1VHOA

Crystal structure of a putative peptidase/endoglucanase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
331
structure length
319
Chain Sequence
b'METGKLLMELSNLDGPSGYETNVVSYIKSVIEPFVDEAKTTRHGSLIGYKKGKGIGKLAFFAHVDEIGFVVSKVEGQFARLEPVYASKVRIYTKNGIERGVIGMLAPHLQDSESRKKVPTYDEIFVDLSLCERGVRVGDIAVIDQTAFETNGKVVGKALDNRASCGVLVKVLEFLKRYDHPWDVYVVFSVQEETGCLGALTGAYEINPDAAIVMDVTFASEPPFSDHIELGKGPVIGLGPVVDRNLVQKIIEIAKKHNVSLQEEAVGGRTDFVQLVRNGVRTSLISIPLKYMHTPVEMVDPRDVEELARLLSLVAVELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords endoglucanase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 94
structure length 319
sequence length 331
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 1vhoA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1vhoA01
2NYQA 1HEEA 4NGQA 1YW6A 3LWUA 2ZEMA 1ZG8A 3PB4X 1ELLP 3KQZA 4MRIA 4K3NA 5IB9A 1DE4C 1TKJA 1Z8LA 4PPZA 3NH8A 4IK2A 3B2YA 2CTBA 2DEAA 5K8MA 2PJBA 2C1CA 2POKA 4RUHA 1LCPA 3H8GA 2FVGA 4P4DA 2CIJA 2AFSA 4EMEA 3FVLA 3SI2A 1VHOA 3B3SA 2J9AA 3PB7X 2C6GA 1VHEA 5ELYA 2JBJA 2XEJA 4X2TA 4A37A 4TWEA 3B3TA 4ZYQA 2PJ6A 2PJ3A 4WWVA 4UIAA 2PJAA 4F9VA 4R7MA 4CPAA 3BI0A 3VATA 5HVFA 3PFEA 3H8FA 1ZG9A 4X8IA 2PJCA 2PJ2A 2V8DA 3FMCA 1CG2A 3KHXA 2GREA 1KWMA 2JEWA 2RFHA 2XEIA 2IMOA 3I1UA 3RBUA 2AFOA 1ZLIA 2IJZA 1ELMP 6CPAA 5HXDA 2ZELA 1YSJA 4A38A 4OC0A 5LYIA 5CPAA 1BLLE 3NFZA 4PQAA 3MRUA 2HB6A 4Z65A 2PJ7A 3FEDA 2G9DA 1TXRA 1BPMA 4JYWA 2HC9A 4FWUA 1VGYA 2PJ4A 3KL9A 4OC2A 5LRJA 3TC8A 5K8NA 3LMSA 3KZWA 3V38A 3IFEA 2PJ8A 2O4HA 4ZX9A 2ZENA 5K8OA 5J1QA 3VARA 4ZY1A 2JBKA 7CPAA 3DLJA 4JZ0A 4DUKA 3D7FA 4P44A 3N5FA 4BD9A 1IY7A 4NJQA 2ANPA 4A94A 4MCPA 5F09A 5LYLA 4UIBA 2NSMA 1TKHA 1GYTA 3CDXA 1BAVA 4P45A 3FECA 1FNOA 4IHMA 4B6ZA 4MCSA 1HDQA 1PCAA 3B3CA 3T8WA 3FX6A 3PBEA 3PEIA 4MXUA 1VIXA 4F8ZA 2ZEOA 2C6PA 5LYFA 2Q43A 1XMBA 1H8LA 3SJGA 3PRTA 3PBBA 1YMEA 5CBMA 1Y0YA 2QVPA 1ZLHA 2PVVA 3KI9A 2PE3A 4WJBA 3IIBA 3PB6X 5DS0A 4OC5A 3PFOA 1EE3P 1QMUA 4MHPA 4ZI6A 2PCUA 2BOAA 2CF4A 4P4FA 1TF8A 1R43A 5K8PA 2V8HA 2ZEPA 5HVGA 1Z2LA 1XJOA 1PYTB 4X3RA 1XFOA 2WYRA 2PJ9A 3IWWA 3D68A 3PB8X 4MHZA 4OC1A 4YU9A 4NJRA 4NGPA 1LANA 3CT9A 4DYOA 3KR4A 5D29A 4PXDA 4O23A 4UF4A 3IJ3A 2ZOFA 1CPSA 2O53A 2EK9A 1XRYA 3D7HA 5HVHA 1AMPA 1TF9A 3IEHA 2ZEEA 1ARMA 5D8NA 4EWTA 1AYEA 1CP7A 2BO9A 3KASA 3WT4A 2AFZA 1ARLA 1CP6A 3RZAA 4MCRA 3FF3A 3SJEA 2BCOA 1OBRA 2F7VA 3S9LA 1YW4A 3WC7A 3DGVA 1R3NA 4P10A 3JRUA 3RAMA 3KQXA 1F57A 4P6YA 1JQGA 3SJFA 4UEZA 2CTCA 3V7ZA 3HLPA 5JH9A 4NGNA 3B3VA 4YWYA 3K2KA 3B35A 3H8EA 1LOKA 2ZEHA 1LAPA 4LQGA 3CPXA 2Q51A 3CPAA 3MN8A 4MMOA 1CX8A 4P4JA 4R6TA 2EK8A 3S9NA 4Q7AA 1M4LA 4OC4A 4NGMA 3WABA 4OIDA 2F8HA 1LAMA 3FEEA 1Y0RA 2C6CA 3KGQA 4TNUA 3KHZA 3D66A 3FJUA 4GM5A 4FBEA 4A39A 4NFRA 4AXVA 3WC5A 1CBXA 3HUVA 1IGBA 3PB9X 1Y7EA 1FT7A 3S9MA 4ONWA 2XEFA 3D7DA 1BPNA 2PRQA 4DJLA 3D4UA 1CPXA 2RB7A 4P4IA 2VL1A 2PIYA 3TX8A 3D7GA 4PXCA 4P4BA 5JGFA 1NSAA 2PVWA 2QYVA 4UEFA 4OMEA 4OP4A 2PJ1A 4KSIA 2PJ5A 4NGRA 2WZNA 3GLJA 4OIWA 4PXBA 8CPAA 1ZG7A 3BHXA 3D67A 3VH9A 1LFWA 2ZOGA 2PJ0A 4F9UA 4ZY2A 5LYDA 1F2OA 4ZX8A 2ZEGA 3SI0A 5JM6A 4UEEA 2AFUA 3K9TA 3ISZA 4G1PA 2PIZA 3BI1A 1XBUA 3B3WA 5LRGA 2Q4ZA 4P4EA 3GB0A 2V8GA 2AFXA 5LRKA 1Z5RA 1F2PA 4OKOA 3NH5A 2I3CA 3WC6A 3FH4A 4IAVA 2OR4A 2XEGA 4NGSA 3B7IA 2GU2A 4MHYA 1HDUA 2V77A 3QNVA 2ZEFA 2EWBA 4ZY0A 2OOTA 4FAIA 4MHNA 4OC3A 4FUUA 2ABZA 1Q7LA 4NGTA 1TKFA 1DTDA 2AFWA 2GLJA 3SJXA 4R8FA 3L2NA 4EFDA 2IQ6A 3NH4A 2QJ8A 2V8VA 1RTQA 1YLOA 3GUXA 1QQ9A 3IO1A 2GLFA 3IC1A 5THWA 1UWYA 3KR5A 3NA6A 4W9YA 3SI1A 4R76A 4PXEA 3BXMA 4MCQA 2ZEDA 4H2KA 2AFMA 5I4MA 3ISXA
chains in the Genus database with same CATH superfamily
1HEEA 1Y9KA 5IYRA 2GQFA 2GJPA 1WDTA 4G7WA 2DIEA 5IK2A 5KW9A 4B48A 2NMTA 1N08A 3PB4X 2EVNA 5IB9A 4B47A 3P2HA 1VKCA 3MCAA 3OW2B 4LC0A 4TMTA 3NH8A 5JQ4A 1XE1A 2CNMA 3JU4A 2DEAA 3U6BA 5F4OA 1KUVA 2PJBA 4K1XA 2DYIA 1LCPA 1N71A 4KOUA 3ASSA 1JA0A 2ZXVA 2VBQA 2Z3NA 2FL4A 2OH1A 2HUZA 3FVLA 1FRQA 1ZUNB 1KC8D 4XNHB 1TVCA 4RN7A 3SI2A 2BGJA 2ZXHA 4F0XA 1VHOA 3B3SA 2C6GA 3UY5A 4HIZA 4PK3A 3CC4B 5ELYA 1KK2A 2XEJA 2ZBVA 5IYQA 4MBUA 2ODFA 4P25A 2PJ3A 4WWVA 2PJAA 4F9VA 4OOSA 4RS2A 3IGRA 4R7MA 2HMAA 4CPAA 2Q6IA 4M85A 2QGGA 1PUAA 4IW3B 1NJID 1ZG9A 3TOBA 4X8IA 2PJCA 4L8JA 4DK0A 2V8DA 2XZLA 1QH0A 4JWPA 1R5BA 4OP7A 5J8CA 4LBYA 3RBUA 4ZV4A 2P6GA 1VQMB 2R8VA 3CP2A 5HXDA 4P26A 3AVUA 2BSWA 3LQEA 3W6SA 2F4NA 3TCVA 1NE9A 1Y7RA 3MMPA 1YJNB 1S7NA 4H89A 1YX2A 3FEDA 1GAWA 2RC6A 2ZITA 4HNWB 1VQPB 2PJ4A 2YNCA 3LACA 2EBJA 2VQYA 1MRZA 2AE6A 1QUEA 4TN1A 4ZX9A 2R9VA 2AJ6A 5TV2A 5GV7A 1GJRA 5J1QA 1HA3A 7CPAA 2R1IA 4G1VA 4DUKA 4XM3A 3CESA 2CNSA 3D7FA 2YWEA 2BM1A 4KS9A 1G7SA 3N5FA 1I1DA 1IY7A 2ANPA 4A94A 5F09A 1YJWB 3ZBTA 2GJKA 2QIRA 1BAVA 4UZUA 4IHMA 1R5OA 3GQBA 3T8WA 4MJ8A 3OW7A 4MXUA 3VR6A 3RNZA 4L8AA 4F8ZA 4ACAA 2VXKA 2B7BA 3VO2A 4HE5A 4M1KA 3F8KA 4CGOA 3PBBA 3WNBA 5CBMA 1D2EA 4KVXA 2PC1A 2IL4A 2PVVA 5DWNA 1BX0A 1YLEA 2DERA 1KMHA 4E8OA 2ATRA 4ZI6A 1QVGB 3ZZIA 4CRYB 2PCUA 1T6ZA 2BOAA 2BVNA 3C26A 5KTDA 4P4FA 3BY2A 1S7LA 3OP1A 4P9SA 2QDXA 3T51B 1TF8A 1R43A 2VZYA 2QECA 4ZGQB 3Q38A 4U9ZA 5EMNA 2WYRA 3IWWA 4OC1A 4Z4UA 4YU9A 5AG4A 1VQ9B 1QSOA 2CXAA 1IYLA 4NJRA 1BLIA 4NGPA 1IB0A 5FNZA 4PXDA 3IJ3A 4LBWA 1BPLA 1GO2A 3CMEB 4C7IA 3W2GA 4AVCA 1G7RA 1AMPA 1W34A 3IEHA 1ARMA 4R3LA 3CC7B 4MFJA 2RC5A 3WT4A 1Z4EA 2Q04A 3H4QA 1CP6A 4CAWA 4QVTA 4E0AA 4AG7A 3RZAA 1XOVA 3JQRA 1Q7YD 4R87A 3MGDA 1CM0A 2YWGA 1RQRA 2C77A 4YAOA 1S60A 3G3SA 3IWEA 4B10A 4EVYA 2V7WA 2XZPA 3JRUA 