3D26A

Norwalk p domain a-trisaccharide complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
287
structure length
284
Chain Sequence
PFTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSIATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGASSGPQQLPINGVFVFVSWVSRFYQLKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the receptor binding specificity of Norwalk virus.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
molecule keywords 58 kd capsid protein
total genus 60
structure length 284
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08435 Calici_coat_C Calicivirus coat protein C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3d26A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3d26A01
5F4JA 4WZTA 3Q39A 4OPVA 3Q3AA 4X05A 4Z4WA 4WZEA 3SLNA 2ZL6A 4RLZA 3D26A 3LQEA 3SEJA 4P26A 4RPBA 2OBRA 3R6KA 3ASSA 3Q6QA 3PA2A 3Q38A 3V7AA 3ONYA 4Z4UA 4RM0A 5IYPA 5F4OA 3SLDA 4P3IA 4X7DA 5IYWA 5KW9A 3ONUA 4QVAA 2OBSA 4P2NA 3BQJA 4RDJA 4OP7A 3BY1A 3ASPA 4QUZA 2OBTA 4RDLA 4Z4YA 1IHMA 3ASTA 4ROXA 5HZAA 4Z4ZA 5IYNA 2ZL5A 5J35A 3LQ6A 4P1VA 4Z4RA 4RPDA 4P25A 4X7EA 3PUNA 3ASQA 4X7CA 4QVJA 5IYRA 5J3OA 4QV2A 3R6JA 5HZBA 3SJPA 4OPOA 3RY8A 4Z4TA 4OPSA 4OOSA 4OOVA 5BSXA 4RDKA 4Z4VA 4WZKA 4OOXA 3ASRA 4X06A 5F4MA 4X7FA 3SKBA 3Q6RA 4WZLA 3BY2A 4P12A 5BSYA 5E6TA 3PA1A 4Z4SA 3PUMA 2ZL7A 3PVDA 4X0CA 5IYQA 4X07A
chains in the Genus database with same CATH superfamily
5F4JA 2YWHA 5A89A 4WZTA 2VNJA 2P3MA 4Z4WA 1QFJA 3AVYA 3G05A 1Q81D 1GJRA 2WJYA 4RLZA 1VQ5B 3BH4A 3GVLA 3LQEA 4M2LA 2W6JA 3OJWA 2WYRA 4RPBA 1VLYA 2X8KA 2V7TA 4PC3A 4WWVA 1OB0A 1KK2A 1B2RA 4HIZA 2WSSA 4LBVA 1N0UA 1VQOB 4AVZA 2VBUA 5IYPA 4ZGNB 1WSRA 4PAAA 2D9RA 1NJID 5AN9A 1D1NA 2X6WA 3A35A 3JQPA 3CCSB 5TR9A 5IK2A 2WZPP 2VJJA 4PC7A 2OBSA 4G6IA 4P2NA 4OP7A 1VHEA 2VBVA 1HZEA 2V31A 4PC2A 4B47A 4N3GA 3BY1A 2BV3A 2OBTA 2NV4A 4RDLA 1BPLA 1KZLA 1S4MA 3ASTA 4Z4YA 2HDNB 5IYNA 2ZL5A 2E1RA 5J35A 3CMAB 4P1VA 5A88A 1VQNB 2BN4A 2ZXIA 4RD0A 1H42A 3OKXA 2GK6A 4RPDA 1QH0A 1EXMA 4P25A 3OW7A 1T5EA 2DCUA 1EP2B 1MABA 3CPWB 1V0EA 3ASQA 3OFNA 4X7CA 4QVJA 1JA1A 5J3OA 1OGIA 3CCQB 3R6JA 5HZBA 2KVOA 