3BNWA

Crystal structure of riboflavin kinase from trypanosoma brucei
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
172
structure length
160
Chain Sequence
HMRQTGSFQPFFLRGKVVHSQLGFPTANIGLDKDVMECLQPYKNLVVYGWGTVSQVPGKERESFGPYPFAASIGFNTLTVEPYFLHEFGWDFYGAVVKIIVLGEIRSMGSFHSLQALVDTIKSDVQFTRDMLQKPQLQEFSRHSLFESPSSTIPYFEDLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Riboflavin kinase from Trypanosoma brucei.
rcsb
source organism Trypanosoma brucei
molecule tags Transferase
molecule keywords Riboflavin kinase, putative
total genus 32
structure length 160
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2007-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 3bnwA00
1S4MA 2VBTA 2X0KA 1N05A 4UZFA 1N06A 1Q9SA 5FNZA 2VBVA 3BNWA 2OYNA 1MRZA 5A89A 1N07A 1T6XA 3ZUGA 1P4MA 3CTAA 2P3MA 5A8AA 5FO1A 2VBSA 4UZEA 3OP1A 1T6ZA 5A88A 1NB9A 1NB0A 1T6YA 1N08A 2I1LA 2VBUA 5FO0A 5TRDA
chains in the Genus database with same CATH superfamily
1N05A 1WOOA 3B82A 1FNDA 1S0UA 2ZZFA 3WXMA 2Q6LA 1QH0A 5DSZA 4YEJA 3W2GA 1WOPA 3CD6B 1KK2A 4ZCMA 3CC4B 2E1RA 1VHOA 4X05A 4X7CA 1UD5A 1BJKA 2OBTA 3LQ6A 2J7KA 1ZM3A 3VR6A 2BV3A 2WZNA 1RQRA 1DDGA 1KK3A 1FRQA 4WQMA 1T5EA 3CCUB 1NB9A 3CCVB 4RD6A 3HAGA 3U6KA 2WPDA 1V0FA 1JA1A 1W34A 2YWFA 4UAJA 1FDRA 1G7TA 2BPOA 3FJOA 3ES9A 4P22A 2QMUA 3P26A 3A35A 2BMWA 3CCMB 3CXCB 4LBZA 3I55B 2ZXHA 4XLCA 1N0UA 1EFUA 2X3UA 1FRNA 3G05A 4RLZA 4RDKA 3OW2B 1BX1A 3CMMA 3CCSB 5KSWB 1T6XA 4PAAA 3WNDA 1CNFA 2B7CA 4G1VA 1JA0A 3GVJA 1IB0A 4AC9A 2X6YA 2Q6KA 2X8KA 3CMAB 1E43A 1VQPB 1R5OA 4AVZA 1QG0A 1COWA 4Z4WA 2WSSA 4G7WA 4DK0A 1S72B 1YHQB 3QSYA 3JQQA 3FPPA 2FX3A 1DARA 2BSAA 3CPXA 4RPBA 4ZCIA 4L8JA 1GAQA 2BM1A 3ASTA 1G7SA 4RD2A 4WZTA 4TN1A 4XOTA 3MMPA 1CNEA 3SKBA 3ZC3A 4C43A 1QGYA 5FNZA 4ZCLA 2ZTNA 2QTZA 3BY2A 4RD3A 3A3GA 4P12A 4MYUA 1B23P 2JJ1A 3CPWB 3CCEB 1K8AD 4NNJA 2XNDA 5A8AA 2RC5A 