3D26A

Norwalk p domain a-trisaccharide complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
287
structure length
284
Chain Sequence
PFTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSIATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGASSGPQQLPINGVFVFVSWVSRFYQLKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords 58 kd capsid protein
publication title Structural basis for the receptor binding specificity of Norwalk virus.
pubmed doi rcsb
source organism Norwalk virus
total genus 60
structure length 284
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08435 Calici_coat_C Calicivirus coat protein C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3d26A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3d26A01
3Q3AA 3PA1A 5J35A 3ASTA 4P12A 5IYWA 4RPBA 3Q39A 4X0CA 3SLNA 4OOVA 4X07A 3ASRA 5IYQA 4QVJA 5BSXA 4Z4ZA 4OP7A 5E6TA 3LQEA 4WZKA 5IYRA 2OBRA 4X7CA 4RDLA 3Q6RA 4QUZA 3ONUA 3PUMA 4ROXA 4WZTA 3ONYA 4RPDA 4Z4SA 3D26A 2OBTA 5HZBA 4Z4TA 2ZL7A 5J3OA 4X7EA 4RM0A 4P26A 4OOSA 5BSYA 5F4OA 3BY2A 4P2NA 4OPOA 3PUNA 4WZLA 3ASQA 4X7FA 3BY1A 4X05A 3ASPA 4WZEA 3R6KA 3R6JA 3Q38A 3ASSA 2ZL6A 4X7DA 4Z4RA 4QVAA 3RY8A 3BQJA 4OPVA 4P3IA 3LQ6A 5KW9A 1IHMA 3PVDA 4Z4WA 4OPSA 5F4JA 4Z4VA 4RLZA 4RDJA 4X06A 5IYNA 4Z4UA 4Z4YA 3SEJA 4RDKA 3SLDA 3V7AA 3Q6QA 5HZAA 2OBSA 2ZL5A 4P1VA 4P25A 3SKBA 4OOXA 5IYPA 4QV2A 3PA2A 5F4MA 3SJPA
chains in the Genus database with same CATH superfamily
1T6YA 4R71A 1WPCA 3OW7A 1T6ZA 3ASTA 1BPLA 4LBWA 2BSAA 2E1RA 3VNVA 4K1XA 3ZZUA 4X0CA 1YI2B 5KNLA 1QGZA 4OOVA 1QH0A 2I1LA 5KSWB 1KMHA 2VNKA 2XNJA 4LC0A 2J7KA 2BM1A 1E1QA 2QMUA 4OP7A 1Q7YD 3CPXA 2YWFA 4RDLA 3A3BA 1S72B 3CP2A 2OTLB 4XONA 1W34A 3CC4B 2X3UA 1VJSA 1UD4A 4YAFA 1KK2A 1BQEA 1VQNB 4TMVA 5GV7A 2QE7A 4P6YA 2VNJA 4XN3A 3ONYA 3ZPNA 1UD3A 3D26A 1H8EA 3OOCA 2ZL7A 5J3OA 1WSVA 4B3GA 3OZWA 1ZUNB 2RC6A 4ZCIA 4PC6A 5A88A 4OOSA 4RD4A 3GVLA 4DK1A 2KVOA 1V0FA 2RC5A 1G7TA 2C78A 3BCDA 3FKSA 1EWYA 4X8IA 4E0FA 2R9VA 4UAJA 1COWA 2D3NA 3I55B 1VQPB 1QVFB 2LZJA 1I18A 3JQPA 3LNNA 4RD2A 2WJVA 4P22A 5CDFA 1FX0A 1EP1B 2Q6LA 1KZLA 4XOPA 3U2QA 1QX4A 1NDHA 4X7DA 3WXMA 1NJID 3RY8A 