1VHOA

Crystal structure of a putative peptidase/endoglucanase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
331
structure length
319
Chain Sequence
METGKLLMELSNLDGPSGYETNVVSYIKSVIEPFVDEAKTTRHGSLIGYKKGKGIGKLAFFAHVDEIGFVVSKVEGQFARLEPVYASKVRIYTKNGIERGVIGMLAPHLQDSESRKKVPTYDEIFVDLSLCERGVRVGDIAVIDQTAFETNGKVVGKALDNRASCGVLVKVLEFLKRYDHPWDVYVVFSVQEETGCLGALTGAYEINPDAAIVMDVTFASEPPFSDHIELGKGPVIGLGPVVDRNLVQKIIEIAKKHNVSLQEEAVGGRTDFVQLVRNGVRTSLISIPLKYMHTPVEMVDPRDVEELARLLSLVAVELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
molecule keywords endoglucanase
total genus 94
structure length 319
sequence length 331
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 1vhoA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1vhoA01
3KZWA 2F7VA 4NFRA 3PB7X 2AFSA 4UIAA 3S9NA 2C1CA 4ZY0A 2PJ8A 3H8EA 4X3RA 4DJLA 3IO1A 1VHEA 4W9YA 5HVFA 3FX6A 2I3CA 3PB8X 3H8GA 4B6ZA 4CPAA 1BPNA 3CDXA 4OC0A 4X8IA 1FNOA 2ABZA 2ZEHA 2EK9A 3PFEA 3VH9A 5IB9A 5K8MA 4MCSA 2VL1A 1VHOA 5HVHA 2PJ2A 3WABA 3KR5A 4OC2A 3PB6X 2AFOA 3V38A 1DE4C 4P4EA 2WYRA 2PIZA 1HDQA 1Y0YA 2V8DA 4UF4A 2PJ5A 4MMOA 1CX8A 2ZEEA 2ZEPA 1Z2LA 1PCAA 4A39A 3B3SA 3FF3A 1VGYA 2IMOA 2XEJA 2XEGA 3CT9A 2PJ4A 4MCRA 3B7IA 2PJ3A 4PXEA 5F09A 1CBXA 8CPAA 3SJEA 1Z8LA 2HC9A 3VATA 1YLOA 2PVVA 4G1PA 4TWEA 1TKHA 1AYEA 5JH9A 4YU9A 2QJ8A 4OC1A 3K2KA 4NJQA 2GREA 2GU2A 3KQZA 3FEEA 2PJAA 4NGQA 1KWMA 2V8GA 5K8NA 3GB0A 3SJXA 1ZG7A 1M4LA 4UEFA 4OC3A 4OC5A 3TX8A 3K9TA 4ONWA 1XJOA 2ZEFA 3PB4X 1BLLE 2AFMA 2JBKA 1TXRA 1TKFA 7CPAA 2V8VA 2EWBA 1HEEA 1TF9A 3D7DA 2CTBA 1NSAA 1FT7A 2PJ9A 3RZAA 2PJCA 5DS0A 2RFHA 3RAMA 3FJUA 4OKOA 1JQGA 4DYOA 1F2PA 4WWVA 4NGPA 2V77A 3H8FA 2JBJA 4DUKA 3NFZA 3IC1A 3B2YA 2AFWA 3BI0A 2O53A 3IWWA 1TF8A 2PJ1A 3KHZA 3PBBA 3S9LA 2QYVA 2JEWA 2BOAA 4FUUA 4NJRA 4MHNA 3ISXA 4BD9A 1CPSA 3KI9A 2Q51A 3ISZA 4R76A 3FH4A 3KR4A 2PJ7A 2C6CA 3BI1A 3GUXA 3CPXA 4NGNA 2QVPA 3HLPA 3SJGA 4ZI6A 1ZLHA 2ZENA 3KL9A 2DEAA 3NH4A 1XRYA 3IEHA 3LWUA 2PJ0A 2PJ6A 4R6TA 3B35A 4LQGA 4Q7AA 4A37A 4UIBA 3JRUA 4OIWA 3SI0A 1CPXA 4ZYQA 4IAVA 2CTCA 4EMEA 1QQ9A 1GYTA 3PEIA 4OP4A 3NA6A 3NH5A 1UWYA 2G9DA 3IFEA 1ZLIA 3L2NA 4MCQA 2O4HA 3KGQA 1EE3P 1IGBA 1F57A 2Q43A 5LYIA 4IK2A 5JM6A 4P4IA 1BPMA 2OR4A 4AXVA 4NGMA 3DGVA 3D7HA 4KSIA 4P44A 4MXUA 2ZOGA 2ZEDA 3TC8A 1ZG8A 3WC5A 1YW4A 2ZELA 4P4BA 4MRIA 1LFWA 3D68A 1LCPA 2PCUA 2PJBA 4GM5A 1ELMP 2C6GA 1RTQA 3FMCA 1Y0RA 3BXMA 4UEZA 5HVGA 3GLJA 4A94A 2NYQA 1CP6A 5I4MA 2FVGA 4F9UA 5J1QA 2IJZA 4WJBA 1XMBA 4JZ0A 5ELYA 1BAVA 1ZG9A 4YWYA 4P45A 3B3CA 2J9AA 4PXDA 2BO9A 5LYLA 1OBRA 4RUHA 5D29A 4NGRA 3LMSA 4FAIA 3MN8A 2GLJA 5D8NA 2ANPA 4PPZA 1ARLA 2PVWA 5K8OA 3CPAA 1H8LA 1ARMA 1LANA 4PXBA 4OIDA 3HUVA 4TNUA 3PFOA 4R8FA 1Q7LA 5LRJA 3QNVA 5CBMA 1R43A 3D4UA 3WT4A 3I1UA 2PIYA 1CP7A 4IHMA 1AMPA 4P4DA 1DTDA 1CG2A 2IQ6A 4MHZA 3RBUA 5JGFA 2NSMA 5CPAA 3BHXA 1LOKA 2BCOA 5HXDA 4NGTA 3KQXA 3T8WA 2CIJA 3FEDA 3NH8A 4PQAA 4R7MA 1ELLP 4K3NA 4MCPA 4P10A 2HB6A 3KHXA 3V7ZA 4EWTA 2OOTA 2AFZA 2AFXA 1IY7A 1F2OA 2F8HA 3D7GA 2CF4A 4FWUA 4NGSA 4P4JA 2RB7A 2ZOFA 2C6PA 3B3WA 3FVLA 4Z65A 2XEIA 2PE3A 4ZX8A 2WZNA 1HDUA 3D7FA 4OMEA 3WC6A 1XFOA 4MHYA 2V8HA 1YMEA 5LYDA 1Z5RA 4JYWA 1YW6A 2ZEOA 3KASA 4ZX9A 4ZY2A 2GLFA 3B3VA 3PRTA 4EFDA 4P6YA 4UEEA 2AFUA 1XBUA 1YSJA 2Q4ZA 3SI2A 4FBEA 3SI1A 3MRUA 4A38A 2XEFA 3FECA 2ZEMA 3B3TA 1Y7EA 5LYFA 3D66A 1TKJA 1PYTB 2ZEGA 3DLJA 4PXCA 3S9MA 2EK8A 4ZY1A 4OC4A 4F8ZA 4O23A 4F9VA 4H2KA 3IJ3A 5LRGA 4MHPA 1QMUA 2PRQA 1LAMA 5THWA 2POKA 3SJFA 3WC7A 1VIXA 6CPAA 4X2TA 1R3NA 4P4FA 3VARA 3D67A 3N5FA 3PB9X 3PBEA 5K8PA 1LAPA 3IIBA 5LRKA
chains in the Genus database with same CATH superfamily
2WSAA 3KZWA 4FD4A 5B6IA 1I21A 2AFSA 4XNFA 3F5BA 2C1CA 4U9ZA 1D2EA 3IO1A 1KK3A 5FIUA 2REFA 1E79A 4XORA 4M85A 5HVFA 3FX6A 3QFSA 2I3CA 3PB8X 3H8GA 4CPAA 3OE7A 3F8KA 1ZM3A 3VO1A 2HMAA 3GVJA 3T9YA 4XONA 3PFEA 3VH9A 5K8MA 4MCSA 4G6IA 1VHOA 1PKVA 2C5HA 4YALA 3V38A 4HNXB 3PVDA 2DCUA 1E64A 4OAEA 3OJWA 2PIZA 2V8DA 3SLNA 3ES9A 2ZEPA 4LBZA 4ASUA 2DERA 1B23P 4MJ8A 4A32A 4HIZA 2XEJA 2XEGA 4L8AA 2PJ4A 4TT3A 4E0AA 1BOBA 4MCRA 3TTHA 1QGZA 2PJ3A 2V7UA 3FNCA 5F09A 2F4NA 3SJEA 1Z8LA 1TKHA 3ASTA 5JH9A 2QJ8A 2Q6OA 4K1XA 4OC1A 4OOVA 1Y9WA 5F49A 4CGLA 2PJAA 1KWMA 3CTAA 2OTLB 2GIVA 3ZBTA 5GV8A 3SJXA 5BWAB 2B3VA 4F7DA 2R7HA 4UEFA 4OC5A 3Q39A 1FRQA 1N0UA 3PB4X 3JUWA 2AFMA 1EFRA 1TF9A 3GKRA 3D7DA 3QB8A 5TV2A 1AIPA 1UD8A 1FT7A 3W2HA 2PJCA 5DS0A 3RAMA 4PABA 1WSVA 1R5BA 4XN3A 3R9FA 2P6EA 1E1QA 3DR8A 5BSXA 2V77A 1QH0A 3H8FA 2JBJA 3CCJB 2FSRA 1S0UA 4B43A 3D2MA 2FE7A 5A8AA 2EVNA 2YNDA 2O53A 1TF8A 2PJ1A 4TMXA 2YNCC 1VLOA 3PBBA 3CMAB 2JEWA 4KORA 4CGMA 5H5JA 4YAFA 1YITB 1CPSA 2Q6IA 1R5OA 4LBVA 1S4MA 1PU9A 3SKBA 3W5VA 2C6CA 5C82A 4N3NA 3GUXA 2D4OA 2ZL7A 2CBXA 3CC2B 3HLPA 1NMTA 4ZI6A 2GJKA 2BPOA 2PRBA 3S6FA 1EP3B 3UY5A 2DEAA 1KK0A 2ARHA 2Q6LA 3IEHA 3CMEB 2I79A 4X05A 2YWFA 1Q7YD 3ONUA 3B35A 4GS4A 4LQGA 3QAYA 5J3OA 1KK1A 5EC4A 4X07A 1BLIA 2P6GA 4UIBA 4KOYA 4OIWA 3BQJA 5DN6A 1Y9KA 2F43A 4KOXA 1WOSA 2ZTGA 4II3A 2I1LA 3NA6A 1MK4A 5H86A 3L2NA 3CRZA 4MCQA 4NCZA 2O4HA 2BGJA 4UAJA 3OZVA 3EFAA 4KSFA 1VF7A 3W6SA 2WZPP 4C7IA 4OPSA 4IK2A 2OR4A 1TTTA 4Y49C 4RD4A 4AXVA 1YJWB 4M6HA 2OK7A 3OZUA 1QUFA 2PIAA 5HZAA 2PR8A 2ZOGA 1VQ5B 4DQKA 1WWZA 4ZCMA 2ZELA 1LFWA 2J8MA 1DDGA 1GVHA 3CCEB 3CCUB 4F0XA 3I55B 4PSXA 5IK2A 3CMMA 2X85A 5HXBA 4A94A 5HVGA 1HZEA 1T6YA 3CCRB 2NYQA 1CP6A 1YVKA 2IJZA 2X6WA 4Z4ZA 3R9GA 1FX0A 1W35A 4TMTA 4CQJA 1BAVA 3MMPA 1ZG9A 3A9LA 2OB0A 3TO9A 2O28A 4CAEA 2PDOA 2BO9A 1X10A 