3D26A

Norwalk p domain a-trisaccharide complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
287
structure length
284
Chain Sequence
PFTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSIATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGASSGPQQLPINGVFVFVSWVSRFYQLKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 58 kd capsid protein
publication title Structural basis for the receptor binding specificity of Norwalk virus.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 60
structure length 284
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08435 Calici_coat_C Calicivirus coat protein C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3d26A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3d26A01
4OP7A 4OPSA 4QVJA 5F4OA 4X7CA 3PA1A 5J3OA 4P3IA 4Z4ZA 2ZL7A 4Z4WA 3R6JA 5KW9A 4OOXA 5IYWA 4X7DA 3BQJA 4OPVA 3RY8A 3BY2A 4P25A 3Q3AA 3PVDA 4OOSA 4ROXA 3SJPA 5BSYA 5F4JA 5HZAA 5IYRA 4RPDA 3V7AA 4OOVA 4WZKA 5HZBA 4QUZA 4WZLA 3PUNA 4Z4TA 2ZL6A 2OBSA 3Q39A 5E6TA 5F4MA 4QVAA 3ONYA 2OBTA 3Q6QA 3SKBA 4RM0A 3SLDA 4X7EA 5IYNA 4Z4SA 3ASQA 5J35A 2OBRA 3LQ6A 4X0CA 4QV2A 3ONUA 1IHMA 3BY1A 5IYQA 3Q38A 4X07A 4RDKA 4WZTA 3R6KA 4OPOA 2ZL5A 4P26A 4RDLA 4X06A 3SEJA 5IYPA 3D26A 4X7FA 3PUMA 3PA2A 4RDJA 4P12A 4WZEA 4Z4RA 3Q6RA 3LQEA 4P2NA 4RLZA 4P1VA 3ASSA 4Z4UA 3ASTA 4Z4VA 3ASRA 4Z4YA 4RPBA 5BSXA 3ASPA 4X05A 3SLNA
chains in the Genus database with same CATH superfamily
4P6VF 3ES9A 3JQQA 3CW2A 1FDRA 4QVJA 1XQBA 2YWEA 2QEXB 4DQLA 4AF7A 1HVXA 4II3A 1GVHA 3LVBA 2NV4A 2YWGA 5J3OA 2C5BA 1NB9A 5L46A 4TMVA 4XORA 1YX2A 4FN5A 1VQMB 1VLYA 1V5VA 2YWHA 4XKWA 3CCSB 5TR9A 4PC6A 1FRQA 3W2FA 2CW5A 4OPVA 2P3MA 2WJYA 2F1LA 2B7CA 4RD0A 1E62A 3CXCB 5TY0A 3Q3AA 1FNDA 1VHEA 3G05A 1YLOA 4HE5A 5F4JA 1T6YA 1JNYA 1W34A 4PAAA 4KKTA 4P3YA 4YEJA 4OOVA 2OK7A 2ZZGA 1R5BA 2RC6A 4B47A 1H85A 5HZBA 3A1PA 1QGYA 2CNDA 1CNEA 1RQPA 1XB2A 3PUNA 4B3XA 2ZL6A 3CB4A 3Q39A 4Y7CA 3WBKA 1W9XA 5E6TA 3OFNA 3QE2A 4PABA 2X8KA 1V0EA 1WOOA 3CRZA 4QVAA 4PC2A 1VQ6B 3BH4A 1I8DA 2EFGA 3VO1A 3SKBA 1TUIA 4RM0A 5EMNA 1G7TA 1GO2A 3SLDA 4G1VA 1FNCA 3OKXA 1S72B 4G6IA 1Y0YA 4XM3A 5IYNA 1VQ8B 