3ZBTA

Ferredoxin-nadp reductase mutant with ser 59 replaced by ala (s59a)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQAIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title A Hydrogen Bond Network in the Active Site of Anabaena Ferredoxin-Nadp(+) Reductase Modulates its Catalytic Efficiency.
pubmed doi rcsb
source organism Nostoc sp. pcc7119
molecule tags Oxidoreductase
total genus 94
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3zbtA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3zbtA02
1CNEA 4FN5A 3CXCB 3A1FA 2OTLB 5TR9A 4ZGQB 1M1KD 2C78A 1N0VC 1TTTA 1XE1A 1UMKA 1FDRA 4TN1A 4YHBA 2EFGA 1H85A 2B7BA 2NPFA 1OGJA 3WXMA 5H5JA 4P6VF 2HMAA 3JQQA 3J81k 2PLFA 1KK0A 1G7TA 3MHPA 2OTJB 1IJEA 3AVVA 1S0UA 4PC3A 1ZM3A 4U9UA 4P3YA 1KK1A 3CCLB 3E1YE 1YJ9B 3QFTA 3CCJB 1A8PA 1QVFB 3OW2B 1G7CA 3CCUB 1EFTA 1EXMA 4AF7A 1QUFA 4N3GA 1ZM2A 1N8RD 2GPJA 1EFCA 3WYAA 2VNIA 4LBVA 1CQXA 3CPWB 1YI2B 4RJLA 3W5HA 4HE6A 1JA0A 1N0UA 1W2BB 2E1RA 4PGOA 2RC5A 2BV3A 1VQ9B 1I7PA 4H9GA 1E64A 4ZGNB 3ZZTA 1EFUA 2BF4A 4AF6A 1QX4A 4B44A 3LO8A 4YALA 4ZV4A 1VQOB 1JNYA 1TLLA 5DSZA 3AVXA 2BGIA 3QSYA 1B2RA 2BM1A 3CC2B 3VO1A 3ZZ0A 1VQPB 3FPKA 4G1VA 3LVBA 4YAWA 3W5UA 3CW2A 1GAQA 1YITB 2VNHA 2QMUA 1KJZA 4NCNA 2DCUA 4RD2A 2BM0A 2HCJB 1F20A 1R5OA 5TY0A 1GR1A 4TMWA 2QN6A 2B5OA 3QFSA 1TUIA 1QVGB 1EP3B 2HDNB 4TMVA 4J0QA 2BVNA 1ELOA 2XNJA 1S72B 4Y9UA 5JBQA 1BX0A 1BQEA 4YAOA 3SJZA 4HE5A 1YJWB 3I56B 2EIXA 1W35A 4ZCLA 2PIAA 5AN9A 1EWYA 1EP2B 2X3UA 3LYUA 4PC6A 3CCMB 5TV2A 1SM4A 1CNFA 1M90D 2QDXA 1VQKB 4C43A 1R5NA 2YWGA 3QE2A 2QTZA 2BN4A 5KSWB 3FJOA 4B4DA 1Q81D 2BMWA 3OZUA 3OJXA 3VMFA 1QFYA 1VQ4B 4NBSA 2YWHA 1FRQA 4RD3A 1IB0A 4PC1A 3V76A 2QEXB 4LBZA 3VNVA 4AC9A 4FK8A 1OB5A 1DG1G 1KC8D 1VQ8B 3W2IA 4G1BA 3B8HA 3B82A 1GJRA 5GV8A 4TMXA 3JQPA 1HA3A 1W87A 2YWEA 2DY1A 1K9MD 4N3NA 2XEXA 4R71A 4ZCIA 3PENA 3ES9A 1QFZA 4LC0A 3W2FA 4ACBA 3VNUA 1ZM9A 1G7RA 4LBYA 4RD6A 1BX1A 3E20A 4RD0A 1KD1D 4B47A 2OK8A 1QGAA 2VYQA 2VZLA 3LRXA 1KK2A 4LBWA 1FRNA 3JQRA 3AVWA 2BSAA 2RC6A 1KK3A 3CMAB 4EH1A 5GV7A 4B43A 3P26A 3WBJA 2VNKA 3CRZA 3CCEB 5THXA 4FWTA 1QG0A 1QGZA 1XB2A 2FX3A 2QTLA 1VQLB 3OZWA 3W2EA 5FA6A 3VO2A 1TVCA 1BJKA 3ZBTA 3CCVB 3QFCA 2XNCA 4M53A 3CCQB 2CRVA 4Q7JB 2BGJA 2C77A 5H59A 1GAWA 4ACAA 2DERA 1QGYA 3AVTA 1U2RA 1DARA 1SKQA 1QFJA 1DDIA 4WQMA 1E62A 3I1FA 4QHYA 1WDTA 3G6EB 4B48A 1QH0A 1JA1A 3WNDA 4PC7A 4TMTA 3U6KA 3CMEB 1NDHA 2DEUA 1JJ2B 1D1NA 3CB4A 1F60A 1KTVA 5HXBA 1B23P 3G4SB 4RD1A 4M0LA 1K8AD 1K73D 4BPRA 1VQMB 3AGQA 3B78A 3W2GA 1QUEA 4RCZA 1JB9A 1FNMA 2VNJA 3W2HA 4DQLA 4UAJA 2QA4B 3AVYA 4RD4A 3OZVA 4M4SA 1KRHA 2B7CA 3AGPA 4DQKA 4Y7CA 4QFMA 1FNDA 1NJID 4Y9RA 3CCRB 2GQFA 5EMNA 2DETA 1W34A 3ZBUA 1E63A 3P27A 1DDGA 1FNBA 3MCAA 3WNCA 1G7SA 3CC4B 1VQNB 3WNBA 4C0SA 1KQSB 2PMDA 3AVUA 1Q82D 4ZCMA 1D2EA 2R6HA 4M2LA 2J7KA 3G71B 4RCYA 1VQ6B 4YAFA 4B3XA 1GVHA 3MMPA 3W5VA 4F7DA 1YHQB 1EP1B 3WBKA 1H42A 3WY9A 3U2QA 2BPOA 4G5GA 2ZITA 4K1XA 1Q86D 2CNDA 1ZM4A 1YIJB 1FNCA 4M1KA 1VQ5B 2YWFA 1D8TA 3CD6B 3CCSB 3I55B 1R5BA 3U6BA 1ZUNB 4IW3B 2AHOA 2D74A 3ZZUA 1J9ZA 4PC2A 3OJWA 1AIPA 1Q7YD 1OB2A 4MYTA 3ZC3A 4YAUA 1YJNB 3QFRA 1VQ7B 4TMZA 4MYUA 1AMOA 1OGIA 3CC7B 2OK7A 1IJFA 1GO2A
chains in the Genus database with same CATH superfamily
2Q8NA 3PFCA 4O2BF 3FDXA 3F6BX 1L5HA 1YWGO 2P4HX 1QTQA 1R6XA 5TR9A 1MC4A 2ADOA 3IDZA 1DQNA 1Y1TA 3EC2A 1Y5RA 2OAQ1 3FUCA 4INZA 1PWZA 2XSZA 3SJBA 3VR3A 4K2AA 2IQIA 1GNRA 3FPBA 2ZRNA 3N75A 2WI8A 4R7ZA 2CCKA 2V59A 4MR9B 5TPWB 1M0SA 1RBMA 2VAWA 3QVTA 4OSEA 1N77A 2BKEA 2WD7B 1TM3E 2G9UA 1A5SB 1M0TA 5HIMA 3VPSA 3EPHA 4MITA 4RELA 4IUBS 2X23A 2BUCA 2QJFA 5KWJA 3LIPA 4D9FA 1U99A 5HS4A 3DO6A 4RTMA 4NV3A 2DH5A 4BTLA 2FR1A 2A14A 2C9DA 1RAEA 2P1RA 3OE1A 2JRLA 2OAEA 4UD2A 1HFEL 3HDJA 1D2MA 3L41A 1J09A 2Z58A 5DE3A 4IH9A 5DM1A 4DZRA 1UOPA 2ZSAA 4RZXA 1XRRA 4IOLA 5BV0A 5HYVA 3PR2B 1KYXA 4R9SA 5HM8A 1T5SA 5KNCD 5JPCA 4ND1A 2O5EA 4R69A 4E94A 3A9TA 4FGKA 2FKNA 2ZTHA 4OSOA 4CTKA 2GEBA 1ZMBA 1DPGA 5DBHX 5F2NA 4FYIA 2IEAA 3EVNA 1FBNA 1ZD5A 3CVOA 3FDIA 4RPLA 4F3YA 3R3WA 1PKEA 1NT2A 3LV8A 4RH3A 4I4TF 4KPFC 4LOIA 2YXBA 4BX0A 2CXSA 3CX7A 2IW3A 2PGXA 1W1WA 1ZMOA 2P9ZA 3Q3HA 4U7TB 3NXKA 2AC2A 3DBOB 3ZHOA 1FFDA 3P9KA 1E7WA 4JP2A 3WDLA 1VLVA 3DV9A 3JQGA 4OI4A 5GGYA 1HBJA 3UPTA 4ER7A 3UFXA 3UA4A 2C07A 3QX9A 1U2QA 4JI1B 2EDCA 4ANFA 3DLBA 1ADGA 5JHGB 1ZCFA 4XLFA 3DAOA 3LMKA 4IMPA 2QYTA 2BFBB 2Q3LA 4BMSA 2R2AA 2YY5A 4PEVA 1H1LA 1WB9A 2AKYA 3CH7A 2J4FA 4YRAA 3B5EA 1X8LA 3VFDA 2UV8A 1W4BA 2C7VA 3IEUA 4X63A 1I7DA 2ZDQA 1FOEB 3NWJA 3NBQA 4S1PA 2A0YA 5ARCA 5AM0A 2ZUWA 5F1KA 2IH5A 3H1EA 1R1DA 3KSUA 1M5UA 1NBIA 3SKBA 1T3HA 2C7GA 3PNKA 5BWCA 5PNTA 3E82A 2XNDD 3EWIA 3WGJA 4CEHA 4PFQA 3ADDA 1EK6A 3L05A 4DBLC 4FFLA 1EBUA 5BXQC 5D2CA 5ALYA 5AJYA 5E1DA 2ZUTA 2IH2A 5DU2A 1X3SA 1W29A 3LCVB 4ARZB 5C5IA 4BLSA 2JLAA 3BS4A 3CPXA 1T5IA 4EENA 1WEKA 3OQ1A 2H2WA 3TKLA 2MDTA 5ESXA 4FYXA 2A9PA 3D4OA 1O2DA 2VYCA 1T6BY 1WY7A 3AZOA 5FA8A 3TLXA 2X7XA 2EX1A 3NFRA 4Q01A 3FPKA 1BXZA 2H57A 4UDXX 3ZKWA 3H4MA 4G1VA 1GTJ1 1VJDA 2R4QA 3RHSA 