1VHOA

Crystal structure of a putative peptidase/endoglucanase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
331
structure length
319
Chain Sequence
METGKLLMELSNLDGPSGYETNVVSYIKSVIEPFVDEAKTTRHGSLIGYKKGKGIGKLAFFAHVDEIGFVVSKVEGQFARLEPVYASKVRIYTKNGIERGVIGMLAPHLQDSESRKKVPTYDEIFVDLSLCERGVRVGDIAVIDQTAFETNGKVVGKALDNRASCGVLVKVLEFLKRYDHPWDVYVVFSVQEETGCLGALTGAYEINPDAAIVMDVTFASEPPFSDHIELGKGPVIGLGPVVDRNLVQKIIEIAKKHNVSLQEEAVGGRTDFVQLVRNGVRTSLISIPLKYMHTPVEMVDPRDVEELARLLSLVAVELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
molecule keywords endoglucanase
total genus 94
structure length 319
sequence length 331
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 1vhoA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1vhoA01
3IEHA 5LRGA 3KR4A 3D7DA 1OBRA 3B3TA 4MHYA 2NYQA 3SJGA 5K8MA 3WC6A 4AXVA 4TNUA 1XBUA 1VIXA 1BPMA 1TF8A 2PJ2A 3SJEA 1BPNA 2PJ7A 1YSJA 2C6PA 4P4FA 2CF4A 5IB9A 3B35A 2Q51A 2RB7A 1YW4A 4DJLA 2ZEEA 2IQ6A 4NJQA 3GUXA 4ZY1A 5HXDA 1LCPA 3B3VA 2XEGA 3FEDA 1HDQA 1JQGA 4A94A 1AYEA 1Z2LA 5K8PA 4ZYQA 4K3NA 4A38A 2WYRA 2V8HA 3CDXA 2AFZA 3VH9A 5JM6A 1CP6A 2PJ1A 3FF3A 4EWTA 2O4HA 4MXUA 1ZLIA 3LWUA 2PVWA 2EK9A 4OC3A 2RFHA 4PQAA 2C1CA 4PXCA 2BCOA 2XEFA 2XEJA 3D7GA 2POKA 4DYOA 1Z5RA 2AFMA 4H2KA 2JBJA 4MCSA 1YMEA 4P4IA 3RAMA 3PB7X 1TKFA 1Y0YA 3KHZA 4NGMA 4PXDA 2PJ9A 3KQXA 3S9NA 4MCRA 4UEZA 3B2YA 3SI2A 2AFUA 2PJCA 3RBUA 4EFDA 4NGQA 5D29A 1GYTA 3KHXA 4OC2A 4IAVA 5ELYA 3IO1A 2PE3A 2ZEPA 3PBBA 1CX8A 4R6TA 2PJ4A 1ELLP 4NGNA 3JRUA 2ZOGA 4ZY0A 1QMUA 4FAIA 2ZEOA 1YLOA 3IWWA 1VHOA 3IC1A 4YU9A 4IK2A 1VGYA 3FEEA 2Q43A 4ZY2A 4ONWA 4UIAA 2XEIA 4P4JA 3BHXA 4MMOA 3CT9A 3PB4X 7CPAA 1CPSA 2WZNA 2AFSA 4FBEA 3V7ZA 1IGBA 1YW6A 3IIBA 4FWUA 1BLLE 3T8WA 3IFEA 3GB0A 5THWA 2EWBA 1PYTB 2V8GA 1NSAA 2O53A 2AFOA 3D7HA 4NGRA 1CP7A 1TF9A 3NH8A 2PJBA 1LANA 2C6GA 3MRUA 3S9MA 3PB8X 1UWYA 2V77A 4OKOA 2GREA 5JH9A 4PXEA 1LAMA 3FH4A 1ELMP 2GLFA 3FECA 4MRIA 3TX8A 5D8NA 2JEWA 5HVFA 2JBKA 3KQZA 2V8DA 3FVLA 4ZX8A 4R8FA 1HEEA 2QVPA 2PIYA 2F8HA 4RUHA 3IJ3A 2V8VA 1AMPA 2EK8A 5LYIA 4NJRA 4IHMA 2F7VA 1CPXA 3SI1A 3D4UA 5HVHA 2ZOFA 4EMEA 4O23A 3PRTA 3BI1A 2ZENA 3ISZA 3D68A 4MCPA 1QQ9A 3KZWA 5LRJA 2ANPA 1R3NA 2PJ8A 1XRYA 4P44A 3LMSA 4OP4A 4JZ0A 3PFEA 4P6YA 6CPAA 2QJ8A 4UEEA 3H8FA 4P10A 2DEAA 4KSIA 4OIDA 4CPAA 2VL1A 3NH4A 4P4BA 4W9YA 3CPXA 4UEFA 3KGQA 4G1PA 1TXRA 2HB6A 1ZLHA 4MHNA 1M4LA 4F8ZA 4OC5A 3DLJA 3SI0A 2J9AA 2QYVA 3D66A 4YWYA 1PCAA 2PJAA 1F2PA 1ZG7A 4WWVA 3WT4A 5LYFA 1DTDA 1KWMA 4P4DA 4B6ZA 4BD9A 3DGVA 2PVVA 1DE4C 4P4EA 3WC5A 3L2NA 2IMOA 2HC9A 3I1UA 4FUUA 4NGTA 3SJFA 1TKHA 2PJ5A 3GLJA 3NA6A 3B7IA 1IY7A 8CPAA 4R76A 3RZAA 1H8LA 3ISXA 4OMEA 1LOKA 3HUVA 4NFRA 4DUKA 1Y0RA 1VHEA 3BI0A 5CPAA 2ZEFA 2AFXA 3H8EA 4MCQA 3TC8A 4GM5A 1F2OA 4OIWA 3PEIA 4R7MA 2AFWA 4P45A 1TKJA 4F9VA 5CBMA 2ZEMA 5I4MA 1EE3P 4MHPA 3FMCA 3H8GA 3K2KA 3KASA 3B3CA 3D67A 4ZX9A 1CG2A 2PRQA 4X8IA 4OC0A 3FJUA 3HLPA 2FVGA 1R43A 3KI9A 4JYWA 4NGPA 5LYDA 1HDUA 3SJXA 2PIZA 1FT7A 2BO9A 2CTCA 1ARMA 3KR5A 2ABZA 3B3WA 5K8OA 4NGSA 3K9TA 2GU2A 1LAPA 2ZEHA 4X3RA 3B3SA 2PJ3A 3MN8A 2PJ0A 3WC7A 4LQGA 2ZEDA 1Q7LA 2CTBA 3PB6X 2ZELA 4TWEA 5K8NA 4F9UA 3NH5A 4A37A 1CBXA 3PB9X 4WJBA 2I3CA 2C6CA 1XFOA 3NFZA 1Z8LA 3PBEA 5DS0A 2GLJA 2BOAA 2IJZA 4MHZA 4OC4A 5HVGA 1FNOA 2PCUA 4A39A 2PJ6A 2Q4ZA 4ZI6A 3VARA 4UIBA 2NSMA 2OR4A 2ZEGA 1ARLA 3WABA 2CIJA 4UF4A 2OOTA 1LFWA 2G9DA 3N5FA 5JGFA 3D7FA 3VATA 4Z65A 4PPZA 3S9LA 3BXMA 1XMBA 3QNVA 3FX6A 1ZG9A 3CPAA 5J1QA 5F09A 1Y7EA 3KL9A 1ZG8A 1XJOA 4OC1A 5LRKA 4PXBA 3V38A 4Q7AA 1F57A 4X2TA 1BAVA 1RTQA 3PFOA 5LYLA
chains in the Genus database with same CATH superfamily
3IEHA 5TRDA 2F4NA 2BL1A 3I3GA 1KK3A 3OPOA 4J0QA 2V7QA 3U2QA 4B43A 2VQYA 3ASTA 1OBRA 3B3TA 1W0KA 3BNWA 4MHYA 3CC4B 2WUUA 4P3YA 1NE9A 2Q44A 4P1VA 4U9YA 3U6BA 1R5BA 1BPMA 2VBTA 4Y49C 4PC2A 4MJ8A 4KVXA 1BPNA 3R6KA 2PJ7A 1OGIA 5AG6A 2C6PA 4Y7CA 4PK3A 1D2EA 5IB9A 1N08A 1IYLA 2DIEA 1KD1D 2JDDA 4CGOA 4ZY1A 4XLCA 4AVBA 3V7AA 2VEZA 4JD6A 1LCPA 3B3VA 2VZYA 3FEDA 2C2WA 3IWEA 1VLYA 1YITB 1BLIA 3QFTA 2GPJA 2VBUA 2ZPAA 2X6WA 1GR1A 2ZTNA 1H8HA 3V76A 1TUIA 4K3NA 2AFZA 2G3TA 3VH9A 5AG4A 5JM6A 1B2RA 4M1KA 4Y9UA 1GAQA 4HPSA 4C68A 2YNCC 2GJKA 3Q3AA 1N06A 1DG1G 4H6ZA 4KS9A 3F0AA 2RFHA 2EUIA 2EO8A 1NB0A 2FE7A 5GV7A 1Q2DA 3ZPNA 2AJ6A 2BCOA 2XEJA 1VQKB 3R6JA 3D7GA 4NSQA 2AFMA 4KUAA 1E62A 4DQKA 2PDOA 2VI7A 4MCSA 1YMEA 4P4IA 1TKFA 2HV2A 4B5OA 3AVWA 1R57A 4MY0A 2VYQA 1G7SA 4M2LA 3KQXA 1MK4A 3WXMA 2I00A 4X06A 5EMIA 4KOTA 2BM0A 1VQMB 4ZBGA 2VNKA 1KQSB 2ARHA 2KCWA 1AIPA 3RBUA 1WDTA 3W6XA 1QFJA 2DOGA 4X07A 1Q86D 3KHXA 3TO7A 3VO2A 5ELYA 3P2FA 5TV2A 5IYRA 2ZEPA 4RDJA 4TMTA 1CX8A 1KK2A 3JRUA 1QMUA 4JMQA 3OP1A 4R57A 4UZUA 2ZEOA 2YNCA 3CMEB 4R87A 1QGYA 2P3MA 4IK2A 3FEEA 1VGYA 1OZPA 4N3GA 3CCSB 5F4MA 2GJRA 2XEIA 3BHXA 4RDLA 4MMOA 3GIUA 1CPSA 1G7RA 3A3BA 2BSAA 1YIJB 2AFSA 1IGBA 4KKSA 1YW6A 4MFZA 1BLLE 1YX0A 1HVXA 3GB0A 2B4DA 3OW2B 2EWBA 1NSAA 3PA2A 4KZTA 4C7IA 2AHOA 2C4TA 1Y9KA 3SXOA 3F5BA 1CP7A 3SLDA 4UCMA 3CC7B 1BOBA 1RQPA 3ZBTA 3BJ7A 4HE6A 2Q6LA 4C7HA 2PLFA 4PXEA 1BMFA 2GLFA 4OOSA 2D9RA 4MRIA 5H84A 3TX8A 5D8NA 1ZM3A 1MJBA 3KQZA 1EFRA 3CZXA 2QECA 3LD2A 4K30A 4DNRB 1K9MD 3S6HA 2BEIA 2QVPA 1Q2YA 2PIYA 2CNTA 2V8VA 4A32A 2J7KA 5LYIA 4PGOA 1OB5A 2Q7SA 4B3FX 2CNDA 4BMHA 5TY0A 5J8CA 2DY1A 5HVHA 2ZOFA 4CYNA 4EVYA 2DETA 4UCPA 1VQLB 1QQ9A 2ANPA 1OB0A 3EC4A 1ZM2A 3OWCA 4II2A 3D2MA 1PJ5A 4CPAA 3NH4A 2G3AA 2ZZEA 1EP1B 2X6YA 1UFHA 2HB6A 4XN3A 2BGIA 4TMXA 4TT3A 1M4LA 4OC5A 4XLAA 2D3LA 