3BNWA

Crystal structure of riboflavin kinase from trypanosoma brucei
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
172
structure length
160
Chain Sequence
HMRQTGSFQPFFLRGKVVHSQLGFPTANIGLDKDVMECLQPYKNLVVYGWGTVSQVPGKERESFGPYPFAASIGFNTLTVEPYFLHEFGWDFYGAVVKIIVLGEIRSMGSFHSLQALVDTIKSDVQFTRDMLQKPQLQEFSRHSLFESPSSTIPYFEDLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Riboflavin kinase, putative
publication title Riboflavin kinase from Trypanosoma brucei.
rcsb
source organism Trypanosoma brucei
total genus 32
structure length 160
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2007-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 3bnwA00
5TRDA 3OP1A 5A89A 2VBUA 1N05A 1P4MA 1T6ZA 5FO0A 1MRZA 3ZUGA 2VBSA 2VBTA 1Q9SA 1N07A 1NB9A 5FNZA 1NB0A 3CTAA 1N08A 1S4MA 1T6YA 5A8AA 1T6XA 2I1LA 4UZFA 4UZEA 1N06A 3BNWA 2VBVA 5A88A 2OYNA 2P3MA 5FO1A 2X0KA
chains in the Genus database with same CATH superfamily
4XMYA 1FDRA 3CCEB 3VNUA 1DG1G 2X85A 2CK3A 1P4MA 2ZZGA 2WSSA 1WORA 1D1NA 1PJ5A 3AVTA 3Q38A 4K1XA 1HVXA 1BQEA 2QTZA 3OW2B 3A8IA 2B7BA 3CMMA 4P22A 4TMXA 5E6TA 4OPVA 2GJKA 2HCJB 4RD4A 5FNZA 5KSWB 1WSRA 4JMQA 2NV4A 4XKVA 1VQ6B 3CC7B 1YLOA 4NBSA 3E20A 3SLDA 1YX2A 2C2WA 1GO2A 2ZXIA 1JA0A 2RC6A 2WJVA 4ZGQB 1VQLB 2ZXHA 2D9RA 1ZM3A 4M0LA 1M1KD 1EFCA 1YJ9B 1OHHA 1S0UA 1QGYA 2ZZQA 3OPOA 3ZZ0A 3QFSA 1TLLA 3ZZUA 3QFRA 4B44A 4DNRB 3CCLB 1VLOA 1Q81D 3A3BA 3CC4B 3CCRB 3OZWA 4Z4SA 1GAQA 2BV3A 3OEHA 1XB2A 1K8AD 2ZTGA 4Z4UA 3CCVB 2ZTNA 2D3LA 4XLAA 1BX0A 4XONA 2BF4A 1VQ7B 3A1PA 1S4MA 3OEEA 1T6YA 4Z4RA 3PUMA 5LMZA 1R5BA 1VQKB 1WOSA 1GJRA 1EFTA 2X6WA 2WJYA 1AIPA 3OOCA 5KNLA 1KMHA 2YWGA 1S72B 3CCUB 1VJSA 4WZLA 1W2BB 2QMUA 1MRZA 1UMKA 4B3GA 1CNEA 5DSZA 1A8PA 4X7FA 4OPSA 2CW5A 4ACAA 4ZCMA 1OB5A 1YHQB 3R6KA 5DN6A 1KZLA 3ISXA 1DDIA 4PGOA 1WTHD 2FX3A 1KK0A 5F4OA 3J81k 3BY1A 4RDJA 3MHPA 4YHBA 2ZL6A 1KK2A 