 1C7FA 1X80A 1NC1A 2KQUA 2YIMA 2Z8XA 2ZJ3A 3U44A 1P80A 2DTDA 1JWBB 1TM2A 2R48A 1C3JA 2DHDA 3O3MB 2XB9A 1UXHA 2P6PA 5FAKA 4AG3A 1K3FA 1QHHA 2IF0A 3EDMA 2P75A 3GP5A 4RU1A 2CVPA 1RTKA 4H6VA 4U2DA 1SKUA 1TJNA 2OHJA 3FZGA 2F7SA 2O2YA 4EPYA 3KJZA 4IDBA 4Z0PA 5DE3A 4IWXA 2V7BA 1N1DA 3OOJA 4MLDA 2O8EB 1VKRA 1G0OA 3ZWVA 3UQZA 1KDRA 1SUDA 5ALXA 3JQFC 5IYZA 5KQMA 2ZRPA 4C7XA 2OY0A 1A7KA 3K6KA 4Z7JA 4MUAA 2HQ1A 3PVCA 2XDQB 3H8JA 3ND8A 1VCNA 4ISBA 2PWBA 5B58T 4JXXA 1LD3A 3ZXUB 1L7DA 4B85A 4NICA 4GL2A 1WUYA 4NG4A 4Q3NA 2PWPA 5EUQB 4A0HA 2Z56A 1SZPA 3M1YA 3N2NA 1KSGA 1RAAA 2RMKA 5FBZA 3S70A 3SKXA 5I7AA 4ZDWA 4FDUA 1A7JA 3QG1A 3IP7A 2ODAA 4IH1A 1R1DA 2F8MA 4LF8B 1TX4B 3FTNA 1TB4A 2BEUB 3I61A 1EUDB 3O84A 3KOUA 1BDMA 5CW2A 4NBLA 3L46A 4JVMA 4YP0A 1HE1C 2REQA 2VYVD 1MFZA 4G0NA 4CR6A 4E6PA 4W5OA 1UD4A 1T1SA 3NHLA 4NE9A 4HUQA 3KQKA 2A92A 1KFEB 3T3IA 1T91A 1W85B 2POQX 2JLUA 1RE0A 2AJCA 2Y9PB 3LLUA 2XA9A 5DULA 4C7OB 2HWKA 1KQOA 1T9KA 1Y1TA 2RB4A 5DU2A 3TLZA 5IT5A 1JJVA 4AKGA 3B70A 2PIAA 2MCFA 2HSJA 4RV9A 1UDBA 2Z6VA 4YRDA 4ZVMA 2BFDB 4RA9A 4IIBA 3TWOA 1XQYA 4MH0R 1TVKB 2BGLA 1KYTA 4JB8A 4M60A 4UPVA 1H2RS 3ZHTA 4B79A 4P83A 3U61B 1IZ7A 3WQSB 4RTLA 3OU2A 4NJMB 4KBGA 3PX3A 1N25A 3BORA 3AEUA 4AROA 4Y2UA 1X38A 2JKZA 2P3MA 1PO7A 3QVKA 3PHIA 2EKLA 3OTGA 3TLBA 3M5PA 3F5MA 5KAPA 4C4TA 3CXRA 4XLAA 4IDGA 3WL8A 1FDUA 2BHNA 3VAZA 1A9XA 3CCQB 1E2BA 3AP1A 4F45A 2CHQA 1MH1A 1SB9A 2GUWA 2XCLA 4WK6A 1QWOA 1A9SA 2F9FA 1QO9A 1L4GA 3WRWA 5FYDA 4O2BF 1MX1A 4M87A 3UXEA 2ZULA 4J3FA 4CKWB 1TVCA 1KAGA 3MBIA 5AUQA 4DDUA 3WGJA 5JY6A 5E1BA 3M81A 3CHYA 3O8DA 4QXRA 5IUKC 1MX3A 2R1ZA 3KJXA 3MCVA 4C4XA 5JR3A 3Q6NA 4DV5B 3KSUA 1A7UA 1ZGAA 1Q11A 2Z8YA 2NO0A 3AUUA 2VT6A 1MG5A 1CFZA 4PC2A 1JDPA 3AL3A 3JD4A 3EW7A 3GA7A 2B35A 3KEQA 4YFYA 1KU6A 4M83A 