3ZBTA

Ferredoxin-nadp reductase mutant with ser 59 replaced by ala (s59a)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQAIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title A Hydrogen Bond Network in the Active Site of Anabaena Ferredoxin-Nadp(+) Reductase Modulates its Catalytic Efficiency.
pubmed doi rcsb
source organism Nostoc sp. pcc7119
total genus 94
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3zbtA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3zbtA02
4LBZA 2DERA 1QUFA 2HMAA 3WBJA 3LYUA 3ZZTA 4PC3A 4TN1A 1H85A 1G7TA 1M1KD 4LBWA 1KK3A 3OZVA 5GV8A 2BPOA 1K9MD 1EP3B 3WBKA 4YALA 3I55B 1JA1A 4MYTA 2VNKA 2XNJA 5H5JA 2YWEA 3CCVB 1Q7YD 4FN5A 2B7CA 1FRQA 2VYQA 1JJ2B 4ACBA 3B82A 1E64A 5TR9A 3CCRB 4HE5A 1VQ4B 2QTLA 3OW2B 3CW2A 1ZM4A 4N3NA 3ZC3A 4NCNA 3AVUA 1W35A 3VO2A 4C0SA 1TVCA 1KD1D 4WQMA 2OK8A 4Y9RA 4N3GA 2J7KA 1TTTA 4UAJA 2EFGA 1KK2A 1M90D 3VNVA 4RCZA 4YHBA 1BQEA 1QFZA 1SKQA 1IJEA 1QFYA 1N0UA 2RC6A 4R71A 4B44A 3WNDA 2X3UA 4AF7A 2YWGA 3CD6B 3W2EA 5THXA 5TV2A 1F60A 5HXBA 4B43A 3WY9A 3OZWA 4Y9UA 2BGJA 2BM0A 1KK0A 3SJZA 1G7SA 1N8RD 4G1VA 3CCEB 4YAOA 1UMKA 2PMDA 1D2EA 4RCYA 3P26A 3U2QA 4TMTA 3W2HA 1S72B 1QUEA 1VQKB 1ZM3A 2DETA 1NJID 3CC7B 4PC6A 1KC8D 1QVGB 2OTLB 4ZV4A 1KTVA 3QFTA 5FA6A 4B48A 1K73D 3AVVA 1GVHA 3QFRA 3VO1A 2QN6A 5GV7A 1FNBA 4RD3A 3OJXA 3QFCA 1KQSB 1FNDA 1GAWA 4H9GA 3CMEB 4F7DA 1QGAA 5H59A 4ACAA 3VMFA 1EFUA 1F20A 2CNDA 2QTZA 4RD6A 3WNBA 2QEXB 3AVYA 2EIXA 3JQQA 4RD4A 3CCUB 1GO2A 3ZBTA 2E1RA 1QH0A 3ES9A 1YI2B 4YAFA 3CCJB 4J0QA 4NBSA 1YHQB 1QG0A 3LVBA 1EP2B 1QFJA 2R6HA 2BSAA 2BN4A 3CXCB 1KRHA 2QA4B 1D1NA 3J81k 1FNCA 5JBQA 3CCSB 2QDXA 1E62A 2C77A 1SM4A 2BGIA 1G7CA 2B7BA 3CCLB 4LBYA 3W2IA 1DARA 3W5VA 3QE2A 2BMWA 2DCUA 3G6EB 1XB2A 4G1BA 1BX1A 2XEXA 1W34A 1VQMB 4P6VF 3MMPA 3P27A 3AVTA 1KJZA 1TLLA 3WXMA 1BJKA 1IB0A 1H42A 4LC0A 1CQXA 1EFTA 3B8HA 2C78A 4M4SA 3LRXA 4PC7A 5TY0A 5DSZA 1B23P 1B2RA 4PC2A 1YJNB 4ZGQB 5EMNA 1VQ8B 1WDTA 4M1KA 1GR1A 1JA0A 1QGYA 3CC4B 1J9ZA 2HDNB 2VNIA 3G71B 1XE1A 1IJFA 1S0UA 3I56B 1R5NA 3W5HA 3ZZUA 2HCJB 2YWFA 3CCQB 4QFMA 1Q81D 1GAQA 2GPJA 3W5UA 2FX3A 2VZLA 2DEUA 2VNJA 4B4DA 1VQPB 4P3YA 1VQ7B 4M2LA 1R5OA 4DQKA 4C43A 1ZM2A 1VQNB 1YJ9B 4K1XA 3CC2B 1VQ6B 4PC1A 1R5BA 3AGQA 4Q7JB 4HE6A 1NDHA 1W2BB 1TUIA 2ZITA 4ZCLA 2RC5A 1OGIA 3QSYA 1Q86D 1DDGA 2OK7A 3JQPA 4PGOA 3CPWB 1VQ5B 1DG1G 1ZM9A 3I1FA 1YJWB 1Q82D 2BVNA 4IW3B 2QMUA 2XNCA 1K8AD 4MYUA 2BV3A 4TMXA 3CCMB 1QGZA 3LO8A 3MHPA 4RD2A 4AC9A 4ZCIA 3CRZA 1CNEA 1N0VC 4QHYA 4RJLA 1AMOA 2VNHA 3FPKA 1AIPA 4FK8A 3QFSA 2D74A 3E1YE 1GJRA 3FJOA 2NPFA 1HA3A 1U2RA 1W87A 2DY1A 3B78A 1CNFA 4Y7CA 4FWTA 1FRNA 1EXMA 3ZBUA 5AN9A 1ZUNB 4B47A 3E20A 2PIAA 3AVXA 3CB4A 4BPRA 1VQ9B 4M53A 1YIJB 3U6BA 4U9UA 3VNUA 4TMZA 2BF4A 4G5GA 4RD1A 1EP1B 4EH1A 1ELOA 3G4SB 1EWYA 1QX4A 2AHOA 1FDRA 1OB2A 1JB9A 1QVFB 1DDIA 4TMWA 3WYAA 2B5OA 2BM1A 3OZUA 4RD0A 2OTJB 1OGJA 3WNCA 1D8TA 3MCAA 2YWHA 4LBVA 1YITB 1A8PA 2GQFA 4ZGNB 3U6KA 4ZCMA 1E63A 4YAUA 1VQOB 4AF6A 1OB5A 1KK1A 3JQRA 3CMAB 1I7PA 1BX0A 3ZZ0A 4B3XA 3OJWA 5KSWB 4TMVA 3V76A 1EFCA 1FNMA 3W2FA 1G7RA 1VQLB 4M0LA 3AVWA 4DQLA 4YAWA 3A1FA 1JNYA 3AGPA 2PLFA 3PENA 3W2GA 2CRVA
chains in the Genus database with same CATH superfamily
4AO8A 4BASA 2ZP1A 1J33A 1H05A 2HXSA 4PQEA 3T9CA 1IAQA 2WZBA 1K6EA 2XSZA 1H4VB 1ZDMA 2W2XA 2JAHA 3MTAA 1TECE 4F9TA 2H16A 4FGWA 4BMNA 4R8LA 5HQ3A 2Q0QA 1CC1S 1I24A 1PZHA 2WE8A 4PS1A 2B4TO 3M8KA 4MZDA 2O3JA 2WZPP 4M1OA 1RSZA 2W6OA 3SLKA 2OCXA 1G21A 2VDRB 2CZCA 4C0JA 2ID9A 5EEHA 5LMNB 1SPXA 3O6VA 4K28A 4DR7B 4UXIA 4F60A 4U2DA 1UBEA 5KWEA 1U8EA 3ZHBA 3LFUA 3LUKA 4RM0A 1T36A 3HH8A 5ALEA 2YS6A 5IVPA 1PEDA 5DIZA 2GJ9A 4EVIA 2FSFA 3ABSB 2MINB 5KKNB 2DQ4A 3Q3AA 3UHFA 4E13A 4ENSA 1E4EB 2X7HA 4UNIA 4YR9A 2XOXA 3WL4A 4PXYA 1JS1X 1LZKA 4XYLA 4OP1A 4W8HA 3W7VA 1RLOA 1XEWX 3CCVB 1MJHA 4ZXFA 2RBEA 1FSGA 3QTBA 4JK3A 3TOXA 5JAPA 1PSZA 2FW6A 2GZMA 3EYWA 2XQKA 3ROMA 4BXOA 1GQSA 1QYIA 3B5JA 1AOXA 3M6WA 2VDOB 4KE7A 2IH4A 4GNKA 4FWBA 4XWAA 3N58A 721PA 3BK7A 1L4YA 3CC8A 3LPMA 3MTQA 1A7KA 4X5OA 5KYTA 2QJTA 4HEQA 4PYIA 1Y9DA 1PJQA 4WXHA 2GGSA 4JXKA 4DGSA 1PLJA 4OB8A 2IJGX 4P12A 2OVBA 4NU8X 2MSNA 2F3UA 1OJLA 1S7CA 3AVUA 1SRRA 2XKAA 5AQ1A 3W3AH 3WGGA 2WTBA 1W35A 4H0CA 4JT2A 1CUHA 3VNSA 1PJCA 2ZJ1A 3FDIA 3QITA 4H1TA 1MENA 2Q1SA 4GKVA 4W99A 1HC7A 5FXMA 3I72A 4N8EA 1JKIA 4M88A 5D1HA 4UAJA 3EXEB 4MQEA 3OOYA 4HDOB 1PGNA 4PANA 1U0JA 2W70A 2YRXA 3AKEA 4WDRA 5AVWA 1CJKC 3WP0A 1Z0AA 3ZLTA 4AZ3B 4G5OA 1P7YA 2CXRA 2WIJA 1C8BA 4AIRA 4CM3A 1XPOA 4KMRA 1L6IA 1Z2DA 3DMTA 3FDFA 4N5HX 3I8SA 2D2FA 4PZUA 5GM2A 3UOWA 1FMFA 3HBMA 3K1TA 2BC9A 2GAAA 5F98A 1ZUHA 1Z5UA 2Y0BA 1U6JA 2D2VA 3S27A 1JEDA 2X3UA 4AF7A 1ZISA 4XWTA 1U9YA 3OIVA 3Q3IA 4RKEA 4F5YA 1JA9A 5HUQA 4ZCSA 3L8DA 3QK7A 2Z04A 2FW8A 1ORTA 4NEHB 3VYSB 4X6LA 5HS4A 5J1TB 1T6XA 1QE0A 1R4AA 3KJIA 4TQ9A 4CR7A 1JZQA 2PTHA 4CTKA 4HL6A 1U8XX 1PWXA 1D9ZA 5EFZA 4FB4A 3OI7A 2GK6A 7YASA 3GFRA 2NV4A 4DUPA 3EFHA 1OB0A 1TK9A 1YC2A 2H2IA 4EKYA 1BCRB 5I3CA 4E3WA 2G25A 3ASTA 1RD4A 1OROA 5I8ZA 4DYDA 1X1AA 