5IYNA

Protruding domain of gii.4 human norovirus chdc2094
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
305
structure length
303
Chain Sequence
KPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTTQLSAVNICNFRGDVTRVGISHDYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGLLTQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDGHQNEPQQWVLPNYSGTSGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDCLLPQEWVSHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVIPPNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Four decades of structural evolution of GII.4 norovirus
rcsb
source organism Norovirus hu/gii.4/chdc2094/1974/us
molecule tags Viral protein
molecule keywords VP1
total genus 69
structure length 303
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5iynA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5iynA01
5HZBA 4Z4RA 3SJPA 2OBRA 3Q6RA 4RM0A 4X06A 4X05A 5IYNA 3LQ6A 5BSXA 4OOSA 3Q3AA 4X7CA 3BY1A 4WZLA 4RPBA 3V7AA 3PA2A 4Z4YA 4P3IA 5F4JA 3SLNA 5KW9A 4Z4WA 3ONYA 5E6TA 5IYPA 4Z4ZA 4P26A 3BY2A 4Z4TA 4RDLA 4WZEA 3SKBA 3RY8A 2OBTA 4P1VA 3R6KA 5BSYA 5J3OA 3ASRA 3Q38A 3Q6QA 3ASPA 3ASTA 4QVJA 5IYWA 4Z4VA 4QUZA 4OPOA 4P25A 3LQEA 4RDKA 3ONUA 5HZAA 4P2NA 3PUNA 3BQJA 3R6JA 4RLZA 4RDJA 4ROXA 4P12A 4Z4SA 5IYRA 4WZKA 4X7EA 4OOXA 3SEJA 2OBSA 3Q39A 4Z4UA 4OPVA 4OPSA 2ZL7A 4OOVA 4WZTA 4X7FA 4RPDA 2ZL5A 5F4MA 4QV2A 4X7DA 5J35A 3ASQA 3PUMA 4X07A 3SLDA 3D26A 5F4OA 3ASSA 1IHMA 5IYQA 3PA1A 4OP7A 4X0CA 2ZL6A 3PVDA 4QVAA
chains in the Genus database with same CATH superfamily
3AGQA 5DS0A 3VMFA 1W2BB 2WJVA 5FNZA 1I8DA 1Q82D 3CP2A 2WJYA 3H9NA 1YIJB 1EFCA 3VNVA 3T56B 2D9RA 4ZCIA 5BSXA 3A3GA 4X7CA 4WZLA 3E1YE 3AVUA 1BPLA 1E63A 1SKYB 2X6WA 5KW9A 3CD6B 3QFTA 3ISXA 2C5BA 4Y7CA 5IYPA 4U9UA 3T53B 1T5EA 1ZM4A 3MCAA 1DARA 3CC2B 1I7PA 1YJNB 4P9SA 4P26A 5FO0A 4Y9UA 2NPFA 4WZEA 3SKBA 4Z1MA 2ZTNA 2OBTA 2GK7A 3R6KA 1VQKB 2V7UA 4XLHA 3GVKA 2BM0A 1B23P 2BGJA 4TMWA 1HVXA 2F1MA 4LBZA 3ASTA 2JJ1A 2YWGA 3V76A 1DDGA 4ZCLA 1GO2A 1TUIA 2DERA 1JB9A 2C5HA 4QUZA 4XONA 1IJFA 4P25A 5LMZA 2X85A 1YI2B 2WR8A 2RC5A 2ZITA 1W34A 2JN9A 2GJRA 2WYRA 1YITB 5JBQA 4P2NA 2C77A 