1VHOA

Crystal structure of a putative peptidase/endoglucanase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
331
structure length
319
Chain Sequence
METGKLLMELSNLDGPSGYETNVVSYIKSVIEPFVDEAKTTRHGSLIGYKKGKGIGKLAFFAHVDEIGFVVSKVEGQFARLEPVYASKVRIYTKNGIERGVIGMLAPHLQDSESRKKVPTYDEIFVDLSLCERGVRVGDIAVIDQTAFETNGKVVGKALDNRASCGVLVKVLEFLKRYDHPWDVYVVFSVQEETGCLGALTGAYEINPDAAIVMDVTFASEPPFSDHIELGKGPVIGLGPVVDRNLVQKIIEIAKKHNVSLQEEAVGGRTDFVQLVRNGVRTSLISIPLKYMHTPVEMVDPRDVEELARLLSLVAVELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
molecule keywords endoglucanase
total genus 94
structure length 319
sequence length 331
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 1vhoA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1vhoA01
1ZG9A 2V8GA 4MMOA 5K8OA 3GUXA 1VIXA 4OC2A 5IB9A 2ANPA 4IHMA 2AFWA 2PE3A 3SI0A 5HVGA 2GLFA 3SI2A 3V38A 5LYFA 3LMSA 4P4JA 2PJ0A 3GLJA 3NFZA 1VHEA 1F57A 3H8GA 4ZY0A 4DYOA 3B3VA 1Y7EA 2CF4A 2WZNA 4OC0A 3VATA 1LAMA 4UF4A 1Y0RA 3WC5A 4OC1A 3N5FA 4IK2A 4CPAA 1XRYA 4X8IA 4ZY2A 2PVVA 1CBXA 1RTQA 5K8PA 3BI0A 2C6GA 2ABZA 4NGTA 5K8MA 3B35A 4TWEA 1LAPA 3NA6A 2PJ2A 3NH4A 3PBBA 4Q7AA 2ZEMA 4EWTA 3MN8A 2BO9A 2POKA 2V8VA 1BLLE 2BOAA 2V77A 3FMCA 1PCAA 1R43A 1DE4C 2EK9A 5F09A 1DTDA 3MRUA 4OMEA 1TKFA 2QVPA 3LWUA 1BPMA 3SJXA 1CX8A 3PB7X 1ZLHA 2PIYA 4NGRA 5LRGA 1CG2A 2AFZA 4DJLA 4PXCA 2ZEHA 3K2KA 1PYTB 1KWMA 1QQ9A 4X3RA 3IEHA 1ZG8A 1IY7A 3KQXA 2C1CA 2ZENA 1TXRA 3IJ3A 3PB9X 4Z65A 3B2YA 5LYDA 2GU2A 2PJ7A 4ZYQA 5CBMA 1XBUA 1Q7LA 2BCOA 1UWYA 3HLPA 1CPXA 1HDUA 2PJ1A 3KI9A 3CPAA 2IJZA 2IMOA 1FNOA 1ELMP 2JBJA 3PBEA 3KQZA 1NSAA 1IGBA 2PJAA 2PJ6A 4OC3A 4X2TA 4TNUA 4P4BA 4F8ZA 3B3WA 5K8NA 4FWUA 2F7VA 2V8HA 3FX6A 4OIDA 4ZX8A 2CIJA 3FEEA 3NH8A 5LYLA 2V8DA 2JBKA 3DLJA 2VL1A 1OBRA 1ELLP 2F8HA 3K9TA 4R76A 1CP6A 4DUKA 4R8FA 1YMEA 2GLJA 1JQGA 3S9NA 4NGMA 2ZEDA 2Q43A 4UEFA 2ZELA 4MHZA 4H2KA 4G1PA 1M4LA 4MCRA 1VGYA 1YW4A 3L2NA 3WC6A 4YU9A 4ZY1A 2C6CA 4PXDA 2NYQA 3S9LA 2ZEPA 5ELYA 3RAMA 5CPAA 4KSIA 3PEIA 2AFUA 2HC9A 4UEZA 2Q51A 2PJ3A 3IIBA 2PCUA 4NGSA 3BHXA 1XMBA 1ZLIA 4R6TA 3D7FA 4MCSA 7CPAA 3WABA 3PFEA 2J9AA 4NGQA 8CPAA 5LRJA 4P4FA 4EFDA 4NGPA 5HXDA 2PJBA 3FVLA 2AFXA 2PJ4A 3PB6X 2PJ5A 4NJQA 4OKOA 3WC7A 2CTCA 4RUHA 2AFOA 1F2PA 3FECA 3B3CA 3D7GA 3RZAA 4MHNA 3BI1A 1VHOA 4WWVA 2JEWA 2PVWA 3KHZA 5JH9A 5J1QA 1HDQA 1HEEA 4P10A 4PPZA 1XFOA 4JZ0A 4O23A 3QNVA 2XEJA 3KZWA 2OOTA 2RB7A 1CPSA 4PXBA 2ZEEA 4A39A 5I4MA 4FAIA 1AMPA 4UIAA 1TF8A 4YWYA 4EMEA 1TKHA 3JRUA 4MHPA 2PJ9A 4NGNA 3SJGA 2WYRA 3KL9A 2XEIA 2O4HA 3KASA 2QJ8A 3V7ZA 1R3NA 1BPNA 4W9YA 4UIBA 4A37A 4GM5A 1YW6A 2CTBA 4BD9A 1CP7A 3D7HA 4LQGA 1YSJA 1AYEA 3WT4A 3IWWA 3IC1A 4MRIA 2AFSA 4ZX9A 2ZOFA 2I3CA 3KR5A 4A94A 5D29A 3D66A 4K3NA 3FH4A 4MCPA 4UEEA 1F2OA 2RFHA 3NH5A 4P4EA 1GYTA 2ZEFA 3D7DA 3FJUA 2XEGA 3D4UA 4NJRA 3PB4X 1FT7A 3TX8A 1H8LA 3CDXA 2C6PA 5HVHA 1ARMA 3DGVA 4IAVA 4OP4A 1BAVA 1Z2LA 2Q4ZA 2EK8A 1TF9A 3SI1A 2DEAA 5JGFA 3I1UA 3RBUA 2G9DA 3B3SA 2HB6A 1Y0YA 1QMUA 4PXEA 1Z8LA 2PRQA 4P45A 4OIWA 5DS0A 2AFMA 3B3TA 1YLOA 3SJFA 3CT9A 4MHYA 2QYVA 4JYWA 3H8FA 3D68A 2XEFA 4ZI6A 3B7IA 2ZEGA 3D67A 3PRTA 1ZG7A 4F9VA 2IQ6A 3ISXA 3KHXA 3GB0A 1LCPA 4P6YA 2EWBA 4MCQA 3H8EA 1TKJA 4OC5A 4WJBA 3CPXA 2PJCA 4P4DA 2OR4A 2GREA 4B6ZA 2NSMA 5LRKA 2PIZA 4FBEA 4FUUA 1LANA 4A38A 4PQAA 5JM6A 2ZOGA 1Z5RA 3VH9A 4P44A 4F9UA 6CPAA 3TC8A 3T8WA 1XJOA 4ONWA 2PJ8A 4OC4A 3PB8X 3KGQA 4P4IA 1EE3P 2ZEOA 5D8NA 3FF3A 4MXUA 3KR4A 3IFEA 2O53A 5HVFA 1LFWA 1ARLA 4R7MA 2FVGA 5LYIA 3PFOA 1LOKA 3IO1A 5THWA 3ISZA 3FEDA 3S9MA 4NFRA 3VARA 3HUVA 4AXVA 3SJEA 3BXMA
chains in the Genus database with same CATH superfamily
1K28D 2V8GA 4KSFA 5AG5A 1MJ9A 3P2FA 2ZZFA 3GUXA 1VIXA 4OC2A 2WUUA 4X7DA 4CAEA 1R5NA 2AFWA 1EFUA 3SI0A 1ZUNB 3J81k 1I18A 3SXNA 1I8DA 2OK8A 2B3UA 1Q86D 1VHEA 5JQ4A 1UD4A 1Z9UA 4ZY0A 3FNCA 2BF4A 1U6MA 2FS5A 2RC6A 3I3GA 1Y7EA 4PSWA 4UWIA 2GJRA 3WC5A 2Z0ZA 4OC1A 1QG0A 1XRYA 4KUAA 1JB9A 5KTDA 5KNLA 1Y7RA 5A88A 2ABZA 4LBZA 5K8MA 4TWEA 3NA6A 4HKFA 4A95A 2PJ2A 2CRVA 1FY7A 4Q7AA 5F48A 4U9UA 1Q2DA 3A3GA 4R87A 4OP7A 5GCNA 1Z4RA 4A32A 2Z11A 4X7CA 4LBYA 5FIUA 3AVTA 3ZZUA 4TMZA 1M90D 2EVNA 3FMCA 4M6HA 1YIJB 1YR0A 4Y49C 2Z3OA 5G21A 1DE4C 5F09A 3QB8A 2C4TA 3MRUA 3D26A 2HUZA 3PB7X 1S7LA 3VO1A 1CG2A 2X6XA 4NNJA 4DJLA 4R57A 1XE4A 4XKVA 4M4SA 3Q3AA 4P3YA 4MFLA 4RDLA 1K73D 4BMHA 4PGOA 1IY7A 1Q81D 3CP8A 4KOXA 1TXRA 3IJ3A 2FE7A 3ZC3A 2GU2A 5CBMA 2OZHA 1GVHA 3TT2A 4YEJA 2PJ1A 3KI9A 4C2YA 2KCWA 1YX2A 2Q7SA 2CBXA 2IMOA 1QGZA 1YQEA 3OW2B 1ELOA 1NSAA 1IGBA 4YAWA 4QBJA 1QGAA 4NF1A 1QSNA 4KORA 3CCMB 2DF5A 2Z10A 4HNWB 3ZIAA 4AG7A 3W5HA 4DK0A 4RI1A 3ONYA 5DN6A 2V8HA 3FX6A 4OIDA 2D74A 3OOCA 1A8PA 1E43A 2CIJA 2D3LA 2X6YA 2V8DA 2B4BA 1IOIA 2QN6A 4KOTA 4R3LA 4YXWA 4C2ZA 4G6IA 1W9XA 1KRHA 5TRDA 1OZPA 2VL1A 2VXKA 2G3AA 1EFRA 1KZLA 2F8HA 4YAFA 3K9TA 1CP6A 1M4DA 2OZUA 4C2XA 4DUKA 4R8FA 4CAVA 1RXTA 3JUWA 4M0LA 5L46A 2JJ1A 3S9NA 5IYPA 4F0YA 4OOSA 2ZELA 4MHZA 3A8JA 4H2KA 1AUGA 4PC2A 2P3MA 3WC6A 4YU9A 2F5IA 4ZY1A 1NB0A 2NMTA 2YNEA 2ZEPA 4B5PA 3RAMA 4R9MA 4KSIA 2PR8A 1UD5A 4QC6A 4AF7A 2X6WA 1UD6A 2QA4B 4XKWA 1CJWA 3AVUA 3PUMA 2PJ3A 3IIBA 1XIXA 4NGSA 3ZUGA 4XOTA 1W34A 3PA1A 1EP3B 3WNBA 2PRBA 4ZV4A 1XMBA 2REFA 2B4DB 4RS2A 1PUAA 3BY1A 5ISVA 3WNDA 3I56B 5LRJA 4ROXA 2PJBA 3DR8A 3FVLA 2XZLA 3IWGA 5F49A 1P4MA 2PJ5A 4RN7A 3FBUA 1B6BA 4B4DA 1KUVA 5HH1A 2BPOA 2AFOA 3VNUA 1F2PA 3FECA 4FWTA 1YHQB 3T56B 3CCUB 3BI1A 4MHNA 2C78A 3D2MA 3AVYA 2XNCA 1W2BB 5J3OA 3AGPA 1JJ2B 3GQBA 1HDQA 1BOBA 3VWEA 