3BNWA

Crystal structure of riboflavin kinase from trypanosoma brucei
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
172
structure length
160
Chain Sequence
b'HMRQTGSFQPFFLRGKVVHSQLGFPTANIGLDKDVMECLQPYKNLVVYGWGTVSQVPGKERESFGPYPFAASIGFNTLTVEPYFLHEFGWDFYGAVVKIIVLGEIRSMGSFHSLQALVDTIKSDVQFTRDMLQKPQLQEFSRHSLFESPSSTIPYFEDLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Riboflavin kinase, putative
publication title Riboflavin kinase from Trypanosoma brucei.
rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 32
structure length 160
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2007-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 3bnwA00
2VBUA 1MRZA 5A8AA 2VBTA 2OYNA 2P3MA 2X0KA 1N06A 5TRDA 5A88A 1N07A 5FO0A 1S4MA 2I1LA 1T6XA 1T6ZA 1N08A 3ZUGA 1NB0A 4UZEA 5FNZA 1NB9A 1P4MA 5FO1A 2VBSA 3OP1A 3CTAA 1N05A 5A89A 1T6YA 1Q9SA 4UZFA 2VBVA 3BNWA
chains in the Genus database with same CATH superfamily
4PC7A 1MRZA 3I56B 2ZTNA 1PJ5A 2QA4B 2X0KA 4XKWA 3CMMA 2CRVA 2ZZQA 2WJVA 1ZUNB 4UAJA 1YJ9B 2B7BA 2C2WA 3ASPA 2BMWA 4PABA 2XNDA 2OK7A 3AVYA 2XOKA 4C43A 2X6YA 3MCAA 4RLZA 1KTVA 1Y0YA 1ZM2A 4FK8A 3W2GA 3WNDA 2R9VA 3SJPA 3ZZUA 4ZCIA 5IYNA 4XLEA 1GO2A 1Q9SA 4ACAA 2HLDA 4Z4RA 4F7DA 3GVKA 3H94A 1WSRA 4B4DA 3OZUA 1CQXA 3Q6RA 4TT3A 5F4MA 1QUFA 2WPDA 3G05A 3ZPNA 5LMZA 3OFNA 2BSAA 2E1BA 4U9UA 1VHOA 5DS0A 3CCRB 1YHQB 2DERA 4XOTA 4XD7A 2VJIA 4X07A 1DDIA 3BY2A 1E79A 4UZEA 3CCUB 4KKSA 4XLFA 3CC7B 1R5NA 1VQKB 1E1QA 1AMOA 3AVXA 2VYQA 1H42A 1MABA 1QGYA 2OK8A 5CDFA 1N05A 4RD1A 2D3LA 3CCQB 4P6YA 2BV3A 3SEJA 2ZL7A 3VMFA 1IJFA 3B8HA 1IHMA 2V7VA 3CXCB 1E1RA 2V7TA 2F4NA 3BH4A 4RD3A 4YALA 3V7AA 1FNCA 3FKSA 2BM1A 1I7PA 1VQOB 5L46A 3WQZA 1QVFB 5KSWB 1QUEA 3QFCA 1JA0A 2QN6A 2XZPA 4PC1A 1KQSB 3SJZA 1QFJA 1W87A 3AGQA 2QE7A 4XORA 2YWGA 2FX3A 1CNFA 5F4JA 2JIZA 3ZBTA 4DNRB 1K73D 1TVCA 1NJID 2XZLA 2VBSA 