4BPRA 1WU8A 4WZEA 3GVLA 4M1KA 4QHYA 1FNBA 2D74A 3JQPA 1OB2A 3ZZTA 3PA1A 4HE6A 2XOKA 1ELOA 4RCYA 1WSVA 4M0LA 2BF4A 4Z4RA 5BSYA 4DNTB 1E3XA 1MABA 3ISXA 3W2IA 4Z4SA 3SLNA 2F4NA 2PE3A 2WR8A 4XLHA 1YIJB 5H5JA 3ASPA 4XKVA 5TY0A 2X0KA 2X53S 3A8JA 5DN6A 2BM0A 2GREA 2BVNA 1G7CA 1FX0A 1KMHA 2QE7A 2OK7A 3JQRA 2W6IA 4M4SA 5THXA 4B3GA 3BY1A 2WZPP 3QFCA 3ZZ0A 4GQNA 4RM0A 1P4MA 1E3ZA 1QX4A 2VNHA 5TR9A 4DQLA 2XNJA 3AVYA 2JDIA 3OOCA 4LBWA 1KC8D 3GIRA 1GAWA 2V7TA 3ONYA 5GV7A 4UZEA 1N8RD 1I7PA 3OE7A 2C5BA 4IW3B 1HA3A 1UD6A 2WJVA 3ZBUA 3W2HA 4QVJA 2GK7A 2C77A 3GVKA 4RD1A 5FO0A 5J3OA 3CC7B 1XQBA 4NBSA 3OPOA 2VZLA 2GJRA 3MCAA 1E79A 3FPKA 3OFNA 2OYNA 1TTTA 3WBKA 1SKQA 4YAOA 4M2LA 2B5OA 3V76A 1J9ZA 2GJPA 1VQKB 2CBXA 1KZLA 3AVUA 1JB9A 4P25A 4ZGQB 1EXMA 3OP1A 1BLIA 1SKYB 2C4TA 5A88A 1GVHA 1ZM4A 1EP3B 1NDHA 4TMWA 2NV4A 3W5HA 1EFCA 3VO2A 2PMDA 2BGIA 3FKSA 3RY8A 4LC0A 3U2QA 1VQNB 2R9VA 1E64A 4YAWA 4N3NA 3CRZA 1S4MA 3PUNA 4HE5A 5HXBA 4J0QA 1VLOA 3SEJA 4RDLA 3B78A 2JJ2A 5HKKA 2XNCA 2QGGA 2ZBVA 1NRKA 3JU4A 4KKUA 1VQ9B 3PA2A 4XONA 2XGJA 1E1QA 5IK2A 4Z4VA 1XE1A 4YELA 3A1PA 5TV2A 4TMXA 5E6TA 2Q6IA 2QTLA 2CNDA 2V31A 2ZL7A 3BCDA 1T6YA 4FN5A 3J81k 1VHEA 4TSFA 4B3FX 3KEWA 1BMFA 2DCUA 4U9UA 2F1LA 4X7EA 1WTHD 4UZFA 4X8IA 1N06A 4II2A 4P6YA 3VMFA 4G1BA 5HZBA 3SJZA 1EWYA 4FXUA 4TKOB 5IYPA 3Q38A 1TVCA 3OZUA 3W5VA 1BQEA 1E1RA 3Q6QA 4Z4ZA 2V7XA 1KK0A 4KKSA 4XLFA 3VO1A 1YJ9B 1F20A 3E20A 5BSXA 3LNNA 1CQXA 4Y9RA 3CB4A 2PLFA 4PC1A 3SLDA 1R5BA 2AHOA 3ZBTA 2HMAA 2ZTGA 3G6EB 3T56B 4XR6A 5KW9A 2ZZGA 2DERA 1H8HA 4DK1A 1QGZA 1W35A 3U6BA 1Y0RA 4HIZA 5AN9A 2GJKA 4B47A 3AGQA 3LQEA 4LBYA 1MRZA 4DNRB 1JJ2B 1M90D 1NJID 1QFZA 3CP2A 3A8IA 1FNCA 2PIAA 5H59A 1G7RA 4XL9A 2ZITA 4XN0A 3W5UA 2HDNB 2DY1A 3NE5B 1YJNB 4XM3A 3W2EA 3CC2B 4CQJA 1QFJA 1T6ZA 2QEXB 1VQ7B 2F43A 4QUZA 1QVGB 3SJPA 4XQFA 1VJSA 1VQ4B 1YI2B 2VYQA 3ONUA 2XEXA 1QGAA 2QA4B 4ROXA 1NBMA 