3BNWA

Crystal structure of riboflavin kinase from trypanosoma brucei
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
172
structure length
160
Chain Sequence
HMRQTGSFQPFFLRGKVVHSQLGFPTANIGLDKDVMECLQPYKNLVVYGWGTVSQVPGKERESFGPYPFAASIGFNTLTVEPYFLHEFGWDFYGAVVKIIVLGEIRSMGSFHSLQALVDTIKSDVQFTRDMLQKPQLQEFSRHSLFESPSSTIPYFEDLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Riboflavin kinase, putative
publication title Riboflavin kinase from Trypanosoma brucei.
rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 32
structure length 160
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2007-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 3bnwA00
1Q9SA 3BNWA 2X0KA 4UZEA 1T6YA 5FO1A 1MRZA 5A89A 5FNZA 3OP1A 2VBVA 1N07A 1NB9A 2VBUA 3CTAA 1NB0A 4UZFA 1N05A 1S4MA 5A8AA 2VBTA 2VBSA 1T6XA 1N06A 2I1LA 5A88A 5FO0A 3ZUGA 1P4MA 1N08A 1T6ZA 2OYNA 5TRDA 2P3MA
chains in the Genus database with same CATH superfamily
3LNNA 5THXA 4BPRA 4UZUA 4RD3A 3OZUA 4QVJA 5FNZA 3BY2A 1W0JA 5KSWB 1W0KA 5HZAA 5H59A 5JBQA 1VHOA 4PC3A 1R5BA 3B82A 4XLEA 1JA1A 3GQBA 3W5HA 2VBTA 4J0QA 4WZKA 2GJKA 4LBWA 2QEXB 4P6YA 3BCDA 1VQNB 4XN0A 1KK3A 3OZVA 1FNDA 1KK2A 4RDLA 3LVBA 4KKUA 1PJ6A 1FX0A 1WOSA 3QE2A 3A8KA 3OJXA 4AVZA 1CQXA 4E0FA 5A89A 4IW3B 2CC2A 1BMFA 2VBVA 2VBUA 1I7PA 2BSAA 1COWA 4G1VA 1OB0A 1RQPA 1DDGA 4XORA 1NB0A 1EXMA 3CCJB 4RD4A 2CBXA 1F20A 2ZXHA 1R5NA 5BSYA 4EH1A 4P3YA 3VMFA 3CC7B 1WOPA 2VNIA 2FX3A 3OE7A 1WDTA 2WZNA 3OKXA 3A8JA 1HZEA 3W2FA 1QGYA 4RCYA 2DOGA 1GAQA 3FPPA 5TY0A 1GO2A 3BCFA 2X6YA 1W35A 1T6YA 3HAGA 4XLCA 1KJZA 1E79A 1Q82D 2C2WA 4ZCIA 1WORA 2WSSA 1EFUA 4B43A 2D3NA 4G1BA 2WPDA 2HCJB 1MABA 5J3OA 4XD7A 1EP3B 1H42A 3SLDA 1A8PA 2ZXIA 3B78A 4LC0A 4C0SA 4RDKA 2GJRA 3ASSA 1FRNA 4RM0A 4NCNA 1VQKB 1T6ZA 3ZC3A 5IYPA 3G71B 4RJLA 2B5OA 4N3GA 3WYAA 2F4NA 4XL9A 1IJFA 1JNYA 5KNLA 4OPOA 1WSVA 2QE7A 5FIUA 1IJEA 