5L3QB 3NTUA 1FYVA 4MHTA 1JR6A 4ISBA 3T95A 3FTQA 5JXHA 1U04A 1TEXA 4FNMA 2VNHA 3QOXA 3RODA 5D5PA 5IS2A 5A3RA 1G8SA 1R2QA 5IWAB 2LDBA 1ZAYA 4Z54A 5AM2A 5J4YA 1YFJA 1RAGA 4MQ5A 4UEJA 4GDMA 2YIMA 3PTLA 3ON5A 4P7FA 3L1HA 4RJIA 3I73A 3OY2A 2FSVC 1F20A 2C2WA 3KE8A 4NABA 4UU7A 1U94A 1VI5A 3WADA 4CGZA 1F6BA 4AWBA 4YRMA 4YR9A 2B5OA 1JEOA 3DMYA 4QOGA 4EL5A 2PQMA 2RGNA 3I1IA 1CK4A 3FGPA 1YTUA 5CNJA 1JLHA 1UWCA 1ELOA 4CKWA 2G5CA 4TLDA 1TZCA 3KJGA 1Y4DE 1HT1E 3NKVA 4C78A 1XZNA 1GG9A 2OECA 1L4FA 1C9DB 1GQSA 2SECE 1GY8A 3CVJA 2ZB7A 2G7ZA 1PYDA 3IEVA 5SICE 1VLQA 4LZPA 2QLBA 1D2NA 2C5HA 1SHKA 3VGPA 2AOXA 1L7VC 1YDWA 1Y3HA 2JFUA 4ZODA 5CFQA 5BSMA 5IDQA 4PC6A 4N82A 1DJNA 2IS4A 1D8AA 1I0LA 2RHRA 4PPGA 2C5SA 4Z4HA 3MJEA 4FKZA 1Z62A 2P7IA 1IHXA 2VBFA 1WPCA 2CHGA 1NVUQ 1TMYA 1KGDA 1LFDB 1QGDA 3Q5GA 5E0KB 3TLAA 4B73A 2PTGA 2ADFA 1YDFA 3GJYA 5JFGA 2A5FA 4ZCQA 4C7OA 3FJOA 1CY2A 4PHHA 5A7GA 1DCFA 3G2KA 1V9CA 2WE7A 2EG5A 3BFXA 3LBAA 4JL6A 1UP6A 1MO3A 4KWHA 4Y8VA 1L1EA 1Z22A 1W4ZA 4BFYA 4BUZA 2GJAA 3UUEA 5AW6A 4C7XA 4YT5A 4GM1A 4RJJA 5CJPA 3WNVA 1USKA 3A6JA 2PHZA 4J7XA 2R6AA 3LUAA 4ND2A 2CNLA 4Y2QA 1JKJA 4Z49A 3A3YA 4UE6A 3T5TA 4BBJA 4XWKA 1QE5A 2NG1A 1A4RA 2Z9BA 3M0EA 3D6JA 3ROKA 5IG2A 2KM1A 5J2UB 5KYKA 4BC1A 3QVKA 2YTZA 2FRXA 3O8BA 1DS6A 5FL7D 4R1OA 2Q62A 2C9BA 2JJYA 3CW9A 5C4GB 3KDAA 4J1TA 1IY2A 4E2WA 1NMQA 4AJOA 1TRHA 3E2IA 1XFOA 5FRDA 1PGOA 2WC1A 5U4QA 4WBNF 1LVHA 6NULA 3I83A 4L3WA 2YV3A 3HYLA 1VJGA 2CZQA 2Y99A 1JJVA 4YJHB 2VPQA 5F7JA 5K01A 3DXFA 1V8BA 2ILVA 3VYTB 4YRKA 2AKEA 4TKLA 2XTZA 3G7UA 2PX6A 4QD3A 5FPYA 3THXA 1JEAA 5HKBA 1F2UB 3IHWA 2A3NA 3HXTA 1SUSA 1XIVA 3EUFA 4XWGA 1NU8A 4E4YA 4EKNB 2Z2YA 4WVFA 2CDAA 2CNOA 1Z5NA 4TT8A 5LNK1 3ICEA 4YHHB 3O7MA 5E1OA 3T38A 2XF2A 2P9JA 3WGLA 4LRSB 4UZSA 3EVEA 2ZRIA 2QHXA 1YUNA 2A9VA 1CZLA 4WE3A 3SSOA 2IH4A 1TC2A 3TEJA 3R3JA 4MUAA 4C07A 1TTHA 2PH5A 3TSCA 3V8VA 5FBVB 3NC4A 4AKIA 2YXDA 1HLFA 1T2FA 2RAUA 3DMRA 2WKPA 4KMOA 5JDCC 3STXA 5CM9C 3UQYS 5B58C 1TEZA 3H9NA 3AOGA 5K7SA 1OTXA 2M1ZA 3HBLA 4KGXA 3TLBA 5G53C 4ND3A 1TDJA 3GJ7A 3OOHA 5DZSA 5C8YA 1CEXA 1Y9AA 2DWPA 2Z2XA 4NK5A 4KPEC 4JLVA 4QUDA 3K31A 5HJ7A 3BOSA 1CE8A 4PNPA 3FYHA 4R9NA 5L3SA 1UZLA 2BT4A 3PHIA 3A10A 3LRXA 1KK2A 1WMAA 5EPEA 3OTOB 1K28D 5L3VA 2J3LA 1FRNA 3EQ8A 3AVWA 1E2DA 1YRAA 4Q24A 1XD8A 5LQSA 3WAJA 3SG0A 2RD2A 4KACA 2GK4A 4JEMA 4LSGA 3GZNB 3T9CA 1J2JA 2AG1A 4H1VA 4YNBA 3JVEA 4EHIA 1Y7IA 2VNKA 1JR4A 4H2DA 1P2FA 4QTUB 5HGJA 4YJ3B 4AN1A 4W9NC 3C2QA 2PA0A 4OQXA 2QTTA 1U1IA 2PFKA 5TB5A 4I1IA 2Q4EA 4E46A 5A5EA 1M1YE 3T1YB 2ZUVA 5FBKA 4FWTA 2AWOA 2XR1A 3JVIA 2FWNA 3ROGA 4BO5A 1L3BA 3AUFA 3ZHSA 2UUAB 3N8GA 3R7AA 1XAGA 2ZSJA 1ECPA 5B1DA 4YJFB 4JENA 4Q9KA 4Q18A 2Q07A 4EUEA 2VN8A 4CN9A 1CVIA 2A7XA 4O0LA 5AH0A 1KYIA 2Y0PA 5CIQA 3BCDA 1RYYA 4OM8A 5ELLA 4BMDA 4CMIA 4I1VA 4KFCA 2GTIA 2XW6A 5E38A 2Z6AA 4OJNA 4E30A 4HDRB 1X1TA 2P2YA 2XXBA 5E7MA 3NYRA 1UPTA 1Y6GA 3GWZA 5K8LA 5TXGA 2B0JA 1KY2A 3WGVA 3B2NA 2FEOA 4MQLA 4ZIRB 1X38A 4ZXPA 3RKUA 1JX6A 1DIGA 2KWIA 4F3CA 3BCFA 1WUYA 4NMWA 1PQUA 3ZH2A 4C05A 4B35A 2QY9A 4CEIB 3K8ZA 2W90A 3RK1A 3ENZA 3ROQA 4CKCA 2C1ZA 5KX5F 1OXUA 2ZRMA 3BAZA 3LUPA 4FYKA 1SIOA 4KBYA 4MVXA 4QJBA 2B1GA 1HYBA 4PLWA 5HA5A 4EPTA 3RAFC 2O8BA 1P1BA 5BUCA 4MVYA 2EW8A 4WL0A 2OHVA 1TJNA 3AKEA 3GOQA 4DDUA 4RTNA 4RC9A 2CXUA 5DLEA 4WLOA 1JAIA 3LDFA 2PSHA 1AK9A 2Q5CA 4Y2YA 3PFBA 4BP9A 2JPDA 2WMYA 2PAFA 3T0FA 1CS0B 3ZE8A 2QLJA 1DI0A 4HXFB 4HRYA 5D87A 4PYKA 5TSDA 2OGSA 4L8YA 4X1IB 4C4XA 4YIHA 1XVVA 4DCVA 1Z28A 3B1YA 2X6XA 3ESBA 4YMTA 5LQUA 5KS2A 1TU3A 3BK1A 1Q12A 4KXNA 3UJNA 5BQ3A 1XD2A 4K1LA 5JZ9A 2ZRCA 1KY3A 1N5MA 3G2PA 3Q9NA 2WIKA 4LDAA 4LJAA 2BFFA 4FBGA 3L7LA 1XEWX 4V1CB 1H0RA 4XASA 1VLOA 2ZRBA 3ZXUB 1UANA 2IGTA 3CLTD 2OP0A 1XPRA 5FLXA 2IITA 3IEKA 3T41A 4Z9FA 4CGYA 3CUWA 6LDHA 1KQNA 5KZMB 3B9QA 3LDHA 1G8KA 1PNTA 1PJ2A 3FZGA 4HEA6 4FMDF 4XLLA 1I24A 2YZ7A 3A06A 4P0TA 3UMBA 3QEMB 4HB2A 1PUJA 3HBFA 2H48A 4E07A 2HA0A 3B78A 1FYDA 2IYAA 2WF6A 3ZVNA 2PQ2A 4Q0MA 3HJCA 2R6FA 4OUDA 4RHTA 3UK6A 2HHHB 4GXTA 3U31A 4QDOA 4B3DA 2VP9A 2VNJA 1ZGZA 4GZLA 4HDKB 4KIWA 5F5NA 1DIOB 2Q2WA 2HPAA 5G0UA 1UDWA 3LSYA 3PNQA 4S24A 4HSGA 1HOTA 3DGEC 4XGQA 2Q1TA 4XWWA 4RD4A 3ONNA 2BTQB 3KVVA 1VDZA 3IQHX 3VU0A 4ZPJA 1NZFA 3B7WA 5BOSB 5B1SA 4HPXB 2O0HA 4D9KA 2DFLA 3PVZA 1ZXBA 3O0DA 4UUNA 3P45A 1UFKA 3GEBA 1GTMA 4RLQA 5FOWA 3T5CA 3THWA 4J3JA 3FNBA 4JNCA 5F3WB 1O1YA 1GSAA 3MVEA 4OX9Y 1L1QA 3DAFA 2GQFA 1X80A 2HRZA 1W34A 2RK6A 4TVKA 4XM2A 3L07A 2M1XA 1H94A 3WA7A 1ZVKA 5A89A 1CHNA 2PJZA 3ETEA 3IS3A 1XK7A 2F2TA 2UAGA 1F1JA 2AFRA 3BXEA 3DEFA 3PC4A 3QOWA 1XDZA 2Q9CA 3AKYA 4BMPB 5LQCA 1MBZA 2G6BA 2YFYA 3QU4A 1WXQA 2JASA 2P9EA 1P75A 2AXEA 1NLYA 2ZYDA 1UC4B 3DF7A 4JVMA 1Y34E 1RZRD 1E7QA 4JL5A 4X44A 1SEPA 3I9MA 4GOXA 2I4OA 2C5GA 5B3KA 1KAQA 2JFYA 4HAXA 4M2LA 3KTAB 3RTEA 3OFKA 2CXQA 1THGA 3ONVA 2A88A 2Y71A 2W58A 5IAJA 4LF6B 4HZGA 1W9MA 2Y8EA 3BE6A 3H7IA 1FSGA 1GFSA 5K0CA 5JY6A 3HM9A 2ODPA 1VQ6B 3ZDDA 2B7LA 2RHWA 1YE3A 3FBWA 1MQAA 1KAHA 1JGTA 2ZANA 3UW1A 3KR1A 1EP1B 2R5FA 3MWGA 5LQKA 1T8RA 4HB4A 5ED4A 