1VHOA

Crystal structure of a putative peptidase/endoglucanase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
331
structure length
319
Chain Sequence
METGKLLMELSNLDGPSGYETNVVSYIKSVIEPFVDEAKTTRHGSLIGYKKGKGIGKLAFFAHVDEIGFVVSKVEGQFARLEPVYASKVRIYTKNGIERGVIGMLAPHLQDSESRKKVPTYDEIFVDLSLCERGVRVGDIAVIDQTAFETNGKVVGKALDNRASCGVLVKVLEFLKRYDHPWDVYVVFSVQEETGCLGALTGAYEINPDAAIVMDVTFASEPPFSDHIELGKGPVIGLGPVVDRNLVQKIIEIAKKHNVSLQEEAVGGRTDFVQLVRNGVRTSLISIPLKYMHTPVEMVDPRDVEELARLLSLVAVELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords endoglucanase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 94
structure length 319
sequence length 331
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 1vhoA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1vhoA01
1BLLE 2QJ8A 4UEFA 4A39A 2RB7A 2NSMA 3DGVA 4W9YA 1Y0YA 3H8GA 2PIZA 1F57A 1JQGA 2ANPA 4UEEA 2PCUA 3ISXA 4TWEA 3T8WA 3NH4A 3IWWA 3MRUA 2CTBA 3FMCA 4DUKA 1YW6A 1ZG9A 1R43A 2BOAA 2AFMA 3FH4A 4P4EA 1XBUA 2ZENA 3SJFA 3LWUA 2C6CA 1AMPA 3I1UA 2ZEPA 4ZYQA 1EE3P 3S9MA 4B6ZA 2AFZA 1BPMA 1HDQA 5JGFA 2C6PA 2PVWA 2XEGA 3BHXA 4X2TA 5JM6A 4UIAA 4MRIA 5HVHA 2AFUA 3KR5A 5CBMA 2NYQA 4O23A 2VL1A 1ARMA 4NGNA 5IB9A 3FF3A 4P44A 4A37A 1YSJA 4DJLA 2F8HA 4OIWA 2V8VA 4P6YA 3FEEA 1CX8A 3IJ3A 3FX6A 2IQ6A 2G9DA 4OC4A 1Q7LA 5K8NA 1VGYA 3HLPA 4AXVA 2PVVA 1ZLHA 2ZEMA 3FEDA 2Q4ZA 2PE3A 2C6GA 5ELYA 3VH9A 1BAVA 1QMUA 1LCPA 5I4MA 1FT7A 5J1QA 3QNVA 3K9TA 1CPSA 1Y7EA 1H8LA 4Q7AA 2V8HA 3B35A 3B3TA 2PJAA 4MCSA 3NH5A 4ONWA 1LAMA 4NGQA 2PIYA 3KHXA 4OC0A 1IY7A 1F2OA 4NGMA 1NSAA 1TF9A 2PJ4A 4ZX9A 1ZG7A 4IHMA 3S9LA 4P4BA 2XEFA 3HUVA 2DEAA 3PB9X 4F9UA 3PB4X 4G1PA 2QVPA 1ELLP 1CPXA 1CP6A 1CP7A 1XRYA 3CPXA 1ARLA 3PEIA 5D8NA 4F8ZA 1F2PA 3KQXA 3KZWA 3WABA 1HEEA 3SI2A 5JH9A 4NGTA 1XFOA 3PFEA 4NGPA 3L2NA 3PB7X 1GYTA 1PYTB 3D7FA 2I3CA 2JBJA 6CPAA 5LRKA 1LOKA 3H8EA 1HDUA 5F09A 2F7VA 3ISZA 3D68A 3FECA 4Z65A 1RTQA 4MHZA 4WWVA 7CPAA 2WYRA 2JBKA 2PJ8A 2ZEDA 3BXMA 3NH8A 4MXUA 4UF4A 2RFHA 3KGQA 1DE4C 3NFZA 1PCAA 2AFSA 4P4DA 4P4IA 4LQGA 3TC8A 4NFRA 4R76A 2IJZA 3LMSA 4PXBA 1CBXA 4EFDA 4MHPA 3VATA 3RBUA 4P10A 5LYDA 3IO1A 3PBBA 1Y0RA 2J9AA 3PBEA 3FJUA 4FBEA 4OC3A 4EWTA 1XMBA 3D67A 3BI1A 3V7ZA 3VARA 4YWYA 4NJRA 4OIDA 3CT9A 5LRGA 3B7IA 3KR4A 3K2KA 1CG2A 2ZEEA 2ZEOA 4PPZA 5LYIA 2Q51A 2CIJA 4BD9A 3WC5A 2POKA 1KWMA 2BCOA 4H2KA 4R7MA 3GUXA 2OR4A 3IC1A 2PJ2A 1R3NA 2XEJA 1TKFA 2ZOFA 4JZ0A 3D7HA 1ZG8A 4FAIA 2PJ3A 4ZY0A 2ABZA 1Z5RA 2AFOA 3SJEA 4OC2A 1VHOA 4MHYA 5LRJA 3WT4A 5K8OA 4UIBA 2PRQA 4NGSA 3DLJA 4A38A 2O4HA 4IK2A 2PJ1A 1LANA 2PJ6A 2PJCA 2GLJA 3PFOA 2IMOA 2ZELA 4MCPA 3D66A 5HVGA 5HVFA 3B3SA 5K8MA 4K3NA 1TXRA 3GB0A 4RUHA 3SJGA 2PJ0A 1DTDA 1VIXA 3H8FA 3IIBA 4FWUA 4OKOA 2PJ7A 3BI0A 1BPNA 3S9NA 2AFXA 2GLFA 3GLJA 2Q43A 3PB6X 4PXDA 1XJOA 3V38A 2CF4A 4OP4A 4GM5A 1ELMP 3KI9A 1YMEA 1TKJA 2PJ5A 4YU9A 4R6TA 1FNOA 2PJBA 2BO9A 4PQAA 4PXEA 3SJXA 3SI1A 1TF8A 2WZNA 2C1CA 2ZOGA 3FVLA 4P4JA 2PJ9A 2OOTA 3MN8A 2ZEFA 4P4FA 3KQZA 3PB8X 1IGBA 1Z8LA 4TNUA 4WJBA 4NGRA 4CPAA 3D4UA 2JEWA 3JRUA 1AYEA 2V8DA 5CPAA 2ZEHA 1OBRA 4PXCA 3TX8A 4DYOA 2XEIA 3WC6A 1LFWA 2EK8A 3IEHA 2FVGA 4MMOA 2V77A 2QYVA 2GU2A 4X8IA 3CPAA 4OC5A 1UWYA 1ZLIA 5LYLA 2CTCA 1M4LA 5D29A 3NA6A 1QQ9A 1LAPA 4X3RA 5K8PA 1YW4A 3IFEA 2HB6A 4A94A 3D7DA 5LYFA 4NJQA 4JYWA 4R8FA 8CPAA 4MHNA 1YLOA 3PRTA 4UEZA 1TKHA 3RAMA 4MCQA 1VHEA 4KSIA 4ZY2A 3B3CA 2EWBA 4EMEA 2GREA 2HC9A 4ZI6A 2AFWA 4P45A 5THWA 1Z2LA 4MCRA 3KL9A 4F9VA 3RZAA 2ZEGA 4IAVA 3WC7A 3CDXA 5HXDA 4OC1A 3B3WA 3B2YA 2EK9A 2O53A 3SI0A 4ZY1A 3N5FA 2V8GA 3KASA 5DS0A 3KHZA 4FUUA 4OMEA 3B3VA 4ZX8A 3D7GA
chains in the Genus database with same CATH superfamily
1BLLE 4Q7JB 2PR1A 4UEFA 4XR6A 3A9LA 1TVCA 1Y0YA 2R1IA 3H8GA 3W2IA 1GHEA 1KK0A 2BPOA 1VQ4B 1IJEA 2PIZA 1RQPA 1F57A 4QVTA 4UEEA 4DNTB 4Z4YA 4F6AA 1YVOA 3T8WA 3MRUA 4M85A 3BLNA 4DUKA 1XMTA 1BJKA 4PSWA 3P26A 4X05A 4M0LA 2R8VA 1R5BA 1Z8WA 2AFMA 2PC1A 5H84A 3G71B 2JJ1A 3B8HA 2J8MA 2OH1A 3I1UA 1RQRA 2E1BA 1IOFA 4UWIA 3ZZTA 1OB5A 2DPSA 4XL9A 3ZZIA 4E0AA 5JGFA 3SLDA 5J35A 2RC6A 3A3BA 1MJAA 4L89A 3ZBTA 4B44A 4MRIA 4C0SA 1WSRA 2AFUA 4KLVA 4YALA 3FB3A 3KR5A 3V76A 4XKWA 2QTLA 1ARMA 4NGNA 5FVJA 3I9SA 3SXOA 4N3NA 3PUNA 1FNBA 5KTAA 2BGJA 2QIRA 4A37A 4AC9A 1KD1D 1I8DA 4OIWA 4P25A 5HMNA 1RO5A 4P6YA 1CX8A 4XPDC 2G9DA 3OAAA 4A31A 4OC4A 1LRZA 1S72B 2ARHA 2CNMA 3HLPA 5DN6A 2PVVA 2QMUA 5ELYA 1ZM3A 2PE3A 4DQKA 1UD3A 1LCPA 2XGJA 1FT7A 2DYIA 2W6JA 5IYRA 3RY8A 4OPVA 3K9TA 5AGEA 1H8LA 3OFNA 2V8HA 3B35A 3AVYA 3R9EA 3WBJA 4MCSA 1QG0A 4Y7CA 4P22A 5H59A 3AVTA 1F2OA 1NSAA 1OB2A 1TF9A 2WR8A 4XOTA 4ZX9A 4TN1A 4P12A 2YWHA 2XEFA 2HLDA 1ZUNB 1NBMA 1YIJB 5BWAB 3PB9X 4F9UA 4RS2A 2BSWA 5GV7A 4NCZA 5HZBA 3BJ7A 1VQPB 5D8NA 4BBHA 1PKVA 2PR8A 3KQXA 3KZWA 4TMWA 1S0UA 3TO7A 5JH9A 3BCDA 1XFOA 4H89A 3L2NA 4YELA 1KUXA 3PB7X 1GYTA 3D7FA 4XMYA 2V7WA 1LOKA 3H8EA 4NEXA 1HDUA 5F09A 2F7VA 5A27A 3D68A 1V0FA 4NCNA 2J8RA 2P0WA 2QEXB 5FO0A 2Q0YA 2BF4A 4NXYA 4ZCIA 2JBKA 2PJ8A 1PJ5A 1IYLA 3GIRA 2Q44A 1DE4C 1VQ8B 3OW2B 5EBVA 3B78A 3LVBA 3CXPA 4FWTA 3D3SA 4P4IA 3BNWA 2QTZA 2OZHA 5G1ZA 2IJZA 2YGWA 4PXBA 1IIDA 3RO0A 4MHPA 3BY2A 1Q81D 3RBUA 3FRMA 4PABA 4YXWA 5LYDA 3MCAA 1AMOA 5HH1A 2X0KA 1W34A 3PBBA 4B5PA 4RPBA 2J9AA 3FJUA 3CCJB 2XEXA 4P3YA 1YX0A 1COWA 3D67A 4AVAA 3V7ZA 3G3SA 4YWYA 3OEHA 4DNCA 2H5MA 3JQQA 5E6TA 4KUAA 3K2KA 1CG2A 2Z0ZA 1HZEA 5LYIA 1JA1A 3CD6B 2PDOA 1YI2B 3OZVA 3WC5A 2JDDA 3VO2A 1J4JA 4H2KA 2GIVA 2K5TA 1R3NA 1TKFA 3TFYA 1EFCA 4CGMA 1B2RA 1D8TA 2PIAA 2Z3KA 1B87A 