2PQ8A 3KQXA 3FRMA 1JQGA 4ACBA 3SJFA 3S6KA 4A31A 4YALA 4JXRA 4X06A 3B3VA 3K2KA 3H8EA 1LOKA 2KVOA 2P6EA 4UWIA 5F4JA 4FD7A 5HKKA 4M2LA 3CPAA 4MFQA 4TKOB 2VYQA 1S7FA 5H84A 4HNXB 1S0UA 1KRHA 4XKWA 3S9NA 4OC4A 3Q6RA 5IYNA 3CXPA 1UD6A 4P2NA 3CW2A 1BX1A 1AMOA 1WK4A 1LAMA 2XGJA 1Y0RA 4M53A 2ZXIA 4TNUA 1WTHD 1E1RA 5G1ZA 4GM5A 3DDYA 1V0FA 1D8TA 4XLAA 3HUVA 1IGBA 3DSBA 4XOPA 4J0QA 1FT7A 3S9MA 4ONWA 4TT3A 3D7DA 4DJLA 1E3ZA 1IYKA 3CB4A 2PIYA 2WPDA 4QVJA 4Z4RA 2HDNB 2Q0YA 4UCMA 2VBUA 5H59A 2H5MA 3OE7A 3SJZA 2WZNA 8CPAA 3ES9A 4MFKA 3VH9A 2ZOGA 4FWTA 4M6HA 4RDKA 4ZX8A 3SI0A 4Q7JB 1I12A 4BMHA 2B5GB 2PIZA 3B3WA 1B6BA 4P4EA 3GB0A 2V8GA 2AFXA 1F2PA 3NH5A 5DN6A 5EC4A 2ZW5A 2OR4A 4IAVA 3D2PA 4MHYA 4GQNA 3OAAA 1SM4A 1VLYA 2XNCA 4R9MA 2EWBA 4NSQA 1WSRA 3FYNA 1E43A 4KOTA 4FUUA 4XLEA 3BCDA 3ZC3A 1Q7LA 4RCYA 4Z4YA 1Z8TA 2AFWA 2OK7A 3SJXA 4KLVA 4C43A 3EC4A 2F5IA 1F20A 2JJ2A 3I56B 3GUXA 4G1BA 3IO1A 5THWA 2VJIA 2J8NA 1YVOA 4FD6A 3NA6A 5L46A 3ZIAA 3SI1A 1K73D 4R76A 3KEWA 3ASRA 3CRZA 2YNEA 3SXNA 1FNDA 2XNDA 2B4DB 2AFMA 4QV2A 4UA3A 3T9YA 4YAFA 3T90A 3AVXA 5THXA 2DF5A 2CBXA 1ZG8A 1D1NA 1W0JA 1M4IA 5E6TA 3ZZTA 4Y7CA 3CCRB 1ELLP 4ASUA 4MRIA 3PGPA 2ZTNA 1TKJA 2W6IA 3QFCA 1QUFA 4KKTA 5TR9A 2VZLA 2FIWA 3FJOA 3G6EB 2CRVA 2CIJA 4EMEA 2JLMA 4HE6A 5EBVA 2CC2A 3W5VA 1EFTA 4GS4A 2C78A 1EFRA 3PB7X 1BQEA 4UAJA 2PRBA 4XONA 3I3GA 4DNRB 1IHMA 4B3FX 5AG6A 2B4BA 1DG1G 1F60A 3ASTA 1I7PA 4YXWA 2ZZGA 3A3GA 3PFEA 4ZBGA 4RM0A 4NBSA 3FMCA 2DETA 1N07A 3KHXA 2GREA 1KWMA 4M4SA 2B58A 2IMOA 4A30A 2QMLA 3HAGA 4U9UA 3I1UA 1IU8A 4B3XA 1TUIA 4OOVA 1IB1E 5F49A 3CMAB 2XEXA 2IJZA 2VBSA 4MI4A 2ZELA 1KTVA 1YSJA 4A38A 1OGIA 1OB5A 1Q2DA 2Q4VA 4AVAA 1Q9SA 2CW5A 3BNWA 2EO8A 3CXQA 3QSYA 2BGIA 3NFZA 2FSRA 2Z6BD 3SLNA 2HB6A 4Z65A 2FT0A 3ZZ0A 2G9DA 5IYPA 4MFPA 1TXRA 2V7QA 2Z3PA 1QGYA 2BL1A 1VGYA 1R57A 3OJXA 2A4NA 4OC2A 3TFYA 2XOKA 5H5JA 1UD5A 3GVJA 3QFTA 2ZBUA 3WBKA 4DNCA 4P3IA 3CCVB 3IFEA 3TE4A 1BOBA 4IF5A 2O4HA 2WPXA 1OB0A 2VBTA 1E1QA 2WJYA 2P0WA 4H6UA 4ZY1A 2JBKA 5IV0A 4OLLA 4UCPA 3CTAA 4B3GA 1QX4A 4P44A 4KSFA 2V31A 4AF6A 4XLFA 4XL9A 1M4GA 4BINA 5LYLA 3FPKA 3NE5B 1JB9A 2EIXA 1N0VC 3ZJ0A 1GYTA 3FECA 1FNOA 3RYOA 2JN9A 4MCSA 3PBEA 3D3SA 3PEIA 2BMWA 4B14A 1XB2A 2YNDA 1L0CA 2ZEOA 5LYFA 2Z3MA 3VNVA 2B3UA 4LQ6A 3GY9A 2VNHA 1Y0YA 4JD6A 2I1LA 2PE3A 3A8JA 3TO6A 1Q2YA 4A2ZA 2ZW4A 3IIBA 1VQKB 2DXQA 5KSWB 1FDRA 4KOWA 3ZUGA 3AGPA 2REFA 3G05A 4KKUA 5A89A 2CF4A 3BQJA 1CNEA 3SHPA 1EFUA 1XQBA 2CY2A 2FXFA 1W0KA 2PMDA 3A3BA 3D68A 2Y0MA 3A9LA 4YFJA 1LANA 4DYOA 1ON0A 1K28D 4I49A 2QMUA 2ZOFA 4RCZA 2O53A 4OADA 1T6YA 4XNFA 1XRYA 1QSMA 3D26A 5TY0A 1PU9A 1CP7A 1P4NA 2QN6A 1FX0A 4MCRA 4ZCMA 5BSXA 1P4MA 1HZEA 3CPWB 1OB2A 5J35A 2QE7A 4ZCIA 2GJRA 1TLLA 3DGVA 3QE2A 4P10A 4X05A 2VNJA 3HLPA 2X8KA 2R98A 4UFWA 4NGNA 2BF4A 2R7HA 3B35A 5FO1A 3CP8A 4LQGA 4U9YA 3CPXA 1XMTA 2WUUA 2D3NA 4KSAA 3R6JA 4P4JA 3LO8A 2D9RA 4PSWA 2D3LA 3ONUA 4RPBA 1S72B 4KUAA 4OIDA 4ORFA 4IUSA 2F8HA 3OZVA 3OJWA 2C6CA 4KOYA 3KGQA 3KHZA 2V7XA 1JJ2B 2DEUA 3D8PA 1ZM2A 4FBEA 3WR7A 4CAFA 1Y9WA 4AXVA 3WC5A 3U6KA 1WORA 3F0AA 3QAHA 4AB7A 3FPPA 3PB9X 1Y7EA 1N8RD 1MK4A 1YX0A 5KNLA 4XN0A 2G3TA 4QUZA 3JQQA 3I1FA 5TRDA 3TX8A 3D7GA 1H42A 2Q7BA 1XEBA 1EP2B 4PXCA 4HPSA 1DDIA 4UFXA 4Z4WA 1NSAA 4QFMA 3S6HA 3PVDA 2QYVA 3JTKA 4UEFA 4OP4A 2PJ1A 2HCJB 2PJ5A 4KSIA 4AF7A 4LX9A 1M4DA 1YITB 1KK0A 4F9UA 3JQPA 1UD3A 2X3UA 2ZZQA 4Z1MA 1F2OA 2VNKA 2ZEGA 2R6HA 5JM6A 1QSRA 3ISZA 4G1PA 3JUWA 2ZL6A 2FX3A 1K8AD 5LRKA 3ONYA 4OKOA 2I3CA 4M0LA 3WC6A 3FH4A 2XEGA 4NGSA 3CCSB 1E62A 1X12A 1HDUA 3A8IA 4QVAA 4CRZB 2PLFA 2ZEFA 5G21A 3SKBA 1CJWA 3GKRA 3FKSA 1KJZA 4II2A 2DY1A 4MY0A 5J8FA 4H6ZA 1B2RA 4OC3A 4G7XA 4CAVA 4FN5A 1VF7A 3W2IA 3I55B 2ABZA 1AUGA 1VQ6B 1DTDA 2CNTA 4C7HA 3PUNA 4G5GA 3L2NA 1YR0A 1QVFB 4YAUA 2YWFA 2GFQA 4X5KA 3LNNA 1QSTA 2QTZA 4AVBA 4XLCA 1NSLA 3AGQA 2PSWA 3EO4A 3RO0A 3IU1A 2Q4YA 1NB0A 2ZTGA 4L89A 3PA1A 3OEHA 2FIAA 4NGMA 5I4MA 5AN9A 3ISXA 4NGQA 1G7CA 2GIVA 5H86A 4F7DA 2WPWA 1WU8A 4A95A 1YHQB 3P2FA 4OOXA 2PIAA 3LVBA 4LUAA 3VO1A 1I21A 1WPCA 1COWA 1DE4C 3OPOA 1Z8LA 4PPZA 5KTAA 1T5EA 4IK2A 4LBZA 4Y49B 2OK8A 4YELA 3T56B 3G71B 3CXSA 2WR8A 4TMVA 1HVXA 2POKA 4NCNA 2C4TA 3WNDA 3H8GA 2FVGA 1Q81D 4P12A 4DQLA 2AFSA 2FS5A 5CDFA 2PR8A 4RJLA 2E1BA 1GVHA 2GPJA 2LZJA 4PC3A 4E2AA 4A37A 2VI7A 5CNPA 5AG7A 4ZYQA 4YHBA 1K9MD 1FNCA 3AVYA 1GAQA 4UIAA 4Z4ZA 1QGZA 3BH4A 4XORA 3BI0A 5HVFA 3H8FA 1N06A 2PJ2A 3A1PA 1CG2A 3DR6A 2RFHA 4RDLA 1XF8A 2M5SA 3ASPA 2OTLB 4CAXA 2QA4B 1J4JA 1KK1A 1ELMP 6CPAA 2OZHA 4RDJA 1V0EA 1M44A 1IJFA 3CMMA 1WOSA 3FBUA 5CPAA 4TMWA 2ARHA 4B5PA 4NEXA 2EUIA 1BLLE 2ZZFA 5A8AA 4PQAA 1QG0A 1OZPA 1WWZA 4XPKA 2J7KA 4PK2A 1Q86D 2QEXB 1NB9A 4JYWA 2HC9A 3R1KA 2O28A 3KL9A 2OB0A 2X7BA 5LRJA 2BV3A 1NDHA 3SJPA 4X7EA 4DQKA 3TC8A 5K8NA 2C5HA 3LMSA 3KZWA 1YREA 2OBSA 2PJ8A 4QUSA 2XZOA 5K8OA 3VARA 2JJ1A 1MJ9A 2G3AA 3DLJA 4JZ0A 1KUXA 4PC1A 1I18A 5C88A 5HZAA 3MHPA 3PUMA 1KD1D 4BD9A 2F1LA 4MCPA 2AHOA 2CK3A 2JDIA 4KVOE 5EMIA 4CYNA 4UIBA 2VEZA 2I00A 2CNDA 2E1RA 2B5OA 5FL7A 4P45A 2X0KA 1HDQA 4PC2A 1PCAA 3B3CA 1VQ5B 1XIXA 3NE7A 4HKFA 5IB0A 4RD4A 1VIXA 3S6GA 1I8DA 1S7KA 2I79A 5AGEA 2Q43A 4U5YA 3CCJB 1ZM4A 1H8LA 3SJGA 2X6XA 4AG9A 3V8IA 1CNFA 3PRTA 1TTTA 4N3NA 2QVPA 1ZLHA 3BJ8A 4CYOA 5FVJA 2V7UA 3QFRA 3BCFA 3R6KA 5ISVA 4UCNA 4WJBA 4QBJA 3PB6X 2OU2A 3QB8A 1XE4A 3WY9A 3PFOA 2Z3KA 2Q7SA 1QMUA 5BWAB 2RC4A 1YI2B 1IJEA 3S6FA 3R95A 4FXUA 5A88A 3E0KA 2JDCA 1UMKA 5HZBA 2BPOA 2WSAA 3DNSA 1S3ZA 5K8PA 2ZEPA 3BC9A 1VLOA 3OKXA 1XJOA 4XNHC 1PYTB 