3OJWA 4M0LA 5IYWA 1YJWB 1N0UA 3R6KA 3CTAA 1RQPA 1QFZA 1V0FA 4X7CA 4P6VF 1WPCA 2ZZEA 2C4TA 3BNWA 2XNJA 4TMTA 4WQMA 2DETA 3VO1A 5IYQA 5E6TA 1D2EA 2RC5A 4P1VA 2JDIA 4BPRA 1XB2A 1T6ZA 3KL9A 1Q82D 1W0KA 1N8RD 2ZL5A 4OPVA 1QX4A 1DDGA 4Z4ZA 2XGJA 3CCVB 5FO1A 2C4UA 4R71A 4X7EA 1KK2A 3KEWA 2CW5A 2J7KA 2Z6BD 4KKUA 1QG0A 3P27A 1GAWA 4TSFA 1YLOA 1E62A 3NE5B 4Y9RA 4LBYA 2PLFA 3I1FA 2F1LA 3CCSB 4WZEA 1ZM3A 1VQ8B 4N3GA 2QGGA 1W0JA 2DOGA 4RD6A 4TN1A 2W6JA 4OOXA 3BC9A 1V0EA 3W5VA 2C78A 4DK0A 1WOSA 1QFYA 1S0UA 1VF7A 4B43A 3A3GA 4YAUA 1YJNB 3ISXA 4B47A 1VJSA 3G4SB 3OP1A 3AGPA 2ZL6A 2BGIA 1WSVA 2CBXA 4RCZA 3B78A 1W2BB 4XLCA 2X53S 2ZBUA 1FDRA 3LQ6A 3MMPA 4HIZA 4P9SA 5B6IA 2RC6A 3ZBUA 3CCLB 3CPWB 4ZGNB 2BVNA 4NCNA 2CF4A 4FXUA 1BJKA 2VNKA 1I18A 4Z4WA 5BSXA 1V5VA 2WJYA 1PJ7A 2X6XA 1OGJA 2VNHA 4P2NA 3A1PA 1W35A 1VLYA 2QMUA 2DCUA 1D1NA 1TLLA 3PUMA 4PC6A 1COWA 1TTTA 4L8JA 1BQEA 4QVJA 2CC2A 1DARA 2ZITA 2X3UA 4YAWA 4ZCLA 1KZLA 3GVJA 3WBJA 2BGJA 4Z4TA 5TRDA 1EFRA 3CMEB 3G6EB 3T53B 1BX0A 2VNJA 2ZTGA 4TMWA 3QFSA 4B3XA 1T5EA 2HCJB 3OZVA 3CW2A 3Q38A 3SLDA 1FNDA 3P26A 3DDYA 1OGIA 3ZZ0A 2CK3A 1H8HA 2DIEA 4X7FA 2BM0A 4M53A 3VNVA 3CESA 3ZC3A 1OB5A 1EP1B 3AVUA 4IW3B 3ONYA 1FNBA 5HZAA 5H5JA 3OOCA 1KK1A 3GSIA 1KK3A 1WDTA 1E43A 1UD3A 4KKTA 2HDNB 5F4OA 2VBVA 1Y0RA 3W5UA 3JQPA 2F43A 4G5GA 2EFGA 2DY1A 1YI2B 1N06A 1PKVA 2FVGA 4X7DA 1JJ2B 1E3XA 3FPPA 3LVBA 2WZPP 2LZJA 3ZIAA 1EXMA 3BQJA 1VLOA 2GJKA 2OBTA 4DQLA 3MHPA 1E3ZA 3SLNA 1F60A 1H8EA 4X0CA 4Z1MA 3VO2A 3LNNA 4C0SA 2DEUA 2GJPA 3OW7A 1GR1A 1NB0A 3WBKA 4Y7CA 2OBRA 4WZLA 1GJRA 1UD6A 4XL9A 2ZXIA 3AVTA 4RDLA 3T56B 2XEXA 3GIRA 3LO8A 4WWVA 1BX1A 3OKXA 2YWFA 2Q6KA 4WZKA 4MYTA 2QTLA 2KVOA 2CNDA 2V4DA 2QDXA 1OB0A 5J3OA 4QVAA 4B3GA 4DK1A 1KRHA 5DSZA 1KC8D 4RCYA 1VQNB 2HMAA 1GVHA 1K8AD 3G71B 3CP8A 1B23P 5A88A 3PVDA 5TR9A 3ASRA 3JQQA 4ACBA 2I1LA 1KK0A 4XLAA 2PIAA 5TY0A 1T6XA 2AHOA 5FA6A 