5F4OA 4RPDA 2PJAA 1F2PA 2YWEA 1QUFA 3OZUA 3K9UA 4WWVA 2Z0ZA 1DTDA 1CNEA 2P0WA 4AVCA 4G1BA 4P4DA 4B6ZA 2PVVA 1OGJA 3H9NA 4PC1A 3U6KA 2Q6IA 3WC5A 3I1UA 4OP7A 3ZZIA 2RC5A 1IY7A 4R76A 2X3UA 5IK2A 3HUVA 2HDNB 4YAUA 4NFRA 2C4UA 2CNMA 4MCQA 1YVKA 1EFTA 1U6MA 1P0HA 4F9VA 1U2RA 4XOPA 2ZEMA 4UBRA 3WBKA 1EE3P 4U9ZA 4F0YA 3FMCA 2WPDA 3PUNA 5H59A 3KASA 2EIXA 4QC6A 3Q6QA 4L8JA 1K8AD 2VZLA 4A30A 4NCNA 1XIXA 3SJZA 1H8EA 3KI9A 4OC0A 4LBZA 3AVXA 3CB4A 3SJXA 2PIZA 3OKXA 1IU8A 1FT7A 4LBVA 5HZBA 1ARMA 4WZLA 1VQ4B 3KR5A 3B3WA 5K8OA 2VBSA 3W5UA 4CAVA 2X0KA 4E0FA 3ZZ0A 4X3RA 2C78A 3B3SA 3DDYA 1KZLA 2PJ0A 4LQGA 3MMPA 1V0EA 4XORA 3PB6X 5K8NA 3TT2A 2D3NA 2B3VA 1EP3B 3PENA 3FPKA 2C6CA 1Z8LA 1IOFA 1VQ9B 3D26A 5H86A 4RD6A 1XE4A 5DS0A 2O28A 2ZZQA 4MHZA 2B7CA 1VQ6B 1FNOA 5AG7A 1VJSA 1FNBA 1ON0A 3GSIA 2R1IA 1VLOA 4MFLA 4UF4A 1S60A 4DNCA 3N5FA 3TOBA 1PKVA 3VATA 2JLMA 1W87A 3ONYA 3CMMA 5A27A 1XMBA 3QNVA 3FX6A 2Q7BA 1ZG9A 3UY5A 1NBMA 1P4MA 2OZHA 3ONUA 2V7VA 4B4DA 2C27A 4OPVA 1QX4A 1KUYA 4OC1A 5CNPA 2ZL6A 4LX9A 3WY9A 2JDCA 1RTQA 3OEEA 3PFOA 1P4NA 4A38A 4YFJA 5LYLA 2YWGA 4Z4YA 2Q4VA 4OOXA 4UZFA 4CAEA 4GXHA 4L89A 1YVOA 4HKFA 4QBJA 4RD1A 3SJGA 5K8MA 3WC6A 4ORFA 2R9VA 4AXVA 4TNUA 3LQ6A 2A4NA 1I21A 1S7LA 1WK4A 3FYNA 3SJEA 1MABA 1CNFA 2VZZA 3A3GA 4AG7A 1YSJA 4Z4VA 3OJXA 1XE1A 2LZJA 5IYQA 1KMHA 4UFWA 1VF7A 2RB7A 3J81k 5KTCA 2WJVA 3CPWB 3ASQA 5DSZA 4OLLA 4Z4RA 5HXDA 1OHHA 3CW2A 4M6IA 2OK7A 3QE2A 1QFYA 2ZXVA 2QA4B 3W6SA 1JQGA 4OOVA 3S6GA 2R98A 1QSMA 1I12A 5H5JA 2DPSA 4HIZA 3CDXA 2YWFA 4G5GA 2BF4A 3B82A 2REFA 2EK9A 3CP8A 1Q7YD 4IF5A 3BJ8A 4C2XA 1Z4RA 4B48A 4QVTA 2XEFA 2QDXA 4KOWA 3B8GA 4DYOA 1Z5RA 4P3IA 2HLDA 2ZW6A 1IHMA 1Z8XA 4H2KA 2JBJA 3RAMA 1IYKA 4M6HA 4UAJA 4U5YA 4IW3B 4YAWA 1Y0YA 4G1VA 2PR1A 1WP6A 4AC9A 2Z3KA 3EY5A 3R95A 3S9NA 1E63A 3SI2A 1N0VC 2AFUA 2XEXA 4E8OA 4Z4WA 2FIWA 4EFDA 4P9SA 4Q36A 1YI2B 4XLEA 2CNSA 4CGMA 2GJPA 5IYNA 3KKWA 5JBQA 4F6AA 2HUZA 2PE3A 1ELLP 1M4GA 1FY7A 4RD2A 1TIQA 3VMFA 2B5GB 4BBHA 3WYAA 1Q81D 1YLOA 3IWWA 1VHOA 3N7ZA 3IC1A 1X10A 5EBVA 1ZUNB 2BM1A 2Q4YA 5HH1A 1E64A 1GJRA 4P4JA 7CPAA 1R5OA 3CRZA 1F60A 4X05A 1QVFB 4OAEA 1MRZA 3IIBA 3IFEA 4XD7A 3H4QA 4FD5A 1QSNA 5L46A 2AFOA 2XNJA 1TF9A 2C6GA 4G7XA 4TSFA 1UWYA 2V77A 1I18A 4OKOA 5JH9A 2DPTA 1I8DA 4R9MA 4P12A 2R8VA 4RCYA 5JQ4A 1Z9UA 1IB0A 2B4BA 2GK7A 3CCUB 4Y49B 4ZX8A 3E0KA 2XOKA 4R8FA 3A35A 1FNCA 2ATRA 2QEXB 4CAXA 4UFXA 2FT0A 4NJRA 2X7BA 4KORA 4M85A 5AG5A 1EXMA 4C2YA 3TO6A 4RCZA 2F7VA 5E6TA 2GE3A 4LQ6A 2JJ1A 1S5KA 2FS5A 3FBUA 3MHPA 3P2HA 5J3OA 4XKVA 1SKQA 3OFNA 3ISZA 1YR0A 4UWJA 4PAAA 2EFGA 2Y0MA 1R3NA 2OK8A 4RD3A 3D8PA 1LRZA 3NE8A 5G20A 3WR7A 4JZ0A 2OBTA 4G7WA 4Z4UA 3PFEA 1KUXA 4P6YA 6CPAA 2V7TA 1M1KD 2QJ8A 1Q82D 3ZBUA 2DEAA 4PC6A 4KVME 4W9YA 4PC3A 5AGEA 4C0SA 3JUWA 1ZLHA 2ZXHA 1NDHA 4CS0B 5A89A 3SI0A 3DNSA 2RC4A 1YQEA 1NRKA 1KZFA 2QIRA 1PJ7A 3GVJA 2OB0A 5F47A 5LYFA 3W91A 1M44A 3W2IA 3AGQA 4CRYB 2QMLA 4A31A 5KSWB 3CCMB 4ACBA 1YK3A 1WSVA 4KSAA 2VBQA 4AVAA 3SJFA 4NGTA 5FO1A 3B8HA 1B87A 3GLJA 4Z4SA 8CPAA 4KOSA 5G21A 2DYIA 4L8AA 3RZAA 3ISXA 1Y0RA 1N07A 1VHEA 5CPAA 1MJAA 4X7DA 2WPXA 2D74A 3H8EA 4GM5A 4XM3A 3G05A 2AFWA 3BCFA 4WZTA 5C88A 3GIRA 3I55B 2YGWA 3I56B 1K28D 5I4MA 4RPBA 2QTLA 2PC1A 3CXQA 1TLLA 4YRHA 2WSAA 1S3ZA 4Q38A 1JJ2B 4NNJA 1IIDA 3V8IA 4UWIA 4M6GA 3LNNA 4P25A 4ZCMA 1WSRA 3QFRA 3T90A 3FJOA 1VHSA 1FX0A 3BY2A 3G8WA 2VJJA 2CTCA 4CRZB 5IYPA 4XNHC 3DR6A 1Z8WA 2PIAA 4UFVA 4CYPA 3ES9A 5A8AA 4A2ZA 1JWQA 4YGOA 2Z3MA 2JN9A 1Q7LA 3QFSA 2BV3A 2CTBA 4TWEA 4R3KA 3FPPA 4B10A 2WJYA 2X8KA 2R6HA 2GANA 1CBXA 3PB9X 3BY1A 4RD0A 4LBWA 3IU2A 4PC7A 1GAWA 1YGHA 3PBEA 3QAYA 2DF5A 2RC6A 5GCNA 1M4IA 3OEHA 4M3SA 1QVGB 1OB2A 1BQEA 1T5EA 3T9YA 3VARA 3PA1A 2OR4A 2ZEGA 5HXBA 4RDKA 2R7HA 5KNLA 4Y9RA 3CCJB 1RO5A 4A95A 1LFWA 2ZZGA 2G9DA 1N05A 2YWHA 4Z65A 5DN6A 4PPZA 5ISVA 3C26A 3JQRA 5IYWA 4QHYA 4QUZA 1I7PA 2QE7A 4X7EA 1BO4A 4FD4A 3TCVA 4MFPA 5LRKA 3QAHA 4Q7AA 1BAVA 5B6IA 5LRGA 1CJWA 2EVNA 2FIAA 3KR4A 3D7DA 4ACAA 4YALA 2NMTA 1S7KA 1VQ7B 4X0CA 4B3GA 1YREA 3CC2B 4G6IA 1VIXA 3A9LA 1UD8A 4UA3A 1PJ6A 4QUSA 5IB0A 2PJ2A 3JQQA 4II3A 5A28A 4P4FA 2F5IA 2WPWA 3WNCA 2CBXA 3RNZA 1E1RA 1VQ8B 2VNIA 2IQ6A 4NJQA 3CXPA 4JLYA 3S6KA 3AVUA 1AUGA 3R9GA 3SXNA 1Y9WA 1SM4A 1WOOA 5FVJA 3ASSA 4Z4TA 4M53A 4I49A 1H85A 1S7NA 3CCEB 4YXWA 1K73D 2HMAA 3WNDA 4ZYQA 5IV0A 2WYRA 2V8HA 5G22A 3W2HA 2DEUA 2I79A 4X7FA 1DDIA 2BMWA 4DNTB 4PSWA 4EH1A 2P6FA 1TTTA 3SEJA 5BSXA 3QFCA 1J9ZA 4KKTA 2XZOA 4JXQA 4ONUA 4OC3A 3PZJA 4BINA 2F1MA 4AF7A 5EC4A 2G0BA 1BPLA 2HCJB 2EBJA 4PXCA 2BGJA 4DK1A 4ZGNB 3W5HA 3VNUA 1WOPA 2DXQA 1NMTA 2B5GA 4MCRA 3B2YA 4KOXA 2PJCA 2QN6A 3A8JA 4MFQA 4MYTA 4CGNA 4NGQA 2ZW5A 5D29A 3RY8A 1GYTA 2CRVA 4OC2A 2P6EA 4F0XA 2PJ4A 4NGNA 3IWGA 2ZOGA 4ZY0A 1HZEA 4FAIA 1FDRA 4TMWA 1B6BA 4YU9A 2Q43A 4F7DA 4ZV4A 1VQPB 4ZY2A 4ONWA 2J8MA 3CTAA 3BH4A 3SKBA 3CT9A 3SJPA 3E20A 1DDGA 2WZNA 4AF6A 4FD7A 3V7ZA 1WORA 4UZEA 4FWUA 3D2PA 5THWA 1PYTB 2V8GA 3FB3A 1EWYA 3G71B 3ZZUA 3D7HA 4NGRA 4X5KA 3MRUA 4HNWB 4II9A 3PB8X 1W34A 4P26A 4RJLA 2W6IA 3W2GA 2ZW4A 3FH4A 3GVLA 1QH0A 2M5SA 1ELMP 3FECA 1AMOA 1VQNB 5HVFA 2JBKA 2V8DA 5FL7A 1RQRA 3SLNA 3I1FA 3T53B 1W2BB 1BX1A 1HEEA 1A8PA 1YJWB 3PUMA 3FRMA 2F8HA 3OJWA 1MJ9A 2EK8A 4XOTA 1NB9A 4B3XA 2B58A 3TTHA 1Y7RA 1CPXA 3TOAA 3FIXA 3SI1A 1YJ9B 3SHPA 3DSBA 3GY9A 2F43A 3LACA 1M1DA 5BWAB 3BI1A 2ZENA 1WPCA 2E1BA 1S72B 4LUAA 4MCPA 4JXRA 2PJ8A 4AG9A 1FRQA 4RN7A 4YHBA 4ROXA 4OP4A 3JQPA 4B14A 1COWA 3WNBA 1M4DA 4Q7JB 1RXTA 2YNEA 4P10A 4KSIA 2VL1A 4KLWA 