5LMZA

Fluorinase from streptomyces sp. ma37
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
291
structure length
281
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMHSICPGVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIRQAAQWAGSGDGFERADGSYIYIAPNNGLLTTVLEEHGYIEAYEVTSTKVIPANPEPTFYSREMVAIPSAHLAAGFPLAEVGRRLDDSEIVRFHRPAVEALSGVVTAIDHPFGNIWTNIHRTDLEKAGIGQGKHLKIILDDVLPFEAPLTPTFADAGAIGNIAFYLNSRGYLSLARNAASLAYPYNLKAGLKVRVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Fluorinase
publication title Identification of fluorinases from Streptomyces sp MA37, Norcardia brasiliensis, and Actinoplanes sp N902-109 by genome mining.
pubmed doi rcsb
source organism Streptomyces sp. ma37
total genus 65
structure length 281
sequence length 291
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 5lmzA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 5lmzA01
2Q6IA 1RQPA 2Q6LA 2ZBVA 2C5HA 2C2WA 2CC2A 2Q6KA 4CQJA 2V7WA 2CW5A 2WR8A 2CBXA 5LMZA 5B6IA 2C5BA 2F4NA 2Q6OA 2V7VA 2ZBUA 2C4UA 2C4TA 2V7TA 2V7UA 1WU8A 2V7XA 5FIUA 1RQRA
chains in the Genus database with same CATH superfamily
5DN6D 4DIFA 1H4TA 4QGAA 1D6JA 1VOTA 4KBGA 3WR5A 3C6YA 1I18A 1XU9A 1F8UA 2ARKA 2QR3A 3TQFA 1I2AA 3ZV6A 1IRXA 1XTKA 2XI4A 3N6VA 3TQOA 1BHQ1 5SYMA 5JD4A 4KV9A 3AF3A 3N74A 4AU1A 4BJ6A 1TUEA 3PVSA 1QH1A 3EFEA 5GADl 1IZ7A 3BMQA 5E2BA 2O8NA 2Q5JA 3CQ9A 3QM1A 4KR6A 1U04A 3VNBA 1NZDA 4Q1CA 2QZPA 2EW2A 4M1WA 4X54A 2VHYA 2B1IA 3CM0A 4YJ3A 5FBWB 1YZLA 4C6TB 2RBGA 1HORA 1RPTA 2Y05A 5AM0A 1GPKA 5CCEA 5JJCA 5DYYA 1X8XA 4IOLA 4PLTA 3AM5A 3H5OA 3L0BA 3RYHB 4DGQA 2INGX 2P4EA 3O95A 1SK9A 3ETGA 2WIFA 4I50F 4MGHA 1WOYA 3ADKA 1CQJB 2DM6A 4KH1A 5CFOA 1XDBA 4XM0A 3SFZA 5BSTA 2AH5A 4L9AA 2RKBA 2ZVPX 3TLCA 2G7MC 1M8PA 1FEZA 1M67A 4DXHA 1J5XA 5JSQA 4HQFA 3HH8A 1XVUA 4JJ4A 4NXNB 1CY8A 1IEQA 2ILVA 3ND5A 1XMIA 5ITZB 4AQYB 1JYFA 1A2QA 1XMXA 2PRZA 2C0PA 4NEQA 3OEED 4IPTA 1I0IA 2ERXA 2OILA 4MROA 4PAQA 3LGSA 4MUGA 1E92A 1Z74A 2C2YA 2QRNA 3OPYI 4KYTA 2V31A 1KJ8A 4TRMA 4YJ2A 3B60A 5C46F 4IIJF 2JFBA 3OCUA 2O8BB 4RNDB 3C3KA 5L3VA 4EFDA 4KSCA 5JPIA 5MHTA 2V9CA 3MLAA 1JALA 3R7FA 1E2PA 3FRIA 1Y42X 4YQEA 1IE3A 2AN9A 3EMVA 1DRKA 4KIUA 5TJHA 2ZBFA 5TGZA 2P2SA 4Q1DA 1OH8A 2J87A 1YFJA 3DW1X 3RC9A 1SIWA 2DB3A 4TVSA 1M1UA 3E9DA 1T2FA 1F14A 1X15A 2A9FA 4D44A 4ZAXA 4BVBA 1OX4B 2PMWB 3SQOA 5CJPA 1Y5IA 1BPLA 3ILHA 3PFCA 4IMPA 2J41A 5JNRA 2FKAA 2R66A 4G1FA 5DISB 1RYYA 3H9UA 3U4QA 1I7LA 4RM2A 4D43A 3HPRA 3UFXA 2LV8A 1JDNA 3ZG6A 2BSQA 1HT3A 2XUQA 1WULS 4RZ3A 4A2PA 3IQWA 4TKMA 4E22A 4EFNA 3E1GA 3ZUGA 3ROMA 3B3JA 3ZUPA 1Z4MA 4KX3A 2AUTA 3CH7A 1TCCA 2OENG 3E5RA 1Y4AE 2P9HA 2ANBA 4HLQB 4JU9A 5EA2A 2Q6KA 1RAHA 2VEOA 2YXEA 2NAFA 3A0RB 3BA6A 1JQKA 3PNOA 4M0DA 3ZE9A 4KXFB 4NCAA 2DQKA 2ONKA 4NOJA 1MH1A 3AY0A 2W6JA 1GPNA 1OXXK 2CF6A 4KDRA 5I9NA 2RI0A 1YVPA 2BKEA 3CMCO 1ADCA 2VDMB 2QL7A 3D6JA 3UCFA 3EAQA 4HRVA 4DV2B 2FB9A 3WMXA 5BQFA 3PTAA 4J3JA 1YS7A 1Q0UA 2R00A 4YMVA 1EHIA 4MX8A 4M49A 4WOKA 4R7GA 1UP6A 2X2FA 3WXBA 1GGJA 3ZIAD 5DSZA 1XYYA 4MR7A 3KKEA 4ZVPA 5THQA 5T6MA 3KZCA 5BT9A 2MTBA 3S68A 5E9WA 2EAUA 5EINA 3F7TA 5BR8B 4MRMA 2QTWB 4YMLA 1GGHA 1AGXA 1JIIA 3PVZA 1OVGA 3KJGA 3L7MA 4P4LA 3KUDA 2NU9B 3FRJA 3IELA 4U7JA 3ML1A 1BDIA 1Q20A 4QASA 3GMTA 1FTWA 4BQFA 3GH3A 4TV8A 1RMTA 2RH4A 1W5AA 1N7HA 1BCSA 1NNI1 1OZFA 2ZXHA 1RACA 3GRRA 2J3EA 1EA7A 3HZOA 3KUXA 5CT9A 1L5LA 4EI2A 3QYFA 1YA6A 4L8JA 4X1KA 4YCDA 4C3UA 1TO1E 1ORWA 3AUFA 3KZOA 4ENTA 3MHTA 2BZSA 3KP1A 1IDOA 1KZ9A 2NU7B 2QW8A 2WBLC 5LQCA 3PNSA 1KL7A 1SXQA 3RJTA 4AVZA 1HZZA 4ALLA 1XWFA 2LE0A 3DZIA 2V5UA 3K6KA 3CNLA 3RO7A 2RD2A 4F2PA 3ELUA 2OXIA 2X6WA 4L4ZA 3LDUA 3NBZC 1RWMA 4OGLA 4O8ZA 4Z4HA 3KKOA 3ORSA 5I47A 2W83A 2J85A 2HO4A 1L7NA 3IAFA 1FP6A 1PUJA 2IDKA 5COBA 4Z4WA 3A32A 4F4UA 2IT1A 3OI7A 3OOEA 2PRYA 1OU4A 4QEDA 1PJBA 2BMWA 1ZH2A 2IGBA 3L0ZA 3NT5A 2V7EA 5AVKA 4Y3UA 2NZJA 1CDZA 1BX3A 2KWIA 5HUQA 2QRMA 1KI3A 1CC1S 1DXHA 1A8HA 4D3SA 4GLFA 1XEXA 1IOLA 3DB2A 2VNJA 4M7PA 4I08A 2R11A 4YLGA 4UBIA 4BMYA 3DVQX 3L0IB 4DNFA 5M29A 2H0QA 1C30B 3ESYA 1K6IA 2D62A 4JSRA 2YW9A 1UAGA 3DPSA 3U9LA 2PGDA 2G0NA 4B09A 1Q7CA 2ZWIA 3JWJA 4WI1A 5FBVB 1NU6A 2NMVA 5CVDA 4QE3A 1AKMA 2Q3MA 4TZKA 2QA4B 2P6MA 3NR2A 1M0WA 1MH9A 3L7NA 2Q1XA 4HX5A 1Y82A 2IUUA 6Q21A 2XKKA 3L3BA 5JO0A 4JKIA 4YRNA 5IPFA 4TGLA 5AM5A 2VZ8A 5EZQA 4B3MB 4U7PB 1M1XB 1DL5A 4OP3A 1ZRMA 2ZJYA 5EJEA 5FJJA 1RJDA 3HJAA 2FPPB 1E3EA 4HTFB 4B17A 5BN1A 9LDTA 2WKQA 3RSZA 4EG1A 4HFJA 2R6R1 2BFCA 1T5EA 2H2AA 2QVBA 4FWBA 3WMWA 4BQRA 4WVLA 4ZCIA 4LZNA 4FZRA 1QC5B 1J0DA 3U7JA 1I4LD 2N1MA 9MHTA 4WXEA 3ZU3A 2CNKA 2ZRLA 5B2FA 1BVHA 5BV2P 3DEZA 4IR7A 1SUBA 2YS6A 2ZTLA 2P78A 3U5TA 1R6BX 3VHRA 1KU6A 4YXWD 3N8GA 4WOJA 2NUAA 1F8XA 4LZJA 2E82A 2LNDA 1CZNA 1ACLA 3HFGA 4C4PA 1NY5A 4L08A 5U1PA 2PX8A 2C2ZA 3ZHTA 5AKIA 1QAQA 1TCBA 4IWNA 2XUPA 4CR6A 2UXBB 2DTDA 3INYA 4DLWA 1XHFA 2WP8J 2JAUA 4V0ME 4DCJA 4W5NA 1ZN7A 3FMPB 4YUAA 3KJQA 5LA6B 3R40A 1W1UA 3UWOA 1N2SA 3MUFA 5AHOA 4FDTA 4BASA 5AVZA 4OM8A 2XVAA 2V7WA 1JEOA 1N9GB 1R6DA 1UKYA 3DQQA 3NP7A 1GD1O 2Z9CA 2CBGA 2HU2A 3O92A 2X13A 2QTHA 1FRQA 