4XR6A 1FRQA 1T6XA 4XLHA 2ZBVA 4Z1MA 1VQ9B 2P3MA 5F4JA 3VR6A 2GJPA 3WYAA 3NE5B 3BCDA 3ZIAA 5BSYA 4OPOA 1E3XA 4YALA 4YAOA 2XEXA 3VO1A 3I1FA 3CCSB 4Z4TA 1E1RA 1V0EA 1W0KA 2DOGA 3W5VA 1Q9SA 4EH1A 2DIEA 2HLDA 3BC9A 2BM1A 4TSFA 2Q6OA 1VQ4B 3KEWA 3CTAA 1N08A 3W5HA 2Q6LA 2DYIA 4UZFA 1K9MD 2HMAA 4HE5A 1COWA 2JJ1A 3QE2A 2V7TA 4GQNA 4ROXA 2XNJA 4X05A 1W35A 3ASQA 3CD6B 2WZNA 1VLYA 4UAJA 5IYQA 2BSAA 1KD1D 1G7SA 4DK1A 1IB0A 1KQSB 3GVLA 1N0UA 2B5OA 2YWEA 4RD6A 1YI2B 1E79A 1G7CA 4QUZA 5IYWA 4RPBA 5FA6A 1Y0RA 3A35A 4KKTA 1ZUNB 3AVXA 4CQJA 1I8DA 3ZBTA 2D74A 4E0FA 4PABA 2NPFA 4DQLA 1PJ6A 1FNBA 1CQXA 1QGAA 4AC9A 4RD1A 4LBYA 1QG0A 3JQRA 5IYNA 1SKQA 2M5SA 2WZPP 4G5GA 3ZPNA 3B82A 2V7WA 5TRDA 4P9SA 3OP1A 1D2EA 2BVNA 3B78A 3OJXA 1E62A 2X6YA 2EFGA 3W2IA 1G7RA 3R6JA 5FL7A 3W2GA 1N8RD 3WNDA 1JJ2B 2VNHA 4FK8A 4RDLA 4ACBA 2EIXA 5TY0A 1Q86D 3KL9A 4RDKA 2LZJA 1V5VA 3FJOA 3OAAA 3RY8A 4P25A 2W6JA 1JB9A 3GIRA 3I55B 4UZUA 2QE7A 3CW2A 3AVUA 4XKWA 2ZBUA 3PA1A 1IJFA 2VZLA 3H9NA 4RCZA 4ZV4A 3CRZA 1EFUA 4QV2A 2Q6KA 2PLFA 2VNJA 3AVYA 3Q39A 1VHEA 4PC6A 3CPXA 4XNFA 2C5HA 2OYNA 3WBJA 3VMFA 4ZGNB 2XZPA 4P6YA 4X7CA 1VQ8B 1N05A 3CPWB 1EFRA 3SEJA 4P2NA 3CMEB 4Y9RA 1QFZA 3SJPA 1YIJB 2GJRA 3ASSA 1DDGA 2C4UA 1H85A 2C4TA 4G1BA 2W6IA 4FWTA 4P26A 1E63A 5H59A 3BY2A 4U9UA 1TVCA 4QFMA 4PAAA 1VQOB 4M53A 2F43A 3CP2A 4P3IA 2GK6A 2KVOA 5KW9A 1BLIA 1UD5A 1ELOA 1KC8D 3I56B 3G4SB 3MMPA 4N3GA 1QUEA 1ZM4A 2BPOA 4H9GA 4Y9UA 1NBMA 1EWYA 1K28D 1U2RA 2BMWA 2CBXA 4B48A 2VNKA 4RD0A 1VQNB 3W2FA 3W2EA 5A89A 5CDFA 2XNCA 1SM4A 4TN1A 2V7XA 4RD3A 5J35A 3VNVA 3WBKA 5L46A 2CF4A 3LQEA 4Z4YA 4LBZA 3G05A 3LO8A 3P26A 1UD4A 1OB0A 2ZITA 1F20A 4YXWA 1UD8A 3G6EB 3FPKA 2D3NA 5GV8A 3OKXA 4XLFA 1EP2B 4YAFA 4BPRA 1QFYA 1KTVA 3B8HA 5GV7A 2I1LA 2PMDA 3BNWA 3QSYA 4P12A 1AMOA 3CCJB 3SJZA 5HZAA 5FO1A 2Z6BD 1WSVA 4TMZA 4WZEA 2X6XA 3D26A 1I18A 1QFJA 2V7VA 4RD2A 1M90D 4X0CA 1E64A 