2XZDA 4MR9B 5FTKA 4FE3A 4ADSG 1RHUA 2XUJA 3COZA 4MV5A 4ZV9A 4DCTA 2IHNA 2P69A 4PAQA 4KX3A 4HAOA 3KJNA 1XAGA 3FMVA 4RM0A 3QEMA 1K4YA 3DL7A 1C3OA 1U8TA 2G1UA 5CDFE 3IEPA 4V0MA 1FSGA 3Q15C 4HNTA 5FUYA 5IAAA 5LM3A 1DCTA 3G89A 4OKIA 3UATA 1UOOA 3LW8A 4EG7A 4P86A 1IVYA 2VJPA 3C3XA 3W3AA 2RK3A 4CRWB 2ZAIA 4TTRA 3TZBA 3K92A 1Y5RA 2QG4A 3DFIA 3GO4A 4ENWA 1WKBA 4D45A 3U80A 1M75A 5GV7A 5KYVA 3WBJA 3GLVA 3JQPA 1STOA 4TMFA 3R3HA 4KXYA 5FWXA 1VQ7B 1JHPA 2TMGA 3KOZA 3DMFA 1EUZA 1WSBA 1Z37A 2P2NA 2PGXA 3HPRA 4FONA 4UU8A 4DILA 4DLPA 4DY4A 4G26A 1WPCA 2FG7C 3W7VA 5HZBA 2IUEA 2PRZA 1FFDA 2FN7A 5I8ZA 1R74A 4UTXA 5B3JA 1U28C 5FWYB 4DLYA 3S1AA 5IAOA 2FX2A 1Z29A 2MSLA 2WZDA 2BGWA 1R0ZA 2XA1A 1XZJA 1PDWA 2QSJA 2HJ9A 4XR6A 3K9LA 1H42A 1UK8A 4KRGA 4P5PA 3RBAA 3V6LA 2HA7A 4LE2A 1QNLA 2MMCA 4ITUA 4RPKA 1N5OX 2NUPA 5JMOA 3UAVA 3DBOB 3GBVA 3KSDO 4X9XA 4R8KA 3EPRA 1R00A 1CUAA 1RXVA 3UCEA 1P2UA 3GFFA 1JDUA 5HKKA 2H5JA 4D0RA 1GPJA 1GG8A 4PCAA 2Q3FA 3DC7A 2ZZNA 2AC2A 1N6LA 2CDRA 2FUNB 2QN8A 1G21E 2Z83A 5T4EA 4BO4A 2H4JA 4ZYXA 5IM5A 5AP9A 2EEZA 3GEHA 3H4MA 2W6PA 1YBAA 2IDMA 1VQ5B 4OG2A 4QXOA 5ICSA 3GRFA 4GKKB 3HJCA 4PWYA 3LPCA 2ZPTX 3ZE8A 1A97A 1FQKA 1O94D 4DC0A 5JQGB 1NRJB 1FDRA 1NXOA 3G9XA 1VYHA 1I51A 4IZOA 2PFKA 1U1CA 3ULKA 2C5GA 4QLAA 2BVNA 5G0SA 2BONA 3NOQA 5LYYA 2ZJFA 5FLEX 1W5FA 1H3FA 1HDYA 1Z2NX 3GDHA 4R40A 2V97A 4RS4A 4ZZIA 5JYDA 1UOQA 4MRVA 1YJNB 2WSSA 2VT3A 2SCUB 1BU5A 3G23A 3QU9A 3CVJA 5H82A 1YR7A 2RHBA 3EC7A 4FVTA 2AXNA 3HVKA 3VYRB 4WZZA 3T4UA 1Z5PA 1TZCA 5BSTA 1OYVA 2BP7A 1FY2A 4NBRA 2XLCA 1M8PA 2IY9A 5CT4A 1PR1A 1G4HA 5AK6A 3I1IA 4WAUA 3TVYA 3G5LA 1R8SA 2EF1A 2PH1A 3C85A 4HLUC 3W3AH 3WWEA 1B1CA 3RHTA 1U1GA 1GWNA 1VE1A 2EU8A 2HRRA 1L4MA 3ZR4B 3SVLA 1V3VA 1JKMA 1C1XA 1MOSA 1RXSA 2EV9A 2H1CA 3HZRA 5GOZA 1Z56C 