2PR1A 1XFOA 1EP1B 2PJ9A 1NRKA 4MHZA 4UFVA 3CCMB 5GV8A 3CT9A 3KR4A 4KLWA 5D29A 2OBTA 4Z4VA 3ZBUA 2YNCC 4M6IA 5HVHA 1TF9A 1OHHA 2ZEEA 4OPSA 2Z0ZA 4XLHA 3T53B 2Z11A 5HXBA 4Z4TA 2BM0A 3CCEB 3FIXA 3JVNA 3IWGA 2HLDA 4RD0A 4XN3A 3FF3A 3OEEA 3SJEA 5IX3A 2BCOA 1GR1A 2D4OA 3A8KA 3G8WA 4QC6A 4ROXA 1R3NA 3WYAA 1PJ7A 1WOOA 2WSSA 4P6YA 4Y9UA 4E0FA 3F5BA 1SKQA 4MFLA 4TSFA 2CTCA 1M1KD 4RD2A 4YWYA 1JA1A 2Q51A 3MN8A 2FE7A 4MMOA 4X7DA 3Q6QA 2EK8A 4NNJA 1YJ9B 3WABA 3SXOA 4XR6A 3GSIA 3GIUA 2OBRA 3FEEA 4HNYB 4B43A 2HQYA 2GK6A 4XPDB 2B7CA 5G20A 2VZZA 1A2ZA 2Q6LA 1S5KA 3FJUA 4A39A 1EP3B 1FNMA 3IU2A 4CAEA 4NFRA 1CBXA 4ZGNB 3G4SB 4B11A 3H9NA 2PDOA 5BSYA 4OPVA 2XEFA 4NF1A 5F46A 1BPNA 2PRQA 3D4UA 2X6WA 4TMXA 4XPLA 2OTJB 1CPXA 2C27A 4M6GA 4P4IA 4WZEA 4ZCLA 1YVKA 2GANA 4MYUA 5LMZA 1VQNB 4B13A 3W2FA 4ZGYB 1JWQA 2PVWA 1W2BB 3OZUA 4CGPA 4NGRA 5KTCA 4OIWA 4PXBA 2C5BA 4RLZA 3PA2A 1QGAA 1ZG7A 4FD5A 1S4MA 3D67A 4PAAA 2HV2A 3OFNA 5E96A 2PJ0A 3PENA 2X53S 1MJAA 2JIZA 2OZUA 2W6JA 2Q6OA 3BI1A 1ZM3A 5LRGA 2Q4ZA 1Q2CA 4C0SA 1YQEA 2VJJA 3VWEA 1VQ7B 1Z5RA 3CCQB 1FNBA 4BBHA 3OZWA 5I0CA 5HH1A 1EWYA 3BLNA 3TO7A 1G7TA 3QNVA 2X6YA 4KOXA 1DARA 3B8GA 2FCKA 4QB9A 3W91A 3ZPNA 4ZY0A 4H9GA 2OOTA 4MHNA 3WBJA 1J9ZA 3W2HA 1ELOA 4Y9RA 4B4DA 2DPTA 1X10A 2VBVA 4JMQA 4NGTA 1TKFA 5F48A 3VNUA 3R9GA 4AVZA 4EFDA 2REEA 2DOGA 3NH4A 2QJ8A 1Z9UA 1QQ9A 2BN4A 3W2EA 2GLFA 1Z8XA 4NCZA 1KUYA 4JXQA 3CCUB 5GCNA 4R57A 4PXEA 3BXMA 1VQOB 2ZEDA 4C2XA 2GK7A 4H2KA 3K9UA 4F6AA 3EFAA 1RO5A 1SQHA 1U2RA 2NYQA 1EXMA 1YW6A 3LWUA 4P6VF 2ZEMA 4TMZA 3VMFA 1Q82D 4Q38A 2BSAA 1YIJB 1ZM9A 3LODA 3PP9A 3KQZA 4K3NA 2ZW6A 4WZLA 4PSXA 3B2YA 2G0BA 3J81k 2OZGA 2CTBA 4CGLA 4WQMA 5K8MA 4II3A 4YGOA 1IIDA 1E63A 3WQZA 1V5VA 2C1CA 2YGWA 4RUHA 3E20A 2WZPP 4R3KA 4P4DA 1WOPA 4UWJA 4NXYA 3AVTA 4Y49C 3B78A 1P0HA 2J9AA 4UZEA 1N0UA 1VHEA 2OYNA 4N3GA 1PJ5A 4BPRA 2JBJA 4X2TA 4TWEA 3B3TA 2PJ6A 3GVLA 1GHEA 4RPDA 3V7AA 4OPOA 1KZLA 1B23P 1CQXA 3VATA 4P3YA 5F4MA 1FRNA 4PC7A 4B12A 3NE8A 2JEWA 2XEIA 4X0CA 4K30A 3SLDA 1KQSB 2AFOA 1UD4A 1ZLIA 3P26A 1VQLB 4C68A 4CYQA 3VWDA 1H8EA 5HMNA 1T6XA 3DDDA 4GXHA 4KOSA 4XOTA 4DK1A 2WJVA 1LRZA 1MABA 3EXNA 4OC0A 2P3MA 5LYIA 1VHSA 4II9A 4PABA 3LD2A 1IICA 1E79A 1ZO0A 3BY1A 1EFCA 1NMTA 3MRUA 3Q39A 3CD6B 2PJ7A 4PV6A 3QFSA 1BPMA 4FWUA 4G6IA 4P22A 4MYTA 3W6XA 4RI1A 2X85A 4QHYA 3V38A 5G22A 2ZENA 2V4DA 3TT2A 4WZKA 4X7FA 3ASQA 4JLYA 4P1VA 2BUEA 3WXMA 4YAWA 1DDGA 4KUBA 1JNYA 3SEJA 3H5ZA 1BMFA 4NJQA 4YRHA 1M90D 4OAEA 3DR8A 2D74A 3TOAA 3TO9A 2NSMA 3A35A 4EH1A 1QSNA 1TKHA 3CDXA 1U6MA 4CGMA 4CQJA 4B6ZA 3P27A 3FX6A 2P6FA 1QFZA 2C2WA 2C6PA 1PKVA 1YGHA 1XMBA 4MFZA 1NBMA 4Q36A 2V7TA 2Z3OA 1YMEA 4ONUA 2VNIA 1Z8WA 4B5PB 3KI9A 4PC6A 4FK8A 1E64A 2GE3A 5DS0A 1UFHA 4OC5A 5DWMA 1N05A 1EE3P 4RD6A 4MHPA 2DCUA 1VJSA 2BEIA 4FD4A 3GVKA 4XD7A 1E3XA 4F0YA 2V8HA 5HVGA 1VQ8B 1Z2LA 3OOCA 1IOIA 4X3RA 3PB8X 3B82A 2XNJA 4O23A 4UF4A 1CPSA 4XMYA 2K5TA 2NV4A 2EK9A 3D7HA 1V0CA 3KKWA 3OWCA 1M1DA 1W87A 4MHDA 5D8NA 4EWTA 4KOVA 1AYEA 2BO9A 3KASA 3Q3AA 3BJ7A 4PGOA 2AFZA 1ARLA 4XQFA 1OGJA 1QFJA 3B8HA 1OBRA 1RXTA 2F7VA 3FB3A 3S9LA 3CZXA 1YW4A 1B87A 2ZW7A 3WC7A 3QAYA 3RAMA 1F57A 5A27A 2DPSA 1H85A 1QFYA 5F47A 4UEZA 3V7ZA 4R71A 5JH9A 3AVVA 2ZEHA 2ZL5A 1LAPA 5IYWA 1WSVA 5JBQA 3GIRA 3WNCA 2B5GA 4UZFA 1RQPA 5JPHA 1CX8A 4R6TA 3W5HA 1H8HA 3R96A 4Q7AA 1M4LA 3CXCB 3GYAA 1UD2A 3CCLB 2YWHA 4KVME 4AC9A 1K4JA 2QTLA 3D66A 2J8MA 1SKYB 1FY7A 1VQ4B 3D2MA 3AVWA 2Q6KA 3LQ6A 1IOFA 4X07A 2RB7A 4XPDC 2VL1A 1UD8A 1BO4A 1YK3A 3R9FA 1W9XA 4P4BA 5JGFA 2JDDA 1R5NA 4OMEA 2EFGA 2J8RA 4M3SA 3V76A 3E1YE 2ZL7A 3GLJA 4MY3A 4C2YA 3H94A 3CC2B 4KKSA 5FIUA 3EY5A 3BHXA 3FXTA 3N7ZA 4XKVA 2B4DA 1LFWA 1MJBA 5J3OA 4ZY2A 5LYDA 5C82A 1BJKA 4A33A 5FO0A 4B5OA 2Z10A 4UEEA 2AFUA 3K9TA 4A32A 4CYPA 1WP6A 2KCWA 1XBUA 4C2ZA 5AG5A 3U2QA 4X7CA 5A28A 4KZTA 4RD1A 1KZFA 4CS0B 3TTHA 3B7IA 2Z3LA 2C4UA 2GU2A 4YEJA 3ZZUA 2V77A 2ZPAA 2F43A 4B44A 4UBRA 2B3VA 1W35A 4RD3A 4FAIA 5DSZA 3R9EA 2ZZEA 1KK3A 4J3GA 5FA6A 1Z4RA 2D4PA 4CGNA 2GLJA 4KORA 4R8FA 4JJXA 4LBVA 1PJ6A 2IQ6A 1A8PA 4DNTB 2V8VA 2F1MA 1RTQA 4WZTA 1YLOA 3FNCA 1AIPA 4Z4SA 2JEVA 1TIQA 3W5UA 3IC1A 1UWYA 3RY8A 3KR5A 4W9YA 2Q44A 5B6IA 2NPFA 3I9SA 2V7VA 4MCQA 3PZJA
chains in the Genus database with same CATH topology
2NYQA 1HEEA 4NGQA 1YW6A 3LWUA 2ZEMA 1ZG8A 3PB4X 1ELLP 3KQZA 4MRIA 4K3NA 5IB9A 1DE4C 1TKJA 1Z8LA 4PPZA 3NH8A 4IK2A 3B2YA 2CTBA 2DEAA 5K8MA 2PJBA 2C1CA 2POKA 4RUHA 1LCPA 3H8GA 2FVGA 4P4DA 2CIJA 2AFSA 4EMEA 3FVLA 3SI2A 1VHOA 3B3SA 2J9AA 3PB7X 2C6GA 1VHEA 5ELYA 2JBJA 2XEJA 4X2TA 4A37A 4TWEA 3B3TA 4ZYQA 2PJ6A 2PJ3A 4WWVA 4UIAA 2PJAA 4F9VA 4R7MA 4CPAA 3BI0A 3VATA 5HVFA 3PFEA 3H8FA 1ZG9A 4X8IA 2PJCA 2PJ2A 2V8DA 3FMCA 1CG2A 3KHXA 2GREA 1KWMA 2JEWA 2RFHA 2XEIA 2IMOA 3I1UA 3RBUA 2AFOA 1ZLIA 2IJZA 1ELMP 6CPAA 5HXDA 2ZELA 1YSJA 4A38A 4OC0A 5LYIA 5CPAA 1BLLE 3NFZA 4PQAA 3MRUA 2HB6A 4Z65A 2PJ7A 3FEDA 2G9DA 1TXRA 1BPMA 4JYWA 2HC9A 4FWUA 1VGYA 2PJ4A 3KL9A 4OC2A 5LRJA 3TC8A 5K8NA 3LMSA 3KZWA 3V38A 3IFEA 2PJ8A 2O4HA 4ZX9A 2ZENA 5K8OA 5J1QA 3VARA 4ZY1A 2JBKA 7CPAA 3DLJA 4JZ0A 4DUKA 3D7FA 4P44A 3N5FA 4BD9A 1IY7A 4NJQA 2ANPA 4A94A 4MCPA 5F09A 5LYLA 4UIBA 2NSMA 1TKHA 1GYTA 3CDXA 1BAVA 4P45A 3FECA 1FNOA 4IHMA 4B6ZA 4MCSA 1HDQA 1PCAA 3B3CA 3T8WA 3FX6A 3PBEA 3PEIA 4MXUA 1VIXA 4F8ZA 2ZEOA 2C6PA 5LYFA 2Q43A 1XMBA 1H8LA 3SJGA 3PRTA 3PBBA 1YMEA 5CBMA 1Y0YA 2QVPA 1ZLHA 2PVVA 3KI9A 2PE3A 4WJBA 3IIBA 3PB6X 5DS0A 4OC5A 3PFOA 1EE3P 1QMUA 4MHPA 4ZI6A 2PCUA 2BOAA 2CF4A 4P4FA 1TF8A 1R43A 5K8PA 