3LX5A 5I3CA 2XNHA 4G56A 3SKXA 3LUDA 2BBTA 1RXSA 3VPGA 1LK0A 3Q3EA 4EDHA 5B64A 3OEHA 2FMHA 3H2JA 1M8KA 4AY6A 3RVPA 2YHSA 1K68A 1VE9A 4ALNA 5LXTA 3W7AA 1USVA 4JLWA 3WIOA 3A3PA 3L0BA 3LW8A 3SEZA 4DDHA 5DOVA 1N5JA 3BIFA 4TGLA 3T4EA 1PW5A 4G4SO 1HT2E 5EZYB 1SKYB 5HR5A 1LVGA 1GKYA 4IHJB 4D8UA 2H85A 4KE8A 4K81B 2Z5VA 5HUQA 4QVIA 3OA0A 4GGPA 3PA8A 3W77A 3SE0A 4ZU1X 3G7SA 2I71A 4HFJA 5EJ7A 2REOA 1NE7A 1YULA 2A33A 4NJEA 3ZDRA 5BV7A 2HOQA 3OJWA 1PRYA 3PB3A 4QOSA 1OCEA 3FNEA 3O4JA 4FDTA 4JV5B 2D2FA 2BKVA 5GJBA 3JU4A 3BSFA 1K0FA 5DP2A 3CLRD 1V9LA 5KNDD 2M98A 2ORYA 3D1VA 2QD5A 3O4IA 4R2MA 4X3OA 2C4NA 3PPVA 1N33B 2JFPA 2ZBDA 4NNPA 3Q98A 3U7RA 3ZZMA 2HBYA 1U0OC 4WCFA 4NCIA 1I1HA 2JJQA 3ZV7A 1QLWA 2FOLA 2HCBA 3L06A 4LNUA 1KBQA 5DLYA 1T6XA 3DDOA 3WYEA 1J8MF 3WGKA 1IB6A 2CVHA 1ZDMA 1FQOA 1OW3B 1Z56C 4OAOA 3RIXA 2A2ZA 4P80A 5BURA 1B0PA 3WDKA 4WGGA 4B6GA 4FN5A 5E3JA 1HEIA 2XQVA 2OTLB 5LBIA 5JR3A 3O3CA 4Z4QA 5F2KA 3UMRA 1VJ1A 3ABIA 2WU3A 5KTPA 4U6NA 2PMWB 3SF8A 3NHJA 1WIWA 2WT9A 3EXHC 4R16A 5FORA 1GYQA 5JS8A 2RKWA 1YAJA 3LQQA 3BXXA 4JI6B 1QQBA 3DF9A 2OQIA 1U0JA 4P5PA 3W04A 4IH1A 4R8RA 5DK4A 3ED1A 3GFFA 3RK4A 3IR6A 1Z2NX 2R86A 2P41A 3LBHA 5AI8A 5BVHB 2XGMA 1R9JA 4MYRA 3TRFA 2ZRFA 1NMYA 2ZRJA 1UMDB 4HTAA 1YB6A 1XDDA 1OLSB 1NLMA 2NUTB 2WE8A 3EIOA 5AUOB 4I1PA 1U80A 1K08A 3HCBA 3THYB 2Y1XA 4P6VF 2YS7A 2AX4A 2ZJ2A 1X13A 4WSOA 4NCHA 2X19A 5J5VA 3S1LA 3SKVA 2BSXA 2C92A 1G7TA 3V1NA 4AECA 3SQMA 4K6MA 3ND7A 3TMYA 1G3UA 3WL7A 4ND8B 4M49A 1IJEA 3WKBA 1PZFA 2C8JA 3KUUA 1L7XA 1Q17A 2OEPA 2QM8A 2ZE8A 3D6FA 1WG8A 2DYIA 2E2WA 2YDXA 3UWPA 2DULA 4Q3KA 1OFVA 4OMFG 5H1YA 5EQTA 3T3MB 3HSKA 1DBWA 1XNRB 4B3TB 2BHLA 3ZK9A 3L7OA 4E2ZA 3DQQA 4TTRA 1YH3A 2FJUA 3IODA 4R6WA 1QYDA 1WMFA 2VH2A 2GZDA 3PK0A 1NNUA 4F1KA 4BLUA 4D4HA 1A7UA 2HMVA 3NC0C 4BB6A 3A31A 2F67A 5EZQA 1J20A 2ZIXB 2PE5A 2ZQYA 1GQYA 1YB1A 4D2IA 1A96A 4TKVA 3FKSA 1ZEJA 2BEWA 3ETNA 4D42A 2OO5C 4UZFA 3GCWA 3V8NA 2WICA 3P9IA 4QQKA 3R9KA 1N2CB 4K28A 4X7DA 4QA9A 4Y2UA 3M83A 2ZSBA 3OX3A 5JMPA 3WLKX 5FWNA 3JSAA 3S81A 5K20A 2DB3A 2OOKA 3SJCA 1VHOA 2IHBA 5KQGA 3H2BA 4KR3A 1D2GA 1OFHA 1QCYA 1Y33E 2Z3VA 2FOIA 2IYNA 4ARSA 2FSIA 2JGAA 2VG8A 2GPWA 4G01B 4PZEA 4E1BA 2B30A 1ZSNA 1C2TA 1FNSA 2IPAB 1NI4A 1T10A 1YA4A 2R65A 2WK1A 3BJRA 4M0EA 3TDNA 3TOZA 4ASUD 5IM4F 1OLUA 4AF6A 4DJEC 1QIKA 1IQRA 2XD9A 1VSBA 1ZMXA 1EM8A 4BL5A 2WNSA 1PK9A 5KQSA 5ALEA 5F4ZA 3QSYA 3N8DA 4RY8A 3FHCB 1JJIA 1DINA 1ZVJA 4EUHA 4EYOA 3ZS9A 3BD8A 3S6JA 4B32A 2N0SA 1FZQA 4RYLA 4RJTA 4KKXB 5A62A 3ZJTA 2WSSA 1JQDA 5CTJA 3DUFB 2PNJA 1DUIA 1KJYA 3MELA 1YQWA 4KRXA 4MZDA 1W52X 3EUEA 4JVSB 1LV7A 1GDHA 2FX5A 1I3CA 4RA9B 2D13A 3H5NA 3D26A 1PR9A 5KQPA 4Z5XA 2J59A 4MKIA 4V0QA 2E9SA 2GPSA 5KYXB 1Y6RA 5B4UA 2VBGA 1JSZA 1E4OA 3AR2A 3KR9A 4LPSA 3JQBC 1SCNE 2EBWA 4RTPA 3WIUA 4KWIA 5KWIA 4Q9HA 1JWBB 4YAIA 5REQB 5EEHA 1GN9A 2HNKA 3OF3A 2C31A 3IOMA 4DM3A 4KKTA 1BWRA 3VUFA 1Y3AA 2D3WA 2R96A 1SKAA 3EGIA 4I5GA 4RZ3A 2OGUA 4TRJA 4XTRA 1FLVA 2HO4A 3K2QA 1BGWA 5DI3A 4CM7A 1GG2A 3V8QA 1RKBA 4JJEA 4BYMA 3REOA 1OD6A 3R5XA 4ZOQI 3T15A 1S72B 1U2PA 4WDRA 1RRMA 1EFAA 1JJAA 2COKA 1QP4A 1BQEA 3OCCA 2XWPA 3KYJB 1QLHA 2HLNA 5EAIA 1RE0A 1VLJA 4MW4A 3TOSA 5JADA 4GR4A 3AB3A 1BJRE 2PO5A 4GVXA 4R1TA 2B1QA 3HE3A 1CERA 4ZCLA 2FPPA 4UHDA 1KMCA 5BN3B 2FSGA 1E9AA 2AQKA 3FFAA 3RUAA 3P4YA 5C81A 5FX2A 2OYCA 1FSFA 3QHQA 1F0YA 3UC9A 5IKXA 4MPPA 4WADA 3I92A 4MV8A 4GRIA 3PXGA 2VK4A 3IJEB 1U2ZA 2RKBA 3LG2A 5F1YA 1Y82A 3RV3A 4CIBA 1HDRA 3QE2A 3ORRA 1P5RA 3HJRA 4AXXA 3AG5A 521PA 5KVCA 1RC0A 4OHUA 2FF7A 5CLIA 4R2KA 3D6AA 4X6XA 1ZIPA 3S70A 2C2GA 3LE8A 1U2DC 1PS8A 1CQZA 2IODA 2IHUA 2IGBA 3VMFA 3B1FA 1WHTA 1UM9B 1GZ6A 3RC8A 1BMTA 4OFBA 3RIHA 1VQ4B 1FIUA 1FFAA 3DBHB 4NCXA 1POWA 4E22A 1IY9A 2QAGB 4MJ7A 4B84A 4XJXA 4J16A 4JBYA 2VJQA 3CLKA 1SZPA 2POQX 3OQPA 3GDOA 3DZCA 1NXXA 1X7DA 3GT0A 2IUUA 3MJSA 4JT4A 5CVUA 3WDSA 2BDTA 1QZXA 3KXLA 3OD1A 4FNAA 4G24A 4MUIA 1D6MA 4TV8F 3RSGA 5ANRB 1SU6A 1ZD8A 2JJ8A 1BE1A 3CEJA 4O2BB 4ZVTA 1VPTA 2GGSA 1WXFA 5HOQA 4X5OA 2XLBA 4EHFA 2C2KA 3NVDA 3KM0A 2YJTD 3TGWA 2HK7A 1JG3A 3RUFA 4BNZA 3HLKA 1EG7A 1GZ7A 2GM3A 3BNWA 2VT7A 4TMXA 3JZDA 4LF8B 1HA3A 4DN6A 1DAKA 1QVWA 2P90A 3DR3A 2R8RA 1VA5A 1CBUA 5B3JC 4Z4IA 2X4IA 4QG3A 1RCUA 4QL3A 3FF4A 5DCUA 4A91A 2ATCA 2FR8C 1KOFA 2RIRA 2D06A 2PSFA 2Q0HA 2WZPP 3HDGA 3N0XA 1QVAA 4NVRA 6ADHA 4PAQA 3FGOA 3NBKA 4ED9A 1U63A 2O19A 2ZP1A 3F49S 1MABB 1UMCA 2QR5A 3EA0A 4XFDA 2BGTA 5IABA 1LDMA 1QJ4A 1KSFX 3ZXXA 4EKYA 3K0SA 2ECPA 4Q05A 1X1AA 3BDAA 2ONCA 2O7QA 1P62B 2MYTA 2VPWA 2E37A 2ZETA 4FDVA 4P84A 5JQGA 1T91A 3PQ6A 4HDQB 1WSRA 1DBPA 1JHXA 2BFCB 2V5UA 4MVJE 3FTFA 5IVPA 3PX3A 3R20A 1BX1A 4B71A 3TZEA 3CP8A 2D0DA 1SK9A 4PSAA 5IAGA 2R1ZA 5H7XA 1JEYA 3EXEB 3H2IA 1JQEA 5DYGA 4MWBA 3FZEA 1SUIA 2HT6A 4I4TB 1UPAA 1UZUA 1DKMA 2ZYIA 1M5TA 4MVWA 4QTXA 1QYXA 4JBNA 2G9NA 4LMAA 3FTEA 4AY5A 1T9GS 3PBKA 3QJYA 4N8SA 4X84A 3NBZC 5ICFA 4BO9A 4XAQA 3ZDYB 3HDTA 4IQGA 1MIHA 2H08A 2VTVA 3RVDA 4UJ3A 1Y5NA 3HDYA 4NBRA 4OPOA 3ABSB 1YJ8A 3NOXA 4LJ4A 5FP0A 4D9CA 4XVQA 5JNRA 3G23A 1I4EB 1OBHA 3C14C 