2X3UA 1EP2B 1QGAA 2BV3A 5THXA 3I55B 3AVVA 5HXBA 4ASUA 2ZZQA 4RD4A 4Q7JB 3GQBA 2GJKA 4ZCIA 1YI2B 2W6JA 2GPJA 3G4SB 4M53A 1B23P 2R6HA 4XOPA 4II2A 5IYQA 1R5NA 3DDYA 4TMWA 2DOGA 4XOTA 1VQKB 1Q9SA 3R6KA 1KMHA 1WP6A 4Y9UA 2JJ2A 2C4UA 2OK8A 1G7SA 4UZEA 2V31A 1AMOA 3OJWA 2E1BA 1PJ5A 2V7XA 1QFJA 1N06A 3CMMA 1VQPB 1IJFA 3E20A 3FPKA 4X8IA 3GSIA 1PJ7A 5IYPA 3AVTA 2VNKA 2VZLA 2WJVA 3OE7A 3HAGA 3B82A 2OTLB 3WNBA 1TLLA 2XNCA 4JMQA 2QMUA 2X6WA 1UD2A 2EIXA 5FA6A 3QSYA 4ZV4A 4P12A 4Z4RA 3Q6RA 4J0QA 1BX0A 1W87A 2ZBUA 4GQNA 4P1VA 1N08A 4FK8A 4DNRB 3U2QA 4PC3A 1ZM2A 3MCAA 2JIZA 2ZITA 5IK2A 2J7KA 5BSXA 3JQRA 4XONA 2CC2A 5A88A 1SM4A 1M90D 4OP7A 4NBSA 1PKVA 1RQRA 2BM0A 2XZPA 1BX1A 2Q6KA 5F4OA 4X7CA 2Q6IA 1FX0A 1H8HA 2BGIA 2LZJA 4P3IA 1Y0RA 2BGJA 4YAFA 1TTTA 4CQJA 3CP8A 4IW3B 5IYWA 2PIAA 3BC9A 1UD4A 4X7DA 1OGJA 2CK3A 1COWA 2VBSA 3BQJA 4P6YA 5DSZA 1G7RA 2DERA 3KL9A 3WXMA 3H94A 4WWVA 4OOSA 1IB0A 3ZUGA 2VJIA 5H5JA 3SJPA 3VO2A 2F1MA 5HZAA 1EFRA 1BLIA 4TKOB 1CNFA 3W2GA 1G7CA 4M4SA 3OEHA 4WZKA 3CC7B 4QUZA 4WZLA 3OP1A 4AC9A 1UD3A 2D74A 4Z4TA 1HA3A 1NDHA 2NPFA 1YIJB 3B78A 1W2BB 1CQXA 2GK6A 2BSAA 1ELOA 1Q81D 3MMPA 2WZPP 3WNDA 2I1LA 2DEUA 1WORA 1N0UA 4YAOA 2VNIA 1WDTA 1PJ6A 1KK1A 4E0FA 2BN4A 1WSVA 4KKSA 2VYQA 1YJ9B 1T5EA 1N0VC 3OZUA 2QTLA 3W2HA 3LQ6A 1KJZA 2QGGA 4X0CA 1YJWB 4Y9RA 1YITB 1E1QA 4NCNA 3VR6A 5KNLA 1DARA 3OZWA 5HKKA 1TVCA 4ZCLA 4XLCA 2D3LA 3Q38A 1ZUNB 2GK7A 2ZZEA 1EXMA 5LMZA 3OOCA 4DNTB 4M1KA 3QFTA 1WSRA 1MRZA 1VQNB 5FIUA 3W5VA 3FJOA 4PC7A 3WQZA 1WTHD 3CCEB 4OPOA 5IYRA 1OB5A 1QH0A 3V76A 1DDIA 4ZGNB 4B3GA 2XNDA 3OZVA 3U6KA 3J81k 1EFUA 4P22A 4M2LA 4WQMA 5GV7A 2XZOA 1QG0A 2YWFA 4XKVA 1OB2A 2Z6BD 1K73D 1A8PA 1XFOA 4ZCMA 4X7FA 1KD1D 3T53B 4YXWA 2D9RA 3A8IA 3JQPA 4RCZA 4XN0A 4ZGQB 1OHHA 5JBQA 5TRDA 4LBYA 2BM1A 2V7TA 4FWTA 1BQEA 4FXUA 1E3XA 5A8AA 3W5HA 4UAJA 3W5UA 4RD2A 3ASTA 3CCVB 3A8JA 3AVXA 2HLDA 1U2RA 3SJZA 4Z4YA 1I7PA 2QE7A 2C78A 1UD6A 2KVOA 3MHPA 4RD3A 1F60A 4K1XA 3ZC3A 1BPLA 1T6XA 2VBUA 5AN9A 2C5HA 2VNJA 1EFTA 1N8RD 3A3BA 4OPSA 1KK3A 2HCJB 2XGJA 3PA1A 3CCRB 1WOPA 2V7WA 4U9UA 4N3GA 2ZL7A 5KW9A 2ZXIA 3U6BA 2GREA 1QUFA 3BNWA 2QDXA 1AIPA 3FPPA 4MYUA 4UZUA 