5IYNA

Protruding domain of gii.4 human norovirus chdc2094
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
305
structure length
303
Chain Sequence
KPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTTQLSAVNICNFRGDVTRVGISHDYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGLLTQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDGHQNEPQQWVLPNYSGTSGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDCLLPQEWVSHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVIPPNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Four decades of structural evolution of GII.4 norovirus
rcsb
source organism Norovirus hu/gii.4/chdc2094/1974/us
molecule tags Viral protein
total genus 69
structure length 303
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5iynA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5iynA01
4Z4RA 3ONUA 4OOVA 5IYQA 4X0CA 3BY1A 4P2NA 2OBRA 3LQ6A 4OOXA 5F4MA 4RLZA 3D26A 4QV2A 4Z4TA 4P3IA 3SLNA 4P1VA 3PVDA 3Q38A 4X06A 4X7DA 4OPSA 3Q6RA 4Z4VA 4QVJA 4P26A 2OBTA 4QUZA 5F4JA 5IYNA 3SJPA 4WZKA 3BQJA 4WZTA 4OPVA 5IYPA 4RM0A 4ROXA 3SLDA 2ZL7A 4X05A 4Z4SA 5HZAA 4Z4YA 4QVAA 5J3OA 4OPOA 4OP7A 2ZL5A 5J35A 4X7CA 4OOSA 3Q3AA 3ASQA 3PUNA 5BSYA 4RDJA 3ASTA 4RDLA 3RY8A 2ZL6A 3V7AA 3ONYA 2OBSA 5E6TA 3BY2A 3ASPA 3ASSA 3LQEA 3PA2A 3Q39A 4RPDA 3ASRA 4X07A 5F4OA 1IHMA 4Z4ZA 3R6JA 4RPBA 4P12A 3SEJA 4X7EA 4RDKA 4P25A 3Q6QA 3SKBA 4Z4WA 4X7FA 5IYRA 3PUMA 5BSXA 5KW9A 3PA1A 5HZBA 3R6KA 4WZEA 4WZLA 4Z4UA 5IYWA
chains in the Genus database with same CATH superfamily
1K28D 4DNRB 3AVTA 1NB0A 5IYQA 2DYIA 3CMAB 3BC9A 3QE2A 2DY1A 1V0FA 1VQ7B 3AVWA 2BF4A 2OBRA 3OE7A 4Y7CA 1VQ8B 4OOXA 3AVYA 2BPOA 3VNUA 1MABA 4ACAA 2QDXA 2QN6A 3MHPA 3W2EA 4PC2A 1NB9A 2CRVA 3OJWA 1UD5A 3OW2B 2KVOA 4XLAA 3B78A 4E0FA 3CPWB 3Q38A 4X06A 4X7DA 4OPSA 2V7TA 3CMMA 4HE6A 4Z4VA 5DN6A 4YALA 4P26A 2D74A 1OHHA 3E20A 5IYNA 1QGYA 4XNFA 3SJPA 1YHQB 1P4MA 4WZKA 3GVJA 2PE3A 2D3NA 4K1XA 4TSFA 1E3ZA 1WU8A 3G05A 5FL7A 4AVZA 1UD3A 4RM0A 2VNHA 2DCUA 1OGIA 4M53A 4M2LA 2DOGA 2GK6A 4P6VF 2F43A 3JQQA 4JMQA 4DNTB 3CMEB 1YX2A 1ZUNB 4X05A 1TTTA 2V7QA 1S72B 3BCDA 5HZAA 3OZWA 1WPCA 