4OPOA 4XONA 3U2QA 3BNWA 3T56B 2CF4A 5KSWB 3H94A 4NBSA 2CC2A 1ZM2A 1PJ7A 3G71B 1UD5A 1E43A 1JA0A 1NB9A 3W2HA 1R5OA 2LZJA 1COWA 2DEUA 5TRDA 3ISXA 2BGJA 4OOVA 1WSVA 3OJXA 5THXA 4Z4VA 2D3LA 1HVXA 4MYUA 3ASRA 1N0VC 1VHOA 2BPOA 2PMDA 4X06A 2F4NA 5F4MA 4X7FA 4XR6A 3SKBA 4F7DA 1GR1A 1RQPA 4ZCLA 2ZBVA 4YALA 3CC2B 3OEEA 3BY2A 4KKTA 2GJRA 1NRKA 2J7KA 2V7VA 3CRZA 1Y0YA 3G6EB 3QFRA 1UD2A 1W0KA 3PENA 4TT3A 1E3XA 4XMYA 1I18A 1OHHA 2NPFA 3MCAA 1FDRA 4Z4SA 3W2IA 4P9SA 4X0CA 5H59A 5IYQA 1E79A 3CMEB 4ZV4A 2VBTA 3OE7A 2QE7A 4PGOA 3T53B 2C77A 3B82A 5DS0A 1KC8D 1VQ9B 5TV2A 4X05A 3A8KA 3GVJA 4TMWA 1YHQB 4B3GA 1WU8A 1KD1D 4ASUA 2XEXA 1KQSB 5EMNA 1M90D 2RC6A 4HE5A 4XNFA 3AVUA 4IW3B 1GAQA 3VR6A 1EP3B 3SEJA 3A8IA 3NE5B 4RD6A 1T6YA 3Q6QA 3U6BA 3T51B 4HE6A 4ACBA 3FJOA 4XN3A 4XM3A 2Q6IA 1IB0A 2QDXA 3B8HA 4RM0A 2VZLA 2FVGA 1V5VA 4BPRA 1KK0A 1DDGA 1FX0A 4P3IA 3WXMA 4E0FA 3CC4B 1FRQA 1UMKA 1KRHA 1Q7YD 4QVAA 4KKUA 1VQ7B 1QGAA 1UD4A 3BC9A 3QFTA 4QHYA 2B5OA 1KK3A 1N06A 2ZZQA 2Q6LA 4QUZA 2Z6BD 5CDFA 3I56B 2JJ2A 1E3ZA 2C4UA 1WPCA 4UZEA 4P22A 4Z4ZA 1W9XA 5L46A 1N05A 2GJPA 3B78A 2BF4A 4XLFA 2QMUA 1FNMA 3CPXA 1N8RD 3OZVA 2HCJB 4PABA 2PIAA 3OPOA 1VQLB 3CCUB 1VQKB 3P27A 1YITB 3W5VA 3CB4A 5IYRA 2DYIA 1FNCA 1H8EA 4G1BA 3SJPA 3AVXA 4AF7A 3CCMB 3CCRB 2QN6A 1W34A 1BQEA 4GQNA 3MHPA 1E1RA 3WNCA 4B43A 3CCLB 1WORA 4PC6A 5KNLA 2VNIA 2FX3A 3ZBUA 3CXCB 2Q6KA 1D8TA 3GSIA 2JN9A 2QA4B 5TY0A 4RCZA 5JBQA 1VF7A 2GQFA 4FXUA 4TMZA 1QGYA 3CP8A 4YELA 1T6XA 5BSXA 4RDKA 3MMPA 2VNHA 1Q86D 4ZGQB 2EIXA 4AC9A 1UD3A 3OZWA 3G4SB 1CQXA 3WYAA 1R5NA 3AVTA 1QVFB 4R71A 4J0QA 4TKOB 2CK3A 1GVHA 4WZLA 3W2EA 3LO8A 1B23P 2HMAA 4P12A 4M4SA 5BSYA 2AHOA 1EFCA 1K8AD 1BX0A 4AF6A 1MRZA 3KEWA 1YI2B 1VQ8B 2BGIA 4B3FX 4EH1A 1XFOA 2V7QA 2JIZA 4LBYA 3AVVA 1D2EA 4K1XA 1YJ9B 2B7BA 1WOPA 3Q39A 2ZITA 3CP2A 4JMQA 1G7TA 1BX1A 3Q3AA 3VNVA 3SJZA 2BMWA 1WOSA 1AIPA 1G7CA 2WZNA 3E1YE 4RD2A 5GV7A 2JDIA 2DY1A 3SLNA 2R9VA 3ZIAA 4L8JA 1U2RA 1AMOA 2X3UA 3ZPNA 2F43A 3P26A 3I55B 4XOTA 1DG1G 1NB0A 1ZM4A 4QFMA 5FIUA 2OK8A 2W6IA 2QEXB 2D3NA 2M5SA 2WR8A 2VYQA 1EWYA 1BJKA 5DN6A 3CESA 4II2A 3ZBTA 3GIRA 1VJSA 3Q38A 2GK7A 1UD6A 5FO1A 1SM4A 1WTHD 1YLOA 