1VHOA

Crystal structure of a putative peptidase/endoglucanase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
331
structure length
319
Chain Sequence
METGKLLMELSNLDGPSGYETNVVSYIKSVIEPFVDEAKTTRHGSLIGYKKGKGIGKLAFFAHVDEIGFVVSKVEGQFARLEPVYASKVRIYTKNGIERGVIGMLAPHLQDSESRKKVPTYDEIFVDLSLCERGVRVGDIAVIDQTAFETNGKVVGKALDNRASCGVLVKVLEFLKRYDHPWDVYVVFSVQEETGCLGALTGAYEINPDAAIVMDVTFASEPPFSDHIELGKGPVIGLGPVVDRNLVQKIIEIAKKHNVSLQEEAVGGRTDFVQLVRNGVRTSLISIPLKYMHTPVEMVDPRDVEELARLLSLVAVELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords endoglucanase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Thermotoga maritima
total genus 94
structure length 319
sequence length 331
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 1vhoA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1vhoA01
1BPMA 3KR5A 2PJ1A 3K9TA 4EMEA 1XRYA 5IB9A 2JEWA 1JQGA 1VGYA 2ZEHA 3IWWA 2OOTA 2CF4A 2QJ8A 1LCPA 1CP6A 5F09A 4X2TA 8CPAA 3KR4A 2ZOFA 1YSJA 4MHYA 3TX8A 3NH5A 1CPXA 5ELYA 3SI0A 2PE3A 4MCSA 5JGFA 2V8VA 1ARLA 2G9DA 3B3VA 3HUVA 4P4IA 1RTQA 4ZYQA 4OKOA 3BI1A 6CPAA 3IFEA 4P44A 2Q4ZA 2ZEPA 4NGRA 3B3CA 5CBMA 4ZY2A 3TC8A 1Q7LA 4PXCA 1QQ9A 4PXDA 3SI1A 2EK8A 3PB8X 3B35A 1ZG9A 3D7FA 4NGSA 1LAPA 4A38A 1AMPA 4NGTA 1CX8A 3PBBA 4NJRA 2AFMA 2PJAA 3FECA 1DE4C 4PXBA 2BCOA 1LAMA 5JM6A 1F57A 5K8OA 5LRKA 3RZAA 1VHEA 1LANA 2PJ9A 2IJZA 4NJQA 1CPSA 2Q51A 4Q7AA 4WJBA 4R76A 3SJFA 5K8NA 2PJ4A 2HC9A 5HXDA 1VIXA 3PRTA 3PBEA 3FMCA 4MHZA 1YMEA 3KI9A 4DUKA 1OBRA 3PFEA 4BD9A 4G1PA 2PRQA 5LYDA 3WABA 2FVGA 2CTBA 1TKHA 4OC4A 5LRJA 2WZNA 3N5FA 3D66A 1Y0RA 4NGQA 4MCQA 4A94A 2WYRA 1F2OA 4R7MA 2ZEGA 3KQXA 1BAVA 1R43A 5K8PA 3HLPA 4PPZA 2I3CA 4EWTA 1LOKA 4OC3A 3WC6A 3SJEA 2IQ6A 3L2NA 3B3SA 3KL9A 3MRUA 2DEAA 4NGNA 3B7IA 1Z8LA 3KASA 2GREA 5JH9A 2ZELA 4IHMA 2F7VA 2PJ7A 3B2YA 4MHPA 3FJUA 2ZEEA 4F8ZA 4X8IA 2AFOA 1YW4A 3QNVA 2IMOA 1CG2A 2BOAA 4UIAA 1ZLHA 4MCPA 3SJGA 1Z5RA 4IAVA 4OC1A 2JBJA 3T8WA 2PVVA 3WC7A 3JRUA 4O23A 3BHXA 4NGPA 5I4MA 1QMUA 2XEGA 2CIJA 2ZEMA 4AXVA 3PEIA 1IY7A 5THWA 4R8FA 4P4BA 3K2KA 2QYVA 1HEEA 1XMBA 2O53A 1PYTB 1ZG7A 2AFWA 3GB0A 4YWYA 2RFHA 2ZENA 3FX6A 4ZY1A 1YLOA 3D7HA 4P10A 3DLJA 2EWBA 2CTCA 4YU9A 5D8NA 1ARMA 4JZ0A 4MRIA 4P4DA 1UWYA 1Z2LA 5LYIA 4ZI6A 7CPAA 4TWEA 3H8GA 4OC0A 3D7DA 3RBUA 3I1UA 2XEJA 2GLFA 3DGVA 4UEEA 1NSAA 4F9VA 4EFDA 2HB6A 2ZEOA 2C6PA 2ZOGA 2ZEFA 1XJOA 2PJ8A 2PJ3A 3H8FA 4RUHA 4LQGA 1YW6A 3CDXA 3FVLA 3KHXA 5LYFA 4FUUA 3CPXA 3NFZA 2PJ6A 3NA6A 3FEEA 3KZWA 3S9NA 3IEHA 4P4FA 1R3NA 3IO1A 4F9UA 4P45A 2F8HA 1EE3P 2GLJA 2GU2A 2ANPA 3H8EA 3VARA 2PJBA 4W9YA 3FEDA 4H2KA 3LWUA 2RB7A 2V8DA 1IGBA 2PJ0A 4FWUA 4WWVA 1AYEA 1TF9A 4OIDA 3IIBA 5J1QA 2ABZA 5LRGA 1M4LA 3CT9A 3RAMA 2V8GA 1CBXA 1KWMA 4MCRA 3MN8A 4DJLA 3SI2A 2V8HA 4MMOA 2J9AA 3PFOA 1CP7A 2OR4A 1ZLIA 3IJ3A 4X3RA 1PCAA 1XBUA 4Z65A 1HDQA 2AFZA 3D67A 3V7ZA 4NGMA 3D68A 4P4EA 4TNUA 1BPNA 5K8MA 2XEFA 4UF4A 4UEZA 4CPAA 3GUXA 2Q43A 4JYWA 2PVWA 4FBEA 4DYOA 3WT4A 4PQAA 2QVPA 1ELLP 1FT7A 4UEFA 3D4UA 4FAIA 4NFRA 3PB4X 3V38A 1FNOA 1TF8A 3S9LA 2PCUA 3IC1A 3PB7X 4B6ZA 3PB6X 1VHOA 2O4HA 3B3TA 4A39A 3KGQA 3VH9A 1TXRA 4IK2A 5D29A 2AFUA 3KHZA 4A37A 3CPAA 1LFWA 5DS0A 3VATA 2PJ5A 2EK9A 5HVGA 2PJ2A 2POKA 4OC5A 2AFSA 4P6YA 2NYQA 1TKJA 4K3NA 5HVFA 3NH4A 5LYLA 4R6TA 1XFOA 3KQZA 1TKFA 2PJCA 4MXUA 4GM5A 3GLJA 4ZY0A 2AFXA 1HDUA 3NH8A 2C6CA 2C1CA 1Y0YA 4OP4A 1ELMP 3BXMA 3FF3A 4KSIA 1GYTA 4MHNA 2V77A 3B3WA 1H8LA 3LMSA 2ZEDA 4ZX9A 5CPAA 3S9MA 4UIBA 3D7GA 2PIYA 3BI0A 3FH4A 4PXEA 3SJXA 1F2PA 2JBKA 3WC5A 3ISXA 1DTDA 3PB9X 2BO9A 4OC2A 4OIWA 1BLLE 2XEIA 2C6GA 3ISZA 4P4JA 2PIZA 1Y7EA 4ONWA 4OMEA 5HVHA 1ZG8A 2VL1A 2NSMA 4ZX8A
chains in the Genus database with same CATH superfamily
3I3GA 3I1FA 2FIAA 3Q38A 4CGLA 5GV7A 3TE4A 2HCJB 1VGYA 4YAFA 1GAQA 2CNMA 1XMTA 2X6WA 1CP6A 5F09A 2R9VA 5HKKA 4MHYA 1VQNB 1NDHA 2ZL5A 2R7HA 5ELYA 3SI0A 2PE3A 4ZYQA 1UD3A 4PC3A 2PRBA 4GQNA 4XPDC 2JIZA 4HNXB 5CNPA 5AG7A 3OEEA 1TVCA 2F4NA 1IYKA 3BY2A 3TC8A 4PXCA 1YJNB 2P6EA 2BV3A 3BLNA 1TLLA 1N0UA 4ASUA 4RCYA 4NF1A 1XQBA 5BSYA 3FYNA 4NGSA 3G05A 2BMWA 3CMEB 4AC9A 3OEHA 1DARA 1JA0A 3FECA 3KKWA 4PXBA 2WPDA 2OB0A 1MK4A 1K73D 1QVFB 4MFKA 2E1RA 2FSRA 5CDFA 2PJ9A 2RC4A 3JQQA 1CPSA 3SJFA 2I1LA 1GAWA 3PENA 2QECA 3B82A 1VIXA 2JLMA 4R87A 3PBEA 1S7NA 2V7WA 3W91A 2DOGA 1OBRA 4BD9A 1E62A 2PRQA 3CCMB 2ZBVA 4WZKA 1YK3A 2XGJA 1TKHA 4OC4A 4C7HA 4B10A 1KTVA 2ZPAA 3A9LA 2GK6A 2D74A 3R96A 1JA1A 1VLOA 4R7MA 5KW9A 3FRMA 2Y0MA 4UZUA 2OZUA 3SXNA 5K8PA 2I3CA 1KZLA 5IK2A 1BOBA 3A3GA 1Q2DA 3SJEA 1KK3A 3L2NA 3B3SA 3KL9A 4B14A 1G7SA 2ZW6A 2GREA 2OBSA 1BMFA 2ZELA 2YWEA 3R9FA 2PJ7A 4XOTA 4MHPA 3JU4A 2ZEEA 2ODFA 1CG2A 1ZLHA 4MCPA 1Z5RA 2OH1A 4UCNA 4OC1A 4BINA 2Z3NA 3T8WA 1OB0A 4ZCIA 5GCNA 4KOWA 4KVME 4NGPA 2EIXA 4FD4A 3FKSA 2OYNA 2OZHA 4CAXA 3CCJB 1MRZA 4C2ZA 1M4IA 2V7XA 3PEIA 2QYVA 1N05A 2O53A 3EO4A 2AFWA 2FIWA 3GB0A 3PUNA 2ZENA 1QSMA 2C27A 3ZJ0A 4ZY1A 2XZLA 3E1YE 4YALA 2RC6A 2F5IA 4XPDB 4YU9A 1ZUNB 2B7BA 1UD2A 2HUZA 1QSTA 4ZI6A 1T5EA 1B87A 4KZTA 3A35A 4Q7JB 4RDLA 4P26A 4FD7A 5F46A 1PJ6A 4KOUA 3F0AA 4MFQA 3PGPA 2EBJA 5DWNA 5F47A 1KK2A 1XEBA 3CCEB 2GQFA 4NCZA 1WDTA 2Q04A 2B4BA 2PQ8A 1S5KA 3T90A 2C6PA 4JLYA 1XJOA 4Y9RA 4XKVA 2C4UA 4Y7CA 3U6KA 3B78A 4QHYA 2KVOA 2WUUA 3RYOA 5LYFA 1ZO0A 5TV2A 1V0FA 1VQMB 2R98A 4L89A 2P6GA 4P1VA 3IEHA 3KZWA 3LD2A 3IO1A 4YAWA 3R95A 2GK7A 3Q3AA 3MGDA 3OWCA 3OE7A 3CP8A 3JQPA 1NE9A 1EE3P 4P25A 4XLHA 5AG4A 3H5ZA 4OP7A 1IB0A 2OK8A 3FEDA 4NSQA 2X3UA 1Q86D 1YQEA 4X5KA 3OAAA 3AVYA 4M6IA 1NRKA 1Y9KA 2GIVA 