3BNWA

Crystal structure of riboflavin kinase from trypanosoma brucei
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
172
structure length
160
Chain Sequence
b'HMRQTGSFQPFFLRGKVVHSQLGFPTANIGLDKDVMECLQPYKNLVVYGWGTVSQVPGKERESFGPYPFAASIGFNTLTVEPYFLHEFGWDFYGAVVKIIVLGEIRSMGSFHSLQALVDTIKSDVQFTRDMLQKPQLQEFSRHSLFESPSSTIPYFEDLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Riboflavin kinase, putative
molecule tags Transferase
source organism Trypanosoma brucei
publication title Riboflavin kinase from Trypanosoma brucei.
rcsb
total genus 32
structure length 160
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2007-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 3bnwA00
1N07A 1NB9A 1T6YA 2VBTA 1T6XA 2P3MA 5TRDA 1S4MA 5A89A 1P4MA 2OYNA 5A8AA 2X0KA 1T6ZA 1N08A 4UZFA 3ZUGA 1N05A 5A88A 1N06A 5FNZA 1Q9SA 5FO1A 2VBSA 3BNWA 3OP1A 5FO0A 2VBUA 3CTAA 1NB0A 2VBVA 2I1LA 1MRZA 4UZEA
chains in the Genus database with same CATH superfamily
4F7DA 4PGOA 4B3XA 4HE5A 4YALA 1NB9A 2RC5A 3CP8A 3CCEB 1CNFA 1R5NA 3WNBA 4K1XA 4P3YA 1WOOA 5HXBA 4II2A 2GJPA 1TTTA 4P6YA 1EFCA 2ZBVA 2V7TA 1YJ9B 4RCZA 1NRKA 4M1KA 1N0VC 3CRZA 2ZXIA 3Q6RA 3PENA 1E79A 3FKSA 5AN9A 3CC7B 3WNCA 1VQ6B 1E3XA 3W5UA 2BGJA 1BJKA 1D8TA 2C78A 4RM0A 5CDFA 3CMEB 1E62A 1SKYB 4ZGNB 5DN6A 1WORA 1M1KD 4LC0A 4HIZA 4XM3A 1OB2A 3CW2A 4B48A 3W2EA 3CCJB 5TRDA 3OW2B 2DCUA 1DG1G 3W2FA 4XLCA 3BY2A 1VQ9B 3CC2B 3JQQA 4Z4SA 1NJID 4N3NA 1CQXA 1WU8A 3ZZ0A 2CW5A 2QA4B 5F4JA 1VJSA 2JDIA 2V7XA 1UD5A 4ACBA 1EFTA 2Z6BD 5FO0A 4PC2A 2WZNA 2OBRA 4PC3A 4M53A 1EXMA 1KZLA 1ZM9A 2M5SA 1EFRA 5EMNA 4UZEA 5FL7A 4B43A 2CC2A 4ZCIA 2W6JA 1WDTA 1F20A 1EWYA 2QTZA 2XZLA 4J0QA 4TKOB 2OYNA 4XORA 2F1LA 3LVBA 1WSRA 5IYQA 1VHEA 4ROXA 3V76A 3Q38A 5FA6A 2PLFA 2OBSA 1QVFB 4XOPA 2JIZA 4YHBA 2CBXA 2ZL7A 3BC9A 3WYAA 3PA2A 1K9MD 2DIEA 1OGJA 1I18A 2HLDA 4Q7JB 1D2EA 2B7BA 3ASSA 2GJKA 