1H1LB 2BCGY 4Y0VA 3LLCA 4FILA 4M9XA 3IMCA 3UKJA 3WDKA 2GPJA 1BOOA 4L2IA 3O7MA 3R41A 4ER3A 3GO4A 4Y9UA 1P2VA 3V3KA 4IIHA 2GGSA 3KEWA 4HZIA 1SUIA 3BGVA 2ZJOA 3W5BA 1UOPA 2VXOA 1KH3A 4OQNA 3AI3A 3IRVA 1HNWB 3T9AA 1PFKA 3GFGA 2YJ3A 1PKVA 3NONA 1LVUA 2B8WA 5A4FS 2YRFA 1NG1A 5ALPA 5TR9A 4G56A 4CM8B 3HU5A 2DFPA 4AB1A 4H0NA 1NX9A 2X4DA 2WAMA 1FUYB 2NIPA 2DBZA 2VDUE 4PSCA 2R84A 1WXGA 4KJZA 3B5JA 5DLPA 3Q3GE 2CSXA 1AS0A 1A9SA 3E35A 5BOSA 1J07A 1JVSA 4KREA 1Z2DA 3HCWA 4TLLB 2PS0A 5BNZA 3L6DA 2H2HA 3PQCA 1OI3A 2FN8A 4PX2A 1G6KA 1B0ZA 5CYFA 4GKAA 4AL4A 2G4LA 5JXIA 1NP7A 3ONUA 2PVSA 1E1QD 3EASA 3HADA 5C80A 3VI4B 3AVYA 1CUIA 3E9MA 4CIDA 4OCZA 3IKMB 3EOAI 2XUFA 4BEWA 1Y9DA 3HGTA 4O2BF 4UM5A 1VTKA 3MILA 4PRLA 3X2FA 1NF2A 1UF9A 2C5FA 3JY6A 4G0WA 2CHVA 4MB6A 2EF1A 3ECCA 1N3YA 2Z2IA 5CM2Z 4EYQA 4J3FA 4E5PA 5DB4A 1VG8A 1Z5NA 2PRKA 2Q49A 4TTRA 1C3JA 1R3DA 4KWIA 2H6EA 1AB5A 4FFBB 3DQPA 4ZVKA 3FG9A 2N75A 4IJWA 4R5HA 4KUEA 5FPYA 3V4OA 4EJ6A 5K4GA 5LOVA 4B7AA 2WUEA 3JWHA 2PX4A 2ZRNA 4O29A 3ISJA 4U39A 1CUGA 4EA6A 3GWGA 4II3A 3A04A 4P4SA 4Z4UA 3GLHA 4JLOA 4OU4A 1HM5A 1R5NA 4QDZA 4Q21A 5DGCA 1EK1A 5ED0A 3SXUA 4D5EA 4ILEA 5C18A 3AU8A 2P6PA 4DCOA 4DT1B 3PUMA 3B8EA 3OBIA 1UH5A 3SY8A 3NPMA 1HX7A 1UXHA 2OLJA 3V8MA 1OREA 1ZNWA 2VUIB 5A6SB 3RSQA 4B9AA 1QORA 2QZJA 4JQCA 4CHTA 4F4CA 4GWKA 5L40A 2PUEA 2NOAA 1YMVA 5B1HA 2G80A 4KB5A 3TOXA 2GKOA 1KIMA 3DZHA 3T99A 1DJOA 1FPMA 2QROA 1TQ8A 4URXR 3DG9A 1Z16A 1M1YB 4ZAFA 4AKSA 1VP3A 2Z58A 3MJHA 1IXRC 3WGMA 1KWGA 3ZOKA 4MS4B 4GDFA 3K2BA 3OD1A 2ZB2A 5LZ5A 4BB9A 2IZ0A 2OYRA 4F9FA 1Z7WA 5IT0A 4TS3A 3O2NA 4IUBS 4EFKA 3LV8A 2H4XA 3FMGA 3ZW7A 2ZAYA 4HGRA 5EYPB 5JBNA 5EJ6A 1ISSA 2Y1CA 3F3MA 1VCIA 1Z0FA 2AWNA 3KB8A 3V4SA 2FN4A 4U6SA 1P9NA 1BA3A 1NF9A 2WZCA 1ORRA 1PR1A 1T0PA 5IJWA 5BQXA 5FNVB 4TN5A 2GI4A 4ZMRA 5A03A 2HLHA 2CXPA 1N8RD 4FEGA 3PKJA 3A27A 3QUCA 4I4CA 4J91A 3KJXA 4KXMA 3ZD8A 3BQ9A 4MAAA 3L8GA 1L4LA 3DHYA 4WZLA 1G20A 3ZTWA 4BDSA 2ZXEA 2DH6A 1PR9A 1U7XA 4KW7A 4AZ3B 3LL7A 2FOLA 4EI7A 1NV9A 4RZIA 1NQOA 4CIWA 2GVDC 1VQPB 3PNPA 3ETEA 4WJKB 2PSEA 4ZVSA 5EKUA 2WUGA 3INNA 2B34A 2RKOA 2OHXA 3OZIA 1XJCA 2JB9A 1TEXA 2EW8A 5AW9A 2VHQA 5LXTA 1UEIA 3VH3A 1ZBDA 1ZMOA 2DLCX 4RGBA 3CLTD 5BWBA 2H29A 1Z9BA 4BNMA 1G7RA 4A9AA 5DLQC 3OQMA 4Z4RA 3D8BA 4K8OA 1FA9A 4YV7A 3ROPA 5BPFA 2UVQA 5JUWA 1PDWA 1OZGA 3A7EA 1WSAA 2BE9A 5D51S 2A58A 2DUNA 2HGZA 4CIBA 4DIEA 2WR8A 1RDFA 1KAOA 4ATNA 1W6UA 4PR3A 4RSGA 3IGFA 3Q9LA 2P6UA 3LC2O 3R6DA 4YMUA 4QUDA 3HVRA 3FUVA 4RZ2A 5D6NA 4UOEA 4R8LA 1RYEA 5IK2A 2XZDA 3HY6A 3OVMA 3STYA 4AMVA 4MO2A 3CC4B 3TN7A 5M2QA 2H2DA 2FG7C 2HRRA 3RB8A 3S5JA 2C8JA 3O74A 1MT0A 2CNOA 3FKJA 2H5JA 1KDYA 2H18A 1DARA 1C3EA 1E1MA 3JD2A 4YAEA 4GH5A 3QFHA 5G1NA 1DCTA 4PYJA 3PDHA 1G8MA 3CFYA 2IYNA 1GZVA 1GUZA 1OHHD 2EJVA 5H9WA 1IBKB 3EB9A 5B58C 2BFBB 3KC2A 2A92A 3AR2A 1ZM2A 2YJ5A 1HMPA 2A0KA 3FZYA 1RCFA 1O57A 4C29A 4RY2A 2FZEA 5KSWB 1UJ4A 1JS1X 1RBYA 4UW9A 3QE0A 5D3ZA 3TLYA 4ZO7A 3TLKA 4YCLA 5IEBA 1JP7A 1N3LA 1G8HA 4CM5A 1OZ0A 5DCWA 3VSBA 5BSFA 3FTQA 2NXCA 1VDZA 2W8BA 4GQNA 1ODSA 5TPWA 2EFYA 4X84A 4FGLA 3SNHA 3H1GA 4B2LA 2GCOA 3DUFA 1S9HA 4M87A 3C8MA 3TQIA 4IIGA 5ECDA 4DJDC 1AXEA 2QLMA 5JYCA 3HAGA 3K0FB 3R0XA 1J8QA 3WGOA 4MS1A 7ADHA 4MGKR 4EIWA 2QX9A 2CW5A 2AJCA 2HT6A 1FX0A 2A6PA 3OT5A 1Y8CA 4JIMA 3PWTA 3UT5B 5BW4A 5FBLB 4FDUA 1XOIA 4B6GA 3ICEA 2HSEA 3WC4A 4V0QA 4BVHA 3BC9A 1SVLA 1YL7A 2R3SA 2WZPP 2UV8A 3LRPA 1IWBB 1VQNB 3LHKA 4PWYA 4X61A 1CYDA 1PF7E 4UEJA 3RVMA 4DA8A 4A1FA 3VR4H 3D1JA 3IEMA 2HOQA 1YB4A 2ZBGA 1WNFA 3IAEA 3PUJA 3VHXB 4CQMB 2OGSA 3M82A 1E5DA 4QNRA 2WSSA 3R9XA 1B00A 5EMHA 3P9XA 2NZ2A 2IYZA 1E8DA 2ZUWA 4UCFA 1ULSA 3EDCA 5IUJC 4AS3A 3O8QA 1WBJB 3Q72A 5B5SA 3RUFA 2CXOA 1J5PA 3QVSA 2CDBA 4H6PA 1VFNA 4KZPA 4EX6A 2NZUG 2I3GA 4WGGA 3BSSA 4JC0A 3UQZA 4BFXA 1E0DA 1L5QA 1NF8A 4L8WB 5DRTA 1RM4A 4EUKA 4J4TA 2O3RA 3I37X 4JI5B 3HP4A 1E32A 2OGUA 4PGAA 3H5LA 2PXHA 2CV0A 1ONPA 1XVVA 2AX4A 4E21A 1BSVA 4CV0A 4DLAA 3LX4A 3V1TC 4MYDA 2FNAA 4YJFB 3SKVA 1SKMA 2FQQA 4AAYA 5FUXA 1AXRA 3IA2A 4INAA 4J1QA 2Q7XA 4XWOA 1NQWA 1E62A 2KM1A 2HX1A 5E6TA 4ECEA 1AVTA 2DF8A 2QUHA 1GT6A 2I4LA 2QLJA 2XUDA 3MJ4A 4QG7A 3QTTA 4NYJQ 4U7TB 5ERGB 3R7DA 4R1QA 3RNLA 1FP4A 3SCZA 4EPTA 5IYQA 4TMWA 4ND4A 5GAJA 5E9JA 4NZ9A 1E1KA 3AMVA 1LPSA 1FCJA 3O21A 4I1YA 4RELA 1XYVA 4WERA 2G82A 1O95C 2WSYB 1YRAA 1N2ZA 1BWRA 3AKEA 4DLBA 3CWQA 3TXYA 5BVGB 2HGSA 3HO6A 1M74A 4XD7A 2YIMA 3L4BC 2PZLA 3NGMA 3GA7A 4E6EA 1L8XA 3AERA 3I6MA 1FYFA 3Q10A 1BMFD 4EJFA 1OV6A 3ROEA 4TLAA 4TS4A 2CSUA 4Y6LA 3K0CA 3OFJA 3REOA 3KQVA 3B7GA 1T34A 4Q9HA 2I67A 2D4HA 2XB4A 4IWYA 1A50B 3W90A 4DC1A 5AM1A 3ZE6A 5CNKA 2HA5A 3MPUA 1W59A 3EUFA 4O4JF 3B53X 5I4IA 1BFUA 1LTQA 4HAWA 2QBYB 4XASA 3WQBA 1XG5A 3DPUA 3IBSA 3L46A 1FSPA 1G6HA 3W5AA 3CEAA 4BLWA 1BGWA 1PLJA 1XQYA 4OHFA 2YQ4A 5KTOA 3OLXA 1GFIA 2A1TS 2IH4A 2AR7A 5DMXA 3G85A 1UIMA 2E1PA 3BE5A 1G0OA 1AHIA 2H2WA 2JW5A 1Q16A 4TKUB 2X40A 4QL3A 4BNZA 3OD5A 4NE2A 3KOMA 2VHZA 3IVGA 1XGKA 1ZLYA 1CJSA 2B1GA 3H9CA 1Q92A 4GBED 5FKJA 1DKOA 1UDWA 3HVIA 3O0DA 1P33A 4NPCA 4W1RA 1EM8A 3AWDA 5EWLA 4OQPA 1MXFA 3L07A 4PQRA 4WDQA 1Z4LA 