4XPDB 3DR6A 2Q4YA 1FX0A 4KOXA 4B14A 4OC2A 1VHOA 4MHYA 4LQ6A 3WT4A 4X0CA 2R9VA 1LANA 2PJ6A 2PJCA 3F5BA 2IMOA 2ZELA 4MCPA 1Q7YD 3W5VA 3D66A 2OBRA 3B3SA 4AG9A 2XNDA 1TXRA 3GB0A 4C43A 1IOIA 2XNJA 3DSBA 1Q2YA 5F49A 1H8HA 4GQNA 4JMQA 3H8FA 2Q4VA 3G6EB 5DWNA 5THXA 3GVJA 3BI0A 1BPNA 1MJ9A 2GLFA 1V0CA 3W5UA 3GLJA 1QSOA 4A33A 3TOBA 4UFXA 5IX3A 3V38A 1G7CA 1E62A 4UCMA 3EC4A 1EP2B 4YU9A 4R6TA 1QX4A 2V7TA 3IWGA 1ZO0A 1YVKA 4TSFA 4XLFA 4PQAA 4F0YA 1W0JA 2Z3NA 4QB9A 3QFRA 4UZUA 1M4GA 2GE3A 4TT3A 4HKFA 4Z4SA 4CPAA 1OGJA 4Y9UA 3AGQA 1X10A 2JEWA 3UY5A 3BH4A 3WXMA 4OAEA 4ZCMA 4M4SA 2BM1A 3EXNA 3B82A 4IW3B 1WOSA 4OADA 1CNFA 3OW7A 3FJOA 2FVGA 4MMOA 4HPSA 1R57A 4OC5A 1Y9WA 1UWYA 1ZLIA 2D9RA 5LYLA 2CTCA 2FIWA 1M4LA 4PC6A 5D29A 2ZXHA 4JJXA 3NA6A 4CAEA 2RC5A 4KZTA 5K8PA 1YW4A 2B4DA 5G22A 5F4MA 4CQJA 4A94A 1KJZA 4FD7A 3TE4A 2Q6OA 1FY7A 4JD6A 2V7VA 4JYWA 2C77A 5KSWB 4XD7A 5KW9A 2CNSA 1YLOA 4NBSA 3QE2A 1KMHA 5JQ4A 2V4DA 2W6IA 2BUEA 4ZY2A 3LNNA 2WSSA 3B3CA 2EWBA 1PJ6A 2BM0A 2OZUA 2GREA 4P45A 2JLMA 4LBVA 3RZAA 2F4NA 1MRZA 1YHQB 4IAVA 5FO1A 3K9UA 2X6XA 3AVVA 4KSAA 3A35A 1QUEA 3U6KA 4OC1A 3B3WA 3QAYA 5IV0A 3OEEA 4XPKA 2DY1A 2G3AA 4P2NA 3SI0A 4X7DA 1E79A 1VHSA 3LO8A 3KASA 1J9ZA 1B23P 1DDIA 3CP2A 2PMDA 1XF8A 2WUUA 5DWMA 4A39A 2JN9A 2RB7A 3DGVA 3I1FA 4A32A 3OE7A 4C2XA 3F0AA 4GS4A 1BO4A 5C88A 1EWYA 3BCFA 1I7PA 3CCLB 2OK7A 3ZC3A 3FPKA 3WY9A 4WZLA 4A30A 1MJBA 2E1RA 2ZTGA 1ZG9A 2Z3OA 3SXNA 2QA4B 3W6XA 1BX1A 3E0KA 1XBUA 3PGPA 1UD2A 2ZENA 1AMPA 3SHPA 2JDCA 3CC4B 4B6ZA 1BPMA 3JU4A 4UA3A 4ZGQB 2QDXA 5JBQA 4CGNA 3ZUGA 3AVXA 2XEGA 4UIAA 5AG7A 5HVHA 2FS5A 3CMMA 5A28A 5CBMA 2YNCC 2NYQA 2VJIA 1WK4A 4O23A 2VBUA 2C4UA 4XKVA 3ONYA 3D2MA 4PC3A 4UAJA 2FSRA 4A95A 2OU2A 1PUAA 2BVNA 3FXTA 2J7KA 4MJ8A 3FEEA 1DARA 2VBTA 1ZM9A 2KVOA 3ASPA 2VZZA 1VKCA 1N07A 3CTAA 5EMIA 4E0FA 2OK8A 1VGYA 2VZLA 4MFKA 1K28D 4MFZA 3FEDA 3VH9A 4Z4RA 3VWDA 3T53B 4EVYA 1QMUA 5I4MA 4II3A 5J1QA 3QNVA 4B3XA 2D74A 2CXAA 2REEA 3B3TA 1Q2DA 2GFQA 4TKOB 4NGQA 4ZV4A 1S5KA 3V7AA 1IY7A 4MHDA 1JJ2B 3AGPA 3Q38A 2HCJB 4KOUA 2V31A 4B47A 2Z3PA 3PB4X 4Z4VA 2GJKA 4PK3A 1ELLP 1CP7A 3WNBA 3CPXA 1N71A 1OGIA 3FIXA 1YX2A 3GSIA 1F2PA 1Z4EA 1HEEA 3SI2A 4QBJA 4NGTA 3OJWA 1G7SA 4FD6A 4XONA 2ZW4A 2JBJA 1M1KD 5AG6A 4F0XA 4X7CA 1H85A 2DOGA 3ZIAA 4B10A 2O28A 3S6GA 4MHZA 3TO6A 4XQFA 3BXMA 2WPXA 4MI4A 3NFZA 5I0CA 2HDNB 5IYWA 4XLHA 2DEUA 2AFSA 1L0CA 3CZXA 3DNSA 2OYNA 3TC8A 2XZPA 2VNIA 3W5HA 2DF5A 1BLIA 3WYAA 3R1KA 4B3FX 1Y0RA 2QMLA 4MFPA 2FCKA 2X7BA 4B43A 2ZL5A 3BQJA 4G7XA 3Q3AA 4ACAA 4EWTA 4KOSA 3RNZA 5LMZA 2CC2A 2P3MA 4CYNA 1F60A 4NJRA 4QV2A 2G3TA 4G5GA 3WNCA 4OOVA 5KTCA 2X6WA 1WTHD 2CIJA 3D2PA 1KWMA 2B3VA 2BCOA 1P0HA 4RD1A 3GUXA 3LD2A 1GJRA 1QFZA 2OR4A 2P6GA 1WSVA 4U9UA 4CYOA 3D7HA 3NE5B 1ZG8A 4OLLA 1N0UA 2ABZA 2VBVA 1Z5RA 1QSMA 3W2GA 4QVJA 3ASRA 3MGDA 5LRJA 2Y0MA 4A38A 4IK2A 2VNKA 2CK3A 1I12A 3ASTA 1Q86D 2GJRA 5HVGA 2WJVA 4AF6A 4G6IA 4KLWA 4KUBA 1CJWA 3CB4A 4RD4A 4J0QA 2PJ0A 4RCZA 4KOTA 1DTDA 1VIXA 2YWEA 4QFMA 1W2BB 1BQEA 3W2EA 4KSFA 4A2ZA 1UD4A 3PB6X 4N3GA 2JDIA 3A8KA 4HE6A 1D2EA 2VBSA 4B5OA 1KZFA 2B5GA 4PGOA 2GANA 3U6BA 1E1QA 1NMTA 2PJBA 3QFCA 4PAAA 4H6ZA 1B6BA 2AE6A 1SKQA 2C1CA 5IK2A 5A89A 1WWZA 3FVLA 3GYAA 3MN8A 4P4FA 1XE1A 3KQZA 1U2RA 1IGBA 4WJBA 2R7HA 3ES9A 4M6IA 1FRNA 3V8IA 4XLCA 3R6JA 3S6HA 3JRUA 5CPAA 2ZEHA 3BC9A 1DDGA 3LQ6A 4RD2A 3GKRA 3TX8A 4C2ZA 1T6YA 2B7BA 4X7FA 4MY3A 3IEHA 2F1MA 3ZPNA 4PV6A 4TMXA 3TT2A 2GK6A 2ZBVA 1Q2CA 2QYVA 5G21A 3A8IA 1GAWA 1WORA 1LAPA 1N05A 1QQ9A 4OOXA 1QSRA 4R3KA 2FXFA 2B58A 5TRDA 1I18A 1QGAA 3IGRA 5LYFA 3FKSA 4NJQA 3JTKA 2QN6A 1CNEA 4R8FA 2FX3A 1MABA 1U6MA 3SLNA 2VI7A 2C78A 3PRTA 4KVXA 4RDJA 4UEZA 2ZZGA 3CXQA 3RAMA 1VHEA 1Z8TA 2FL4A 4CYPA 4M53A 4E2AA 2ZBUA 4MCRA 2ODFA 1FNCA 1TUIA 2D4PA 4RLZA 1ELOA 3B2YA 5AG4A 2O53A 4UWJA 4ZY1A 1FRQA 1EP1B 4II9A 1N0VC 5F4JA 4FUUA 4YFJA 1W0KA 2CRVA 2NSMA 2P6FA 4W9YA 2B7CA 1NB0A 2F1LA 3JQPA 4XN0A 1VQLB 4CAVA 3CCVB 5KNLA 1JQGA 3FPPA 4Q36A 2PCUA 3OP1A 5ISVA 1Z8XA 3ISXA 4TWEA 1QSTA 3GY9A 2EO8A 3NH4A 3IWWA 1GVHA 1QVGB 4KKUA 3QAHA 1W35A 1R43A 4TMTA 2BOAA 3CCMB 1G7TA 2EVNA 3FH4A 4P4EA 4XPLA 1QVFB 1WDTA 3LWUA 5HXBA 2ZEPA 3VR6A 1ON0A 1KUYA 1EE3P 2AFZA 1VQ5B 1GR1A 4B5PB 1JA0A 2C6PA 3SJPA 3IWEA 4X2TA 2XOKA 1NJID 3PA2A 4K1XA 3B8GA 2XZOA 4QHYA 4DK0A 4UFWA 1K8AD 2VXKA 3ONUA 4R87A 2VEZA 2EBJA 3FF3A 1UMKA 4P44A 1GO2A 1MK4A 1YSJA 4M3SA 2F8HA 4HNXB 1YJWB 4E8OA 3SKBA 1E3XA 2ZZEA 3IJ3A 4HNWB 3FX6A 1D1NA 4YAOA 2KCWA 1XOVA 1Q7LA 5K8NA 2B3UA 4JLYA 2ZW6A 1KK3A 5CNPA 1S4MA 3ZZ0A 1ZLHA 2ZEMA 1QGYA 5IYPA 3W91A 1HA3A 3PZJA 1P4NA 4I49A 2NMTA 1T5EA 4KORA 4GXHA 1M4IA 4Q7AA 2PJAA 1W9XA 5A8AA 4ONWA 1LAMA 3CXSA 1E63A 4PC1A 4OC0A 3WQZA 4ZBGA 4NGMA 1ZG7A 4IHMA 1XEBA 4OPSA 4DQLA 1JNYA 1DG1G 3HUVA 2DEAA 2CNTA 3ASSA 2Q6IA 2X3UA 2VYQA 1CPXA 1S7LA 3DDYA 1IHMA 5IB0A 3PEIA 1EP3B 3CCUB 1X12A 3WABA 4P6VF 2QE7A 5EC4A 2GQFA 3D8PA 4KOYA 5EMNA 3OOCA 3PFEA 4F7DA 3CESA 1NSLA 2ZW5A 1PYTB 1TTTA 3PP9A 5FA6A 2PLFA 2NPFA 3ISZA 1OZPA 1VJSA 3PUMA 4H6UA 4Z65A 3I55B 4KVME 2HV2A 7CPAA 4K30A 3ZJ0A 2WYRA 2X6YA 4RJLA 4AF7A 3NH8A 4UF4A 2RFHA 3KGQA 4M6HA 3U2QA 3W6SA 2DPTA 1PCAA 2BGIA 3CRZA 4MYTA 3OZUA 4Z1MA 3TOAA 3W2FA 4R76A 4P26A 1M4DA 2DETA 5A88A 1WP6A 2ZTNA 1CBXA 4EFDA 4R9MA 3VATA 4H9GA 4XORA 1PU9A 1QFYA 3IO1A 1KK2A 4YAUA 3LQEA 4OC3A 2OTLB 1XMBA 2ZZFA 4CGOA 4C68A 3D26A 3BI1A 4KS9A 4B12A 3CPWB 2A4NA 2ZXVA 3S6KA 3KR4A 3P2HA 2EIXA 4XNFA 2WZPP 2Q51A 1QSNA 2B4DB 3LODA 4DK1A 4PC7A 3KEWA 1XIXA 2B4BA 2M5SA 4KKTA 3IC1A 4RD3A 1SQHA 4RM0A 2XEJA 