4P4BA 5BSYA 4KLVA 5E96A 3KGQA 4G1PA 4KUBA 5CDFA 1S7FA 1XEBA 1JA1A 4MHNA 2Z3NA 4FK8A 4FN5A 3DLJA 3KEWA 4DQLA 2J9AA 4E2AA 3ASRA 4YWYA 1PCAA 1KUVA 2Q04A 1WU8A 1ZG7A 1Q9SA 3GKRA 1KWMA 1E3XA 1XB2A 2VBVA 3CP2A 3FNCA 4HE5A 1E43A 3T51B 4HNXB 3ASPA 2F1LA 5HZAA 4P4EA 2IMOA 2HC9A 3BC9A 1KC8D 1TKHA 4ZCIA 2PJ5A 4MFJA 3AVTA 4NF1A 3BLNA 2PQ8A 4RI1A 3ZZTA 4QB9A 3TFYA 2B5OA 1H8LA 4DUKA 3CCRB 4LC0A 2ZEFA 2AFXA 1F2OA 3CD6B 4XR6A 2ZW7A 5CBMA 4WZKA 4KOYA 4OPSA 4WQMA 3H8GA 4CAWA 3ZJ0A 1JA0A 3B3CA 4R3LA 3D67A 2P6GA 4CGLA 1CG2A 5LMZA 2PRQA 3A1PA 2OZUA 4AB7A 3PGPA 3HLPA 2FVGA 2J8RA 4NGPA 5LYDA 1SKYB 2ZBUA 1HDUA 2VNJA 3FKSA 3VWDA 4MBUA 2DCUA 1QG0A 1ZO0A 4M0LA 1XMTA 4GS4A 2B3UA 1T6XA 3S6FA 4B44A 2GU2A 2ZEHA 3MN8A 2B7BA 3WC7A 2ZEDA 3OZWA 2CY2A 2ZELA 4F9UA 3B78A 2ZBVA 4UCNA 1E1QA 1UD4A 4H9GA 3OZVA 1G7CA 2I3CA 4XQFA 2ZL7A 1XOVA 1Q2CA 3JVNA 4N3NA 2IJZA 5HVGA 2GFQA 5GV8A 4ZGYB 2CW5A 2PJ6A 2J8NA 5C82A 2IL4A 3PP9A 4ZI6A 4UIBA 1ARLA 3WABA 2CIJA 1GVHA 4MI4A 2OOTA 1T6ZA 4TN1A 5J8FA 3TE4A 3JU4A 1HA3A 2ZXIA 1WWZA 3NE5B 2OU2A 2KVOA 2W6JA 3S9LA 4ZCLA 2QGGA 3BXMA 2Q6KA 2Z6BD 2Z3LA 3CPAA 3CXSA 2OBRA 1XQBA 3KL9A 2ODFA 3H94A 4PXBA 2V4DA 1ZM9A 1QSTA 2Z3OA 4B5PA 4QVJA 1FNMA 1GO2A 4FWTA 3A8IA 1JB9A 4FD6A 2NYQA 1J4JA 1XBUA 1NSLA 3GVKA 2GIVA 4H89A 4Z4ZA 2JDIA 3EO4A 1TF8A 2Z11A 1D1NA 4Z1MA 5G1ZA 4LBYA 2X85A 1YLEA 4PK2A 5HKKA 3W2FA 4NCZA 3GYAA 3Q39A 1YJNB 3OW7A 2CF4A 3B35A 2Q51A 3Q6RA 4M4SA 2HQYA 1T6YA 1S0UA 1YW4A 3QSYA 4DJLA 4AVZA 2E1RA 3OE7A 2ZEEA 1KK0A 3GUXA 4XONA 3CCQB 1G7TA 1UD5A 4P6VF 2XEGA 1CM0A 1X12A 4PABA 3W2EA 1W9XA 1HDQA 1BX0A 4A94A 1AYEA 1NJID 1QSRA 1Z2LA 5K8PA 3HAGA 3JTKA 1IOIA 4P22A 1CP6A 2PJ1A 3F8KA 3FF3A 4EWTA 2ZITA 4XNFA 1B23P 2OZGA 5F4JA 2O4HA 4MXUA 3BQJA 1ZLIA 1V0FA 2ZL5A 1YX2A 1H42A 4MYUA 2K5TA 2VXKA 5FNZA 3LWUA 1QFZA 2PVWA 2D4OA 1E79A 4PQAA 2C1CA 5F49A 1A2ZA 4YELA 1KK1A 4C43A 2POKA 4QVAA 4JWPA 4KOUA 4P2NA 3PB7X 4H6UA 1S4MA 3KHZA 4NGMA 4PXDA 4B13A 2PJ9A 2BSWA 4OADA 2CC2A 4CAFA 5KTAA 3BCDA 3CCVB 1L0CA 2V7UA 4UEZA 2XNCA 3WBJA 3EXNA 1DARA 4XLFA 3CMAB 4IAVA 3IO1A 3PBBA 3TO9A 2V31A 4R6TA 4TKOB 2XGJA 1WOSA 3RO0A 5KW9A 1EFCA 2QTZA 2BVNA 1N8RD 1IJEA 1BJKA 2XZLA 1Z8TA 4UIAA 2X6XA 4BPRA 4PV6A 5HMNA 3VWEA 3PB4X 4KVOE 4A33A 3RYOA 4FBEA 4TMVA 1QGAA 2OTJB 1PUAA 3T8WA 1QSOA 4CQJA 2OYNA 2X53S 1VQOB 2O53A 2BN4A 2XNDA 1EP2B 4YAFA 3MGDA 4XPKA 3DDDA 4NEXA 3NH8A 2PJBA 2FL4A 4YAOA 1LANA 3S9MA 1YHQB 2GQFA 1VQ5B 4JJXA 2Q6OA 2GREA 1QUEA 4MHDA 1LAMA 2YNDA 5FA6A 5THXA 4YEJA 2XZPA 2D4PA 3LODA 2OBSA 2NV4A 1IICA 2JEWA 1XF8A 2DERA 4RS2A 3FVLA 4XMYA 1UD2A 3LQEA 2C5BA 5KTDA 4FXUA 3ZC3A 4RUHA 3IJ3A 1AMPA 1WTHD 3R1KA 2ZZFA 3OAAA 4XPLA 1V0CA 4IHMA 3P26A 1UD6A 5FO0A 2VJIA 2JEVA 4MFKA 3G3SA 5IX3A 1KTVA 3PVDA 3D4UA 4XN0A 1M90D 3P27A 4EMEA 4O23A 3PRTA 4HNYB 4B12A 3D3SA 4R71A 3D68A 4XNHB 1V5VA 3KZWA 3ZUGA 5LRJA 3FXTA 2AE6A 5JPHA 3A8KA 1XRYA 4P44A 3LMSA 1ELOA 1IJFA 3QB8A 2CXAA 4B47A 1E3ZA 4UEEA 3H8FA 4OIDA 1W35A 3CPXA 2FSRA 3VO1A 4UEFA 4ZGQB 1TXRA 1QGZA 2PSWA 5TR9A 4F8ZA 3LVBA 5J35A 2QMUA 3T56B 2QYVA 3D66A 3R96A 3DR8A 3CXCB 2PR8A 2Z3PA 3CCLB 1D8TA 3WT4A 5AN9A 5A88A 4ASUA 4RD4A 4BD9A 3DGVA 1DE4C 5FIUA 4MY3A 2FXFA 3L2NA 4FUUA 3NA6A 4KSFA 3I9SA 3B7IA 4DK0A 4QFMA 3W5VA 1UMKA 1I1DA 4OMEA 3E1YE 1LOKA 2OH1A 2C5HA 3BI0A 2Z10A 3IGRA 2V7WA 3TC8A 4KOVA 4OIWA 3PEIA 4R7MA 4J3GA 4P45A 4U9UA 1IB1E 4B11A 1TKJA 4CYQA 3OOCA 3H5ZA 2I1LA 4MHPA 3LO8A 2JJ2A 1R5NA 5F46A 2BPOA 1GHEA 4C2ZA 3G4SB 3K2KA 4QV2A 4RLZA 3EFAA 4ZX9A 4XPDC 1VKCA 4X8IA 2H5MA 4K1XA 2REEA 1F20A 4TMZA 1N71A 3FJUA 3ZIAA 1R43A 4JYWA 2BO9A 5EMNA 2JIZA 2FX3A 2OTLB 3IU1A 4PSXA 3VR6A 4RM0A 1JNYA 2ABZA 4NGSA 3K9TA 2WR8A 1LAPA 3R9EA 4CGPA 2PJ3A 1FRNA 1SQHA 2B4DB 3VNVA 4GQNA 3NH5A 4E0AA 3AVVA 3G6EB 3AVYA 4A37A 4WZEA 1N0UA 2C77A 4XKWA 2VNHA 2NPFA 4WJBA 4NXYA 3R9FA 1XFOA 2BUEA 3NFZA 3Q38A 2CK3A 1K4JA 4XLHA 2GLJA 4CYOA 2BOAA 3GQBA 4OC4A 2PCUA 4A39A 5DWNA 2Q4ZA 2Q0YA 5F48A 2NSMA 1EFUA 2V7XA 4XPDB 5JGFA 2WSSA 3D7FA 3NE7A 5DWMA 2PRBA 3MCAA 4KKUA 4B5PB 4XL9A 1KRHA 4X7CA 4OPOA 5I0CA 2ZTGA 2GK6A 2WZPP 1Z4EA 1FNDA 5J1QA 3AGPA 1ZM4A 5F09A 1UD3A 4NBSA 1Y7EA 4IUSA 1TVCA 1ZG8A 2FCKA 1XJOA 2PMDA 3CESA 3V38A 3WQZA 1F57A 4X2TA 1KJZA 1CQXA 1W0JA 1PU9A
chains in the Genus database with same CATH topology
3IEHA 5LRGA 3KR4A 3D7DA 1OBRA 3B3TA 4MHYA 2NYQA 3SJGA 5K8MA 3WC6A 4AXVA 4TNUA 1XBUA 1VIXA 1BPMA 1TF8A 2PJ2A 3SJEA 1BPNA 2PJ7A 1YSJA 2C6PA 4P4FA 2CF4A 5IB9A 3B35A 2Q51A 2RB7A 1YW4A 4DJLA 2ZEEA 2IQ6A 4NJQA 3GUXA 4ZY1A 5HXDA 1LCPA 3B3VA 2XEGA 3FEDA 1HDQA 1JQGA 4A94A 1AYEA 1Z2LA 5K8PA 4ZYQA 4K3NA 4A38A 2WYRA 2V8HA 3CDXA 2AFZA 3VH9A 5JM6A 1CP6A 2PJ1A 3FF3A 4EWTA 2O4HA 4MXUA 1ZLIA 3LWUA 2PVWA 2EK9A 4OC3A 2RFHA 4PQAA 2C1CA 4PXCA 2BCOA 2XEFA 2XEJA 3D7GA 2POKA 4DYOA 1Z5RA 2AFMA 4H2KA 2JBJA 4MCSA 1YMEA 4P4IA 3RAMA 3PB7X 1TKFA 1Y0YA 3KHZA 4NGMA 4PXDA 2PJ9A 3KQXA 3S9NA 4MCRA 4UEZA 3B2YA 3SI2A 2AFUA 2PJCA 3RBUA 4EFDA 4NGQA 5D29A 1GYTA 3KHXA 4OC2A 4IAVA 5ELYA 3IO1A 2PE3A 2ZEPA 3PBBA 1CX8A 4R6TA 2PJ4A 1ELLP 4NGNA 3JRUA 2ZOGA 4ZY0A 1QMUA 4FAIA 2ZEOA 1YLOA 3IWWA 1VHOA 3IC1A 4YU9A 4IK2A 1VGYA 3FEEA 2Q43A 4ZY2A 4ONWA 4UIAA 2XEIA 4P4JA 3BHXA 4MMOA 3CT9A 3PB4X 7CPAA 1CPSA 2WZNA 2AFSA 4FBEA 3V7ZA 1IGBA 1YW6A 3IIBA 4FWUA 1BLLE 3T8WA 3IFEA 3GB0A 5THWA 2EWBA 1PYTB 2V8GA 1NSAA 2O53A 2AFOA 3D7HA 4NGRA 1CP7A 1TF9A 3NH8A 2PJBA 1LANA 2C6GA 3MRUA 3S9MA 3PB8X 1UWYA 2V77A 4OKOA 2GREA 5JH9A 4PXEA 1LAMA 3FH4A 1ELMP 2GLFA 3FECA 4MRIA 3TX8A 5D8NA 2JEWA 5HVFA 2JBKA 3KQZA 2V8DA 3FVLA 4ZX8A 4R8FA 1HEEA 2QVPA 2PIYA 