1R12A 2ONJA 4V0NA 3T7DA 4GMHA 2YN0A 4MYUA 1EQ2A 2C2KA 3ANXA 5DISB 4WKBA 5JUWA 4EJMA 4R1OA 1ZJWA 2FOIA 3IBYA 3I0ZA 4RJ2A 1U8AA 1P7VA 3OZBA 1DO2A 1BA2A 1DWOA 1G4UR 4GOMD 1OFVA 3EDCA 1G5PA 3A7EA 2BPOA 3V4RA 1Q7GA 3A35A 3PCXA 3GEIA 4PNEA 3EZ7A 1MAUA 4CV0A 2IUUA 3H5TA 2XHZA 3ASYA 2EL7A 3L41A 1QIFA 1HUQA 3F6CA 1TE2A 2FUCA 3G9ZA 4HMPA 2Y2UA 3ISJA 3CJQA 1YBMA 4RETA 3DKPA 2BHRA 2C78A 3CMEB 4JROA 3OF3A 5AVJA 2H1HA 3FZEA 1V6SA 4RELA 3EEOA 1LBEA 1H22A 1QMPA 2M2IA 3L7OA 1JEQB 4ZDJA 1XR3A 4LDNA 1N0HA 1ZM2A 1OUMA 2HL6A 2X9NA 2JCXA 3CONA 1EGQA 3VO9A 3RYIB 4KPUA 3LBIA 2VJDA 1SOVA 4N7MA 1H5UA 1GTJ1 4NOKA 3KHUA 1X1EA 5F4OA 2Q5QA 4B6JA 4TZ0A 1CQIB 2HIMA 4K2HA 4ZOEA 4EVQA 2DGDA 4XARA 3NCTA 4B44A 4LF6B 4XVRA 2I3ZA 1NJSA 1FYDA 2F3QA 1DTEA 2CJPA 1G4AE 1ONNA 2Y1XA 2CYAA 4GVPA 5JNSA 5DNYB 3A04A 3JZFA 5EZ6B 1XQ6A 3AOEA 3GT0A 4KGXA 4QRHA 4DCGA 2BMVA 2E21A 5SZKB 4D3XA 2P9TA 4D0LB 3ASUA 2QSZA 2PVCA 4TT3A 4K9MA 5TJ9A 3PPWA 1DAOA 1WABA 3L6RA 3ZWBA 2HBYA 1G8HA 4I1SA 1NP6A 3I2FA 4Q37A 4NQRA 1BH2A 3TNFA 3TW8A 1GZSA 1E60A 4KR3A 4A8PA 1GT91 3TOVA 3CA8A 4P7GA 4NHEA 2W6ZA 4P82A 6REQA 1S89A 1X9IA 1II8A 4M8IA 2P40A 1CR2A 3ABQB 3VYWA 3QBVA 1U99A 4NH4A 5YASA 3G71B 4EHDA 5ES4B 1I1HA 1CCWA 3IHKA 4LSWA 4XEHA 1PQPA 1B2LA 3OPQA 3UC5A 1Q74A 2XJ9A 1FUEA 2F64A 2FN4A 1ZIDA 1YONA 1KZ4A 3A28A 4NCXA 3TW8B 4C05A 4LBYA 1TIBA 4O4LF 5D85A 4RK6A 1FQWA 1VHJA 3BMCB 5J40A 1RXUA 4QPZA 4BO0A 4LKRA 2WE7A 1Z4LA 3FI9A 1O03A 4DJ5X 3BSSA 3HDQA 1WETA 1IN5A 4UZSA 2BEJA 4F3YA 4PRLA 4CEIB 1SBCA 2VQEB 5D5PA 1Z7WA 1Y33E 2IHZA 5KCZA 3WJ1A 1L5HB 3I5XA 2WWYA 1JLLB 4IX1A 1HTTA 4GKAA 1F5NA 5E95A 4IJKA 5IK2A 5CM2Z 2LW7A 3OM0A 4PRYA 2GD2A 2I87A 4W5RA 4N7JA 4B3FX 1WKVA 4BX3A 1ZN9A 4BNIA 1GGHA 1GKKA 3CM0A 1T1IA 2BC9A 4HQLA 4DCPA 4HUTA 2DWQA 4Y2GA 1EYZA 2PVPA 3ONVA 2GEVA 