1NDHA 2FVGA 4YAWA 2BGJA 1DARA 1NRKA 4YEJA 4X07A 4X7EA 4Z4VA 4II3A 3ONYA 4TMVA 1JA1A 3A3GA 1Q82D 2DCUA 3ASPA 4DQKA 3G71B 3GQBA 4UZEA 2C77A 3MCAA 4M1KA 4G6IA 4XN0A 1WU8A 5J3OA 1YJNB 2GK7A 4AVZA 1WPCA 3U6KA 1VHOA 3CCMB 3T51B 4PC2A 3CCQB 3CMAB 2JJ2A 1RQPA 4DNTB 3SKBA 3CESA 1T6ZA 2QTLA 4NCNA 1EP1B 5B6IA 2JDIA 1UD3A 2BM0A 2R6HA 4PC7A 3ASTA 4DK0A 5FIUA 2E1BA 5TR9A 1NB0A 2AHOA 4WWVA 5H5JA 1VQ5B 1W0JA 1HZEA 4X06A 4AF7A 3CB4A 3AGQA 3ES9A 1YJWB 1BMFA 3PENA 4RJLA 1WOPA 3ZBUA 4XOPA 2OTLB 3AGPA 4FXUA 1EP3B 1K73D 1TUIA 2XNDA 1Q7YD 2F1MA 5HKKA 2XOKA 1VQPB 1GAWA 2VBSA 4ZCIA 2VJJA 3PVDA 1E1QA 3PUNA 1NJID 1QVFB 2JIZA 4RM0A 3BQJA 1KK3A 3ASRA 1WOOA 4HE6A 4J0QA 2V7QA 4XL9A 4L8JA 2WPDA 3JQQA 1E3ZA 4FN5A 4II2A 2OBSA 1QVGB 4XN3A 4KKSA 1WP6A 1BPLA 1R5NA 4TKOB 1W34A 1QUFA 2OBRA 2QEXB 4OOSA 1GR1A 1FX0A 2DEUA 1CNFA 4N3NA 2X0KA 4B4DA 3OE7A 4NNJA 3V7AA 2VBUA 4WZKA 2PE3A 3WXMA 3AVVA 3WQZA 4M4SA 4OP7A 1UD6A 3WY9A 1IHMA 4XM3A 2OBTA 3E1YE 2VBTA 2F1LA 4KKUA 3A8JA 1H8HA 1W87A 4P3YA 5THXA 4MYUA 1N07A 3OW7A 2V31A 4QHYA 1FNCA 1HA3A 4RPDA 3LNNA 2VJIA 2DY1A 1T5EA 3SLNA 3ZC3A 1QH0A 1VQMB 1XE1A 1VF7A 4B43A 1KRHA 4QVAA 1SKYB 1E43A 1Y0YA 4G7XA 2V7UA 2WR8A 4B3FX 1IJEA 1R5OA 2F4NA 4YELA 5AN9A 3HAGA 5FO0A 4HIZA 4RLZA 2BN4A 2VNIA 1ZM9A 1H8EA 2C78A 3CP8A 1ZM2A 2OK8A 3Q3AA 3FKSA 3Q6RA 4R71A 4X8IA 1MABA 2C5BA 3W5UA 4YAUA 2QA4B 4XOTA 5A8AA 1N0VC 2DERA 4P6VF 3CXCB 2GPJA 4Z4WA 1OB2A 2XGJA 5F4MA 3LVBA 2BGIA 3T53B 3VO2A 4F7DA 4XLCA 1XFOA 3LQ6A 4WQMA 1YITB 3ZUGA 4Q7JB 1J9ZA 1UD2A 4IW3B 2B7CA 2OK7A 1WDTA 4LC0A 2XZLA 1D8TA 5TV2A 3Q6QA 1XQBA 4XQFA 3A8KA 1NB9A 3OZVA 2PIAA 4WZTA 4C0SA 3V76A 5BSXA 1TTTA 5HZBA 3ONUA 4B47A 4XD7A 1PKVA 2VYQA 2WYRA 1H42A 3AVWA 4MYTA 2VBVA 1B23P 5A88A 1FRNA 1I7PA 2CC2A 5HXBA 4P1VA 4TMTA 4B3XA 3H94A 2CRVA 4LBVA 3W2HA 5IYRA 2OTJB 4G7WA 5DS0A 3DDYA 1KK1A 3ZZTA 2V4DA 2HDNB 1OGIA 4XLEA 4PC3A 3FPPA 4ASUA 2ZL7A 2JN9A 