2F8HA 4RUHA 3IJ3A 2V8VA 1AMPA 2EK8A 5LYIA 4NJRA 4IHMA 2F7VA 1CPXA 3SI1A 3D4UA 5HVHA 2ZOFA 4EMEA 4O23A 3PRTA 3BI1A 2ZENA 3ISZA 3D68A 4MCPA 1QQ9A 3KZWA 5LRJA 2ANPA 1R3NA 2PJ8A 1XRYA 4P44A 3LMSA 4OP4A 4JZ0A 3PFEA 4P6YA 6CPAA 2QJ8A 4UEEA 3H8FA 4P10A 2DEAA 4KSIA 4OIDA 4CPAA 2VL1A 3NH4A 4P4BA 4W9YA 3CPXA 4UEFA 3KGQA 4G1PA 1TXRA 2HB6A 1ZLHA 4MHNA 1M4LA 4F8ZA 4OC5A 3DLJA 3SI0A 2J9AA 2QYVA 3D66A 4YWYA 1PCAA 2PJAA 1F2PA 1ZG7A 4WWVA 3WT4A 5LYFA 1DTDA 1KWMA 4P4DA 4B6ZA 4BD9A 3DGVA 2PVVA 1DE4C 4P4EA 3WC5A 3L2NA 2IMOA 2HC9A 3I1UA 4FUUA 4NGTA 3SJFA 1TKHA 2PJ5A 3GLJA 3NA6A 3B7IA 1IY7A 8CPAA 4R76A 3RZAA 1H8LA 3ISXA 4OMEA 1LOKA 3HUVA 4NFRA 4DUKA 1Y0RA 1VHEA 3BI0A 5CPAA 2ZEFA 2AFXA 3H8EA 4MCQA 3TC8A 4GM5A 1F2OA 4OIWA 3PEIA 4R7MA 2AFWA 4P45A 1TKJA 4F9VA 5CBMA 2ZEMA 5I4MA 1EE3P 4MHPA 3FMCA 3H8GA 3K2KA 3KASA 3B3CA 3D67A 4ZX9A 1CG2A 2PRQA 4X8IA 4OC0A 3FJUA 3HLPA 2FVGA 1R43A 3KI9A 4JYWA 4NGPA 5LYDA 1HDUA 3SJXA 2PIZA 1FT7A 2BO9A 2CTCA 1ARMA 3KR5A 2ABZA 3B3WA 5K8OA 4NGSA 3K9TA 2GU2A 1LAPA 2ZEHA 4X3RA 3B3SA 2PJ3A 3MN8A 2PJ0A 3WC7A 4LQGA 2ZEDA 1Q7LA 2CTBA 3PB6X 2ZELA 4TWEA 5K8NA 4F9UA 3NH5A 4A37A 1CBXA 3PB9X 4WJBA 2I3CA 2C6CA 1XFOA 3NFZA 1Z8LA 3PBEA 5DS0A 2GLJA 2BOAA 2IJZA 4MHZA 4OC4A 5HVGA 1FNOA 2PCUA 4A39A 2PJ6A 2Q4ZA 4ZI6A 3VARA 4UIBA 2NSMA 2OR4A 2ZEGA 1ARLA 3WABA 2CIJA 4UF4A 2OOTA 1LFWA 2G9DA 3N5FA 5JGFA 3D7FA 3VATA 4Z65A 4PPZA 3S9LA 3BXMA 1XMBA 3QNVA 3FX6A 1ZG9A 3CPAA 5J1QA 5F09A 1Y7EA 3KL9A 1ZG8A 1XJOA 4OC1A 5LRKA 4PXBA 3V38A 4Q7AA 1F57A 4X2TA 1BAVA 1RTQA 3PFOA 5LYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEH A;  5LRG A;  3KR4 A;  3D7D A;  1OBR A;  3B3T A;  4MHY A;  2NYQ A;  3SJG A;  5K8M A;  3WC6 A;  4AXV A;  4TNU A;  1XBU A;  1VIX A;  1BPM A;  1TF8 A;  2PJ2 A;  3SJE A;  1BPN A;  2PJ7 A;  1YSJ A;  2C6P A;  4P4F A;  2CF4 A;  5IB9 A;  3B35 A;  2Q51 A;  2RB7 A;  1YW4 A;  4DJL A;  2ZEE A;  2IQ6 A;  4NJQ A;  3GUX A;  4ZY1 A;  5HXD A;  1LCP A;  3B3V A;  2XEG A;  3FED A;  1HDQ A;  1JQG A;  4A94 A;  1AYE A;  1Z2L A;  5K8P A;  4ZYQ A;  4K3N A;  4A38 A;  2WYR A;  2V8H A;  3CDX A;  2AFZ A;  3VH9 A;  5JM6 A;  1CP6 A;  2PJ1 A;  3FF3 A;  4EWT A;  2O4H A;  4MXU A;  1ZLI A;  3LWU A;  2PVW A;  2EK9 A;  4OC3 A;  2RFH A;  4PQA A;  2C1C A;  4PXC A;  2BCO A;  2XEF A;  2XEJ A;  3D7G A;  2POK A;  4DYO A;  1Z5R A;  2AFM A;  4H2K A;  2JBJ A;  4MCS A;  1YME A;  4P4I A;  3RAM A;  3PB7 X;  1TKF A;  1Y0Y A;  3KHZ A;  4NGM A;  4PXD A;  2PJ9 A;  3KQX A;  3S9N A;  4MCR A;  4UEZ A;  3B2Y A;  3SI2 A;  2AFU A;  2PJC A;  3RBU A;  4EFD A;  4NGQ A;  5D29 A;  1GYT A;  3KHX A;  4OC2 A;  4IAV A;  5ELY A;  3IO1 A;  2PE3 A;  2ZEP A;  3PBB A;  1CX8 A;  4R6T A;  2PJ4 A;  1ELL P;  4NGN A;  3JRU A;  2ZOG A;  4ZY0 A;  1QMU A;  4FAI A;  2ZEO A;  1YLO A;  3IWW A;  1VHO A;  3IC1 A;  4YU9 A;  4IK2 A;  1VGY A;  3FEE A;  2Q43 A;  4ZY2 A;  4ONW A;  4UIA A;  2XEI A;  4P4J A;  3BHX A;  4MMO A;  3CT9 A;  3PB4 X;  7CPA A;  1CPS A;  2WZN A;  2AFS A;  4FBE A;  3V7Z A;  1IGB A;  1YW6 A;  3IIB A;  4FWU A;  1BLL E;  3T8W A;  3IFE A;  3GB0 A;  5THW A;  2EWB A;  1PYT B;  2V8G A;  1NSA A;  2O53 A;  2AFO A;  3D7H A;  4NGR A;  1CP7 A;  1TF9 A;  3NH8 A;  2PJB A;  1LAN A;  2C6G A;  3MRU A;  3S9M A;  3PB8 X;  1UWY A;  2V77 A;  4OKO A;  2GRE A;  5JH9 A;  4PXE A;  1LAM A;  3FH4 A;  1ELM P;  2GLF A;  3FEC A;  4MRI A;  3TX8 A;  5D8N A;  2JEW A;  5HVF A;  2JBK A;  3KQZ A;  2V8D A;  3FVL A;  4ZX8 A;  4R8F A;  1HEE A;  2QVP A;  2PIY A;  2F8H A;  4RUH A;  3IJ3 A;  2V8V A;  1AMP A;  2EK8 A;  5LYI A;  4NJR A;  4IHM A;  2F7V A;  1CPX A;  3SI1 A;  3D4U A;  5HVH A;  2ZOF A;  4EME A;  4O23 A;  3PRT A;  3BI1 A;  2ZEN A;  3ISZ A;  3D68 A;  4MCP A;  1QQ9 A;  3KZW A;  5LRJ A;  2ANP A;  1R3N A;  2PJ8 A;  1XRY A;  4P44 A;  3LMS A;  4OP4 A;  4JZ0 A;  3PFE A;  4P6Y A;  6CPA A;  2QJ8 A;  4UEE A;  3H8F A;  4P10 A;  2DEA A;  4KSI A;  4OID A;  4CPA A;  2VL1 A;  3NH4 A;  4P4B A;  4W9Y A;  3CPX A;  4UEF A;  3KGQ A;  4G1P A;  1TXR A;  2HB6 A;  1ZLH A;  4MHN A;  1M4L A;  4F8Z A;  4OC5 A;  3DLJ A;  3SI0 A;  2J9A A;  2QYV A;  3D66 A;  4YWY A;  1PCA A;  2PJA A;  1F2P A;  1ZG7 A;  4WWV A;  3WT4 A;  5LYF A;  1DTD A;  1KWM A;  4P4D A;  4B6Z A;  4BD9 A;  3DGV A;  2PVV A;  1DE4 C;  4P4E A;  3WC5 A;  3L2N A;  2IMO A;  2HC9 A;  3I1U A;  4FUU A;  4NGT A;  3SJF A;  1TKH A;  2PJ5 A;  3GLJ A;  3NA6 A;  3B7I A;  1IY7 A;  8CPA A;  4R76 A;  3RZA A;  1H8L A;  3ISX A;  4OME A;  1LOK A;  3HUV A;  4NFR A;  4DUK A;  1Y0R A;  1VHE A;  3BI0 A;  5CPA A;  2ZEF A;  2AFX A;  3H8E A;  4MCQ A;  3TC8 A;  4GM5 A;  1F2O A;  4OIW A;  3PEI A;  4R7M A;  2AFW A;  4P45 A;  1TKJ A;  4F9V A;  5CBM A;  2ZEM A;  5I4M A;  1EE3 P;  4MHP A;  3FMC A;  3H8G A;  3K2K A;  3KAS A;  3B3C A;  3D67 A;  4ZX9 A;  1CG2 A;  2PRQ A;  4X8I A;  4OC0 A;  3FJU A;  3HLP A;  2FVG A;  1R43 A;  3KI9 A;  4JYW A;  4NGP A;  5LYD A;  1HDU A;  3SJX A;  2PIZ A;  1FT7 A;  2BO9 A;  2CTC A;  1ARM A;  3KR5 A;  2ABZ A;  3B3W A;  5K8O A;  4NGS A;  3K9T A;  2GU2 A;  1LAP A;  2ZEH A;  4X3R A;  3B3S A;  2PJ3 A;  3MN8 A;  2PJ0 A;  3WC7 A;  4LQG A;  2ZED A;  1Q7L A;  2CTB A;  3PB6 X;  2ZEL A;  4TWE A;  5K8N A;  4F9U A;  3NH5 A;  4A37 A;  1CBX A;  3PB9 X;  4WJB A;  2I3C A;  2C6C A;  1XFO A;  3NFZ A;  1Z8L A;  3PBE A;  5DS0 A;  2GLJ A;  2BOA A;  2IJZ A;  4MHZ A;  4OC4 A;  5HVG A;  1FNO A;  2PCU A;  4A39 A;  2PJ6 A;  2Q4Z A;  4ZI6 A;  3VAR A;  4UIB A;  2NSM A;  2OR4 A;  2ZEG A;  1ARL A;  3WAB A;  2CIJ A;  4UF4 A;  2OOT A;  1LFW A;  2G9D A;  3N5F A;  5JGF A;  3D7F A;  3VAT A;  4Z65 A;  4PPZ A;  3S9L A;  3BXM A;  1XMB A;  3QNV A;  3FX6 A;  1ZG9 A;  3CPA A;  5J1Q A;  5F09 A;  1Y7E A;  3KL9 A;  1ZG8 A;  1XJO A;  4OC1 A;  5LRK A;  4PXB A;  3V38 A;  4Q7A A;  1F57 A;  4X2T A;  1BAV A;  1RTQ A;  3PFO A;  5LYL A; 