2V8HA 2ZEPA 5HVGA 1Z2LA 1XJOA 1PYTB 4X3RA 1XFOA 2WYRA 2PJ9A 3IWWA 3D68A 3PB8X 4MHZA 4OC1A 4YU9A 4NJRA 4NGPA 1LANA 3CT9A 4DYOA 3KR4A 5D29A 4PXDA 4O23A 4UF4A 3IJ3A 2ZOFA 1CPSA 2O53A 2EK9A 1XRYA 3D7HA 5HVHA 1AMPA 1TF9A 3IEHA 2ZEEA 1ARMA 5D8NA 4EWTA 1AYEA 1CP7A 2BO9A 3KASA 3WT4A 2AFZA 1ARLA 1CP6A 3RZAA 4MCRA 3FF3A 3SJEA 2BCOA 1OBRA 2F7VA 3S9LA 1YW4A 3WC7A 3DGVA 1R3NA 4P10A 3JRUA 3RAMA 3KQXA 1F57A 4P6YA 1JQGA 3SJFA 4UEZA 2CTCA 3V7ZA 3HLPA 5JH9A 4NGNA 3B3VA 4YWYA 3K2KA 3B35A 3H8EA 1LOKA 2ZEHA 1LAPA 4LQGA 3CPXA 2Q51A 3CPAA 3MN8A 4MMOA 1CX8A 4P4JA 4R6TA 2EK8A 3S9NA 4Q7AA 1M4LA 4OC4A 4NGMA 3WABA 4OIDA 2F8HA 1LAMA 3FEEA 1Y0RA 2C6CA 3KGQA 4TNUA 3KHZA 3D66A 3FJUA 4GM5A 4FBEA 4A39A 4NFRA 4AXVA 3WC5A 1CBXA 3HUVA 1IGBA 3PB9X 1Y7EA 1FT7A 3S9MA 4ONWA 2XEFA 3D7DA 1BPNA 2PRQA 4DJLA 3D4UA 1CPXA 2RB7A 4P4IA 2VL1A 2PIYA 3TX8A 3D7GA 4PXCA 4P4BA 5JGFA 1NSAA 2PVWA 2QYVA 4UEFA 4OMEA 4OP4A 2PJ1A 4KSIA 2PJ5A 4NGRA 2WZNA 3GLJA 4OIWA 4PXBA 8CPAA 1ZG7A 3BHXA 3D67A 3VH9A 1LFWA 2ZOGA 2PJ0A 4F9UA 4ZY2A 5LYDA 1F2OA 4ZX8A 2ZEGA 3SI0A 5JM6A 4UEEA 2AFUA 3K9TA 3ISZA 4G1PA 2PIZA 3BI1A 1XBUA 3B3WA 5LRGA 2Q4ZA 4P4EA 3GB0A 2V8GA 2AFXA 5LRKA 1Z5RA 1F2PA 4OKOA 3NH5A 2I3CA 3WC6A 3FH4A 4IAVA 2OR4A 2XEGA 4NGSA 3B7IA 2GU2A 4MHYA 1HDUA 2V77A 3QNVA 2ZEFA 2EWBA 4ZY0A 2OOTA 4FAIA 4MHNA 4OC3A 4FUUA 2ABZA 1Q7LA 4NGTA 1TKFA 1DTDA 2AFWA 2GLJA 3SJXA 4R8FA 3L2NA 4EFDA 2IQ6A 3NH4A 2QJ8A 2V8VA 1RTQA 1YLOA 3GUXA 1QQ9A 3IO1A 2GLFA 3IC1A 5THWA 1UWYA 3KR5A 3NA6A 4W9YA 3SI1A 4R76A 4PXEA 3BXMA 4MCQA 2ZEDA 4H2KA 2AFMA 5I4MA 3ISXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYQ A;  1HEE A;  4NGQ A;  1YW6 A;  3LWU A;  2ZEM A;  1ZG8 A;  3PB4 X;  1ELL P;  3KQZ A;  4MRI A;  4K3N A;  5IB9 A;  1DE4 C;  1TKJ A;  1Z8L A;  4PPZ A;  3NH8 A;  4IK2 A;  3B2Y A;  2CTB A;  2DEA A;  5K8M A;  2PJB A;  2C1C A;  2POK A;  4RUH A;  1LCP A;  3H8G A;  2FVG A;  4P4D A;  2CIJ A;  2AFS A;  4EME A;  3FVL A;  3SI2 A;  1VHO A;  3B3S A;  2J9A A;  3PB7 X;  2C6G A;  1VHE A;  5ELY A;  2JBJ A;  2XEJ A;  4X2T A;  4A37 A;  4TWE A;  3B3T A;  4ZYQ A;  2PJ6 A;  2PJ3 A;  4WWV A;  4UIA A;  2PJA A;  4F9V A;  4R7M A;  4CPA A;  3BI0 A;  3VAT A;  5HVF A;  3PFE A;  3H8F A;  1ZG9 A;  4X8I A;  2PJC A;  2PJ2 A;  2V8D A;  3FMC A;  1CG2 A;  3KHX A;  2GRE A;  1KWM A;  2JEW A;  2RFH A;  2XEI A;  2IMO A;  3I1U A;  3RBU A;  2AFO A;  1ZLI A;  2IJZ A;  1ELM P;  6CPA A;  5HXD A;  2ZEL A;  1YSJ A;  4A38 A;  4OC0 A;  5LYI A;  5CPA A;  1BLL E;  3NFZ A;  4PQA A;  3MRU A;  2HB6 A;  4Z65 A;  2PJ7 A;  3FED A;  2G9D A;  1TXR A;  1BPM A;  4JYW A;  2HC9 A;  4FWU A;  1VGY A;  2PJ4 A;  3KL9 A;  4OC2 A;  5LRJ A;  3TC8 A;  5K8N A;  3LMS A;  3KZW A;  3V38 A;  3IFE A;  2PJ8 A;  2O4H A;  4ZX9 A;  2ZEN A;  5K8O A;  5J1Q A;  3VAR A;  4ZY1 A;  2JBK A;  7CPA A;  3DLJ A;  4JZ0 A;  4DUK A;  3D7F A;  4P44 A;  3N5F A;  4BD9 A;  1IY7 A;  4NJQ A;  2ANP A;  4A94 A;  4MCP A;  5F09 A;  5LYL A;  4UIB A;  2NSM A;  1TKH A;  1GYT A;  3CDX A;  1BAV A;  4P45 A;  3FEC A;  1FNO A;  4IHM A;  4B6Z A;  4MCS A;  1HDQ A;  1PCA A;  3B3C A;  3T8W A;  3FX6 A;  3PBE A;  3PEI A;  4MXU A;  1VIX A;  4F8Z A;  2ZEO A;  2C6P A;  5LYF A;  2Q43 A;  1XMB A;  1H8L A;  3SJG A;  3PRT A;  3PBB A;  1YME A;  5CBM A;  1Y0Y A;  2QVP A;  1ZLH A;  2PVV A;  3KI9 A;  2PE3 A;  4WJB A;  3IIB A;  3PB6 X;  5DS0 A;  4OC5 A;  3PFO A;  1EE3 P;  1QMU A;  4MHP A;  4ZI6 A;  2PCU A;  2BOA A;  2CF4 A;  4P4F A;  1TF8 A;  1R43 A;  5K8P A;  2V8H A;  2ZEP A;  5HVG A;  1Z2L A;  1XJO A;  1PYT B;  4X3R A;  1XFO A;  2WYR A;  2PJ9 A;  3IWW A;  3D68 A;  3PB8 X;  4MHZ A;  4OC1 A;  4YU9 A;  4NJR A;  4NGP A;  1LAN A;  3CT9 A;  4DYO A;  3KR4 A;  5D29 A;  4PXD A;  4O23 A;  4UF4 A;  3IJ3 A;  2ZOF A;  1CPS A;  2O53 A;  2EK9 A;  1XRY A;  3D7H A;  5HVH A;  1AMP A;  1TF9 A;  3IEH A;  2ZEE A;  1ARM A;  5D8N A;  4EWT A;  1AYE A;  1CP7 A;  2BO9 A;  3KAS A;  3WT4 A;  2AFZ A;  1ARL A;  1CP6 A;  3RZA A;  4MCR A;  3FF3 A;  3SJE A;  2BCO A;  1OBR A;  2F7V A;  3S9L A;  1YW4 A;  3WC7 A;  3DGV A;  1R3N A;  4P10 A;  3JRU A;  3RAM A;  3KQX A;  1F57 A;  4P6Y A;  1JQG A;  3SJF A;  4UEZ A;  2CTC A;  3V7Z A;  3HLP A;  5JH9 A;  4NGN A;  3B3V A;  4YWY A;  3K2K A;  3B35 A;  3H8E A;  1LOK A;  2ZEH A;  1LAP A;  4LQG A;  3CPX A;  2Q51 A;  3CPA A;  3MN8 A;  4MMO A;  1CX8 A;  4P4J A;  4R6T A;  2EK8 A;  3S9N A;  4Q7A A;  1M4L A;  4OC4 A;  4NGM A;  3WAB A;  4OID A;  2F8H A;  1LAM A;  3FEE A;  1Y0R A;  2C6C A;  3KGQ A;  4TNU A;  3KHZ A;  3D66 A;  3FJU A;  4GM5 A;  4FBE A;  4A39 A;  4NFR A;  4AXV A;  3WC5 A;  1CBX A;  3HUV A;  1IGB A;  3PB9 X;  1Y7E A;  1FT7 A;  3S9M A;  4ONW A;  2XEF A;  3D7D A;  1BPN A;  2PRQ A;  4DJL A;  3D4U A;  1CPX A;  2RB7 A;  4P4I A;  2VL1 A;  2PIY A;  3TX8 A;  3D7G A;  4PXC A;  4P4B A;  5JGF A;  1NSA A;  2PVW A;  2QYV A;  4UEF A;  4OME A;  4OP4 A;  2PJ1 A;  4KSI A;  2PJ5 A;  4NGR A;  2WZN A;  3GLJ A;  4OIW A;  4PXB A;  8CPA A;  1ZG7 A;  3BHX A;  3D67 A;  3VH9 A;  1LFW A;  2ZOG A;  2PJ0 A;  4F9U A;  4ZY2 A;  5LYD A;  1F2O A;  4ZX8 A;  2ZEG A;  3SI0 A;  5JM6 A;  4UEE A;  2AFU A;  3K9T A;  3ISZ A;  4G1P A;  2PIZ A;  3BI1 A;  1XBU A;  3B3W A;  5LRG A;  2Q4Z A;  4P4E A;  3GB0 A;  2V8G A;  2AFX A;  5LRK A;  1Z5R A;  1F2P A;  4OKO A;  3NH5 A;  2I3C A;  3WC6 A;  3FH4 A;  4IAV A;  2OR4 A;  2XEG A;  4NGS A;  3B7I A;  2GU2 A;  4MHY A;  1HDU A;  2V77 A;  3QNV A;  2ZEF A;  2EWB A;  4ZY0 A;  2OOT A;  4FAI A;  4MHN A;  4OC3 A;  4FUU A;  2ABZ A;  1Q7L A;  4NGT A;  1TKF A;  1DTD A;  2AFW A;  2GLJ A;  3SJX A;  4R8F A;  3L2N A;  4EFD A;  2IQ6 A;  3NH4 A;  2QJ8 A;  2V8V A;  1RTQ A;  1YLO A;  3GUX A;  1QQ9 A;  3IO1 A;  2GLF A;  3IC1 A;  5THW A;  1UWY A;  3KR5 A;  3NA6 A;  4W9Y A;  3SI1 A;  4R76 A;  4PXE A;  3BXM A;  4MCQ A;  2ZED A;  4H2K A;  2AFM A;  5I4M A;  3ISX A; 