1TLLA 3ONYA 1G7SA 2C78A 3QSYA 2I1LA 5F4OA 3SLDA 1XB2A 1XQBA 2HLDA 3WY9A 1N07A 4X7DA 1YIJB 3QFSA 5IYWA 3E20A 2ZXHA 3CCJB 2F1MA 1FRNA 3GVKA 2Q6OA 3ZC3A 1PJ5A 3CCVB 4XN0A 1EP1B 2DOGA 4XKVA 2YWEA 1XE1A 3OZUA 3WNDA 1K28D 3BQJA 4UZUA 3GQBA 1E1QA 2X85A 3I1FA 3JQQA 3W2GA 1VQMB 3CC7B 4P6YA 2CNDA 3J81k 4B4DA 2VNKA 2DETA 1IHMA 5HZAA 4DQLA 1NBMA 4XLAA 1UD8A 4TN1A 2YWGA 4XLEA 3CMMA 3VNUA 2OK7A 2GREA 4M0LA 4NNJA 4Z4RA 2PLFA 2WJVA 2X6XA 3A3GA 1KJZA 4XQFA 1PJ6A 4H9GA 3WBJA 1Q9SA 1V0FA 2BVNA 3FPKA 4RCYA 1S72B 1I7PA 4QV2A 2D74A 2XNJA 4DK0A 1KK1A 2XOKA 4YAOA 4Y9UA 3OP1A 2V4DA 2WPDA 3LVBA 3JQRA 4RD4A 2OYNA 1SKYB 2VBSA 1DDIA 4OPSA 2JJ1A 4TMXA 1F20A 2QTZA 2ZBUA 1M1KD 1WDTA 2F1LA 2BM1A 5LMZA 1G7RA 3AGPA 1JJ2B 5HKKA 4LC0A 1ELOA 4FN5A 2V7UA 4WZKA 4XLHA 4OOXA 1QFYA 2EFGA 4M1KA 5FA6A 2PE3A 1VQPB 1PKVA 2ZTGA 5FO0A 2XZPA 3CTAA 2B7CA 3Q6RA 2C2WA 3CD6B 1KTVA 1ZM3A 2V7WA 2ZTNA 1EFUA 1TUIA 1H85A 2V7XA 4TSFA 2XGJA 4G1VA 4TMTA 3CCEB 4YAUA 3QE2A 4YEJA 3PA1A 4RD1A 1TVCA 2ZL7A 1CNFA 1TTTA 1EFRA 4XOPA 1WP6A 1W87A 4X07A 4Y7CA 3U6KA 2R6HA 2BSAA 1K9MD 2QGGA 4LBZA 4DNRB 4OPVA 4Z1MA 4WZEA 2E1BA 5H5JA 2ZL6A 3ZZTA 3WQZA 2X53S 3D26A 3FKSA 1S0UA 2C5BA 1W35A 3ZUGA 2YWFA 4ACAA 1CNEA 4P26A 2OBRA 3R6KA 1RQRA 3ASSA 3VMFA 4DNTB 1F60A 3PA2A 4B3XA 1QG0A 2RC5A 1NDHA 1H8HA 1DARA 1BMFA 3OAAA 4FK8A 4P3YA 3V7AA 3W2FA 1OB5A 4Z4UA 1IJFA 2OTLB 3ES9A 1QUFA 1QVGB 1OGJA 1SKQA 3OOCA 4FWTA 4XD7A 4U9UA 1W2BB 3AVWA 2CW5A 1N08A 5B6IA 3QFCA 2X0KA 4KKSA 2ZZGA 5KW9A 2GPJA 3KL9A 3CW2A 2XNCA 3ONUA 4B48A 3JU4A 5DSZA 1IJEA 1QFZA 1BLIA 3OEHA 4RDJA 1KMHA 3LNNA 1VLOA 1Y0RA 1HA3A 3ASPA 1ZM9A 3BCDA 2XZOA 4XLCA 2C5HA 4DQKA 4ROXA 2C4TA 2GJKA 5FL7A 4MYTA 1WOOA 3LQ6A 1YX2A 3A8JA 1Q82D 4G7XA 1VQ4B 4II3A 4X7EA 3VO2A 2X6YA 4P6VF 4YXWA 3A3BA 4TMVA 2BM0A 1EFTA 3PUNA 4Y9RA 4DK1A 3WBKA 3V76A 3DDYA 3W5UA 4RJLA 2DERA 5A8AA 1E63A 1QX4A 1T6ZA 1ZUNB 1FNDA 3VO1A 1FNBA 4B44A 3ZZUA 4C43A 1YJWB 4XKWA 1GO2A 3RY8A 4G7WA 4ZCIA 4Z4TA 1QUEA 1K73D 5FNZA 4YAWA 1JB9A 4NCNA 4UAJA 4OOSA 3BCFA 4XL9A 1E62A 3W5HA 4RD3A 3A1PA 1I8DA 3AGQA 1JNYA 2CBXA 1W0JA 1J9ZA 4ZCMA 4N3NA 2QTLA 4C0SA 1R5BA 2CRVA 3H9NA 4WQMA 2OTJB 1QGZA 1P4MA 3HAGA 1E64A 2ZZEA 4PC1A 1OB2A 5GV8A 1GAWA 4XORA 2ZZFA 4X8IA 4G5GA 4CQJA 4M53A 5HXBA 5E6TA 3WNBA 1VQ6B 3FPPA 4YAFA 3ZZ0A 2DIEA 4Q7JB 4YHBA 3PUMA 4LBWA 3PVDA 3OW2B 2XZLA 1YJNB 1A8PA 4UZFA 2XNDA 2VJIA