1M90D 4G1VA 3U6BA 2XNCA 4FWTA 3HAGA 4XONA 2BN4A 4QUZA 4B3FX 1P4MA 2GREA 4B44A 2B7CA 1K28D 2C5HA 1DG1G 5J35A 2M5SA 2VBUA 3A35A 2VNIA 4OOVA 5A8AA 2F1MA 2ZBVA 4YELA 2W6IA 4X05A 2E1RA 3PUNA 3W2FA 2NV4A 1SM4A 1F20A 1K9MD 3GVLA 4FN5A 1TUIA 5IK2A 1S4MA 4XKVA 1UD4A 1WOOA 4P25A 1ELOA 4XOPA 3CB4A 3D26A 2EIXA 4RPDA 2GPJA 4XN0A 4UZUA 5FNZA 3Q6QA 4AF6A 1YITB 1OHHA 4K1XA 4P26A 1EFTA 2V7XA 4NNJA 1AIPA 1JA1A 1HZEA 2YWHA 2P3MA 1KD1D 1G7CA 2BPOA 4CQJA 4E0FA 1EP2B 1WP6A 3WXMA 5THXA 2C77A 1KMHA 3W2IA 5KNLA 1WU8A 2ZZGA 4AVZA 3CD6B 4XNFA 1W9XA 3CCEB 3OPOA 4PC3A 4YAOA 3ZZTA 4Z4UA 2OBSA 4ZGQB 4OPOA 2QEXB 1FRQA 2YWEA 1NBMA 4XN3A 4RM0A 2WYRA 4AC9A 4P22A 4Q7JB 3V76A 2NPFA 2XZOA 2JJ2A 5BSYA 2BF4A 3ASTA 1HVXA 2GK7A 3A8IA 3JU4A 5HZBA 1CNEA 5H59A 2Q6LA 3PENA 1VQ7B 1VQ4B 4Z4YA 4HE5A 4TMXA 4ASUA 4RDJA 1Q7YD 1UD2A 4LBVA 3A3BA 2OTJB 5IYRA 1QH0A 3OEHA 1XQBA 2ZXHA 1VQ5B 1WTHD 1Q81D 3BCFA 1G7TA 3W2HA 1N08A 3ONUA 4RPBA 3A8JA 1VQ6B 1YX2A 4HE6A 3QFRA 2X85A 2Q6IA 3ES9A 4LC0A 5A89A 3GQBA 1T6YA 2Q6OA 4H9GA 1XFOA 1ZM4A 3R6JA 1VQPB 1A8PA 1EP3B 2PMDA 1R5OA 1VHEA 3E20A 4Z4SA 5GV8A 5HKKA 2OYNA 2WSSA 4G7WA 4M4SA 2QTZA 1JB9A 5FL7A 5FO0A 3CPXA 4XLHA 4TKOB 1BMFA 4Y9UA 1EWYA 4PGOA 1UD8A 4JMQA 4WZTA 1G7RA 4NBSA 3AVVA 2X6WA 1D8TA 3SKBA 4XR6A 2JN9A 2V7UA 3ZUGA 3VR6A 1JNYA 1NB9A 4XQFA 3WNCA 3FJOA 1IB0A 4LBZA 3PA1A 1BPLA 3OAAA 1NDHA 4GQNA 4LBWA 2WZNA 4Z4VA 3U6KA 2X8KA 2D3NA 3Q39A 1XE1A 3U2QA 4YHBA 3QE2A 2C5BA 4PAAA 4YXWA 1IJEA 5HXBA 1NRKA 4TMZA 4PC2A 3H9NA 3CC4B 4TMVA 1GAQA 1QVGB 4II3A 4RDKA 5IYPA 3B82A 3J81k 2R6HA 4RD0A 1W34A 1G7SA 1VQMB 1J9ZA 1PJ6A 3E1YE 4P12A 4QHYA 4DNTB 1BLIA 3I55B 4J0QA 4N3NA 2GJRA 1QGAA 4RD4A 1WOPA 5EMNA 1FNMA 2PE3A 3BCDA 4X8IA 5JBQA 5GV7A 1I8DA 3JQRA 4G1BA 3VNUA 2V7QA 3ASQA 1E64A 2DYIA 1UD5A 3QFTA 4MYUA 1S72B 2VBTA 4RJLA 3Q3AA 3T51B 3CP2A 1Q86D 3CCJB 1HA3A 4EH1A 1N07A 2V7WA 5KW9A 3OJXA 3CRZA 1QGZA 1H85A 2D9RA 3BY1A 