#chains in the Genus database with same CATH topology
 1HEE A;  1Y9K A;  5IYR A;  2GQF A;  2GJP A;  1WDT A;  4G7W A;  2DIE A;  5IK2 A;  5KW9 A;  4B48 A;  2NMT A;  1N08 A;  3PB4 X;  2EVN A;  5IB9 A;  4B47 A;  3P2H A;  1VKC A;  3MCA A;  3OW2 B;  4LC0 A;  4TMT A;  3NH8 A;  5JQ4 A;  1XE1 A;  2CNM A;  3JU4 A;  2DEA A;  3U6B A;  5F4O A;  1KUV A;  2PJB A;  4K1X A;  2DYI A;  1LCP A;  1N71 A;  4KOU A;  3ASS A;  1JA0 A;  2ZXV A;  2VBQ A;  2Z3N A;  2FL4 A;  2OH1 A;  2HUZ A;  3FVL A;  1FRQ A;  1ZUN B;  1KC8 D;  4XNH B;  1TVC A;  4RN7 A;  3SI2 A;  2BGJ A;  2ZXH A;  4F0X A;  1VHO A;  3B3S A;  2C6G A;  3UY5 A;  4HIZ A;  4PK3 A;  3CC4 B;  5ELY A;  1KK2 A;  2XEJ A;  2ZBV A;  5IYQ A;  4MBU A;  2ODF A;  4P25 A;  2PJ3 A;  4WWV A;  2PJA A;  4F9V A;  4OOS A;  4RS2 A;  3IGR A;  4R7M A;  2HMA A;  4CPA A;  2Q6I A;  4M85 A;  2QGG A;  1PUA A;  4IW3 B;  1NJI D;  1ZG9 A;  3TOB A;  4X8I A;  2PJC A;  4L8J A;  4DK0 A;  2V8D A;  2XZL A;  1QH0 A;  4JWP A;  1R5B A;  4OP7 A;  5J8C A;  4LBY A;  3RBU A;  4ZV4 A;  2P6G A;  1VQM B;  2R8V A;  3CP2 A;  5HXD A;  4P26 A;  3AVU A;  2BSW A;  3LQE A;  3W6S A;  2F4N A;  3TCV A;  1NE9 A;  1Y7R A;  3MMP A;  1YJN B;  1S7N A;  4H89 A;  1YX2 A;  3FED A;  1GAW A;  2RC6 A;  2ZIT A;  4HNW B;  1VQP B;  2PJ4 A;  2YNC A;  3LAC A;  2EBJ A;  2VQY A;  1MRZ A;  2AE6 A;  1QUE A;  4TN1 A;  4ZX9 A;  2R9V A;  2AJ6 A;  5TV2 A;  5GV7 A;  1GJR A;  5J1Q A;  1HA3 A;  7CPA A;  2R1I A;  4G1V A;  4DUK A;  4XM3 A;  3CES A;  2CNS A;  3D7F A;  2YWE A;  2BM1 A;  4KS9 A;  1G7S A;  3N5F A;  1I1D A;  1IY7 A;  2ANP A;  4A94 A;  5F09 A;  1YJW B;  3ZBT A;  2GJK A;  2QIR A;  1BAV A;  4UZU A;  4IHM A;  1R5O A;  3GQB A;  3T8W A;  4MJ8 A;  3OW7 A;  4MXU A;  3VR6 A;  3RNZ A;  4L8A A;  4F8Z A;  4ACA A;  2VXK A;  2B7B A;  3VO2 A;  4HE5 A;  4M1K A;  3F8K A;  4CGO A;  3PBB A;  3WNB A;  5CBM A;  1D2E A;  4KVX A;  2PC1 A;  2IL4 A;  2PVV A;  5DWN A;  1BX0 A;  1YLE A;  2DER A;  1KMH A;  4E8O A;  2ATR A;  4ZI6 A;  1QVG B;  3ZZI A;  4CRY B;  2PCU A;  1T6Z A;  2BOA A;  2BVN A;  3C26 A;  5KTD A;  4P4F A;  3BY2 A;  1S7L A;  3OP1 A;  4P9S A;  2QDX A;  3T51 B;  1TF8 A;  1R43 A;  2VZY A;  2QEC A;  4ZGQ B;  3Q38 A;  4U9Z A;  5EMN A;  2WYR A;  3IWW A;  4OC1 A;  4Z4U A;  4YU9 A;  5AG4 A;  1VQ9 B;  1QSO A;  2CXA A;  1IYL A;  4NJR A;  1BLI A;  4NGP A;  1IB0 A;  5FNZ A;  4PXD A;  3IJ3 A;  4LBW A;  1BPL A;  1GO2 A;  3CME B;  4C7I A;  3W2G A;  4AVC A;  1G7R A;  1AMP A;  1W34 A;  3IEH A;  1ARM A;  4R3L A;  3CC7 B;  4MFJ A;  2RC5 A;  3WT4 A;  1Z4E A;  2Q04 A;  3H4Q A;  1CP6 A;  4CAW A;  4QVT A;  4E0A A;  4AG7 A;  3RZA A;  1XOV A;  3JQR A;  1Q7Y D;  4R87 A;  3MGD A;  1CM0 A;  2YWG A;  1RQR A;  2C77 A;  4YAO A;  1S60 A;  3G3S A;  3IWE A;  4B10 A;  4EVY A;  2V7W A;  2XZP A;  3JRU A;  2PQ8 A;  3KQX A;  3FRM A;  1JQG A;  4ACB A;  3SJF A;  3S6K A;  4A31 A;  4YAL A;  4JXR A;  4X06 A;  3B3V A;  3K2K A;  3H8E A;  1LOK A;  2KVO A;  2P6E A;  4UWI A;  5F4J A;  4FD7 A;  5HKK A;  4M2L A;  3CPA A;  4MFQ A;  4TKO B;  2VYQ A;  1S7F A;  5H84 A;  4HNX B;  1S0U A;  1KRH A;  4XKW A;  3S9N A;  4OC4 A;  3Q6R A;  5IYN A;  3CXP A;  1UD6 A;  4P2N A;  3CW2 A;  1BX1 A;  1AMO A;  1WK4 A;  1LAM A;  2XGJ A;  1Y0R A;  4M53 A;  2ZXI A;  4TNU A;  1WTH D;  1E1R A;  5G1Z A;  4GM5 A;  3DDY A;  1V0F A;  1D8T A;  4XLA A;  3HUV A;  1IGB A;  3DSB A;  4XOP A;  4J0Q A;  1FT7 A;  3S9M A;  4ONW A;  4TT3 A;  3D7D A;  4DJL A;  1E3Z A;  1IYK A;  3CB4 A;  2PIY A;  2WPD A;  4QVJ A;  4Z4R A;  2HDN B;  2Q0Y A;  4UCM A;  2VBU A;  5H59 A;  2H5M A;  3OE7 A;  3SJZ A;  2WZN A;  8CPA A;  3ES9 A;  4MFK A;  3VH9 A;  2ZOG A;  4FWT A;  4M6H A;  4RDK A;  4ZX8 A;  3SI0 A;  4Q7J B;  1I12 A;  4BMH A;  2B5G B;  2PIZ A;  3B3W A;  1B6B A;  4P4E A;  3GB0 A;  2V8G A;  2AFX A;  1F2P A;  3NH5 A;  5DN6 A;  5EC4 A;  2ZW5 A;  2OR4 A;  4IAV A;  3D2P A;  4MHY A;  4GQN A;  3OAA A;  1SM4 A;  1VLY A;  2XNC A;  4R9M A;  2EWB A;  4NSQ A;  1WSR A;  3FYN A;  1E43 A;  4KOT A;  4FUU A;  4XLE A;  3BCD A;  3ZC3 A;  1Q7L A;  4RCY A;  4Z4Y A;  1Z8T A;  2AFW A;  2OK7 A;  3SJX A;  4KLV A;  4C43 A;  3EC4 A;  2F5I A;  1F20 A;  2JJ2 A;  3I56 B;  3GUX A;  4G1B A;  3IO1 A;  5THW A;  2VJI A;  2J8N A;  1YVO A;  4FD6 A;  3NA6 A;  5L46 A;  3ZIA A;  3SI1 A;  1K73 D;  4R76 A;  3KEW A;  3ASR A;  3CRZ A;  2YNE A;  3SXN A;  1FND A;  2XND A;  2B4D B;  2AFM A;  4QV2 A;  4UA3 A;  3T9Y A;  4YAF A;  3T90 A;  3AVX A;  5THX A;  2DF5 A;  2CBX A;  1ZG8 A;  1D1N A;  1W0J A;  1M4I A;  5E6T A;  3ZZT A;  4Y7C A;  3CCR B;  1ELL P;  4ASU A;  4MRI A;  3PGP A;  2ZTN A;  1TKJ A;  2W6I A;  3QFC A;  1QUF A;  4KKT A;  5TR9 A;  2VZL A;  2FIW A;  3FJO A;  3G6E B;  2CRV A;  2CIJ A;  4EME A;  2JLM A;  4HE6 A;  5EBV A;  2CC2 A;  3W5V A;  1EFT A;  4GS4 A;  2C78 A;  1EFR A;  3PB7 X;  1BQE A;  4UAJ A;  2PRB A;  4XON A;  3I3G A;  4DNR B;  1IHM A;  4B3F X;  5AG6 A;  2B4B A;  1DG1 G;  1F60 A;  3AST A;  1I7P A;  4YXW A;  2ZZG A;  3A3G A;  3PFE A;  4ZBG A;  4RM0 A;  4NBS A;  3FMC A;  2DET A;  1N07 A;  3KHX A;  2GRE A;  1KWM A;  4M4S A;  2B58 A;  2IMO A;  4A30 A;  2QML A;  3HAG A;  4U9U A;  3I1U A;  1IU8 A;  4B3X A;  1TUI A;  4OOV