5LMZA

Fluorinase from streptomyces sp. ma37
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
291
structure length
281
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMHSICPGVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIRQAAQWAGSGDGFERADGSYIYIAPNNGLLTTVLEEHGYIEAYEVTSTKVIPANPEPTFYSREMVAIPSAHLAAGFPLAEVGRRLDDSEIVRFHRPAVEALSGVVTAIDHPFGNIWTNIHRTDLEKAGIGQGKHLKIILDDVLPFEAPLTPTFADAGAIGNIAFYLNSRGYLSLARNAASLAYPYNLKAGLKVRVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of fluorinases from Streptomyces sp MA37, Norcardia brasiliensis, and Actinoplanes sp N902-109 by genome mining.
pubmed doi rcsb
source organism Streptomyces sp. ma37
molecule tags Transferase
molecule keywords Fluorinase
total genus 65
structure length 281
sequence length 291
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 5lmzA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 5lmzA01
1RQPA 2F4NA 2V7TA 2V7UA 2C5BA 2V7WA 2CBXA 2WR8A 4CQJA 2C4UA 5FIUA 5B6IA 2CW5A 2Q6IA 2C5HA 2V7VA 2Q6KA 1RQRA 2Q6LA 2ZBUA 2Q6OA 2C2WA 5LMZA 2C4TA 2CC2A 2ZBVA 1WU8A 2V7XA
chains in the Genus database with same CATH superfamily
2DUNA 1WD5A 1XRMA 1LTHR 5AJTA 5LP6A 2GK7A 2ZUBA 4P84A 1CF2O 1M3SA 3ZHXA 1G3MA 1HE4A 3QSGA 4HLQB 2OLEA 1C0PA 2QUHA 3HG7A 3K32A 1IUPA 1K9VF 3USZA 1KDRA 2ZUCA 3X43A 3ZWNA 4RX1A 1LSSA 2Y6UA 2O2CA 3U7RA 1I4WA 1K8ZB 3F3SA 2X1HA 2XX3A 2D13A 4HTAA 4KKVA 4BX0A 1T2DA 3SE0A 2PRYA 2AG5A 3D7RA 1QP7A 5IKEA 1CB0A 2GEUA 4IJMA 1C9EA 5ALOA 1NBMA 4LZPA 4WVFA 2Q6LA 3J80A 1XKLA 2ET6A 1VG1A 2FN7A 5T4HA 4G0WA 3V33A 4EDFA 3WXMA 1WL8A 4W5QA 5KTKA 2O5EA 3LWNA 4TV8A 1NXWA 5C8YF 4G36A 1CW2B 2Q45A 5JQGA 3ESQA 2JG3A 2BBTA 3D6JA 1KO7A 1GV0A 1NJFA 2DFDA 3Q3AA 2H6EA 4DCUA 3ETJA 3VHLB 3C3MA 3QJGA 1J9ZA 3K53A 3U5TA 1SO8A 3Q39A 4JOCA 2PD3A 4G4JA 3DMGA 4HEJA 1FF9A 1Y63A 2H4YA 4WBSA 2AQHA 1KQFA 4PLVA 3G5UA 4Q34A 1E5TA 1EBBA 1FU7A 1KYVA 1RW4A 4G5GA 4AF6A 1CY6A 1RIIA 1U1EA 2GZSA 2HU2A 3FVQA 3IALA 3T5BA 1XAJA 1CUHA 4FSHA 1TPYA 2DRIA 4O1MA 4QBFA 3RFTA 4AKEA 2OAP1 4KYIB 1YDEA 4COKA 4L3OA 1XZGA 2J3LA 1VE9A 4X20B 2ZB3A 3HM2A 4E4YA 3SR3A 1X8JA 4R3UC 4NQZA 1JJBA 1XB2A 1V48A 1GG5A 1Y3BE 3IB3A 4FZ5A 4ZN6A 5C8ZA 1VYUA 3A3BA 2A3NA 3KKZA 2PRIA 3GRPA 4XEHA 1IVNA 1GZDA 1QPBA 2ST1A 2MTBA 2WAOA 2C84A 2Z57A 3ANNA 1UWLA 1YASA 2QMYA 1YCDA 5FBVB 5JASA 1ZX1A 3TE6A 2EGUA 1RWBA 5ILGA 2H4ZA 1IY9A 1XTTA 2Z98A 3ZHZA 4BKOA 1T4MA 3NM5A 1ZJYA 2W90A 2Y99A 1UXJA 4ASUD 1XOIA 1BEZA 1HDIA 1AHHA 2VYVD 2YXBA 5KB3A 3L8EA 1E4OA 4IQ4A 4FE4A 4BRWA 2DTEA 1CUSA 1Q7EA 1I7SB 2VHYA 1Y0RA 3R76A 5IPFA 4QYWA 1UMDA 1L0BA 1NASA 1PN3A 2C4TA 2QT1A 2R6FA 4ZTZB 5GOZA 5KU7A 1H1LB 5H02A 3U44A 3AEUA 3T12A 4X6LA 4A7PA 4BQPA 1JSCA 2O6LA 2IUTA 3PD1A 5IAKA 1N07A 5LBTA 2QV7A 2GTPA 3BX1A 1JA1A 5DS0A 3L1HA 1WPCA 5BMVB 2VHUA 4JP5A 2JIMA 3AEKA 4YAEA 2V74B 2JJ1A 1TADA 3R3WA 1XCBA 1R8SA 4I5FA 2VF5X 1HDOA 5LB2A 3DUFA 1FRQA 3GJTA 3JQQA 3IJEB 4FINA 4H7KA 2CJFA 4H7PA 1AQUA 4QFCA 4Y98A 5AOBA 5TMDA 1ISGA 3KKLA 4LHYA 4AY4A 4YMGA 2D7DA 1VHWA 2JCVA 4ERNA 4BIIA 1VIAA 5KCZA 2WMNB 3C87A 5K7SA 2EXXA 1OXBB 1JFLA 4B6GA 1J00A 3DHYA 3G89A 5F4BA 1FQOA 4TXNA 3TQFA 4MHTA 1UQUA 4RWZA 4YT4A 4CE6A 3W7VA 3BJRA 4JBNA 1QS0B 1ISHA 2EW8A 5B3LA 5IYRA 4WXMA 4U3JA 4DMHA 1F4PA 2A4KA 3DTVA 4JUDX 3EFOB 4ACBA 2DR2A 3PC8C 1SXJE 1LCIA 1X2BA 5ARDA 4YASA 1B6TA 1UBFA 3Q11A 1NUTA 4TPKA 5B3JA 3VSBA 2H59A 3ZY6A 3BHNA 3PPYA 5GM1A 4TKZA 2OGSA 1AT1A 1BU8A 5CNKA 5SV2A 5K0ZA 3LQFA 4WZAA 3I01M 4CEIA 5K0BA 5IEBA 1MC8A 5DTRA 1K8RA 1HSZA 1XP8A 4BQSA 3P5SA 4C88A 1NVUQ 1XRQA 3L0CA 2R6GA 4JLWA 3EY9A 1T29A 3WBFA 4QPDA 2I1LA 3OHMA 1WZCA 4FGJA 4XOUA 2QPLA 3O93A 2GSDA 5EFOA 3IAM1 2EBUA 2QM7A 2VJLA 4LJAA 1ZVVA 2OM2A 2VDLB 5DCLA 3UQZA 4GL2A 4KLNA 4FHZA 3VX4A 2J7KA 2RC6A 3A2KA 1Z88A 2GR9A 2REBA 4HAYA 4DRXB 4EHJA 1VZ2A 2Z6QA 2PH5A 2PWZA 2R97A 3VR5H 4MTLA 1SRRA 5EMNA 2QR3A 3KTAB 2NAFA 1JE1A 3WV5A 1TT5B 2ZXHA 4YMHA 3EPRA 4LMAA 2CDNA 3RWOA 2NSDA 4B3BA 2V8BA 5DXAA 4BAZA 5HRCA 4KO8A 4GOMD 3P2JA 3PZRA 4G67A 2QTLA 4IO0A 1F17A 4J1TA 4JJ7A 2NZWA 4IRXA 5AUQA 2ZRPA 3HACA 3IA2A 3LNTA 3R3UA 3JPWA 1PZNA 4B9AA 1U80A 3W79A 1EGVB 4OTZA 2H31A 4ZVSA 2ZANA 1QANA 5A1JA 1J2JA 4Q18A 1ZK0A 3K9CA 1YK0A 4AKGA 4ND1A 2FPUA 3D81A 1HZZC 5MFZA 1RXVA 1ZN7A 3NTXA 3OC6A 4E70A 5BXYA 4QLOA 1VPLA 3AVTA 2H51A 2IPMA 3KJIA 2FG7C 4LKOA 4MVJI 4P38A 4BNHA 2Q9CA 4MUEA 2QRGA 2G80A 2YJTD 3OEEA 1GQSA 2E9SA 4KPYA 4B2LA 2HZBA 5A88A 3S99A 4QBKA 1E2NA 3IEMA 4YUZA 3D4IA 4GKJB 4A4DA 4FNGA 4RVNA 1DAEA 2NV4A 1SPBS 4XGQA 3UPUA 2WIFA 1F9AA 3IS3A 2A30A 2KBEA 1KKLA 1VJSA 1CUEA 1QFSA 2VDRB 2JGLA 2VK8A 4K86A 4WA8A 4WCVA 4WTOA 1NDUA 5COQA 5K2MA 1YFJA 4YT8A 1X7ZA 4F8EA 4GG1A 2FWMX 1NW6A 1WULS 1U2TA 4JQCA 2HQOA 4QU5A 3QVMA 4EHFA 1KEEA 1PLLA 4J7XA 3WBKA 4ZU6X 1P73A 3U1TA 2UXDB 4HS9A 3TXYA 3ENZA 1WCV1 3I5YA 3H9CA 1GT91 2BBWA 2C5GA 2H7XA 1BHJA 2RBGA 1RZVA 3FPEA 1I4DD 3UENA 3CMAB 2W98A 1E9EA 3VHQA 1WSAA 5TPZD 5M34A 2YXNA 4HDKB 3G4SB 1D4FA 5KMGA 3RNOA 3U16A 1U8XX 1NA5A 3AY6A 3OUZA 3FTNA 4G4IA 2D1SA 1T1RA 2WAMA 4JP2A 4FT2A 1GG9A 2HJWA 2HWXA 4FK8A 5DTJA 5EPUA 1U7XA 2AYZA 5D3MA 1ZA1A 3AJEA 2VA9A 1KMNA 1W5EA 3BXXA 5T3UA 