3D26A

Norwalk p domain a-trisaccharide complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
287
structure length
284
Chain Sequence
b'PFTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSIATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGASSGPQQLPINGVFVFVSWVSRFYQLKPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 58 kd capsid protein
publication title Structural basis for the receptor binding specificity of Norwalk virus.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 60
structure length 284
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08435 Calici_coat_C Calicivirus coat protein C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3d26A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3d26A01
4X7EA 5BSXA 3R6JA 5F4MA 4Z4RA 4P2NA 4ROXA 3Q39A 3R6KA 3V7AA 3ONUA 5E6TA 4OOXA 3PA1A 5J3OA 3ASTA 3SKBA 4P1VA 3PA2A 1IHMA 4WZEA 4P12A 4Z4UA 4Z4YA 5HZAA 4QVJA 3ONYA 4QV2A 3SLNA 4X06A 4OOVA 5F4OA 3ASPA 3ASSA 4QUZA 4WZTA 4X05A 4RM0A 3LQ6A 4X7DA 3Q6QA 3LQEA 5IYRA 4Z4SA 4Z4VA 4RLZA 4OPSA 3PUNA 4OOSA 3ASRA 4RPDA 3Q3AA 5IYQA 4RDLA 3PUMA 3SJPA 3BY1A 4Z4WA 3ASQA 5J35A 3Q6RA 5IYPA 5F4JA 3PVDA 3BY2A 2ZL5A 4P3IA 2ZL6A 3RY8A 2OBRA 4X07A 4X7FA 5BSYA 4P25A 5IYNA 3SEJA 4RDJA 4QVAA 4OPVA 3Q38A 4OPOA 4Z4ZA 4X7CA 5KW9A 2ZL7A 5HZBA 4WZLA 4RDKA 3D26A 4Z4TA 3BQJA 5IYWA 4RPBA 4OP7A 4WZKA 2OBTA 4X0CA 3SLDA 4P26A 2OBSA
chains in the Genus database with same CATH superfamily
2B7BA 1DG1G 4YELA 1FNCA 3OOCA 3OZVA 4QFMA 2BPOA 4X7EA 3CCEB 1YJWB 3GSIA 2DYIA 1W0JA 1ELOA 4RD2A 4XONA 3CB4A 1UD2A 5FO1A 2NV4A 1JB9A 4P2NA 2PE3A 1S0UA 1WSVA 1J9ZA 3AVUA 4ROXA 1D2EA 3PENA 1KK0A 3R6KA 5EMNA 3CCJB 4YAUA 1KMHA 4H9GA 4YAOA 1F20A 3A8JA 3B82A 2OTJB 2QN6A 4P1VA 2HLDA 2GK7A 1E62A 3GVJA 1WOOA 1N0VC 2CF4A 4YHBA 1QFYA 3JQPA 1VHOA 4P22A 2D74A 3ISXA 5HZAA 4QVJA 1V0FA 3AVTA 1P4MA 3ONYA 4E0FA 4R71A 1KJZA 3G6EB 3CCUB 1JA1A 1BJKA 1NB9A 3GIRA 2EFGA 4RM0A 1KK3A 3VO2A 1KQSB 3LQ6A 1WSRA 1TVCA 2M5SA 4XM3A 1IJEA 5IYRA 2R6HA 2GK6A 4G1BA 3ES9A 2Q6OA 2V7QA 2VNHA 3LO8A 4YAFA 3MCAA 2YWEA 2ZTGA 5THXA 1E1QA 2RC5A 3LVBA 4PC3A 3SJPA 1UD5A 3ZPNA 5AN9A 4TMZA 4XOTA 1W2BB 1T6YA 