3D26A

Norwalk p domain a-trisaccharide complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
287
structure length
284
Chain Sequence
b'PFTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSIATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGASSGPQQLPINGVFVFVSWVSRFYQLKPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 58 kd capsid protein
molecule tags Viral protein
source organism Norwalk virus
publication title Structural basis for the receptor binding specificity of Norwalk virus.
pubmed doi rcsb
total genus 60
structure length 284
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08435 Calici_coat_C Calicivirus coat protein C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3d26A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3d26A01
5KW9A 4OOSA 3SKBA 3SJPA 4RM0A 3V7AA 3PA2A 4RPDA 4QVAA 4RDLA 4Z4TA 4X7DA 3ASRA 5HZBA 5E6TA 3Q6RA 5J3OA 3BY1A 5IYWA 4WZEA 4RDKA 4Z4WA 4RDJA 4QV2A 3ONYA 5F4MA 4P3IA 4QVJA 4OP7A 4P2NA 5F4OA 4Z4VA 4X7FA 5IYQA 2ZL6A 3ASSA 4P26A 3LQEA 2ZL5A 3PA1A 4X05A 3ONUA 4OOXA 2OBSA 3Q38A 3BY2A 3Q6QA 4P12A 3R6JA 3ASQA 4X0CA 4OPOA 3SEJA 4WZLA 3ASTA 2OBRA 3PUNA 4QUZA 4RPBA 4Z4SA 4X7CA 4Z4RA 3Q39A 3R6KA 4WZTA 4Z4ZA 2ZL7A 3PUMA 4ROXA 4P1VA 5IYRA 3SLNA 3RY8A 4Z4YA 2OBTA 5IYPA 5BSYA 3BQJA 4Z4UA 4X06A 4P25A 3D26A 4OPVA 1IHMA 4OOVA 3PVDA 4X07A 4WZKA 5HZAA 4X7EA 5F4JA 4OPSA 3SLDA 3LQ6A 4RLZA 5J35A 5BSXA 3Q3AA 3ASPA 5IYNA
chains in the Genus database with same CATH superfamily
3A3GA 4PC6A 1VQLB 3SKBA 1QUFA 3ZBTA 1KMHA 3PA2A 4PC1A 2X6WA 4CQJA 1FX0A 1FNDA 4RDLA 1XFOA 3WBJA 3A8IA 3WQZA 4GQNA 2DCUA 1AMOA 3JQPA 4P6VF 3ZC3A 4B44A 4XLFA 2ZTNA 4HE5A 5TV2A 3ZZ0A 3BH4A 4XLEA 3CCMB 1VQMB 2X3UA 3OJXA 1H42A 3ZBUA 4IW3B 2DY1A 3CCUB 2ZXIA 3NE5B 3CTAA 2OK8A 1VLYA 3OZUA 2VNIA 4RDJA 1WP6A 1I8DA 4QV2A 1JJ2B 3B78A 3W2GA 3CCSB 3CXCB 1RQPA 1KK2A 2XEXA 3ONYA 4XLCA 1KJZA 4P3IA 4L8JA 4OP7A 4QVJA 1BMFA 1EP1B 1CQXA 3T51B 3OEEA 3WYAA 1T5EA 1G7RA 1VQPB 1SKYB 4NNJA 2E1BA 1FDRA 5TY0A 1W2BB 3QE2A 1QX4A 4P26A 4RD6A 1I7PA 2QA4B 2HMAA 1VHOA 2VJIA 3PA1A 2OTLB 2BV3A 3W2FA 1J9ZA 2V7WA 1KQSB 1N05A 3PENA 1VQNB 3SJZA 4XN0A 3CMMA 4ZCIA 1NRKA 4M2LA 