3FPKA 3CCMB 2JJ1A 4YEJA 3WY9A 3PA2A 2D74A 1OB2A 1EFUA 4B48A 1R5BA 2GQFA 3A8KA 4M2LA 3WNBA 4OP7A 5AN9A 1WORA 5TV2A 1YIJB 4X06A 2B5OA 1RQRA 2V31A 3ASSA 4II2A 4M1KA 3AVWA 4OPSA 2GK6A 4OOSA 2WR8A 3W5HA 3CMAB 2ZZFA 1UMKA 1M1KD 1FX0A 1SKQA 1ZM9A 1FRNA 3QSYA 4YAFA 3OW2B 3LQEA 4P3YA 3CC2B 4RD2A 2VZLA 2VJJA 4ZCMA 1VQ9B 4G6IA 4QV2A 4DQKA 1SKYB 4P3IA 3W2EA 3WYAA 1B2RA 1U2RA 2OTLB 1E63A 1VQLB 1KJZA 5FIUA 3RY8A 3OEEA 4ZV4A 4XMYA 3OZWA 5DN6A 3OE7A 4AF7A 4QFMA 4UZFA 4XM3A 4G7XA 1N0VC 4ROXA 1EFCA
chains in the Genus database with same CATH topology
2VBUA 1MRZA 5A8AA 2VBTA 2OYNA 2P3MA 2X0KA 1N06A 5TRDA 5A88A 1N07A 5FO0A 1S4MA 2I1LA 1T6XA 1T6ZA 1N08A 3ZUGA 1NB0A 4UZEA 5FNZA 1NB9A 1P4MA 5FO1A 2VBSA 3OP1A 3CTAA 1N05A 5A89A 1T6YA 1Q9SA 4UZFA 2VBVA 3BNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBU A;  1MRZ A;  5A8A A;  2VBT A;  2OYN A;  2P3M A;  2X0K A;  1N06 A;  5TRD A;  5A88 A;  1N07 A;  5FO0 A;  1S4M A;  2I1L A;  1T6X A;  1T6Z A;  1N08 A;  3ZUG A;  1NB0 A;  4UZE A;  5FNZ A;  1NB9 A;  1P4M A;  5FO1 A;  2VBS A;  3OP1 A;  3CTA A;  1N05 A;  5A89 A;  1T6Y A;  1Q9S A;  4UZF A;  2VBV A;  3BNW A; 
#chains in the Genus database with same CATH topology
 4PC7 A;  1MRZ A;  3I56 B;  2ZTN A;  1PJ5 A;  2QA4 B;  2X0K A;  4XKW A;  3CMM A;  2CRV A;  2ZZQ A;  2WJV A;  1ZUN B;  4UAJ A;  1YJ9 B;  2B7B A;  2C2W A;  3ASP A;  2BMW A;  4PAB A;  2XND A;  2OK7 A;  3AVY A;  2XOK A;  4C43 A;  2X6Y A;  3MCA A;  4RLZ A;  1KTV A;  1Y0Y A;  1ZM2 A;  4FK8 A;  3W2G A;  3WND A;  2R9V A;  3SJP A;  3ZZU A;  4ZCI A;  5IYN A;  4XLE A;  1GO2 A;  1Q9S A;  4ACA A;  2HLD A;  4Z4R A;  4F7D A;  3GVK A;  3H94 A;  1WSR A;  4B4D A;  3OZU A;  1CQX A;  3Q6R A;  4TT3 A;  5F4M A;  1QUF A;  2WPD A;  3G05 A;  3ZPN A;  5LMZ A;  3OFN A;  2BSA A;  2E1B A;  4U9U A;  1VHO A;  5DS0 A;  3CCR B;  1YHQ B;  2DER A;  4XOT A;  4XD7 A;  2VJI A;  4X07 A;  