#chains in the Genus database with same CATH topology
 3IEH A;  5TRD A;  2F4N A;  2BL1 A;  3I3G A;  1KK3 A;  3OPO A;  4J0Q A;  2V7Q A;  3U2Q A;  4B43 A;  2VQY A;  3AST A;  1OBR A;  3B3T A;  1W0K A;  3BNW A;  4MHY A;  3CC4 B;  2WUU A;  4P3Y A;  1NE9 A;  2Q44 A;  4P1V A;  4U9Y A;  3U6B A;  1R5B A;  1BPM A;  2VBT A;  4Y49 C;  4PC2 A;  4MJ8 A;  4KVX A;  1BPN A;  3R6K A;  2PJ7 A;  1OGI A;  5AG6 A;  2C6P A;  4Y7C A;  4PK3 A;  1D2E A;  5IB9 A;  1N08 A;  1IYL A;  2DIE A;  1KD1 D;  2JDD A;  4CGO A;  4ZY1 A;  4XLC A;  4AVB A;  3V7A A;  2VEZ A;  4JD6 A;  1LCP A;  3B3V A;  2VZY A;  3FED A;  2C2W A;  3IWE A;  1VLY A;  1YIT B;  1BLI A;  3QFT A;  2GPJ A;  2VBU A;  2ZPA A;  2X6W A;  1GR1 A;  2ZTN A;  1H8H A;  3V76 A;  1TUI A;  4K3N A;  2AFZ A;  2G3T A;  3VH9 A;  5AG4 A;  5JM6 A;  1B2R A;  4M1K A;  4Y9U A;  1GAQ A;  4HPS A;  4C68 A;  2YNC C;  2GJK A;  3Q3A A;  1N06 A;  1DG1 G;  4H6Z A;  4KS9 A;  3F0A A;  2RFH A;  2EUI A;  2EO8 A;  1NB0 A;  2FE7 A;  5GV7 A;  1Q2D A;  3ZPN A;  2AJ6 A;  2BCO A;  2XEJ A;  1VQK B;  3R6J A;  3D7G A;  4NSQ A;  2AFM A;  4KUA A;  1E62 A;  4DQK A;  2PDO A;  2VI7 A;  4MCS A;  1YME A;  4P4I A;  1TKF A;  2HV2 A;  4B5O A;  3AVW A;  1R57 A;  4MY0 A;  2VYQ A;  1G7S A;  4M2L A;  3KQX A;  1MK4 A;  3WXM A;  2I00 A;  4X06 A;  5EMI A;  4KOT A;  2BM0 A;  1VQM B;  4ZBG A;  2VNK A;  1KQS B;  2ARH A;  2KCW A;  1AIP A;  3RBU A;  1WDT A;  3W6X A;  1QFJ A;  2DOG A;  4X07 A;  1Q86 D;  3KHX A;  3TO7 A;  3VO2 A;  5ELY A;  3P2F A;  5TV2 A;  5IYR A;  2ZEP A;  4RDJ A;  4TMT A;  1CX8 A;  1KK2 A;  3JRU A;  1QMU A;  4JMQ A;  3OP1 A;  4R57 A;  4UZU A;  2ZEO A;  2YNC A;  3CME B;  4R87 A;  1QGY A;  2P3M A;  4IK2 A;  3FEE A;  1VGY A;  1OZP A;  4N3G A;  3CCS B;  5F4M A;  2GJR A;  2XEI A;  3BHX A;  4RDL A;  4MMO A;  3GIU A;  1CPS A;  1G7R A;  3A3B A;  2BSA A;  1YIJ B;  2AFS A;  1IGB A;  4KKS A;  1YW6 A;  4MFZ A;  1BLL E;  1YX0 A;  1HVX A;  3GB0 A;  2B4D A;  3OW2 B;  2EWB A;  1NSA A;  3PA2 A;  4KZT A;  4C7I A;  2AHO A;  2C4T A;  1Y9K A;  3SXO A;  3F5B A;  1CP7 A;  3SLD A;  4UCM A;  3CC7 B;  1BOB A;  1RQP A;  3ZBT A;  3BJ7 A;  4HE6 A;  2Q6L A;  4C7H A;  2PLF A;  4PXE A;  1BMF A;  2GLF A;  4OOS A;  2D9R A;  4MRI A;  5H84 A;  3TX8 A;  5D8N A;  1ZM3 A;  1MJB A;  3KQZ A;  1EFR A;  3CZX A;  2QEC A;  3LD2 A;  4K30 A;  4DNR B;  1K9M D;  3S6H A;  2BEI A;  2QVP A;  1Q2Y A;  2PIY A;  2CNT A;  2V8V A;  4A32 A;  2J7K A;  5LYI A;  4PGO A;  1OB5 A;  2Q7S A;  4B3F X;  2CND A;  4BMH A;  5TY0 A;  5J8C A;  2DY1 A;  5HVH A;  2ZOF A;  4CYN A;  4EVY A;  2DET A;  4UCP A;  1VQL B;  1QQ9 A;  2ANP A;  1OB0 A;  3EC4 A;  1ZM2 A;  3OWC A;  4II2 A;  3D2M A;  1PJ5 A;  4CPA A;  3NH4 A;  2G3A A;  2ZZE A;  1EP1 B;  2X6Y A;  1UFH A;  2HB6 A;  4XN3 A;  2BGI A;  4TMX A;  4TT3 A;  1M4L A;  4OC5 A;  4XLA A;  2D3L A;  5F4O A;  4RPD A;  2PJA A;  1F2P A;  2YWE A;  1QUF A;  3OZU A;  3K9U A;  4WWV A;  2Z0Z A;  1DTD A;  1CNE A;  2P0W A;  4AVC A;  4G1B A;  4P4D A;  4B6Z A;  2PVV A;  1OGJ A;  3H9N A;  4PC1 A;  3U6K A;  2Q6I A;  3WC5 A;  3I1U A;  4OP7 A;  3ZZI A;  2RC5 A;  1IY7 A;  4R76 A;  2X3U A;  5IK2 A;  3HUV A;  2HDN B;  4YAU A;  4NFR A;  2C4U A;  2CNM A;  4MCQ A;  1YVK A;  1EFT A;  1U6M A;  1P0H A;  4F9V A;  1U2R A;  4XOP A;  2ZEM A;  4UBR A;  3WBK A;  1EE3 P;  4U9Z A;  4F0Y A;  3FMC A;  2WPD A;  3PUN A;  5H59 A;  3KAS A;  2EIX A;  4QC6 A;  3Q6Q A;  4L8J A;  1K8A D;  2VZL A;  4A30 A;  4NCN A;  1XIX A;  3SJZ A;  1H8E A;  3KI9 A;  4OC0 A;  4LBZ A;  3AVX A;  3CB4 A;  3SJX A;  2PIZ A;  3OKX A;  1IU8 A;  1FT7 A;  4LBV A;  5HZB A;  1ARM A;  4WZL A;  1VQ4 B;  3KR5 A;  3B3W A;  5K8O A;  2VBS A;  3W5U A;  4CAV A;  2X0K A;  4E0F A;  3ZZ0 A;  4X3R A;  2C78 A;  3B3S A;  3DDY A;  1KZL A;  2PJ0 A;  4LQG A;  3MMP A;  1V0E A;  4XOR A;  3PB6 X;  5K8N A;  3TT2 A;  2D3N A;  2B3V A;  1EP3 B;  3PEN A;  3FPK A;  2C6C A;  1Z8L A;  1IOF A;  1VQ9 B;  3D26 A;  5H86 A;  4RD6 A;  1XE4 A;  5DS0 A;  2O28 A;  2ZZQ A;  4MHZ A;  2B7C A;  1VQ6 B;  1FNO A;  5AG7 A;  1VJS A;  1FNB A;  1ON0 A;  3GSI A;  2R1I A;  1VLO A;  4MFL A;  4UF4 A;  1S60 A;  4DNC A;  3N5F A;  3TOB A;  1PKV A;  3VAT A;  2JLM A;  1W87 A;  3ONY A;  3CMM A;  5A27 A;  1XMB A;  3QNV A;  3FX6 A;  2Q7B A;  1ZG9 A;  3UY5 A;  1NBM A;  1P4M A;  2OZH A;  3ONU A;  2V7V A;  4B4D A;  2C27 A;  4OPV A;  1QX4 A;  1KUY A;  4OC1 A;  5CNP A;  2ZL6 A;  4LX9 A;  3WY9 A;  2JDC A;  1RTQ A;  3OEE A;  3PFO A;  1P4N A;  4A38 A;  4YFJ A;  5LYL A;  2YWG A;  4Z4Y A;  2Q4V A;  4OOX A;  4UZF A;  4CAE A;  4GXH A;  4L89 A;  1YVO A;  4HKF A;  4QBJ A;  4RD1 A;  3SJG A;  5K8M A;  3WC6 A;  4ORF A;  2R9V A;  4AXV A;  4TNU A;  3LQ6 A;  2A4N A;  1I21 A;  1S7L A;  1WK4 A;  3FYN A;  3SJE A;  1MAB A;  1CNF A;  2VZZ A;  3A3G A;  4AG7 A;  1YSJ A;  4Z4V A;  3OJX A;  1XE1 A;  2LZJ A;  5IYQ A;  1KMH A;  4UFW A;  1VF7 A;  2RB7 A;  3J81 k;  5KTC A;  2WJV A;  3CPW B;  3ASQ A;  5DSZ A;  4OLL A;  4Z4R A;  5HXD A;  1OHH A;  3CW2 A;  4M6I A;  2OK7 A;  3QE2 A;  1QFY A;  2ZXV A;  2QA4 B;  3W6S A;  1JQG A;  4OOV A;  3S6G A;  2R98 A;  1QSM A;  1I12 A;  5H5J A;  2DPS A;  4HIZ A;  3CDX A;  2YWF A;  4G5G A;  2BF4 A;  3B82 A;  2REF