chains in the Genus database with same CATH topology
5F4JA 4WZTA 3Q39A 4OPVA 3Q3AA 4X05A 4Z4WA 4WZEA 3SLNA 2ZL6A 4RLZA 3D26A 3LQEA 3SEJA 4P26A 4RPBA 2OBRA 3R6KA 3ASSA 3Q6QA 3PA2A 3Q38A 3V7AA 3ONYA 4Z4UA 4RM0A 5IYPA 5F4OA 3SLDA 4P3IA 4X7DA 5IYWA 5KW9A 3ONUA 4QVAA 2OBSA 4P2NA 3BQJA 4RDJA 4OP7A 3BY1A 3ASPA 4QUZA 2OBTA 4RDLA 4Z4YA 1IHMA 3ASTA 4ROXA 5HZAA 4Z4ZA 5IYNA 2ZL5A 5J35A 3LQ6A 4P1VA 4Z4RA 4RPDA 4P25A 4X7EA 3PUNA 3ASQA 4X7CA 4QVJA 5IYRA 5J3OA 4QV2A 3R6JA 5HZBA 3SJPA 4OPOA 3RY8A 4Z4TA 4OPSA 4OOSA 4OOVA 5BSXA 4RDKA 4Z4VA 4WZKA 4OOXA 3ASRA 4X06A 5F4MA 4X7FA 3SKBA 3Q6RA 4WZLA 3BY2A 4P12A 5BSYA 5E6TA 3PA1A 4Z4SA 3PUMA 2ZL7A 3PVDA 4X0CA 5IYQA 4X07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F4J A;  4WZT A;  3Q39 A;  4OPV A;  3Q3A A;  4X05 A;  4Z4W A;  4WZE A;  3SLN A;  2ZL6 A;  4RLZ A;  3D26 A;  3LQE A;  3SEJ A;  4P26 A;  4RPB A;  2OBR A;  3R6K A;  3ASS A;  3Q6Q A;  3PA2 A;  3Q38 A;  3V7A A;  3ONY A;  4Z4U A;  4RM0 A;  5IYP A;  5F4O A;  3SLD A;  4P3I A;  4X7D A;  5IYW A;  5KW9 A;  3ONU A;  4QVA A;  2OBS A;  4P2N A;  3BQJ A;  4RDJ A;  4OP7 A;  3BY1 A;  3ASP A;  4QUZ A;  2OBT A;  4RDL A;  4Z4Y A;  1IHM A;  3AST A;  4ROX A;  5HZA A;  4Z4Z A;  5IYN A;  2ZL5 A;  5J35 A;  3LQ6 A;  4P1V A;  4Z4R A;  4RPD A;  4P25 A;  4X7E A;  3PUN A;  3ASQ A;  4X7C A;  4QVJ A;  5IYR A;  5J3O A;  4QV2 A;  3R6J A;  5HZB A;  3SJP A;  4OPO A;  3RY8 A;  4Z4T A;  4OPS A;  4OOS A;  4OOV A;  5BSX A;  4RDK A;  4Z4V A;  4WZK A;  4OOX A;  3ASR A;  4X06 A;  5F4M A;  4X7F A;  3SKB A;  3Q6R A;  4WZL A;  3BY2 A;  4P12 A;  5BSY A;  5E6T A;  3PA1 A;  4Z4S A;  3PUM A;  2ZL7 A;  3PVD A;  4X0C A;  5IYQ A;  4X07 A; 
#chains in the Genus database with same CATH topology