1UD8A 1XE1A 2Q6IA 4YAFA 1GAWA 3R6JA 4DK0A 4B47A 4PC3A 1YJWB 3U6BA 4B44A 2NV4A 1S72B 2X53S 2QEXB 3OZVA 1KK2A 1W35A 1F60A 2ZBUA 4OOXA 2V4DA 3BH4A 2OBSA 1WOOA 2DYIA 4ZGNB 1QG0A 1SKQA 2ZL7A 4OOVA 3WNDA 1A8PA 1NB9A 1Y0YA 1FRQA 1QUFA 3MMPA 4WZTA 1E62A 2C4TA 2X6YA 4X7FA 3QFSA 4DK1A 2F43A 4PC6A 1W87A 1D8TA 3OJXA 1EP3B 1OB0A 2ZL5A 1S4MA 3NE5B 1E3ZA 1PJ6A 4XORA 1WSRA 1G7CA 5TR9A 1EXMA 2D74A 2WZNA 2B7BA 3ASQA 2XZOA 5TRDA 4XLFA 4C43A 2R6HA 5HKKA 2AHOA 2XEXA 3I55B 2QTZA 4X07A 4II2A 5CDFA 4RCYA 4ACAA 2XGJA 3SLDA 3A3BA 1UMKA 1NBMA 1BQEA 3B8HA 2QE7A 1IB0A 1K9MD 3QFRA 1BLIA 1ZM9A 1R5BA 1FNBA 1D1NA 4TMTA 1R5OA 1KD1D 3J81k 5HXBA 4PGOA 4YELA 3ES9A 3G71B 4Z4SA 2C78A 1VQ5B 2E1RA 1NDHA 3HAGA 4Z4RA 3W2HA 3SJPA 2DIEA 2OBRA 4G1VA 3OFNA 3OJWA 5AN9A 3CB4A 4N3GA 4X06A 1HA3A 3CCJB 3AVWA 3BNWA 3CESA 4NBSA 3Q3AA 3W5VA 1JJ2B 2XNDA 3BY1A 4RPBA 3CW2A 3V7AA 1DG1G 3PA2A 1RQPA 4G1BA 2FVGA 1V0EA 4JMQA 3P27A 4RD6A 1AIPA 1V5VA 4FXUA 5F4JA 4ASUA 4FWTA 1CNFA 4Z4WA 3VR6A 3VO1A 4Q7JB 3ZBTA 1VQ6B 3WNBA 1BX0A 3ZZUA 3KEWA 4B3GA 3BY2A 1E3XA 1FNDA 4Z4TA 4PC2A 1XQBA 4M4SA 2JDIA 4LBYA 1QVFB 3AVYA 2PE3A 3OW7A 4KKUA 1N08A 1VHOA 4P1VA 4CQJA 1Q81D 1MRZA 3P26A 2D3LA 2WZPP 2X6XA 3ASRA 5BSYA 4HE6A 1VQMB 1OB5A 4XQFA 1FX0A 2HMAA 3I56B 3JQPA 2EFGA 4P22A 3CC4B 3FPPA 3WBJA 3G6EB 4YXWA 2QTLA 3AVVA 4XKVA 3G4SB 4YAUA 1VQOB 2Z6BD 2PMDA 1UD2A 1ELOA 1I18A 1KJZA 2ZBVA 3QSYA 1N8RD 4X8IA 3A8KA 2V7WA 2XNJA 1YX2A 2QGGA 4AVZA 5A88A 1NRKA 2BSAA 3W5UA 1KK0A 1W0JA 3W2EA 1VQ8B 3VNUA 5HZAA 1BJKA 4M0LA 3PUNA 4RD1A 2CNDA 4TMZA 2XZLA 1B2RA 3OZUA 4ZCMA 4RDJA 4ROXA 1N07A 2ZZEA 2RC6A 4G6IA 4WZKA 1CNEA 1P4MA 4TSFA 4XOTA 1T6YA 1RQRA 3JQRA 1EFTA 1N06A 4DQLA 4TT3A 1WU8A 4YHBA 4M53A 3CMMA 4B3FX 1VQNB 4QFMA 4F7DA 2ZTGA 5FL7A 1WOPA 4II3A 5F4MA 4RD2A 3CCRB 5J35A 4G7WA 4BPRA 1VQPB 2GJKA 5EMNA 4AF7A 1N05A 2Q6KA 1T6ZA 2PIAA 2VYQA 1QVGB 4DQKA 3D26A 1N0VC 2V7XA 2VBTA 3GIRA 3QE2A 5FA6A 3ZIAA 1VJSA 3CCSB 3ASSA 2X8KA 2FX3A 3BCFA 2GREA 2CF4A 2C2WA 1FNMA 2HCJB 3FKSA 3CCVB 2ZXIA 4OP7A 1YJ9B 1FRNA 3DDYA 2ZL6A 3QFCA 2DOGA 3PVDA 4RD4A 3CCQB 2BMWA 4TN1A 4UZEA 5HZBA 4YALA 5IK2A 5KNLA 1TTTA 2KVOA 2CBXA 2VBVA 1JA0A 2EIXA 3GVLA 4RM0A 5IYNA 2R9VA 3W2IA 1BMFA 