1FNCA 2F1LA 1Q7YD 4WZLA 4PC2A 3AVTA 3AGPA 3ASTA 1EFRA 2WZNA 2ZXHA 4Y9UA 1OB0A 1BX1A 4TN1A 1YX2A 4ZCLA 1EFUA 1OGJA 3W5HA 1WSRA 1BQEA 3CPWB 1T6XA 3Q39A 2BM1A 1E64A 2VBVA 4WZTA 4JMQA 1DDGA 4Z4ZA 1E43A 2QEXB 1W35A 1G7TA 3ZIAA 1CNEA 3PUMA 2QMUA 3RY8A 1SKQA 4KKTA 4RD2A 1R5OA 1I18A 4MYTA 2V7XA 2D74A 3OJWA 1EWYA 4HIZA 4OOVA 4PC3A 1YJ9B 1PJ6A 1NBMA 1W34A 3GQBA 1TTTA 3W2EA 4YAUA 4G6IA 2V4DA 1GR1A 3DDYA 5GV8A 1G7CA 3CC7B 1JA1A 1N08A 4RLZA 1EFTA 1V5VA 4N3GA 5DSZA 2XNCA 1YIJB 2GREA 4ZGNB 3CCQB 3A1PA 1UD5A 2GJPA 2X6XA 1VQOB 1ZM3A 4RJLA 1DDIA 5HXBA 3GVKA 4II2A 4ZV4A 3SJPA 2XNDA 3CESA 4WQMA 1N06A 4YHBA 3ZPNA 1UD3A 2W6JA 4LBWA 4EH1A 4R71A 3BC9A 1RQRA 1P4MA 2FX3A 4Z4TA 1ZM2A 4RD0A 2QGGA 2VBUA 1K8AD 2X53S 3VO1A 2PMDA 4M4SA 4X7DA 4XKWA 3ASRA 5H5JA 2B5OA 3MCAA 5IYWA 4UZEA 5KSWB 3A35A 3WNCA 1BPLA 5H59A 4XNFA 2CF4A 2PE3A 2HCJB 3JQQA 3AGQA 5F4MA 5LMZA 4WWVA 1KK3A 4B48A 5AN9A 1WOSA 2VJJA 2YWFA 1Q81D 2KVOA 2QN6A 5FO0A 4YAFA 3GIRA 5IYQA 2FVGA 1UD8A 1B2RA 3ASSA 2AHOA 3A8JA 4B4DA 4X05A 5CDFA 3CMAB 3LNNA 2OBSA 3BY2A 4II3A 3W2IA 2WSSA 2WR8A 4XQFA 2VNKA 5TR9A 2ZZEA 4DNRB 4KKSA 4PABA 1YLOA 2V7QA 1G7SA 1VQ4B 1N07A 3BCDA 3VO2A 1ELOA 2QTZA 3LVBA 2OBRA 2E1RA 1WSVA 4U9UA 3BNWA 4Z4SA 1TVCA 1GJRA 4TMTA 2VNJA 1YJWB 1T6ZA 2BF4A 4RCYA 1Q86D 3OOCA 4FXUA 2WJYA 2X8KA 3W5VA 1WPCA 2C5HA 1W0JA 2D3LA 4N3NA 2V7UA 1AIPA 1UD2A 3I56B 4RD3A 2GPJA 4ROXA 5IYRA 4FK8A 3SLNA 3CC4B 2BM0A 1OB2A 2Q6OA 3CW2A 4Q7JB 1HZEA 1DARA 4M53A 4E0FA 4B3XA 5BSYA 1NB0A 3G4SB 2M5SA 4FWTA 3I1FA 1K73D 5GV7A 2YWHA 2P3MA 2F1MA 3QFTA 2Q6KA 3D26A 1WOPA 1GVHA 2ZZGA 3PVDA 3ZUGA 1KC8D 4WZKA 3V76A 1F20A 4XR6A 1R5BA 1VF7A 4ACAA 2JJ2A 3VNUA 3VR6A 4ASUA 1M1KD 5TRDA 2VNHA 5BSXA 3OFNA 3Q3AA 4ZCMA 1PJ5A 3WNBA 3B82A 1QVGB 1KK0A 2CC2A 4G7XA 1PJ7A 2ZZQA 4OOSA 1Q82D 2GQFA 3CCJB 4G1VA 4ACBA 1HA3A 4RM0A 3GVLA 4XL9A 4H9GA 4RPDA 3W2HA 3AVXA 3VMFA 2ZZFA 5A89A 1ZUNB 3P26A 1WOOA 4LBYA 3CCLB 4P9SA 1QFZA 1COWA 5FA6A 2CBXA 2CK3A 4F7DA 4TMXA 1HVXA 1VQKB 2V7VA 1IB0A 4AC9A 1VQ9B 1MRZA 1ZM9A 2B7CA 3OW2B 3AVWA 3CP8A 3GVJA 4DNTB 1WU8A 1GO2A 4DK0A 2LZJA 4WZEA 4X8IA 1GAQA 3JU4A 1KD1D 4M0LA 4M1KA 5JBQA 4FN5A 2WZPP 4Z4WA 3OAAA 2C77A 3OZWA 4YEJA 5L46A 