 5F4J A;  2YWH A;  5A89 A;  4WZT A;  2VNJ A;  2P3M A;  4Z4W A;  1QFJ A;  3AVY A;  3G05 A;  1Q81 D;  1GJR A;  2WJY A;  4RLZ A;  1VQ5 B;  3BH4 A;  3GVL A;  3LQE A;  4M2L A;  2W6J A;  3OJW A;  2WYR A;  4RPB A;  1VLY A;  2X8K A;  2V7T A;  4PC3 A;  4WWV A;  1OB0 A;  1KK2 A;  1B2R A;  4HIZ A;  2WSS A;  4LBV A;  1N0U A;  1VQO B;  4AVZ A;  2VBU A;  5IYP A;  4ZGN B;  1WSR A;  4PAA A;  2D9R A;  1NJI D;  5AN9 A;  1D1N A;  2X6W A;  3A35 A;  3JQP A;  3CCS B;  5TR9 A;  5IK2 A;  2WZP P;  2VJJ A;  4PC7 A;  2OBS A;  4G6I A;  4P2N A;  4OP7 A;  1VHE A;  2VBV A;  1HZE A;  2V31 A;  4PC2 A;  4B47 A;  4N3G A;  3BY1 A;  2BV3 A;  2OBT A;  2NV4 A;  4RDL A;  1BPL A;  1KZL A;  1S4M A;  3AST A;  4Z4Y A;  2HDN B;  5IYN A;  2ZL5 A;  2E1R A;  5J35 A;  3CMA B;  4P1V A;  5A88 A;  1VQN B;  2BN4 A;  2ZXI A;  4RD0 A;  1H42 A;  3OKX A;  2GK6 A;  4RPD A;  1QH0 A;  1EXM A;  4P25 A;  3OW7 A;  1T5E A;  2DCU A;  1EP2 B;  1MAB A;  3CPW B;  1V0E A;  3ASQ A;  3OFN A;  4X7C A;  4QVJ A;  1JA1 A;  5J3O A;  1OGI A;  3CCQ B;  3R6J A;  5HZB A;  2KVO A;  4OPO A;  4XON A;  3U2Q A;  3BNW A;  3T56 B;  2CF4 A;  5KSW B;  3H94 A;  4NBS A;  2CC2 A;  1ZM2 A;  1PJ7 A;  3G71 B;  1UD5 A;  1E43 A;  1JA0 A;  1NB9 A;  3W2H A;  1R5O A;  2LZJ A;  1COW A;  2DEU A;  5TRD A;  3ISX A;  2BGJ A;  4OOV A;  1WSV A;  3OJX A;  5THX A;  4Z4V A;  2D3L A;  1HVX A;  4MYU A;  3ASR A;  1N0V C;  1VHO A;  2BPO A;  2PMD A;  4X06 A;  2F4N A;  5F4M A;  4X7F A;  4XR6 A;  3SKB A;  4F7D A;  1GR1 A;  1RQP A;  4ZCL A;  2ZBV A;  4YAL A;  3CC2 B;  3OEE A;  3BY2 A;  4KKT A;  2GJR A;  1NRK A;  2J7K A;  2V7V A;  3CRZ A;  1Y0Y A;  3G6E B;  3QFR A;  1UD2 A;  1W0K A;  3PEN A;  4TT3 A;  1E3X A;  4XMY A;  1I18 A;  1OHH A;  2NPF A;  3MCA A;  1FDR A;  4Z4S A;  3W2I A;  4P9S A;  4X0C A;  5H59 A;  5IYQ A;  1E79 A;  3CME B;  4ZV4 A;  2VBT A;  3OE7 A;  2QE7 A;  4PGO A;  3T53 B;  2C77 A;  3B82 A;  5DS0 A;  1KC8 D;  1VQ9 B;  5TV2 A;  4X05 A;  3A8K A;  3GVJ A;  4TMW A;  1YHQ B;  4B3G A;  1WU8 A;  1KD1 D;  4ASU A;  2XEX A;  1KQS B;  5EMN A;  1M90 D;  2RC6 A;  4HE5 A;  4XNF A;  3AVU A;  4IW3 B;  1GAQ A;  3VR6 A;  1EP3 B;  3SEJ A;  3A8I A;  3NE5 B;  4RD6 A;  1T6Y A;  3Q6Q A;  3U6B A;  3T51 B;  4HE6 A;  4ACB A;  3FJO A;  4XN3 A;  4XM3 A;  2Q6I A;  1IB0 A;  2QDX A;  3B8H A;  4RM0 A;  2VZL A;  2FVG A;  1V5V A;  4BPR A;  1KK0 A;  1DDG A;  1FX0 A;  4P3I A;  3WXM A;  4E0F A;  