1JNYA 1XFOA 3GVKA 2X6WA 2YWEA 1VQ7B 5HKKA 1YLOA 5FO0A 4P3IA 3LQ6A 1GR1A 4HE5A 5H59A 2ZZGA 1JA1A 3NE5B 2CK3A 3W2IA 4RD0A 4UZEA 3G6EB 2V7TA 3T53B 3PENA 1W35A 2DEUA 1FNDA 1Y0RA 2JDIA 4M4SA 4Z4VA 2WYRA 1YJNB 3KL9A 1OB5A 1HA3A 2D74A 3ZUGA 4PC2A 1VQ9B 4N3GA 2BV3A 4Z4UA 1F60A 3CD6B 1E63A 2DERA 3OJXA 4HE6A 3OW2B 1KD1D 2BF4A 1KRHA 1R5NA 1KTVA 4Y9UA 3CCQB 3SEJA 3I1FA 3CCMB 3SLDA 1JA0A 1D8TA 1RQRA 2BGIA 5HZAA 3QFCA 1K8AD 4P1VA 3CMMA 4P25A 2R6HA 4TKOB 1DG1G 1BLIA 3B78A 3GQBA 4II3A 3P26A 1PKVA 5GV8A 3J81k 2VBUA 1KC8D 3VNUA 2D3LA 3CC2B 2P3MA 2CW5A 4G5GA 3A8KA 3MMPA 1WOPA 2WPDA 1PJ6A 3A1PA 3Q3AA 4FWTA 2CRVA 3P27A 2VBSA 4C43A 2F43A 1VQ6B 4Y7CA 1ZM3A 3CP8A 1DDGA 4P12A 3QE2A 5FNZA 5IYWA 1N07A 2B7BA 3SLNA 1HVXA 1Q82D 1F20A 1PJ7A 4BPRA 3G4SB 5IYQA 2V7UA 3W2HA 4F7DA 2F1LA 2YWHA 1Y0YA 2W6JA 3BH4A 5BSXA 1Q9SA 3AVXA 2FVGA 1OHHA 1KJZA 1QGAA 4WZKA 2GK6A 1NBMA 4KKSA 3CMEB 3ONUA 3AGQA 4IW3B 1ZM9A 4ROXA 3BC9A 2VJJA 3OE7A 4XOTA 4RD6A 5AN9A 1JB9A 2ZZQA 4RPDA 2PLFA 2OBTA 1WTHD 3OPOA 4Z4TA 3ZBUA 4QHYA 3FJOA 3OEHA 4XQFA 4X7EA 1QFZA 2XZOA 1GAQA 2YWGA 2DCUA 1KQSB 5F4OA 4AVZA 4YAOA 4YXWA 3MCAA 2Z6BD 3CRZA 4DK0A 3CXCB 4P2NA 3AVVA 3CPWB 2CBXA 1DARA 3ASQA 4WZLA 4KKUA 4RD3A 4X05A 4X7FA 2ZBUA 2NPFA 4B43A 3ASPA 1B23P 3U6KA 2WJYA 2F1MA 3R6KA 4H9GA 4RCZA 2PMDA 4RD1A 4CQJA 4QVAA 4TMWA 5FA6A 2EFGA 2ZTNA 4OPVA 5FL7A 1M90D 2C2WA 3QFRA 5KW9A 3OFNA 3OKXA 3PVDA 4U9UA 5FO1A 4Z4WA 2OTJB 3MHPA 1BJKA 3OEEA 1NRKA 3OJWA 4KKTA 3QFSA 1FRNA 2V4DA 4XKVA 5DN6A 3A8IA 1E62A 4RDJA 5IK2A 1QVGB 2Q6KA 3B82A 4YALA 4XNFA 2DYIA 2C5HA 2C4TA 4M0LA 2XGJA 2DY1A 1UMKA 4B44A 3V7AA 2HMAA 3A8JA 4G7WA 3B8HA 4HIZA 1PJ5A 1YJWB 2HDNB 4Y9RA 3CW2A 4ACBA 1I8DA 4P9SA 2VZLA 1W0JA 2E1BA 2JJ1A 4AC9A 2ZZFA 4NBSA 1BMFA 5IYPA 1ZM2A 2V7QA 4YEJA 2ZZEA 4PGOA 2ZXIA 2FX3A 2OK8A 4B3FX 5EMNA 5THXA 5TY0A 2ZXHA 3GIRA 3AVTA 4DQKA 3PA1A 1FRQA 1TUIA 2C4UA 4XL9A 3CCSB 1GO2A 3KEWA 3CCRB 3AVUA 1GJRA 5L46A 2DIEA 4PAAA 2JJ2A 1U2RA 3WNBA 3W2FA 1J9ZA 4XORA 1I7PA 3AVYA 3H9NA 4PC1A 3VO1A 1V5VA 1M1KD 4B48A 3ASRA 4DQLA 3AGPA 2BGJA 2JIZA 3WBKA 4II2A 3VR6A 4Z4ZA 2HLDA 3T56B 2VNIA 2BPOA 3CTAA 1XQBA 4PC3A 1E43A 3WY9A 3OZVA 4X7CA 5TR9A 4B4DA 1YJ9B 