2CXAA 1ZO0A 3ONUA 3QNVA 1VLYA 3KZWA 3CCEB 2BSWA 3TFYA 4FN5A 1CNFA 4A39A 3TOBA 4FAIA 4UIAA 4ZGYB 3LQ6A 4YWYA 2GJPA 1R5BA 5FA6A 4LBVA 3JQRA 3BQJA 4MHPA 2QMLA 1WSRA 4TMXA 2VJIA 1EWYA 4XPKA 4MYTA 3KASA 1H85A 3R9EA 4C7HA 2WZPP 5DSZA 3VO2A 1R3NA 3TCVA 1SKYB 2CTBA 1E79A 1CP7A 2QTLA 4LQGA 1YSJA 2DPSA 3TOAA 3EXNA 5IYWA 3BH4A 3IC1A 3QAYA 2ZOFA 1I12A 5D29A 4LBWA 1W35A 3VNVA 3FH4A 4MCPA 4UEEA 4DNRB 1GYTA 4Z4VA 2FXFA 2ZEFA 2XEGA 4NJRA 3PB4X 1IB1E 1FT7A 3R9FA 1H8LA 1IYLA 1QGYA 1M4GA 1N07A 1J9ZA 2HV2A 4IAVA 4OP4A 1BAVA 5A28A 2Q4ZA 2EK8A 2G0BA 2Q7BA 4A31A 3U6BA 1FNMA 3OJXA 3RYOA 3W5UA 3R6KA 1Y0YA 3CCJB 2V7WA 4PXEA 2C2WA 1GHEA 2JDDA 3B3TA 5FL7A 1J4JA 4CYPA 1WDTA 4UFXA 3SJFA 3CT9A 1NB9A 2WPDA 2QYVA 2B3VA 4AG9A 1QFJA 3OP1A 3R95A 4ZI6A 1ZM3A 1UD3A 4QVAA 2ZEGA 3D67A 1UD8A 2VJJA 4XPLA 2WJYA 3KHXA 2YGWA 2VBQA 2OZGA 1TKJA 4ACBA 4JD6A 2NSMA 5GV7A 1VHSA 2PQ8A 4MHDA 4II3A 5JM6A 1YK3A 1VQ5B 4K1XA 5IYNA 1D8TA 1IJEA 3T8WA 1H42A 4TT3A 2ZW6A 3IU2A 4ONWA 3PB8X 2F1MA 1S72B 3KGQA 4P4IA 1IU8A 5AG4A 2ZEOA 5D8NA 3JTKA 4U9ZA 4MXUA 1YVOA 3D3SA 4WQMA 4PC3A 5LYIA 4HE5A 2J7KA 1LOKA 4HNXB 5IYRA 5THWA 2OBRA 4MFKA 2B7CA 4AXVA 3BXMA 3U6KA 3W6XA 4A33A 1WOPA 2JN9A 2LZJA 4CRYB 4IW3B 5CDFA 4CYQA 2BMWA 5IB9A 5F4MA 2ANPA 1EP2B 4IHMA 4OPSA 2PDOA 3W2FA 4M1KA 4GS4A 2PE3A 4KKUA 2GLFA 3V38A 2R8VA 3LMSA 2PJ0A 1Z4EA 4NSQA 4Q36A 2DCUA 3NFZA 3R6JA 4YALA 2CK3A 3B3VA 4TMTA 4NXYA 3CCQB 2VZZA 4MFJA 4G1VA 2E1BA 3CXPA 3OZVA 4GXHA 4JJXA 4CPAA 1E3ZA 2BSAA 3MMPA 2PVVA 4HE6A 3T51B 1LRZA 3BI0A 1YJNB 2C6GA 3IU1A 4KVME 1LAPA 1RQPA 3CRZA 3PBBA 1VQMB 3OZWA 4CRZB 3ES9A 5IV0A 5FO1A 4B13A 2FIAA 4U5YA 2R7HA 1Q7YD 2B5GA 3SEJA 4CYOA 5LMZA 4P6VF 2V77A 3W5VA 1Z8XA 3OW7A 1PCAA 2J8MA 5C88A 1R43A 4CGPA 1DTDA 1V0EA 1TKFA 4P12A 3SJXA 5LRGA 2RC4A 2AFZA 1ON0A 3Q6RA 3ASPA 1PYTB 4X3RA 2V7UA 2BM0A 5HMNA 4X7FA 2XGJA 3KQXA 4XONA 3PB9X 3E1YE 3ASQA 4Z65A 5LYDA 2R98A 3T90A 3PVDA 3AVWA 5FVJA 4KOUA 1V0CA 1HDUA 3SJPA 4B11A 2IJZA 5FO0A 3G8WA 2ZZGA 4F7DA 1ELMP 1XF8A 3PBEA 4C0SA 1VQOB 1QSTA 2F4NA 4X2TA 1V0FA 4UCNA 1VQPB 5TY0A 3W2IA 3MHPA 4OPOA 3QFTA 4G7XA 3SHPA 5H86A 4X05A 3BNWA 3GSIA 2H5MA 1OGIA 1PU9A 4G1BA 1BLIA 4B3XA 5KTAA 3V7AA 1FRNA 1XEBA 4GQNA 4XNHC 1OBRA 4Z4ZA 3BCDA 5G20A 1TTTA 1K4JA 4KVOE 4JXQA 1YMEA 4JLYA 4NGMA 2C4UA 4UEFA 4NBSA 2B5GB 1S4MA 1CM0A 4MCRA 1YW4A 1WTHD 3L2NA 4NCZA 2C6CA 5TR9A 2NYQA 3GVJA 4KUBA 3PEIA 2X85A 1DDGA 1K9MD 2AFUA 2GK7A 2P6GA 2HC9A 4YAUA 2ZL5A 4UEZA 2QMUA 4QUZA 1PJ5A 4QHYA 2PLFA 2R9VA 1KZFA 4LUAA 2Z3KA 3EY5A 2FIWA 4LQ6A 3U2QA 2AFXA 4OAEA 4P2NA 4NJQA 2VZLA 3SKBA 4Y49B 1L0CA 2HCJB 3QFCA 1T6XA 5CNPA 3QFRA 3D7GA 3TO9A 3CP2A 1IOFA 2ZTGA 2BVNA 3PUNA 3VMFA 4QVTA 1HEEA 1FNBA 4JZ0A 4O23A 1EXMA 2YNCC 2XEJA 2OOTA 4KKTA 1CPSA 5IX3A 1FDRA 4ASUA 4E2AA 5I4MA 4Y9UA 1AMPA 2JDIA 4JMQA 4RD6A 3KKWA 5F46A 1QVGB 1YGHA 4RPDA 5FNZA 3AVVA 3ZJ0A 4UFWA 2XEIA 5EBVA 2QJ8A 2YWFA 1VQ6B 1Q82D 3FPKA 1BPNA 4W9YA 5AN9A 2QEXB 2XOKA 3WQZA 1Y9KA 1U2RA 3I9SA 2OTJB 3SLNA 4DQKA 1DG1G 4MRIA 3AVXA 2V7VA 4K3NA 1F2OA 4AF6A 1FRQA 4KLVA 3NH5A 4P4EA 1QVFB 4NCNA 3D4UA 1S7KA 3TX8A 2V7TA 2Q04A 2Z3PA 3CDXA 1XMTA 1VQ4B 4ZBGA 2WR8A 4L8AA 1KK3A 4UCMA 1JA1A 3SI1A 1GO2A 2DEAA 2DERA 3I1UA 1HVXA 2EFGA 3UY5A 3IGRA 4TSFA 1N0VC 4CGOA 1G7SA 4OIWA 4IF5A 1S3ZA 4MY3A 2ZZQA 2CNSA 3QSYA 3R1KA 2DYIA 5AG6A 3GVLA 2VNJA 3D68A 4RD4A 1N06A 4XPDC 2X53S 3CMMA 3B7IA 3G6EB 1PKVA 1YLEA 1G7RA 5THXA 1S60A 1X12A 2Q4YA 3GB0A 1LCPA 4P6YA 3W6SA 4OC5A 1KK1A 2F1LA 4WJBA 3CPXA 4Y7CA 3CD6B 1XQBA 1MRZA 1E63A 1D2EA 4ZCLA 2AE6A 1LANA 2ZTNA 4ORFA 4PQAA 2WSAA 5EC4A 3CMAB 4BINA 2HLDA 4F9UA 2ZPAA 2X0KA 4C68A 4ACAA 4R3KA 4Z4TA 2FT0A 3FXTA 2CW5A 1EE3P 3IFEA 4YGOA 5HVFA 2X3UA 5EMIA 1MJBA 4B3FX 4M6GA 2Y0MA 3E20A 3T9YA 2QDXA 1EFTA 1T6YA 1ZG9A 1E64A 3CC4B 2PC1A 2GIVA 1RQRA 4G5GA 2VBUA 3G3SA 2FSRA 3OFNA 4UZEA 1N71A 5TV2A 2NV4A 5HZBA 4M3SA 4G7WA 1VQKB 5HVGA 4F0XA 1IB0A 3H4QA 3SI2A 1S7FA 3CPWB 4K30A 1M4IA 2VZYA 3GLJA 4UBRA 4B48A 1CQXA 2AHOA 3G4SB 1F57A 2BUEA 3EO4A 2CNTA 4OADA 4DYOA 4P9SA 4CGMA 2JEVA 4C43A 2CF4A 4Z1MA 2QIRA 4OC0A 1B2RA 1LAMA 2D4OA 4UF4A 3BJ8A 1AIPA 4Z4SA 2V4DA 1I21A 3LODA 3FPPA 4IK2A 3V76A 1P0HA 4Z4YA 4X8IA 4PC7A 5K8PA 3F5BA 2XNJA 4RPBA 4E0AA 4J0QA 3K9UA 4NGTA 4H6UA 4BBHA 3RY8A 2X7BA 2GK6A 4PAAA 4EWTA 3S6KA 1WWZA 3WYAA 1BLLE 2Z3MA 2R1IA 4DNTB 1NRKA 3JQPA 1F60A 4KS9A 2XZOA 2ZL7A 2Q4VA 2EK9A 3H9NA 2EO8A 4FD4A 3ZZIA 4X5KA 4XN0A 3NE5B 3LWUA 4RCYA 2W6JA 2PIYA 4HPSA 3CW2A 4B12A 4Z4UA 2B4DA 4PXCA 2ZEHA 3R96A 3JVNA 3CXCB 2ZBVA 5KTCA 3A8KA 1COWA 4WZEA 3NE7A 4M6IA 2C1CA 4DK1A 3SJZA 4KSAA 1KJZA 4B47A 1WOOA 4ZYQA 2BCOA 1UWYA 3HLPA 4A30A 1CPXA 4TMVA 5J8CA 4M85A 3E0KA 3CPAA 5HKKA 1P4NA 5A27A 3QFSA 3FYNA 4PK3A 2D3NA 3KQZA 1S0UA 1OB0A 4QV2A 1FNCA 1QH0A 1A2ZA 4TNUA 2DIEA 3FB3A 2DY1A 3CZXA 2B7BA 3DNSA 4F8ZA 1F20A 2ZXIA 2C77A 2Q6KA 1OB2A 4Q38A 1WP6A 3W2HA 4YFJA 2OBTA 4P1VA 5A89A 2F7VA 4XLAA 2WPWA 5IYQA 3D2PA 1BMFA 3MCAA 2FX3A 1XB2A 5H59A 5H5JA 1YREA 2Q44A 1FNDA 2OYNA 3CCRB 3NH8A 1KK2A 5LYLA 2B5OA 4UWJA 1NMTA 1K8AD 3DLJA 1WSVA 2JJ2A 2YWEA 3CTAA 3G05A 1BJKA 1ELLP 4H6ZA 5JBQA 4QFMA 1H8EA 2XZPA 4R76A 4I49A 4PC1A 1Z8WA 4Z4RA 3QE2A 2GLJA 3A1PA 4RDKA 2Q43A 4G1PA 3VWDA 1E1RA 4E0FA 1QSOA 3IWEA 3CC2B 3GVKA 4PXDA 1UD2A 4PC6A 3S9LA 3LNNA 5ELYA 2HDNB 5CPAA 1KUYA 4UZUA 3ZZTA 1SM4A 1TLLA 2BGIA 2VI7A 4Z4WA 3ASSA 2HQYA 4WZKA 3BHXA 1W0JA 3LVBA 2OU2A 4R6TA 3D7FA 1T5EA 7CPAA 3WABA 3PFEA 2NPFA 3GYAA 4NGQA 4TKOB 5HXBA 3NE8A 4XORA 3ZPNA 5HXDA 4RD1A 4PABA 2PJ4A 2QTZA 3DDDA 3PB6X 2EBJA 3CESA 4OKOA 3WC7A 3A35A 3JU4A 2CTCA 4RUHA 