1DDI A;  3BY2 A;  1E79 A;  4UZE A;  3CCU B;  4KKS A;  4XLF A;  3CC7 B;  1R5N A;  1VQK B;  1E1Q A;  1AMO A;  3AVX A;  2VYQ A;  1H42 A;  1MAB A;  1QGY A;  2OK8 A;  5CDF A;  1N05 A;  4RD1 A;  2D3L A;  3CCQ B;  4P6Y A;  2BV3 A;  3SEJ A;  2ZL7 A;  3VMF A;  1IJF A;  3B8H A;  1IHM A;  2V7V A;  3CXC B;  1E1R A;  2V7T A;  2F4N A;  3BH4 A;  4RD3 A;  4YAL A;  3V7A A;  1FNC A;  3FKS A;  2BM1 A;  1I7P A;  1VQO B;  5L46 A;  3WQZ A;  1QVF B;  5KSW B;  1QUE A;  3QFC A;  1JA0 A;  2QN6 A;  2XZP A;  4PC1 A;  1KQS B;  3SJZ A;  1QFJ A;  1W87 A;  3AGQ A;  2QE7 A;  4XOR A;  2YWG A;  2FX3 A;  1CNF A;  5F4J A;  2JIZ A;  3ZBT A;  4DNR B;  1K73 D;  1TVC A;  1NJI D;  2XZL A;  2VBS A;  3OJW A;  4M0L A;  5IYW A;  1YJW B;  1N0U A;  3R6K A;  3CTA A;  1RQP A;  1QFZ A;  1V0F A;  4X7C A;  4P6V F;  1WPC A;  2ZZE A;  2C4T A;  3BNW A;  2XNJ A;  4TMT A;  4WQM A;  2DET A;  3VO1 A;  5IYQ A;  5E6T A;  1D2E A;  2RC5 A;  4P1V A;  2JDI A;  4BPR A;  1XB2 A;  1T6Z A;  3KL9 A;  1Q82 D;  1W0K A;  1N8R D;  2ZL5 A;  4OPV A;  1QX4 A;  1DDG A;  4Z4Z A;  2XGJ A;  3CCV B;  5FO1 A;  2C4U A;  4R71 A;  4X7E A;  1KK2 A;  3KEW A;  2CW5 A;  2J7K A;  2Z6B D;  4KKU A;  1QG0 A;  3P27 A;  1GAW A;  4TSF A;  1YLO A;  1E62 A;  3NE5 B;  4Y9R A;  4LBY A;  2PLF A;  3I1F A;  2F1L A;  3CCS B;  4WZE A;  1ZM3 A;  1VQ8 B;  4N3G A;  2QGG A;  1W0J A;  2DOG A;  4RD6 A;  4TN1 A;  2W6J A;  4OOX A;  3BC9 A;  1V0E A;  3W5V A;  2C78 A;  4DK0 A;  1WOS A;  1QFY A;  1S0U A;  1VF7 A;  4B43 A;  3A3G A;  4YAU A;  1YJN B;  3ISX A;  4B47 A;  1VJS A;  3G4S B;  3OP1 A;  3AGP A;  2ZL6 A;  2BGI A;  1WSV A;  2CBX A;  4RCZ A;  3B78 A;  1W2B B;  4XLC A;  2X53 S;  2ZBU A;  1FDR A;  3LQ6 A;  3MMP A;  4HIZ A;  4P9S A;  5B6I A;  2RC6 A;  3ZBU A;  3CCL B;  3CPW B;  4ZGN B;  2BVN A;  4NCN A;  2CF4 A;  4FXU A;  1BJK A;  2VNK A;  1I18 A;  4Z4W A;  5BSX A;  1V5V A;  2WJY A;  1PJ7 A;  