3MHPA 1GAWA 3OJXA 4RDLA 1EP1B 4LBYA 4UZUA 5TR9A 4OOXA 1KD1D 4TMZA 4NBSA 3AVXA 1GAQA 2XNCA 2OK7A 1VQPB 1W35A 4JMQA 3OOCA 2QE7A 2X6YA 1ZUNB 1VQMB 4C43A 4CQJA 3LQ6A 4G5GA 1W87A 2V7UA 1H42A 2X0KA 2WR8A 3KL9A 3ZBTA 4RD1A 4G7WA 3BCDA 3OZWA 2XEXA 4Z4WA 1N05A 5A88A 1OB0A 4QV2A 3CD6B 4RPDA 3R6JA 1FNCA 3ASPA 4DQLA 1N8RD 2F43A 2CF4A 1UD4A 4WQMA 4NNJA 1FDRA 1PKVA 4ZCMA 2JJ2A 4XR6A 5E6TA 4FN5A 1QGZA 1NBMA 1VQ4B 1ZM3A 4LBVA 1Q7YD 3LO8A 4OP7A 4Z4RA 2DOGA 2KVOA 3AGQA 1E64A 1P4MA 1VF7A 1XE1A 4QVAA 3U2QA 3CB4A 4Z4YA 2X6WA 1UD8A 4Z4TA 1T6ZA 4UAJA 5HZAA 2CK3A 4H9GA 2PE3A 4DNTB 3WQZA 2B5OA 1Q9SA 1V5VA 2AHOA 4IW3B 1KK0A 4FWTA 3ONUA 1QH0A 1QFJA 2XZOA 4OPOA 2WJYA 3CCMB 2J7KA 2OTJB 2ZZEA 3QE2A 3QFCA 1W0KA 2BMWA 2XNJA 2ZL5A 4NCNA 1S4MA 4M2LA 1IJFA 5KSWB 2YWGA 1QVGB 4WWVA 2B7CA 2X8KA 2YWEA 2XGJA 5BSYA 4P1VA 4WZLA 3CMAB 2XZPA 4YELA 2VBSA 5IYWA 3BNWA 3BCFA 2WPDA 4DK1A 3OFNA 1JB9A 1YI2B 1PJ5A 1R5OA 1GJRA 4TMVA 4QFMA 4LBZA 3OPOA 3B8HA 4X7FA 2X3UA 2DETA 4HE6A 2QN6A 1VQ5B 4RD3A 4FK8A 4M4SA 4ZCLA 2BSAA 5A89A 3AVWA 4AC9A 2C4UA 1TUIA 3DDYA 5F4MA 1E1RA 4P26A 5IYNA 2HCJB 1MABA 5KNLA 4DNRB 1DDIA 3D26A 5H5JA 3ZUGA 2WJVA 1BPLA 5HKKA 2BPOA 4PC6A 3R6KA 1OGIA 4P22A 3AVYA 1EP3B 3A8IA 5GV8A 1V0FA 5IYPA 3ZIAA 1OB5A 1VQNB 5J3OA 4U9UA 2VBVA 3W5HA 2Q6IA 4OPVA 1YIJB 4KKTA 3CCUB 1IHMA 3LQEA 5TV2A 2VZLA 2VBTA 3ISXA 4TSFA 1YJNB 4LBWA 1COWA 1KMHA 4RCYA 3AVTA 4RLZA 1Q86D 4X05A 4EH1A 2CNDA 3B78A 2GQFA 3P27A 1RQPA 4ACAA 4Y9UA 4TMWA 1G7CA 3QFRA 3SLNA 1KJZA 1WP6A 2GREA 4X7EA 1VHOA 4XNFA 1E43A 1KK3A 4QHYA 2DEUA 1KTVA 3QFTA 2OK8A 5F4OA 4OOSA 2Q6OA 4X06A 1JA1A 5FO1A 4YAUA 4M0LA 5BSXA 3I55B 2BN4A 3BQJA 4X07A 4G6IA 2QEXB 2ZITA 2LZJA 3QFSA 5GV7A 1FRQA 4YAFA 2D9RA 3B82A 3U6BA 3VNVA 1MRZA 4AF7A 5IK2A 1G7TA 3ZZTA 2HMAA 3G71B 3Q39A 1T6XA 2VNHA 1CNEA 4FXUA 2PIAA 4MYTA 3WY9A 2NPFA 5JBQA 3GVLA 2GJRA 2VJIA 2ZBUA 4PABA 4B47A 3JU4A 5LMZA 4TT3A 2V7VA 1TVCA 