3LTNC 3DKPA 1MEEA 2EXXA 2IQ5A 1YZHA 2QM8A 5I9IA 1SAYA 3VPCA 5JU6A 2EAUA 3KAJA 1B93A 2L2QA 3MBOA 4MW7A 1SPBS 2BGUA 5BN5A 1FRZA 3DZKA 4KX5A 2V98A 4GBED 3SXUA 1AHPA 3ZHSA 2V97A 3L5OA 1VLHA 3NOXA 4RK6A 1X9GA 2WB2A 4F4IA 1RZVA 3L1JA 3C14C 3FKQA 2DETA 2ATXA 4G56A 3Q7TA 3CC7B 3BL5A 1T0JB 1EGAA 3O21A 2QRLA 3DNMA 3L1VA 3DMHA 1CERA 2VAMA 2XQVA 5NLLA 3CNQS 3PZBA 1XTKA 2XTMA 1I4OA 3F2VA 4IH1A 1JNXX 1Q7CA 2D0PB 3CZMA 5AUQA 3VR2D 2CYCA 4YXWD 3HBAA 1ZGZA 2PGXA 2QHXA 2RJNA 4IQ4A 1QH9A 1T5SA 3TRIA 2J32A 1REQB 5I4IA 1QJCA 4X85A 4TWAA 1Q44A 1XVAA 1T9AA 5DLEA 2WSSD 2Q7OE 4BZZA 6REQA 1Z4IA 1P80A 1FNDA 2W9XA 4NFLA 4ZARA 4JU8A 2I91A 2PV0A 5FBHA 5J23A 4NI5A 3K0BA 4YJ3F 1CQJB 3HSSA 2CJPA 1Y7LA 2LV8A 3Q6MA 3FWKA 4LZLA 4NPCA 3STWA 4D8WA 4DBLE 1R8JA 4ACAA 4KR6A 2PCLA 3IQWA 1W0CA 2IHKA 5CDHA 2FMKA 4AX4A 1I4DD 2H3HA 3MCWA 1ULBA 3WIUA 4C6TB 1F4PA 4XKVA 4NAUA 4IDNA 1DFHA 1RWNA 4WK2B 2YXBA 1UBCA 3E9YA 1YZYA 2AFHA 1Z7YA 1FTQA 2WTEA 4I5DA 3DL2A 1T8SA 3W0LB 4F85A 4C89A 4QEZA 4XOTA 1Z2AA 1MHTA 2AR9A 2FP3A 3DXYA 1II0A 2D00A 1NW4A 1K6JA 2OD2A 4EZBA 2RGNC 4QQFA 5HQJA 1E7SA 2PQMA 1RQ2A 3RROA 3ZTTA 4O4HF 3WLFA 2O8DA 4J0QA 4H6PA 2YUIA 1NBWB 1R9NA 2E82A 3B3FA 3LNNA 3E7DA 3QE4A 5AW8A 3U7FB 2AJTA 1D07A 2GDJA 3MWEB 3TZBA 2HV9A 2IHTA 3FCYA 821PA 1XCJA 4TRJA 4WCFA 5LXTA 3K70B 1LX7A 1YZUA 3HUTA 3HU3A 4X44A 3SJUA 3A4VA 3VO8A 3KQVA 5G0WA 3UMJA 1NNUA 1QTQA 2BFAA 1WZ2A 4PYQA 8LDHA 1WVGA 2OEPA 3EQ7A 4PWZA 1SM4A 1B4DA 4RJ2A 1GU7A 5DNWA 4ZZIA 2X8WA 4C7XA 2GO7A 2WBLC 4AUKA 4LGMA 1E60A 3EMVA 4UCQA 4JLAA 3DEKA 1EDBA 3WFZA 3W5VA 5B6PA 1H3FA 1VRCA 4IDOA 2BSQA 2P2LA 3LVFO 2AC7A 4LIPD 5LOVA 3IQDB 2O8EA 2V6FA 3SP1A 5B2ZA 4G1BA 4AKIA 2CJXA 3HXTA 3RLFA 4C7MA 3EVFA 2EJVA 1YS6A 1IM2A 3N87A 4N3BA 3ISXA 4RPCA 3EEYA 4BX2A 1RXEA 5BR1A 4BU1A 5IJ0A 1SGWA 2VBCA 4DY6A 5K3OA 1QYWA 1XKLA 1JDJA 3B20A 2DHEA 3IUMA 4G41A 4MUHA 2CK3A 4PTLA 4L7VA 2VDMB 5CXXA 5A1TA 4L5JA 3QY0A 1ZVKA 1KJZA 3CUUA 1RPNA 3O5AA 4JGGA 4BCDA 4F21A 2PWPA 3KLPX 4AXBA 2X6QA 4C9BA 1T8WA 3NYRA 2HRZA 1TPZA 1V48A 2RHOA 2VPWA 3BMCB 5CD9A 4CEHB 4OQPA 4D0GA 4TYNA 3TW4A 3DXZA 2G07A 3D6TB 3ZGXA 3WGNA 3E05A 4A0HA 1T9KA 1UJ5A 2ZJ0A 4ILKA 2I7CA 5CH8A 3RWMB 3UHOA 4CNQA 5DYGA 4XM3A 3HVKA 4PC2A 2ZBQA 3F6RA 4TWBA 1IHPA 1M8JA 4R1MA 3HO6A 2Z3VA 4X97A 1U8FO 2IL1A 1O6BA 5FWXB 3LKZA 3NEPX 3LNTA 4R1SA 5CVEA 2X6RA 3ZU2A 2P8JA 3KJFA 3VAAA 1QGYA 4AKEA 3TUZC 2VNIA 3F9RA 3A3NA 2HOQA 1OZAA 3JV7A 2HK7A 1XFOA 3VNRA 4CMGA 1KKUA 3RSZA 1S7GA 2PM8A 4A15A 2XB2A 2Z5VA 2YHBA 5K7SA 3FLMA 1NU8A 1PFQA 2DFVA 2VCYA 3NTOA 4P93A 1J97A 3AP1A 1I2BA 3KFXA 4D97A 1LKZA 2KYRA 4H1VA 4K87A 3QJ5A 4BVEA 2ZCVA 3NBFA 4U5QA 1Y3DE 2ARKA 2IY8A 2Y77A 2R2GA 4M22A 4Q47A 1G60A 2GKGA 1SCQA 3VPAA 1GARA 1CUBA 1WF3A 2R3SA 3MC1A 5DKFA 2Y71A 5E95A 2QSYA 3ULKA 1M8GA 4W8GA 3TQQA 1O95A 5BYKA 2VSOA 3Q3CA 1TPYA 1Z6AA 5EVJA 2GBGA 1XRSB 2VPZA 3PT9A 5KTKA 1TGVA 2ACKA 5B57C 4UUQA 4M76B 3UAYA 4C43A 1U2ZA 2FG5A 3T1YB 4L07A 4MI3A 1ULSA 5HKAA 1VQNB 3SEJA 2AXQA 1S8AA 3Q12A 2ZRIA 3L82B 4EI7A 2LCFA 1WKCA 3JY6A 1YK0A 3B60A 1V7ZA 2L18A 4P4GA 1PT7A 5K0ZA 4C08A 3PWTA 1P6UA 4JVNA 4YUWA 5JPDA 1W46A 3WSWA 2XSZD 1K7EB 5GGYA 3ETDA 3QQ5A 2OQ2A 1NUSA 2P9FA 3NDIA 1TOAA 2ZJAA 4EABA 1GVNB 2CXHA 1H3EA 4GOLD 3UOGA 5CPBA 4PABA 1GUDA 2PQ6A 1QIEA 3ZBQA 3RCBA 2O8FA 3H87A 3NHYA 4MMXB 1MUUA 5CLLA 1DXQA 4C20A 2TMKA 3TTTA 3AFNA 2ZRDA 1C7FA 2D2IA 1I14A 4X7EA 3MYRA 4FEGA 2W2QA 4IO1A 3TRDA 1LVHA 3WZMA 4NCBA 3TW0A 2J5XA 1KIMA 4FHFA 2R60A 2UUCB 4JLDA 5A03A 2ZTNA 3N2NA 1W4LA 3KWLA 3KK0A 2JIDA 3G2PA 2Y1LA 4DPLA 3DYVA 6AT1A 4PGOA 1BOFA 2YWRA 1DFIA 5KQPA 1HMYA 1PQYA 2PFGA 3E7WA 1ISPA 1NXXA 2R8BA 3KDSE 3OUTA 3UAOA 3TFOA 3I92A 2X40A 5EUBA 4URVR 4V02A 5IC4A 3EXFB 1VMDA 1ZJZA 4GOND 4GZMA 3EEFA 5SY9A 4AWBA 2EP7A 4U2CA 1FMCA 5K09A 3L6DA 7ABPA 3PYLA 2OP1A 4RO0A 4YWHA 3C7CB 4CCSA 3NONA 5JYEA 2HD4A 1AS3A 3C8MA 4DA0A 5AK5A 3BAZA 1PFVA 4RVFA 4B40A 4ZFNA 2C95A 1X8LA 5CB4B 4TZKA 2DIEA 4HMQA 3ANTA 1QGZA 3GU3A 1BEEA 3LO8A 4A82A 4ZVVA 4R40A 1QQAA 3JQDA 1N9KA 3U3JA 3ZJYA 3EFBA 1WPGA 3QHPA 4D9FA 1Z2EA 1BGWA 4FYXA 2D74A 2AGVA 2PKCA 3IDQA 4JR2A 4JLVA 5JQWA 3DEHA 1IOVA 2GK4A 4FYKA 3FJOA 4NSNA 2W6JD 4JVLA 1LV7A 1YUMA 2WYRA 3LBFA 3KKQA 4Q9NA 3TSAA 1JHRA 1HVXA 5EZ6B 4EHLA 3QGMA 1G1MA 1VLZA 5AKXA 1YUBA 2EGGA 3L0YA 4MRAA 2A5GA 4MAMA 3ZDQA 3KIPA 4AY2A 4JAVC 3S2UA 1SG6A 5ARCA 4Q4JA 5BQ5A 1TO6A 2G0NA 4U7DA 1NRJB 1VL1A 1JKFA 4A10A 3Q8MA 3C4VA 4ND8A 4BJ1A 1PJLA 2YVUA 1MNAA 1RJGA 1YACA 2QGNA 3ETEA 2V7TA 4U9UA 5CIQA 2C54A 4N3AA 1S2OA 4P1ZA 1IPEA 4PBRA 4E5DA 3CPXA 4WBNA 4R7GA 3CNHA 5ALSA 2C9YA 5TS2A 4ZWNA 4DSAA 4YP1A 4WDQA 3EEIA 1KYVA 4EH1A 2YVLA 1TIKA 3ND9A 3ZWXA 4E08A 5IS2A 3A8KA 3JTMA 4NV3A 1X1BA 2WUWE 4ZODA 3QW4B 1EWYA 4O1MA 1WEHA 3DBHA 2B34A 4B6JA 4G0VA 1P4JA 4LTNA 2HCTA 3R7DA 3DF7A 5FHRA 1QP8A 1CE8B 1Z62A 2I6XA 2NTYC 1DBPA 1UD3A 3L01A 4R9SA 2Q29A 1A9SA 2R47A 3O9MA 4WSOA 1IXZA 1Y3IA 1Z4PX 3S2GA 1JFSA 4ZCPA 4OKIA 1W85A 1YB4A 3LCRA 1W36D 4WHMA 5GMOA 1E4YA 2P77A 1NHWA 3GP3A 3Q0EA 4WNYA 3BB1A 1U2GA 2EKLA 2KJQA 1JPNA 4BO4A 3KQHA 3YASA 2Z6AA 4KXUA 3DD1A 2P1ZA 3H9NA 1H4TA 1UK9A 