2X6X A;  1OGJ A;  2VNH A;  4P2N A;  3A1P A;  1W35 A;  1VLY A;  2QMU A;  2DCU A;  1D1N A;  1TLL A;  3PUM A;  4PC6 A;  1COW A;  1TTT A;  4L8J A;  1BQE A;  4QVJ A;  2CC2 A;  1DAR A;  2ZIT A;  2X3U A;  4YAW A;  4ZCL A;  1KZL A;  3GVJ A;  3WBJ A;  2BGJ A;  4Z4T A;  5TRD A;  1EFR A;  3CME B;  3G6E B;  3T53 B;  1BX0 A;  2VNJ A;  2ZTG A;  4TMW A;  3QFS A;  4B3X A;  1T5E A;  2HCJ B;  3OZV A;  3CW2 A;  3Q38 A;  3SLD A;  1FND A;  3P26 A;  3DDY A;  1OGI A;  3ZZ0 A;  2CK3 A;  1H8H A;  2DIE A;  4X7F A;  2BM0 A;  4M53 A;  3VNV A;  3CES A;  3ZC3 A;  1OB5 A;  1EP1 B;  3AVU A;  4IW3 B;  3ONY A;  1FNB A;  5HZA A;  5H5J A;  3OOC A;  1KK1 A;  3GSI A;  1KK3 A;  1WDT A;  1E43 A;  1UD3 A;  4KKT A;  2HDN B;  5F4O A;  2VBV A;  1Y0R A;  3W5U A;  3JQP A;  2F43 A;  4G5G A;  2EFG A;  2DY1 A;  1YI2 B;  1N06 A;  1PKV A;  2FVG A;  4X7D A;  1JJ2 B;  1E3X A;  3FPP A;  3LVB A;  2WZP P;  2LZJ A;  3ZIA A;  1EXM A;  3BQJ A;  1VLO A;  2GJK A;  2OBT A;  4DQL A;  3MHP A;  1E3Z A;  3SLN A;  1F60 A;  1H8E A;  4X0C A;  4Z1M A;  3VO2 A;  3LNN A;  4C0S A;  2DEU A;  2GJP A;  3OW7 A;  1GR1 A;  1NB0 A;  3WBK A;  4Y7C A;  2OBR A;  4WZL A;  1GJR A;  1UD6 A;  4XL9 A;  2ZXI A;  3AVT A;  4RDL A;  3T56 B;  2XEX A;  3GIR A;  3LO8 A;  4WWV A;  1BX1 A;  3OKX A;  2YWF A;  2Q6K A;  4WZK A;  4MYT A;  2QTL A;  2KVO A;  2CND A;  2V4D A;  2QDX A;  1OB0 A;  5J3O A;  4QVA A;  4B3G A;  4DK1 A;  1KRH A;  5DSZ A;  1KC8 D;  4RCY A;  1VQN B;  2HMA A;  1GVH A;  1K8A D;  3G71 B;  3CP8 A;  1B23 P;  5A88 A;  3PVD A;  5TR9 A;  3ASR A;  3JQQ A;  4ACB A;  2I1L A;  1KK0 A;  4XLA A;  2PIA A;  5TY0 A;  1T6X A;  2AHO A;  5FA6 A;  1M90 D;  4G1V A;  3U6B A;  2XNC A;  4FWT A;  3HAG A;  4XON A;  2BN4 A;  4QUZ A;  4B3F X;  1P4M A;  2GRE A;  4B44 A;  2B7C A;  1K28 D;  2C5H A;  1DG1 G;  5J35 A;  2M5S A;  2VBU A;  3A35 A;  2VNI A;  4OOV A;  5A8A A;  2F1M A;  2ZBV A;  4YEL