1N07A 3G6EB 3AGQA 3BY2A 1YJNB 1W0JA 2RC5A 1S0UA 3PVDA 4ROXA 3AVWA 1EP3B 3CCLB 5BSYA 1VQOB 3CC4B 3QFCA 1KQSB 3LNNA 4RPDA 3V7AA 1UD8A 2V7VA 4XL9A 1VQ5B 3CMAB 3P27A 1Q86D 4RCYA 2VJJA 2OBSA 1E64A 1JB9A 2V7UA 3KEWA 1SKYB 5F4MA 1R5OA 3P26A 1EFCA 1WOSA 2W6IA 3CCUB 2OBTA 2Q6OA 1JA1A 3Q6QA 1K28D 3T51B 4AF6A 2PLFA 4XQFA 3A3GA 1KRHA 3B8HA 1QGZA 1FNBA 4B43A 3A8KA 4X7EA 3G71B 1GR1A 3ASQA 3A35A 3T56B 1KTVA 2DIEA 2OBRA 1P4MA 1T6ZA 4QV2A 3WYAA 2V4DA 2HDNB 3JU4A 2F43A 4LBVA 2CF4A 1ZM3A 1GJRA 2GJPA 4RJLA 4WZTA 2WPDA 4DQKA 2PMDA 3CP2A 4TMTA 4PC1A 1E3ZA 1D2EA 3QFRA 1E43A 3W2IA 3GIRA 1MABA 3ZBUA 4TMZA 1E63A 2QN6A 2VNHA 1KC8D 1H8EA 1QUEA 2XZLA 4P26A 4RDLA 4X06A 1D1NA 4HE6A 3SEJA 3D26A 2C2WA 1QX4A 3OEEA 3NE5B 1QVFB 3WNCA 1GAWA 1E1RA 3OAAA 2QA4B 2AHOA 1VQLB 4G7XA 4RDJA 3WBJA 4WZEA 4C0SA 1M1KD 4BPRA 1NJID 1K9MD 3LQEA 3OJXA 1S4MA 3VMFA 2GJRA 2VBVA 4RLZA 1Q7YD 4Z4UA 5CDFA 1BJKA 2GQFA 2C4TA 3BCDA 1IJEA 4QFMA 5TV2A 1I18A 1OGIA 4B3FX 4B48A 3AVYA 1KK0A 3GVLA 4UZFA 4B44A 2HMAA 1KK2A 1WU8A 4P25A 4X05A 2X6YA 4LBZA 1NRKA 2X0KA 1JA0A 1VQ4B 4M0LA 4YHBA 5DN6A 1DG1G 3W2EA 4XMYA 4YAUA 1SKQA 2V7QA 2R9VA 4Z4ZA 4Z1MA 4Z4WA 3CESA 3R6JA 2WZNA 2ZTGA 4OOXA 3FKSA 4XLHA 3H9NA 1B2RA 1QFYA 3ZZ0A 1QVGB 2VBTA 2XOKA 3RY8A 4NNJA 4HIZA 4TN1A 2CBXA 1FNMA 2M5SA 2DYIA 2WYRA 3VNVA 5FL7A 4ACBA 2D3NA 3BCFA 2ZBVA 2ZTNA 4PGOA 1NB0A 1ZM4A 4RD6A 4XLEA 3AVUA 2BPOA 3CCQB 4XR6A 3OW7A 1K8AD 3QFSA 4XLAA 1KZLA 3GVKA 2F4NA 1EP1B 3CCJB 4TSFA 3ONYA 5A89A 3CCMB 3I1FA 2JJ1A 4C43A 1W0KA 2FVGA 2X85A 4LBWA 4TT3A 2BVNA 3OPOA 3ZIAA 4DK0A 4MYTA 4B4DA 3ZPNA 4Z4SA 2FX3A 5J35A 3OW2B 3GVJA 5GV8A 1EWYA 3LO8A 5DS0A 3CC2B 2DY1A 4P9SA 4EH1A 3E1YE 4G1BA 3ONUA 4XLFA 1IHMA 1V0FA 1NBMA 2C77A 4G5GA 3BY1A 2BMWA 4X07A 4XN3A 2X53S 4RDKA 1VLOA 1VJSA 5FO0A 4N3NA 1UD5A 4YAWA 5KSWB 1JJ2B 2JDIA 4F7DA 3AGPA 4RD1A 3WY9A 1D8TA 2OYNA 1J9ZA 2ZXHA 4YALA 5FNZA 2Q6LA 4H9GA 2ZL5A 2OTJB 4G7WA 3ZBTA 4KKUA 4LC0A 2CRVA 4QHYA 5H59A 2X6XA 2BF4A 4DK1A 1VF7A 2B7BA 1VHOA 1N05A 2WSSA 1Q82D 4XNFA 4ACAA 3PUMA 3ZZTA 3VNUA 1F20A 1OB0A 3ISXA 5B6IA 3CTAA 1E79A 1BMFA 4TMXA 4XD7A 2DETA 3PA2A 1HZEA 3PENA 4L8JA 3CMEB 2QTZA 1YHQB 2WR8A 1UMKA 4AVZA 2XNJA 2ZZFA 2JN9A 1QFZA 1VQ7B 2XEXA 4P2NA 3CPWB 3ASSA 4Z4VA 1XE1A 2E1RA 3ASRA 3ZZUA 2PE3A 3I56B 5FO1A 1FRNA 1VQ9B 1H42A 4YELA 1ZM9A 1DDGA 1GAQA 4RPBA 3CD6B 3ASPA 2DCUA 1WPCA 1W35A 2B5OA 3SLNA 3CPXA 4R71A