3C1UA 3R7BA 1Q2XA 2F17A 3AESA 1KDTA 4FD2A 1ZZEA 1IL0A 3PGVA 3KJEA 3DTTA 3T38A 3UJ6A 3BF8A 1DCFA 2Y1OA 1I2DA 1N6LA 2PH7A 4FHFA 4GOND 1VC2A 3T9EA 4ER7A 3X1DA 4D5GA 1HSZA 1JPUA 1USWA 2NZXA 5WRFA 4LBYA 4AP6A 2WIDA 1GZ6A 1X3LA 2JGKA 2ZP1A 3GVXA 3BORA 1SVOA 3L4EA 3MT9A 3ZCPA 1J5EB 3CLHA 4TTVA 4X45A 1BXZA 1PV1A 1XFAA 5DBFA 4DWJA 4E4RA 4EHNA 2O2YA 1FW6A 1L4NA 4ZVVA 2ZWAA 5IVPA 1QKIA 1V2GA 5K0BA 1TTHA 1F8GA 3EXHA 1Q86D 4L0MA 1XCMA 5DX1A 4XOUA 5J40A 3QFRA 3B51X 3H4IA 3RWOA 1JKJA 1MQ9A 1G1MA 3V8EA 5FPPA 4ZTBA 1I2BA 2XE6A 5EP4A 1RWKA 1W88B 4I4TA 4EVIA 4YCNA 2R8XA 1ZCFA 2YOFA 3G6EB 1NRJB 4OI1A 4P12A 1YVRA 3VU9A 2P9EA 4UTNA 2ZLBA 3QWBA 4XSGA 1C3OA 1Z47A 1TQDA 3TQCA 1X94A 1O5OA 3SQNA 1MX9A 2UYGA 3RIGA 5AJUA 5GONF 1JHPA 3F78A 3T6KA 3V55A 2FPIA 2R8ZA 4AJ2A 2O8VA 4YUVA 1FLNA 1WZIA 3S1AA 2J9ZB 4PG5A 2D1SA 4AY3A 1HQDA 2EFCB 3WJAA 1KO8A 3P9KA 1WTCA 3V4RA 3MCAA 2ENUA 1XVLA 2VJPA 3ZY2A 3WGKA 4LJYA 4CETA 1YTUA 1Y7HA 2WJPA 2ZBVA 3PRKE 3WFZA 3OJWA 3RFCA 3FB1A 4IHAA 1YXMA 2C2KA 4PYQA 5TS2A 3WIOA 5JCOC 3FM9A 4HH0A 1BQEA 3QA3E 2I2FA 4P9NA 3VYWA 2NPFA 2GKSA 2I2WA 3RRFA 3NAMA 2OBXA 3VPCA 2D00A 2WB4A 1R9GA 3FZGA 3KE8A 4MVJI 3D3WA 5DHAA 1P7ZA 2RHGB 2GCGA 1WUIS 2JDID 1CLUA 1KJ9A 2CGEA 2G17A 2QOEA 4PLYA 1HDYA 3NTXA 3Q3EA 3PGLA 4IHKA 4FE3A 4BQEA 5GIPE 3HVUA 3QELB 4D8XA 4E1AA 3GYBA 3K0KA 3HA7A 3HYLA 3QV1A 2OR3A 1K4YA 1KAGA 2MSNA 3ECAA 3HL0A 3UKOA 3WBFA 3OT1A 1Z4JA 3MFYA 1XVTA 1ZVVA 4PNPA 5CXXA 1YU6A 2XBMA 4N76A 4YMHA 1O95D 1US8B 3DM5A 5K0NA 4DRXB 4Z49A 3I2GA 4LNUA 5ALJA 5DDIP 1Q5PA 4B3CA 2SHKA 2DYKA 2LKDA 3K35A 2CFCA 1SBHA 3BEDA 3AR3A 3HJBA 4ZOLB 3U61B 2RGNA 5FOQA 2Y1LA 3FCCA 2COKA 2VUUA 2PA0A 2GEFA 2W8ZA 4I1RA 1UIRA 5EWMB 2Q9CA 4YWHA 4X3OA 3IT1A 5FTWA 4RCYA 3MTGA 2Q46A 4IO0A 4M1QA 5CLLA 1FFGA 4AKTA 4C89A 1KKUA 3Q9UA 4JLSA 4RPDA 2EWMA 2JBWA 4K46A 3G88A 4XLLA 3B12A 4NH0A 3SKYA 1USIA 3I72A 4OJKA 1MB4A 2RB4A 1KK3A 2B1QA 1CF2O 1VECA 3P5SA 4YGXB 3WLFA 5BV7A 4PO1A 3U4GA 2C3MA 4Y2YA 3ERCA 1C80A 1T6ZA 4R84A 4XDYA 2ZZKA 3SFVA 1SOVA 3H9BA 4FYVA 4ZVMA 4B3BA 4E33A 4EY5A 4PGMA 2ASVA 5HJEA 3BCFA 5L4SA 2I76A 4CLOB 5KYKA 3I5YA 1OC2A 1FP1D 4NCHA 4S2EA 1G3UA 1HDGO 4PX3A 1LDBA 1D07A 2I22A 4FWTA 3Q5GA 3D6TB 1KOFA 1KJIA 4Z3KA 1G2IA 1O5IA 3KHTA 3C14C 2XQVA 1JIKA 5TDHA 2J67A 2X14A 2NG1A 1NQAO 3H94A 4W1QA 4CF6A 4K40A 3RSOA 3T4UA 3W5JA 4DSAA 5C52B 2YN2A 2PX6A 3ASSA 1QE5A 3CZ4A 4PBRA 4QA9A 4RSMA 4EYKA 5A4DA 2X1VA 1T4CB 3BY1A 2NWQA 2VHWA 2VF7A 3FLAA 3EVBA 5K3DA 4ZMSA 3HCCA 2VYND 5ES3A 1QPZA 2AKEA 2O1WA 2P27A 1U2ZA 4U7WA 2YX1A 5DP2A 1T13A 5HX7A 4K1LA 1BH6A 1ZUHA 4U2BA 4IUCS 2GTIA 4OAOA 5E7IA 3L0CA 4G2NA 1U1CA 5CB0A 3P0RA 5JJIA 2R5WA 4IDHA 2OGTA 1SUSA 3KR1A 3TCKA 2HL6A 5IH3A 5M7EA 1P7YA 1E2JA 3HZHA 2IOYA 2X9NA 2ZUEA 4BE4A 3DMFA 4B80A 1V47A 1BEZA 4KKTA 4G1UC 4GRIA 3VKVA 1CRWG 2RHBA 1H85A 4CU2A 3IUJA 3QEMB 1W44A 5FRDA 4A4DA 2AS0A 2WG0A 3EXIB 5F21A 1KEUA 3P9QA 4NZOA 3RGWS 3DZGA 2H9YA 4KR0A 2Y8EA 3SSAA 4UHHA 1WJGA 3KZNA 5JNSA 1K08A 1A96A 4H3KB 3L7JA 3QWIA 1GVHA 3HYTA 1NFRA 3PL1A 4J7CA 4B34A 4QOGA 4GPIB 2CXXA 3UB2A 5IXSA 1XU7A 2GBCA 1FTYA 1LCIA 3MD9A 4WXMA 3EVFA 4MPTA 3V32A 2WFLB 3PQ6A 2CCGA 1CDOA 4DQ0A 3TF5A 3THXB 2PUJA 2POQX 3EZ9A 3PE4A 2IOFA 3H4MA 3MWLA 3A8IA 4GD3Q 4PIMA 2DWOA 3SX2A 1MTOA 2BDTA 3KT8A 2I29A 4EECA 4DSOA 3TM4A 1YRWA 5A05A 2HWWA 2J33A 3BBPA 1RADA 2RHTA 4MYCA 3ABOB 2QMUA 1T8PA 4WAUA 1MQAA 2G6BA 3LUJA 6AT1A 2PKEA 4LQCA 7REQB 4N3GA 1QRTA 5D85A 2CVZA 3D3QA 2Q3EA 2WU8A 2XT9A 2C7RA 2HQOA 3OY7A 4RVHA 4V0KA 3V2IA 3BPSA 3FAKA 4EL0A 3O8CA 2Z8YA 1N34B 2JJ8A 3HDQA 1DBRA 2QN9A 2PBFA 4JY7A 2O2HA 4K28A 5COQA 4ZD6A 5LLTA 2GPNA 1O6ZA 1PL6A 1PL0A 2R6FA 4J1TA 4D74A 1OB2A 1E2GA 1EU1A 1YVUA 1DQYA 3QF7A 4Z0TA 4BLPA 5A6VA 3QE3A 3JQ7B 4GOOD 1E6WA 2X5JO 1Q15A 4L07A 5KYUB 4LSZA 1BW9B 4S1VA 2QX8A 4TLDA 4MZDA 1E0AA 3OQVA 2XDAA 4CTOA 2ISCA 3A3OA 1LPBB 1R8SA 4HATA 2NTYC 4FQ8A 3RIYA 4IH4A 3PR1A 3LBYA 1KTVA 2YV4A 2B25A 3AHHA 3JQ9C 4CDGA 3ZWKA 1YE5A 1Y8RA 1BXRA 2VK8A 1SKQA 2RC5A 2CMDA 5E4JA 1FS4A 2VPZA 2PA3A 2DBRA 3UMBA 4C0LA 1PJCA 3AFOA 3B2EA 1GNQA 3O9ZA 4AD8A 1L9XA 2AJTA 3AF2A 1PGPA 3UAGA 1KMIY 3AL0C 1IY0A 3EVGA 4NECA 2JD2A 2WMDA 3VR3A 4N48A 4B6PA 1ECBA 2VPPA 1R64A 2JEOA 4ZYXA 2J6BA 3P2IA 3L8MA 2NN3C 1IJEA 4P1VA 3F96A 4WCFB 3IAUA 1PTKA 1UD4A 2HO5A 2NO1A 4EJ0A 1DVRA 3G9TA 3K4HA 2Y1DA 1YVEI 1VJGA 4NE7A 1ND5A 2JK0A 2O2JA 1NC3A 5F2OA 4UZFA 1O3YA 5FH9A 2DWPA 3I9OA 3OJLA 3PFWO 3IXLA 3OLZA 4RTOA 3SG0A 3JW8A 3EPKA 1RKQA 4ZT4A 3AI7A 1PG0A 1VMEA 2XV1A 4Q3BA 3PXGA 3R44A 2LTAA 1IVSA 2HN9A 3C3CA 3GRZA 3PPVA 1A7JA 1S9DA 5ALKA 3IPCA 2D2XA 3D5EA 5KDLA 2PEZA 4TWRA 1T25A 5TQ0A 2YZNA 2UYHA 4WMLA 3P7MA 4RBNA 2IPNA 3V9PA 2OQVA 5I4BA 1DAOA 3GLQA 4B6RA 5KVQA 4QG3A 4OQEA 3DC7A 2KJQA 2I7DA 4IOJA 2QSUA 2AOVA 1RAEA 3F4KA 4RJ2A 5DT9A 4E4TA 5DVZA 4R1NA 2HDOA 1USUA 2QI9F 2R8BA 1DQNA 2REXB 4KRXA 4LE2A 3SYMA 4UUMA 2D9RA 4NZYA 2FXIA 2QZ4A 3BGWA 4DUYB 1N8NA 2H2FA 2I5PO 3CLSD 1QH8B 3KKLA 3UC5A 4EG4A 1LQTA 4FWIB 1IQ0A 4DNOA 5HQ3B 2ZB4A 2WMOB 3NV7A 4Z8XA 4YMGA 4TX1A 5F9FA 3ED5A 2KW5A 1QCZA 1JR3E 1WM1A 4XLEA 4CIYA 1MU0A 4E03A 3KLNA 3U4CA 1JA0A 3M1YA 4L3WA 2WTUA 4MVJH 2VP5A 4CLDA 4N5LA 