A;  2W6I A;  4X05 A;  2E1R A;  3PUN A;  3W2F A;  2NV4 A;  1SM4 A;  1F20 A;  1K9M D;  3GVL A;  4FN5 A;  1TUI A;  5IK2 A;  1S4M A;  4XKV A;  1UD4 A;  1WOO A;  4P25 A;  1ELO A;  4XOP A;  3CB4 A;  3D26 A;  2EIX A;  4RPD A;  2GPJ A;  4XN0 A;  4UZU A;  5FNZ A;  3Q6Q A;  4AF6 A;  1YIT B;  1OHH A;  4K1X A;  4P26 A;  1EFT A;  2V7X A;  4NNJ A;  1AIP A;  1JA1 A;  1HZE A;  2YWH A;  2P3M A;  1KD1 D;  1G7C A;  2BPO A;  4CQJ A;  4E0F A;  1EP2 B;  1WP6 A;  3WXM A;  5THX A;  2C77 A;  1KMH A;  3W2I A;  5KNL A;  1WU8 A;  2ZZG A;  4AVZ A;  3CD6 B;  4XNF A;  1W9X A;  3CCE B;  3OPO A;  4PC3 A;  4YAO A;  3ZZT A;  4Z4U A;  2OBS A;  4ZGQ B;  4OPO A;  2QEX B;  1FRQ A;  2YWE A;  1NBM A;  4XN3 A;  4RM0 A;  2WYR A;  4AC9 A;  4P22 A;  4Q7J B;  3V76 A;  2NPF A;  2XZO A;  2JJ2 A;  5BSY A;  2BF4 A;  3AST A;  1HVX A;  2GK7 A;  3A8I A;  3JU4 A;  5HZB A;  1CNE A;  5H59 A;  2Q6L A;  3PEN A;  1VQ7 B;  1VQ4 B;  4Z4Y A;  4HE5 A;  4TMX A;  4ASU A;  4RDJ A;  1Q7Y D;  1UD2 A;  4LBV A;  3A3B A;  2OTJ B;  5IYR A;  1QH0 A;  3OEH A;  1XQB A;  2ZXH A;  1VQ5 B;  1WTH D;  1Q81 D;  3BCF A;  1G7T A;  3W2H A;  1N08 A;  3ONU A;  4RPB A;  3A8J A;  1VQ6 B;  1YX2 A;  4HE6 A;  3QFR A;  2X85 A;  2Q6I A;  3ES9 A;  4LC0 A;  5A89 A;  3GQB A;  1T6Y A;  2Q6O A;  4H9G A;  1XFO A;  1ZM4 A;  3R6J A;  1VQP B;  1A8P A;  1EP3 B;  2PMD A;  1R5O A;  1VHE A;  3E20 A;  4Z4S A;  5GV8 A;  5HKK A;  2OYN A;  2WSS A;  4G7W A;  4M4S A;  2QTZ A;  1JB9 A;  5FL7 A;  5FO0 A;  3CPX A;  4XLH A;  4TKO B;  1BMF A;  4Y9U A;  1EWY A;  4PGO A;  1UD8 A;  4JMQ A;  4WZT A;  1G7R A;  4NBS A;  3AVV A;  2X6W A;  1D8T A;  3SKB A;  4XR6 A;  2JN9 A;  2V7U A;  3ZUG A;  3VR6 A;  1JNY A;  1NB9 A;  4XQF A;  3WNC A;  3FJO A;  1IB0 A;  4LBZ A;  3PA1 A;  1BPL A;  3OAA A;  1NDH A;  4GQN A;  4LBW A;  2WZN A;  4Z4V A;  3U6K A;  2X8K A;  2D3N A;  3Q39 A;  1XE1 A;  3U2Q A;  4YHB A;  3QE2 