4OOSA 1UD6A 2LZJA 2VJIA 3A1PA 1HZEA 5DN6A 4B48A 3AGPA 4LBWA 4P3IA 3SLNA 1H42A 1OGJA 2HDNB 2PLFA 2YWEA 3G05A 1VQ4B 1H8EA 1UD5A 3I1FA 1EFUA 5TY0A 1M90D 4RDLA 4XN3A 2P3MA 4RCZA 4PC7A 1GR1A 2M5SA 4M1KA 1VQ9B 2YWHA 3W2GA 2B5OA 5J3OA 1DDIA 1Q9SA 4WWVA 4XM3A 1WP6A 1KZLA 1FNCA 3Q38A 3Q6QA 3ASPA 1WSVA 2DETA 2CW5A 2ZZGA 4ACBA 3B82A 5GV7A 3AVXA 4DNRB 4K1XA 3FJOA 1QGYA 5H59A 2GJPA 1KK1A 1ZM3A 2DCUA 5A89A 4Z4VA 4L8JA 1EP2B 2VNIA 3ZBUA 1KQSB 1IJEA 3WNCA 2BM1A 2GPJA 2V7VA 2HLDA 3LQEA 1KK3A 3BC9A 1W9XA 2F1LA 1WOSA 3PENA 2BVNA 2OTJB 4M2LA 2W6IA 4YEJA 1Q86D 3CCLB 2VNJA 4UZFA 1BX1A 2V7TA 1K73D 1QFZA 3CP8A 1OGIA 4P12A 3FPKA 4B3XA 5IYRA 4UZUA 1N0UA 2OYNA 1WTHD 3CRZA 3OW2B 2BF4A 1QX4A 3SEJA 1PJ7A 2VNHA 4FK8A 3GVJA 1CQXA 3Q39A 2Q6OA 4Z4UA 3ZZ0A 4IW3B 1WPCA 3CXCB 2DEUA 4OPVA 1JNYA 1KMHA 1Y0RA 2WSSA 1OHHA 2CC2A 2QA4B 1YLOA 3LO8A 2QMUA 3CCUB 2BV3A 3CC7B 5A8AA 1J9ZA 4QV2A 2B7CA 1UD4A 1EWYA 2GQFA 2V31A 3T51B 1KRHA 1PKVA 3OEEA 1FDRA 4YAWA 1S0UA 4HIZA 4AF6A 1COWA 3CMAB 2BPOA 2YWFA 3OP1A 3A35A 3WQZA 1R5NA 2E1BA 3OPOA 2X3UA 4LC0A 2VNKA 1G7SA 1IHMA 1MABA 2ZXHA 2WPDA 1QGAA 2OK7A 4RD0A 5FIUA 2QN6A 4KKSA 3CMEB 5FO1A 4TKOB 3VO2A 1G7TA 4C0SA 3OOCA 1QGZA 3OZWA 2CRVA 2VBSA 1UD3A 3Q6RA 1AMOA 4PAAA 1TLLA 2J7KA 4QHYA 1GJRA 1GVHA 4XKWA 4XNFA 4X05A 3W5HA 3SJZA 3LQ6A 1KTVA 3U2QA 3U6KA 4LBVA 2DY1A 4J0QA 1GAQA 3KL9A 4Z4YA 1H85A 1XB2A 4AC9A 3GQBA 1VLOA 3ONYA 2C4UA 1K28D 3OE7A 2VBUA 4XLEA 5E6TA 4Z4ZA 3A8IA 4XLCA 4XR6A 1VHEA 2ZZQA 1QUEA 4KKTA 4TMVA 1SM4A 4YAOA 3WXMA 4XOPA 2GK6A 3RY8A 4Y9RA 3WY9A 1M1KD 2JJ2A 4DNTB 2X0KA 1PJ5A 1YHQB 1TVCA 3B78A 1E79A 3H94A 4PABA 1ZM2A 3MHPA 1VQLB 4QVJA 4ZV4A 5GV8A 5IYWA 1NJID 4HE5A 2I1LA 3WBKA 3ZUGA 3CPWB 1G7RA 3JU4A 4EH1A 3AVTA 2QDXA 1U2RA 1QFYA 3E20A 1QFJA 4MYTA 1VLYA 4P6VF 4E0FA 4OPOA 4B43A 3CCEB 4XLAA 1VQ7B 2VZLA 1EP1B 1H8HA 4RDKA 3ZZTA 4B4DA 4NNJA 4XMYA 3ONUA 4XL9A 4MYUA 4P3YA 3OKXA 5H5JA 1QH0A 1V0FA 3BQJA 3CCMB 1VF7A 2F4NA 4RLZA 4RJLA 3LNNA 4P6YA 1W0KA 4XN0A 5TV2A 1JA1A 4X7EA 4G7XA 1E1QA 1KC8D 3LVBA 3ZC3A 2BN4A 3CPXA 3A8JA 4R71A 2OTLB 1K8AD 3W2FA 4RD3A 4PC1A 1OB2A 3OEHA 4OPSA 4TMXA 1XFOA 1E64A 1WDTA 1Q7YD 2XOKA 5L46A 1EFRA 5KSWB 4RPDA 4UAJA 4ZGQB 2V7QA 2VJJA 5B6IA 1ZUNB 4H9GA 4WQMA 4GQNA 1WORA 4XD7A 5THXA 2OK8A 2W6JA 4X7DA 1F20A 3CTAA 3BCDA 4N3NA 3PUMA 4FN5A 3GSIA 2Q6LA 2D3NA 2XZPA 3JQQA 3ZPNA 5F4OA 4NCNA 5DSZA 1NB0A 1T6XA 2XNCA 5IYQA 4G5GA 2ZZFA 3OAAA 3PA1A 3WYAA 4X0CA 1D2EA 2JIZA 1E1RA 2BGIA 1E43A 2CK3A 4QVAA