2VJKA 3FI0A 3HACA 5FBRB 4XDHA 3FOZA 1QG0A 3B1JA 1CUDA 3KL4A 1C9YA 3MFQA 2SKCA 1WVIA 1ZJZA 4MYHA 3NV9A 2Q49A 1BXGA 5EESA 2J45A 4IDQA 1TM5E 4OJYA 5CGZA 2OG2A 5HW0A 4QPJC 3VYWA 2O1SA 2DHDA 3ZWBA 5KKAA 1Y4UA 1RQXA 1QFXA 1XPUA 1NV8A 4MUKA 3ZWPA 2BEUA 2QRUA 3QE0A 2WUWE 1J22A 4KXLA 1KI6B 2ZDGA 4TT3A 2G17A 4NBKA 3EEBA 1FS5A 3CE9A 4UTXA 4G84A 4PICA 3RSSA 3KLNA 1P5HA 3UGTA 2XNCA 1IN1A 4HRXA 3O2SB 4KXWA 3CCQB 3S2YA 1JG2A 1L5MA 1T2DA 1B6SA 4OP3A 1YRLA 2NTYC 3R8FA 2P4QA 4DRXA 2AG0A 3A9CA 2PUBA 2QW1A 1Z35A 3ADKA 2BGJA 2BDUA 2PRSA 3EFHA 2UYOA 4FUTA 4PAWA 2BDEA 3R41A 1MRNA 1HO3A 1G5IA 4QBIA 3QLVA 4FNGA 4LS3A 4E4RA 4P0QB 3K70B 2RFLA 1QFJA 3B5JA 3IAEA 4OQNA 2WHEA 4QBFA 2WIDA 3WL6A 3I4FA 1ZJ5A 4Z86A 3A2LA 3B6MA 3HHPA 3QH4A 1ULHA 3SEAA 3CRRA 1OXSC 1TTPB 2HPVA 2OBLA 3JZAA 2BYTA 2HU2A 2DR2A 1RBZA 1Z6GA 4S1NA 4X05A 2I6GA 1RXUA 4ID3A 2C7OA 4HHEA 4RGBA 1MF7A 1GV1A 2JGKA 3F6PA 3T0GA 3TNFA 4BATA 3WJ2A 3KOOA 3I1YA 3RAGA 3RH0A 1JF8A 1OXMA 1WMBA 2F1JA 3BXOA 4KREA 4LA4A 3Q41A 4PVDA 4GD3Q 4BU0A 3P8ZA 2GQ0A 5HXAA 4KKUA 4LVCA 5BYJA 1DSSG 3KZOA 3FLMA 4YBZA 2A5JA 3ABOB 1N0HA 2G06A 3KLMX 1N9KA 3Q0EA 3H97A 2VS1A 3L40A 4LJ7A 3WK7A 1OVGA 3WOHA 3ZWMA 1BCRB 3INNA 3VX4A 2JBWA 3L02A 3I53A 4HLNA 4B4WA 1F2TA 1VQMB 1L0BA 2GKSA 3K0AA 3N2IA 3NDRA 4TN5A 2Q1WA 3ZK8A 4ETNA 4CKYA 2XE8A 3GELA 4MCAA 4MEBA 3ED5A 4ZYXA 3CUEF 4DQLA 1X1DA 2I1VB 1KI9A 3A6LA 4S0ZA 3VOAA 1Q1QA 2P5YA 4BAGA 3IALA 5KTMA 4CMKA 1NJFA 3CE6A 1G20B 2IIVA 1CF2O 1NQTA 2G1KA 3U56A 1AB5A 5D7NA 1XTQA 4ICIA 5A0TA 4DE5A 1FS6A 2AF3C 2QTGA 4OQLA 1ZC3A 1SBZA 2YX1A 4FC7A 4LE2A 1GRRA 3QLJA 3Q7QA 5JMOA 1KY5A 1YASA 1C30A 3MK31 5GMOA 3R7BA 1DE0A 1GYRA 1KFCB 1MJGA 5H9WA 1ZH0A 2AJCA 4C5BA 3K1ZA 5IKEA 4P7GA 5IUJC 1AURA 2PYIA 4DQKA 4WNIA 4WOJA 1QIJA 1KRXA 2R8BA 1G1AA 1FJ2A 1XMSA 5EXTA 2H31A 3KSRA 1EAMA 2HYDA 2JGFA 4JNKA 4L8WB 4LRTB 4ZOBA 5H82A 3C7AA 1C3VA 4OU5A 4V0SA 4AKSA 2FZCA 1V8PA 4E0FA 2FVXA 2I3ZA 3DMNA 1S2LA 5WRFA 2ZOSA 1JPVA 2QM0A 4EW6A 2H4FA 4JYPA 1NN3A 3OZIA 2QVYX 3N8IA 2PGNA 2R62A 3IUPA 1HSOA 2OORC 4O63O 4OHCA 4AK9A 5AVVA 3KTOA 4DLPA 2OAP1 1OXXK 1KXZA 2ZJAA 3LQ6A 4FWIB 1KQSB 4KXFB 5BSRA 4LMPA 4MDEA 3ICVA 4HYYA 1EG2A 3DEIA 3TW8A 1N7IA 1O57A 1Q44A 1RMTA 3BWXA 3NHRA 4G67A 5BN5A 1C0LA 2ETVA 2DQZA 5FAKA 1GSIA 5L95A 2L17A 1NYRA 3NAQA 2ID9A 1USUA 3OA2A 2QMEA 4O3MA 1I80A 3A8JA 4JUDX 1V47A 2IYPA 5A3JA 4OXYA 1QJCA 1DMSA 1I2AA 1PJ6A 2JNWA 4FD3A 1S2DA 4LWQA 3MMPA 1EB9A 1ZJ6A 2QUKA 4IIJF 2QMQA 3B51X 4DYHA 1V16A 1MXFA 1R3DA 1DDOA 3GUYA 5D1HA 1ZSYA 5IJAA 4PGAA 4MS4B 3IBTA 3OPMA 2BPOA 1M1YB 4K1XA 1BE0A 1WTHD 4EJ0A 1WF6A 3C3XA 4MS3A 5F7OA 1L9XA 2E4VA 2FN3A 3AIIA 3LVFO 4NE7A 3O84A 4HMPA 2GNPA 4ZAGA 3DAPA 4CFSA 4DCSA 3O3OB 3QHPA 2B25A 4K5QA 4ZKDA 2GCEA 4QZVA 1VKRA 2VQ6A 1QKKA 3I9FA 4UOZA 4UCWA 2CZCA 2H1RA 2OFXA 5E2IA 2AXQA 2VO1A 3F2IA 5EMHA 2ZQZA 2X5OA 4KQGA 1AN9A 4TS9A 1QZ3A 4F45A 5K03A 1GNTA 1PF7E 3BRSA 3A6KA 4HAYA 5BMVA 1TZMA 4F04A 3HJNA 1J99A 3OOEA 1T5LA 1E6KA 2W22A 1R16A 3T34A 4U2GA 3EAFA 1E9VA 1NY6A 2OV6A 1M8FA 1J9ZA 3N76A 3GFVA 4D3SA 1AIPA 4X7EA 4F56A 3KEGA 1M2WA 1ZCBA 1C4XA 1O4VA 3QMWA 1D6NA 3R6DA 2ZBFA 3SN6A 3H2GA 4UBOA 2E1BA 3K0BA 2IFTA 3LLCA 1KIMA 3NRCA 3QVSA 4A0SA 4CR8A 2RAVA 2C9OA 1FXWF 2ONKA 4KWCA 1ZHHA 4O2RA 5DBIA 1RM3A 4JEHA 5ALZA 2WIGA 3EQZA 4H3VA 3LKVA 1CEYA 2YHUA 1TQ8A 2R4TA 5CBPA 4HNQA 3OFSA 5H4GA 2A6PA 5AXBA 1VSVA 5BSKA 2JAUA 2E4WA 2JD0A 2FPGA 5ES3A 4BCDA 5D3QA 2F4VB 3A28A 1UJ4A 2I6UA 4PZZA 2X5XA 1NB9A 2QD2A 3MA0A 3WFIA 1NXWA 4I5IA 1KMQA 4DZTA 1B16A 3MTIA 4CG3A 3IUSA 4ZI7F 3TUZC 3L0SA 1FUEA 2WWTA 5DX8A 1FDRA 4M7OA 5DWDA 1FK8A 3GDHA 1MJGM 1NSFA 1PX0A 2O2JA 4BV3A 3TS1A 4CUKA 2WILA 2X5KO 2IXTA 4EZBA 2ZVQX 5JEEA 3I8SA 3TTWA 1ZH4A 4FGLA 4J4HA 1CQPA 2DY0A 2V45A 2N1MA 4ILKA 1MAWA 4EYQA 1WW8A 2AJ8A 1LEHA 2F1KA 3ZWAA 2ZU0C 4YRFA 3C7TA 3T3GA 3PEFA 5CFOA 5IX8A 3FFBA 2CXNA 1G4HA 1U6KA 2E4XA 4KDCA 5D3KA 3RS2A 5KX5B 5TRDA 2P8JA 2XWSA 2YFHA 4M0DA 3T3DA 4FCCA 3GIWA 4QUKA 1TIPA 2AN4A 2BM8A 4B87A 5IANA 2IE8A 2ZKIA 5FB3A 1Y8RB 1EPUA 3H11A 5EY5B 3QQ5A 1Q7EA 2VWPA 5DIFA 5C0OE 3QE9Y 4CU2A 4N5MA 3G0HA 3H5IA 1KKUA 5HMMA 2C59A 4HOYA 1W2GA 1WZ2A 2Y1WA 1KEVA 1VL0A 3DBLA 4X06A 2JI7A 3B2EA 3GFBA 4A6XA 5JT1A 2GEDA 1YS7A 2ATIA 3TL2A 4Z7OB 1J24A 2BMAA 4M22A 1I13A 3CCJB 3ZKAA 2YWJA 5ALJA 1T5EA 2DE0X 3TZHA 2JD2A 3K4PA 2VP3A 4Q4LA 8AT1A 1TB4A 2AR9A 1U9YA 3JAWA 4K9LA 5CIWA 3E22A 3RHFA 3ZIAD 4EB8A 2EKPA 3GEEA 3GVIA 4I55F 4H1WA 3H7AA 2H2HA 3E1KA 3F71A 1B3RA 3IX7A 1QE3A 4FMDB 1N5LA 1WDLA 2PXAA 5FTLA 5IYZA 1J90A 1VJ5A 3HRHA 3VXKA 5B3AA 3ZCUA 3WB9A 4CG0A 1JBKA 4OMCA 4IF4A 4YK7A 4BO6A 4CLOA 2V7WA 1RRPA 1N0UA 1R4AA 3MCTA 2BTOA 4WZBE 3SY8A 5MGNA 1J9EA 4GPIB 1QHHA 1DJOA 2JJMA 4MJ3A 1IG0A 4W1RA 4O3FA 5IZ4A 5LWQA 5K0ZA 3NHUA 4G5FA 4H9GA 1XTRA 4D8TA 1JG6A 1XAHA 5AM5A 3DCIA 3ZZTA 2FG6C 3DHVA 3JQ6A 1V11A 1Q21A 4XIYA 4OBWA 2CWWA 3FNQA 2WJYA 4G5RA 3ZPXA 3QZUA 2GHQA 2QLTA 2GOYA 3K20A 3KZVA 3PPIA 2BF4A 1ZZGA 1CRZA 4R9UC 5JE8A 4JC8A 4YJGB 1P29A 1E20A 2JGIA 3LCRA 4XUCA 3VAAA 1M1XB 4M1WA 1A8IA 3QF4A 4O5OA 1JNYA 3UWDA 3T5DA 2JLWA 3ZIDA 1NQWA 3ERCA 5H3HA 1B2RA 1KEUA 4UCQA 