1JJ2B 1ZM2A 3LNNA 2XZLA 2Q6LA 4JMQA 2WZPP 4Y9UA 3A35A 1W0KA 5L46A 3GVLA 2FX3A 3E1YE 4Z1MA 1KTVA 2HMAA 2F43A 2JN9A 2VJIA 3U6BA 1I18A 5FL7A 1HZEA 2ZXHA 1PJ5A 2QTZA 3OZUA 2XNJA 2VBTA 2WZNA 3QFSA 4LBYA 5IYNA 5H59A 2GJRA 4RD4A 3WNCA 4RDJA 1XE1A 3CC4B 1E3ZA 4P6VF 4YXWA 4XN0A 2XNDA 1WOSA 5DS0A 4G5GA 2BMWA 2VYQA 4TMTA 4U9UA 3J81k 3CCSB 4OPVA 2XGJA 4RCYA 1WTHD 2BM0A 3AVWA 3Q38A 4L8JA 3QFTA 4DK0A 1BQEA 4ASUA 2XZOA 3A8IA 1TTTA 1FDRA 3OPOA 3QFRA 1EP2B 3JU4A 2OK7A 4Z4TA 1OHHA 4HE6A 3T51B 1VHEA 3CCVB 2C4UA 1QVFB 1EFUA 3BQJA 2QGGA 1CQXA 2OBTA 1OB0A 2F1MA 4C43A 2BGJA 4Z4UA 4CQJA 2JDIA 2EIXA 3G4SB 2OK8A 2V7TA 4P6YA 1YI2B 2ZBUA 4GQNA 2CC2A 2B7CA 3BNWA 1DDIA 4N3NA 3CW2A 1B23P 1QFZA 1GAWA 2XNCA 1UD8A 1K8AD 1VQOB 1QUFA 2BSAA 4XN3A 4YEJA 1YX2A 1VQMB 3I55B 3CMAB 1W87A 3Q39A 1ZUNB 1CNEA 1ZM4A 1IJFA 1SKYB 4B3GA 2WJYA 2WJVA 2ZZFA 4WWVA 3OZWA 3SKBA 1AIPA 3QSYA 3CPXA 3OFNA 3PA2A 3U2QA 1KK1A 3A1PA 4WZEA 1QGZA 3B78A 4XKVA 3BCFA 2CW5A 3ZZ0A 1SM4A 4XQFA 1DDGA 5HXBA 3ASPA 1R5BA 3ASSA 5IK2A 4QUZA 1H8EA 3JQQA 1E63A 4DK1A 4X7DA 2Z6BD 3ZUGA 4XMYA 3E20A 1T5EA 1VQ9B 2C4TA 1NBMA 1PKVA 2WSSA 4XLFA 2XEXA 4TN1A 4PC7A 4YALA 3WBJA 3T56B 3G71B 2R9VA 1Q82D 5LMZA 4XLAA 3ASRA 2HDNB 4RPDA 4BPRA 5IYQA 1NRKA 2VBUA 4KKTA 4PABA 3BY1A 4AVZA 2GJPA 4YAWA 3WXMA 3VNVA 1KK2A 1VQ7B 1E79A 1XQBA 4ACBA 1BX1A 4II2A 1T6ZA 2Q6KA 1S4MA 4PAAA 2X8KA 3BC9A 2KVOA 1M1KD 3Q6RA 5IYPA 2GPJA 1QGYA 2VNKA 1FX0A 1B2RA 1WPCA 5F4JA 1RQRA 2DY1A 3W2IA 2V31A 2ZZEA 4C0SA 4DNRB 2BN4A 4P3IA 3CP2A 4QHYA 1SKQA 3OP1A 3RY8A 3VNUA 1V5VA 4UZUA 1N06A 2V7WA 2OBRA 1W35A 2X6YA 4X07A 5BSYA 4P25A 4XLEA 3CC7B 1ZM9A 3CC2B 4AC9A 1M90D 1H42A 2VNJA 1E3XA 3GVKA 2GQFA 1WDTA 1VLYA 1HA3A 1WORA 4M0LA 1I8DA 4DNTB 4QVAA 2ZBVA 1GJRA 3OE7A 1YLOA 3VO1A 3SJZA 5KSWB 4ZCLA 3CD6B 2AHOA 1Q81D 2X85A 4N3GA 2ZL7A 3WY9A 5HZBA 2E1BA 4RDKA 1H8HA 4MYUA 1Q86D 1OB5A 3WYAA 4LBVA 5KNLA 5IYWA 4RPBA 3B8HA 1BMFA 1FRQA 4XNFA 4J0QA 4Y9RA 1R5NA 1VQ8B 3W2GA 1XB2A 1EP3B 1UD4A 2VBSA 2XOKA 1HVXA 5A88A 4FWTA 1JNYA 2BV3A 1VQ6B 4RD6A 4RJLA 1DARA 3CTAA 3ZZUA 4DQKA 4HIZA 5F4MA 1GVHA 1EFCA 4Z4RA 3CXCB 2QTLA 3ZZTA 5FIUA 5A89A 2CRVA 5CDFA 4M1KA 2XZPA 3ONUA 1OB2A 2VJJA 2JIZA 2WPDA 