5LMZA

Fluorinase from streptomyces sp. ma37
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
291
structure length
281
Chain Sequence
b'RPIIAFMSDLGTTDDSVAQCKGLMHSICPGVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIRQAAQWAGSGDGFERADGSYIYIAPNNGLLTTVLEEHGYIEAYEVTSTKVIPANPEPTFYSREMVAIPSAHLAAGFPLAEVGRRLDDSEIVRFHRPAVEALSGVVTAIDHPFGNIWTNIHRTDLEKAGIGQGKHLKIILDDVLPFEAPLTPTFADAGAIGNIAFYLNSRGYLSLARNAASLAYPYNLKAGLKVRVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluorinase
molecule tags Transferase
source organism Streptomyces sp. ma37
publication title Identification of fluorinases from Streptomyces sp MA37, Norcardia brasiliensis, and Actinoplanes sp N902-109 by genome mining.
pubmed doi rcsb
total genus 65
structure length 281
sequence length 291
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 5lmzA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 5lmzA01
4CQJA 2ZBUA 2V7XA 5LMZA 2C4UA 2V7WA 1WU8A 1RQRA 2C2WA 2CW5A 1RQPA 2F4NA 2WR8A 2C5BA 5B6IA 2V7VA 2C5HA 2C4TA 2Q6KA 2ZBVA 2Q6IA 2Q6LA 2CC2A 5FIUA 2V7UA 2CBXA 2V7TA 2Q6OA
chains in the Genus database with same CATH superfamily
2PGDA 2JAPA 1T4CB 4KIJA 5FPQA 1GPH1 2R86A 4H35A 4KH0A 5BYKA 4EUSA 2FQXA 4Z86A 1LC0A 4X5OA 3DZDA 3I37X 4BQQA 2IF0A 1JAXA 3PC6A 1R0YA 3W6OA 1OMOA 1UD2A 5B3KA 1ZD5A 4Q9HA 2XZDA 1P5HA 2QTVB 5JUWA 2Z1MA 4GE0A 4X6LA 3CW9A 3MWGA 4J7UA 4LCEA 4PZ9A 5TDHA 4P5PA 4Y1FA 3SQXA 2COKA 1LSUA 3H6KA 1X9IA 1JG2A 1PFUA 3JASB 4RAOA 4XOIA 1ZJ4A 4XN0A 3WL3A 3FW1A 2LZ0A 3OMWA 2VH1A 4IXNA 4Q1EA 4CGZA 4ALLA 4RDKA 2D0IA 1U3TA 3DV9A 4P4NA 3LKVA 3NEJA 2X1MA 5DSXA 1M0TA 5HKLA 2V74B 2BT4A 2PEZA 3I61A 5IT9A 1H94A 2C4WA 3RS4A 3HCBA 5LXTA 1M6HA 3TECE 3MXTA 3UHOA 2BMWA 2OZEA 5ENDA 4NBUA 2QVBA 3DWGA 3GLVA 4UQPA 1UPCA 4HEA1 3RQIA 3LG2A 1ECPA 3UJHA 2OCBA 3D7MA 5I8ZA 4YUVA 1V43A 3WR5A 1Q0TA 2VDPB 2DEUA 1YUBA 2H8GA 2NZWA 4GX0A 3HYLA 3N1UA 1QQ6A 4HPJB 3V4SA 4YAUA 1PHRA 1PUXA 2OR3A 3T5DA 4GMGA 1DOAA 1TQHA 2IPLA 3H75A 4HAUA 3T56B 5L46A 1B8OA 2VJQA 2PXXA 2VAWA 3W6NA 3MLAA 5ER9A 4RY0A 2CNNA 3G9XA 3OZVA 2BFDB 4JLJA 3T0IA 4KQFA 1RXSA 3S7ZA 3PQ5A 2BEVA 3IEVA 1UBRS 5FI0B 3JXEA 1HZJA 4OI0A 4XQFA 4E0FA 1UKVY 3KKPA 4GXQA 3FR8A 1VKRA 1R18A 1QTIA 1LV7A 1P39A 2IUTA 3RBVA 1D6JA 2PG3A 4RACA 5CG2A 4XVHA 2O5RA 2QN9A 3ONYA 2FNAA 4PZCA 3MM4A 1JDSA 1RZRA 2IUFA 4BLVA 4FYHA 3A28A 5E3HA 5ALVA 1T5EA 3UAZA 4DV2B 1DQNA 1VQ7B 1ESMA 2ZU6A 3E15A 4IQFA 1I13A 1UC9A 1MMFB 4TSFA 3IHWA 1F51E 3NRCA 1DAOA 5GJVC 2V7UA 1ML3A 4NP6A 4UEQA 2CHQA 3PI7A 2Q0SA 2UZIR 3CHYA 3GB9A 2E1PA 1Q3KA 3FPEA 3UNXA 1L5RA 3FOAA 3I62A 4BWVA 1K08A 1QF7A 1I3OA 4HFNA 3NUGA 3FIUA 4MUMA 1PX2A 4WKOA 4Q02A 3TAUA 4BU1A 5ALHA 2Q0HA 5K03A 2AVNA 4IF4A 4LNHA 4LYEA 2JLXA 1U2QA 2ZYTX 2BIFA 4FQ5A 4WD3A 4XD2A 5DV9A 1IY2A 2R44A 5JCOA 1SCDA 5CX1B 2B92A 3ZHTA 1B7GO 3MMSA 3FVTA 4XWWA 3VPHA 1B93A 1Q7BA 2GPNA 4L0CA 5KQSA 4P38A 1RI1A 1TAQA 3ZNNA 3KTOA 4HEQA 1U1CA 4K81B 4ENRA 4NCBA 1X1CA 2PSSA 1X15A 1JYFA 3OIVA 1P7WA 1IHDA 3TLXA 3S2FA 3AUKA 2A5LA 3RYHB 2RHHA 5JS8A 1QV9A 3UCFA 3UBMA 4DA8A 4Q4JA 4L2IB 3SFTA 3EYWA 3LFUA 3OEHA 3WGOA 1XKQA 1R0BA 4ZOCA 4ZDJA 3MK31 5JAQA 3ND6A 4G5HA 1YD7A 2DMRA 4B3HA 4CCAA 1JWLA 1Z35A 2GZ2A 3I9V6 1Z0DA 4FFWA 5K3CA 4Z1MA 3IODA 4C22A 2WJ4A 4X1OA 1DLIA 2HMWA 4BFCA 1MKYA 4BNIA 2ZJ0A 3MCVA 1KRWA 3HZHA 1F2TB 2CHUA 3EXG2 2YINC 1PBNA 2Q4OA 3AHHA 1OXVA 3VI3B 3EVFA 1CDEA 3FMOB 3ER9A 3L9WA 4YRJA 4MKZA 4BATA 3R3ZA 5K20A 3I56B 1WB5A 2FP3A 1QJCA 4Q12A 3GLIE 4ZTUB 2UU9B 1PJ2A 1N34B 1TI7A 2ORIA 4DCOA 2CMHA 3M9LA 4ROSA 1FFHA 1I4TD 1K88A 2V31A 4YIHA 3HDYA 3BL8A 1DC3A 3E82A 4JH0A 3ZQKA 2X22A 4OD0A 1RXUA 5CNKA 3NYWA 2ALJA 1JQ3A 3T8YA 4RVSA 4P54A 2C7RA 5BO5A 1GLVA 1GZ3A 1VI6A 1WZEA 3CCRB 3G79A 3UB4A 2HXSA 3ZUGA 3I83A 3OT1B 3PUXA 4OXKA 4WJLA 5FV4A 4H60A 1E1RD 1Q50A 3IHLA 2B1GA 5A1JA 2K7FA 3WQZA 2KS6A 2JIMA 2Q49A 5DX1A 4D9JA 1RYFA 1X2EA 4FTWA 3WK7A 4QFMA 1GZ5A 2Q3CA 2DY0A 4QUZA 1YKFA 2C57A 1O77A 2ZSDA 3NJ4A 1W94A 2P41A 1BJKA 2JIQA 3CKKA 3NIDB 2UAGA 4AVYA 3S1LA 1YR1A 4Q15A 3TEMA 1NOJA 3D3KA 2ROQA 3EJ6A 3FMFA 4HEJA 2HNAA 3OX3A 4UTZA 5FFFA 2Q6OA 1KOFA 2BEUA 4FE7A 3ZG6A 4B9AA 3WWPA 1AHIA 2G28A 2I62A 2JF0A 3GFRA 2Q1TA 4I3GA 3TLBA 3DLHA 3FYDA 1DPFA 4GLBA 4MB0A 5KYGA 3EEFA 1AB6A 3ZN2A 3U17A 3AF4A 5TSDA 4I9UA 2O8FA 2I33A 3SWWA 4W9MC 4W5NA 3WKAA 1P80A 1U11A 3OZGA 3UAOA 3WWDA 4I6JA 5KIAA 2G7MC 3A7DA 4OGGA 2DTEA 2O06A 4R3WA 5LLSA 5AUNB 2VK2A 2VS1A 2GGSA 2WDPA 4CKCA 5G1OA 2CDCA 1CX9B 3WLHA 3AESA 3NAGA 1FS5A 4E1AA 1TRHA 1K5PA 2V58A 5KQGA 1SB8A 3ORRA 4AJJA 4YELA 3DFIA 4OHBA 2O2EA 1L5NA 2QP4A 5JHHB 2H48A 2ISCA 2ZL5A 1JZTA 3CURA 3IP6A 3CCFA 1SELA 4A0QA 3BH4A 4ASUA 3RY8A 2M5SA 1TAGA 1NQXA 1XL1A 2O48X 2UZ1B 3HB5X 4LGVA 2MYUA 1HEIA 1I7QB 2XSZD 5K2OA 2W8BB 2X4LA 4JI4B 4WZAB 4IBOA 3CNEA 3TB6A 4UHFA 3FA2A 4IHJA 1XTKA 1X86B 2WZQA 3D54D 2W6PA 2NUBA 3K5HA 3QLUA 4PBRA 4XYGA 5AHRA 5B58C 3AX6A 3EZNA 4JEHA 1OTHA 2VPXA 2IZZA 4IILA 3OZBA 4KQWA 3TW6A 4YR7A 4EMSA 5ECYA 3U09A 3QPAA 3AF6A 1QHXA 1ZOOA 1R8XA 2WD7A 3AG5A 3FVWA 3RADC 3RGGA 1MO3A 1TEHA 4FOLA 4GKAA 5M7EA 4DB4A 1NHWA 2FLKA 4K2AA 3QBEA 2XMBA 3UPTA 1A7KA 4HAOA 1YQUA 1ZOIA 