4Q7JB 4TMVA 2JIZA 3CCJB 2DYIA 1WDTA 2VNJA 4KKTA 2VBVA 1KTVA 2V7VA 3BNWA 5FIUA 1EP1B 1N07A 2DOGA 3OZWA 3BH4A 5DS0A 2WJYA 2RC6A 3OJWA 2V7WA 3CTAA 4ACAA 2GQFA 5IYNA 3AVWA 1Q82D 3CCLB 4YHBA 2YWGA 2Q6OA 2VNKA 3LO8A 2ZL6A 3CCRB 4C0SA 1ZUNB 2V7QA 2ZZEA 4F7DA 3A8KA 3AVXA 2VNIA 3CW2A 1H8EA 1I18A 4M53A 1Q7YD 5JBQA 4RD4A 4WWVA 4X7FA 1OGJA 2BGJA 4Z4YA 4PGOA 1K9MD 1WP6A 3D26A 4P3IA 4PC2A 3WBJA 1K28D 3R6JA 5FL7A 2XZLA 3QFRA 3LVBA 3MHPA 3BC9A 2D3LA 3Q39A 5IYWA 2C4UA 1Q81D 3VNVA 3G71B 1WOSA 4P26A 1KRHA 3A3BA 4P1VA 5KNLA 4WZKA 4OPVA 2VBUA 2HCJB 4PC3A 1PJ7A 4UZUA 1D8TA 3WQZA 4RJLA 4RD0A 1VQOB 1H85A 3WNBA 1PJ6A 1KJZA 4MYTA 3OEHA 4AF7A 1IJFA 1W0KA 1QFYA 4RCZA 4FWTA 2CC2A 1AMOA 3CCQB 1WORA 1UD3A 2B7BA 3CESA 2QN6A 2D3NA 4LBVA 1VQ8B 3I1FA 4Y7CA 2QDXA 4K1XA 1Y0YA 4WZLA 3OAAA 4X06A 1N0VC 4NCNA 2GPJA 4Z4UA 2XZOA 1YJWB 4ZV4A 2NPFA 2C78A 4B44A 1E62A 5HZAA 2X85A 4QV2A 4Y9UA 1H42A 3WNCA 1DDIA 4E0FA 2ZZQA 3OW7A 1QUEA 1GO2A 1YLOA 5A89A 2V7UA 3T51B 4TT3A 3ASQA 1HZEA 3ZUGA 1M1KD 4YXWA 3B8HA 3ZZUA 1D1NA 4FK8A 3WY9A 1BX0A 2X6XA 1YX2A 4XNFA 2OBRA 4TMZA 1IHMA 4X0CA 1EP2B 1VLYA 3W2FA 5L46A 4PC6A 2V4DA 3G4SB 4PABA 5EMNA 2VJJA 1F60A 4RPDA 4ASUA 5CDFA 5LMZA 4OPOA 1B2RA 4XN3A 3ZPNA 2VBTA 3WYAA 3P27A 2M5SA 2DETA 4XLAA 1YITB 2ZBUA 4B3XA 3OJXA 1VF7A 1TLLA 3PVDA 2XZPA 4YAFA 3T53B 4XD7A 1WSRA 2ZL5A 2Z6BD 4P6VF 1RQPA 3PENA 1BPLA 5FO1A 4X7DA 5F4JA 1W87A 1DG1G 1A8PA 1UD4A 2CF4A 1SM4A 4P3YA 4B4DA 2BN4A 4OOSA 4Z4TA 3AGPA 1U2RA 2KVOA 3QFTA 4DQKA 3OEEA 2C2WA 1AIPA 2VJIA 1TUIA 4XOPA 1VQLB 2WYRA 5TRDA 4G5GA 3PUMA 3Q6RA 1OB5A 2F1MA 1K73D 4Z1MA 4XKWA 1Q9SA 3V7AA 2X6WA 1QUFA 3I56B 2ZXIA 4OPSA 1PKVA 1XB2A 2D9RA 3KL9A 4OP7A 2CRVA 4YALA 1UD8A 3OZVA 3ZIAA 1GR1A 1W9XA 4G6IA 3VNUA 4RDJA 1OGIA 2VBSA 5GV8A 1VQMB 2FVGA 2E1BA 1V0EA 3Q3AA 3DDYA 1NB0A 3BQJA 4H9GA 1WPCA 1ZM9A 4PC7A 4QFMA 1N08A 5B6IA 2I1LA 1PJ5A 1XFOA 3H94A 1V5VA 1EFTA 3ASSA 4P2NA 3OKXA 1D2EA 