1G7RA 2X6XA 3AVWA 3SJZA 3LO8A 1A8PA 4TT3A 3PUMA 4ACAA 4XN0A 1EP2B 2W6IA 2ZBVA 4WZTA 5DS0A 3U6BA 5FIUA 1RQPA 1B2RA 2BM0A 1EFCA 3E1YE 1WU8A 1QUEA 2QTLA 3LVBA 3CMAB 1T5EA 1W0KA 1ZM4A 4PABA 2QA4B 5BSYA 1W9XA 4FXUA 2XZPA 1YX2A 3ES9A 4LBYA 1H42A 4LBZA 1SKQA 5TV2A 1MABA 3ZIAA 1KK0A 3CCJB 1EP3B 2JN9A 2Q6IA 4G1BA 3FPKA 4UZFA 1Q81D 1HZEA 4XMYA 4P6VF 1S4MA 2V7WA 4WZEA 3BNWA 2BVNA 3R6JA 4FN5A 3ASSA 4Z1MA 5TRDA 4ZV4A 1WP6A 1OGIA 1VQ4B 1VQKB 1AIPA 1IJFA 2PIAA 1WOOA 3CESA 1BX1A 1S0UA 3FPPA 4DNRB 1XB2A 3CCEB 3BCFA 3WBJA 3ZBTA 3WNDA 1IHMA 2V7VA 4XLHA 3JQRA 1H85A 2ZTGA 1T6XA 1E64A 1Q86D 2OK7A 3ZZ0A 4ZCMA 4OPSA 2GREA 3V76A 1NB9A 1EXMA 2XEXA 4X06A 1G7SA 5IYNA 1JJ2B 1QFYA 2XNCA 1K9MD 1WOSA 4Z4YA 2QN6A 4EH1A 1QG0A 1FDRA 4WWVA 4XD7A 3CCVB 1MRZA 1FNCA 3Q6QA 3W5UA 4ZGNB 2VJIA 1V0EA 2ZL5A 1VQ8B 3SKBA 4ZGQB 1UD6A 2GK7A 3T51B 5A8AA 2VBTA 1G7CA 3JU4A 4J0QA 4OOXA 5LMZA 3W5HA 3OP1A 3GSIA 3QFTA 2VNHA 4GQNA 1IB0A 3W5VA 1YITB 2NV4A 4QV2A 3PA2A 5A89A 2CF4A 3ZC3A 2WR8A 3SJPA 2QDXA 2AHOA 3GVJA 1UD2A 2CNDA 4C0SA 2GJKA 1EFTA 4M2LA 5J35A 2GPJA 4JMQA 4B47A 4NCNA 1WSRA 1VQOB 4QFMA 2XZLA 1IJEA 2CC2A 1CQXA 1K73D 2X85A 4RPBA 3W2GA 2QGGA 3Q39A 1ELOA 4XM3A 5DSZA 1OGJA 5HXBA 1VF7A 3A3GA 4AF7A 4G7XA 3OAAA 4X07A 3ISXA 4P3YA 1BX0A 4QVJA 1P4MA 2Q6OA 1W87A 4RJLA 4XKWA 1QGYA 3WNCA 1VLOA 1KK1A 1E3XA 4YHBA 3LQEA 5E6TA 3CC7B 1VHEA 1W2BB 1KK3A 3HAGA 4ZCLA 5IYRA 2OBRA 2GJPA 3Q6RA 4QUZA 2XOKA 1VLYA 2X6YA 4WQMA 2GJRA 2V31A 4YAWA 4TMXA 5JBQA 1VQMB 2PE3A 1TTTA 1FNMA 4Z4SA 2DOGA 1VQ5B 5HZBA 1R5OA 4RCYA 1N0UA 4G1VA 1VHOA 1H8HA 1SKYB 1E79A 4RM0A 4P26A 4B3XA 4XR6A 4XLFA 2OYNA 2HCJB 3WYAA 1OB2A 1EFRA 1N06A 1XE1A 1EFUA 3BY2A 2DETA 3DDYA 4FK8A 2F4NA 2X53S 1N05A 2BN4A 2D9RA 3PUNA 4N3NA 4OPOA 3ZZTA 4TMTA 4M1KA 2GQFA 3BY1A 2QEXB 2QTZA 3I56B 2B5OA 4DNTB 1UD8A 1NB0A 3Q38A 1CNFA 2ZL6A 4XLEA 2BMWA 4Z4RA 2EIXA 3VO2A 2WZNA 1OB0A 2M5SA 3W2EA 4M53A 4ASUA 1QFJA 3BQJA 3OZUA 3JQQA 1E3ZA 2XNDA 4TSFA 4XLAA 2VBVA 4G6IA 3CCUB 4LBVA 4YELA 5B6IA 1N8RD 4MYUA 1GVHA 5F4JA 4RLZA 2V7XA 3VMFA 1YIJB 1D2EA 1QUFA 1R5BA 1WORA 1GAWA 4TN1A 4L8JA 2WZPP 1E1RA 1UD5A 3CB4A 4XLCA 2C5BA 4MYTA 4TMZA 4AF6A 3E20A 2C77A 4Q7JB 2ZITA 4NNJA 1K28D 4RDKA 1D1NA 1N08A 3G05A 3A35A 1CNEA 2VYQA 1VQLB 2OBSA 3CCLB 2WSSA 1WDTA 1FNBA 2B7CA 1TLLA 3H94A 3G71B 3WQZA 1SM4A 4PC7A 1YHQB 2X0KA 2X8KA 4UZUA 1N0VC 5F4MA 4YAUA 5H5JA 1TVCA 3QSYA 1AMOA 1DDIA