3VX4A 4AAYA 1ZDMA 3M7IA 4U00A 1DHTA 1EVZA 3HU3A 3OF5A 5CJPA 1YVUA 2HZBA 2ZM5A 4M9RA 3ADBA 2BFMA 4FBLA 1FUYB 4MP3A 1DAFA 3N2YA 4OMFG 4L5AA 4O59O 4DV1B 4B6QA 4TL7A 4DS3A 3H9NA 5L7TA 2PA0A 2E5LB 2FB9A 2RONA 2C04A 3IAFA 4IUYA 4PYQA 3FVRA 3P71T 3GLTA 2IXBA 3ETNA 2AG8A 2GN8A 1XCGB 2J08A 2PGAA 2PL1A 2Y27A 4RZSA 4UZSA 5LZ5A 4RK1A 3LO8A 1KDRA 1SQSA 3EG9B 3N8GA 1LRKA 4M8KA 2QD3A 1O94C 3ZQUA 4A6XA 1UJ2A 4R41A 1M72A 2AV6A 4NDNE 3L4SO 3L7BA 4G1EB 1IHYA 1BRTA 1VSQA 2W2LD 3KSAC 2F3SA 3QBDA 2VF8A 4I5DA 4X8MA 1BFDA 1PJ7A 3BC9A 3BPSA 1OZFA 4RFSA 4KXVA 3KQHA 3I2FA 4J0QA 1PWYE 3RTDA 3U4IA 4PZ0A 4EVIA 2O8CB 4ZREA 3H8WA 3R9WA 5EI5A 3ZHZA 4L3OA 3OZSA 2DWPA 1CY1A 3UKDA 2ZZMA 4WEOA 5I7AA 2Q99A 1RTKA 1TVEA 1T25A 4N5DA 4XJXA 1RLUA 2FEOA 2W4MA 4L5JA 1M1YE 5DE3A 1UJCA 4HN9A 2I3GA 2IUUA 3U7QA 3E5NA 1R4AA 4DRXB 3HEBA 2J31A 4N6NA 1XVUA 3F7OA 3K6RA 3RV4A 4KUEA 3FUWA 5CAEB 2V7TA 5BSUA 5IM5A 2HCBA 2QY9A 3QVUA 4Q16A 4TRRA 5IDVA 1JEOA 5MGBA 4Y6RA 1HM5A 1YTUA 2Q5CA 3B1KA 2FPWA 4HQ0A 1P29A 2P9JA 2Q28A 2HF2A 5FORA 3W1WA 1N8RD 1T4DA 1V6CA 3ZEIA 2O2JA 2R5NA 4TS3A 4EKYA 5E7MA 2XUZA 2WZDA 3MLBA 2G82A 2OHXA 3U6BA 1CUSA 3HKEB 1I4LD 4NESA 2JARA 4CQLA 4YALA 3NHUA 2H3EA 5JCZA 3D6JA 1VDZA 2C7OA 2JFHA 3R5SA 1N6LA 1KI8A 2NUPB 3H5AA 4FDAA 4W8HA 4L8LA 2JPDA 2X15A 1A9RA 3ESDA 4XPIB 3QE0A 5F78A 5BXQC 1GGEA 3OE4A 4K03A 4KXLA 1ZK1A 4TKOB 2IIBA 2YWCA 2XVAA 3KDSE 4CZ2A 3OQVA 1RI4A 3NI2A 1PKXA 4EG0A 2ZJ7A 4P83A 1JE0A 3R6WA 3SU8A 2JFQA 4GGPA 3GLKA 3KTDA 1NVDA 2PDAA 3ORSA 2F4VB 5BN1A 1YMVA 1NVXQ 1C8VB 1SC6A 3UJ3X 3R3XA 3HCNA 5C5DA 3LGAA 1RBZA 2IXFA 1VE1A 4QOIA 1N3BA 4UEKA 2QRKA 4DLVA 1T15A 2GZHA 1SQ5A 4KJXA 4PFSA 2IBTA 2G07A 1KDTA 2RHRA 2VWQA 3VO2A 1GNRA 1HMYA 2C83A 1KGSA 2PT6A 2B8NA 4X6YA 1ATIA 4ZEWA 3RC9A 2WSLA 1G21E 5HFAA 3DLBA 1SZPA 3PNYA 3BXFA 3GEBA 5AJWA 1V16B 3LCRA 5IJZA 5LQDA 2P9ZA 1FK8A 2EZ4A 2YWXA 2F1OA 2M9MA 4OK5A 1OZ0A 1ZHHA 1VJ0A 2I3DA 1LSSA 2VF4X 3FYCA 1IK4A 2YMPA 5DM1A 5JPIA 3THYB 1LK7A 4N3GA 1WXIA 3ESRA 4MULA 1MV5A 4ENSA 4WZ6A 1ACLA 2BMDA 1Y1QA 1H4TA 2AD5A 2J3DA 3H7AA 3HM2A 4L8YA 4DHEA 1U02A 2EQ5A 2WTEA 1XMVA 3KU1A 4ZGGA 5DEOA 4B31A 1YIJB 5KVAA 1Z7BA 2BDTA 1K7SN 2G67A 3LOPA 4NJMA 4O2BA 5JMOA 5MN5A 3DSRA 2J3LA 3LQQA 5FPTA 5DTQA 4PN3A 3VNSA 3I6ZA 1NAIA 1QGYA 5L3VA 2NO7A 3CUKA 1T4BA 2V5VA 1JA1A 3M5CA 3W9BA 4E2YA 1KJNA 3NVMB 3OE7D 5EA2A 3T4PA 4ZKEA 4E09A 2IZ7A 3PS9A 1O6GA 2A94A 2FZKA 2R1ZA 2GCIA 2P2CA 3BF8A 3PC2A 4X93A 2AWNA 5DZSA 4CF4A 5IT4A 5A0VA 2QPAA 3IA2A 3ME5A 1OFTA 4F8JA 7YASA 2C4MA 2BUBA 3CNHA 4QQFA 4HZUA 1MRSA 3IAEA 4R1MA 2HWKA 3L1JA 1TMKA 1YQXA 3WGJA 1PWEA 1ZK3A 4Y3UA 2H29A 1Z2CA 1T10A 3E2PA 1M75A 3H1FA 4E22A 3CLHA 4HFJA 5CYGA 3TSWA 1QFMA 4LNUA 1A98A 2DWOA 1ZLXA 3D3NA 3R6DA 4MVCA 3K0CC 4UBOA 4DV6B 2IPAB 1KI3A 4HKTA 4NMWA 5BWCA 4JLSA 2V6MA 4RZIA 3U7RA 2WAOA 1UZAA 3NC4A 1VHJA 1JEQB 2WG1A 3RCBA 3SIXA 3FTCA 2PWYA 1YFJA 4DC9A 4AFNA 2I2AA 2FLVA 2IX9A 4BX3A 4MV4A 1NJ6A 2XHEA 1Z5ZA 5C32A 1GT91 2QRJA 3DR5A 2WUFA 4FFMA 2NMVA 1LDBA 2WA1A 3DMHA 3A1TA 2Z6BD 4ZQBA 3ZXIA 5L53A 3PSHA 1S9HA 2AFHB 1N78A 4ZK2A 1JDPA 2VBTA 2X8WA 4N0DA 3PBKA 4NRDA 3LDAA 3UJPA 1LV8A 4F5YA 3FNGA 1JG6A 1WDMA 4FGLA 3QK7A 3V34A 3KR1A 1CTQA 3IMEA 4WFJA 2HMVA 4ESVA 2YIMA 1YRHA 1WS6A 3MTBA 2IEBA 1XDSA 5TVGA 1AGYA 3DV2A 3VZSA 3TDKA 5H83A 3QLVC 1CE8A 2IHUA 2HSDA 3BFJA 3QWHA 3IDFA 1B4DA 4GHWA 4LXTA 3WIEA 2PZEA 3ZE9A 2CMFA 1JJAA 1ECCA 1FFWA 2Z09A 5FBKA 3W6UA 1VC2A 1JHUA 3U9LA 1KTVA 1Y5NA 1N2HA 5DYWA 3A06A 3BMNA 4IIFA 5I9TA 2M6LA 5BVHA 5A7HA 4RQTA 2NXJA 4CU2A 4OOSA 1N2JA 4Q7KA 1SVNA 4MLPA 4WESA 3MSCA 2UXDB 3RVKA 2VZ0A 4ZYYA 3VOSA 2NV6A 5ICCA 3I09A 3WS7A 2DKOA 3PF8A 1SWVA 3PIIA 3NUQA 4JC0A 4MPJA 3CX4A 3UANA 4X65B 1KK3A 2EJBA 3MJFA 4IEIA 2ESRA 1QE3A 5H5JA 5J2TF 1ECGA 3ECCA 3RU9A 4DQVA 1P2TA 4IW3B 3B48A 3WLNA 4K9SA 5F9HA 3H3XA 4D4JA 3WV5A 4BPBA 4N1AA 4CMIB 1AKTA 2P5TB 5EIBC 4JLKA 1U3GA 3DDWA 1WVGA 3PP8A 1P1FA 1Z6GA 3GD7A 3FCOA 1DT5A 1E3JA 2OY0A 4H7KA 1I2MA 5EZYF 2D0DA 3KOOA 1XXHB 4PIPA 3FWHA 5DHSA 3M89A 4HYQA 1E99A 3E3NA 4W5JA 4QQKA 2X14A 4GUDA 4CCYB 1XA3A 4Z7JA 4FT4A 2JZCA 3JAKA 5IYWA 3KM0A 4MRMB 4OREX 3VYTB 3UJCA 1KPHA 3ONNA 5T7BA 1XC7A 1CNFA 3VU0A 1QHHA 3BXEA 1GQYA 1O95D 3CLUD 4LY9A 4YLGA 1CR4A 1CWUA 2LRHA 5DM2A 2PR2A 3QNUA 4CKWA 5JW6A 2ZI6A 2OB1A 5EYPA 2E89A 3F3KA 1D6NA 3OHPA 4OQQA 1E58A 4BP1A 3ZGNA 4BRSA 4C0KA 6Q21A 3SQMA 4KQEA 2GTIA 1Z08A 3WIUA 5FPYA 1RZ3A 4N39A 4DLSA 3WLAA 5GJBA 3R7DA 3HH8A 2TS1A 2Y0BA 3QQPA 4MUGA 4WSOA 3KTAA 2HL6A 4HB3A 5AM1A 2GVDC 3EC1A 4LHEA 2GEKA 1A1VA 2ZS9A 3HI6A 4E4RA 3U7JA 2EC5A 3TTXA 5EXXA 4EHNA 1NW7A 1OYVA 2PX8A 1GRCA 3MGCA 3OFVA 3W2HA 1IAVA 2JDID 3HEMA 3IB6A 1HZZC 1TO6A 2GD2A 4WH0A 1E4YA 3RVNA 2PS0A 1PTKA 1HRDA 3LY5A 4MDHA 4WXEA 1KP9A 4CHGA 4DLKA 1NY6A 2AMLA 3B6MA 3BE8A 1Z6YA 5AJUA 4RZ3A 5C37A 2XOKA 1CUDA 1CUWA 2DECA 4OU4A 4RHXA 4RY2A 1I7NA 2HA0A 3CX8A 1QH1A 4IXMA 1DCTA 4X1KA 3CVXA 4ZP1A 3SC2A 1TGVA 3MUOA 1B76A 4IIVA 3EQ6A 2PRKA 3K4HA 3NOXA 2HJSA 4FBMA 3VPDA 1USVA 4Z7NB 1G0NA 2Y67A 3A2MA 1T5HX 2DY1A 1OY1A 2X76A 2NAPA 2XMPA 2FQ1A 3EXFA 5K8VA 2OFWA 3ZGVA 2VQSA 4W1QA 4I08A 4BVEA 1TYEB 2Q4DA 5TV2A 1JVSA 4JLPA 4MQBA 4TWJA 4ZOLA 4PONA 