4O0LA 3W9BA 3WL6A 9ABPA 3ZVNA 1I6WA 5EE9A 4QYSA 1EB9A 1JAXA 4S1WA 3THYB 2Z1NA 3S2YA 2XD9A 4B6SA 1UOQA 2IX9A 4ITVA 3QFTA 2GYUA 4OOVA 3LWDA 2A9RA 3P9SA 3D8NA 3QLTA 4A2CA 3EIEA 2XOKA 1YO6A 1W52X 2CJPA 3QWHA 3U3RA 4PHHA 3NHYA 4C7XA 4PONA 5IN4A 5U9CA 1VE1A 2YOGA 2CL7X 4R7TA 1X80A 2O0KA 4XH9B 1K7XB 3PFFA 2VQDA 2MSDB 3FHCB 1KFEB 1IOVA 1Y1PA 1Z0IA 2APJA 2F1HA 3GXOA 3GOHA 1XRPA 4NJEA 3MTAA 3H5RA 1T9BA 3M9XA 3FAZA 1YK0A 2D7JA 2TRSB 4H7KA 2AD5A 1Z2PX 1NBOA 4G1BA 2I2BA 3LH5A 3Q6QA 4R3NA 4UE2A 3T7CA 3DXYA 1QZZA 4NS4A 4PC7A 4DRYA 1A5BB 5HKAA 2FQWA 4POAA 2ZTGA 5EQTA 3VMFA 1GGKA 3KELA 4Z2YA 5DRYA 1UD3A 4DK1A 2CV2A 3PIIA 1VHEA 2PSSA 3CZCA 4OP1A 1YOVB 4BIIA 1IY8A 3MZ0A 2C4UA 4OPVA 3FNFA 3LECA 4KVAA 3QVGA 5CM9C 2IU0A 3ZDQA 1A9QA 1KE1A 1N7IA 3WLEA 2O59A 3HJFA 1N6KA 3GB9A 4YAFA 1LV8A 3N8HA 3OP4A 4TXJA 4JS0A 2G9VA 2PLFA 1QIKA 4W6QA 4QXAA 4WN9A 4DEVA 2XW6A 1QYIA 5I7WA 4H77A 4OVKA 2XCSB 1JDBC 2ERYA 2ATCA 3JR7A 2IS1A 4NNJA 5CGQB 3FJYA 1CY6A 4LY3A 1AK1A 1ZU4A 5DWQA 2ID8A 1PK9A 3GDWA 5TE9A 3REFA 2C04A 2ENWA 1VQ4B 2V7QD 4IVRA 1B3BA 2WE7A 4AZVA 4XVUA 1FFBA 1P4JA 3EA5A 1RWPA 4LDPA 2YHIA 3DO5A 4ZTUB 4KWCA 3IP3A 1UPXA 1Z4KA 4B45A 2E2WA 4F04A 1OT5A 1N3IA 1WPRA 1PTJC 1FUEA 2QTVA 3LY7A 3WE7A 5A5VA 5HOQA 4KEAA 2FMIA 3RKUA 3JZMA 2Q2NA 1ZN8A 2BI4A 3NH9A 3KOWA 2OK8A 5AXDA 2AFVA 4M1ZA 4RV5A 3GJ8A 1X9GA 3FTNA 5AKHA 3ZGLA 4O2AF 2AQKA 4FZ3A 3TSWA 4BU0A 1W5SA 1QG6A 2F3SA 1FYDA 2VKTA 4MLDA 1RFGE 5DOVA 4M1EA 5HMMA 3ADDA 2FG6C 1J8FA 1ISRA 3M1LA 4G0UA 3LZ6A 4OKIA 3AIOA 4ZVTA 1FVFA 1T3ZA 4MIEA 4WKCA 2BZ0A 4PBTA 1Z13A 5KU1A 5JSUA 2GPWA 2ZFUA 3F2VA 2ASEA 4F1KA 1K6EA 3W3ZB 3X0DA 2BGGA 4UAJA 1F9AA 1ZL0A 3G8CA 5IU6A 4AJLA 2V7VA 3QLUC 2YZ2A 5AVOA 1G17A 1XMOB 4ZZ0A 1JTVA 5LIPA 5BXQC 1GPH1 3OU7A 2X19A 1YB1A 3G2JA 1DQZA 1XP8A 2I1WA 1E3MA 1M54A 1VG9B 2BGKA 2NM0A 2BEUB 3BC1A 5ALGA 1Q83A 3ZZMA 3FPKA 2B2XA 1UMKA 2C0CA 2OM6A 4LX0A 1YUBA 4U63A 4R8KA 4KLCA 3JTEA 4Y2JA 1OPRA 4JP5A 2PJZA 1VRCA 5A4MS 2IH5A 2G40A 2N46A 2ZYUX 1JKIA 1WVIA 1IZ9A 5JYBA 5EJ8A 2ZRHA 2Z6UA 4RKEA 4DHWA 2QAIA 3BILA 2PYDA 3WMRA 5C5EA 1O5TA 2W0MA 4FJ1A 4W8GA 5TNXA 3ZI7A 3KG2A 4NFHA 4L0QA 3CMEB 5D3QA 5TRDA 4PAOA 3R8FA 3LM8A 4GZMA 1L4EA 2OFXA 2VQ6A 1ITZA 1CHDA 3E84A 3DWEX 4JXJA 1X7DA 4WVFA 5HKLA 5JD3A 5E3HA 4PIPA 4DBLE 4U6NA 1UZMA 3B6IA 1CUJA 4UUAA 4E5KA 1R88A 3A1CA 4WOPA 4F72A 3U62A 3N2KB 3R0IA 2ZYAA 3U49A 1PL7A 2H0AA 4DLVA 5H4GA 3R9WA 1FZTA 3WRVA 1SIUA 2VI5A 4GX1A 2CD7A 4PR0A 3DE7X 4JL8A 3ZWAA 1BGXT 2JFXA 4NBNA 2VPXA 2AMVA 4ND8A 3VVCA 1H2FA 5CB4A 1UR5A 2ZXIA 3GJQA 4IMRA 1NULA 3P97A 4E31A 4L76A 2BKAA 4LJ9A 1QXSA 4UQPA 3K1YA 4W7HA 1FS6A 1C1DA 1SKYB 2AW5A 3DFFA 4FK8A 1PO7A 3LS2A 1CUCA 4CM7A 1IWOA 4N8EA 5EJFA 4RDLA 5JARA 1FW8A 1XLTC 4JJEA 5A9SB 3EIXA 4Z4QA 1D7OA 1T36B 3GFRA 3H0KA 3CWCA 4CODB 3H04A 5M04A 3HXMA 5CJJA 2RB5A 5G0SA 2CV1A 3K0AB 3KEQA 3RC8A 4HN9A 4WBNF 3HDVA 1QS0A 2YWHA 2BMAA 2FVXA 3NHLA 1OBHA 3RBXA 1ND6A 3RS8A 3L06A 4Q4AA 2GEKA 1IK6A 5F4JA 1W85B 3CLVA 4NARA 3DZFA 2MSLA 4P3OA 3OPQA 5K6AC 1P45A 2YR0A 4QOJA 1PUXA 3A9UA 1GRNA 4B0OA 1HEYA 5IVDA 3B2QA 5FPSA 4HWKA 4G0VA 5KWSA 1V7PC 5I9MA 1HK7A 2F00A 2PR2A 4TKOB 1NAIA 2MHCA 2V4ZA 2WT9A 1MTZA 1Z68A 2FW8A 3ILYA 3JQAD 3LJKA 4HB4A 1CV2A 4JJ8A 1XPJA 4GP6A 4NQRA 3W6UA 1FF9A 3QQPA 2XXBA 1ORHA 2Q1TA 1T5IA 2RJNA 5G3ZA 3OM8A 4L8VA 4DHEA 1QV7A 4ZMBA 4HEA6 4PYLA 1U3FA 4JP8A 4LVCA 4MVJM 4E3ZA 4C43A 1IN4A 3GX1A 4HDKB 2FSVC 1D1NA 3OHSX 2XB9A 3PV0A 5L6LB 2PK3A 2Y77A 5FWAA 1WOMA 2VJCA 4OI4A 1NVGA 2EJBA 2VP9A 4B4DA 4JOCA 3KV3O 1YDGA 1N2CE 2IYLD 4KQ1A 3PRYA 4L5YA 4NZZA 3BWCA 4R1UA 3ZI0A 4IXTA 2G07A 4NU0A 4RK4A 5FFFA 2BGTA 3ZXUB 4O3MA 5B3KA 3JWEA 1DAPA 4IIYA 4KE9A 4ALNA 2R96A 2SCUA 3LNTA 4XKWA 1WW3A 4ACBA 4LE1A 1HYHA 4O4HA 1D2AA 2I7TA 3I8OA 5KJ1A 1XBTA 5AOAA 5JJKA 4R3UC 5DYTA 2GJ4A 2ZT8A 3ZYCA 2HBYA 3CPXA 1WSRA 3C39A 3ND6A 3S81A 2G77B 3HYNA 1ZIDA 4N5MA 4XQCA 4GKBA 1EK0A 3F71A 1JDZA 1QHHA 4BRWA 1FDOA 2DECA 2ZDQA 1SXHA 1FYVA 3T7DA 2F4VB 4BX9A 3QLEA 1LPAB 4UVDA 4P08A 1EHCA 3CRNA 1C0IA 2XITA 4FGZA 4OHCA 5J59A 3SPXA 4URVR 4PF1A 2DQSA 4K0RA 3W7VA 2BZ1A 1PLKA 1V1JA 3Q41A 1JHVA 2OB1A 1Y98A 5IKMA 4TL9A 4WNAA 1A9OA 1GUFA 1G2OA 1DX6A 2OAQ1 1XL0A 2VO1A 3QHAA 3BCDA 4W5JA 3V5NA 2UUAB 3PUVA 3KOUA 2WWTA 4MOWA 2PT9A 1SZPA 2CL5A 4C0AC 3UUFA 4XLTA 1DTSA 1SY7A 2EF0A 2JARA 2NSJA 3HFSA 5ESWA 4KRYA 1AKVA 1T9AA 1VSQA 2G09A 4BB6A 4TYYA 3W2TA 2I33A 2WG2A 4A0HA 3IV6A 4KSYA 3I9V6 2IZZA 3UAZA 1DMRA 3BZBA 3QXSA 3U3ZA 4Q1FA 4BKPA 5MF6A 3BGSA 1W9XA 1THTA 2GXUA 2CK3A 2Q6OA 2H9AA 3I4CA 5CX1A 3W3AA 3LDAA 1Y37A 1PQWA 1TF7A 3EYAA 3GEHA 3ID6C 3OU6A 3TSCA 1YS1X 2YQ5A 2HSZA 2HHAA 3TNLA 5C1IA 1HKHA 2FMTA 1L8LA 4FYMA 4HADA 5ICEA 4EMSA 1RXEA 2DQYA 4UXJA 4QQNA 3F5DA 3QKUA 1S8FA 5K2OA 3ZU5A 3J81k 1P5ZB 2WUVA 3WL7A 2P3QA 3THWA 4P6VF 2Q1UA 5K4HA 4H2DA 4MMYB 1X7ZB 5ALFA 5JC1A 2P68A 1OF1A 5BQ3A 4YDHB 5A2GA 4DILA 4AJ1A 3MEQA 5FHQA 3AONB 3WGGA 3ZIDA 5HZAA 1TVKB 3G3EA 3IMGA 3IO5A 1O7JA 3ORFA 4HQOA 5LQAA 5AUOB 1D09A 1U0LA 4BJ1A 3GK3A 4I6EA 4OD0A 3RJZA 2UYOA 3LPAA 3CINA 1Y89A 3EEIA 3G9QA 1X39A 1WZEA 3VYSB 2E5LB 2P8JA 3USES 3ADBA 3PQ2A 1ZK1A 2R6CA 3AIMA 2XGSA 4ZYVA 4M22A 4B3DA 2WB2A 