5IYNA

Protruding domain of gii.4 human norovirus chdc2094
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
305
structure length
303
Chain Sequence
KPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTTQLSAVNICNFRGDVTRVGISHDYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGLLTQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDGHQNEPQQWVLPNYSGTSGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDCLLPQEWVSHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVIPPNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords VP1
publication title Four decades of structural evolution of GII.4 norovirus
rcsb
source organism Norovirus hu/gii.4/chdc2094/1974/us
total genus 69
structure length 303
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5iynA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5iynA01
3RY8A 3D26A 3LQ6A 4RDKA 3PVDA 3PUMA 4RM0A 4WZKA 5IYPA 4OPVA 2ZL5A 5IYNA 4OOVA 4P26A 4RDJA 4X05A 3SLDA 4P25A 5HZBA 4Z4SA 4X06A 4WZEA 2OBRA 4QVJA 3Q3AA 4X07A 4OP7A 3SKBA 3SLNA 4P3IA 3LQEA 3ASPA 4P12A 4QVAA 4RPBA 4Z4RA 3R6JA 3BY2A 3PA1A 3R6KA 4WZLA 5F4OA 3ONYA 5J35A 4RDLA 4X7FA 4OPSA 3SJPA 4ROXA 3ASRA 3V7AA 3SEJA 3ASTA 5J3OA 3PA2A 4X7CA 4X7DA 4RLZA 2OBSA 3Q6RA 2ZL6A 5BSXA 5BSYA 4OOXA 4RPDA 4P1VA 2ZL7A 3BQJA 4Z4ZA 4X7EA 3ASQA 3ASSA 5F4JA 4QUZA 4X0CA 3BY1A 1IHMA 4Z4WA 3PUNA 4OOSA 5IYWA 3Q38A 4Z4TA 5E6TA 5KW9A 3ONUA 3Q6QA 4Z4YA 5HZAA 2OBTA 4QV2A 5IYQA 5F4MA 4WZTA 3Q39A 4OPOA 4Z4UA 4P2NA 5IYRA 4Z4VA
chains in the Genus database with same CATH superfamily
1YJWB 3FKSA 4DNTB 2XNJA 5H5JA 3U2QA 1YJNB 2KVOA 1KQSB 3PVDA 4XONA 3PUMA 4TSFA 1QFYA 3WBKA 3B82A 2F1MA 5IYPA 2P3MA 1XB2A 4DQKA 1BJKA 1G7CA 1YJ9B 2ZTNA 1KTVA 1KK1A 2C77A 3SLDA 3CCEB 4B47A 4HE6A 1E1RA 5HZBA 2DETA 1GVHA 1QVFB 1VHEA 2B7CA 1EP3B 1I7PA 2JN9A 4X07A 4XD7A 1KD1D 2OK7A 1WPCA 4P3IA 1SKQA 2XZOA 1BQEA 3CP8A 2QDXA 4MYTA 3WYAA 4B48A 2E1RA 1MRZA 3CB4A 3CCQB 3LO8A 1KK2A 1S4MA 1UD5A 2HLDA 2X53S 1HVXA 2YWFA 1EP2B 2ZXHA 1JA0A 4PC1A 3T51B 3JQQA 3ZPNA 4AVZA 2F43A 3ASRA 4U9UA 4AC9A 1ZM4A 2OK8A 3VNVA 1ELOA 1KK3A 1HA3A 1OB0A 1QFJA 2BV3A 3LNNA 1PJ7A 1E63A 3W2FA 3CCMB 5DS0A 3BNWA 4RD2A 2Q6IA 