2C77A 4OOXA 5J3OA 3ASTA 1WU8A 1VLOA 2CNDA 2VBVA 1WOPA 2V4DA 1N05A 3A3GA 3BH4A 4Z4YA 2DERA 1CNFA 3MHPA 4TMVA 4XORA 2F1LA 2J7KA 3CCRB 3AGQA 3H9NA 2DOGA 4QV2A 1RQPA 3WQZA 4KKUA 4XLHA 1TUIA 3KL9A 1W9XA 5F4OA 1BLIA 4ACAA 4XOPA 1VQ5B 2X3UA 5TV2A 4WZTA 2YWHA 3U6KA 3A3BA 4XKWA 3Q6QA 1KD1D 3AVYA 2GJKA 3CP8A 3P26A 4Z4SA 1COWA 1XFOA 4RLZA 3HAGA 3PUNA 4OOSA 5B6IA 3AVXA 1IB0A 4XL9A 4ZGNB 2V7UA 1ZM3A 3NE5B 3Q3AA 4XD7A 2DEUA 3AVVA 2BGIA 2V7VA 1E64A 2LZJA 2PLFA 3OW7A 4B48A 4KKSA 4K1XA 5FA6A 1E43A 1V0EA 1YIJB 1VQKB 5TRDA 3ZC3A 2OYNA 2WR8A 4B47A 3PVDA 1UD6A 1UD3A 1YJ9B 3BCDA 3CPWB 2ZZGA 2E1RA 3OAAA 2P3MA 4PC6A 4PGOA 4TMWA 2C5HA 4B3FX 2OTLB 1W34A 1VQPB 2C78A 1EWYA 1VQLB 1FRNA 2X53S 3KEWA 4MYTA 1K9MD 2W6IA 5TY0A 4TMXA 3FPKA 4UZEA 4AF6A 2YWGA 2JJ2A 3FKSA 4RD3A 1EFTA 1R5OA 3OEHA 4EH1A 3T53B 4Z4ZA 5JBQA 4X7CA 4IW3B 4Q7JB 4TT3A 1G7RA 1QGAA 5KW9A 3CMEB 1OGIA 1MABA 4P9SA 2GREA 3D26A 3W5HA 5DSZA 2JJ1A 3CCMB 4WZKA 4AF7A 4X0CA 4M53A 3AGPA 1YJNB 4P26A 1GAQA 4ZCIA 1PJ6A 3CCQB 1I7PA 1QFJA 3OKXA 5GV7A 4F7DA 2W6JA 5BSXA 4LBWA 3QE2A 3R6JA 1N07A 3CMMA 4UAJA 2C5BA 2WYRA 2ZZQA 3WNBA 4ZGQB 4XR6A 1G7SA 4NBSA 4X8IA 2BVNA 1YITB 3DDYA 1BPLA 4LC0A 4XLCA 5FNZA 4DQLA 4II3A 4G7XA 1G7CA 1VQNB 3V7AA 2BF4A 1FNBA 2X6WA 2DIEA 1Q7YD 5DN6A 5E6TA 3PA1A 2X0KA 2NPFA 1FNMA 1G7TA 1U2RA 1Y0RA 2C2WA 4G6IA 4RD1A 1EP1B 1N8RD 2D9RA 1IHMA 3OJWA 1N08A 2QEXB 1VQ4B 4P12A 4TSFA 1GR1A 3H94A 4NNJA 5GV8A 1NDHA 1S72B 4G1VA 1D8TA 2DETA 1NJID 1KZLA 3SLNA 4X06A 2CBXA 3I1FA 3ZBUA 4OOVA 3OJXA 4RD0A 1WP6A 1VJSA 4X05A 4PC2A 1OGJA 4P3YA 1AMOA 4NCNA 3LQEA 3W2EA 3ZBTA 1KRHA 4Z4VA 3CCLB 3CESA 4UZFA 3FJOA 4M2LA 4OPSA 4B4DA 2QA4B 2B5OA 3WBKA 3W5VA 1A8PA 3VMFA 3CRZA 4RDLA 4B43A 2QE7A 5H5JA 1TLLA 1UMKA 3PUMA 1K73D 1EXMA 4ZCMA 4FXUA 2D3NA 2DCUA 3G05A 4HE5A 1KC8D 4Z4WA 3ASQA 3W2FA 5J35A 3JQRA 1T6XA 2BM1A 4M4SA 1EFRA 1QUEA 1VF7A 4LBZA 2PIAA 2ZL5A 3BY2A 3GQBA 4B44A 2X6XA 1QH0A 2ZL6A 1K28D 3W2HA 1H85A 2D3LA 4WQMA 4X7FA 1GO2A 4Y7CA 5FO0A 2FVGA 1MRZA 1QVGB 2YWFA 3ZIAA 4TKOB 3V76A 2ZXIA 1F60A 1JA0A 3FPPA 2CK3A 2Q6IA 3SEJA 1QX4A 2ZTNA 4RCZA 1N0UA 3QFCA 2F4NA 5HKKA 2VNIA 1QG0A 4PC1A 1D1NA 4OPOA 1FNDA 4B3XA 1PJ7A 3P27A 3A8KA 1BX0A 2RC6A 4FN5A 1Y0YA 4WZLA 1E1RA 3VR6A 2VZLA 3I56B 3OW2B 1Q9SA 2PMDA 2ZITA 4FK8A 1YHQB 3MMPA 2QMUA 4G7WA 5TR9A 2I1LA 4OP7A 5A8AA 3W5UA 2V7XA 2QDXA 1NB0A 4ZV4A 3SLDA 3OEEA 2HCJB 3WNDA 2OBSA