1D2MA 1RQPA 3U3MA 3LOQA 1Y9EA 3U1VA 1EVEA 2WHPB 1PP4A 3WRXC 2UZ4A 4QT4A 2B2NA 4O2RA 3WLAA 2JHPA 4OV6B 2IK8A 3BMOB 2JLXA 3F5MA 4FKZA 3O8OB 1E6LA 1QIMA 2FEMA 2HCRA 5DNYB 2OT3B 1DWUA 2WJHA 4RY9A 1QO9A 3T4PA 4DYDA 4EVRA 3A8KA 3FCYA 3ZHSA 2B7LA 1R4NB 1ZC4A 4O0MA 1ZONA 2C8VA 1DT5A 1FQOA 3I5AA 5FUQA 3OQOA 4TL6A 1IPFA 1U8CB 1WLYA 2NUPB 3H16A 2PH1A 4LVOA 3MTQA 1YAJA 3DE0X 1B23P 2OSVA 4W5WA 2PGJA 1AURA 2YJ4A 5A0TA 2FJPA 3L0PA 3DR3A 3DFZA 4EP1A 4Z4GA 3VZCA 4DFDA 1H6DA 3D4OA 2RGEA 2BGUA 2ZEJA 1J0EA 2GVNA 2I87A 3DKRA 2BR3A 2G83A 1PE0A 3UWDA 3WYFA 2XOXA 1ZRNA 1LX6A 1ZIXA 1I80A 1UKAA 1C4KA 1PI3A 2PKQO 5JQGA 1N4DA 3DE4X 3OT4A 1BQ3A 4HQKA 1ICEA 2EATA 1G16A 2JGFA 3ZBTA 3ESXA 1O6GA 1V3UA 4G9EA 4JGGA 3OJXA 1UBFA 1V5WA 2J45A 3CX8A 1JGTA 3KEOA 1R9JA 3RLIA 4DF3A 2YINC 3W1EA 4KMMA 1IJKA 2OCYC 1HQKA 2O50A 1DAGA 3F49S 3EWSA 1HOTA 4WRRA 5EQFA 3DBVO 1EAYA 1TB4A 1U7TA 3HYRA 3NIDB 4FFDA 1A88A 2YWJA 2Z08A 4V0NA 1V11A 4PAAA 4RQUA 4CQLA 4UDOA 3QFCA 4AJHA 4B7UA 3QMPA 1AHNA 1SOUA 2ADOA 2AT1A 4YJGB 5BRAA 2IH2A 3ZDAA 2XGMA 4W99A 4K3VA 2Q1YA 1QGOA 3I01A 2J07A 4EW6A 3RT9A 2E3JA 2P40A 3WYGA 1P4GA 2GZHA 3JQBC 2AN1A 5GQSA 5FOUA 3ZXSA 2JBAB 2RGWA 3EXEB 5FP0A 1JZTA 1JLKA 1E63A 4MYUA 2R751 3FI0A 4JH0A 1BJKA 1XJWA 1ZWKA 3DOFA 3UWPA 1B73A 4Q9LA 3GFOA 1JHRA 4P53A 3KSRA 3MIIA 3SVZA 4ARVA 2WUWE 3WADA 1SUCA 1O96A 3KYJB 1QGZA 2W48A 2X42A 4RE6A 4JASB 5ESXA 2V4MA 3RC2A 5BSWA 3VPGA 3R5HA 3DS8A 1YBMA 3I9V1 4OOXA 1MVNA 1Z8DA 5T4EA 2NNLD 2HJWA 4NAHA 1F8FA 4UUQA 4EHLA 2MYTA 3U16A 1UBUS 4EG6A 2OBRA 3GZ4A 4FDLA 4HGYA 1V7CA 3A9RA 4MCIA 4ZDJA 1MC1A 3WSVA 2RHWA 4KI7A 4MKRA 5JBIA 1G8YA 1NWCA 2PGAA 3RRBA 1A1SA 3TLXA 5HPYB 2O3TA 1BRMA 3WS7A 1RXSA 2WM2A 1YNOA 3DMRA 1ZCZA 4JLVA 2C82A 2H4YA 2JLBA 1E64A 5DI3B 2CXNA 5LMCA 3F6PA 2YW2A 4Z4EA 2IQ5A 3TR5A 3VX3A 5TJ9A 4HX9A 2BFPA 3TZLA 2LKCA 5IAJA 3D2BA 5D3MA 1K8XB 1CPYA 3JALB 3IYLW 1RAIA 2IU3A 4UBNA 1CYEA 2PTHA 3IR7A 3ZD9A 4W9MC 3IQDB 4LY0A 4XJSA 5JEEA 4Z0PA 4OG2A 1HO3A 2DOGA 1V2HE 1JMVA 4LRUA 4M1TA 4C9BA 3EW9A 2ZREA 2JFGA 2Z6QA 2WA1A 1FDTA 1FRFS 3EVNA 4J2OA 3W5CA 1P5RA 1GYPA 1F17A 1KR2A 4I1OA 4M0FA 2YMQA 4Q1BA 2M32A 4C5CA 3TD2A 3PLNA 3PWSA 1NQUA 1WUJS 4UHJA 1CVIA 2EKPA 5K8LA 1URPA 1S0UA 4A82A 2IYQA 1MN6A 3F8WA 4GWLA 1Q91A 4HS9A 3AM1A 3DFUA 2CY0A 4NAVA 1GHTA 1JT9A 4YV2A 1YKGA 3OLVA 3BMCA 4C2AA 1N0VC 1O9GA 4BFVA 2DVMA 3MTBA 1T5BA 1EWQA 1U0HC 3V2GA 2GAOA 2Q2VA 2W2QA 2AKYA 1THGA 3IVAA 2I03A 1RPZA 2GARA 2WIKA 1TIBA 3Q38A 1H2HA 5G0WA 1L4YA 2CDRA 4PC1A 1SUWA 2D5LA 4I7EA 1ZY2A 1GQRA 3RT7A 2A9OA 4GI7A 2CMFA 1NN3A 1EH5A 2JCSA 1D3AA 2FP4A 4FYJA 4RF4A 4CV2A 1QK5A 1P7PA 2I2CA 3G6KA 1HFJA 4H1TA 4JKOA 5AVUA 2OZEA 2PMFA 2AEEA 4GOMD 4ZPXA 4MJLA 2BEJA 1J23A 5ENDA 4F9TA 3GA5A 1E8NA 1UADA 3BMNB 1J06A 2JL1A 2XXAA 1JQJC 4HCJA 4IM7A 1RI5A 3OMLA 1VLLA 1IUNA 1TVCA 4Q12A 1KVRA 1U8EA 4J8PA 4ZT2A 3TVDA 3BDAA 1J9ZA 3ENVA 3WGZA 2AIRA 4XJVA 2ES4A 5BUCA 3RYCA 1OC4A 3BWDD 1XMVA 3GUZA 1K1EA 3GLVA 3DZCA 2VRBA 3SEJA 1O8BA 1YQEA 4BC0A 5BN3B 1D6MA 1KQPA 4WT7A 2WPNA 3T3PB 3DM9B 2QVZX 4IQFA 3DD5A 3UMMA 2NGRA 2CXTA 1ENYA 1CY4A 4IHJA 4WZAB 3SSNA 1RXUA 3MXTA 1L5KA 4R0MA 4EUFA 5IJAA 1QYRA 4E70A 2DLNA 3CA8A 3LZDA 1TCAA 4TKVB 4K2AA 1SD2A 1AKTA 3GHHA 3HWWA 4NFYA 3MMSA 4HDMB 3VQTA 5JC8A 1GZUA 1Z4QA 4EBBA 5CCXA 3VR5D 4XWAA 4IZ6A 1RR6A 2E6KA 2AG8A 2O8EA 4K87A 2I3BA 3Q0TA 3M5PA 2R87A 1YS4A 3ACDA 1CEYA 1M73E 1CJKC 4YJHB 4UUNA 2ZZNA 1O87A 3F8SA 3PTLA 5T67A 2WI8A 4KE6A 3SQXA 4AJ9A 1LPPA 1O95A 1G60A 1GNTA 3B9RA 1RM5A 4XQ9A 3HKEB 1PK7A 4UMFA 3M2TA 1MABB 1QIHA 2MDTA 3EEOA 3HCAA 1JLLB 2G1UA 4HNHA 1R9NA 4IJQA 4WV3A 2FZWA 1B8UA 1H8ED 3HN2A 4N39A 5TSDA 3CRZA 3DDHA 2BJWA 3GT3A 1KBOA 1E1CB 1KJQA 3CZQA 4LXGA 5AIAA 4B3XA 1J6UA 3KQPA 3EGDB 1SBYA 2HU7A 1FFHA 3GGGA 3H3XA 3JQFC 3QV2A 4XX1A 1RZRA 3ZWMA 1EM6A 3HCNA 1B2LA 2O2CA 1K63A 3IAXA 2NSHA 4BUJA 1A9XB 1VE9A 1KSHA 3LK7A 3IULA 2G0TA 1KDZA 3JRNA 1ZVMA 3AETB 1VL0A 2Q5QA 4KQEA 4HZGA 4R8SA 3ZCRA 4C4SA 3GARA 4BV8A 3HB0A 2R47A 1P77A 3NHFA 1N07A 4DMMA 1TECE 2C96A 1SAYA 1GLNA 1YR8A 1NNEA 2OYNA 3FMFA 5I7HA 4O4IA 2R7KA 3CH6A 2FR8C 2FR0A 3NP9A 4P54A 3SAJA 2XVYA 2QP9X 2W22A 1F20A 4AS2A 4DV0B 4ZWNA 3LDGA 4S1PA 1U7ZA 5ICGA 5J5VA 1K8RA 2RIPA 1KYXA 1M2VB 4A26A 4A6XA 4Y2GA 5AK5A 1TK9A 1EFRA 2NV4A 2CVOA 2KE5A 4MO9A 1U90A 1DTWA 5D01A 4Q3DA 1KI6B 1ZESA 3KDSE 1AQYA 1GPLA 2H9IA 4A7PA 4QTXA 4PFKA 4US0R 4NOMA 1R0CA 2C57A 2I7XA 5KSYA 2OZKA 5I3CA 4FW8A 3HJUA 1YBHA 1WX1A 3LLUA 3W5UA 1VHWA 2GZDA 1T6YA 3AGQA 4B3GA 3HCOA 1E5QA 3IKJA 3NANA 3HP7A 4OQMA 5TQ2A 1U1FA 1SQ0A 4I55F 3NDBB 1MBZA 4PV7A 5J2UF 5MGBA 1QTNA 4QDKA 4RLSA 2O52A 3F7OA 3N6XA 4RQBA 4EITA 4W5QA 3CX7A 3OPXA 3GT4A 4TV9F 3T52A 5JS1A 1OUMA 4C04A 2NUBA 1J1UA 2PE5A 2J48A 2OHHA 2QNBA 1DMSA 3PQ8A 4MKFA 5FBRB 5SZHB 1NSTA 3RV3A 3RBZA 1P9LA 2ZR0A 5AR1A 1VCMA 3EAFA 4DMCA 4IHQA 4G5HA 3ZJYA 3UG6A 3NNDA 4Q3KA 2Y0DA 4NCBA 3TJMA 1STOA 3SS8A 1BXGB 1ESZA 2AJDA 3HV0A 4B8YA 1K86A 3RTDA 1Z2CA 4GX5A 5CXUA 4RGYA 1JRLA 3VHLB 4HDRB 3ZV4A 4TWJA 1T0UA 2M1XA 1U3UA 4S3MA 5KI6A 3QVVA 2AK3A 3RW9A 4WSOA 1R66A 2UU9B 1DDIA 2ZT7A 4R1MA 1G6OA 5HJ5A 1H94A 1U0SY 3EDMA 1UBOS 4LXYA 4B7CA 3ZZ0A 1C4XA 1HT0A 3ZGYA 2GK4A 