1OGJA 3OFNA 4RCYA 2QDXA 1BJKA 3P27A 4ZCLA 3OZUA 3GVJA 3WNBA 4TT3A 3OJWA 2YWFA 4Z4ZA 2X3UA 3CC2B 3WNCA 3PA2A 1FNDA 1GVHA 5JBQA 1W9XA 4PC1A 1N06A 4XORA 1F60A 3QFTA 1RQRA 4QVJA 2XZOA 2RC5A 1PJ7A 1KJZA 2YWHA 2QN6A 2J7KA 1JNYA 4Y7CA 2X53S 2QGGA 2CNDA 3GVKA 4M2LA 3T56B 4OOXA 3U6BA 1G7TA 3QFCA 4AF6A 1V0FA 4LBWA 1BX1A 4TMWA 5EMNA 4C43A 1QX4A 2E1RA 1B2RA 2Q6IA 2ZL5A 4X7DA 3JU4A 3GSIA 2ZZEA 2X8KA 2GQFA 3JQPA 5IYPA 3U2QA 2DETA 4OOVA 1FNMA 5IK2A 2GREA 3BCFA 3BH4A 1EXMA 1QGZA 2R9VA 2ZZFA 4G1VA
chains in the Genus database with same CATH topology
5TRDA 3OP1A 5A89A 2VBUA 1N05A 1P4MA 1T6ZA 5FO0A 1MRZA 3ZUGA 2VBSA 2VBTA 1Q9SA 1N07A 1NB9A 5FNZA 1NB0A 3CTAA 1N08A 1S4MA 1T6YA 5A8AA 1T6XA 2I1LA 4UZFA 4UZEA 1N06A 3BNWA 2VBVA 5A88A 2OYNA 2P3MA 5FO1A 2X0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TRD A;  3OP1 A;  5A89 A;  2VBU A;  1N05 A;  1P4M A;  1T6Z A;  5FO0 A;  1MRZ A;  3ZUG A;  2VBS A;  2VBT A;  1Q9S A;  1N07 A;  1NB9 A;  5FNZ A;  1NB0 A;  3CTA A;  1N08 A;  1S4M A;  1T6Y A;  5A8A A;  1T6X A;  2I1L A;  4UZF A;  4UZE A;  1N06 A;  3BNW A;  2VBV A;  5A88 A;  2OYN A;  2P3M A;  5FO1 A;  2X0K A; 
#chains in the Genus database with same CATH topology
 4XMY A;  1FDR A;  3CCE B;  3VNU A;  1DG1 G;  2X85 A;  2CK3 A;  1P4M A;  2ZZG A;  2WSS A;  1WOR A;  1D1N A;  1PJ5 A;  3AVT A;  3Q38 A;  4K1X A;  1HVX A;  1BQE A;  2QTZ A;  3OW2 B;  3A8I A;  2B7B A;  3CMM A;  4P22 A;  4TMX A;  5E6T A;  4OPV A;  2GJK A;  2HCJ B;  4RD4 A;  5FNZ A;  5KSW B;  1WSR A;  4JMQ A;  2NV4 A;  4XKV A;  1VQ6 B;  3CC7 B;  1YLO A;  4NBS A;  3E20 A;  3SLD A;  1YX2 A;  2C2W A;  1GO2 A;  2ZXI A;  1JA0 A;  2RC6 A;  2WJV A;  4ZGQ B;  1VQL B;  2ZXH A;  2D9R A;  1ZM3 A;  4M0L A;  1M1K D;  1EFC A;  1YJ9 B;  1OHH A;  1S0U A;  1QGY A;  2ZZQ A;  3OPO A;  3ZZ0 A;  3QFS A;  1TLL A;  3ZZU A;  3QFR A;  4B44 A;  4DNR B;  3CCL B;  1VLO A;  1Q81 D;  