3U6BA 2BGIA 2I1LA 1BX0A 4XONA 2XOKA 4DK1A 1W0KA 2C5BA 2V7TA 5F4OA 1S4MA 3KEWA 4AVZA 3U6KA 3CRZA 1JA0A 3FPPA 4XM3A 1FNBA 4Z4VA 2NV4A 5THXA 4P22A 4X7FA 1H8HA 2NPFA 3QSYA 1FNMA 2HLDA 1KTVA 2C78A 5FL7A 3AVVA 1QFJA 2DIEA 2ZL6A 2JIZA 3BCFA 1B23P 1IJEA 1U2RA 2CRVA 2GJRA 2J7KA 2ZL5A 3MHPA 4NBSA 4Y7CA 1VQ5B 4YALA 3ONUA 2GJKA 3Q38A 5EMNA 4XLHA 2F4NA 1BJKA 4B43A 4DQLA 2QTLA 3R6JA 3ASQA 1BLIA 3FJOA 4OPOA 5IK2A 3ZZTA 2DYIA 2YWEA 4G7WA 2PIAA 4TMWA 3VNVA 4XN3A 1VQ6B 1QH0A 2PLFA 4LC0A 3U2QA 1Q9SA 3PUNA 4QUZA 1WORA 5A8AA 1OHHA 1V0FA 2D9RA 4UZUA 1UD4A 3AVYA 1S0UA 1QGAA 3GSIA 5KNLA 1XQBA 1A8PA 2C4TA 4Y9RA 4RCZA 4HE6A 4YXWA 3HAGA 1WDTA 2Q6LA 2D3NA 4XOPA 3OE7A 3CMEB 4RD4A 1ZM4A 4XOTA 4XORA 3CPXA 3B8HA 1E62A 4XLAA 1D8TA 1K9MD 4B47A 2RC6A 1YI2B 2DERA 1TLLA 1VJSA 3G05A 5FIUA 4Z4YA 2XZOA 3ISXA 1KK1A 3A3BA 4P3YA 3BQJA 1N8RD 2XNJA 1Y0YA 2ZITA 1NDHA 4Z4UA 2VYQA 2V31A 1D1NA 1CNFA 4OPVA 1EXMA 3CC2B 1E79A 4QHYA 4TSFA 2DEUA 4X07A 1H85A 2F43A 4P6YA 3LO8A 4QFMA 1OB5A 3CCRB 3G71B 1QGYA 5F4JA 1T6YA 4OPSA 2BSAA 3SLDA 3LQ6A 2JDIA 3OEHA 4PAAA 4TMZA 3FKSA 4YAOA 3CP2A 3H94A 1Y0RA 2WJVA 3ASPA 4B3GA 5KW9A 1S72B 2BPOA 1QUEA 3CB4A 5A88A 2JJ1A 2X6YA 2ZBVA 1E63A 3V7AA 3CCEB 3OKXA 2XZLA 1VQ7B 4B3FX 4QVAA 2OK7A 4XMYA 2HDNB 3H9NA 2R6HA 1F60A 4PGOA 3WXMA 2OTJB 1W87A 2C2WA 3J81k 4YAWA 3OP1A 3WNDA 4BPRA 2YWGA 1GAWA 5J3OA 4ZGQB 1KZLA 2EIXA 3Q6RA 3BY1A 5E6TA 3WY9A 5HZBA 1YITB 1WTHD 2Z6BD 1YHQB 4RDKA 3WBKA 1PKVA 3QFRA 3W5UA 2OYNA 1NB9A 4RD1A 3G6EB 1EP2B 2GK7A 3ES9A 3FPKA 2BMWA 2B7BA 2BGJA 1JNYA 2VBTA 3KL9A 4G5GA 1N0VC 4P2NA 2DOGA 1VHEA 1D2EA 4G1BA 4UAJA 4PC7A 3QFSA 5B6IA 1SM4A 2R9VA 1R5NA 2QDXA 2RC5A 4YELA 1QVFB 3P27A 3LQEA 3QFCA 1N0UA 1XB2A 1V0EA 1E3ZA 1EP3B 4XKVA 3T56B 4OOXA 4UZFA 2JN9A 1QGZA 3E1YE 1DG1G 5HKKA 2C4UA 3Q6QA 3CD6B 2WYRA 1QFYA 4TMVA 4C43A 4P12A 1YJNB 4X0CA 3E20A 3SEJA 3T53B 1E1QA 5DN6A 2X85A 2CNDA 1MABA 1OGIA 4KKUA 2QE7A 4MYUA 1W9XA 1FRNA 3OW7A 4RPBA 2VBSA 3MMPA 3AVUA 2X0KA 2BVNA 1FRQA 4XD7A 3I55B 1M90D 5FO1A 3OZVA 4Z1MA 3OPOA 4X7CA 4Z4RA 3R6KA 2GK6A 2XGJA 2ZL7A 1NJID 1IJFA 1H8EA 2VZLA 2ZBUA 4P1VA 5FNZA 3A8KA 4J0QA 4NCNA 4LBVA 4AF7A 2OBTA 5IYPA 2Q6IA 2EFGA 2W6IA 2ZTGA 1UD6A 1K28D 2BN4A 1E1RA 4X06A 4P25A 4TKOB 1VQ8B 1IHMA 1JB9A 1VLOA 4AF6A 5DS0A 1XE1A 1KRHA 4K1XA 5HZAA 4X7EA 2WPDA 1QG0A 1UMKA 5J35A 2XZPA 3ZZUA 2DETA 1TUIA 3CCVB 1EFCA 4DQKA 4TT3A 1E3XA 3JQRA 2CW5A 5IYNA 4C0SA 4LBZA