1M1KD 1R5BA 3OPOA 1FNBA 1N06A 3I56B 3OP1A 2BSAA 1E63A 2X8KA 3OEEA 2QMUA 5A88A 1ZM2A 2GJRA 4M1KA 2QA4B 1FNDA 1D1NA 1EP3B 1VF7A 3B82A 2RC6A 4X7CA 3V76A 1KJZA 4B47A 1W87A 1S4MA 4IW3B 3ASTA 4FK8A 4KKUA 2LZJA 4RDLA 4XD7A 3RY8A 4HIZA 4CQJA 4B3XA 2VYQA 2VBUA 2ZTGA 2ZZGA 3ONYA 5AN9A 4N3GA 1BMFA 2ZBUA 3VO1A 5FA6A 3WNCA 1UD6A 4Y9UA 3G71B 5DS0A 5E6TA 4AF6A 5LMZA 4B4DA 1PKVA 3BY2A 1NDHA 1M90D 1VQ6B 2QTZA 2B7CA 3CRZA 2CBXA 1JNYA 1QH0A 4NBSA 3GSIA 2YWGA 1EFUA 5TY0A 4UZEA 2XZOA 1T6XA 3QFCA 4P12A 3G4SB 3CCRB 1I18A 1QFZA 1NRKA 2VJJA 4RCZA 5H5JA 4P25A 3SKBA 5KSWB 1D8TA 2V7UA 2PLFA 2BGJA 3PUMA 5BSXA 2C77A 2F1MA 1W2BB 4RD1A 1GAWA 1V5VA 2XNJA 4II2A 3FKSA 4YEJA 2WPDA 2YWHA 3J81k 1VJSA 3OEHA 3OKXA 4WZEA 1WSRA 1XQBA 1ZM9A 4DQKA 4WZLA 4G7WA 4Z4UA 1YJWB 4XLEA 5IYWA 1A8PA 2CW5A 4QHYA 1VHEA 3JQRA 1OB5A 4P22A 3GVKA 1QVFB 2HMAA 3ZZTA 4X0CA 3ZPNA 1E43A 1HA3A 3HAGA 2RC5A 5JBQA 3WBJA 4LC0A 3ES9A 3T51B 1PJ7A 4XKVA 3W5HA 1BX1A 2C2WA 2JIZA 2VJIA 1EP1B 5F4MA 4ZGNB 2BMWA 4G1BA 2BN4A 4RLZA 2M5SA 3D26A 4QV2A 1QUEA 2BM1A 3JQPA 3CW2A 1N08A 4P3IA 3W2HA 4P1VA 4U9UA 3G6EB 2DEUA 3CCUB 1KTVA 3Q6RA 4MYUA 4QVJA 3JU4A 5A89A 1E1QA 2X85A 1KK1A 5KNLA 3QSYA 3GQBA 3A8KA 2OTLB 3ZC3A 4XLHA 2HLDA 2VNJA 4OPVA 2NPFA 5TR9A 5A8AA 3OZVA 1B23P 1VQPB 1VQ5B 2V7WA 1B2RA 3KL9A 1ELOA 4HE5A 2E1RA 4XOTA 3SJZA 1IJEA 2ZZEA 4RD3A 3SLDA 4LBWA 2VNIA 1XE1A 1JA0A 1FRNA 4TN1A 1UD2A 3CCJB 1WTHD 1QX4A 3CP2A 3W5VA 1VHOA 5CDFA 4TMWA 5J3OA 4TMZA 3AVXA 1IJFA 1E1RA 3CXCB 1XFOA 4RD0A 4YAFA 3CC4B 1WOPA 1T6YA 3LO8A 1U2RA 1W9XA 3QFTA 2WJVA 1N07A 2GPJA 1WOSA 2B5OA 1G7TA 5J35A 1OGJA 1T5EA 5GV8A 3ASQA 3PUNA 4FXUA 1IB0A 1FNCA 2V7XA 2EIXA 4RDJA 3WXMA 3ISXA 3H94A 4TKOB 1EP2B 4PABA 1E79A 1N0UA 1WSVA 4XL9A 4B44A 5HXBA 4GQNA 5H59A 2JDIA 4M4SA 3A8IA 1OB2A 1GAQA 1T6ZA 2YWFA 4M0LA 4PC1A 1TLLA 2OYNA 1F60A 3CCLB 1K9MD 2JJ2A 3PA2A 3Q39A 1Q82D 3A35A 4RPDA 2OTJB 1IHMA 3R6JA 4XMYA 2E1BA 2VBVA 4R71A 4NCNA 4WWVA 1FRQA 4DK0A 1SM4A 2Q6KA 3SEJA 1DARA 1GJRA 3ZIAA 1BQEA 1BPLA 1YLOA 3Q6QA 4Z4WA 2BGIA 1W0KA 1QG0A 1Y0RA 1E64A 1AIPA 2C4TA 4PC3A 1Q7YD 1BLIA 3PA1A 4C0SA 2QEXB 4YELA 2C78A 2VBTA 2QGGA 2CF4A 4N3NA 4RD6A 5DSZA 2ZXIA 1Q86D 4YHBA 1N0VC 