3EWNA 2AX3A 5EIXA 2X13A 3F9CA 4LHSA 1M67A 4XN0A 4KH0A 2MCFA 3RHSA 3G59A 2QL7A 3N8GA 3ONNA 5J9FA 5DBGA 3OZCA 4GDMA 5JDIC 3AWIA 3V7AA 3AL3A 3EE6A 2Z2JA 1HPLA 4BO6A 4YHBA 1Y8ZA 4RA9A 5JALA 1U2DA 2GBPA 2EKDA 1VL1A 4X91A 4A10A 4DE5A 3EWSA 3WGTA 5E7MA 4GH5A 3KKMA 1M8KA 1C5KA 4BPRA 2FKAA 2X77A 3OY2A 4KRGA 4MEBA 4TQAA 4EP1A 1M34E 5KOHB 2JGKA 4PPYA 4OHYA 1R0WA 1SCQA 2VHCA 1W29A 4S12A 1EGQA 2EGGA 1FMTA 4XM2A 2WDPA 4CETA 5ALQA 4PWYA 1JR4A 2GBGA 4IUYA 1KI3A 1QVWA 4XYLA 1IWBB 3HJHA 4OPMA 1RQLA 3A1SA 4P4SB 5DHSA 3WHLA 4COOA 1KTVA 1ZJ5A 3OX4A 4JSRA 3UMCA 4G26A 3IIJA 1E6UA 4M9CA 1T8SA 2C9ZA 2X5KO 2GBFA 2DETA 4FW8A 1FUKA 3WLIA 1J2TA 2ZUSA 3CZ9A 2EP7A 2R3SA 3RKRA 4LF9B 5JNSA 4XR9A 1JUDA 1UJ2A 4TUYF 5FUYA 5CJ2A 1GVHA 2X40A 3ET4A 1VYTA 3CE9A 3A9TA 3L8MA 3R5SA 1BRMA 4QWWA 5FCDA 2AK3A 3SFZA 1UBJS 4RA9B 5KINB 1YSCA 4YV7A 3RW9A 5AIBA 3OWOA 1G6Q1 3GN1A 2YZKA 2QQGA 2UVPB 2I2AA 4YJ3A 2A5FA 1BXZA 3L82B 3JSAA 2G09A 3QVOA 4JU9A 5EMLA 3OW7A 4FFDA 3DMTA 1K7SN 4K2AA 4W9RA 4XB6B 3ZHOA 3INTA 3J7AC 2Q6VA 1J22A 3FTCA 5FWAA 3AZOA 1GUFA 3I4LA 2C2OA 3KDPA 5AJWA 5KPDA 1M1ZA 3MHPA 1DQZA 3LIPA 3O38A 3T7DA 3VA7A 3S3TA 4PXAA 4QEZA 4I1PA 2VQ6A 1M1YA 2YZ2A 3UXYA 4ZC8A 4QUGA 1JA0A 5TXGA 4RKQA 1W0JA 4JFAA 1GSIA 4BNKA 4N7BA 4X7RA 1NRIA 2QTGA 1Z0SA 3O4IA 1ZJ4A 3PNLA 1QH8A 4EGFA 4F0JA 2I4RA 2XD9A 3DMNA 4LS3A 3HZRA 2G5GX 1E4VA 2GJAA 4X07A 1CZUA 3PQEA 4FOTA 3TKLA 5DNCA 1EWVA 3SDBA 1H1LA 2JGJA 4YP1A 5KSOA 4E94A 1G8GA 2XDQA 5TVGA 1N5DA 4U7TB 4F1KA 1K97A 4B75A 5IN4A 4N0DA 3BGWA 4LOLA 3SFTA 3R5HA 3TLXA 3VHXA 2OD9A 4MV5A 2PQ2A 1NP3A 3LDAA 1HY3A 4TMZA 2EIHA 3KHUA 5E0OA 2IUUA 4S1TA 2LZ0A 4F9FA 2P8JA 5KPJA 5HKAA 4XOIA 3ZYCA 3R9XB 1KS9A 1UPCA 3DE3X 4IIVA 3KYIB 1UK8A 2Q5LA 2W2XA 3D31A 3MELA 4FEYA 4RZ3A 2PSSA 3B52X 2DYKA 4X3OA 3UPTA 1JKJA 1E7MA 2FI1A 5ESRA 2FZGA 4RV9A 4U2CA 1DS6A 2WUFA 3T54A 3K70D 3SQXA 2BGGA 3AJ9A 1Q16A 3HE3A 4AFNA 4UPVA 3A4VA 3E9QA 4IUCS 2VH2A 1WU8A 3TXXA 3KL9A 1NFRA 1KA9H 2BP7A 3PE6A 4QAJA 5GGYA 3VZRA 3WQQA 4HMOA 5KC8A 2XGMA 2PS3A 4B4OA 1GRRA 2JCBA 1JTVA 2M6SA 3GX1A 4PC1A 4DY4A 4UZEA 2D2IA 4TV9F 1ZD1A 3R7AA 1QZTA 4MGKR 1R12A 5I5EA 1ESDA 3CZ4A 3EDCA 3UPDA 2IC5A 3L6CA 3QV1A 3A3KA 4TKVA 3ADBA 3PEYA 3ICQB 2IHJA 2DUWA 4KI7A 4KN5A 4QNRA 2NTVA 3AINA 4KRYA 4GYYA 2R2GA 4JGIA 3EVGA 1ISSA 2ESRA 5K3CA 2Q3BA 4ZRMA 2P3OA 3ASRA 3PWKA 5CT5A 1NXOA 1O3YA 4KLAA 2C8KA 2PG3A 3PR2B 3Q0EA 1EVLA 2VJIA 1OILA 5F3WB 4L6AA 3O8NA 4D4GA 2HLHA 1D4AA 4OSOA 1Q17A 5IZCC 3UM9A 1R15A 1W93A 3UUWA 4H15A 5K3SA 4R0NA 2O50A 2OCAA 1T8RA 4AULA 2HMTA 1IBMB 2Z2KA 3NBZC 3ORSA 4K3VA 4QA9A 3LC0A 4AWBA 3CCQB 2BEUA 2HSDA 4RY0A 2OZKA 3EJ6A 4LC9A 2IHYA 4N5MA 4R2MA 3SSAA 5L3QB 3W3ZB 2HT1A 2PBLA 2ZJ7A 4KK4A 3ICEA 2XE4A 3RVNA 5JRZA 1H5UA 3GUHA 4I50F 4X1YA 1C4KA 1VGRA 3CRNA 4M8LA 1JX6A 4OJQA 5LIRA 5J3OA 1WM1A 2Y0DA 3DTVB 1TKCA 4FOSA 4ZRDA 3CNQS 1S3FA 2IPNA 3LC2O 4MI3A 5SYMA 2QE6A 4J0CA 5J2TB 4UTVA 5CA0B 4G85A 1D6MA 1PT9A 3HVJA 2XYVA 3UANA 1EQ2A 4CMGA 2CXRA 1YBVA 3NDIA 1S2OA 4UNIA 2ZUTA 3GPLA 1BVHA 1AB5A 1THZA 4WKCA 1T35A 1FFWA 4JCOA 4EA9A 1HE3A 1L5MA 3QJ5A 4P5EA 5U4XA 3I72A 4M60A 5FWYA 5K6AC 1JILA 2VRNA 1Q6YA 3X1ZA 1NF2A 4M0CA 2WKWA 2DMRA 4AN1A 4D99A 1DIGA 2VKTA 2D7CA 2OYSA 4RKYA 4ES6A 3WWPA 2VDPB 4EY8A 4DR2B 3NJRA 4UBOA 1U0GA 1RE1A 3HH8A 3B1JA 1WXFA 4WZTA 1BYIA 1GGMA 1X39A 2ZIGA 3GFBA 2RHWA 3JARA 2R44A 1AGRA 5LQKA 2AZXA 2XCQA 4RPIA 4W8GA 2DPHA 2JJYA 4EHDA 4D0SA 2P1DA 4JVSB 1W47A 1EVYA 2X0RA 3BAZA 1F14A 1RAIA 3IOEA 2DFTA 3LPCA 4HWKA 3M4YA 3GVPA 4Q66C 2BI8A 3IOCA 3OLZA 1Z82A 2OBNA 3KSAC 4IWNA 3UJ3X 3D6TB 3EWAA 2FWNA 3FDZA 3ZLTA 1LUAA 3M6WA 3IUYA 2ZTNA 1XJWA 1YRYE 3WGOA 1W4AA 4KJXA 4PHFA 1FUIA 1N6KA 2YTZA 1FYDA 4JT4A 4BV2A 4F4JA 5GIPE 3M2TA 5C1IA 1C3OA 3FVVA 2UZ4A 3IIMA 1C8VB 4ONEA 4OLAA 3UOGA 1PGOA 2R6R1 2O52A 1ZHFA 3QMPA 4QDOA 4NAHA 5EIBC 3WZMA 4D98A 1K6JA 3H5VA 3PUVA 5HF6A 3H5TA 3AVYA 5LQUA 2IF2A 2VTBA 3W5HA 1PVDA 2PTHA 2XMGA 3GXBA 4CF4A 4DEXA 4JIGA 3Q5GA 4X3PA 4UM7A 1HYHA 1OR8A 3QLUA 1TAQA 2EYUA 2FR8A 3D3QA 3W2FA 1XX6A 5EHIA 4FYIA 1ZK4A 2ATXA 3SHVA 4AIIA 4DQDA 2BV3A 1SQGA 3ZLBA 1V2GA 2M1XA 4C43A 3IXQA 5ENZA 2YMMA 2JIZD 4JB2A 1O9GA 5JI3E 1TC2A 5FPPA 2JD2A 1H9AA 2Y77A 3GCXA 3MMSA 3UJAA 1GL6A 5IBRA 5K3FA 1SWWA 1YQDA 5FOVA 3IMFA 3PX2A 2PX0A 2QRKA 4JJAA 3VU9B 4UNPA 3WNQA 5JSHA 1H9BA 4EHIA 3Q40A 4E5NA 4OHVA 4P4UA 3OAAD 5JXJA 3OCZA 3ZTYA 5JJCA 2BJHA 3WK7A 2PZLA 2XMPA 2ZRIA 4H4EA 3T3MB 4AWAA 5AVYA 4IHJB 1DV1A 2WFLA 4HFMA 1AA9A 1B26A 3NS7A 4GU5A 4DMLA 3ENVA 3LKDA 5IBCA 1HL7A 2XKKA 1BCRB 4BE7B 4CPDA 3W6PA 1FJGB 1KZ7B 3D6HA 2IZ0A 3DAFA 4KXNA 5EKDA 5HQJA 3WJ1A 4DJFC 1LLDA 1KEUA 5AW5A 3RRMA 1I3NA 6Q21A 1G1AA 5ALZA 1FY2A 1SBIA 3CCSB 3EVBA 3ETDA 4GLBA 4OK5A 3A3PA 2WF8A 3DQZA 4IS3A 1F2UB 4ZOBA 4MJXA 5BW6B 5IAOA 4HX5A 1CZKA 5C2JB 1XZCA 2AS0A 5FTMA 1OREA 3I39X 1FQJA 5BSUA 1DOZA 1T0BA 2EP5A 4PY2A 1N5MA 1W9XA 5JMTA 1MAAA 3M6LA 1W0CA 3RIMA 3IILA 2QBYA 2VUIB 4EEKA 3BE8A 2C4HA 2RI6A 4K9DA 2NVUA 5ICSA 2M6KA 4BATA 4S2UA 4ODIA 4IHJF 4AM8A 3ROGA 4DKXA 3K9FC 3O4VA 4QDJA 3VKGA 2KLBA 3NEJA 4GFDA 4JB3A 4NE7A 3V8PA 4LC1A 3UGKA 4YRAA 1YZKA 2J9FA 2EWWA 1U1FA 3HYRA 4PZ9A 2IOFK 4BNJA 1AGPA 4BWYA 