chains in the Genus database with same CATH topology
5KW9A 4OOSA 3SKBA 3SJPA 4RM0A 3V7AA 3PA2A 4RPDA 4QVAA 4RDLA 4Z4TA 4X7DA 3ASRA 5HZBA 5E6TA 3Q6RA 5J3OA 3BY1A 5IYWA 4WZEA 4RDKA 4Z4WA 4RDJA 4QV2A 3ONYA 5F4MA 4P3IA 4QVJA 4OP7A 4P2NA 5F4OA 4Z4VA 4X7FA 5IYQA 2ZL6A 3ASSA 4P26A 3LQEA 2ZL5A 3PA1A 4X05A 3ONUA 4OOXA 2OBSA 3Q38A 3BY2A 3Q6QA 4P12A 3R6JA 3ASQA 4X0CA 4OPOA 3SEJA 4WZLA 3ASTA 2OBRA 3PUNA 4QUZA 4RPBA 4Z4SA 4X7CA 4Z4RA 3Q39A 3R6KA 4WZTA 4Z4ZA 2ZL7A 3PUMA 4ROXA 4P1VA 5IYRA 3SLNA 3RY8A 4Z4YA 2OBTA 5IYPA 5BSYA 3BQJA 4Z4UA 4X06A 4P25A 3D26A 4OPVA 1IHMA 4OOVA 3PVDA 4X07A 4WZKA 5HZAA 4X7EA 5F4JA 4OPSA 3SLDA 3LQ6A 4RLZA 5J35A 5BSXA 3Q3AA 3ASPA 5IYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KW9 A;  4OOS A;  3SKB A;  3SJP A;  4RM0 A;  3V7A A;  3PA2 A;  4RPD A;  4QVA A;  4RDL A;  4Z4T A;  4X7D A;  3ASR A;  5HZB A;  5E6T A;  3Q6R A;  5J3O A;  3BY1 A;  5IYW A;  4WZE A;  4RDK A;  4Z4W A;  4RDJ A;  4QV2 A;  3ONY A;  5F4M A;  4P3I A;  4QVJ A;  4OP7 A;  4P2N A;  5F4O A;  4Z4V A;  4X7F A;  5IYQ A;  2ZL6 A;  3ASS A;  4P26 A;  3LQE A;  2ZL5 A;  3PA1 A;  4X05 A;  3ONU A;  4OOX A;  2OBS A;  3Q38 A;  3BY2 A;  3Q6Q A;  4P12 A;  3R6J A;  3ASQ A;  4X0C A;  4OPO A;  3SEJ A;  4WZL A;  3AST A;  2OBR A;  3PUN A;  4QUZ A;  4RPB A;  4Z4S A;  4X7C A;  4Z4R A;  3Q39 A;  3R6K A;  4WZT A;  4Z4Z A;  2ZL7 A;  3PUM A;  4ROX A;  4P1V A;  5IYR A;  3SLN A;  3RY8 A;  4Z4Y A;  2OBT A;  5IYP A;  5BSY A;  3BQJ A;  4Z4U A;  4X06 A;  4P25 A;  3D26 A;  4OPV A;  1IHM A;  4OOV A;  3PVD A;  4X07 A;  4WZK A;  5HZA A;  4X7E A;  5F4J A;  4OPS A;  3SLD A;  3LQ6 A;  4RLZ A;  5J35 A;  5BSX A;  3Q3A A;  3ASP A;  5IYN A; 
#chains in the Genus database with same CATH topology
 3A3G A;  4PC6 A;  1VQL B;  3SKB A;  1QUF A;  3ZBT A;  1KMH A;  3PA2 A;  4PC1 A;  2X6W A;  4CQJ A;  1FX0 A;  1FND A;  4RDL A;  1XFO A;  3WBJ A;  3A8I A;  3WQZ A;  4GQN A;  2DCU A;  1AMO A;  3JQP A;  4P6V F;  3ZC3 A;  4B44 A;  4XLF A;  2ZTN A;  4HE5 A;  5TV2 A;  3ZZ0 A;  3BH4 A;  4XLE A;  3CCM B;  1VQM B;  2X3U A;  3OJX A;  1H42 A;  3ZBU A;  4IW3 B;  2DY1 A;  3CCU B;  2ZXI A;  3NE5 B;  3CTA A;  2OK8 A;  1VLY A;  3OZU A;  2VNI A;  4RDJ A;  1WP6 A;  1I8D A;  4QV2 A;  1JJ2 B;  3B78 A;  3W2G A;  3CCS B;  3CXC B;  1RQP A;  1KK2 A;  2XEX A;  3ONY A;  4XLC A;  1KJZ A;  4P3I A;  4L8J A;  4OP7 A;  4QVJ A;  1BMF A;  1EP1 B;  1CQX A;  3T51 B;  3OEE A;  3WYA A;  1T5E A;  1G7R A;  1VQP B;  1SKY B;  4NNJ A;  2E1B A;  1FDR A;  5TY0 A;  1W2B B;  3QE2 A;  1QX4 A;  4P26 A;  4RD6 A;  1I7P A;  2QA4 B;  2HMA A;  1VHO A;  2VJI A;  3PA1 A;  2OTL B;  2BV3 A;  3W2F A;  1J9Z A;  2V7W A;  1KQS B;  1N05 A;  3PEN A;  1VQN B;  3SJZ A;  4XN0 A;  3CMM A;  4ZCI A;  1NRK A;  4M2L A;  1FNC A;  2F1L A;  1Q7Y D;  4WZL A;  4PC2 A;  3AVT A;  3AGP A;  3AST A;  1EFR A;  2WZN A;  2ZXH A;  4Y9U A;  1OB0 A;  1BX1 A;  4TN1 A;  1YX2 A;  4ZCL A;  1EFU A;  1OGJ A;  3W5H A;  1WSR A;  1BQE A;  3CPW B;  1T6X A;  3Q39 A;  2BM1 A;  1E64 A;  2VBV A;  4WZT A;  4JMQ A;  1DDG A;  4Z4Z A;  1E43 A;  2QEX B;  1W35 A;  1G7T A;  3ZIA A;  1CNE A;  3PUM A;  2QMU A;  3RY8 A;  1SKQ A;  4KKT A;  4RD2 A;  1R5O A;  1I18 A;  4MYT A;  2V7X A;  2D74 A;  3OJW A;  1EWY A;  4HIZ A;  4OOV A;  4PC3 A;  1YJ9 B;  1PJ6 A;  1NBM A;  1W34 A;  3GQB A;  1TTT A;  3W2E A;  4YAU A;  4G6I A;  2V4D A;  1GR1 A;  3DDY A;  5GV8 A;  1G7C A;  3CC7 B;  1JA1 A;  1N08 A;  4RLZ A;  1EFT A;  1V5V A;  4N3G A;  5DSZ A;  2XNC A;  1YIJ B;  2GRE A;  4ZGN B;  3CCQ B;  3A1P A;  1UD5 A;  2GJP A;  2X6X A;  1VQO B;  1ZM3 A;  4RJL A;  1DDI A;  5HXB A;  3GVK A;  4II2 A;  4ZV4 A;  3SJP A;  2XND A;  3CES A;  4WQM A;  1N06 A;  4YHB A;  3ZPN A;  1UD3 A;  2W6J A;  4LBW A;  4EH1 A;  4R71 A;  3BC9 A;  1RQR A;  1P4M A;  2FX3 A;  4Z4T A;  1ZM2 A;  4RD0 A;  2QGG A;  2VBU A;  1K8A D;  2X53 S;  3VO1 A;  2PMD A;  4M4S A;  4X7D A;  4XKW A;  3ASR A;  5H5J A;  2B5O A;  3MCA A;  5IYW A;  4UZE A;  5KSW B;  3A35 A;  3WNC A;  1BPL A;  5H59 A;  4XNF A;  2CF4 A;  2PE3 A;  2HCJ B;  3JQQ A;  3AGQ A;  5F4M A;  5LMZ A;  4WWV A;  1KK3 A;  4B48 A;  5AN9 A;  1WOS A;  2VJJ A;  