2ZITA 1Y0RA 4ASUA 1B23P 2QN6A 1YHQB 3AVXA 1B2RA 2CNDA 5BSXA 3GSIA 2QMUA 4N3NA 1JA1A 4OOXA 3GQBA 4LBYA 2BSAA 1NRKA 2X8KA 1AMOA 4JMQA 1V0FA 2LZJA 1H8EA 4HIZA 3WQZA 4Y9RA 3VMFA 1AIPA 3BQJA 2C2WA 1KRHA 5FIUA 4B44A 1VQOB 4UAJA 5TR9A 4XL9A 1EFTA 2QE7A 3P26A 1NB9A 3ZC3A 3ZZTA 3WNBA 4PC7A 4YAFA 4UZUA 1E43A 4X0CA 4B43A 4YAUA 1U2RA 2C4TA 3Q38A 4XN3A 4Z4TA 2RC5A 2E1BA 2XNDA 1OB5A 3G4SB 1R5BA 1W35A 4PC2A 4Z4YA 2C5HA 2F4NA 1W87A 4M4SA 1WSVA 2W6JA 4TMXA 5CDFA 2QTZA 3KL9A 2DCUA 4OPOA 5TV2A 2JDIA 1BMFA 2DERA 2WR8A 2ZXIA 2VBSA 1DDIA 2WJVA 1K9MD 3A8IA 2CC2A 1OGIA 1N05A 3QFSA 2RC6A 4XLFA 4DNRB 3LQ6A 4FXUA 3OW7A 1ZM3A 3G05A 3FPKA 3WXMA 4B4DA 3CC4B 2HDNB 5IK2A 1FNBA 3ZIAA 3B78A 4HE5A 4II2A 3CCUB 4ZGQB 4RCYA 4OPVA 2ZL5A 4Q7JB 1WOSA 4XR6A 4X05A 1JNYA 1R5NA 2XOKA 4XMYA 1F60A 2VJIA 4M53A 2BPOA 2PLFA 2Q6OA 2R6HA 4QVJA 1GR1A 3VR6A 2GK7A 4OP7A 2GJKA 3SKBA 2YWEA 3SLNA 1W0KA 4PC6A 2CRVA 3MCAA 1VJSA 4N3GA 4P12A 3AGQA 3R6JA 4PABA 3CXCB 3BY2A 3E1YE 3GVLA 4UZFA 1W9XA 5KNLA 1IB0A 1N8RD 4XM3A 3OFNA 3OEHA 1EXMA 3HAGA 3MMPA 1PJ6A 4OPSA 4X7FA 5HKKA 2WZNA 1TTTA 4UZEA 2Q6KA 2XZPA 4YELA 4RD4A 3OKXA 1VQ5B 3KEWA 1IJEA 1DARA 2X3UA 3SJPA 4ROXA 1WU8A 2J7KA 1VQKB 1PJ5A 1QFZA 4ACAA 3V7AA 3VO2A 3CD6B 2BMWA 1VQ6B 2B5OA 1I8DA 3OZUA 2YWGA 5H59A 4PC3A 4L8JA 1H85A 1W34A 2GQFA 3CCRB 3A8JA 2D3LA 1CQXA 5TY0A 2VJJA 1N0UA 2CBXA 1QGZA 2F1LA 4YEJA 3W5VA 3CCLB 1W2BB 2WYRA 1KMHA 2V4DA 2VYQA 3OW2B 3AGPA 4M0LA 3OZWA 2CF4A 4C43A 1NDHA 3GVJA 4RPDA 1VLOA 1BLIA 5LMZA 3QE2A 1G7RA 4DK0A 3A3BA 4P6YA 2ZL7A 4P22A 2M5SA 1GAQA 4K1XA 3W2IA 4NNJA 2DOGA 4XN0A 1UD3A 1VF7A 2AHOA 3CC2B 4G1BA 4DQLA 4ZCLA 1FDRA 2X85A 1T6ZA 4XOTA 1YIJB 1WOOA 3B8HA 4M2LA 2XGJA 1N0VC 1UD4A 3SJZA 5GV8A 3CMEB 3V76A 3WY9A 2V7TA 4YXWA 4TKOB 3ONUA 1EFCA 5HXBA 4Y9UA 2I1LA 1S0UA 3W5HA 3BH4A 1T6YA 2JIZA 5IYQA 2BM1A 2CW5A 2DIEA 1VQNB 1ZM9A 1QG0A 3Q39A 2D3NA 1MABA 1TLLA 4BPRA 4QHYA 4P2NA 3ES9A 3I1FA 1E3XA 1YITB 2C5BA 4RJLA 3MHPA 3A35A 4XOPA 4MYUA 5A88A 1D2EA 3OEEA 4Z4VA 2DYIA 4DK1A 3CCVB 3D26A 2ZTGA 1VQ9B 4Z1MA 5A89A 3J81k 1H8HA 4G5GA 4RM0A 1EFRA 4LC0A 1G7SA 2ZZGA 4NBSA 1FX0A 1K28D 4LBZA 5IYNA 2PE3A 3CP2A 4G1VA 4OOVA 4P26A 1YX2A 1VHOA 2WJYA 3CW2A 4RDJA 1G7TA 