1COWA 1WU8A 3RAMA 4R57A 3IWEA 1AMOA 4M4SA 3MN8A 2ZW4A 4PC1A 4DJLA 1KUVA 4JXQA 1T6XA 3PFOA 1N06A 5J8FA 3FIXA 2VNKA 1ZLIA 4X3RA 1TUIA 4U9YA 1PCAA 4QVJA 1XBUA 4Z65A 4CAFA 4XLAA 1VF7A 1XB2A 4TNUA 2D4OA 5ISVA 3U2QA 2VNHA 3GQBA 2QA4B 4PAAA 2W6IA 3CRZA 1F20A 3T9YA 4F0XA 1UD8A 1A2ZA 1ELLP 2G3AA 1EWYA 1BQEA 1IU8A 3D4UA 3PB4X 4TMVA 1FNOA 1H85A 1CQXA 3IC1A 3PB7X 2F43A 1R5NA 1QUFA 1UMKA 4KKUA 1U6MA 4UA3A 4H9GA 5KNLA 5G1ZA 2QGGA 3CXPA 4H6ZA 1E1QA 4HE6A 5D29A 2Z10A 3CPAA 1E63A 4P6VF 1IIDA 4G5GA 4DK0A 3CMMA 2EK9A 3OZUA 5HVGA 2PJ2A 1MJ9A 4MY0A 1I1DA 3EY5A 2P3MA 2I00A 1TKJA 1QGZA 1Z8WA 1K4JA 3ZPNA 2DERA 1VQ9B 2Q6OA 1ZM9A 1LRZA 1TKFA 3W2HA 4TMTA 2G3TA 1KQSB 3TO9A 5HZAA 2BGIA 3S6FA 2C5HA 3G4SB 1M1DA 4Z4RA 3NE7A 4YAOA 3B3WA 3CTAA 4RLZA 1WSVA 3LMSA 1B23P 1PUAA 3WYAA 4ACAA 1MJAA 1HA3A 2PIYA 2ZW7A 3BI0A 4PXEA 3SJXA 2DCUA 2WSSA 4Y9UA 3TT2A 1DTDA 1Q9SA 2C6GA 4WZEA 2ZL6A 1DDIA 4II3A 4OMEA 1ZG8A 4AVBA 1VLYA 3LACA 4Z4SA 2ZXVA 1BPMA 3KR5A 5IB9A 3EXNA 1JQGA 2D9RA 2FL4A 2FCKA 2VEZA 2OOTA 3FXTA 1PKVA 4XM3A 3HAGA 2ZOFA 3ONYA 4QVTA 1S7FA 3TX8A 3G3SA 1VQ7B 1CPXA 4RCZA 2VZYA 2X0KA 2V8VA 2G9DA 1YJWB 1RTQA 1BJKA 1R57A 3AVXA 5L46A 3GY9A 4KS9A 5IX3A 1M1KD 1Q7LA 4PXDA 4E0AA 2PR8A 1EFCA 2DIEA 2EK8A 1VQLB 3CC4B 5JQ4A 2BM0A 4B5PB 1AMPA 3DDYA 1CX8A 2B7CA 3PBBA 3E0KA 2VQYA 3W6XA 4MI4A 4M1KA 1CM0A 2BGJA 2ZBUA 2ZXHA 1F57A 4WQMA 1S7LA 4F0YA 2HQYA 3GYAA 5BSXA 4CAEA 3BNWA 5LRKA 4M53A 2HDNB 3RZAA 1LANA 2PC1A 5A27A 3R9EA 2Q51A 4WJBA 4R76A 2PJ4A 2HC9A 1VJSA 4TMZA 1PJ7A 3B8HA 3MCAA 3FMCA 1QUEA 3KI9A 2QIRA 1QGYA 3OW7A 4G1PA 1QSRA 3BCFA 4KLVA 3SEJA 1NB9A 2JDCA 1QFJA 3WABA 2FVGA 2CTBA 4P12A 4PC2A 5IYPA 3D2PA 3CXQA 2OTJB 2V7VA 1S0UA 5JPHA 4UAJA 4X7FA 4XL9A 4LBYA 2C2WA 1W2BB 3RO0A 4KSFA 2ZZEA 1G7RA 2NV4A 2ZEGA 4R71A 4QUZA 5KTCA 4J0QA 3QAYA 5FA6A 4LX9A 4JXRA 1QFZA 4RDJA 1I8DA 1BAVA 4QB9A 5AG5A 1AIPA 3QFTA 4I49A 1G7TA 1YREA 5KTDA 4OC3A 4YAUA 1ZM4A 3WC6A 2IQ6A 2PIAA 3PVDA 5F4JA 2R6HA 3VWEA 1EP2B 3CXSA 2Z3MA 3OJXA 1Z8TA 3W6SA 1YHQB 4PC6A 3CCVB 4II2A 2JN9A 1D1NA 2GANA 1BX1A 1IICA 4IF5A 1GR1A 2YGWA 4X8IA 2OBTA 3WNBA 2IMOA 3WR7A 1S3ZA 4UIAA 2JBJA 3IWGA 3ZUGA 3N7ZA 3D8PA 3WC7A 3BHXA 4BMHA 1VQ5B 5A28A 3SLNA 2E1BA 2P6FA 2XEGA 2CIJA 4G7WA 4G6IA 5THWA 2FT0A 2C4TA 4OPVA 3K2KA 3BJ8A 5IYWA 1Q2YA 1XMBA 1JB9A 2BSWA 3JUWA 4IW3B 4XORA 2ZTNA 4MJ8A 1WOSA 3SLDA 1YLOA 1OB2A 3WQZA 4PK2A 3DLJA 3I56B 2EWBA 2Z3KA 3CW2A 1W34A 4KOTA 4OPSA 2HV2A 4JZ0A 3TTHA 1YIJB 4P4DA 1UWYA 3I55B 1H8HA 4TWEA 3CP2A 5A88A 4NEXA 4CQJA 4XONA 1VQKB 2XEJA 2B3UA 3FBUA 4DNTB 4XOPA 2ZTGA 4F9VA 4MY3A 1DDGA 4M6HA 2WSAA 4M85A 2YNCA 3GSIA 1H42A 3D2MA 2VBVA 4KLWA 1RQRA 2A4NA 4UWIA 5KSWB 3EC4A 3QE2A 4L8JA 2B5GB 3QFRA 2WPXA 4RUHA 1Y9WA 3CB4A 1YW6A 3FVLA 1T6ZA 1KC8D 2JDIA 4RM0A 3LNNA 4C43A 4CGNA 2PJ6A 1NJID 3W2GA 3S9NA 1MABA 1WK4A 3PP9A 2Q4YA 3GIRA 4CYNA 1E79A 4K1XA 1GVHA 2VJJA 2F8HA 1QSOA 1SKQA 4MFZA 2GLJA 2GU2A 4RN7A 4PSXA 3PA2A 3CXCB 2PJBA 4B3XA 4UZEA 5F4OA 3QSYA 4H2KA 4RDKA 2V8DA 2D4PA 4CYQA 1TF9A 1RO5A 5J1QA 3ASTA 2ARHA 2X6YA 5LRGA 3CESA 1KUXA 4RPBA 3CT9A 3RNZA 4AF6A 2V8GA 4B5PA 1M4DA 2BF4A 3CCSB 2B4DA 1FDRA 1GO2A 1KZFA 1VQ8B 4MMOA 4JJXA 1EXMA 2J9AA 2XNJA 3IJ3A 4FD5A 4XLFA 2QE7A 2AFZA 3V7ZA 2XNDA 3D68A 2V31A 4P4EA 2CC2A 3QFSA 2XZPA 2Q43A 4AF7A 5I0CA 2JJ1A 3DR8A 4UEFA 4FAIA 3S9LA 2NMTA 1Q2CA 4R3LA 3OZVA 4ONUA 3PB6X 4AG7A 1VHOA 3PZJA 4J3GA 3DDDA 4TN1A 3V8IA 2DYIA 2ZW5A 3AVTA 4IK2A 2AFUA 2AE6A 1E3XA 3LODA 3OJWA 4A95A 4X05A 2REEA 2QTLA 4N3GA 2PSWA 5DS0A 4ZV4A 2DETA 4IUSA 4OC5A 3QFCA 2CY2A 4G1BA 3A1PA 4XLEA 5LYLA 4R6TA 1B2RA 3KQZA 3ZC3A 5EMIA 2B58A 1TIQA 4ACBA 1D2EA 4KOVA 4UCMA 4GM5A 3S6GA 1R5OA 3NE8A 3NH8A 2C1CA 2QMLA 4HNWB 4OP4A 4PK3A 2BL1A 1S60A 2V77A 2PMDA 1A8PA 5TR9A 1UFHA 4XQFA 3D26A 3TCVA 4ZX9A 2Q7SA 2BPOA 2WPWA 4XNFA 4R3KA 3FH4A 1IJFA 2JBKA 1Q81D 1BX0A 4JD6A 3ASPA 5LMZA 2Q7BA 4B4DA 4QBJA 3ISZA 3CCRB 4P4JA 2JDDA 4P9SA 4ONWA 4HE5A 4KORA 2VL1A 1W87A 3H9NA 3P26A 3SHPA 1XRYA 2J8NA 4MYUA 1OGJA 1P0HA 1LCPA 4X2TA 8CPAA 5IYRA 3KR4A 2QMUA 2WJYA 1YLEA 3NH5A 5G22A 1KRHA 1QSNA 1G7CA 2GPJA 1ARLA 4MBUA 3B3VA 4P4IA 4OKOA 3BI1A 6CPAA 4P44A 2Q4ZA 4LBWA 2VBUA 3TO7A 4NGRA 1K28D 3B3CA 3RY8A 5J3OA 4DNCA 1QQ9A 3ASQA 4A33A 3SKBA 4OADA 1RXTA 3PB8X 1VQ6B 3F8KA 3B35A 1X12A 1XE1A 3OPOA 1EP1B 2DPSA 4CS0B 4A31A 3FJOA 1DE4C 2DPTA 3CZXA 3E20A 4P3YA 5JM6A 3A8KA 1FNBA 1VHEA 2IJZA 4NJQA 4JWPA 5K8NA 5HXDA 3C26A 4BPRA 3PRTA 2AHOA 3CC7B 3IU1A 4MHZA 5TRDA 4DUKA 4HIZA 3PFEA 5THXA 2X53S 1EFRA 2FXFA 2VZZA 1CNFA 2WZNA 4OOVA 2Q6KA 3CCLB 4ZX8A 5FO1A 3N5FA 2B3VA 2R8VA 1ZM3A 4NGQA 4Z4VA 4MCQA 1NB0A 2D3NA 4CYOA 2Q4VA 4JMQA 2WYRA 4B5OA 4PV6A 4B11A 3Q6QA 4LUAA 4A2ZA 2R1IA 1CNEA 4C0SA 3LQ6A 2BVNA 2CNTA 4OLLA 3HLPA 1L0CA 3J81k 4EWTA 1LOKA 4XR6A 4KVXA 3F5BA 3MRUA 4MFLA 2J7KA 4E2AA 4KOYA 2J8MA 1V0EA 2QDXA 4ORFA 2GFQA 5JH9A 1YVKA 4PGOA 1I12A 3GVLA 1YVOA 2V7QA 3ASRA 3FJUA 1W0KA 3K9UA 4F8ZA 4RD4A 3BY1A 2AFOA 4FN5A 1YW4A 2PDOA 1QVGB 2XEXA 3B8GA 3SJGA 4IAVA 1H8EA 4N3NA 1IJEA 3VMFA 2PVVA 2EO8A 4O23A 5J8CA 1NBMA 3ZZTA 3TFYA 5IB0A 4YFJA 1IY7A 1WORA 2O28A 2DY1A 4P4BA 4R8FA 2BSAA 1HEEA 1OZPA 5G20A 4X7EA 1ZG7A 3Q6RA 4YWYA 2OK7A 2RFHA 1ELOA 5FVJA 4Z1MA 2LZJA 2DF5A 3FX6A 4MYTA 4X0CA 4QFMA 4X7DA 2VXKA 2CTCA 1ARMA 2W6JA 5LYIA 1D8TA 4AG9A 1W35A 4OC0A 3D7DA 3RBUA 3P2FA 2RC5A 4AVZA 3W2FA 1Y7RA 4UEEA 1NSAA 4M6GA 2ZITA 5KTAA 1XOVA 5FO0A 4MHDA 1BO4A 2PLFA 1I7PA 2ZL7A 4KVOE 2ZEOA 4MFPA 5BWAB 1WWZA 4F6AA 2PJ8A 2JJ2A 4C7IA 4TMWA 4AVCA 3H8FA 4XPLA 2WZPP 4DNRB 2Q6IA 1KK0A 3KHXA 1KMHA 3CPXA 2OU2A 4E8OA 4H89A 3VNVA 1UD6A 