3CC4 B;  1FRQ A;  1UMK A;  1KRH A;  1Q7Y D;  4QVA A;  4KKU A;  1VQ7 B;  1QGA A;  1UD4 A;  3BC9 A;  3QFT A;  4QHY A;  2B5O A;  1KK3 A;  1N06 A;  2ZZQ A;  2Q6L A;  4QUZ A;  2Z6B D;  5CDF A;  3I56 B;  2JJ2 A;  1E3Z A;  2C4U A;  1WPC A;  4UZE A;  4P22 A;  4Z4Z A;  1W9X A;  5L46 A;  1N05 A;  2GJP A;  3B78 A;  2BF4 A;  4XLF A;  2QMU A;  1FNM A;  3CPX A;  1N8R D;  3OZV A;  2HCJ B;  4PAB A;  2PIA A;  3OPO A;  1VQL B;  3CCU B;  1VQK B;  3P27 A;  1YIT B;  3W5V A;  3CB4 A;  5IYR A;  2DYI A;  1FNC A;  1H8E A;  4G1B A;  3SJP A;  3AVX A;  4AF7 A;  3CCM B;  3CCR B;  2QN6 A;  1W34 A;  1BQE A;  4GQN A;  3MHP A;  1E1R A;  3WNC A;  4B43 A;  3CCL B;  1WOR A;  4PC6 A;  5KNL A;  2VNI A;  2FX3 A;  3ZBU A;  3CXC B;  2Q6K A;  1D8T A;  3GSI A;  2JN9 A;  2QA4 B;  5TY0 A;  4RCZ A;  5JBQ A;  1VF7 A;  2GQF A;  4FXU A;  4TMZ A;  1QGY A;  3CP8 A;  4YEL A;  1T6X A;  5BSX A;  4RDK A;  3MMP A;  2VNH A;  1Q86 D;  4ZGQ B;  2EIX A;  4AC9 A;  1UD3 A;  3OZW A;  3G4S B;  1CQX A;  3WYA A;  1R5N A;  3AVT A;  1QVF B;  4R71 A;  4J0Q A;  4TKO B;  2CK3 A;  1GVH A;  4WZL A;  3W2E A;  3LO8 A;  1B23 P;  2HMA A;  4P12 A;  4M4S A;  5BSY A;  2AHO A;  1EFC A;  1K8A D;  1BX0 A;  4AF6 A;  1MRZ A;  3KEW A;  1YI2 B;  1VQ8 B;  2BGI A;  4B3F X;  4EH1 A;  1XFO A;  2V7Q A;  2JIZ A;  4LBY A;  3AVV A;  1D2E A;  4K1X A;  1YJ9 B;  2B7B A;  1WOP A;  3Q39 A;  2ZIT A;  3CP2 A;  4JMQ A;  1G7T A;  1BX1 A;  3Q3A A;  3VNV A;  3SJZ A;  2BMW A;  1WOS A;  1AIP A;  1G7C A;  2WZN A;  3E1Y E;  4RD2 A;  5GV7 A;  2JDI A;  2DY1 A;  3SLN A;  2R9V A;  3ZIA A;  4L8J A;  1U2R A;  1AMO A;  2X3U A;  3ZPN A;  2F43 A;  3P26 A;  3I55 B;  4XOT A;  1DG1 G;  1NB0 A;  1ZM4 A;  4QFM A;  5FIU A;  2OK8 A;  2W6I A;  2QEX B;  2D3N A;  2M5S A;  2WR8 A;  2VYQ A;  1EWY A;  1BJK A;  5DN6 A;  3CES A;  4II2 A;  3ZBT A;  3GIR A;  1VJS A;  3Q38 A;  2GK7 A;  1UD6 A;  5FO1 A;  1SM4 A;  1WTH D;  1YLO A;  1TLL A;  3ONY A;  1G7S A;  2C78 A;  3QSY A;  2I1L A;  5F4O A;  3SLD A;  1XB2 A;  1XQB A;  2HLD A;  3WY9 A;  1N07 A;  4X7D A;  1YIJ B;  3QFS A;  5IYW A;  3E20 A;  2ZXH A;  3CCJ B;  2F1M A;  1FRN A;  3GVK A;  2Q6O A;  3ZC3 A;  1PJ5 A;  3CCV