chains in the Genus database with same CATH topology
4X7EA 5BSXA 3R6JA 5F4MA 4Z4RA 4P2NA 4ROXA 3Q39A 3R6KA 3V7AA 3ONUA 5E6TA 4OOXA 3PA1A 5J3OA 3ASTA 3SKBA 4P1VA 3PA2A 1IHMA 4WZEA 4P12A 4Z4UA 4Z4YA 5HZAA 4QVJA 3ONYA 4QV2A 3SLNA 4X06A 4OOVA 5F4OA 3ASPA 3ASSA 4QUZA 4WZTA 4X05A 4RM0A 3LQ6A 4X7DA 3Q6QA 3LQEA 5IYRA 4Z4SA 4Z4VA 4RLZA 4OPSA 3PUNA 4OOSA 3ASRA 4RPDA 3Q3AA 5IYQA 4RDLA 3PUMA 3SJPA 3BY1A 4Z4WA 3ASQA 5J35A 3Q6RA 5IYPA 5F4JA 3PVDA 3BY2A 2ZL5A 4P3IA 2ZL6A 3RY8A 2OBRA 4X07A 4X7FA 5BSYA 4P25A 5IYNA 3SEJA 4RDJA 4QVAA 4OPVA 3Q38A 4OPOA 4Z4ZA 4X7CA 5KW9A 2ZL7A 5HZBA 4WZLA 4RDKA 3D26A 4Z4TA 3BQJA 5IYWA 4RPBA 4OP7A 4WZKA 2OBTA 4X0CA 3SLDA 4P26A 2OBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X7E A;  5BSX A;  3R6J A;  5F4M A;  4Z4R A;  4P2N A;  4ROX A;  3Q39 A;  3R6K A;  3V7A A;  3ONU A;  5E6T A;  4OOX A;  3PA1 A;  5J3O A;  3AST A;  3SKB A;  4P1V A;  3PA2 A;  1IHM A;  4WZE A;  4P12 A;  4Z4U A;  4Z4Y A;  5HZA A;  4QVJ A;  3ONY A;  4QV2 A;  3SLN A;  4X06 A;  4OOV A;  5F4O A;  3ASP A;  3ASS A;  4QUZ A;  4WZT A;  4X05 A;  4RM0 A;  3LQ6 A;  4X7D A;  3Q6Q A;  3LQE A;  5IYR A;  4Z4S A;  4Z4V A;  4RLZ A;  4OPS A;  3PUN A;  4OOS A;  3ASR A;  4RPD A;  3Q3A A;  5IYQ A;  4RDL A;  3PUM A;  3SJP A;  3BY1 A;  4Z4W A;  3ASQ A;  5J35 A;  3Q6R A;  5IYP A;  5F4J A;  3PVD A;  3BY2 A;  2ZL5 A;  4P3I A;  2ZL6 A;  3RY8 A;  2OBR A;  4X07 A;  4X7F A;  5BSY A;  4P25 A;  5IYN A;  3SEJ A;  4RDJ A;  4QVA A;  4OPV A;  3Q38 A;  4OPO A;  4Z4Z A;  4X7C A;  5KW9 A;  2ZL7 A;  5HZB A;  4WZL A;  4RDK A;  3D26 A;  4Z4T A;  3BQJ A;  5IYW A;  4RPB A;  4OP7 A;  4WZK A;  2OBT A;  4X0C A;  3SLD A;  4P26 A;  2OBS A; 
#chains in the Genus database with same CATH topology