3OJWA 5IK2A 3U6BA 3ASPA 2C78A 4Z1MA 1FRQA 2Q6LA 2AHOA 2M5SA 4P9SA 1KMHA 2DEUA 4ZGQB 2EIXA 1H8EA 3JQRA 3CD6B 1G7SA 3GSIA 3VNUA 3PUNA 3VO2A 4II2A 4NBSA 2R6HA 1W9XA 5A88A 2BVNA 1ELOA 1ZUNB 2C77A 2XEXA 4LBZA 4RPDA 4WZTA 4YHBA 3ZUGA 4XQFA 1W2BB 2QDXA 2DETA 1Q9SA 3CP8A 2PIAA 3CCRB 3Q6RA 2EFGA 4G7WA 2QA4B 1E63A 1HA3A 2CK3A 2C5BA 2OK8A 4RD6A 4X05A 4YAOA 3V7AA 3A8IA 1NB9A 1TLLA 2ZBVA 3MCAA 2E1BA 5AN9A 1VQ9B 1TTTA 2DIEA 4TKOB 1NRKA 4ACBA 1EP2B 3R6JA 4OPVA 3CC2B 3GVLA 2Q6IA 3A1PA 3CRZA 2XNDA 3FKSA 1YHQB 1QUEA 1YJWB 4X06A 4B44A 2J7KA 3CCSB 1FNCA 1QVGB 1KRHA 1S0UA 1BX0A 1QG0A 4Z4WA 1XQBA 1YIJB 2CW5A 2WR8A 3H94A 1MRZA 2BN4A 2OK7A 4PC2A 4X7EA 4P22A 3KL9A 2RC6A 2V7QA 1WU8A 2F43A 2JIZA 2D3LA 4FWTA 4WZEA 2WZPP 1U2RA 5L46A 4U9UA 3GVKA 1D2EA 3LQEA 1K8AD 5TV2A 3PA2A 4R71A 4XR6A 3FPKA 3ONUA 4B3FX 4RD0A 1EFRA 2V4DA 2OBRA 2ZZQA 5GV7A 2NPFA 2YWEA 2VZLA 3WBKA 1R5OA 4P1VA 5IYQA 1NJID 2HDNB 3CW2A 3T53B 5GV8A 3Q6QA 2X0KA 4YXWA 1OB2A 2W6JA 3AVWA 5HZBA 3A35A 3OPOA 2V7WA 3RY8A 4MYUA 1JA0A 3ZIAA 1D8TA 4UZFA 4AF6A 1E62A 1W87A 2C4TA 4L8JA 2F1LA 1BPLA 1QFYA 5DSZA 3OW2B 1ZM3A 2ZZGA 4WZLA 2C5HA 3LQ6A 4K1XA 3GIRA 5KW9A 1Q86D 1GJRA 2X3UA 3JU4A 4Z4SA 1VHEA 2WYRA 4XKWA 3R6KA 4XLFA 1SKQA 4OP7A 1FNMA 1QUFA 1VQ6B 3QFSA 3CXCB 1M1KD 4XNFA 1GVHA 3BH4A 2V7UA 2YWHA 3JQPA 3AGPA 4QHYA 1CNEA 1T5EA 1WSRA 2ZZEA 3VR6A 3PUMA 2QGGA 4G7XA 1GAWA 2JJ1A 3CPWB 1N0UA 4N3NA 4RPBA 2PMDA 2BGJA 1G7CA 1YX2A 4B47A 4XLAA 1WPCA 3CPXA 4X0CA 4OOVA 4B48A 4XONA 1OGJA 2ZL6A 3QFTA 3G6EB 4Z4RA 1V5VA 3G4SB 1QFJA 2VBSA 4B3GA 2FVGA 3ASTA 1M90D 4Z4YA 3Q38A 1OB5A 1B23P 1I18A 1KQSB 1N08A 2ZITA 2E1RA 3ZZUA 5E6TA 5J35A 3GVJA 3H9NA 5IYWA 2ZZFA 1KZLA 3PVDA 2GJPA 4AC9A 2V7TA 4KKTA 1VQ7B 3CMMA 4YAFA 4XMYA 4X07A 3W2GA 4Z4ZA 1QGZA 4M0LA 3U2QA 4P12A 4XLHA 2BGIA 2VJIA 2BPOA 1DG1G 3CMEB 4FK8A 4YAWA 2XOKA 4F7DA 1UD6A 3CMAB 3VNVA 1VQ5B 3WBJA 2OTJB 1KD1D 5TRDA 1QFZA 1EP1B 