5EP4A 3OPYA 1CUYA 1CK4A 1XAGA 1NXXA 3B20A 2GPTA 1ORVA 1V5VA 1MFZA 1GILA 3EGDB 2QW1A 4CIVA 4UHDA 2GOYA 3OZGA 2R6JA 3GEGA 3C8ZA 2PE5A 2VTDA 1F2UA 2ZIAA 5IMSA 1L7RA 5JAZA 4R6XA 2GJRA 1LA2A 1OXTA 4BMNA 3GJQA 4MV7A 3ZHSA 4H2DA 4PNHA 4GLJA 2QD4A 3IMCA 1W8DA 4FI3F 2WPDD 4YR7A 2PCJA 3DAYA 1IYZA 1BCRA 3QEBZ 3OZUA 1BGWA 1NN3A 3A8JA 1P2UA 1RWKA 2XA9A 2ZBPA 4RDKA 3LD9A 1U0TA 2M6RA 3SKXA 4DV7B 1Y89A 4G8DA 2HU8A 3UHFA 3HC7A 3BBLA 3PTAA 1UMBB 1EX6A 3EBLA 3TSAA 4E11A 5J4LA 1DBQA 1JIVA 3FI0A 4XR4A 2RE8A 2AB0A 3B85A 4QUDA 4BFLA 3F78A 1U3FA 2YWDA 4FFPA 4ZCIA 4EJ6A 3P9YA 3H2ZA 3SOPA 2HHHB 5K3FB 1Z08A 4X0EA 3NQ41 1YZNA 4AKSA 4AUMA 1K2WA 3AR5A 1ZI6A 5T64A 4ZYTA 4QNNA 1QH9A 2W6JD 2JJMA 5EXPA 2PSDA 4NQRA 1C8LA 3DZ8A 5A8AA 4S04A 5IYWA 3NFRA 1P0CA 2A7QA 3C8HA 3UMVA 2FZ5A 3E53A 2A0YA 1SEPA 1WDTA 2AHRA 2QRHA 3AKDA 3OZFA 4G5XA 4MK4A 3ZKWB 1UXIA 4H0FA 2GK4A 4IFIA 1NMEA 3L7JA 4HGOA 1M6WA 4X92A 2WQ6A 4X95A 2GNPA 2QB5A 1BMDA 2XXBA 3LPAA 4GHWA 2VBGA 2N1MA 3UT5B 5I7FA 5LOVA 2YFKA 4XE5A 3I2JA 4XVHA 4HMQA 3Q12A 1UBHS 4AXBA 3GSIA 4MX8A 1DC5A 2AQKA 3P2IA 5KVCA 3K0CC 3ZWQA 2Y1CA 3HY3A 4X7EA 4M1OA 4CWAA 5BV2P 1HLFA 3MINB 1PJ2A 1OBVA 4XORA 1Z12A 1E6EA 1O94D 3PC8A 1V7PC 4C14A 3V42A 5CH3A 3U7HB 3JQPA 1GEEA 2P9YA 3HKCB 3PHBE 4KV9A 1J1ZA 5A7FA 4M21A 1I9GA 3G7NA 4DV1B 2XZLA 2ID4A 4MYHA 4KHZA 4Y6RA 3I9V6 4H7IA 2ZSJA 3ED1A 3N0WA 3ZHTA 1HOTA 3JD1A 4CKYA 2FE4A 1WY7A 1BD3A 1EH5A 2P8SA 5JJ5A 2ENUA 2YY5A 3A1VA 3QXXA 4QUHA 3BWVA 3D8TA 3S2GA 2XUZA 3FSGD 5B37A 3SJUA 1G3RA 1U2EA 1CLUA 2ZCUA 3JAKB 4N3AA 5AVVA 5LQJA 1A8UA 2QROA 4D9GA 2N1BA 4P5DA 3I62A 5IYNA 2YHIA 2CD9A 2QLMA 3N87A 4FBGA 2FA9A 5JTUA 1E92A 5GONB 2WTNA 3AKCA 3O8DA 5BQ5A 5A3SA 3SC4A 1TU4A 5LMZA 5ALRA 5BR1A 3M5CA 1F20A 2ZS9A 3LZCA 1HQDA 4AQYB 4DDMA 2IE0A 2K2QB 4H3VA 4QQFA 4B35A 4RJJA 4K0KB 3K9QO 4AX8A 1ILEA 4CEHA 4NY1A 1XZMA 4HH4A 1U3GA 2WF5A 4MA0A 3VV2A 4S24A 5CA0A 3L6UA 5CVJA 3BK2A 1KVQA 3AHFA 1G8YA 3MS2A 4Q3AA 5B36A 2UUAB 2VA8A 2H2IA 2GJ8A 4BWGA 3A04A 1T9DA 2AFIA 1D1QA 3AR9A 3WQZA 3JWEA 4GT1A 3OCJA 4XDGA 3S0JA 3VPAA 2W6IA 1RYEA 2V7GA 3WDLA 3ZQUA 1JALA 3F98A 3MBKA 3ZQ4A 3DMYA 1L4NA 4RDHA 3V8BA 4EECA 3RUPA 4YRDA 2HIGA 1D1TA 3WLMA 5DASA 1R10A 2H07A 4DSOA 4BRUA 3DBIA 4NFHA 3K6SB 1VQLB 3DZCA 4Q6WA 3PEUA 4D8VA 5K8UA 3IBCA 4RTPA 1G6OA 3C24A 4YAGA 1P61B 3HVUA 3KPWA 4R31A 4EOGA 3LGXA 2ZAYA 1H2WA 1X0VA 3WQRA 2VYND 2H65A 1NJ6A 3KFVA 4J43A 5HR5A 1HE2A 1QHHA 2O07A 2O0KA 2ZGVA 4RBNA 1WMEA 4YMLA 3A26A 3I05A 4XVQA 4LY9A 2PH1A 4ZALA 3SF0A 4DYVA 1OTHA 4KQ2A 3W2IA 2E49A 3OE7D 4OCZA 3BTUA 4QYIA 4WMLA 4WZAE 2Q49A 3NHAA 4QD3A 4YRGA 5EHZA 1CX9B 3GYBA 1FEZA 3C45A 1AZLA 3NCHA 3QZUA 4R40A 4F2DA 1GXSA 1VKHA 1Z34A 3FCAA 3O1JC 5CK5A 5TQ2B 4ERXA 4ENRA 5IXSA 3ZYZA 1EHIA 4KXQA 4D9FA 3MJSA 4TXHA 4Q4HB 4MYUA 1X0XA 2AMFA 2VT7A 1VIYA 3GLUA 3NNNA 3QUSA 1RMTA 1PG0A 4OA8A 4NABA 1N3LA 1QHYA 4KZPA 5JYCA 2GAJA 1OH6A 3MOGA 3PICA 3KEOA 4HRYA 1ZCFA 2PRSA 2I6GA 3N28A 2V31A 1SCIA 2ICAA 4QDZA 1U0LA 3HDGA 3NRCA 4H7HA 4V0QA 5EHQA 4EF5A 5J2TA 1W5TA 2CF5A 4KAJA 5IJAA 3NGXA 3LT1A 4MWDA 1QYIA 3OF5A 2HSJA 4JKYA 2O06A 3SFVA 2R8BA 1UCFA 2GPJA 3CKMA 1KOGA 4X1YB 1RYZA 5C4MA 5K6TA 3F97A 2FZCA 4Q4JA 1FXWA 4B4UA 1M6EX 4F60A 1P17A 2WJ6A 1FP7A 4J4HA 3D7KA 4JAVC 5DCUA 2PGIA 4XONA 1T26A 4GD3Q 4XSVA 4L9SA 3TZEA 1MX5A 1XA4A 4H31A 4BV9A 3R9XA 4KL8S 3I30X 2B1RA 2YV1A 3D4BA 2BFCA 3GA0A 3O8LA 3ZJ5A 3OPXA 1GGEA 1B41A 2QTAA 2DQZA 4LMBA 4DCJA 5JAUA 5J5AA 2PBFA 1V6SA 1SVLA 2ZPUA 3UB3A 5A9TA 4ENWA 4JROA 3FG9A 4OH1A 3OECA 4OJTA 1X94A 3H99A 3RI3A 3AB3A 2I2FA 4IIJA 1P3Y1 2ZM6B 1TXGA 4IDNA 3A4TA 5E9QA 3N8IA 1EJ2A 4Z8YA 5G4LA 1CS4C 5JXWA 2PLRA 5TARA 5DYYA 3L1UA 4TXJA 3R3VA 5EI5A 4P5PA 3TIGA 3P97A 1EFKA 3WGLA 2Y3IA 1NWCA 5B4UA 2CNDA 3C6XA 2UZAA 1IJKA 1DUVG 1FDOA 1TUGA 2LVBA 3ET5A 3I6YA 4HN4B 4I4TF 1K7XB 1EA5A 4KAAA 5ES3A 3RS2A 1PJZA 2IXFA 3EZFA 4NRDA 1QLHA 2BMFA 5JRDS 4RC9A 4ED9A 1IM8A 1XTJA 1LWNA 1E64A 2FZ4A 1S8AA 2V7BA 3R3ZA 2XH8A 3BCDA 4CR6A 2VJNA 3AF2A 2ZM5A 1WLYA 1Z6QA 2GN6A 5DIFA 3LRPA 1CNEA 4JI6B 1A50B 4TS4A 4CKCB 3QTTA 1WEHA 4MLDA 4JJEA 5IASA 2WJYA 1LC0A 1LWOA 3TNYA 4YYZA 5AVUA 4BMPB 5IT0A 1ZM3A 2QX9A 3RGGA 3P9KA 1S1CA 4ZDIA 5CBKA 5D84A 5IK2D 1NBWB 3UMSA 2J3IA 2ZPTX 4LKRA 4RTNA 3BD9A 4Q3KA 1EZZA 3EULA 4NI5A 3ZDBA 5BSGA 4DPMA 4GRDA 1TM4E 3GNQA 2AN1A 2GPWA 1WW3A 3KOYA 3L4EA 4JIMA 2J67A 2JRLA 4DLKA 4ZMSA 3IHLA 3RJZA 2D8MA 3PNSA 4BVJA 4LJ7A 3NTOA 3WGQA 2NU9B 1L5HB 4CIYA 5MN5A 5BVGA 3M3HA 3TLGB 4BLTA 4D97A 1KGDA 3IP8A 3USCS 1TYZA 2ZFUA 4L2IA 2WHRA 3Q7SA 1BS2A 1P0IA 3M5DA 3QENA 3VDNB 1HMPA 2C2HA 3I5MA 3X1JA 1E1RA 1UBRS 2CNBA 5AXAA 3VPBA 5LZ2A 5ULLA 1OQAA 1RJ9A 3AFGA 3NOXA 1LF0A 4JLUA 3UMGA 3TQSA 4CL3A 5CTJA 3FM9A 4ZO7A 1GDTA 5BSFA 2P6MA 1BO6A 1OJLA 1C1HA 1U31A 3DGEC 1XU7A 2PSFA 3NGLA 4HV4A 3BK1A 2I87A 3KYDB 1LZLA 1IK4A 1R66A 3DE1X 1URPA 4RIGA 2B2XA 1UZLA 5IJ0A 1QPZA 4LA4A 3PLNA 2AMVA 4I8DA 3VR3A 1PT5A 3I92A 1D8AA 4MITA 3WYEA 2Y1DA 1C7JA 5KQSA 1JHRA 1KZYC 1PQYA 1U7WA 3ASVA 3RYTC 1KEZA 2DKNA 1TQDA 4JQYA 4PTZA 1KXZA 2PMFA 1GQQA 4F86A 5DMHA 5COBA 1IFXA 2PV7A 2C2ZA 4M0FA 4J0GA 3DLCA 4AJHA 4X00A 4C4ZA 2E0IA 4N8EA 5CK4A 3CH5A 5CLHA 1GYQA 1BWSA 2G17A 