3Q72A 2H6EA 4FLEA 4JT2A 1A82A 2B4TO 4CIYA 4ZI5A 3AEKB 4X63A 2UUAB 1EP2B 4MW2A 1N1DA 3P96A 4EUEA 3QNMA 2F9FA 3PGVA 2SCUA 5C80A 3ITKA 3AVWA 1V3VA 1YRBA 3VJLA 4FGUA 2J45A 4P53A 1GNLA 4QWMA 3NXKA 1GUAA 2FPUA 3HDGA 4YN3A 3ZVLA 3RS9A 4YT8A 1XQBA 1M5UA 5C31A 1MZPA 1X14A 1L4GA 1RRVA 2PYDA 2Y1OA 5ALGA 4EYEA 4FGKA 1EUCB 3L0DA 4V3BA 4YAKA 5DF1A 2IYQA 1FU4A 3NBXX 3QYJA 1WXHA 4L8GA 3GRRA 1QXSA 2B36A 4GPEA 5JALA 3V1KA 5KYWA 1JTVA 2ZJYA 4AWBA 1XVTA 2HJRA 2R8OA 3EIWA 3Q3CA 2BM0A 2IP1A 3P27A 4NC9A 2RAFA 3N05A 1X70A 4Q3BA 5C4MA 3RDPA 2JLBA 1N2BA 2RGUA 4GPTA 2QZSA 4FR0A 5GIPE 4KLNA 6YASA 1E2FA 5B64A 4QAJA 4P0QB 1J9GA 4ZRDA 3AR5A 4RLHA 4D9KA 4EPYA 3MD0A 4LC9A 2H1CA 5ETJA 5DNVA 4CFZA 4BO1A 1PFQA 3EZLA 3GZNA 4B47A 2WU0A 3PQDA 4JUCA 2I7DA 1WG8A 4R51A 4FGSA 3JZAA 3WAKA 2OBNA 3DULA 1ZG3A 1GPJA 4WJKB 1I6LA 1ZN7A 1M1YA 3PB3A 1ZSVA 1WTAA 4QTUB 4FOTA 3WLMA 1MW8X 3BXPA 5JSZA 2BGIA 1IN7A 3DVAA 4M0DA 1W25A 4G0VA 1Y0YA 3VR1A 2UXCB 3TL3A 2IYXA 4DANA 3T53B 1XDWA 3D4IA 4ZT2A 1VMIA 1YTLA 4HOYA 3RVOA 1W73A 2QD2A 4G07A 4ER3A 1N4DA 4PZEA 3HVRA 2Y1KA 1VCMA 4M89A 4LYJA 4TSKA 5HWSA 1JQEA 3C5EA 1AN9A 2ZBEA 1MEJA 5CT5A 5CD9A 3ZW8A 3L77A 1M66A 1RKVA 2AR0A 2I4MA 4QTZA 2P5YA 3BH6A 3C24A 3K6SA 1ZJWA 1LPAB 4N40A 3WB2A 3S5JA 4ZDIA 1TKCA 5DLPA 3MTIA 3QG5A 5F2NA 5D3MB 1KVTA 2ANBA 1O5OA 2XGSA 3LX5A 3TM4A 1Q7EA 1BO6A 4K6OA 5A05A 2ZRAA 2FPGA 3P94A 3QTBA 3WKCA 2GK6A 3HDVA 4RDIA 5BN3A 4RTLA 1VKNA 3D8TA 4X3OA 3QYAA 4ZQFA 2PQMA 2GH1A 3NE5B 5A8AA 2MSDB 2JC3A 4M22A 2BEWA 4OLJA 2D5BA 3BMCA 3O3OB 3ZQJA 3MCTA 2YYYA 1GPLA 1O95A 4P58A 4KWEA 3W7VA 3TNLA 1EQ2A 3G5LA 1M0SA 5DYNA 5DCWA 2PJDA 3L7AA 3ZGLA 2Y2VA 1WCYA 2XLCA 4HSGA 3U7GA 1XGKA 4JI0B 1X87A 2V1XA 3STVA 5EUBA 5JS7A 4DR6B 4LRWA 4MR8A 2UVQA 2XZTA 1U7DA 3PUWA 4N48A 3VOBA 1PNQA 4H3HB 4OI4A 3ZOKA 2PAAA 2V45A 5JU6A 2OV3A 1AGPA 4NCXA 3JZIA 5AESA 4TM7A 1DEHA 4RKQA 3I3SR 1T0BA 3SIRA 4YJ2F 3UATA 1Z73A 3S2SA 1D2GA 3IJRA 2EDCA 1J42A 2XGGA 4WI1A 4Y6PA 1Q0QA 3TDMA 3VNRA 5JRZA 2VK1A 3LMKA 3GQBA 1ZD4A 1T9KA 1YK1A 5IEJA 2I8AA 4MCJA 3IDZA 3QOWA 4Y2JA 3LKBA 3NDJA 4OUDB 4QT0A 2GETA 3SYLA 2BFCA 3A4LA 3RFVA 1V4VA 2QPLA 1R6BX 1FSPA 3NGMA 2EFCB 4UDOA 1EDOA 4HQFA 1B74A 1DADA 2C3UA 4EX6A 1ZHFA 2J5RA 2R8PA 1FX0A 5TRTA 1GQFA 4IWXA 3GUHA 2IEYA 2VHVA 3IUJA 4RDJA 3LWZA 4PYOA 5JZMA 3JTEA 2DIEA 4IIHA 5L7WA 2MSKA 3UUGA 2QN8A 3EYAA 4PABA 4BMXA 1IN8A 2WFLA 4FEAA 3E9YA 1R6UA 2R47A 3CTAA 2VYCA 1O08A 4NDZA 1L7XA 1ARZA 4HDNA 4KH1A 4RVNA 2Z6VA 5KNBA 3ZWXA 3IERA 4MEJA 4LIPD 2Q2WA 4BGEA 5B3JC 3QE9Y 5DM0A 4PU0A 4YEJA 2J0EA 4IEFB 2POQX 4X7EA 2Q3FA 4KFUA 4Z9AA 2C94A 1Y6FA 1LA2A 2IYSA 4RMNA 2W7TA 4RM2A 5EG5A 2IS1A 2P67A 1UMDA 3LUAA 3R6JA 1ORTA 1QIFA 3SPXA 3S40A 4AZ0A 3BT7A 1PQ4A 5A5EA 4G1VA 3F47A 2WW8A 1G7TA 1OIXA 1SU8A 2FSGA 2X7JA 1E61A 1Y8QB 3VBEA 4B73A 4LC1A 4P0PB 1X7GA 1U7HA 3HKCB 2Q8NA 3IKLA 4KX3A 3DLPX 4NK5A 3EN0A 4TQUS 3FBTA 4M54A 3K32A 3VR2A 1R74A 4D5GA 3TN7A 3N2GA 3OJOA 2VJIA 4FWIB 5CURA 3QHPA 4DUZB 1JVBA 1DG9A 1JBKA 1KHTA 2RMKA 3NEPX 5LIRA 1B73A 2Y1CA 4YROA 3CD6B 1S96A 2VTBA 3RYIB 2OCGA 4G6IA 2FRDC 2F8SA 4EOGA 3TSAA 5DKFA 4IIJB 3UQYS 1YBFA 1Z06A 1M2VA 4M0EA 2G1PA 1D1SA 3ISVA 4PS0A 3JQFA 2YJ4A 4AJOA 2EWVA 1U80A 2GBIA 2H63A 3FTFA 2IXTA 2VYND 3A8TA 1E1DA 1GKIA 2ZCVA 1MBZA 1PJQA 3E61A 2C7VA 1W0KA 1SCIA 4IOKA 3UGKA 2QQGA 1Z34A 2ECQA 2EKLA 2CSXA 3DC2A 4JYCA 1KI2A 1E94E 2HLDA 2AKEA 2BEKA 3QIAA 1WM1A 4LQLA 2CW5A 4XQEA 1FMTA 5EUCA 1FTWA 1YBVA 2CXRA 2OYNA 2XMRA 4CMHA 2XCTB 4II3A 1JSZA 2YWJA 1F06A 2ZSIA 1HSOA 3PX2A 5HF8A 2QPTA 3T5TA 1AMNA 1SUDA 5JV5A 2XXAB 1EESA 1VG1A 4ZGQB 1XZGA 3DHNA 4BN4A 4DR4B 2GK3A 1TU3A 3H1PA 4OMUA 3VU8A 1YR3A 5AN9A 2WT4A 2A58A 4QXQA 1HC7A 4BCBA 4P3KA 1KH1A 3ZU3A 1Q57A 1Y8RB 1NMQA 1A50B 2G36A 3L0CA 2HNKA 1UBTS 4WOPA 2RGEA 3IBCA 2CF5A 1VPLA 4UBMA 1NJ1A 2V4MA 3O8BA 3ZV5A 2GK4A 1T3TA 3UG6A 4ROXA 4DB2A 5BSEA 3DO6A 3OEWA 4D9GA 3CPJB 1XAIA 4UXHA 4R69A 2W90A 2XB6A 5BN5A 3RLFA 3CVYA 2C96A 5AOBA 2G40A 4J75A 2YASA 2NYUA 3VOTA 5GOZA 4Q4LA 1RR6A 1WSAA 2FMIA 3RF6A 4KXYA 3N0TA 3WL5A 2GHTA 1AB5A 1ZZEA 3RW9A 3EVNA 1VFPA 3WAGA 1BEUB 1TFUA 5DHPA 3UKOA 2FFRA 5K8CA 1Z2DA 3IDOA 3MT8A 4QBTA 4ARIA 4LE0A 1XTQA 1G8AA 1O97C 3DMTC 1VBFA 1QLWA 1HE3A 2PX0A 4OY3A 4IDQA 1JHXA 1J2YA 1AS3A 1QV7A 2VHUA 1EFUA 3AR6A 1D2CA 2GJKA 4HGRA 2NVUB 2HIMA 3U3OA 1UJ5A 2AJLI 3OOYA 2AXPA 4KSYA 3U56A 3SICE 5ITVA 3BRWA 3NR2A 4JR1A 2RHGB 4FDTA 4TOIA 3STWA 2WNIA 4RE5A 4D57A 3C8HA 3GVJA 1E6UA 3R7WA 1W581 3P9YA 3FYHA 3Q1KA 1VB3A 4D9HA 1HQDA 4DMUB 1X42A 1ZAKA 4M76B 1KQOA 3HVJA 4MS4A 1A5ZA 1FLNA 2IYRA 5DOZA 1KWGA 4INJA 4H7JA 4UKDA 3VA7A 4UHCA 3NAZA 3BQJA 3UN1A 3LBFA 1YMUA 1P74A 3B8HA 2ZUWA 3QH4A 4EJMA 1TT5A 3NYRA 4NK4A 2F4NA 2QN1A 4JJIA 3ZDYB 5B53A 2WD9A 3EC2A 3UT5B 4HS4A 3WYGA 3BIXA 4ZAXA 2RKOA 1HDEA 2X8BA 2XQVA 4URVR 1YJQA 1I30A 1UD6A 4DLNA 2DP4E 3GLSA 1ZJYA 2F9LA 1JH8A 5E4FA 2H2HA 4C9BA 4UU8A 3TOXA 2H4XA 4BE9A 3SAJA 4C2TA 2O7RA 2P4EA 3NIGB 3Q12A 4MW9A 6PFKA 3IOYA 3HR4A 4TYMA 5JROA 1RRKA 1POXA 2GEJA 1BA2A 2FUG1 2VDNB 3RM3A 4G67A 3TUZC 3PQFA 2J9RA 4HJRA 1NVVR 1Q81D 4XX0A 2AEMA 4CM9A 3M3PA 2P0EA 2B61A 2FWRA 3IP3A 2COUA 3MYYA 4JJ7A 4V38A 1R0KA 3PX3A 3SOPA 1G0OA 