2F67A 2FP4B 4MWBA 5ALYA 3HZRA 3SI7A 4HTAA 2J3HA 2FN9A 4MGIR 3INRA 1U9ZA 4UDOA 2VEOA 3G85A 2C04A 5E9WA 5T6BA 1QVWA 1NNI1 4ALLA 5YASA 4C0BA 5MDHA 5JS7A 4V03A 5HDQA 2YXEA 1E1CB 2O0KA 1TUGA 4ZCMA 1UOOA 3NYWA 1SXHA 1XTVA 4P9NA 3VU9A 5T7BA 3IEPA 1AKEA 3R5KA 1RM0A 4FPXA 3OF3A 4LMAA 4ZVOA 2OMEA 3CP2A 1TVMA 2ZDGA 4GXQA 1Q83A 2VBVA 1GLGA 3PGA1 3BICA 5HKOA 2DFTA 4JN6B 1X7WB 1GU0A 3F3SA 3FFBA 3IFSA 4XR4A 3U17A 3WGVA 4PYRA 1U0OC 2BOVA 2PUGA 4EHAA 1IUNA 1KC1A 2LCIA 2C99A 2LUOA 2EVWX 4C0WA 4UU7A 4AP5A 4NABA 5ESDA 2ZXIA 3WJAA 4AS3A 3V76A 2CJFA 2QLTA 2XR1A 5CGQB 5LBTA 3FMPB 5AVYA 5BVHB 3HRHA 4IDGA 3VX3A 1VA5A 1USVA 1JN0A 3NBXX 4TTIA 4L7QA 4YP0A 2OM6A 5DGDA 4RSHA 1BEUB 4YAWA 4L78A 2R9VA 2NW6A 2PEZA 4HWRA 5ERGB 1OKKA 2QXUA 1OFGA 2COUA 2OT3B 1VHQA 4HNGA 4ZQFA 4FT4A 3TM5A 4M21A 3OHMA 4L0CA 2FG7C 4QRDA 3HP1A 4UVGA 1N0WA 5B7GA 2TMGA 1ZUD1 3AJ9A 4Y2UA 2XJ4A 1RT9A 3K6KA 2HIMA 2IYLD 1X1QA 1V16A 2PYZA 2IPLA 2ZTHA 3CRNA 3DCYA 3FYUA 5EUCA 3KZKA 3DFUA 3QPCA 1NPYA 4HDAA 4I6GA 3BY1A 3BKXA 1KZ9A 4FBMA 5BWMA 4CM8B 3U4DA 1Y7HA 1JXAA 3IA2A 4HEJA 5BSUA 1A95A 1E2PA 1HFJA 2ONCA 5ILQA 5E2AA 1UXOA 2CUKA 2P1RA 2Q3BA 4X1IA 4AM8A 5IFKA 2H1LA 3ZNOA 1E9CA 1WMBA 3EDRA 4QG3A 4LJYA 3WLOA 1F3LA 2FUEA 2YJ3A 5FPKA 3F7TA 4CMBA 4I5GA 3L7DA 3EW9A 4HXGA 4CIYA 1OYWA 1NRIA 1CR2A 5L53A 2J08A 3I8OA 3I39X 1E2IA 4O2BA 2FWNA 4FYIA 3BCHA 3K09A 3RC7A 5KYXB 3RBVA 2UUBB 3H5VA 2G1KA 4ZYZA 1N6HA 3NRBA 1EWQA 3UT0A 1RQXA 2FSGA 2PR2A 3HEBA 5G53C 1L8LA 3BF8A 3IOCA 4Y2YA 3SAJA 3T4PA 3OKPA 4C2TA 1CHDA 1FUYB 4MYTA 2KM1A 4HDCA 3V8MA 4N41A 1DLIA 1Q6ZA 1TFUA 2CFCA 1VF7A 1ZHFA 3KOXA 2P65A 1PVDA 3O7WA 3TD6A 5LKRA 3JQFA 4CM6A 3TM4A 2G9UA 2NU9B 1X2EA 2HV8A 4RVOA 4BVAA 1EQAA 2EWWA 2GHRA 2HWXA 2NTNA 2XB4A 1CY2A 2WU1A 3C45A 3M5WA 3WIBA 1PNRA 3AR8A 1E64A 4PO3X 4Z4HA 4G4SP 5TR9A 1Q50A 1NWCA 5KQLA 1VQ4B 3WHKA 3WICA 1W2GA 3O8OB 3FI0A 1DZ3A 3V7FA 4D9HA 2VAWA 4QVIA 4AP9A 2GXUA 2J09A 1HF3A 1RLUA 1VIAA 2NNWB 2J3DA 2WAOA 3KHKA 3SQOA 2UYHA 3VYRB 3R8XA 3OH8A 4ZOAA 2P4EA 5F52A 4RCVA 2BBOA 3THWB 2G1PA 5DYYA 1T8TA 5LQUA 1OI3A 1ORDA 1ESDA 1ZY2A 2R86A 4HB4A 5CNJA 3PEVA 5KVVA 1NE2A 3K15A 4W4TA 3R76A 4HAYA 4ALKA 1KK2A 3H6GA 5CA1B 2IFTA 4CMEC 1NOJA 2ZE7A 1N07A 4GQNA 2J4FA 2ZUDA 5C37A 1L7RA 4B84A 1YQTA 4WKCA 1EAYA 3B2NA 3AG6A 1DGQA 3F4KA 4PQYA 5CJ2A 3V8RA 5EJ5A 5A4JA 2YJ4A 2NXNA 1XPRA 1KBQA 4MMZB 1QIKA 3M5CA 4G9GA 4LV5B 5AOVA 5EE5B 4J1SA 3B3QA 4RHUA 5C1PA 1RHUA 4US1R 1PFYA 4W7HA 4DVGA 2Q3DA 4ITVA 4AF8A 4GX1A 3VPBA 1Z0FA 3QPWA 3CD6B 3ONNA 3MLAA 4ONEA 3E9DA 2VDUE 4J7AA 3QBJA 4JITA 5LDGA 2MSCB 2D9RA 2VJDA 3MNFA 1N1EA 4WVFA 2VSNA 3UTDA 2I67A 4IV5A 1LTKA 5KQMA 3KLMX 4LCJA 4WZBA 3IIEA 3QX9A 1DAHA 4NJMB 1ECPA 2ZUSA 2DLDA 4B73A 2WAMA 1YVDA 2O20A 1XNRB 4KSYA 5J2TA 1D1TA 4YACA 4X00A 2PE3A 1SK8A 2B1IA 3UG7A 4CDGA 4JJFA 3NATA 4EOGA 4MW2A 3TNDA 1T25A 3GFVA 1E79A 2YZKA 3RGGA 2VIIA 5IUJC 3RYCB 3PPWA 4PO1A 3MM4A 2FSUA 5B3LA 3WAGA 1PDVA 2A2ZA 1O96B 5JDCA 4ZVSA 1D2EA 4OOFA 1P1BA 4QXMA 4UDYX 2HA4A 2OPBA 2IEZA 3HKDA 3GHHA 1ZKMA 3TR6A 1O95D 3CQ9A 1FEZA 4XJXA 3O8CA 4PAAA 3RFFA 1GGJA 1H2RS 5JDIC 4XM1A 1Q22A 4YDQA 1NQWA 1Y7IA 2NPOA 3GJZA 3ORSA 3E5MA 2Y2UA 1G38A 3JZDA 4UCWA 1QK3A 5F4OA 4HDKB 2OAEA 3F6YA 4C5BA 1PUIA 2NUBA 3BE8A 1SU8A 3IKLA 3T5BA 3Q7IA 4NBRA 4X7MA 3ER9A 5GONB 4MIKA 1B0AA 3TZEA 4YRSA 2FVGA 4DLAA 1MO6A 4FIDA 3QFTA 4K9OA 4UMVA 4ZCTA 4BNUA 1IVSA 1OIXA 5D1NA 4E14A 3IP7A 1KFBB 1HK7A 1Q91A 1ZXXA 2ACEA 2VK4A 2Z43A 4Q1FA 2QQ5A 1LZLA 3VI4B 1LA2A 4DHEA 2BDUA 2CMKA 4EGAA 1WB9A 3NC4A 2X53S 4FDTA 5FJJA 2CN1A 3BVPA 2C2HA 3O4GA 1JILA 2RGCA 1KDZA 1SOVA 3OLZA 4KKVA 4JX8A 1TUBB 4IDBA 1CP3A 1QAMA 1QGAA 2C2YA 5JW6A 4E4RA 4QE3A 1SD2A 1YQUA 1Z0ZA 3QLEA 3EGWA 1E9DA 1LSSA 3FKSA 1AUVA 2IEDA 5DU2A 1KYIA 5LPNA 3HJHA 1E8MA 2OESA 1A9XB 1DADA 1WB4A 5F51A 3RRZA 2OLEA 4J3NA 1K5GA 1XAJA 2FPGB 3TLGA 3U7QA 4C7VA 3GNSA 4E22A 3S81A 5IPFA 2A5YB 2NYVA 2V6MA 3OD1A 3LXMA 1PUXA 2QL9A 5C8YF 1CCWA 4N7JA 1XCPA 3D8RA 1ZD2P 2HTEA 3VHRA 3BT7A 1L4GA 3LWNA 4MKHA 1MAHA 2D59A 1FP1D 1HNNA 3EVAA 1JPUA 3PV0A 4ME6A 3LUAA 1ZZEA 4Q48A 2E21A 1EXDA 3T06B 1HG0A 1WKBA 2PSEA 5EZQA 3RC2A 5I7UA 5KJ6A 4ZO9A 2IYNA 1L6RA 1ORWA 3NEYA 4E7PA 3OZGA 4O4JB 2QM0A 2FPIB 1M6HA 2WICA 2B4QA 2J41A 4M1SA 3TYXA 1E6EA 1TLFA 2QSJA 3W6OA 3VU1A 4LYAA 4MVXA 1JKMA 4R05A 4J3FA 5LZ4A 2FR8C 5JD5A 4I14A 4WH0A 2SCUA 1RMYA 3BZBA 2YIVX 2VP3A 2ZRKA 1WSWA 3A10A 3SZOA 3VZQA 3B7PA 3L0OA 1DL5A 4LECA 4WOPA 1EFRA 3TOCA 1UXJA 2VDWB 3ITKA 5C81A 1UDBA 1P9WA 3K5WA 1TJNA 3PCXA 1U4OA 3MJRA 4XLEA 1G7CA 2VPTA 1AQJA 1G1AA 2FW9A 4TRNA 2IOQA 1Q20A 5L7TA 3IJPA 1HOXA 4QVKA 1BNCA 1RNLA 2JGDA 5HF9A 2A94A 3JYOA 4BQPA 4HGYA 1GKIA 2Z98A 5JARA 1JEOA 4P26A 1JLKA 1W34A 3GW8A 2MYTA 4CG0A 4S04A 4IJ6A 1J1IA 1PAUA 5BW8A 4GPD1 1BE0A 4FJ2A 4P8RA 3C3XA 5BR7A 2QSZA 1AXRA 1IDN1 1CG6A 1VLQA 3GO4A 5IAEA 4ZAVA 4GQAA 3LWZA 4MRVA 3ZV4A 4ITUA 4E07A 2H4WA 2JARA 2D7JA 4ESOA 4JR0A 4DZZA 5FNZA 3OQOA 4MCAA 3EXAA 4ZC8A 1SKAA 3BL6A 2OXIA 2CJWB 4E5NA 4GVPA 3KR2A 3BTSA 3A14A 3B8HA 2A84A 3JYPA 3WYGA 3A3YA 4JB2A 2C78A 4NYJQ 3WK5A 1YONA 3OJLA 5IH7A 4HDNB 3E5NA 4WOBA 3FMOB 3UJBA 1E4EA 