3A3B A;  3CC4 B;  3CCR B;  3OZW A;  4Z4S A;  1GAQ A;  2BV3 A;  3OEH A;  1XB2 A;  1K8A D;  2ZTG A;  4Z4U A;  3CCV B;  2ZTN A;  2D3L A;  4XLA A;  1BX0 A;  4XON A;  2BF4 A;  1VQ7 B;  3A1P A;  1S4M A;  3OEE A;  1T6Y A;  4Z4R A;  3PUM A;  5LMZ A;  1R5B A;  1VQK B;  1WOS A;  1GJR A;  1EFT A;  2X6W A;  2WJY A;  1AIP A;  3OOC A;  5KNL A;  1KMH A;  2YWG A;  1S72 B;  3CCU B;  1VJS A;  4WZL A;  1W2B B;  2QMU A;  1MRZ A;  1UMK A;  4B3G A;  1CNE A;  5DSZ A;  1A8P A;  4X7F A;  4OPS A;  2CW5 A;  4ACA A;  4ZCM A;  1OB5 A;  1YHQ B;  3R6K A;  5DN6 A;  1KZL A;  3ISX A;  1DDI A;  4PGO A;  1WTH D;  2FX3 A;  1KK0 A;  5F4O A;  3J81 k;  3BY1 A;  4RDJ A;  3MHP A;  4YHB A;  2ZL6 A;  1KK2 A;  4XR6 A;  1FRQ A;  1T6X A;  4XLH A;  2ZBV A;  4Z1M A;  1VQ9 B;  2P3M A;  5F4J A;  3VR6 A;  2GJP A;  3WYA A;  3NE5 B;  3BCD A;  3ZIA A;  5BSY A;  4OPO A;  1E3X A;  4YAL A;  4YAO A;  2XEX A;  3VO1 A;  3I1F A;  3CCS B;  4Z4T A;  1E1R A;  1V0E A;  1W0K A;  2DOG A;  3W5V A;  1Q9S A;  4EH1 A;  2DIE A;  2HLD A;  3BC9 A;  2BM1 A;  4TSF A;  2Q6O A;  1VQ4 B;  3KEW A;  3CTA A;  1N08 A;  3W5H A;  2Q6L A;  2DYI A;  4UZF A;  1K9M D;  2HMA A;  4HE5 A;  1COW A;  2JJ1 A;  3QE2 A;  2V7T A;  4GQN A;  4ROX A;  2XNJ A;  4X05 A;  1W35 A;  3ASQ A;  3CD6 B;  2WZN A;  1VLY A;  4UAJ A;  5IYQ A;  2BSA A;  1KD1 D;  1G7S A;  4DK1 A;  1IB0 A;  1KQS B;  3GVL A;  1N0U A;  2B5O A;  2YWE A;  4RD6 A;  1YI2 B;  1E79 A;  1G7C A;  4QUZ A;  5IYW A;  4RPB A;  5FA6 A;  1Y0R A;  3A35 A;  4KKT A;  1ZUN B;  3AVX A;  4CQJ A;  1I8D A;  3ZBT A;  2D74 A;  4E0F A;  4PAB A;  2NPF A;  4DQL A;  1PJ6 A;  1FNB A;  1CQX A;  1QGA A;  4AC9 A;  4RD1 A;  4LBY A;  1QG0 A;  3JQR A;  5IYN A;  1SKQ A;  2M5S A;  2WZP P;  4G5G A;  3ZPN A;  3B82 A;  2V7W A;  5TRD A;  4P9S A;  3OP1 A;  1D2E A;  2BVN A;  3B78 A;  3OJX A;  1E62 A;  2X6Y A;  2EFG A;  3W2I A;  1G7R A;  3R6J A;  5FL7 A;  3W2G