3B8HA 5IYWA 3WXMA 5JBQA 4JXRA 5D29A 1YR0A 1IU8A 4OPOA 1L0CA 3MN8A 2GLJA 3WYAA 5KTAA 1GO2A 4NSQA 1TIQA 2WJYA 3CCVB 2VNIA 4MFQA 5G22A 4C7HA 1J4JA 1MRZA 1Q7LA 5LRJA 4Z4YA 5H59A 3TE4A 1CP7A 1A2ZA 4IHMA 1XQBA 4Y7CA 4LQ6A 4UFXA 3BJ7A 2NSMA 2DF5A 5EMIA 5HXDA 4NGTA 2F1LA 2ZZFA 3AVWA 3NH8A 3G71B 2Q4YA 3NE5B 4R7MA 4XKVA 1ELLP 2QMLA 5A28A 5GCNA 4P10A 1NB9A 2OOTA 5EMNA 2FX3A 2CC2A 1EFUA 4JWPA 3BNWA 4B11A 2WZNA 3A3GA 3QFTA 1HDUA 4RCYA 5IYPA 4OMEA 1WK4A 2JIZA 4P9SA 3WC6A 2R9VA 2XNJA 3G3SA 1IOIA 2CK3A 5F4OA 2EUIA 4H6UA 5KTCA 2VNKA 3ZC3A 4UZEA 5L46A 4B12A 2GLFA 3IGRA 2G3AA 3T53B 3P2FA 4CRYB 4U9YA 4YELA 4UEEA 2AFUA 1CNEA 1ELOA 3QFCA 4YHBA 1YSJA 4FBEA 3SI2A 1MABA 2D3NA 3MRUA 4II9A 2XEFA 4QC6A 5AG6A 1VQ9B 2C4UA 4G7XA 4KOSA 2YGWA 4BMHA 1KQSB 2V7QA 1VQPB 4UCNA 4RJLA 2GANA 4ZY1A 3QE2A 1QSRA 4F8ZA 4O23A 4F9VA 4RS2A 4H2KA 2C78A 1H8EA 4MHPA 1RQPA 4DNCA 2PMDA 5THWA 3SJFA 1QFJA 1VIXA 6CPAA 4X2TA 1QSOA 3VARA 2FL4A 3N5FA 3CB4A 4XPDB 4XPDC 4DQLA 1G7TA 1S7KA 4I49A 2QEXB 5IYQA 4E2AA 2R98A 4JMQA 4UIAA 4M6GA 1N08A 3H5ZA 4G1BA 4A2ZA 2CNDA 4FD7A 3CC7B 4RI1A 4RN7A 3WNBA 5IX3A 3GVLA 3CDXA 1ON0A 2OZGA 1FNOA 2ABZA 2Q04A 2EK9A 3QSYA 4AVZA 5IB9A 2VL1A 1NSLA 1VQ8B 2JJ2A 3BH4A 3ZZIA 2PJ2A 3T90A 3KR5A 2BM0A 4B5PA 4QBJA 2PJ5A 4WZTA 2DXQA 2AJ6A 1Z2LA 2X6YA 4A39A 2VNJA 3ASPA 1E63A 2VZYA 3AVTA 4PXEA 2REEA 4KOWA 3RO0A 5TY0A 1TVCA 3VATA 2ZTNA 4G1PA 4TWEA 3AVXA 3W5UA 1I1DA 2HUZA 5J8CA 4UWJA 3K2KA 5F48A 2GREA 2GU2A 3KQZA 4NGQA 4XPLA 1I12A 4G1VA 2V8GA 3OWCA 2ZW5A 4LUAA 1ZG7A 4IUSA 1M4LA 4MBUA 4OC3A 2AHOA 2D4PA 2OU2A 4Z4WA 4MFKA 4ONWA 1BLLE 4CAWA 1OB0A 1TXRA 2JLMA 1S7FA 1PUAA 2V8VA 1BPLA 5FO0A 2J7KA 1NJID 2J8RA 5CNPA 1QFZA 1Q86D 1SKYB 1W34A 2BVNA 3RZAA 3NE8A 2V7WA 1M1DA 4DNRB 4LBYA 4WWVA 4NGPA 1WOPA 5J35A 1W9XA 1I8DA 4GQNA 3IWEA 4DK1A 3W6XA 3NFZA 3IC1A 3F0AA 2V31A 5KNLA 4KZTA 5ISVA 4KLWA 2VBUA 1VQLB 1VQKB 3PZJA 2HDNB 4UCPA 4FD6A 1IICA 4XN0A 2XZPA 1YX2A 2BOAA 3ISXA 3KI9A 4AF6A 2Q51A 3PUMA 1KRHA 3FH4A 4RDKA 3I56B 1CM0A 4B3GA 4E0FA 2RC5A 1X12A 4M1KA 3R9EA 3SJGA 1FDRA 3E0KA 1KZFA 1ZLHA 2CY2A 3AVUA 1YK3A 2ZENA 3KL9A 3R6JA 4NF1A 2B4DB 4R3KA 4RCZA 4YFJA 1E3XA 1XRYA 3LWUA 2PJ0A 4OADA 4OOSA 4R6TA 4KOTA 4Q7AA 5HKKA 3B78A 1CNFA 4CYPA 3R6KA 4QUZA 5FA6A 3EXNA 4OLLA 3JRUA 3SI0A 1B2RA 4RM0A 2VBQA 1BX0A 4IAVA 3I1FA 3AVYA 2YWEA 1QQ9A 4B13A 4JXQA 1QGAA 2QDXA 4TMZA 3NH5A 1QSMA 1UWYA 2G9DA 4QB9A 1F20A 2XNDA 1ZLIA 3IFEA 2YNEA 1WP6A 2XGJA 2ZW6A 3KGQA 3OFNA 1EE3P 4XM3A 2BMWA 1WU8A 1K73D 1F57A 2GJPA 1M44A 3BY1A 4RPDA 5IYRA 1BPMA 3GIRA 2X8KA 3SLDA 1XIXA 3DGVA 4NGMA 3WBJA 4P44A 4WQMA 1RO5A 3P2HA 4HE6A 3FJOA 4ZGQB 5AGEA 2Z3KA 3MGDA 1YW4A 2B5OA 1PJ7A 3ZJ0A 3A3BA 1QSTA 2PJBA 1FNCA 1ELMP 4RLZA 1RTQA 1QVFB 2PR1A 4C2ZA 3BXMA 2JDIA 2R6HA 2WSSA 5F47A 4HPSA 1Q2CA 2FVGA 2Q4VA 1Z9UA 1KUVA 5J1QA 1WPCA 1CQXA 3PA2A 1XMBA 4BBHA 4JZ0A 3S6KA 2V7TA 3Q6QA 1VKCA 3B3CA 2OBTA 3SXOA 3D3SA 2NMTA 4QHYA 3SJPA 4NCNA 1Z4RA 3G4SB 4NGRA 3LMSA 4AG9A 1IB0A 2VXKA 3FYNA 5G21A 5DSZA 3PP9A 4H89A 4MY0A 2ZZEA 2PVWA 4M0LA 4M4SA 4KUBA 3GYAA 3BCDA 1VQ6B 4X7EA 1KUYA 4OIDA 4TNUA 1IJFA 2QE7A 3PFOA 1P4MA 2XZLA 2D3LA 4X7FA 3QNVA 2PSWA 3D4UA 3WT4A 2B5GB 3I1UA 4QUSA 1Z4EA 5IB0A 5JPHA 1AMPA 2WPXA 2IQ6A 1QVGB 2G3TA 3MHPA 1VQOB 1W2BB 4PV6A 3KQXA 5FNZA 1SKQA 3FEDA 3CPWB 4CYOA 1SM4A 3FPKA 4PQAA 4CGOA 4PSWA 4MCPA 2VYQA 3OAAA 1S72B 3QFRA 2QTZA 2AFZA 5F4MA 1IY7A 3D7GA 2F8HA 4FWUA 4X5KA 2BSWA 2IL4A 2PC1A 1YJNB 1KD1D 2RB7A 3B3WA 2C6PA 2PE3A 4QFMA 3D7FA 1YHQB 1UD4A 1XFOA 3V76A 5IV0A 4RD1A 4WZLA 5LYDA 1YVOA 4JYWA 4FK8A 4Q36A 4YGOA 4ZX9A 3FBUA 1RQRA 3B3VA 1IIDA 1LRZA 4MY3A 3A1PA 1EP2B 1G7CA 4XLCA 1XBUA 2DETA 2R8VA 1U6MA 2C2WA 4C43A 2Q4ZA 4C2XA 3SI1A 1E62A 4K30A 2J8NA 2ZEMA 4B10A 3B3TA 4KSAA 4IW3B 3D66A 1V5VA 3PGPA 4XOTA 4CGPA 5F46A 2KCWA 1QFYA 1NDHA 4OC4A 1BQEA 3LQEA 1H85A 2BL1A 4JLYA 1M1KD 2PRQA 1LAMA 1WSRA 3CXQA 3FB3A 3WC7A 1IB1E 2PQ8A 3JVNA 3ZIAA 1R3NA 4P3IA 4P4FA 3D67A 1EP1B 3PB9X 3PBEA 5KTDA 1EFTA 4MFZA 5E96A 4P25A 3IIBA 5LRKA 1Z8XA 3NE7A 4A33A 4PC7A 2YNCA 3WNDA 2F7VA 3CP2A 4NFRA 1QG0A 2WJVA 2OBSA 1OB2A 4XNHC 2RC6A 4AVBA 1KC8D 3W2GA 3P27A 2PJ8A 3H8EA 4X3RA 4RD3A 4FN5A 4DJLA 3BC9A 3WNCA 3LVBA 1R57A 2KVOA 3AVVA 4W9YA 4Q38A 3TO7A 4HKFA 4GXHA 4B6ZA 4H6ZA 3OW7A 2ZXHA 4OC0A 2Z0ZA 2ODFA 3RYOA 3A8IA 2ZEHA 3N7ZA 2BUEA 3PA1A 2Q44A 4R87A 2ZW4A 2CW5A 1JA0A 4OC2A 2AFOA 4Z4TA 5HH1A 4EVYA 3VNVA 2WYRA 1HDQA 1Y0YA 2QECA 4LX9A 3MCAA 4TSFA 4MMOA 1CX8A 2ZEEA 3OP1A 1YJ9B 1WTHD 1XE4A 2QN6A 1UD2A 4RD6A 2IMOA 3R1KA 4CYNA 1VJSA 4KVME 4CAFA 4ZBGA 1HA3A 3HAGA 4QVJA 5CDFA 3PENA 1CBXA 8CPAA 5A88A 4X06A 2HC9A 3OJXA 4C68A 4YU9A 3S6GA 1IYLA 2OBRA 5DWMA 4CYQA 4RD2A 1G7SA 4ACBA 3D26A 5K8NA 4CGNA 3GB0A 4TMVA 4WZKA 3TX8A 3K9TA 1XJOA 2ZEFA 3ASRA 2JBKA 4Z4SA 3JQQA 4BINA 7CPAA 3U2QA 4F0YA 3SJZA 4FD5A 1IHMA 1HEEA 1NRKA 2JDDA 4KUAA 1WOOA 2PJ9A 2RC4A 2RFHA 3FXTA 1S5KA 1NBMA 2WPDA 3JTKA 1JQGA 2X6XA 1KUXA 2OZUA 2Z10A 4LC0A 3VWDA 2Q7SA 4PK3A 1V0FA 4Y9RA 2GJRA 2BV3A 2ZZQA 3BCFA 1H42A 2AFWA 3BI0A 2GQFA 2ZPAA 1ZUNB 1YREA 3OW2B 2QYVA 4NJRA 4MHNA 4X0CA 1OGIA 4MFLA 3ISZA 4R76A 2YWGA 4C0SA 2PJ7A 3E1YE 3FPPA 1P4NA 1Q2YA 4P2NA 3IU2A 3CPXA 4PK2A 2VZLA 2HQYA 2C77A 1VQNB 4B14A 2CNTA 3AGQA 1MJ9A 3Q6RA 3NH4A 2B5GA 1V0CA 1VLYA 1SQHA 5C88A 2D74A 2M5SA 4X7CA 4A37A 1GAQA 4ZYQA 1HVXA 3TO6A 3ONYA 4EMEA 1GYTA 3PEIA 3VO2A 3OKXA 4ZGYB 1M4DA 4OP4A 2YWHA 3C26A 4M53A 2DYIA 1MJAA 1QGYA 2Z3PA 4ONUA 1UD5A 2ZITA 2JDCA 2NV4A 1IGBA 2PLFA 4P22A 2Q43A 1OGJA 1XB2A 1KK2A 4QV2A 5JM6A 4P4IA 1YGHA 4RD0A 1ZM4A 3H9NA 4B44A 4KKUA 4XMYA 3ZBUA 