chains in the Genus database with same CATH topology
5HZBA 4Z4RA 3SJPA 2OBRA 3Q6RA 4RM0A 4X06A 4X05A 5IYNA 3LQ6A 5BSXA 4OOSA 3Q3AA 4X7CA 3BY1A 4WZLA 4RPBA 3V7AA 3PA2A 4Z4YA 4P3IA 5F4JA 3SLNA 5KW9A 4Z4WA 3ONYA 5E6TA 5IYPA 4Z4ZA 4P26A 3BY2A 4Z4TA 4RDLA 4WZEA 3SKBA 3RY8A 2OBTA 4P1VA 3R6KA 5BSYA 5J3OA 3ASRA 3Q38A 3Q6QA 3ASPA 3ASTA 4QVJA 5IYWA 4Z4VA 4QUZA 4OPOA 4P25A 3LQEA 4RDKA 3ONUA 5HZAA 4P2NA 3PUNA 3BQJA 3R6JA 4RLZA 4RDJA 4ROXA 4P12A 4Z4SA 5IYRA 4WZKA 4X7EA 4OOXA 3SEJA 2OBSA 3Q39A 4Z4UA 4OPVA 4OPSA 2ZL7A 4OOVA 4WZTA 4X7FA 4RPDA 2ZL5A 5F4MA 4QV2A 4X7DA 5J35A 3ASQA 3PUMA 4X07A 3SLDA 3D26A 5F4OA 3ASSA 1IHMA 5IYQA 3PA1A 4OP7A 4X0CA 2ZL6A 3PVDA 4QVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HZB A;  4Z4R A;  3SJP A;  2OBR A;  3Q6R A;  4RM0 A;  4X06 A;  4X05 A;  5IYN A;  3LQ6 A;  5BSX A;  4OOS A;  3Q3A A;  4X7C A;  3BY1 A;  4WZL A;  4RPB A;  3V7A A;  3PA2 A;  4Z4Y A;  4P3I A;  5F4J A;  3SLN A;  5KW9 A;  4Z4W A;  3ONY A;  5E6T A;  5IYP A;  4Z4Z A;  4P26 A;  3BY2 A;  4Z4T A;  4RDL A;  4WZE A;  3SKB A;  3RY8 A;  2OBT A;  4P1V A;  3R6K A;  5BSY A;  5J3O A;  3ASR A;  3Q38 A;  3Q6Q A;  3ASP A;  3AST A;  4QVJ A;  5IYW A;  4Z4V A;  4QUZ A;  4OPO A;  4P25 A;  3LQE A;  4RDK A;  3ONU A;  5HZA A;  4P2N A;  3PUN A;  3BQJ A;  3R6J A;  4RLZ A;  4RDJ A;  4ROX A;  4P12 A;  4Z4S A;  5IYR A;  4WZK A;  4X7E A;  4OOX A;  3SEJ A;  2OBS A;  3Q39 A;  4Z4U A;  4OPV A;  4OPS A;  2ZL7 A;  4OOV A;  4WZT A;  4X7F A;  4RPD A;  2ZL5 A;  5F4M A;  4QV2 A;  4X7D A;  5J35 A;  3ASQ A;  3PUM A;  4X07 A;  3SLD A;  3D26 A;  5F4O A;  3ASS A;  1IHM A;  5IYQ A;  3PA1 A;  4OP7 A;  4X0C A;  2ZL6 A;  3PVD A;  4QVA A; 
#chains in the Genus database with same CATH topology