2ZBVA 2NPFA 2GREA 1XE1A 3ZUGA 3CCJB 1S72B 4XQFA 4XORA 2QGGA 2VBTA 2OYNA 1E3ZA 1FRQA 1UMKA 4RD3A 4ZGNB 3ZBUA 4Z4SA 3BCDA 4X06A 2BM0A 2OBRA 2EFGA 2V7XA 3Q3AA 2ZZEA 3E20A 1BX1A 3CPWB 1WDTA 4Z4RA 1ZM2A 5B6IA 3PA1A 3R6KA 2D74A 4B3XA 3JQRA 2PMDA 3OE7A 4FN5A 4WZLA 1NB0A 1OHHA 3ONYA 4TMVA 3LVBA 4XLAA 1VQMB 4RDLA 1WTHD 1UD8A 4P3YA 4PGOA 5JBQA 3W2EA 1UD2A 1K8AD 2HMAA 3OJXA 2D9RA 2X0KA 2YWHA 4XLCA 4F7DA 3FJOA 3CTAA 3SEJA 1SM4A 1IJFA 1UD6A 3ZBTA 5FO1A 3PA2A 4FWTA 4AF6A 4RLZA 4ACBA 1T5EA 1A8PA 4XKVA 3ZZUA 2BVNA 1Q81D 4YAWA 1QGYA 4P6VF 2ZL6A 1N06A 3U6BA 2V7UA 4ZCIA 3W2HA 4LBWA 2BN4A 2X6XA 1Q9SA 3VO1A 1D8TA 2VNKA 1E1QA 4IW3B 4P1VA 3GVKA 1E64A 1Q86D 4Z4ZA 3ASQA 1XQBA 2QTLA 1WOPA 2WPDA 4QUZA 3A8KA 2PIAA 4YHBA 1EWYA 1WP6A 1BX0A 1GO2A 3DDYA 1K73D 1D1NA 2FX3A 1GAWA 3CMMA 3BY1A 1CNFA 3T53B 5IYWA 4RD0A 5E6TA 3OAAA 3QSYA 4TT3A 1NJID 2V31A 2ZBUA 3Q6QA 4G7WA 5THXA 2ZZFA 3U6KA 1YI2B 1QH0A 4H9GA 1CNEA 1W0JA 2V7VA 4ZCMA 1VQ7B 3FPPA 5L46A 1FNDA 3H9NA 4C0SA 4RD1A 1HZEA 3QFCA 5F4MA 4WZTA 2GJPA 1DDGA 1YLOA 1T6XA 4NCNA 4WQMA 5DN6A 2B7BA 5IYRA 2HCJB 4P9SA 3G71B 1NBMA 2BGJA 4XLEA 1ZUNB 4TMZA 3AVVA 4KKTA 1WORA 4QFMA 2WSSA 1VQPB 4X8IA 4KKSA 3RY8A 4RDKA 4XNFA 4XKWA 1QVGB 1I18A 1EFUA 2WZPP 3WNDA 3A1PA 4WZKA 3QFTA 1E62A 1GJRA 4GQNA 1RQPA 3BCFA 4RD6A 3W2GA 4WWVA 5EMNA 3G6EB 4FK8A 2QEXB 4P25A 1BPLA 1KZLA 4YAOA 3OZVA 2CK3A 2XEXA 1DG1G 4WZEA 2JJ1A 1KJZA 4AF7A 1E79A 1Q7YD 3OPOA 1R5OA 4ZV4A 5FA6A 1EP1B 4EH1A 1COWA 3LQEA 3A3GA 2XNCA 3ASPA 3AVUA 1Y0YA 3AVYA 4QVAA 4RPBA 2OTLB 3CESA 4LBVA 2VNHA 5GV7A 2W6IA 1OGJA 5F4OA 3W5UA 2VBVA 1F20A 3OOCA 5J35A 1VQ4B 1QX4A 2NV4A 3P27A 2X6WA 3ZZ0A 5FL7A 3QFRA 2XZLA 1PKVA 1VQLB 2GJRA 1SKYB 3T56B 1J9ZA 5DSZA 5KSWB 1QGAA 2C4UA 5TRDA 3ASTA 5FNZA 5J3OA 2JJ2A 1QUFA 1VLYA 3CC7B 4TMWA 4X7CA 4B3FX 4X7DA 3NE5B 3WBJA 1V0EA 2R9VA 1FRNA 2VBUA 2GK6A 4RCZA 1KC8D 3BC9A 2OBSA 1VQ8B 1WSRA 3Q6RA 1N07A 4G6IA 3WNCA 2BGIA 2C78A 2Z6BD 1H42A 1TUIA 3CRZA 2DEUA 3H94A 2V7WA 4YALA 2FVGA 5BSYA 1JB9A 3I55B 5FO0A 4TMTA 1QUEA 4II3A 2VZLA 1JJ2B 3CPXA 3AVTA 4XLHA 2Q6LA 3I56B 4TN1A 4X7EA 3ASSA 5AN9A 3OP1A 5F4JA 4B3GA 2OTJB 3PENA 2VNJA 2EIXA 3JU4A 4G7XA 1FNMA 1XFOA 2VNIA 2X6YA 4KKUA 4E0FA 4R71A 4Y7CA 2DY1A 1N08A 2ZZQA 4CQJA 1OB2A 1IHMA 4Z4WA 3PUNA 4OOSA 4PAAA 5KW9A 1M1KD 1P4MA 1KK0A 2BF4A 4M1KA 3ISXA 5HZAA 1Q82D 3VNUA 2OBTA 4QV2A 2V7QA 1M90D 2QA4B 4J0QA 3CCSB 2GPJA 3CMAB 3AVWA 1FNCA 3OJWA 4Z4UA 1RQRA 3GIRA 3JQPA 5A8AA 1V5VA 1TVCA