1Y1RA 2MYNA 4HUJA 4DV0B 3VVMA 3QLUC 3E2IA 4R1NA 4JK3A 1PAUA 1R7RA 2YIDA 3DE5X 4DDKA 3KJHA 4XWGA 3U7EB 2CUKA 3F67A 1I7SB 3PQ8A 1N2CB 1SK9A 2J30A 1IULA 2DUMA 1U1EA 4HMOA 4TKLA 1GPWB 4N49A 1DJPA 1UK7A 1L8AA 3O8CA 1UXKA 1O6CA 1UZUA 4YRIA 4FK8A 2VHCA 5CFOA 2A9OA 1T36B 2OZLA 4PXAA 3GFGA 4LRSB 5FUXA 4GLFA 4FEYA 5HCNA 3W34A 4QA9A 1LEHA 2MINB 3JQ7B 4WXPA 3PF9A 2LZJA 3D8UA 1MW9X 1AKVA 3A1UA 3GMTA 4C6HA 1RQ7A 2J48A 1JG7A 2LPMA 4NCJA 4AKGA 3R6GA 2Q3LA 1CV2A 2YCLA 5DVZA 3BK7A 4L3VA 5B55A 1WR8A 2V96A 1F8UA 2R7MA 3OJFA 4KXFB 3WMWA 2XT9A 1O95C 1JEAA 4D74A 1X39A 3IIKA 1ZWLA 2NTJA 3K1AA 2VHTA 1MUUA 3C70A 2Z8YA 2DQZA 3PC8C 3T4XA 2BFPA 5IVPA 5FB3A 2OM6A 1NG9A 4NJOA 1JR6A 4KG7A 1PI3A 1MLDA 5KVCA 2A84A 4P3XA 2PNJA 3FKQA 4L51A 2OOKA 2X4IA 3I2IA 3IQXA 3LXXA 4GEKA 4HNHA 2JGJA 3TI7A 1U2PA 3L0OA 4O2AB 4K1XA 2JLSA 2H2AA 4KB5A 1EFRA 5B37A 4Q6BA 4REQB 4E0BA 2IHNA 2PKQP 2ZTMA 1UZMA 3I5AA 4N5MA 4HRVA 4ZV7A 3PXDA 5L40A 1I4EB 3V4RA 1LY1A 2C5AA 4PEVA 1SD2A 1Y33E 1W44A 1OBVA 2R1UA 1YCGA 3CM0A 2B83A 3K35A 1Z63A 3NBQA 3TLMA 1WD7A 3FNRA 3QG1A 1RHKA 1YR2A 2OZKA 4GMFA 4INOA 1I1OA 2ABWA 2JJYA 2C82A 1MTZA 3BRCA 3ZE8A 1XTZA 2OO3A 3EDRA 3A3OA 1XDZA 2AMVA 1NQOA 3N0RA 4JJ6A 4XYMA 5F51A 3WYFA 2I7CA 4S1NA 2VOJA 4B9EA 3FDZA 3FZEA 3PVSA 2AC4A 2REXB 2HHAA 1NQWA 1Z3CA 3BGIA 4KWIA 4YXWD 1T8SA 2XPCA 1WSBA 1ECLA 4PWZA 1RC1A 4JWTA 5IS2A 2B2CA 4C0AC 2O3UA 2P2NA 4NNOA 5LQKA 3IP5A 1OXXK 2AC7A 2O05A 2XY4A 4II2A 3UWSA 5KYYB 3M4JA 4RK4A 4ZAYA 3HI4A 3P4YA 3ROMA 3RUFA 4DDVA 5FIUA 3LT4A 1P2BA 5HOQA 3SLNA 3DJYA 1VPWA 1M34B 1N1EA 3V7UA 5HIJA 3NGXA 2W00A 3WKDA 1WMDA 5KQPA 2O8DB 3UW3A 1COWA 4QRDA 3GLQA 1ZUNA 1N77A 4QGSA 1M8JA 4HE5A 3HB7A 1RHUA 3UXEA 3WIVA 4EHDA 3AXSA 2WM8A 4M49A 4MQMA 3ZY4A 1X7WB 2V1UA 3PDCA 3VUEA 1N2SA 1S2OA 1QCCA 3FNQA 2YICA 2JAHA 1JDBB 2QA4B 2D7CA 3QQ5A 5C5CA 4N5NA 4IGEA 2X5NA 3LFHA 3SMQA 4BNWA 4WZLA 2DWQA 3EK2A 2HRDA 4LF4B 4JBIA 1ATZA 3BJEA 4AP5A 3I8SA 4I4NA 1ETUA 4K9DA 1A8HA 1GQ2A 4K9QA 4LI0A 4E14A 4YUWA 1XD8A 2FWNA 4PWYA 1QAQA 4KPGA 2QG9A 3BN3A 1K2WA 2ZK7A 5HR5A 3COWA 5LBUA 3U4CA 3KEWA 1C2TA 3WK8A 4PSKA 3TXAA 3B52X 5E2AA 3GJTA 4DPMA 3VZPA 1X1DA 5AKIA 1G18A 1KJIA 2FUEA 4LJYA 4AL4A 3N8IA 4R68A 3RHTA 1P75A 1WLSA 4JEIA 5CEJA 1HXHA 2Y92A 3F71A 3PCTA 1CIVA 4ZYLA 4C0QC 1X1TA 3JQQA 2CYCA 1N9GB 1I1QB 2IBMA 3C8DA 3EDQA 3OHSX 4YHBA 3QVXA 5F7JA 1GTRA 1U94A 1KD1D 4MDYA 2VBSA 2P65A 4QL3A 4A2PA 1QZZA 1YVDA 2FPOA 2RH9B 3EIQA 4XIGS 3R40A 10MHA 1S1CA 3GJ6A 4U0JA 1AIPA 4EA9A 2I9KA 2C4VA 4AJKA 3R5HA 2AT1A 3GLGE 4K9MA 3OJLA 3QE4A 1T6XA 4N01A 1I2AA 3EASA 4G6ZA 4ZJUA 5HQ3B 2BGGA 4NHEA 1PGPA 5AKYA 2R6ZA 5ERGB 3EJWA 1M2NA 5DPMA 3E1KA 1E9AA 4YGXB 5T8KC 4D4IA 1FJXA 1EBFA 3BMOA 2FEAA 2K7ZA 3CLSD 3VU3A 1UD5A 1WOSA 1JR2A 1JHQA 1LTQA 2I91A 1R8SA 1Z0JA 4DYDA 2PIDA 4RKWA 3A3KA 1II9A 4IDCA 3G5TA 2J5KA 2AF4C 3KWLA 4FCCA 2WRZA 4XNFA 3E5HA 3LQ2A 2XLBA 3V48A 3V9PA 1ZMTA 3WFZA 4PLFA 4F9EA 3ICQB 1NE2A 4ACAA 4KLZA 4B09A 4ESHA 1WSRA 1BXGA 1QYCA 1X8LA 1RLMA 2G8LA 4WERA 3WSTA 4LECA 3M3HA 4TLAA 4MK4A 2EEPA 2NX2A 2W4QA 2SECE 3TAXA 2FEKA 1Q6YA 4KN6A 4D7AA 2VAXA 3QFFA 3PJDA 4XI9A 2HCTA 3LQ4A 4KUGA 3T15A 4D3ZA 4TTTS 2BGTA 1C30A 4JCOA 2WWVD 2H16A 2VAPA 2WTNA 2QTZA 3EBPA 1PFVA 1MGPA 2VPQA 3F7TA 3C16C 2N42A 5EWJA 3ASUA 2OV1A 3AOEC 1MJNA 2GQFA 3A1EA 4CR6A 4M4SA 4O5AA 3PEVA 2MR6A 1ONPA 1VQ9B 1VKZA 1PJTA 4BO7A 2WWHA 2C5LA 1FFSA 1NIPA 1ESEA 3ELDA 3GLFB 3AV0B 3ZHVA 2XAAA 4D46A 2F2TA 3A6GA 3L04A 4P0TA 3I05A 4DIMA 4JJEA 4P92A 3WGIA 2ZZNA 2HJ9A 3N7AA 4N5LA 2GCGA 2QYHA 3V42A 4DR7B 1DINA 3JD3A 1J20A 1A27A 4ZQCB 3WDKA 5EXSA 1NA5A 3FETA 4ALMA 2AR9A 3AHFA 3BCUA 4Q7JB 3G8CA 1E1RA 4NV0A 2I78A 2OBYA 2KM1A 2I3ZA 4IMJB 1DKRA 4WOCA 5E1BA 5ECDA 5AUPB 3MRVA 4JBYA 4EGAA 1XMIA 3BY1A 4MV0A 1UDAA 3QOYA 3E1YE 5CLIA 1GL7A 3KKMA 1V0JA 3JAWA 4GKKB 1KQ3A 3R3JA 3AVTA 2QD1A 1U0RA 3FB4A 4JVNA 3NOQA 4R8MA 2GLTA 5TVKA 2P9BA 5I7WA 2PUCA 5IKXA 4ZC1A 1YKGA 3C3JA 5AOVA 3F97A 2BKLA 3VU9A 1UP6A 1HE1C 5CP8A 5D8DA 1N05A 1XCOA 2GJPA 3A1NA 4BV9A 3Q39A 4Q9IA 4C07A 3INGA 3RWMB 5FWAA 1DEXA 4E21A 1DJMA 3KALA 4ON9A 3CZ4A 4UOQA 3ZKWB 3CZ9A 4KREA 2AMJA 3BZBA 3JS5A 1F9AA 4F5WA 3AF2A 1A5TA 3FH0A 3NBFA 4AIRA 1SUBA 2WIKA 2MCFA 5P8WA 3UHPA 1YVRA 3L06A 2C2ZA 4F72A 2EW8A 2WJ3A 2AYZA 5C8DA 2O8BA 1A95A 2QS9A 3JYPA 2R3SA 4M0PA 2D06A 4MDFA 1GU0A 4D82A 1ZKDA 2ZJFA 2WUWE 4I4TA 5G3YA 2BFBB 5LNK6 5EMMA 5EJEA 4IS3A 1V1JA 2X53S 2NO1A 4MB2A 4CV0A 1ZW1A 1RJWA 3AC0A 1M2JA 2ZJ1A 5EJ2A 3I2GA 2ZIUB 1JXMA 3VR3D 2AQHA 5CH8A 3LP8A 5CHYA 1E5QA 4RV9A 1U4OA 2B8WA 1NXSA 1OLUB 3NG1A 1MX1A 5CVUA 2I7TA 3NUZA 3T7SA 2SNIE 2JBAB 2GYWA 3JU3A 4A91A 1N2CE 2I99A 2PRYA 3FLAA 3PITA 2Q50A 2Y77A 1XQVA 4B7AA 2CHGA 3IVXA 3WL6A 4BBPA 3KHKA 2NIPA 2C8VA 4W99A 1WP4A 5GV8A 1VJCA 5JAMA 3V33A 1BMTA 3WYCA 2D00A 1L4KA 1NW5A 3DMGA 4Q03A 1ULTA 4WPGA 4PW0A 2XWBF 2FW6A 1JIKA 3DL2A 3JQFC 4PRZA 5AHWA 3CLTC 5KOIA 4RFVA 4ZYXA 4LZLA 4ICIA 4R1OA 3SYRA 3AR7A 3G85A 1UBSB 3MWDA 2Z3WA 4KDFA 1SZCA 1S8NA 4BNDA 4GKJB 1RZRD 2JGRA 3TVTA 3ZR4B 1IY8A 3RT7A 1P7YA 4TKVB 4BY9E 1IXSB 3L0ZA 2VRWA 3H2SA 1SQ6A 1PFKA 1XAHA 3HYNA 2CF6A 1DKPA 2FP4A 4GYWA 2V4DA 3ONUA 3RAGA 4BMCA 3HY4A 1EXWA 1XK7A 