chains in the Genus database with same CATH topology
3Q3AA 3PA1A 5J35A 3ASTA 4P12A 5IYWA 4RPBA 3Q39A 4X0CA 3SLNA 4OOVA 4X07A 3ASRA 5IYQA 4QVJA 5BSXA 4Z4ZA 4OP7A 5E6TA 3LQEA 4WZKA 5IYRA 2OBRA 4X7CA 4RDLA 3Q6RA 4QUZA 3ONUA 3PUMA 4ROXA 4WZTA 3ONYA 4RPDA 4Z4SA 3D26A 2OBTA 5HZBA 4Z4TA 2ZL7A 5J3OA 4X7EA 4RM0A 4P26A 4OOSA 5BSYA 5F4OA 3BY2A 4P2NA 4OPOA 3PUNA 4WZLA 3ASQA 4X7FA 3BY1A 4X05A 3ASPA 4WZEA 3R6KA 3R6JA 3Q38A 3ASSA 2ZL6A 4X7DA 4Z4RA 4QVAA 3RY8A 3BQJA 4OPVA 4P3IA 3LQ6A 5KW9A 1IHMA 3PVDA 4Z4WA 4OPSA 5F4JA 4Z4VA 4RLZA 4RDJA 4X06A 5IYNA 4Z4UA 4Z4YA 3SEJA 4RDKA 3SLDA 3V7AA 3Q6QA 5HZAA 2OBSA 2ZL5A 4P1VA 4P25A 3SKBA 4OOXA 5IYPA 4QV2A 3PA2A 5F4MA 3SJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q3A A;  3PA1 A;  5J35 A;  3AST A;  4P12 A;  5IYW A;  4RPB A;  3Q39 A;  4X0C A;  3SLN A;  4OOV A;  4X07 A;  3ASR A;  5IYQ A;  4QVJ A;  5BSX A;  4Z4Z A;  4OP7 A;  5E6T A;  3LQE A;  4WZK A;  5IYR A;  2OBR A;  4X7C A;  4RDL A;  3Q6R A;  4QUZ A;  3ONU A;  3PUM A;  4ROX A;  4WZT A;  3ONY A;  4RPD A;  4Z4S A;  3D26 A;  2OBT A;  5HZB A;  4Z4T A;  2ZL7 A;  5J3O A;  4X7E A;  4RM0 A;  4P26 A;  4OOS A;  5BSY A;  5F4O A;  3BY2 A;  4P2N A;  4OPO A;  3PUN A;  4WZL A;  3ASQ A;  4X7F A;  3BY1 A;  4X05 A;  3ASP A;  4WZE A;  3R6K A;  3R6J A;  3Q38 A;  3ASS A;  2ZL6 A;  4X7D A;  4Z4R A;  4QVA A;  3RY8 A;  3BQJ A;  4OPV A;  4P3I A;  3LQ6 A;  5KW9 A;  1IHM A;  3PVD A;  4Z4W A;  4OPS A;  5F4J A;  4Z4V A;  4RLZ A;  4RDJ A;  4X06 A;  5IYN A;  4Z4U A;  4Z4Y A;  3SEJ A;  4RDK A;  3SLD A;  3V7A A;  3Q6Q A;  5HZA A;  2OBS A;  2ZL5 A;  4P1V A;  4P25 A;  3SKB A;  4OOX A;  5IYP A;  4QV2 A;  3PA2 A;  5F4M A;  3SJP A; 
#chains in the Genus database with same CATH topology