3EO4A 4MXUA 4OP7A 3TC8A 3FKSA 2BM1A 4G5GA 3WC5A 4P4BA 4MRIA 2OK8A 3ZZUA 3CP8A 3V8IA 4UWIA 4KKSA 4XPKA 3U6BA 2C6GA 1Q82D 1PJ6A 2ZXVA 4UEZA 3GLJA 4UFWA 4YRHA 4HNWB 2ZBVA 4ACAA 3ZZTA 1GHEA 4WJBA 2GK6A 2ATRA 5ELYA 1FNBA 4YWYA 2NPFA 4P45A 1ZM9A 2J9AA 1T5EA 4DNTB 2QA4B 2ZZGA 4J3GA 4L89A 4RPBA 4TMWA 1N71A 3TT2A 4UZUA 4FAIA 2EIXA 4WZEA 2JN9A 5AG4A 2ANPA 3G8WA 3FIXA 4Z4VA 1E3ZA 2VI7A 3BY2A 4AG7A 1ZM2A 3HUVA 1W0JA 4R8FA 3SHPA 3U6KA 4YEJA 3VNUA 4UFVA 2QGGA 1R43A 5H84A 2VBVA 4EH1A 2OYNA 1DTDA 1CG2A 4MHZA 5KSWB 2ZL5A 4XQFA 2CNMA 4ROXA 5AG7A 4Q7JB 1A8PA 4P26A 4AC9A 4YAWA 2XEXA 2B7BA 4NBSA 4K3NA 5A27A 1JWQA 1GJRA 4R9MA 1UMKA 3V7ZA 3ASQA 4UCMA 1FNMA 4XLEA 3ZUGA 2E1BA 3I9SA 2Z3NA 5BSYA 1NE9A 1B87A 1N0VC 2B4DA 4MYUA 4P4JA 2VJJA 1Z8WA 4B3XA 2ZOFA 1S7NA 4Z65A 2R1IA 3DR6A 3OOCA 5THXA 1N07A 2XOKA 3GQBA 3WY9A 1S3ZA 2V8HA 2WR8A 1YW6A 3G6EB 2ZEOA 3OEEA 1GAWA 1JB9A 4FXUA 2B4BA 4ZY2A 5FL7A 3PRTA 3ZPNA 1OHHA 4P6YA 3DSBA 2ZBUA 2WPWA 1D8TA 4R3LA 3CESA 2BSAA 4A38A 1YI2B 3FECA 3GSIA 2FCKA 1Y7EA 3WR7A 5LYFA 5EBVA 1CJWA 2WUUA 3CCLB 3DLJA 5I0CA 4PXCA 2CRVA 5FVJA 4AVAA 4H9GA 1Z8TA 4NNJA 1E43A 5LRGA 5AG5A 1QMUA 1XOVA 1W0KA 1QSNA 2X0KA 5K8PA 1UD3A 1LAPA 4ZV4A 5G1ZA 4CAXA 3K9UA 4JJXA 4A95A 4MFJA 3B8GA 4YXWA 1S7LA 1M90D 2BF4A 3PB7X 3J81k 2P0WA 3CZXA 3S9NA 3G05A 4ZY0A 2QTLA 2G0BA 1XMTA 2Z11A 3E20A 1FY7A 1VHEA 2CNSA 1WDTA 3W91A 3CCQB 4KLVA 4X7DA 4QVAA 4A30A 4YAUA 1EFCA 4CS0B 4KVXA 1DARA 1BPNA 4HNYB 4X8IA 4CRZB 3D2PA 2BN4A 1BMFA 4XR6A 1IYKA 2DIEA 4KOUA 2W6IA 1VQMB 4PGOA 5HVHA 2BGIA 5HMNA 3JQRA 3WABA 3BJ8A 3PB6X 1DE4C 1DDIA 4P4EA 3V7AA 1GR1A 2EBJA 4MI4A 5G20A 1Y7RA 4RDJA 4UF4A 3T51B 4G7WA 1PCAA 3SEJA 3SXNA 3B3SA 4P3YA 3FF3A 4M6IA 1B6BA 1VGYA 3CT9A 4XD7A 1T6ZA 4ZCIA 2OZHA 3B7IA 3D8PA 2ZW7A 4XL9A 1EXMA 1DG1G 2FT0A 2V4DA 2XZOA 1D1NA 3TOBA 1YLOA 2PVVA 1AYEA 4B4DA 1UFHA 2H5MA 3CCSB 3W5HA 4B47A 2VJIA 4IF5A 2JJ1A 4NJQA 3QAHA 1TUIA 4BPRA 3FEEA 4PC3A 1COWA 5TRDA 3LD2A 3LODA 4HE5A 5DWNA 4U9UA 3GIUA 2GE3A 1Q2DA 4AF7A 3Q38A 1TKFA 2D9RA 1VHSA 1I7PA 2EWBA 3I3GA 2F1MA 4YAOA 4P1VA 4PC1A 2CTBA 3LNNA 1BO4A 1NSAA 2QIRA 1U2RA 1IJEA 3FJUA 4OKOA 4AVCA 5LMZA 4DYOA 2FIWA 1F2PA 2V7XA 3DDYA 4II2A 3CW2A 2P6FA 2X3UA 2B7CA 2E1RA 2A4NA 4OPVA 4XKWA 1XF8A 4DUKA 3LO8A 3S6HA 3KKWA 2FS5A 3LACA 1M4GA 2CXAA 5A89A 2DEUA 1IOFA 2B3UA 3B2YA 2GK7A 2I00A 3IWWA 3KHZA 2GPJA 3PUNA 5E6TA 3S9LA 4RDLA 4FUUA 4BD9A 2VQYA 3VWEA 1S60A 1WORA 4L8JA 1BJKA 3KR4A 2W6JA 5TR9A 3H4QA 4Y49B 1T6XA 1QX4A 3BI1A 3CD6B 4MHDA 4NGNA 2QVPA 1F60A 1NB0A 3JU4A 4M2LA 3Q3AA 3TCVA 4B5PB 3WQZA 3W2IA 2HV2A 1JA1A 2PJ6A 2VZZA 3GVKA 1AUGA 3B82A 2Z3MA 3IU1A 4JD6A 3TOAA 1JNYA 1VQ4B 1CPXA 3CXCB 1FRNA 4F6AA 4OOXA 1E1RA 2CTCA 2OH1A 2F5IA 2OTJB 3EC4A 2Y0MA 1K4JA 5GV7A 5JQ4A 3JQPA 2AE6A 5LYIA 3OZWA 4UZFA 3BLNA 1N05A 1XE1A 3R96A 3ASSA 1YIJB 2VBTA 3D7HA 4KSIA 2B58A 1XEBA 1V0EA 1VQ7B 2ZEDA 4MFPA 1ZG8A 4R71A 4Z1MA 3D68A 3DDDA 1H8HA 1LCPA 3IWGA 2PCUA 4GM5A 3FMCA 3DNSA 1Y0RA 4TN1A 3T56B 3A8JA 4N3GA 4PAAA 5I4MA 5F4JA 4XLAA 4UBRA 4F9UA 4AB7A 2QMUA 2BEIA 1P0HA 1K9MD 2DY1A 2C4TA 1FNDA 4PXDA 1N8RD 5LYLA 1OBRA 4RUHA 4XNHB 4A31A 3CXSA 5KW9A 4CAVA 1BX1A 3A35A 5D8NA 1I18A 4PPZA 1PJ5A 2Z6BD 1ARLA 1Q81D 4LBWA 5K8OA 2X7BA 2Q6KA 3RNZA 1YLEA 3CPAA 1H8LA 2X53S 1ARMA 4NEXA 2EFGA 1LANA 4PXBA 4P6VF 2HCJB 2HLDA 1OZPA 1N06A 1K8AD 3FRMA 1YQEA 4ZGNB 1EWYA 5CBMA 3KEWA 2PIYA 4P4DA 3RBUA 2LZJA 2ZXIA 4NXYA 5JGFA 5CPAA 3BHXA 2XNCA 1LOKA 2BCOA 3T8WA 4MYTA 1Q9SA 4B3FX 3R95A 4QVTA 2CIJA 4ORFA 4FWTA 3AGPA 4XOPA 2K5TA 1OB5A 4U5YA 2HB6A 3ZZ0A 3KHXA 4TKOB 3OPOA 4EWTA 3OEHA 4XLFA 4P12A 1R5NA 3LQ6A 2FIAA 5HZBA 1QUEA 2Q7BA 2ZL6A 2AFXA 1F2OA 2CF4A 4KOVA 2DPTA 4NGSA 4KS9A 1K28D 5J8FA 2C5BA 2DOGA 5IYNA 5AN9A 4E8OA 3CCMB 4R57A 3FVLA 2XEIA 4ZX8A 3VMFA 1RXTA 4DK0A 1KZLA 4Z4RA 3RY8A 4MHYA 1YX0A 5FO1A 1YMEA 4B5OA 2JEVA 1Z5RA 1G7RA 3KASA 1M4IA 3W2FA 4J0QA 4M3SA 1TLLA 4EFDA 2V7VA 4UA3A 1KJZA 1MJBA 4Z4UA 2VBSA 4XLHA 4Y9UA 3H94A 3WBKA 2Z3OA 3EY5A 4ZCLA 1ZO0A 2FXFA 2VEZA 3CC4B 4KKTA 4PC2A 3A8KA 2Z3LA 4C2YA 1W87A 1J9ZA 1TKJA 2Q0YA 1PYTB 1KTVA 2C27A 2ZEGA 2DPSA 3S9MA 2EK8A 1KMHA 3IJ3A 2P3MA 1JJ2B 2POKA 3W2EA 3P26A 2GFQA 3VR6A 4B48A 3CXPA 2VNHA 3TFYA 1UD6A 4KVOE 2EO8A 1AMOA 4PC6A 3GY9A
chains in the Genus database with same CATH topology
3KZWA 2F7VA 4NFRA 3PB7X 2AFSA 4UIAA 3S9NA 2C1CA 4ZY0A 2PJ8A 3H8EA 4X3RA 4DJLA 3IO1A 1VHEA 4W9YA 5HVFA 3FX6A 2I3CA 3PB8X 3H8GA 4B6ZA 4CPAA 1BPNA 3CDXA 4OC0A 4X8IA 1FNOA 2ABZA 2ZEHA 2EK9A 3PFEA 3VH9A 5IB9A 5K8MA 4MCSA 2VL1A 1VHOA 5HVHA 2PJ2A 3WABA 3KR5A 4OC2A 3PB6X 2AFOA 3V38A 1DE4C 4P4EA 2WYRA 2PIZA 1HDQA 1Y0YA 2V8DA 4UF4A 2PJ5A 4MMOA 1CX8A 2ZEEA 2ZEPA 1Z2LA 1PCAA 4A39A 3B3SA 3FF3A 1VGYA 2IMOA 2XEJA 2XEGA 3CT9A 2PJ4A 4MCRA 3B7IA 2PJ3A 4PXEA 5F09A 1CBXA 8CPAA 3SJEA 1Z8LA 2HC9A 3VATA 1YLOA 2PVVA 4G1PA 4TWEA 1TKHA 1AYEA 5JH9A 4YU9A 2QJ8A 4OC1A 3K2KA 4NJQA 2GREA 2GU2A 3KQZA 3FEEA 2PJAA 4NGQA 1KWMA 2V8GA 5K8NA 3GB0A 3SJXA 1ZG7A 1M4LA 4UEFA 4OC3A 4OC5A 3TX8A 3K9TA 4ONWA 1XJOA 2ZEFA 3PB4X 1BLLE 2AFMA 2JBKA 1TXRA 1TKFA 7CPAA 2V8VA 2EWBA 1HEEA 1TF9A 3D7DA 2CTBA 1NSAA 1FT7A 2PJ9A 3RZAA 2PJCA 5DS0A 2RFHA 3RAMA 3FJUA 4OKOA 1JQGA 4DYOA 1F2PA 4WWVA 4NGPA 2V77A 3H8FA 2JBJA 4DUKA 3NFZA 3IC1A 3B2YA 2AFWA 3BI0A 2O53A 3IWWA 1TF8A 2PJ1A 3KHZA 3PBBA 3S9LA 2QYVA 2JEWA 2BOAA 4FUUA 4NJRA 4MHNA 3ISXA 4BD9A 1CPSA 3KI9A 2Q51A 3ISZA 4R76A 3FH4A 3KR4A 2PJ7A 2C6CA 3BI1A 3GUXA 3CPXA 4NGNA 2QVPA 3HLPA 3SJGA 4ZI6A 1ZLHA 2ZENA 3KL9A 2DEAA 3NH4A 1XRYA 3IEHA 3LWUA 2PJ0A 2PJ6A 4R6TA 3B35A 4LQGA 4Q7AA 4A37A 4UIBA 