A;  1N8R D;  3WND A;  1JJ2 B;  2VNH A;  4FK8 A;  4RDL A;  4ACB A;  2EIX A;  5TY0 A;  1Q86 D;  3KL9 A;  4RDK A;  2LZJ A;  1V5V A;  3FJO A;  3OAA A;  3RY8 A;  4P25 A;  2W6J A;  1JB9 A;  3GIR A;  3I55 B;  4UZU A;  2QE7 A;  3CW2 A;  3AVU A;  4XKW A;  2ZBU A;  3PA1 A;  1IJF A;  2VZL A;  3H9N A;  4RCZ A;  4ZV4 A;  3CRZ A;  1EFU A;  4QV2 A;  2Q6K A;  2PLF A;  2VNJ A;  3AVY A;  3Q39 A;  1VHE A;  4PC6 A;  3CPX A;  4XNF A;  2C5H A;  2OYN A;  3WBJ A;  3VMF A;  4ZGN B;  2XZP A;  4P6Y A;  4X7C A;  1VQ8 B;  1N05 A;  3CPW B;  1EFR A;  3SEJ A;  4P2N A;  3CME B;  4Y9R A;  1QFZ A;  3SJP A;  1YIJ B;  2GJR A;  3ASS A;  1DDG A;  2C4U A;  1H85 A;  2C4T A;  4G1B A;  2W6I A;  4FWT A;  4P26 A;  1E63 A;  5H59 A;  3BY2 A;  4U9U A;  1TVC A;  4QFM A;  4PAA A;  1VQO B;  4M53 A;  2F43 A;  3CP2 A;  4P3I A;  2GK6 A;  2KVO A;  5KW9 A;  1BLI A;  1UD5 A;  1ELO A;  1KC8 D;  3I56 B;  3G4S B;  3MMP A;  4N3G A;  1QUE A;  1ZM4 A;  2BPO A;  4H9G A;  4Y9U A;  1NBM A;  1EWY A;  1K28 D;  1U2R A;  2BMW A;  2CBX A;  4B48 A;  2VNK A;  4RD0 A;  1VQN B;  3W2F A;  3W2E A;  5A89 A;  5CDF A;  2XNC A;  1SM4 A;  4TN1 A;  2V7X A;  4RD3 A;  5J35 A;  3VNV A;  3WBK A;  5L46 A;  2CF4 A;  3LQE A;  4Z4Y A;  4LBZ A;  3G05 A;  3LO8 A;  3P26 A;  1UD4 A;  1OB0 A;  2ZIT A;  1F20 A;  4YXW A;  1UD8 A;  3G6E B;  3FPK A;  2D3N A;  5GV8 A;  3OKX A;  4XLF A;  1EP2 B;  4YAF A;  4BPR A;  1QFY A;  1KTV A;  3B8H A;  5GV7 A;  2I1L A;  2PMD A;  3BNW A;  3QSY A;  4P12 A;  1AMO A;  3CCJ B;  3SJZ A;  5HZA A;  5FO1 A;  2Z6B D;  1WSV A;  4TMZ A;  4WZE A;  2X6X A;  3D26 A;  1I18 A;  1QFJ A;  2V7V A;  4RD2 A;  1M90 D;  4X0C A;  1E64 A;  1NDH A;  2FVG A;  4YAW A;  2BGJ A;  1DAR A;  1NRK A;  4YEJ A;  4X07 A;  4X7E A;  4Z4V A;  4II3 A;  3ONY A;  4TMV A;  1JA1 A;  3A3G A;  1Q82 D;  2DCU A;  3ASP A;  4DQK A;  3G71 B;  3GQB A;  4UZE A;  2C77 A;  3MCA A;  4M1K A;  4G6I