1Z0KA 3RVKA 2OQRA 4YP0A 4M36A 1XLVA 1N1GA 2B8EA 3WRYC 1DC6A 3Q9LA 1RTTA 5BSUA 1PUIA 4Y6LA 3BMCA 5D6NA 4ZK6A 2V4MA 3KQSA 2HXSA 1Y6ZA 1I2ZA 3MS7A 4MLCA 3VMMA 3I5XA 1L8XA 4H3KB 4E33A 5EOVA 3PA1A 5ALNA 1ZOLA 2B8NA 3HMKA 3NVMB 2DSNA 1JAXA 2DP4E 3A1UA 4D9NA 4Q12A 4W4TA 2N47A 4ZALA 1V7QA 2LGJA 2UUOA 1STOA 1X94A 1XTVA 2EARA 2Q8QA 1VL8A 3EZLA 2Y77A 2O2CA 2DPHA 3BQMB 1YC5A 1RYDA 3FRJA 1ODCA 3JQAA 3N3BC 3QMPA 2QN8A 4MNTA 2GASA 3VHLB 4EYSA 1M6HA 3NHLA 5TY0A 1E94E 1VL2A 1YR3A 2XVYA 3KLPX 3G2MA 4NYMQ 4FHFA 4XCQA 4YB8A 4LQ4A 3R7LA 2HQSA 4V0KA 2PZEA 3DBIA 1NJ2A 4BMYA 3I09A 4RPCA 3ZX5A 2IHVA 1XU7A 3UMCA 4JLDA 2V3VA 3NUQA 1QDLB 1PZHA 2Q41A 4RVFA 4I2NA 4U39A 3T4UA 4BKUA 4OP7A 1A7JA 1NFQA 2QEQA 2PU5A 1RM0A 2XADA 2CLSA 4GBMA 4NH0A 5K0GA 1YV9A 3B1VA 3O4GA 3TTXA 4D8YA 4R83A 4LZNA 1B26A 1OX5A 4JLJA 3Q7EA 4FJ1A 2B78A 1LLUA 4LMBA 3G3EA 3T5PA 1WHSA 2F1IA 4PNEA 2J0VA 1CJVC 2X53S 1XC7A 4B45A 3FIUA 2HJSA 5GY7A 4UM9B 2IPMA 2I54A 4M83A 3PD0A 3JQ9A 1XKTA 4F21A 1SG6A 4M8KA 5AHWA 2AZXA 1IOZA 4G3XA 3BT7A 3GRZA 1R5NA 1TU4A 3KSBC 1H6DA 4MQBA 4MWGA 1XWIA 3CKMA 3CUKA 4WZAB 4LXIA 1KI3A 4ETWA 3T3PB 2YVLA 4F9EA 2H16A 2G0AA 2GBCA 4R9RA 3E70C 3GLGE 3QKRA 3NBAA 4QVGA 2VXCA 3DZDA 4O4HF 1IM8A 4LKOA 2AEFA 1T9CA 1X7WA 2BUBA 2H7XA 2ZE7A 3WIBA 2NU9A 1M6WA 2IQ5A 1U81A 3OZUA 1JHDA 2C8LA 3OIVA 4GGOA 3PDUA 4HQKA 1BH2A 2IVFA 1A5TA 5C2JB 5K3EA 1XOIA 1ORVA 4HDCA 1GAXA 1RYNA 4XDYA 4YT4A 4UM9D 1GQFA 2OGTA 4J6EA 3R44A 2LPMA 4HFNA 3RU9A 2G71A 1IB0A 1I3LA 2C5FA 3O75A 1KI7A 1V5WA 3PHGA 3FTNA 3DMGA 3DVAB 3HVJA 3K9NA 3QBJA 4HWRA 2BGRA 5AJUA 4DPMA 1N9GB 1UWKA 2BFEA 1Z38A 1YDEA 4PCAA 3ONUA 1U8EA 3GR6A 2HMUA 3VPCA 3QTBA 2IIPA 4I46A 4KWTA 4DIFA 2VI5A 5T4EA 3VISA 3HM2A 3H94A 2QT9A 4W1PA 3QXCA 4TYPA 3QYFA 2GRJA 5I3ZA 1XZPA 3F3KA 4Q00A 1NC1A 4H1HA 3B6KA 4DWVA 1EFRA 1URPA 1ZNQO 3E84A 3FIJA 3B82A 3N39C 4ZU3A 4MARA 4Q4DA 3VTZA 4BLOA 9MHTA 1VTKA 1ZICA 3BZBA 4RQUA 1C1XA 2QT0A 4RCVA 1AG9A 1XDSA 2PFGA 4PX5A 4WKGA 5JS7A 4MB6A 2WYUA 1OUMA 2DY1A 3RYHA 3OP4A 1J6UA 1N6KA 3FROA 1JJFA 1K5PA 2XEXA 1D9ZA 1T0IA 2GKOA 1Q83A 4LJ6A 4UHKA 5BWNA 9LDTA 5KSZA 3DXYA 5JI2E 1V96A 2Z43A 3LPAA 2VSXA 1DU4A 3O38A 1JHPA 4BUCA 4CV2A 1TMOA 2VJDA 4QNMA 1M1NA 1GL7A 2XZDA 6PFKA 4QUHA 2W6JD 1ZEMA 3HZHA 1VLZA 1WR8A 1BU8A 1JEEA 3TG2A 2VT3A 3ZD7A 1Q0HA 2EP8A 2PZBA 4H7JA 1DJLA 4F71A 4XM1A 4YUVA 5I45A 2XHEA 1RTKA 1KHHA 3LGXA 4A6EA 4CF5A 1ZGGA 4PQRA 4YPOA 2JHFA 2Y2UA 2R6ZA 1KZ1A 2PNFA 4NZNA 4KDRA 1JHOA 1AD2A 1BXRB 2HRRA 4A0HA 3QM1A 1YC2A 5KWSA 1JQ5A 3I37X 1YCHA 2HN9A 3U39A 5LC1A 1WV1A 1IPEA 1FP4B 1TVKB 2NNWB 5HCIA 4KPGA 4D79A 4I50F 4DRZA 4QLBA 2XE7A 4QYWA 4O4LA 4U9IS 1NLZA 3TIXB 3R9WA 4HYEA 4CUJA 3R8XA 4JU9A 1FTYA 3EZNA 1B0UA 1KP3A 1Y3CE 2VRBA 3RNLA 2NSDA 4LF7B 2RGNC 1WUKS 3GVCA 1XEAA 2V1XA 3QPCA 1BHSA 3CT4A 3I9JA 4QVKA 1J33A 4XX1A 3KOMA 4RK7A 1ZR4A 3H99A 1KOGA 5C5CA 2RBKA 4P2NA 4CDGA 1CDZA 5AKJA 2WWWA 1OI3A 2O5VA 1FJHA 5FA6A 4KAAA 4LCBA 2O8DB 5A0VA 4M9QA 1WL8A 1PP4A 1I51A 3H8SA 4MR8A 2GILA 1YGYA 3LFUA 1FDWA 1E6UA 4QGGA 3DAHA 5EXDA 4D0NA 1CVRA 1LBIA 3C70A 4G0NA 2PSJA 4LTDA 4DT1B 4BKMA 4FSHA 2J0UB 4UEOA 1L5ZA 3WYBA 4WW0A 3PUMA 3AF1A 4UMEA 1OX6A 5KKNB 3PL1A 4X6UA 3NG1A 3ZQJA 5HBGA 2V7PA 3OOSA 3R6WA 4MW7A 4XYBA 4AKTA 2LKCA 1ZHFA 2YH2A 2F59A 4LI0A 3OLVA 4CM9A 2C5EA 1UKYA 2WM3A 3PQCA 5FUBA 3K9CA 4NZ9A 3HO1A 3AVTA 1R8SA 4L07A 1A69A 3MYRA 3AM3A 2PLRA 3BPSA 3C15C 4TL8A 3KLBA 5TF0A 2V7GA 5AW4A 4GUDA 1HVXA 3PU6A 3CZ4A 1O6FA 7GPBA 1GM5A 1P4RA 4Q4HB 1V8ZA 2FCRA 3CLUD 2CUTA 2CEKA 2OM2A 2RONA 3FA2A 4IGKA 5K2OA 2KB0A 5L6LB 4J6FA 4O1HA 1IUKA 5AVRA 4HN2A 5GIOE 1S8FA 3WQZA 2PRIA 1XJCA 4J1TC 4EA7A 3EHEA 5A4KA 821PA 4A7PA 3WFZA 2YW2A 5EP4A 1UJ2A 4G2TA 2WW8A 4CM4B 1ZN2A 4CQJA 3KU4A 1G64A 3RM3A 5B7GA 4CL2A 2Q9BA 4XB2A 1J2RA 1JJ2B 3IAM6 3O8DA 2EKLA 3EDCA 3FYDA 4PBTA 1TQ6A 2FFQA 3E9EA 4YMVA 3TIGA 3RB8A 2L2QA 3H5OA 4L4RA 5DHRA 5DLQC 2BP7A 2N9UA 3GJZA 3HJFA 3UT6A 1V48A 2C2MA 4JP3A 5DXAA 1O87A 1QGUB 4FFOA 3SS9X 1EU1A 2IUEA 1NQ5A 1D4FA 1K73D 5DHPA 4Y3UA 5E7JA 4TXHA 3ROMA 1XTUA 3KEFA 1SVLA 4QFBA 5IJ0B 4GOLD 4WOPA 4D25A 421PA 5JS6A 5DB4A 2FW1A 3DLCA 3HB9A 3Q88A 4RSHA 4EFNA 3ZHZA 4OGFA 1F4VA 3KJEA 5LQNA 1Z13A 2WFAA 3D7SA 1PEKE 1AZWA 2EX4A 2NTVA 5FTKA 1MX9A 5LP1A 3R24A 3FPCA 1N8KA 4G0ZA 1PT6A 3U3KA 4LPKA 1P9WA 3L0OA 1RPAA 1UT5A 1VKHA 4YUAA 1II8A 2H4WA 2ODAA 4G0XA 5KYWA 3FOAA 3KBBA 3PTAA 3GGPA 5JYCA 4HV4A 4HQRA 3JAMA 5AFSA 2ONJA 2B21A 2OMEA 3LCUA 1DT5A 1EQUA 1TPZA 3KZXA 1DUSA 1ONOA 3K9QO 4I14A 4U7FA 2LZJA 5JZOA 4Y9RA 4NLLA 1K75A 3H9QA 4D4JA 4RTKA 2ZXUA 3TK1A 1T29A 3FSGA 1FFBA 3HKCB 5AIAA 4DTIA 3ETJA 5IHPA 4Q3EA 1RQ2A 2NYUA 1MG5A 4TKUA 2VEOA 4MUBA 2ZRGA 3BY2A 3QRWA 1K6XA 3S2SA 4A92A 3WNCA 4HN4B 1JIKA 2X1VA 4JP5A 4EW3A 4KFSA 1PT9A 1T1JA 3QVUA 1SWVA 2A9KA 4GR9A 1F4PA 1PLLA 4Q5IA 1AQYA 2WWIA 4KGDA 1R8YA 2LVBA 4FFPA 3TUJC 3TG8A 4RY9A 3G68A 4CM8B 1AKYA 2VYVA 3MM4A 4ZCMA 1LV8A 3IP1A 4P35A 3SU8A 4K0KB 3C8HA 4H7EA 4CKZA 4CT5A 4DCMA 5HPYB 1AZLA 3WK6A 1S3SA 2KSQA 1BN7A 1RCFA 2GN4A 4WASA 4GT1A 2ZM6B 3W1WA 3JASB 3FTCA 3GD7A 3OICA 1JL3A 2ECKA 5FO0A 1M6VB 2FSUA 4GKVA 4JT8A 4KXMA 4LN1A 