2OB0A 1WOPA 4YEJA 3Q6RA 4JZ0A 3CC2B 2YNCA 4CRZB 2VNJA 4C2YA 4YGOA 3A3GA 2J8NA 4XLAA 2AFOA 1E43A 3SJEA 3A1PA 2PRBA 1FNDA 4L8AA 5K8OA 3R96A 4XM3A 2PRQA 2V7UA 4NF1A 4NGSA 3NE8A 1VQ7B 3R95A 4X7EA 1SKYB 2FIAA 2PSWA 2HUZA 3PFOA 3AVWA 4U9ZA 5HVFA 4QVAA 4G1VA 1JB9A 4K3NA 4XN3A 1CQXA 1V0EA 4RUHA 4MBUA 4X5KA 3SJGA 4IUSA 1H42A 2RC4A 4LUAA 4OP7A 4M2LA 1KZLA 4C7IA 2PJ7A 1E1RA 3CC7B 2ATRA 2AFXA 2Q43A 4RI1A 4CAXA 4PXDA 2ZL6A 1XJOA 2CF4A 4OP4A 4ASUA 4PC2A 3WR7A 1ELMP 1KK1A 3PVDA 1TKJA 2PJ5A 3WBKA 4AB7A 4B48A 1FNOA 2BO9A 2C2WA 3JQRA 3CMAB 2WJYA 1N08A 5J8CA 4PXEA 3SJXA 3SI1A 2WZNA 4BINA 4P1VA 1IJFA 2PJ9A 3RYOA 3IU1A 1QGZA 2R98A 3EO4A 3JUWA 4NGRA 4ZGYB 4QUSA 2XNCA 3HAGA 4FD5A 2V8DA 4CS0B 4PXCA 3IU2A 3DR8A 1Q9SA 2GJPA 4DYOA 1XE4A 4ZCLA 4UCNA 3WC6A 4PSXA 4HE5A 5HKKA 2EK8A 2OBSA 4WZEA 2YWGA 2Z6BD 1PJ7A 2VZYA 5TV2A 1I21A 4CGLA 3CPAA 3J81k 5JPHA 3SEJA 2CY2A 1M44A 1OB0A 3MHPA 2G0BA 3CP8A 3P2FA 4X3RA 2HMAA 2X53S 2C27A 1T6XA 1KC8D 1YLEA 3MMPA 3D7DA 4C7HA 5H86A 3VWEA 3C26A 3BY1A 2CBXA 3H4QA 3CCQB 1M1DA 1R5OA 5F47A 8CPAA 2BEIA 3ZZUA 4MHNA 4BPRA 1HVXA 1QH0A 4XNHC 1W87A 4OPOA 1IICA 3A8JA 1N8RD 3OWCA 4MCQA 4KSIA 2IL4A 2JEVA 2DCUA 2HC9A 1I1DA 1VF7A 4UCPA 3E20A 4ONUA 3KL9A 2ZEGA 1VQ9B 5TR9A 1VQMB 3CDXA 5HXDA 1IYKA 1OHHA 1S60A 3CCEB 2Q7BA 1WU8A 5DS0A 4P9SA 4YAFA 3KHZA 3CXCB 3G4SB 3D7GA 5DSZA 1SM4A 1QFJA 2QJ8A 2DXQA 3DDDA 4G7WA 5B6IA 3R9FA 1FNMA 4B3GA 4UBRA 2VQYA 4MYUA 3G8WA 1A8PA 2R6HA 2ANPA 4AVCA 4Z4ZA 2B5OA 1EFRA 4TMVA 3CW2A 5KTDA 3H94A 2V7QA 1EFTA 2CTBA 3I3GA 2BN4A 3FMCA 1Z4RA 3EFAA 1YW6A 2QECA 3OZWA 1IU8A 1ZM4A 3E1YE 3R6KA 4LBYA 3SJFA 3Q6QA 4ROXA 2C6CA 4ZYQA 3CCRB 3S9MA 1HDQA 2FT0A 4B13A 3TTHA 2ZITA 2VBQA 1NB9A 1R5NA 4QUZA 2I1LA 2PVWA 5AN9A 2P6EA 3N7ZA 3BHXA 5JM6A 3T56B 1VQOB 2CNDA 3EY5A 4UZEA 3SJZA 4FN5A 3LACA 4MFJA 2DIEA 2VL1A 5F4OA 1EFUA 1YK3A 1IB1E 5IB9A 1H8EA 2BMWA 4DJLA 4NNJA 4CAWA 1Q82D 2V8VA 4JXRA 2IQ6A 1Z9UA 1GAQA 3OPOA 1K9MD 2EUIA 4YHBA 3QFTA 2ZPAA 2GK7A 5F48A 4WZKA 4Z4UA 3FBUA 4AXVA 1YJNB 1YR0A 5TY0A 2C6GA 2Q4ZA 1BAVA 4II2A 3T51B 1EXMA 3BJ8A 4Y49C 5AG5A 1WPCA 1CPSA 4FD4A 1Y7EA 4CGPA 3NH5A 5IYQA 2PIYA 3KHXA 4RN7A 2ZW7A 2PJ4A 1CM0A 1TIQA 1VQNB 3S9LA 2WPDA 4P4BA 2Z11A 3NE7A 2CW5A 4M1KA 4XNHB 4G1PA 4YRHA 5J8FA 2QVPA 2ZXIA 4LBZA 1CP6A 2D3LA 1XRYA 1ARLA 1UD8A 4F8ZA 1VLYA 4HNYB 1V5VA 4RDKA 2ZZQA 5IYNA 1BX0A 3H5ZA 4NGPA 3F8KA 3P27A 2REFA 2I3CA 6CPAA 3AVUA 2B5GB 5LRKA 4M6GA 1IB0A 3FECA 1RTQA 4L8JA 3GVKA 4WWVA 2Z3MA 4OOSA 4CRYB 2I79A 1KUVA 1QUFA 1G7RA 2F5IA 2ZEDA 3R9GA 4MXUA 2VNHA 1VQ6B 1BPLA 3CMEB 1XB2A 2JJ2A 4P4DA 4LC0A 1S3ZA 2PQ8A 4LQGA 4QC6A 3GIUA 4NFRA 3OKXA 1KTVA 4ZGNB 3LMSA 4MY0A 2Q04A 1UD6A 2YNDA 5BSYA 4P10A 1S7NA 2C4TA 4DNRB 1UD5A 1A2ZA 3PBEA 4AVBA 2DERA 2Z10A 4NSQA 4FBEA 2HQYA 2V7XA 3VARA 4KKSA 4OIDA 1FDRA 3CT9A 5LRGA 3B7IA 4RCYA 2ZEEA 2ZEOA 4PPZA 3PENA 4BD9A 2QGGA 2POKA 4R7MA 2Z3LA 2GPJA 4FXUA 2Q6LA 2PJ2A 3TCVA 4UFVA 2ZOFA 5G20A 2OTJB 4FAIA 2PJ3A 4ZY0A 4R3LA 1KQSB 1NRKA 5GV8A 2VJJA 2BL1A 3Q39A 4UIBA 4J3GA 1S7KA 4AG7A 3GVLA 3WNDA 3DLJA 3FNCA 2O4HA 3VNUA 4Z4TA 2PJ1A 2FE7A 3VNVA 1BOBA 1AIPA 2GLJA 1RXTA 4HIZA 5E96A 2NV4A 2Q6KA 3ZBUA 5J3OA 4Y49B 5K8MA 4B11A 3KKWA 4LX9A 1UFHA 2AJ6A 1YQEA 3IIBA 4FWUA 4OKOA 1Y7RA 3S9NA 1JWQA 3W2HA 4CAFA 1KRHA 1YITB 4Y9RA 4GM5A 1P4MA 3KI9A 1YMEA 4UZFA 4YAWA 4U5YA 2C5BA 4PK2A 4X06A 3FYNA 3TO9A 1AUGA 4RD0A 2BSAA 2F43A 4IF5A 4WQMA 1TF8A 5F46A 2ZOGA 3S6FA 4P4JA 2OOTA 4Q38A 2D4OA 4MFLA 2ZEFA 1N06A 3PB8X 1Z8LA 4TNUA 4R71A 2WSAA 4ORFA 4RDLA 3I56B 2AHOA 2EFGA 2X85A 3D4UA 4ACBA 4X07A 1NDHA 2LZJA 4LBWA 1M90D 1AYEA 1WOOA 2BV3A 1OBRA 4Z4WA 5BSXA 1K73D 5FIUA 3CCSB 3QSYA 2XEIA 4KOVA 4KOWA 2WPWA 1K4JA 1LFWA 3G05A 5FL7A 4TMZA 4AVZA 2V77A 3T9YA 1XQBA 2GU2A 4X8IA 4P3IA 4JXQA 3OJXA 2Q7SA 4MFQA 5CDFA 2YWFA 2YNEA 3IFEA 3T90A 4BMHA 2HB6A 3QFSA 5L46A 1ZM2A 4EH1A 2XZLA 1S7FA 2X8KA 3H9NA 1BMFA 4KVOE 4B4DA 3PA1A 1YREA 3GQBA 1TLLA 1F20A 1VQKB 2D3NA 4RD6A 2JIZA 3QB8A 2I00A 4G1BA 1NE9A 1TKHA 1E64A 4CYQA 3JVNA 4WZTA 5C82A 2OBTA 3VMFA 5FNZA 2OZGA 4EMEA 1YGHA 4ZI6A 4XLEA 2AFWA 5THWA 2ZL7A 1Z2LA 4F9VA 3WC7A 4U9YA 4R57A 4JWPA 2C5HA 5H5JA 2EK9A 4RPDA 3VO1A 1T6ZA 4FK8A 3N5FA 2V8GA 5GCNA 3ASQA 1E3ZA 4XOPA 1Y9KA 1YJ9B 4OMEA 1VLOA 5HZAA 3B3VA 4ZX8A
chains in the Genus database with same CATH topology
1BLLE 2QJ8A 4UEFA 4A39A 2RB7A 2NSMA 3DGVA 4W9YA 1Y0YA 3H8GA 2PIZA 1F57A 1JQGA 2ANPA 4UEEA 2PCUA 3ISXA 4TWEA 3T8WA 3NH4A 3IWWA 3MRUA 2CTBA 3FMCA 4DUKA 1YW6A 1ZG9A 1R43A 2BOAA 2AFMA 3FH4A 4P4EA 1XBUA 2ZENA 3SJFA 3LWUA 2C6CA 1AMPA 3I1UA 2ZEPA 4ZYQA 1EE3P 3S9MA 4B6ZA 2AFZA 1BPMA 1HDQA 5JGFA 2C6PA 2PVWA 2XEGA 3BHXA 4X2TA 5JM6A 4UIAA 4MRIA 5HVHA 2AFUA 3KR5A 5CBMA 2NYQA 4O23A 2VL1A 1ARMA 4NGNA 5IB9A 3FF3A 4P44A 4A37A 1YSJA 4DJLA 2F8HA 4OIWA 2V8VA 4P6YA 3FEEA 1CX8A 3IJ3A 3FX6A 2IQ6A 2G9DA 4OC4A 1Q7LA 5K8NA 1VGYA 3HLPA 4AXVA 2PVVA 1ZLHA 2ZEMA 3FEDA 2Q4ZA 2PE3A 2C6GA 5ELYA 3VH9A 1BAVA 1QMUA 1LCPA 5I4MA 1FT7A 5J1QA 3QNVA 3K9TA 1CPSA 1Y7EA 1H8LA 4Q7AA 2V8HA 3B35A 3B3TA 2PJAA 4MCSA 3NH5A 4ONWA 1LAMA 4NGQA 2PIYA 3KHXA 4OC0A 1IY7A 1F2OA 4NGMA 1NSAA 1TF9A 2PJ4A 4ZX9A 1ZG7A 4IHMA 3S9LA 4P4BA 2XEFA 3HUVA 2DEAA 3PB9X 4F9UA 3PB4X 4G1PA 2QVPA 1ELLP 1CPXA 1CP6A 1CP7A 1XRYA 3CPXA 1ARLA 3PEIA 5D8NA 4F8ZA 1F2PA 3KQXA 3KZWA 3WABA 1HEEA 3SI2A 5JH9A 4NGTA 1XFOA 3PFEA 4NGPA 3L2NA 3PB7X 1GYTA 1PYTB 3D7FA 2I3CA 2JBJA 6CPAA 5LRKA 1LOKA 3H8EA 1HDUA 5F09A 2F7VA 3ISZA 3D68A 3FECA 4Z65A 1RTQA 4MHZA 4WWVA 7CPAA 2WYRA 2JBKA 2PJ8A 2ZEDA 3BXMA 3NH8A 4MXUA 4UF4A 2RFHA 3KGQA 1DE4C 3NFZA 1PCAA 2AFSA 4P4DA 