5E9QA 1KOGA 4JJAA 1NQAO 2AG8A 3M6FA 3MWGA 1I0LA 1XZPA 4OOEA 3VDMA 1P91A 4QGGA 5FNZA 1E7YA 1W2HA 1WTCA 3DCNA 1H0HA 3PS9A 2W9XA 4H7HA 1SKQA 4DE5A 2IPOA 2BCJQ 1XZFA 3G2MA 4UZEA 3T1OA 4HDCA 1A4RA 1TQ2A 4HATA 3RR2A 2DE0X 2R2GA 4CGYA 1QANA 2PK3A 3DZCA 1JHUA 1YHZA 4TMTA 4IJVA 2WHQA 1K8RA 3PQ6A 3OT1A 3SE0A 3EYAA 3UK2A 4B3BA 1Z6XA 4YT4A 1E5DA 4B31A 3UJNA 4ARSA 3VDRA 3LDAA 3HUTA 3X2SA 1QK3A 3OTQA 1ZJJA 4JHXA 3G2QA 2YWCA 5KCMA 4Q7MB 4Z4EA 1GPDG 2AEJA 1U2QA 4IV8A 4PZ0A 4EY4A 3GF4A 2IHJA 5C7YA 4QDZA 2V0CA 3E15A 2BSAA 3HCBA 5AJYA 5SY4A 1XE1A 4BKUA 1L7XA 3TJZA 3Q6MA 4D25A 1EXNA 1S5PA 4IUDS 4GQNA 4G63A 1Q17A 4DDWA 1DV2A 2GAJA 4OPVA 2BW0A 2WAMA 2V4MA 1OXUA 1JR4A 1CUBA 5DM60 2L19A 4REQA 1KKLA 1XBTA 5JHGB 3RRYA 4OAPA 4NBWA 3QJGA 3SD7A 4GYWA 1N36B 1SJ9A 2I2FA 3WLNA 2QNBA 4FDVA 4TRJA 3PENA 4INAA 3EIWA 1ZI6A 2VNJA 4ENTA 5FI1B 4O1IA 1HOXA 4OLBA 1SEPA 3TGLA 1GUZA 3OEYA 4OJMX 2AWNA 2IFTA 1KPIA 4X1KA 5JMWA 3JWJA 4FFBA 4M0UA 4EG4A 4NK4A 4G24A 1WOMA 1SHUX 1JE1A 2IUSA 2XUGA 5L3VA 3GJ4A 2VYVA 4YLEA 2OEPA 5LA6A 1YZGA 2X6WA 4BX0A 4PG8A 3CLHA 3L8GA 2J3JA 3AF2A 3QHPA 2HMWA 4QBHA 4A6EA 3I5AA 3UAYA 4IIJA 1RJDA 4JZKA 4DCUA 5ABPA 4Q3EA 5EWLB 1NFRA 2RHRA 1SUPA 4LCBA 4Y6OA 2GFQA 3VBCA 1A27A 1DRJA 4IRXA 5EIEA 1XXHB 2BMJA 1E6EA 4X20A 2G7MC 4X63A 3P94A 1AZWA 4K9LA 2JFYA 3CG0A 4Q9AA 1TUEA 4MWOA 3U4QB 4GR4A 3H5RA 4H08A 1J06A 2VI5A 3HBMA 4PO8A 3LMKA 3AQ4A 3SU8A 3OAAA 5L51A 1UD3A 2ZLBA 1Q0RA 3RT9A 1DOHA 2QY6A 5CLIA 1DKUA 1SCQA 4OBWA 4WY5A 3OCUA 4KZPA 1JH9A 3SF8A 2KWIA 3SMQA 3OEWA 1QK4A 1NVAA 1YRYE 1CP2A 1C0PA 5F4JA 2C04A 4I4TB 5K0JA 1QU2A 1IAVA 1DIRA 1W0KD 3C1OA 4B6FA 3EGCA 4KPEC 1PJRA 2GPAA 1XK6A 4BUZA 4LWPA 3BIFA 2OQ2A 3A10A 2PX3A 4YY3B 1N1EA 3VHXB 2J5RA 3E8XA 3KEOA 1GGEA 3IUMA 1TO2E 3PNKA 3LYHA 4KC0A 4RCZA 1T5IA 3VZDA 4NE7A 1XFDA 