3JRUA 4OIWA 3SI0A 1CPXA 4ZYQA 4IAVA 2CTCA 4EMEA 1QQ9A 1GYTA 3PEIA 4OP4A 3NA6A 3NH5A 1UWYA 2G9DA 3IFEA 1ZLIA 3L2NA 4MCQA 2O4HA 3KGQA 1EE3P 1IGBA 1F57A 2Q43A 5LYIA 4IK2A 5JM6A 4P4IA 1BPMA 2OR4A 4AXVA 4NGMA 3DGVA 3D7HA 4KSIA 4P44A 4MXUA 2ZOGA 2ZEDA 3TC8A 1ZG8A 3WC5A 1YW4A 2ZELA 4P4BA 4MRIA 1LFWA 3D68A 1LCPA 2PCUA 2PJBA 4GM5A 1ELMP 2C6GA 1RTQA 3FMCA 1Y0RA 3BXMA 4UEZA 5HVGA 3GLJA 4A94A 2NYQA 1CP6A 5I4MA 2FVGA 4F9UA 5J1QA 2IJZA 4WJBA 1XMBA 4JZ0A 5ELYA 1BAVA 1ZG9A 4YWYA 4P45A 3B3CA 2J9AA 4PXDA 2BO9A 5LYLA 1OBRA 4RUHA 5D29A 4NGRA 3LMSA 4FAIA 3MN8A 2GLJA 5D8NA 2ANPA 4PPZA 1ARLA 2PVWA 5K8OA 3CPAA 1H8LA 1ARMA 1LANA 4PXBA 4OIDA 3HUVA 4TNUA 3PFOA 4R8FA 1Q7LA 5LRJA 3QNVA 5CBMA 1R43A 3D4UA 3WT4A 3I1UA 2PIYA 1CP7A 4IHMA 1AMPA 4P4DA 1DTDA 1CG2A 2IQ6A 4MHZA 3RBUA 5JGFA 2NSMA 5CPAA 3BHXA 1LOKA 2BCOA 5HXDA 4NGTA 3KQXA 3T8WA 2CIJA 3FEDA 3NH8A 4PQAA 4R7MA 1ELLP 4K3NA 4MCPA 4P10A 2HB6A 3KHXA 3V7ZA 4EWTA 2OOTA 2AFZA 2AFXA 1IY7A 1F2OA 2F8HA 3D7GA 2CF4A 4FWUA 4NGSA 4P4JA 2RB7A 2ZOFA 2C6PA 3B3WA 3FVLA 4Z65A 2XEIA 2PE3A 4ZX8A 2WZNA 1HDUA 3D7FA 4OMEA 3WC6A 1XFOA 4MHYA 2V8HA 1YMEA 5LYDA 1Z5RA 4JYWA 1YW6A 2ZEOA 3KASA 4ZX9A 4ZY2A 2GLFA 3B3VA 3PRTA 4EFDA 4P6YA 4UEEA 2AFUA 1XBUA 1YSJA 2Q4ZA 3SI2A 4FBEA 3SI1A 3MRUA 4A38A 2XEFA 3FECA 2ZEMA 3B3TA 1Y7EA 5LYFA 3D66A 1TKJA 1PYTB 2ZEGA 3DLJA 4PXCA 3S9MA 2EK8A 4ZY1A 4OC4A 4F8ZA 4O23A 4F9VA 4H2KA 3IJ3A 5LRGA 4MHPA 1QMUA 2PRQA 1LAMA 5THWA 2POKA 3SJFA 3WC7A 1VIXA 6CPAA 4X2TA 1R3NA 4P4FA 3VARA 3D67A 3N5FA 3PB9X 3PBEA 5K8PA 1LAPA 3IIBA 5LRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZW A;  2F7V A;  4NFR A;  3PB7 X;  2AFS A;  4UIA A;  3S9N A;  2C1C A;  4ZY0 A;  2PJ8 A;  3H8E A;  4X3R A;  4DJL A;  3IO1 A;  1VHE A;  4W9Y A;  5HVF A;  3FX6 A;  2I3C A;  3PB8 X;  3H8G A;  4B6Z A;  4CPA A;  1BPN A;  3CDX A;  4OC0 A;  4X8I A;  1FNO A;  2ABZ A;  2ZEH A;  2EK9 A;  3PFE A;  3VH9 A;  5IB9 A;  5K8M A;  4MCS A;  2VL1 A;  1VHO A;  5HVH A;  2PJ2 A;  3WAB A;  3KR5 A;  4OC2 A;  3PB6 X;  2AFO A;  3V38 A;  1DE4 C;  4P4E A;  2WYR A;  2PIZ A;  1HDQ A;  1Y0Y A;  2V8D A;  4UF4 A;  2PJ5 A;  4MMO A;  1CX8 A;  2ZEE A;  2ZEP A;  1Z2L A;  1PCA A;  4A39 A;  3B3S A;  3FF3 A;  1VGY A;  2IMO A;  2XEJ A;  2XEG A;  3CT9 A;  2PJ4 A;  4MCR A;  3B7I A;  2PJ3 A;  4PXE A;  5F09 A;  1CBX A;  8CPA A;  3SJE A;  1Z8L A;  2HC9 A;  3VAT A;  1YLO A;  2PVV A;  4G1P A;  4TWE A;  1TKH A;  1AYE A;  5JH9 A;  4YU9 A;  2QJ8 A;  4OC1 A;  3K2K A;  4NJQ A;  2GRE A;  2GU2 A;  3KQZ A;  3FEE A;  2PJA A;  4NGQ A;  1KWM A;  2V8G A;  5K8N A;  3GB0 A;  3SJX A;  1ZG7 A;  1M4L A;  4UEF A;  4OC3 A;  4OC5 A;  3TX8 A;  3K9T A;  4ONW A;  1XJO A;  2ZEF A;  3PB4 X;  1BLL E;  2AFM A;  2JBK A;  1TXR A;  1TKF A;  7CPA A;  2V8V A;  2EWB A;  1HEE A;  1TF9 A;  3D7D A;  2CTB A;  1NSA A;  1FT7 A;  2PJ9 A;  3RZA A;  2PJC A;  5DS0 A;  2RFH A;  3RAM A;  3FJU A;  4OKO A;  1JQG A;  4DYO A;  1F2P A;  4WWV A;  4NGP A;  2V77 A;  3H8F A;  2JBJ A;  4DUK A;  3NFZ A;  3IC1 A;  3B2Y A;  2AFW A;  3BI0 A;  2O53 A;  3IWW A;  1TF8 A;  2PJ1 A;  3KHZ A;  3PBB A;  3S9L A;  2QYV A;  2JEW A;  2BOA A;  4FUU A;  4NJR A;  4MHN A;  3ISX A;  4BD9 A;  1CPS A;  3KI9 A;  2Q51 A;  3ISZ A;  4R76 A;  3FH4 A;  3KR4 A;  2PJ7 A;  2C6C A;  3BI1 A;  3GUX A;  3CPX A;  4NGN A;  2QVP A;  3HLP A;  3SJG A;  4ZI6 A;  1ZLH A;  2ZEN A;  3KL9 A;  2DEA A;  3NH4 A;  1XRY A;  3IEH A;  3LWU A;  2PJ0 A;  2PJ6 A;  4R6T A;  3B35 A;  4LQG A;  4Q7A A;  4A37 A;  4UIB A;  3JRU A;  4OIW A;  3SI0 A;  1CPX A;  4ZYQ A;  4IAV A;  2CTC A;  4EME A;  1QQ9 A;  1GYT A;  3PEI A;  4OP4 A;  3NA6 A;  3NH5 A;  1UWY A;  2G9D A;  3IFE A;  1ZLI A;  3L2N A;  4MCQ A;  2O4H A;  3KGQ A;  1EE3 P;  1IGB A;  1F57 A;  2Q43 A;  5LYI A;  4IK2 A;  5JM6 A;  4P4I A;  1BPM A;  2OR4 A;  4AXV A;  4NGM A;  3DGV A;  3D7H A;  4KSI A;  4P44 A;  4MXU A;  2ZOG A;  2ZED A;  3TC8 A;  1ZG8 A;  3WC5 A;  1YW4 A;  2ZEL A;  4P4B A;  4MRI A;  1LFW A;  3D68 A;  1LCP A;  2PCU A;  2PJB A;  4GM5 A;  1ELM P;  2C6G A;  1RTQ A;  3FMC A;  1Y0R A;  3BXM A;  4UEZ A;  5HVG A;  3GLJ A;  4A94 A;  2NYQ A;  1CP6 A;  5I4M A;  2FVG A;  4F9U A;  5J1Q A;  2IJZ A;  4WJB A;  1XMB A;  4JZ0 A;  5ELY A;  1BAV A;  1ZG9 A;  4YWY A;  4P45 A;  3B3C A;  2J9A A;  4PXD A;  2BO9 A;  5LYL A;  1OBR A;  4RUH A;  5D29 A;  4NGR A;  3LMS A;  4FAI A;  3MN8 A;  2GLJ A;  5D8N A;  2ANP A;  4PPZ A;  1ARL A;  2PVW A;  5K8O A;  3CPA A;  1H8L A;  1ARM A;  1LAN A;  4PXB A;  4OID A;  3HUV A;  4TNU A;  3PFO A;  4R8F A;  1Q7L A;  5LRJ A;  3QNV A;  5CBM A;  1R43 A;  3D4U A;  3WT4 A;  3I1U A;  2PIY A;  1CP7 A;  4IHM A;  1AMP A;  4P4D A;  1DTD A;  1CG2 A;  2IQ6 A;  4MHZ A;  3RBU A;  5JGF A;  2NSM A;  5CPA A;  3BHX A;  1LOK A;  2BCO A;  5HXD A;  4NGT A;  3KQX A;  3T8W A;  2CIJ A;  3FED A;  3NH8 A;  4PQA A;  4R7M A;  1ELL P;  4K3N A;  4MCP A;  4P10 A;  2HB6 A;  3KHX A;  3V7Z A;  4EWT A;  2OOT A;  2AFZ A;  2AFX A;  1IY7 A;  1F2O A;  2F8H A;  3D7G A;  2CF4 A;  4FWU A;  4NGS A;  4P4J A;  2RB7 A;  2ZOF A;  2C6P A;  3B3W A;  3FVL A;  4Z65 A;  2XEI A;  2PE3 A;  4ZX8 A;  2WZN A;  1HDU A;  3D7F A;  4OME A;  3WC6 A;  1XFO A;  4MHY A;  2V8H A;  1YME A;  5LYD A;  1Z5R A;  4JYW A;  1YW6 A;  2ZEO A;  3KAS A;  4ZX9 A;  4ZY2 A;  2GLF A;  3B3V A;  3PRT A;  4EFD A;  4P6Y A;  4UEE A;  2AFU A;  1XBU A;  1YSJ A;  2Q4Z A;  3SI2 A;  4FBE A;  3SI1 A;  3MRU A;  4A38 A;  2XEF A;  3FEC A;  2ZEM A;  3B3T A;  1Y7E A;  5LYF A;  3D66 A;  1TKJ A;  1PYT B;  2ZEG A;  3DLJ A;  4PXC A;  3S9M A;  2EK8 A;  4ZY1 A;  4OC4 A;  4F8Z A;  4O23 A;  4F9V A;  4H2K A;  3IJ3 A;  5LRG A;  4MHP A;  1QMU A;  2PRQ A;  1LAM A;  5THW A;  2POK A;  3SJF A;  3WC7 A;  1VIX A;  6CPA A;  4X2T A;  1R3N A;  4P4F A;  3VAR A;  3D67 A;  3N5F A;  3PB9 X;  3PBE A;  5K8P A;  1LAP A;  3IIB A;  5LRK A; 