A;  2EK9 A;  3CP8 A;  1Q7Y D;  4IF5 A;  3BJ8 A;  4C2X A;  1Z4R A;  4B48 A;  4QVT A;  2XEF A;  2QDX A;  4KOW A;  3B8G A;  4DYO A;  1Z5R A;  4P3I A;  2HLD A;  2ZW6 A;  1IHM A;  1Z8X A;  4H2K A;  2JBJ A;  3RAM A;  1IYK A;  4M6H A;  4UAJ A;  4U5Y A;  4IW3 B;  4YAW A;  1Y0Y A;  4G1V A;  2PR1 A;  1WP6 A;  4AC9 A;  2Z3K A;  3EY5 A;  3R95 A;  3S9N A;  1E63 A;  3SI2 A;  1N0V C;  2AFU A;  2XEX A;  4E8O A;  4Z4W A;  2FIW A;  4EFD A;  4P9S A;  4Q36 A;  1YI2 B;  4XLE A;  2CNS A;  4CGM A;  2GJP A;  5IYN A;  3KKW A;  5JBQ A;  4F6A A;  2HUZ A;  2PE3 A;  1ELL P;  1M4G A;  1FY7 A;  4RD2 A;  1TIQ A;  3VMF A;  2B5G B;  4BBH A;  3WYA A;  1Q81 D;  1YLO A;  3IWW A;  1VHO A;  3N7Z A;  3IC1 A;  1X10 A;  5EBV A;  1ZUN B;  2BM1 A;  2Q4Y A;  5HH1 A;  1E64 A;  1GJR A;  4P4J A;  7CPA A;  1R5O A;  3CRZ A;  1F60 A;  4X05 A;  1QVF B;  4OAE A;  1MRZ A;  3IIB A;  3IFE A;  4XD7 A;  3H4Q A;  4FD5 A;  1QSN A;  5L46 A;  2AFO A;  2XNJ A;  1TF9 A;  2C6G A;  4G7X A;  4TSF A;  1UWY A;  2V77 A;  1I18 A;  4OKO A;  5JH9 A;  2DPT A;  1I8D A;  4R9M A;  4P12 A;  2R8V A;  4RCY A;  5JQ4 A;  1Z9U A;  1IB0 A;  2B4B A;  2GK7 A;  3CCU B;  4Y49 B;  4ZX8 A;  3E0K A;  2XOK A;  4R8F A;  3A35 A;  1FNC A;  2ATR A;  2QEX B;  4CAX A;  4UFX A;  2FT0 A;  4NJR A;  2X7B A;  4KOR A;  4M85 A;  5AG5 A;  1EXM A;  4C2Y A;  3TO6 A;  4RCZ A;  2F7V A;  5E6T A;  2GE3 A;  4LQ6 A;  2JJ1 A;  1S5K A;  2FS5 A;  3FBU A;  3MHP A;  3P2H A;  5J3O A;  4XKV A;  1SKQ A;  3OFN A;  3ISZ A;  1YR0 A;  4UWJ A;  4PAA A;  2EFG A;  2Y0M A;  1R3N A;  2OK8 A;  4RD3 A;  3D8P A;  1LRZ A;  3NE8 A;  5G20 A;  3WR7 A;  4JZ0 A;  2OBT A;  4G7W A;  4Z4U A;  3PFE A;  1KUX A;  4P6Y A;  6CPA A;  2V7T A;  1M1K D;  2QJ8 A;  1Q82 D;  3ZBU A;  2DEA A;  4PC6 A;  4KVM E;  4W9Y A;  4PC3 A;  5AGE A;  4C0S A;  3JUW A;  1ZLH A;  2ZXH A;  1NDH A;  4CS0 B;  5A89 A;  3SI0 A;  3DNS A;  2RC4 A;  1YQE A;  1NRK A;  1KZF A;  2QIR A;  1PJ7 A;  3GVJ A;  2OB0 A;  5F47 A;  5LYF A;  3W91 A;  1M44 A;  3W2I A;  3AGQ A;  4CRY B;  2QML A;  4A31 A;  5KSW B;  3CCM B;  4ACB A;  1YK3 A;  1WSV A;  4KSA A;  2VBQ A;  4AVA A;  3SJF A;  4NGT A;  5FO1 A;  3B8H A;  1B87 A;  3GLJ A;  4Z4S A;  8CPA A;  4KOS A;  5G21 A;  2DYI A;  4L8A A;  3RZA A;  3ISX A;  1Y0R A;  1N07 A;  1VHE A;  5CPA A;  1MJA A;  4X7D A;  2WPX A;  2D74 A;  3H8E A;  4GM5 A;  4XM3 A;  3G05 A;  2AFW A;  3BCF A;  4WZT A;  5C88 A;  3GIR A;  3I55 B;  2YGW A;  3I56 B;  1K28 D;  5I4M A;  4RPB A;  2QTL A;  2PC1 A;  3CXQ A;  1TLL A;  4YRH A;  2WSA A;  1S3Z A;  4Q38 A;  1JJ2 B;  4NNJ A;  1IID A;  3V8I A;  4UWI A;  4M6G A;  3LNN A;  4P25 A;  4ZCM A;  1WSR A;  3QFR A;  3T90 A;  3FJO A;  1VHS A;  1FX0 A;  3BY2 A;  3G8W A;  2VJJ A;  2CTC A;  4CRZ B;  5IYP A;  4XNH C;  3DR6 A;  1Z8W A;  2PIA A;  4UFV A;  4CYP A;  3ES9 A;  5A8A A;  4A2Z A;  1JWQ A;  4YGO A;  2Z3M A;  2JN9 A;  1Q7L A;  3QFS A;  2BV3 A;  2CTB A;  4TWE A;  4R3K A;  3FPP A;  4B10 A;  2WJY A;  2X8K A;  2R6H A;  2GAN A;  1CBX A;  3PB9 X;  3BY1 A;  4RD0 A;  4LBW A;  3IU2 A;  4PC7 A;  1GAW A;  1YGH A;  3PBE A;  3QAY A;  2DF5 A;  2RC6 A;  5GCN A;  1M4I A;  3OEH A;  4M3S A;  1QVG B;  1OB2 A;  1BQE A;  1T5E A;  3T9Y A;  3VAR A;  3PA1 A;  2OR4 A;  2ZEG A;  5HXB A;  4RDK A;  2R7H A;  5KNL A;  4Y9R A;  3CCJ B;  1RO5 A;  4A95 A;  1LFW A;  2ZZG A;  2G9D A;  1N05 A;  2YWH A;  4Z65 A;  5DN6 A;  4PPZ A;  5ISV A;  3C26 A;  3JQR A;  5IYW A;  4QHY A;  4QUZ A;  1I7P A;  2QE7 A;  4X7E A;  1BO4 A;  4FD4 A;  3TCV A;  4MFP A;  5LRK A;  3QAH A;  4Q7A A;  1BAV A;  5B6I A;  5LRG A;  1CJW A;  2EVN A;  2FIA A;  3KR4 A;  3D7D A;  4ACA A;  4YAL A;  2NMT A;  1S7K A;  1VQ7 B;  4X0C A;  4B3G A;  1YRE A;  3CC2 B;  4G6I A;  1VIX A;  3A9L A;  1UD8 A;  4UA3 A;  1PJ6 A;  4QUS A;  5IB0 A;  2PJ2 A;  3JQQ A;  4II3 A;  5A28 A;  4P4F A;  2F5I A;  2WPW A;  3WNC A;  2CBX A;  3RNZ A;  1E1R A;  1VQ8 B;  2VNI A;  2IQ6 A;  4NJQ A;  3CXP A;  4JLY A;  3S6K A;  3AVU A;  1AUG A;  3R9G A;  3SXN A;  1Y9W A;  1SM4 A;  1WOO A;  5FVJ A;  3ASS A;  4Z4T A;  4M53 A;  4I49 A;  1H85 A;  1S7N A;  3CCE B;  4YXW A;  1K73 D;  2HMA A;  3WND A;  4ZYQ A;  5IV0 A;  2WYR A;  2V8H A;  5G22 A;  3W2H A;  2DEU A;  2I79 A;  4X7F A;  1DDI A;  2BMW A;  4DNT B;  4PSW A;  4EH1 A;  2P6F A;  1TTT A;  3SEJ A;  5BSX A;  3QFC A;  1J9Z A;  4KKT A;  2XZO A;  4JXQ A;  4ONU A;  4OC3 A;  3PZJ A;  4BIN A;  2F1M A;  4AF7 A;  5EC4 A;  2G0B A;  1BPL A;  2HCJ B;  2EBJ A;  4PXC A;  2BGJ A;  4DK1 A;  4ZGN B;  3W5H A;  3VNU A;  1WOP A;  2DXQ A;  1NMT A;  2B5G A;  4MCR A;  3B2Y A;  4KOX A;  2PJC A;  2QN6 A;  3A8J A;  4MFQ A;  4MYT A;  4CGN A;  4NGQ A;  2ZW5 A;  5D29 A;  3RY8 A;  1GYT A;  2CRV A;  4OC2 A;  2P6E A;  4F0X A;  2PJ4 A;  4NGN A;  3IWG A;  2ZOG A;  4ZY0 A;  1HZE A;  4FAI A;  1FDR A;  4TMW A;  1B6B A;  4YU9 A;  2Q43 A;  4F7D A;  4ZV4 A;  1VQP B;  4ZY2 A;  4ONW A;  2J8M A;  3CTA A;  3BH4 A;  3SKB A;  3CT9 A;  3SJP A;  3E20 A;  1DDG A;  2WZN A;  4AF6 A;  4FD7 A;  3V7Z A;  1WOR A;  4UZE A;  4FWU A;  3D2P A;  5THW A;  1PYT B;  2V8G A;  3FB3 A;  1EWY A;  3G71 B;  3ZZU A;  3D7H A;  4NGR A;  4X5K A;  3MRU A;  4HNW B;  4II9 A;  3PB8 X;  1W34 A;  4P26 A;  4RJL A;  2W6I A;  3W2G A;  2ZW4 A;  3FH4 A;  3GVL A;  1QH0 A;  2M5S A;  1ELM P;  3FEC A;  1AMO A;  1VQN B;  5HVF A;  2JBK A;  2V8D A;  5FL7 A;  1RQR A;  3SLN A;  3I1F A;  3T53 B;  1W2B B;  1BX1 A;  1HEE A;  1A8P A;  1YJW B;  3PUM A;  3FRM A;  2F8H A;  3OJW A;  1MJ9 A;  2EK8 A;  4XOT A;  1NB9 A;  4B3X