4P4IA 4LQGA 3TC8A 4NFRA 4R76A 2IJZA 3LMSA 4PXBA 1CBXA 4EFDA 4MHPA 3VATA 3RBUA 4P10A 5LYDA 3IO1A 3PBBA 1Y0RA 2J9AA 3PBEA 3FJUA 4FBEA 4OC3A 4EWTA 1XMBA 3D67A 3BI1A 3V7ZA 3VARA 4YWYA 4NJRA 4OIDA 3CT9A 5LRGA 3B7IA 3KR4A 3K2KA 1CG2A 2ZEEA 2ZEOA 4PPZA 5LYIA 2Q51A 2CIJA 4BD9A 3WC5A 2POKA 1KWMA 2BCOA 4H2KA 4R7MA 3GUXA 2OR4A 3IC1A 2PJ2A 1R3NA 2XEJA 1TKFA 2ZOFA 4JZ0A 3D7HA 1ZG8A 4FAIA 2PJ3A 4ZY0A 2ABZA 1Z5RA 2AFOA 3SJEA 4OC2A 1VHOA 4MHYA 5LRJA 3WT4A 5K8OA 4UIBA 2PRQA 4NGSA 3DLJA 4A38A 2O4HA 4IK2A 2PJ1A 1LANA 2PJ6A 2PJCA 2GLJA 3PFOA 2IMOA 2ZELA 4MCPA 3D66A 5HVGA 5HVFA 3B3SA 5K8MA 4K3NA 1TXRA 3GB0A 4RUHA 3SJGA 2PJ0A 1DTDA 1VIXA 3H8FA 3IIBA 4FWUA 4OKOA 2PJ7A 3BI0A 1BPNA 3S9NA 2AFXA 2GLFA 3GLJA 2Q43A 3PB6X 4PXDA 1XJOA 3V38A 2CF4A 4OP4A 4GM5A 1ELMP 3KI9A 1YMEA 1TKJA 2PJ5A 4YU9A 4R6TA 1FNOA 2PJBA 2BO9A 4PQAA 4PXEA 3SJXA 3SI1A 1TF8A 2WZNA 2C1CA 2ZOGA 3FVLA 4P4JA 2PJ9A 2OOTA 3MN8A 2ZEFA 4P4FA 3KQZA 3PB8X 1IGBA 1Z8LA 4TNUA 4WJBA 4NGRA 4CPAA 3D4UA 2JEWA 3JRUA 1AYEA 2V8DA 5CPAA 2ZEHA 1OBRA 4PXCA 3TX8A 4DYOA 2XEIA 3WC6A 1LFWA 2EK8A 3IEHA 2FVGA 4MMOA 2V77A 2QYVA 2GU2A 4X8IA 3CPAA 4OC5A 1UWYA 1ZLIA 5LYLA 2CTCA 1M4LA 5D29A 3NA6A 1QQ9A 1LAPA 4X3RA 5K8PA 1YW4A 3IFEA 2HB6A 4A94A 3D7DA 5LYFA 4NJQA 4JYWA 4R8FA 8CPAA 4MHNA 1YLOA 3PRTA 4UEZA 1TKHA 3RAMA 4MCQA 1VHEA 4KSIA 4ZY2A 3B3CA 2EWBA 4EMEA 2GREA 2HC9A 4ZI6A 2AFWA 4P45A 5THWA 1Z2LA 4MCRA 3KL9A 4F9VA 3RZAA 2ZEGA 4IAVA 3WC7A 3CDXA 5HXDA 4OC1A 3B3WA 3B2YA 2EK9A 2O53A 3SI0A 4ZY1A 3N5FA 2V8GA 3KASA 5DS0A 3KHZA 4FUUA 4OMEA 3B3VA 4ZX8A 3D7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLL E;  2QJ8 A;  4UEF A;  4A39 A;  2RB7 A;  2NSM A;  3DGV A;  4W9Y A;  1Y0Y A;  3H8G A;  2PIZ A;  1F57 A;  1JQG A;  2ANP A;  4UEE A;  2PCU A;  3ISX A;  4TWE A;  3T8W A;  3NH4 A;  3IWW A;  3MRU A;  2CTB A;  3FMC A;  4DUK A;  1YW6 A;  1ZG9 A;  1R43 A;  2BOA A;  2AFM A;  3FH4 A;  4P4E A;  1XBU A;  2ZEN A;  3SJF A;  3LWU A;  2C6C A;  1AMP A;  3I1U A;  2ZEP A;  4ZYQ A;  1EE3 P;  3S9M A;  4B6Z A;  2AFZ A;  1BPM A;  1HDQ A;  5JGF A;  2C6P A;  2PVW A;  2XEG A;  3BHX A;  4X2T A;  5JM6 A;  4UIA A;  4MRI A;  5HVH A;  2AFU A;  3KR5 A;  5CBM A;  2NYQ A;  4O23 A;  2VL1 A;  1ARM A;  4NGN A;  5IB9 A;  3FF3 A;  4P44 A;  4A37 A;  1YSJ A;  4DJL A;  2F8H A;  4OIW A;  2V8V A;  4P6Y A;  3FEE A;  1CX8 A;  3IJ3 A;  3FX6 A;  2IQ6 A;  2G9D A;  4OC4 A;  1Q7L A;  5K8N A;  1VGY A;  3HLP A;  4AXV A;  2PVV A;  1ZLH A;  2ZEM A;  3FED A;  2Q4Z A;  2PE3 A;  2C6G A;  5ELY A;  3VH9 A;  1BAV A;  1QMU A;  1LCP A;  5I4M A;  1FT7 A;  5J1Q A;  3QNV A;  3K9T A;  1CPS A;  1Y7E A;  1H8L A;  4Q7A A;  2V8H A;  3B35 A;  3B3T A;  2PJA A;  4MCS A;  3NH5 A;  4ONW A;  1LAM A;  4NGQ A;  2PIY A;  3KHX A;  4OC0 A;  1IY7 A;  1F2O A;  4NGM A;  1NSA A;  1TF9 A;  2PJ4 A;  4ZX9 A;  1ZG7 A;  4IHM A;  3S9L A;  4P4B A;  2XEF A;  3HUV A;  2DEA A;  3PB9 X;  4F9U A;  3PB4 X;  4G1P A;  2QVP A;  1ELL P;  1CPX A;  1CP6 A;  1CP7 A;  1XRY A;  3CPX A;  1ARL A;  3PEI A;  5D8N A;  4F8Z A;  1F2P A;  3KQX A;  3KZW A;  3WAB A;  1HEE A;  3SI2 A;  5JH9 A;  4NGT A;  1XFO A;  3PFE A;  4NGP A;  3L2N A;  3PB7 X;  1GYT A;  1PYT B;  3D7F A;  2I3C A;  2JBJ A;  6CPA A;  5LRK A;  1LOK A;  3H8E A;  1HDU A;  5F09 A;  2F7V A;  3ISZ A;  3D68 A;  3FEC A;  4Z65 A;  1RTQ A;  4MHZ A;  4WWV A;  7CPA A;  2WYR A;  2JBK A;  2PJ8 A;  2ZED A;  3BXM A;  3NH8 A;  4MXU A;  4UF4 A;  2RFH A;  3KGQ A;  1DE4 C;  3NFZ A;  1PCA A;  2AFS A;  4P4D A;  4P4I A;  4LQG A;  3TC8 A;  4NFR A;  4R76 A;  2IJZ A;  3LMS A;  4PXB A;  1CBX A;  4EFD A;  4MHP A;  3VAT A;  3RBU A;  4P10 A;  5LYD A;  3IO1 A;  3PBB A;  1Y0R A;  2J9A A;  3PBE A;  3FJU A;  4FBE A;  4OC3 A;  4EWT A;  1XMB A;  3D67 A;  3BI1 A;  3V7Z A;  3VAR A;  4YWY A;  4NJR A;  4OID A;  3CT9 A;  5LRG A;  3B7I A;  3KR4 A;  3K2K A;  1CG2 A;  2ZEE A;  2ZEO A;  4PPZ A;  5LYI A;  2Q51 A;  2CIJ A;  4BD9 A;  3WC5 A;  2POK A;  1KWM A;  2BCO A;  4H2K A;  4R7M A;  3GUX A;  2OR4 A;  3IC1 A;  2PJ2 A;  1R3N A;  2XEJ A;  1TKF A;  2ZOF A;  4JZ0 A;  3D7H A;  1ZG8 A;  4FAI A;  2PJ3 A;  4ZY0 A;  2ABZ A;  1Z5R A;  2AFO A;  3SJE A;  4OC2 A;  1VHO A;  4MHY A;  5LRJ A;  3WT4 A;  5K8O A;  4UIB A;  2PRQ A;  4NGS A;  3DLJ A;  4A38 A;  2O4H A;  4IK2 A;  2PJ1 A;  1LAN A;  2PJ6 A;  2PJC A;  2GLJ A;  3PFO A;  2IMO A;  2ZEL A;  4MCP A;  3D66 A;  5HVG A;  5HVF A;  3B3S A;  5K8M A;  4K3N A;  1TXR A;  3GB0 A;  4RUH A;  3SJG A;  2PJ0 A;  1DTD A;  1VIX A;  3H8F A;  3IIB A;  4FWU A;  4OKO A;  2PJ7 A;  3BI0 A;  1BPN A;  3S9N A;  2AFX A;  2GLF A;  3GLJ A;  2Q43 A;  3PB6 X;  4PXD A;  1XJO A;  3V38 A;  2CF4 A;  4OP4 A;  4GM5 A;  1ELM P;  3KI9 A;  1YME A;  1TKJ A;  2PJ5 A;  4YU9 A;  4R6T A;  1FNO A;  2PJB A;  2BO9 A;  4PQA A;  4PXE A;  3SJX A;  3SI1 A;  1TF8 A;  2WZN A;  2C1C A;  2ZOG A;  3FVL A;  4P4J A;  2PJ9 A;  2OOT A;  3MN8 A;  2ZEF A;  4P4F A;  3KQZ A;  3PB8 X;  1IGB A;  1Z8L A;  4TNU A;  4WJB A;  4NGR A;  4CPA A;  3D4U A;  2JEW A;  3JRU A;  1AYE A;  2V8D A;  5CPA A;  2ZEH A;  1OBR A;  4PXC A;  3TX8 A;  4DYO A;  2XEI A;  3WC6 A;  1LFW A;  2EK8 A;  3IEH A;  2FVG A;  4MMO A;  2V77 A;  2QYV A;  2GU2 A;  4X8I A;  3CPA A;  4OC5 A;  1UWY A;  1ZLI A;  5LYL A;  2CTC A;  1M4L A;  5D29 A;  3NA6 A;  1QQ9 A;  1LAP A;  4X3R A;  5K8P A;  1YW4 A;  3IFE A;  2HB6 A;  4A94 A;  3D7D A;  5LYF A;  4NJQ A;  4JYW A;  4R8F A;  8CPA A;  4MHN A;  1YLO A;  3PRT A;  4UEZ A;  1TKH A;  3RAM A;  4MCQ A;  1VHE A;  4KSI A;  4ZY2 A;  3B3C A;  2EWB A;  4EME A;  2GRE A;  2HC9 A;  4ZI6 A;  2AFW A;  4P45 A;  5THW A;  1Z2L A;  4MCR A;  3KL9 A;  4F9V A;  3RZA A;  2ZEG A;  4IAV A;  3WC7 A;  3CDX A;  5HXD A;  4OC1 A;  3B3W A;  3B2Y A;  2EK9 A;  2O53 A;  3SI0 A;  4ZY1 A;  3N5F A;  2V8G A;  3KAS A;  5DS0 A;  3KHZ A;  4FUU A;  4OME A;  3B3V A;  4ZX8 A;  3D7G A; 