1GTG1 4Q66C 2Q4BA 4JP2A 4YV1A 3CS3A 2Q9UA 1GZSA 2BGRA 2Z5GA 2XIQA 3M9WA 2Z2YA 3GDGA 4Y9DA 2EFJA 5CAEB 4DREA 2XT9A 5KB3A 1AH2A 2J9FB 1NT2A 2PL3A 1ORIA 4I55B 2XWSA 1DG9A 2CXOA 4K9NA 1M1NB 4KYVA 2NUAB 3SKXA 1N5OX 5LD2B 4B3SB 2EATA 2YMPA 3W5CA 1W2HA 3S3TA 1AKYA 4HYYA 3L0BA 2ST1A 4XLHA 3P8ZA 1LY1A 3K7EA 3U4IA 2FPPB 4TLEA 3FPBA 2BFCB 3IUBA 3OKXA 1Z13A 3Q7SA 4FGUA 4ZT3A 5KJ1A 2FWBA 3VSDA 3TZCA 2GHTA 4Q3CA 4F38A 2ZSBA 5CK4A 2B5VA 3KT0A 4D4GA 5E38A 2W8ZA 4Z4RA 4TWJA 3DFFA 5BYJA 2FZ4A 1VECA 4QXRA 1GTMA 1QG4A 2CCGA 2VZLA 3NALA 4TWZA 3CZ5A 2VNJA 3IMFA 5BNZA 2PA0A 4U7JA 4NULA 4CKBB 5ETJA 1AGYA 4AJKA 3INTA 3AF1A 4AY3A 1N8KA 4UMDA 4Z4SA 2QTCA 1ATZA 2HCBA 3EXEA 1QO0A 3NJ4A 3WMXA 1D2AA 2LP4Y 3G5TA 1E1LA 4B85A 4F56A 4AZ3A 4QBKA 2Y99A 3SMQA 1Z5NA 3PFBA 3VJRA 4Y2SA 1EE9A 1VQ6B 1AKNA 1V5GA 4QPJC 4ZAGA 5K2MA 3Q8LA 1R0ZA 2R4UA 5CRIA 5FBWB 3KD3A 3L0CA 4FOPA 1NDUA 4EF4A 2G9RA 3SEFA 4DG8A 4NBVA 3CT4A 3MAGA 3FYCA 3L7AA 1R6VA 2F1HA 2XOEA 1NFRA 4RQUA 3A1EA 3HI6A 4BYGA 1QIJA 4M36A 1VLVA 4YCAA 3CT6A 1I6MA 2RAUA 3FWZA 4WACA 3BXGA 5DGIA 3IV6A 2OFXA 1LVUA 1ZICA 1FNSA 1W36C 1JKJB 3E3LA 1ZIOA 2HMUA 2ZYRA 3GWGA 2ISQA 1Q16A 3H2YA 3GFTA 3JS5A 4ZXPA 5C80A 4AVZA 3N0WA 3PNPA 2W5UA 1MO4A 3SSAA 1FYWA 2W8BA 1RTTA 4G5SA 4W1SA 2BFMA 3ASPA 2ZBVA 3DBOB 1L5RA 3ZLVA 1X1SA 2XGJA 3KD2A 2J0EA 5K0LA 4BVGA 1R8QA 3FVWA 3KV3O 3I62A 4DIMA 5HIJA 1V8ZA 1C3OA 2WF9A 1NVEA 1BCRA 2ISSD 2PJDA 4CBVA 4CN8A 1E6LA 4K7JA 5TGDA 3VISA 5CFMA 2LNDA 3B2EA 2FFBA 3H5LA 5TVKA 1H2FA 4I5IA 5EEGA 5ADHA 3CKLA 4LJRA 4GZ5A 3REGA 4UHDA 4PV7A 3T5GA 2TRSB 2ZXEA 4HFJA 3WC4A 3T41A 621PA 1QE5A 1GZ5A 5TNXA 1FVXA 4AJEA 4NOLA 2WNHA 4XKJA 1IY0A 2PGOA 2J67A 3HA3A 4AC9A 2OC9A 3LRTA 3Q98A 2B3DA 4PYOA 4XIIA 3CRZA 2IXFA 1O97D 2HZ7A 5EKDA 1ZBQA 1BXZA 1T9ZA 2P9QA 4LCEA 3Q6IA 4HS4A 2W2KA 1WY5A 2Y9PB 3KJQA 2CFOA 2O0MA 4BJHB 5KREA 1YFJA 4TXNA 1AIPA 3RY8A 4FK8A 1OV6A 4NP6A 2VSFA 1G3MA 2ERXA 3C3WA 3H18A 2R65A 4BCBA 3LUJA 1TO2E 1FW8A 1JKXA 1NVVQ 2GLTA 4KKTA 3OPNA 4WT7A 1HLGA 2ODNA 1T3GA 3DWGA 1RRFA 2PJRA 3KVYA 3WL6A 4EGJA 1E9BA 1OWOA 4MUJA 1M5RA 3OOJA 1REQA 5JWRA 1YJXA 1UAAA 2EEZA 1IOLA 4EVSA 1RAIA 4UHKA 3K35A 4D0NA 3WV5A 1XYVA 4X7DA 4OQNA 1Y3CE 2GN2A 4KXMA 3UN1A 4B4KA 4C7BA 4C05A 2YWCA 3BWVA 5BXYA 3LJKA 3KQLA 3F46A 1CQJA 1XJ5A 4GL4A 4ZHQF 1V8FA 1BC5A 5B7PA 1R16A 4O02B 4W6ZA 4I1UA 4RJTA 5JS1A 4KN8A 4EGFA 3BC1A 1P2TA 3BJZA 1SKYE 5DSXA 3T12A 4DQ0A 1MC1A 4GKJB 2L82A 1Z0KA 1GL6A 2KSQA 2VRCA 1VKZA 3OQJA 1UMCB 5TQJA 3G4SB 1AG9A 3LUCA 2HJGA 1EA5A 2F9MA 2OQRA 3EODA 4DXDA 1HDZA 4R2LA 4K0RA 2KI5A 3PL1A 4KSCA 1ILWA 1IUPA 3KYDB 1EVZA 3D6JA 3KVNA 3QYFA 3HO1A 3N7AA 2C7GA 2JHPA 5JAQA 2GEKA 2XCOA 3CVYA 1TT5B 1RQ7A 2CHGA 3SDBA 4AK9A 3I28A 4ZGWA 1LC0A 1H8EA 4JUFA 3HJBA 1E79D 4NJEB 3DE3X 1KYQA 4F2HA 1NGSA 3MWEA 1OGJA 4U6QA 3LC7O 3N07A 5AVQA 3FZGA 1VZ2A 5AHRA 2VHUA 4FQ5A 4IM7A 2AEMA 1KQNA 4D26A 4OHYA 3ZWAA 2VWPA 4DNPA 3PDUA 5TGTA 1TK2A 1JHUA 1V43A 2V0GA 1UBOS 3VH1A 2H18A 1G8FA 3GUVA 3T3GA 1M83A 2Z5LA 3PDIA 4CV3A 2P2SA 4EQZA 3W7AA 4XEUA 2WLTA 3ZWVA 4EW1A 2XTNA 1Q7RA 4KHZA 4YLEA 4KQIA 4IVQA 2J5QA 1Q21A 3DLAA 2FR1A 3MT9A 3HLYA 3TLEA 4NAHA 5EIAA 1NTOA 3L6BA 5J4HA 4MVWA 4M1EA 3ZKWA 4DPMA 2JFNA 1FNMA 3UJCA 3NTXA 3V5NA 1PVVA 5JIBA 1WABA 3D3EA 3KPYA 3O4IA 2HT6A 1Z5PA 4E70A 1UDXA 4KH1A 3TXXA 1N6OA 2CYAA 2IUTA 4OH1A 5DLPA 2W6PA 1KI9A 3H13A 1Z56C 3VJKA 3PA1A 2DOGA 4JSYA 2PLFA 3BE6A 3BMCA 4MJLA 4ARVA 1VE6A 5DS0A 3U3DA 5TB5A 2SKDA 1C2YA 1EK6A 4LC1A 4DDTA 1UWKA 3J7TA 4PGHA 4R0VA 2XWQA 3EAFA 4NBTA 4E0FA 5DM60 4K2HA 4A26A 4YCLA 3G88A 4QBTA 3FKSD 4XEHA 1D3AA 3K0CA 1F12A 4Y3UA 5CLJA 1KRWA 3UV3A 1WXXA 2DKNA 2WM9B 2YV4A 5A5GA 2GB4A 5FPPA 1GFZA 1N9GA 2J5RA 1KDTA 2X5KO 5FWXA 3RBZA 4AS2A 5LXTF 4ZI7B 3AIOA 1SVWA 5AJYA 4W1QA 1PQUA 3N2GA 3Q72A 1G291 4JBGA 3WTBA 4B6RA 5JYBA 2GCPA 1NW9B 2BKXA 1M1KD 1B42A 3PUVA 3C7TA 1ZG3A 2IBMA 3JAMA 1WJGA 5BSKA 4H4DA 4Y2XA 4FVTA 3FTFA 4OXNA 3V4VB 4NU0A 1ZD4A 4PCLA 4NWIA 4Q01A 5FULA 4FKBA 5AVSA 4RKRA 3LL4A 4OJTA 4N54A 4O63O 1G8SA 2QP9X 3SLRA 1Z06A 1C5KA 2ZULA 1ZI9A 1R0LA 4DL9A 1FDUA 1TRKA 4NCHA 1EA7A 2QGFA 2WK1A 4IIVA 3AKCA 2HKIA 2UZ3A 2Q4DA 3K9BA 5KX5F 3VDXA 4F06A 5FLEX 2DR0A 3CH5A 3O4FA 2ZUUA 4PBTA 2P2ZA 4DIFA 5GY7A 1KZYC 3GBVA 3DPSA 4IO0A 1AQIA 3ZU6A 3RSSA 3GPIA 3PEFA 3UOAB 3HCDA 4ZYVA 3AL2A 1X7ZA 2V3VA 3ESAA 4KAXA 1GKUB 4WLOA 2CF6A 4FFPA 3MJ4A 4KW7A 2QV7A 3GF4A 4L5AA 4P3PA 2RI0A 4TV8B 1HL3A 3WWZA 3GLKA 4EL0A 4NMLA 5KSPA 4BKRA 1LW7A 2WZQA 5I9BA 1UFKA 3RKSA 4B8ZA 4E94A 5EUMA 3KP1A 1NXPA 1V7CA 2UYCA 2G28A 4D42A 1OXTA 5HJ7A 4PS0A 5DBFA 3OLXA 3UB2A 2OHIA 4WN3A 3HBNA 4JODA 3BZUA 4IF6A 4IXDA 4LY3A 2OXRA 1EJ0A 3DLTA 1PDOA 2GOYA 1AKMA 2RDMA 3IR6A 3KQWA 3ECSA 1ZHHA 1NB0A 2IYYA 3PUIA 4IEIA 1NF2A 3CRMA 4MUKA 4UUOA 5AVZA 6CHYA 3WKDA 3AI7A 5C18A 1DIGA 4JB0A 5IN4A 5DHTA 4ZQEA 1G20A 1DG3A 2H4HA 1VLYA 2E48A 1U8ZA 4RPIA 3SGLA 1UFVA 1PSWA 1TIBA 3ENWA 3TQIA 1IXYA 4JNKA 5F4MA 2FQQA 4WXYB 3AZPA 1E66A 2NV6A 3H2GA 4FHZA 4IPTA 4ZYXA 4CEJA 1CSEE 3EXFA 3SPXA 4O59O 1EFVB 3QLJA 4L0MA 2BFEB 3BK1A 1JDTA 1OH7A 4LF8B 2A1TS 5FH9A 4IV8A 4KQWA 4RH0A 2HPAA 3I64A 5TLSA 