A;  2C5B A;  4PAA A;  4YXW A;  1IJE A;  5HXB A;  1NRK A;  4TMZ A;  4PC2 A;  3H9N A;  3CC4 B;  4TMV A;  1GAQ A;  1QVG B;  4II3 A;  4RDK A;  5IYP A;  3B82 A;  3J81 k;  2R6H A;  4RD0 A;  1W34 A;  1G7S A;  1VQM B;  1J9Z A;  1PJ6 A;  3E1Y E;  4P12 A;  4QHY A;  4DNT B;  1BLI A;  3I55 B;  4J0Q A;  4N3N A;  2GJR A;  1QGA A;  4RD4 A;  1WOP A;  5EMN A;  1FNM A;  2PE3 A;  3BCD A;  4X8I A;  5JBQ A;  5GV7 A;  1I8D A;  3JQR A;  4G1B A;  3VNU A;  2V7Q A;  3ASQ A;  1E64 A;  2DYI A;  1UD5 A;  3QFT A;  4MYU A;  1S72 B;  2VBT A;  4RJL A;  3Q3A A;  3T51 B;  3CP2 A;  1Q86 D;  3CCJ B;  1HA3 A;  4EH1 A;  1N07 A;  2V7W A;  5KW9 A;  3OJX A;  3CRZ A;  1QGZ A;  1H85 A;  2D9R A;  3BY1 A;  3FPK A;  3CCM B;  2JJ1 A;  4YEJ A;  3WY9 A;  3PA2 A;  2D74 A;  1OB2 A;  1EFU A;  4B48 A;  1R5B A;  2GQF A;  3A8K A;  4M2L A;  3WNB A;  4OP7 A;  5AN9 A;  1WOR A;  5TV2 A;  1YIJ B;  4X06 A;  2B5O A;  1RQR A;  2V31 A;  3ASS A;  4II2 A;  4M1K A;  3AVW A;  4OPS A;  2GK6 A;  4OOS A;  2WR8 A;  3W5H A;  3CMA B;  2ZZF A;  1UMK A;  1M1K D;  1FX0 A;  1SKQ A;  1ZM9 A;  1FRN A;  3QSY A;  4YAF A;  3OW2 B;  3LQE A;  4P3Y A;  3CC2 B;  4RD2 A;  2VZL A;  2VJJ A;  4ZCM A;  1VQ9 B;  4G6I A;  4QV2 A;  4DQK A;  1SKY B;  4P3I A;  3W2E A;  3WYA A;  1B2R A;  1U2R A;  2OTL B;  1E63 A;  1VQL B;  1KJZ A;  5FIU A;  3RY8 A;  3OEE A;  4ZV4 A;  4XMY A;  3OZW A;  5DN6 A;  3OE7 A;  4AF7 A;  4QFM A;  4UZF A;  4XM3 A;  4G7X A;  1N0V C;  4ROX A;  1EFC A; 
#chains in the Genus database with same CATH homology
 2VBU A;  1MRZ A;  5A8A A;  2VBT A;  2OYN A;  2P3M A;  2X0K A;  1N06 A;  5TRD A;  5A88 A;  1N07 A;  5FO0 A;  1S4M A;  2I1L A;  1T6X A;  1T6Z A;  1N08 A;  3ZUG A;  1NB0 A;  4UZE A;  5FNZ A;  1NB9 A;  1P4M A;  5FO1 A;  2VBS A;  3OP1 A;  3CTA A;  1N05 A;  5A89 A;  1T6Y A;  1Q9S A;  4UZF A;  2VBV A;  3BNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...