 1T6Y A;  4R71 A;  1WPC A;  3OW7 A;  1T6Z A;  3AST A;  1BPL A;  4LBW A;  2BSA A;  2E1R A;  3VNV A;  4K1X A;  3ZZU A;  4X0C A;  1YI2 B;  5KNL A;  1QGZ A;  4OOV A;  1QH0 A;  2I1L A;  5KSW B;  1KMH A;  2VNK A;  2XNJ A;  4LC0 A;  2J7K A;  2BM1 A;  1E1Q A;  2QMU A;  4OP7 A;  1Q7Y D;  3CPX A;  2YWF A;  4RDL A;  3A3B A;  1S72 B;  3CP2 A;  2OTL B;  4XON A;  1W34 A;  3CC4 B;  2X3U A;  1VJS A;  1UD4 A;  4YAF A;  1KK2 A;  1BQE A;  1VQN B;  4TMV A;  5GV7 A;  2QE7 A;  4P6Y A;  2VNJ A;  4XN3 A;  3ONY A;  3ZPN A;  1UD3 A;  3D26 A;  1H8E A;  3OOC A;  2ZL7 A;  5J3O A;  1WSV A;  4B3G A;  3OZW A;  1ZUN B;  2RC6 A;  4ZCI A;  4PC6 A;  5A88 A;  4OOS A;  4RD4 A;  3GVL A;  4DK1 A;  2KVO A;  1V0F A;  2RC5 A;  1G7T A;  2C78 A;  3BCD A;  3FKS A;  1EWY A;  4X8I A;  4E0F A;  2R9V A;  4UAJ A;  1COW A;  2D3N A;  3I55 B;  1VQP B;  1QVF B;  2LZJ A;  1I18 A;  3JQP A;  3LNN A;  4RD2 A;  2WJV A;  4P22 A;  5CDF A;  1FX0 A;  1EP1 B;  2Q6L A;  1KZL A;  4XOP A;  3U2Q A;  1QX4 A;  1NDH A;  4X7D A;  3WXM A;  1NJI D;  3RY8 A;  1JNY A;  1XFO A;  3GVK A;  2X6W A;  2YWE A;  1VQ7 B;  5HKK A;  1YLO A;  5FO0 A;  4P3I A;  3LQ6 A;  1GR1 A;  4HE5 A;  5H59 A;  2ZZG A;  1JA1 A;  3NE5 B;  2CK3 A;  3W2I A;  4RD0 A;  4UZE A;  3G6E B;  2V7T A;  3T53 B;  3PEN A;  1W35 A;  2DEU A;  1FND A;  1Y0R A;  2JDI A;  4M4S A;  4Z4V A;  2WYR A;  1YJN B;  3KL9 A;  1OB5 A;  1HA3 A;  2D74 A;  3ZUG A;  4PC2 A;  1VQ9 B;  4N3G A;  2BV3 A;  4Z4U A;  1F60 A;  3CD6 B;  1E63 A;  2DER A;  3OJX A;  4HE6 A;  3OW2 B;  1KD1 D;  2BF4 A;  1KRH A;  1R5N A;  1KTV A;  4Y9U A;  3CCQ B;  3SEJ A;  3I1F A;  3CCM B;  3SLD A;  1JA0 A;  1D8T A;  1RQR A;  2BGI A;  5HZA A;  3QFC A;  1K8A D;  4P1V A;  3CMM A;  4P25 A;  2R6H A;  4TKO B;  1DG1 G;  1BLI A;  3B78 A;  3GQB A;  4II3 A;  3P26 A;  1PKV A;  5GV8 A;  3J81 k;  2VBU A;  1KC8 D;  3VNU A;  2D3L A;  3CC2 B;  2P3M A;  2CW5 A;  4G5G A;  3A8K A;  3MMP A;  1WOP A;  2WPD A;  1PJ6 A;  3A1P A;  3Q3A A;  4FWT A;  2CRV A;  3P27 A;  2VBS A;  4C43 A;  2F43 A;  1VQ6 B;  4Y7C A;  1ZM3 A;  3CP8 A;  1DDG A;  4P12 A;  3QE2 A;  5FNZ A;  5IYW A;  1N07 A;  2B7B A;  3SLN A;  1HVX A;  1Q82 D;  1F20 A;  1PJ7 A;  4BPR A;  3G4S B;  5IYQ A;  2V7U A;  3W2H A;  4F7D A;  2F1L A;  2YWH A;  1Y0Y A;  2W6J A;  3BH4 A;  5BSX A;  1Q9S A;  3AVX A;  2FVG A;  1OHH A;  1KJZ A;  1QGA A;  4WZK A;  2GK6 A;  1NBM A;  4KKS A;  3CME B;  