4ZCPA 4E5UA 4ZJZA 1LDNA 3EHDA 4M9CA 5IH7A 5AVUA 1DRKA 4YT8A 3WC4A 3DZIA 3R0XA 3WRVA 1KZ7B 2Q28A 4RO0A 3ZXYA 1FUIA 2FX2A 3NIGB 3QKWA 4H7FA 2WU1A 1LI5A 3LBYA 1KH3A 3FJ1A 1Y7LA 3FVQA 4MKZA 2J0QA 1KE2A 1GADO 4I9FA 4YVFA 4YCDA 1OH6A 3RSOA 5CK4A 2YNMA 3QVWA 1I3MA 1H3EA 3V2UA 3DLTA 1MAVA 3I1JA 3Q3JB 3H4IA 1HURA 5B55A 1SN7A 4ZZ0A 3QE4A 4EA6A 121PA 1A8SA 2NYAA 1GGEA 1JXMA 4MKGA 5J4VA 3IE1A 1W9XA 4MGEA 4ZAZA 1R5BA 1SURA 1DEAA 5KVVA 3HL0A 1FVHA 4KAJA 4XYMA 3HGMA 2AHOA 3L8YA 3P0RA 5DNWA 3WB1A 4WX2B 2FJPA 1R8XA 5HZKA 1BG6A 5KDOA 1G0OA 2JIDA 2OCGA 2UUPA 3C1OA 2WHRA 4J0FA 3S7ZA 3SDBA 4US1R 3ZWQA 1YMQA 4I5DA 3HSYA 1EFLA 2PY6A 1XU4A 2HH9A 4RULA 5CX1A 5DTIA 2QW8A 2Y92A 3QPUA 5CYGA 4FCWA 1XJ0A 1QIMA 1LUAA 5JLAA 2XDQB 3O2QB 3UZUA 4E0BA 1JAYA 4C0XA 3RSFA 1NSTA 4J94A 1JECA 5IT5A 1DKLA 2OK7A 4II3A 1VB3A 2IIQA 3DAGA 3KCQA 3GV0A 2BEKA 1EZ4A 4RKYA 4X7RA 3NZEA 4EMSA 5FPKA 4TZ6A 3O8QB 4RGVA 3UXMA 4AJ9A 5I9NA 1AKUA 4L6IA 1U11A 2WJPA 3PHBE 4NICA 1X9IA 4RVHA 3A1FA 3G89A 2ZPTX 3RVSA 3JD1A 4LYHA 4YFVA 5JBNA 1II0A 4II2A 1I14A 2I4IA 2WPNA 3CZRA 4YCCA 1FU4A 5CX4A 3RU2A 3FPAA 3H17A 5IFKA 1GQRA 5CDHA 3NNDA 3WJ7A 3D02A 3GP5A 2ZI3A 1C4KA 4R81A 4DQXA 1O8CA 1XBTA 3C3MA 3OLWA 4XMYA 4OEHA 2QG4A 1N2SA 4D6PA 1YLOA 1ZLYA 3VKHA 3TQTA 3OJEA 4WKNA 1JG4A 5AK5A 3MWJA 5I7EA 3P0HA 1DC5A 4RH0A 4PYIA 4RK6A 1YJCA 1PBNA 5L3ZA 4CUZA 2J87A 3E35A 4ZA2A 3UCEA 2VHVA 4QBHA 2WQ6A 4EHAA 4QTZA 1DRVA 3MWEA 3NH6A 3LIIA 4ZT6A 3DLHA 2WWXA 1SVKA 1FP7A 1RWQA 1SIBE 2B37A 2N75A 3URKA 3VZDA 3GVXA 4AO6A 2Q6VA 1MLDA 3IMFA 2W2LA 4MIYA 2NO4A 3ZHCA 2HCTA 1HL3A 3PXDA 1YS6A 1VGRA 5J2TF 1XRQA 2GT1A 2IZ1A 3BD9A 3R6TA 4EMUA 3IUMA 2HQOA 3IT3A 2ENUA 2REBA 5JTUA 3QU9A 1SXPA 2BMFA 2P6OA 3GT7A 4MW5A 4JC5A 1UBTS 1VECA 2TYSB 3SLNA 2ORED 3IC5A 3HK2A 4D9BA 4RGQA 4WKBA 1IBCA 5MGBA 4L74A 4CIXA 5HHTA 4MW6A 2PVPA 3AJRA 1VP3A 5IASA 3HCAA 2BGKA 1YJ9B 3M34A 3MC1A 3L5OA 2BD0A 3P9CA 4JI8B 4X24A 1BHO1 1ZI8A 3PDIA 1HDEA 5F78A 1C1DA 3HR7A 1CUYA 5C8XA 1ZI6A 4IJMA 2J67A 3R7WA 3COVA 4IJKA 4D43A 1H23A 1P33A 4L2IB 2YJ6A 4GMFA 4TSRA 3CEMA 4BQIA 2V5VA 1OT3A 1YE5A 2O0LA 5DJ5A 3MMNA 1XROA 2X8JB 1VLMA 3JQ8B 3RARA 5HKKD 4JUIA 1SOVA 9ABPA 4DNPA 3AP2A 1GCUA 2XB9A 1XV5A 4MWSA 1JBQA 1UBCA 1Z68A 3CS3A 3D7RA 1A4UA 1T36B 1V35A 4G8CA 5IZCA 4P93A 4X8OA 5K8JB 3IBCA 2WHXA 4BLQA 1NFRA 3UC5A 1Z8HA 1GLGA 2O8NA 4F93B 4DLAA 1E64A 4UOQA 2MSWA 3DW3X 2JZNA 3GN1A 2LR0A 1KMMA 1P0IA 2PXXA 3AR4A 4WY2A 1EJBA 3SQNA 2VSOA 4DTCA 1G4AE 2XVZA 3SBOA 2FFHA 2VRCA 1LNZA 1CUXA 1IFXA 1M2OA 1RYEA 3H18A 3ITEA 3M5PA 4OGKA 1W0JD 4QARA 5FFMA 3HP4A 3WFJA 4AKHA 2Q5EA 3OE7D 1DQZA 3EWAA 1ESCA 2OCYC 2WTXA 4PYLA 1TLLA 1WXEA 5KWEA 4MB0A 1WABA 3TBKA 1U1DA 4UBKA 2IBTA 2DH6A 1FQKA 3VO1A 3ZZ0A 1ZONA 4K6HA 1Q74A 4XX0A 3EG5A 1XRLA 1B4DA 2XT6A 4Y6RA 3K1AB 1C41A 4HS4A 1G5PA 4WD3A 1BTOA 4ZO4A 1BZYA 1TPYA 2F90A 4GBGA 4B7ZA 4Z7NB 2G1UA 1C3XA 3PJEA 2FOXA 1UDAA 4FT4A 1UBLS 4LRXA 2JH8A 2RE8A 3U9SA 1LXCA 3ZE6A 2V7QD 1FF9A 4PN3A 1SPXA 3SC6A 1ISRA 1GZDA 1Z2DA 1XZJA 1B8VA 1RWBA 5DK6A 4Y1RB 5TX7A 5A3QA 3VA7A 2QUJA 5C31A 3FDJA 2HCJB 1XMOB 7ADHA 2OBRA 3WGUA 2O05A 5I5EA 2Z9DA 2HZ7A 5ICCA 2QRKA 1FRFS 3R3VA 1YBMA 1KAMA 4XD7D 2O2SA 4FLMA 3A2MA 5C35A 4IIJB 4DKJA 4Y2SA 2P3OA 2NQTA 1JFFA 2R87A 1CYDA 3DT6A 3Q3GE 5SY9A 4ZCTA 4KXQA 3PQEA 5HJ2A 4RPGA 3P2EA 1ZOIA 4RQAA 5FPHA 3SWWA 3ISTA 4MI9A 2P7HA 2DF8A 2I8AA 5C1IA 3NAZA 1NBMD 1DTSA 2QQFA 2R8EA 4B09A 4C2AA 4ESOA 1EDOA 5M5BA 3T51B 2MMCA 4TTJA 2GPYA 1PQWA 1JRLA 1B93A 3KV3O 4ALLA 4B8ZA 1IZ8A 2IV3A 2QL9A 3C7CB 3D64A 4C0JA 1E79A 1GT91 1OQAA 2CBZA 2XCSB 2PS9A 3OCZA 1M90D 3IIIA 2I9PA 2QQGA 1Z4PX 2NU6B 2OC4A 3Q11A 4EGCB 1S2GA 2WNHA 3EEOA 1VM6A 1CV2A 2H4ZA 4Q3NA 2WVGA 2I4MA 1YHZA 2QTZA 2WUDA 3LUGA 2G67A 1ES9A 2HBQA 1UJNA 4TSFD 4WINA 3Q12A 2H6EA 1KC3A 1P4JA 3HYCA 3L0CA 2ZIVB 2ZWPA 5HK8A 1AUVA 2CCGA 2AVNA 3RY8A 3IVCA 3KPWA 4WA7A 5CP8A 2BMWA 1VBFA 3WLFA 3GLIE 2AFVA 3T6KA 5AUPB 2AJTA 4H3SA 4HNRA 4HVTA 2GCNA 4L0DA 3OLXA 1IOWA 1R3UA 3RFVA 1FPMA 4GE0A 4RD3A 3HHEA 2PGOA 4QDTA 4MGYR 1PFQA 2CVZA 1UBMS 2GRUA 2QUAA 3JQFC 2HSGA 2CLMB 4I1UA 1E3IA 1PGNA 2RMKA 1JI3A 4PC1A 1EP9A 3A05A 3AERA 3PYLA 3GDGA 1UFQA 4FTWA 3KUCA 4G0QA 5K09A 4EPXA 4JCOA 3WLMA 3A0UA 4OU4A 1Q11A 3DL7A 1N92A 4QEZA 1NR7A 1RYZA 4LYEA 1U9JA 2J5XA 2FEAA 4KLRA 1V4VA 4ALMA 2Q0XA 3LC7O 4FXOA 2XZOA 3W2IA 1AGPA 3A58B 4HQOA 5JSZB 1BS1A 5ITZB 1EWTA 1GNVA 3VDQA 4ZI7B 1M2VB 3WK5A 5IK2D 1BCSA 1M10A 1CPYA 3VZSA 1IBMB 3GK3A 2YWEA 2QTMA 3MILA 4WK0B 4Q7LA 4B2LA 1D6SA 4UKDA 3NBMA 1NFFA 2FP4A 5CAEB 2O2IA 1K4KA 2CNKA 5CUQA 4BP8A 1VF7A 3GNQA 2I3GA 3A27A 2O0KA 4MZXA 2VSYA 2NAPA 3E9RA 3VR5H 3A25A 4NJOA 4HSEA 3MTGA 4CNQA 2C29D 1PV1A 1OI2A 1WM1A 4LY9A 1K8QA 4KSYA 2RGDA 2IEBA 1I32A 3C6BA 3PFWO 1SY7A 3Q7PA 3PYXA 4BEVA 5DN6D 4TOIA 1QE0A 2PX3A 2D1QA 3Q72A 2E49A 4K9MA 4ZPXA 3FNHA 4NG4A 1XXHA 3FH0A 3HFJA 3BERA 3IBSA 4QUEA 5DTRA 4TQ9A 3VJKA 1XEFA 4BE9A 1V0FA 3A6PC 4QU9A 4GRDA 3WMGA 1RIFA 2JGJA 1LDGA 3PNMA 4R31A 3ZWWA 5HUJA 2D2VA 3C43A 2VZLA 3ZZNA 1M8GA 1KI1A 2KLHA 2NV6A 2OMKA 2W4MA 3K2IA 2IYRA 2MSNA 5DM4A 3SI7A 4MKXA 1U1FA 3DDYA 5SY6A 3SVZA 1ZH6A 1H6BA 