3A3GA 1HVXA 1XB2A 1G7CA 1I7PA 1KK2A 5EMNA 4OOVA 4UAJA 1DDGA 1PJ6A 4G5GA 3I55B 2GK7A 2ZITA 2PIAA 5GV7A 2WSSA 4P2NA 2X6XA 3LQ6A 4PC6A 2WZPP 3NE5B 1BJKA 1RQRA 4XLFA 1VQMB 3OAAA 1QVGB 4WQMA 1VLOA 3OZUA 3BCFA 1YIJB 2X6YA 1ZM3A 2OK7A 2P3MA 2XGJA 4TMXA 4B43A 1QUFA 1TUIA 2R9VA 1KK3A 1DDIA 2XNDA 4TMVA 4Y9RA 1N8RD 3BQJA 4WZTA 3LVBA 1FX0A 4XM3A 3AGPA 4XR6A 3BNWA 3QFSA 1KD1D 5HKKA 4P6YA 3BH4A 2Q6LA 1FNMA 3MCAA 2ZL7A 1UMKA 4XONA 1SKYB 3A8JA 4Z4YA 2D9RA 4B3FX 4XLCA 1H8EA 4KKTA 4PGOA 3CCMB 1YJNB 4P3YA 4RJLA 1JB9A 4YAUA 2B7BA 3AGQA 4AF7A 4ZCIA 2ZZFA 2HCJB 4OP7A 5FO1A 2HDNB 1H85A 2PMDA 4LBYA 1VQ9B 1KK0A 3FPKA 3AVUA 1VLYA 1QGZA 5BSYA 2FX3A 1BX0A 4P9SA 4TT3A 4ZCLA 1JJ2B 1YITB 2ZZQA 3WQZA 2ZL6A 3I1FA 3V7AA 3A3BA 1S0UA 3T53B 1V0EA 1AMOA 1H42A 4UZUA 4RD4A 3OFNA 1GO2A 1PJ5A 3ZBTA 3CB4A 3WNBA 2YWEA 2BVNA 2J7KA 2I1LA 3T56B 1DG1G 2QE7A 1K73D 4KKSA 2XOKA 5F4OA 4C43A 1GVHA 2QTLA 3QFRA 2EFGA 2BM0A 1CNFA 1WORA 2GREA 4RPBA 3ZZ0A 1QFJA 2ZBVA 5TRDA 4X7EA 1J9ZA 4RDKA 2X3UA 4BPRA 3CPXA 4X7FA 3W2GA 3WNDA 1R5NA 1WP6A 4ZGQB 1WDTA 1HZEA 2F1LA 2XEXA 5KW9A 1Q9SA 2F4NA 4L8JA 2ZXHA 4X8IA 5B6IA 2W6IA 3P26A 3LNNA 3W5UA 2AHOA 2XZPA 2WJYA 3CCQB 3B8HA 3CCEB 4XN3A 4XKWA 3FPPA 4FWTA 1UD4A 4MYTA 3CD6B 4Z4RA 1KZLA 2GJKA 3H9NA 2C5BA 3ONUA 4J0QA 4H9GA 2DETA 1UD8A 1TVCA 3FJOA 3ZBUA 1VQNB 2OK8A 3BY1A 1EFTA 4B3GA 4LBZA 1GR1A 2V31A 1CQXA 4RD2A 2CC2A 4NNJA 4TMTA 2X6WA 1VQKB 4G1VA 2VNKA 1COWA 4Z4TA 3SLNA 3PVDA 4G7XA 1YI2B 1NBMA 3VO2A 4EH1A 5FO0A 3CP8A 4PC7A 3OJXA 2OBTA 1E62A 3GVLA 4QUZA 3E1YE 5F4JA 3OOCA 2WR8A 4Z1MA 5THXA 3KEWA 3GIRA 1H8HA 2CNDA 4UZFA 1EFRA 4XOPA 1KQSB 4YAOA 1CNEA 1QFYA 5IYPA 3VR6A 1G7SA 1OB0A 4ROXA 1W0JA 1W35A 4Q7JB 4YAWA 2Z6BD 1NJID 4Z4SA 2JN9A 1YJ9B 2WZNA 2C4UA 3CC2B 1EXMA 2WYRA 2NV4A 4QVAA 3WBKA 1JA1A 2Q6OA 4DK1A 3CTAA 3U6BA 4OPOA 4YXWA 3AVVA 1VQOB 2DERA 2X53S 5FIUA 2X0KA 2ZL5A 3U2QA 1N05A 2W6JA 3DDYA 2XZLA 2VZLA 3A1PA 1VQLB 1KMHA 4QFMA 3ZUGA 1E3XA 5IK2A 4OOSA 3Q3AA 2V4DA 1F20A 1KRHA 2DIEA 4XORA 2C5HA 3W2FA 2D3LA 1KC8D 2JJ1A 3PENA 4G6IA 2XNCA 2OBSA 1FDRA 2VBSA 4ZCMA 1WOOA 4AC9A 4B48A 2FVGA 1K8AD 4ZV4A 3ASPA 1QGAA 2V7VA 4RCYA 4XN0A 4XQFA 3ASSA 3LQEA 5FNZA 3CCVB 3WYAA 3ZZUA 1G7RA 1W34A 2GJPA 1R5OA 3ASRA 4X07A 1RQPA 1ZM4A 4Z4ZA 2BV3A 1EWYA 2R6HA 1I8DA 4LBVA 1VQ4B 1Q81D 4DQLA 3VMFA 3OW7A 1EFCA 2Q6IA 5IYRA 3CC7B 3U6KA 2ZTNA 3W2IA 2CK3A 3VNVA 5L46A 3MMPA 3CCSB 3P27A 4FN5A 2GQFA 5TV2A 4F7DA 5HZBA 3R6KA 4PAAA 1D2EA 4ACBA 1Y0YA 1SKQA 4ASUA 4II3A 3WY9A 3CESA 1MRZA