chains in the Genus database with same CATH topology
3RY8A 3D26A 3LQ6A 4RDKA 3PVDA 3PUMA 4RM0A 4WZKA 5IYPA 4OPVA 2ZL5A 5IYNA 4OOVA 4P26A 4RDJA 4X05A 3SLDA 4P25A 5HZBA 4Z4SA 4X06A 4WZEA 2OBRA 4QVJA 3Q3AA 4X07A 4OP7A 3SKBA 3SLNA 4P3IA 3LQEA 3ASPA 4P12A 4QVAA 4RPBA 4Z4RA 3R6JA 3BY2A 3PA1A 3R6KA 4WZLA 5F4OA 3ONYA 5J35A 4RDLA 4X7FA 4OPSA 3SJPA 4ROXA 3ASRA 3V7AA 3SEJA 3ASTA 5J3OA 3PA2A 4X7CA 4X7DA 4RLZA 2OBSA 3Q6RA 2ZL6A 5BSXA 5BSYA 4OOXA 4RPDA 4P1VA 2ZL7A 3BQJA 4Z4ZA 4X7EA 3ASQA 3ASSA 5F4JA 4QUZA 4X0CA 3BY1A 1IHMA 4Z4WA 3PUNA 4OOSA 5IYWA 3Q38A 4Z4TA 5E6TA 5KW9A 3ONUA 3Q6QA 4Z4YA 5HZAA 2OBTA 4QV2A 5IYQA 5F4MA 4WZTA 3Q39A 4OPOA 4Z4UA 4P2NA 5IYRA 4Z4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RY8 A;  3D26 A;  3LQ6 A;  4RDK A;  3PVD A;  3PUM A;  4RM0 A;  4WZK A;  5IYP A;  4OPV A;  2ZL5 A;  5IYN A;  4OOV A;  4P26 A;  4RDJ A;  4X05 A;  3SLD A;  4P25 A;  5HZB A;  4Z4S A;  4X06 A;  4WZE A;  2OBR A;  4QVJ A;  3Q3A A;  4X07 A;  4OP7 A;  3SKB A;  3SLN A;  4P3I A;  3LQE A;  3ASP A;  4P12 A;  4QVA A;  4RPB A;  4Z4R A;  3R6J A;  3BY2 A;  3PA1 A;  3R6K A;  4WZL A;  5F4O A;  3ONY A;  5J35 A;  4RDL A;  4X7F A;  4OPS A;  3SJP A;  4ROX A;  3ASR A;  3V7A A;  3SEJ A;  3AST A;  5J3O A;  3PA2 A;  4X7C A;  4X7D A;  4RLZ A;  2OBS A;  3Q6R A;  2ZL6 A;  5BSX A;  5BSY A;  4OOX A;  4RPD A;  4P1V A;  2ZL7 A;  3BQJ A;  4Z4Z A;  4X7E A;  3ASQ A;  3ASS A;  5F4J A;  4QUZ A;  4X0C A;  3BY1 A;  1IHM A;  4Z4W A;  3PUN A;  4OOS A;  5IYW A;  3Q38 A;  4Z4T A;  5E6T A;  5KW9 A;  3ONU A;  3Q6Q A;  4Z4Y A;  5HZA A;  2OBT A;  4QV2 A;  5IYQ A;  5F4M A;  4WZT A;  3Q39 A;  4OPO A;  4Z4U A;  4P2N A;  5IYR A;  4Z4V A; 
#chains in the Genus database with same CATH topology