5C82A 1NBMA 3B3CA 4XLCA 2CY2A 3RZAA 1X10A 2AJ6A 3CXQA 1IIDA 3B8GA 2PVWA 4CAXA 1GR1A 1HZEA 3KHZA 2C5HA 5JH9A 5J1QA 1CNEA 4XM3A 4P10A 4CYNA 1XFOA 4XLEA 1S7NA 4E8OA 4CS0B 2ODFA 2VEZA 4X07A 3W2EA 5DWMA 2RB7A 3B82A 2VQYA 4EH1A 4ZCIA 1UFHA 4II2A 3WY9A 2O28A 2YWHA 2ZW4A 1T6ZA 4TN1A 1MJAA 4ZCMA 3GY9A 2OBSA 2ZBUA 1TF8A 4PV6A 3EC4A 1TVCA 3W91A 1TKHA 4CAWA 3PGPA 1PJ6A 2D4PA 2PJ9A 4KOYA 4YHBA 3SJGA 2WYRA 3KL9A 4CAFA 2ZL6A 4RD3A 2O4HA 2P6EA 2ZITA 4RD0A 2RC5A 3FKSA 4M53A 3H94A 5F4JA 4GM5A 1YW6A 4BD9A 4AC9A 1XOVA 5B6IA 3WBJA 2OB0A 3WT4A 3QAHA 2P0WA 3B78A 3IWWA 4OOXA 1XE1A 2OTLB 3BLNA 2AFSA 4A94A 2P6FA 4XNFA 3R9GA 4C7IA 5KW9A 2OK7A 1VLOA 2CC2A 3CC7B 3D7DA 3FJUA 2BV3A 4IUSA 1QFYA 2C6PA 4X06A 1QX4A 1ARMA 3F0AA 2I79A 3DGVA 1Q9SA 4ZGNB 1Z2LA 4XR6A 1W0KA 1TF9A 2JDCA 5JGFA 1MABA 2BEIA 3S6FA 4XL9A 1YVKA 1VJSA 2JIZA 4NEXA 4KKSA 2HB6A 1QMUA 1Z8LA 2E1RA 2WSSA 4P45A 3DSBA 5DS0A 3SXOA 4XN3A 3P2HA 2AFMA 2G3TA 1YLOA 1KK0A 2EIXA 2DOGA 4QVJA 3H8FA 5EMNA 2DPTA 3P26A 5BWAB 3PRTA 4Q7JB 1VQNB 4F9VA 5A8AA 4MYUA 1M1KD 2IQ6A 3ISXA 3OEHA 4FD7A 4LC0A 3GIRA 3Q6QA 1QSMA 3Q38A 4P4DA 2OR4A 2GREA 1B23P 4B43A 4MY0A 2PIZA 5AG7A 4FBEA 4OPVA 1BX1A 4A38A 1IYKA 2ZOGA 1Z5RA 4FD6A 3VH9A 2V7QA 4B10A 3H5ZA 1XJOA 2DETA 3BY2A 5F4OA 4YELA 4XD7A 2J8RA 4WZTA 1LFWA 5JPHA 4BPRA 1WOSA 2Q6LA 4B3GA 2FVGA 3PFOA 1QFZA 3VR6A 4KVXA 1E1QA 3WR7A 4RCZA 3IO1A 2Q0YA 1WK4A 3CCLB 3VARA 2BN4A 3PENA 3HUVA 3RO0A 3SJEA 3T53B 1VQ8B 4MMOA 5K8OA 2VNKA 3OPOA 3N7ZA 1G7TA 1VQ9B 2GANA 1JA0A 4XLHA 3W2GA 1M1DA 1Z8TA 1KMHA 3TO6A 2EUIA 1N05A 3CCSB 3F8KA 3WNCA 5LYFA 4XPDB 4P4JA 3A3BA 1EFCA 4XQFA 4KOVA 3H8GA 4YAOA 2FCKA 4B44A 3A8IA 1VQLB 5F47A 2WZNA 3VATA 5G1ZA 1Y0RA 2VBTA 3N5FA 1NE9A 4ZY2A 1BX0A 1V5VA 1CBXA 1RTQA 2J8NA 5G22A 3OWCA 3P27A 1BPLA 3B35A 4CGNA 2XNDA 3MGDA 3CXSA 3SLDA 1KUXA 3TE4A 4N3GA 3NH4A 4FD5A 4B14A 2WJVA 4M2LA 2ZEMA 3MN8A 2BO9A 1OGJA 3S6GA 2POKA 3CCVB 2V8VA 3PZJA 2BOAA 2QGGA 2DEUA 1GJRA 2WPXA 2IL4A 2Q6IA 2VYQA 4A2ZA 3EFAA 4OMEA 1PJ7A 2QVPA 4MFQA 4RM0A 1BPMA 3V8IA 1CX8A 2GJKA 1ZLHA 3LQEA 4NGRA 3TO7A 3ASRA 1SKQA 4JWPA 3K2KA 2A4NA 1KWMA 1QQ9A 5BSYA 2VNIA 3IEHA 4PSXA 1ZG8A 1NSLA 2PSWA 1G7CA 2ZENA 2ZW7A 4P3IA 3B2YA 4QB9A 4XMYA 4AVZA 2PJ7A 1XBUA 4R71A 3DR6A 1Q7LA 3PP9A 4DQLA 3JQQA 2ARHA 2OH1A 1NJID 2W6IA 2GPJA 4JXRA 3LD2A 4J3GA 4WZLA 2QE7A 1FNOA 3FIXA 2KVOA 2JBJA 1KC8D 2PJAA 2PJ6A 4OC3A 4HNYB 4AVBA 2FL4A 4P4BA 3KEWA 3A9LA 2ZZEA 2YWGA 1YJWB 2BGJA 2PIAA 5IK2A 3B3WA 5K8NA 4FWUA 3ZBTA 4U9YA 4OOVA 1YITB 1VKCA 1DARA 4ZX8A 4AVCA 2C5BA 3ZBUA 3FEEA 3LACA 1UMKA 3PA2A 1GAWA 1QUFA 2JBKA 4RLZA 4DNCA 1WPCA 4II9A 4P25A 2BL1A 5KSWB 3GKRA 1JWQA 4FK8A 3WXMA 1YI2B 3BJ7A 1N08A 2M5SA 5E6TA 1JQGA 4XOPA 2ZEDA 5HZAA 1WORA 1B87A 1M4LA 3S6HA 4N3NA 1VGYA 1QSRA 4MJ8A 2DXQA 2Z3NA 2ATRA 4H89A 2Z3LA 1RO5A 2R6HA 3CMEB 4UA3A 3RNZA 4KOWA 2Q51A 1TUIA 4L89A 4QUSA 3HAGA 2PCUA 4RDJA 1SQHA 3LO8A 1EP1B 3OKXA 3GIUA 1ZLIA 2VBVA 4MCSA 2J9AA 5H84A 5E96A 8CPAA 4RD2A 2V31A 4MFZA 5AGEA 5DWNA 4P4FA 4EFDA 4NGPA 1BQEA 1KTVA 4H9GA 3C26A 4UZFA 1IHMA 4P22A 3WBKA 2CNDA 4XLFA 2GE3A 1Q2YA 1KD1D 4UFVA 4CQJA 2PR1A 3ASTA 1VHOA 4X0CA 3OJWA 4WWVA 4PK2A 2JEWA 4YRHA 5I0CA 4RJLA 4LX9A 4PPZA 1IJFA 2YNDA 1N0UA 4TMWA 2I00A 3CB4A 3FJOA 1JNYA 2K5TA 4PXBA 2ZEEA 2GFQA 1R5OA 4OLLA 2Z6BD 4XNHB 4ZGQB 3G71B 4EMEA 2X8KA 3JRUA 2PMDA 1Q2CA 1S5KA 2BM1A 4NGNA 4UCPA 2F43A 4L8JA 1I7PA 3BCFA 1YJ9B 2QECA 1ZM9A 3V7ZA 1HA3A 4UAJA 4UIBA 4A37A 2JLMA 1DDIA 4AVAA 3D7HA 2ZXVA 1GAQA 3ZZ0A 1AYEA 1Y9WA 1NDHA 4MI4A 1M44A 2V7XA 4ZX9A 2I3CA 4Y9RA 3KR5A 3D66A 2HMAA 3TTHA 4B5PB 2RFHA 4F6AA 1MK4A 1ZM4A 4FXUA 3OAAA 2CNMA 2ZXHA 1YX0A 1H8HA 5HVHA 2D9RA 3D8PA 5GV8A 2B58A 3RBUA 2G9DA 1KQSB 3B3SA 3DDYA 3OZUA 2PRQA 1VQ7B 3B8HA 1BO4A 5J35A 1IICA 4X7EA 1ZM2A 2ZW5A 4MHYA 5IB0A 4MFPA 5BSXA 4JYWA 4P26A 4KZTA 2XEFA 2YNCA 1ZG7A 1FX0A 5J8FA 2C27A 4KLWA 4CGLA 1I1DA 2EWBA 1WU8A 4MCQA 4MBUA 3H8EA 4HIZA 2XEXA 2PJCA 3BC9A 3AGQA 4B6ZA 3I1FA 5LRKA 1OHHA 4FUUA 4B5OA 3Q39A 2Q6OA 2REEA 3FRMA 4P44A 2GQFA 6CPAA 3TC8A 4EVYA 2PJ8A 4ONUA 4OC4A 1W87A 3I55B 1TIQA 1OB5A 3FF3A 4KOSA 2VNHA 3KR4A 1QUEA 2O53A 1E62A 1ARLA 1D1NA 4R7MA 4AB7A 1VF7A 3OEEA 2I1LA 1E3XA 3ISZA 3OE7A 3FEDA 3S9MA 4NFRA 2VBSA 1R57A 1N8RD 1AMOA
chains in the Genus database with same CATH topology
1ZG9A 2V8GA 4MMOA 5K8OA 3GUXA 1VIXA 4OC2A 5IB9A 2ANPA 4IHMA 2AFWA 2PE3A 3SI0A 5HVGA 2GLFA 3SI2A 3V38A 5LYFA 3LMSA 4P4JA 2PJ0A 3GLJA 3NFZA 1VHEA 1F57A 3H8GA 4ZY0A 4DYOA 3B3VA 1Y7EA 2CF4A 2WZNA 4OC0A 3VATA 1LAMA 4UF4A 1Y0RA 3WC5A 4OC1A 3N5FA 4IK2A 4CPAA 1XRYA 4X8IA 4ZY2A 2PVVA 1CBXA 1RTQA 5K8PA 3BI0A 2C6GA 2ABZA 4NGTA 5K8MA 3B35A 4TWEA 1LAPA 3NA6A 2PJ2A 3NH4A 3PBBA 4Q7AA 2ZEMA 4EWTA 3MN8A 2BO9A 2POKA 2V8VA 1BLLE 2BOAA 2V77A 3FMCA 1PCAA 1R43A 1DE4C 2EK9A 5F09A 1DTDA 3MRUA 4OMEA 1TKFA 2QVPA 3LWUA 1BPMA 3SJXA 1CX8A 3PB7X 1ZLHA 2PIYA 4NGRA 5LRGA 1CG2A 2AFZA 4DJLA 4PXCA 2ZEHA 3K2KA 1PYTB 1KWMA 1QQ9A 4X3RA 3IEHA 1ZG8A 1IY7A 3KQXA 2C1CA 2ZENA 1TXRA 3IJ3A 3PB9X 4Z65A 3B2YA 5LYDA 2GU2A 2PJ7A 4ZYQA 5CBMA 1XBUA 1Q7LA 2BCOA 1UWYA 3HLPA 1CPXA 1HDUA 2PJ1A 3KI9A 3CPAA 2IJZA 2IMOA 1FNOA 1ELMP 2JBJA 3PBEA 3KQZA 1NSAA 1IGBA 2PJAA 2PJ6A 4OC3A 4X2TA 4TNUA 4P4BA 4F8ZA 3B3WA 5K8NA 4FWUA 2F7VA 2V8HA 3FX6A 4OIDA 4ZX8A 2CIJA 3FEEA 3NH8A 5LYLA 2V8DA 2JBKA 3DLJA 2VL1A 1OBRA 1ELLP 2F8HA 3K9TA 4R76A 1CP6A 4DUKA 4R8FA 1YMEA 2GLJA 1JQGA 3S9NA 4NGMA 2ZEDA 2Q43A 4UEFA 2ZELA 4MHZA 4H2KA 4G1PA 1M4LA 4MCRA 1VGYA 1YW4A 3L2NA 3WC6A 4YU9A 4ZY1A 2C6CA 4PXDA 2NYQA 3S9LA 2ZEPA 5ELYA 3RAMA 5CPAA 4KSIA 3PEIA 2AFUA 2HC9A 