4QVAA 4ZCLA 4P4FA 2CNSA 4YELA 1BLIA 4P45A 4Z4ZA 2X6XA 4G1VA 4NBSA 5HZBA 4B48A 3VARA 4U9UA 2Z3PA 3ZIAA 1YR0A 4W9YA 4X06A 3LWUA 2KCWA 4GXHA 1IGBA 2PJ0A 4FD6A 4FWUA 3T51B 4OIDA 3JTKA 5EMNA 5DWMA 3LQEA 3G8WA 4P2NA 4P22A 2CXAA 1M4LA 1F60A 2YWGA 2YWFA 3WNCA 1W9XA 3NE5B 1N0VC 4Q36A 4NXYA 2WJVA 1P4MA 2CRVA 1CBXA 1KWMA 2IL4A 3OOCA 2DEUA 3SI2A 2C77A 1OB5A 4OPOA 3SJPA 1NSLA 5G21A 1S7KA 2XNCA 3SXOA 1HDQA 2GJRA 4RI1A 3D67A 2ZXIA 5F49A 3W5VA 3ES9A 4U9ZA 1FNDA 1KJZA 1BPNA 3VNUA 4K30A 5JBQA 2XEFA 4UF4A 4UEZA 4ZGYB 2NPFA 4RD6A 1KK1A 3GUXA 1WOPA 2PVWA 4JYWA 4FBEA 3BQJA 2BN4A 5EBVA 3OKXA 1IOIA 1R5BA 3VWDA 2QVPA 1PJ5A 4PSWA 2FS5A 2Z0ZA 2X85A 1GHEA 4NFRA 4KKSA 1HVXA 3V38A 1TF8A 5AG6A 2EUIA 4KOSA 1YI2B 3W2EA 3S6HA 1IYLA 4C2XA 2YNEA 5DN6A 3AGQA 3VH9A 1TXRA 4HNYB 2BUEA 4CAVA 1WPCA 4YRHA 4RD1A 3KHZA 4A37A 4CGMA 3JVNA 4UFVA 2Q6LA 1EFTA 2ATRA 1N07A 1XIXA 4RD0A 2C5BA 3VATA 4HKFA 2AFSA 4P6YA 2NYQA 2VI7A 2VBTA 1QH0A 3UY5A 1VQOB 1V0CA 1XFOA 4YHBA 1Z4RA 3H94A 2PJCA 4UZFA 3GLJA 2F1LA 5TY0A 2AFXA 4Y49C 4II9A 1M44A 1YJ9B 1Q82D 3WXMA 5EC4A 3ZZUA 4KSIA 1GYTA 5B6IA 4QV2A 1YX2A 1H8LA 2Z6BD 4EVYA 4AVAA 4DK1A 5CPAA 3S9MA 1CJWA 4UFXA 3A8IA 2REFA 1F2PA 3D3SA 2CBXA 3WC5A 5HH1A 5IYNA 3W5HA 2JEVA 5C82A 4OC2A 4OIWA 4NNJA 5A8AA 5F4MA 5H5JA 2PIZA 4UCPA 3W5UA 2V7UA 4OAEA 2NSMA 4A32A 4G7XA 4RD3A 2PJ1A 3K9TA 2VZLA 4EMEA 4A30A 2JEWA 2ZZFA 2ZEHA 3IWWA 4P3IA 1T6YA 4B44A 3AVWA 2C78A 2CF4A 1PU9A 4X07A 2QJ8A 1TTTA 1YSJA 3ZZ0A 4ZCMA 1RQPA 1FY7A 3CC2B 1Z8XA 4MCSA 5JGFA 3V76A 3R6KA 2OZGA 3HUVA 5H86A 1WP6A 3IFEA 2ZEPA 1SKYB 4RJLA 5CBMA 4ZY2A 2Z3OA 2CW5A 4LC0A 3BCDA 3SI1A 4CRZB 2VBSA 1FRQA 1ZG9A 3D7FA 1LAPA 4A38A 4M3SA 4NGTA 5FL7A 1QFYA 4NJRA 2AFMA 4KUBA 2PJAA 1FNMA 1E43A 2H5MA 4CYPA 1M4GA 4CAWA 1S72B 2BCOA 1LAMA 5IYQA 4ZBGA 3BH4A 4AB7A 1OGIA 5K8OA 3P2HA 3QB8A 2V7TA 1FNCA 4Q7AA 1N08A 3KEWA 3ZZIA 1K8AD 1YMEA 3I9SA 1Z4EA 2WR8A 3V7AA 1I21A 2GE3A 4TMXA 4KUAA 5LYDA 3IGRA 5AGEA 5LRJA 4QC6A 5F48A 1E1RA 2CK3A 3D66A 1Y0RA 2G0BA 3A3BA 2Q0YA 2YNCC 1E64A 3WBJA 4A94A 2Z11A 2XOKA 3AVUA 1F2OA 1YX0A 3FPKA 4XNHC 2FE7A 3KQXA 3DSBA 1R43A 4Y49B 5FIUA 1VKCA 3TO6A 3VO1A 4PPZA 4HPSA 2Q44A 3G6EB 2BEIA 4FWTA 4XKWA 4Z4TA 2BM1A 2DEAA 4NGNA 1P4NA 1UD5A 3B7IA 2V4DA 1Z8LA 1QG0A 3AGPA 5FNZA 3Q39A 3KASA 1Q7YD 4C2YA 4L8AA 1V5VA 2XZOA 3ASSA 4TKOB 5HXBA 2VNJA 3WNDA 1JJ2B 3A8JA 4IHMA 2QN6A 3W2IA 4LQ6A 3FNCA 2F7VA 1J4JA 3B2YA 4RD2A 5DSZA 2GJKA 5AN9A 3GIUA 4RPDA 3QNVA 3GKRA 2BOAA 3BJ7A 2VYQA 4YEJA 3FB3A 3OP1A 1BPLA 1J9ZA 1NMTA 3JRUA 3AVVA 5I4MA 1EFUA 1QMUA 2FX3A 2OTLB 2ZEMA 1XE4A 4AXVA 4ZGNB 3VR6A 2B5GA 4XN0A 1VQPB 1PYTB 2X7BA 3ZBTA 2K5TA 3H4QA 3MHPA 3G71B 1N71A 3D7HA 3WY9A 4P10A 2VNIA 5E6TA 5D8NA 3R6JA 1EP3B 4MRIA 4UFWA 2VBQA 1Z2LA 7CPAA 3PA1A 1B6BA 3H8GA 1FX0A 3I1UA 5A89A 1ON0A 2HLDA 2M5SA 2GLFA 3DGVA 4UBRA 1JWQA 5HMNA 4B3FX 3GVKA 3MMPA 4KOXA 4EFDA 1MJBA 2HB6A 4M0LA 1KUYA 4H6UA 3R9GA 3VO2A 2ZOGA 3S6KA 3LO8A 2ZEFA 2QTZA 4XN3A 4TSFA 2P0WA 2PJ3A 1VQ4B 1Z9UA 1E3ZA 1JNYA 3CDXA 4LQGA 3CCUB 2YNDA 4FUUA 3NFZA 3LVBA 2EVNA 4Z4UA 4CGOA 3NA6A 3FEEA 3OW2B 1R3NA 1WTHD 4PABA 4F9UA 2Z3LA 3CD6B 5C88A 3TOAA 3JQRA 4OOXA 2ANPA 4FXUA 3H8EA 2AJ6A 1YITB 1IOFA 4NCNA 3TOBA 2B5OA 4KKTA 2VJIA 1XF8A 2RB7A 4XD7A 1YGHA 3PUMA 4WWVA 4XMYA 1AYEA 4B43A 4U5YA 4YGOA 3IIBA 4LBVA 4RS2A 3SJZA 4R9MA 2ABZA 1HZEA 3CMAB 1AUGA 4XPKA 4XNHB 2CNDA 4B3GA 3DNSA 1WSRA 1UD4A 4YXWA 1SQHA 4MCRA 3FPPA 1IB1E 3IU2A 2EFGA 2V8HA 3EFAA 4WZTA 1CP7A 2OR4A 5IV0A 2X8KA 4M2LA 4B12A 4B13A 3GVJA 4NGMA 4B47A 1K9MD 1QGAA 5K8MA 4XLCA 4CPAA 1GJRA 4FK8A 4DYOA 4DQKA 3WT4A 2D3LA 1WOOA 4PQAA 3OFNA 4DQLA 1FT7A 4TT3A 4ZGQB 4LBZA 3P27A 2PCUA 4B6ZA 3OZWA 5H59A 3ONUA 1X10A 2J8RA 2O4HA 4PC7A 3B3TA 4A39A 3KGQA 2B4DB 1LFWA 4OOSA 3CPWB 2ZZQA 2PR1A 2PJ5A 3WBKA 1S4MA 2POKA 4X7CA 4EH1A 2I79A 1W0JA 3T56B 4K3NA 5HVFA 1FRNA 3NH4A 2GJPA 4QUSA 4UWJA 2QEXB 4Z4WA 4MXUA 3T53B 5J35A 4C68A 2YWHA 4ZY0A 1HDUA 2C6CA 3U6BA 4KSAA 1Y0YA 4Z4YA 2HMAA 4ROXA 1ELMP 2DXQA 3BXMA 3FF3A 3QAHA 2ZZGA 4MHNA 1QX4A 5GV8A 4CGPA 4Q38A 4MFJA 1VHSA 4E0FA 2ZEDA 3ZBUA 4GS4A 3CCQB 1KD1D 1N8RD 4UIBA 3D7GA 1M90D 1I18A 2F1MA 1SM4A 3BC9A 4CRYB 2OBRA 3ISXA 1IHMA 4WZLA 1U2RA 4F7DA 3PB9X 2BO9A 1BLLE 2XEIA 1ZM2A 5H84A 3R1KA 4BBHA 1Y7EA 1OHHA 5HVHA 1DG1G 5E96A 3DR6A
chains in the Genus database with same CATH topology
1BPMA 3KR5A 2PJ1A 3K9TA 4EMEA 1XRYA 5IB9A 2JEWA 1JQGA 1VGYA 2ZEHA 3IWWA 2OOTA 2CF4A 2QJ8A 1LCPA 1CP6A 5F09A 4X2TA 8CPAA 3KR4A 2ZOFA 1YSJA 4MHYA 3TX8A 3NH5A 1CPXA 5ELYA 3SI0A 2PE3A 4MCSA 5JGFA 2V8VA 1ARLA 2G9DA 3B3VA 3HUVA 4P4IA 1RTQA 4ZYQA 4OKOA 3BI1A 6CPAA 3IFEA 4P44A 2Q4ZA 2ZEPA 4NGRA 3B3CA 5CBMA 4ZY2A 3TC8A 1Q7LA 4PXCA 1QQ9A 4PXDA 3SI1A 2EK8A 3PB8X 3B35A 1ZG9A 3D7FA 4NGSA 1LAPA 4A38A 1AMPA 4NGTA 1CX8A 3PBBA 4NJRA 2AFMA 2PJAA 3FECA 1DE4C 4PXBA 2BCOA 1LAMA 5JM6A 1F57A 5K8OA 5LRKA 3RZAA 1VHEA 1LANA 2PJ9A 2IJZA 4NJQA 1CPSA 2Q51A 4Q7AA 4WJBA 4R76A 3SJFA 5K8NA 2PJ4A 2HC9A 5HXDA 1VIXA 3PRTA 3PBEA 3FMCA 4MHZA 1YMEA 3KI9A 4DUKA 1OBRA 3PFEA 4BD9A 4G1PA 2PRQA 5LYDA 3WABA 2FVGA 2CTBA 1TKHA 4OC4A 5LRJA 2WZNA 3N5FA 3D66A 1Y0RA 4NGQA 4MCQA 4A94A 2WYRA 1F2OA 4R7MA 2ZEGA 3KQXA 1BAVA 1R43A 5K8PA 3HLPA 4PPZA 2I3CA 4EWTA 1LOKA 4OC3A 3WC6A 3SJEA 2IQ6A 3L2NA 3B3SA 3KL9A 3MRUA 2DEAA 4NGNA 3B7IA 1Z8LA 3KASA 2GREA 5JH9A 2ZELA 4IHMA 2F7VA 2PJ7A 3B2YA 4MHPA 3FJUA 2ZEEA 4F8ZA 4X8IA 2AFOA 1YW4A 3QNVA 2IMOA 1CG2A 2BOAA 4UIAA 1ZLHA 4MCPA 3SJGA 1Z5RA 4IAVA 4OC1A 2JBJA 3T8WA 2PVVA 3WC7A 3JRUA 4O23A 3BHXA 4NGPA 5I4MA 1QMUA 2XEGA 2CIJA 2ZEMA 4AXVA 3PEIA 1IY7A 5THWA 4R8FA 