2OTJB 3AVVA 4B48A 1FNMA 1E63A 2CW5A 5F4MA 5FA6A 1KQSB 1EFRA 4II3A 4AF6A 5IYQA 1W2BB 5IYRA 3CMEB 1UD2A 2C5HA 4OOVA 1JNYA 3CP8A 3R6KA 4XORA 1KD1D 2EIXA 1KK1A 2OK8A 4EH1A 2LZJA 2CK3A 3E1YE 3ASRA 3QFSA 4R71A 4JMQA 1GJRA 4XLEA 2EFGA 1OB0A 4OOXA 4P9SA 2R6HA 4TMTA 2HLDA 3AVTA 2DIEA 2YWEA 4QVAA 4XMYA 4YAUA 1W0JA 4G7XA 5F4OA 1Q86D 4N3GA 4ACBA 3QE2A 2DEUA 2OBSA 2P3MA 1VQ6B 4X07A 1IJEA 1UMKA 2GK6A 3GSIA 1QVFB 2W6JA 1R5NA 1VQ5B 1I8DA 1OHHA 4B43A 2JN9A 4ZGNB 1HVXA 3GQBA 3BCFA 2OTLB 3H9NA 5J35A 2YWHA 1ZM2A
chains in the Genus database with same CATH topology
1S4MA 2VBTA 2X0KA 1N05A 4UZFA 1N06A 1Q9SA 5FNZA 2VBVA 3BNWA 2OYNA 1MRZA 5A89A 1N07A 1T6XA 3ZUGA 1P4MA 3CTAA 2P3MA 5A8AA 5FO1A 2VBSA 4UZEA 3OP1A 1T6ZA 5A88A 1NB9A 1NB0A 1T6YA 1N08A 2I1LA 2VBUA 5FO0A 5TRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4M A;  2VBT A;  2X0K A;  1N05 A;  4UZF A;  1N06 A;  1Q9S A;  5FNZ A;  2VBV A;  3BNW A;  2OYN A;  1MRZ A;  5A89 A;  1N07 A;  1T6X A;  3ZUG A;  1P4M A;  3CTA A;  2P3M A;  5A8A A;  5FO1 A;  2VBS A;  4UZE A;  3OP1 A;  1T6Z A;  5A88 A;  1NB9 A;  1NB0 A;  1T6Y A;  1N08 A;  2I1L A;  2VBU A;  5FO0 A;  5TRD A; 
#chains in the Genus database with same CATH topology
 1N05 A;  1WOO A;  3B82 A;  1FND A;  1S0U A;  2ZZF A;  3WXM A;  2Q6L A;  1QH0 A;  5DSZ A;  4YEJ A;  3W2G A;  1WOP A;  3CD6 B;  1KK2 A;  4ZCM A;  3CC4 B;  2E1R A;  1VHO A;  4X05 A;  4X7C A;  1UD5 A;  1BJK A;  2OBT A;  3LQ6 A;  2J7K A;  1ZM3 A;  3VR6 A;  2BV3 A;  2WZN A;  1RQR A;  1DDG A;  1KK3 A;  1FRQ A;  4WQM A;  1T5E A;  3CCU B;  1NB9 A;  3CCV B;  4RD6 A;  3HAG A;  3U6K A;  2WPD A;  1V0F A;  1JA1 A;  1W34 A;  2YWF A;  4UAJ A;  1FDR A;  1G7T A;  2BPO A;  3FJO A;  3ES9 A;  4P22 A;  2QMU A;  3P26 A;  3A35 A;  2BMW A;  3CCM B;  3CXC B;  4LBZ A;  3I55 B;  2ZXH A;  4XLC A;  1N0U A;  1EFU A;  2X3U A;  1FRN A;  3G05 A;  4RLZ A;  4RDK A;  3OW2 B;  