4WNAB 1LBHA 1ULAA 1XTJA 2G3YA 3CPSA 3D6HA 3KTAB 5CB4A 1YMVA 2I54A 3HTXA 2H3EA 4E12A 3ISVA 2VP9A 5C5EA 5DNUA 3G2OA 2ODBA 1F8YA 3M34A 2C98A 1A82A 3PQ8A 1FUKA 2FFQA 2VTKA 4A2WA 4HAZA 1CKEA 1TW3A 2C9MA 3SJZA 1QU2A 4UJ5A 1JMVA 5BOVA 2E4XA 4PW0A 2IYAA 5ALKA 3VTAA 1L1QA 2LZJA 2HDOA 2GZ2A 1ABEA 2XUZA 3MPUA 3Q3HA 5BSMA 3TR0A 4I1VA 2CSUA 5CM8B 2PUFA 4G6ZA 2XCSB 2Y1WA 2XGSA 3VDNB 3UMYA 5CBKA 4G8CA 4WASA 3T4UA 3RODA 3EMBA 1I2MA 3TQCA 5CFLA 1QWOA 1T4BA 3R6GA 1YS7A 3DWFA 4Q15A 1OLUB 1QQ7A 3WLSA 4DJEC 1QO0D 2K6GA 2IHZA 5F64A 3C8UA 1KC8D 2G9QA 3NW9A 2GBLA 3D6MA 1QVGB 2JZCA 4P0TA 4A27A 5JAZA 3CF4A 4K6HA 4HNSA 1LNSA 2A1UB 4YQZA 3AUYA 2AQIA 2H2FA 2J30A 3L0DA 4CCWA 1HYGA 3EXHA 2DRIA 2BMFA 3RUFA 2X5OA 1IK6A 4BHTA 1SC1A 3G17A 4K88A 1EBBA 4X6XA 1DWOA 4BLPA 2IBSA 3VKHA 1KKMA 1KRXA 4WK6A 5BV0A 2ZJZA 5K6AA 3VO1A 2QN6A 3Q41A 1KJYA 2VOEA 2A58A 2VQEB 2VJIA 3FR8A 2CZQA 4K6OA 5GTDA 3SG0A 3QFCA 2KVOA 1PJ8A 1S2GA 1QONA 4LSZA 3VKUA 2DBQA 3COSA 5ELLA 1K5HA 1U2GC 1F8XA 1JEJA 2Q5EA 4RAQA 1I36A 1P33A 2M6SA 5IULC 5ECYA 2DC1A 3Q3VA 1KARA 3IKTA 1MHPA 1F9EA 2QMHA 1XEAA 1R8SA 2J3KA 2RHGB 3CINA 3IT3A 3EC1A 5BYBA 2XB9A 4B87A 3TZ6A 4BUJA 2JGKA 2FP4A 4LDJA 1TEVA 3H9UA 4PF1A 1M8FA 1Z0DA 2YN0A 3ZOKA 4LVCA 4OMDA 2ZUVA 3A4IA 2X4DA 1YS1X 4FB5A 1OA1A 3E22B 4Z7NB 1PK8A 5JMOA 4CGZA 1XQYA 4LK3A 3SU8A 2FSPA 2PRKA 2ZYDA 2RHDA 3EXG2 1EZ1A 2D5CA 3A27A 3Q0IA 1GAEO 3CCJB 3QYJA 1C41A 1X7WA 1LK5A 1RYMA 1SKYB 2Q2OA 1QCZA 3AF3A 4Z9XA 4EYGA 1YHQB 4DJTA 5G4LA 4LRWA 3I4CA 3PR2B 4U3JB 1Z6GA 5FNVA 3IX7A 2R8ZA 2H51A 1USIA 3JQEA 2FE1A 4DDUA 2A0YA 2ZQYA 1XQVA 5DXFA 3QKTA 2JH3A 4V0KA 2A9JA 3CTPA 5BVHA 2VLBA 4YRZA 4L9SA 1FTNA 2QDXA 4YMTA 2H1SA 1C14A 4N48A 4XQFA 3AR3A 3GGDA 1T43A 3CPHA 4QZVA 3CCLB 5KTTA 4J90A 4PNPA 3HB5X 3UBTA 3W9UA 1IEWA 3RG8A 1QO7A 2HQOA 4BNJA 1WW2A 2ECQA 3HJGA 2H2HA 3HWRA 3ZHYA 3WV4A 3T53B 4DLYA 2DG2A 4NFSA 1DZIA 1V6SA 2P4QA 1XVTA 3KYBA 4B5KA 4EPYA 1DEXA 1XD9A 4JUIA 4EG1A 2ZBEA 1HORA 3FBWA 3RANA 3T1NA 4CM8A 4ZEMA 4FYYA 5JFOA 4OGFA 1Z12A 3WIOA 1QFMA 4UM9D 5K6TA 3JZIA 2G1JA 4OSEA 4TSRA 1FUEA 4F6RA 1DV2A 1D04A 3DUWA 4C88A 5E7QA 2HYDA 2VRCD 3EDOA 3I9FA 3PK0A 1JQBA 1E3MA 4R3WA 5ALFA 2CHQA 4F8EA 3PUZA 4BTVA 2XWJI 3KHSA 3NDBB 4LHYA 4OK6A 3WXMA 1SU7A 2ZZKA 1QF6A 1C4OA 3VYUB 4REQB 2DQSA 1P8AA 2NG1A 1WVMA 4I99A 2ZJ3A 1RWQA 3GOQA 4HZGA 4UE3S 1ADGA 1L5MA 5KYXA 2ODTX 4LOKA 4BAZA 2GUWA 2RHMA 1TJYA 4R5MA 4YV2A 5IAAA 4AB1A 3AFIA 3G9UA 1JHYA 4MVJP 1H8ED 3I9MA 1MOZA 3WFJA 4EDFA 2HCFA 1WCYA 4JT8A 4MVYA 3H04A 3F78A 4EX6A 2JW5A 1VQ8B 1B3RA 3HXLA 4IDFA 4KTTE 4TUYF 4OL9A 3UWSA 4QVAA 1L4UA 1SUFA 4MP8A 4YPOA 3AHIA 4JC0A 3TBHA 4HX2A 2CBXA 4BGDA 2FRDC 2NU9A 3NFRA 1Q0HA 5BUCA 3H0EA 2CXXA 5FJIA 1U7ZA 2H57A 2FI1A 1ADCA 3AM5A 3GAAA 4NPHA 5HM6A 5KYKA 1DIHA 4A16A 3H5RA 1GTRA 4I1SA 1U4NA 3DVAA 2ZOSA 3CZCA 3ESZA 4R83A 4RPHA 1THTA 1LQ2A 3BG5A 4I0WB 4ZAXA 2BGLA 3SX4A 2JHAA 2P9JA 3CUYA 2GM9A 1ISFA 3CIFA 3O8OA 3SKYA 4E2FA 3PLRA 3VR0A 2JCBA 4DV4B 3GK3A 3I4FA 4GRIA 2HJSA 1SG9A 5T4BA 2GHQA 1FUUA 1ZRNA 3HYSA 4R54A 4OXIA 5D5QA 1HYEA 4YFVA 2NZVG 2MTBA 1NUTA 3THWA 1IUOA 2ZIVB 3RRNA 1BDBA 3B5IA 1LPNA 4ZYWA 1VQPB 1L5VA 3OCUA 3ZE9A 4F0JA 1A5BB 1UBMS 1TM3E 2D5BA 3CU5A 4ND2A 2DECA 4RSGA 1TQ8A 4YUAA 5L3VA 1ZM2A 1MOQA 2P3SA 1K0FA 3DZCA 4ZHSA 1Y89A 4C76A 1YJ9B 5DTQA 4PQRA 5HA5A 3VXKA 4JJKA 1WSAA 2UZ0A 4R1UA 3TSCA 3ZVKA 2OQVA 1ID8A 2C5AA 2DTEA 5A2GA 3I32A 3ACBA 3RVPA 1T8YA 1XP8A 2JK1A 2NX2A 4GVLA 3T0GA 3KHUA 4MYRA 3HB7A 3PWZA 1RCUA 3O1IC 3T7CA 1N6IA 5CFRA 3PR1A 4KB5A 1TJ5A 5HE9A 3Q6RA 4JYCA 2M6LA 1MB3A 2HA6A 1S3SA 3ORQA 3MSXA 4U2KA 5JCZA 1P4SA 4RADA 3SFVA 4W1RA 4YN3A 3TWOA 4PFSA 4BQEA 3G59A 3IUYA 2EDAA 1BDMA 4LF4B 2WR8A 3A6FA 3JAWB 1DDGA 2II6A 3K0HA 3JQPA 3D7RA 3WLPA 5IX8A 2D5AA 3U40A 4KQ9A 5ED0A 4LEIA 4L4UA 4JLWA 4KU4A 4IUCS 1X92A 5K05A 1E0SA 5EQTA 3RYCA 4XJVA 3OPYA 2WOOA 2CV2A 1Q84A 1P9LA 2C29D 2FPXA 2EG5A 1O96A 3KKPA 4CLDA 1M34E 1IZYA 1J23A 2F1IA 1GSIA 4OJYA 1TQ2A 3WGHA 1A7JA 1UEJA 2EW1A 3EGEA 3PC4A 4G24A 4WW0A 3CZQA 3V8EA 4F92B 3HGQA 1KETA 1Y6JA 1KE1A 5L95A 4MYUA 1MH1A 2GEVA 3OE7D 1BN7A 4Q9AA 4G6IA 3LQYA 3W77A 4WESB 4YMUA 1FMJA 1P72A 2AEFA 5TF4A 4A1OA 2JLXA 2P9GA 2WB4A 3ORRA 2X6XA 4DMHA 4HDKA 3ON5A 2YZMA 1NB9A 3A9RA 1Y33E 4WRRA 5GONA 3WJ2A 1FQKA 3EGOA 5EWJB 3WGQA 4DCGA 4MRMB 1GJRA 1WCWA 2PKYX 4MZXA 1E4VA 2X5XA 3R5SA 1OX6A 4UNQA 3X1DA 1YA8A 3EFEA 4TS3A 1O6FA 5DGXA 1WDKA 4EWLA 5HPYB 3DZHA 5F4BA 3HL4A 4X95A 3RK4A 4XCXA 2DKFA 1RFLA 3L49A 1F1JA 1QIMA 4FMCB 1HZJA 2J5BA 1NAHA 4YP5A 3T38A 5JNRA 3K0AA 4O2RA 1JEQB 3WVNA 4KC0A 1EE1A 1ZUNB 3PF9A 2GN0A 3KEGA 3RC8A 1SOMA 1TUBA 1JIUA 2HEGA 2EOAA 2PXAA 2FDRA 1K7SN 2J59A 5KWVA 1MDFA 2WLSA 3ZXYA 5EIEA 4PZZA 3Q88A 2P5UA 3ER6A 1S01A 1CRZA 3ZXUB 4L6AA 2GZDA 3JR7A 4KJXA 1NQTA 1TU0A 1EEHA 4FYHA 3UPTA 4D82A 4TTPA 2C0CA 5F7OA 1QX3A 1ESMA 3M1LA 1EP1B 2NXCA 4IIJF 4L57A 5HF5A 1RI2A 3ZHCA 1FS6A 3TSOA 2OOKA 1XPJA 4DE5A 5DVZA 3U4GA 1TM5E 1K4YA 2QR5A 1HDEA 2B94A 1JB9A 3EVZA 3RSOA 4DMCA 1H6AA 1ZR2A 3CONA 1P1KA 2MR5A 2O7RA 3T5AA 3WGIA 2X2EA 2V7PA 4FW9A 1W8DA 3WQQA 1A2QA 2FPIA 3R8FA 3WRVA 1G3RA 4R41A 2P3MA 3S8MA 