3GL9A 3JQDA 4G1MB 1YR3A 2I4TA 4ESHA 3OQNA 3ZHZA 3W78A 4KAXA 2XGJA 4EYOA 2P2YA 2PAAA 2O4UX 2QWXA 4EELA 3EHEA 2H9YA 3LE8A 1GAXA 1YCGA 3FPJA 2LR0A 2O3UA 2FV8A 4TYMA 3TD9A 3RASA 3V9PA 1ZI8A 4G07A 1M6VB 1WCIB 1YE5A 1ZNQO 1W9MA 1Y8AA 3BFJA 5TJHA 1J90A 1ORVA 4H16A 3D8HA 1EG7A 4ZAGA 2ZSJA 3GT3A 4OLAA 3OFVA 2GQFA 2QAGC 4DKJA 5GV8A 5AKXA 2NPFA 4MJ7A 5GZ1A 2YWRA 4YMGA 3I8OA 4XFJA 4ZV4A 1QDEA 3UAGA 2WHPA 5DLEA 2ZDGA 1ODJA 2MR6A 2UYGA 2XCIA 4MIYA 4NULA 1NDHA 2XTNA 3ZY2A 1HV8A 1VMDA 2R8YA 3KTAA 3L02A 1IE3A 4JU9A 4U9HS 5EPEA 2IHKA 1JJIA 1N06A 3KSRA 4R69A 4L74A 5AK0A 4DEYA 3OHMA 3H9GA 4GYKA 4R83A 2R00C 1CUEA 3K5IA 3SR3A 3A9TA 1MRZA 4FGWA 3OPYI 5EIXA 3UJBA 2HQBA 1I6MA 1C0LA 4G4JA 2DSNA 1IN1A 1DS6A 3DV0A 4TS3A 4UDXX 1VHOA 3I28A 4E09A 1FJXA 4X8OA 4GRIA 4HXGA 1SUIA 5KSYA 1SUEA 2W2LA 4J43A 1MC4A 3UT5B 4MRMA 3TE6A 4UQLA 1VIAA 4YV0A 2XXAA 3MT8A 3GNLA 4LWOA 1II0A 3G0CA 3K6SB 1OGJA 2OC9A 2YQ5A 3WFZA 1W49A 4G84A 3OIWA 5EQFA 2IV7A 4DIMA 5ALIA 3GCGA 2CHUA 3X1KA 1LZLA 3NWEA 4PYKA 4NX2A 4QTXA 2I7TA 5DNVA 4RYDA 1FU8A 3SC3A 1LSOA 3D2AA 1ZA2A 3H2ZA 3JQ9A 3U9SA 1KKMA 2WF9A 3HNOA 4D4MA 4I50B 4U2BA 2WJZB 5KAMA 2BZ1A 2PRSA 1SHLA 1UC8A 3UB4A 2GNPA 3AL0C 4J07A 2PUWA 3DEJA 2P30A 5JXJA 2WILA 1DKLA 1A9ZA 4V38A 1UZNA 1VMAA 1Z0AA 4XJSA 5EWJA 3HUFA 1N3BA 1L5ZA 4WD3A 1WXWA 1P81A 2FE4A 4UEOA 4ZYZA 2CV2A 3OEED 1UXKA 1QRAA 2ID9A 3CNNA 3F49S 3P1JA 3P0EA 4WX2B 3AB7A 4Y2QA 4TTQA 2A9QA 3RTEA 1PR0A 3AY6A 3ODGA 2C4UA 4K9NA 4FZRA 4P0TA 2E82A 3CTAA 1L4KA 1T24A 3EBPA 4QE3A 4RLQA 4M1MA 5J4HA 3A4VA 1RHRA 2BLNA 4LZWA 3RUDA 2ODTX 2UZ3A 3E70C 4X1KB 4MRSA 4CETA 5HZMA 3ZZ1A 3AHCA 5JXWA 2PU5A 1JIQA 3K9HA 4LXYA 4Q3LA 1GL7A 3WSWA 2ECFA 1XDDA 3OWHA 5ALQA 2D1SA 4RADA 3JYOA 1T5EA 1Z12A 2CXHA 4L51A 1AG9A 5IVDA 5TV2A 1MTOA 2ECOA 3RHZA 4ASUD 4G3XA 4EL5A 5KYWA 