A;  4XN0 A;  1WU8 A;  5J3O A;  1YJN B;  2GK7 A;  4AVZ A;  1WPC A;  3U6K A;  1VHO A;  3CCM B;  3T51 B;  4PC2 A;  3CCQ B;  3CMA B;  2JJ2 A;  1RQP A;  4DNT B;  3SKB A;  3CES A;  1T6Z A;  2QTL A;  4NCN A;  1EP1 B;  5B6I A;  2JDI A;  1UD3 A;  2BM0 A;  2R6H A;  4PC7 A;  3AST A;  4DK0 A;  5FIU A;  2E1B A;  5TR9 A;  1NB0 A;  2AHO A;  4WWV A;  5H5J A;  1VQ5 B;  1W0J A;  1HZE A;  4X06 A;  4AF7 A;  3CB4 A;  3AGQ A;  3ES9 A;  1YJW B;  1BMF A;  3PEN A;  4RJL A;  1WOP A;  3ZBU A;  4XOP A;  2OTL B;  3AGP A;  4FXU A;  1EP3 B;  1K73 D;  1TUI A;  2XND A;  1Q7Y D;  2F1M A;  5HKK A;  2XOK A;  1VQP B;  1GAW A;  2VBS A;  4ZCI A;  2VJJ A;  3PVD A;  1E1Q A;  3PUN A;  1NJI D;  1QVF B;  2JIZ A;  4RM0 A;  3BQJ A;  1KK3 A;  3ASR A;  1WOO A;  4HE6 A;  4J0Q A;  2V7Q A;  4XL9 A;  4L8J A;  2WPD A;  3JQQ A;  1E3Z A;  4FN5 A;  4II2 A;  2OBS A;  1QVG B;  4XN3 A;  4KKS A;  1WP6 A;  1BPL A;  1R5N A;  4TKO B;  1W34 A;  1QUF A;  2OBR A;  2QEX B;  4OOS A;  1GR1 A;  1FX0 A;  2DEU A;  1CNF A;  4N3N A;  2X0K A;  4B4D A;  3OE7 A;  4NNJ A;  3V7A A;  2VBU A;  4WZK A;  2PE3 A;  3WXM A;  3AVV A;  3WQZ A;  4M4S A;  4OP7 A;  1UD6 A;  3WY9 A;  1IHM A;  4XM3 A;  2OBT A;  3E1Y E;  2VBT A;  2F1L A;  4KKU A;  3A8J A;  1H8H A;  1W87 A;  4P3Y A;  5THX A;  4MYU A;  1N07 A;  3OW7 A;  2V31 A;  4QHY A;  1FNC A;  1HA3 A;  4RPD A;  3LNN A;  2VJI A;  2DY1 A;  1T5E A;  3SLN A;  3ZC3 A;  1QH0 A;  1VQM B;  1XE1 A;  1VF7 A;  4B43 A;  1KRH A;  4QVA A;  1SKY B;  1E43 A;  1Y0Y A;  4G7X A;  2V7U A;  2WR8 A;  4B3F X;  1IJE A;  1R5O A;  2F4N A;  4YEL A;  5AN9 A;  3HAG A;  5FO0 A;  4HIZ A;  4RLZ A;  2BN4 A;  2VNI A;  1ZM9 A;  1H8E A;  2C78 A;  3CP8 A;  1ZM2 A;  2OK8 A;  3Q3A A;  3FKS A;  3Q6R A;  4R71 A;  4X8I A;  1MAB A;  2C5B A;  3W5U A;  4YAU A;  2QA4 B;  4XOT A;  5A8A A;  1N0V C;  2DER A;  4P6V F;  3CXC B;  2GPJ A;  4Z4W A;  1OB2 A;  2XGJ A;  5F4M