2D74A 1OHHA 2RC6A 4XLEA 3WXMA 1W0JA 4QUZA 4RD0A 2X53S 1XFOA 4ASUA 2E1BA 2ZZGA 1B23P 1S72B 1FNBA 5H59A 4AF6A 1PJ6A 4XN3A 4DQKA 1VLOA 4C0SA 4PAAA 2I1LA 3CPXA 1QFYA 4RDKA 3SJPA 1BX1A 3H94A 3SEJA 1QUFA 2HDNB 3PA1A 2EIXA 1T6YA 1YLOA 4L8JA 2D3LA 1B2RA 2C5HA 4G7XA 5L46A 2QGGA 2D3NA 3JQPA 3MMPA 1KQSB 1FNDA 2C5BA 3BY1A 3RY8A 4XKVA 2YWFA 2V31A 1H8EA 3FPKA 4Y9RA 4R71A 1PJ7A 1HVXA 3OW7A 1XQBA 1W2BB 4Y7CA 3A3BA 1WOPA 3I56B 2GK6A 3LNNA 2EFGA 2FX3A 1BLIA 1WPCA 1YX2A 2WYRA 1KK2A 2R9VA 4X7DA 2OTLB 3ES9A 1TLLA 3AVUA 2QDXA 5THXA 2BV3A 2C77A 3PVDA 4TMTA 3CXCB 2V7WA 3J81k 3WBKA 1ZM4A 2P3MA 2FVGA 3CP2A 3JQRA 2ZZQA 4GQNA 1RQRA 1H85A 5A8AA 1FNMA 2BM0A 1Q81D 1VQ7B 1KRHA 3VO1A 3FPPA 3GVKA 3SKBA 3G6EB 4DK0A 1FRNA 3ONYA 1R5BA 2E1RA 1BMFA 1U2RA 1E3ZA 3OP1A 1IB0A 4P6VF 2ZZFA 3Q6QA 1NB0A 3OZUA 1SKQA 4Z1MA 2F4NA 1UD6A 2V4DA 4MYUA 4P3IA 3ZC3A 3OEHA 1Y0RA 2VNKA 3Q3AA 4KKUA 5TY0A 3G4SB 1NDHA 4B44A 1UD2A 2NV4A 4XKWA 1JJ2B 1JA0A 3W2HA 4E0FA 3U6KA 3CCSB 3W5VA 3CCVB 2BVNA 1F60A 1K73D 1N0UA 1G7SA 1J9ZA 1SM4A 2GK7A 2VYQA 3VMFA 3GSIA 4XLHA 1WOSA 2DYIA 1JNYA 4TN1A 3CCRB 3KEWA 1VQKB 2W6IA 4YEJA 1ZM2A 1FX0A 3A1PA 3CPWB 1I8DA 3T53B 4XMYA 4XQFA 2OBTA 4QVJA 1D1NA 3HAGA 4RD6A 1T5EA 3AVVA 1S0UA 3VR6A 1VQ8B 1H8HA 4TMXA 4PC1A 2V7QA 3QSYA 4RPBA 2WSSA 2XOKA 3E20A 3ZBUA 1DARA 3VNUA 4P2NA 4PC7A 2ZXHA 2X6XA 1VQLB 1A8PA 2DERA 1I7PA 3WNDA 3ZZUA 4XOTA 3CCQB 2VJJA 1W9XA 3SJZA 4Z4VA 2WZPP 1WTHD 4XLAA 1QGAA 1Y0YA 3A8KA 4XL9A 4BPRA 4XN0A 3A8JA 1QGYA 1KK1A 2BM1A 2Q6LA 4P12A 4WZKA 2R6HA 1N08A 2BGIA 2PMDA 3W2IA 3T51B 2CRVA 1G7RA 1XB2A 4G1VA 1W34A 4YXWA 3CCLB 3OAAA 3H9NA 1V0EA 1YJWB 4AVZA 4RJLA 2QTLA 2VBUA 4P25A 4WZTA 2C2WA 2C4TA 4B3FX 3ZPNA 2JN9A 2VNIA 5DS0A 3SLDA 3OEEA 2ZTGA 4OPSA 2XNDA 3PUNA 4X0CA 4ZGQB 4OOVA 4X7CA 1QFZA 4N3GA 4P9SA 4KKSA 4RD4A 5B6IA 3I1FA 1ELOA 4II3A 1UD3A 3G05A 4WZEA 4UZFA 4XLFA 5FIUA 2YWHA 1AIPA 3OE7A 3ASRA 1N06A 1EFUA 4XONA 3NE5B 