4P4BA 3K2KA 2QYVA 1HEEA 1XMBA 2O53A 1PYTB 1ZG7A 2AFWA 3GB0A 4YWYA 2RFHA 2ZENA 3FX6A 4ZY1A 1YLOA 3D7HA 4P10A 3DLJA 2EWBA 2CTCA 4YU9A 5D8NA 1ARMA 4JZ0A 4MRIA 4P4DA 1UWYA 1Z2LA 5LYIA 4ZI6A 7CPAA 4TWEA 3H8GA 4OC0A 3D7DA 3RBUA 3I1UA 2XEJA 2GLFA 3DGVA 4UEEA 1NSAA 4F9VA 4EFDA 2HB6A 2ZEOA 2C6PA 2ZOGA 2ZEFA 1XJOA 2PJ8A 2PJ3A 3H8FA 4RUHA 4LQGA 1YW6A 3CDXA 3FVLA 3KHXA 5LYFA 4FUUA 3CPXA 3NFZA 2PJ6A 3NA6A 3FEEA 3KZWA 3S9NA 3IEHA 4P4FA 1R3NA 3IO1A 4F9UA 4P45A 2F8HA 1EE3P 2GLJA 2GU2A 2ANPA 3H8EA 3VARA 2PJBA 4W9YA 3FEDA 4H2KA 3LWUA 2RB7A 2V8DA 1IGBA 2PJ0A 4FWUA 4WWVA 1AYEA 1TF9A 4OIDA 3IIBA 5J1QA 2ABZA 5LRGA 1M4LA 3CT9A 3RAMA 2V8GA 1CBXA 1KWMA 4MCRA 3MN8A 4DJLA 3SI2A 2V8HA 4MMOA 2J9AA 3PFOA 1CP7A 2OR4A 1ZLIA 3IJ3A 4X3RA 1PCAA 1XBUA 4Z65A 1HDQA 2AFZA 3D67A 3V7ZA 4NGMA 3D68A 4P4EA 4TNUA 1BPNA 5K8MA 2XEFA 4UF4A 4UEZA 4CPAA 3GUXA 2Q43A 4JYWA 2PVWA 4FBEA 4DYOA 3WT4A 4PQAA 2QVPA 1ELLP 1FT7A 4UEFA 3D4UA 4FAIA 4NFRA 3PB4X 3V38A 1FNOA 1TF8A 3S9LA 2PCUA 3IC1A 3PB7X 4B6ZA 3PB6X 1VHOA 2O4HA 3B3TA 4A39A 3KGQA 3VH9A 1TXRA 4IK2A 5D29A 2AFUA 3KHZA 4A37A 3CPAA 1LFWA 5DS0A 3VATA 2PJ5A 2EK9A 5HVGA 2PJ2A 2POKA 4OC5A 2AFSA 4P6YA 2NYQA 1TKJA 4K3NA 5HVFA 3NH4A 5LYLA 4R6TA 1XFOA 3KQZA 1TKFA 2PJCA 4MXUA 4GM5A 3GLJA 4ZY0A 2AFXA 1HDUA 3NH8A 2C6CA 2C1CA 1Y0YA 4OP4A 1ELMP 3BXMA 3FF3A 4KSIA 1GYTA 4MHNA 2V77A 3B3WA 1H8LA 3LMSA 2ZEDA 4ZX9A 5CPAA 3S9MA 4UIBA 3D7GA 2PIYA 3BI0A 3FH4A 4PXEA 3SJXA 1F2PA 2JBKA 3WC5A 3ISXA 1DTDA 3PB9X 2BO9A 4OC2A 4OIWA 1BLLE 2XEIA 2C6GA 3ISZA 4P4JA 2PIZA 1Y7EA 4ONWA 4OMEA 5HVHA 1ZG8A 2VL1A 2NSMA 4ZX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BPM A;  3KR5 A;  2PJ1 A;  3K9T A;  4EME A;  1XRY A;  5IB9 A;  2JEW A;  1JQG A;  1VGY A;  2ZEH A;  3IWW A;  2OOT A;  2CF4 A;  2QJ8 A;  1LCP A;  1CP6 A;  5F09 A;  4X2T A;  8CPA A;  3KR4 A;  2ZOF A;  1YSJ A;  4MHY A;  3TX8 A;  3NH5 A;  1CPX A;  5ELY A;  3SI0 A;  2PE3 A;  4MCS A;  5JGF A;  2V8V A;  1ARL A;  2G9D A;  3B3V A;  3HUV A;  4P4I A;  1RTQ A;  4ZYQ A;  4OKO A;  3BI1 A;  6CPA A;  3IFE A;  4P44 A;  2Q4Z A;  2ZEP A;  4NGR A;  3B3C A;  5CBM A;  4ZY2 A;  3TC8 A;  1Q7L A;  4PXC A;  1QQ9 A;  4PXD A;  3SI1 A;  2EK8 A;  3PB8 X;  3B35 A;  1ZG9 A;  3D7F A;  4NGS A;  1LAP A;  4A38 A;  1AMP A;  4NGT A;  1CX8 A;  3PBB A;  4NJR A;  2AFM A;  2PJA A;  3FEC A;  1DE4 C;  4PXB A;  2BCO A;  1LAM A;  5JM6 A;  1F57 A;  5K8O A;  5LRK A;  3RZA A;  1VHE A;  1LAN A;  2PJ9 A;  2IJZ A;  4NJQ A;  1CPS A;  2Q51 A;  4Q7A A;  4WJB A;  4R76 A;  3SJF A;  5K8N A;  2PJ4 A;  2HC9 A;  5HXD A;  1VIX A;  3PRT A;  3PBE A;  3FMC A;  4MHZ A;  1YME A;  3KI9 A;  4DUK A;  1OBR A;  3PFE A;  4BD9 A;  4G1P A;  2PRQ A;  5LYD A;  3WAB A;  2FVG A;  2CTB A;  1TKH A;  4OC4 A;  5LRJ A;  2WZN A;  3N5F A;  3D66 A;  1Y0R A;  4NGQ A;  4MCQ A;  4A94 A;  2WYR A;  1F2O A;  4R7M A;  2ZEG A;  3KQX A;  1BAV A;  1R43 A;  5K8P A;  3HLP A;  4PPZ A;  2I3C A;  4EWT A;  1LOK A;  4OC3 A;  3WC6 A;  3SJE A;  2IQ6 A;  3L2N A;  3B3S A;  3KL9 A;  3MRU A;  2DEA A;  4NGN A;  3B7I A;  1Z8L A;  3KAS A;  2GRE A;  5JH9 A;  2ZEL A;  4IHM A;  2F7V A;  2PJ7 A;  3B2Y A;  4MHP A;  3FJU A;  2ZEE A;  4F8Z A;  4X8I A;  2AFO A;  1YW4 A;  3QNV A;  2IMO A;  1CG2 A;  2BOA A;  4UIA A;  1ZLH A;  4MCP A;  3SJG A;  1Z5R A;  4IAV A;  4OC1 A;  2JBJ A;  3T8W A;  2PVV A;  3WC7 A;  3JRU A;  4O23 A;  3BHX A;  4NGP A;  5I4M A;  1QMU A;  2XEG A;  2CIJ A;  2ZEM A;  4AXV A;  3PEI A;  1IY7 A;  5THW A;  4R8F A;  4P4B A;  3K2K A;  2QYV A;  1HEE A;  1XMB A;  2O53 A;  1PYT B;  1ZG7 A;  2AFW A;  3GB0 A;  4YWY A;  2RFH A;  2ZEN A;  3FX6 A;  4ZY1 A;  1YLO A;  3D7H A;  4P10 A;  3DLJ A;  2EWB A;  2CTC A;  4YU9 A;  5D8N A;  1ARM A;  4JZ0 A;  4MRI A;  4P4D A;  1UWY A;  1Z2L A;  5LYI A;  4ZI6 A;  7CPA A;  4TWE A;  3H8G A;  4OC0 A;  3D7D A;  3RBU A;  3I1U A;  2XEJ A;  2GLF A;  3DGV A;  4UEE A;  1NSA A;  4F9V A;  4EFD A;  2HB6 A;  2ZEO A;  2C6P A;  2ZOG A;  2ZEF A;  1XJO A;  2PJ8 A;  2PJ3 A;  3H8F A;  4RUH A;  4LQG A;  1YW6 A;  3CDX A;  3FVL A;  3KHX A;  5LYF A;  4FUU A;  3CPX A;  3NFZ A;  2PJ6 A;  3NA6 A;  3FEE A;  3KZW A;  3S9N A;  3IEH A;  4P4F A;  1R3N A;  3IO1 A;  4F9U A;  4P45 A;  2F8H A;  1EE3 P;  2GLJ A;  2GU2 A;  2ANP A;  3H8E A;  3VAR A;  2PJB A;  4W9Y A;  3FED A;  4H2K A;  3LWU A;  2RB7 A;  2V8D A;  1IGB A;  2PJ0 A;  4FWU A;  4WWV A;  1AYE A;  1TF9 A;  4OID A;  3IIB A;  5J1Q A;  2ABZ A;  5LRG A;  1M4L A;  3CT9 A;  3RAM A;  2V8G A;  1CBX A;  1KWM A;  4MCR A;  3MN8 A;  4DJL A;  3SI2 A;  2V8H A;  4MMO A;  2J9A A;  3PFO A;  1CP7 A;  2OR4 A;  1ZLI A;  3IJ3 A;  4X3R A;  1PCA A;  1XBU A;  4Z65 A;  1HDQ A;  2AFZ A;  3D67 A;  3V7Z A;  4NGM A;  3D68 A;  4P4E A;  4TNU A;  1BPN A;  5K8M A;  2XEF A;  4UF4 A;  4UEZ A;  4CPA A;  3GUX A;  2Q43 A;  4JYW A;  2PVW A;  4FBE A;  4DYO A;  3WT4 A;  4PQA A;  2QVP A;  1ELL P;  1FT7 A;  4UEF A;  3D4U A;  4FAI A;  4NFR A;  3PB4 X;  3V38 A;  1FNO A;  1TF8 A;  3S9L A;  2PCU A;  3IC1 A;  3PB7 X;  4B6Z A;  3PB6 X;  1VHO A;  2O4H A;  3B3T A;  4A39 A;  3KGQ A;  3VH9 A;  1TXR A;  4IK2 A;  5D29 A;  2AFU A;  3KHZ A;  4A37 A;  3CPA A;  1LFW A;  5DS0 A;  3VAT A;  2PJ5 A;  2EK9 A;  5HVG A;  2PJ2 A;  2POK A;  4OC5 A;  2AFS A;  4P6Y A;  2NYQ A;  1TKJ A;  4K3N A;  5HVF A;  3NH4 A;  5LYL A;  4R6T A;  1XFO A;  3KQZ A;  1TKF A;  2PJC A;  4MXU A;  4GM5 A;  3GLJ A;  4ZY0 A;  2AFX A;  1HDU A;  3NH8 A;  2C6C A;  2C1C A;  1Y0Y A;  4OP4 A;  1ELM P;  3BXM A;  3FF3 A;  4KSI A;  1GYT A;  4MHN A;  2V77 A;  3B3W A;  1H8L A;  3LMS A;  2ZED A;  4ZX9 A;  5CPA A;  3S9M A;  4UIB A;  3D7G A;  2PIY A;  3BI0 A;  3FH4 A;  4PXE A;  3SJX A;  1F2P A;  2JBK A;  3WC5 A;  3ISX A;  1DTD A;  3PB9 X;  2BO9 A;  4OC2 A;  4OIW A;  1BLL E;  2XEI A;  2C6G A;  3ISZ A;  4P4J A;  2PIZ A;  1Y7E A;  4ONW A;  4OME A;  5HVH A;  1ZG8 A;  2VL1 A;  2NSM A;  4ZX8 A; 