B;  4XN0 A;  1EP1 B;  2DOG A;  4XKV A;  2YWE A;  1XE1 A;  3OZU A;  3WND A;  1K28 D;  3BQJ A;  4UZU A;  3GQB A;  1E1Q A;  2X85 A;  3I1F A;  3JQQ A;  3W2G A;  1VQM B;  3CC7 B;  4P6Y A;  2CND A;  3J81 k;  4B4D A;  2VNK A;  2DET A;  1IHM A;  5HZA A;  4DQL A;  1NBM A;  4XLA A;  1UD8 A;  4TN1 A;  2YWG A;  4XLE A;  3CMM A;  3VNU A;  2OK7 A;  2GRE A;  4M0L A;  4NNJ A;  4Z4R A;  2PLF A;  2WJV A;  2X6X A;  3A3G A;  1KJZ A;  4XQF A;  1PJ6 A;  4H9G A;  3WBJ A;  1Q9S A;  1V0F A;  2BVN A;  3FPK A;  4RCY A;  1S72 B;  1I7P A;  4QV2 A;  2D74 A;  2XNJ A;  4DK0 A;  1KK1 A;  2XOK A;  4YAO A;  4Y9U A;  3OP1 A;  2V4D A;  2WPD A;  3LVB A;  3JQR A;  4RD4 A;  2OYN A;  1SKY B;  2VBS A;  1DDI A;  4OPS A;  2JJ1 A;  4TMX A;  1F20 A;  2QTZ A;  2ZBU A;  1M1K D;  1WDT A;  2F1L A;  2BM1 A;  5LMZ A;  1G7R A;  3AGP A;  1JJ2 B;  5HKK A;  4LC0 A;  1ELO A;  4FN5 A;  2V7U A;  4WZK A;  4XLH A;  4OOX A;  1QFY A;  2EFG A;  4M1K A;  5FA6 A;  2PE3 A;  1VQP B;  1PKV A;  2ZTG A;  5FO0 A;  2XZP A;  3CTA A;  2B7C A;  3Q6R A;  2C2W A;  3CD6 B;  1KTV A;  1ZM3 A;  2V7W A;  2ZTN A;  1EFU A;  1TUI A;  1H85 A;  2V7X A;  4TSF A;  2XGJ A;  4G1V A;  4TMT A;  3CCE B;  4YAU A;  3QE2 A;  4YEJ A;  3PA1 A;  4RD1 A;  1TVC A;  2ZL7 A;  1CNF A;  1TTT A;  1EFR A;  4XOP A;  1WP6 A;  1W87 A;  4X07 A;  4Y7C A;  3U6K A;  2R6H A;  2BSA A;  1K9M D;  2QGG A;  4LBZ A;  4DNR B;  4OPV A;  4Z1M A;  4WZE A;  2E1B A;  5H5J A;  2ZL6 A;  3ZZT A;  3WQZ A;  2X53 S;  3D26 A;  3FKS A;  1S0U A;  2C5B A;  1W35 A;  3ZUG A;  2YWF A;  4ACA A;  1CNE A;  4P26 A;  2OBR A;  3R6K A;  1RQR A;  3ASS A;  3VMF A;  4DNT B;  1F60 A;  3PA2 A;  4B3X A;  1QG0 A;  2RC5 A;  1NDH A;  1H8H A;  1DAR A;  1BMF A;  3OAA A;  4FK8 A;  4P3Y A;  3V7A A;  3W2F A;  1OB5 A;  4Z4U A;  1IJF A;  2OTL B;  3ES9 A;  1QUF A;  1QVG B;  1OGJ A;  1SKQ A;  3OOC A;  4FWT A;  4XD7 A;  4U9U A;  1W2B B;  3AVW A;  2CW5 A;  1N08 A;  5B6I A;  3QFC A;  2X0K A;  4KKS A;  2ZZG A;  5KW9 A;  2GPJ A;  3KL9 A;  3CW2 A;  2XNC A;  3ONU A;  4B48 A;  3JU4 A;  5DSZ A;  1IJE A;  1QFZ A;  1BLI A;  3OEH A;  4RDJ A;  1KMH A;  3LNN A;  1VLO A;  1Y0R A;  1HA3 A;  3ASP A;  1ZM9 A;  