A;  2B58 A;  3TTH A;  1Y7R A;  1CPX A;  3TOA A;  3FIX A;  3SI1 A;  1YJ9 B;  3SHP A;  3DSB A;  3GY9 A;  2F43 A;  3LAC A;  1M1D A;  5BWA B;  3BI1 A;  2ZEN A;  1WPC A;  2E1B A;  1S72 B;  4LUA A;  4MCP A;  4JXR A;  2PJ8 A;  4AG9 A;  1FRQ A;  4RN7 A;  4YHB A;  4ROX A;  4OP4 A;  3JQP A;  4B14 A;  1COW A;  3WNB A;  1M4D A;  4Q7J B;  1RXT A;  2YNE A;  4P10 A;  4KSI A;  2VL1 A;  4KLW A;  4P4B A;  5BSY A;  4KLV A;  5E96 A;  3KGQ A;  4G1P A;  4KUB A;  5CDF A;  1S7F A;  1XEB A;  1JA1 A;  4MHN A;  2Z3N A;  4FK8 A;  4FN5 A;  3DLJ A;  3KEW A;  4DQL A;  2J9A A;  4E2A A;  3ASR A;  4YWY A;  1PCA A;  1KUV A;  2Q04 A;  1WU8 A;  1ZG7 A;  1Q9S A;  3GKR A;  1KWM A;  1E3X A;  1XB2 A;  2VBV A;  3CP2 A;  3FNC A;  4HE5 A;  1E43 A;  3T51 B;  4HNX B;  3ASP A;  2F1L A;  5HZA A;  4P4E A;  2IMO A;  2HC9 A;  3BC9 A;  1KC8 D;  1TKH A;  4ZCI A;  2PJ5 A;  4MFJ A;  3AVT A;  4NF1 A;  3BLN A;  2PQ8 A;  4RI1 A;  3ZZT A;  4QB9 A;  3TFY A;  2B5O A;  1H8L A;  4DUK A;  3CCR B;  4LC0 A;  2ZEF A;  2AFX A;  1F2O A;  3CD6 B;  4XR6 A;  2ZW7 A;  5CBM A;  4WZK A;  4KOY A;  4OPS A;  4WQM A;  3H8G A;  4CAW A;  3ZJ0 A;  1JA0 A;  3B3C A;  4R3L A;  3D67 A;  2P6G A;  4CGL A;  1CG2 A;  5LMZ A;  2PRQ A;  3A1P A;  2OZU A;  4AB7 A;  3PGP A;  3HLP A;  2FVG A;  2J8R A;  4NGP A;  5LYD A;  1SKY B;  2ZBU A;  1HDU A;  2VNJ A;  3FKS A;  3VWD A;  4MBU A;  2DCU A;  1QG0 A;  1ZO0 A;  4M0L A;  1XMT A;  4GS4 A;  2B3U A;  1T6X A;  3S6F A;  4B44 A;  2GU2 A;  2ZEH A;  3MN8 A;  2B7B A;  3WC7 A;  2ZED A;  3OZW A;  2CY2 A;  2ZEL A;  4F9U A;  3B78 A;  2ZBV A;  4UCN A;  1E1Q A;  1UD4 A;  4H9G A;  3OZV A;  1G7C A;  2I3C A;  4XQF A;  2ZL7 A;  1XOV A;  1Q2C A;  3JVN A;  4N3N A;  2IJZ A;  5HVG A;  2GFQ A;  5GV8 A;  4ZGY B;  2CW5 A;  2PJ6 A;  2J8N A;  5C82 A;  2IL4 A;  3PP9 A;  4ZI6 A;  4UIB A;  1ARL A;  3WAB A;  2CIJ A;  1GVH A;  4MI4 A;  2OOT A;  1T6Z A;  4TN1 A;  5J8F A;  3TE4 A;  3JU4 A;  1HA3 A;  2ZXI A;  1WWZ A;  3NE5 B;  2OU2 A;  2KVO A;  2W6J A;  3S9L A;  4ZCL A;  2QGG A;  3BXM A;  2Q6K A;  2Z6B D;  2Z3L A;  3CPA A;  3CXS A;  2OBR A;  1XQB A;  3KL9 A;  2ODF A;  3H94 A;  4PXB A;  2V4D A;  1ZM9 A;  1QST A;  2Z3O A;  4B5P A;  4QVJ A;  1FNM A;  1GO2 A;  4FWT A;  3A8I A;  1JB9 A;  4FD6 A;  2NYQ A;  1J4J A;  1XBU A;  1NSL A;  3GVK A;  2GIV A;  4H89 A;  4Z4Z A;  2JDI A;  3EO4 A;  1TF8 A;  2Z11 A;  1D1N A;  4Z1M A;  5G1Z A;  4LBY A;  2X85 A;  1YLE A;  4PK2 A;  5HKK A;  3W2F A;  4NCZ A;  3GYA A;  3Q39 A;  1YJN B;  3OW7 A;  2CF4 A;  3B35 A;  2Q51 A;  3Q6R A;  4M4S A;  2HQY A;  1T6Y A;  1S0U A;  1YW4 A;  3QSY A;  4DJL A;  4AVZ A;  2E1R A;  3OE7 A;  2ZEE A;  1KK0 A;  3GUX A;  4XON A;  3CCQ B;  1G7T A;  1UD5 A;  4P6V F;  2XEG A;  1CM0 A;  1X12 A;  4PAB A;  3W2E A;  1W9X A;  1HDQ A;  1BX0 A;  4A94 A;  1AYE A;  1NJI D;  1QSR A;  1Z2L A;  5K8P A;  3HAG A;  3JTK A;  1IOI A;  4P22 A;  1CP6 A;  2PJ1 A;  3F8K A;  3FF3 A;  4EWT A;  2ZIT A;  4XNF A;  1B23 P;  2OZG A;  5F4J A;  2O4H A;  4MXU A;  3BQJ A;  1ZLI A;  1V0F A;  2ZL5 A;  1YX2 A;  1H42 A;  4MYU A;  2K5T A;  2VXK A;  5FNZ A;  3LWU A;  1QFZ A;  2PVW A;  2D4O A;  1E79 A;  4PQA A;  2C1C A;  5F49 A;  1A2Z A;  4YEL A;  1KK1 A;  4C43 A;  2POK A;  4QVA A;  4JWP A;  4KOU A;  4P2N A;  3PB7 X;  4H6U A;  1S4M A;  3KHZ A;  4NGM A;  4PXD A;  4B13 A;  2PJ9 A;  2BSW A;  4OAD A;  2CC2 A;  4CAF A;  5KTA A;  3BCD A;  3CCV B;  1L0C A;  2V7U A;  4UEZ A;  2XNC A;  3WBJ A;  3EXN A;  1DAR A;  4XLF A;  3CMA B;  4IAV A;  3IO1 A;  3PBB A;  3TO9 A;  2V31 A;  4R6T A;  4TKO B;  2XGJ A;  1WOS A;  3RO0 A;  5KW9 A;  1EFC A;  2QTZ A;  2BVN A;  1N8R D;  1IJE A;  1BJK A;  2XZL A;  1Z8T A;  4UIA A;  2X6X A;  4BPR A;  4PV6 A;  5HMN A;  3VWE A;  3PB4 X;  4KVO E;  4A33 A;  3RYO A;  4FBE A;  4TMV A;  1QGA A;  2OTJ B;  1PUA A;  3T8W A;  1QSO A;  4CQJ A;  2OYN A;  2X53 S;  1VQO B;  2O53 A;  2BN4 A;  2XND A;  1EP2 B;  4YAF A;  3MGD A;  4XPK A;  3DDD A;  4NEX A;  3NH8 A;  2PJB A;  2FL4 A;  4YAO A;  1LAN A;  3S9M A;  1YHQ B;  2GQF A;  1VQ5 B;  4JJX A;  2Q6O A;  2GRE A;  1QUE A;  4MHD A;  1LAM A;  2YND A;  5FA6 A;  5THX A;  4YEJ A;  2XZP A;  2D4P A;  3LOD A;  2OBS A;  2NV4 A;  1IIC A;  2JEW A;  1XF8 A;  2DER A;  4RS2 A;  3FVL A;  4XMY A;  1UD2 A;  3LQE A;  2C5B A;  5KTD A;  4FXU A;  3ZC3 A;  4RUH A;  3IJ3 A;  1AMP A;  1WTH D;  3R1K A;  2ZZF A;  3OAA A;  4XPL A;  1V0C A;  4IHM A;  3P26 A;  1UD6 A;  5FO0 A;  2VJI A;  2JEV A;  4MFK A;  3G3S A;  5IX3 A;  1KTV A;  3PVD A;  3D4U A;  4XN0 A;  1M90 D;  3P27 A;  4EME A;  4O23 A;  3PRT A;  4HNY B;  4B12 A;  3D3S A;  4R71 A;  3D68 A;  4XNH B;  1V5V A;  3KZW A;  3ZUG A;  5LRJ A;  3FXT A;  2AE6 A;  5JPH A;  3A8K A;  1XRY A;  4P44 A;  3LMS A;  1ELO A;  1IJF A;  3QB8 A;  2CXA A;  4B47 A;  1E3Z A;  4UEE A;  3H8F A;  4OID A;  1W35 A;  3CPX A;  2FSR A;  3VO1 A;  4UEF A;  4ZGQ B;  1TXR A;  1QGZ A;  2PSW A;  5TR9 A;  4F8Z A;  3LVB A;  5J35 A;  2QMU A;  3T56 B;  2QYV A;  3D66 A;  3R96 A;  3DR8 A;  3CXC B;  2PR8 A;  2Z3P A;  3CCL B;  1D8T A;  3WT4 A;  5AN9 A;  5A88 A;  4ASU A;  4RD4 A;  4BD9 A;  3DGV A;  1DE4 C;  5FIU A;  4MY3 A;  2FXF A;  3L2N A;  4FUU A;  3NA6 A;  4KSF A;  3I9S A;  3B7I A;  4DK0 A;  4QFM A;  3W5V A;  1UMK A;  1I1D A;  4OME A;  3E1Y E;  1LOK A;  2OH1 A;  2C5H A;  3BI0 A;  2Z10 A;  3IGR A;  2V7W A;  3TC8 A;  4KOV A;  4OIW A;  3PEI A;  4R7M A;  4J3G A;  4P45 A;  4U9U A;  1IB1 E;  4B11 A;  1TKJ A;  4CYQ A;  3OOC A;  3H5Z A;  2I1L A;  4MHP A;  3LO8 A;  2JJ2 A;  1R5N