2CF4A 1PKVA 3QFRA 3AVXA 2QMUA 3G05A 2XZLA 4Q7JB 3CCQB 2XNJA 1SM4A 3CCVB 2GK7A 1KTVA 2HMAA 1QGAA 3PA1A 4WWVA 4X7CA 4G6IA 3OAAA 1BJKA 4C43A 1D1NA 1GR1A 4PABA 1QVFB 3SJZA 2VYQA 1OHHA 3ZBTA 2OBTA 4X8IA 2VNKA 4ACAA 1E64A 1RQRA 1S4MA 2PLFA 4LBYA 1Q7YD 4HIZA 3B8HA 4DQLA 4HE5A 4UAJA 4M53A 3CCUB 5FO0A 4KKSA 2JDIA 3Q39A 3OEEA 1CNFA 3P27A 1UD3A 1VLYA 3WY9A 2X6XA 2ZL5A 5B6IA 4II3A 4XOPA 5DS0A 1K73D 4TSFA 4ZCLA 2WJYA 4ZGNB 1TUIA 3BNWA 5HKKA 3BQJA 1E3XA 1DARA 4UZEA 5H5JA 1AMOA 3KEWA 3ES9A 2NV4A 2PE3A 5FA6A 5BSXA 2LZJA 2BMWA 2GK6A 4P26A 2XZPA 1V0EA 1E3ZA 1WOOA 3ASRA 1ZM9A 4M4SA 3PENA 1E43A 1PJ5A 3MMPA 4PC1A 1ZM4A 2CNDA 3JQQA 1HVXA 4PC6A 4Y7CA 1E1RA 1QX4A 3ZZ0A 3I55B 2GPJA 1N06A 4P25A 2JN9A 1UD5A 3CCMB 5IYRA 3Q3AA 1K9MD 1S72B 2XGJA 5F4OA 2Z6BD 4B3XA 2CRVA 4YALA 4DQKA 1VQOB 1NBMA 5FO1A 1FNBA 5F4MA 3CESA 3AVYA 5EMNA 3OP1A 3SEJA 1EWYA 4RCZA 3BC9A 1YJ9B 2VNHA 3OOCA 1QH0A 1KK1A 4X7FA 5FL7A 4ZV4A 3V76A 3U6KA 3AVTA 1VQ8B 4QFMA 1WP6A 3CP2A 3E20A 2Q6KA 5CDFA 2GQFA 4LBVA 3CC4B 4RLZA 4QVAA 1G7RA 3W2EA 4AF7A 2OYNA 1BLIA 3SLNA 4DNRB 2QN6A 1YITB 3QFCA 3ZPNA 1YI2B 4CQJA 2V7XA 2DCUA 2ZTGA 4Z4TA 4Z4UA 3ZBUA 2OTLB 1VLOA 2YWGA 1FDRA 3WNBA 1DDIA 2B7CA 3OW7A 2Q6OA 3DDYA 2QTZA 3W5UA 3WQZA 2X53S 1YJNB 5DN6A 3WNDA 2D74A 4OOSA 4OPSA 4NNJA 4XN3A 3I56B 4TN1A 3SJPA 4QV2A 1VF7A 1KC8D 3T56B 1K28D 3CCLB 5LMZA 5IYNA 3ASQA 2C4UA 3OFNA 4TT3A 3T51B 1J9ZA 4ASUA 4RD2A 1VQ4B 1PJ7A 1TVCA 2I1LA 1VQLB 5F4JA 1UD4A 2P3MA 4RD1A 1UMKA 2BM0A 4TMWA 4DNTB 1XB2A 1IHMA 4TMXA 2D9RA 3LO8A 2HLDA 1AIPA 3A3GA 2B7BA 3E1YE 2VJJA 4X7DA 4FXUA 3ISXA 4MYTA 1IB0A 1Q81D 3OEHA 3FJOA 3SKBA 2DYIA 2XZOA 1V0FA 1N05A 3D26A 2XNCA 4H9GA 3MHPA 1E1QA 1H8HA 3QSYA 5TR9A 1YLOA 4DK1A 1Y0RA 4XM3A 1F60A 1B2RA 1UD8A 2JJ2A 2RC5A 2V31A 3WXMA 3J81k 4WQMA 2V7VA 2ZBUA 4P3IA 2QTLA 3A3BA 2KVOA 3ONYA 4Y9UA 4OOXA 1N8RD 1N07A 1NDHA 3VO1A 2W6IA 1UD2A 2DY1A 4ROXA 1G7TA 1SKYB 2DERA 1ZM2A 