3MCAA 3V7AA 4B3GA 1YITB 2ZL6A 3GQBA 1HA3A 3OKXA 3OJWA 3P26A 4RD2A 4YAOA 1E1QA 2ZTNA 1AMOA 3CC4B 1GVHA 1EP2B 1WSVA 1DDGA 1UMKA 3A3GA 4Z4UA 5KW9A 1Q82D 1IJEA 3A35A 1N07A 1VLYA 3OZVA 3W2GA 4ZV4A 1BX0A 2F1MA 3ASQA 5DSZA 3AGPA 3WBJA 1QUEA 1HZEA 1QG0A 5J35A 3ASTA 1K8AD 3CESA 2BF4A 2Q6KA 1M90D 2VNJA 1QX4A 4Z4ZA 3FJOA 3VO2A 1KC8D 3BH4A 3GIRA 3T56B 2X85A 4XD7A 1GR1A 1K28D 4RDJA 4X8IA 1GO2A 4G1BA 5FNZA 5IYRA 2JJ1A 1E63A 2DY1A 1VQOB 3PUMA 3E1YE 4YAWA 2QMUA 3CTAA 1BQEA 3GVJA 3CMMA 4B4DA 2GPJA 5HZBA 1YHQB
chains in the Genus database with same CATH topology
1N07A 1NB9A 1T6YA 2VBTA 1T6XA 2P3MA 5TRDA 1S4MA 5A89A 1P4MA 2OYNA 5A8AA 2X0KA 1T6ZA 1N08A 4UZFA 3ZUGA 1N05A 5A88A 1N06A 5FNZA 1Q9SA 5FO1A 2VBSA 3BNWA 3OP1A 5FO0A 2VBUA 3CTAA 1NB0A 2VBVA 2I1LA 1MRZA 4UZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N07 A;  1NB9 A;  1T6Y A;  2VBT A;  1T6X A;  2P3M A;  5TRD A;  1S4M A;  5A89 A;  1P4M A;  2OYN A;  5A8A A;  2X0K A;  1T6Z A;  1N08 A;  4UZF A;  3ZUG A;  1N05 A;  5A88 A;  1N06 A;  5FNZ A;  1Q9S A;  5FO1 A;  2VBS A;  3BNW A;  3OP1 A;  5FO0 A;  2VBU A;  3CTA A;  1NB0 A;  2VBV A;  2I1L A;  1MRZ A;  4UZE A; 
#chains in the Genus database with same CATH topology
 4F7D A;  4PGO A;  4B3X A;  4HE5 A;  4YAL A;  1NB9 A;  2RC5 A;  3CP8 A;  3CCE B;  1CNF A;  1R5N A;  3WNB A;  4K1X A;  4P3Y A;  1WOO A;  5HXB A;  4II2 A;  2GJP A;  1TTT A;  4P6Y A;  1EFC A;  2ZBV A;  2V7T A;  1YJ9 B;  4RCZ A;  1NRK A;  4M1K A;  1N0V C;  3CRZ A;  2ZXI A;  3Q6R A;  3PEN A;  1E79 A;  3FKS A;  5AN9 A;  3CC7 B;  3WNC A;  1VQ6 B;  1E3X A;  3W5U A;  2BGJ A;  1BJK A;  1D8T A;  2C78 A;  4RM0 A;  5CDF A;  3CME B;  1E62 A;  1SKY B;  4ZGN B;  5DN6 A;  1WOR A;  1M1K D;  4LC0 A;  4HIZ A;  4XM3 A;  1OB2 A;  3CW2 A;  4B48 A;  3W2E A;  3CCJ B;  5TRD A;  3OW2 B;  2DCU A;  1DG1 G;  3W2F A;  4XLC A;  3BY2 A;  1VQ9 B;  3CC2 B;  3JQQ A;  4Z4S