#chains in the Genus database with same CATH topology
 1BLL E;  4Q7J B;  2PR1 A;  4UEF A;  4XR6 A;  3A9L A;  1TVC A;  1Y0Y A;  2R1I A;  3H8G A;  3W2I A;  1GHE A;  1KK0 A;  2BPO A;  1VQ4 B;  1IJE A;  2PIZ A;  1RQP A;  1F57 A;  4QVT A;  4UEE A;  4DNT B;  4Z4Y A;  4F6A A;  1YVO A;  3T8W A;  3MRU A;  4M85 A;  3BLN A;  4DUK A;  1XMT A;  1BJK A;  4PSW A;  3P26 A;  4X05 A;  4M0L A;  2R8V A;  1R5B A;  1Z8W A;  2AFM A;  2PC1 A;  5H84 A;  3G71 B;  2JJ1 A;  3B8H A;  2J8M A;  2OH1 A;  3I1U A;  1RQR A;  2E1B A;  1IOF A;  4UWI A;  3ZZT A;  1OB5 A;  2DPS A;  4XL9 A;  3ZZI A;  4E0A A;  5JGF A;  3SLD A;  5J35 A;  2RC6 A;  3A3B A;  1MJA A;  4L89 A;  3ZBT A;  4B44 A;  4MRI A;  4C0S A;  1WSR A;  2AFU A;  4KLV A;  4YAL A;  3FB3 A;  3KR5 A;  3V76 A;  4XKW A;  2QTL A;  1ARM A;  4NGN A;  5FVJ A;  3I9S A;  3SXO A;  4N3N A;  3PUN A;  1FNB A;  5KTA A;  2BGJ A;  2QIR A;  4A37 A;  4AC9 A;  1KD1 D;  1I8D A;  4OIW A;  4P25 A;  5HMN A;  1RO5 A;  4P6Y A;  1CX8 A;  4XPD C;  2G9D A;  3OAA A;  4A31 A;  4OC4 A;  1LRZ A;  1S72 B;  2ARH A;  2CNM A;  3HLP A;  5DN6 A;  2PVV A;  2QMU A;  5ELY A;  1ZM3 A;  2PE3 A;  4DQK A;  1UD3 A;  1LCP A;  2XGJ A;  1FT7 A;  2DYI A;  2W6J A;  5IYR A;  3RY8 A;  4OPV A;  3K9T A;  5AGE A;  1H8L A;  3OFN A;  2V8H A;  3B35 A;  3AVY A;  3R9E A;  3WBJ A;  4MCS A;  1QG0 A;  4Y7C A;  4P22 A;  5H59 A;  3AVT A;  1F2O A;  1NSA A;  1OB2 A;  1TF9 A;  2WR8 A;  4XOT A;  4ZX9 A;  4TN1 A;  4P12 A;  2YWH A;  2XEF A;  2HLD A;  1ZUN B;  1NBM A;  1YIJ B;  5BWA B;  3PB9 X;  4F9U A;  4RS2 A;  2BSW A;  5GV7 A;  4NCZ A;  5HZB A;  3BJ7 A;  1VQP B;  5D8N A;  4BBH A;  1PKV A;  2PR8 A;  3KQX A;  3KZW A;  4TMW A;  1S0U A;  3TO7 A;  5JH9 A;  3BCD A;  1XFO A;  4H89 A;  3L2N A;  4YEL A;  1KUX A;  3PB7 X;  1GYT A;  3D7F A;  4XMY A;  2V7W A;  1LOK A;  3H8E A;  4NEX A;  1HDU A;  5F09 A;  2F7V A;  5A27 A;  3D68 A;  1V0F A;  4NCN A;  2J8R A;  2P0W A;  2QEX B;  5FO0 A;  2Q0Y A;  2BF4 A;  4NXY A;  4ZCI A;  2JBK A;  2PJ8 A;  1PJ5 A;  1IYL A;  3GIR A;  2Q44 A;  1DE4 C;  1VQ8 B;  3OW2 B;  5EBV A;  3B78 A;  3LVB A;  3CXP A;  4FWT A;  3D3S A;  4P4I A;  3BNW A;  2QTZ A;  2OZH A;  5G1Z A;  2IJZ A;  2YGW A;  4PXB A;  1IID A;  3RO0 A;  4MHP A;  3BY2 A;  1Q81 D;  3RBU A;  3FRM A;  4PAB A;  4YXW A;  5LYD A;  3MCA A;  1AMO A;  5HH1 A;  2X0K A;  1W34 A;  3PBB A;  4B5P A;  4RPB A;  2J9A A;  3FJU A;  3CCJ B;  2XEX A;  4P3Y A;  1YX0 A;  1COW A;  3D67 A;  4AVA A;  3V7Z A;  3G3S A;  4YWY A;  3OEH A;  4DNC A;  2H5M A;  3JQQ A;  5E6T A;  4KUA A;  3K2K A;  1CG2 A;  2Z0Z A;  1HZE A;  5LYI A;  1JA1 A;  3CD6 B;  2PDO A;  1YI2 B;  3OZV A;  3WC5 A;  2JDD A;  3VO2 A;  1J4J A;  4H2K A;  2GIV A;  2K5T A;  1R3N A;  1TKF A;  3TFY A;  1EFC A;  4CGM A;  1B2R A;  1D8T A;  2PIA A;  2Z3K A;  1B87 A;  4XPD B;  3DR6 A;  2Q4Y A;  1FX0 A;  4KOX A;  4B14 A;  4OC2 A;  1VHO A;  4MHY A;  4LQ6 A;  3WT4 A;  4X0C A;  2R9V A;  1LAN A;  2PJ6 A;  2PJC A;  3F5B A;  2IMO A;  2ZEL A;  4MCP A;  1Q7Y D;  3W5V A;  3D66 A;  2OBR A;  3B3S A;  4AG9 A;  2XND A;  1TXR A;  3GB0 A;  4C43 A;  1IOI A;  2XNJ A;  3DSB A;  1Q2Y A;  5F49 A;  1H8H A;  4GQN A;  4JMQ A;  3H8F A;  2Q4V A;  3G6E B;  5DWN A;  5THX A;  3GVJ A;  3BI0 A;  1BPN A;  1MJ9 A;  2GLF A;  1V0C A;  3W5U A;  3GLJ A;  1QSO A;  4A33 A;  3TOB A;  4UFX A;  5IX3 A;  3V38 A;  1G7C A;  1E62 A;  4UCM A;  3EC4 A;  1EP2 B;  4YU9 A;  4R6T A;  1QX4 A;  2V7T A;  3IWG A;  1ZO0 A;  1YVK A;  4TSF A;  4XLF A;  4PQA A;  4F0Y A;  1W0J A;  2Z3N A;  4QB9 A;  3QFR A;  4UZU A;  1M4G A;  2GE3 A;  4TT3 A;  4HKF A;  4Z4S A;  4CPA A;  1OGJ A;  4Y9U A;  3AGQ A;  1X10 A;  2JEW A;  3UY5 A;  3BH4 A;  3WXM A;  4OAE A;  4ZCM A;  4M4S A;  2BM1 A;  3EXN A;  3B82 A;  4IW3 B;  1WOS A;  4OAD A;  1CNF A;  3OW7 A;  3FJO A;  2FVG A;  4MMO A;  4HPS A;  1R57 A;  4OC5 A;  1Y9W A;  1UWY A;  1ZLI A;  2D9R A;  5LYL A;  2CTC A;  2FIW A;  1M4L A;  4PC6 A;  5D29 A;  2ZXH A;  4JJX A;  3NA6 A;  4CAE A;  2RC5 A;  4KZT A;  5K8P A;  1YW4 A;  2B4D A;  5G22 A;  5F4M A;  4CQJ A;  4A94 A;  1KJZ A;  4FD7 A;  3TE4 A;  2Q6O A;  1FY7 A;  4JD6 A;  2V7V A;  4JYW A;  2C77 A;  5KSW B;  4XD7 A;  5KW9 A;  2CNS A;  1YLO A;  4NBS A;  3QE2 A;  1KMH A;  5JQ4 A;  2V4D A;  2W6I A;  2BUE A;  4ZY2 A;  3LNN A;  2WSS A;  3B3C A;  2EWB A;  1PJ6 A;  2BM0 A;  2OZU A;  2GRE A;  4P45 A;  2JLM A;  4LBV A;  3RZA A;  2F4N A;  1MRZ A;  1YHQ B;  4IAV A;  5FO1 A;  3K9U A;  2X6X A;  3AVV A;  4KSA A;  3A35 A;  1QUE A;  3U6K A;  4OC1 A;  3B3W A;  3QAY A;  5IV0 A;  3OEE A;  4XPK A;  2DY1 A;  2G3A A;  4P2N A;  3SI0 A;  4X7D A;  1E79 A;  1VHS A;  3LO8 A;  3KAS A;  1J9Z A;  1B23 P;  1DDI A;  3CP2 A;  2PMD A;  1XF8 A;  2WUU A;  5DWM A;  4A39 A;  2JN9 A;  2RB7 A;  3DGV A;  3I1F A;  4A32 A;  3OE7 A;  4C2X A;  3F0A A;  4GS4 A;  1BO4 A;  5C88 A;  1EWY A;  3BCF A;  1I7P A;  3CCL B;  2OK7 A;  3ZC3 A;  3FPK A;  3WY9 A;  4WZL A;  4A30 A;  1MJB A;  2E1R A;  2ZTG A;  1ZG9 A;  2Z3O A;  3SXN A;  2QA4 B;  3W6X A;  1BX1 A;  3E0K A;  1XBU A;  3PGP A;  1UD2 A;  2ZEN A;  1AMP A;  3SHP A;  2JDC A;  3CC4 B;  4B6Z A;  1BPM A;  3JU4 A;  4UA3 A;  4ZGQ B;  2QDX A;  5JBQ A;  4CGN A;  3ZUG A;  3AVX