 2B7B A;  1DG1 G;  4YEL A;  1FNC A;  3OOC A;  3OZV A;  4QFM A;  2BPO A;  4X7E A;  3CCE B;  1YJW B;  3GSI A;  2DYI A;  1W0J A;  1ELO A;  4RD2 A;  4XON A;  3CB4 A;  1UD2 A;  5FO1 A;  2NV4 A;  1JB9 A;  4P2N A;  2PE3 A;  1S0U A;  1WSV A;  1J9Z A;  3AVU A;  4ROX A;  1D2E A;  3PEN A;  1KK0 A;  3R6K A;  5EMN A;  3CCJ B;  4YAU A;  1KMH A;  4H9G A;  4YAO A;  1F20 A;  3A8J A;  3B82 A;  2OTJ B;  2QN6 A;  4P1V A;  2HLD A;  2GK7 A;  1E62 A;  3GVJ A;  1WOO A;  1N0V C;  2CF4 A;  4YHB A;  1QFY A;  3JQP A;  1VHO A;  4P22 A;  2D74 A;  3ISX A;  5HZA A;  4QVJ A;  1V0F A;  3AVT A;  1P4M A;  3ONY A;  4E0F A;  4R71 A;  1KJZ A;  3G6E B;  3CCU B;  1JA1 A;  1BJK A;  1NB9 A;  3GIR A;  2EFG A;  4RM0 A;  1KK3 A;  3VO2 A;  1KQS B;  3LQ6 A;  1WSR A;  1TVC A;  2M5S A;  4XM3 A;  1IJE A;  5IYR A;  2R6H A;  2GK6 A;  4G1B A;  3ES9 A;  2Q6O A;  2V7Q A;  2VNH A;  3LO8 A;  4YAF A;  3MCA A;  2YWE A;  2ZTG A;  5THX A;  1E1Q A;  2RC5 A;  3LVB A;  4PC3 A;  3SJP A;  1UD5 A;  3ZPN A;  5AN9 A;  4TMZ A;  4XOT A;  1W2B B;  1T6Y A;  1JJ2 B;  1ZM2 A;  3LNN A;  2XZL A;  2Q6L A;  4JMQ A;  2WZP P;  4Y9U A;  3A35 A;  1W0K A;  5L46 A;  3GVL A;  2FX3 A;  3E1Y E;  4Z1M A;  1KTV A;  2HMA A;  2F43 A;  2JN9 A;  2VJI A;  3U6B A;  1I18 A;  5FL7 A;  1HZE A;  2ZXH A;  1PJ5 A;  2QTZ A;  3OZU A;  2XNJ A;  2VBT A;  2WZN A;  3QFS A;  4LBY A;  5IYN A;  5H59 A;  2GJR A;  4RD4 A;  3WNC A;  4RDJ A;  1XE1 A;  3CC4 B;  1E3Z A;  4P6V F;  4YXW A;  4XN0 A;  2XND A;  1WOS A;  5DS0 A;  4G5G A;  2BMW A;  2VYQ A;  4TMT A;  4U9U A;  3J81 k;  3CCS B;  4OPV A;  2XGJ A;  4RCY A;  1WTH D;  2BM0 A;  3AVW A;  3Q38 A;  4L8J A;  3QFT A;  4DK0 A;  1BQE A;  4ASU A;  2XZO A;  3A8I A;  1TTT A;  1FDR A;  3OPO A;  3QFR A;  1EP2 B;  3JU4 A;  2OK7 A;  4Z4T A;  1OHH A;  4HE6 A;  3T51 B;  1VHE A;  3CCV B;  2C4U A;  1QVF B;  1EFU A;  3BQJ A;  2QGG A;  1CQX A;  2OBT A;  1OB0 A;  2F1M A;  4C43 A;  2BGJ A;  4Z4U A;  4CQJ A;  2JDI A;  2EIX A;  3G4S B;  2OK8 A;  2V7T A;  4P6Y A;  1YI2 B;  2ZBU A;  4GQN A;  2CC2 A;  2B7C A;  3BNW A;  1DDI A;  4N3N A;  3CW2 A;  1B23 P;  1QFZ A;  1GAW A;  2XNC A;  1UD8 A;  1K8A D;  1VQO B;  1QUF A;  2BSA A;  4XN3 A;  4YEJ A;  1YX2 A;  1VQM B;  3I55 B;  3CMA B;  1W87 A;  3Q39 A;  1ZUN B;  1CNE A;  1ZM4 A;  1IJF A;  1SKY B;  4B3G A;  2WJY A;  2WJV A;  2ZZF A;  4WWV A;  3OZW A;  3SKB A;  1AIP A;  3QSY A;  3CPX A;  3OFN A;  3PA2 