2QHXA 2XMBA 1USGA 4C4YA 4EHNA 3IHTA 2JFPA 5IJXA 3ZU5A 4BVEA 1YB2A 4N1AA 2GAIA 3PFCA 2PUVA 4I1RA 4C0BA 1IIBA 2JBWA 3LDHA 1CJTC 3A25A 2B92A 3LZ6A 6AT1A 5A1TA 4ROXA 2FPPB 1WPXA 5KYWA 3U3DA 1LRJA 5IT4A 3GLIB 3OE1A 1O6CA 2V4MA 3DBVO 2ZZKA 4KMRA 4JLJA 1WXIA 2Z8YA 3RHFA 2W7TA 2VF4X 5CITA 1FTNA 4B6PA 1N7JA 3DDZX 3HB0A 1HVXA 5AI0A 2IX3A 1HRDA 1GY8A 2A58A 3BJZA 3D3JA 1P3DA 1ZCBA 2C3YA 5K3BA 4EJFA 2B4TO 1CF9A 4S1NA 4ANFA 3ZY5A 1NXPA 4KUEA 2O8DB 4MPPA 2BFBB 3H16A 2YFQA 4IDFA 4XWGA 5BT8A 1V4BA 4HPWA 2RHGB 4PAGA 3T06B 5HXBA 1EK0A 2BCEA 5JD3A 3WOVA 1V96A 5JBIA 2PNJA 2CXTA 1SBHA 3G2JA 2AFHB 3SQNA 1QB7A 1ZSVA 3O75A 1MV5A 2R11A 4XX0A 1S72B 1O6GA 3AP1A 5G1OA 3TFWA 3EBPA 4QOSA 2FEOA 2GAOA 1ILWA 4CODB 3DT6A 1E3JA 5ILOA 2ABWA 4A16A 2DXIA 3DE4X 1C8BA 3NT2A 4JUBA 4ZQBA 1WB4A 1PFVA 4XL9A 1XROA 1CJUC 3BNWA 3V48A 3WOHA 4HR7A 2OYNA 4WERA 5JD5A 1UIRA 2VP3A 5FBHA 2O1WA 2AGVA 4PRZA 4ZEOA 3WL8A 3BRWA 1CP3A 1NVKA 2PLWA 3G8YA 2F2TA 3OJEA 3QVWA 3E22A 4RMIA 3LT5A 2QTZA 1DARA 3QBEA 2YWGA 5CHYA 2O8EB 3C39A 2VJJA 2VBVA 3D8RA 5BSKA 5JAPA 5GJWC 2XUDA 3P9RA 5C8YB 1YI0A 3DQPA 4IVQA 2OHFA 1V16A 3VH4A 2HB6A 2FOXA 1M10A 1Q84A 2YS7A 3OY7A 4ZZIA 5AOCA 4ABTA 4ID9A 3GCGA 5BYJA 1J0CA 3SY8A 3U4MA 1D5WA 4PYMA 1SUBA 3HO6A 4DNFA 3HFGA 1SA0B 2VDUE 5LA6A 3N75A 4GWKA 5B3JC 5BSEA 1GNTA 1WV0A 2GB4A 3N8NA 4Q37A 3S2YA 4US2R 3A3GA 5HZKA 2GBCA 4ZVKA 4RTMA 2PU7A 2VAWA 1CNFA 2ZZGA 4Q48A 1UKZA 1SC6A 3IP1A 3QIVA 3FYSA 3WBBA 4Y0VA 5CA1F 1AG9A 2NO1A 4L72A 1Y1RA 3K15A 1EE9A 3WQHA 4ZJPA 5LPNA 1PR9A 5JT1A 3MS7A 1FDRA 1X1SA 2VLBA 1BX1A 1FFDA 4QX6A 5JNTA 3LQYA 4NE2A 1VGVA 3VZSA 3CXCB 1KQ3A 2AD1A 2JLYA 2EOAA 1K8XB 5ICFA 1A9XA 2ZUEA 1MDBA 5FI5A 3ZV3A 1QRRA 2LCFA 3CYFA 1V39A 4PLGA 3ZEAA 2BOVA 5JSFA 3IDQA 4HDCA 5E0KB 1FFYA 5CM9C 4WGGA 1VQ5B 3NX4A 5EPOA 1TF2A 3RSGA 3TMAA 4B2IA 2HSGA 3U7EB 3ISJA 4OK6A 4HCJA 4A0RA 3EVAA 1V6AA 1VJTA 3K35A 4NC9A 4PLYA 1PD1A 5M2QA 1V0FA 1B4DA 2W93A 2RKOA 3O2JA 4WFQA 1QS0A 1L4EA 1N3YA 4ZOQI 4X06A 3BB4A 4LYJA 4YECA 2CJWA 1V7ZA 3LUPA 4J2HA 3VZDA 5JDIA 3AIKA 4EG7A 4EX6A 5JMWA 3WP1B 4A8HA 2E4XA 2XWPA 4AJNA 1QQ7A 2WR8A 3OQIA 2Q2NA 5B2EA 3Q3CA 2OMEA 1PKEA 1E3TA 2H1CA 4KYTA 4F6RB 3W4IA 3NALA 4L0CA 1IN1A 5IX8A 2OGWA 4Q1VA 5HOEA 4R1MA 3HYCA 1NPYA 2C20A 5JE8A 3NVMB 4MA4A 3S28A 1MR3F 3DMFA 3DUFB 2FUEA 2P11A 1DEHA 4C29A 1GUZA 1VYHA 3L9WA 2P0EA 2H2FA 3PEEA 1DIHA 2PKCA 3RF6A 1RZRA 2FPWA 1SJ9A 1TDJA 5FUWA 4QU9A 3EG5A 4IR7A 1IWPB 4AROA 3MRTA 4X24A 1CP2A 3V00A 1O77A 4OL9A 1ODCA 1MW9X 3DLBA 2RC5A 1NNSA 3JQ9A 1CDEA 1ZNYA 1BIFA 1HYEA 1O6BA 1KDYA 1M2VA 1UMKA 4HVTA 3P20A 1CZNA 4R2LA 3ZXSA 1HDCA 1IAQA 4QELA 5B3AA 3M1YA 1E0AA 3I52A 4XARA 2QUIA 1YDWA 3OT5A 1GARA 3VNUA 2F00A 3EA5A 2I22A 2IYUA 1LJ8A 2UYCA 5DF1A 1F1JA 1L5ZA 5JZSA 4IYRA 1GU0A 4L22A 3GPCA 3ZDXB 1D2HA 1VM6A 2CGEA 2EP8A 2XNDD 1R9JA 2CHGA 3IBGA 1T3TA 2D1YA 2GMWA 1B6SA 3AB7A 4PZLA 1JQEA 3BJMA 1TJYA 4KSYA 4DDVA 1GNPA 2HWUA 2J0UA 5AM5A 1N7GA 3L8CA 5A6SB 4EKGA 3Q9LA 3X2EA 5KNBH 3WB2A 3E8XA 5DV9A 3ZGZA 1G2PA 1R18A 1NBIA 3RC7A 2V3VA 3I28A 5EERA 1BCSB 1T15A 2GA8A 3GQBB 4BNNA 1ECFA 4V0MA 1XPOA 1ONOA 5K6AA 4NECA 2AFRA 4JBYA 1AXRA 3HXMA 4FUTA 3NDRA 3H1EA 1UUFA 1X1CA 4G0MA 4M7OA 3CW8X 3BDAA 1ANKA 2QKYA 3B2EA 4BAUA 1RLTA 3OPOA 1KHTA 4MRRA 3LVQE 4RF5A 3KZNA 2G6BA 2RARA 1FW6A 2GF9A 3MLEA 3MNFA 2A9PA 2P9BA 1UMDB 4HXYA 1YUMA 1C0LA 2YCBA 4RHFA 4XI9A 3LFTA 4KR9A 1EK6A 4TTRA 1O89A 2AD5A 1UPXA 1WMSA 1KRXA 4I50B 3RVKA 5FOQA 2F1OA 2WU0A 2H0RA 4U4AA 4OATA 2XUKA 1KORA 1VPVA 2PGXA 4KACA 1NF8A 1DE0A 2BMDA 2VDOB 2ZYVX 1N5JA 5NULA 1LPBB 1NI5A 5FL7A 3UMJA 4FYJA 1QBGA 2J9ZB 3O0TA 4GP6A 2ZQYA 4B5KA 4XZ3A 5AW8A 1NE2A 1XDDA 5C5IA 3EGXA 3RROA 2VZEA 4BTVA 1R0KA 4Q4JB 1NRJB 1Z7BA 5IW8A 3F6PA 3NWOA 3OMLA 4GZLA 3TRFA 1YU6A 2BC9A 3D5EA 3OM9A 1C14A 1PT8A 2GJKA 4HZGA 4PCLA 5H4HA 1KARA 4URZR 4CL2A 5L3VA 1DL5A 2GREA 5EZ5A 2QK4A 3KAPA 4MH0R 5AUOB 3L6EA 4CLOA 4AS1A 4ZV4A 3D0OA 2W2PA 3DZHA 4NEGA 4XUCA 3BTSA 4BMZA 1J2UA 4LNHA 5DYWA 2ZBRA 1PTJC 2FPIA 2X0IA 1LLFA 3E5HA 1JDZA 4GKVA 1RI1A 4K3UA 5FNVB 5TC4A 3DOJA 5CP8A 1I14A 3ONUA 2FZVA 4P4NA 1S3IA 2ZIEA 5BUQA 3QXSA 3VR5D 4UBNA 4IVRA 4R6WA 3U1VA 2NXJA 4QPCA 3R8XA 2OC9A 1KZLA 3WKCA 5T4BA 3UWOA 4GPAA 4PQRA 3TNDA 4P98A 4MYDA 4D2IA 3KSBC 2O2YA 2J48A 1XWIA 5T67A 2IXAA 1GR0A 2Q50A 3QFSA 4XYGA 1NL3A 3K05A 4BLVA 5JAHA 2XQVA 4FMDB 1WMBA 2Q5OA 4OOFA 3DEYX 2BVNA 2VHZA 3KOWA 3QA9A 2I80A 4QUKA 4RIHA 2XXAB 4CCSA 1MHTA 1FYXA 1P5RA 4JL8A 5A4AA 3I5XA 2Q5CA 121PA 5K01A 3A8KA 3C14C 4B7UA 2IFTA 1Y1PA 3EVNA 5JBNA 3GL9A 1QO0D 3S1AB 2EJVA 4CDGA 3I45A 2CKDA 4CZ2A 4NK4A 2ZQ5A 5DKFA 4P3YA 2H2WA 4EJMA 3NG1A 2FW8A 1DBIA 1PFYA 1KU0A 2LV8A 2GHIA 2IYLD 1BJRE 3M4JA 4QTUB 1YZVA 4HDMA 5EKUA 3QVKA 5IYZF 4DSZA 3K1TA 1R4MB 1TCUA 3KB2A 1YDHA 4OFBA 1C0KA 5B4VA 3W3AA 4B3HA 1NBMD 3RBAA 5I7SA 1U9ZA 2WLSA 5HTOA 3ESAA 3TBFA 5BSWA 1L9XA 3T7CA 4A1OA 1KSHA 1Z62A 3ZNQA 3G5TA 3QK7A 4N9WA 4PG6A 1U3WA 4FDAA 2GD2A 1USKA 1VI6A 1ZJJA 1QH0A 4B33A 4DJTA 3ONYA 2J3KA 1BZYA 1SUIA 1TM5E 2CXPA 2EBFX 4O2BB 4P4GA 5F4ZA 3FPPA 1OHHD 1PGPA 3BERA 2XAAA 5IAGA 1O2DA 3KL2A 4B3FX 1NQWA 3LTEA 1JZTA 1QH1A 3EZNA 4HN9A 4IEIA 3D7MA 1SBQA 1JN0A 1G8FA 2A59A 