#chains in the Genus database with same CATH topology
 3I3G A;  3I1F A;  2FIA A;  3Q38 A;  4CGL A;  5GV7 A;  3TE4 A;  2HCJ B;  1VGY A;  4YAF A;  1GAQ A;  2CNM A;  1XMT A;  2X6W A;  1CP6 A;  5F09 A;  2R9V A;  5HKK A;  4MHY A;  1VQN B;  1NDH A;  2ZL5 A;  2R7H A;  5ELY A;  3SI0 A;  2PE3 A;  4ZYQ A;  1UD3 A;  4PC3 A;  2PRB A;  4GQN A;  4XPD C;  2JIZ A;  4HNX B;  5CNP A;  5AG7 A;  3OEE A;  1TVC A;  2F4N A;  1IYK A;  3BY2 A;  3TC8 A;  4PXC A;  1YJN B;  2P6E A;  2BV3 A;  3BLN A;  1TLL A;  1N0U A;  4ASU A;  4RCY A;  4NF1 A;  1XQB A;  5BSY A;  3FYN A;  4NGS A;  3G05 A;  2BMW A;  3CME B;  4AC9 A;  3OEH A;  1DAR A;  1JA0 A;  3FEC A;  3KKW A;  4PXB A;  2WPD A;  2OB0 A;  1MK4 A;  1K73 D;  1QVF B;  4MFK A;  2E1R A;  2FSR A;  5CDF A;  2PJ9 A;  2RC4 A;  3JQQ A;  1CPS A;  3SJF A;  2I1L A;  1GAW A;  3PEN A;  2QEC A;  3B82 A;  1VIX A;  2JLM A;  4R87 A;  3PBE A;  1S7N A;  2V7W A;  3W91 A;  2DOG A;  1OBR A;  4BD9 A;  1E62 A;  2PRQ A;  3CCM B;  2ZBV A;  4WZK A;  1YK3 A;  2XGJ A;  1TKH A;  4OC4 A;  4C7H A;  4B10 A;  1KTV A;  2ZPA A;  3A9L A;  2GK6 A;  2D74 A;  3R96 A;  1JA1 A;  1VLO A;  4R7M A;  5KW9 A;  3FRM A;  2Y0M A;  4UZU A;  2OZU A;  3SXN A;  5K8P A;  2I3C A;  1KZL A;  5IK2 A;  1BOB A;  3A3G A;  1Q2D A;  3SJE A;  1KK3 A;  3L2N A;  3B3S A;  3KL9 A;  4B14 A;  1G7S A;  2ZW6 A;  2GRE A;  2OBS A;  1BMF A;  2ZEL A;  2YWE A;  3R9F A;  2PJ7 A;  4XOT A;  4MHP A;  3JU4 A;  2ZEE A;  2ODF A;  1CG2 A;  1ZLH A;  4MCP A;  1Z5R A;  2OH1 A;  4UCN A;  4OC1 A;  4BIN A;  2Z3N A;  3T8W A;  1OB0 A;  4ZCI A;  5GCN A;  4KOW A;  4KVM E;  4NGP A;  2EIX A;  4FD4 A;  3FKS A;  2OYN A;  2OZH A;  4CAX A;  3CCJ B;  1MRZ A;  4C2Z A;  1M4I A;  2V7X A;  3PEI A;  2QYV A;  1N05 A;  2O53 A;  3EO4 A;  2AFW A;  2FIW A;  3GB0 A;  3PUN A;  2ZEN A;  1QSM A;  2C27 A;  3ZJ0 A;  4ZY1 A;  2XZL A;  3E1Y E;  4YAL A;  2RC6 A;  2F5I A;  4XPD B;  4YU9 A;  1ZUN B;  2B7B A;  1UD2 A;  2HUZ A;  1QST A;  4ZI6 A;  1T5E A;  1B87 A;  4KZT A;  3A35 A;  4Q7J B;  4RDL A;  4P26 A;  4FD7 A;  5F46 A;  1PJ6 A;  4KOU A;  3F0A A;  4MFQ A;  3PGP A;  2EBJ A;  5DWN A;  5F47 A;  1KK2 A;  1XEB A;  3CCE B;  2GQF A;  4NCZ A;  1WDT A;  2Q04 A;  2B4B A;  2PQ8 A;  1S5K A;  3T90 A;  2C6P A;  4JLY A;  1XJO A;  4Y9R A;  4XKV A;  2C4U A;  4Y7C A;  3U6K A;  3B78 A;  4QHY A;  2KVO A;  2WUU A;  3RYO A;  5LYF A;  1ZO0 A;  5TV2 A;  1V0F A;  1VQM B;  2R98 A;  4L89 A;  2P6G A;  4P1V A;  3IEH A;  3KZW A;  3LD2 A;  3IO1 A;  4YAW A;  3R95 A;  2GK7 A;  3Q3A A;  3MGD A;  3OWC A;  3OE7 A;  3CP8 A;  3JQP A;  1NE9 A;  1EE3 P;  4P25 A;  4XLH A;  5AG4 A;  3H5Z A;  4OP7 A;  1IB0 A;  2OK8 A;  3FED A;  4NSQ A;  2X3U A;  1Q86 D;  1YQE A;  4X5K A;  3OAA A;  3AVY A;  4M6I A;  1NRK A;  1Y9K A;  2GIV A;  1COW A;  1WU8 A;  3RAM A;  4R57 A;  3IWE A;  1AMO A;  4M4S A;  3MN8 A;  2ZW4 A;  4PC1 A;  4DJL A;  1KUV A;  4JXQ A;  1T6X A;  3PFO A;  1N06 A;  5J8F A;  3FIX A;  2VNK A;  1ZLI A;  4X3R A;  1TUI A;  4U9Y A;  1PCA A;  4QVJ A;  1XBU A;  4Z65 A;  4CAF A;  4XLA A;  1VF7 A;  1XB2 A;  4TNU A;  2D4O A;  5ISV A;  3U2Q A;  2VNH A;  3GQB A;  2QA4 B;  4PAA A;  2W6I A;  3CRZ A;  1F20 A;  3T9Y A;  4F0X A;  1UD8 A;  1A2Z A;  1ELL P;  2G3A A;  1EWY A;  1BQE A;  1IU8 A;  3D4U A;  3PB4 X;  4TMV A;  1FNO A;  1H85 A;  1CQX A;  3IC1 A;  3PB7 X;  2F43 A;  1R5N A;  1QUF A;  1UMK A;  4KKU A;  1U6M A;  4UA3 A;  4H9G A;  5KNL A;  5G1Z A;  2QGG A;  3CXP A;  4H6Z A;  1E1Q A;  4HE6 A;  5D29 A;  2Z10 A;  3CPA A;  1E63 A;  4P6V F;  1IID A;  4G5G A;  4DK0 A;  3CMM A;  2EK9 A;  3OZU A;  5HVG A;  2PJ2 A;  1MJ9 A;  4MY0 A;  1I1D A;  3EY5 A;  2P3M A;  2I00 A;  1TKJ A;  1QGZ A;  1Z8W A;  1K4J A;  3ZPN A;  2DER A;  1VQ9 B;  2Q6O A;  1ZM9 A;  1LRZ A;  1TKF A;  3W2H A;  4TMT A;  2G3T A;  1KQS B;  3TO9 A;  5HZA A;  2BGI A;  3S6F A;  2C5H A;  3G4S B;  1M1D A;  4Z4R A;  3NE7 A;  4YAO A;  3B3W A;  3CTA A;  4RLZ A;  1WSV A;  3LMS A;  1B23 P;  1PUA A;  3WYA A;  4ACA A;  1MJA A;  1HA3 A;  2PIY A;  2ZW7 A;  3BI0 A;  4PXE A;  3SJX A;  2DCU A;  2WSS A;  4Y9U A;  3TT2 A;  1DTD A;  1Q9S A;  2C6G A;  4WZE A;  2ZL6 A;  1DDI A;  4II3 A;  4OME A;  1ZG8 A;  4AVB A;  1VLY A;  3LAC A;  4Z4S A;  2ZXV A;  1BPM A;  3KR5 A;  5IB9 A;  3EXN A;  1JQG A;  2D9R A;  2FL4 A;  2FCK A;  2VEZ A;  2OOT A;  3FXT A;  1PKV A;  4XM3 A;  3HAG A;  2ZOF A;  3ONY A;  4QVT A;  1S7F A;  3TX8 A;  3G3S A;  1VQ7 B;  1CPX A;  4RCZ A;  2VZY A;  2X0K A;  2V8V A;  2G9D A;  1YJW B;  1RTQ A;  1BJK A;  1R57 A;  3AVX A;  5L46 A;  3GY9 A;  4KS9 A;  5IX3 A;  1M1K D;  1Q7L A;  4PXD A;  4E0A A;  2PR8 A;  1EFC A;  2DIE A;  2EK8 A;  1VQL B;  3CC4 B;  5JQ4 A;  2BM0 A;  4B5P B;  1AMP A;  3DDY A;  1CX8 A;  2B7C A;  3PBB A;  3E0K A;  2VQY A;  3W6X A;  4MI4 A;  4M1K A;  1CM0 A;  2BGJ A;  2ZBU A;  2ZXH A;  1F57 A;  4WQM A;  1S7L A;  4F0Y A;  2HQY A;  3GYA A;  5BSX A;  4CAE A;  3BNW A;  5LRK A;  4M53 A;  2HDN B;  3RZA A;  1LAN A;  2PC1 A;  5A27 A;  3R9E A;  2Q51 A;  4WJB A;  4R76 A;  2PJ4 A;  2HC9 A;  1VJS A;  4TMZ A;  1PJ7 A;  3B8H A;  3MCA A;  3FMC A;  1QUE A;  3KI9 A;  2QIR A;  1QGY A;  3OW7 A;  4G1P A;  1QSR A;  3BCF A;  4KLV A;  3SEJ A;  