2WJVA 2X8KA 4GQNA 3W5VA 2F1MA 4P6VF 3CB4A 1JB9A 3BY1A 3W2HA 4QUZA 4XOTA 4P2NA 1BX1A 1N0VC 4ZCMA 1JJ2B 1VQMB 2OBSA 3I1FA 2VNJA 4PAAA 4G5GA 4M2LA 4M1KA 1EFTA 4YAUA 2GREA 2YWFA 4TMZA 3OZWA 1WTHD 4B4DA 3AVUA 2BM1A 3NE5B 3CCEB 3CTAA 1H85A 2ZL7A 1W34A 4PC7A 4Y9RA 3W2IA 4XKVA 1EFCA 1I8DA 1Y0YA 1XE1A 4HE6A 1VJSA 4DK0A 5HXBA 4Z4VA 4YELA 4YEJA 5A8AA 2BF4A 3P26A 3AVVA 4JMQA 1VQPB 2ZTNA 3AGQA 4TMTA 2R9VA 2X6WA 1T6XA 3ZZTA 1XFOA 1KK0A 1P4MA 4RDJA 1BQEA 4PGOA 1OGIA 4TMVA 3WNCA 2BV3A 2X85A 4FN5A
chains in the Genus database with same CATH topology
1Q9SA 3BNWA 2X0KA 4UZEA 1T6YA 5FO1A 1MRZA 5A89A 5FNZA 3OP1A 2VBVA 1N07A 1NB9A 2VBUA 3CTAA 1NB0A 4UZFA 1N05A 1S4MA 5A8AA 2VBTA 2VBSA 1T6XA 1N06A 2I1LA 5A88A 5FO0A 3ZUGA 1P4MA 1N08A 1T6ZA 2OYNA 5TRDA 2P3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9S A;  3BNW A;  2X0K A;  4UZE A;  1T6Y A;  5FO1 A;  1MRZ A;  5A89 A;  5FNZ A;  3OP1 A;  2VBV A;  1N07 A;  1NB9 A;  2VBU A;  3CTA A;  1NB0 A;  4UZF A;  1N05 A;  1S4M A;  5A8A A;  2VBT A;  2VBS A;  1T6X A;  1N06 A;  2I1L A;  5A88 A;  5FO0 A;  3ZUG A;  1P4M A;  1N08 A;  1T6Z A;  2OYN A;  5TRD A;  2P3M A; 
#chains in the Genus database with same CATH topology
 3LNN A;  5THX A;  4BPR A;  4UZU A;  4RD3 A;  3OZU A;  4QVJ A;  5FNZ A;  3BY2 A;  1W0J A;  5KSW B;  1W0K A;  5HZA A;  5H59 A;  5JBQ A;  1VHO A;  4PC3 A;  1R5B A;  3B82 A;  4XLE A;  1JA1 A;  3GQB A;  3W5H A;  2VBT A;  4J0Q A;  4WZK A;  2GJK A;  4LBW A;  2QEX B;  4P6Y A;  3BCD A;  1VQN B;  4XN0 A;  1KK3 A;  3OZV A;  1FND A;  1KK2 A;  4RDL A;  3LVB A;  4KKU A;  1PJ6 A;  1FX0 A;  1WOS A;  3QE2 A;  3A8K A;  3OJX A;  4AVZ A;  1CQX A;  4E0F A;  5A89 A;  4IW3 B;  2CC2 A;  1BMF A;  2VBV A;  2VBU A;  1I7P A;  2BSA A;  1COW A;  4G1V A;  1OB0 A;  1RQP A;  1DDG A;  4XOR A;  1NB0 A;  1EXM A;  3CCJ B;  4RD4 A;  2CBX A;  1F20 A;  2ZXH A;  1R5N A;  5BSY A;  4EH1 A;  