1BX1 A;  3CMM A;  3CCS B;  5KSW B;  1T6X A;  4PAA A;  3WND A;  1CNF A;  2B7C A;  4G1V A;  1JA0 A;  3GVJ A;  1IB0 A;  4AC9 A;  2X6Y A;  2Q6K A;  2X8K A;  3CMA B;  1E43 A;  1VQP B;  1R5O A;  4AVZ A;  1QG0 A;  1COW A;  4Z4W A;  2WSS A;  4G7W A;  4DK0 A;  1S72 B;  1YHQ B;  3QSY A;  3JQQ A;  3FPP A;  2FX3 A;  1DAR A;  2BSA A;  3CPX A;  4RPB A;  4ZCI A;  4L8J A;  1GAQ A;  2BM1 A;  3AST A;  1G7S A;  4RD2 A;  4WZT A;  4TN1 A;  4XOT A;  3MMP A;  1CNE A;  3SKB A;  3ZC3 A;  4C43 A;  1QGY A;  5FNZ A;  4ZCL A;  2ZTN A;  2QTZ A;  3BY2 A;  4RD3 A;  3A3G A;  4P12 A;  4MYU A;  1B23 P;  2JJ1 A;  3CPW B;  3CCE B;  1K8A D;  4NNJ A;  2XND A;  5A8A A;  2RC5 A;  4BPR A;  1WU8 A;  4WZE A;  3GVL A;  4M1K A;  4QHY A;  1FNB A;  2D74 A;  3JQP A;  1OB2 A;  3ZZT A;  3PA1 A;  4HE6 A;  2XOK A;  1ELO A;  4RCY A;  1WSV A;  4M0L A;  2BF4 A;  4Z4R A;  5BSY A;  4DNT B;  1E3X A;  1MAB A;  3ISX A;  3W2I A;  4Z4S A;  3SLN A;  2F4N A;  2PE3 A;  2WR8 A;  4XLH A;  1YIJ B;  5H5J A;  3ASP A;  4XKV A;  5TY0 A;  2X0K A;  2X53 S;  3A8J A;  5DN6 A;  2BM0 A;  2GRE A;  2BVN A;  1G7C A;  1FX0 A;  1KMH A;  2QE7 A;  2OK7 A;  3JQR A;  2W6I A;  4M4S A;  5THX A;  4B3G A;  3BY1 A;  2WZP P;  3QFC A;  3ZZ0 A;  4GQN A;  4RM0 A;  1P4M A;  1E3Z A;  1QX4 A;  2VNH A;  5TR9 A;  4DQL A;  2XNJ A;  3AVY A;  2JDI A;  3OOC A;  4LBW A;  1KC8 D;  3GIR A;  1GAW A;  2V7T A;  3ONY A;  5GV7 A;  4UZE A;  1N8R D;  1I7P A;  3OE7 A;  2C5B A;  4IW3 B;  1HA3 A;  1UD6 A;  2WJV A;  3ZBU A;  3W2H A;  4QVJ A;  2GK7 A;  2C77 A;  3GVK A;  4RD1 A;  5FO0 A;  5J3O A;  3CC7 B;  1XQB A;  4NBS A;  3OPO A;  2VZL A;  2GJR A;  3MCA A;  1E79 A;  3FPK A;  3OFN A;  2OYN A;  1TTT A;  3WBK A;  1SKQ A;  4YAO A;  4M2L A;  2B5O A;  3V76 A;  1J9Z A;  2GJP A;  1VQK B;  2CBX A;  1KZL A;  3AVU A;  1JB9 A;  4P25 A;  4ZGQ B;  1EXM A;  3OP1 A;  1BLI A;  1SKY B;  2C4T A;  5A88 A;  1GVH A;  1ZM4 