1NB9 A;  2JDC A;  1QFJ A;  3WAB A;  2FVG A;  2CTB A;  4P12 A;  4PC2 A;  5IYP A;  3D2P A;  3CXQ A;  2OTJ B;  2V7V A;  1S0U A;  5JPH A;  4UAJ A;  4X7F A;  4XL9 A;  4LBY A;  2C2W A;  1W2B B;  3RO0 A;  4KSF A;  2ZZE A;  1G7R A;  2NV4 A;  2ZEG A;  4R71 A;  4QUZ A;  5KTC A;  4J0Q A;  3QAY A;  5FA6 A;  4LX9 A;  4JXR A;  1QFZ A;  4RDJ A;  1I8D A;  1BAV A;  4QB9 A;  5AG5 A;  1AIP A;  3QFT A;  4I49 A;  1G7T A;  1YRE A;  5KTD A;  4OC3 A;  4YAU A;  1ZM4 A;  3WC6 A;  2IQ6 A;  2PIA A;  3PVD A;  5F4J A;  2R6H A;  3VWE A;  1EP2 B;  3CXS A;  2Z3M A;  3OJX A;  1Z8T A;  3W6S A;  1YHQ B;  4PC6 A;  3CCV B;  4II2 A;  2JN9 A;  1D1N A;  2GAN A;  1BX1 A;  1IIC A;  4IF5 A;  1GR1 A;  2YGW A;  4X8I A;  2OBT A;  3WNB A;  2IMO A;  3WR7 A;  1S3Z A;  4UIA A;  2JBJ A;  3IWG A;  3ZUG A;  3N7Z A;  3D8P A;  3WC7 A;  3BHX A;  4BMH A;  1VQ5 B;  5A28 A;  3SLN A;  2E1B A;  2P6F A;  2XEG A;  2CIJ A;  4G7W A;  4G6I A;  5THW A;  2FT0 A;  2C4T A;  4OPV A;  3K2K A;  3BJ8 A;  5IYW A;  1Q2Y A;  1XMB A;  1JB9 A;  2BSW A;  3JUW A;  4IW3 B;  4XOR A;  2ZTN A;  4MJ8 A;  1WOS A;  3SLD A;  1YLO A;  1OB2 A;  3WQZ A;  4PK2 A;  3DLJ A;  3I56 B;  2EWB A;  2Z3K A;  3CW2 A;  1W34 A;  4KOT A;  4OPS A;  2HV2 A;  4JZ0 A;  3TTH A;  1YIJ B;  4P4D A;  1UWY A;  3I55 B;  1H8H A;  4TWE A;  3CP2 A;  5A88 A;  4NEX A;  4CQJ A;  4XON A;  1VQK B;  2XEJ A;  2B3U A;  3FBU A;  4DNT B;  4XOP A;  2ZTG A;  4F9V A;  4MY3 A;  1DDG A;  4M6H A;  2WSA A;  4M85 A;  2YNC A;  3GSI A;  1H42 A;  3D2M A;  2VBV A;  4KLW A;  1RQR A;  2A4N A;  4UWI A;  5KSW B;  3EC4 A;  3QE2 A;  4L8J A;  2B5G B;  3QFR A;  2WPX A;  4RUH A;  1Y9W A;  3CB4 A;  1YW6 A;  3FVL A;  1T6Z A;  1KC8 D;  2JDI A;  4RM0 A;  3LNN A;  4C43 A;  4CGN A;  2PJ6 A;  1NJI D;  3W2G A;  3S9N A;  1MAB A;  1WK4 A;  3PP9 A;  2Q4Y A;  3GIR A;  4CYN A;  1E79 A;  4K1X A;  1GVH A;  2VJJ A;  2F8H A;  1QSO A;  1SKQ A;  4MFZ A;  2GLJ A;  2GU2 A;  4RN7 A;  4PSX A;  3PA2 A;  3CXC B;  2PJB A;  4B3X A;  4UZE A;  5F4O A;  3QSY A;  4H2K A;  4RDK A;  2V8D A;  2D4P A;  4CYQ A;  1TF9 A;  1RO5 A;  5J1Q A;  3AST A;  2ARH A;  2X6Y A;  5LRG A;  3CES A;  1KUX A;  4RPB A;  3CT9 A;  3RNZ A;  4AF6 A;  2V8G A;  4B5P A;  1M4D A;  2BF4 A;  3CCS B;  2B4D A;  1FDR A;  1GO2 A;  1KZF A;  1VQ8 B;  4MMO A;  4JJX A;  1EXM A;  2J9A A;  2XNJ A;  3IJ3 A;  4FD5 A;  4XLF A;  2QE7 A;  2AFZ A;  3V7Z A;  2XND A;  3D68 A;  2V31 A;  4P4E A;  2CC2 A;  3QFS A;  2XZP A;  2Q43 A;  4AF7 A;  5I0C A;  2JJ1 A;  3DR8 A;  4UEF A;  4FAI A;  3S9L A;  2NMT A;  1Q2C A;  4R3L A;  3OZV A;  4ONU A;  3PB6 X;  4AG7 A;  1VHO A;  3PZJ A;  4J3G A;  3DDD A;  4TN1 A;  3V8I A;  2DYI A;  2ZW5 A;  3AVT A;  4IK2 A;  2AFU A;  2AE6 A;  1E3X A;  3LOD A;  3OJW A;  4A95 A;  4X05 A;  2REE A;  2QTL A;  4N3G A;  2PSW A;  5DS0 A;  4ZV4 A;  2DET A;  4IUS A;  4OC5 A;  3QFC A;  2CY2 A;  4G1B A;  3A1P A;  4XLE A;  5LYL A;  4R6T A;  1B2R A;  3KQZ A;  3ZC3 A;  5EMI A;  2B58 A;  1TIQ A;  4ACB A;  1D2E A;  4KOV A;  4UCM A;  4GM5 A;  3S6G A;  1R5O A;  3NE8 A;  3NH8 A;  2C1C A;  2QML A;  4HNW B;  4OP4 A;  4PK3 A;  2BL1 A;  1S60 A;  2V77 A;  2PMD A;  1A8P A;  5TR9 A;  1UFH A;  4XQF A;  3D26 A;  3TCV A;  4ZX9 A;  2Q7S A;  2BPO A;  2WPW A;  4XNF A;  4R3K A;  3FH4 A;  1IJF A;  2JBK A;  1Q81 D;  1BX0 A;  4JD6 A;  3ASP A;  5LMZ A;  2Q7B A;  4B4D A;  4QBJ A;  3ISZ A;  3CCR B;  4P4J A;  2JDD A;  4P9S A;  4ONW A;  4HE5 A;  4KOR A;  2VL1 A;  1W87 A;  3H9N A;  3P26 A;  3SHP A;  1XRY A;  2J8N A;  4MYU A;  1OGJ A;  1P0H A;  1LCP A;  4X2T A;  8CPA A;  5IYR A;  3KR4 A;  2QMU A;  2WJY A;  1YLE A;  3NH5 A;  5G22 A;  1KRH A;  1QSN A;  1G7C A;  2GPJ A;  1ARL A;  4MBU A;  3B3V A;  4P4I A;  4OKO A;  3BI1 A;  6CPA A;  4P44 A;  2Q4Z A;  4LBW A;  2VBU A;  3TO7 A;  4NGR A;  1K28 D;  3B3C A;  3RY8 A;  5J3O A;  4DNC A;  1QQ9 A;  3ASQ A;  4A33 A;  3SKB A;  4OAD A;  1RXT A;  3PB8 X;  1VQ6 B;  3F8K A;  3B35 A;  1X12 A;  1XE1 A;  3OPO A;  1EP1 B;  2DPS A;  4CS0 B;  4A31 A;  3FJO A;  1DE4 C;  2DPT A;  3CZX A;  3E20 A;  4P3Y A;  5JM6 A;  3A8K A;  1FNB A;  1VHE A;  2IJZ A;  4NJQ A;  4JWP A;  5K8N A;  5HXD A;  3C26 A;  4BPR A;  3PRT A;  2AHO A;  3CC7 B;  3IU1 A;  4MHZ A;  5TRD A;  4DUK A;  4HIZ A;  3PFE A;  5THX A;  2X53 S;  1EFR A;  2FXF A;  2VZZ A;  1CNF A;  2WZN A;  4OOV A;  2Q6K A;  3CCL B;  4ZX8 A;  5FO1 A;  3N5F A;  2B3V A;  2R8V A;  1ZM3 A;  4NGQ A;  4Z4V A;  4MCQ A;  1NB0 A;  2D3N A;  4CYO A;  2Q4V A;  4JMQ A;  2WYR A;  4B5O A;  4PV6 A;  4B11 A;  3Q6Q A;  4LUA A;  4A2Z A;  2R1I A;  1CNE A;  4C0S A;  3LQ6 A;  2BVN A;  2CNT A;  4OLL A;  3HLP A;  1L0C A;  3J81 k;  4EWT A;  1LOK A;  4XR6 A;  4KVX A;  3F5B A;  3MRU A;  4MFL A;  2J7K A;  4E2A A;  4KOY A;  2J8M A;  1V0E A;  2QDX A;  4ORF A;  2GFQ A;  5JH9 A;  1YVK A;  4PGO A;  1I12 A;  3GVL A;  1YVO A;  2V7Q A;  3ASR A;  3FJU A;  1W0K A;  3K9U A;  4F8Z A;  4RD4 A;  3BY1 A;  2AFO A;  4FN5 A;  1YW4 A;  2PDO A;  1QVG B;  2XEX A;  3B8G A;  3SJG A;  4IAV A;  1H8E A;  4N3N A;  1IJE A;  3VMF A;  2PVV A;  2EO8 A;  4O23 A;  5J8C A;  1NBM A;  3ZZT A;  3TFY A;  5IB0 A;  4YFJ A;  1IY7 A;  1WOR A;  2O28 A;  2DY1 A;  4P4B A;  4R8F A;  2BSA A;  1HEE A;  1OZP A;  5G20 A;  4X7E A;  1ZG7 A;  3Q6R A;  4YWY A;  2OK7 A;  2RFH A;  1ELO A;  5FVJ A;  4Z1M A;  2LZJ A;  2DF5 A;  3FX6 A;  4MYT A;  4X0C A;  4QFM A;  4X7D A;  2VXK A;  2CTC A;  1ARM A;  2W6J A;  5LYI A;  1D8T A;  4AG9 A;  1W35 A;  4OC0 A;  3D7D A;  3RBU A;  3P2F A;  2RC5 A;  4AVZ A;  3W2F A;  1Y7R A;  