4P3Y A;  3VMF A;  3CC7 B;  1WOP A;  2VNI A;  2FX3 A;  3OE7 A;  1WDT A;  2WZN A;  3OKX A;  3A8J A;  1HZE A;  3W2F A;  1QGY A;  4RCY A;  2DOG A;  1GAQ A;  3FPP A;  5TY0 A;  1GO2 A;  3BCF A;  2X6Y A;  1W35 A;  1T6Y A;  3HAG A;  4XLC A;  1KJZ A;  1E79 A;  1Q82 D;  2C2W A;  4ZCI A;  1WOR A;  2WSS A;  1EFU A;  4B43 A;  2D3N A;  4G1B A;  2WPD A;  2HCJ B;  1MAB A;  5J3O A;  4XD7 A;  1EP3 B;  1H42 A;  3SLD A;  1A8P A;  2ZXI A;  3B78 A;  4LC0 A;  4C0S A;  4RDK A;  2GJR A;  3ASS A;  1FRN A;  4RM0 A;  4NCN A;  1VQK B;  1T6Z A;  3ZC3 A;  5IYP A;  3G71 B;  4RJL A;  2B5O A;  4N3G A;  3WYA A;  2F4N A;  4XL9 A;  1IJF A;  1JNY A;  5KNL A;  4OPO A;  1WSV A;  2QE7 A;  5FIU A;  1IJE A;  3OJW A;  5IK2 A;  3U6B A;  3ASP A;  2C78 A;  4Z1M A;  1FRQ A;  2Q6L A;  2AHO A;  2M5S A;  4P9S A;  1KMH A;  2DEU A;  4ZGQ B;  2EIX A;  1H8E A;  3JQR A;  3CD6 B;  1G7S A;  3GSI A;  3VNU A;  3PUN A;  3VO2 A;  4II2 A;  4NBS A;  2R6H A;  1W9X A;  5A88 A;  2BVN A;  1ELO A;  1ZUN B;  2C77 A;  2XEX A;  4LBZ A;  4RPD A;  4WZT A;  4YHB A;  3ZUG A;  4XQF A;  1W2B B;  2QDX A;  2DET A;  1Q9S A;  3CP8 A;  2PIA A;  3CCR B;  3Q6R A;  2EFG A;  4G7W A;  2QA4 B;  1E63 A;  1HA3 A;  2CK3 A;  2C5B A;  2OK8 A;  4RD6 A;  4X05 A;  4YAO A;  3V7A A;  3A8I A;  1NB9 A;  1TLL A;  2ZBV A;  3MCA A;  2E1B A;  5AN9 A;  1VQ9 B;  1TTT A;  2DIE A;  4TKO B;  1NRK A;  4ACB A;  1EP2 B;  3R6J A;  4OPV A;  3CC2 B;  3GVL A;  2Q6I A;  3A1P A;  3CRZ A;  2XND A;  3FKS A;  1YHQ B;  1QUE A;  1YJW B;  4X06 A;  4B44 A;  2J7K A;  3CCS B;  1FNC A;  1QVG B;  1KRH A;  1S0U A;  1BX0 A;  1QG0 A;  4Z4W A;  1XQB A;  1YIJ B;  2CW5 A;  2WR8 A;  3H94 A;  1MRZ A;  2BN4 A;  2OK7 A;  4PC2 A;  4X7E A;  4P22 A;  3KL9 A;  2RC6 A;  2V7Q A;  1WU8 A;  2F43 A;  2JIZ A;  2D3L A;  4FWT A;  4WZE A;  2WZP P;  1U2R A;  5L46 A;  4U9U A;  3GVK A;  1D2E A;  3LQE A;  1K8A D;  5TV2 A;  3PA2 A;  4R71 