5ITSA 2C7QA 2C9OA 2VK2A 3DOOA 3NOXA 5BW5A 4ZU3A 3EXFA 3DTVD 4QQFA 5IABA 1VA4A 4CQNA 4OQYA 4ARBA 4X7DA 3JYHA 3LBAA 4LYJA 4ZJYA 3CEHA 3PUZA 3ZI4A 4U02A 4EH1A 5KSPA 5FCDA 2NW6A 4HNAA 2A5DA 4Q03A 5JCOA 4ZDWA 3M4ZA 4N54A 3GFBA 2ZXFA 1M33A 1OTYA 3OCYA 4U0KA 4I5GA 5E2AA 2HADA 4FMCB 3PNBA 3INGA 4AMGA 4YH1A 4C21A 3CP2A 1XDSA 2FK7A 3E03A 4B3TB 1U8UA 1Q1BA 2EFJA 3F4LA 5BQPA 4DDUA 2Z3VA 2MINA 3EJ6A 4JBNA 1OGYA 1PUIA 4C2BA 5I7SA 3JSXA 5T57A 2E37A 4FHDA 1SG0A 3JD1A 2RI1A 2ZROA 1NXQA 3UXMA 4FCCA 3OAAD 4B83A 2CMHA 2ZM5A 1YS6A 1HE1C 3WLPA 1IXZA 2EWWA 3HKCA 1BVUA 1IEWA 2OESA 3P2MA 3KX2A 1ECGA 3NM5A 4P86A 1BOFA 3WQSB 3NTOA 1VE3A 5JY6A 1SZDA 3BAZA 3M7IA 4MB0A 3T3MB 4B84A 2XAAA 3WDMA 3ZHUA 5BY2A 2VT6A 3A70A 2WJ6A 1CP2A 2JJ2D 4JT8A 2QX4A 1EFLA 4JIGA 1PDVA 3IEVA 3AU9A 1WOOA 1Q6YA 4PLGA 3KWJA 1X19A 4QUBA 4HWPA 1YBFA 3DE3X 3P26A 2X3YA 4HSGA 4LCJA 4NENB 3B9PA 5JI3E 1TZJA 3U44B 4Z0NA 3CO0S 1QDUA 1U9IC 1L5YA 3I58A 5EWJB 1E9CA 1L3BA 2GSDA 1UOOA 4JSTA 4G4SO 4N7BA 4QBHA 2HY7A 1TQ4A 1YDMA 2VDPB 5JNTA 4ND6A 1M72A 3WICA 4F93B 2H7XA 3QEOA 3O9MA 1ZVJA 3P8ZA 2DFDA 5AJZA 3KVRA 1M6VB 3INTA 2E21A 4DCNA 2RK6A 1QFSA 5CNJA 5AI9A 4HQLA 3EGXA 3TWOA 3QUQA 1F0KA 4CG1A 1Z6QA 3SEAA 4GYYA 2XMCA 5CW1A 3W6PA 3FYTA 5KQLA 1EUYA 1SNYA 3I4FA 4LF6B 2H16A 4A8JB 2X77A 3BD6A 2F6RA 2M98A 1XEFA 2CDNA 3CUEF 1QRSA 1U4NA 4TS1A 3NVDA 2ABWA 3BMQB 3DOUA 2VAXA 3BWXA 3E70C 4QBKA 2BTQB 4F1WA 5JECA 3FSGA 1XJ5A 3A9VA 3DPIA 3BRQA 3SR3A 1M34E 4S05A 4O2LA 5IYZA 4U2CA 5EG5A 5EHGA 4EFLA 3PQ3A 4XLFA 3B3FA 2RC6A 4MQMA 3I05A 1AF7A 4P98A 1GPWB 2H1FA 4WPGA 5EFOA 4CM4B 4EHFA 3K8QA 5HNKA 2FQXA 4GUAA 4DJTA 1NYTA 3LGAA 3UA4A 4GF5A 3VR2D 2IBMA 5KNLA 1FDRA 2WJ4A 5CJ2A 3RRYA 4QXPA 1AKRA 5J1SB 1Q1NA 3WJ2A 5T4HA 4IKPA 4CFZA 4LS3A 2CXRA 2EXXA 1W581 3RAEC 4HDCA 1ULUA 2A9KA 4OPSA 3A4NA 3D4NA 3U0BA 4CEHA 4JYMA 1JHQA 1ZD4A 3HKDB 4COOA 2B9VA 4RTLA 1TEVA 4WKOA 1RS0A 2ID9A 3HE3A 1Y9ZA 5PNTA 5IDXA 1JDUA 4LWOA 4QRDA 4C22A 2A8YA 1FXWA 3S0JA 4D9EA 3ZIUA 1O6CA 1T8UA 1L2TA 1KSFX 4N47A 4XTRA 2WHEA 4WBXC 4HN4B 5BVHA 4E5DA 4BFSA 4HG2A 4NG4A 1M8GA 3NC4A 1PG5A 2C4MA 4BMOB 1L5NA 1RRMA 1A72A 1I2MA 5EP1A 5FBKA 4IRUB 2DY1A 2CNWA 5A1JA 5C8DA 2VC2B 4URUR 2VTKA 2HSDA 5A8AA 1NVUQ 1JR3D 2F9FA 2ZCVA 3NJ8A 4QM7A 3PIDA 1EWYA 1X7YA 1IQRA 3BK7A 3PHLA 2PLAA 1OJ7A 1V9SA 5AW7A 3IX7A 3LHSA 4JGBA 3WL4A 5FAXA 3W7BA 5BO5A 3AUJB 3ROQA 4LHYA 3MCUA 1U1GA 3RR2A 3RVJA 3TRDA 2EP5A 3BRCA 2XUOA 5ER9A 3RYTC 4D0NA 4YK7A 5CXSA 2Z5LA 2WQ7A 1N5OX 4IRMA 5TMBA 1ONNA 4ZI7A 2FW9A 1J8MF 3CNNA 1HETA 2QV7A 3EHDA 3ISVA 4L8YA 1C8KA 3OFKA 3WLRA 1MGOA 2BKLA 2HRDA 3O4GA 3ZHYA 2OFWA 3F5FA 1Q84A 2XGOA 5CDUA 2VP4A 2VHJA 1GCAA 2FDCA 4IFBA 5G2OA 1O6BA 3EWAA 3OWHA 3IMKA 3QTLA 2QQFA 3SM9A 3W06A 3O1IC 5CBKA 3O84A 4OLHA 3K5HA 5DV9A 1NLMA 1EJ0A 4D3YA 2XMPA 1SR8A 1JG6A 4P34A 4TTTS 1NVXQ 3AEYA 3RAFC 1R8QA 2FWJA 1RYFA 2HC9A 1E2HA 1CE8A 3IUSA 4NCJA 3T06B 3DLBA 3RH0A 1U2PA 1FFXA 3UN1A 2AFHB 5EPUA 3RYFB 2HF7A 3Q88A 4G24A 1J33A 4IQGA 1GR0A 4NEHB 5EZYA 1VJ0A 4ZEMA 2ZR8A 5F1YA 4QUKA 1P80A 5IH7A 4QD3A 3RTEA 4MR7B 5DGIA 1MB3A 1JG1A 4MVJF 1V1MA 2OCDA 2YHSA 3EZLA 1R4MB 3AUXA 2P2GA 1UFQA 3NDRA 4XFKA 4MRMB 5JADA 1D4ZA 5BYJA 1VQ1A 2P2CA 3JQ9A 4Q3CA 2JFWA 4LYFA 1QOZA 3EZXA 1AZSC 2HD4A 2GN9A 4FIDA 4JLBA 2Z2ZA 3MJEA 4MUHA 2GXAA 4Q19A 4RSHA 1ISGA 2ZJBA 3D8RA 1YJWB 4X1KB 2JK1A 4Z4CA 3QXXA 3WK5A 3NTQA 5CDYA 2NU8A 5T3UA 2IHNA 2AX3A 5E9AA 5EHQA 3AVPA 3ELWA 5EJAA 4EABA 1KMHB 2Q27A 4RTNA 4B82A 5CNIA 3S99A 3N2ZB 1VPTA 3FPSA 1CIPA 3K15A 4LC1A 4C4YA 2GJAA 2P35A 4XVQA 3BICA 2C7GA 1TVMA 3L7LA 5CGZA 3ELYA 3TKLA 5LUAA 2A86A 1FVXA 1G4AE 3Q40A 3EFOA 3MA0A 2PKQP 2OVBA 4RA6A 2V0GA 3LE8A 2E4WA 1K6MA 1EHYA 1S2OA 2R8EA 2BUAA 3R4VA 3ZH9B 4BAZA 5CA0A 4DIMA 2FUNB 3JVDA 4PQEA 4EI8A 1GKKA 4L27A 1J8VA 3RADC 4Q4HA 2VNIA 3G5AA 4C6HA 2UYCA 1XEXB 3JD0A 4G84A 2XOEA 2VPQA 4FU0A 4KYIB 3AKYA 1CR2A 2Q6VA 1Y33E 3CRRA 2PVPA 4O63O 3V4ZA 2Q2WA 4DDVA 1EVYA 4JX8A 4LEIA 1WDLA 1WQ4A 3E5HA 2NO9A 4H18A 4L02A 4UFNA 2ZIWB 3VO2A 8MHTA 3DYBA 1NI5A 3MTEA 4AXBA 4Y6PA 1VQKB 1ZSVA 3C43A 1VCHA 3TMAA 1TDJA 1AE1A 3BOSA 3NRBA 4B7XA 1IEXA 4MV7A 5LQNA 3MW8A 2OCLA 2D8AA 1PD1A 4BMVA 1PJ4A 4CMEC 5JD5A 1FQKA 3CT6A 3V1NA 1SC1A 5IDWA 1LA2A 1MVOA 1ZD1A 4GVPA 2W2LD 2PRSA 3ITKA 3GDHA 4Q9JA 1CY1A 3GEEA 2FXVA 3AQ4A 3IJ5A 4M2LA 4X91A 5DLEA 3S27A 3HB9A 1FFAA 5KWVA 2IE8A 1Z2OX 4G0XA 2QMZA 3TAUA 1HXHA 4PLFA 5I9TA 1FMTA 4E32A 3E22B 4MXDA 3A31A 1BAPA 1R0RE 5A7HA 3FYDA 3VPFA 4RHXA 2IWRA 5LD2B 5IYPA 2DE0X 1J2TA 2NO0A 2BEVA 3G8AA 4QHYA 5J2TF 3RU7A 1GKIA 4UHFA 4Z9AA 1O03A 4PYRA 5DS0A 1M1KD 4GMDA 1D8AA 4Z9YA 1ECCA 1XYGA 2IEBA 1RVDA 2QN2A 1CF4A 1YZKA 4LSGA 2CEKA 2HHCA 3PFKA 4R9UC 4UTRA 3ZZNA 4YRPA 2ZRGA 2GPAA 1U0TA 3L77A 4H08A 4N6GA 2G6TA 5MGNA 4G0YA 2JFVA 2I4RA 1A7AA 2JGDB 3UGQA 5INTA 1NQ5A 1Y3DE 2YZKA 5JANA 1KC8D 4F5ZA 3GNQA 4RK5A 4HAOA 1N0UA 3SX0A 4DDMA 1RWXA 4YVFA 2XSZA 1N6RA 2CLEB 5AKYA 4MW0A 3W7AA 3GZNA 1N9ZA 3LWBA 4U8GA 3ZCQA 4HDAA 5I4KA 3AF5A 4KN5A 4V1CA 3PK0A 1RSZA 4ZVRA 3Q39A 2QJFA 3MJVA 3B9BA 3DEYX 4BFCA 1JN0A 1ZS9A 3PIRA 3E9CA 1FIUA 4ZP1A 3ZNPA 1B6SA 3B78A 4KQKA 5G02A 5CDHA 5J3JA 3RG2A 1R2QA 2F59A 3WLJA 4IX9A 2BFAA 