A;  1EP3 B;  1NDH A;  4TMW A;  2NV4 A;  3W5H A;  1EFC A;  3VO2 A;  2PMD A;  2BGI A;  3FKS A;  3RY8 A;  4LC0 A;  3U2Q A;  1VQN B;  2R9V A;  1E64 A;  4YAW A;  4N3N A;  3CRZ A;  1S4M A;  3PUN A;  4HE5 A;  5HXB A;  4J0Q A;  1VLO A;  3SEJ A;  4RDL A;  3B78 A;  2JJ2 A;  5HKK A;  2XNC A;  2QGG A;  2ZBV A;  1NRK A;  3JU4 A;  4KKU A;  1VQ9 B;  3PA2 A;  4XON A;  2XGJ A;  1E1Q A;  5IK2 A;  4Z4V A;  1XE1 A;  4YEL A;  3A1P A;  5TV2 A;  4TMX A;  5E6T A;  2Q6I A;  2QTL A;  2CND A;  2V31 A;  2ZL7 A;  3BCD A;  1T6Y A;  4FN5 A;  3J81 k;  1VHE A;  4TSF A;  4B3F X;  3KEW A;  1BMF A;  2DCU A;  4U9U A;  2F1L A;  4X7E A;  1WTH D;  4UZF A;  4X8I A;  1N06 A;  4II2 A;  4P6Y A;  3VMF A;  4G1B A;  5HZB A;  3SJZ A;  1EWY A;  4FXU A;  4TKO B;  5IYP A;  3Q38 A;  1TVC A;  3OZU A;  3W5V A;  1BQE A;  1E1R A;  3Q6Q A;  4Z4Z A;  2V7X A;  1KK0 A;  4KKS A;  4XLF A;  3VO1 A;  1YJ9 B;  1F20 A;  3E20 A;  5BSX A;  3LNN A;  1CQX A;  4Y9R A;  3CB4 A;  2PLF A;  4PC1 A;  3SLD A;  1R5B A;  2AHO A;  3ZBT A;  2HMA A;  2ZTG A;  3G6E B;  3T56 B;  4XR6 A;  5KW9 A;  2ZZG A;  2DER A;  1H8H A;  4DK1 A;  1QGZ A;  1W35 A;  3U6B A;  1Y0R A;  4HIZ A;  5AN9 A;  2GJK A;  4B47 A;  3AGQ A;  3LQE A;  4LBY A;  1MRZ A;  4DNR B;  1JJ2 B;  1M90 D;  1NJI D;  1QFZ A;  3CP2 A;  3A8I A;  1FNC A;  2PIA A;  5H59 A;  1G7R A;  4XL9 A;  2ZIT A;  4XN0 A;  3W5U A;  2HDN B;  2DY1 A;  3NE5 B;  1YJN B;  4XM3 A;  3W2E A;  3CC2 B;  4CQJ A;  1QFJ A;  1T6Z A;  2QEX B;  1VQ7 B;  2F43 A;  4QUZ A;  1QVG B;  3SJP A;  4XQF A;  1VJS A;  1VQ4 B;  1YI2 B;  2VYQ A;  3ONU A;  2XEX A;  1QGA A;  2QA4 B;  4ROX A;  1NBM A;  4Q7J B;  4TMV A;  2JIZ A;  3CCJ B;  2DYI A;  1WDT A;  2VNJ A;  4KKT A;  2VBV A;  1KTV A;  2V7V A;  3BNW A;  5FIU A;  1EP1 B;  1N07 A;  2DOG A;  3OZW A;  3BH4 A;  5DS0 A;  2WJY A;  2RC6 A;  3OJW A;  2V7W A;  3CTA A;  4ACA A;  2GQF A;  5IYN A;  3AVW A;  1Q82 