2G9ZA 3L7CA 4IRUB 5F7ZA 5C37A 1H6BA 1NLUA 2X2FA 2YBEA 4RE6A 1Z0AA 5IANA 3G0BA 2NU6B 7MDHA 2C88A 2OXRA 4XQGA 1DKNA 4C7XA 2FFHA 3PNPA 1SOAA 1Z17A 4UE2A 3SXUA 2ANCA 1XKTA 2FB9A 3ZW7A 4BJHB 3KDAA 3P0JA 3AJAA 4AJPA 1GZSA 2CYBA 4NBKA 1D2MA 5FTNA 2FQYA 1T0UA 3P5BA 1ML4A 2HWYA 1W5AA 5HG0A 2XE7A 3DA8A 4UAVA 4JU8A 1XALA 1NXSA 3R0JA 4XUDA 2RCNA 3TEMA 4QG3A 2DBRA 1DRKA 1LC3A 3CONA 1K8QA 3A1DA 3N5KA 4KUHA 3X1YA 1CNMA 1YONA 1UOEA 3ADCA 1R0SA 1UKBA 4K6OA 2B2NA 4C89A 4GC5A 3L7NA 3PB3A 3PXBA 1F5SA 1TIKA 5EIHA 3BA6A 3EXEA 4YDHB 3C4VA 4X66B 1MZPA 5PNTA 3VC7A 5FI1B 5BR4A 2MSEB 1JL3A 1SIOA 1AK1A 2RH8A 1I7LA 3WK6A 1DIBA 1YC2A 1FFSA 4MEJA 1GZ4A 1KIFA 1JKIA 5GGXA 4MDFA 3VUFA 2OBMA 1JFVA 2ZJ0A 3QX9A 4IWXA 1S9DA 4UUBA 2WA1A 4JXZA 3RK4A 2VJBA 4RZQA 2PGLA 1BE1A 2PFGA 2P2DA 4ZCSA 1SUFA 4NESA 4RVCA 1SIWA 2D5CA 1M90D 3GNSA 2VYFA 3I9NA 4WIAA 3AUYA 4LV8B 1LB1B 1YA4A 3P9SA 1MC5A 2OHIA 3L0ZA 2C31A 1RU3A 1WVIA 3CKYA 2VYQA 1GCAA 1XNGA 4HK4A 3DVQX 1NC3A 3DXFA 5EA2A 4DV5B 4YMWA 5DM4A 5CCBA 4IFTA 5ESXA 1UMBA 3QTLA 4IX1A 2ES4A 3ZWKA 3DL0A 5A4JA 4CIAA 2RB4A 4HXGA 4KQEA 4C3VA 5J5VA 5IZ4A 4HQFA 1W9MA 3UAXA 1L7DA 2X58A 2H63A 3EARA 2AQIA 5EJAA 3IERA 5C81A 4FEGA 4F3TA 4LBZA 3EUAA 3OICA 3R6WA 5B55A 3HRHA 3S68A 1MHPA 1UDRA 2JANA 1YZFA 2W6QA 3CLVA 2X23A 4I66A 2YYZA 4PYRA 1A1VA 2WVAA 1V41E 1YZLA 1Q0ZA 2J7PD 1EXMA 2EDAA 3DHEA 4CKWB 2D7JA 1MABB 3AOGA 3I2FA 3IPAA 3K09A 1FNSA 1OWPA 3FDIA 3VSCA 1PZHA 4QDTA 2ZETA 3S29A 3HHEA 4C07A 2GXAA 1BTOA 3U0VA 1RPNA 5F5XA 5FA8A 1DU4A 5T8KC 1NQUA 2A9VA 1SH7A 3I1JA 2D0DA 3PUJA 3ASYA 1SG0A 3AILA 4QYXA 5HGJA 4RPKA 3E2PA 3PTLA 5L6LB 4YJGB 4MQ5A 1PW7A 2PL9A 3NXKA 4K2HA 2BHRA 1P91A 3O2NA 2YN4A 1M1XB 1W34A 5E9AA 5TEVA 4J3NA 3AIOA 1E2GA 3JQAD 2DH5A 4DM3A 4EHKA 2XCRB 3IT3A 4I3GA 1KYWA 1E8NA 4QNMA 2LR0A 4ND4A 5H68A 4EB0A 4BCDA 4HQ0A 1GL9B 4W1QA 1W36B 4LXIA 3B5JA 1UT6A 1ZOPA 3NBYC 1QR6A 4Y30A 1S8NA 2VJPA 2XB4A 4U2DA 2IS4A 4CFSA 5DK4A 2ZXIA 2QR5A 1J24A 1Z7YA 3BH4A 5KJCA 1WORA 4EFMA 1XVTA 2D4HA 1ABEA 1H1TA 2Q62A 3KIPA 3LUDA 1Z28A 3LO5A 1KAHA 1NVFA 2FUG6 4WN3A 3RU7A 4ALKA 1ZK1A 1P1KA 1TTQB 1ZKMA 3H83A 1J70A 4R3NA 4AO7A 5ARBA 2JFYA 3MCUA 1N2CA 1TLLA 1VLQA 2C5SA 3HFSA 3I6IA 1U2QA 4EHHA 4DHEA 2DGDA 1G3QA 1E89A 2UZIR 3KCQA 3SYKA 4Z7OB 1CUCA 1Z39A 5A2QA 1N7HA 3IHKA 5EVJA 1S7CA 3LSYA 5AW9A 3GJZA 5D8DA 1E2FA 1BOOA 2RGDA 1DRUA 3FCSB 1PJCA 2I76A 4A82A 1CQIA 1F8GA 2RHMA 1JVSA 5K0NA 4N6NA 2OQVA 3B82A 4LGMA 1QE5A 4W8OA 3ZW8A 1VHTA 2A84A 2DPMA 3QKUA 4ZOLA 4W5NA 3NWPA 1KBOA 4LEIA 1UODA 2AQ8A 2OFPA 5K0LA 1B8VA 3KT8A 3U0BA 3SBDA 1QRAA 3QEJA 1OBHA 1P1FA 4MCHA 1TEXA 2A1UA 1RZUA 3GMTA 3UJNA 4DMFA 2H1WA 3AXSA 1LPPA 2WJ4A 3OCVA 4I9HA 2NZUG 2XE8A 1XSEA 4J75A 4M1SA 3S4YA 1FXSA 4XM0A 3I6ZA 3NZEA 4H27A 4M83A 4OMDA 2NO9A 4PG5A 4MV4A 1IY0A 3DYBA 4XX1A 1Z8HA 2P40A 1SCUA 5GVRA 3T7IA 3I9LA 1Z45A 2ONJA 3VKFA 2E5WA 4NFSA 1U5BA 2BPOA 1DADA 2TMKA 3CO5A 1N92A 3V7WA 4OH7A 4OFZA 3RO7A 2ZYGA 1R3UA 2DWPA 5IH7A 1R8YA 1DC4A 1W19A 2B3TA 1P6UA 2YMPA 3GMSA 4KO2S 4R2WA 4Y2RA 2J33A 3BT7A 4WKNA 1R64A 2J6HA 3VR4H 3EIXA 1BXRA 1S0UA 4ZTBA 2J5QA 2IX9A 2B98A 3UJCA 3KR2A 3AR2A 2VO1A 3EDMA 3FCUB 4WBXC 2G8NA 1T1GA 2IXBA 1QCYA 5C8DA 3JARB 4DYHA 1WNFA 1FS5A 1DNPA 1SB9A 1YRWA 1Z36A 1KR2A 4RH0A 3WRVA 2WTEA 1Y6GA 4IVNA 1OY1A 3BE6A 5A89A 5JISA 3AEQA 4MVJG 4DLTA 1CV2A 3G2KA 3TCXB 2FAXA 5AXBA 3WLPA 2P0YA 2I3AA 1EJ0A 2ZW9A 1FBNA 1PL7A 4MW0A 7AT1A 4DDHA 2N47A 3NYWA 1W4BA 3GAMA 1VTKA 5JHHB 3F8TA 3G0IA 3AF6A 3CH6A 3ORHA 4BGUA 3OUUA 4RMGA 1XI2A 1QE3A 4AZTA 1GD1O 4NICA 3IOBA 5A05A 5IU6A 1WZIA 3CD6B 2C42A 1H0KA 5EVCA 1O8BA 4B3GA 2X9QA 4J6FA 2PGAA 4J7UA 2C58A 2CZQA 3CR8A 3PF9A 4W99A 3A9UA 1T9AA 3IYLW 4JP3A 1OI2A 5SICE 4Q03A 5LUBA 1ITZA 3SHWA 4YN3A 1P1BA 1LEHA 3GP5A 1IOLA 2E55A 2FUG1 2BGIA 3RUAA 1YULA 4D3XA 3GLFA 4R7TA 1DXQA 4GX1A 4MJLA 2BEUB 2PBRA 4CFYA 1WZNA 4B8WA 7REQA 4RTKA 2O8NA 5EHGA 1DWQA 3ESZA 3FKQA 4HAXA 4UVGA 4WK2B 5TS3A 4A0FA 5IKPA 5FBQB 5A0TA 3JZAA 3GQVA 1RWQA 3E61A 3PITA 4OHCA 3SEQA 4EL5A 5FPKA 5KNBD 2AC2A 5U9CA 2G4VA 1ENOA 2AUMA 2IITA 4H4CA 9LDTA 1UBMS 1SBNE 4EZIA 4AG6A 1SRQA 3M3PA 4O02B 2P4UA 1ABBA 2XBLA 4ND3A 1H0HA 1O4WA 1T9HA 5LWHA 1I30A 3QWBA 5G3ZA 5J47A 1C30A 1X13A 2OT3B 2TS1A 2LXNA 4C21A 1RRFA 5F1OA 5IYQA 1J25A 3Q10A 3R7NA 3SVTA 1ODKA 3MQ4A 4DIKA 1W76A 1P6QA 4ISCA 4JBLA 1RXEA 5CH8A 3JTEA 1RHQA 1YCGA 1V4VA 2X4IA 2PS1A 3FRHA 4JJIA 3FCOA 4B40A 2CNWA 1H6CA 3DZKA 2I6TA 4ZK6A 3PL5A 4M1TA 2R00A 5EUMA 3KVNA 1MF7A 2CJWB 4LJKA 3EF0A 2XNSA 1YQTA 5DTIA 1Z6GA 2R7LA 1RMQA 3UK1A 2GAAA 2W2MA 4HNAA 1G5HA 2QJRA 4UDYX 1PQPA 5CT6A 5FLEX 4MV3A 2LW7A 4FJ1A 3H0CA 5FEMA 2HA0A 5ADHA 5A5GA 1SK8A 4P0TA 1N6HA 3UAYA 3IHWA 1WPRA 4DR1B 3OOJA 3M3DA 2QZJA 4G5HA 1OGJA 3WXBA 1REQA 1AZSC 3E9YA 1HQKA 4O4HF 2QRVB 4R1QA 4N41A 1CERA 1FP4A 3HBLA 4I36A 4O4JB 1WP6A 2JK1A 3TPZA 5KS2A 2A0XA 3FOEC 2IS6A 4XW2A 2FSVA 3JRWA 4WNYA 3W34A 4BMVA 4WWVA 1E7QA 2GDZA 4IJ5A 2VAXA 4GZ6A 1YWGO 2PKXA 2SHKA 2H52A 3EMBA 4M76B 3T5GA 4CEJB 4AB1A 4XSGA 2EL7A 2ZREA 4MI9A 2W8BA 4JX9A 1BS1A 2VDJA 3TSWA 3LDFA 4HH3C 1SKAA 2GPAA 3P94A 2D5IA 2VWPA 1NN5A 1C9YA 3B6IA 4G1UC 4LSZA 2BBOA 1E9RA 1U28A 4MKIA 5T4FA 2HZ7A 2SECE 3LI2A 