A;  1NJI D;  4N3N A;  1CQX A;  1WU8 A;  3ZZ0 A;  2CW5 A;  2QA4 B;  5F4J A;  1VJS A;  2JDI A;  2V7X A;  1UD5 A;  4ACB A;  1EFT A;  2Z6B D;  5FO0 A;  4PC2 A;  2WZN A;  2OBR A;  4PC3 A;  4M53 A;  1EXM A;  1KZL A;  1ZM9 A;  2M5S A;  1EFR A;  5EMN A;  4UZE A;  5FL7 A;  4B43 A;  2CC2 A;  4ZCI A;  2W6J A;  1WDT A;  1F20 A;  1EWY A;  2QTZ A;  2XZL A;  4J0Q A;  4TKO B;  2OYN A;  4XOR A;  2F1L A;  3LVB A;  1WSR A;  5IYQ A;  1VHE A;  4ROX A;  3V76 A;  3Q38 A;  5FA6 A;  2PLF A;  2OBS A;  1QVF B;  4XOP A;  2JIZ A;  4YHB A;  2CBX A;  2ZL7 A;  3BC9 A;  3WYA A;  3PA2 A;  1K9M D;  2DIE A;  1OGJ A;  1I18 A;  2HLD A;  4Q7J B;  1D2E A;  2B7B A;  3ASS A;  2GJK A;  3MHP A;  1GAW A;  3OJX A;  4RDL A;  1EP1 B;  4LBY A;  4UZU A;  5TR9 A;  4OOX A;  1KD1 D;  4TMZ A;  4NBS A;  3AVX A;  1GAQ A;  2XNC A;  2OK7 A;  1VQP B;  1W35 A;  4JMQ A;  3OOC A;  2QE7 A;  2X6Y A;  1ZUN B;  1VQM B;  4C43 A;  4CQJ A;  3LQ6 A;  4G5G A;  1W87 A;  2V7U A;  1H42 A;  2X0K A;  2WR8 A;  3KL9 A;  3ZBT A;  4RD1 A;  4G7W A;  3BCD A;  3OZW A;  2XEX A;  4Z4W A;  1N05 A;  5A88 A;  1OB0 A;  4QV2 A;  3CD6 B;  4RPD A;  3R6J A;  1FNC A;  3ASP A;  4DQL A;  1N8R D;  2F43 A;  2CF4 A;  1UD4 A;  4WQM A;  4NNJ A;  1FDR A;  1PKV A;  4ZCM A;  2JJ2 A;  4XR6 A;  5E6T A;  4FN5 A;  1QGZ A;  1NBM A;  1VQ4 B;  1ZM3 A;  4LBV A;  1Q7Y D;  3LO8 A;  4OP7 A;  4Z4R A;  2DOG A;  2KVO A;  3AGQ A;  1E64 A;  1P4M A;  1VF7 A;  1XE1 A;  4QVA A;  3U2Q A;  3CB4 A;  4Z4Y A;  2X6W A;  1UD8 A;  4Z4T A;  1T6Z A;  4UAJ A;  5HZA A;  2CK3 A;  4H9G A;  2PE3 A;  4DNT B;  3WQZ A;  2B5O A;  1Q9S A;  1V5V A;  2AHO A;  4IW3 B;  1KK0 A;  4FWT A;  3ONU A;  1QH0 A;  1QFJ A;  2XZO A;  4OPO A;  2WJY A;  3CCM B;  2J7K A;  2OTJ B;  2ZZE A;  3QE2 A;  3QFC A;  1W0K A;  2BMW A;  2XNJ A;  2ZL5 A;  4NCN A;  1S4M A;  4M2L A;  1IJF A;  5KSW B;  2YWG A;  1QVG B;  4WWV A;  2B7C A;  2X8K A;  2YWE A;  