2YWF A;  1Q81 D;  2KVO A;  2QN6 A;  5FO0 A;  4YAF A;  3GIR A;  5IYQ A;  2FVG A;  1UD8 A;  1B2R A;  3ASS A;  2AHO A;  3A8J A;  4B4D A;  4X05 A;  5CDF A;  3CMA B;  3LNN A;  2OBS A;  3BY2 A;  4II3 A;  3W2I A;  2WSS A;  2WR8 A;  4XQF A;  2VNK A;  5TR9 A;  2ZZE A;  4DNR B;  4KKS A;  4PAB A;  1YLO A;  2V7Q A;  1G7S A;  1VQ4 B;  1N07 A;  3BCD A;  3VO2 A;  1ELO A;  2QTZ A;  3LVB A;  2OBR A;  2E1R A;  1WSV A;  4U9U A;  3BNW A;  4Z4S A;  1TVC A;  1GJR A;  4TMT A;  2VNJ A;  1YJW B;  1T6Z A;  2BF4 A;  4RCY A;  1Q86 D;  3OOC A;  4FXU A;  2WJY A;  2X8K A;  3W5V A;  1WPC A;  2C5H A;  1W0J A;  2D3L A;  4N3N A;  2V7U A;  1AIP A;  1UD2 A;  3I56 B;  4RD3 A;  2GPJ A;  4ROX A;  5IYR A;  4FK8 A;  3SLN A;  3CC4 B;  2BM0 A;  1OB2 A;  2Q6O A;  3CW2 A;  4Q7J B;  1HZE A;  1DAR A;  4M53 A;  4E0F A;  4B3X A;  5BSY A;  1NB0 A;  3G4S B;  2M5S A;  4FWT A;  3I1F A;  1K73 D;  5GV7 A;  2YWH A;  2P3M A;  2F1M A;  3QFT A;  2Q6K A;  3D26 A;  1WOP A;  1GVH A;  2ZZG A;  3PVD A;  3ZUG A;  1KC8 D;  4WZK A;  3V76 A;  1F20 A;  4XR6 A;  1R5B A;  1VF7 A;  4ACA A;  2JJ2 A;  3VNU A;  3VR6 A;  4ASU A;  1M1K D;  5TRD A;  2VNH A;  5BSX A;  3OFN A;  3Q3A A;  4ZCM A;  1PJ5 A;  3WNB A;  3B82 A;  1QVG B;  1KK0 A;  2CC2 A;  4G7X A;  1PJ7 A;  2ZZQ A;  4OOS A;  1Q82 D;  2GQF A;  3CCJ B;  4G1V A;  4ACB A;  1HA3 A;  4RM0 A;  3GVL A;  4XL9 A;  4H9G A;  4RPD A;  3W2H A;  3AVX A;  3VMF A;  2ZZF A;  5A89 A;  1ZUN B;  3P26 A;  1WOO A;  4LBY A;  3CCL B;  4P9S A;  1QFZ A;  1COW A;  5FA6 A;  2CBX A;  2CK3 A;  4F7D A;  4TMX A;  1HVX A;  1VQK B;  2V7V A;  1IB0 A;  4AC9 A;  1VQ9 B;  1MRZ A;  1ZM9 A;  2B7C A;  3OW2 B;  3AVW A;  3CP8 A;  3GVJ A;  4DNT B;  1WU8 A;  1GO2 A;  4DK0 A;  2LZJ A;  4WZE A;  4X8I A;  1GAQ A;  3JU4 A;  1KD1 D;  4M0L A;  4M1K A;  5JBQ A;  4FN5 A;  2WZP P;  4Z4W A;  3OAA A;  2C77 A;  3OZW A;  4YEJ A;  5L46 A;  3U6B A;  2BGI A;  2I1L A;  1BX0 A;  4XON A;  2XOK A;  4DK1 A;  1W0K A;  2C5B A;  2V7T A;  5F4O A;  1S4M A;  3KEW A;  4AVZ A;  3U6K A;  3CRZ A;  1JA0 A;  3FPP A;  4XM3 A;  1FNB A;  4Z4V A;  2NV4 A;  5THX A;  4P22 A;  4X7F A;  1H8H A;  2NPF A;  3QSY A;  1FNM A;  2HLD A;  1KTV A;  