chains in the Genus database with same CATH topology
4OP7A 4OPSA 4QVJA 5F4OA 4X7CA 3PA1A 5J3OA 4P3IA 4Z4ZA 2ZL7A 4Z4WA 3R6JA 5KW9A 4OOXA 5IYWA 4X7DA 3BQJA 4OPVA 3RY8A 3BY2A 4P25A 3Q3AA 3PVDA 4OOSA 4ROXA 3SJPA 5BSYA 5F4JA 5HZAA 5IYRA 4RPDA 3V7AA 4OOVA 4WZKA 5HZBA 4QUZA 4WZLA 3PUNA 4Z4TA 2ZL6A 2OBSA 3Q39A 5E6TA 5F4MA 4QVAA 3ONYA 2OBTA 3Q6QA 3SKBA 4RM0A 3SLDA 4X7EA 5IYNA 4Z4SA 3ASQA 5J35A 2OBRA 3LQ6A 4X0CA 4QV2A 3ONUA 1IHMA 3BY1A 5IYQA 3Q38A 4X07A 4RDKA 4WZTA 3R6KA 4OPOA 2ZL5A 4P26A 4RDLA 4X06A 3SEJA 5IYPA 3D26A 4X7FA 3PUMA 3PA2A 4RDJA 4P12A 4WZEA 4Z4RA 3Q6RA 3LQEA 4P2NA 4RLZA 4P1VA 3ASSA 4Z4UA 3ASTA 4Z4VA 3ASRA 4Z4YA 4RPBA 5BSXA 3ASPA 4X05A 3SLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OP7 A;  4OPS A;  4QVJ A;  5F4O A;  4X7C A;  3PA1 A;  5J3O A;  4P3I A;  4Z4Z A;  2ZL7 A;  4Z4W A;  3R6J A;  5KW9 A;  4OOX A;  5IYW A;  4X7D A;  3BQJ A;  4OPV A;  3RY8 A;  3BY2 A;  4P25 A;  3Q3A A;  3PVD A;  4OOS A;  4ROX A;  3SJP A;  5BSY A;  5F4J A;  5HZA A;  5IYR A;  4RPD A;  3V7A A;  4OOV A;  4WZK A;  5HZB A;  4QUZ A;  4WZL A;  3PUN A;  4Z4T A;  2ZL6 A;  2OBS A;  3Q39 A;  5E6T A;  5F4M A;  4QVA A;  3ONY A;  2OBT A;  3Q6Q A;  3SKB A;  4RM0 A;  3SLD A;  4X7E A;  5IYN A;  4Z4S A;  3ASQ A;  5J35 A;  2OBR A;  3LQ6 A;  4X0C A;  4QV2 A;  3ONU A;  1IHM A;  3BY1 A;  5IYQ A;  3Q38 A;  4X07 A;  4RDK A;  4WZT A;  3R6K A;  4OPO A;  2ZL5 A;  4P26 A;  4RDL A;  4X06 A;  3SEJ A;  5IYP A;  3D26 A;  4X7F A;  3PUM A;  3PA2 A;  4RDJ A;  4P12 A;  4WZE A;  4Z4R A;  3Q6R A;  3LQE A;  4P2N A;  4RLZ A;  4P1V A;  3ASS A;  4Z4U A;  3AST A;  4Z4V A;  3ASR A;  4Z4Y A;  4RPB A;  5BSX A;  3ASP A;  4X05 A;  3SLN A; 
#chains in the Genus database with same CATH topology