3ONU A;  3AGQ A;  4IW3 B;  1ZM9 A;  4ROX A;  3BC9 A;  2VJJ A;  3OE7 A;  4XOT A;  4RD6 A;  5AN9 A;  1JB9 A;  2ZZQ A;  4RPD A;  2PLF A;  2OBT A;  1WTH D;  3OPO A;  4Z4T A;  3ZBU A;  4QHY A;  3FJO A;  3OEH A;  4XQF A;  4X7E A;  1QFZ A;  2XZO A;  1GAQ A;  2YWG A;  2DCU A;  1KQS B;  5F4O A;  4AVZ A;  4YAO A;  4YXW A;  3MCA A;  2Z6B D;  3CRZ A;  4DK0 A;  3CXC B;  4P2N A;  3AVV A;  3CPW B;  2CBX A;  1DAR A;  3ASQ A;  4WZL A;  4KKU A;  4RD3 A;  4X05 A;  4X7F A;  2ZBU A;  2NPF A;  4B43 A;  3ASP A;  1B23 P;  3U6K A;  2WJY A;  2F1M A;  3R6K A;  4H9G A;  4RCZ A;  2PMD A;  4RD1 A;  4CQJ A;  4QVA A;  4TMW A;  5FA6 A;  2EFG A;  2ZTN A;  4OPV A;  5FL7 A;  1M90 D;  2C2W A;  3QFR A;  5KW9 A;  3OFN A;  3OKX A;  3PVD A;  4U9U A;  5FO1 A;  4Z4W A;  2OTJ B;  3MHP A;  1BJK A;  3OEE A;  1NRK A;  3OJW A;  4KKT A;  3QFS A;  1FRN A;  2V4D A;  4XKV A;  5DN6 A;  3A8I A;  1E62 A;  4RDJ A;  5IK2 A;  1QVG B;  2Q6K A;  3B82 A;  4YAL A;  4XNF A;  2DYI A;  2C5H A;  2C4T A;  4M0L A;  2XGJ A;  2DY1 A;  1UMK A;  4B44 A;  3V7A A;  2HMA A;  3A8J A;  4G7W A;  3B8H A;  4HIZ A;  1PJ5 A;  1YJW B;  2HDN B;  4Y9R A;  3CW2 A;  4ACB A;  1I8D A;  4P9S A;  2VZL A;  1W0J A;  2E1B A;  2JJ1 A;  4AC9 A;  2ZZF A;  4NBS A;  1BMF A;  5IYP A;  1ZM2 A;  2V7Q A;  4YEJ A;  2ZZE A;  4PGO A;  2ZXI A;  2FX3 A;  2OK8 A;  4B3F X;  5EMN A;  5THX A;  5TY0 A;  2ZXH A;  3GIR A;  3AVT A;  4DQK A;  3PA1 A;  1FRQ A;  1TUI A;  2C4U A;  4XL9 A;  3CCS B;  1GO2 A;  3KEW A;  3CCR B;  3AVU A;  1GJR A;  5L46 A;  2DIE A;  4PAA A;  2JJ2 A;  1U2R A;  3WNB A;  3W2F A;  1J9Z A;  4XOR A;  1I7P A;  3AVY A;  3H9N A;  4PC1 A;  3VO1 A;  1V5V A;  1M1K D;  4B48 A;  3ASR A;  4DQL A;  3AGP A;  2BGJ A;  2JIZ A;  3WBK A;  4II2 A;  3VR6 A;  4Z4Z A;  2HLD A;  3T56 B;  2VNI A;  2BPO A;  3CTA A;  1XQB A;  4PC3 A;  1E43 A;  3WY9 A;  3OZV A;  4X7C A;  5TR9 A;  4B4D A;  1YJ9 B;  1G7R A;  2X6X A;  3AVW A;  3SJZ A;  3LO8 A;  1A8P A;  4TT3 A;  3PUM A;  4ACA A;  4XN0 A;  1EP2 B;  2W6I A;  2ZBV A;  4WZT A;  5DS0 A;  3U6B A;  5FIU A;  1RQP A;  1B2R A;  2BM0 A;  1EFC A;  3E1Y E;  1WU8 A;  1QUE A;  2QTL A;  3LVB A;  3CMA B;  1T5E A;  1W0K A;  