A;  3U2Q A;  1KK1 A;  3A1P A;  4WZE A;  1QGZ A;  3B78 A;  4XKV A;  3BCF A;  2CW5 A;  3ZZ0 A;  1SM4 A;  4XQF A;  1DDG A;  5HXB A;  3ASP A;  1R5B A;  3ASS A;  5IK2 A;  4QUZ A;  1H8E A;  3JQQ A;  1E63 A;  4DK1 A;  4X7D A;  2Z6B D;  3ZUG A;  4XMY A;  3E20 A;  1T5E A;  1VQ9 B;  2C4T A;  1NBM A;  1PKV A;  2WSS A;  4XLF A;  2XEX A;  4TN1 A;  4PC7 A;  4YAL A;  3WBJ A;  3T56 B;  3G71 B;  2R9V A;  1Q82 D;  5LMZ A;  4XLA A;  3ASR A;  2HDN B;  4RPD A;  4BPR A;  5IYQ A;  1NRK A;  2VBU A;  4KKT A;  4PAB A;  3BY1 A;  4AVZ A;  2GJP A;  4YAW A;  3WXM A;  3VNV A;  1KK2 A;  1VQ7 B;  1E79 A;  1XQB A;  4ACB A;  1BX1 A;  4II2 A;  1T6Z A;  2Q6K A;  1S4M A;  4PAA A;  2X8K A;  3BC9 A;  2KVO A;  1M1K D;  3Q6R A;  5IYP A;  2GPJ A;  1QGY A;  2VNK A;  1FX0 A;  1B2R A;  1WPC A;  5F4J A;  1RQR A;  2DY1 A;  3W2I A;  2V31 A;  2ZZE A;  4C0S A;  4DNR B;  2BN4 A;  4P3I A;  3CP2 A;  4QHY A;  1SKQ A;  3OP1 A;  3RY8 A;  3VNU A;  1V5V A;  4UZU A;  1N06 A;  2V7W A;  2OBR A;  1W35 A;  2X6Y A;  4X07 A;  5BSY A;  4P25 A;  4XLE A;  3CC7 B;  1ZM9 A;  3CC2 B;  4AC9 A;  1M90 D;  1H42 A;  2VNJ A;  1E3X A;  3GVK A;  2GQF A;  1WDT A;  1VLY A;  1HA3 A;  1WOR A;  4M0L A;  1I8D A;  4DNT B;  4QVA A;  2ZBV A;  1GJR A;  3OE7 A;  1YLO A;  3VO1 A;  3SJZ A;  5KSW B;  4ZCL A;  3CD6 B;  2AHO A;  1Q81 D;  2X85 A;  4N3G A;  2ZL7 A;  3WY9 A;  5HZB A;  2E1B A;  4RDK A;  1H8H A;  4MYU A;  1Q86 D;  1OB5 A;  3WYA A;  4LBV A;  5KNL A;  5IYW A;  4RPB A;  3B8H A;  1BMF A;  1FRQ A;  4XNF A;  4J0Q A;  4Y9R A;  1R5N A;  1VQ8 B;  3W2G A;  1XB2 A;  1EP3 B;  1UD4 A;  2VBS A;  2XOK A;  1HVX A;  5A88 A;  4FWT A;  1JNY A;  2BV3 A;  1VQ6 B;  4RD6 A;  4RJL A;  1DAR A;  3CTA A;  3ZZU A;  4DQK A;  4HIZ A;  5F4M A;  1GVH A;  1EFC A;  4Z4R A;  3CXC B;  2QTL A;  3ZZT A;  5FIU A;  5A89 A;  2CRV A;  5CDF A;  4M1K A;  2XZP A;  3ONU A;  1OB2 A;  2VJJ A;  2JIZ A;  2WPD A;  2C77 A;  4OOX A;  5J3O A;  3AST A;  1WU8 A;  1VLO A;  2CND A;  2VBV A;  1WOP A;  2V4D A;  1N05 A;  3A3G A;  3BH4 A;  4Z4Y A;  2DER A;  1CNF A;  3MHP A;  4TMV A;  4XOR A;  2F1L A;  2J7K A;  3CCR B;  3AGQ A;  3H9N A;  2DOG A;  4QV2 A;  1RQP A;  3WQZ A;  