2C78 A;  5FL7 A;  3AVV A;  1QFJ A;  2DIE A;  2ZL6 A;  2JIZ A;  3BCF A;  1B23 P;  1IJE A;  1U2R A;  2CRV A;  2GJR A;  2J7K A;  2ZL5 A;  3MHP A;  4NBS A;  4Y7C A;  1VQ5 B;  4YAL A;  3ONU A;  2GJK A;  3Q38 A;  5EMN A;  4XLH A;  2F4N A;  1BJK A;  4B43 A;  4DQL A;  2QTL A;  3R6J A;  3ASQ A;  1BLI A;  3FJO A;  4OPO A;  5IK2 A;  3ZZT A;  2DYI A;  2YWE A;  4G7W A;  2PIA A;  4TMW A;  3VNV A;  4XN3 A;  1VQ6 B;  1QH0 A;  2PLF A;  4LC0 A;  3U2Q A;  1Q9S A;  3PUN A;  4QUZ A;  1WOR A;  5A8A A;  1OHH A;  1V0F A;  2D9R A;  4UZU A;  1UD4 A;  3AVY A;  1S0U A;  1QGA A;  3GSI A;  5KNL A;  1XQB A;  1A8P A;  2C4T A;  4Y9R A;  4RCZ A;  4HE6 A;  4YXW A;  3HAG A;  1WDT A;  2Q6L A;  2D3N A;  4XOP A;  3OE7 A;  3CME B;  4RD4 A;  1ZM4 A;  4XOT A;  4XOR A;  3CPX A;  3B8H A;  1E62 A;  4XLA A;  1D8T A;  1K9M D;  4B47 A;  2RC6 A;  1YI2 B;  2DER A;  1TLL A;  1VJS A;  3G05 A;  5FIU A;  4Z4Y A;  2XZO A;  3ISX A;  1KK1 A;  3A3B A;  4P3Y A;  3BQJ A;  1N8R D;  2XNJ A;  1Y0Y A;  2ZIT A;  1NDH A;  4Z4U A;  2VYQ A;  2V31 A;  1D1N A;  1CNF A;  4OPV A;  1EXM A;  3CC2 B;  1E79 A;  4QHY A;  4TSF A;  2DEU A;  4X07 A;  1H85 A;  2F43 A;  4P6Y A;  3LO8 A;  4QFM A;  1OB5 A;  3CCR B;  3G71 B;  1QGY A;  5F4J A;  1T6Y A;  4OPS A;  2BSA A;  3SLD A;  3LQ6 A;  2JDI A;  3OEH A;  4PAA A;  4TMZ A;  3FKS A;  4YAO A;  3CP2 A;  3H94 A;  1Y0R A;  2WJV A;  3ASP A;  4B3G A;  5KW9 A;  1S72 B;  2BPO A;  1QUE A;  3CB4 A;  5A88 A;  2JJ1 A;  2X6Y A;  2ZBV A;  1E63 A;  3V7A A;  3CCE B;  3OKX A;  2XZL A;  1VQ7 B;  4B3F X;  4QVA A;  2OK7 A;  4XMY A;  2HDN B;  3H9N A;  2R6H A;  1F60 A;  4PGO A;  3WXM A;  2OTJ B;  1W87 A;  2C2W A;  3J81 k;  4YAW A;  3OP1 A;  3WND A;  4BPR A;  2YWG A;  1GAW A;  5J3O A;  4ZGQ B;  1KZL A;  2EIX A;  3Q6R A;  3BY1 A;  5E6T A;  3WY9 A;  5HZB A;  1YIT B;  1WTH D;  2Z6B D;  1YHQ B;  4RDK A;  3WBK A;  1PKV A;  3QFR A;  3W5U A;  2OYN A;  1NB9 A;  4RD1 A;  3G6E B;  1EP2 B;  2GK7 A;  3ES9 A;  3FPK A;  2BMW A;  2B7B A;  2BGJ A;  1JNY A;  2VBT A;  3KL9 A;  4G5G A;  1N0V C;  4P2N A;  2DOG A;  1VHE A;  1D2E A;  4G1B A;  4UAJ A;  4PC7 A;  3QFS A;  5B6I A;  1SM4 A;  2R9V A;  1R5N A;  2QDX A;  2RC5 