2XGJ A;  5BSY A;  4P1V A;  4WZL A;  3CMA B;  2XZP A;  4YEL A;  2VBS A;  5IYW A;  3BNW A;  3BCF A;  2WPD A;  4DK1 A;  3OFN A;  1JB9 A;  1YI2 B;  1PJ5 A;  1R5O A;  1GJR A;  4TMV A;  4QFM A;  4LBZ A;  3OPO A;  3B8H A;  4X7F A;  2X3U A;  2DET A;  4HE6 A;  2QN6 A;  1VQ5 B;  4RD3 A;  4FK8 A;  4M4S A;  4ZCL A;  2BSA A;  5A89 A;  3AVW A;  4AC9 A;  2C4U A;  1TUI A;  3DDY A;  5F4M A;  1E1R A;  4P26 A;  5IYN A;  2HCJ B;  1MAB A;  5KNL A;  4DNR B;  1DDI A;  3D26 A;  5H5J A;  3ZUG A;  2WJV A;  1BPL A;  5HKK A;  2BPO A;  4PC6 A;  3R6K A;  1OGI A;  4P22 A;  3AVY A;  1EP3 B;  3A8I A;  5GV8 A;  1V0F A;  5IYP A;  3ZIA A;  1OB5 A;  1VQN B;  5J3O A;  4U9U A;  2VBV A;  3W5H A;  2Q6I A;  4OPV A;  1YIJ B;  4KKT A;  3CCU B;  1IHM A;  3LQE A;  5TV2 A;  2VZL A;  2VBT A;  3ISX A;  4TSF A;  1YJN B;  4LBW A;  1COW A;  1KMH A;  4RCY A;  3AVT A;  4RLZ A;  1Q86 D;  4X05 A;  4EH1 A;  2CND A;  3B78 A;  2GQF A;  3P27 A;  1RQP A;  4ACA A;  4Y9U A;  4TMW A;  1G7C A;  3QFR A;  3SLN A;  1KJZ A;  1WP6 A;  2GRE A;  4X7E A;  1VHO A;  4XNF A;  1E43 A;  1KK3 A;  4QHY A;  2DEU A;  1KTV A;  3QFT A;  2OK8 A;  5F4O A;  4OOS A;  2Q6O A;  4X06 A;  1JA1 A;  5FO1 A;  4YAU A;  4M0L A;  5BSX A;  3I55 B;  2BN4 A;  3BQJ A;  4X07 A;  4G6I A;  2QEX B;  2ZIT A;  2LZJ A;  3QFS A;  5GV7 A;  1FRQ A;  4YAF A;  2D9R A;  3B82 A;  3U6B A;  3VNV A;  1MRZ A;  4AF7 A;  5IK2 A;  1G7T A;  3ZZT A;  2HMA A;  3G71 B;  3Q39 A;  1T6X A;  2VNH A;  1CNE A;  4FXU A;  2PIA A;  4MYT A;  3WY9 A;  2NPF A;  5JBQ A;  3GVL A;  2GJR A;  2VJI A;  2ZBU A;  4PAB A;  4B47 A;  3JU4 A;  5LMZ A;  4TT3 A;  2V7V A;  1TVC A;  2D74 A;  1OHH A;  2RC6 A;  4XLE A;  3WXM A;  1W0J A;  4QUZ A;  4RD0 A;  2X53 S;  1XFO A;  4ASU A;  2E1B A;  2ZZG A;  1B23 P;  1S72 B;  1FNB A;  5H59 A;  4AF6 A;  1PJ6 A;  4XN3 A;  4DQK A;  1VLO A;  4C0S A;  4PAA A;  2I1L A;  3CPX A;  1QFY A;  4RDK A;  3SJP