3BCD A;  2XZO A;  4XLC A;  2C5H A;  4DQK A;  4ROX A;  2C4T A;  2GJK A;  5FL7 A;  4MYT A;  1WOO A;  3LQ6 A;  1YX2 A;  3A8J A;  1Q82 D;  4G7X A;  1VQ4 B;  4II3 A;  4X7E A;  3VO2 A;  2X6Y A;  4P6V F;  4YXW A;  3A3B A;  4TMV A;  2BM0 A;  1EFT A;  3PUN A;  4Y9R A;  4DK1 A;  3WBK A;  3V76 A;  3DDY A;  3W5U A;  4RJL A;  2DER A;  5A8A A;  1E63 A;  1QX4 A;  1T6Z A;  1ZUN B;  1FND A;  3VO1 A;  1FNB A;  4B44 A;  3ZZU A;  4C43 A;  1YJW B;  4XKW A;  1GO2 A;  3RY8 A;  4G7W A;  4ZCI A;  4Z4T A;  1QUE A;  1K73 D;  5FNZ A;  4YAW A;  1JB9 A;  4NCN A;  4UAJ A;  4OOS A;  3BCF A;  4XL9 A;  1E62 A;  3W5H A;  4RD3 A;  3A1P A;  1I8D A;  3AGQ A;  1JNY A;  2CBX A;  1W0J A;  1J9Z A;  4ZCM A;  4N3N A;  2QTL A;  4C0S A;  1R5B A;  2CRV A;  3H9N A;  4WQM A;  2OTJ B;  1QGZ A;  1P4M A;  3HAG A;  1E64 A;  2ZZE A;  4PC1 A;  1OB2 A;  5GV8 A;  1GAW A;  4XOR A;  2ZZF A;  4X8I A;  4G5G A;  4CQJ A;  4M53 A;  5HXB A;  5E6T A;  3WNB A;  1VQ6 B;  3FPP A;  4YAF A;  3ZZ0 A;  2DIE A;  4Q7J B;  4YHB A;  3PUM A;  4LBW A;  3PVD A;  3OW2 B;  2XZL A;  1YJN B;  1A8P A;  4UZF A;  2XND A;  2VJI A; 
#chains in the Genus database with same CATH homology
 5F4J A;  4WZT A;  3Q39 A;  4OPV A;  3Q3A A;  4X05 A;  4Z4W A;  4WZE A;  3SLN A;  2ZL6 A;  4RLZ A;  3D26 A;  3LQE A;  3SEJ A;  4P26 A;  4RPB A;  2OBR A;  3R6K A;  3ASS A;  3Q6Q A;  3PA2 A;  3Q38 A;  3V7A A;  3ONY A;  4Z4U A;  4RM0 A;  5IYP A;  5F4O A;  3SLD A;  4P3I A;  4X7D A;  5IYW A;  5KW9 A;  3ONU A;  4QVA A;  2OBS A;  4P2N A;  3BQJ A;  4RDJ A;  4OP7 A;  3BY1 A;  3ASP A;  4QUZ A;  2OBT A;  4RDL A;  4Z4Y A;  1IHM A;  3AST A;  4ROX A;  5HZA A;  4Z4Z A;  5IYN A;  2ZL5 A;  5J35 A;  3LQ6 A;  4P1V A;  4Z4R A;  4RPD A;  4P25 A;  4X7E A;  3PUN A;  3ASQ A;  4X7C A;  4QVJ A;  5IYR A;  5J3O A;  4QV2 A;  3R6J A;  5HZB A;  3SJP A;  4OPO A;  3RY8 A;  4Z4T A;  4OPS A;  4OOS A;  4OOV A;  5BSX A;  4RDK A;  4Z4V A;  4WZK A;  4OOX A;  3ASR A;  4X06 A;  5F4M A;  4X7F A;  3SKB A;  3Q6R A;  4WZL A;  3BY2 A;  4P12 A;  5BSY A;  5E6T A;  3PA1 A;  4Z4S A;  3PUM A;  2ZL7 A;  3PVD A;  4X0C A;  5IYQ A;  4X07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...