4UEE A;  1NSA A;  4M6G A;  2ZIT A;  5KTA A;  1XOV A;  5FO0 A;  4MHD A;  1BO4 A;  2PLF A;  1I7P A;  2ZL7 A;  4KVO E;  2ZEO A;  4MFP A;  5BWA B;  1WWZ A;  4F6A A;  2PJ8 A;  2JJ2 A;  4C7I A;  4TMW A;  4AVC A;  3H8F A;  4XPL A;  2WZP P;  4DNR B;  2Q6I A;  1KK0 A;  3KHX A;  1KMH A;  3CPX A;  2OU2 A;  4E8O A;  4H89 A;  3VNV A;  1UD6 A;  4QVA A;  4ZCL A;  4P4F A;  2CNS A;  4YEL A;  1BLI A;  4P45 A;  4Z4Z A;  2X6X A;  4G1V A;  4NBS A;  5HZB A;  4B48 A;  3VAR A;  4U9U A;  2Z3P A;  3ZIA A;  1YR0 A;  4W9Y A;  4X06 A;  3LWU A;  2KCW A;  4GXH A;  1IGB A;  2PJ0 A;  4FD6 A;  4FWU A;  3T51 B;  4OID A;  3JTK A;  5EMN A;  5DWM A;  3LQE A;  3G8W A;  4P2N A;  4P22 A;  2CXA A;  1M4L A;  1F60 A;  2YWG A;  2YWF A;  3WNC A;  1W9X A;  3NE5 B;  1N0V C;  4Q36 A;  4NXY A;  2WJV A;  1P4M A;  2CRV A;  1CBX A;  1KWM A;  2IL4 A;  3OOC A;  2DEU A;  3SI2 A;  2C77 A;  1OB5 A;  4OPO A;  3SJP A;  1NSL A;  5G21 A;  1S7K A;  2XNC A;  3SXO A;  1HDQ A;  2GJR A;  4RI1 A;  3D67 A;  2ZXI A;  5F49 A;  3W5V A;  3ES9 A;  4U9Z A;  1FND A;  1KJZ A;  1BPN A;  3VNU A;  4K30 A;  5JBQ A;  2XEF A;  4UF4 A;  4UEZ A;  4ZGY B;  2NPF A;  4RD6 A;  1KK1 A;  3GUX A;  1WOP A;  2PVW A;  4JYW A;  4FBE A;  3BQJ A;  2BN4 A;  5EBV A;  3OKX A;  1IOI A;  1R5B A;  3VWD A;  2QVP A;  1PJ5 A;  4PSW A;  2FS5 A;  2Z0Z A;  2X85 A;  1GHE A;  4NFR A;  4KKS A;  1HVX A;  3V38 A;  1TF8 A;  5AG6 A;  2EUI A;  4KOS A;  1YI2 B;  3W2E A;  3S6H A;  1IYL A;  4C2X A;  2YNE A;  5DN6 A;  3AGQ A;  3VH9 A;  1TXR A;  4HNY B;  2BUE A;  4CAV A;  1WPC A;  4YRH A;  4RD1 A;  3KHZ A;  4A37 A;  4CGM A;  3JVN A;  4UFV A;  2Q6L A;  1EFT A;  2ATR A;  1N07 A;  1XIX A;  4RD0 A;  2C5B A;  3VAT A;  4HKF A;  2AFS A;  4P6Y A;  2NYQ A;  2VI7 A;  2VBT A;  1QH0 A;  3UY5 A;  1VQO B;  1V0C A;  1XFO A;  4YHB A;  1Z4R A;  3H94 A;  2PJC A;  4UZF A;  3GLJ A;  2F1L A;  5TY0 A;  2AFX A;  4Y49 C;  4II9 A;  1M44 A;  1YJ9 B;  1Q82 D;  3WXM A;  5EC4 A;  3ZZU A;  4KSI A;  1GYT A;  5B6I A;  4QV2 A;  1YX2 A;  1H8L A;  2Z6B D;  4EVY A;  4AVA A;  4DK1 A;  5CPA A;  3S9M A;  1CJW A;  4UFX A;  3A8I A;  2REF A;  1F2P A;  3D3S A;  2CBX A;  3WC5 A;  5HH1 A;  5IYN A;  3W5H A;  2JEV A;  5C82 A;  4OC2 A;  4OIW A;  4NNJ A;  5A8A A;  5F4M A;  5H5J A;  2PIZ A;  4UCP A;  3W5U A;  2V7U A;  4OAE A;  2NSM A;  4A32 A;  4G7X A;  4RD3 A;  2PJ1 A;  3K9T A;  2VZL A;  4EME A;  4A30 A;  2JEW A;  2ZZF A;  2ZEH A;  3IWW A;  4P3I A;  1T6Y A;  4B44 A;  3AVW A;  2C78 A;  2CF4 A;  1PU9 A;  4X07 A;  2QJ8 A;  1TTT A;  1YSJ A;  3ZZ0 A;  4ZCM A;  1RQP A;  1FY7 A;  3CC2 B;  1Z8X A;  4MCS A;  5JGF A;  3V76 A;  3R6K A;  2OZG A;  3HUV A;  5H86 A;  1WP6 A;  3IFE A;  2ZEP A;  1SKY B;  4RJL A;  5CBM A;  4ZY2 A;  2Z3O A;  2CW5 A;  4LC0 A;  3BCD A;  3SI1 A;  4CRZ B;  2VBS A;  1FRQ A;  1ZG9 A;  3D7F A;  1LAP A;  4A38 A;  4M3S A;  4NGT A;  5FL7 A;  1QFY A;  4NJR A;  2AFM A;  4KUB A;  2PJA A;  1FNM A;  1E43 A;  2H5M A;  4CYP A;  1M4G A;  4CAW A;  1S72 B;  2BCO A;  1LAM A;  5IYQ A;  4ZBG A;  3BH4 A;  4AB7 A;  1OGI A;  5K8O A;  3P2H A;  3QB8 A;  2V7T A;  1FNC A;  4Q7A A;  1N08 A;  3KEW A;  3ZZI A;  1K8A D;  1YME A;  3I9S A;  1Z4E A;  2WR8 A;  3V7A A;  1I21 A;  2GE3 A;  4TMX A;  4KUA A;  5LYD A;  3IGR A;  5AGE A;  5LRJ A;  4QC6 A;  5F48 A;  1E1R A;  2CK3 A;  3D66 A;  1Y0R A;  2G0B A;  3A3B A;  2Q0Y A;  2YNC C;  1E64 A;  3WBJ A;  4A94 A;  2Z11 A;  2XOK A;  3AVU A;  1F2O A;  1YX0 A;  3FPK A;  4XNH C;  2FE7 A;  3KQX A;  3DSB A;  1R43 A;  4Y49 B;  5FIU A;  1VKC A;  3TO6 A;  3VO1 A;  4PPZ A;  4HPS A;  2Q44 A;  3G6E B;  2BEI A;  4FWT A;  4XKW A;  4Z4T A;  2BM1 A;  2DEA A;  4NGN A;  1P4N A;  1UD5 A;  3B7I A;  2V4D A;  1Z8L A;  1QG0 A;  3AGP A;  5FNZ A;  3Q39 A;  3KAS A;  1Q7Y D;  4C2Y A;  4L8A A;  1V5V A;  2XZO A;  3ASS A;  4TKO B;  5HXB A;  2VNJ A;  3WND A;  1JJ2 B;  3A8J A;  4IHM A;  2QN6 A;  3W2I A;  4LQ6 A;  3FNC A;  2F7V A;  1J4J A;  3B2Y A;  4RD2 A;  5DSZ A;  2GJK A;  5AN9 A;  3GIU A;  4RPD A;  3QNV A;  3GKR A;  2BOA A;  3BJ7 A;  2VYQ A;  4YEJ A;  3FB3 A;  3OP1 A;  1BPL A;  1J9Z A;  1NMT A;  3JRU A;  3AVV A;  5I4M A;  1EFU A;  1QMU A;  2FX3 A;  2OTL B;  2ZEM A;  1XE4 A;  4AXV A;  4ZGN B;  3VR6 A;  2B5G A;  4XN0 A;  1VQP B;  1PYT B;  2X7B A;  3ZBT A;  2K5T A;  3H4Q A;  3MHP A;  3G71 B;  1N71 A;  3D7H A;  3WY9 A;  4P10 A;  2VNI A;  5E6T A;  5D8N A;  3R6J A;  1EP3 B;  4MRI A;  4UFW A;  2VBQ A;  1Z2L A;  7CPA A;  3PA1 A;  1B6B A;  3H8G A;  1FX0 A;  3I1U A;  5A89 A;  1ON0 A;  2HLD A;  2M5S A;  2GLF A;  3DGV A;  4UBR A;  1JWQ A;  5HMN A;  4B3F X;  3GVK A;  3MMP A;  4KOX A;  4EFD A;  1MJB A;  2HB6 A;  4M0L A;  1KUY A;  4H6U A;  3R9G A;  3VO2 A;  2ZOG A;  3S6K A;  3LO8 A;  2ZEF A;  2QTZ A;  4XN3 A;  4TSF A;  2P0W A;  2PJ3 A;  1VQ4 B;  1Z9U A;  1E3Z A;  1JNY A;  3CDX A;  4LQG A;  3CCU B;  2YND A;  4FUU A;  3NFZ A;  3LVB A;  2EVN A;  4Z4U A;  4CGO A;  3NA6 A;  3FEE A;  3OW2 B;  1R3N A;  1WTH D;  4PAB A;  4F9U A;  2Z3L A;  3CD6 B;  5C88 A;  3TOA A;  3JQR A;  4OOX A;  2ANP A;  4FXU A;  3H8E A;  2AJ6 A;  1YIT B;  1IOF A;  4NCN A;  3TOB A;  2B5O A;  4KKT A;  2VJI A;  1XF8 A;  2RB7 A;  4XD7 A;  1YGH A;  3PUM A;  4WWV A;  4XMY A;  1AYE A;  4B43 A;  4U5Y A;  4YGO A;  3IIB A;  4LBV A;  4RS2 A;  3SJZ A;  4R9M A;  2ABZ A;  1HZE A;  3CMA B;  1AUG A;  4XPK A;  4XNH B;  2CND A;  4B3G A;  3DNS A;  1WSR A;  1UD4 A;  4YXW A;  1SQH A;  4MCR A;  3FPP A;  1IB1 E;  3IU2 A;  2EFG A;  2V8H A;  3EFA A;  4WZT A;  1CP7 A;  2OR4 A;  5IV0 A;  