2IYLD 1E6EA 2B8WA 1KYTA 3F5MA 3R6JA 1VMEA 1JTVA 2H3HA 3OC6A 5GV7A 5J63A 3WIDA 1ZD1A 4CMHA 2FWPA 2PXHA 3W8EA 1G2IA 3ZGLA 4B80A 4EG1A 5BR4A 4W5NA 4I55B 4RH1A 3QGMA 2X0DA 5KO2A 2GK3A 2ERXA 4U5XA 4KQ6A 1E0JA 3VI4B 3L7YA 4QOJA 1WB6A 4PZ9A 4ROTA 1K86A 2QTLA 2XVMA 3ESRA 3ABZA 1X92A 4HQ0A 2IC5A 2C3OA 4RENA 3RI3A 3VKVA 4UTZA 3R7NA 2JN9A 4L15A 1I9CA 3IUNA 3VHXA 1W5BA 4LY3A 3ZY2A 1KQGA 1J9GA 4RA6A 1M5RA 1RP1A 4N1AA 4WV3A 2GXAA 4DSAA 4J0HA 2OILA 1MA0A 2AE2A 1LJUA 4N7JA 4D3ZA 4REQB 1CY7A 4MIKA 1P2UA 2OBYA 4HBZA 3CLSC 3VR0A 1PFGA 3AP3A 1E4EB 4BQRA 4HWSA 1UXOA 5KNCA 4U0JA 1WAMA 4HVLA 4B6RA 4DLTA 4Z4FA 1CQIB 3I6ZA 5TPWA 5G0TA 3N0VA 2VBIA 2GF0A 3RYFB 5K6AA 2WKQA 2P9YA 1HY3A 4B85A 1EDZA 1P7WA 4WESB 3KXDA 4YMHA 3AEYA 2KBFA 4MWCA 2ARKA 1Z6XA 2PIDA 1DDIA 2WWGA 3EIEA 3D7LA 4JJAA 4MI3A 4AZ0A 2PT7A 3K6SB 1L8OA 1IOVA 5LVAA 1UDCA 4X8HA 3OZXA 3ZV4A 2ZZGA 3ZI0A 4B6EA 3GLHB 4HKTA 3DEHA 2XCIA 3DVSX 4KO1S 3Q6RA 3LVQE 4AG3A 1IUOA 3VV3A 4UMDA 2SCUB 1BMFA 2H63A 3RT7A 3WNDA 3FKJA 3JVDA 1P80A 4Q03A 2E6KA 3DZKA 2FUNB 3PF9A 2AFIA 1U0BB 4BIIA 5KQMA 2Y1OA 4GPAA 4RIFA 4HDSB 3VOTA 5J5CA 4DDWA 1Y1LA 4IEEA 4XYGA 1TA0A 2WT4A 3DDHA 4FOOA 2Z3ZA 1IXYA 3UENA 3USCS 4HDNB 2ZS8A 3H1AA 2VKQA 4AZSA 2KYRA 4AG6A 1FVXA 3KYDB 5AYVA 2IY8A 3WGHA 4NH4A 4KDFA 3JX9A 3ANTA 3F7TA 3V00A 3CMCO 3QWFA 3NDPA 4B3GA 2UZ1A 4M89A 4PFJA 5JSQA 3W2TA 1L7OA 3BXPA 1J56A 1IE3A 3TPCA 5JD5A 2C2OA 3NTRA 3A9WA 4YCBA 5CH8A 1EFPB 3NGMA 3R3ZA 1E1KA 2C00A 2D00A 1NXPA 1QONA 2MSCB 3ASRA 3LDAA 2IL1A 3N6XA 4UHBA 5KYYB 4M38A 3QLEA 1Q15A 3T9BA 4DPLA 1PK7A 1XZ8A 3MWKA 3LUCA 3MCWA 1XVIA 3UUGA 1FLAA 4PRZA 4PLVA 4QUIA 3DPIA 5GVRA 3SC4A 3VJMA 4A9AA 2C7BA 3WHKA 4H6VA 2BGUA 3AI7A 4HGRA 4U7JA 3CIFA 1P3Y1 4FUQA 3WX0A 3KELA 5TQ2B 3ONDA 3VKFA 2IUYA 1T9GR 3VVMA 3CU5A 1B1CA 1F51E 1FNDA 4QECA 2PRZA 3QVOA 3TN7A 4CL8A 3LBIA 3NB0A 4MTLA 2ZRKA 1REQA 1OHHA 2O2HA 4TKOB 4O4HB 4K87A 4YO7A 5FLYA 4DADA 5C7YA 4HXGA 1E1CA 1UM8A 4YMSA 2J3HA 1Z2CA 3H5TA 1KEEA 4NCAA 1UAGA 2RH5A 5FI5A 3Q4GA 5JCZA 4EGJA 1Z2PX 1OLOA 2ZBRA 3PEVA 5DYTA 4DREA 4ENUA 4MDHA 1XYYA 4Q1FA 4OD0A 3EUAA 4TMFA 3S5JA 5KNBH 2JCSA 3ECCA 2IP1A 2YRXA 2A86A 3R9XB 3R2JA 3LPMA 1CLEA 1U8XX 2H51A 1ENZA 2YBEA 1T4BA 1Z4JA 1NZDA 2NPIA 3INYA 4WKOA 3I12A 4MWOA 4ZQCB 8LDHA 4OJMX 2N3ZA 3CF4A 3QQPA 3U4QA 3KWFA 5AUNB 3V4FA 1V7ZA 3SHVA 1Y81A 1Z5VA 5HQJA 1HRDA 2Z6QA 1TUBB 5FI0B 4IYRA 2CV0A 5EHXA 5JWHA 3QEOA 3CNLA 1PGQA 2J3JA 3IQWA 3LQRA 4W82A 2ZBPA 4JB8A 5CT5A 4NF2A 5AESA 1V3VA 3CLVA 2M6LA 1ABBA 3OPQA 5FO1A 1K7SN 2HFKA 2J5BA 4M8SA 4UE3S 3VC2A 1D2HA 2RK3A 1AH2A 1XVUA 4D9HA 4F4DA 4KLZA 1RYMA 1FPQA 3OOYA 3A6ZA 3ZU5A 2BJWA 1Z7BA 4R51A 2Q4OA 3KSDO 3UK2A 1AQ6A 3DFKA 3G2LA 3MIZA 3ILYA 3SIPA 4KV7A 4QPPA 2EZTA 3VYVA 2VF5X 4GAEA 4U8GA 1E3LA 2J3IA 2G4LA 2M6SA 4LHWA 1SH7A 4PCUA 2WRZA 4O33A 3SBEA 3A7DA 2IUFA 3QLVC 4Y2VA 1ZUNB 2FRVA 1W8IA 1DOHA 2O9JA 3CZ5A 4MWEA 3STVA 1P6UA 2YMMA 3RAPR 1K5HA 4EOGA 1EA7A 4Q39A 1J7JA 1RJFA 2QLNA 4BNVA 3A6EA 3E9YA 1RI5A 3E7XA 3KKMA 3IP3A 4WN9A 4Y6PA 3G59A 3V4ZA 1S8AA 4JLOA 4DJDC 1BXKA 1KO4A 5HNKA 5HRUA 3MJDA 1AGXA 4RNDB 1H9AA 4BNKA 5KTOA 2O8CA 4IXMA 2GS9A 4TS1A 5I7FA 5FL7A 1U3GA 2GPTA 5FOXA 3PNOA 4H77A 5FQOA 5EI5A 1JDJA 3Q7RA 5BVGA 1A7AA 2FG7C 5JZSA 2HF7A 1GHTA 3WP0A 2CYCA 2A5DA 1NVGA 1ZFNA 2E85A 1SA0B 3LYAA 3OZGA 4I50B 2TS1A 3N59A 1HEUA 3T7CA 1NYTA 2ZYGA 1GXSB 3S8EA 4RLSA 3TNJA 2SKEA 5A2QA 5SV2A 4NWIA 3KV1A 1HNNA 1UZAA 5JCOA 3SLRA 3KHSA 3V4SA 1LA2A 3ZPNA 4KVAA 4KOEC 2FNAA 3AUUA 1RPNA 2JJ1D 1AMNA 3ET4A 3V2HA 3F98A 4Y30A 1O94A 4U63A 5E3IA 5FI3A 4ZMRA 3K9HA 3WVNA 3HNPA 2R6GA 1W75A 2I0FA 4GHWA 5EERA 2HEIA 4P4TA 1MOZA 1QLJA 2PBLA 3A9VA 4OHXA 2O7RA 4BZQA 3CPJB 3LGSA 2O1WA 5EIAA 4D9JA 2JLZA 3C3AA 2XUOA 1I6WA 4RNCA 1P4MA 1JTFA 3AU8A 2AFHE 4X8LA 4EFDA 1OTHA 3BJEA 4ISCA 5EGSA 1EGVB 3BMQA 4UNRA 4M1SA 4EI9A 2YWXA 3Q38A 2B9EA 2G82A 2JI9A 1EFVA 1TUGA 3BMNA 4YJHA 3ROPA 4N49A 1Z4MA 3FPSA 3L49A 1M6NA 4OQFA 5DNEA 5EKUA 4BMNA 2BBWA 3R74A 1MH1A 1S02A 1YZLA 2PZAA 1UR5A 3NXSA 8ADHA 3S4YA 4AMVA 3NBYC 1FVOA 4L08A 3EG9B 2VT6A 4MRAA 4HH3C 5JYDA 3GCZA 4IDOA 1QNLA 2B4QA 3AM5A 4D8XA 2E4YA 4A73A 1ZQ1A 1E9BA 1L3CA 3I32A 3QJGA 1RWVA 4MV7A 3RD5A 1FU7A 5F73A 4WNAB 1G18A 2CDNA 4DXAA 1KIAA 5FIUA 1J0CA 1KFEB 3BORA 2CNWD 1WSBA 2W2OA 1ZA1A 4FSXA 1FB5A 1HFKA 2IDJA 5IC6A 1E3SA 2JJ2D 2QU7A 4RXMA 5EKTA 2XZPA 2OHJA 4BTEA 2VUIB 1T2UA 4I5EA 3IDAA 3MCUA 3MINB 2YICA 1APBA 3BZWA 2YV4A 4AO7A 1E1NA 5F51A 1KDYA 1Q7BA 1E2IA 4IJ5A 4JQZA 4HZUB 4AS1A 1BQ3A 1EFTA 3CVUA 4ECEA 1GU7A 3B89A 3C16C 1DCKA 2X8LA 4NYJQ 1XMXA 1TYDE 5A5FA 5AW1A 4YCAA 4PXYA 4ZMSA 3VC7A 1RHJA 3TM4A 1RM5A 4WI1A 2OD7A 2DQYA 3AFHA 3KB2A 5EIHA 4M1QA 1N2BA 2GYYA 2XE6A 1K89A 3NI2A 4OMDA 1U4NA 4GPZA 4CFZA 3GZNA 3KKZA 2FW8A 1Z5OA 3UXYA 3VR6D 2R66A 3EVFA 4EPWA 1KS9A 4MP8A 4K6OA 3N2KA 5LDHA 1PZGA 3DHEA 4IDFA 3E7WA 4EGAA 2CJFA 3BSSA 4NEHB 3UOAB 1C3LA 5HILA 4EECA 4ZO6A 5MFZA 1RWNA 1BSVA 3AHGA 3ZGZA 5CT4A 2ZZNA 1L4NA 2JFHA 2PS3A 3UO8B 5JFTA 4WWHA 2F1OA 4R84A 4DCNA 4R6XA 4FB5A 4LZAA 5L8VA 1FU8A 2QLFA 3I0NA 4GU5A 1YK1A 3CCFA 3T1QA 4ZHSA 3AY6A 1J0DA 2ZVDA 4ARBA 5BR1A 1W47A 2PWYA 