#chains in the Genus database with same CATH topology
 2WSA A;  3KZW A;  4FD4 A;  5B6I A;  1I21 A;  2AFS A;  4XNF A;  3F5B A;  2C1C A;  4U9Z A;  1D2E A;  3IO1 A;  1KK3 A;  5FIU A;  2REF A;  1E79 A;  4XOR A;  4M85 A;  5HVF A;  3FX6 A;  3QFS A;  2I3C A;  3PB8 X;  3H8G A;  4CPA A;  3OE7 A;  3F8K A;  1ZM3 A;  3VO1 A;  2HMA A;  3GVJ A;  3T9Y A;  4XON A;  3PFE A;  3VH9 A;  5K8M A;  4MCS A;  4G6I A;  1VHO A;  1PKV A;  2C5H A;  4YAL A;  3V38 A;  4HNX B;  3PVD A;  2DCU A;  1E64 A;  4OAE A;  3OJW A;  2PIZ A;  2V8D A;  3SLN A;  3ES9 A;  2ZEP A;  4LBZ A;  4ASU A;  2DER A;  1B23 P;  4MJ8 A;  4A32 A;  4HIZ A;  2XEJ A;  2XEG A;  4L8A A;  2PJ4 A;  4TT3 A;  4E0A A;  1BOB A;  4MCR A;  3TTH A;  1QGZ A;  2PJ3 A;  2V7U A;  3FNC A;  5F09 A;  2F4N A;  3SJE A;  1Z8L A;  1TKH A;  3AST A;  5JH9 A;  2QJ8 A;  2Q6O A;  4K1X A;  4OC1 A;  4OOV A;  1Y9W A;  5F49 A;  4CGL A;  2PJA A;  1KWM A;  3CTA A;  2OTL B;  2GIV A;  3ZBT A;  5GV8 A;  3SJX A;  5BWA B;  2B3V A;  4F7D A;  2R7H A;  4UEF A;  4OC5 A;  3Q39 A;  1FRQ A;  1N0U A;  3PB4 X;  3JUW A;  2AFM A;  1EFR A;  1TF9 A;  3GKR A;  3D7D A;  3QB8 A;  5TV2 A;  1AIP A;  1UD8 A;  1FT7 A;  3W2H A;  2PJC A;  5DS0 A;  3RAM A;  4PAB A;  1WSV A;  1R5B A;  4XN3 A;  3R9F A;  2P6E A;  1E1Q A;  3DR8 A;  5BSX A;  2V77 A;  1QH0 A;  3H8F A;  2JBJ A;  3CCJ B;  2FSR A;  1S0U A;  4B43 A;  3D2M A;  2FE7 A;  5A8A A;  2EVN A;  2YND A;  2O53 A;  1TF8 A;  2PJ1 A;  4TMX A;  2YNC C;  1VLO A;  3PBB A;  3CMA B;  2JEW A;  4KOR A;  4CGM A;  5H5J A;  4YAF A;  1YIT B;  1CPS A;  2Q6I A;  1R5O A;  4LBV A;  1S4M A;  1PU9 A;  3SKB A;  3W5V A;  2C6C A;  5C82 A;  4N3N A;  3GUX A;  2D4O A;  2ZL7 A;  2CBX A;  3CC2 B;  3HLP A;  1NMT A;  4ZI6 A;  2GJK A;  2BPO A;  2PRB A;  3S6F A;  1EP3 B;  3UY5 A;  2DEA A;  1KK0 A;  2ARH A;  2Q6L A;  3IEH A;  3CME B;  2I79 A;  4X05 A;  2YWF A;  1Q7Y D;  3ONU A;  3B35 A;  4GS4 A;  4LQG A;  3QAY A;  5J3O A;  1KK1 A;  5EC4 A;  4X07 A;  1BLI A;  2P6G A;  4UIB A;  4KOY A;  4OIW A;  3BQJ A;  5DN6 A;  1Y9K A;  2F43 A;  4KOX A;  1WOS A;  2ZTG A;  4II3 A;  2I1L A;  3NA6 A;  1MK4 A;  5H86 A;  3L2N A;  3CRZ A;  4MCQ A;  4NCZ A;  2O4H A;  2BGJ A;  4UAJ A;  3OZV A;  3EFA A;  4KSF A;  1VF7 A;  3W6S A;  2WZP P;  4C7I A;  4OPS A;  4IK2 A;  2OR4 A;  1TTT A;  4Y49 C;  4RD4 A;  4AXV A;  1YJW B;  4M6H A;  2OK7 A;  3OZU A;  1QUF A;  2PIA A;  5HZA A;  2PR8 A;  2ZOG A;  1VQ5 B;  4DQK A;  1WWZ A;  4ZCM A;  2ZEL A;  1LFW A;  2J8M A;  1DDG A;  1GVH A;  3CCE B;  3CCU B;  4F0X A;  3I55 B;  4PSX A;  5IK2 A;  3CMM A;  2X85 A;  5HXB A;  4A94 A;  5HVG A;  1HZE A;  1T6Y A;  3CCR B;  2NYQ A;  1CP6 A;  1YVK A;  2IJZ A;  2X6W A;  4Z4Z A;  3R9G A;  1FX0 A;  1W35 A;  4TMT A;  4CQJ A;  1BAV A;  3MMP A;  1ZG9 A;  3A9L A;  2OB0 A;  3TO9 A;  2O28 A;  4CAE A;  2PDO A;  2BO9 A;  1X10 A;  3B8H A;  5IYW A;  3WXM A;  5JBQ A;  4JXR A;  5D29 A;  1YR0 A;  1IU8 A;  4OPO A;  1L0C A;  3MN8 A;  2GLJ A;  3WYA A;  5KTA A;  1GO2 A;  4NSQ A;  1TIQ A;  2WJY A;  3CCV B;  2VNI A;  4MFQ A;  5G22 A;  4C7H A;  1J4J A;  1MRZ A;  1Q7L A;  5LRJ A;  4Z4Y A;  5H59 A;  3TE4 A;  1CP7 A;  1A2Z A;  4IHM A;  1XQB A;  4Y7C A;  4LQ6 A;  4UFX A;  3BJ7 A;  2NSM A;  2DF5 A;  5EMI A;  5HXD A;  4NGT A;  2F1L A;  2ZZF A;  3AVW A;  3NH8 A;  3G71 B;  2Q4Y A;  3NE5 B;  4R7M A;  4XKV A;  1ELL P;  2QML A;  5A28 A;  5GCN A;  4P10 A;  1NB9 A;  2OOT A;  5EMN A;  2FX3 A;  2CC2 A;  1EFU A;  4JWP A;  3BNW A;  4B11 A;  2WZN A;  3A3G A;  3QFT A;  1HDU A;  4RCY A;  5IYP A;  4OME A;  1WK4 A;  2JIZ A;  4P9S A;  3WC6 A;  2R9V A;  2XNJ A;  3G3S A;  1IOI A;  2CK3 A;  5F4O A;  2EUI A;  4H6U A;  5KTC A;  2VNK A;  3ZC3 A;  4UZE A;  5L46 A;  4B12 A;  2GLF A;  3IGR A;  2G3A A;  3T53 B;  3P2F A;  4CRY B;  4U9Y A;  4YEL A;  4UEE A;  2AFU A;  1CNE A;  1ELO A;  3QFC A;  4YHB A;  1YSJ A;  4FBE A;  3SI2 A;  1MAB A;  2D3N A;  3MRU A;  4II9 A;  2XEF A;  4QC6 A;  5AG6 A;  1VQ9 B;  2C4U A;  4G7X A;  4KOS A;  2YGW A;  4BMH A;  1KQS B;  2V7Q A;  1VQP B;  4UCN A;  4RJL A;  2GAN A;  4ZY1 A;  3QE2 A;  1QSR A;  4F8Z A;  4O23 A;  4F9V A;  4RS2 A;  4H2K A;  2C78 A;  1H8E A;  4MHP A;  1RQP A;  4DNC A;  2PMD A;  5THW A;  3SJF A;  1QFJ A;  1VIX A;  6CPA A;  4X2T A;  1QSO A;  3VAR A;  2FL4 A;  3N5F A;  3CB4 A;  4XPD B;  4XPD C;  4DQL A;  1G7T A;  1S7K A;  4I49 A;  2QEX B;  5IYQ A;  4E2A A;  2R98 A;  4JMQ A;  4UIA A;  4M6G A;  1N08 A;  3H5Z A;  4G1B A;  4A2Z A;  2CND A;  4FD7 A;  3CC7 B;  4RI1 A;  4RN7 A;  3WNB A;  5IX3 A;  3GVL A;  3CDX A;  1ON0 A;  2OZG A;  1FNO A;  2ABZ A;  2Q04 A;  2EK9 A;  3QSY A;  4AVZ A;  5IB9 A;  2VL1 A;  1NSL A;  1VQ8 B;  2JJ2 A;  3BH4 A;  3ZZI A;  2PJ2 A;  3T90 A;  3KR5 A;  2BM0 A;  4B5P A;  4QBJ A;  2PJ5 A;  4WZT A;  2DXQ A;  2AJ6 A;  1Z2L A;  2X6Y A;  4A39 A;  2VNJ A;  3ASP A;  1E63 A;  2VZY A;  3AVT A;  4PXE A;  2REE A;  4KOW A;  3RO0 A;  5TY0 A;  1TVC A;  3VAT A;  2ZTN A;  4G1P A;  4TWE A;  3AVX A;  3W5U A;  1I1D A;  2HUZ A;  5J8C A;  4UWJ A;  3K2K A;  5F48 A;  2GRE A;  2GU2 A;  3KQZ A;  4NGQ A;  4XPL A;  1I12 A;  4G1V A;  2V8G A;  3OWC A;  2ZW5 A;  4LUA A;  1ZG7 A;  4IUS A;  1M4L A;  4MBU A;  4OC3 A;  2AHO A;  2D4P A;  2OU2 