 4P6V F;  3ES9 A;  3JQQ A;  3CW2 A;  1FDR A;  4QVJ A;  1XQB A;  2YWE A;  2QEX B;  4DQL A;  4AF7 A;  1HVX A;  4II3 A;  1GVH A;  3LVB A;  2NV4 A;  2YWG A;  5J3O A;  2C5B A;  1NB9 A;  5L46 A;  4TMV A;  4XOR A;  1YX2 A;  4FN5 A;  1VQM B;  1VLY A;  1V5V A;  2YWH A;  4XKW A;  3CCS B;  5TR9 A;  4PC6 A;  1FRQ A;  3W2F A;  2CW5 A;  4OPV A;  2P3M A;  2WJY A;  2F1L A;  2B7C A;  4RD0 A;  1E62 A;  3CXC B;  5TY0 A;  3Q3A A;  1FND A;  1VHE A;  3G05 A;  1YLO A;  4HE5 A;  5F4J A;  1T6Y A;  1JNY A;  1W34 A;  4PAA A;  4KKT A;  4P3Y A;  4YEJ A;  4OOV A;  2OK7 A;  2ZZG A;  1R5B A;  2RC6 A;  4B47 A;  1H85 A;  5HZB A;  3A1P A;  1QGY A;  2CND A;  1CNE A;  1RQP A;  1XB2 A;  3PUN A;  4B3X A;  2ZL6 A;  3CB4 A;  3Q39 A;  4Y7C A;  3WBK A;  1W9X A;  5E6T A;  3OFN A;  3QE2 A;  4PAB A;  2X8K A;  1V0E A;  1WOO A;  3CRZ A;  4QVA A;  4PC2 A;  1VQ6 B;  3BH4 A;  1I8D A;  2EFG A;  3VO1 A;  3SKB A;  1TUI A;  4RM0 A;  5EMN A;  1G7T A;  1GO2 A;  3SLD A;  4G1V A;  1FNC A;  3OKX A;  1S72 B;  4G6I A;  1Y0Y A;  4XM3 A;  5IYN A;  1VQ8 B;  2X3U A;  1EP2 B;  1QGA A;  2BV3 A;  5THX A;  3I55 B;  3AVV A;  5HXB A;  4ASU A;  2ZZQ A;  4RD4 A;  4Q7J B;  3GQB A;  2GJK A;  4ZCI A;  1YI2 B;  2W6J A;  2GPJ A;  3G4S B;  4M53 A;  1B23 P;  2R6H A;  4XOP A;  4II2 A;  5IYQ A;  1R5N A;  3DDY A;  4TMW A;  2DOG A;  4XOT A;  1VQK B;  1Q9S A;  3R6K A;  1KMH A;  1WP6 A;  4Y9U A;  2JJ2 A;  2C4U A;  2OK8 A;  1G7S A;  4UZE A;  2V31 A;  1AMO A;  3OJW A;  2E1B A;  1PJ5 A;  2V7X A;  1QFJ A;  1N06 A;  3CMM A;  1VQP B;  1IJF A;  3E20 A;  3FPK A;  4X8I A;  3GSI A;  1PJ7 A;  5IYP A;  3AVT A;  2VNK A;  2VZL A;  2WJV A;  3OE7 A;  3HAG A;  3B82 A;  2OTL B;  3WNB A;  1TLL A;  2XNC A;  4JMQ A;  2QMU A;  2X6W A;  1UD2 A;  2EIX A;  5FA6 A;  3QSY A;  4ZV4 A;  4P12 A;  4Z4R A;  3Q6R A;  4J0Q A;  1BX0 A;  1W87 A;  2ZBU A;  4GQN A;  4P1V A;  1N08 A;  4FK8 A;  4DNR B;  3U2Q A;  4PC3 A;  1ZM2 A;  3MCA A;  2JIZ A;  2ZIT A;  5IK2 A;  2J7K A;  5BSX A;  3JQR A;  4XON A;  2CC2 A;  5A88 A;  1SM4 A;  1M90 D;  4OP7 A;  4NBS A;  1PKV A;  1RQR A;  2BM0 A;  2XZP A;  1BX1 A;  2Q6K A;  5F4O A;  4X7C A;  2Q6I A;  1FX0 A;  1H8H A;  2BGI A;  2LZJ A;  4P3I A;  1Y0R A;  2BGJ A;  4YAF A;  1TTT A;  4CQJ A;  3CP8 A;  4IW3 B;  5IYW A;  2PIA A;  3BC9 A;  1UD4 A;  4X7D A;  1OGJ A;  2CK3 A;  1COW A;  2VBS A;  3BQJ A;  4P6Y A;  5DSZ A;  1G7R A;  2DER A;  3KL9 A;  3WXM