1VJRA 3BSYA 4C03A 4ZYLA 2IYQA 3IE1A 1E4EB 2H08A 4HVLA 2WWYA 1QH8B 2M1ZA 2X0JA 1PU2A 2B7LA 5F73A 4F3KA 1USVA 2EZ9A 3M70A 5DW0A 4JENA 3KHSA 2DFKB 5C8YA 3V7YA 5JQGF 1E20A 3HEBA 1MB2A 2MIIA 1K73D 5FD8A 3RHTA 1KYIA 4B48A 1VE3A 1LFDB 3NHFA 5HIMA 2ODBA 5FO0A 3O03A 4LTNA 4A23A 1LJUA 4D4JA 2X4LA 3RVDA 3MAAC 4REQB 1QSGA 2FSFA 3ZWWA 3BIWA 4MWEA 1DLIA 1RIFA 2ZZMA 1TLTA 4FFOA 2WIDA 3K0AB 3N6XA 4PCAA 4QHTA 3N0XA 1N4AA 2IEBA 3JAMA 1FE8A 4JJGA 1CFZA 3Q2IA 3ZEIA 3IMEA 3M0EA 1P74A 1ZN9A 4CM7A 2G1UA 4PWZA 4TLLB 1VIMA 3EDQA 3EEOA 2HOQA 5DBHX 3WAGA 4WZBB 5GOTA 4MUNA 5TEWA 1JYFA 2ACVA 3GC6A 3SZGA 5IYZA 4OUDA 1WXWA 2E85A 4WFJA 1RTKA 5AVZA 1X7DA 2BH2A 3KK0A 5E2BA 2W11A 1XP5A 3NYIA 2GUGA 4FKMA 4N39A 3UJ7A 5LJLA 1UOOA 1DT3A 1W85B 2RHJA 3RYFA 1L7NA 2CFSA 3F67A 5GIOE 2VWGA 3QVGA 3OQMA 2V7QA 2FGJA 2XY4A 4H35A 1USUA 5CLLA 4EPTA 4JJ4A 2VSNA 5L7YA 3BH7A 1I8DA 2OYRA 5IJ0B 4P4SA 2DWUA 2VBCA 2O8BB 5EQTA 2EKZA 4TROA 5HFNA 2R6HA 1IHMA 1AKRA 2FPRA 2OKGA 2EL9A 3EQZA 3O94A 4LZLA 1TM1E 3D2BA 3WFIA 4IIDA 1H4VB 1J1IA 4PGHA 3DOFA 3FHOA 4RQUA 3A10A 1S5PA 2Z09A 2JVJA 1UK7A 4MQFA 4QVGA 5T41A 2QG4A 3DZFA 3F90A 4S1VA 4UUNA 4ARBA 4V2IA 2HFJA 5IM4F 2B82A 4TVKA 1V1MA 1JAZA 2C5HA 1I1HA 1V4NA 4ITUA 3JU3A 1Z16A 3W77A 5KTPA 1NQ5A 2F3QA 3H2YA 3D0KA 5GJCA 3VR2D 2FVYA 3CCBA 3WICA 3C4QA 5FTJA 4CM9A 4AZVA 4PG7A 2QRJA 2KS6A 2RHHA 3KLPX 2AJLI 5AM0A 4EW6A 3BA1A 5FUMA 1OFTA 1XN1A 2H2GA 3IUJA 5EJ7A 4MVCA 4XLHA 4P35A 4R81A 2JFVA 2Z08A 4GVPA 1SB8A 1X15A 5G0SA 2H1HA 5BT9A 1U3DA 2RK3A 3TZQA 1BAPA 1P0MA 4KFCA 1IN7A 2XLCA 4CM4B 2ZB4A 2XNCA 1DKQA 4RXTA 3CX6A 1OVMA 4I1YA 5E3JA 1H5NA 2DZDA 1N77A 1ZCJA 4GXRA 1NQAO 1G5FA 2LCQA 1S02A 1JQ5A 3FPKA 1SAYA 4JASB 1BXGB 3FB4A 4EABA 4JT9A 1N5LA 1Y8RA 3BXZA 4I55A 1PGJA 1QLJA 1SHZA 4Y6SA 4PYLA 1HTWA 1CETA 2RGNC 1FW8A 1DJQA 4PQGA 4BO0A 1FPMA 4OLJA 1IBKB 1LX7A 2NPFA 3NM6B 4N40A 2P5SA 2VJCA 3TLGA 2HUNA 3UAOA 1YR7A 3EUFA 4UULA 4D46A 3VAYA 4ZRNA 4NPAA 4RS4A 4Y9RA 1V6CA 2ZULA 3GDWA 4PZUA 3ASSA 4X1KA 2Q8QA 3BMQA 3RJMA 1Y7IA 5TMPA 2XZPA 3N0TA 4YRRA 2D3NA 4HMPA 4J2TA 4WASA 5EEHA 3ZK7A 1M34B 4IQFA 4JLPA 3R5FA 3SM9A 2ZBDA 1HM5A 2VBFA 2XRMA 3EXHB 2MU1A 1U1IA 2VJKA 2IA5A 2WILA 1LNSA 4REMA 1JR6A 4L02A 1SHUX 4OJMX 1DO2A 2P41A 1ADJA 3BIJA 5D2CA 5AT1A 4NYIR 1X9IA 1KJIA 3SXJA 4XRGA 3DXYA 3A4MA 3IP3A 1ZAYA 3NR2A 3CH7A 4H3HB 4E7PA 4ER6A 2XECA 1ZMOA 2CB9A 4REQA 4OHUA 1EZ1A 1Q57A 2H54A 1VF7A 1JHXA 3I2KA 4P32A 3A14A 5NLLA 4BVAA 1J9GA 4JLBA 5FJIA 4YR9A 3T5PA 1SEVA 4R2KA 2ZXUA 2C29D 3EGOA 3OD5A 1WZ2A 1EP1B 2B37A 4HRVA 1DRJA 2XWQA 4EWLA 1X14A 5EE1A 1N5KA 2RONA 1Z0JA 5EWMA 4ZI3A 1RNLA 1QK3A 3VYTB 4QICA 4O8CA 2QRLA 3MA0A 4P6VF 3MOIA 5DULA 1SHJA 1A7UA 2ZCVA 5EXTA 1ZVJA 4QU8A 1GKYA 5TF0A 1JR3A 1KJWA 3D6MA 1E7RA 4LDJA 1G5TA 2CMDA 2N9UA 2LKDA 3FUCA 1EB9A 1ZD2P 4FBLA 4X94A 4MUIA 3VNBA 5CB0A 4MICA 4HDOB 3T7RA 1LI7A 2IIQA 4LOAA 5KYXB 3ZVNA 3IDZA 4HN2A 3GJXC 5DK6A 2WV9A 3RIHA 1X92A 1HMYA 4LI3X 1WMDA 1NDHA 4P3IA 1F0KA 2Z4RA 3KJFA 4JITA 5EJ2A 3W05A 3PGLA 1VJGA 3UMFA 5EL0A 5KKAA 3PUIA 4I5DA 3CEAA 4F7WA 4CMCA 1Y5NA 3GLIE 1WWKA 3GWZA 4DSAA 1TB4A 3AETB 4DV3B 4A0HA 4ZZ1A 3R0ZA 4ETWA 2FP3A 3WNBA 3Q8XB 2LTAA 4GWLA 3PYLA 1CR6A 2BZ1A 3O3NB 4KLCA 2OV3A 4ZCTA 7GPBA 3L43A 3QVTA 1NRKA 4HGZA 3B2QA 1QHEA 5K0JA 4BWVA 4JMLA 4AN0A 4RXUA 2QTVA 2UZ0A 4B6SA 1VG8A 1IXZA 3FYDA 2F1HA 3GB9A 4XDZA 3ZGXA 4RGBA 1T34A 4D9MA 4R0MA 1G5QA 2W9XA 4WOPA 3VZBA 4U3JB 4B7CA 3QITA 4YRIA 4N54A 2WT4A 5B64A 3KSRA 1ZITA 2PZKA 1YU9A 2WC1A 1YHYA 3BMCB 3OF2A 4WY2A 4WZEA 3F4KA 5MFPA 1OIWA 3KVOA 5EZYF 3GGSA 1W581 4ZAZA 5HKKA 3K9HA 3WDMA 4X8OA 1M34A 4BYGA 2VTEA 3BEDA 1AD2A 2AOUB 2OCKA 3L1KA 2KE5A 3TTSA 4DV4B 2ZITA 1ZJZA 5TMBA 2IPXA 2PX3A 4URFA 3CCMB 1JXQA 3QLJA 5DGTA 1Q3KA 1T5LA 2P4EA 2JIDA 1GADO 3ISXA 2HDWA 3JQDA 2NSHA 4OGFA 2HCJB 4KQCA 1KI6B 3WGYA 4YAWA 4E31A 1PYGA 3JVVA 1QHHB 1S89A 2WM9B 4PZPA 3IO5A 4YV2A 2XOEA 3VYUB 3GLFE 1CSEE 1V8ZA 3T3NA 4CJXA 4DC1A 2QPAA 4PSVA 4BV3A 3WLRA 2P9EA 4PE5B 1KU6A 4Q4AA 5GJBA 1MB3A 1BH2A 2X8BA 3SX0A 3U44B 2A78A 2BCGY 1IN4A 2P6PA 3GUUA 2XQKA 3BCFA 3N74A 1G20E 4I4TB 3ZDAA 3I2HA 3FLAA 2VH5R 3MIZA 5B7PA 1QU2A 3PG5A 1NZJA 2Y9PB 3JPYA 1AQLA 1KFKB 1QGUB 4D9JA 3HK2A 3SLNA 1NLYA 4M55A 3FUWA 4RK0A 4U39A 1XJ5A 1KDZA 4D81A 1KP2A 3PEFA 3P2MA 2WB4A 3G9UA 1DT5A 3I53A 5EE0A 4KGDA 4DLRA 4FR5A 2IYXA 3ZBQA 4QV2A 2JCGA 1SZDA 7MHTA 1KMQA 5IM5A 4U8HA 5JVDA 4MP8A 1ZXXA 2V9CA 3VUEA 1YKSA 3U4QB 4WSOA 5EJ5A 2XUAA 2IDZA 1C50A 2QGNA 5HIIA 2CLSA 4Q00A 1N5IA 2L17A 3AP3A 4ADSG 1CS0A 4CMBA 4MPRA 5DYTA 2LCIA 1NP7A 2XYHA 5HTKA 3NIBA 3G9TA 1V8BA 1BH6A 3BHMA 5DXFA 2C2MA 2QBYB 5ICGA 4K9MA 5DH9A 1PR5A 3GLQA 1UD4A 3RABA 2KX7A 3JAKA 1H05A 4OGKA 4OY3A 1JEQB 3G9XA 1P7YA 3H1AA 1DC3A 4V0RA 4U02A 1U8TA 1NVMB 2ODPA 3EFHA 1HNWB 3WWEA 1U0FA 2QN3A 2YQ4A 1E6KA 3OZBA 4PGAA 1KJNA 1G4UR 2B8NA 1BG6A 2FG5A 2WHXA 4MS3A 1ONNA 4OIFA 1F7UA 3E03A 1QV9A 1GT6A 1W85A 5ECWA 1JHOA 3DV2A 1PJRA 4XIJA 3O84A 3H5OA 1XZQA 4IIXA 2ONZA 3R44A 4W1PA 3UJBA 3FETA 4KOAA 3WMFA 3COVA 2V59A 4LGYA 1LTKA 1GTMA 1KE2A 4BFYA 4TTPA 2ISSD 3MZ0A 3ZIUA 5FADA 2WHEA 2PD6A 2XV1A 4EO4A 3CCRB 1WUJS 1G8KA 3COPA 1SBYA 1JFTA 1UAYA 2V7VA 1VSUA 5BNWA 3D3NA 5JAMA 4ZYYA 5LR6A 2ZIVB 2ROQA 1PG2A 3WISA 1OBCA 2PM8A 3P71T 3T53B 1AKEA 4Y2YA 1Z2DA 5FA5A 4MV8A 3H8JA 5CM8B 5FYQA 4CLXA 4KRFA 4TZ6A 3N2ZB 1L5KA 3W6UA 1S4QA 5HZMA 4MW1A 2WSSD 3GFFA 4XSHA 3TTYA 2ZSFA 4O4HA 1RHUA 5I5GA 3HWX1 2A1TS 3D6FA 4L6CA 2GYVA 3OJLA 5F23A 1N2CE 1RLUA 4X7MA 4A2PA 3BRQA 3NORA 4REOA 5H70A 4ARVA 4F06A 4MLZA 2O14A 1Q95A 4JELA 5EMKA 3EPJA 3C5HA 1Y9ZA 4H7FA 1PZFA 5I48A 1EMDA 2VDKB 1X7WB 1E5QA 1BJKA 3O82A 2I3DA 4ZO9A 4FHDA 1G7RA 3VJLA 4BCCA 1N2CB 3GLHE 2A0WA 3OOWA 2QPOA 2OAGA 4HXFB 4NENA 4UUMA 3S1LA 1ZD5A 1UBNA 1LPOA 2P91A 3GRZA 4FTWA 2ZYWX 4XLFA 2VPZA 3DV9A 2NZVG 2V7XA 2I9PA 3E9NA 3IRVA 16PKA 2HEIA 2WIAA 3RYHB 3GUVA 2XW6A 3IBYA 2G04A 1QFZA 2FLWA 2J3MA 1RRGA 4NCIA 1PWZA 1KH2A 4GZ3A 5E6SA 3II6X 2WV7A 3U9LA 1HDGO 4YCNA 4I7EA 2ZI7A 3MMPA 1DXHA 3KKPA 3GEHA 2FY8A 1L1FA 4D8TA 1JWLA 4UE3S 2BRUA 4GMXA 4UPDA 1QKJA 4RMNA 4TKUB 2ZRDA 4UEWA 2IEIA 4KV7A 3V8EA 4HNAB 2PUAA 4KKXB 3W2GA 1EAYA 1ULBA 2ZRCA 3LNCA 3T9CA 4JNCA 3DC7A 5FOUA 5E1MA 1M83A 1N3IA 1X80A 3HGTA 4R2XA 4ZXPA 3NMUF 5DYNA 2G25A 4MP6A 2E2WA 2H5IA 2IEGA 4A6DA 4E14A 3AQIA 1MVOA 3V2HA 4RCYA 1LLUA 2OGZA 1FSZA 3UBMA 4FWBA 4J90A 4MHOA 4B17A 4C2BA 5KTSA 4HDNB 1DZ3A 1RJWA 3O8QA 1PJ3A 1ZXBA 3D6AA 2ECKA 1SXJA 2PS0A 2B4AA 3KEGA 3Q1LA 4ILKA 3RG8A 5JJIA 1PZMA 3K7EA 3ABSB 1IEWA 2C1ZA 4UHEA 4UHCA 1KDTA 1E60A 2H2DA 1T13A 3IUEA 1HO3A 5D5QA 1YS2X 1NIPA 3ZGNA 1VQ1A 4Z4RA 4H3SA 1BKSB 2Q5EA 3TPFA 2WF7A 3DFZA 3V2IA 4AMUA 1FB5A 4BU0A 5KQMA 2WNIA 4DTCA 5AVRA 4FQ8A 3PVDA 4AMZA 4YRNA 4NE9A 4UU1A 5BN4A 4OQNA 4IZOA 2A57A 3KO8A 2DAPA 1ZD4A 2UV8A 4DBVO 3DV0B 1CQPA 4JUIA 2ZJ3A 3NRBA 2WFLB 4E5PA 4HLUC 4LRXA 2XITA 3KNZA 4CT5A 3EG9A 3GF4A 3THWB 2JZCA 1JDPA 3Q7EA 5JRJA 4HYTA 2Z6BD 1U8FO 1UP4A 2JKVA 3GVCA 3IAM6 2OTCA 2HSZA 1AQJA 2HCFA 3UTDA 4M99A 4DVJA 1NKSA 5JCZA 4ZQCB 2Q21A 5JC8A 1ORDA 5IUNC 3DFKA 3Q9NA 5H3LA 3A6PC 5H1YA 4J0IA 3NBXX 1L4LA 1GDHA 4NAVA 1MAHA 1QQTA 1DEXA 1VSTA 2EFEB 2YXPX 4ZIRA 2V03A 4ZQHA 4IHAA 3CLSD 3KUDA 1P5HA 1QIKA 4MWCA 3KAJA 3PPXA 3QBJA 4G09A 3PWSA 1E1KA 1RRKA 3KJXA 4O33A 4H6XA 2IEDA 3G0OA 3IUMA 2B4RO 2OCPA 3OJCA 2VP6A 9ATCA 3HBMA 1JDJA 1MDFA 1CJBA 1X7XA 4EUHA 1JIJA 3KWFA 1PZEA 4BTLA 3NVDA 1G7SA 2QZPA 5J58A 3EW9A 4MUBA 3ROQA 2WVHA 2XVXA 4A5SA 3MRSA 3L4BC 2XGOA 3F3KA 4JC8A 1SUAA 4D3YA 1CZOA 2JFOA 2A0KA 5CLGA 5JS8A 3P0RA 5MGBA 2VDWA 4AI6A 2Y9MB 5FR1A 4LZNA 4IDDA 3I58A 1D07A 3TIIA 1G8PA 1H69A 2QN2A 3D3WA 3L0YA 3FDZB 3GPDG 3B6EA 2O9JA 3RIEA 3I56B 1EFDN 3MJCA 4A2QA 4XCXA 4OQEA 4DCPA 1WUTA 3CJRA 2K5UA 5BVHB 4C4OA 5CVTA 3VZCA 3ONEA 2UAGA 1FC0A 1OZHA 1KC8D 1RC1A 1OZ0A 1ULHA 2HN9A 2JLQA 2QL6A 5LCXA 5KNDH 2RHLA 3A3OA 2C8VA 5IHXA 5JR3A 3RS9A 2OSVA 2Q1SA 1QH1B 1GGKA 1XELA 4JEUA 1ODSA 3UATA 4RVFA 2JJ8A 3LWBA 1NULA 1EPUA 4JC5A 3S6JA 3TH5A 1Y3CE 4PC3A 1O95A 1WU7A 4CF7A 3AYXB 5D3QA 1TLFA 1QYXA 2NP7A 2XYQA 1GCGA 1K1EA 4XGRA 1DCMA 4FR0A 5DBFA 3T7EA 4LYHA 4XIFA 1YQEA 5BV1A 1CQIB 1I2ZA 1XVVA 5EAIA 4F3YA 5AKXA 2E89A 3PT5A 4IV5A 4RMJA 4C7OB 1MRSA 3I8XA 1UWKA 2UUOA 3UAGA 4IIBA 1GCOA 5JQWA 1U2GC 2QRUA 1ZC3A 3ZNNA 1KERA 1X9GA 2VQ3A 1I13A 1YV9A 1PFUA 5CLJA 1PR4A 2GM5A 4TSFA 4M0EA 2X4GA 4CMIA 3W04A 2OTLB 1KETA 2GN2A 3LCVB 4A1FA 1MGOA 3G6KA 1ZNXA 3E4CA 3ROFA 3S1AA 4BMYA 3QWIA 3IUSA 3PJDA 2JN9A 2PUWA 4LMPA 1DC6A 2ZR7A 4OJYA 2J30A 4Z2YA 5DE3A 2WDZA 1YRBA 2YYAA 1UXGA 4UMDA 4YUXA 5IM4A 4TSFD 3A9VA 3OIWA 4K81B 4RZXA 2I91A 3DEHA 1LK5A 3GA5A 3OURA 1XCJA 2HA5A 3SOZA 3ZCVA 3K0FA 1RQXA 1RBMA 1SKQA 4I5GA 3ENKA 1V3QE 1WSWA 1T2VA 4JSYA 2GJ4A 4EW1A 5CCXA 2BI7A 4H6WA 3SLDA 1EDZA 3GZJA 5TVKA 1JB1A 3NTLA 3ZGOA 2QD1A 1SBTA 4AF8A 4KE6A 4IG9A 2FP4B 1ZRSA 2VPQA 3K1AB 2YRFA 4Z0HO 5J2TF 1BPLA 5BOSB 8LDHA 1P8JA 4RJLA 2V9PA 1NYTA 4NBWA 3CUUA 5FNVA 1QYVA 1WXQA 2F3UA 3ZV4A 1XZJA 2WOOA 3QLEA 1KBZA 4KN6A 1TYAE 2JCXA 3OKXA 4MP3A 1E1MA 1XQWA 1YB1A 4LDNA 3TEFA 1L7PA 5ALLA 5LYJA 3TZKA 1XFAA 2EEZA 4R9UC 4DG5A 2IH2A 2FV8A 3Q85A 4QRDA 4WESB 3SIPA 3F71A 3NDJA 4XFKA 3I9V1 1WCYA 3BQNB 1N2GA 3JYHA 3R2JA 4RV5A 2A35A 4EGJA 1WHTB 2QYHA 3NPMA 4TYPA 3UMYA 1XHLA 4WN9A 4FM9A 1WKCA 3CIFA 3CPEA 4JCCA 3TW4A 4YAKA 2PZ8A 1H8HD 1MAWA 2F9LA 3IDFA 5FTKA 4BL5A 1TCCA 1TE2A 1G8SA 2ERCA 2YIJA 4OG2A 4URVR 2PEZA 5I01A 1JVNA 2GA9A 2WKPA 1GA1A 1K4YA 4RDIA 4Q9NA 4BV8A 1QVGB 1I24A 1TTTA 2Q1TA 4FXPA 5DCWA 2HF7A 4QDUA 4NZ9A 1RM0A 1H2YA 5AW0A 1NBME 5JMPA 1C7IA 1CIPA 4L3WA 2FPMA 3TLZA 1A9OA 1Y1LA 3THSA 5TNXA 3TN7A 5K5EA 5CM2Z 1SNYA 4QVKA 4K9NA 4NCNA 1H93A 1BN6A 4PVDA 2ZWMA 1DV2A 2HW8A 4XLEA 1E3DA 3IEUA 2X6YA 3IEXA 4TRJA 2JFWA 2ZJ5A 3KXPA 2HREA 1V5GA 4DBLC 4RVUA 1K86A 4M88A 5JNVA 4QWMA 1ISIA 2FWIA 1FDVA 1FCJA 4GLOA 3CUVA 4PR3A 3K1YA 3IJ5A 2O2JA 1IN8A 1PCXA 1CHDA 2YZ7A 3TR6A 4IOKA 5D5HA 1M1YB 5FLYA 1NT4A 2FRDA 3LU1A 4BLSA 5B57C 2B4YA 4KKUA 4GP7A 1FP6A 3HPQA 1ZM4A 1I32A 2JVKA 3CCFA 2X8KA 2IH4A 2ZYUX 1YL5A 3HR4A 4ME6A 2BCJQ 1FYFA 2IKQA 2Z0MA 1CJKC 4RM0A 2C9MA 3BFKA 3G1TA 2XAUA 5CX1B 4R68A 1QJ4A 4ZV7A 4EW3A 3OTHA 4NP6A 4NCJA 1YJXA 1L5FA 1XQ9A 2UVPA 3DS8A 2NUPB 3N3AC 3L0OA 4UEJA 2BONA 4IUBS 3ES9A 2BJVA 2G07A 5SZIA 3QXGA 3RLIA 1JSLA 5TRDA 2QLBA 2XVAA 4KWEA 4IPTA 4Y7DA 4ZQIA 4PYNA 4RYDA 1EINA 3KL4A 2H1IA 4UC0A 3K31A 5F3RA 