4UEZA 2Q51A 2PJ3A 3IIBA 2PCUA 4NGSA 3BHXA 1XMBA 1ZLIA 4R6TA 3D7FA 4MCSA 7CPAA 3WABA 3PFEA 2J9AA 4NGQA 8CPAA 5LRJA 4P4FA 4EFDA 4NGPA 5HXDA 2PJBA 3FVLA 2AFXA 2PJ4A 3PB6X 2PJ5A 4NJQA 4OKOA 3WC7A 2CTCA 4RUHA 2AFOA 1F2PA 3FECA 3B3CA 3D7GA 3RZAA 4MHNA 3BI1A 1VHOA 4WWVA 2JEWA 2PVWA 3KHZA 5JH9A 5J1QA 1HDQA 1HEEA 4P10A 4PPZA 1XFOA 4JZ0A 4O23A 3QNVA 2XEJA 3KZWA 2OOTA 2RB7A 1CPSA 4PXBA 2ZEEA 4A39A 5I4MA 4FAIA 1AMPA 4UIAA 1TF8A 4YWYA 4EMEA 1TKHA 3JRUA 4MHPA 2PJ9A 4NGNA 3SJGA 2WYRA 3KL9A 2XEIA 2O4HA 3KASA 2QJ8A 3V7ZA 1R3NA 1BPNA 4W9YA 4UIBA 4A37A 4GM5A 1YW6A 2CTBA 4BD9A 1CP7A 3D7HA 4LQGA 1YSJA 1AYEA 3WT4A 3IWWA 3IC1A 4MRIA 2AFSA 4ZX9A 2ZOFA 2I3CA 3KR5A 4A94A 5D29A 3D66A 4K3NA 3FH4A 4MCPA 4UEEA 1F2OA 2RFHA 3NH5A 4P4EA 1GYTA 2ZEFA 3D7DA 3FJUA 2XEGA 3D4UA 4NJRA 3PB4X 1FT7A 3TX8A 1H8LA 3CDXA 2C6PA 5HVHA 1ARMA 3DGVA 4IAVA 4OP4A 1BAVA 1Z2LA 2Q4ZA 2EK8A 1TF9A 3SI1A 2DEAA 5JGFA 3I1UA 3RBUA 2G9DA 3B3SA 2HB6A 1Y0YA 1QMUA 4PXEA 1Z8LA 2PRQA 4P45A 4OIWA 5DS0A 2AFMA 3B3TA 1YLOA 3SJFA 3CT9A 4MHYA 2QYVA 4JYWA 3H8FA 3D68A 2XEFA 4ZI6A 3B7IA 2ZEGA 3D67A 3PRTA 1ZG7A 4F9VA 2IQ6A 3ISXA 3KHXA 3GB0A 1LCPA 4P6YA 2EWBA 4MCQA 3H8EA 1TKJA 4OC5A 4WJBA 3CPXA 2PJCA 4P4DA 2OR4A 2GREA 4B6ZA 2NSMA 5LRKA 2PIZA 4FBEA 4FUUA 1LANA 4A38A 4PQAA 5JM6A 2ZOGA 1Z5RA 3VH9A 4P44A 4F9UA 6CPAA 3TC8A 3T8WA 1XJOA 4ONWA 2PJ8A 4OC4A 3PB8X 3KGQA 4P4IA 1EE3P 2ZEOA 5D8NA 3FF3A 4MXUA 3KR4A 3IFEA 2O53A 5HVFA 1LFWA 1ARLA 4R7MA 2FVGA 5LYIA 3PFOA 1LOKA 3IO1A 5THWA 3ISZA 3FEDA 3S9MA 4NFRA 3VARA 3HUVA 4AXVA 3SJEA 3BXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZG9 A;  2V8G A;  4MMO A;  5K8O A;  3GUX A;  1VIX A;  4OC2 A;  5IB9 A;  2ANP A;  4IHM A;  2AFW A;  2PE3 A;  3SI0 A;  5HVG A;  2GLF A;  3SI2 A;  3V38 A;  5LYF A;  3LMS A;  4P4J A;  2PJ0 A;  3GLJ A;  3NFZ A;  1VHE A;  1F57 A;  3H8G A;  4ZY0 A;  4DYO A;  3B3V A;  1Y7E A;  2CF4 A;  2WZN A;  4OC0 A;  3VAT A;  1LAM A;  4UF4 A;  1Y0R A;  3WC5 A;  4OC1 A;  3N5F A;  4IK2 A;  4CPA A;  1XRY A;  4X8I A;  4ZY2 A;  2PVV A;  1CBX A;  1RTQ A;  5K8P A;  3BI0 A;  2C6G A;  2ABZ A;  4NGT A;  5K8M A;  3B35 A;  4TWE A;  1LAP A;  3NA6 A;  2PJ2 A;  3NH4 A;  3PBB A;  4Q7A A;  2ZEM A;  4EWT A;  3MN8 A;  2BO9 A;  2POK A;  2V8V A;  1BLL E;  2BOA A;  2V77 A;  3FMC A;  1PCA A;  1R43 A;  1DE4 C;  2EK9 A;  5F09 A;  1DTD A;  3MRU A;  4OME A;  1TKF A;  2QVP A;  3LWU A;  1BPM A;  3SJX A;  1CX8 A;  3PB7 X;  1ZLH A;  2PIY A;  4NGR A;  5LRG A;  1CG2 A;  2AFZ A;  4DJL A;  4PXC A;  2ZEH A;  3K2K A;  1PYT B;  1KWM A;  1QQ9 A;  4X3R A;  3IEH A;  1ZG8 A;  1IY7 A;  3KQX A;  2C1C A;  2ZEN A;  1TXR A;  3IJ3 A;  3PB9 X;  4Z65 A;  3B2Y A;  5LYD A;  2GU2 A;  2PJ7 A;  4ZYQ A;  5CBM A;  1XBU A;  1Q7L A;  2BCO A;  1UWY A;  3HLP A;  1CPX A;  1HDU A;  2PJ1 A;  3KI9 A;  3CPA A;  2IJZ A;  2IMO A;  1FNO A;  1ELM P;  2JBJ A;  3PBE A;  3KQZ A;  1NSA A;  1IGB A;  2PJA A;  2PJ6 A;  4OC3 A;  4X2T A;  4TNU A;  4P4B A;  4F8Z A;  3B3W A;  5K8N A;  4FWU A;  2F7V A;  2V8H A;  3FX6 A;  4OID A;  4ZX8 A;  2CIJ A;  3FEE A;  3NH8 A;  5LYL A;  2V8D A;  2JBK A;  3DLJ A;  2VL1 A;  1OBR A;  1ELL P;  2F8H A;  3K9T A;  4R76 A;  1CP6 A;  4DUK A;  4R8F A;  1YME A;  2GLJ A;  1JQG A;  3S9N A;  4NGM A;  2ZED A;  2Q43 A;  4UEF A;  2ZEL A;  4MHZ A;  4H2K A;  4G1P A;  1M4L A;  4MCR A;  1VGY A;  1YW4 A;  3L2N A;  3WC6 A;  4YU9 A;  4ZY1 A;  2C6C A;  4PXD A;  2NYQ A;  3S9L A;  2ZEP A;  5ELY A;  3RAM A;  5CPA A;  4KSI A;  3PEI A;  2AFU A;  2HC9 A;  4UEZ A;  2Q51 A;  2PJ3 A;  3IIB A;  2PCU A;  4NGS A;  3BHX A;  1XMB A;  1ZLI A;  4R6T A;  3D7F A;  4MCS A;  7CPA A;  3WAB A;  3PFE A;  2J9A A;  4NGQ A;  8CPA A;  5LRJ A;  4P4F A;  4EFD A;  4NGP A;  5HXD A;  2PJB A;  3FVL A;  2AFX A;  2PJ4 A;  3PB6 X;  2PJ5 A;  4NJQ A;  4OKO A;  3WC7 A;  2CTC A;  4RUH A;  2AFO A;  1F2P A;  3FEC A;  3B3C A;  3D7G A;  3RZA A;  4MHN A;  3BI1 A;  1VHO A;  4WWV A;  2JEW A;  2PVW A;  3KHZ A;  5JH9 A;  5J1Q A;  1HDQ A;  1HEE A;  4P10 A;  4PPZ A;  1XFO A;  4JZ0 A;  4O23 A;  3QNV A;  2XEJ A;  3KZW A;  2OOT A;  2RB7 A;  1CPS A;  4PXB A;  2ZEE A;  4A39 A;  5I4M A;  4FAI A;  1AMP A;  4UIA A;  1TF8 A;  4YWY A;  4EME A;  1TKH A;  3JRU A;  4MHP A;  2PJ9 A;  4NGN A;  3SJG A;  2WYR A;  3KL9 A;  2XEI A;  2O4H A;  3KAS A;  2QJ8 A;  3V7Z A;  1R3N A;  1BPN A;  4W9Y A;  4UIB A;  4A37 A;  4GM5 A;  1YW6 A;  2CTB A;  4BD9 A;  1CP7 A;  3D7H A;  4LQG A;  1YSJ A;  1AYE A;  3WT4 A;  3IWW A;  3IC1 A;  4MRI A;  2AFS A;  4ZX9 A;  2ZOF A;  2I3C A;  3KR5 A;  4A94 A;  5D29 A;  3D66 A;  4K3N A;  3FH4 A;  4MCP A;  4UEE A;  1F2O A;  2RFH A;  3NH5 A;  4P4E A;  1GYT A;  2ZEF A;  3D7D A;  3FJU A;  2XEG A;  3D4U A;  4NJR A;  3PB4 X;  1FT7 A;  3TX8 A;  1H8L A;  3CDX A;  2C6P A;  5HVH A;  1ARM A;  3DGV A;  4IAV A;  4OP4 A;  1BAV A;  1Z2L A;  2Q4Z A;  2EK8 A;  1TF9 A;  3SI1 A;  2DEA A;  5JGF A;  3I1U A;  3RBU A;  2G9D A;  3B3S A;  2HB6 A;  1Y0Y A;  1QMU A;  4PXE A;  1Z8L A;  2PRQ A;  4P45 A;  4OIW A;  5DS0 A;  2AFM A;  3B3T A;  1YLO A;  3SJF A;  3CT9 A;  4MHY A;  2QYV A;  4JYW A;  3H8F A;  3D68 A;  2XEF A;  4ZI6 A;  3B7I A;  2ZEG A;  3D67 A;  3PRT A;  1ZG7 A;  4F9V A;  2IQ6 A;  3ISX A;  3KHX A;  3GB0 A;  1LCP A;  4P6Y A;  2EWB A;  4MCQ A;  3H8E A;  1TKJ A;  4OC5 A;  4WJB A;  3CPX A;  2PJC A;  4P4D A;  2OR4 A;  2GRE A;  4B6Z A;  2NSM A;  5LRK A;  2PIZ A;  4FBE A;  4FUU A;  1LAN A;  4A38 A;  4PQA A;  5JM6 A;  2ZOG A;  1Z5R A;  3VH9 A;  4P44 A;  4F9U A;  6CPA A;  3TC8 A;  3T8W A;  1XJO A;  4ONW A;  2PJ8 A;  4OC4 A;  3PB8 X;  3KGQ A;  4P4I A;  1EE3 P;  2ZEO A;  5D8N A;  3FF3 A;  4MXU A;  3KR4 A;  3IFE A;  2O53 A;  5HVF A;  1LFW A;  1ARL A;  4R7M A;  2FVG A;  5LYI A;  3PFO A;  1LOK A;  3IO1 A;  5THW A;  3ISZ A;  3FED A;  3S9M A;  4NFR A;  3VAR A;  3HUV A;  4AXV A;  3SJE A;  3BXM A; 