 3AGQ A;  5DS0 A;  3VMF A;  1W2B B;  2WJV A;  5FNZ A;  1I8D A;  1Q82 D;  3CP2 A;  2WJY A;  3H9N A;  1YIJ B;  1EFC A;  3VNV A;  3T56 B;  2D9R A;  4ZCI A;  5BSX A;  3A3G A;  4X7C A;  4WZL A;  3E1Y E;  3AVU A;  1BPL A;  1E63 A;  1SKY B;  2X6W A;  5KW9 A;  3CD6 B;  3QFT A;  3ISX A;  2C5B A;  4Y7C A;  5IYP A;  4U9U A;  3T53 B;  1T5E A;  1ZM4 A;  3MCA A;  1DAR A;  3CC2 B;  1I7P A;  1YJN B;  4P9S A;  4P26 A;  5FO0 A;  4Y9U A;  2NPF A;  4WZE A;  3SKB A;  4Z1M A;  2ZTN A;  2OBT A;  2GK7 A;  3R6K A;  1VQK B;  2V7U A;  4XLH A;  3GVK A;  2BM0 A;  1B23 P;  2BGJ A;  4TMW A;  1HVX A;  2F1M A;  4LBZ A;  3AST A;  2JJ1 A;  2YWG A;  3V76 A;  1DDG A;  4ZCL A;  1GO2 A;  1TUI A;  2DER A;  1JB9 A;  2C5H A;  4QUZ A;  4XON A;  1IJF A;  4P25 A;  5LMZ A;  2X85 A;  1YI2 B;  2WR8 A;  2RC5 A;  2ZIT A;  1W34 A;  2JN9 A;  2GJR A;  2WYR A;  1YIT B;  5JBQ A;  4P2N A;  2C77 A;  1UD8 A;  1XE1 A;  2Q6I A;  4YAF A;  1GAW A;  3R6J A;  4DK0 A;  4B47 A;  4PC3 A;  1YJW B;  3U6B A;  4B44 A;  2NV4 A;  1S72 B;  2X53 S;  2QEX B;  3OZV A;  1KK2 A;  1W35 A;  1F60 A;  2ZBU A;  4OOX A;  2V4D A;  3BH4 A;  2OBS A;  1WOO A;  2DYI A;  4ZGN B;  1QG0 A;  1SKQ A;  2ZL7 A;  4OOV A;  3WND A;  1A8P A;  1NB9 A;  1Y0Y A;  1FRQ A;  1QUF A;  3MMP A;  4WZT A;  1E62 A;  2C4T A;  2X6Y A;  4X7F A;  3QFS A;  4DK1 A;  2F43 A;  4PC6 A;  1W87 A;  1D8T A;  3OJX A;  1EP3 B;  1OB0 A;  2ZL5 A;  1S4M A;  3NE5 B;  1E3Z A;  1PJ6 A;  4XOR A;  1WSR A;  1G7C A;  5TR9 A;  1EXM A;  2D74 A;  2WZN A;  2B7B A;  3ASQ A;  2XZO A;  5TRD A;  4XLF A;  4C43 A;  2R6H A;  5HKK A;  2AHO A;  2XEX A;  3I55 B;  2QTZ A;  4X07 A;  4II2 A;  5CDF A;  4RCY A;  4ACA A;  2XGJ A;  3SLD A;  3A3B A;  1UMK A;  1NBM A;  1BQE A;  3B8H A;  2QE7 A;  1IB0 A;  1K9M D;  3QFR A;  1BLI A;  1ZM9 A;  1R5B A;  1FNB A;  1D1N A;  4TMT A;  1R5O A;  1KD1 D;  3J81 k;  5HXB A;  4PGO A;  4YEL A;  3ES9 A;  3G71 B;  4Z4S A;  2C78 A;  1VQ5 B;  2E1R A;  1NDH A;  3HAG A;  4Z4R A;  3W2H A;  3SJP A;  2DIE A;  2OBR A;  4G1V A;  3OFN A;  3OJW A;  5AN9 A;  3CB4 A;  4N3G A;  4X06 A;  1HA3 A;  3CCJ B;  3AVW A;  3BNW A;  3CES A;  4NBS A;  3Q3A A;  3W5V A;  1JJ2 B;  2XND A;  3BY1 A;  4RPB A;  3CW2 A;  3V7A A;  1DG1 G;  3PA2 A;  1RQP A;  4G1B A;  2FVG A;  1V0E A;  4JMQ A;  3P27 A;  4RD6 A;  1AIP A;  1V5V A;  4FXU A;  5F4J A;  4ASU A;  4FWT A;  1CNF