A;  2XEG A;  4UIA A;  5AG7 A;  5HVH A;  2FS5 A;  3CMM A;  5A28 A;  5CBM A;  2YNC C;  2NYQ A;  2VJI A;  1WK4 A;  4O23 A;  2VBU A;  2C4U A;  4XKV A;  3ONY A;  3D2M A;  4PC3 A;  4UAJ A;  2FSR A;  4A95 A;  2OU2 A;  1PUA A;  2BVN A;  3FXT A;  2J7K A;  4MJ8 A;  3FEE A;  1DAR A;  2VBT A;  1ZM9 A;  2KVO A;  3ASP A;  2VZZ A;  1VKC A;  1N07 A;  3CTA A;  5EMI A;  4E0F A;  2OK8 A;  1VGY A;  2VZL A;  4MFK A;  1K28 D;  4MFZ A;  3FED A;  3VH9 A;  4Z4R A;  3VWD A;  3T53 B;  4EVY A;  1QMU A;  5I4M A;  4II3 A;  5J1Q A;  3QNV A;  4B3X A;  2D74 A;  2CXA A;  2REE A;  3B3T A;  1Q2D A;  2GFQ A;  4TKO B;  4NGQ A;  4ZV4 A;  1S5K A;  3V7A A;  1IY7 A;  4MHD A;  1JJ2 B;  3AGP A;  3Q38 A;  2HCJ B;  4KOU A;  2V31 A;  4B47 A;  2Z3P A;  3PB4 X;  4Z4V A;  2GJK A;  4PK3 A;  1ELL P;  1CP7 A;  3WNB A;  3CPX A;  1N71 A;  1OGI A;  3FIX A;  1YX2 A;  3GSI A;  1F2P A;  1Z4E A;  1HEE A;  3SI2 A;  4QBJ A;  4NGT A;  3OJW A;  1G7S A;  4FD6 A;  4XON A;  2ZW4 A;  2JBJ A;  1M1K D;  5AG6 A;  4F0X A;  4X7C A;  1H85 A;  2DOG A;  3ZIA A;  4B10 A;  2O28 A;  3S6G A;  4MHZ A;  3TO6 A;  4XQF A;  3BXM A;  2WPX A;  4MI4 A;  3NFZ A;  5I0C A;  2HDN B;  5IYW A;  4XLH A;  2DEU A;  2AFS A;  1L0C A;  3CZX A;  3DNS A;  2OYN A;  3TC8 A;  2XZP A;  2VNI A;  3W5H A;  2DF5 A;  1BLI A;  3WYA A;  3R1K A;  4B3F X;  1Y0R A;  2QML A;  4MFP A;  2FCK A;  2X7B A;  4B43 A;  2ZL5 A;  3BQJ A;  4G7X A;  3Q3A A;  4ACA A;  4EWT A;  4KOS A;  3RNZ A;  5LMZ A;  2CC2 A;  2P3M A;  4CYN A;  1F60 A;  4NJR A;  4QV2 A;  2G3T A;  4G5G A;  3WNC A;  4OOV A;  5KTC A;  2X6W A;  1WTH D;  2CIJ A;  3D2P A;  1KWM A;  2B3V A;  2BCO A;  1P0H A;  4RD1 A;  3GUX A;  3LD2 A;  1GJR A;  1QFZ A;  2OR4 A;  2P6G A;  1WSV A;  4U9U A;  4CYO A;  3D7H A;  3NE5 B;  1ZG8 A;  4OLL A;  1N0U A;  2ABZ A;  2VBV A;  1Z5R A;  1QSM A;  3W2G A;  4QVJ A;  3ASR A;  3MGD A;  5LRJ A;  2Y0M A;  4A38 A;  4IK2 A;  2VNK A;  2CK3 A;  1I12 A;  3AST A;  1Q86 D;  2GJR A;  5HVG A;  2WJV A;  4AF6 A;  4G6I A;  4KLW A;  4KUB A;  1CJW A;  3CB4 A;  4RD4 A;  4J0Q A;  2PJ0 A;  4RCZ A;  4KOT A;  1DTD A;  1VIX A;  2YWE A;  4QFM A;  1W2B B;  1BQE A;  3W2E A;  4KSF A;  4A2Z A;  1UD4 A;  3PB6 X;  4N3G A;  2JDI A;  3A8K A;  4HE6 A;  1D2E A;  2VBS A;  4B5O A;  1KZF A;  2B5G A;  4PGO A;  2GAN A;  3U6B A;  1E1Q A;  1NMT A;  2PJB A;  3QFC A;  4PAA A;  4H6Z A;  1B6B A;  2AE6 A;  1SKQ A;  2C1C A;  5IK2 A;  5A89 A;  1WWZ A;  3FVL A;  3GYA A;  3MN8 A;  4P4F A;  1XE1 A;  3KQZ A;  1U2R A;  1IGB A;  4WJB A;  2R7H A;  3ES9 A;  4M6I A;  1FRN A;  3V8I A;  4XLC A;  3R6J A;  3S6H A;  3JRU A;  5CPA A;  2ZEH A;  3BC9 A;  1DDG A;  3LQ6 A;  4RD2 A;  3GKR A;  3TX8 A;  4C2Z A;  1T6Y A;  2B7B A;  4X7F A;  4MY3 A;  3IEH A;  2F1M A;  3ZPN A;  4PV6 A;  4TMX A;  3TT2 A;  2GK6 A;  2ZBV A;  1Q2C A;  2QYV A;  5G21 A;  3A8I A;  1GAW A;  1WOR A;  1LAP A;  1N05 A;  1QQ9 A;  4OOX A;  1QSR A;  4R3K A;  2FXF A;  2B58 A;  5TRD A;  1I18 A;  1QGA A;  3IGR A;  5LYF A;  3FKS A;  4NJQ A;  3JTK A;  2QN6 A;  1CNE A;  4R8F A;  2FX3 A;  1MAB A;  1U6M A;  3SLN A;  2VI7 A;  2C78 A;  3PRT A;  4KVX A;  4RDJ A;  4UEZ A;  2ZZG A;  3CXQ A;  3RAM A;  1VHE A;  1Z8T A;  2FL4 A;  4CYP A;  4M53 A;  4E2A A;  2ZBU A;  4MCR A;  2ODF A;  1FNC A;  1TUI A;  2D4P A;  4RLZ A;  1ELO A;  3B2Y A;  5AG4 A;  2O53 A;  4UWJ A;  4ZY1 A;  1FRQ A;  1EP1 B;  4II9 A;  1N0V C;  5F4J A;  4FUU A;  4YFJ A;  1W0K A;  2CRV A;  2NSM A;  2P6F A;  4W9Y A;  2B7C A;  1NB0 A;  2F1L A;  3JQP A;  4XN0 A;  1VQL B;  4CAV A;  3CCV B;  5KNL A;  1JQG A;  3FPP A;  4Q36 A;  2PCU A;  3OP1 A;  5ISV A;  1Z8X A;  3ISX A;  4TWE A;  1QST A;  3GY9 A;  2EO8 A;  3NH4 A;  3IWW A;  1GVH A;  1QVG B;  4KKU A;  3QAH A;  1W35 A;  1R43 A;  4TMT A;  2BOA A;  3CCM B;  1G7T A;  2EVN A;  3FH4 A;  4P4E A;  4XPL A;  1QVF B;  1WDT A;  3LWU A;  5HXB A;  2ZEP A;  3VR6 A;  1ON0 A;  1KUY A;  1EE3 P;  2AFZ A;  1VQ5 B;  1GR1 A;  4B5P B;  1JA0 A;  2C6P A;  3SJP A;  3IWE A;  4X2T A;  2XOK A;  1NJI D;  3PA2 A;  4K1X A;  3B8G A;  2XZO A;  4QHY A;  4DK0 A;  4UFW A;  1K8A D;  2VXK A;  3ONU A;  4R87 A;  2VEZ A;  2EBJ A;  3FF3 A;  1UMK A;  4P44 A;  1GO2 A;  1MK4 A;  1YSJ A;  4M3S A;  2F8H A;  4HNX B;  1YJW B;  4E8O A;  3SKB A;  1E3X A;  2ZZE A;  3IJ3 A;  4HNW B;  3FX6 A;  1D1N A;  4YAO A;  2KCW A;  1XOV A;  1Q7L A;  5K8N A;  2B3U A;  4JLY A;  2ZW6 A;  1KK3 A;  5CNP A;  1S4M A;  3ZZ0 A;  1ZLH A;  2ZEM A;  1QGY A;  5IYP A;  3W91 A;  1HA3 A;  3PZJ A;  1P4N A;  4I49 A;  2NMT A;  1T5E A;  4KOR A;  4GXH A;  1M4I A;  4Q7A A;  2PJA A;  1W9X A;  5A8A A;  4ONW A;  1LAM A;  3CXS A;  1E63 A;  4PC1 A;  4OC0 A;  3WQZ A;  4ZBG A;  4NGM A;  1ZG7 A;  4IHM A;  1XEB A;  4OPS A;  4DQL A;  1JNY A;  1DG1 G;  3HUV A;  2DEA A;  2CNT A;  3ASS A;  2Q6I A;  2X3U A;  2VYQ A;  1CPX A;  1S7L A;  3DDY A;  1IHM A;  5IB0 A;  3PEI A;  1EP3 B;  3CCU B;  1X12 A;  3WAB A;  4P6V F;  2QE7 A;  5EC4 A;  2GQF A;  3D8P A;  4KOY A;  5EMN A;  3OOC A;  3PFE A;  4F7D A;  3CES A;  1NSL A;  2ZW5 A;  1PYT B;  1TTT A;  3PP9 A;  5FA6 A;  2PLF A;  2NPF A;  3ISZ A;  1OZP A;  1VJS A;  3PUM A;  4H6U A;  4Z65 A;  3I55 B;  4KVM E;  2HV2 A;  7CPA A;  4K30 A;  3ZJ0 A;  2WYR A;  2X6Y A;  4RJL A;  4AF7 A;  3NH8 A;  4UF4 A;  2RFH A;  3KGQ A;  4M6H A;  3U2Q A;  3W6S A;  2DPT A;  1PCA A;  2BGI A;  3CRZ A;  4MYT A;  3OZU A;  4Z1M A;  3TOA A;  3W2F A;  4R76 A;  4P26 A;  1M4D A;  2DET A;  5A88 A;  1WP6 A;  2ZTN A;  1CBX A;  4EFD A;  4R9M A;  3VAT A;  4H9G A;  4XOR A;  1PU9 A;  