A;  4Z4W A;  4MFK A;  4ONW A;  1BLL E;  4CAW A;  1OB0 A;  1TXR A;  2JLM A;  1S7F A;  1PUA A;  2V8V A;  1BPL A;  5FO0 A;  2J7K A;  1NJI D;  2J8R A;  5CNP A;  1QFZ A;  1Q86 D;  1SKY B;  1W34 A;  2BVN A;  3RZA A;  3NE8 A;  2V7W A;  1M1D A;  4DNR B;  4LBY A;  4WWV A;  4NGP A;  1WOP A;  5J35 A;  1W9X A;  1I8D A;  4GQN A;  3IWE A;  4DK1 A;  3W6X A;  3NFZ A;  3IC1 A;  3F0A A;  2V31 A;  5KNL A;  4KZT A;  5ISV A;  4KLW A;  2VBU A;  1VQL B;  1VQK B;  3PZJ A;  2HDN B;  4UCP A;  4FD6 A;  1IIC A;  4XN0 A;  2XZP A;  1YX2 A;  2BOA A;  3ISX A;  3KI9 A;  4AF6 A;  2Q51 A;  3PUM A;  1KRH A;  3FH4 A;  4RDK A;  3I56 B;  1CM0 A;  4B3G A;  4E0F A;  2RC5 A;  1X12 A;  4M1K A;  3R9E A;  3SJG A;  1FDR A;  3E0K A;  1KZF A;  1ZLH A;  2CY2 A;  3AVU A;  1YK3 A;  2ZEN A;  3KL9 A;  3R6J A;  4NF1 A;  2B4D B;  4R3K A;  4RCZ A;  4YFJ A;  1E3X A;  1XRY A;  3LWU A;  2PJ0 A;  4OAD A;  4OOS A;  4R6T A;  4KOT A;  4Q7A A;  5HKK A;  3B78 A;  1CNF A;  4CYP A;  3R6K A;  4QUZ A;  5FA6 A;  3EXN A;  4OLL A;  3JRU A;  3SI0 A;  1B2R A;  4RM0 A;  2VBQ A;  1BX0 A;  4IAV A;  3I1F A;  3AVY A;  2YWE A;  1QQ9 A;  4B13 A;  4JXQ A;  1QGA A;  2QDX A;  4TMZ A;  3NH5 A;  1QSM A;  1UWY A;  2G9D A;  4QB9 A;  1F20 A;  2XND A;  1ZLI A;  3IFE A;  2YNE A;  1WP6 A;  2XGJ A;  2ZW6 A;  3KGQ A;  3OFN A;  1EE3 P;  4XM3 A;  2BMW A;  1WU8 A;  1K73 D;  1F57 A;  2GJP A;  1M44 A;  3BY1 A;  4RPD A;  5IYR A;  1BPM A;  3GIR A;  2X8K A;  3SLD A;  1XIX A;  3DGV A;  4NGM A;  3WBJ A;  4P44 A;  4WQM A;  1RO5 A;  3P2H A;  4HE6 A;  3FJO A;  4ZGQ B;  5AGE A;  2Z3K A;  3MGD A;  1YW4 A;  2B5O A;  1PJ7 A;  3ZJ0 A;  3A3B A;  1QST A;  2PJB A;  1FNC A;  1ELM P;  4RLZ A;  1RTQ A;  1QVF B;  2PR1 A;  4C2Z A;  3BXM A;  2JDI A;  2R6H A;  2WSS A;  5F47 A;  4HPS A;  1Q2C A;  2FVG A;  2Q4V A;  1Z9U A;  1KUV A;  5J1Q A;  1WPC A;  1CQX A;  3PA2 A;  1XMB A;  4BBH A;  4JZ0 A;  3S6K A;  2V7T A;  3Q6Q A;  1VKC A;  3B3C A;  2OBT A;  3SXO A;  3D3S A;  2NMT A;  4QHY A;  3SJP A;  4NCN A;  1Z4R A;  3G4S B;  4NGR A;  3LMS A;  4AG9 A;  1IB0 A;  2VXK A;  3FYN A;  5G21 A;  5DSZ A;  3PP9 A;  4H89 A;  4MY0 A;  2ZZE A;  2PVW A;  4M0L A;  4M4S A;  4KUB A;  3GYA A;  3BCD A;  1VQ6 B;  4X7E A;  1KUY A;  4OID A;  4TNU A;  1IJF A;  2QE7 A;  3PFO A;  1P4M A;  2XZL A;  2D3L A;  4X7F A;  3QNV A;  2PSW A;  3D4U A;  3WT4 A;  2B5G B;  3I1U A;  4QUS A;  1Z4E A;  5IB0 A;  5JPH A;  1AMP A;  2WPX A;  2IQ6 A;  1QVG B;  2G3T A;  3MHP A;  1VQO B;  1W2B B;  4PV6 A;  3KQX A;  5FNZ A;  1SKQ A;  3FED A;  3CPW B;  4CYO A;  1SM4 A;  3FPK A;  4PQA A;  4CGO A;  4PSW A;  4MCP A;  2VYQ A;  3OAA A;  1S72 B;  3QFR A;  2QTZ A;  2AFZ A;  5F4M A;  1IY7 A;  3D7G A;  2F8H A;  4FWU A;  4X5K A;  2BSW A;  2IL4 A;  2PC1 A;  1YJN B;  1KD1 D;  2RB7 A;  3B3W A;  2C6P A;  2PE3 A;  4QFM A;  3D7F A;  1YHQ B;  1UD4 A;  1XFO A;  3V76 A;  5IV0 A;  4RD1 A;  4WZL A;  5LYD A;  1YVO A;  4JYW A;  4FK8 A;  4Q36 A;  4YGO A;  4ZX9 A;  3FBU A;  1RQR A;  3B3V A;  1IID A;  1LRZ A;  4MY3 A;  3A1P A;  1EP2 B;  1G7C A;  4XLC A;  1XBU A;  2DET A;  2R8V A;  1U6M A;  2C2W A;  4C43 A;  2Q4Z A;  4C2X A;  3SI1 A;  1E62 A;  4K30 A;  2J8N A;  2ZEM A;  4B10 A;  3B3T A;  4KSA A;  4IW3 B;  3D66 A;  1V5V A;  3PGP A;  4XOT A;  4CGP A;  5F46 A;  2KCW A;  1QFY A;  1NDH A;  4OC4 A;  1BQE A;  3LQE A;  1H85 A;  2BL1 A;  4JLY A;  1M1K D;  2PRQ A;  1LAM A;  1WSR A;  3CXQ A;  3FB3 A;  3WC7 A;  1IB1 E;  2PQ8 A;  3JVN A;  3ZIA A;  1R3N A;  4P3I A;  4P4F A;  3D67 A;  1EP1 B;  3PB9 X;  3PBE A;  5KTD A;  1EFT A;  4MFZ A;  5E96 A;  4P25 A;  3IIB A;  5LRK A;  1Z8X A;  3NE7 A;  4A33 A;  4PC7 A;  2YNC A;  3WND A;  2F7V A;  3CP2 A;  4NFR A;  1QG0 A;  2WJV A;  2OBS A;  1OB2 A;  4XNH C;  2RC6 A;  4AVB A;  1KC8 D;  3W2G A;  3P27 A;  2PJ8 A;  3H8E A;  4X3R A;  4RD3 A;  4FN5 A;  4DJL A;  3BC9 A;  3WNC A;  3LVB A;  1R57 A;  2KVO A;  3AVV A;  4W9Y A;  4Q38 A;  3TO7 A;  4HKF A;  4GXH A;  4B6Z A;  4H6Z A;  3OW7 A;  2ZXH A;  4OC0 A;  2Z0Z A;  2ODF A;  3RYO A;  3A8I A;  2ZEH A;  3N7Z A;  2BUE A;  3PA1 A;  2Q44 A;  4R87 A;  2ZW4 A;  2CW5 A;  1JA0 A;  4OC2 A;  2AFO A;  4Z4T A;  5HH1 A;  4EVY A;  3VNV A;  2WYR A;  1HDQ A;  1Y0Y A;  2QEC A;  4LX9 A;  3MCA A;  4TSF A;  4MMO A;  1CX8 A;  2ZEE A;  3OP1 A;  1YJ9 B;  1WTH D;  1XE4 A;  2QN6 A;  1UD2 A;  4RD6 A;  2IMO A;  3R1K A;  4CYN A;  1VJS A;  4KVM E;  4CAF A;  4ZBG A;  1HA3 A;  3HAG A;  4QVJ A;  5CDF A;  3PEN A;  1CBX A;  8CPA A;  5A88 A;  4X06 A;  2HC9 A;  3OJX A;  4C68 A;  4YU9 A;  3S6G A;  1IYL A;  2OBR A;  5DWM A;  4CYQ A;  4RD2 A;  1G7S A;  4ACB A;  3D26 A;  5K8N A;  4CGN A;  3GB0 A;  4TMV A;  4WZK A;  3TX8 A;  3K9T A;  1XJO A;  2ZEF A;  3ASR A;  2JBK A;  4Z4S A;  3JQQ A;  4BIN A;  7CPA A;  3U2Q A;  4F0Y A;  3SJZ A;  4FD5 A;  1IHM A;  1HEE A;  1NRK A;  2JDD A;  4KUA A;  1WOO A;  2PJ9 A;  2RC4 A;  2RFH A;  3FXT A;  1S5K A;  1NBM A;  2WPD A;  3JTK A;  1JQG A;  2X6X A;  1KUX A;  2OZU A;  2Z10 A;  4LC0 A;  3VWD A;  2Q7S A;  4PK3 A;  1V0F A;  4Y9R A;  2GJR A;  2BV3 A;  2ZZQ A;  3BCF A;  1H42 A;  2AFW A;  3BI0 A;  2GQF A;  2ZPA A;  1ZUN B;  1YRE A;  3OW2 B;  2QYV A;  4NJR A;  4MHN A;  4X0C A;  1OGI A;  4MFL A;  3ISZ A;  4R76 A;  2YWG A;  4C0S A;  2PJ7 A;  3E1Y E;  3FPP A;  1P4N A;  1Q2Y A;  4P2N A;  3IU2 A;  3CPX A;  4PK2 A;  2VZL A;  2HQY A;  2C77 A;  1VQN B;  4B14 A;  2CNT A;  3AGQ A;  1MJ9 A;  3Q6R A;  3NH4 A;  2B5G A;  1V0C A;  1VLY A;  1SQH A;  5C88 A;  2D74 A;  2M5S A;  4X7C A;  4A37 A;  1GAQ A;  4ZYQ A;  1HVX A;  3TO6 A;  3ONY A;  4EME A;  1GYT A;  3PEI A;  3VO2 A;  3OKX A;  4ZGY B;  1M4D A;  4OP4 A;  2YWH A;  3C26 A;  4M53 A;  2DYI A;  1MJA A;  1QGY A;  2Z3P A;  4ONU A;  1UD5 A;  2ZIT A;  2JDC A;  2NV4 A;  1IGB A;  2PLF A;  4P22 A;  2Q43 A;  1OGJ A;  1XB2 A;  1KK2 A;  4QV2 A;  5JM6 A;  4P4I A;  1YGH A;  4RD0 A;  1ZM4 A;  3H9N A;  4B44 A;  4KKU A;  4XMY A;  3ZBU A;  3EO4 A;  4MXU A;  4OP7 A;  3TC8 A;  3FKS A;  2BM1 A;  4G5G A;  3WC5 A;  4P4B A;  4MRI A;  2OK8 A;  3ZZU A;  3CP8 A;  3V8I A;  4UWI A;  4KKS A;  4XPK A;  3U6B A;  2C6G A;  1Q82 D;  1PJ6 A;  2ZXV A;  4UEZ A;  3GLJ A;  4UFW A;  4YRH A;  4HNW B;  2ZBV A;  4ACA A;  3ZZT A;  1GHE A;  4WJB A;  2GK6 A;  2ATR A;  5ELY A;  1FNB A;  4YWY A;  2NPF A;  4P45 A;  1ZM9 A;  2J9A A;  1T5E A;  4DNT B;  2QA4 B;  2ZZG A;  4J3G A;  4L89 A;  4RPB A;  4TMW A;  1N71 A;  3TT2 A;  4UZU A;  4FAI A;  2EIX A;  4WZE A;  2JN9 A;  5AG4 A;  2ANP A;  3G8W A;  3FIX A;  4Z4V A;  1E3Z A;  2VI7 A;  3BY2 A;  4AG7 A;  1ZM2 A;  3HUV A;  1W0J A;  4R8F A;  3SHP A;  3U6K A;  4YEJ A;  3VNU A;  4UFV A;  2QGG A;  1R43 A;  5H84 A;  2VBV A;  4EH1 A;  2OYN A;  1DTD A;  1CG2 A;  4MHZ A;  5KSW B;  2ZL5 A;  4XQF A;  2CNM A;  4ROX A;  5AG7 A;  4Q7J B;  1A8P A;  4P26 A;  4AC9 A;  4YAW A;  2XEX A;  2B7B A;  4NBS A;  4K3N A;  5A27 A;  1JWQ A;  1GJR A;  4R9M A;  1UMK A;  3V7Z A;  3ASQ A;  4UCM A;  1FNM A;  4XLE A;  3ZUG A;  2E1B A;  3I9S A;  2Z3N A;  5BSY A;  1NE9 A;  1B87 A;  1N0V C;  2B4D A;  4MYU A;  4P4J A;  2VJJ A;  1Z8W A;  4B3X A;  2ZOF A;  1S7N A;  4Z65 A;  2R1I A;  3DR6 A;  3OOC A;  5THX A;  1N07 A;  2XOK A;  3GQB A;  3WY9 A;  1S3Z A;  2V8H A;  2WR8 A;  1YW6 A;  3G6E B;  2ZEO A;  3OEE A;  1GAW A;  1JB9 A;  4FXU A;  2B4B A;  4ZY2 A;  5FL7 A;  3PRT A;  3ZPN A;  1OHH A;  4P6Y A;  3DSB A;  2ZBU A;  2WPW A;  1D8T A;  4R3L A;  3CES A;  2BSA A;  4A38 A;  1YI2 B;  3FEC A;  3GSI A;  2FCK A;  1Y7E A;  3WR7 A;  5LYF A;  5EBV A;  1CJW A;  2WUU A;  3CCL B;  3DLJ A;  5I0C A;  4PXC A;  2CRV A;  5FVJ A;  4AVA A;  4H9G A;  1Z8T A;  4NNJ A;  1E43 A;  5LRG A;  5AG5 A;  1QMU A;  1XOV A;  1W0K A;  1QSN A;  2X0K A;  5K8P A;  1UD3 A;  1LAP A;  4ZV4 A;  5G1Z A;  4CAX A;  3K9U A;  4JJX A;  4A95 A;  4MFJ A;  3B8G A;  4YXW A;  1S7L A;  1M90 D;  2BF4 A;  3PB7 X;  3J81 k;  2P0W A;  3CZX A;  3S9N A;  3G05 A;  4ZY0 A;  2QTL A;  2G0B A;  1XMT A;  2Z11 A;  3E20 A;  1FY7 A;  1VHE A;  2CNS A;  1WDT A;  3W91 A;  3CCQ B;  4KLV A;  4X7D A;  4QVA A;  4A30 A;  4YAU A;  1EFC A;  4CS0 B;  4KVX A;  1DAR A;  1BPN A;  4HNY B;  4X8I A;  4CRZ B;  3D2P A;  2BN4 A;  1BMF A;  4XR6 A;  1IYK A;  2DIE A;  4KOU A;  2W6I A;  1VQM B;  4PGO A;  5HVH A;  2BGI A;  5HMN A;  3JQR A;  3WAB A;  3BJ8 A;  3PB6 X;  1DE4 C;  1DDI A;  4P4E A;  3V7A A;  1GR1 A;  2EBJ A;  4MI4 A;  5G20 A;  1Y7R A;  4RDJ A;  4UF4 A;  3T51 B;  4G7W A;  1PCA A;  3SEJ A;  3SXN A;  3B3S A;  4P3Y A;  3FF3 A;  4M6I A;  1B6B A;  1VGY A;  3CT9 A;  4XD7 A;  1T6Z A;  4ZCI A;  2OZH A;  3B7I A;  3D8P A;  2ZW7 A;  4XL9 A;  1EXM A;  1DG1 G;  2FT0 A;  2V4D A;  2XZO A;  1D1N A;  3TOB A;  1YLO A;  2PVV A;  1AYE A;  4B4D A;  1UFH A;  2H5M A;  3CCS B;  3W5H A;  4B47 A;  2VJI A;  4IF5 A;  2JJ1 A;  4NJQ A;  3QAH A;  1TUI A;  4BPR A;  3FEE A;  4PC3 A;  1COW A;  5TRD A;  3LD2 A;  3LOD A;  4HE5 A;  5DWN A;  4U9U A;  3GIU A;  2GE3 A;  1Q2D A;  4AF7 A;  3Q38 A;  1TKF A;  2D9R A;  1VHS A;  1I7P A;  2EWB A;  3I3G A;  2F1M A;  4YAO A;  4P1V A;  4PC1 A;  2CTB A;  3LNN A;  1BO4 A;  1NSA A;  2QIR A;  1U2R A;  1IJE A;  3FJU A;  4OKO A;  4AVC A;  5LMZ A;  4DYO A;  2FIW A;  1F2P A;  2V7X A;  3DDY A;  4II2 A;  3CW2 A;  2P6F A;  2X3U A;  2B7C A;  2E1R A;  2A4N A;  4OPV A;  4XKW A;  1XF8 A;  4DUK A;  3LO8 A;  3S6H A;  3KKW A;  2FS5 A;  3LAC A;  1M4G A;  2CXA A;  5A89 A;  2DEU A;  1IOF A;  2B3U A;  3B2Y A;  2GK7 A;  2I00 A;  3IWW A;  3KHZ A;  2GPJ A;  3PUN A;  5E6T A;  3S9L A;  4RDL A;  4FUU A;  4BD9 A;  2VQY A;  3VWE A;  1S60 A;  1WOR A;  4L8J A;  1BJK A;  3KR4 A;  2W6J A;  5TR9 A;  3H4Q A;  4Y49 B;  1T6X A;  1QX4 A;  3BI1 A;  3CD6 B;  4MHD A;  4NGN A;  2QVP A;  1F60 A;  1NB0 A;  3JU4 A;  4M2L A;  3Q3A A;  3TCV A;  4B5P B;  3WQZ A;  3W2I A;  2HV2 A;  1JA1 A;  2PJ6 A;  2VZZ A;  3GVK A;  1AUG A;  3B82 A;  2Z3M A;  3IU1 A;  4JD6 A;  3TOA A;  1JNY A;  1VQ4 B;  1CPX A;  3CXC B;  1FRN A;  4F6A A;  4OOX A;  1E1R A;  2CTC A;  2OH1 A;  2F5I A;  2OTJ B;  3EC4 A;  2Y0M A;  1K4J A;  5GV7 A;  5JQ4 A;  3JQP A;  2AE6 A;  5LYI A;  3OZW A;  4UZF A;  3BLN A;  1N05 A;  1XE1 A;  3R96 A;  3ASS A;  1YIJ B;  2VBT A;  3D7H A;  4KSI A;  2B58 A;  1XEB A;  1V0E A;  1VQ7 B;  2ZED A;  4MFP A;  1ZG8 A;  4R71 A;  4Z1M A;  3D68 A;  3DDD A;  1H8H A;  1LCP A;  3IWG A;  2PCU A;  4GM5 A;  3FMC A;  3DNS A;  1Y0R A;  4TN1 A;  3T56 B;  3A8J A;  4N3G A;  4PAA A;  5I4M A;  5F4J A;  4XLA A;  4UBR A;  4F9U A;  4AB7 A;  2QMU A;  2BEI A;  1P0H A;  1K9M D;  2DY1 A;  2C4T A;  1FND A;  4PXD A;  1N8R D;  5LYL A;  1OBR A;  4RUH A;  4XNH B;  4A31 A;  3CXS A;  5KW9 A;  4CAV A;  1BX1 A;  3A35 A;  5D8N A;  1I18 A;  4PPZ A;  1PJ5 A;  2Z6B D;  1ARL A;  1Q81 D;  4LBW A;  5K8O A;  2X7B A;  2Q6K A;  3RNZ A;  1YLE A;  3CPA A;  1H8L A;  2X53 S;  1ARM A;  4NEX A;  2EFG A;  1LAN A;  4PXB A;  4P6V F;  2HCJ B;  2HLD A;  1OZP A;  1N06 A;  1K8A D;  3FRM A;  1YQE A;  4ZGN B;  1EWY A;  5CBM A;  3KEW A;  2PIY A;  4P4D A;  3RBU A;  2LZJ A;  2ZXI A;  4NXY A;  5JGF A;  5CPA A;  3BHX A;  2XNC