A;  1BX1 A;  3H94 A;  3SEJ A;  1QUF A;  2HDN B;  3PA1 A;  2EIX A;  1T6Y A;  1YLO A;  4L8J A;  2D3L A;  1B2R A;  2C5H A;  4G7X A;  5L46 A;  2QGG A;  2D3N A;  3JQP A;  3MMP A;  1KQS B;  1FND A;  2C5B A;  3BY1 A;  3RY8 A;  4XKV A;  2YWF A;  2V31 A;  1H8E A;  3FPK A;  4Y9R A;  4R71 A;  1PJ7 A;  1HVX A;  3OW7 A;  1XQB A;  1W2B B;  4Y7C A;  3A3B A;  1WOP A;  3I56 B;  2GK6 A;  3LNN A;  2EFG A;  2FX3 A;  1BLI A;  1WPC A;  1YX2 A;  2WYR A;  1KK2 A;  2R9V A;  4X7D A;  2OTL B;  3ES9 A;  1TLL A;  3AVU A;  2QDX A;  5THX A;  2BV3 A;  2C77 A;  3PVD A;  4TMT A;  3CXC B;  2V7W A;  3J81 k;  3WBK A;  1ZM4 A;  2P3M A;  2FVG A;  3CP2 A;  3JQR A;  2ZZQ A;  4GQN A;  1RQR A;  1H85 A;  5A8A A;  1FNM A;  2BM0 A;  1Q81 D;  1VQ7 B;  1KRH A;  3VO1 A;  3FPP A;  3GVK A;  3SKB A;  3G6E B;  4DK0 A;  1FRN A;  3ONY A;  1R5B A;  2E1R A;  1BMF A;  1U2R A;  1E3Z A;  3OP1 A;  1IB0 A;  4P6V F;  2ZZF A;  3Q6Q A;  1NB0 A;  3OZU A;  1SKQ A;  4Z1M A;  2F4N A;  1UD6 A;  2V4D A;  4MYU A;  4P3I A;  3ZC3 A;  3OEH A;  1Y0R A;  2VNK A;  3Q3A A;  4KKU A;  5TY0 A;  3G4S B;  1NDH A;  4B44 A;  1UD2 A;  2NV4 A;  4XKW A;  1JJ2 B;  1JA0 A;  3W2H A;  4E0F A;  3U6K A;  3CCS B;  3W5V A;  3CCV B;  2BVN A;  1F60 A;  1K73 D;  1N0U A;  1G7S A;  1J9Z A;  1SM4 A;  2GK7 A;  2VYQ A;  3VMF A;  3GSI A;  4XLH A;  1WOS A;  2DYI A;  1JNY A;  4TN1 A;  3CCR B;  3KEW A;  1VQK B;  2W6I A;  4YEJ A;  1ZM2 A;  1FX0 A;  3A1P A;  3CPW B;  1I8D A;  3T53 B;  4XMY A;  4XQF A;  2OBT A;  4QVJ A;  1D1N A;  3HAG A;  4RD6 A;  1T5E A;  3AVV A;  1S0U A;  3VR6 A;  1VQ8 B;  1H8H A;  4TMX A;  4PC1 A;  2V7Q A;  3QSY A;  4RPB A;  2WSS A;  2XOK A;  3E20 A;  3ZBU A;  1DAR A;  3VNU A;  4P2N A;  4PC7 A;  2ZXH A;  2X6X A;  1VQL B;  1A8P A;  2DER A;  1I7P A;  3WND A;  3ZZU A;  4XOT A;  3CCQ B;  2VJJ A;  1W9X A;  3SJZ A;  4Z4V A;  2WZP P;  1WTH D;  4XLA A;  1QGA A;  1Y0Y A;  3A8K A;  