1ZM4 A;  4PAB A;  2QA4 B;  5BSY A;  1W9X A;  4FXU A;  2XZP A;  1YX2 A;  3ES9 A;  4LBY A;  1H42 A;  4LBZ A;  1SKQ A;  5TV2 A;  1MAB A;  3ZIA A;  1KK0 A;  3CCJ B;  1EP3 B;  2JN9 A;  2Q6I A;  4G1B A;  3FPK A;  4UZF A;  1Q81 D;  1HZE A;  4XMY A;  4P6V F;  1S4M A;  2V7W A;  4WZE A;  3BNW A;  2BVN A;  3R6J A;  4FN5 A;  3ASS A;  4Z1M A;  5TRD A;  4ZV4 A;  1WP6 A;  1OGI A;  1VQ4 B;  1VQK B;  1AIP A;  1IJF A;  2PIA A;  1WOO A;  3CES A;  1BX1 A;  1S0U A;  3FPP A;  4DNR B;  1XB2 A;  3CCE B;  3BCF A;  3WBJ A;  3ZBT A;  3WND A;  1IHM A;  2V7V A;  4XLH A;  3JQR A;  1H85 A;  2ZTG A;  1T6X A;  1E64 A;  1Q86 D;  2OK7 A;  3ZZ0 A;  4ZCM A;  4OPS A;  2GRE A;  3V76 A;  1NB9 A;  1EXM A;  2XEX A;  4X06 A;  1G7S A;  5IYN A;  1JJ2 B;  1QFY A;  2XNC A;  1K9M D;  1WOS A;  4Z4Y A;  2QN6 A;  4EH1 A;  1QG0 A;  1FDR A;  4WWV A;  4XD7 A;  3CCV B;  1MRZ A;  1FNC A;  3Q6Q A;  3W5U A;  4ZGN B;  2VJI A;  1V0E A;  2ZL5 A;  1VQ8 B;  3SKB A;  4ZGQ B;  1UD6 A;  2GK7 A;  3T51 B;  5A8A A;  2VBT A;  1G7C A;  3JU4 A;  4J0Q A;  4OOX A;  5LMZ A;  3W5H A;  3OP1 A;  3GSI A;  3QFT A;  2VNH A;  4GQN A;  1IB0 A;  3W5V A;  1YIT B;  2NV4 A;  4QV2 A;  3PA2 A;  5A89 A;  2CF4 A;  3ZC3 A;  2WR8 A;  3SJP A;  2QDX A;  2AHO A;  3GVJ A;  1UD2 A;  2CND A;  4C0S A;  2GJK A;  1EFT A;  4M2L A;  5J35 A;  2GPJ A;  4JMQ A;  4B47 A;  4NCN A;  1WSR A;  1VQO B;  4QFM A;  2XZL A;  1IJE A;  2CC2 A;  1CQX A;  1K73 D;  2X85 A;  4RPB A;  3W2G A;  2QGG A;  3Q39 A;  1ELO A;  4XM3 A;  5DSZ A;  1OGJ A;  5HXB A;  1VF7 A;  3A3G A;  4AF7 A;  4G7X A;  3OAA A;  4X07 A;  3ISX A;  4P3Y A;  1BX0 A;  4QVJ A;  1P4M A;  2Q6O A;  1W87 A;  4RJL A;  4XKW A;  1QGY A;  3WNC A;  1VLO A;  1KK1 A;  1E3X A;  4YHB A;  3LQE A;  5E6T A;  3CC7 B;  1VHE A;  1W2B B;  1KK3 A;  3HAG A;  4ZCL A;  5IYR A;  2OBR A;  2GJP A;  3Q6R A;  4QUZ A;  2XOK A;  1VLY A;  2X6Y A;  4WQM A;  2GJR A;  2V31 A;  4YAW A;  4TMX A;  5JBQ A;  1VQM B;  2PE3 A;  1TTT A;  1FNM A;  4Z4S A;  2DOG A;  1VQ5 B;  5HZB A;  1R5O A;  4RCY A;  1N0U A;  4G1V A;  1VHO A;  1H8H A;  1SKY B;  1E79 A;  4RM0 A;  4P26 A;  4B3X A;  4XR6 A;  4XLF A;  2OYN A;  2HCJ B;  3WYA A;  1OB2 A;  