chains in the Genus database with same CATH topology
4Z4RA 3ONUA 4OOVA 5IYQA 4X0CA 3BY1A 4P2NA 2OBRA 3LQ6A 4OOXA 5F4MA 4RLZA 3D26A 4QV2A 4Z4TA 4P3IA 3SLNA 4P1VA 3PVDA 3Q38A 4X06A 4X7DA 4OPSA 3Q6RA 4Z4VA 4QVJA 4P26A 2OBTA 4QUZA 5F4JA 5IYNA 3SJPA 4WZKA 3BQJA 4WZTA 4OPVA 5IYPA 4RM0A 4ROXA 3SLDA 2ZL7A 4X05A 4Z4SA 5HZAA 4Z4YA 4QVAA 5J3OA 4OPOA 4OP7A 2ZL5A 5J35A 4X7CA 4OOSA 3Q3AA 3ASQA 3PUNA 5BSYA 4RDJA 3ASTA 4RDLA 3RY8A 2ZL6A 3V7AA 3ONYA 2OBSA 5E6TA 3BY2A 3ASPA 3ASSA 3LQEA 3PA2A 3Q39A 4RPDA 3ASRA 4X07A 5F4OA 1IHMA 4Z4ZA 3R6JA 4RPBA 4P12A 3SEJA 4X7EA 4RDKA 4P25A 3Q6QA 3SKBA 4Z4WA 4X7FA 5IYRA 3PUMA 5BSXA 5KW9A 3PA1A 5HZBA 3R6KA 4WZEA 4WZLA 4Z4UA 5IYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4R A;  3ONU A;  4OOV A;  5IYQ A;  4X0C A;  3BY1 A;  4P2N A;  2OBR A;  3LQ6 A;  4OOX A;  5F4M A;  4RLZ A;  3D26 A;  4QV2 A;  4Z4T A;  4P3I A;  3SLN A;  4P1V A;  3PVD A;  3Q38 A;  4X06 A;  4X7D A;  4OPS A;  3Q6R A;  4Z4V A;  4QVJ A;  4P26 A;  2OBT A;  4QUZ A;  5F4J A;  5IYN A;  3SJP A;  4WZK A;  3BQJ A;  4WZT A;  4OPV A;  5IYP A;  4RM0 A;  4ROX A;  3SLD A;  2ZL7 A;  4X05 A;  4Z4S A;  5HZA A;  4Z4Y A;  4QVA A;  5J3O A;  4OPO A;  4OP7 A;  2ZL5 A;  5J35 A;  4X7C A;  4OOS A;  3Q3A A;  3ASQ A;  3PUN A;  5BSY A;  4RDJ A;  3AST A;  4RDL A;  3RY8 A;  2ZL6 A;  3V7A A;  3ONY A;  2OBS A;  5E6T A;  3BY2 A;  3ASP A;  3ASS A;  3LQE A;  3PA2 A;  3Q39 A;  4RPD A;  3ASR A;  4X07 A;  5F4O A;  1IHM A;  4Z4Z A;  3R6J A;  4RPB A;  4P12 A;  3SEJ A;  4X7E A;  4RDK A;  4P25 A;  3Q6Q A;  3SKB A;  4Z4W A;  4X7F A;  5IYR A;  3PUM A;  5BSX A;  5KW9 A;  3PA1 A;  5HZB A;  3R6K A;  4WZE A;  4WZL A;  4Z4U A;  5IYW A; 
#chains in the Genus database with same CATH topology