1V11A 1KSJA 1ORHA 1PUIA 3HEAA 1ZVKA 2O3RA 2K6GA 1J56A 1GSHA 3EY4A 3QUSA 4HPXB 4B35A 1U0HC 2QE6A 5JYBA 4MUEA 1EUDB 1IXRC 4Y98A 4HVAA 5FBQB 4H2DA 4LYDA 2ZUVA 2QYSA 3CT4A 2QL5A 2OO7A 3RIHA 1D2MA 3UH0A 2ZVJA 3DEZA 2HMAA 2C7GA 3UFXA 2PPVA 1NM5A 1OWOA 2ONKA 3GGPA 2VJPA 5CNJA 3MJCA 4HD8A 2EP5A 3NHLA 3RI3A 3HCPA 2BDUA 4GE3A 5DLDA 3EPPA 3UIEA 5EJIA 3ZD9A 5TIIA 3TZHA 3HWSA 4BAGA 4P4GA 3BFKA 4R9NA 2IA5A 1X80B 5JZ9A 5K3EA 1U3FA 1Y9AA 3OPMA 1A77A 1TVKB 3RD5A 4IDAA 1PK7A 4UQOA 4KGZA 1YJXA 3FJYA 2IOFK 2QN2A 2WKSA 4ZVKA 3V1LA 1XYVA 4RJKA 2OV6A 3DZJA 5J40A 3BJRA 3SSNA 2PFKA 5KTMA 5FWYA 3ROEA 2DXIA 1JPVA 1LU9A 1JGTA 3KOXA 1Z4MA 4B4UA 2C07A 3O38A 2PVCA 4D8XA 1DE0A 5DNUA 4B48A 4L5YA 2NU7B 4CEHB 3QA3E 1EP1B 1Q3HA 5JYCA 4YCDA 4FZ3A 4C14A 1E3SA 2J9XB 3LRXA 3PQ7A 1MC1A 2BH9A 4DIKA 1RJDA 4XLAA 2YY7A 3B3AA 4HV4A 3AVPA 4QVGA 2AZDA 3RYFA 3P2KA 5JJKA 4XARA 2BM8A 4GNKA 2LP4Y 4Q39A 3GZTB 4YDQA 4IJKA 5KNDD 1CY0A 3ASVA 2JI9A 4D26A 5E1MA 2XMCA 1L2TA 2C5GA 2PKQO 5B4UA 1K27A 1QAOA 3LDGA 4Q4AB 5IBPA 2XMQA 2CMGA 4YQZA 4HHEA 4EB3A 3VO1A 4HLNA 4OB7A 5C7YA 5JWHA 3C3BA 4HGNA 1ZSYA 5J2TB 1ZR2A 1TA4A 1ZESA 1EFCA 5J3OA 1LXCA 4FYMA 5DI9A 2JEOA 3H9QA 4UD6A 2ON6A 4H16A 4HH4A 4MVXA 1OFIA 3WRXA 1RWXA 2QEXB 1JYEA 4C0XA 1EIZA 3AF3A 3WVNA 4K86A 4C4OA 2O2SA 5JCJA 1SVIA 4NARA 1SXHA 3N2ZB 5AHKA 2ZYRA 4EO7A 5H80A 1FP1D 3DBVO 4L0QA 3FPLA 4J7CA 3RFXA 3TL6A 4MI1A 1OROA 3WHLA 3O2QB 3L93A 4QXOA 4RPGA 5K99A 1X1EA 1YA6A 1H3EA 2C95A 2MHCA 1EH5A 2P9YA 3DGFC 3QU5A 2NN3C 4XXHA 1GAXA 4LC0A 3DDSA 2QR2A 4E2XA 3STUA 2PGOA 4P9NA 3JVVA 4BKRA 1HDCA 4RJ2A 3ANLA 4DHWA 2WPDD 3W0LB 1GGKA 4EECA 2A3NA 5EKSA 3WLOA 3KWJA 1FJHA 2XNCA 1XZQA 2KHZA 3NBKA 2XUKA 3DTVD 3SCZA 4E5PA 3SJAA 1XOIA 4BMPB 1GEGA 1M2KA 1D9ZA 4OU5A 3O8OB 1XVAA 3MUFA 4WCFC 1QG4A 4Y6LA 3DG9A 4BJ1A 3FYSA 2R6GA 5L3RA 4DY6A 1F5SA 1RWNA 2H4FA 3JR3A 3OHMA 2OXIA 3RUCA 5JY1A 1IMOA 2GNAA 1FNMA 1FNSA 1G60A 4EF4A 1OASA 3U44A 3D3JA 1R0ZA 4KR3A 1I6MA 2I6FA 3C87A 3PWSA 3TNYA 1E1YA 4HATA 3UV3A 3TFOA 2XQFA 3R09A 3ZX4A 5FNZA 3TW8A 4CM4B 2J67A 4AY5A 4CNQA 3OCZA 5KX5A 1Z6TA 1NNEA 2BFFA 2FJUA 1OB0A 4ZTBA 5JISA 1PBTA 2BYTA 3GC6A 1NX9A 4NCIA 3CF0A 1MCZA 1ZM3A 3U9TA 3P2IA 2ZJ4A 2ZSFA 1XZCA 2GKSA 5BPFA 1FFBA 1YCHA 1ZXBA 2PN1A 1A9ZA 1MA0A 2Y68A 1MD9A 4Q7EA 4EMUA 3LX6A 1KC1A 1VSTA 4WZKA 3BG5A 3TVDA 4Q9DA 3NDIA 3QKRA 3DLTA 2JIPA 3DBRA 1LF5A 2HUNA 1UDCA 1C1DA 1PQWA 2GESA 2VZEA 1M74A 4ENWA 3TOZA 1KBZA 4JS0A 4AY4A 4O25A 1Z33A 3W8FA 3KELA 3T3GA 1E3WB 1QVRA 2REBA 2YJ6A 4RCYA 4PTYA 4Z4WA 2QHXA 1AKYA 1P4RA 2ZUUA 4EQ6A 3I55B 4ZVPA 1IWPB 1D1QA 1NJ5A 2FF7A 4ML3A 1AGNA 1IG0A 4MRRA 3CCQB 4O2AF 1FX1A 4RTQA 4PCVA 2BF7A 1I0IA 5FPKA 5EINA 4RXTA 3Q5DA 1E7WA 3CCMB 1DO0A 1GUFA 3A8KA 5CXSA 1KBQA 2BI7A 2PTGA 4ND8B 4K0KB 4IJ5A 4OXRA 1NXVA 3HYRA 5KNDH 4DWJA 1EBUA 2GPJA 4E5VA 2ZXFA 4RPJA 1Q6ZA 3W8EA 4ZVSA 4ED9A 3GEIA 4OJTA 1VP9A 1AKUA 3KXKA 3LO5A 1U6JA 4CTNA 4DN6A 1QAMA 3JU4A 1CZHA 3TQQA 3NH6A 3MINB 1IXZA 1GCAA 1GG5A 1H6CA 4XW2A 1EP3B 4AIIA 5H9VA 3HHEA 2VA8A 1QGZA 3JQDA 2E55A 5GOTA 4R2XA 1DWPA 1XZ8A 3KL4A 4A8JA 4XYLA 4EWLA 5JDIA 5LWQA 5JRDS 2GTPA 1Z5GA 3DKIA 2PU5A 5F4BA 3ENZA 3GLHB 4LWPA 5AM5A 1V7ZA 1I80A 1TC2A 5D3KA 3K9BA 2R1VB 1V45E 3GA5A 3UKJA 4KITB 3DOIA 5K0JA 2AQKA 1L7MA 4N0MA 3AZOA 3L8ZA 3EW7A 2BPOA 2C9ZA 1W6UA 3KQNA 4D25A 4PHTA 3GA7A 3HRKA 3EGEA 3A37A 5ALMA 2ZLBA 4H0FA 4ZWNA 1IAQA 3RK1A 1U9IA 5L45A 3ISTA 1KAGA 5SZJA 2PX3A 2W5UA 1PJLA 2G4VA 5F35A 2QZ9A 5DK4A 1MO5A 1W0KD 2NO4A 1LQUA 4M8IA 4OHWA 3AI2A 5BSMA 3ZYCA 3O4HA 4PG8A 2ODTX 3NVKI 5DYIA 2HM7A 2P77A 4YT2A 5G0WA 4C89A 4C3ZA 3CH7A 2XKBA 4L9RA 5D7NA 3W2EA 4WRRA 3G6EB 5MN4A 2YUTA 1P6UA 4HWGA 4RCZA 4DIBA 5IAGA 1XFOA 3DNMA 1Z4OA 2C2KA 4KPEC 4RJJA 5CLFA 2L69A 5ES4B 1N6OA 2E87A 3N8HA 4QYTA 2A78A 3LU1A 3TPZA 3AHGA 5JD3A 4OJKA 4HNAB 1BDIA 1TNDA 3D7KA 3DKVA 2ZUEA 1MAHA 2R66A 5E38A 4OA8A 4C4XA 3VKWA 3RYCB 3I5XA 1DG3A 3R5FA 1MO2A 1NF9A 3F8WA 2WJYA 2YDXA 3AR3A 2ODEA 2QKYA 1W47A 2X9QA 3HJHA 4IL5A 3GVKA 3K09A 4X41A 4ZA2A 5EUMA 4AJ2A 5I4IA 1TUGA 1J5EB 3ED5A 2Y1EA 4TRMA 4C76A 4M9CA 2CXTA 2XBLA 4OX9B 3H0EA 2LW7A 5ILQA 4OL0A 2NW6A 4LYGA 1N8TA 3BXZA 3C5CA 1XRNA 4KSBA 2AZXA 1RP1A 2V9ZA 5F1OA 3VR5A 1DBQA 1IATA 3P9ZA 4BFLA 2BR4A 3SZGA 3DMTA 4G56A 3AUXA 5CH5A 1XFDA 3TMYA 4LF7B 4D8UA 2FSVC 2K5UA 1FFDA 3CR8A 1PJBA 5JSYA 5AW2A 3S70A 1A8PA 5LQCA 3KZ1E 5CA1B 4D4LA 3EB9A 1J24A 2WJGA 1ST2A 3GLHE 4XRRA 1A9YA 3EDMA 3ZXSA 4X1YB 2Q2VA 1SVOA 4UMFA 1XZJA 2M98A 4A3SA 1DFIA 1XMXA 4FUQA 2KWIA 4HDCA 1IB0A 4X8IA 1Q0ZA 4RD6A 2WVHA 1IE3A 2ENUA 1XHEA 2ID9A 2ZJ6A 4ZMRA 1NJ2A 2W6OA 2YY6A 2O57A 3EAQA 3I6IA 5KJCA 3O8QA 3HABA 4X8OA 1Z16A 3AL2A 5DNCA 5IT5A 4YRFA 4LDPA 3UC9A 3V3TA 2QZPA 4DUGD 4O2LA 5FTJA 3GP5A 4Q7LA 3JX9A 2RI1A 4I1YA 4P7JA 4AO6A 3NEYA 2BW0A 1F12A 3BBPA 4WHMA 3V6MA 3EAGA 3EFOB 5JANA 3SQOA 1HR0B 3WYEA 4PAAA 2QRHA 3TQTA 1GTMA 3ZHCA 3DDUA 2LTAA 4RKEA 4WW0A 4HDRA 4HLDA 2CJWA 4ITRC 4TS9A 1R15A 2M6RA 4GRAA 1R9MA 4DTIA 4U2KA 4YO8A 2CJPA 3PXGA 1WXEA 3H2HA 5KMGA 2WU8A 3KQLA 4I1OA 2HF7A 3X1WA 2VSOA 3AETB 3FNFA 3EIXA 1ZD3A 2A9JA 5EZYB 1ZMRA 3NW9A 1ISPA 2IKSA 2OA0A 4C7BA 4HTFB 1JHMA 1O9BA 1UFQA 1PG2A 3PHBE 5DIZA 4N4AA 4YAJA 