D;  3CCL B;  4YHB A;  2YWG A;  2Q6O A;  2VNK A;  3LO8 A;  2ZL6 A;  3CCR B;  4C0S A;  1ZUN B;  2V7Q A;  2ZZE A;  4F7D A;  3A8K A;  3AVX A;  2VNI A;  3CW2 A;  1H8E A;  1I18 A;  4M53 A;  1Q7Y D;  5JBQ A;  4RD4 A;  4WWV A;  4X7F A;  1OGJ A;  2BGJ A;  4Z4Y A;  4PGO A;  1K9M D;  1WP6 A;  3D26 A;  4P3I A;  4PC2 A;  3WBJ A;  1K28 D;  3R6J A;  5FL7 A;  2XZL A;  3QFR A;  3LVB A;  3MHP A;  3BC9 A;  2D3L A;  3Q39 A;  5IYW A;  2C4U A;  1Q81 D;  3VNV A;  3G71 B;  1WOS A;  4P26 A;  1KRH A;  3A3B A;  4P1V A;  5KNL A;  4WZK A;  4OPV A;  2VBU A;  2HCJ B;  4PC3 A;  1PJ7 A;  4UZU A;  1D8T A;  3WQZ A;  4RJL A;  4RD0 A;  1VQO B;  1H85 A;  3WNB A;  1PJ6 A;  1KJZ A;  4MYT A;  3OEH A;  4AF7 A;  1IJF A;  1W0K A;  1QFY A;  4RCZ A;  4FWT A;  2CC2 A;  1AMO A;  3CCQ B;  1WOR A;  1UD3 A;  2B7B A;  3CES A;  2QN6 A;  2D3N A;  4LBV A;  1VQ8 B;  3I1F A;  4Y7C A;  2QDX A;  4K1X A;  1Y0Y A;  4WZL A;  3OAA A;  4X06 A;  1N0V C;  4NCN A;  2GPJ A;  4Z4U A;  2XZO A;  1YJW B;  4ZV4 A;  2NPF A;  2C78 A;  4B44 A;  1E62 A;  5HZA A;  2X85 A;  4QV2 A;  4Y9U A;  1H42 A;  3WNC A;  1DDI A;  4E0F A;  2ZZQ A;  3OW7 A;  1QUE A;  1GO2 A;  1YLO A;  5A89 A;  2V7U A;  3T51 B;  4TT3 A;  3ASQ A;  1HZE A;  3ZUG A;  1M1K D;  4YXW A;  3B8H A;  3ZZU A;  1D1N A;  4FK8 A;  3WY9 A;  1BX0 A;  2X6X A;  1YX2 A;  4XNF A;  2OBR A;  4TMZ A;  1IHM A;  4X0C A;  1EP2 B;  1VLY A;  3W2F A;  5L46 A;  4PC6 A;  2V4D A;  3G4S B;  4PAB A;  5EMN A;  2VJJ A;  1F60 A;  4RPD A;  4ASU A;  5CDF A;  5LMZ A;  4OPO A;  1B2R A;  4XN3 A;  3ZPN A;  2VBT A;  3WYA A;  3P27 A;  2M5S A;  2DET A;  4XLA A;  1YIT B;  2ZBU A;  4B3X A;  3OJX A;  1VF7 A;  1TLL A;  3PVD A;  2XZP A;  4YAF A;  3T53 B;  4XD7 A;  1WSR A;  2ZL5 A;  2Z6B D;  4P6V F;  1RQP A;  3PEN A;  1BPL A;  5FO1 A;  4X7D A;  5F4J A;  1W87 A;  1DG1 G;  1A8P A;  1UD4 A;  2CF4 A;  1SM4 A;  4P3Y A;  4B4D A;  2BN4 A;  4OOS A;  