A;  5F46 A;  2BPO A;  1GHE A;  4C2Z A;  3G4S B;  3K2K A;  4QV2 A;  4RLZ A;  3EFA A;  4ZX9 A;  4XPD C;  1VKC A;  4X8I A;  2H5M A;  4K1X A;  2REE A;  1F20 A;  4TMZ A;  1N71 A;  3FJU A;  3ZIA A;  1R43 A;  4JYW A;  2BO9 A;  5EMN A;  2JIZ A;  2FX3 A;  2OTL B;  3IU1 A;  4PSX A;  3VR6 A;  4RM0 A;  1JNY A;  2ABZ A;  4NGS A;  3K9T A;  2WR8 A;  1LAP A;  3R9E A;  4CGP A;  2PJ3 A;  1FRN A;  1SQH A;  2B4D B;  3VNV A;  4GQN A;  3NH5 A;  4E0A A;  3AVV A;  3G6E B;  3AVY A;  4A37 A;  4WZE A;  1N0U A;  2C77 A;  4XKW A;  2VNH A;  2NPF A;  4WJB A;  4NXY A;  3R9F A;  1XFO A;  2BUE A;  3NFZ A;  3Q38 A;  2CK3 A;  1K4J A;  4XLH A;  2GLJ A;  4CYO A;  2BOA A;  3GQB A;  4OC4 A;  2PCU A;  4A39 A;  5DWN A;  2Q4Z A;  2Q0Y A;  5F48 A;  2NSM A;  1EFU A;  2V7X A;  4XPD B;  5JGF A;  2WSS A;  3D7F A;  3NE7 A;  5DWM A;  2PRB A;  3MCA A;  4KKU A;  4B5P B;  4XL9 A;  1KRH A;  4X7C A;  4OPO A;  5I0C A;  2ZTG A;  2GK6 A;  2WZP P;  1Z4E A;  1FND A;  5J1Q A;  3AGP A;  1ZM4 A;  5F09 A;  1UD3 A;  4NBS A;  1Y7E A;  4IUS A;  1TVC A;  1ZG8 A;  2FCK A;  1XJO A;  2PMD A;  3CES A;  3V38 A;  3WQZ A;  1F57 A;  4X2T A;  1KJZ A;  1CQX A;  1W0J A;  1PU9 A; 
#chains in the Genus database with same CATH homology
 3IEH A;  5LRG A;  3KR4 A;  3D7D A;  1OBR A;  3B3T A;  4MHY A;  2NYQ A;  3SJG A;  5K8M A;  3WC6 A;  4AXV A;  4TNU A;  1XBU A;  1VIX A;  1BPM A;  1TF8 A;  2PJ2 A;  3SJE A;  1BPN A;  2PJ7 A;  1YSJ A;  2C6P A;  4P4F A;  2CF4 A;  5IB9 A;  3B35 A;  2Q51 A;  2RB7 A;  1YW4 A;  4DJL A;  2ZEE A;  2IQ6 A;  4NJQ A;  3GUX A;  4ZY1 A;  5HXD A;  1LCP A;  3B3V A;  2XEG A;  3FED A;  1HDQ A;  1JQG A;  4A94 A;  1AYE A;  1Z2L A;  5K8P A;  4ZYQ A;  4K3N A;  4A38 A;  2WYR A;  2V8H A;  3CDX A;  2AFZ A;  3VH9 A;  5JM6 A;  1CP6 A;  2PJ1 A;  3FF3 A;  4EWT A;  2O4H A;  4MXU A;  1ZLI A;  3LWU A;  2PVW A;  2EK9 A;  4OC3 A;  2RFH A;  4PQA A;  2C1C A;  4PXC A;  2BCO A;  2XEF A;  2XEJ A;  3D7G A;  2POK A;  4DYO A;  1Z5R A;  2AFM A;  4H2K A;  2JBJ A;  4MCS A;  1YME A;  4P4I A;  3RAM A;  3PB7 X;  1TKF A;  1Y0Y A;  3KHZ A;  4NGM A;  4PXD A;  2PJ9 A;  3KQX A;  3S9N A;  4MCR A;  4UEZ A;  3B2Y A;  3SI2 A;  2AFU A;  2PJC A;  3RBU A;  4EFD A;  4NGQ A;  5D29 A;  1GYT A;  3KHX A;  4OC2 A;  4IAV A;  5ELY A;  3IO1 A;  2PE3 A;  2ZEP A;  3PBB A;  1CX8 A;  4R6T A;  2PJ4 A;  1ELL P;  4NGN A;  3JRU A;  2ZOG A;  4ZY0 A;  1QMU A;  4FAI A;  2ZEO A;  1YLO A;  3IWW A;  1VHO A;  3IC1 A;  4YU9 A;  4IK2 A;  1VGY A;  3FEE A;  2Q43 A;  4ZY2 A;  4ONW A;  4UIA A;  2XEI A;  4P4J A;  3BHX A;  4MMO A;  3CT9 A;  3PB4 X;  7CPA A;  1CPS A;  2WZN A;  2AFS A;  4FBE A;  3V7Z A;  1IGB A;  1YW6 A;  3IIB A;  4FWU A;  1BLL E;  3T8W A;  3IFE A;  3GB0 A;  5THW A;  2EWB A;  1PYT B;  2V8G A;  1NSA A;  2O53 A;  2AFO A;  3D7H A;  4NGR A;  1CP7 A;  1TF9 A;  3NH8 A;  2PJB A;  1LAN A;  2C6G A;  3MRU A;  3S9M A;  3PB8 X;  1UWY A;  2V77 A;  4OKO A;  2GRE A;  5JH9 A;  4PXE A;  1LAM A;  3FH4 A;  1ELM P;  2GLF A;  3FEC A;  4MRI A;  3TX8 A;  5D8N A;  2JEW A;  5HVF A;  2JBK A;  3KQZ A;  2V8D A;  3FVL A;  4ZX8 A;  4R8F A;  1HEE A;  2QVP A;  2PIY A;  2F8H A;  4RUH A;  3IJ3 A;  2V8V A;  1AMP A;  2EK8 A;  5LYI A;  4NJR A;  4IHM A;  2F7V A;  1CPX A;  3SI1 A;  3D4U A;  5HVH A;  2ZOF A;  4EME A;  4O23 A;  3PRT A;  3BI1 A;  2ZEN A;  3ISZ A;  3D68 A;  4MCP A;  1QQ9 A;  3KZW A;  5LRJ A;  2ANP A;  1R3N A;  2PJ8 A;  1XRY A;  4P44 A;  3LMS A;  4OP4 A;  4JZ0 A;  3PFE A;  4P6Y A;  6CPA A;  2QJ8 A;  4UEE A;  3H8F A;  4P10 A;  2DEA A;  4KSI A;  4OID A;  4CPA A;  2VL1 A;  3NH4 A;  4P4B A;  4W9Y A;  3CPX A;  4UEF A;  3KGQ A;  4G1P A;  1TXR A;  2HB6 A;  1ZLH A;  4MHN A;  1M4L A;  4F8Z A;  4OC5 A;  3DLJ A;  3SI0 A;  2J9A A;  2QYV A;  3D66 A;  4YWY A;  1PCA A;  2PJA A;  1F2P A;  1ZG7 A;  4WWV A;  3WT4 A;  5LYF A;  1DTD A;  1KWM A;  4P4D A;  4B6Z A;  4BD9 A;  3DGV A;  2PVV A;  1DE4 C;  4P4E A;  3WC5 A;  3L2N A;  2IMO A;  2HC9 A;  3I1U A;  4FUU A;  4NGT A;  3SJF A;  1TKH A;  2PJ5 A;  3GLJ A;  3NA6 A;  3B7I A;  1IY7 A;  8CPA A;  4R76 A;  3RZA A;  1H8L A;  3ISX A;  4OME A;  1LOK A;  3HUV A;  4NFR A;  4DUK A;  1Y0R A;  1VHE A;  3BI0 A;  5CPA A;  2ZEF A;  2AFX A;  3H8E A;  4MCQ A;  3TC8 A;  4GM5 A;  1F2O A;  4OIW A;  3PEI A;  4R7M A;  2AFW A;  4P45 A;  1TKJ A;  4F9V A;  5CBM A;  2ZEM A;  5I4M A;  1EE3 P;  4MHP A;  3FMC A;  3H8G A;  3K2K A;  3KAS A;  3B3C A;  3D67 A;  4ZX9 A;  1CG2 A;  2PRQ A;  4X8I A;  4OC0 A;  3FJU A;  3HLP A;  2FVG A;  1R43 A;  3KI9 A;  4JYW A;  4NGP A;  5LYD A;  1HDU A;  3SJX A;  2PIZ A;  1FT7 A;  2BO9 A;  2CTC A;  1ARM A;  3KR5 A;  2ABZ A;  3B3W A;  5K8O A;  4NGS A;  3K9T A;  2GU2 A;  1LAP A;  2ZEH A;  4X3R A;  3B3S A;  2PJ3 A;  3MN8 A;  2PJ0 A;  3WC7 A;  4LQG A;  2ZED A;  1Q7L A;  2CTB A;  3PB6 X;  2ZEL A;  4TWE A;  5K8N A;  4F9U A;  3NH5 A;  4A37 A;  1CBX A;  3PB9 X;  4WJB A;  2I3C A;  2C6C A;  1XFO A;  3NFZ A;  1Z8L A;  3PBE A;  5DS0 A;  2GLJ A;  2BOA A;  2IJZ A;  4MHZ A;  4OC4 A;  5HVG A;  1FNO A;  2PCU A;  4A39 A;  2PJ6 A;  2Q4Z A;  4ZI6 A;  3VAR A;  4UIB A;  2NSM A;  2OR4 A;  2ZEG A;  1ARL A;  3WAB A;  2CIJ A;  4UF4 A;  2OOT A;  1LFW A;  2G9D A;  3N5F A;  5JGF A;  3D7F A;  3VAT A;  4Z65 A;  4PPZ A;  3S9L A;  3BXM A;  1XMB A;  3QNV A;  3FX6 A;  1ZG9 A;  3CPA A;  5J1Q A;  5F09 A;  1Y7E A;  3KL9 A;  1ZG8 A;  1XJO A;  4OC1 A;  5LRK A;  4PXB A;  3V38 A;  4Q7A A;  1F57 A;  4X2T A;  1BAV A;  1RTQ A;  3PFO A;  5LYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...