A;  4XR6 A;  3FPK A;  3ONU A;  4B3F X;  4RD0 A;  1EFR A;  2V4D A;  2OBR A;  2ZZQ A;  5GV7 A;  2NPF A;  2YWE A;  2VZL A;  3WBK A;  1R5O A;  4P1V A;  5IYQ A;  1NJI D;  2HDN B;  3CW2 A;  3T53 B;  5GV8 A;  3Q6Q A;  2X0K A;  4YXW A;  1OB2 A;  2W6J A;  3AVW A;  5HZB A;  3A35 A;  3OPO A;  2V7W A;  3RY8 A;  4MYU A;  1JA0 A;  3ZIA A;  1D8T A;  4UZF A;  4AF6 A;  1E62 A;  1W87 A;  2C4T A;  4L8J A;  2F1L A;  1BPL A;  1QFY A;  5DSZ A;  3OW2 B;  1ZM3 A;  2ZZG A;  4WZL A;  2C5H A;  3LQ6 A;  4K1X A;  3GIR A;  5KW9 A;  1Q86 D;  1GJR A;  2X3U A;  3JU4 A;  4Z4S A;  1VHE A;  2WYR A;  4XKW A;  3R6K A;  4XLF A;  1SKQ A;  4OP7 A;  1FNM A;  1QUF A;  1VQ6 B;  3QFS A;  3CXC B;  1M1K D;  4XNF A;  1GVH A;  3BH4 A;  2V7U A;  2YWH A;  3JQP A;  3AGP A;  4QHY A;  1CNE A;  1T5E A;  1WSR A;  2ZZE A;  3VR6 A;  3PUM A;  2QGG A;  4G7X A;  1GAW A;  2JJ1 A;  3CPW B;  1N0U A;  4N3N A;  4RPB A;  2PMD A;  2BGJ A;  1G7C A;  1YX2 A;  4B47 A;  4XLA A;  1WPC A;  3CPX A;  4X0C A;  4OOV A;  4B48 A;  4XON A;  1OGJ A;  2ZL6 A;  3QFT A;  3G6E B;  4Z4R A;  1V5V A;  3G4S B;  1QFJ A;  2VBS A;  4B3G A;  2FVG A;  3AST A;  1M90 D;  4Z4Y A;  3Q38 A;  1OB5 A;  1B23 P;  1I18 A;  1KQS B;  1N08 A;  2ZIT A;  2E1R A;  3ZZU A;  5E6T A;  5J35 A;  3GVJ A;  3H9N A;  5IYW A;  2ZZF A;  1KZL A;  3PVD A;  2GJP A;  4AC9 A;  2V7T A;  4KKT A;  1VQ7 B;  3CMM A;  4YAF A;  4XMY A;  4X07 A;  3W2G A;  4Z4Z A;  1QGZ A;  4M0L A;  3U2Q A;  4P12 A;  4XLH A;  2BGI A;  2VJI A;  2BPO A;  1DG1 G;  3CME B;  4FK8 A;  4YAW A;  2XOK A;  4F7D A;  1UD6 A;  3CMA B;  3VNV A;  1VQ5 B;  3WBJ A;  2OTJ B;  1KD1 D;  5TRD A;  1QFZ A;  1EP1 B;  2CF4 A;  1PKV A;  3QFR A;  3AVX A;  2QMU A;  3G05 A;  2XZL A;  4Q7J B;  3CCQ B;  2XNJ A;  1SM4 A;  3CCV B;  2GK7 A;  1KTV A;  2HMA A;  1QGA A;  3PA1 A;  4WWV A;  4X7C A;  4G6I A;  3OAA A;  1BJK A;  4C43 A;  1D1N A;  1GR1 A;  4PAB A;  1QVF