1EFVB 3DOFA 5TX7A 4PIVA 2AOXA 3WGNA 2FEXA 4V1CI 3Q0TA 2XB2A 5AJVB 3ANYB 3BS4A 1BTOA 3O1LA 1U8FO 4TXNA 4YI5A 3TTYA 3I2HA 3OLXA 5B1EA 1U0SY 1V0FA 1E2UA 3ZD8A 2AUTA 1C29B 3W05A 1YQTA 4F6CA 3OU2A 1P7ZA 1GWNA 3FCSB 5EKTA 4Z1OA 3WLFA 4H7FA 3PFIA 1TUBB 2WJWA 4C21A 3V2IA 2Q21A 2ZZKA 2J3QA 5BUZA 2BKAA 1I7PA 3CLSC 5BORA 2IHJA 2XNDD 1G3MA 3H1BA 1DBPA 3WLEA 1R9GA 4O33A 1NKTA 3KQQA 3B6KA 3RSFA 2B0JA 1YDGA 2PSFA 3JV7A 3PXUA 4Z4YA 3L1HA 3QSGA 4NV3A 4DMCA 4BE4A 3FXAA 1KQFA 1UT5A 4J29A 2V0NA 3KOUA 3QVLA 4E30A 3ZZ0A 2UKDA 3B5IA 5CLJA 3AU8A 1KZHA 2VUIB 1DNPA 5AM0A 3N9IA 1CD5A 3TJRA 2WHEA 3DDOA 4XFKA 4PNEA 1ZOPA 1DAEA 1KH2A 2CVFA 5DTEA 3EWAA 5JNLA 1YDMA 2WTMA 4M6WB 1EM8A 1N7HA 2DUJA 6ADHA 5A5DA 1J99A 2DTDA 2X8JB 3LA6A 2XUAA 4KSCA 3QFCA 3D64A 2ZBUA 2D2VA 4KW7A 3R0ZA 4BCDA 3PWKA 3RSLA 3GNLA 5KW9A 1I0LA 4DYVA 4RIFA 3VR0A 2JS7A 5K0SA 2IEDA 2WPNA 4B4VA 3EQ9A 3K9FC 1II8B 2NAFA 3L18A 4RK7A 5KAPA 3NHRA 5LR6A 5B6PA 3EVEA 4FYVA 4F2PA 3GLIB 3R23A 3LUCA 3PA8A 3FYUA 1UOPA 4GSKA 1PJCA 2P2GA 1BVUA 3G0BA 1GADO 3V1MA 3ZCUA 5JXIA 2BRUA 1OX4A 1RC0A 1KQPA 2Q2OA 1E98A 2PX2A 2VXBA 4M60A 4NYJR 4UUQA 4E4YA 4RY8A 4F1WA 3TZQA 3PGJA 2QL6A 2AKAB 5U9CA 1CY2A 3EVDA 4W8OA 5ICMA 1GPMA 2AOUB 1I7LA 1V37A 2X5OA 3OCJA 4HDMA 2ODPA 1IEVA 3IT1A 4KPUB 5A6VA 3FX2A 4B3RB 3QIVA 3K92A 5J4KA 2FR1A 4BN5A 2YV2A 2O3QA 3H83A 2AIRA 4TSRA 5F7OA 1WZIA 2NTNA 3CC2B 1JLMA 1Q5PA 1UP4A 1ZUHA 3K9LA 2C8LA 2ZE8A 3K0FA 1ZK4A 1VOTA 2OCAA 4GGOA 4XTCS 5KU1A 1M6EX 4GXNA 2VAMA 3SHVA 1U28C 4TRJA 4YMTA 4GICA 2H1OA 4LCBA 5IEBA 3C0KA 5I3ZA 3I9MA 2YY5A 4TV9A 4NABA 4BWYA 1VQOB 3EWNA 3TR5A 1W30A 3WZLA 4R6WA 5J5AA 3OQOA 1GV0A 3PC3A 5DCLA 2ZJZA 3AILA 4CE6A 3E23A 3O31A 2EP8A 2HDOA 4CJXA 3WBKA 3IIIA 4KRFA 2I65A 1RRGA 3CTMA 5EL0A 1ENZA 2VPYA 5LZ8A 2WSIA 3HO8A 2AL7A 1U7WA 1OXKB 1BWRA 2JH8A 3NAMA 4XKWA 4XOPA 2X6TA 3L3BA 4XGQA 4WK0B 3A35A 1Q3TA 4YO7A 5IP5A 5EWMB 5EJ9A 5LKAA 2GN0A 2QSUA 1O6FA 4UFNA 1EXNA 3EMBA 1T8PA 1NM5C 5ICFA 2JLAA 5F3WB 1V2GA 2OGUA 1NVEA 1VYTA 1YVEI 3H4IA 4FDMA 1MQSA 1QORA 4LSWA 2PLRA 1L7QA 3FHJA 3JAMA 2VWGA 2XCRB 2DUUA 1FDTA 4FP9A 2DLCX 3HGTA 4WNCA 4X24A 4B46A 3OTIA 1WUIS 1X2BA 3DFZA 2DG2A 3M6LA 4IR7A 1QHEA 5JMPA 1V6AA 2C84A 2V6IA 4YP1A 5AKZA 5FX2A 1J22A 1KFBB 1VIVA 1ZJJA 4BTLA 2A7XA 3NDBB 2E18A 4PSAA 4EDHA 2WE7A 2F43B 5I7VA 5J35A 3LDHA 1B00A 4LVOA 2B1RA 3DZHA 1GCGA 1MDFA 1YJAA 2XX3A 3CF2A 3KSRA 2BGJA 4UPDA 5D1HA 1NBHA 1L4MA 4YPFA 1Y4SA 4BMDA 1XLTC 4CF6A 4DIFA 4DRYA 1ODCA 1P6QA 5KOHB 1RXWA 1OILA 4CG2A 2FOIA 2IT1A 4TUYA 1CDZA 1Z17A 3QW4B 4U2FA 1KE2A 3WLPA 1IN5A 4B76A 4Z53A 3ZI7A 1DTEA 3DMDA 3ASQA 5JAZA 4UD2A 4MWCA 1IDN1 1KPIA 4C7JA 2QYOA 1UPUA 2Q1WA 4JXXA 1RWKA 1YDFA 2FN3A 1PR3A 4JD5A 3A4NA 1NGSA 2WM3A 3CY6A 3GAAA 5E1DA 3VR5H 4BUCA 1VE6A 2HDWA 4X7CA 3G6KA 4E5SA 3OZXA 4FXUA 1CW2B 1RLJA 3AY6A 3EF0A 2C9YA 4MICA 3STYA 1JXQA 3ZLTA 3IULA 2NZUG 1KH3A 3ENNA 3NT4A 1ISIA 4RLZA 3OZWA 4WE3A 1E18A 2BP7B 1XZKA 3Q3EA 3LVQE 4G0YA 5ALFA 4Z4FA 1TE2A 2WWWA 5AVXA 5E2BA 2FPRA 1P3JA 4C3OB 4CF7A 3FFTA 3OOCA 3SF8B 3S1AB 1CLEA 3AK4A 3SIPA 1YI2B 1T1EA 2B5OA 1C7QA 2YW9A 1XB2A 2ZL6A 3HG7A 2BHTA 1X8JA 1OHHA 1AGXA 4PXYA 3L7NA 4CUJA 1H4QA 1L4BA 2Q5FA 5FAXA 1R6XA 3LX4A 3VNBA 4BU0A 1ORVA 3KKZA 1B0UA 5KYUB 2FN4A 1A8SA 2WM9B 1UFVA 2ZWVA 1IM5A 4ZVVA 3KUCA 1JJBA 2DHEA 4S0XA 3UJ7A 1NPDA 4YRDA 2KLHA 4CRWB 2B1QA 3MTAA 2AK2A 1VHWA 1EEXB 1XF1A 2IZ1A 3HUFA 1YZTA 2G1KA 1SD5A 1S2MA 2GBFA 3BZUA 3QVTA 4G0PA 4IUBS 1HVXA 2JKYA 1BS1A 2FHSA 3AFIA 4BX0A 5CDGA 2JJQA 3KETA 3BCSA 3UGQA 3MB5A 4AXXA 1KBOA 1G41A 3ZVRA 4LZOA 3OO1A 5LQNA 1M6VA 2P5UA 3OQJA 4MDEA 1CS0A 4JC5A 3NHWA 1QBKC 3I0NA 1S3IA 4FNAA 1DKLA 1VRVA 4HYYA 3EDCA 4RYDA 5JXJA 1QMPA 4OQEA 1B2RA 2EJWA 1IPEA 1BEZA 5JQWA 3PX7A 5KJFA 2D3NA 1B8PA 2A9RA 5FNVA 3P45A 3EXHB 1NP7A 3O1IC 1PLLA 2A86A 1W5EA 2AG5A 4X05A 2HIHA 2W43A 1DO8A 3S2EA 3ZDAA 2HRQA 3OUZA 2APJA 4ZGWA 2R00C 4HDKB 5HZHA 3LA8A 1E7QA 2QRMA 1VPDA 3NT2A 3PT5A 4HS9A 1TO2E 3ZJYA 1ZIDA 2V54A 3DT8A 3FZNA 2VBFA 2A4KA 4GEGA 4KBGA 4PPQA 4ZAZA 1GEEA 1H3FA 2W6ID 2WV7A 2WSSD 4KO1S 1NG1A 5EERA 1E62A 4J16C 1ESNA 1DX6A 3T5MA 8LDHA 3PR1A 2YN0A 1PG0A 4DSAA 1GGFA 1RXEA 1VA5A 1G6HA 3GNTA 4HTAA 1KJQA 3W90A 4BQPA 5GGXA 4FN4A 3FWKA 2NXEA 4OLAA 5T4FA 4HIZA 4E70A 3JWHA 1T5BA 2QN6A 1YDEA 3A25A 3OLYA 4KI7A 5BNFA 3CE6A 1AUXA 4DA0A 1DKUA 5CT4A 4XA8A 5FFNA 5CA0F 4CKYA 4AICA 1U0JA 2XMZA 1MH9A 3I2YX 4JP8A 4DDMA 1HG0A 2FQYA 5FKJA 4DDWA 2XQIA 5J23A 4EENA 5JJLA 2R5WA 3H1TA 3VTFA 3AJDA 3KKEA 4EZIA 1HGXA 4MUIA 1H93A 3B13B 3O4RA 3G7NA 4GI2A 5JECA 4Y30A 5KKNB 2CDNA 2YBEA 1AJEA 2A1IA 2G71A 1U98A 3B1ZA 2VCEA 3ETHA 5L6LB 4IP0A 1JWBB 3AG6A 1E3EA 1TX4B 4V1CA 4KWCA 2ZQ5A 3FWNA 2PVSA 2UVPB 3FPCA 1GDHA 1I6KA 3RSSA 5C7IO 5CCEA 1A8IA 1FUIA 3F46A 2IRWA 4HP8A 2X2FA 1HYEA 3MNFA 5BNIA 1KKUA 4U6NA 4XL9A 2I4IA 4HSEA 3RSHA 3I9FA 3ZXXA 3UWPA 2EYUA 2P8SA 2SKCA 4FT2A 3KKNA 1DRWA 4CM1A 5DI3B 3D8NA 3LYHA 2WB2A 4IJMA 4INAA 3AP3A 1QMGA 1O2DA 4O4HA 1DZIA 4D92A 1M2EA 1QM5A 3FCAA 1DBSA 1VQPB 2OP0A 3E9DA 3PDIA 1H0SA 3R0IA 5EZSA 4EGSA 5EVJA 4KAJA 1T0IA 1YNOA 1W49A 2JDIA 2JKZA 4J8PA 3K5IA 2YMLA 4FCVA 1UBLS 4UARA 2QUZA 3PD1A 1I2CA 3GO4A 5EWLB 2CNDA 2D1RA 2IYTA 