A;  4Z4W A;  3VR6 A;  3VO1 A;  4Q7J B;  3ZBT A;  1VQ6 B;  3WNB A;  1BX0 A;  3ZZU A;  3KEW A;  4B3G A;  3BY2 A;  1E3X A;  1FND A;  4Z4T A;  4PC2 A;  1XQB A;  4M4S A;  2JDI A;  4LBY A;  1QVF B;  3AVY A;  2PE3 A;  3OW7 A;  4KKU A;  1N08 A;  1VHO A;  4P1V A;  4CQJ A;  1Q81 D;  1MRZ A;  3P26 A;  2D3L A;  2WZP P;  2X6X A;  3ASR A;  5BSY A;  4HE6 A;  1VQM B;  1OB5 A;  4XQF A;  1FX0 A;  2HMA A;  3I56 B;  3JQP A;  2EFG A;  4P22 A;  3CC4 B;  3FPP A;  3WBJ A;  3G6E B;  4YXW A;  2QTL A;  3AVV A;  4XKV A;  3G4S B;  4YAU A;  1VQO B;  2Z6B D;  2PMD A;  1UD2 A;  1ELO A;  1I18 A;  1KJZ A;  2ZBV A;  3QSY A;  1N8R D;  4X8I A;  3A8K A;  2V7W A;  2XNJ A;  1YX2 A;  2QGG A;  4AVZ A;  5A88 A;  1NRK A;  2BSA A;  3W5U A;  1KK0 A;  1W0J A;  3W2E A;  1VQ8 B;  3VNU A;  5HZA A;  1BJK A;  4M0L A;  3PUN A;  4RD1 A;  2CND A;  4TMZ A;  2XZL A;  1B2R A;  3OZU A;  4ZCM A;  4RDJ A;  4ROX A;  1N07 A;  2ZZE A;  2RC6 A;  4G6I A;  4WZK A;  1CNE A;  1P4M A;  4TSF A;  4XOT A;  1T6Y A;  1RQR A;  3JQR A;  1EFT A;  1N06 A;  4DQL A;  4TT3 A;  1WU8 A;  4YHB A;  4M53 A;  3CMM A;  4B3F X;  1VQN B;  4QFM A;  4F7D A;  2ZTG A;  5FL7 A;  1WOP A;  4II3 A;  5F4M A;  4RD2 A;  3CCR B;  5J35 A;  4G7W A;  4BPR A;  1VQP B;  2GJK A;  5EMN A;  4AF7 A;  1N05 A;  2Q6K A;  1T6Z A;  2PIA A;  2VYQ A;  1QVG B;  4DQK A;  3D26 A;  1N0V C;  2V7X A;  2VBT A;  3GIR A;  3QE2 A;  5FA6 A;  3ZIA A;  1VJS A;  3CCS B;  3ASS A;  2X8K A;  2FX3 A;  3BCF A;  2GRE A;  2CF4 A;  2C2W A;  1FNM A;  2HCJ B;  3FKS A;  3CCV B;  2ZXI A;  4OP7 A;  1YJ9 B;  1FRN A;  3DDY A;  2ZL6 A;  3QFC A;  2DOG A;  3PVD A;  4RD4 A;  3CCQ B;  2BMW A;  4TN1 A;  4UZE A;  5HZB A;  4YAL A;  5IK2 A;  5KNL A;  1TTT A;  2KVO A;  2CBX A;  2VBV A;  1JA0 A;  2EIX A;  3GVL A;  4RM0 A;  5IYN A;  2R9V A;  3W2I A;  1BMF A;  4OOS A;  1UD6 A;  2LZJ A;  2VJI A;  3A1P A;  1HZE A;  5DN6 A;  4B48 A;  3AGP A;  4LBW A;  4P3I A;  3SLN A;  1H42 A;  1OGJ A;  2HDN B;  2PLF A;  2YWE A;  3G05 A;  1VQ4 B;  1H8E A;  1UD5 A;  3I1F A;  1EFU A;  5TY0 A;  1M90 D;  4RDL A;  4XN3 A;  2P3M A;  4RCZ A;  4PC7 A;  1GR1 A;  2M5S A;  4M1K A;  1VQ9 B;  2YWH A;  3W2G A;  2B5O A;  5J3O A;  1DDI A;  