 1YJW B;  3FKS A;  4DNT B;  2XNJ A;  5H5J A;  3U2Q A;  1YJN B;  2KVO A;  1KQS B;  3PVD A;  4XON A;  3PUM A;  4TSF A;  1QFY A;  3WBK A;  3B82 A;  2F1M A;  5IYP A;  2P3M A;  1XB2 A;  4DQK A;  1BJK A;  1G7C A;  1YJ9 B;  2ZTN A;  1KTV A;  1KK1 A;  2C77 A;  3SLD A;  3CCE B;  4B47 A;  4HE6 A;  1E1R A;  5HZB A;  2DET A;  1GVH A;  1QVF B;  1VHE A;  2B7C A;  1EP3 B;  1I7P A;  2JN9 A;  4X07 A;  4XD7 A;  1KD1 D;  2OK7 A;  1WPC A;  4P3I A;  1SKQ A;  2XZO A;  1BQE A;  3CP8 A;  2QDX A;  4MYT A;  3WYA A;  4B48 A;  2E1R A;  1MRZ A;  3CB4 A;  3CCQ B;  3LO8 A;  1KK2 A;  1S4M A;  1UD5 A;  2HLD A;  2X53 S;  1HVX A;  2YWF A;  1EP2 B;  2ZXH A;  1JA0 A;  4PC1 A;  3T51 B;  3JQQ A;  3ZPN A;  4AVZ A;  2F43 A;  3ASR A;  4U9U A;  4AC9 A;  1ZM4 A;  2OK8 A;  3VNV A;  1ELO A;  1KK3 A;  1HA3 A;  1OB0 A;  1QFJ A;  2BV3 A;  3LNN A;  1PJ7 A;  1E63 A;  3W2F A;  3CCM B;  5DS0 A;  3BNW A;  4RD2 A;  2Q6I A;  2ZIT A;  1Y0R A;  4ASU A;  1B23 P;  2QN6 A;  1YHQ B;  3AVX A;  1B2R A;  2CND A;  5BSX A;  3GSI A;  2QMU A;  4N3N A;  1JA1 A;  4OOX A;  3GQB A;  4LBY A;  2BSA A;  1NRK A;  2X8K A;  1AMO A;  4JMQ A;  1V0F A;  2LZJ A;  1H8E A;  4HIZ A;  3WQZ A;  4Y9R A;  3VMF A;  1AIP A;  3BQJ A;  2C2W A;  1KRH A;  5FIU A;  4B44 A;  1VQO B;  4UAJ A;  5TR9 A;  4XL9 A;  1EFT A;  2QE7 A;  3P26 A;  1NB9 A;  3ZC3 A;  3ZZT A;  3WNB A;  4PC7 A;  4YAF A;  4UZU A;  1E43 A;  4X0C A;  4B43 A;  4YAU A;  1U2R A;  2C4T A;  3Q38 A;  4XN3 A;  4Z4T A;  2RC5 A;  2E1B A;  2XND A;  1OB5 A;  3G4S B;  1R5B A;  1W35 A;  4PC2 A;  4Z4Y A;  2C5H A;  2F4N A;  1W87 A;  4M4S A;  1WSV A;  2W6J A;  4TMX A;  5CDF A;  2QTZ A;  3KL9 A;  2DCU A;  4OPO A;  5TV2 A;  2JDI A;  1BMF A;  2DER A;  2WR8 A;  2ZXI A;  2VBS A;  1DDI A;  2WJV A;  1K9M D;  3A8I A;  2CC2 A;  1OGI A;  1N05 A;  3QFS A;  2RC6 A;  4XLF A;  4DNR B;  3LQ6 A;  4FXU A;  3OW7 A;  1ZM3 A;  3G05 A;  3FPK A;  3WXM A;  4B4D A;  3CC4 B;  2HDN B;  5IK2 A;  1FNB A;  3ZIA A;  3B78 A;  4HE5 A;  4II2 A;  3CCU B;  4ZGQ B;  4RCY A;  4OPV A;  2ZL5 A;  4Q7J B;  1WOS A;  4XR6 A;  4X05 A;  1JNY A;  1R5N A;  2XOK A;  4XMY A;  1F60 A;  2VJI A;  4M53 A;  2BPO A;  2PLF A;  2Q6O A;  2R6H A;  4QVJ A;  1GR1 A;  3VR6 A;  2GK7 A;  4OP7 A;  2GJK A;  3SKB A;  2YWE A;  3SLN A;  1W0K A;  4PC6 A;  2CRV A;  3MCA A;  1VJS A;  4N3G A;  4P12 A;  3AGQ A;  3R6J A;  4PAB A;  3CXC