2YINC 2RJOA 4R6WA 1NATA 1Y1KE 1ECCA 2ADFA 5KVCA 4RFVA 4XR9A 3FFWA 4B4KA 4A8JB 3BFXA 3L93A 1FYFA 2NWQA 2FWMX 3NC4A 1VBNA 1HNXB 1I2DA 3VZQA 4OHVA 2FN8A 1QH1A 5BQOA 1LBQA 4OGLA 1AY0A 2UYQA 1CUVA 5I3CA 4AN4A 1FS4A 1YJ5A 3KJQA 3K71B 4QU9A 3WGKA 1CUXA 1D4OA 1CS0A 5C35A 3LYLA 2B7LA 5KREA 1KYVA 2I4NA 1GAJA 1EU1A 1PP4A 3FFTA 5AO9A 2JJQA 1M0SA 5NLLA 1SKYB 1RZUA 3WLQA 3SQDA 1BJKA 1CQWA 1CRZA 1SUFA 2C5SA 2F1OA 1VE3A 3B3QA 1RXYA 5LZ5A 1UWCA 5C1DA 1A72A 5B6IA 1VYTA 5HIIA 4AG5A 4WECA 1M1NB 4MW4A 4QWWA 1KFBB 1H6BA 5CM8B 3ZWXA 3CXUA 1IQUA 1USGA 4Q03A 2F4VB 2K7ZA 3F4BA 2RI0A 2E4VA 4FFMA 4NJEA 3C74A 3UGTA 5HKAA 4FHDA 1Q91A 2K6GA 3K70D 1I94B 1I01A 3OM1A 4IO0A 2C7QA 1LU9A 3O26A 2QY9A 4J9UE 1E9RA 2N9UA 1AQLA 1J00A 2HW8A 1Y98A 1KDPA 3ILYA 2DULA 1YUMA 3VO8A 3F97A 2V98A 3H05A 4OSOA 1BVRA 3HJNA 3KPYA 1K3TA 2YW9A 4FEEA 4Z4RA 1QVFB 2N1BA 4IGEA 2CLFB 2OKCA 5EXPA 2CBGA 3V1TC 4AULA 4KQIA 1SKYE 4HK4A 3DE0X 2ZYWX 1QV7A 1XALA 4IIYA 2GVNA 4JSYA 2HA0A 4NLLA 4ALMA 3EXIA 4MX8A 2ONYA 1H23A 4GGMX 3LLMA 1X0XA 1JN0A 2V6MA 3UXMA 3VR3A 1Y4SA 2EARA 2L42A 2EIHA 3ACCA 3WLSA 4IUBS 4RZHA 4UULA 2AG1A 5H3CA 2PH7A 1TA4A 3P27A 2ZJ8A 3BTOA 3LDUA 3MTAA 2Y27A 1P2TA 5TY0A 2PYIA 3PFGA 1J1IA 1EA7A 1OFGA 2JDID 5CB4A 2NSHA 3O2NA 2OVBA 3KOOA 5FTWA 2YYZA 1QG6A 3JQEA 5L8VA 1J5PA 5JPIA 3E0XA 1PJ3A 1W76A 3GVPA 3ZLTA 1JDTA 3HMKA 4EJ0A 5KWIA 2OGZA 2BFOA 3HR7A 3WGZA 3QKIA 1KVTA 3KD2A 2W6JA 5JT1A 4G41A 5EQTA 1JLKA 4ZCIA 5GWXA 2OYCA 2I2DA 2YXLA 3N2GA 3QBEA 1WKCA 3ZGLA 3S2YA 2VN8A 2C4NA 3DAGA 4I1PA 4LV8B 5U4XA 3BSFA 3MOGA 3BE4A 4XSVA 1OH7A 1MABA 3KC2A 5FUVA 3LUGA 3GBPA 3IE2A 1GPLA 5THXA 1AF4A 1CNFA 1OJLA 4H1VA 5DYYA 2ZXFA 3VKUA 4EPXA 2A6PA 3U6KA 2HMUA 2VP6A 3BQJA 3OFSA 1QKKA 4R2LA 5IUNC 2ZREA 2G8NA 2GPSA 3LVBA 1Z82A 1TZ2A 2KMLA 3R0ZA 5ALGA 1HEUA 4BKPA 3LY8A