1Q9S A;  4WWV A;  4XM3 A;  1WP6 A;  1KZL A;  1FNC A;  3Q38 A;  3Q6Q A;  3ASP A;  1WSV A;  2DET A;  2CW5 A;  2ZZG A;  4ACB A;  3B82 A;  5GV7 A;  3AVX A;  4DNR B;  4K1X A;  3FJO A;  1QGY A;  5H59 A;  2GJP A;  1KK1 A;  1ZM3 A;  2DCU A;  5A89 A;  4Z4V A;  4L8J A;  1EP2 B;  2VNI A;  3ZBU A;  1KQS B;  1IJE A;  3WNC A;  2BM1 A;  2GPJ A;  2V7V A;  2HLD A;  3LQE A;  1KK3 A;  3BC9 A;  1W9X A;  2F1L A;  1WOS A;  3PEN A;  2BVN A;  2OTJ B;  4M2L A;  2W6I A;  4YEJ A;  1Q86 D;  3CCL B;  2VNJ A;  4UZF A;  1BX1 A;  2V7T A;  1K73 D;  1QFZ A;  3CP8 A;  1OGI A;  4P12 A;  3FPK A;  4B3X A;  5IYR A;  4UZU A;  1N0U A;  2OYN A;  1WTH D;  3CRZ A;  3OW2 B;  2BF4 A;  1QX4 A;  3SEJ A;  1PJ7 A;  2VNH A;  4FK8 A;  3GVJ A;  1CQX A;  3Q39 A;  2Q6O A;  4Z4U A;  3ZZ0 A;  4IW3 B;  1WPC A;  3CXC B;  2DEU A;  4OPV A;  1JNY A;  1KMH A;  1Y0R A;  2WSS A;  1OHH A;  2CC2 A;  2QA4 B;  1YLO A;  3LO8 A;  2QMU A;  3CCU B;  2BV3 A;  3CC7 B;  5A8A A;  1J9Z A;  4QV2 A;  2B7C A;  1UD4 A;  1EWY A;  2GQF A;  2V31 A;  3T51 B;  1KRH A;  1PKV A;  3OEE A;  1FDR A;  4YAW A;  1S0U A;  4HIZ A;  4AF6 A;  1COW A;  3CMA B;  2BPO A;  2YWF A;  3OP1 A;  3A35 A;  3WQZ A;  1R5N A;  2E1B A;  3OPO A;  2X3U A;  4LC0 A;  2VNK A;  1G7S A;  1IHM A;  1MAB A;  2ZXH A;  2WPD A;  1QGA A;  2OK7 A;  4RD0 A;  5FIU A;  2QN6 A;  4KKS A;  3CME B;  5FO1 A;  4TKO B;  3VO2 A;  1G7T A;  4C0S A;  3OOC A;  1QGZ A;  3OZW A;  2CRV A;  2VBS A;  1UD3 A;  3Q6R A;  1AMO A;  4PAA A;  1TLL A;  2J7K A;  4QHY A;  1GJR A;  1GVH A;  4XKW A;  4XNF A;  4X05 A;  3W5H A;  3SJZ A;  3LQ6 A;  1KTV A;  3U2Q A;  3U6K A;  4LBV A;  2DY1 A;  4J0Q A;  1GAQ A;  3KL9 A;  4Z4Y A;  1H85 A;  1XB2 A;  4AC9 A;  3GQB A;  1VLO A;  3ONY A;  2C4U A;  1K28 D;  3OE7 A;  2VBU A;  4XLE A;  5E6T A;  4Z4Z A;  3A8I A;  4XLC A;  4XR6 A;  1VHE A;  2ZZQ A;  1QUE A;  4KKT A;  4TMV A;  1SM4 A;  4YAO A;  3WXM A;  4XOP A;  2GK6 A;  3RY8 A;  4Y9R A;  3WY9 A;  1M1K D;  2JJ2 A;  4DNT B;  2X0K A;  1PJ5 A;  1YHQ B;  1TVC A;  3B78 A;  1E79 A;  3H94 A;  4PAB A;  1ZM2 A;  3MHP A;  1VQL B;  4QVJ A;  4ZV4 A;  5GV8 A;  5IYW A;  1NJI D;  4HE5 A;  2I1L A;  3WBK A;  3ZUG A;  3CPW B;  1G7R A;  3JU4 