#chains in the Genus database with same CATH topology
 1K28 D;  2V8G A;  4KSF A;  5AG5 A;  1MJ9 A;  3P2F A;  2ZZF A;  3GUX A;  1VIX A;  4OC2 A;  2WUU A;  4X7D A;  4CAE A;  1R5N A;  2AFW A;  1EFU A;  3SI0 A;  1ZUN B;  3J81 k;  1I18 A;  3SXN A;  1I8D A;  2OK8 A;  2B3U A;  1Q86 D;  1VHE A;  5JQ4 A;  1UD4 A;  1Z9U A;  4ZY0 A;  3FNC A;  2BF4 A;  1U6M A;  2FS5 A;  2RC6 A;  3I3G A;  1Y7E A;  4PSW A;  4UWI A;  2GJR A;  3WC5 A;  2Z0Z A;  4OC1 A;  1QG0 A;  1XRY A;  4KUA A;  1JB9 A;  5KTD A;  5KNL A;  1Y7R A;  5A88 A;  2ABZ A;  4LBZ A;  5K8M A;  4TWE A;  3NA6 A;  4HKF A;  4A95 A;  2PJ2 A;  2CRV A;  1FY7 A;  4Q7A A;  5F48 A;  4U9U A;  1Q2D A;  3A3G A;  4R87 A;  4OP7 A;  5GCN A;  1Z4R A;  4A32 A;  2Z11 A;  4X7C A;  4LBY A;  5FIU A;  3AVT A;  3ZZU A;  4TMZ A;  1M90 D;  2EVN A;  3FMC A;  4M6H A;  1YIJ B;  1YR0 A;  4Y49 C;  2Z3O A;  5G21 A;  1DE4 C;  5F09 A;  3QB8 A;  2C4T A;  3MRU A;  3D26 A;  2HUZ A;  3PB7 X;  1S7L A;  3VO1 A;  1CG2 A;  2X6X A;  4NNJ A;  4DJL A;  4R57 A;  1XE4 A;  4XKV A;  4M4S A;  3Q3A A;  4P3Y A;  4MFL A;  4RDL A;  1K73 D;  4BMH A;  4PGO A;  1IY7 A;  1Q81 D;  3CP8 A;  4KOX A;  1TXR A;  3IJ3 A;  2FE7 A;  3ZC3 A;  2GU2 A;  5CBM A;  2OZH A;  1GVH A;  3TT2 A;  4YEJ A;  2PJ1 A;  3KI9 A;  4C2Y A;  2KCW A;  1YX2 A;  2Q7S A;  2CBX A;  2IMO A;  1QGZ A;  1YQE A;  3OW2 B;  1ELO A;  1NSA A;  1IGB A;  4YAW A;  4QBJ A;  1QGA A;  4NF1 A;  1QSN A;  4KOR A;  3CCM B;  2DF5 A;  2Z10 A;  4HNW B;  3ZIA A;  4AG7 A;  3W5H A;  4DK0 A;  4RI1 A;  3ONY A;  5DN6 A;  2V8H A;  3FX6 A;  4OID A;  2D74 A;  3OOC A;  1A8P A;  1E43 A;  2CIJ A;  2D3L A;  2X6Y A;  2V8D A;  2B4B A;  1IOI A;  2QN6 A;  4KOT A;  4R3L A;  4YXW A;  4C2Z A;  4G6I A;  1W9X A;  1KRH A;  5TRD A;  1OZP A;  2VL1 A;  2VXK A;  2G3A A;  1EFR A;  1KZL A;  2F8H A;  4YAF A;  3K9T A;  1CP6 A;  1M4D A;  2OZU A;  4C2X A;  4DUK A;  4R8F A;  4CAV A;  1RXT A;  3JUW A;  4M0L A;  5L46 A;  2JJ1 A;  3S9N A;  5IYP A;  4F0Y A;  4OOS A;  2ZEL A;  4MHZ A;  3A8J A;  4H2K A;  1AUG A;  4PC2 A;  2P3M A;  3WC6 A;  4YU9 A;  2F5I A;  4ZY1 A;  1NB0 A;  2NMT A;  2YNE A;  2ZEP A;  4B5P A;  3RAM A;  4R9M A;  4KSI A;  2PR8 A;  1UD5 A;  4QC6 A;  4AF7 A;  2X6W A;  1UD6 A;  2QA4 B;  4XKW A;  1CJW A;  3AVU A;  3PUM A;  2PJ3 A;  3IIB A;  1XIX A;  4NGS A;  3ZUG A;  4XOT A;  1W34 A;  3PA1 A;  1EP3 B;  3WNB A;  2PRB A;  4ZV4 A;  1XMB A;  2REF A;  2B4D B;  4RS2 A;  1PUA A;  3BY1 A;  5ISV A;  3WND A;  3I56 B;  5LRJ A;  4ROX A;  2PJB A;  3DR8 A;  3FVL A;  2XZL A;  3IWG A;  5F49 A;  1P4M A;  2PJ5 A;  4RN7 A;  3FBU A;  1B6B A;  4B4D A;  1KUV A;  5HH1 A;  2BPO A;  2AFO A;  3VNU A;  1F2P A;  3FEC A;  4FWT A;  1YHQ B;  3T56 B;  3CCU B;  3BI1 A;  4MHN A;  2C78 A;  3D2M A;  3AVY A;  2XNC A;  1W2B B;  5J3O A;  3AGP A;  1JJ2 B;  3GQB A;  1HDQ A;  1BOB A;  3VWE A;  2CXA A;  1ZO0 A;  3ONU A;  3QNV A;  1VLY A;  3KZW A;  3CCE B;  2BSW A;  3TFY A;  4FN5 A;  1CNF A;  4A39 A;  3TOB A;  4FAI A;  4UIA A;  4ZGY B;  3LQ6 A;  4YWY A;  2GJP A;  1R5B A;  5FA6 A;  4LBV A;  3JQR A;  3BQJ A;  4MHP A;  2QML A;  1WSR A;  4TMX A;  2VJI A;  1EWY A;  4XPK A;  4MYT A;  3KAS A;  1H85 A;  3R9E A;  4C7H A;  2WZP P;  5DSZ A;  3VO2 A;  1R3N A;  3TCV A;  1SKY B;  2CTB A;  1E79 A;  1CP7 A;  2QTL A;  4LQG A;  1YSJ A;  2DPS A;  3TOA A;  3EXN A;  5IYW A;  3BH4 A;  3IC1 A;  3QAY A;  2ZOF A;  1I12 A;  5D29 A;  4LBW A;  1W35 A;  3VNV A;  3FH4 A;  4MCP A;  4UEE A;  4DNR B;  1GYT A;  4Z4V A;  2FXF A;  2ZEF A;  2XEG A;  4NJR A;  3PB4 X;  1IB1 E;  1FT7 A;  3R9F A;  1H8L A;  1IYL A;  1QGY A;  1M4G A;  1N07 A;  1J9Z A;  2HV2 A;  4IAV A;  4OP4 A;  1BAV A;  5A28 A;  2Q4Z A;  2EK8 A;  2G0B A;  2Q7B A;  4A31 A;  3U6B A;  1FNM A;  3OJX A;  3RYO A;  3W5U A;  3R6K A;  1Y0Y A;  3CCJ B;  2V7W A;  4PXE A;  2C2W A;  1GHE A;  2JDD A;  3B3T A;  5FL7 A;  1J4J A;  4CYP A;  1WDT A;  4UFX A;  3SJF A;  3CT9 A;  1NB9 A;  2WPD A;  2QYV A;  2B3V A;  4AG9 A;  1QFJ A;  3OP1 A;  3R95 A;  4ZI6 A;  1ZM3 A;  1UD3 A;  4QVA A;  2ZEG A;  3D67 A;  1UD8 A;  2VJJ A;  4XPL A;  2WJY A;  3KHX A;  2YGW A;  2VBQ A;  2OZG A;  1TKJ A;  4ACB A;  4JD6 A;  2NSM A;  5GV7 A;  1VHS A;  2PQ8 A;  4MHD A;  4II3 A;  5JM6 A;  1YK3 A;  1VQ5 B;  4K1X A;  5IYN A;  1D8T A;  1IJE A;  3T8W A;  1H42 A;  4TT3 A;  2ZW6 A;  3IU2 A;  4ONW A;  3PB8 X;  2F1M A;  1S72 B;  3KGQ A;  4P4I A;  1IU8 A;  5AG4 A;  2ZEO A;  5D8N A;  3JTK A;  4U9Z A;  4MXU A;  1YVO A;  3D3S A;  4WQM A;  4PC3 A;  5LYI A;  4HE5 A;  2J7K A;  1LOK A;  4HNX B;  5IYR A;  5THW A;  2OBR A;  4MFK A;  2B7C A;  4AXV A;  3BXM A;  3U6K A;  3W6X A;  4A33 A;  1WOP A;  2JN9 A;  2LZJ A;  4CRY B;  4IW3 B;  5CDF A;  4CYQ A;  2BMW A;  5IB9 A;  5F4M A;  2ANP A;  1EP2 B;  4IHM A;  4OPS A;  2PDO A;  3W2F A;  4M1K A;  4GS4 A;  2PE3 A;  4KKU A;  2GLF A;  3V38 A;  2R8V A;  3LMS A;  2PJ0 A;  1Z4E A;  4NSQ A;  4Q36 A;  2DCU A;  3NFZ A;  3R6J A;  4YAL A;  2CK3 A;  3B3V A;  4TMT A;  4NXY A;  3CCQ B;  2VZZ A;  4MFJ A;  4G1V A;  2E1B A;  3CXP A;  3OZV A;  4GXH A;  4JJX A;  4CPA A;  1E3Z A;  2BSA A;  3MMP A;  2PVV A;  4HE6 A;  3T51 B;  1LRZ A;  3BI0 A;  1YJN B;  2C6G A;  3IU1 A;  4KVM E;  1LAP A;  1RQP A;  3CRZ A;  3PBB A;  1VQM B;  3OZW A;  4CRZ B;  3ES9 A;  5IV0 A;  5FO1 A;  4B13 A;  2FIA A;  4U5Y A;  2R7H A;  1Q7Y D;  2B5G A;  3SEJ A;  4CYO A;  5LMZ A;  4P6V F;  2V77 A;  3W5V A;  1Z8X A;  3OW7 A;  1PCA A;  2J8M A;  5C88 A;  1R43 A;  4CGP A;  1DTD A;  1V0E A;  1TKF A;  4P12 A;  3SJX A;  5LRG A;  2RC4 A;  2AFZ A;  1ON0 A;  3Q6R A;  3ASP A;  1PYT B;  4X3R A;  2V7U A;  2BM0 A;  5HMN A;  4X7F A;  2XGJ A;  3KQX A;  4XON A;  3PB9 X;  3E1Y E;  3ASQ A;  4Z65 A;  5LYD A;  2R98 A;  3T90 A;  3PVD A;  3AVW A;  5FVJ A;  4KOU A;  1V0C A;  1HDU A;  3SJP A;  4B11 A;  2IJZ A;  5FO0 A;  3G8W A;  2ZZG A;  4F7D A;  1ELM P;  1XF8 A;  3PBE A;  4C0S A;  1VQO B;  1QST A;  2F4N A;  4X2T A;  1V0F A;  4UCN A;  1VQP B;  5TY0 A;  3W2I A;  3MHP A;  4OPO A;  3QFT A;  4G7X A;  3SHP A;  5H86 A;  4X05 A;  3BNW A;  3GSI A;  2H5M A;  1OGI A;  1PU9 A;  4G1B A;  1BLI A;  4B3X A;  5KTA A;  3V7A A;  1FRN A;  1XEB A;  4GQN A;  4XNH C;  1OBR A;  4Z4Z A;  3BCD A;  5G20 A;  1TTT A;  1K4J A;  4KVO E;  4JXQ A;  1YME A;  4JLY A;  4NGM A;  2C4U A;  4UEF A;  4NBS A;  2B5G B;  1S4M A;  1CM0 A;  4MCR A;  1YW4 A;  1WTH D;  3L2N A;  4NCZ A;  2C6C A;  5TR9 A;  2NYQ A;  3GVJ A;  4KUB A;  3PEI A;  2X85 A;  1DDG A;  1K9M D;  2AFU A;  2GK7 A;  2P6G A;  2HC9 A;  4YAU A;  2ZL5 A;  4UEZ A;  2QMU A;  4QUZ A;  1PJ5 A;  4QHY A;  2PLF A;  2R9V A;  1KZF A;  4LUA A;  2Z3K A;  3EY5 A;  2FIW A;  4LQ6 A;  3U2Q A;  2AFX A;  4OAE A;  4P2N A;  4NJQ A;  2VZL A;  3SKB A;  4Y49 B;  1L0C A;  2HCJ B;  3QFC A;  1T6X A;  5CNP A;  3QFR A;  3D7G A;  3TO9 A;  3CP2 A;  1IOF A;  2ZTG A;  2BVN A;  3PUN A;  3VMF A;  4QVT A;  1HEE A;  1FNB A;  4JZ0 A;  4O23 A;  1EXM A;  2YNC C;  2XEJ A;  2OOT A;  4KKT A;  1CPS A;  5IX3 A;  1FDR A;  4ASU A;  4E2A A;  5I4M A;  4Y9U A;  1AMP A;  2JDI A;  4JMQ A;  4RD6 A;  3KKW A;  5F46 A;  1QVG B;  1YGH A;  4RPD A;  5FNZ A;  3AVV A;  3ZJ0 A;  4UFW A;  2XEI A;  5EBV A;  2QJ8 A;  2YWF A;  1VQ6 B;  1Q82 D;  3FPK A;  1BPN A;  4W9Y A;  5AN9 A;  2QEX B;  2XOK A;  3WQZ A;  1Y9K A;  1U2R A;  3I9S A;  2OTJ B;  3SLN A;  4DQK A;  1DG1 G;  4MRI A;  3AVX A;  2V7V A;  4K3N A;  1F2O A;  4AF6 A;  1FRQ A;  4KLV A;  3NH5 A;  4P4E A;  1QVF B;  4NCN A;  3D4U A;  1S7K A;  3TX8 A;  2V7T A;  2Q04 A;  2Z3P A;  3CDX A;  1XMT A;  1VQ4 B;  4ZBG A;  2WR8 A;  4L8A A;  1KK3 A;  4UCM A;  1JA1 A;  3SI1 A;  1GO2 A;  2DEA A;  2DER A;  3I1U A;  1HVX A;  2EFG A;  3UY5 A;  3IGR A;  4TSF A;  1N0V C;  4CGO A;  1G7S A;  4OIW A;  4IF5 A;  1S3Z A;  4MY3 A;  2ZZQ A;  2CNS A;  3QSY A;  3R1K A;  2DYI A;  5AG6 A;  3GVL A;  2VNJ A;  3D68 A;  4RD4 A;  1N06 A;  4XPD C;  2X53 S;  3CMM A;  3B7I A;  3G6E B;  1PKV A;  1YLE A;  1G7R A;  5THX A;  1S60 A;  1X12 A;  2Q4Y A;  3GB0 A;  1LCP A;  4P6Y A;  3W6S A;  4OC5 A;  1KK1 A;  2F1L A;  4WJB A;  3CPX A;  4Y7C A;  3CD6 B;  1XQB A;  1MRZ A;  1E63 A;  1D2E A;  4ZCL A;  2AE6 A;  1LAN A;  2ZTN A;  4ORF A;  4PQA A;  2WSA A;  5EC4 A;  3CMA B;  4BIN A;  2HLD A;  4F9U A;  2ZPA A;  2X0K A;  4C68 A;  4ACA A;  4R3K A;  4Z4T A;  2FT0 A;  3FXT A;  2CW5 A;  1EE3 P;  3IFE A;  4YGO A;  5HVF A;  2X3U A;  5EMI A;  1MJB A;  4B3F X;  4M6G A;  2Y0M A;  3E20 A;  3T9Y A;  2QDX A;  1EFT A;  1T6Y A;  1ZG9 A;  1E64 A;  3CC4 B;  2PC1 A;  2GIV A;  1RQR A;  4G5G A;  2VBU A;  3G3S A;  2FSR A;  3OFN A;  4UZE A;  1N71 A;  5TV2 A;  2NV4 A;  5HZB A;  4M3S A;  4G7W A;  1VQK B;  5HVG A;  4F0X A;  1IB0 A;  3H4Q A;  3SI2 A;  1S7F A;  3CPW B;  4K30 A;  1M4I A;  2VZY A;  3GLJ A;  4UBR A;  4B48 A;  1CQX A;  2AHO A;  3G4S B;  1F57 A;  2BUE A;  3EO4 A;  2CNT A;  4OAD A;  4DYO A;  4P9S A;  4CGM A;  2JEV A;  4C43 A;  2CF4 A;  4Z1M A;  2QIR A;  4OC0 A;  1B2R A;  1LAM A;  2D4O A;  4UF4 A;  3BJ8 A;  1AIP A;  4Z4S A;  2V4D A;  1I21 A;  3LOD A;  3FPP A;  4IK2 A;  3V76 A;  1P0H A;  4Z4Y A;  4X8I A;  4PC7 A;  5K8P A;  3F5B A;  2XNJ A;  4RPB A;  4E0A A;  4J0Q A;  3K9U A;  4NGT A;  4H6U A;  4BBH A;  3RY8 A;  2X7B A;  2GK6 A;  4PAA A;  4EWT A;  3S6K A;  1WWZ A;  3WYA A;  1BLL E;  2Z3M A;  2R1I A;  4DNT B;  1NRK A;  3JQP A;  1F60 A;  4KS9 A;  2XZO A;  2ZL7 A;  2Q4V A;  2EK9 A;  3H9N A;  2EO8 A;  4FD4 A;  3ZZI A;  4X5K A;  4XN0 A;  3NE5 B;  3LWU A;  4RCY A;  2W6J A;  2PIY A;  4HPS A;  3CW2 A;  4B12 A;  4Z4U A;  2B4D A;  4PXC A;  2ZEH A;  3R96 A;  3JVN A;  3CXC B;  2ZBV A;  5KTC A;  3A8K A;  1COW A;  4WZE A;  3NE7 A;  4M6I A;  2C1C A;  4DK1 A;  3SJZ A;  4KSA A;  1KJZ A;  4B47 A;  1WOO A;  4ZYQ A;  2BCO A;  1UWY A;  3HLP A;  4A30 A;  1CPX A;  4TMV A;  5J8C A;  4M85 A;  3E0K A;  3CPA A;  5HKK A;  1P4N A;  5A27 A;  3QFS A;  3FYN A;  4PK3 A;  2D3N A;  3KQZ A;  1S0U A;  1OB0 A;  4QV2 A;  1FNC A;  1QH0 A;  1A2Z A;  4TNU A;  2DIE A;  3FB3 A;  2DY1 A;  3CZX A;  2B7B A;  3DNS A;  4F8Z A;  1F20 A;  2ZXI A;  2C77 A;  2Q6K A;  1OB2 A;  4Q38 A;  1WP6 A;  3W2H A;  4YFJ A;  2OBT A;  4P1V A;  5A89 A;  2F7V A;  4XLA A;  2WPW A;  5IYQ A;  3D2P A;  1BMF A;  3MCA A;  2FX3 A;  1XB2 A;  5H59 A;  5H5J A;  1YRE A;  2Q44 A;  1FND A;  2OYN A;  3CCR B;  3NH8 A;  1KK2 A;  5LYL A;  2B5O A;  4UWJ A;  1NMT A;  1K8A D;  3DLJ A;  1WSV A;  2JJ2 A;  2YWE A;  3CTA A;  3G05 A;  1BJK A;  1ELL P;  4H6Z A;  5JBQ A;  4QFM A;  1H8E A;  2XZP A;  4R76 A;  4I49 A;  4PC1 A;  1Z8W A;  4Z4R A;  3QE2 A;  2GLJ A;  3A1P A;  4RDK A;  2Q43 A;  4G1P A;  3VWD A;  1E1R A;  4E0F A;  1QSO A;  3IWE A;  3CC2 B;  3GVK A;  4PXD A;  1UD2 A;  4PC6 A;  3S9L A;  3LNN A;  5ELY A;  2HDN B;  5CPA A;  1KUY A;  4UZU