1QFY A;  3IO1 A;  1KK2 A;  4YAU A;  3LQE A;  4OC3 A;  2OTL B;  1XMB A;  2ZZF A;  4CGO A;  4C68 A;  3D26 A;  3BI1 A;  4KS9 A;  4B12 A;  3CPW B;  2A4N A;  2ZXV A;  3S6K A;  3KR4 A;  3P2H A;  2EIX A;  4XNF A;  2WZP P;  2Q51 A;  1QSN A;  2B4D B;  3LOD A;  4DK1 A;  4PC7 A;  3KEW A;  1XIX A;  2B4B A;  2M5S A;  4KKT A;  3IC1 A;  4RD3 A;  1SQH A;  4RM0 A;  2XEJ A;  2OB0 A;  1WOP A;  4YEJ A;  3Q6R A;  4JZ0 A;  3CC2 B;  2YNC A;  4CRZ B;  2VNJ A;  4C2Y A;  4YGO A;  3A3G A;  2J8N A;  4XLA A;  2AFO A;  1E43 A;  3SJE A;  3A1P A;  2PRB A;  1FND A;  4L8A A;  5K8O A;  3R96 A;  4XM3 A;  2PRQ A;  2V7U A;  4NF1 A;  4NGS A;  3NE8 A;  1VQ7 B;  3R95 A;  4X7E A;  1SKY B;  2FIA A;  2PSW A;  2HUZ A;  3PFO A;  3AVW A;  4U9Z A;  5HVF A;  4QVA A;  4G1V A;  1JB9 A;  4K3N A;  4XN3 A;  1CQX A;  1V0E A;  4RUH A;  4MBU A;  4X5K A;  3SJG A;  4IUS A;  1H42 A;  2RC4 A;  4LUA A;  4OP7 A;  4M2L A;  1KZL A;  4C7I A;  2PJ7 A;  1E1R A;  3CC7 B;  2ATR A;  2AFX A;  2Q43 A;  4RI1 A;  4CAX A;  4PXD A;  2ZL6 A;  1XJO A;  2CF4 A;  4OP4 A;  4ASU A;  4PC2 A;  3WR7 A;  1ELM P;  1KK1 A;  3PVD A;  1TKJ A;  2PJ5 A;  3WBK A;  4AB7 A;  4B48 A;  1FNO A;  2BO9 A;  2C2W A;  3JQR A;  3CMA B;  2WJY A;  1N08 A;  5J8C A;  4PXE A;  3SJX A;  3SI1 A;  2WZN A;  4BIN A;  4P1V A;  1IJF A;  2PJ9 A;  3RYO A;  3IU1 A;  1QGZ A;  2R98 A;  3EO4 A;  3JUW A;  4NGR A;  4ZGY B;  4QUS A;  2XNC A;  3HAG A;  4FD5 A;  2V8D A;  4CS0 B;  4PXC A;  3IU2 A;  3DR8 A;  1Q9S A;  2GJP A;  4DYO A;  1XE4 A;  4ZCL A;  4UCN A;  3WC6 A;  4PSX A;  4HE5 A;  5HKK A;  2EK8 A;  2OBS A;  4WZE A;  2YWG A;  2Z6B D;  1PJ7 A;  2VZY A;  5TV2 A;  1I21 A;  4CGL A;  3CPA A;  3J81 k;  5JPH A;  3SEJ A;  2CY2 A;  1M44 A;  1OB0 A;  3MHP A;  2G0B A;  3CP8 A;  3P2F A;  4X3R A;  2HMA A;  2X53 S;  2C27 A;  1T6X A;  1KC8 D;  1YLE A;  3MMP A;  3D7D A;  4C7H A;  5H86 A;  3VWE A;  3C26 A;  3BY1 A;  2CBX A;  3H4Q A;  3CCQ B;  1M1D A;  1R5O A;  5F47 A;  8CPA A;  2BEI A;  3ZZU A;  4MHN A;  4BPR A;  1HVX A;  1QH0 A;  4XNH C;  1W87 A;  4OPO A;  1IIC A;  3A8J A;  1N8R D;  3OWC A;  4MCQ A;  4KSI A;  2IL4 A;  2JEV A;  2DCU A;  2HC9 A;  1I1D A;  1VF7 A;  4UCP A;  3E20 A;  4ONU A;  3KL9 A;  2ZEG A;  1VQ9 B;  5TR9 A;  1VQM B;  3CDX A;  5HXD A;  1IYK A;  1OHH A;  1S60 A;  3CCE B;  2Q7B A;  1WU8 A;  5DS0 A;  4P9S A;  4YAF A;  3KHZ A;  3CXC B;  3G4S B;  3D7G A;  5DSZ A;  1SM4 A;  1QFJ A;  2QJ8 A;  2DXQ A;  3DDD A;  4G7W A;  5B6I A;  3R9F A;  1FNM A;  4B3G A;  4UBR A;  2VQY A;  4MYU A;  3G8W A;  1A8P A;  2R6H A;  2ANP A;  4AVC A;  4Z4Z A;  2B5O A;  1EFR A;  4TMV A;  3CW2 A;  5KTD A;  3H94 A;  2V7Q A;  1EFT A;  2CTB A;  3I3G A;  2BN4 A;  3FMC A;  1Z4R A;  3EFA A;  1YW6 A;  2QEC A;  3OZW A;  1IU8 A;  1ZM4 A;  3E1Y E;  3R6K A;  4LBY A;  3SJF A;  3Q6Q A;  4ROX A;  2C6C A;  4ZYQ A;  3CCR B;  3S9M A;  1HDQ A;  2FT0 A;  4B13 A;  3TTH A;  2ZIT A;  2VBQ A;  1NB9 A;  1R5N A;  4QUZ A;  2I1L A;  2PVW A;  5AN9 A;  2P6E A;  3N7Z A;  3BHX A;  5JM6 A;  3T56 B;  1VQO B;  2CND A;  3EY5 A;  4UZE A;  3SJZ A;  4FN5 A;  3LAC A;  4MFJ A;  2DIE A;  2VL1 A;  5F4O A;  1EFU A;  1YK3 A;  1IB1 E;  5IB9 A;  1H8E A;  2BMW A;  4DJL A;  4NNJ A;  4CAW A;  1Q82 D;  2V8V A;  4JXR A;  2IQ6 A;  1Z9U A;  1GAQ A;  3OPO A;  1K9M D;  2EUI A;  4YHB A;  3QFT A;  2ZPA A;  2GK7 A;  5F48 A;  4WZK A;  4Z4U A;  3FBU A;  4AXV A;  1YJN B;  1YR0 A;  5TY0 A;  2C6G A;  2Q4Z A;  1BAV A;  4II2 A;  3T51 B;  1EXM A;  3BJ8 A;  4Y49 C;  5AG5 A;  1WPC A;  1CPS A;  4FD4 A;  1Y7E A;  4CGP A;  3NH5 A;  5IYQ A;  2PIY A;  3KHX A;  4RN7 A;  2ZW7 A;  2PJ4 A;  1CM0 A;  1TIQ A;  1VQN B;  3S9L A;  2WPD A;  4P4B A;  2Z11 A;  3NE7 A;  2CW5 A;  4M1K A;  4XNH B;  4G1P A;  4YRH A;  5J8F A;  2QVP A;  2ZXI A;  4LBZ A;  1CP6 A;  2D3L A;  1XRY A;  1ARL A;  1UD8 A;  4F8Z A;  1VLY A;  4HNY B;  1V5V A;  4RDK A;  2ZZQ A;  5IYN A;  1BX0 A;  3H5Z A;  4NGP A;  3F8K A;  3P27 A;  2REF A;  2I3C A;  6CPA A;  3AVU A;  2B5G B;  5LRK A;  4M6G A;  1IB0 A;  3FEC A;  1RTQ A;  4L8J A;  3GVK A;  4WWV A;  2Z3M A;  4OOS A;  4CRY B;  2I79 A;  1KUV A;  1QUF A;  1G7R A;  2F5I A;  2ZED A;  3R9G A;  4MXU A;  2VNH A;  1VQ6 B;  1BPL A;  3CME B;  1XB2 A;  2JJ2 A;  4P4D A;  4LC0 A;  1S3Z A;  2PQ8 A;  4LQG A;  4QC6 A;  3GIU A;  4NFR A;  3OKX A;  1KTV A;  4ZGN B;  3LMS A;  4MY0 A;  2Q04 A;  1UD6 A;  2YND A;  5BSY A;  4P10 A;  1S7N A;  2C4T A;  4DNR B;  1UD5 A;  1A2Z A;  3PBE A;  4AVB A;  2DER A;  2Z10 A;  4NSQ A;  4FBE A;  2HQY A;  2V7X A;  3VAR A;  4KKS A;  4OID A;  1FDR A;  3CT9 A;  5LRG A;  3B7I A;  4RCY A;  2ZEE A;  2ZEO A;  4PPZ A;  3PEN A;  4BD9 A;  2QGG A;  2POK A;  4R7M A;  2Z3L A;  2GPJ A;  4FXU A;  2Q6L A;  2PJ2 A;  3TCV A;  4UFV A;  2ZOF A;  5G20 A;  2OTJ B;  4FAI A;  2PJ3 A;  4ZY0 A;  4R3L A;  1KQS B;  1NRK A;  5GV8 A;  2VJJ A;  2BL1 A;  3Q39 A;  4UIB A;  4J3G A;  1S7K A;  4AG7 A;  3GVL A;  3WND A;  3DLJ A;  3FNC A;  2O4H A;  3VNU A;  4Z4T A;  2PJ1 A;  2FE7 A;  3VNV A;  1BOB A;  1AIP A;  2GLJ A;  1RXT A;  4HIZ A;  5E96 A;  2NV4 A;  2Q6K A;  3ZBU A;  5J3O A;  4Y49 B;  5K8M A;  4B11 A;  3KKW A;  4LX9 A;  1UFH A;  2AJ6 A;  1YQE A;  3IIB A;  4FWU A;  4OKO A;  1Y7R A;  3S9N A;  1JWQ A;  3W2H A;  4CAF A;  1KRH A;  1YIT B;  4Y9R A;  4GM5 A;  1P4M A;  3KI9 A;  1YME A;  4UZF A;  4YAW A;  4U5Y A;  2C5B A;  4PK2 A;  4X06 A;  3FYN A;  3TO9 A;  1AUG A;  4RD0 A;  2BSA A;  2F43 A;  4IF5 A;  4WQM A;  1TF8 A;  5F46 A;  2ZOG A;  3S6F A;  4P4J A;  2OOT A;  4Q38 A;  2D4O A;  