 1K28 D;  4DNR B;  3AVT A;  1NB0 A;  5IYQ A;  2DYI A;  3CMA B;  3BC9 A;  3QE2 A;  2DY1 A;  1V0F A;  1VQ7 B;  3AVW A;  2BF4 A;  2OBR A;  3OE7 A;  4Y7C A;  1VQ8 B;  4OOX A;  3AVY A;  2BPO A;  3VNU A;  1MAB A;  4ACA A;  2QDX A;  2QN6 A;  3MHP A;  3W2E A;  4PC2 A;  1NB9 A;  2CRV A;  3OJW A;  1UD5 A;  3OW2 B;  2KVO A;  4XLA A;  3B78 A;  4E0F A;  3CPW B;  3Q38 A;  4X06 A;  4X7D A;  4OPS A;  2V7T A;  3CMM A;  4HE6 A;  4Z4V A;  5DN6 A;  4YAL A;  4P26 A;  2D74 A;  1OHH A;  3E20 A;  5IYN A;  1QGY A;  4XNF A;  3SJP A;  1YHQ B;  1P4M A;  4WZK A;  3GVJ A;  2PE3 A;  2D3N A;  4K1X A;  4TSF A;  1E3Z A;  1WU8 A;  3G05 A;  5FL7 A;  4AVZ A;  1UD3 A;  4RM0 A;  2VNH A;  2DCU A;  1OGI A;  4M53 A;  4M2L A;  2DOG A;  2GK6 A;  4P6V F;  2F43 A;  3JQQ A;  4JMQ A;  4DNT B;  3CME B;  1YX2 A;  1ZUN B;  4X05 A;  1TTT A;  2V7Q A;  1S72 B;  3BCD A;  5HZA A;  3OZW A;  1WPC A;  1M1K D;  1R5B A;  3OPO A;  1FNB A;  1N06 A;  3I56 B;  3OP1 A;  2BSA A;  1E63 A;  2X8K A;  3OEE A;  2QMU A;  5A88 A;  1ZM2 A;  2GJR A;  4M1K A;  2QA4 B;  1FND A;  1D1N A;  1EP3 B;  1VF7 A;  3B82 A;  2RC6 A;  4X7C A;  3V76 A;  1KJZ A;  4B47 A;  1W87 A;  1S4M A;  4IW3 B;  3AST A;  4FK8 A;  4KKU A;  2LZJ A;  4RDL A;  4XD7 A;  3RY8 A;  4HIZ A;  4CQJ A;  4B3X A;  2VYQ A;  2VBU A;  2ZTG A;  2ZZG A;  3ONY A;  5AN9 A;  4N3G A;  1BMF A;  2ZBU A;  3VO1 A;  5FA6 A;  3WNC A;  1UD6 A;  4Y9U A;  3G71 B;  5DS0 A;  5E6T A;  4AF6 A;  5LMZ A;  4B4D A;  1PKV A;  3BY2 A;  1NDH A;  1M90 D;  1VQ6 B;  2QTZ A;  2B7C A;  3CRZ A;  2CBX A;  1JNY A;  1QH0 A;  4NBS A;  3GSI A;  2YWG A;  1EFU A;  5TY0 A;  4UZE A;  2XZO A;  1T6X A;  3QFC A;  4P12 A;  3G4S B;  3CCR B;  1I18 A;  1QFZ A;  1NRK A;  2VJJ A;  4RCZ A;  5H5J A;  4P25 A;  3SKB A;  5KSW B;  1D8T A;  2V7U A;  2PLF A;  2BGJ A;  3PUM A;  5BSX A;  2C77 A;  2F1M A;  1W2B B;  4RD1 A;  1GAW A;  1V5V A;  2XNJ A;  4II2 A;  3FKS A;  4YEJ A;  2WPD A;  2YWH A;  3J81 k;  1VJS A;  3OEH A;  3OKX A;  4WZE A;  1WSR A;  1XQB A;  1ZM9 A;  4DQK A;  4WZL A;  4G7W A;  4Z4U A;  1YJW B;  4XLE A;  5IYW A;  1A8P A;  2CW5 A;  4QHY A;  1VHE A;  3JQR A;  1OB5 A;  4P22 A;  3GVK A;  1QVF B;  2HMA A;  3ZZT A;  4X0C A;  3ZPN A;  1E43 A;  1HA3 A;  3HAG A;  2RC5 A;  5JBQ A;  3WBJ A;  4LC0 A;  3ES9 A;  3T51 