2JGDB 4XR9A 2IPOA 1K9SA 4Q9LA 3INYA 3B36A 3IS3A 4LJ5A 2ACEA 1BKSB 3K5PA 5HCIA 1C80A 4RIHA 1W4RA 3JATB 3CP8A 4CMBA 4DV7B 3TD6A 2G9QA 1U81A 2OCXA 3MG9A 2YL2A 3R24A 5KOYA 3KSDO 4TGLA 3QVJA 1E92A 2D0PB 1NBOA 1VE9A 2Y9PB 2J7PA 2HDHA 3CZQA 3UT0A 1O97D 4WNAA 4AUMA 2JB9A 2VUSA 2VXYA 2ZULA 3GDWA 4EW2A 2OQRA 4FGJA 4TRNA 4W1SA 4DDHA 1IZ0A 1R4MB 2J3MA 3FPJA 3QEMA 4IH1A 1LNZA 1B23P 1OBHA 4JVMA 3TCKA 3VZQA 3QRWA 4HDSA 5KYUA 2Q4RA 3VV2A 5DJ5A 2F59A 3EA4A 3CB2A 3DQPA 2Q29A 4NYJQ 2RBGA 3TSOA 1PZEA 3JYOA 2I54A 4HEHA 1WHTB 1TJYA 2B4KA 2RHWA 3OWHA 3DUFB 4US1R 4M0LA 3UJBA 4YRMA 3E7FA 3CCLB 1CY4A 3OIWA 1M2WA 3RARA 3HQ4O 1L4HA 3IH5A 3ANTA 4P86A 5L3ZA 1DKMA 2QV0A 4TXLA 2QSJA 4P5DA 2J0VA 2A9VA 3BE6A 3WTCA 5DW0A 4J3JA 1VLOA 3C85A 4IM7A 4E51A 1S7CA 4LJ7A 2YV5A 1M6NA 5IKOA 3S4YA 4M9XA 1T6ZA 1NBEA 3M6FA 1DIHA 2JIDA 4IRMA 4QRHA 3I4CA 1JEYA 2QI9F 1G21B 1T3SA 4G1UC 4IV0A 5DCYA 1KEUA 3LXRA 3VC3A 3ZD7A 1OLSA 4WIAA 1KZ1A 5K0CA 2NTYC 2EBUA 2ES4A 2PBFA 1Y5MA 3NVDA 1PL0A 4KX5A 3RIGA 4G0QA 2PLWA 3Q4GA 1BGVA 4OYYA 4O1IA 5DHTA 5H70A 1D6SA 3NO4A 1AA9A 3N0XA 1RI2A 1U28A 4FM9A 3K2QA 3JALA 1CHNA 2QTWB 2VJMB 1O0BA 2GNPA 1ZR4A 3R1IA 5DM70 4DR2B 2ZRMA 3MRSA 3QUCA 4Z4QA 2JH3A 2QLNA 2IL1A 2PTHA 1UP7A 3GRAA 5AYVA 1SNYA 5BV2P 3GHYA 1IZ7A 2WAXA 1E5DA 4EUHA 2HWWA 1ZRNA 4ND7A 4XIIA 3IE0A 3GJSA 4GWGA 5CVVA 3AH8A 5E9QA 3IKTA 2QX6A 2DPGA 3OPYB 1FOEB 1ZH8A 1U6IA 2LNDA 3OKAA 3OX4A 1PR0A 4GF5A 4EUNA 1F5NA 1N8NA 4G65A 3TSYA 5I4KA 5CB4A 5HUHA 4G1BA 3CRMA 1P1RA 2FU5C 4RJIA 2CF4A 4WXMA 4BNXA 3OPQA 3V1UA 4QVIA 5F3RA 1JECA 1K6IA 4JLMA 4KQIA 3AL3A 4IFIA 4PYMA 3ZU4A 4ZPXA 1OWMA 2DUWA 3CX3A 3QVKA 5EKXA 5C46F 4DLWA 5A71A 2NPOA 2OHFA 3U2QA 2GSDA 2YR0A 3DHEA 2IDKA 3VO8A 3F6RA 4FC7A 1E7RA 2FOXA 1AHHA 3P9SA 4R0NA 3ITNA 1SQ0A 5I9BA 1UAAA 2HO5A 5AT1A 1DAGA 5ICGA 5HKKA 4LGYA 2ZT6A 2Q3EA 2Y4NA 4QYIB 1VMKA 4HAZA 1H2FA 1U5BA 3L02A 1AQNA 5G4LA 5ED0A 2WM2A 1N0HA 4ZEXA 2YFHA 5TF0A 5JDCA 3IQIX 2R8RA 3CN9A 3MHPA 1XMSA 1D2EA 3OWXA 4FYPA 1K6XA 3UG7A 4CMCA 2C77A 1U63A 3ZWBA 3R0QA 4A6DA 4PFJA 2KLBA 3AHEA 1CZUA 2GVNA 2XIJA 5SYAA 1GN8A 2DFPA 4TKVA 4OFXA 2PZ8A 1JKJB 3BTUA 3QVSA 5FOQA 2G08A 1KA9H 3V00A 1XELA 4BV3A 1VFNA 4IDDA 1MAWA 2QRLA 3HU5A 3HBNA 3O4IA 4BV8A 2WHRA 2I2BA 4QHTA 3B9PA 3IUEA 4ZYZA 3COZA 5HZGA 5M2QA 5A3QA 2NTEA 3W6PA 2OYSA 4HNGA 1V7CA 4GRDA 3BCDA 4NNJA 4TMVA 1A3CA 2Z95A 3IX7A 3TTTA 3U9SA 2CFRA 1PJAA 1IWOA 4YAFA 3DQQA 3GLGB 3CW2A 4YP7A 3B70A 2BFEB 3LCCA 1RPAA 1MZVA 1NW8A 2FCAA 2ORYA 3F3SA 3ZPXA 4JQCA 5C2JB 1SG6A 3TBKA 3F5DA 4A8PA 2HLNA 5JMWA 2DHCA 2V4ZA 4NXMB 3KV3O 3SGLA 1J0EA 1FSSA 5LDHA 1JJVA 4RA9B 3AI1A 5T41A 2EV9A 1UKBA 2VJNA 4OAOA 3W5IA 4W9NC 3TAHA 2E2WA 1I36A 1V8PA 2Z2XA 4OI2A 2ODWA 3NBZC 1A69A 1CYDA 1EGVB 3N75A 4EI7A 5AKLA 1SD1A 1FMCA 1WCWA 2HPHA 4Y2YA 3UJAA 2FDRA 1HH4A 4L5CA 5I5EA 4Y9RA 3OQMA 4MW1A 4RDLA 3IBSA 1SUIA 2WMOB 1A7AA 3H97A 4DCCA 5J58A 1XZLA 3HUUA 2QUAA 3DAFA 2FHPA 2ZYWX 3Q2OA 1NZJA 4NE7A 3SFZA 1U9CA 1W2WB 3D5TA 4KQJA 4OSPA 2AOTA 3OTWA 4MITA 5L3SA 4A2WA 3IAM6 4UNQA 4GR5A 4B79A 2W9XA 3AMVA 1G6Q1 3DD1A 4OHVA 3LCUA 2JCGA 4KMSA 2GXSA 3HVUA 3AEQA 1ADCA 1C3EA 3LLVA 3P19A 4UDNA 2RK4A 2W6JA 3NP9A 5FBWB 3JWEA 4AWXA 4IQ4A 3R8XA 4W5OA 1I7DA 3PDUA 2AVDA 4C04A 1NMZA 1THMA 3AJAA 2IITA 3EIHA 2NU9B 3KAKA 4TROA 2P6MA 1ZO8A 2GEVA 4KMMA 4K6FA 3LQEA 1NTOA 3BWDD 4PC2A 1XYYA 4A5OA 1JHVA 2PCLA 3A8JA 3NTLA 1V5GA 1NXTA 3N2KA 4PHGA 3SEZA 4F46A 3B60A 2LUOA 1RWMA 1S5PA 4HYEA 2ARKA 2OWDA 2GI4A 4QASA 3W8RA 1ZWKA 2BBSA 1JX6A 4V03A 2Q9BA 3CRW1 1EDEA 3U3DA 4CL3A 5J5VA 1SXJB 2HV8A 2Z2IA 2CFCA 2MSCB 4LDJA 4CMGA 1YRLA 3NDRA 2H7CA 5DT9A 2OYCA 3TYXA 3D7NA 4XE5A 3HV2A 5ISMA 3RJ9A 5CCBA 1Z6PA 3AW9A 3KJQA 1PR6A 1WEKA 1BW9B 3H9UA 4X1IB 4NBSA 1MJGA 5KTPA 1Y3DE 1VJGA 1S3SA 4P4TA 1PJ3A 4JKYA 4WK6A 4I1SA 2JZNA 4BO0A 5TQ2B 4ZMSA 1PF7E 5FBRB 1Z2NX 1FJ2A 2HIGA 3HKBA 5DM60 1T4MA 4D6YA 5L3QA 3BXGA 2CMDA 1ZGBA 5HEKA 1WHSB 3A31A 2D1SA 3VQTA 1WMSA 2PCJA 3QX7A 3ELBA 4PLZA 4IRUB 4V3CA 1OB2A 3EMKA 3UMVA 1XRPA 1ZIOA 3G82C 4REMA 4DCUA 3FGZA 1V3TA 4NBTA 1H5UA 1XTPA 1R4NA 4OHXA 3MMPA 1N3LA 1J7JA 3S6JA 1GYPA 4E2FA 2AYXA 5JFTA 2EDAA 4YMSA 2ZKIA 1G20B 1P61B 4IO1A 4H6VA 4LRTB 3L1VA 2OEPA 3V4FA 5CDYA 1ISMA 3Q88A 4HL6A 2YYZA 3HJRA 1ZMXA 2DQ4A 3DW1X 5DBGA 1V8BA 1M2FA 4P7FA 1RAEA 1X1SA 2CL5A 2J85A 3JQ8A 4O63O 4TPKA 4ECEA 4GQNA 1XYGA 2XWQA 3MXOA 1EVJA 1Q17A 4L50A 4PX3A 4U6SA 4P08A 5BOSA 4NMHA 4GXTA 1I8DA 4QUDA 2SKDA 1QVZA 2V7QD 1IH8A 2XXBA 1JSCA 2CNLA 3FBGA 2X42A 3EZ6A 3S55A 1OHHD 1Z39A 5JYDA 3CH6A 3CR7A 4LMAA 1LPPA 1E2JA 4ZO4A 1F8YA 3COJA 1NAHA 1MQAA 1MHPA 3DZGA 3DV0A 3CH5A 3GIWA 4G5XA 4QPCA 1KC8D 4RTMA 2BUAA 2YXDA 3ZZ1A 5JAHA 4HN2A 3WHIA 5FUQA 5H0IA 4V02A 3GPBA 4QU0A 3AB8A 2F00A 4M0CA 4FFBB 4U0KA 4FNOA 5HK9A 1WE2A 5ITWA 1L7BA 2RB4A 3ESYA 1CEQA 2EGGA 1OX6A 4QPPA 3ZWNA 1TM5E 2EG5A 4HAVA 5HZKA 4J0FA 2BF4A 1X7ZB 2XEDA 3I58A 4HY3A 1JI0A 1W34A 2DAPA 2Y1LA 3Q38A 1P1CA 4W82A 5K4GA 3S2GA 1AVTA 1NVFA 1XTUA 1PNVA 5LL6P 1UMBA 5KWEA 2CXPA 1FTSA 5GVRA 4P1ZA 1P45A 2WYHA 3EPHA 4KO8A 16PKA 4LAFA 1B6SA 2FPIB 4MVYA 1QIJA 2D2IA 2P8JA 3LLCA 3B89A 2QIPA 3PD0A 2VYQA 4RHYA 2QLTA 3RRYA 3BK2A 4PF1A 1SAYA 3ZX5A 5K6RA 