4MFL A;  2ZEF A;  1N06 A;  3PB8 X;  1Z8L A;  4TNU A;  4R71 A;  2WSA A;  4ORF A;  4RDL A;  3I56 B;  2AHO A;  2EFG A;  2X85 A;  3D4U A;  4ACB A;  4X07 A;  1NDH A;  2LZJ A;  4LBW A;  1M90 D;  1AYE A;  1WOO A;  2BV3 A;  1OBR A;  4Z4W A;  5BSX A;  1K73 D;  5FIU A;  3CCS B;  3QSY A;  2XEI A;  4KOV A;  4KOW A;  2WPW A;  1K4J A;  1LFW A;  3G05 A;  5FL7 A;  4TMZ A;  4AVZ A;  2V77 A;  3T9Y A;  1XQB A;  2GU2 A;  4X8I A;  4P3I A;  4JXQ A;  3OJX A;  2Q7S A;  4MFQ A;  5CDF A;  2YWF A;  2YNE A;  3IFE A;  3T90 A;  4BMH A;  2HB6 A;  3QFS A;  5L46 A;  1ZM2 A;  4EH1 A;  2XZL A;  1S7F A;  2X8K A;  3H9N A;  1BMF A;  4KVO E;  4B4D A;  3PA1 A;  1YRE A;  3GQB A;  1TLL A;  1F20 A;  1VQK B;  2D3N A;  4RD6 A;  2JIZ A;  3QB8 A;  2I00 A;  4G1B A;  1NE9 A;  1TKH A;  1E64 A;  4CYQ A;  3JVN A;  4WZT A;  5C82 A;  2OBT A;  3VMF A;  5FNZ A;  2OZG A;  4EME A;  1YGH A;  4ZI6 A;  4XLE A;  2AFW A;  5THW A;  2ZL7 A;  1Z2L A;  4F9V A;  3WC7 A;  4U9Y A;  4R57 A;  4JWP A;  2C5H A;  5H5J A;  2EK9 A;  4RPD A;  3VO1 A;  1T6Z A;  4FK8 A;  3N5F A;  2V8G A;  5GCN A;  3ASQ A;  1E3Z A;  4XOP A;  1Y9K A;  1YJ9 B;  4OME A;  1VLO A;  5HZA A;  3B3V A;  4ZX8 A; 
#chains in the Genus database with same CATH homology
 1BLL E;  2QJ8 A;  4UEF A;  4A39 A;  2RB7 A;  2NSM A;  3DGV A;  4W9Y A;  1Y0Y A;  3H8G A;  2PIZ A;  1F57 A;  1JQG A;  2ANP A;  4UEE A;  2PCU A;  3ISX A;  4TWE A;  3T8W A;  3NH4 A;  3IWW A;  3MRU A;  2CTB A;  3FMC A;  4DUK A;  1YW6 A;  1ZG9 A;  1R43 A;  2BOA A;  2AFM A;  3FH4 A;  4P4E A;  1XBU A;  2ZEN A;  3SJF A;  3LWU A;  2C6C A;  1AMP A;  3I1U A;  2ZEP A;  4ZYQ A;  1EE3 P;  3S9M A;  4B6Z A;  2AFZ A;  1BPM A;  1HDQ A;  5JGF A;  2C6P A;  2PVW A;  2XEG A;  3BHX A;  4X2T A;  5JM6 A;  4UIA A;  4MRI A;  5HVH A;  2AFU A;  3KR5 A;  5CBM A;  2NYQ A;  4O23 A;  2VL1 A;  1ARM A;  4NGN A;  5IB9 A;  3FF3 A;  4P44 A;  4A37 A;  1YSJ A;  4DJL A;  2F8H A;  4OIW A;  2V8V A;  4P6Y A;  3FEE A;  1CX8 A;  3IJ3 A;  3FX6 A;  2IQ6 A;  2G9D A;  4OC4 A;  1Q7L A;  5K8N A;  1VGY A;  3HLP A;  4AXV A;  2PVV A;  1ZLH A;  2ZEM A;  3FED A;  2Q4Z A;  2PE3 A;  2C6G A;  5ELY A;  3VH9 A;  1BAV A;  1QMU A;  1LCP A;  5I4M A;  1FT7 A;  5J1Q A;  3QNV A;  3K9T A;  1CPS A;  1Y7E A;  1H8L A;  4Q7A A;  2V8H A;  3B35 A;  3B3T A;  2PJA A;  4MCS A;  3NH5 A;  4ONW A;  1LAM A;  4NGQ A;  2PIY A;  3KHX A;  4OC0 A;  1IY7 A;  1F2O A;  4NGM A;  1NSA A;  1TF9 A;  2PJ4 A;  4ZX9 A;  1ZG7 A;  4IHM A;  3S9L A;  4P4B A;  2XEF A;  3HUV A;  2DEA A;  3PB9 X;  4F9U A;  3PB4 X;  4G1P A;  2QVP A;  1ELL P;  1CPX A;  1CP6 A;  1CP7 A;  1XRY A;  3CPX A;  1ARL A;  3PEI A;  5D8N A;  4F8Z A;  1F2P A;  3KQX A;  3KZW A;  3WAB A;  1HEE A;  3SI2 A;  5JH9 A;  4NGT A;  1XFO A;  3PFE A;  4NGP A;  3L2N A;  3PB7 X;  1GYT A;  1PYT B;  3D7F A;  2I3C A;  2JBJ A;  6CPA A;  5LRK A;  1LOK A;  3H8E A;  1HDU A;  5F09 A;  2F7V A;  3ISZ A;  3D68 A;  3FEC A;  4Z65 A;  1RTQ A;  4MHZ A;  4WWV A;  7CPA A;  2WYR A;  2JBK A;  2PJ8 A;  2ZED A;  3BXM A;  3NH8 A;  4MXU A;  4UF4 A;  2RFH A;  3KGQ A;  1DE4 C;  3NFZ A;  1PCA A;  2AFS A;  4P4D A;  4P4I A;  4LQG A;  3TC8 A;  4NFR A;  4R76 A;  2IJZ A;  3LMS A;  4PXB A;  1CBX A;  4EFD A;  4MHP A;  3VAT A;  3RBU A;  4P10 A;  5LYD A;  3IO1 A;  3PBB A;  1Y0R A;  2J9A A;  3PBE A;  3FJU A;  4FBE A;  4OC3 A;  4EWT A;  1XMB A;  3D67 A;  3BI1 A;  3V7Z A;  3VAR A;  4YWY A;  4NJR A;  4OID A;  3CT9 A;  5LRG A;  3B7I A;  3KR4 A;  3K2K A;  1CG2 A;  2ZEE A;  2ZEO A;  4PPZ A;  5LYI A;  2Q51 A;  2CIJ A;  4BD9 A;  3WC5 A;  2POK A;  1KWM A;  2BCO A;  4H2K A;  4R7M A;  3GUX A;  2OR4 A;  3IC1 A;  2PJ2 A;  1R3N A;  2XEJ A;  1TKF A;  2ZOF A;  4JZ0 A;  3D7H A;  1ZG8 A;  4FAI A;  2PJ3 A;  4ZY0 A;  2ABZ A;  1Z5R A;  2AFO A;  3SJE A;  4OC2 A;  1VHO A;  4MHY A;  5LRJ A;  3WT4 A;  5K8O A;  4UIB A;  2PRQ A;  4NGS A;  3DLJ A;  4A38 A;  2O4H A;  4IK2 A;  2PJ1 A;  1LAN A;  2PJ6 A;  2PJC A;  2GLJ A;  3PFO A;  2IMO A;  2ZEL A;  4MCP A;  3D66 A;  5HVG A;  5HVF A;  3B3S A;  5K8M A;  4K3N A;  1TXR A;  3GB0 A;  4RUH A;  3SJG A;  2PJ0 A;  1DTD A;  1VIX A;  3H8F A;  3IIB A;  4FWU A;  4OKO A;  2PJ7 A;  3BI0 A;  1BPN A;  3S9N A;  2AFX A;  2GLF A;  3GLJ A;  2Q43 A;  3PB6 X;  4PXD A;  1XJO A;  3V38 A;  2CF4 A;  4OP4 A;  4GM5 A;  1ELM P;  3KI9 A;  1YME A;  1TKJ A;  2PJ5 A;  4YU9 A;  4R6T A;  1FNO A;  2PJB A;  2BO9 A;  4PQA A;  4PXE A;  3SJX A;  3SI1 A;  1TF8 A;  2WZN A;  2C1C A;  2ZOG A;  3FVL A;  4P4J A;  2PJ9 A;  2OOT A;  3MN8 A;  2ZEF A;  4P4F A;  3KQZ A;  3PB8 X;  1IGB A;  1Z8L A;  4TNU A;  4WJB A;  4NGR A;  4CPA A;  3D4U A;  2JEW A;  3JRU A;  1AYE A;  2V8D A;  5CPA A;  2ZEH A;  1OBR A;  4PXC A;  3TX8 A;  4DYO A;  2XEI A;  3WC6 A;  1LFW A;  2EK8 A;  3IEH A;  2FVG A;  4MMO A;  2V77 A;  2QYV A;  2GU2 A;  4X8I A;  3CPA A;  4OC5 A;  1UWY A;  1ZLI A;  5LYL A;  2CTC A;  1M4L A;  5D29 A;  3NA6 A;  1QQ9 A;  1LAP A;  4X3R A;  5K8P A;  1YW4 A;  3IFE A;  2HB6 A;  4A94 A;  3D7D A;  5LYF A;  4NJQ A;  4JYW A;  4R8F A;  8CPA A;  4MHN A;  1YLO A;  3PRT A;  4UEZ A;  1TKH A;  3RAM A;  4MCQ A;  1VHE A;  4KSI A;  4ZY2 A;  3B3C A;  2EWB A;  4EME A;  2GRE A;  2HC9 A;  4ZI6 A;  2AFW A;  4P45 A;  5THW A;  1Z2L A;  4MCR A;  3KL9 A;  4F9V A;  3RZA A;  2ZEG A;  4IAV A;  3WC7 A;  3CDX A;  5HXD A;  4OC1 A;  3B3W A;  3B2Y A;  2EK9 A;  2O53 A;  3SI0 A;  4ZY1 A;  3N5F A;  2V8G A;  3KAS A;  5DS0 A;  3KHZ A;  4FUU A;  4OME A;  3B3V A;  4ZX8 A;  3D7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...