B;  3SJZ A;  2VYQ A;  1OHH A;  3ZBT A;  2OBT A;  4X8I A;  2VNK A;  4ACA A;  1E64 A;  1RQR A;  1S4M A;  2PLF A;  4LBY A;  1Q7Y D;  4HIZ A;  3B8H A;  4DQL A;  4HE5 A;  4UAJ A;  4M53 A;  3CCU B;  5FO0 A;  4KKS A;  2JDI A;  3Q39 A;  3OEE A;  1CNF A;  3P27 A;  1UD3 A;  1VLY A;  3WY9 A;  2X6X A;  2ZL5 A;  5B6I A;  4II3 A;  4XOP A;  5DS0 A;  1K73 D;  4TSF A;  4ZCL A;  2WJY A;  4ZGN B;  1TUI A;  3BNW A;  5HKK A;  3BQJ A;  1E3X A;  1DAR A;  4UZE A;  5H5J A;  1AMO A;  3KEW A;  3ES9 A;  2NV4 A;  2PE3 A;  5FA6 A;  5BSX A;  2LZJ A;  2BMW A;  2GK6 A;  4P26 A;  2XZP A;  1V0E A;  1E3Z A;  1WOO A;  3ASR A;  1ZM9 A;  4M4S A;  3PEN A;  1E43 A;  1PJ5 A;  3MMP A;  4PC1 A;  1ZM4 A;  2CND A;  3JQQ A;  1HVX A;  4PC6 A;  4Y7C A;  1E1R A;  1QX4 A;  3ZZ0 A;  3I55 B;  2GPJ A;  1N06 A;  4P25 A;  2JN9 A;  1UD5 A;  3CCM B;  5IYR A;  3Q3A A;  1K9M D;  1S72 B;  2XGJ A;  5F4O A;  2Z6B D;  4B3X A;  2CRV A;  4YAL A;  4DQK A;  1VQO B;  1NBM A;  5FO1 A;  1FNB A;  5F4M A;  3CES A;  3AVY A;  5EMN A;  3OP1 A;  3SEJ A;  1EWY A;  4RCZ A;  3BC9 A;  1YJ9 B;  2VNH A;  3OOC A;  1QH0 A;  1KK1 A;  4X7F A;  5FL7 A;  4ZV4 A;  3V76 A;  3U6K A;  3AVT A;  1VQ8 B;  4QFM A;  1WP6 A;  3CP2 A;  3E20 A;  2Q6K A;  5CDF A;  2GQF A;  4LBV A;  3CC4 B;  4RLZ A;  4QVA A;  1G7R A;  3W2E A;  4AF7 A;  2OYN A;  1BLI A;  3SLN A;  4DNR B;  2QN6 A;  1YIT B;  3QFC A;  3ZPN A;  1YI2 B;  4CQJ A;  2V7X A;  2DCU A;  2ZTG A;  4Z4T A;  4Z4U A;  3ZBU A;  2OTL B;  1VLO A;  2YWG A;  1FDR A;  3WNB A;  1DDI A;  2B7C A;  3OW7 A;  2Q6O A;  3DDY A;  2QTZ A;  3W5U A;  3WQZ A;  2X53 S;  1YJN B;  5DN6 A;  3WND A;  2D74 A;  4OOS A;  4OPS A;  4NNJ A;  4XN3 A;  3I56 B;  4TN1 A;  3SJP A;  4QV2 A;  1VF7 A;  1KC8 D;  3T56 B;  1K28 D;  3CCL B;  5LMZ A;  5IYN A;  3ASQ A;  2C4U A;  3OFN A;  4TT3 A;  3T51 B;  1J9Z A;  4ASU A;  4RD2 A;  1VQ4 B;  1PJ7 A;  1TVC A;  2I1L A;  1VQL