A;  3LVB A;  2BGI A;  3T53 B;  3VO2 A;  4F7D A;  4XLC A;  1XFO A;  3LQ6 A;  4WQM A;  1YIT B;  3ZUG A;  4Q7J B;  1J9Z A;  1UD2 A;  4IW3 B;  2B7C A;  2OK7 A;  1WDT A;  4LC0 A;  2XZL A;  1D8T A;  5TV2 A;  3Q6Q A;  1XQB A;  4XQF A;  3A8K A;  1NB9 A;  3OZV A;  2PIA A;  4WZT A;  4C0S A;  3V76 A;  5BSX A;  1TTT A;  5HZB A;  3ONU A;  4B47 A;  4XD7 A;  1PKV A;  2VYQ A;  2WYR A;  1H42 A;  3AVW A;  4MYT A;  2VBV A;  1B23 P;  5A88 A;  1FRN A;  1I7P A;  2CC2 A;  5HXB A;  4P1V A;  4TMT A;  4B3X A;  3H94 A;  2CRV A;  4LBV A;  3W2H A;  5IYR A;  2OTJ B;  4G7W A;  5DS0 A;  3DDY A;  1KK1 A;  3ZZT A;  2V4D A;  2HDN B;  1OGI A;  4XLE A;  4PC3 A;  3FPP A;  4ASU A;  2ZL7 A;  2JN9 A;  1OGJ A;  3OFN A;  4RCY A;  2QDX A;  1BJK A;  3P27 A;  4ZCL A;  3OZU A;  3GVJ A;  3WNB A;  4TT3 A;  3OJW A;  2YWF A;  4Z4Z A;  2X3U A;  3CC2 B;  3WNC A;  3PA2 A;  1FND A;  1GVH A;  5JBQ A;  1W9X A;  4PC1 A;  1N06 A;  4XOR A;  1F60 A;  3QFT A;  1RQR A;  4QVJ A;  2XZO A;  2RC5 A;  1PJ7 A;  1KJZ A;  2YWH A;  2QN6 A;  2J7K A;  1JNY A;  4Y7C A;  2X53 S;  2QGG A;  2CND A;  3GVK A;  4M2L A;  3T56 B;  4OOX A;  3U6B A;  1G7T A;  3QFC A;  4AF6 A;  1V0F A;  4LBW A;  1BX1 A;  4TMW A;  5EMN A;  4C43 A;  1QX4 A;  2E1R A;  1B2R A;  2Q6I A;  2ZL5 A;  4X7D A;  3JU4 A;  3GSI A;  2ZZE A;  2X8K A;  2GQF A;  3JQP A;  5IYP A;  3U2Q A;  2DET A;  4OOV A;  1FNM A;  5IK2 A;  2GRE A;  3BCF A;  3BH4 A;  1EXM A;  1QGZ A;  2R9V A;  2ZZF A;  4G1V A; 
#chains in the Genus database with same CATH homology
 5TRD A;  3OP1 A;  5A89 A;  2VBU A;  1N05 A;  1P4M A;  1T6Z A;  5FO0 A;  1MRZ A;  3ZUG A;  2VBS A;  2VBT A;  1Q9S A;  1N07 A;  1NB9 A;  5FNZ A;  1NB0 A;  3CTA A;  1N08 A;  1S4M A;  1T6Y A;  5A8A A;  1T6X A;  2I1L A;  4UZF A;  4UZE A;  1N06 A;  3BNW A;  2VBV A;  5A88 A;  2OYN A;  2P3M A;  5FO1 A;  2X0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...