1PR6A 1SHUX 3TVTA 4BQFA 1WPRA 5BRNA 2BGIA 4FFWA 5EG5A 3A4LA 5F7ZA 2OB1A 4ETIA 1MHPA 2GETA 1E5VA 4RK0A 5F98A 4QTTB 3EZYA 2F6RA 5K3CA 4KU4A 2UXCB 3FCEA 2HD4A 4C06A 4CQMA 2DBVO 2XLCA 3PICA 1GUZA 4RDIA 3MGAA 3OETA 3QBEA 1H93A 1X7ZA 5M04A 1GTL1 2B5VA 1A9ZA 3A6HA 3ISJA 3I2FA 1JLSA 4GOOD 1Z9BA 4KAFA 4CQLB 2Y67A 1YFZA 4YUZA 1N36B 5HFJA 2DHCA 1U0GA 4R2HA 4C0LA 3EK2A 4U7HA 3RJ9A 3O5AA 3HL4A 2BL4A 2YXPX 3E05A 5CLHA 5H3CA 5JO9A 3O1LA 1LBQA 5CNMA 3UIEA 2E5WA 1V2GA 5LCXA 3UPDA 1U0TA 1Y3IA 1ZCJA 1IBSA 2HIHA 3U44B 1YRBA 1GR1A 5THQA 1F0PA 5AI6A 3OFVA 3IQIX 4OGWA 1G17A 1JE1A 2ON6A 2XBMA 2X22A 4JC4A 1AS3A 1M75A 4L5JA 5DHSA 2HC9A 4LDZA 2HDNB 2H1CA 3PFNA 3ZDZB 4DVJA 1OILA 4M88A 5D8DA 1Y1SA 1Y8CA 4I9UA 1X77A 4LQLA 4WLNA 4JEUA 3QVMA 1YI8A 1U8FO 2P3SA 3C6MA 3PD1A 3PKJA 4G0WA 1SXJC 1Z7EA 3EPPA 4XWYA 3W3AD 1BS9A 1JIQA 5JS2A 3VPAA 4O4IA 1KL7A 2IWHA 3ADCA 2AD5A 4PM4A 2WVJA 2RGGA 4J0DA 4MV6A 4GQBA 4MV1A 5K45A 1CIJA 4GECA 1XHFA 1Y42X 4D97A 2X8AA 3U48A 3NOVA 4L4ZA 2OT3B 3U37A 2QDXA 1BFKA 4KN9S 1RKVA 3O93A 1UK9A 5KPDA 4UTOA 4KXVA 3CN7A 4OK5A 1NW8A 2CT8A 4ZGGA 5FWDA 4W5HA 5KSWB 2QXUA 1C3OA 1CYEA 2BCJQ 2BFWA 2K87A 4HDKA 3WLOA 1YVDA 2BISA 1CVLA 4RQBA 5FV7A 3HTXA 4CEJB 5KC8A 4LRQA 3IDFA 3G0DA 3KOWA 2DFDA 3MTQA 1OPRA 3WTCA 3EXFA 2JFNA 2BZGA 3NH9A 4JU8A 2VNSA 4NTZA 4S3MA 3WWCA 4C3VA 3CT6A 3FWPA 3S1AB 4TYWA 1RZRA 2P4EA 3G8CA 4TS4A 4EY4A 1U2SA 3PVDA 4JP1A 5A03A 5K4GA 2O57A 2Y0BA 4HAUA 1TO2E 5TGZA 3BB3A 1F0KA 3TZCA 1JN0A 1UF9A 1ML4A 2IV7A 5G0VA 3MF4A 1OXVA 1KO8A 2X6QA 1WCIA 3D8NA 3DLPX 3W6NA 4BVKA 4N8DA 1M2GA 5LLSA 4BKOA 2NTEA 4GDFA 4FS8A 3CO0S 2B34A 1KF0A 3OLYA 3WGIA 1PFKA 1GRVA 1N3LA 1QZTA 1FDTA 1X1CA 2IHNA 2BY4A 1KKLA 2AA3A 4JR0A 4KQ9A 4V0RA 1MNQA 2XUJA 5EFOA 4X7BA 1T8WA 4ZVMA 3KYCB 3EXHB 2DFVA 5AJVB 4BCCA 5C4MA 5GV8A 2ZJ6A 5DIZA 3OTGA 3QEJA 5JASA 1PIWA 1EX6A 5DLPA 1IEWA 4RK1A 3KT3A 3N5KA 4GYWA 1JSCA 4PONA 4UATA 2PKQO 2VTDA 3H42B 3DO5A 3HCWA 1D03A 4N3NA 3DDUA 4M8IA 1A82A 1OMOA 1QYWA 2P2NA 2AWNA 2HUPA 3QYJA 1OA1A 1PJCA 3NP9A 4C88A 2QMYA 5JMTA 2BZ0A 4BGVA 3D31A 1NPDA 1O5OA 1N2XA 1WZCA 2XOXA 1H66A 3BEDA 1K63A 1RI4A 3F6SA 3ID6C 1Z0DA 4G4SP 4Y2PA 5FOTA 3GXOA 4GKKB 4LV6A 4BQOA 3UNXA 3SQXA 2N1BA 2D1FA 3A9SA 4JKOA 3BQ9A 1S8OA 2Q5JA 2NGRA 4GI7A 3ZE9A 5EP2A 1B00A 3ELBA 4W8OA 1EAYA 3GGJA 3L8MA 4P31A 5DO9A 4RAOA 3CR3C 4WIAA 4R2WA 3TIIA 3GEDA 1A9XA 5J2TB 4NOLA 3IQGX 4KRFA 1Q7GA 5JAOA 3O1JC 4K6CA 1GPYA 1DXYA 5LU8A 1QCCA 1EE1A 4HC4A 2Q8PA 1OXBB 5A1TA 1NUUA 8MHTA 1BX3A 2B61A 3KXPA 5HDBB 3OKCA 3VNAA 1QFMA 2W48A 1EH5A 3CINA 4E6EA 4JUBA 1VCOA 3OHSX 4IHJA 1T6NA 4TTAA 2HLPA 2JI4A 3JATB 3TAXA 3U4GA 5U4XA 2CE2X 1ODJA 2HA3A 4LZZA 4RL6A 2PL3A 3P5SA 3P9XA 5CDSA 4KMSA 5AW9A 3WL8A 2J5KA 5LMUB 1QK4A 1FFGA 2GZSA 3P26A 4DLYA 4UEQA 1JPUA 2WDZA 1K7EB 4RPKA 1ZR2A 1Q3TA 2XMSA 1KPGA 1RAAA 1BQ4A 1TAQA 2PAAA 4NFHA 4WFIA 3EQ2A 1QB7A 3Q7SA 5DBEX 5B37A 2NMVA 1KFJB 2A0WA 2B1IA 2VK1A 3GMIA 2CLEB 4PPFA 1L6IA 2PLNA 3BK2A 5BNTA 2FX3A 3GNTA 3I9V6 3MOSA 1QHXA 3PIRA 3KC2A 4X1YB 2QM7A 5COAA 2EBFX 3Q5DA 4M8NE 5HQ3B 3NTVA 1RLUA 1T25A 3IT1A 4QATA 3NNNA 3QVGA 1TVCA 4B79A 1YKFA 4KOAA 3U9TA 2LW7A 4BNXA 1DRUA 4P92A 1GZSA 2X9VA 5TARA 4F3TA 3QFCA 3EIXA 5DHAA 4M53A 3BWEA 4JIGA 3V1YA 3EXIA 3X1YA 2FR0A 3V34A 3W4IA 2B6NA 1U6JA 1H2XA 3CBGA 1ZN8A 3CQ9A 4LX8A 4MLZA 2UZIR 3RABA 3H2ZA 3IR5A 1AUQA 3M6XA 3A2NA 3NHAA 4G4JA 4W99A 2O8EB 3KYBA 1YVEI 3VC1A 2VYND 3ODGA 4H4DA 3U4MA 3T3OA 3JQ7B 3LXMA 4V3BA 3WQQA 1GTG1 1P7ZA 4KIUA 1P1FA 1V39A 3TQCA 4GKJB 2CF5A 1R6VA 4JX8A 2QU8A 1XDBA 5EQJB 3TBFA 2V1UA 1JLKA 1UMDA 2C0CA 4GEGA 1OLSA 1WOMA 2CHVA 3ESCA 3D1LA 4Z8YA 1GD1O 2OKCA 5F77A 4HWTA 1FMJA 2FN9A 3S68A 1S4QA 4JB3A 1NIJA 3T7TA 4LXTA 1H2YA 3PJDA 4M37A 3T52A 3UAOA 4D45A 1R0KA 2ZXHA 1T6YA 3BHMA 3NLLA 3ZWYA 1UD5A 1K98A 2I8CA 4XW2A 1JIIA 4OHRA 3ZY5A 2UXBB 3AJDA 1EIWA 4WJKB 1IBLB 3FMIA 2GM4A 3C8MA 1K88A 3DM9B 4EI7A 2O23A 1O0CA 4AG5A 1KY4A 2XTMA 2QGNA 4OHPA 1FTWA 4DEVA 5LOVA 2CLDX 4UNPA 1S3GA 2DHEA 2EP5A 2QSYA 1N3YA 4ECAA 2WHPB 3F46A 3PZRA 4JVOA 1YVPA 1N32B 3W2GA 4RCZA 2WKRA 4M87A 1N6RA 5DYNA 1EB8A 1W93A 4KHZA 5E4TA 1NZJA 4CMGA 3GRCA 4ASUA 3D0OA 1GA4A 3D3WA 4GC9A 1ML3A 3BWDD 4X92A 4CHTA 4LSMA 1KVTA 2REQA 1N6IA 2YVAA 1NUSA 3ITDA 3DYBA 5EJIA 2Z83A 3H2YA 3P5BA 1T3TA 4AS3A 1ZW6A 2O59A 1PSZA 2OCDA 3MWDB 4YDRA 1PN3A 2JVIA 3G7NA 1YQ9A 3L8HA 4MDYA 1VCHA 5DF1A 4CKBB 5JBIA 1MUUA 3I3SR 3LQYA 4QULA 5C8YF 2C95A 3UAWA 4F6RA 5KU7A 4RIEA 2H9IA 4BAUA 1PGPA 2H5JA 1HZZA 1E63A 3AEUA 1QRSA 4WY8A 1DCTA 1I3NA 4IXWA 4L75A 3STYA 5IF9A 2NWQA 3MCAA 1K8ZB 5TT1A 2NSJA 2D4AA 1M8PA 4PPQA 4CLHA 3LP6A 5D1NA 5IMSA 2PMDA 5AXAA 2EATA 2Q5LA 2VBUA 2VLBA 4A8JC 5JAIA 4JVNA 4ZZ3A 2VSFA 4G41A 4FMCF 4CT0A 2B8TA 5HTKA 3F4BA 1HTBA 1T43A 2YXNA 1G21A 1P1JA 3LUKA 3OTWA 2HDOA 2XOKD 2IU3A 1Y0YA 3I3OA 3QNUA 3V2IA 1EXVA 3LUFA 1D1QA 1YA8A 2XB2A 1YOVB 2GM5A 1NLFA 3PPWA 3D6TB 1FQJA 3BTSA 4H08A 4UEWA 1T9KA 4V03A 4EWLA 3M82A 1V1RA 4HFRA 4RA9A 4WEQA 4FU0A 4NU0A 4HTFA 3WBKA 1VSUA 1DOZA 1XZEA 3U2QA 1NJ1A 2C2XA 2WJVA 1MOSA 3TNLA 4HX2A 4C0WA 5BSWA 5JD6A 5EZ6B 3ZBPA 3SZOA 5ALGA 3U1VA 1Q1EA 4OG2A 3G0GA 3I9KA