A;  3H94 A;  4WWV A;  4OOS A;  1IB0 A;  3ZUG A;  2VJI A;  5H5J A;  3SJP A;  3VO2 A;  2F1M A;  5HZA A;  1EFR A;  1BLI A;  4TKO B;  1CNF A;  3W2G A;  1G7C A;  4M4S A;  3OEH A;  4WZK A;  3CC7 B;  4QUZ A;  4WZL A;  3OP1 A;  4AC9 A;  1UD3 A;  2D74 A;  4Z4T A;  1HA3 A;  1NDH A;  2NPF A;  1YIJ B;  3B78 A;  1W2B B;  1CQX A;  2GK6 A;  2BSA A;  1ELO A;  1Q81 D;  3MMP A;  2WZP P;  3WND A;  2I1L A;  2DEU A;  1WOR A;  1N0U A;  4YAO A;  2VNI A;  1WDT A;  1PJ6 A;  1KK1 A;  4E0F A;  2BN4 A;  1WSV A;  4KKS A;  2VYQ A;  1YJ9 B;  1T5E A;  1N0V C;  3OZU A;  2QTL A;  3W2H A;  3LQ6 A;  1KJZ A;  2QGG A;  4X0C A;  1YJW B;  4Y9R A;  1YIT B;  1E1Q A;  4NCN A;  3VR6 A;  5KNL A;  1DAR A;  3OZW A;  5HKK A;  1TVC A;  4ZCL A;  4XLC A;  2D3L A;  3Q38 A;  1ZUN B;  2GK7 A;  2ZZE A;  1EXM A;  5LMZ A;  3OOC A;  4DNT B;  4M1K A;  3QFT A;  1WSR A;  1MRZ A;  1VQN B;  5FIU A;  3W5V A;  3FJO A;  4PC7 A;  3WQZ A;  1WTH D;  3CCE B;  4OPO A;  5IYR A;  1OB5 A;  1QH0 A;  3V76 A;  1DDI A;  4ZGN B;  4B3G A;  2XND A;  3OZV A;  3U6K A;  3J81 k;  1EFU A;  4P22 A;  4M2L A;  4WQM A;  5GV7 A;  2XZO A;  1QG0 A;  2YWF A;  4XKV A;  1OB2 A;  2Z6B D;  1K73 D;  1A8P A;  1XFO A;  4ZCM A;  4X7F A;  1KD1 D;  3T53 B;  4YXW A;  2D9R A;  3A8I A;  3JQP A;  4RCZ A;  4XN0 A;  4ZGQ B;  1OHH A;  5JBQ A;  5TRD A;  4LBY A;  2BM1 A;  2V7T A;  4FWT A;  1BQE A;  4FXU A;  1E3X A;  5A8A A;  3W5H A;  4UAJ A;  3W5U A;  4RD2 A;  3AST A;  3CCV B;  3A8J A;  3AVX A;  2HLD A;  1U2R A;  3SJZ A;  4Z4Y A;  1I7P A;  2QE7 A;  2C78 A;  1UD6 A;  2KVO A;  3MHP A;  4RD3 A;  1F60 A;  4K1X A;  3ZC3 A;  1BPL A;  1T6X A;  2VBU A;  5AN9 A;  2C5H A;  2VNJ A;  1EFT A;  1N8R D;  3A3B A;  4OPS A;  1KK3 A;  2HCJ B;  2XGJ A;  3PA1 A;  3CCR B;  1WOP A;  2V7W A;  4U9U A;  4N3G A;  2ZL7 A;  5KW9 A;  2ZXI A;  3U6B A;  2GRE A;  1QUF A;  3BNW A;  2QDX A;  1AIP A;  3FPP A;  4MYU A;  4UZU A;  1N07 A;  3G6E B;  3AGQ A;  3BY2 A;  1YJN B;  1W0J A;  2RC5 A;  1S0U A;  3PVD A;  4ROX A;  3AVW A;  1EP3 B;  3CCL B;  5BSY A;  1VQO B;  3CC4 B;  3QFC A;  1KQS B;  3LNN A;  4RPD A;  3V7A A;  1UD8 A;  2V7V A;  4XL9 A;  1VQ5 B;  3CMA B;  3P27 A;  1Q86 D;  