2X8K A;  4M2L A;  4B12 A;  4B13 A;  3GVJ A;  4NGM A;  4B47 A;  1K9M D;  1QGA A;  5K8M A;  4XLC A;  4CPA A;  1GJR A;  4FK8 A;  4DYO A;  4DQK A;  3WT4 A;  2D3L A;  1WOO A;  4PQA A;  3OFN A;  4DQL A;  1FT7 A;  4TT3 A;  4ZGQ B;  4LBZ A;  3P27 A;  2PCU A;  4B6Z A;  3OZW A;  5H59 A;  3ONU A;  1X10 A;  2J8R A;  2O4H A;  4PC7 A;  3B3T A;  4A39 A;  3KGQ A;  2B4D B;  1LFW A;  4OOS A;  3CPW B;  2ZZQ A;  2PR1 A;  2PJ5 A;  3WBK A;  1S4M A;  2POK A;  4X7C A;  4EH1 A;  2I79 A;  1W0J A;  3T56 B;  4K3N A;  5HVF A;  1FRN A;  3NH4 A;  2GJP A;  4QUS A;  4UWJ A;  2QEX B;  4Z4W A;  4MXU A;  3T53 B;  5J35 A;  4C68 A;  2YWH A;  4ZY0 A;  1HDU A;  2C6C A;  3U6B A;  4KSA A;  1Y0Y A;  4Z4Y A;  2HMA A;  4ROX A;  1ELM P;  2DXQ A;  3BXM A;  3FF3 A;  3QAH A;  2ZZG A;  4MHN A;  1QX4 A;  5GV8 A;  4CGP A;  4Q38 A;  4MFJ A;  1VHS A;  4E0F A;  2ZED A;  3ZBU A;  4GS4 A;  3CCQ B;  1KD1 D;  1N8R D;  4UIB A;  3D7G A;  1M90 D;  1I18 A;  2F1M A;  1SM4 A;  3BC9 A;  4CRY B;  2OBR A;  3ISX A;  1IHM A;  4WZL A;  1U2R A;  4F7D A;  3PB9 X;  2BO9 A;  1BLL E;  2XEI A;  1ZM2 A;  5H84 A;  3R1K A;  4BBH A;  1Y7E A;  1OHH A;  5HVH A;  1DG1 G;  5E96 A;  3DR6 A; 
#chains in the Genus database with same CATH homology
 1BPM A;  3KR5 A;  2PJ1 A;  3K9T A;  4EME A;  1XRY A;  5IB9 A;  2JEW A;  1JQG A;  1VGY A;  2ZEH A;  3IWW A;  2OOT A;  2CF4 A;  2QJ8 A;  1LCP A;  1CP6 A;  5F09 A;  4X2T A;  8CPA A;  3KR4 A;  2ZOF A;  1YSJ A;  4MHY A;  3TX8 A;  3NH5 A;  1CPX A;  5ELY A;  3SI0 A;  2PE3 A;  4MCS A;  5JGF A;  2V8V A;  1ARL A;  2G9D A;  3B3V A;  3HUV A;  4P4I A;  1RTQ A;  4ZYQ A;  4OKO A;  3BI1 A;  6CPA A;  3IFE A;  4P44 A;  2Q4Z A;  2ZEP A;  4NGR A;  3B3C A;  5CBM A;  4ZY2 A;  3TC8 A;  1Q7L A;  4PXC A;  1QQ9 A;  4PXD A;  3SI1 A;  2EK8 A;  3PB8 X;  3B35 A;  1ZG9 A;  3D7F A;  4NGS A;  1LAP A;  4A38 A;  1AMP A;  4NGT A;  1CX8 A;  3PBB A;  4NJR A;  2AFM A;  2PJA A;  3FEC A;  1DE4 C;  4PXB A;  2BCO A;  1LAM A;  5JM6 A;  1F57 A;  5K8O A;  5LRK A;  3RZA A;  1VHE A;  1LAN A;  2PJ9 A;  2IJZ A;  4NJQ A;  1CPS A;  2Q51 A;  4Q7A A;  4WJB A;  4R76 A;  3SJF A;  5K8N A;  2PJ4 A;  2HC9 A;  5HXD A;  1VIX A;  3PRT A;  3PBE A;  3FMC A;  4MHZ A;  1YME A;  3KI9 A;  4DUK A;  1OBR A;  3PFE A;  4BD9 A;  4G1P A;  2PRQ A;  5LYD A;  3WAB A;  2FVG A;  2CTB A;  1TKH A;  4OC4 A;  5LRJ A;  2WZN A;  3N5F A;  3D66 A;  1Y0R A;  4NGQ A;  4MCQ A;  4A94 A;  2WYR A;  1F2O A;  4R7M A;  2ZEG A;  3KQX A;  1BAV A;  1R43 A;  5K8P A;  3HLP A;  4PPZ A;  2I3C A;  4EWT A;  1LOK A;  4OC3 A;  3WC6 A;  3SJE A;  2IQ6 A;  3L2N A;  3B3S A;  3KL9 A;  3MRU A;  2DEA A;  4NGN A;  3B7I A;  1Z8L A;  3KAS A;  2GRE A;  5JH9 A;  2ZEL A;  4IHM A;  2F7V A;  2PJ7 A;  3B2Y A;  4MHP A;  3FJU A;  2ZEE A;  4F8Z A;  4X8I A;  2AFO A;  1YW4 A;  3QNV A;  2IMO A;  1CG2 A;  2BOA A;  4UIA A;  1ZLH A;  4MCP A;  3SJG A;  1Z5R A;  4IAV A;  4OC1 A;  2JBJ A;  3T8W A;  2PVV A;  3WC7 A;  3JRU A;  4O23 A;  3BHX A;  4NGP A;  5I4M A;  1QMU A;  2XEG A;  2CIJ A;  2ZEM A;  4AXV A;  3PEI A;  1IY7 A;  5THW A;  4R8F A;  4P4B A;  3K2K A;  2QYV A;  1HEE A;  1XMB A;  2O53 A;  1PYT B;  1ZG7 A;  2AFW A;  3GB0 A;  4YWY A;  2RFH A;  2ZEN A;  3FX6 A;  4ZY1 A;  1YLO A;  3D7H A;  4P10 A;  3DLJ A;  2EWB A;  2CTC A;  4YU9 A;  5D8N A;  1ARM A;  4JZ0 A;  4MRI A;  4P4D A;  1UWY A;  1Z2L A;  5LYI A;  4ZI6 A;  7CPA A;  4TWE A;  3H8G A;  4OC0 A;  3D7D A;  3RBU A;  3I1U A;  2XEJ A;  2GLF A;  3DGV A;  4UEE A;  1NSA A;  4F9V A;  4EFD A;  2HB6 A;  2ZEO A;  2C6P A;  2ZOG A;  2ZEF A;  1XJO A;  2PJ8 A;  2PJ3 A;  3H8F A;  4RUH A;  4LQG A;  1YW6 A;  3CDX A;  3FVL A;  3KHX A;  5LYF A;  4FUU A;  3CPX A;  3NFZ A;  2PJ6 A;  3NA6 A;  3FEE A;  3KZW A;  3S9N A;  3IEH A;  4P4F A;  1R3N A;  3IO1 A;  4F9U A;  4P45 A;  2F8H A;  1EE3 P;  2GLJ A;  2GU2 A;  2ANP A;  3H8E A;  3VAR A;  2PJB A;  4W9Y A;  3FED A;  4H2K A;  3LWU A;  2RB7 A;  2V8D A;  1IGB A;  2PJ0 A;  4FWU A;  4WWV A;  1AYE A;  1TF9 A;  4OID A;  3IIB A;  5J1Q A;  2ABZ A;  5LRG A;  1M4L A;  3CT9 A;  3RAM A;  2V8G A;  1CBX A;  1KWM A;  4MCR A;  3MN8 A;  4DJL A;  3SI2 A;  2V8H A;  4MMO A;  2J9A A;  3PFO A;  1CP7 A;  2OR4 A;  1ZLI A;  3IJ3 A;  4X3R A;  1PCA A;  1XBU A;  4Z65 A;  1HDQ A;  2AFZ A;  3D67 A;  3V7Z A;  4NGM A;  3D68 A;  4P4E A;  4TNU A;  1BPN A;  5K8M A;  2XEF A;  4UF4 A;  4UEZ A;  4CPA A;  3GUX A;  2Q43 A;  4JYW A;  2PVW A;  4FBE A;  4DYO A;  3WT4 A;  4PQA A;  2QVP A;  1ELL P;  1FT7 A;  4UEF A;  3D4U A;  4FAI A;  4NFR A;  3PB4 X;  3V38 A;  1FNO A;  1TF8 A;  3S9L A;  2PCU A;  3IC1 A;  3PB7 X;  4B6Z A;  3PB6 X;  1VHO A;  2O4H A;  3B3T A;  4A39 A;  3KGQ A;  3VH9 A;  1TXR A;  4IK2 A;  5D29 A;  2AFU A;  3KHZ A;  4A37 A;  3CPA A;  1LFW A;  5DS0 A;  3VAT A;  2PJ5 A;  2EK9 A;  5HVG A;  2PJ2 A;  2POK A;  4OC5 A;  2AFS A;  4P6Y A;  2NYQ A;  1TKJ A;  4K3N A;  5HVF A;  3NH4 A;  5LYL A;  4R6T A;  1XFO A;  3KQZ A;  1TKF A;  2PJC A;  4MXU A;  4GM5 A;  3GLJ A;  4ZY0 A;  2AFX A;  1HDU A;  3NH8 A;  2C6C A;  2C1C A;  1Y0Y A;  4OP4 A;  1ELM P;  3BXM A;  3FF3 A;  4KSI A;  1GYT A;  4MHN A;  2V77 A;  3B3W A;  1H8L A;  3LMS A;  2ZED A;  4ZX9 A;  5CPA A;  3S9M A;  4UIB A;  3D7G A;  2PIY A;  3BI0 A;  3FH4 A;  4PXE A;  3SJX A;  1F2P A;  2JBK A;  3WC5 A;  3ISX A;  1DTD A;  3PB9 X;  2BO9 A;  4OC2 A;  4OIW A;  1BLL E;  2XEI A;  2C6G A;  3ISZ A;  4P4J A;  2PIZ A;  1Y7E A;  4ONW A;  4OME A;  5HVH A;  1ZG8 A;  2VL1 A;  2NSM A;  4ZX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...