4Z4T A;  3AGP A;  1U2R A;  2KVO A;  3QFT A;  4DQK A;  3OEE A;  2C2W A;  1AIP A;  2VJI A;  1TUI A;  4XOP A;  1VQL B;  2WYR A;  5TRD A;  4G5G A;  3PUM A;  3Q6R A;  1OB5 A;  2F1M A;  1K73 D;  4Z1M A;  4XKW A;  1Q9S A;  3V7A A;  2X6W A;  1QUF A;  3I56 B;  2ZXI A;  4OPS A;  1PKV A;  1XB2 A;  2D9R A;  3KL9 A;  4OP7 A;  2CRV A;  4YAL A;  1UD8 A;  3OZV A;  3ZIA A;  1GR1 A;  1W9X A;  4G6I A;  3VNU A;  4RDJ A;  1OGI A;  2VBS A;  5GV8 A;  1VQM B;  2FVG A;  2E1B A;  1V0E A;  3Q3A A;  3DDY A;  1NB0 A;  3BQJ A;  4H9G A;  1WPC A;  1ZM9 A;  4PC7 A;  4QFM A;  1N08 A;  5B6I A;  2I1L A;  1PJ5 A;  1XFO A;  3H94 A;  1V5V A;  1EFT A;  3ASS A;  4P2N A;  3OKX A;  1D2E A;  2OTJ B;  3AVV A;  4B48 A;  1FNM A;  1E63 A;  2CW5 A;  5F4M A;  5FA6 A;  1KQS B;  1EFR A;  4II3 A;  4AF6 A;  5IYQ A;  1W2B B;  5IYR A;  3CME B;  1UD2 A;  2C5H A;  4OOV A;  1JNY A;  3CP8 A;  3R6K A;  4XOR A;  1KD1 D;  2EIX A;  1KK1 A;  2OK8 A;  4EH1 A;  2LZJ A;  2CK3 A;  3E1Y E;  3ASR A;  3QFS A;  4R71 A;  4JMQ A;  1GJR A;  4XLE A;  2EFG A;  1OB0 A;  4OOX A;  4P9S A;  2R6H A;  4TMT A;  2HLD A;  3AVT A;  2DIE A;  2YWE A;  4QVA A;  4XMY A;  4YAU A;  1W0J A;  4G7X A;  5F4O A;  1Q86 D;  4N3G A;  4ACB A;  3QE2 A;  2DEU A;  2OBS A;  2P3M A;  1VQ6 B;  4X07 A;  1IJE A;  1UMK A;  2GK6 A;  3GSI A;  1QVF B;  2W6J A;  1R5N A;  1VQ5 B;  1I8D A;  1OHH A;  4B43 A;  2JN9 A;  4ZGN B;  1HVX A;  3GQB A;  3BCF A;  2OTL B;  3H9N A;  5J35 A;  2YWH A;  1ZM2 A; 
#chains in the Genus database with same CATH homology
 1S4M A;  2VBT A;  2X0K A;  1N05 A;  4UZF A;  1N06 A;  1Q9S A;  5FNZ A;  2VBV A;  3BNW A;  2OYN A;  1MRZ A;  5A89 A;  1N07 A;  1T6X A;  3ZUG A;  1P4M A;  3CTA A;  2P3M A;  5A8A A;  5FO1 A;  2VBS A;  4UZE A;  3OP1 A;  1T6Z A;  5A88 A;  1NB9 A;  1NB0 A;  1T6Y A;  1N08 A;  2I1L A;  2VBU A;  5FO0 A;  5TRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...