A;  1IB1 E;  5F49 A;  3CMA B;  2XEX A;  2IJZ A;  2VBS A;  4MI4 A;  2ZEL A;  1KTV A;  1YSJ A;  4A38 A;  1OGI A;  1OB5 A;  1Q2D A;  2Q4V A;  4AVA A;  1Q9S A;  2CW5 A;  3BNW A;  2EO8 A;  3CXQ A;  3QSY A;  2BGI A;  3NFZ A;  2FSR A;  2Z6B D;  3SLN A;  2HB6 A;  4Z65 A;  2FT0 A;  3ZZ0 A;  2G9D A;  5IYP A;  4MFP A;  1TXR A;  2V7Q A;  2Z3P A;  1QGY A;  2BL1 A;  1VGY A;  1R57 A;  3OJX A;  2A4N A;  4OC2 A;  3TFY A;  2XOK A;  5H5J A;  1UD5 A;  3GVJ A;  3QFT A;  2ZBU A;  3WBK A;  4DNC A;  4P3I A;  3CCV B;  3IFE A;  3TE4 A;  1BOB A;  4IF5 A;  2O4H A;  2WPX A;  1OB0 A;  2VBT A;  1E1Q A;  2WJY A;  2P0W A;  4H6U A;  4ZY1 A;  2JBK A;  5IV0 A;  4OLL A;  4UCP A;  3CTA A;  4B3G A;  1QX4 A;  4P44 A;  4KSF A;  2V31 A;  4AF6 A;  4XLF A;  4XL9 A;  1M4G A;  4BIN A;  5LYL A;  3FPK A;  3NE5 B;  1JB9 A;  2EIX A;  1N0V C;  3ZJ0 A;  1GYT A;  3FEC A;  1FNO A;  3RYO A;  2JN9 A;  4MCS A;  3PBE A;  3D3S A;  3PEI A;  2BMW A;  4B14 A;  1XB2 A;  2YND A;  1L0C A;  2ZEO A;  5LYF A;  2Z3M A;  3VNV A;  2B3U A;  4LQ6 A;  3GY9 A;  2VNH A;  1Y0Y A;  4JD6 A;  2I1L A;  2PE3 A;  3A8J A;  3TO6 A;  1Q2Y A;  4A2Z A;  2ZW4 A;  3IIB A;  1VQK B;  2DXQ A;  5KSW B;  1FDR A;  4KOW A;  3ZUG A;  3AGP A;  2REF A;  3G05 A;  4KKU A;  5A89 A;  2CF4 A;  3BQJ A;  1CNE A;  3SHP A;  1EFU A;  1XQB A;  2CY2 A;  2FXF A;  1W0K A;  2PMD A;  3A3B A;  3D68 A;  2Y0M A;  3A9L A;  4YFJ A;  1LAN A;  4DYO A;  1ON0 A;  1K28 D;  4I49 A;  2QMU A;  2ZOF A;  4RCZ A;  2O53 A;  4OAD A;  1T6Y A;  4XNF A;  1XRY A;  1QSM A;  3D26 A;  5TY0 A;  1PU9 A;  1CP7 A;  1P4N A;  2QN6 A;  1FX0 A;  4MCR A;  4ZCM A;  5BSX A;  1P4M A;  1HZE A;  3CPW B;  1OB2 A;  5J35 A;  2QE7 A;  4ZCI A;  2GJR A;  1TLL A;  3DGV A;  3QE2 A;  4P10 A;  4X05 A;  2VNJ A;  3HLP A;  2X8K A;  2R98 A;  4UFW A;  4NGN A;  2BF4 A;  2R7H A;  3B35 A;  5FO1 A;  3CP8 A;  4LQG A;  4U9Y A;  3CPX A;  1XMT A;  2WUU A;  2D3N A;  4KSA A;  3R6J A;  4P4J A;  3LO8 A;  2D9R A;  4PSW A;  2D3L A;  3ONU A;  4RPB A;  1S72 B;  4KUA A;  4OID A;  4ORF A;  4IUS A;  2F8H A;  3OZV A;  3OJW A;  2C6C A;  4KOY A;  3KGQ A;  3KHZ A;  2V7X A;  1JJ2 B;  2DEU A;  3D8P A;  1ZM2 A;  4FBE A;  3WR7 A;  4CAF A;  1Y9W A;  4AXV A;  3WC5 A;  3U6K A;  1WOR A;  3F0A A;  3QAH A;  4AB7 A;  3FPP A;  3PB9 X;  1Y7E A;  1N8R D;  1MK4 A;  1YX0 A;  5KNL A;  4XN0 A;  2G3T A;  4QUZ A;  3JQQ A;  3I1F A;  5TRD A;  3TX8 A;  3D7G A;  1H42 A;  2Q7B A;  1XEB A;  1EP2 B;  4PXC A;  4HPS A;  1DDI A;  4UFX A;  4Z4W A;  1NSA A;  4QFM A;  3S6H A;  3PVD A;  2QYV A;  3JTK A;  4UEF A;  4OP4 A;  2PJ1 A;  2HCJ B;  2PJ5 A;  4KSI A;  4AF7 A;  4LX9 A;  1M4D A;  1YIT B;  1KK0 A;  4F9U A;  3JQP A;  1UD3 A;  2X3U A;  2ZZQ A;  4Z1M A;  1F2O A;  2VNK A;  2ZEG A;  2R6H A;  5JM6 A;  1QSR A;  3ISZ A;  4G1P A;  3JUW A;  2ZL6 A;  2FX3 A;  1K8A D;  5LRK A;  3ONY A;  4OKO A;  2I3C A;  4M0L A;  3WC6 A;  3FH4 A;  2XEG A;  4NGS A;  3CCS B;  1E62 A;  1X12 A;  1HDU A;  3A8I A;  4QVA A;  4CRZ B;  2PLF A;  2ZEF A;  5G21 A;  3SKB A;  1CJW A;  3GKR A;  3FKS A;  1KJZ A;  4II2 A;  2DY1 A;  4MY0 A;  5J8F A;  4H6Z A;  1B2R A;  4OC3 A;  4G7X A;  4CAV A;  4FN5 A;  1VF7 A;  3W2I A;  3I55 B;  2ABZ A;  1AUG A;  1VQ6 B;  1DTD A;  2CNT A;  4C7H A;  3PUN A;  4G5G A;  3L2N A;  1YR0 A;  1QVF B;  4YAU A;  2YWF A;  2GFQ A;  4X5K A;  3LNN A;  1QST A;  2QTZ A;  4AVB A;  4XLC A;  1NSL A;  3AGQ A;  2PSW A;  3EO4 A;  3RO0 A;  3IU1 A;  2Q4Y A;  1NB0 A;  2ZTG A;  4L89 A;  3PA1 A;  3OEH A;  2FIA A;  4NGM A;  5I4M A;  5AN9 A;  3ISX A;  4NGQ A;  1G7C A;  2GIV A;  5H86 A;  4F7D A;  2WPW A;  1WU8 A;  4A95 A;  1YHQ B;  3P2F A;  4OOX A;  2PIA A;  3LVB A;  4LUA A;  3VO1 A;  1I21 A;  1WPC A;  1COW A;  1DE4 C;  3OPO A;  1Z8L A;  4PPZ A;  5KTA A;  1T5E A;  4IK2 A;  4LBZ A;  4Y49 B;  2OK8 A;  4YEL A;  3T56 B;  3G71 B;  3CXS A;  2WR8 A;  4TMV A;  1HVX A;  2POK A;  4NCN A;  2C4T A;  3WND A;  3H8G A;  2FVG A;  1Q81 D;  4P12 A;  4DQL A;  2AFS A;  2FS5 A;  5CDF A;  2PR8 A;  4RJL A;  2E1B A;  1GVH A;  2GPJ A;  2LZJ A;  4PC3 A;  4E2A A;  4A37 A;  2VI7 A;  5CNP A;  5AG7 A;  4ZYQ A;  4YHB A;  1K9M D;  1FNC A;  3AVY A;  1GAQ A;  4UIA A;  4Z4Z A;  1QGZ A;  3BH4 A;  4XOR A;  3BI0 A;  5HVF A;  3H8F A;  1N06 A;  2PJ2 A;  3A1P A;  1CG2 A;  3DR6 A;  2RFH A;  4RDL A;  1XF8 A;  2M5S A;  3ASP A;  2OTL B;  4CAX A;  2QA4 B;  1J4J A;  1KK1 A;  1ELM P;  6CPA A;  2OZH A;  4RDJ A;  1V0E A;  1M44 A;  1IJF A;  3CMM A;  1WOS A;  3FBU A;  5CPA A;  4TMW A;  2ARH A;  4B5P A;  4NEX A;  2EUI A;  1BLL E;  2ZZF A;  5A8A A;  4PQA A;  1QG0 A;  1OZP A;  1WWZ A;  4XPK A;  2J7K A;  4PK2 A;  1Q86 D;  2QEX B;  1NB9 A;  4JYW A;  2HC9 A;  3R1K A;  2O28 A;  3KL9 A;  2OB0 A;  2X7B A;  5LRJ A;  2BV3 A;  1NDH A;  3SJP A;  4X7E A;  4DQK A;  3TC8 A;  5K8N A;  2C5H A;  3LMS A;  3KZW A;  1YRE A;  2OBS A;  2PJ8 A;  4QUS A;  2XZO A;  5K8O A;  3VAR A;  2JJ1 A;  1MJ9 A;  2G3A A;  3DLJ A;  4JZ0 A;  1KUX A;  4PC1 A;  1I18 A;  5C88 A;  5HZA A;  3MHP A;  3PUM A;  1KD1 D;  4BD9 A;  2F1L A;  4MCP A;  2AHO A;  2CK3 A;  2JDI A;  4KVO E;  5EMI A;  4CYN A;  4UIB A;  2VEZ A;  2I00 A;  2CND A;  2E1R A;  2B5O A;  5FL7 A;  4P45 A;  2X0K A;  1HDQ A;  4PC2 A;  1PCA A;  3B3C A;  1VQ5 B;  1XIX A;  3NE7 A;  4HKF A;  5IB0 A;  4RD4 A;  1VIX A;  3S6G A;  1I8D A;  1S7K A;  2I79 A;  5AGE A;  2Q43 A;  4U5Y A;  3CCJ B;  1ZM4 A;  1H8L A;  3SJG A;  2X6X A;  4AG9 A;  3V8I A;  1CNF A;  3PRT A;  1TTT A;  4N3N A;  2QVP A;  1ZLH A;  3BJ8 A;  4CYO A;  5FVJ A;  2V7U A;  