A;  4EH1 A;  3AVT A;  2QDX A;  1U2R A;  1QFY A;  3E20 A;  1QFJ A;  4MYT A;  1VLY A;  4P6V F;  4E0F A;  4OPO A;  4B43 A;  3CCE B;  4XLA A;  1VQ7 B;  2VZL A;  1EP1 B;  1H8H A;  4RDK A;  3ZZT A;  4B4D A;  4NNJ A;  4XMY A;  3ONU A;  4XL9 A;  4MYU A;  4P3Y A;  3OKX A;  5H5J A;  1QH0 A;  1V0F A;  3BQJ A;  3CCM B;  1VF7 A;  2F4N A;  4RLZ A;  4RJL A;  3LNN A;  4P6Y A;  1W0K A;  4XN0 A;  5TV2 A;  1JA1 A;  4X7E A;  4G7X A;  1E1Q A;  1KC8 D;  3LVB A;  3ZC3 A;  2BN4 A;  3CPX A;  3A8J A;  4R71 A;  2OTL B;  1K8A D;  3W2F A;  4RD3 A;  4PC1 A;  1OB2 A;  3OEH A;  4OPS A;  4TMX A;  1XFO A;  1E64 A;  1WDT A;  1Q7Y D;  2XOK A;  5L46 A;  1EFR A;  5KSW B;  4RPD A;  4UAJ A;  4ZGQ B;  2V7Q A;  2VJJ A;  5B6I A;  1ZUN B;  4H9G A;  4WQM A;  4GQN A;  1WOR A;  4XD7 A;  5THX A;  2OK8 A;  2W6J A;  4X7D A;  1F20 A;  3CTA A;  3BCD A;  4N3N A;  3PUM A;  4FN5 A;  3GSI A;  2Q6L A;  2D3N A;  2XZP A;  3JQQ A;  3ZPN A;  5F4O A;  4NCN A;  5DSZ A;  1NB0 A;  1T6X A;  2XNC A;  5IYQ A;  4G5G A;  2ZZF A;  3OAA A;  3PA1 A;  3WYA A;  4X0C A;  1D2E A;  2JIZ A;  1E1R A;  2BGI A;  1E43 A;  2CK3 A;  4QVA A; 
#chains in the Genus database with same CATH homology
 5HZB A;  4Z4R A;  3SJP A;  2OBR A;  3Q6R A;  4RM0 A;  4X06 A;  4X05 A;  5IYN A;  3LQ6 A;  5BSX A;  4OOS A;  3Q3A A;  4X7C A;  3BY1 A;  4WZL A;  4RPB A;  3V7A A;  3PA2 A;  4Z4Y A;  4P3I A;  5F4J A;  3SLN A;  5KW9 A;  4Z4W A;  3ONY A;  5E6T A;  5IYP A;  4Z4Z A;  4P26 A;  3BY2 A;  4Z4T A;  4RDL A;  4WZE A;  3SKB A;  3RY8 A;  2OBT A;  4P1V A;  3R6K A;  5BSY A;  5J3O A;  3ASR A;  3Q38 A;  3Q6Q A;  3ASP A;  3AST A;  4QVJ A;  5IYW A;  4Z4V A;  4QUZ A;  4OPO A;  4P25 A;  3LQE A;  4RDK A;  3ONU A;  5HZA A;  4P2N A;  3PUN A;  3BQJ A;  3R6J A;  4RLZ A;  4RDJ A;  4ROX A;  4P12 A;  4Z4S A;  5IYR A;  4WZK A;  4X7E A;  4OOX A;  3SEJ A;  2OBS A;  3Q39 A;  4Z4U A;  4OPV A;  4OPS A;  2ZL7 A;  4OOV A;  4WZT A;  4X7F A;  4RPD A;  2ZL5 A;  5F4M A;  4QV2 A;  4X7D A;  5J35 A;  3ASQ A;  3PUM A;  4X07 A;  3SLD A;  3D26 A;  5F4O A;  3ASS A;  1IHM A;  5IYQ A;  3PA1 A;  4OP7 A;  4X0C A;  2ZL6 A;  3PVD A;  4QVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...