A;  3ZZT A;  1SM4 A;  1TLL A;  2BGI A;  2VI7 A;  4Z4W A;  3ASS A;  2HQY A;  4WZK A;  3BHX A;  1W0J A;  3LVB A;  2OU2 A;  4R6T A;  3D7F A;  1T5E A;  7CPA A;  3WAB A;  3PFE A;  2NPF A;  3GYA A;  4NGQ A;  4TKO B;  5HXB A;  3NE8 A;  4XOR A;  3ZPN A;  5HXD A;  4RD1 A;  4PAB A;  2PJ4 A;  2QTZ A;  3DDD A;  3PB6 X;  2EBJ A;  3CES A;  4OKO A;  3WC7 A;  3A35 A;  3JU4 A;  2CTC A;  4RUH A;  5C82 A;  1NBM A;  3B3C A;  4XLC A;  2CY2 A;  3RZA A;  1X10 A;  2AJ6 A;  3CXQ A;  1IID A;  3B8G A;  2PVW A;  4CAX A;  1GR1 A;  1HZE A;  3KHZ A;  2C5H A;  5JH9 A;  5J1Q A;  1CNE A;  4XM3 A;  4P10 A;  4CYN A;  1XFO A;  4XLE A;  1S7N A;  4E8O A;  4CS0 B;  2ODF A;  2VEZ A;  4X07 A;  3W2E A;  5DWM A;  2RB7 A;  3B82 A;  2VQY A;  4EH1 A;  4ZCI A;  1UFH A;  4II2 A;  3WY9 A;  2O28 A;  2YWH A;  2ZW4 A;  1T6Z A;  4TN1 A;  1MJA A;  4ZCM A;  3GY9 A;  2OBS A;  2ZBU A;  1TF8 A;  4PV6 A;  3EC4 A;  1TVC A;  3W91 A;  1TKH A;  4CAW A;  3PGP A;  1PJ6 A;  2D4P A;  2PJ9 A;  4KOY A;  4YHB A;  3SJG A;  2WYR A;  3KL9 A;  4CAF A;  2ZL6 A;  4RD3 A;  2O4H A;  2P6E A;  2ZIT A;  4RD0 A;  2RC5 A;  3FKS A;  4M53 A;  3H94 A;  5F4J A;  4GM5 A;  1YW6 A;  4BD9 A;  4AC9 A;  1XOV A;  5B6I A;  3WBJ A;  2OB0 A;  3WT4 A;  3QAH A;  2P0W A;  3B78 A;  3IWW A;  4OOX A;  1XE1 A;  2OTL B;  3BLN A;  2AFS A;  4A94 A;  2P6F A;  4XNF A;  3R9G A;  4C7I A;  5KW9 A;  2OK7 A;  1VLO A;  2CC2 A;  3CC7 B;  3D7D A;  3FJU A;  2BV3 A;  4IUS A;  1QFY A;  2C6P A;  4X06 A;  1QX4 A;  1ARM A;  3F0A A;  2I79 A;  3DGV A;  1Q9S A;  4ZGN B;  1Z2L A;  4XR6 A;  1W0K A;  1TF9 A;  2JDC A;  5JGF A;  1MAB A;  2BEI A;  3S6F A;  4XL9 A;  1YVK A;  1VJS A;  2JIZ A;  4NEX A;  4KKS A;  2HB6 A;  1QMU A;  1Z8L A;  2E1R A;  2WSS A;  4P45 A;  3DSB A;  5DS0 A;  3SXO A;  4XN3 A;  3P2H A;  2AFM A;  2G3T A;  1YLO A;  1KK0 A;  2EIX A;  2DOG A;  4QVJ A;  3H8F A;  5EMN A;  2DPT A;  3P26 A;  5BWA B;  3PRT A;  4Q7J B;  1VQN B;  4F9V A;  5A8A A;  4MYU A;  1M1K D;  2IQ6 A;  3ISX A;  3OEH A;  4FD7 A;  4LC0 A;  3GIR A;  3Q6Q A;  1QSM A;  3Q38 A;  4P4D A;  2OR4 A;  2GRE A;  1B23 P;  4B43 A;  4MY0 A;  2PIZ A;  5AG7 A;  4FBE A;  4OPV A;  1BX1 A;  4A38 A;  1IYK A;  2ZOG A;  1Z5R A;  4FD6 A;  3VH9 A;  2V7Q A;  4B10 A;  3H5Z A;  1XJO A;  2DET A;  3BY2 A;  5F4O A;  4YEL A;  4XD7 A;  2J8R A;  4WZT A;  1LFW A;  5JPH A;  4BPR A;  1WOS A;  2Q6L A;  4B3G A;  2FVG A;  3PFO A;  1QFZ A;  3VR6 A;  4KVX A;  1E1Q A;  3WR7 A;  4RCZ A;  3IO1 A;  2Q0Y A;  1WK4 A;  3CCL B;  3VAR A;  2BN4 A;  3PEN A;  3HUV A;  3RO0 A;  3SJE A;  3T53 B;  1VQ8 B;  4MMO A;  5K8O A;  2VNK A;  3OPO A;  3N7Z A;  1G7T A;  1VQ9 B;  2GAN A;  1JA0 A;  4XLH A;  3W2G A;  1M1D A;  1Z8T A;  1KMH A;  3TO6 A;  2EUI A;  1N05 A;  3CCS B;  3F8K A;  3WNC A;  5LYF A;  4XPD B;  4P4J A;  3A3B A;  1EFC A;  4XQF A;  4KOV A;  3H8G A;  4YAO A;  2FCK A;  4B44 A;  3A8I A;  1VQL B;  5F47 A;  2WZN A;  3VAT A;  5G1Z A;  1Y0R A;  2VBT A;  3N5F A;  1NE9 A;  4ZY2 A;  1BX0 A;  1V5V A;  1CBX A;  1RTQ A;  2J8N A;  5G22 A;  3OWC A;  3P27 A;  1BPL A;  3B35 A;  4CGN A;  2XND A;  3MGD A;  3CXS A;  3SLD A;  1KUX A;  3TE4 A;  4N3G A;  3NH4 A;  4FD5 A;  4B14 A;  2WJV A;  4M2L A;  2ZEM A;  3MN8 A;  2BO9 A;  1OGJ A;  3S6G A;  2POK A;  3CCV B;  2V8V A;  3PZJ A;  2BOA A;  2QGG A;  2DEU A;  1GJR A;  2WPX A;  2IL4 A;  2Q6I A;  2VYQ A;  4A2Z A;  3EFA A;  4OME A;  1PJ7 A;  2QVP A;  4MFQ A;  4RM0 A;  1BPM A;  3V8I A;  1CX8 A;  2GJK A;  1ZLH A;  3LQE A;  4NGR A;  3TO7 A;  3ASR A;  1SKQ A;  4JWP A;  3K2K A;  2A4N A;  1KWM A;  1QQ9 A;  5BSY A;  2VNI A;  3IEH A;  4PSX A;  1ZG8 A;  1NSL A;  2PSW A;  1G7C A;  2ZEN A;  2ZW7 A;  4P3I A;  3B2Y A;  4QB9 A;  4XMY A;  4AVZ A;  2PJ7 A;  1XBU A;  4R71 A;  3DR6 A;  1Q7L A;  3PP9 A;  4DQL A;  3JQQ A;  2ARH A;  2OH1 A;  1NJI D;  2W6I A;  2GPJ A;  4JXR A;  3LD2 A;  4J3G A;  4WZL A;  2QE7 A;  1FNO A;  3FIX A;  2KVO A;  2JBJ A;  1KC8 D;  2PJA A;  2PJ6 A;  4OC3 A;  4HNY B;  4AVB A;  2FL4 A;  4P4B A;  3KEW A;  3A9L A;  2ZZE A;  2YWG A;  1YJW B;  2BGJ A;  2PIA A;  5IK2 A;  3B3W A;  5K8N A;  4FWU A;  3ZBT A;  4U9Y A;  4OOV A;  1YIT B;  1VKC A;  1DAR A;  4ZX8 A;  4AVC A;  2C5B A;  3ZBU A;  3FEE A;  3LAC A;  1UMK A;  3PA2 A;  1GAW A;  1QUF A;  2JBK A;  4RLZ A;  4DNC A;  1WPC A;  4II9 A;  4P25 A;  2BL1 A;  5KSW B;  3GKR A;  1JWQ A;  4FK8 A;  3WXM A;  1YI2 B;  3BJ7 A;  1N08 A;  2M5S A;  5E6T A;  1JQG A;  4XOP A;  2ZED A;  5HZA A;  1WOR A;  1B87 A;  1M4L A;  3S6H A;  4N3N A;  1VGY A;  1QSR A;  4MJ8 A;  2DXQ A;  2Z3N A;  2ATR A;  4H89 A;  2Z3L A;  1RO5 A;  2R6H A;  3CME B;  4UA3 A;  3RNZ A;  4KOW A;  2Q51 A;  1TUI A;  4L89 A;  4QUS A;  3HAG A;  2PCU A;  4RDJ A;  1SQH A;  3LO8 A;  1EP1 B;  3OKX A;  3GIU A;  1ZLI A;  2VBV A;  4MCS A;  2J9A A;  5H84 A;  5E96 A;  8CPA A;  4RD2 A;  2V31 A;  4MFZ A;  5AGE A;  5DWN A;  4P4F A;  4EFD A;  4NGP A;  1BQE A;  1KTV A;  4H9G A;  3C26 A;  4UZF A;  1IHM A;  4P22 A;  3WBK A;  2CND A;  4XLF A;  2GE3 A;  1Q2Y A;  1KD1 D;  4UFV A;  4CQJ A;  2PR1 A;  3AST A;  1VHO A;  4X0C A;  3OJW A;  4WWV A;  4PK2 A;  2JEW A;  4YRH A;  5I0C A;  4RJL A;  4LX9 A;  4PPZ A;  1IJF A;  2YND A;  1N0U A;  4TMW A;  2I00 A;  3CB4 A;  3FJO A;  1JNY A;  2K5T A;  4PXB A;  2ZEE A;  2GFQ A;  1R5O A;  4OLL A;  2Z6B D;  4XNH B;  4ZGQ B;  3G71 B;  4EME A;  2X8K A;  3JRU A;  2PMD A;  1Q2C A;  1S5K A;  2BM1 A;  4NGN A;  4UCP A;  2F43 A;  4L8J A;  1I7P A;  3BCF A;  1YJ9 B;  2QEC A;  1ZM9 A;  3V7Z A;  1HA3 A;  4UAJ A;  4UIB