3QFR A;  3BCF A;  3R6K A;  5ISV A;  4UCN A;  4WJB A;  4QBJ A;  3PB6 X;  2OU2 A;  3QB8 A;  1XE4 A;  3WY9 A;  3PFO A;  2Z3K A;  2Q7S A;  1QMU A;  5BWA B;  2RC4 A;  1YI2 B;  1IJE A;  3S6F A;  3R95 A;  4FXU A;  5A88 A;  3E0K A;  2JDC A;  1UMK A;  5HZB A;  2BPO A;  2WSA A;  3DNS A;  1S3Z A;  5K8P A;  2ZEP A;  3BC9 A;  1VLO A;  3OKX A;  1XJO A;  4XNH C;  1PYT B;  2PR1 A;  1XFO A;  1EP1 B;  2PJ9 A;  1NRK A;  4MHZ A;  4UFV A;  3CCM B;  5GV8 A;  3CT9 A;  3KR4 A;  4KLW A;  5D29 A;  2OBT A;  4Z4V A;  3ZBU A;  2YNC C;  4M6I A;  5HVH A;  1TF9 A;  1OHH A;  2ZEE A;  4OPS A;  2Z0Z A;  4XLH A;  3T53 B;  2Z11 A;  5HXB A;  4Z4T A;  2BM0 A;  3CCE B;  3FIX A;  3JVN A;  3IWG A;  2HLD A;  4RD0 A;  4XN3 A;  3FF3 A;  3OEE A;  3SJE A;  5IX3 A;  2BCO A;  1GR1 A;  2D4O A;  3A8K A;  3G8W A;  4QC6 A;  4ROX A;  1R3N A;  3WYA A;  1PJ7 A;  1WOO A;  2WSS A;  4P6Y A;  4Y9U A;  4E0F A;  3F5B A;  1SKQ A;  4MFL A;  4TSF A;  2CTC A;  1M1K D;  4RD2 A;  4YWY A;  1JA1 A;  2Q51 A;  3MN8 A;  2FE7 A;  4MMO A;  4X7D A;  3Q6Q A;  2EK8 A;  4NNJ A;  1YJ9 B;  3WAB A;  3SXO A;  4XR6 A;  3GSI A;  3GIU A;  2OBR A;  3FEE A;  4HNY B;  4B43 A;  2HQY A;  2GK6 A;  4XPD B;  2B7C A;  5G20 A;  2VZZ A;  1A2Z A;  2Q6L A;  1S5K A;  3FJU A;  4A39 A;  1EP3 B;  1FNM A;  3IU2 A;  4CAE A;  4NFR A;  1CBX A;  4ZGN B;  3G4S B;  4B11 A;  3H9N A;  2PDO A;  5BSY A;  4OPV A;  2XEF A;  4NF1 A;  5F46 A;  1BPN A;  2PRQ A;  3D4U A;  2X6W A;  4TMX A;  4XPL A;  2OTJ B;  1CPX A;  2C27 A;  4M6G A;  4P4I A;  4WZE A;  4ZCL A;  1YVK A;  2GAN A;  4MYU A;  5LMZ A;  1VQN B;  4B13 A;  3W2F A;  4ZGY B;  1JWQ A;  2PVW A;  1W2B B;  3OZU A;  4CGP A;  4NGR A;  5KTC A;  4OIW A;  4PXB A;  2C5B A;  4RLZ A;  3PA2 A;  1QGA A;  1ZG7 A;  4FD5 A;  1S4M A;  3D67 A;  4PAA A;  2HV2 A;  3OFN A;  5E96 A;  2PJ0 A;  3PEN A;  2X53 S;  1MJA A;  2JIZ A;  2OZU A;  2W6J A;  2Q6O A;  3BI1 A;  1ZM3 A;  5LRG A;  2Q4Z A;  1Q2C A;  4C0S A;  1YQE A;  2VJJ A;  3VWE A;  1VQ7 B;  1Z5R A;  3CCQ B;  1FNB A;  4BBH A;  3OZW A;  5I0C A;  5HH1 A;  1EWY A;  3BLN A;  3TO7 A;  1G7T A;  3QNV A;  2X6Y A;  4KOX A;  1DAR A;  3B8G A;  2FCK A;  4QB9 A;  3W91 A;  3ZPN A;  4ZY0 A;  4H9G A;  2OOT A;  4MHN A;  3WBJ A;  1J9Z A;  3W2H A;  1ELO A;  4Y9R A;  4B4D A;  2DPT A;  1X10 A;  2VBV A;  4JMQ A;  4NGT A;  1TKF A;  5F48 A;  3VNU A;  3R9G A;  4AVZ A;  4EFD A;  2REE A;  2DOG A;  3NH4 A;  2QJ8 A;  1Z9U A;  1QQ9 A;  2BN4 A;  3W2E A;  2GLF A;  1Z8X A;  4NCZ A;  1KUY A;  4JXQ A;  3CCU B;  5GCN A;  4R57 A;  4PXE A;  3BXM A;  1VQO B;  2ZED A;  4C2X A;  2GK7 A;  4H2K A;  3K9U A;  4F6A A;  3EFA A;  1RO5 A;  1SQH A;  1U2R A;  2NYQ A;  1EXM A;  1YW6 A;  3LWU A;  4P6V F;  2ZEM A;  4TMZ A;  3VMF A;  1Q82 D;  4Q38 A;  2BSA A;  1YIJ B;  1ZM9 A;  3LOD A;  3PP9 A;  3KQZ A;  4K3N A;  2ZW6 A;  4WZL A;  4PSX A;  3B2Y A;  2G0B A;  3J81 k;  2OZG A;  2CTB A;  4CGL A;  4WQM A;  5K8M A;  4II3 A;  4YGO A;  1IID A;  1E63 A;  3WQZ A;  1V5V A;  2C1C A;  2YGW A;  4RUH A;  3E20 A;  2WZP P;  4R3K A;  4P4D A;  1WOP A;  4UWJ A;  4NXY A;  3AVT A;  4Y49 C;  3B78 A;  1P0H A;  2J9A A;  4UZE A;  1N0U A;  1VHE A;  2OYN A;  4N3G A;  1PJ5 A;  4BPR A;  2JBJ A;  4X2T A;  4TWE A;  3B3T A;  2PJ6 A;  3GVL A;  1GHE A;  4RPD A;  3V7A A;  4OPO A;  1KZL A;  1B23 P;  1CQX A;  3VAT A;  4P3Y A;  5F4M A;  1FRN A;  4PC7 A;  4B12 A;  3NE8 A;  2JEW A;  2XEI A;  4X0C A;  4K30 A;  3SLD A;  1KQS B;  2AFO A;  1UD4 A;  1ZLI A;  3P26 A;  1VQL B;  4C68 A;  4CYQ A;  3VWD A;  1H8E A;  5HMN A;  1T6X A;  3DDD A;  4GXH A;  4KOS A;  4XOT A;  4DK1 A;  2WJV A;  1LRZ A;  1MAB A;  3EXN A;  4OC0 A;  2P3M A;  5LYI A;  1VHS A;  4II9 A;  4PAB A;  3LD2 A;  1IIC A;  1E79 A;  1ZO0 A;  3BY1 A;  1EFC A;  1NMT A;  3MRU A;  3Q39 A;  3CD6 B;  2PJ7 A;  4PV6 A;  3QFS A;  1BPM A;  4FWU A;  4G6I A;  4P22 A;  4MYT A;  3W6X A;  4RI1 A;  2X85 A;  4QHY A;  3V38 A;  5G22 A;  2ZEN A;  2V4D A;  3TT2 A;  4WZK A;  4X7F A;  3ASQ A;  4JLY A;  4P1V A;  2BUE A;  3WXM A;  4YAW A;  1DDG A;  4KUB A;  1JNY A;  3SEJ A;  3H5Z A;  1BMF A;  4NJQ A;  4YRH A;  1M90 D;  4OAE A;  3DR8 A;  2D74 A;  3TOA A;  3TO9 A;  2NSM A;  3A35 A;  4EH1 A;  1QSN A;  1TKH A;  3CDX A;  1U6M A;  4CGM A;  4CQJ A;  4B6Z A;  3P27 A;  3FX6 A;  2P6F A;  1QFZ A;  2C2W A;  2C6P A;  1PKV A;  1YGH A;  1XMB A;  4MFZ A;  1NBM A;  4Q36 A;  2V7T A;  2Z3O A;  1YME A;  4ONU A;  2VNI A;  1Z8W A;  4B5P B;  3KI9 A;  4PC6 A;  4FK8 A;  1E64 A;  2GE3 A;  5DS0 A;  1UFH A;  4OC5 A;  5DWM A;  1N05 A;  1EE3 P;  4RD6 A;  4MHP A;  2DCU A;  1VJS A;  2BEI A;  4FD4 A;  3GVK A;  4XD7 A;  1E3X A;  4F0Y A;  2V8H A;  5HVG A;  1VQ8 B;  1Z2L A;  3OOC A;  1IOI A;  4X3R A;  3PB8 X;  3B82 A;  2XNJ A;  4O23 A;  4UF4 A;  1CPS A;  4XMY A;  2K5T A;  2NV4 A;  2EK9 A;  3D7H A;  1V0C A;  3KKW A;  3OWC A;  1M1D A;  1W87 A;  4MHD A;  5D8N A;  4EWT A;  4KOV A;  1AYE A;  2BO9 A;  3KAS A;  3Q3A A;  3BJ7 A;  4PGO A;  2AFZ A;  1ARL A;  4XQF A;  1OGJ A;  1QFJ A;  3B8H A;  1OBR A;  1RXT A;  2F7V A;  3FB3 A;  3S9L A;  3CZX A;  1YW4 A;  1B87 A;  2ZW7 A;  3WC7 A;  3QAY A;  3RAM A;  1F57 A;  5A27 A;  2DPS A;  1H85 A;  1QFY A;  5F47 A;  4UEZ A;  3V7Z A;  4R71 A;  5JH9 A;  3AVV A;  2ZEH A;  2ZL5 A;  1LAP A;  5IYW A;  1WSV A;  5JBQ A;  3GIR A;  3WNC A;  2B5G A;  4UZF A;  1RQP A;  5JPH A;  1CX8 A;  4R6T A;  3W5H A;  1H8H A;  3R96 A;  4Q7A A;  1M4L A;  3CXC B;  3GYA A;  1UD2 A;  3CCL B;  2YWH A;  4KVM E;  4AC9 A;  1K4J A;  2QTL A;  3D66 A;  2J8M A;  1SKY B;  1FY7 