4RCY A;  2VJJ A;  2OBS A;  1E64 A;  1JB9 A;  2V7U A;  3KEW A;  1SKY B;  5F4M A;  1R5O A;  3P26 A;  1EFC A;  1WOS A;  2W6I A;  3CCU B;  2OBT A;  2Q6O A;  1JA1 A;  3Q6Q A;  1K28 D;  3T51 B;  4AF6 A;  2PLF A;  4XQF A;  3A3G A;  1KRH A;  3B8H A;  1QGZ A;  1FNB A;  4B43 A;  3A8K A;  4X7E A;  3G71 B;  1GR1 A;  3ASQ A;  3A35 A;  3T56 B;  1KTV A;  2DIE A;  2OBR A;  1P4M A;  1T6Z A;  4QV2 A;  3WYA A;  2V4D A;  2HDN B;  3JU4 A;  2F43 A;  4LBV A;  2CF4 A;  1ZM3 A;  1GJR A;  2GJP A;  4RJL A;  4WZT A;  2WPD A;  4DQK A;  2PMD A;  3CP2 A;  4TMT A;  4PC1 A;  1E3Z A;  1D2E A;  3QFR A;  1E43 A;  3W2I A;  3GIR A;  1MAB A;  3ZBU A;  4TMZ A;  1E63 A;  2QN6 A;  2VNH A;  1KC8 D;  1H8E A;  1QUE A;  2XZL A;  4P26 A;  4RDL A;  4X06 A;  1D1N A;  4HE6 A;  3SEJ A;  3D26 A;  2C2W A;  1QX4 A;  3OEE A;  3NE5 B;  1QVF B;  3WNC A;  1GAW A;  1E1R A;  3OAA A;  2QA4 B;  2AHO A;  1VQL B;  4G7X A;  4RDJ A;  3WBJ A;  4WZE A;  4C0S A;  1M1K D;  4BPR A;  1NJI D;  1K9M D;  3LQE A;  3OJX A;  1S4M A;  3VMF A;  2GJR A;  2VBV A;  4RLZ A;  1Q7Y D;  4Z4U A;  5CDF A;  1BJK A;  2GQF A;  2C4T A;  3BCD A;  1IJE A;  4QFM A;  5TV2 A;  1I18 A;  1OGI A;  4B3F X;  4B48 A;  3AVY A;  1KK0 A;  3GVL A;  4UZF A;  4B44 A;  2HMA A;  1KK2 A;  1WU8 A;  4P25 A;  4X05 A;  2X6Y A;  4LBZ A;  1NRK A;  2X0K A;  1JA0 A;  1VQ4 B;  4M0L A;  4YHB A;  5DN6 A;  1DG1 G;  3W2E A;  4XMY A;  4YAU A;  1SKQ A;  2V7Q A;  2R9V A;  4Z4Z A;  4Z1M A;  4Z4W A;  3CES A;  3R6J A;  2WZN A;  2ZTG A;  4OOX A;  3FKS A;  4XLH A;  3H9N A;  1B2R A;  1QFY A;  3ZZ0 A;  1QVG B;  2VBT A;  2XOK A;  3RY8 A;  4NNJ A;  4HIZ A;  4TN1 A;  2CBX A;  1FNM A;  2M5S A;  2DYI A;  2WYR A;  3VNV A;  5FL7 A;  4ACB A;  2D3N A;  3BCF A;  2ZBV A;  2ZTN A;  4PGO A;  1NB0 A;  1ZM4 A;  4RD6 A;  4XLE A;  3AVU A;  2BPO A;  3CCQ B;  4XR6 A;  3OW7 A;  1K8A D;  3QFS A;  4XLA A;  1KZL A;  3GVK A;  2F4N A;  1EP1 B;  3CCJ B;  4TSF A;  3ONY A;  5A89 A;  3CCM B;  3I1F A;  2JJ1 A;  4C43 A;  1W0K A;  2FVG A;  2X85 A;  4LBW A;  4TT3 A;  2BVN A;  3OPO A;  3ZIA A;  4DK0 A;  4MYT A;  4B4D A;  3ZPN A;  4Z4S A;  2FX3 A;  5J35 A;  3OW2 B;  3GVJ A;  5GV8 A;  1EWY A;  3LO8 A;  