4XL9 A;  4BPR A;  4XN0 A;  3A8J A;  1QGY A;  1KK1 A;  2BM1 A;  2Q6L A;  4P12 A;  4WZK A;  2R6H A;  1N08 A;  2BGI A;  2PMD A;  3W2I A;  3T51 B;  2CRV A;  1G7R A;  1XB2 A;  4G1V A;  1W34 A;  4YXW A;  3CCL B;  3OAA A;  3H9N A;  1V0E A;  1YJW B;  4AVZ A;  4RJL A;  2QTL A;  2VBU A;  4P25 A;  4WZT A;  2C2W A;  2C4T A;  4B3F X;  3ZPN A;  2JN9 A;  2VNI A;  5DS0 A;  3SLD A;  3OEE A;  2ZTG A;  4OPS A;  2XND A;  3PUN A;  4X0C A;  4ZGQ B;  4OOV A;  4X7C A;  1QFZ A;  4N3G A;  4P9S A;  4KKS A;  4RD4 A;  5B6I A;  3I1F A;  1ELO A;  4II3 A;  1UD3 A;  3G05 A;  4WZE A;  4UZF A;  4XLF A;  5FIU A;  2YWH A;  1AIP A;  3OE7 A;  3ASR A;  1N06 A;  1EFU A;  4XON A;  3NE5 B;  3MCA A;  3V7A A;  4B3G A;  1YIT B;  2ZL6 A;  3GQB A;  1HA3 A;  3OKX A;  3OJW A;  3P26 A;  4RD2 A;  4YAO A;  1E1Q A;  2ZTN A;  1AMO A;  3CC4 B;  1GVH A;  1EP2 B;  1WSV A;  1DDG A;  1UMK A;  3A3G A;  4Z4U A;  5KW9 A;  1Q82 D;  1IJE A;  3A35 A;  1N07 A;  1VLY A;  3OZV A;  3W2G A;  4ZV4 A;  1BX0 A;  2F1M A;  3ASQ A;  5DSZ A;  3AGP A;  3WBJ A;  1QUE A;  1HZE A;  1QG0 A;  5J35 A;  3AST A;  1K8A D;  3CES A;  2BF4 A;  2Q6K A;  1M90 D;  2VNJ A;  1QX4 A;  4Z4Z A;  3FJO A;  3VO2 A;  1KC8 D;  3BH4 A;  3GIR A;  3T56 B;  2X85 A;  4XD7 A;  1GR1 A;  1K28 D;  4RDJ A;  4X8I A;  1GO2 A;  4G1B A;  5FNZ A;  5IYR A;  2JJ1 A;  1E63 A;  2DY1 A;  1VQO B;  3PUM A;  3E1Y E;  4YAW A;  2QMU A;  3CTA A;  1BQE A;  3GVJ A;  3CMM A;  4B4D A;  2GPJ A;  5HZB A;  1YHQ B; 
#chains in the Genus database with same CATH homology
 1N07 A;  1NB9 A;  1T6Y A;  2VBT A;  1T6X A;  2P3M A;  5TRD A;  1S4M A;  5A89 A;  1P4M A;  2OYN A;  5A8A A;  2X0K A;  1T6Z A;  1N08 A;  4UZF A;  3ZUG A;  1N05 A;  5A88 A;  1N06 A;  5FNZ A;  1Q9S A;  5FO1 A;  2VBS A;  3BNW A;  3OP1 A;  5FO0 A;  2VBU A;  3CTA A;  1NB0 A;  2VBV A;  2I1L A;  1MRZ A;  4UZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...