2G6BA 1GDDA 1FMTA 5AJXA 1VPDA 1Z16A 2EZ4A 4W5RA 1S2MA 4F5WA 1RYNA 2G17A 2QLMA 3PXUA 3NIBA 5K99A 3EBOA 4U5XA 4FONA 1PV1A 3N76A 2VDWA 2C97A 1CVLA 2FR0A 3ESRA 4P08A 2OCAA 3EQ2A 3RAEC 4UTVA 1E63A 2NXJA 3R75A 4A2PA 3A1CA 4DMGA 1L4MA 2P75A 4DLUA 1OZ0A 4MIYA 1P7CA 1P5HA 3DVLA 1OLSB 2YXDA 1GLVA 4X65B 4PX5A 3GEGA 3OA0A 4YTEA 3ZY3A 1G17A 3HZZA 2F1KA 3NWJA 1SXJB 1U3VA 2TMDA 3RS0A 5KC9A 1VLMA 2XDQB 1L2TA 3GUHA 1DMRA 2E5LB 1RPZA 2G1UA 1CXZA 1KYWA 3AM3A 2H48A 4ALMA 1QMPA 1V0FA 3A04A 1GPJA 3A2NA 3AFGA 4KXFB 4CDMA 1ZN2A 3ORYA 1NW6A 2BBSA 2UDPA 1YJBA 4U39A 4JLNA 4WECA 4LRQA 1XZFA 5AKEA 2CJWA 1DTEA 2ORIA 3PENA 3M4ZA 2H06A 4WGFA 3IEVA 3SC3A 1Y63A 5DEOA 3RVBA 5HUHA 1KPHA 1JSZA 4NLLA 4P7FA 3SQXA 1SCKA 3GIDA 2QW0X 4Q3AA 2BMEA 4ZYYA 2Z4TA 2ZWMA 1A71A 1Z0IA 1OI4A 3FCXA 3R20A 4UVIA 5IARA 4AP6A 5BWBA 2Y0CA 3HV2A 4UM8B 2Z8YM 1SUCA 4KK3A 4D0RA 5BN3B 3UC5A 2JNWA 4OEHA 2WKRA 4OI4A 5CAEA 2IYVA 3DCIA 1PFUA 1LDGA 2UUAB 1H85A 2J9FA 2JLZA 1HDGO 3VO9A 5LP1A 3OCXA 3KV1A 3MCZA 3OG9A 2B20A 3OLYA 4I55A 4EO4A 5JH7F 1GAXA 1SH7A 1DVRA 5INTA 3HGTA 3OU2A 1XLTA 4LCBA 1Q0RA 5F2OA 4P5EA 4WCVA 3WZLA 4E5SA 2ZTLA 1JJVA 1IAVA 2I7TA 5DF1A 3R0XA 3T9AA 1QTIA 2Z2KA 2MJLA 3VVLA 3OEHA 4CDNA 5C7LO 3MMZA 2BFCA 1U9CA 2CCKA 2X2PA 3GLQA 4MPDA 4MVJG 4R2KA 4QWWA 3PUWA 4YALA 4D9MA 3L04A 1K08A 3H84A 4EPXA 4X8OA 5AI5A 2C03A 2D5LA 2Q9BA 2I1WA 1YJCA 4G0YA 2HDHA 1NZFA 1XD2B 1VI2A 2OECA 2H5JA 4UNNA 5H5JA 3RW9A 5LR6A 3E6AA 4N76A 5SZHB 3ZCRA 2EHJA 4IOKA 5KYWA 3CHYA 1DHRA 3ITEA 1QP0A 3DDWA 4FN5A 1XRJA 3DOIA 4LPKA 3X1JA 3DJYA 4BMOB 4QDZA 4E31A 3W06A 1XZQA 2VYQA 3A7DA 4K9QA 1ZW6A 3LHDA 3V1NA 1NJ1A 1RLIA 4FNOA 2KLHA 5BVGB 1P75A 3PD0A 1H4QA 2ZJ7A 3AL0C 1JFVA 1KIFA 1PS0A 3QBTA 5BQ3A 1ZGBA 2OBBA 1P73A 3RVRA 4YMLA 1I9GA 1H66A 1TJ3A 2YCBA 3ABQB 3NT2A 3R3JA 5JPCA 1AC5A 4LX0A 3L05A 5LYJF 3D26A 1F6BA 2QD1A 3FFTA 3I23A 4YAIA 3Q8KA 1ADYA 3TGWA 2V9CA 5HR5A 3VI3B 1DQYA 3S1AB 5B37A 2Z95A 4MV9A 1V1JA 1SVIA 3BD6A 3K2IA 1PBTA 1WQ3A 1HSOA 3ND8A 3NH9A 2OBTA 1KSFX 2IITA 3ZY2A 3QKWA 4H7HA 1RXUA 1JKJA 1MG0A 2V7EA 1DWPA 2YZNA 3FCCA 3WL5A 1GU1A 4DCUA 4DV3B 1BHSA 4R2WA 4RCZA 5CJJA 4V0LA 1HZZA 1VMIA 5TDHA 3T3IA 5DULA 1G6HA 1NMSA 1XZLA 2QN2A 1WB5A 4PLVA 3RHTA 3JQ9A 4TN5A 3VHQA 2AQ8A 3F8SA 4G4IA 4LF6B 3NAQA 2ZU6A 4QFDA 3N53A 5B3AA 2YWGA 3E7PA 1Q1AA 1C7ZA 2AUMA 3IP8A 3PVZA 1LTHR 5FPSA 2QUIA 1Z6PA 1P6QA 3D2CA 3QJGA 3UKJA 1S1MA 1UDRA 4QSMA 1YRWA 2HAEA 3G9XA 1JG3A 3PLAE 1N32B 1Y8QB 1KDYA 4CLOB 1ZJ6A 4MAAA 3SZ3A 3V1YA 4R8VA 4BE4A 4A7PA 5KPDA 1XRLA 1JX6A 1WSRA 1I2AA 1NMZA 3MD0A 1JHPA 2OYRA 3WK6A 2QYOA 4KAJA 5KNDH 4O1HA 3NORA 2NADA 2GO1A 1VCIA 3EAGA 3OJEA 5DW3A 1C3JA 4LOIA 5NULA 5T8KC 3RBXA 1Z8FA 5DNVA 1PGOA 3A6LA 2P35A 2XB6A 2AZ4A 4W9NA 3G7NA 2AMFA 3NRJA 3LQKA 3EPLA 3U7JA 1XSEA 3LT4A 3NZEA 1WBBA 4QOGA 2MR6A 3TLXA 3ZS9A 2A7XA 2J4CA 2P8SA 3ETJA 7MHTA 4NG4A 1DBWA 4M49A 4N0QA 4OQQA 3UMBA 2OPHA 1F9AA 3NVDA 4BEVA 4EKGA 4ES6A 5JT1A 1KOJA 4BAUA 1EBFA 3R0JA 4OXRA 5DM4A 1C7JA 4F96A 1D2RA 4MIOA 5FP0A 4BBZA 3GVLA 1VLLA 4TYPA 4CKWB 1LLDA 4I4CA 1PS9A 1EDZA 2XVMA 2TSYB 4MW5A 3V4LA 2O8BB 1VSQA 2RKOA 1OCEA 4P38A 4OQEA 1Q0SA 3H1TA 1DT5A 3R3SA 5EOVA 4LFCB 3UG6A 1DSSG 1JTEA 2D3TA 4UMEA 1YBFA 3SEAA 3FGNA 4FP9A 4H6VA 2DFKB 5KTSA 4XFKA 1M34B 4WLFA 3CVXA 5JI3E 1SQ0A 1CJBA 2O3QA 4PSKA 4EFDA 3MTGA 2E55A 1QMGA 3AR5A 1QVZA 3KOWA 1W0KA 1UMCA 1XKQA 1GZUA 1AN0A 2WHXA 3R5FA 4B48A 2R1ZA 1G4HA 1K73D 1O6GA 2AYZA 2HA7A 1J5PA 3A6KA 1JG4A 3CX4A 4J43A 4IICA 2E3JA 1LRLA 1YRBA 1FJ2A 3HDTA 2YRFA 1EVJA 5TE9A 2HMSA 3KYDA 2O2JA 3C41J 3ETGA 3FRJA 4OY3A 4PZ9A 2Z09A 4FGZA 1B8PA 3IRVA 3EZYA 2WIFA 3AMVA 3C6KA 4MW6A 1Z35A 3SYRA 4C0AC 3Q7PA 1TT5A 4QATA 5ALNA 4PU0A 4HDQB 1NPTO 5M34A 1UEXC 1MJGM 4NJEA 3OX3A 4GQBA 4MVCA 2JLBA 1CF4A 2EF1A 3WNBA 4PXAA 1E2JA 2R0QC 3LYAA 3KJHA 1JE1A 5A7FA 1YRHA 2Y1OA 5SZIA 4BWVA 4Y2RA 4P7KA 3ZDEA 1QZXA 3O74A 2BHNA 1AQLA 1E9EA 2CLFB 2PU7A 2V6GA 2JKZA 8GPBA 1XEFA 3H1BA 3WJ7A 3O9ZA 4BQIA 5IANA 2FZ5A 1MNQA 3LPCA 4FIZA 1EDEA 1D5CA 1X14A 2GRUA 3ET4A 3AUUA 5ABPA 1X7YA 1U2QA 5A9TA 5K0BA 4JQSA 1XL1A 3DV9A 3H5WA 1DKOA 2AXNA 4LZPA 2B0CA 4AZSA 1ZOIA 2WMDA 3WL7A 4HGPA 4TTTS 4AG5A 4J16A 5BUZA 5EP4A 1EDOA 3B3JA 1US8B 2BI4A 4GC9A 3S7ZA 1KJQA 1FNCA 1PTJA 4L8JA 1RKVA 2N1BA 5AICA 2EFCB 1E3LA 2ROQA 1N57A 1XK7A 1A7AA 2HPVA 2B8TA 1YV9A 2HXYA 2Q1YA 3GMTA 3KUDA 2UVPB 3MUNA 2O05A 4LDQA 1IXKA 4DIDA 4X8IA 3OJ0A 4HNHA 2CD9A 1XDBA 2R11A 5FTMA 3AEQA 2JEOA 5AVTA 4Q3OA 1UZUA 3RTCA 2Z6QA 1ZWKA 3L4SO 2DF8A 3CY6A 1JLSA 5F3RA 4X0CA 4RBNA 2EBUA 1SKMA 4Z4VA 3TZLA 3RIYA 2REXB 2IGTA 3DYBA 5FPTA 1DAFA 2XYGA 3RWBA 1ZPDA 1Y1QA 2A7QA 3JARB 4IJQA 1T2AA 1FQWA 1KHHA 3EIUA 3UTCA 4GI7A 5CP8A 1RBZA 4HPXB 4ICIA 3PUNA 1CQWA 4QJ5A 1CVIA 1TC2A 2IE8A 4I50F 3D5TA 1Q5PA 4JIGA 5E8RA 2VQDA 1YS9A 4ZI7A 5JADA 2Q5OA 2NQ8A 5B1DA 2NO9A 1E3DA 2OCIA 4C3OB 1OC2A 2LKCA 4GM1A 1ONOA 1SKBA 3ECAA 1G66A 1OV4A 4PRZA 3WYFA 4F91B 1TKAA 1GQOA 1Y0BA 2WWVD 3ANLA 4ZA2A 3SKBA 1E32A 4P7BA 4EHJA 5JISA 2VVTA 1F2TA 2FN8A 4KE9A 2ZAGA 2X1LA 1GG2A 4Y6PA 1R7RA 1E2MA 4FSXA 5DOVA 5TY0A 1WHSB 2P27A 3IBSA 5HNKA 1Q7GA 4URHA 1B23P 2WAXA 1DAOA 