5DS0 A;  3CC2 B;  2DY1 A;  4P9S A;  4EH1 A;  3E1Y E;  4G1B A;  3ONU A;  4XLF A;  1IHM A;  1V0F A;  1NBM A;  2C77 A;  4G5G A;  3BY1 A;  2BMW A;  4X07 A;  4XN3 A;  2X53 S;  4RDK A;  1VLO A;  1VJS A;  5FO0 A;  4N3N A;  1UD5 A;  4YAW A;  5KSW B;  1JJ2 B;  2JDI A;  4F7D A;  3AGP A;  4RD1 A;  3WY9 A;  1D8T A;  2OYN A;  1J9Z A;  2ZXH A;  4YAL A;  5FNZ A;  2Q6L A;  4H9G A;  2ZL5 A;  2OTJ B;  4G7W A;  3ZBT A;  4KKU A;  4LC0 A;  2CRV A;  4QHY A;  5H59 A;  2X6X A;  2BF4 A;  4DK1 A;  1VF7 A;  2B7B A;  1VHO A;  1N05 A;  2WSS A;  1Q82 D;  4XNF A;  4ACA A;  3PUM A;  3ZZT A;  3VNU A;  1F20 A;  1OB0 A;  3ISX A;  5B6I A;  3CTA A;  1E79 A;  1BMF A;  4TMX A;  4XD7 A;  2DET A;  3PA2 A;  1HZE A;  3PEN A;  4L8J A;  3CME B;  2QTZ A;  1YHQ B;  2WR8 A;  1UMK A;  4AVZ A;  2XNJ A;  2ZZF A;  2JN9 A;  1QFZ A;  1VQ7 B;  2XEX A;  4P2N A;  3CPW B;  3ASS A;  4Z4V A;  1XE1 A;  2E1R A;  3ASR A;  3ZZU A;  2PE3 A;  3I56 B;  5FO1 A;  1FRN A;  1VQ9 B;  1H42 A;  4YEL A;  1ZM9 A;  1DDG A;  1GAQ A;  4RPB A;  3CD6 B;  3ASP A;  2DCU A;  1WPC A;  1W35 A;  2B5O A;  3SLN A;  3CPX A;  4R71 A; 
#chains in the Genus database with same CATH homology
 4OP7 A;  4OPS A;  4QVJ A;  5F4O A;  4X7C A;  3PA1 A;  5J3O A;  4P3I A;  4Z4Z A;  2ZL7 A;  4Z4W A;  3R6J A;  5KW9 A;  4OOX A;  5IYW A;  4X7D A;  3BQJ A;  4OPV A;  3RY8 A;  3BY2 A;  4P25 A;  3Q3A A;  3PVD A;  4OOS A;  4ROX A;  3SJP A;  5BSY A;  5F4J A;  5HZA A;  5IYR A;  4RPD A;  3V7A A;  4OOV A;  4WZK A;  5HZB A;  4QUZ A;  4WZL A;  3PUN A;  4Z4T A;  2ZL6 A;  2OBS A;  3Q39 A;  5E6T A;  5F4M A;  4QVA A;  3ONY A;  2OBT A;  3Q6Q A;  3SKB A;  4RM0 A;  3SLD A;  4X7E A;  5IYN A;  4Z4S A;  3ASQ A;  5J35 A;  2OBR A;  3LQ6 A;  4X0C A;  4QV2 A;  3ONU A;  1IHM A;  3BY1 A;  5IYQ A;  3Q38 A;  4X07 A;  4RDK A;  4WZT A;  3R6K A;  4OPO A;  2ZL5 A;  4P26 A;  4RDL A;  4X06 A;  3SEJ A;  5IYP A;  3D26 A;  4X7F A;  3PUM A;  3PA2 A;  4RDJ A;  4P12 A;  4WZE A;  4Z4R A;  3Q6R A;  3LQE A;  4P2N A;  4RLZ A;  4P1V A;  3ASS A;  4Z4U A;  3AST A;  4Z4V A;  3ASR A;  4Z4Y A;  4RPB A;  5BSX A;  3ASP A;  4X05 A;  3SLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...