4KKU A;  4XLH A;  1TUI A;  3KL9 A;  1W9X A;  5F4O A;  1BLI A;  4ACA A;  4XOP A;  1VQ5 B;  2X3U A;  5TV2 A;  4WZT A;  2YWH A;  3U6K A;  3A3B A;  4XKW A;  3Q6Q A;  1KD1 D;  3AVY A;  2GJK A;  3CP8 A;  3P26 A;  4Z4S A;  1COW A;  1XFO A;  4RLZ A;  3HAG A;  3PUN A;  4OOS A;  5B6I A;  3AVX A;  1IB0 A;  4XL9 A;  4ZGN B;  2V7U A;  1ZM3 A;  3NE5 B;  3Q3A A;  4XD7 A;  2DEU A;  3AVV A;  2BGI A;  2V7V A;  1E64 A;  2LZJ A;  2PLF A;  3OW7 A;  4B48 A;  4KKS A;  4K1X A;  5FA6 A;  1E43 A;  1V0E A;  1YIJ B;  1VQK B;  5TRD A;  3ZC3 A;  2OYN A;  2WR8 A;  4B47 A;  3PVD A;  1UD6 A;  1UD3 A;  1YJ9 B;  3BCD A;  3CPW B;  2ZZG A;  2E1R A;  3OAA A;  2P3M A;  4PC6 A;  4PGO A;  4TMW A;  2C5H A;  4B3F X;  2OTL B;  1W34 A;  1VQP B;  2C78 A;  1EWY A;  1VQL B;  1FRN A;  2X53 S;  3KEW A;  4MYT A;  1K9M D;  2W6I A;  5TY0 A;  4TMX A;  3FPK A;  4UZE A;  4AF6 A;  2YWG A;  2JJ2 A;  3FKS A;  4RD3 A;  1EFT A;  1R5O A;  3OEH A;  4EH1 A;  3T53 B;  4Z4Z A;  5JBQ A;  4X7C A;  4IW3 B;  4Q7J B;  4TT3 A;  1G7R A;  1QGA A;  5KW9 A;  3CME B;  1OGI A;  1MAB A;  4P9S A;  2GRE A;  3D26 A;  3W5H A;  5DSZ A;  2JJ1 A;  3CCM B;  4WZK A;  4AF7 A;  4X0C A;  4M53 A;  3AGP A;  1YJN B;  4P26 A;  1GAQ A;  4ZCI A;  1PJ6 A;  3CCQ B;  1I7P A;  1QFJ A;  3OKX A;  5GV7 A;  4F7D A;  2W6J A;  5BSX A;  4LBW A;  3QE2 A;  3R6J A;  1N07 A;  3CMM A;  4UAJ A;  2C5B A;  2WYR A;  2ZZQ A;  3WNB A;  4ZGQ B;  4XR6 A;  1G7S A;  4NBS A;  4X8I A;  2BVN A;  1YIT B;  3DDY A;  1BPL A;  4LC0 A;  4XLC A;  5FNZ A;  4DQL A;  4II3 A;  4G7X A;  1G7C A;  1VQN B;  3V7A A;  2BF4 A;  1FNB A;  2X6W A;  2DIE A;  1Q7Y D;  5DN6 A;  5E6T A;  3PA1 A;  2X0K A;  2NPF A;  1FNM A;  1G7T A;  1U2R A;  1Y0R A;  2C2W A;  4G6I A;  4RD1 A;  1EP1 B;  1N8R D;  2D9R A;  1IHM A;  3OJW A;  1N08 A;  2QEX B;  1VQ4 B;  4P12 A;  4TSF A;  1GR1 A;  3H94 A;  4NNJ A;  5GV8 A;  1NDH A;  1S72 B;  4G1V A;  1D8T A;  2DET A;  1NJI D;  1KZL A;  3SLN A;  4X06 A;  2CBX A;  3I1F A;  3ZBU A;  4OOV A;  3OJX A;  4RD0 A;  1WP6 A;  1VJS A;  4X05 A;  4PC2 A;  1OGJ A;  4P3Y A;  1AMO A;  4NCN A;  3LQE A;  3W2E A;  3ZBT A;  1KRH A;  4Z4V A;  3CCL B;  3CES A;  4UZF A;  3FJO A;  