A;  1LOK A;  2BCO A;  3T8W A;  4MYT A;  1Q9S A;  4B3F X;  3R95 A;  4QVT A;  2CIJ A;  4ORF A;  4FWT A;  3AGP A;  4XOP A;  2K5T A;  1OB5 A;  4U5Y A;  2HB6 A;  3ZZ0 A;  3KHX A;  4TKO B;  3OPO A;  4EWT A;  3OEH A;  4XLF A;  4P12 A;  1R5N A;  3LQ6 A;  2FIA A;  5HZB A;  1QUE A;  2Q7B A;  2ZL6 A;  2AFX A;  1F2O A;  2CF4 A;  4KOV A;  2DPT A;  4NGS A;  4KS9 A;  1K28 D;  5J8F A;  2C5B A;  2DOG A;  5IYN A;  5AN9 A;  4E8O A;  3CCM B;  4R57 A;  3FVL A;  2XEI A;  4ZX8 A;  3VMF A;  1RXT A;  4DK0 A;  1KZL A;  4Z4R A;  3RY8 A;  4MHY A;  1YX0 A;  5FO1 A;  1YME A;  4B5O A;  2JEV A;  1Z5R A;  1G7R A;  3KAS A;  1M4I A;  3W2F A;  4J0Q A;  4M3S A;  1TLL A;  4EFD A;  2V7V A;  4UA3 A;  1KJZ A;  1MJB A;  4Z4U A;  2VBS A;  4XLH A;  4Y9U A;  3H94 A;  3WBK A;  2Z3O A;  3EY5 A;  4ZCL A;  1ZO0 A;  2FXF A;  2VEZ A;  3CC4 B;  4KKT A;  4PC2 A;  3A8K A;  2Z3L A;  4C2Y A;  1W87 A;  1J9Z A;  1TKJ A;  2Q0Y A;  1PYT B;  1KTV A;  2C27 A;  2ZEG A;  2DPS A;  3S9M A;  2EK8 A;  1KMH A;  3IJ3 A;  2P3M A;  1JJ2 B;  2POK A;  3W2E A;  3P26 A;  2GFQ A;  3VR6 A;  4B48 A;  3CXP A;  2VNH A;  3TFY A;  1UD6 A;  4KVO E;  2EO8 A;  1AMO A;  4PC6 A;  3GY9 A; 
#chains in the Genus database with same CATH homology
 3KZW A;  2F7V A;  4NFR A;  3PB7 X;  2AFS A;  4UIA A;  3S9N A;  2C1C A;  4ZY0 A;  2PJ8 A;  3H8E A;  4X3R A;  4DJL A;  3IO1 A;  1VHE A;  4W9Y A;  5HVF A;  3FX6 A;  2I3C A;  3PB8 X;  3H8G A;  4B6Z A;  4CPA A;  1BPN A;  3CDX A;  4OC0 A;  4X8I A;  1FNO A;  2ABZ A;  2ZEH A;  2EK9 A;  3PFE A;  3VH9 A;  5IB9 A;  5K8M A;  4MCS A;  2VL1 A;  1VHO A;  5HVH A;  2PJ2 A;  3WAB A;  3KR5 A;  4OC2 A;  3PB6 X;  2AFO A;  3V38 A;  1DE4 C;  4P4E A;  2WYR A;  2PIZ A;  1HDQ A;  1Y0Y A;  2V8D A;  4UF4 A;  2PJ5 A;  4MMO A;  1CX8 A;  2ZEE A;  2ZEP A;  1Z2L A;  1PCA A;  4A39 A;  3B3S A;  3FF3 A;  1VGY A;  2IMO A;  2XEJ A;  2XEG A;  3CT9 A;  2PJ4 A;  4MCR A;  3B7I A;  2PJ3 A;  4PXE A;  5F09 A;  1CBX A;  8CPA A;  3SJE A;  1Z8L A;  2HC9 A;  3VAT A;  1YLO A;  2PVV A;  4G1P A;  4TWE A;  1TKH A;  1AYE A;  5JH9 A;  4YU9 A;  2QJ8 A;  4OC1 A;  3K2K A;  4NJQ A;  2GRE A;  2GU2 A;  3KQZ A;  3FEE A;  2PJA A;  4NGQ A;  1KWM A;  2V8G A;  5K8N A;  3GB0 A;  3SJX A;  1ZG7 A;  1M4L A;  4UEF A;  4OC3 A;  4OC5 A;  3TX8 A;  3K9T A;  4ONW A;  1XJO A;  2ZEF A;  3PB4 X;  1BLL E;  2AFM A;  2JBK A;  1TXR A;  1TKF A;  7CPA A;  2V8V A;  2EWB A;  1HEE A;  1TF9 A;  3D7D A;  2CTB A;  1NSA A;  1FT7 A;  2PJ9 A;  3RZA A;  2PJC A;  5DS0 A;  2RFH A;  3RAM A;  3FJU A;  4OKO A;  1JQG A;  4DYO A;  1F2P A;  4WWV A;  4NGP A;  2V77 A;  3H8F A;  2JBJ A;  4DUK A;  3NFZ A;  3IC1 A;  3B2Y A;  2AFW A;  3BI0 A;  2O53 A;  3IWW A;  1TF8 A;  2PJ1 A;  3KHZ A;  3PBB A;  3S9L A;  2QYV A;  2JEW A;  2BOA A;  4FUU A;  4NJR A;  4MHN A;  3ISX A;  4BD9 A;  1CPS A;  3KI9 A;  2Q51 A;  3ISZ A;  4R76 A;  3FH4 A;  3KR4 A;  2PJ7 A;  2C6C A;  3BI1 A;  3GUX A;  3CPX A;  4NGN A;  2QVP A;  3HLP A;  3SJG A;  4ZI6 A;  1ZLH A;  2ZEN A;  3KL9 A;  2DEA A;  3NH4 A;  1XRY A;  3IEH A;  3LWU A;  2PJ0 A;  2PJ6 A;  4R6T A;  3B35 A;  4LQG A;  4Q7A A;  4A37 A;  4UIB A;  3JRU A;  4OIW A;  3SI0 A;  1CPX A;  4ZYQ A;  4IAV A;  2CTC A;  4EME A;  1QQ9 A;  1GYT A;  3PEI A;  4OP4 A;  3NA6 A;  3NH5 A;  1UWY A;  2G9D A;  3IFE A;  1ZLI A;  3L2N A;  4MCQ A;  2O4H A;  3KGQ A;  1EE3 P;  1IGB A;  1F57 A;  2Q43 A;  5LYI A;  4IK2 A;  5JM6 A;  4P4I A;  1BPM A;  2OR4 A;  4AXV A;  4NGM A;  3DGV A;  3D7H A;  4KSI A;  4P44 A;  4MXU A;  2ZOG A;  2ZED A;  3TC8 A;  1ZG8 A;  3WC5 A;  1YW4 A;  2ZEL A;  4P4B A;  4MRI A;  1LFW A;  3D68 A;  1LCP A;  2PCU A;  2PJB A;  4GM5 A;  1ELM P;  2C6G A;  1RTQ A;  3FMC A;  1Y0R A;  3BXM A;  4UEZ A;  5HVG A;  3GLJ A;  4A94 A;  2NYQ A;  1CP6 A;  5I4M A;  2FVG A;  4F9U A;  5J1Q A;  2IJZ A;  4WJB A;  1XMB A;  4JZ0 A;  5ELY A;  1BAV A;  1ZG9 A;  4YWY A;  4P45 A;  3B3C A;  2J9A A;  4PXD A;  2BO9 A;  5LYL A;  1OBR A;  4RUH A;  5D29 A;  4NGR A;  3LMS A;  4FAI A;  3MN8 A;  2GLJ A;  5D8N A;  2ANP A;  4PPZ A;  1ARL A;  2PVW A;  5K8O A;  3CPA A;  1H8L A;  1ARM A;  1LAN A;  4PXB A;  4OID A;  3HUV A;  4TNU A;  3PFO A;  4R8F A;  1Q7L A;  5LRJ A;  3QNV A;  5CBM A;  1R43 A;  3D4U A;  3WT4 A;  3I1U A;  2PIY A;  1CP7 A;  4IHM A;  1AMP A;  4P4D A;  1DTD A;  1CG2 A;  2IQ6 A;  4MHZ A;  3RBU A;  5JGF A;  2NSM A;  5CPA A;  3BHX A;  1LOK A;  2BCO A;  5HXD A;  4NGT A;  3KQX A;  3T8W A;  2CIJ A;  3FED A;  3NH8 A;  4PQA A;  4R7M A;  1ELL P;  4K3N A;  4MCP A;  4P10 A;  2HB6 A;  3KHX A;  3V7Z A;  4EWT A;  2OOT A;  2AFZ A;  2AFX A;  1IY7 A;  1F2O A;  2F8H A;  3D7G A;  2CF4 A;  4FWU A;  4NGS A;  4P4J A;  2RB7 A;  2ZOF A;  2C6P A;  3B3W A;  3FVL A;  4Z65 A;  2XEI A;  2PE3 A;  4ZX8 A;  2WZN A;  1HDU A;  3D7F A;  4OME A;  3WC6 A;  1XFO A;  4MHY A;  2V8H A;  1YME A;  5LYD A;  1Z5R A;  4JYW A;  1YW6 A;  2ZEO A;  3KAS A;  4ZX9 A;  4ZY2 A;  2GLF A;  3B3V A;  3PRT A;  4EFD A;  4P6Y A;  4UEE A;  2AFU A;  1XBU A;  1YSJ A;  2Q4Z A;  3SI2 A;  4FBE A;  3SI1 A;  3MRU A;  4A38 A;  2XEF A;  3FEC A;  2ZEM A;  3B3T A;  1Y7E A;  5LYF A;  3D66 A;  1TKJ A;  1PYT B;  2ZEG A;  3DLJ A;  4PXC A;  3S9M A;  2EK8 A;  4ZY1 A;  4OC4 A;  4F8Z A;  4O23 A;  4F9V A;  4H2K A;  3IJ3 A;  5LRG A;  4MHP A;  1QMU A;  2PRQ A;  1LAM A;  5THW A;  2POK A;  3SJF A;  3WC7 A;  1VIX A;  6CPA A;  4X2T A;  1R3N A;  4P4F A;  3VAR A;  3D67 A;  3N5F A;  3PB9 X;  3PBE A;  5K8P A;  1LAP A;  3IIB A;  5LRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...