B;  5F4J A;  1UD4 A;  2P3M A;  4RD1 A;  1UMK A;  2BM0 A;  4TMW A;  4DNT B;  1XB2 A;  1IHM A;  4TMX A;  2D9R A;  3LO8 A;  2HLD A;  1AIP A;  3A3G A;  2B7B A;  3E1Y E;  2VJJ A;  4X7D A;  4FXU A;  3ISX A;  4MYT A;  1IB0 A;  1Q81 D;  3OEH A;  3FJO A;  3SKB A;  2DYI A;  2XZO A;  1V0F A;  1N05 A;  3D26 A;  2XNC A;  4H9G A;  3MHP A;  1E1Q A;  1H8H A;  3QSY A;  5TR9 A;  1YLO A;  4DK1 A;  1Y0R A;  4XM3 A;  1F60 A;  1B2R A;  1UD8 A;  2JJ2 A;  2RC5 A;  2V31 A;  3WXM A;  3J81 k;  4WQM A;  2V7V A;  2ZBU A;  4P3I A;  2QTL A;  3A3B A;  2KVO A;  3ONY A;  4Y9U A;  4OOX A;  1N8R D;  1N07 A;  1NDH A;  3VO1 A;  2W6I A;  1UD2 A;  2DY1 A;  4ROX A;  1G7T A;  1SKY B;  2DER A;  1ZM2 A;  2WJV A;  2X8K A;  4GQN A;  3W5V A;  2F1M A;  4P6V F;  3CB4 A;  1JB9 A;  3BY1 A;  3W2H A;  4QUZ A;  4XOT A;  4P2N A;  1BX1 A;  1N0V C;  4ZCM A;  1JJ2 B;  1VQM B;  2OBS A;  3I1F A;  2VNJ A;  4PAA A;  4G5G A;  4M2L A;  4M1K A;  1EFT A;  4YAU A;  2GRE A;  2YWF A;  4TMZ A;  3OZW A;  1WTH D;  4B4D A;  3AVU A;  2BM1 A;  3NE5 B;  3CCE B;  3CTA A;  1H85 A;  2ZL7 A;  1W34 A;  4PC7 A;  4Y9R A;  3W2I A;  4XKV A;  1EFC A;  1I8D A;  1Y0Y A;  1XE1 A;  4HE6 A;  1VJS A;  4DK0 A;  5HXB A;  4Z4V A;  4YEL A;  4YEJ A;  5A8A A;  2BF4 A;  3P26 A;  3AVV A;  4JMQ A;  1VQP B;  2ZTN A;  3AGQ A;  4TMT A;  2R9V A;  2X6W A;  1T6X A;  3ZZT A;  1XFO A;  1KK0 A;  1P4M A;  4RDJ A;  1BQE A;  4PGO A;  1OGI A;  4TMV A;  3WNC A;  2BV3 A;  2X85 A;  4FN5 A; 
#chains in the Genus database with same CATH homology
 1Q9S A;  3BNW A;  2X0K A;  4UZE A;  1T6Y A;  5FO1 A;  1MRZ A;  5A89 A;  5FNZ A;  3OP1 A;  2VBV A;  1N07 A;  1NB9 A;  2VBU A;  3CTA A;  1NB0 A;  4UZF A;  1N05 A;  1S4M A;  5A8A A;  2VBT A;  2VBS A;  1T6X A;  1N06 A;  2I1L A;  5A88 A;  5FO0 A;  3ZUG A;  1P4M A;  1N08 A;  1T6Z A;  2OYN A;  5TRD A;  2P3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...