4QUAA 5TGZA 3WHIA 2J5KA 2PV7A 2OWEA 4QUDA 3RBAA 2YYAA 1GNLA 1NN3A 3T7JA 4H7EA 3GFPA 1CIVA 5KYGA 4RHFA 1BWSA 5LA6F 2E0IA 5JAMA 2CNBA 3QHAA 4YMSA 2HSEA 3FN4A 1G8GA 2IY9A 4XOPA 1JDUA 4Y67A 3L7MA 2VT7A 3TLAA 3T7EA 3ZR4B 1UXKA 1J56A 5DYTA 3G2MA 4DW8A 1TCUA 4AWXA 4FDLA 1VP9A 2IHYA 3R44A 4LUCA 2O2DA 1V5EA 2VNSA 1QYCA 2W4MA 2Q9AA 1J2EA 2P4SA 5JVDB 1XRQA 1JTFA 4AJPA 4TV8A 4JOCA 3DWIA 3SBEA 4CFYA 2I76A 3FVTA 3PJDA 4UTXA 1MCZA 3U62A 1BW9A 4ZV9A 1LFAA 1GWNA 4B3BA 3KL9A 1Q57A 2B6HA 3ICVA 1APBA 1XZBA 1NJ6A 3M49A 2JGRA 4RPJA 3UF0A 3BY2A 3ID6C 3ZW7A 3L7NA 3HBJA 2Z30A 4CQMB 5AM3A 1QP7A 5BMVA 3OTHA 4LSWA 1ISGA 3PNVA 3PPVA 2J3IA 4B3HA 5A4AA 1L5QA 1QQBA 3BOSA 4I8XA 1XAHA 4M8KA 1UANA 4HTFB 2PCJA 3BCFA 4DLPA 1GUBA 1POXA 3QLVA 2BMAA 1EBUA 3G3EA 4GF5A 1DKUA 1SB9A 3FUCA 4H4EA 4JOBA 5DISB 2ZM5A 2L0XA 3F5DA 4NXNB 1NDHA 3OKAA 4Q3KA 2BFEA 4KQFA 4GU5A 3BMOB 3JU3A 1E3TA 4RA9B 4QM6A 2PZKA 4MVJH 4WNAA 3GVKA 2CFSA 4U9IS 2IYEA 3DTYA 3KTAA 3PQ2A 5H16A 1PZXA 4BUZA 4CKCA 3SY8A 4P0QB 4DWWA 4GW3A 1N08A 3NE5B 2JD2A 4BNYA 3HXMA 2D4HA 1TE2A 2IXAA 3VVMA 2OK7A 1HG1A 2PS9A 3T3NA 2I8LA 1I5OA 3NGMA 5DPMA 2BMVA 5HXAA 1RJ9B 3PA6A 4M55A 3SE0A 1SCAA 3CPWB 4ANFA 5HZGA 5CDYA 1VQ5B 1VLJA 3I2YX 3AEYA 3P2IA 5KTNA 3L4BC 4LZAA 4OHKA 1K8RA 4D98A 2P3LA 3ZVNA 1WXDA 3C15C 1T2FA 2XUKA 3FGPA 3FLEA 1R0RE 2NWQA 3GBPA 3HR7A 5K03A 4JI7B 2GM4A 5AH0A 1MOPA 4IX1A 4JHXA 1ADBA 4GOKA 2J3QA 1QVRA 2R8OA 2INGX 1F4VA 2Z1NA 4TMXA 3KBOA 2QE7A 3LQ6A 3VX4A 1ZNXA 3Q0TA 1OLUA 2TS1A 3KPWA 3TKYA 1ECJA 1EGQA 1YDEA 2ZCJA 2PU5A 2OV8A 4JI5B 1Z5ZA 4ZT2A 4QHYA 4ZP1A 5BSYA 2GMWA 3EXHC 3H1AA 1E9SA 1AMOA 4S1WA 4BNHA 3UJ9A 2A1UA 3CCFA 3ETLA 3AFMA 3OZTA 1RP1A 2HPHA 3M6UA 1PL0A 3SN6A 1XHEA 3HZOA 3LOUA 4ZOEA 1ISIA 1CUUA 2BE7A 3RS9A 4COKA 1T5TA 5E6RB 2WIGA 5K6AC 4RPDA 1CY0A 1DE0A 1T3SA 1WO8A 2K4MA 4IHAA 2QSUA 1HE3A 3CF2A 3N8DA 4FFBB 1VTKA 1ENYA 4FZRA 3TI7A 1FCJA 1B74A 4PAWA 2FKNA 1Y6RA 1RPJA 2QNIA 3O1HB 3VJMA 1C9DB 1G0NA 1Q12A 4Y7CA 1CY6A 3QWBA 1P2GA 4NOJA 4Q1EA 3H94A 4L2IB 4ZOLA 3HRIA 4IDPA 2E6KA 4F11A 2ET6A 3D3WB 3CVOA 4MW1A 4YX9A 4QTTB 2FPRA 3ADKA 3NCTA 1XROA 1KZGB 1T1JA 5JS8A 2OBSA 1R8XA 1PJTA 2XEDA 1RIIA 4YP7A 5BURA 5CU7A 2A3NA 3HC7A 3ZVMA 1JRLA 2PGNA 1DFGA 4Q7KA 1TD1A 2M2IA 3OEEA 3TOVA 3GZNA 4LOAA 4XTRA 2IU3A 2OYNA 1LRJA 4GI3A 4P5DA 1E5LA 1WDLA 2FN7A 3OC0A 1A2BA 2WJJA 1PF7E 1VQ1A 1KI1A 4HNRA 3G2JA 5BSGA 4C1NA 5F5XA 2Q8QA 3GIWA 1M66A 3E22A 4RDKA 5TARA 2XA9A 1QO9A 3RYTC 5TMPA 2D54A 3DKRA 1VCOA 2OHGA 4OMCA 1V45E 1VGVA 4BX3A 1NY5A 4P83A 4AJ9A 3MT8A 2XMZA 4HK4A 4M9UA 3RUCA 2PS3A 1P4AA 3WKAA 1DDIA 3TJZA 4OBBA 2QMZA 2XRYA 1RZRA 5DGTA 3WB9A 4IUYA 5DO9A 2WTNA 4MULA 4P80A 4QAJA 3CX3A 4JJAA 3IT0A 4GE3A 4TOIA 4U3JA 3USES 2BWJA 2E1PA 3V00A 4A2QA 2QNBA 3R0ZA 3AHCA 4D0LB 3L3BA 4F4FA 3LC1O 4KO8A 3GAFA 1RVDA 5EZYB 4F3TA 3H99A 3GV0A 4KACA 5ES3A 4UBKA 3J80A 1II8A 2J45A 5PNTA 2CXSA 3BN3A 3HU5A 1BFUA 1MIOB 2QLNA 3UXMA 2XMCA 1BHJA 4BCCA 4N6OA 3P5BA 4B75A 5BSVA 2VDQB 4IJWA 3MINB 3A1PA 3K5PA 2J0VA 4YONB 1BA3A 2HNKA 2WM2A 4O1IA 1EAMA 2ZR8A 2ZYIA 2ZRLA 2D3WA 2AF3C 3LQEA 4LHVA 1EUZA 1K5DA 4KXYA 1CK4A 2Q0HA 4Q7EA 4EG3A 3EZ6A 3O0DA 2R7NA 3K5HA 4XGKA 4JGBA 3WIVA 4JP5A 1WOPA 2OBMA 2R68A 4EMBA 1SVSA 1NIJA 3QOFA 2ZI6A 1E2HA 1YRYE 1W0KD 2XMPA 4H1WA 2A88A 4NIMA 3OSZA 3ROPA 1U8YA 5D87A 3MJSA 1N6KA 4KDCA 2ZM6B 1PU2A 3O1LA 2G77B 4WD3A 1TYBE 2P2DA 4G4SO 5E2BA 1VJ0A 3NHUA 3G2NA 4REQA 3GLRA 1PR0A 4J4TA 2VP6A 3EBPA 2K2WA 2GFIA 3G23A 3K0FB 1T6ZA 2MSKA 3BH7A 2D1FA 1EB8A 1KNQA 3PYXA 3QVLA 1P1IA 4XNFA 4HYEA 5B1HA 3VC2A 4LZNA 4J2HA 1HMPA 3GSIA 1Z4OA 3UWPA 3HB1A 2ZTVA 3ILHA 3OJCA 4JZKA 1FTGA 2FPUA 2VH2A 4MQMA 2B25A 1L5HB 2JBHA 3RADC 2EKQA 1BJRE 1BXGA 1U2DC 1XLVA 3PHIA 3ROFA 1U1EA 1G7TA 2ECFA 3BSFA 5EIBD 3O93A 3AB8A 1PGJA 4RKQA 2GWHA 4Z3DA 2HRRA 1ZJJA 1TYCA 4C14A 2PHZA 4LQ4A 3FTQA 5LVAA 2WQZA 3PWKA 1M1XB 2WFAA 2G7MC 7MDHA 4OQDA 1XRRA 2AXEA 1G2PA 3R3WA 4O4JF 2ZJBA 2CMHA 4C07A 4D96A 3D8BA 3QUSA 4Y8VA 4JVSB 1EP3B 1DTSA 1CUAA 3E2IA 3L77A 4PYMA 3OC6A 1O77A 3EJWA 1MZVA 1W49A 4MV7A 4OGGA 3RIHA 1EQUA 2BGMA 3PNKA 2C58A 1KORA 3V34A 1FXWF 4KIUA 2WJPA 3NH6A 3FB1A 3H2JA 4B3GA 3IHWA 1TEHA 3QRWA 4KNVA 1W44A 5FEMA 4YUZA 1Q7YD 2H7XA 4NVRA 1XTTA 2ACVA 1ISMA 1TKRA 3FBGA 3DZ8A 5LQJA 5IYQA 4HX9A 5J2UF 1BLIA 5CDTA 3GVCA 1NVUQ 3PX2A 2RK6A 3RARA 3IAXA 5M7EA 1M1YE 5L4SA 2YV1A 4BRWA 5LBUA 4D8TA 1ST3A 2H1IA 3DT6A 2VDLB 3F90A 4KLCA 2EF0A 3KS9A 1IEXA 4CV2A 2DUUA 3PU6A 4FTWA 2OGUA 3ZXSA 5DM1A 1JAYA 5IBPA 5DBIA 1JVBA 3C6XA 2RIPA 1GT6A 3U3OA 3R4CA 4UEWA 4EHDA 3DDNA 2OAGA 5AVUA 3H5TA 4Z9BA 1RXIA 3CWQA 4AO6A 4QDUA 1XDGA 2VJNA 3ZD7A 1KAOA 2BTOA 3PD1A 1WBJB 5JCOA 1R8YA 3H6KA 1A88A 4QOSA 4TRMA 3VPDA 1YR1A 2WF5A 2BJVA 5ULLA 3V1TC 6ABPA 1C7IA 5H7XA 3N05A 4G2TA 1PJ2A 1O87A 4NNPA 2JH9A 3RUEA 4INAA 3GGPA 3JAWA 4Q37A 2PMCA 3H3XA 1QFYA 1U1FA 5EYPB 2WY2D 1E3JA 5J4VA 2WKPA 4ZOBA 3ELYA 1GNVA 3H2HA 3IDAA 4RDXA 3G5LA 4B44A 1I10A 1T9BA 2WA1A 3T1QA 3NMUF 2ZSEA 1L4LA 1VSTA 1CUIA 1PUJA 2ERYA 5KU7A 4YO7A 2BGNA 4JJEA 4LJKA 5T5QA 3ENNA 1J1UA 3K96A 3N3AC 1P5ZB 2XDAA 5THXA 2OL4A 2P5YA 3SM3A 1F2DA 4RZQA 1OYOA 5G1OA 