B;  3BY2 A;  3E1Y E;  3GVL A;  4UZF A;  1W9X A;  5KNL A;  1IB0 A;  1N8R D;  4XM3 A;  3OFN A;  3OEH A;  1EXM A;  3HAG A;  3MMP A;  1PJ6 A;  4OPS A;  4X7F A;  5HKK A;  2WZN A;  1TTT A;  4UZE A;  2Q6K A;  2XZP A;  4YEL A;  4RD4 A;  3OKX A;  1VQ5 B;  3KEW A;  1IJE A;  1DAR A;  2X3U A;  3SJP A;  4ROX A;  1WU8 A;  2J7K A;  1VQK B;  1PJ5 A;  1QFZ A;  4ACA A;  3V7A A;  3VO2 A;  3CD6 B;  2BMW A;  1VQ6 B;  2B5O A;  1I8D A;  3OZU A;  2YWG A;  5H59 A;  4PC3 A;  4L8J A;  1H85 A;  1W34 A;  2GQF A;  3CCR B;  3A8J A;  2D3L A;  1CQX A;  5TY0 A;  2VJJ A;  1N0U A;  2CBX A;  1QGZ A;  2F1L A;  4YEJ A;  3W5V A;  3CCL B;  1W2B B;  2WYR A;  1KMH A;  2V4D A;  2VYQ A;  3OW2 B;  3AGP A;  4M0L A;  3OZW A;  2CF4 A;  4C43 A;  1NDH A;  3GVJ A;  4RPD A;  1VLO A;  1BLI A;  5LMZ A;  3QE2 A;  1G7R A;  4DK0 A;  3A3B A;  4P6Y A;  2ZL7 A;  4P22 A;  2M5S A;  1GAQ A;  4K1X A;  3W2I A;  4NNJ A;  2DOG A;  4XN0 A;  1UD3 A;  1VF7 A;  2AHO A;  3CC2 B;  4G1B A;  4DQL A;  4ZCL A;  1FDR A;  2X85 A;  1T6Z A;  4XOT A;  1YIJ B;  1WOO A;  3B8H A;  4M2L A;  2XGJ A;  1N0V C;  1UD4 A;  3SJZ A;  5GV8 A;  3CME B;  3V76 A;  3WY9 A;  2V7T A;  4YXW A;  4TKO B;  3ONU A;  1EFC A;  5HXB A;  4Y9U A;  2I1L A;  1S0U A;  3W5H A;  3BH4 A;  1T6Y A;  2JIZ A;  5IYQ A;  2BM1 A;  2CW5 A;  2DIE A;  1VQN B;  1ZM9 A;  1QG0 A;  3Q39 A;  2D3N A;  1MAB A;  1TLL A;  4BPR A;  4QHY A;  4P2N A;  3ES9 A;  3I1F A;  1E3X A;  1YIT B;  2C5B A;  4RJL A;  3MHP A;  3A35 A;  4XOP A;  4MYU A;  5A88 A;  1D2E A;  3OEE A;  4Z4V A;  2DYI A;  4DK1 A;  3CCV B;  3D26 A;  2ZTG A;  1VQ9 B;  4Z1M A;  5A89 A;  3J81 k;  1H8H A;  4G5G A;  4RM0 A;  1EFR A;  4LC0 A;  1G7S A;  2ZZG A;  4NBS A;  1FX0 A;  1K28 D;  4LBZ A;  5IYN A;  2PE3 A;  3CP2 A;  4G1V A;  4OOV A;  4P26 A;  1YX2 A;  1VHO A;  2WJY A;  3CW2 A;  4RDJ A;  1G7T A;  2ZBV A;  2NPF A;  2GRE A;  1XE1 A;  3ZUG A;  3CCJ B;  1S72 B;  4XQF A;  4XOR A;  2QGG A;  2VBT A;  2OYN A;  1E3Z A;  1FRQ A;  1UMK A;  4RD3 A;  4ZGN B;  3ZBU A;  4Z4S A;  3BCD A;  4X06 A;  2BM0 A;  2OBR A;  2EFG A;  2V7X A;  3Q3A A;  2ZZE A;  3E20 A;  1BX1 A;  3CPW B;  1WDT A;  4Z4R A;  1ZM2 A;  5B6I A;  3PA1 A;  3R6K A;  2D74 