A;  4A37 A;  2JLM A;  1DDI A;  4AVA A;  3D7H A;  2ZXV A;  1GAQ A;  3ZZ0 A;  1AYE A;  1Y9W A;  1NDH A;  4MI4 A;  1M44 A;  2V7X A;  4ZX9 A;  2I3C A;  4Y9R A;  3KR5 A;  3D66 A;  2HMA A;  3TTH A;  4B5P B;  2RFH A;  4F6A A;  1MK4 A;  1ZM4 A;  4FXU A;  3OAA A;  2CNM A;  2ZXH A;  1YX0 A;  1H8H A;  5HVH A;  2D9R A;  3D8P A;  5GV8 A;  2B58 A;  3RBU A;  2G9D A;  1KQS B;  3B3S A;  3DDY A;  3OZU A;  2PRQ A;  1VQ7 B;  3B8H A;  1BO4 A;  5J35 A;  1IIC A;  4X7E A;  1ZM2 A;  2ZW5 A;  4MHY A;  5IB0 A;  4MFP A;  5BSX A;  4JYW A;  4P26 A;  4KZT A;  2XEF A;  2YNC A;  1ZG7 A;  1FX0 A;  5J8F A;  2C27 A;  4KLW A;  4CGL A;  1I1D A;  2EWB A;  1WU8 A;  4MCQ A;  4MBU A;  3H8E A;  4HIZ A;  2XEX A;  2PJC A;  3BC9 A;  3AGQ A;  4B6Z A;  3I1F A;  5LRK A;  1OHH A;  4FUU A;  4B5O A;  3Q39 A;  2Q6O A;  2REE A;  3FRM A;  4P44 A;  2GQF A;  6CPA A;  3TC8 A;  4EVY A;  2PJ8 A;  4ONU A;  4OC4 A;  1W87 A;  3I55 B;  1TIQ A;  1OB5 A;  3FF3 A;  4KOS A;  2VNH A;  3KR4 A;  1QUE A;  2O53 A;  1E62 A;  1ARL A;  1D1N A;  4R7M A;  4AB7 A;  1VF7 A;  3OEE A;  2I1L A;  1E3X A;  3ISZ A;  3OE7 A;  3FED A;  3S9M A;  4NFR A;  2VBS A;  1R57 A;  1N8R D;  1AMO A; 
#chains in the Genus database with same CATH homology
 1ZG9 A;  2V8G A;  4MMO A;  5K8O A;  3GUX A;  1VIX A;  4OC2 A;  5IB9 A;  2ANP A;  4IHM A;  2AFW A;  2PE3 A;  3SI0 A;  5HVG A;  2GLF A;  3SI2 A;  3V38 A;  5LYF A;  3LMS A;  4P4J A;  2PJ0 A;  3GLJ A;  3NFZ A;  1VHE A;  1F57 A;  3H8G A;  4ZY0 A;  4DYO A;  3B3V A;  1Y7E A;  2CF4 A;  2WZN A;  4OC0 A;  3VAT A;  1LAM A;  4UF4 A;  1Y0R A;  3WC5 A;  4OC1 A;  3N5F A;  4IK2 A;  4CPA A;  1XRY A;  4X8I A;  4ZY2 A;  2PVV A;  1CBX A;  1RTQ A;  5K8P A;  3BI0 A;  2C6G A;  2ABZ A;  4NGT A;  5K8M A;  3B35 A;  4TWE A;  1LAP A;  3NA6 A;  2PJ2 A;  3NH4 A;  3PBB A;  4Q7A A;  2ZEM A;  4EWT A;  3MN8 A;  2BO9 A;  2POK A;  2V8V A;  1BLL E;  2BOA A;  2V77 A;  3FMC A;  1PCA A;  1R43 A;  1DE4 C;  2EK9 A;  5F09 A;  1DTD A;  3MRU A;  4OME A;  1TKF A;  2QVP A;  3LWU A;  1BPM A;  3SJX A;  1CX8 A;  3PB7 X;  1ZLH A;  2PIY A;  4NGR A;  5LRG A;  1CG2 A;  2AFZ A;  4DJL A;  4PXC A;  2ZEH A;  3K2K A;  1PYT B;  1KWM A;  1QQ9 A;  4X3R A;  3IEH A;  1ZG8 A;  1IY7 A;  3KQX A;  2C1C A;  2ZEN A;  1TXR A;  3IJ3 A;  3PB9 X;  4Z65 A;  3B2Y A;  5LYD A;  2GU2 A;  2PJ7 A;  4ZYQ A;  5CBM A;  1XBU A;  1Q7L A;  2BCO A;  1UWY A;  3HLP A;  1CPX A;  1HDU A;  2PJ1 A;  3KI9 A;  3CPA A;  2IJZ A;  2IMO A;  1FNO A;  1ELM P;  2JBJ A;  3PBE A;  3KQZ A;  1NSA A;  1IGB A;  2PJA A;  2PJ6 A;  4OC3 A;  4X2T A;  4TNU A;  4P4B A;  4F8Z A;  3B3W A;  5K8N A;  4FWU A;  2F7V A;  2V8H A;  3FX6 A;  4OID A;  4ZX8 A;  2CIJ A;  3FEE A;  3NH8 A;  5LYL A;  2V8D A;  2JBK A;  3DLJ A;  2VL1 A;  1OBR A;  1ELL P;  2F8H A;  3K9T A;  4R76 A;  1CP6 A;  4DUK A;  4R8F A;  1YME A;  2GLJ A;  1JQG A;  3S9N A;  4NGM A;  2ZED A;  2Q43 A;  4UEF A;  2ZEL A;  4MHZ A;  4H2K A;  4G1P A;  1M4L A;  4MCR A;  1VGY A;  1YW4 A;  3L2N A;  3WC6 A;  4YU9 A;  4ZY1 A;  2C6C A;  4PXD A;  2NYQ A;  3S9L A;  2ZEP A;  5ELY A;  3RAM A;  5CPA A;  4KSI A;  3PEI A;  2AFU A;  2HC9 A;  4UEZ A;  2Q51 A;  2PJ3 A;  3IIB A;  2PCU A;  4NGS A;  3BHX A;  1XMB A;  1ZLI A;  4R6T A;  3D7F A;  4MCS A;  7CPA A;  3WAB A;  3PFE A;  2J9A A;  4NGQ A;  8CPA A;  5LRJ A;  4P4F A;  4EFD A;  4NGP A;  5HXD A;  2PJB A;  3FVL A;  2AFX A;  2PJ4 A;  3PB6 X;  2PJ5 A;  4NJQ A;  4OKO A;  3WC7 A;  2CTC A;  4RUH A;  2AFO A;  1F2P A;  3FEC A;  3B3C A;  3D7G A;  3RZA A;  4MHN A;  3BI1 A;  1VHO A;  4WWV A;  2JEW A;  2PVW A;  3KHZ A;  5JH9 A;  5J1Q A;  1HDQ A;  1HEE A;  4P10 A;  4PPZ A;  1XFO A;  4JZ0 A;  4O23 A;  3QNV A;  2XEJ A;  3KZW A;  2OOT A;  2RB7 A;  1CPS A;  4PXB A;  2ZEE A;  4A39 A;  5I4M A;  4FAI A;  1AMP A;  4UIA A;  1TF8 A;  4YWY A;  4EME A;  1TKH A;  3JRU A;  4MHP A;  2PJ9 A;  4NGN A;  3SJG A;  2WYR A;  3KL9 A;  2XEI A;  2O4H A;  3KAS A;  2QJ8 A;  3V7Z A;  1R3N A;  1BPN A;  4W9Y A;  4UIB A;  4A37 A;  4GM5 A;  1YW6 A;  2CTB A;  4BD9 A;  1CP7 A;  3D7H A;  4LQG A;  1YSJ A;  1AYE A;  3WT4 A;  3IWW A;  3IC1 A;  4MRI A;  2AFS A;  4ZX9 A;  2ZOF A;  2I3C A;  3KR5 A;  4A94 A;  5D29 A;  3D66 A;  4K3N A;  3FH4 A;  4MCP A;  4UEE A;  1F2O A;  2RFH A;  3NH5 A;  4P4E A;  1GYT A;  2ZEF A;  3D7D A;  3FJU A;  2XEG A;  3D4U A;  4NJR A;  3PB4 X;  1FT7 A;  3TX8 A;  1H8L A;  3CDX A;  2C6P A;  5HVH A;  1ARM A;  3DGV A;  4IAV A;  4OP4 A;  1BAV A;  1Z2L A;  2Q4Z A;  2EK8 A;  1TF9 A;  3SI1 A;  2DEA A;  5JGF A;  3I1U A;  3RBU A;  2G9D A;  3B3S A;  2HB6 A;  1Y0Y A;  1QMU A;  4PXE A;  1Z8L A;  2PRQ A;  4P45 A;  4OIW A;  5DS0 A;  2AFM A;  3B3T A;  1YLO A;  3SJF A;  3CT9 A;  4MHY A;  2QYV A;  4JYW A;  3H8F A;  3D68 A;  2XEF A;  4ZI6 A;  3B7I A;  2ZEG A;  3D67 A;  3PRT A;  1ZG7 A;  4F9V A;  2IQ6 A;  3ISX A;  3KHX A;  3GB0 A;  1LCP A;  4P6Y A;  2EWB A;  4MCQ A;  3H8E A;  1TKJ A;  4OC5 A;  4WJB A;  3CPX A;  2PJC A;  4P4D A;  2OR4 A;  2GRE A;  4B6Z A;  2NSM A;  5LRK A;  2PIZ A;  4FBE A;  4FUU A;  1LAN A;  4A38 A;  4PQA A;  5JM6 A;  2ZOG A;  1Z5R A;  3VH9 A;  4P44 A;  4F9U A;  6CPA A;  3TC8 A;  3T8W A;  1XJO A;  4ONW A;  2PJ8 A;  4OC4 A;  3PB8 X;  3KGQ A;  4P4I A;  1EE3 P;  2ZEO A;  5D8N A;  3FF3 A;  4MXU A;  3KR4 A;  3IFE A;  2O53 A;  5HVF A;  1LFW A;  1ARL A;  4R7M A;  2FVG A;  5LYI A;  3PFO A;  1LOK A;  3IO1 A;  5THW A;  3ISZ A;  3FED A;  3S9M A;  4NFR A;  3VAR A;  3HUV A;  4AXV A;  3SJE A;  3BXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...