A;  4YEL A;  1QVF B;  3P27 A;  3LQE A;  3QFC A;  1N0U A;  1XB2 A;  1V0E A;  1E3Z A;  1EP3 B;  4XKV A;  3T56 B;  4OOX A;  4UZF A;  2JN9 A;  1QGZ A;  3E1Y E;  1DG1 G;  5HKK A;  2C4U A;  3Q6Q A;  3CD6 B;  2WYR A;  1QFY A;  4TMV A;  4C43 A;  4P12 A;  1YJN B;  4X0C A;  3E20 A;  3SEJ A;  3T53 B;  1E1Q A;  5DN6 A;  2X85 A;  2CND A;  1MAB A;  1OGI A;  4KKU A;  2QE7 A;  4MYU A;  1W9X A;  1FRN A;  3OW7 A;  4RPB A;  2VBS A;  3MMP A;  3AVU A;  2X0K A;  2BVN A;  1FRQ A;  4XD7 A;  3I55 B;  1M90 D;  5FO1 A;  3OZV A;  4Z1M A;  3OPO A;  4X7C A;  4Z4R A;  3R6K A;  2GK6 A;  2XGJ A;  2ZL7 A;  1NJI D;  1IJF A;  1H8E A;  2VZL A;  2ZBU A;  4P1V A;  5FNZ A;  3A8K A;  4J0Q A;  4NCN A;  4LBV A;  4AF7 A;  2OBT A;  5IYP A;  2Q6I A;  2EFG A;  2W6I A;  2ZTG A;  1UD6 A;  1K28 D;  2BN4 A;  1E1R A;  4X06 A;  4P25 A;  4TKO B;  1VQ8 B;  1IHM A;  1JB9 A;  1VLO A;  4AF6 A;  5DS0 A;  1XE1 A;  1KRH A;  4K1X A;  5HZA A;  4X7E A;  2WPD A;  1QG0 A;  1UMK A;  5J35 A;  2XZP A;  3ZZU A;  2DET A;  1TUI A;  3CCV B;  1EFC A;  4DQK A;  4TT3 A;  1E3X A;  3JQR A;  2CW5 A;  5IYN A;  4C0S A;  4LBZ A; 
#chains in the Genus database with same CATH homology
 5KW9 A;  4OOS A;  3SKB A;  3SJP A;  4RM0 A;  3V7A A;  3PA2 A;  4RPD A;  4QVA A;  4RDL A;  4Z4T A;  4X7D A;  3ASR A;  5HZB A;  5E6T A;  3Q6R A;  5J3O A;  3BY1 A;  5IYW A;  4WZE A;  4RDK A;  4Z4W A;  4RDJ A;  4QV2 A;  3ONY A;  5F4M A;  4P3I A;  4QVJ A;  4OP7 A;  4P2N A;  5F4O A;  4Z4V A;  4X7F A;  5IYQ A;  2ZL6 A;  3ASS A;  4P26 A;  3LQE A;  2ZL5 A;  3PA1 A;  4X05 A;  3ONU A;  4OOX A;  2OBS A;  3Q38 A;  3BY2 A;  3Q6Q A;  4P12 A;  3R6J A;  3ASQ A;  4X0C A;  4OPO A;  3SEJ A;  4WZL A;  3AST A;  2OBR A;  3PUN A;  4QUZ A;  4RPB A;  4Z4S A;  4X7C A;  4Z4R A;  3Q39 A;  3R6K A;  4WZT A;  4Z4Z A;  2ZL7 A;  3PUM A;  4ROX A;  4P1V A;  5IYR A;  3SLN A;  3RY8 A;  4Z4Y A;  2OBT A;  5IYP A;  5BSY A;  3BQJ A;  4Z4U A;  4X06 A;  4P25 A;  3D26 A;  4OPV A;  1IHM A;  4OOV A;  3PVD A;  4X07 A;  4WZK A;  5HZA A;  4X7E A;  5F4J A;  4OPS A;  3SLD A;  3LQ6 A;  4RLZ A;  5J35 A;  5BSX A;  3Q3A A;  3ASP A;  5IYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...