A;  4B3X A;  3JQR A;  2PMD A;  3OE7 A;  4FN5 A;  4WZL A;  1NB0 A;  1OHH A;  3ONY A;  4TMV A;  3LVB A;  4XLA A;  1VQM B;  4RDL A;  1WTH D;  1UD8 A;  4P3Y A;  4PGO A;  5JBQ A;  3W2E A;  1UD2 A;  1K8A D;  2HMA A;  3OJX A;  2D9R A;  2X0K A;  2YWH A;  4XLC A;  4F7D A;  3FJO A;  3CTA A;  3SEJ A;  1SM4 A;  1IJF A;  1UD6 A;  3ZBT A;  5FO1 A;  3PA2 A;  4FWT A;  4AF6 A;  4RLZ A;  4ACB A;  1T5E A;  1A8P A;  4XKV A;  3ZZU A;  2BVN A;  1Q81 D;  4YAW A;  1QGY A;  4P6V F;  2ZL6 A;  1N06 A;  3U6B A;  2V7U A;  4ZCI A;  3W2H A;  4LBW A;  2BN4 A;  2X6X A;  1Q9S A;  3VO1 A;  1D8T A;  2VNK A;  1E1Q A;  4IW3 B;  4P1V A;  3GVK A;  1E64 A;  1Q86 D;  4Z4Z A;  3ASQ A;  1XQB A;  2QTL A;  1WOP A;  2WPD A;  4QUZ A;  3A8K A;  2PIA A;  4YHB A;  1EWY A;  1WP6 A;  1BX0 A;  1GO2 A;  3DDY A;  1K73 D;  1D1N A;  2FX3 A;  1GAW A;  3CMM A;  3BY1 A;  1CNF A;  3T53 B;  5IYW A;  4RD0 A;  5E6T A;  3OAA A;  3QSY A;  4TT3 A;  1NJI D;  2V31 A;  2ZBU A;  3Q6Q A;  4G7W A;  5THX A;  2ZZF A;  3U6K A;  1YI2 B;  1QH0 A;  4H9G A;  1CNE A;  1W0J A;  2V7V A;  4ZCM A;  1VQ7 B;  3FPP A;  5L46 A;  1FND A;  3H9N A;  4C0S A;  4RD1 A;  1HZE A;  3QFC A;  5F4M A;  4WZT A;  2GJP A;  1DDG A;  1YLO A;  1T6X A;  4NCN A;  4WQM A;  5DN6 A;  2B7B A;  5IYR A;  2HCJ B;  4P9S A;  3G71 B;  1NBM A;  2BGJ A;  4XLE A;  1ZUN B;  4TMZ A;  3AVV A;  4KKT A;  1WOR A;  4QFM A;  2WSS A;  1VQP B;  4X8I A;  4KKS A;  3RY8 A;  4RDK A;  4XNF A;  4XKW A;  1QVG B;  1I18 A;  1EFU A;  2WZP P;  3WND A;  3A1P A;  4WZK A;  3QFT A;  1E62 A;  1GJR A;  4GQN A;  1RQP A;  3BCF A;  4RD6 A;  3W2G A;  4WWV A;  5EMN A;  3G6E B;  4FK8 A;  2QEX B;  4P25 A;  1BPL A;  1KZL A;  4YAO A;  3OZV A;  2CK3 A;  2XEX A;  1DG1 G;  4WZE A;  2JJ1 A;  1KJZ A;  4AF7 A;  1E79 A;  1Q7Y D;  3OPO A;  1R5O A;  4ZV4 A;  5FA6 A;  1EP1 B;  4EH1 A;  1COW A;  3LQE A;  3A3G A;  2XNC A;  3ASP A;  3AVU A;  1Y0Y A;  3AVY A;  4QVA A;  4RPB A;  2OTL B;  3CES A;  4LBV A;  2VNH A;  5GV7 A;  2W6I A;  1OGJ A;  5F4O A;  3W5U A;  2VBV A;  1F20 A;  3OOC A;  5J35 A;  1VQ4 B;  1QX4 A;  2NV4 A;  3P27 A;  2X6W A;  3ZZ0 A;  5FL7 A;  3QFR A;  2XZL A;  1PKV A;  1VQL B;  2GJR A;  1SKY B;  3T56 