A;  1VQ4 B;  3D2M A;  3AVW A;  2Q6K A;  3LQ6 A;  1IOF A;  4X07 A;  2RB7 A;  4XPD C;  2VL1 A;  1UD8 A;  1BO4 A;  1YK3 A;  3R9F A;  1W9X A;  4P4B A;  5JGF A;  2JDD A;  1R5N A;  4OME A;  2EFG A;  2J8R A;  4M3S A;  3V76 A;  3E1Y E;  2ZL7 A;  3GLJ A;  4MY3 A;  4C2Y A;  3H94 A;  3CC2 B;  4KKS A;  5FIU A;  3EY5 A;  3BHX A;  3FXT A;  3N7Z A;  4XKV A;  2B4D A;  1LFW A;  1MJB A;  5J3O A;  4ZY2 A;  5LYD A;  5C82 A;  1BJK A;  4A33 A;  5FO0 A;  4B5O A;  2Z10 A;  4UEE A;  2AFU A;  3K9T A;  4A32 A;  4CYP A;  1WP6 A;  2KCW A;  1XBU A;  4C2Z A;  5AG5 A;  3U2Q A;  4X7C A;  5A28 A;  4KZT A;  4RD1 A;  1KZF A;  4CS0 B;  3TTH A;  3B7I A;  2Z3L A;  2C4U A;  2GU2 A;  4YEJ A;  3ZZU A;  2V77 A;  2ZPA A;  2F43 A;  4B44 A;  4UBR A;  2B3V A;  1W35 A;  4RD3 A;  4FAI A;  5DSZ A;  3R9E A;  2ZZE A;  1KK3 A;  4J3G A;  5FA6 A;  1Z4R A;  2D4P A;  4CGN A;  2GLJ A;  4KOR A;  4R8F A;  4JJX A;  4LBV A;  1PJ6 A;  2IQ6 A;  1A8P A;  4DNT B;  2V8V A;  2F1M A;  1RTQ A;  4WZT A;  1YLO A;  3FNC A;  1AIP A;  4Z4S A;  2JEV A;  1TIQ A;  3W5U A;  3IC1 A;  1UWY A;  3RY8 A;  3KR5 A;  4W9Y A;  2Q44 A;  5B6I A;  2NPF A;  3I9S A;  2V7V A;  4MCQ A;  3PZJ A; 
#chains in the Genus database with same CATH homology
 2NYQ A;  1HEE A;  4NGQ A;  1YW6 A;  3LWU A;  2ZEM A;  1ZG8 A;  3PB4 X;  1ELL P;  3KQZ A;  4MRI A;  4K3N A;  5IB9 A;  1DE4 C;  1TKJ A;  1Z8L A;  4PPZ A;  3NH8 A;  4IK2 A;  3B2Y A;  2CTB A;  2DEA A;  5K8M A;  2PJB A;  2C1C A;  2POK A;  4RUH A;  1LCP A;  3H8G A;  2FVG A;  4P4D A;  2CIJ A;  2AFS A;  4EME A;  3FVL A;  3SI2 A;  1VHO A;  3B3S A;  2J9A A;  3PB7 X;  2C6G A;  1VHE A;  5ELY A;  2JBJ A;  2XEJ A;  4X2T A;  4A37 A;  4TWE A;  3B3T A;  4ZYQ A;  2PJ6 A;  2PJ3 A;  4WWV A;  4UIA A;  2PJA A;  4F9V A;  4R7M A;  4CPA A;  3BI0 A;  3VAT A;  5HVF A;  3PFE A;  3H8F A;  1ZG9 A;  4X8I A;  2PJC A;  2PJ2 A;  2V8D A;  3FMC A;  1CG2 A;  3KHX A;  2GRE A;  1KWM A;  2JEW A;  2RFH A;  2XEI A;  2IMO A;  3I1U A;  3RBU A;  2AFO A;  1ZLI A;  2IJZ A;  1ELM P;  6CPA A;  5HXD A;  2ZEL A;  1YSJ A;  4A38 A;  4OC0 A;  5LYI A;  5CPA A;  1BLL E;  3NFZ A;  4PQA A;  3MRU A;  2HB6 A;  4Z65 A;  2PJ7 A;  3FED A;  2G9D A;  1TXR A;  1BPM A;  4JYW A;  2HC9 A;  4FWU A;  1VGY A;  2PJ4 A;  3KL9 A;  4OC2 A;  5LRJ A;  3TC8 A;  5K8N A;  3LMS A;  3KZW A;  3V38 A;  3IFE A;  2PJ8 A;  2O4H A;  4ZX9 A;  2ZEN A;  5K8O A;  5J1Q A;  3VAR A;  4ZY1 A;  2JBK A;  7CPA A;  3DLJ A;  4JZ0 A;  4DUK A;  3D7F A;  4P44 A;  3N5F A;  4BD9 A;  1IY7 A;  4NJQ A;  2ANP A;  4A94 A;  4MCP A;  5F09 A;  5LYL A;  4UIB A;  2NSM A;  1TKH A;  1GYT A;  3CDX A;  1BAV A;  4P45 A;  3FEC A;  1FNO A;  4IHM A;  4B6Z A;  4MCS A;  1HDQ A;  1PCA A;  3B3C A;  3T8W A;  3FX6 A;  3PBE A;  3PEI A;  4MXU A;  1VIX A;  4F8Z A;  2ZEO A;  2C6P A;  5LYF A;  2Q43 A;  1XMB A;  1H8L A;  3SJG A;  3PRT A;  3PBB A;  1YME A;  5CBM A;  1Y0Y A;  2QVP A;  1ZLH A;  2PVV A;  3KI9 A;  2PE3 A;  4WJB A;  3IIB A;  3PB6 X;  5DS0 A;  4OC5 A;  3PFO A;  1EE3 P;  1QMU A;  4MHP A;  4ZI6 A;  2PCU A;  2BOA A;  2CF4 A;  4P4F A;  1TF8 A;  1R43 A;  5K8P A;  2V8H A;  2ZEP A;  5HVG A;  1Z2L A;  1XJO A;  1PYT B;  4X3R A;  1XFO A;  2WYR A;  2PJ9 A;  3IWW A;  3D68 A;  3PB8 X;  4MHZ A;  4OC1 A;  4YU9 A;  4NJR A;  4NGP A;  1LAN A;  3CT9 A;  4DYO A;  3KR4 A;  5D29 A;  4PXD A;  4O23 A;  4UF4 A;  3IJ3 A;  2ZOF A;  1CPS A;  2O53 A;  2EK9 A;  1XRY A;  3D7H A;  5HVH A;  1AMP A;  1TF9 A;  3IEH A;  2ZEE A;  1ARM A;  5D8N A;  4EWT A;  1AYE A;  1CP7 A;  2BO9 A;  3KAS A;  3WT4 A;  2AFZ A;  1ARL A;  1CP6 A;  3RZA A;  4MCR A;  3FF3 A;  3SJE A;  2BCO A;  1OBR A;  2F7V A;  3S9L A;  1YW4 A;  3WC7 A;  3DGV A;  1R3N A;  4P10 A;  3JRU A;  3RAM A;  3KQX A;  1F57 A;  4P6Y A;  1JQG A;  3SJF A;  4UEZ A;  2CTC A;  3V7Z A;  3HLP A;  5JH9 A;  4NGN A;  3B3V A;  4YWY A;  3K2K A;  3B35 A;  3H8E A;  1LOK A;  2ZEH A;  1LAP A;  4LQG A;  3CPX A;  2Q51 A;  3CPA A;  3MN8 A;  4MMO A;  1CX8 A;  4P4J A;  4R6T A;  2EK8 A;  3S9N A;  4Q7A A;  1M4L A;  4OC4 A;  4NGM A;  3WAB A;  4OID A;  2F8H A;  1LAM A;  3FEE A;  1Y0R A;  2C6C A;  3KGQ A;  4TNU A;  3KHZ A;  3D66 A;  3FJU A;  4GM5 A;  4FBE A;  4A39 A;  4NFR A;  4AXV A;  3WC5 A;  1CBX A;  3HUV A;  1IGB A;  3PB9 X;  1Y7E A;  1FT7 A;  3S9M A;  4ONW A;  2XEF A;  3D7D A;  1BPN A;  2PRQ A;  4DJL A;  3D4U A;  1CPX A;  2RB7 A;  4P4I A;  2VL1 A;  2PIY A;  3TX8 A;  3D7G A;  4PXC A;  4P4B A;  5JGF A;  1NSA A;  2PVW A;  2QYV A;  4UEF A;  4OME A;  4OP4 A;  2PJ1 A;  4KSI A;  2PJ5 A;  4NGR A;  2WZN A;  3GLJ A;  4OIW A;  4PXB A;  8CPA A;  1ZG7 A;  3BHX A;  3D67 A;  3VH9 A;  1LFW A;  2ZOG A;  2PJ0 A;  4F9U A;  4ZY2 A;  5LYD A;  1F2O A;  4ZX8 A;  2ZEG A;  3SI0 A;  5JM6 A;  4UEE A;  2AFU A;  3K9T A;  3ISZ A;  4G1P A;  2PIZ A;  3BI1 A;  1XBU A;  3B3W A;  5LRG A;  2Q4Z A;  4P4E A;  3GB0 A;  2V8G A;  2AFX A;  5LRK A;  1Z5R A;  1F2P A;  4OKO A;  3NH5 A;  2I3C A;  3WC6 A;  3FH4 A;  4IAV A;  2OR4 A;  2XEG A;  4NGS A;  3B7I A;  2GU2 A;  4MHY A;  1HDU A;  2V77 A;  3QNV A;  2ZEF A;  2EWB A;  4ZY0 A;  2OOT A;  4FAI A;  4MHN A;  4OC3 A;  4FUU A;  2ABZ A;  1Q7L A;  4NGT A;  1TKF A;  1DTD A;  2AFW A;  2GLJ A;  3SJX A;  4R8F A;  3L2N A;  4EFD A;  2IQ6 A;  3NH4 A;  2QJ8 A;  2V8V A;  1RTQ A;  1YLO A;  3GUX A;  1QQ9 A;  3IO1 A;  2GLF A;  3IC1 A;  5THW A;  1UWY A;  3KR5 A;  3NA6 A;  4W9Y A;  3SI1 A;  4R76 A;  4PXE A;  3BXM A;  4MCQ A;  2ZED A;  4H2K A;  2AFM A;  5I4M A;  3ISX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...