1EFR A;  1N06 A;  1XE1 A;  1EFU A;  3BY2 A;  2DET A;  3DDY A;  4FK8 A;  2F4N A;  2X53 S;  1N05 A;  2BN4 A;  2D9R A;  3PUN A;  4N3N A;  4OPO A;  3ZZT A;  4TMT A;  4M1K A;  2GQF A;  3BY1 A;  2QEX B;  2QTZ A;  3I56 B;  2B5O A;  4DNT B;  1UD8 A;  1NB0 A;  3Q38 A;  1CNF A;  2ZL6 A;  4XLE A;  2BMW A;  4Z4R A;  2EIX A;  3VO2 A;  2WZN A;  1OB0 A;  2M5S A;  3W2E A;  4M53 A;  4ASU A;  1QFJ A;  3BQJ A;  3OZU A;  3JQQ A;  1E3Z A;  2XND A;  4TSF A;  4XLA A;  2VBV A;  4G6I A;  3CCU B;  4LBV A;  4YEL A;  5B6I A;  1N8R D;  4MYU A;  1GVH A;  5F4J A;  4RLZ A;  2V7X A;  3VMF A;  1YIJ B;  1D2E A;  1QUF A;  1R5B A;  1WOR A;  1GAW A;  4TN1 A;  4L8J A;  2WZP P;  1E1R A;  1UD5 A;  3CB4 A;  4XLC A;  2C5B A;  4MYT A;  4TMZ A;  4AF6 A;  3E20 A;  2C77 A;  4Q7J B;  2ZIT A;  4NNJ A;  1K28 D;  4RDK A;  1D1N A;  1N08 A;  3G05 A;  3A35 A;  1CNE A;  2VYQ A;  1VQL B;  2OBS A;  3CCL B;  2WSS A;  1WDT A;  1FNB A;  2B7C A;  1TLL A;  3H94 A;  3G71 B;  3WQZ A;  1SM4 A;  4PC7 A;  1YHQ B;  2X0K A;  2X8K A;  4UZU A;  1N0V C;  5F4M A;  4YAU A;  5H5J A;  1TVC A;  3QSY A;  1AMO A;  1DDI A; 
#chains in the Genus database with same CATH homology
 3Q3A A;  3PA1 A;  5J35 A;  3AST A;  4P12 A;  5IYW A;  4RPB A;  3Q39 A;  4X0C A;  3SLN A;  4OOV A;  4X07 A;  3ASR A;  5IYQ A;  4QVJ A;  5BSX A;  4Z4Z A;  4OP7 A;  5E6T A;  3LQE A;  4WZK A;  5IYR A;  2OBR A;  4X7C A;  4RDL A;  3Q6R A;  4QUZ A;  3ONU A;  3PUM A;  4ROX A;  4WZT A;  3ONY A;  4RPD A;  4Z4S A;  3D26 A;  2OBT A;  5HZB A;  4Z4T A;  2ZL7 A;  5J3O A;  4X7E A;  4RM0 A;  4P26 A;  4OOS A;  5BSY A;  5F4O A;  3BY2 A;  4P2N A;  4OPO A;  3PUN A;  4WZL A;  3ASQ A;  4X7F A;  3BY1 A;  4X05 A;  3ASP A;  4WZE A;  3R6K A;  3R6J A;  3Q38 A;  3ASS A;  2ZL6 A;  4X7D A;  4Z4R A;  4QVA A;  3RY8 A;  3BQJ A;  4OPV A;  4P3I A;  3LQ6 A;  5KW9 A;  1IHM A;  3PVD A;  4Z4W A;  4OPS A;  5F4J A;  4Z4V A;  4RLZ A;  4RDJ A;  4X06 A;  5IYN A;  4Z4U A;  4Z4Y A;  3SEJ A;  4RDK A;  3SLD A;  3V7A A;  3Q6Q A;  5HZA A;  2OBS A;  2ZL5 A;  4P1V A;  4P25 A;  3SKB A;  4OOX A;  5IYP A;  4QV2 A;  3PA2 A;  5F4M A;  3SJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...