2X0DA 4OSPA 4EHAA 1SZCA 3RUDA 1KPHA 1O8CA 1VLZA 3CCCA 1WXWA 1NMXA 3ORQA 3QEKA 3HGMA 3L01A 4GMHA 4K6KA 4F3YA 2QTLA 4QOEA 4R2XA 4X7RA 4C0HA 4AM8A 4LDAA 1XIVA 2YL2A 3DFMA 3DMYA 1L5ZA 1N06A 4UM8B 5L45A 1Z6YA 2QT1A 1PG2A 1HUQA 2CUNA 4PXYA 4JT4A 3TEMA 3FNEA 2CLHB 4MQFB 2HSJA 1M2WA 1BQ4A 3GLIE 3OTHA 4XIFA 2ICAA 1DP4A 2ZUUA 4PZYA 2PPVA 2Z1DA 4TWIA 3ZY3A 1C9JA 3M89A 1PTJA 1GTRA 4DQLA 3HJRA 2J9YB 2ALJA 3D59A 2JHGA 3ENZA 3KFXA 3KVOA 1LZKA 2IVZA 4QRIA 4Z54A 1T0HB 3D7KA 4UQLA 1QFMA 1ZD3A 1N0HA 2FZ5A 3OY2A 4LYHA 4Q82A 4FOTA 4X92A 3AEKB 3VZBA 1XEAA 2CE7A 2YH2A 4JYCA 3W8RA 2ZSIA 3B6ZA 3N3BC 4Z3DA 5CFLA 1YR6A 2DMRA 5KMGA 3C74A 4BN4A 4UVEA 2FTKE 3EQ6A 3WYDA 3FNIA 3ZGXA 1RHQA 1TFRA 2EGUA 1NGSA 3IL2A 1QF6A 1WV1A 4ZCTA 2ZUCA 4WX2B 3GR6A 2NNWB 5I7VA 2QQEA 3TW8A 5CVTA 3IOCA 1PFVA 1LJLA 1ZI8A 2CWWA 3AINA 3ASYA 3DT9A 5AOVA 1QRDA 5IJ0B 3D3JA 3JZDA 4L8LA 3ZHQA 3EGIA 2VQ3A 3MWFA 4HEJA 3MBKA 2IEAA 1UCFA 2AE1A 4Z6KA 3LUFA 5E6UB 3EOBI 1RI3A 4IDOA 3EQ8A 3X2EA 2RG7A 4MW9A 4LBWA 4W1PA 2ZTNA 1RZ3A 2PUTA 2YUIA 3O0TA 4HLNA 4MVWA 2NVOA 3DLCA 3IVXA 1S3GA 1UZNA 5FWYB 2G28A 4YP6A 3MD0A 3DV0A 3ZCVA 3W77A 1UMCB 3ZHBA 4ECAA 2X8JA 5ERYA 2OQ2A 2Q5IA 1X1TA 5K0LA 5SYNA 1BYUA 2BGWA 5IM4A 1H4QA 3GEGA 2GM4A 1K6JA 1E5TA 1XD9A 3K9CA 1XMJA 4EATA 3O8NA 3LWZA 1TNDA 2QZZA 3BRSA 1T4DA 3LQ1A 1CDDA 3EXG2 4FI3C 4PG6A 3MMXA 5NULA 4HPJB 2EZ9A 3VZSA 1IN5A 3PICA 5K0GA 4FSHA 5KPJA 1C4WA 1E79A 2WDPA 4I8XA 4JCCA 4Y9DA 5FBQB 2Z9BA 3JYOA 1NW9B 1GNRA 1UDXA 1YV9A 2OYSA 3OZ7A 4UBKA 4I81A 1L4FA 2CNNA 3GP5A 4X1IB 4EB6A 1AO0A 4ABTA 2BPOA 3B6EA 3TH5A 4L5JA 2JHFA 4E11A 4XWKA 1Y4SA 2A9VA 5JH7A 5HVNA 1C7RA 1JMYA 3K1AA 3AFMA 1I4TD 1SHZA 1YR3A 2FPWA 2NZ8A 1SQFA 1Z37A 2EHJA 2XMBA 3E82A 2BFEB 4N03A 4O8CA 5E1OA 3ZZUA 3ZDXB 1WSDA 4M8IA 4R9SA 1DIHA 1M76A 3KYIB 4PSKA 1HDEA 4BJ3A 4BNLA 1WZ2A 3P1JA 1OAKA 1W5TA 4MP3A 3MB8A 3LYLA 4PLHA 3T3GA 4D6YA 4DLPA 3SDZA 1B76A 2ZYHA 4KITB 1TAUA 2ONZA 3BD8A 3KJZA 4XKJA 4DJ5X 4E5VA 3I09A 3T7TA 3VDQA 1YGPA 1XLTA 3C85A 2Q3HA 1WA5A 3JRWA 1NRKA 1M2OA 3VR4A 2X8LA 4K9OA 3RVQA 1GTSA 1ZIYA 4L16A 4OX9Y 1DWOA 3N75A 4Q4JA 2ZL6A 2DQZA 1PKXA 5J23A 2AKAB 1Y8AA 4CIVA 3M4YA 3ESCA 1QHXA 4PSUA 4FS8A 4TUYF 1YKFA 2C1EA 4BVLA 2BELA 4XW2A 2C00A 5K6AA 3A1NA 2PLWA 2JJMA 3DW3X 2B30A 3HYSA 4GEKA 4R41A 4AZTA 1VPWA 2C4WA 1JQLB 3BXEA 1ZM7A 3QMVA 5KJEA 2GJPA 3Q3AA 3PWZA 4NBWA 3SQWA 1R7RA 1VGQA 5FPHA 4BUCA 1UJBA 2J5XA 3D7LA 3LL4A 1F1JA 3QXCA 3PDUA 2R25B 5ERXA 5BSMA 1R15A 3MWDA 4G0QA 4M36A 3SBEA 3KXDA 2GTPA 4YP1A 2PPLA 5A1TA 5F3RA 1IN7A 5FLXA 2P75A 1CCWA 3GPCA 1B0UA 3CCQB 2HMUA 4ZGQB 1GWNA 5AD1A 1WKBA 3IT3A 1CS0A 1HYBA 2FSVA 3EARA 3QNWA 5JTTA 3B1YA 3TTYA 3EVCA 3GRYA 4QDOA 4XUCA 2F2TA 3QGMA 2K4MA 5AUNB 2Z3WA 1RC0A 1N2IA 2XKBA 4EUSA 3CVXA 4TLMB 4X60A 5H3CA 1HQYE 3VNRA 2I80A 4BATA 1T8WA 1WD7A 4BS9A 4OQQA 4AYXA 1LQ2A 5TRTA 1X1SA 1DBSA 1ZX1A 2MMCA 1CUAA 4TPKA 2Q3DA 3RYIB 1RM0A 3AEUA 5LYJB 1I3OA 3K96A 3QU5A 1MD9A 3CUVA 2DT8A 4BO4A 2MMGA 1V5VA 2PUFA 2IYPA 2BBWA 1LVHA 1O94A 1XVAA 2D2FA 2JCYA 3I2IA 4FX2A 5HUHA 1H3EA 2PH5A 2QQ0A 3QBTA 3BN3A 3CW9A 3RSGA 3ZCXA 2IP4A 3Q3HA 5IC6A 1GTVA 1ECJA 3L9WA 2V1XA 1ZD8A 2JAXA 3IP7A 4MS1B 2FEPA 5F4OA 4NR0A 1VMIA 1LDEA 2H31A 1GSHA 2XWBF 3G1UA 3ZVRA 2C1ZA 1OMOA 3DLAA 4MVJE 1AY0A 1CKEA 2C58A 1UP4A 2Q5LA 2PBRA 3H3FA 2WM3A 1Z5VA 2VDVE 5CW2A 3T5MA 3KQSA 2GWRA 1BWQA 2IIQA 4HH3C 6LDHA 4I3HA 1XZ8A 1KAMA 2RH8A 4MSUA 5JFTA 1JJVA 2XRFA 4GYWA 3OE4A 4D80A 5JIBA 3R9XB 3DO6A 3A1DA 1FFCA 3NHSA 2FWBA 4U3JA 3EH2A 2FSUA 3E20A 2AI2A 1KMNA 1ODKA 4LYEA 3VPDA 4CKYA 4F4DA 4F71A 1UDBA 1YQXA 2QE7D 1COZA 1R9MA 2JF0A 3LPLA 1CIJA 1Q74A 5BV1A 4OP2A 5LB4A 3TW0A 1NR7A 4ZQCB 2F1OA 4BB5A 4IXMA 4BRSA 2JVJA 4RHTA 5JMPA 1QP4A 1QO7A 1Y6RA 5DN9A 4UPEA 4C7OA 1YDEA 3ANLA 4FJ0A 3RUPA 3PUYA 1DXYA 1E6CA 1RD4A 2O5VA 4N7MA 3V8VA 5GINE 1CQZA 3MG9A 3GDGA 1PK8A 2P0AA 2MCFA 2Q0SA 2KYRA 5I7UA 3K71B 4C76A 3AF6A 1H22A 2NYVA 5HM6A 3UWSA 4JDUA 2F1LA 1G66A 1EWKA 3HY3A 3FTCA 4OFXA 4XPZA 3CJQA 4LGVA 1SCAA 4HXEB 2WUFA 1EP1B 3I0MA 3I42A 2A9QA 3GGOA 5JXWA 3LP6A 1SQ5A 1RAGA 1YL6A 4CRWB 3BXPA 4M55A 3C6ZA 1F5SA 2J59A 4MV0A 4HQNA 2HNAA 2QTGA 2LGJA 4NU8X 1O97C 2CXHA 2EBHX 1XTTA 2A0WA 2AZ4A 2X8AA 1I3LA 3L0OA 1T91A 2HJVA 3LAWA 4G4SP 5LDGA 3THRA 3T3DA 1SOAA 3CIOA 1XTZA 2ZAGA 4C0BA 2Q62A 1K7YA 3UAYA 1NVBA 2BFMA 3GDFA 3U40A 5KX5F 3UMRA 3P9ZA 1C1YA 4KXWA 1DXOA 3LRTA 2GLUA 4WFKA 4ML3A 3WBBA 5K3CA 3AUAA 4OQXA 5AKLA 3UMSA 4BU1A 1EX7A 1JFFA 1V3VA 1XCBA 2ZS9A 3EC1A 4XJTA 5HIMA 4A03A 5CNMA 5A5EA 1IOWA 3WRXA 1D9ZA 5ALSA 2XCUA 4C20A 3GMSA 1R8JA 1GPMA 3IILA 3QF4B 1TTTA 4DV1B 3D6UA 3WYNA 1Q22A 2BY4A 1SHKA 2IOQA 3GA0A 4HPWA 1DKMA 3FCOA 3DE1X 4D9MA 1C9YA 2DWUA 3E1KA 2SECE 1N6IA 4ZHQA 2C07A 4C4ZA 2IOFK 3WY9A 1V5GA 3JX9A 5HIIA 1NFQA 1RQ7A 1P5FA 1SEVA 1VI2A 2A5JA 2P30A 1W76A 5EE1A 4Z9FA 1P3DA 3ZEIA 4Q9AA 5FULA 5NLLA 5JS8A 1G8PA 2LXNA 3OIWA 1W2WB 4TTPA 3TTUA 5B7GA 5HRAA 2EX1A 3SDBA 2DUMA 3V4FA 3QU9A 4CKBA 3FPLA 1U8YA 2CLCX 1GGMA 5H80A 1VL8A 3IT2A 5B3JA 3Q6NA 4RZQA 4ASUD 2C9MA 1E7SA 1V8ZA 1KOGA 3HUTA 4LIPD 1FP7A 5KKAA 2OKCA 1PLLA 5AJHA 3BA1A 1K0UA 3OTWA 3AESB 2VIIA 3NS7A 1Y3FE 4OATA 1WXHA 2YMMA 1NUSA 3B7PA 1UM9A 