3PC7A 4YWHA 1Q15A 1H1DA 5TRTA 3G2IA 2OBLA 3FR8A 2C83A 4WFKA 3WLOA 1XTRA 5CIYA 1E0JA 1VLHA 2CLHB 3DV0A 5MHTA 1FTGA 3VSEA 1Y6RA 4EVQA 5BNZA 3DTYA 3RUFA 5AVQA 5BN4B 1A2BA 4P82A 1M6HA 4RAQA 4IMJB 1ZG3A 3KOOA 3LF1A 3ZG6A 2H4WA 3FPCA 4CM8B 4UCQA 1GTVA 1VP3A 2X8JB 2Y93A 2OSBA 2BFFA 1QDLB 3QBDA 2MYTA 4ZAXA 1A2OA 1P7WA 2Y1WA 4UD6A 1K5GA 1V26A 2EDCA 2RB5A 2IXGA 3H05A 3U62A 3W2HA 4XWTA 1RADA 1FXUA 3HB5X 1FTQA 2RAUA 3UQYS 5BQXA 3I55B 2RK4A 3KXDA 3ANLA 4OYYA 1L1QA 3HGQA 1NV8A 3LX5A 2MDTA 3ITEA 2D59A 3OT4A 1MOSA 5AKKA 5BRNA 3HUDA 2HC9A 4MKRA 2GLTA 1Q7RA 4XAQA 2HTFA 1IHYA 3O7WA 1M0SA 3JQ8B 4LBYA 5JNUA 3S7ZA 2XRYA 4R8VA 1X80B 1F38A 4AW9A 3HCCA 3HHPA 2JZOA 3O1IC 4H0CA 5ALSA 3FVWA 3IQZA 3Q4GA 4HHEA 4RK6A 4YUAA 3ZQ6A 5K09A 2A8YA 3DTNA 3FPHA 2FCAA 3H8SA 4LJSA 3W5JA 3UUGA 4D4MA 2YHUA 1S96A 2Q46A 4YV1A 5A3RA 4ND8A 2IZ5A 2YWFA 9LDBA 4NU6A 2OFFA 1GYRA 4UTXA 2PL5A 2QR2A 2D00A 2HO5A 4C3OB 3AR7A 4WXYB 2C59A 3EIEA 5DI9A 1NXTA 2D8AA 3TZCA 1L6IA 2CUKA 2VIIA 4XIIA 4H1HA 2AI3A 2C8JA 3FUTA 4FD2A 5FPQA 4X1IA 3RFVA 5KWSA 1CQJB 1KI2A 2ASEA 2W2TA 2ISQA 3F7OA 3LHKA 4LJRA 3W8DA 2CXUA 4LHVA 4TS3A 1YE8A 4PPFA 1EFLA 3E3AA 3R5XA 3SI7A 2JJQA 5KTRA 4ND7A 4UHJA 1XVAA 2EG9A 2D74A 2WAXA 2FEWB 4LISA 2IZ6A 3FSJX 1QK4A 3KX2A 4M9QA 4H1WA 5CDFE 1VQ9B 2P5YA 1P2TA 1EVZA 4NPHA 1KYTA 1YBHA 3AHJA 2JLWA 2EFJA 3OKPA 3DO6A 5JAOA 1CY8A 4GX2A 4EW2A 5TIIA 4M1YA 2ZVDA 1QYWA 4DLSA 2R1UA 3TZBA 1HT0A 1QHGA 5DO9A 3FVTA 4HRAA 1H2EA 3E3OA 4C7VA 2JFBA 3CA8A 3FNBA 3O2QB 4IZHA 3ZWAA 3Q5EA 3UH1A 6YASA 4P08A 2AE1A 2ZUFA 4LVUA 4RACA 2G67A 3T1QA 3A0UA 3DP7A 1L6RA 1XHFA 3E0XA 3PS9A 3O4JA 1V8DA 4JSTA 4NOKA 3SKBA 5AM2A 3DTVD 2IWHA 4RSMA 5BWNA 3KUCA 1J49A 1MCZA 1ZRNA 1EHCA 4BNDA 3Q41A 2HL6A 1JQAA 4ZREA 1ZHHA 4WOCA 5AVXA 3BZUA 3VR6H 2QZ4A 5A4DA 4YELA 5BUZA 1YOVB 3I6MA 2C0QA 3S8YA 4FCWA 5REQB 5EJEA 1RJFA 2YWRA 2OV4A 1VBNA 2JB9A 3QHQA 4LMRA 4Q9DA 4LY3A 3TQTA 4GZMA 4CQJA 1FJHA 1Z0UA 2CL5A 3P2KA 1E69A 1P4RA 3A6KA 4UUAA 3UHPA 4JLMA 1PYOA 2CJXA 2QU8A 4YMVA 1CUXA 2Q6TA 1B2RA 1DMRA 2MSDB 3H2SA 1LVHA 4BO1A 4D43A 3LXXA 4QGBA 1D7AA 1EEHA 4AYWA 3SD7A 5FPSA 2ZRKA 3ZIAA 3GUZA 3U4AA 1Y4ZA 3H1FA 1GTRA 4JL6A 4NDNE 4CXMA 2B7BA 3C74A 3JQAA 3ECSA 2Q29A 3DDHA 4ZVQA 1RHRA 5L51A 4I81A 2RFLA 1BYUA 3B1VA 3DVAB 3F7NA 3C70A 1NW8A 4PV7A 3KLMX 3VDQA 3V8VA 2ZBVA 3QG1A 3WLHA 8MHTA 3UGJA 4MRMB 4GMGA 2AOTB 3ZZ1A 3HBJA 3KQQA 4YRCA 1D0VA 5C3UA 4XNFA 1AOXA 2KLHA 2RH4A 1EGMB 1M2JA 1ZOOA 2O2IA 2JGDA 2PN1A 3BWMA 3KZXA 4WZLA 1JXAA 1K5PA 2RSLA 3MCZA 5EIAA 3RVQA 1NJID 1G2OA 3L7BA 3AH8A 2R7MA 1N6OA 4DCCA 3HKDA 1NR1A 1XMJA 1PF7E 3SK0A 1D2EA 4GOXA 2YY6A 4A8TA 4D9HA 1VHQA 1K5DA 1H85A 2RCYA 1GZ5A 5JXGA 5K8JB 5CFZA 3SNKA 2H5LA 3DBRB 1XPRA 1SBCA 3H7IA 2J7PA 4M9ZA 2ZKIA 4TWAA 4PYOA 4JOSA 2V4DA 3GVHA 4MINA 3PNBA 3DO5A 4IIUA 4EMUA 5CYPA 5C1DA 1O9BA 4DLWA 721PA 1WKBA 1ODTC 1BE0A 1W30A 5G02A 3V1NA 3N7TA 3E6AA 4RH1A 4ACAA 3AEZA 4FCCA 3Q6QA 2J5RA 1W75A 4MVJA 1T8WA 4IDQA 2F4VB 1WOOA 4U8GA 1XEXA 5AK0A 4DA9A 4X90A 1MOPA 5CVUA 4DHWA 3KZCA 3O95A 4MMXB 5CT4A 3H97A 4OU4A 1I6WA 1V95A 3R3JA 4MZXA 2YH2A 5J59A 3PUWA 3QYAA 5AYVA 4J0QA 2BMAA 1OT3A 3WMXA 1ID8A 5BSYA 1H22A 4KPFC 3VHRA 4DKJA 3OLQA 2XWBF 3HBAA 4LYFA 3G13A 1EDDA 3NV7A 2G9VA 4L2IB 3ZWXA 3IFSA 1YAHA 1UDXA 1K4MA 3UIEA 4D74A 3O4HA 5K9ZA 1TMYA 2QD3A 1F48A 5FWDA 3RYIA 2RHDA 1KFEB 2FZLA 4Y9UA 1C8KA 1XMSA 2H0AA 4NNJA 2YJNA 4LXHA 1XGKA 1FSPA 4UBKA 1QG6A 3G0CA 1CKEA 1ODIA 4IDEA 3A1NA 1VKNA 1RI3A 3OQOA 3QU5A 2QN9A 1YS4A 1DSSG 3GGGA 5DGXA 3H5IA 5BRAA 4MYCA 3R7FA 5I47A 1OJ7A 5JD4A 4ASUA 3IKMB 4BB9A 3HSSA 1Q7YD 5L7TA 2WICA 3EMVA 3A2NA 3IURA 4MRPA 4ZA2A 2MYUA 4I2NA 2GM4A 1I4OA 2DHQA 2ZIXA 5IFKA 3RK0A 3ER9A 4FLFA 1CRWG 3A2LA 3O8RA 1RKUA 4E32A 4KW7A 2XB6A 4N47A 4POOA 2ZI4A 3GRFA 4URYR 1FYEA 1P77A 2G1KA 1C9MA 4UNSA 3X2FA 3DOEA 4UDNA 4QOIA 1PNTA 1KY4A 3H8VA 4HGQA 2DB3A 2BF4A 4J94A 1CUWA 4TTVA 3SMVA 1J5XA 4JB8A 1UAGA 2B25A 4FUQA 5AJHA 2AKAB 3WKAA 1EUQA 2G63A 4Z9BA 1C4OA 3FHLA 2ENWA 2CXHA 4PO9A 1Y5MA 1VJ5A 1WIWA 4IXWA 1VSQA 5ETJA 3UXMA 2PJRA 2JEOA 2IU0A 3JQBA 1ST3A 1ZH4A 3K92A 3GARA 1T3GA 4D25A 3C3DA 1QR2A 1OHHA 1N2HA 2E48A 2C2WA 4EUKA 2O8CB 4DZZA 2AYYA 1L5LA 4P86A 4FILA 4O0LA 3VJKA 5HCUA 4X62B 4QT0A 3N05A 5JEEA 3K4QA 3ONDA 2HGZA 2P9GA 3C3JA 5P21A 3K70C 2CFOA 1ES9A 1ZIDA 2EJTA 1CFJA 1WCIB 3OLWA 13PKA 2CLOB 1FFBA 1SCNE 3N0VA 4ZARA 4BO5A 4ZJZA 4R8RA 1U0RA 1OBOA 1AN0A 2W43A 3EXFA 2PBZA 3SZUA 4PZ0A 5CAEB 1L5GB 3FYHA 4CNQA 5AXCA 1R6VA 3HDHA 3NO4A 3WC4A 4CQLA 2CUZA 4YALA 4UTNA 1FFCA 3HCDA 5HIKA 1JNYA 1NTRA 4PAMA 5JNRA 3CVYA 3IBTA 3SEJA 2CN1A 4I4IA 4X7PA 5AQEA 1RWXA 2XA2A 2QL5A 3MPUA 5KO2A 3TW0A 2FMXA 1X1EA 1W2WB 3ER6A 4C76A 3GDOA 3UGTA 3JQEA 4IBOA 2C7QA 2FQ1A 3GLHB 3H5AA 1C9JA 3MJFA 2IU3A 3QNWA 3V4VB 4AYTA 4HIZA 3INYA 4KVFA 1VB3A 3O3MB 4D6YA 4DMCA 1E3SA 3WO0A 4UU0A 5HZHA 1QF9A 5FBWB 5ITVA 2PO7A 5KHLB 4XQ0A 3MJVA 3JS5A 3GLGA 5DW3A 1W88B 2F17A 2V7EA 4M87A 3OESA 4BP9A 3QSYA 3DP9A 4MW2A 3WSTA 2Z4TA 4Z51A 2R1ZA 3OSUA 1C9NA 3QWFA 4BFCA 1JG1A 4OQDA 3P27A 1YHQB 1T8PA 1UKYA 3RAPR 3RS3A 5LQMA 4WJKB 2HJHA 2VXOA 1T25A 2XADA 3HCRA 3I2IA 1A2KC 1QRDA 2WMYA 4IGKA 4O4LF 4P3KA 2NYAA 1DP4A 3OT1B 3WHKA