4M2L A;  4OPS A;  4B4D A;  2QA4 B;  2B5O A;  3WBK A;  3W5V A;  1A8P A;  3VMF A;  3CRZ A;  4RDL A;  4B43 A;  2QE7 A;  5H5J A;  1TLL A;  1UMK A;  3PUM A;  1K73 D;  1EXM A;  4ZCM A;  4FXU A;  2D3N A;  2DCU A;  3G05 A;  4HE5 A;  1KC8 D;  4Z4W A;  3ASQ A;  3W2F A;  5J35 A;  3JQR A;  1T6X A;  2BM1 A;  4M4S A;  1EFR A;  1QUE A;  1VF7 A;  4LBZ A;  2PIA A;  2ZL5 A;  3BY2 A;  3GQB A;  4B44 A;  2X6X A;  1QH0 A;  2ZL6 A;  1K28 D;  3W2H A;  1H85 A;  2D3L A;  4WQM A;  4X7F A;  1GO2 A;  4Y7C A;  5FO0 A;  2FVG A;  1MRZ A;  1QVG B;  2YWF A;  3ZIA A;  4TKO B;  3V76 A;  2ZXI A;  1F60 A;  1JA0 A;  3FPP A;  2CK3 A;  2Q6I A;  3SEJ A;  1QX4 A;  2ZTN A;  4RCZ A;  1N0U A;  3QFC A;  2F4N A;  5HKK A;  2VNI A;  1QG0 A;  4PC1 A;  1D1N A;  4OPO A;  1FND A;  4B3X A;  1PJ7 A;  3P27 A;  3A8K A;  1BX0 A;  2RC6 A;  4FN5 A;  1Y0Y A;  4WZL A;  1E1R A;  3VR6 A;  2VZL A;  3I56 B;  3OW2 B;  1Q9S A;  2PMD A;  2ZIT A;  4FK8 A;  1YHQ B;  3MMP A;  2QMU A;  4G7W A;  5TR9 A;  2I1L A;  4OP7 A;  5A8A A;  3W5U A;  2V7X A;  2QDX A;  1NB0 A;  4ZV4 A;  3SLD A;  3OEE A;  2HCJ B;  3WND A;  2OBS A; 
#chains in the Genus database with same CATH homology
 4X7E A;  5BSX A;  3R6J A;  5F4M A;  4Z4R A;  4P2N A;  4ROX A;  3Q39 A;  3R6K A;  3V7A A;  3ONU A;  5E6T A;  4OOX A;  3PA1 A;  5J3O A;  3AST A;  3SKB A;  4P1V A;  3PA2 A;  1IHM A;  4WZE A;  4P12 A;  4Z4U A;  4Z4Y A;  5HZA A;  4QVJ A;  3ONY A;  4QV2 A;  3SLN A;  4X06 A;  4OOV A;  5F4O A;  3ASP A;  3ASS A;  4QUZ A;  4WZT A;  4X05 A;  4RM0 A;  3LQ6 A;  4X7D A;  3Q6Q A;  3LQE A;  5IYR A;  4Z4S A;  4Z4V A;  4RLZ A;  4OPS A;  3PUN A;  4OOS A;  3ASR A;  4RPD A;  3Q3A A;  5IYQ A;  4RDL A;  3PUM A;  3SJP A;  3BY1 A;  4Z4W A;  3ASQ A;  5J35 A;  3Q6R A;  5IYP A;  5F4J A;  3PVD A;  3BY2 A;  2ZL5 A;  4P3I A;  2ZL6 A;  3RY8 A;  2OBR A;  4X07 A;  4X7F A;  5BSY A;  4P25 A;  5IYN A;  3SEJ A;  4RDJ A;  4QVA A;  4OPV A;  3Q38 A;  4OPO A;  4Z4Z A;  4X7C A;  5KW9 A;  2ZL7 A;  5HZB A;  4WZL A;  4RDK A;  3D26 A;  4Z4T A;  3BQJ A;  5IYW A;  4RPB A;  4OP7 A;  4WZK A;  2OBT A;  4X0C A;  3SLD A;  4P26 A;  2OBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...