4LVNA 1SH7A 2XE7A 3DBOB 1AT1A 1FMJA 1W4RA 2OSBA 4UXHA 3KKQA 5CK4A 5JAQA 1GPJA 2ZKIA 3CB4A 1VLMA 1LU9A 2VCEA 2ZWVA 3C7KA 3V7NA 2VYQA 1SWVA 1E58A 3JARA 5KOJA 1GEEA 1TTPB 2V74B 3BIXA 3GHYA 1E7YA 2B20A 4MV6A 3U48A 1BNCA 5LP6B 5JSHA 3R24A 5KNDH 1VKJA 2A3NA 3QU7A 3O8DA 2IF2A 1HTWA 2NO6A 4OL0A 1U5BA 4HUJA 4JWKA 5T5QA 2QSYA 3LMKA 1E4YA 4RFSA 3W04A 4E7PA 4CKCA 1K68A 1OWPA 1LVGA 3GNLA 1JKJB 3L1IA 4HI0E 4QREA 1ZWLA 5ARCA 3TTSA 1ENOA 1IHYA 3WLLA 5ED4A 5DM70 3MGCA 1OWNA 3STVA 1AUQA 2PLNA 3RS0A 5I7RA 5LU9A 3SWWA 1T5SA 3JQBA 3O73A 1GFWA 3QUAA 4EW1A 4U7DA 1QP8A 2FX5A 4F12A 3GJ7A 3MWYW 4Y2TA 4RVSA 4MV8A 5ILQA 1IUOA 2XUGA 2WZNA 1YRYE 3RTGA 4K9DA 2FPIB 2OLKA 5G4KB 3KEMA 3A2KA 1MIOB 1YQWA 1E9FA 2GJSA 4AZ0A 2P0EA 2O7RA 3P0IA 1DRWA 3AV3A 3D7RA 3ZKWB 4N5IX 4BO8A 5CITA 3HWSA 4U2DA 2H11A 1RU3A 4EY8A 4MB2A 2O07A 4XN3A 2F67A 4TVBA 5EMJA 4BE9A 4YLYA 2ZVJA 4YRKA 4CM9A 3TZHA 1NPDA 1WTHD 4KACA 3JASA 4PGHA 3UF0A 6ADHA 2VHVA 4AZSA 2YY5A 2O6HA 4FBLA 4DCMA 4X85A 4RQAA 3HMKA 4J75A 1VLOA 4WXRA 1W29A 4YP5A 5LU8A 4FE7A 4BVGA 3D3WB 4GSLA 4LK3A 4OHKA 4IG9A 3ILSA 1IJBA 1E9DA 2AC7A 2YWRA 3ZNQA 1K7FB 2OHVA 3FMVA 3R7LA 4MA4A 3GAFA 4V0OA 3PJDA 4LRSB 1SKYE 5DCUA 1HLGA 3PB3A 1S2NA 4BLVA 4QM6A 1T26A 3BCRA 1RLJA 5EJGA 4BYMA 4PN7A 5CIYA 3HKBA 5EXPA 5I6DA 5M5BA 4WK0B 5K8IA 2V0NA 1W2BB 3HJHA 3COYA 4J43A 2WF5A 1HSOA 1MJHA 2HYDA 2E55A 3DFKA 3MOSA 3LVRE 3R2JA 4LGMA 1P7VA 4Y18A 3TZBA 4CYMA 5TARA 5GIOE 4LNUB 5AVQA 3I3SR 3Q9SA 1WHTA 4FCWA 3PXUA 4Y6QA 5C34B 4KQCA 5KYXA 1R0KA 2X6XA 4AULA 1ISPA 1H2XA 3ONYA 2ZS8A 1PFQA 2C5SA 4GOKA 3Q7TA 5DU2A 3H11B 3UXEA 3T7EA 1ESCA 2CL6X 1PZEA 1P0PA 2CXQA 2ZGVA 1T9GS 3O03A 2XYHA 4HDOB 2FUG1 3T3HA 1AA6A 5KYGA 2RJOA 3JAWB 4KKVA 4Q4DA 4R8RA 3SC2B 3SQLA 3TFQA 4HVTA 1Z4NA 3CF4G 4OLAA 2IZOA 2QAJA 4I1VA 4XNFA 3G2OA 2Q50A 1NUAA 1O0SA 1DXQA 1C7EA 1PJRA 4BAUA 1RZUA 3L6CA 3TIFA 1KO4A 2YN0A 2P0YA 3GRFA 2UZAA 4ZKEA 1DBWA 4NBKA 1OA1A 1KVUA 1DIGA 4IS2A 3NKFA 4C4OA 2KX7A 1SCJA 2GERA 3D7MA 4P7JA 4PYIA 4LBVA 2Z5FA 3QIVA 4KVGA 1R5BA 1MA3A 2ZYVX 1F4VA 3CX6A 2WHRA 4DLUA 4J0GA 4N41A 3GG2A 3VPBA 2X41A 3BULA 3KXKA 3P9CA 4HEHA 4RMHA 4NY1A 4UU1A 1XJ0A 3K70D 1Z12A 4INOA 2V6GA 3ACCA 2WINI 3AF4A 4ZOQI 2BHTA 2AVNA 3NI2A 1U9CA 1E6EA 3EF1A 3G1TA 3IDAA 5GJVC 3TIGA 3VSEA 3D2LA 1ZPDA 4KPGA 5IT4A 4L22A 2JAWA 2JLCA 3AVQA 4ZK6A 2BD0A 3KKKA 4JBIA 3NDJA 4DV7B 4DKJA 1RABA 1U65A 3UWMA 2FFHA 4XIGS 2PUAA 3L8EA 1VXOA 4R69A 4JB0A 2IHTA 4RD6A 4ZICA 3GVCA 1A04A 3OZSA 3WXMA 3WTBA 4BNNA 3EPLA 1MFZA 1QSGA 2RGAA 4JB2A 5DGTA 4DW8A 1XALA 4GS5A 5ALQA 1V8PA 2R86A 5JPCA 1B0PA 4FYIA 2QLNA 2G3YA 2PQ0A 4Y8VA 2WHYA 2QUBA 1WDKA 5IFKA 4L15A 4OMCA 3WFIA 2AD1A 3ZR4B 4X05A 2UZ0A 2QYOA 4LYGA 1YC5A 3ICOA 2ZBEA 4DNRB 1KGSA 5JZMA 5K3FA 2V7GA 5EJ7A 3QP9A 2XNSA 4D3DA 1IWPB 3KQYA 3SLNA 3OZAA 4XPIB 1B2RA 5EQDA 4C01A 4P33A 4CNQA 4BKUA 4O5AA 2YBDA 1GP2A 3OZDA 4YT2A 2FW0A 3H5WA 3VYUB 3HDJA 1KP2A 4IINA 3ROXA 1PX0A 5DXJA 4X65B 2OV1A 1M10A 1XNHA 1YK1A 2P9CA 1FTGA 4HXGA 3WO1A 5CDGA 3H19A 1X3SA 4QJ5A 4E94A 2V45A 4IIJB 4ES6A 1M8FA 5F1KA 5DASA 5DBOA 4Q48A 4PFJA 1P73A 3QVMA 2A57A 4LOLA 1U94A 1ZN9A 4M89A 2X6RA 3HDHA 3EN0A 4JA0A 3GLFA 3RASA 4CKZA 1V16A 3FF1A 4MUJA 2DUUA 3T9DA 2JGJA 1SJ9A 3VVMA 3ZQKA 1D04A 1ZA2A 5CVCA 2BP7B 2OZLB 3H5IA 1SBZA 3FVWA 2JGMA 1JJBA 3ITEA 2E4UA 3O4FA 3QEJA 2OZPA 3JYPA 3ONFA 1V25A 4MGZR 2HWXA 5JVDA 4F9GA 2X0RA 1MOZA 1OW3B 1J1IA 4HYQA 4KQFA 1Z6TA 2D1TA 2C7VA 2NUTB 2VBCA 3AP1A 1F2TB 3PYLA 2WYIA 2I6XA 3OIDA 5KQMA 1R5OA 5IF9A 4BXOB 1KRXA 1OKKD 2WDZA 1XTPA 1GXSA 3NBXX 4MQ5A 4D02A 3V76A 1YU9A 5DCYA 4G0PA 4A5OA 4WUVA 3TUJC 3FPPA 4GX0A 1E9SA 1Y7IA 1B4DA 1YJAA 1AA9A 3UW1A 1J99A 1T1RA 3JQFA 3KWMA 1WUYA 4JENA 4U9HS 3UV3A 4EB8A 1F2UB 2ZI6A 2I4MA 5HCIA 4EJSB 4OA8A 3P2OA 3R0JA 3MJDA 2BSXA 5K8VA 3FVTA 5KYWA 3NAGA 5KJ6A 2IYVA 1LLFA 1JSLA 3NOVA 3H5TA 5EVCA 1E9AA 1UKVY 4XLCA 2ACKA 2HBQA 3OU2A 2FZCA 2II6A 4GKKB 1GEGA 2BISA 3MNFA 3PD0A 1RAFA 3V97A 5KCZA 3T5BA 1C41A 2Q4TA 4B8WA 3A4LA 4H7JA 2FR8A 4CL0A 4ROSA 2QTZA 1SWWA 1DG9A 1S96A 1X7HA 3CG0A 4UXIA 5EMLA 1HLPA 3DWGA 1QLJA 2R2GA 4MVJA 4A3SA 2CFRA 1KK0A 1Y6JA 1PT5A 3VR6D 4F5WA 4C78A 4HVCA 1IC6A 4OUDB 1KBQA 5JSKA 4C7JA 2DPHA 1U7WA 2DBYA 1J20A 1PFYA 1WCIA 2J6IA 1RMQA 1XF1A 3IAHA 1CQXA 3ZV5A 2PD6A 3ER9A 3K6JA 1CF9A 3M4XA 4TTIA 4Q9DA 1MFPA 1NP6A 2J9FA 1R0ZA 2FFBA 2F8TA 3SKBA 4MI9A 1AMUA 3L4JA 2AG6A 5EE0A 1SUEA 3EFHA 1MLDA 4Z86A 3M33A 1E2IA 1X92A 2RHJA 3DTNA 1QH0A 1ZJ6A 3O3OB 4X7CA 1B1AA 1NKTA 3U60B 2ODWA 3LXUX 1CQPA 4LGYA 3MPOA 1UQTA 1G5HA 4DABA 1LJ8A 5LZ4A 5L4LA 1CR1A 3V4VB 2YMPA 3R9IA 4U2GA 1P9WA 1SXJE 1WZNA 2XYQA 1IRIA 2FLVA 3AY3A 5EY5B 3CCMB 3UW3A 2O48X 4JLMA 3CBGA 1JLRA 4R4JA 1WOPA 1K9VF 3OLQA 1YL5A 3V8BA 4CMCA 5J43A 3A35A 1P91A 3R7NA 4IFTA 4DLRA 1M3SA 3A1TA 2FRDC 2I2XB 4M8LA 3CLRC 4OBWA 2Z2JA 5GPBA 2G71A 2KBEA 3G9ZA 3GBPA 1X7XA 3UMGA 3R0QA 4HGZA 3UPDA 3C45A 3D81A 5KOIA 4LXQA 2XDQA 1MZPA 3DAYA 2ZCJA 2UZ1A 4E09A 3WL8A 2WKWA 3AM4A 1BDMA 3LCUA 3P0HA 4EEKA 4DR7B 3KHKA 5TQ0B 3KCNA 4FMBB 1TKBA 3UJDA 4AT1A 3UV6A 4AUNA 5ALXA 4CIAA 1OLUA 1YZQA 2ODBA 3DEKA 3KAJA 3A1SA 1LI4A 3NETA 4QULA 2JZOA 1PNQA 1VQ6B 4G5XA 3PE3A 4CKWA 5CP8A 5IXYA 2CRVA