1DC5A 1ETHA 3BD9A 3IRVA 1GAEO 3IOCA 1VGRA 3WNBA 1U0BB 1QTNA 2RKBA 2XJ9A 3FOFC 3WGLA 4ZDKA 5AJTA 4FDVA 1FU7A 2O2XA 4Y9UA 1R88A 1UZNA 2XW6A 3GN2A 4IOMA 5KJEA 2P2ZA 1P2SA 4BEWA 1CUUA 3M49A 3DMYA 1ML4A 2VBUA 1VXOA 2ZVQX 5CGQB 5BR1A 1POWA 4QSHA 3RH0A 3HVHA 3ZHRA 3FLEA 5DLYA 5ALWA 1XU4A 4KR9A 2H7VA 2ZIXA 4UBKA 4JITA 4GBED 5B1IA 4A2CA 1D4OA 3COSA 1FFXB 3RJ5A 2PSJA 4NATA 2A5YB 3O6VA 1X7YA 3DVSX 3WGQA 3AO0B 2YXNA 2WHPB 2X3YA 3NRBA 3P0HA 1PYDA 3EGDA 4PLPA 1L7OA 2ZAGA 4YMIA 3T35A 1QYWA 3G7SA 2AOWA 3CB4A 1XNJA 4AUEA 5KNBD 1CRQA 1YRQA 4HJXA 4NH0A 4RSMA 1X3LA 2OORC 3HCCA 4Q1VA 3E9EA 1MEOA 4RNDB 3UWOA 2YIJA 3BGOS 3CUTA 5IBCA 1Z2OX 2E82A 5C7OO 5C4IA 2JASA 2P1DA 4GX5A 2GEDA 4F84A 4WY2A 4BP8A 1TJ5A 2P69A 2FSIA 1RZUA 2TYSB 4Y1GA 3L4EA 4Z9XA 3ABIA 1QGUA 4TTVA 4PQRA 2W0SA 4MSUA 2P6RA 3ZDDA 1GZSA 5C8VA 1BPLA 1GKLA 5T67A 1KWKA 2ZXHA 3DDYA 4WOKA 1LPMA 4H27A 2OGSA 1LZLA 3BWCA 3IEPA 1LGYA 2IYPA 2QRUA 3RS7A 1Q19A 3NC0C 3QSYA 1K98A 5LA6F 1TUEA 2WFAA 3FPHA 3CCUB 1U3VA 2HPVA 4JYZA 1XUOA 3LY9A 3GRFA 5FWXA 4XUGB 4I4TF 1J9ZA 4QTXA 1ODJA 4O4LF 2I4OA 5FTKA 1E20A 4PLGA 5JNVA 1PR2A 4BFUA 3UK6A 4BNGA 4EA7A 3KT6A 2C7BA 5KOJB 2TMYA 5HKOA 1NYLA 2HWUA 4YRKA 4MQLA 3C6MA 3AEUA 1DOZA 4IZ6A 3KOWA 5BYJA 2ZYGA 1Q7GA 3ND5A 1HYQA 4F7DA 1M83A 2HLHA 1L3BA 2UUOA 1JZQA 5KDOA 1IN6A 3IL2A 2OQIA 4GLJA 2XMDA 1QTRA 4B3CA 4ALNA 1D4FA 1NJSA 2A6PA 1O5IA 3IOBA 1UMKA 2CVHA 4Z8XA 4BB6A 1EA5A 4EKGA 2QE7A 2EKQA 3FDIA 3DEYX 1I24A 1SCUA 5ERXA 4K6KA 3T7TA 1TO1E 2YJ5A 1S4QA 2B94A 4FI3C 2HY7A 2CRVA 3PNSA 5BMOA 3OESA 3WSVA 2ATCA 3CF4G 3M6AA 3GAZA 3BQMB 4B84A 1UIMA 2UZ3A 3OQ1A 4JIGA 4BWGA 4YJFA 1HI9A 5F12A 5LCXA 3TBFA 4EHJA 2FWIA 5DHRA 3BWVA 2PMFA 4UM9D 3SZUA 5K8IA 3LAWA 1EB8A 3L49A 2IH5A 3ZHUA 2I76A 4XRGA 1KYQA 1HFJA 1R3DA 1Q22A 4PHCA 1L5GB 1PJZA 4WWHA 4C88A 3A05A 2PWPA 2B20A 1WCIB 5LMZA 2Q6VA 4UU1A 4J43A 3N2EA 2NXWA 4QYSA 4G37A 1G9TA 4MS3B 1FNDA 1FUUA 3TH5A 4EFKA 5F4OA 1XR3A 4OP7A 5JQGB 5B3LA 2QBYB 3L8FA 3RABA 5DXJA 4MO2A 1NXQA 4QQ8A 1WP9A 2B9VA 3Q87B 5FA5A 3A0RB 3KZCA 1AV6A 2FEPA 2JFXA 4G7XA 3SXUA 4AJLA 1G38A 3GDHA 4ZCSA 5ALEA 3FGOA 1PVDA 4RFLA 2AWOA 2Q62A 3D1JA 3T3EA 2FMHA 5JSFA 4GECA 1D2AA 3NFYA 3C1AA 1LBQA 5B7QA 1AH2A 1GFIA 4F71A 4G26A 4MUKA 2QAGB 2BEJA 3DO8A 4NR0A 4Z9FA 5ESWA 1AQUA 2XF8A 1EHCA 4GPZA 4BX9A 4E1VA 4FINA 1QFYA 4OQLA 2YIVX 3RIMA 1DZ3A 1DAHA 3A1VA 4P4UA 1LSJA 4X45A 4C6RA 3ACCA 2MT9A 5G0UA 1YJ5A 4G84A 1OV6A 3P4UA 2ZYUX 3PHJA 4C08A 4EVRA 5M34A 2E7ZA 2DCUA 3B6ZA 2GJ9A 2GILA 2O0KA 2JGIA 2AW3A 3CCJB 4CM6A 4OOFA 1DRUA 3GH1A 1KK2A 1YONA 1ZSNA 3DBHB 4GM0A 1VBKA 3G9QA 2XE7A 4I2VA 3ZH2A 4A0SA 1JU9A 4CIVA 5JAIA 1FRZA 1FRNA 2VJJA 3DHVA 2C2YA 2YV3A 3G5UA 3M82A 1Q1BA 4E5KA 4BECA 4O4JF 1EGHA 3JYLA 3BMXA 4TN5A 2VQEB 3KKLA 3KYIB 3MTQA 3O95A 4MGEA 4EARA 3OMXA 5HJ2A 2O7NA 2F3TA 1W6RA 3Q5EA 2G1JA 4G36A 1M2OB 2ORED 4HPWA 2X8AA 4RIEA 4B43A 4BS9A 3L05A 1P4AA 2TRSB 1V3QE 2XUDA 3BYZA 3H94A 4PAQA 3BCFA 5LYJB 2FWJA 2CD7A 1Q86D 4QPJC 3ORYA 4YP5A 1LTKA 2JLQA 3DXYA 1LBSA 1T5OA 1U7OA 4OLFA 3CRVA 3CPXA 3EH2A 4EY4A 3L0BA 1HE4A 5CJJA 2FPPA 5JD4A 1OGJA 7REQB 3OA2A 4I14A 4BIIA 5SYNA 3FTEA 1WXGA 4MOWA 4TQAA 5CA0A 2IE0A 2ZI3A 4MVJF 5C8ZA 1A5AB 1D4ZA 1I2BA 3Q9LA 4MRPA 2IDZA 3OLZA 4KFRA 2H7XA 2QLMA 3BMQA 4BZZA 3NIBA 2CEKA 2PGIA 3FSEA 4KQGA 2QLFA 1K4YA 1A88A 1JU3A 1LQ2A 2AX4A 3QUBA 5CTJA 3E05A 4O29A 3V8NA 3TZLA 3WMXA 2PANA 5I7HA 2OXFA 2O54A 2CV2A 4N8DA 3AONB 1N1MA 1GR1A 3H9BA 4WV3A 2CEAA 4XWTA 3VPAA 5HDBB 5A1TA 2IX3A 4IQGA 1DXOA 5FJIA 3HJCA 1V48A 2EJTA 4UHBA 4C29A 1BX0A 4PHHA 2OAQ1 1VHDA 4RVCA 1QCDA 2VDMB 4ZI2A 2GCEA 1PS8A 4LRYA 5AW6A 2H5IA 1JFTA 4EM6A 1OWNA 1QANA 2PR7A 4CLDA 1L5YA 2IGBA 1KEWA 1QFSA 3CPEA 4DCJA 5A0TA 1MX9A 3I8XA 3OJ0A 1NXPA 3RG2A 2I6XA 3IR5A 5E6UA 4P26A 5AJZA 5AW3A 3N6VA 5FPSA 2GCPA 1ZH0A 3QBTA 3AVYA 3BUSA 2XTAA 5G40A 4ZHQA 1RIIA 3EQZA 4KKVA 3IEXA 1SHKA 2G88A 3U0VA 3PGLA 4O4LA 1I01A 4UULA 4RIIA 2D3WA 2WQ6A 1P72A 3KPJA 4DQLA 2J6IA 1B42A 2WSMA 3FFXA 4M83A 4X6UA 1JDZA 3JQ9A 3TW4A 3BFVA 2XTJA 1W88A 3VXKA 3DPSA 1GVNB 2BTQB 3BSSA 1YS4A 1WLYA 2VP0A 3E9QA 1ECBA 1XJWA 1LTHR 2WQ7A 4MJXA 2QTCA 4J03A 4CI9A 1T8WA 2CV0A 1BEEA 1FP2A 2H1LA 1K8YB 1KMNA 1D1TA 1PFWA 1D09A 1M33A 1Z4QA 1JHAA 3WGGA 2JI8A 1ZK0A 1RVDA 3T4EA 4D8YA 3THWB 1CPYA 1GA4A 1K5HA 1TAHA 5IVKA 3X1JA 3FJOA 4XORA 1JDVA 5BN4A 4GI5A 4MKIA 5LMUB 5IFKA 3DEHA 3L0IB 1DP4A 4H7PA 4H7HA 4KYUA 4ZXPA 3EGCA 4DVJA 2WJVA 1HV8A 5DNYB 3ZBQA 4KP7A 2VT7A 1CVRA 3SX4A 4LQDA 2QTNA 3EDYA 1IJKA 3TVYA 4BNNA 5A4IS 4I2NA 1O89A 4EY8A 1RFLA 5IJ0B 3DHYA 3JQGA 2JAQA 2QVZX 2IEGA 2QW0X 1YBHA 3IKMB 4HWTA 1FXUA 1LFDB 1P4GA 2CDRA 2JFWA 4AX8A 1KRXA 3DBLB 3JQAA 2G0AA 2R60A 3M83A 4R8SA 5TARA 3WQSB 3V8BA 4DK0A 4MMYB 2DZDA 2XWJI 2AS0A 1OE0A 1RNLA 4K88A 3CLKA 1FFGA 4BKUA 2YS6A 3HCOA 1I5RA 1EK2A 2PV7A 4H77A 4LTMA 4UOEA 2HW8A 2GM9A 3U3ZA 3HLTA 1UFKA 3CE9A 3EXG1 1OLXB 4RPHA 3AUUA 4B3FX 4WDRA 1XTTA 1JZSA 2ONJA 4FGWA 4XSVA 2RJNA 2Z1DA 3MSXA 2Q1SA 5AXCA 4B33A 1WWKA 1VQ5B 1SXJD 2CNKA 1G8HA 4I4LA 2J9FA 3NNNA 5MGNA 2VT2A 4HMQA 3ZHXA 4Q18A 2PRZA 1JKIA 3NTRA 4PGFA 2VRBA 3RC8A 3V8PA 5BMVA 4FMCF 1QRSA 3HA2A 1M10A 2JBHA 2A35A 3N6XA 5E8RA 1ENPA 5HKAA 4H4CA