4GECA 2JVJA 4JC4A 3K2BA 4KN9S 4KQ1A 5KJCA 1L9XA 1D4ZA 1CUCA 2QM7A 1F48A 3FOWA 4MWCA 3ERCA 3V33A 5IMSA 1KU6A 5KQRA 1MT0A 1YU6A 2PVSA 1IG3A 3P9NA 3H8VA 5EERA 1UK7A 1L7BA 3AW9A 2HLHA 1KJNA 2NAPA 2P5TB 2QTHA 4K05A 4N9WA 1KVUA 1W4AA 2VSXA 3PT5A 5EWJA 1ZH2A 3G2HA 3ANNA 3LOPA 3I01A 3TAXA 4MRMA 2FPKA 1ZMXA 2RK4A 3W90A 1UBJS 2IYFA 1H4SA 4GPTA 3H5AA 4CT0A 4D4IA 1D0SA 1RRPA 3BERA 3VBEA 5KOIA 5CPFA 3S5JA 4E11A 3FJ1A 4J0EA 1CLUA 1P2BA 3QJYA 4FLEA 1KWGA 1GYPA 4OXQA 1QKJA 1XQ9A 1FRFS 1X80A 3M9XA 4PNHA 3CKMA 4BTLA 2JA1A 1I9CA 4YJDA 2O8VA 4J4HA 5K3DA 4YWJA 1ZUNA 2QK4A 5HEKA 3CSUA 3TSWA 2JVKA 2NTEA 4Q7LA 2GPBA 4P6YA 2I3ZA 1VPEA 2HHLA 2VWGA 3H0KA 4J0IA 1QM5A 3MT7A 5LQSA 3VZSA 4BGVA 1NL3A 3IIKA 2D0OB 3NETA 4MDYA 3UXHA 1RYFA 2A9VA 1DV1A 2VHQA 3M2PA 1LS6A 1W0JA 1KI2A 4WFQA 5ERXA 4GI5A 4LDRA 2Q9CA 5HUJA 4XPIA 1QU3A 1M2WA 4QO7A 1VIVA 5A4KA 2W2LA 4FFMA 1KHTA 3NAZA 4ZTBA 1X1DA 3HL0A 4QBFA 1XUOA 3AJAA 4NNOA 1NUPA 1U0BB 5FDFA 1RKQA 2OHVA 4NONA 3N59A 3IODA 1E2LA 5L3ZA 2HN9A 1VG8A 2RARA 2ZR7A 4IYJA 3ROTA 2F9LA 4S35A 1ZJWA 2DPHA 4TLCA 3FVQA 2PLRA 4YRRA 4HXYA 3G0HA 5KNDA 2WT8A 1PR9A 3HLKA 1UKBA 3M4XA 2PVPA 3G2KA 1B76A 2H52A 3ZE2B 3T5MA 5I5EA 4RDJA 4IIXA 2VYFA 1TM2A 3GARA 5DRTA 5IJ9B 3K8YA 3QFFA 3NOQA 4P2NA 1AB6A 1O0BA 1CS0B 1DIRA 1KYZA 1NVGA 3CXUA 1E1NA 3CFYA 2GPWA 4ITRC 2HWKA 4YJ3B 1QDUA 5JQGF 2JKYA 1B41A 3Q7RA 2A5DA 3G1WA 4US0R 2QE7D 5L51A 1MGPA 3OMXA 1JZTA 1UK8A 2IOFK 3ES9A 1J24A 3A31A 3BH6A 1J0BA 2AE2A 5D00A 2C9CA 4YQFA 1MC8A 4HDRB 1OLSA 3IOYA 1UBNA 4J7XA 4I3GA 4OFZA 5IF9A 3RAJA 4PYJA 5K8CA 1J5EB 1I1NA 3QI2A 2XDQA 1PT5A 3WNQA 4DMMA 3LGSA 1IHDA 3MZ0A 3LF2A 1M0TA 2F8LA 3WRXA 1ONSA 4B6EA 1XQXA 3KPVA 5JTUA 1YQGA 3CCSB 1P9OA 1GY8A 1NV8A 2O1SA 1ZH4A 2D1QA 4YDSA 3IB3A 1HDYA 5AM4A 4O4HB 4F8JA 5ELXA 4G0WA 5E4TA 1E8DA 1Q7TA 4KFUA 3STXA 3ZXIA 2GYVA 1X0VA 1VB5A 4JI0B 4G8BA 2VUIB 3W2IA 1PR5A 3Q9UA 3ZNPA 3LF1A 1XC7A 4FMBB 1NOKA 4OJNA 3HP4A 3M3PA 1YA6A 1P7PA 2RBGA 4U7HA 3R9IA 2VJJA 2I6GA 2OLKA 2C4WA 2EKPA 5HWSA 3KKEA 3WQZA 1IZ9A 4RIGA 2XRZA 3OVMA 1R4ZA 2F3PA 5IHPA 2JI4A 4WUTA 2JFQA 1XRMA 2JGEA 3OEED 5DEIA 1M6EX 5BN3A 4HNQA 4RH3A 3MW8A 1KZ6A 3DE2X 1BH6A 2HJVA 2JAUA 3I1YA 1R5JA 4UUPA 3ZWOA 4BKMA 1MD9A 2H2DA 3MUEA 3IAEA 6PFKA 1BGVA 1ENZA 2VPQA 1PZNA 2TMYA 4ZTZB 1DC6A 1RI5A 4O2LA 3ASSA 3D59A 1NUAA 3EBLA 3Q5EA 1CIPA 2VZ8A 2WWHA 2X4LA 5BYAA 2JIQA 1BQ3A 1OXMA 3FHLA 4DZTA 2I2DA 1C2TA 2ZK7A 4WKNA 4BEBA 3IO3A 3ZJVA 1K28D 4I4NA 5CLQA 1CZOA 3HR8A 1KMHB 2HNBA 4UBJA 3CX7A 5CVDA 5K3AA 4PC7A 1CQZA 2Q1WA 4RTQA 2P9ZA 3T7TA 2JLYA 4LNHA 1CUFA 5I7HA 3P1JA 1KMCA 1VKNA 5LZ9A 1A97A 4AZ0A 4H2DA 4NENA 4DWOA 1XD2A 5EMNA 1AKQA 3RE1A 4XX0B 3R5TA 3DDYA 1X19A 3BWDD 1BMQA 2K87A 3H9QA 2B9EA 2F17A 2F3TA 3KJEA 3PI6A 4ON9A 4RYDA 3TMKA 2AI2A 3V7NA 2XD4A 2A9RA 1DB3A 3T7IA 3ZJ4A 1E6CA 2H1CA 4A36A 4ZDIA 5BOSB 5BVGA 1RYHA 3NB0A 3P9ZA 3NHPA 3HCRA 3OF5A 4HEA1 5FUYA 1XZIA 2XOKD 3SOPA 1KQ3A 3T99A 2XKKA 1LDEA 4CU5A 3ZEAA 1UIRA 4JEMA 4Z53A 1FNNA 4J29A 4C7JA 1IONA 1EVYA 1V96A 1V6CA 2O0HA 2WD8A 2P9CA 3KE9A 5DB4A 5M29A 4IAOA 1Y8RB 1EX9A 1PI3A 2X8BA 2DPLA 2RB4A 2WIAA 4QU9A 2OFFA 3RAPR 1E0AA 4IVRA 4IMIB 4F84A 3V1LA 4OLBA 5ADUS 1CJMA 3P45A 1TA0A 4ZVUA 3S1AA 3R09A 2I3GA 1KNXA 4EJSB 2V0NA 2GJRA 1KGSA 3NXSA 1NATA 1X7XB 4QYIA 1VQ7B 1M6YA 1HZZC 3EIFA 4DQDA 2OHXA 4IMPA 5CLHA 5AW5A 1R5OA 3FLBA 4BMVA 4F2WA 4WGGA 4QT4A 4V1CI 1NMQA 3I5MA 4YMGA 5IVHA 3JQ9C 4GFDA 1TEZA 1OWLA 5FLKA 3I2FA 2H9IA 4OSPA 4QXQA 2WJ3A 1KP9A 2ZRFA 4E6EA 3CC2B 2HYIC 2G40A 4DSTA 2QYSA 4A2CA 1JE0A 1U9JA 2YN2A 3FZEA 5EIFA 4F2PA 3ZE6A 4PC1A 2ZSHA 4Q16A 2VAXA 1M33A 3HSKA 3WGZA 4HE6A 5AK4A 4PHCA 5JOQA 3BIFA 2FMIA 2XCLA 4JLPA 4QUKA 4I9NA 5PGMA 1W2BB 3GGOA 5CX4A 5IWCA 4ZCLA 3UB3A 4D5GA 1OXXK 1UODA 2G83A 2Q5HA 1V0EA 4RF4A 2XWPA 3K9WA 4ZMRA 1JIQA 1H2HA 1M1YB 4MJ7A 5G1NA 1Y8QA 3F7OA 2NP6A 1Z08A 4CLOA 4EA6A 2XVYA 1ACMA 1ODLA 2XMSA 1OX5A 3NNDA 2ORYA 4MR8B 3SX2A 2WD7B 3QPBA 4RORA 4FE7A 4I7EA 3B51X 3HYCA 4OI2A 1J5XA 2GTIA 1FLDA 3A28A 2FVXA 5TT1A 1WUJS 3EZLA 2N46A 2VK2A 1NJ8A 3O84A 1XO1A 5JWOA 1JMYA 2IP2A 1SCJA 4P4LA 4QHSA 3FM9A 1KQGA 4HADA 5C1IA 2F8MA 1U80A 1Z75A 3RM3A 1VKHA 1DBVO 2VH1A 2OB2A 2QZSA 5K0JA 1UAGA 4L8YA 3L8FA 2I6TA 2YS7A 2AG6A 1VHOA 3C5EA 5EKUA 3OEWA 2A1TR 1E2UA 4NV0A 1ML4A 1C4XA 3EZ9A 5CGZA 2GJAA 4CKWA 2GA8A 4BMPB 5GQSA 1CNEA 2ZJ6A 2O8BA 1T9GS 2KPOA 3AKDA 1Q6YA 3O83A 4JENA 4MS3B 4P33A 2G8NA 1KH1A 5H1YA 5CT5A 1KPIA 2WKSA 1M34A 4YRLA 3UAWA 4PLFA 5DX1A 1RC0A 1KSJA 2ZANA 1U7HA 5ICFA 3UATA 1LPPA 2IZ1A 5EGSA 1U7TA 5LKAA 1XWWA 3QOWA 3VPGA 2DY1A 2V6JA 4KBGA 1LLQA 3C3EA 4BEJA 2DTDA 2QTNA 4EO7A 1W6UA 8ATCA 2ORWA 2ZE5A 4ALJA 4EYOA 2B37A 5D3QA 1YQXA 5HZMA 2FETA 2UKDA 1DJPA 3M3DA 3DBRB 1N2BA 3GFQA 2ZVPX 3OUUA 4M53A 2CDBA 4GMXA 3AUTA 1QBGA 1YKFA 1KMNA 1X8XA 1IHOA 2PYDA 3C7KA 3PFWO 4LW8A 4Y98A 3X1ZA 4ZVPA 2VUUA 4KPYA 1HLFA 3C3YA 2V5VA 3FDXA 4GYYA 5DTRA 3HWSA 3LDAA 5FWNA 2CCJA 3EG5A 1G64A 4HSEA 4OOVA 1KFKB 4YT5A 1C3VA 4C3VA 5ICCA 1OBCA 2D13A 3H11B 3HS3A 3HU2A 1XALA 3JQ7B 1KDVA 4AN1A 2Q4RA 3JVUA 4I8DA 2QMYA 3TZQA 3EVDA 2M6RA 4KKUA 4IJUA 4IWXA 4HAWA 1IQ0A 1CPYA 3MBIA 4POAA