B;  1J9Z A;  5DSZ A;  5KSW B;  1QGA A;  2C4U A;  5TRD A;  3AST A;  5FNZ A;  5J3O A;  2JJ2 A;  1QUF A;  1VLY A;  3CC7 B;  4TMW A;  4X7C A;  4B3F X;  4X7D A;  3NE5 B;  3WBJ A;  1V0E A;  2R9V A;  1FRN A;  2VBU A;  2GK6 A;  4RCZ A;  1KC8 D;  3BC9 A;  2OBS A;  1VQ8 B;  1WSR A;  3Q6R A;  1N07 A;  4G6I A;  3WNC A;  2BGI A;  2C78 A;  2Z6B D;  1H42 A;  1TUI A;  3CRZ A;  2DEU A;  3H94 A;  2V7W A;  4YAL A;  2FVG A;  5BSY A;  1JB9 A;  3I55 B;  5FO0 A;  4TMT A;  1QUE A;  4II3 A;  2VZL A;  1JJ2 B;  3CPX A;  3AVT A;  4XLH A;  2Q6L A;  3I56 B;  4TN1 A;  4X7E A;  3ASS A;  5AN9 A;  3OP1 A;  5F4J A;  4B3G A;  2OTJ B;  3PEN A;  2VNJ A;  2EIX A;  3JU4 A;  4G7X A;  1FNM A;  1XFO A;  2VNI A;  2X6Y A;  4KKU A;  4E0F A;  4R71 A;  4Y7C A;  2DY1 A;  1N08 A;  2ZZQ A;  4CQJ A;  1OB2 A;  1IHM A;  4Z4W A;  3PUN A;  4OOS A;  4PAA A;  5KW9 A;  1M1K D;  1P4M A;  1KK0 A;  2BF4 A;  4M1K A;  3ISX A;  5HZA A;  1Q82 D;  3VNU A;  2OBT A;  4QV2 A;  2V7Q A;  1M90 D;  2QA4 B;  4J0Q A;  3CCS B;  2GPJ A;  3CMA B;  3AVW A;  1FNC A;  3OJW A;  4Z4U A;  1RQR A;  3GIR A;  3JQP A;  5A8A A;  1V5V A;  1TVC A; 
#chains in the Genus database with same CATH homology
 3RY8 A;  3D26 A;  3LQ6 A;  4RDK A;  3PVD A;  3PUM A;  4RM0 A;  4WZK A;  5IYP A;  4OPV A;  2ZL5 A;  5IYN A;  4OOV A;  4P26 A;  4RDJ A;  4X05 A;  3SLD A;  4P25 A;  5HZB A;  4Z4S A;  4X06 A;  4WZE A;  2OBR A;  4QVJ A;  3Q3A A;  4X07 A;  4OP7 A;  3SKB A;  3SLN A;  4P3I A;  3LQE A;  3ASP A;  4P12 A;  4QVA A;  4RPB A;  4Z4R A;  3R6J A;  3BY2 A;  3PA1 A;  3R6K A;  4WZL A;  5F4O A;  3ONY A;  5J35 A;  4RDL A;  4X7F A;  4OPS A;  3SJP A;  4ROX A;  3ASR A;  3V7A A;  3SEJ A;  3AST A;  5J3O A;  3PA2 A;  4X7C A;  4X7D A;  4RLZ A;  2OBS A;  3Q6R A;  2ZL6 A;  5BSX A;  5BSY A;  4OOX A;  4RPD A;  4P1V A;  2ZL7 A;  3BQJ A;  4Z4Z A;  4X7E A;  3ASQ A;  3ASS A;  5F4J A;  4QUZ A;  4X0C A;  3BY1 A;  1IHM A;  4Z4W A;  3PUN A;  4OOS A;  5IYW A;  3Q38 A;  4Z4T A;  5E6T A;  5KW9 A;  3ONU A;  3Q6Q A;  4Z4Y A;  5HZA A;  2OBT A;  4QV2 A;  5IYQ A;  5F4M A;  4WZT A;  3Q39 A;  4OPO A;  4Z4U A;  4P2N A;  5IYR A;  4Z4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...