B;  1PJ7 A;  4XKV A;  3W5H A;  1BX1 A;  2C2W A;  2JIZ A;  2VJI A;  1EP1 B;  5F4M A;  4ZGN B;  2BMW A;  4G1B A;  2BN4 A;  4RLZ A;  2M5S A;  3D26 A;  4QV2 A;  1QUE A;  2BM1 A;  3JQP A;  3CW2 A;  1N08 A;  4P3I A;  3W2H A;  4P1V A;  4U9U A;  3G6E B;  2DEU A;  3CCU B;  1KTV A;  3Q6R A;  4MYU A;  4QVJ A;  3JU4 A;  5A89 A;  1E1Q A;  2X85 A;  1KK1 A;  5KNL A;  3QSY A;  3GQB A;  3A8K A;  2OTL B;  3ZC3 A;  4XLH A;  2HLD A;  2VNJ A;  4OPV A;  2NPF A;  5TR9 A;  5A8A A;  3OZV A;  1B23 P;  1VQP B;  1VQ5 B;  2V7W A;  1B2R A;  3KL9 A;  1ELO A;  4HE5 A;  2E1R A;  4XOT A;  3SJZ A;  1IJE A;  2ZZE A;  4RD3 A;  3SLD A;  4LBW A;  2VNI A;  1XE1 A;  1JA0 A;  1FRN A;  4TN1 A;  1UD2 A;  3CCJ B;  1WTH D;  1QX4 A;  3CP2 A;  3W5V A;  1VHO A;  5CDF A;  4TMW A;  5J3O A;  4TMZ A;  3AVX A;  1IJF A;  1E1R A;  3CXC B;  1XFO A;  4RD0 A;  4YAF A;  3CC4 B;  1WOP A;  1T6Y A;  3LO8 A;  1U2R A;  1W9X A;  3QFT A;  2WJV A;  1N07 A;  2GPJ A;  1WOS A;  2B5O A;  1G7T A;  5J35 A;  1OGJ A;  1T5E A;  5GV8 A;  3ASQ A;  3PUN A;  4FXU A;  1IB0 A;  1FNC A;  2V7X A;  2EIX A;  4RDJ A;  3WXM A;  3ISX A;  3H94 A;  4TKO B;  1EP2 B;  4PAB A;  1E79 A;  1N0U A;  1WSV A;  4XL9 A;  4B44 A;  5HXB A;  4GQN A;  5H59 A;  2JDI A;  4M4S A;  3A8I A;  1OB2 A;  1GAQ A;  1T6Z A;  2YWF A;  4M0L A;  4PC1 A;  1TLL A;  2OYN A;  1F60 A;  3CCL B;  1K9M D;  2JJ2 A;  3PA2 A;  3Q39 A;  1Q82 D;  3A35 A;  4RPD A;  2OTJ B;  1IHM A;  3R6J A;  4XMY A;  2E1B A;  2VBV A;  4R71 A;  4NCN A;  4WWV A;  1FRQ A;  4DK0 A;  1SM4 A;  2Q6K A;  3SEJ A;  1DAR A;  1GJR A;  3ZIA A;  1BQE A;  1BPL A;  1YLO A;  3Q6Q A;  4Z4W A;  2BGI A;  1W0K A;  1QG0 A;  1Y0R A;  1E64 A;  1AIP A;  2C4T A;  4PC3 A;  1Q7Y D;  1BLI A;  3PA1 A;  4C0S A;  2QEX B;  4YEL A;  2C78 A;  2VBT A;  2QGG A;  2CF4 A;  4N3N A;  4RD6 A;  5DSZ A;  2ZXI A;  1Q86 D;  4YHB A;  1N0V C;  3A3G A;  1HVX A;  1XB2 A;  1G7C A;  1I7P A;  1KK2 A;  5EMN A;  4OOV A;  4UAJ A;  1DDG A;  1PJ6 A;  4G5G A;  3I55 B;  2GK7 A;  2ZIT A;  2PIA A;  5GV7 A;  2WSS A;  4P2N A;  2X6X A;  3LQ6 A;  4PC6 A;  2WZP P;  3NE5 B;  1BJK A;  1RQR A;  4XLF A;  1VQM B;  3OAA A;  1QVG B;  4WQM A;  1VLO A;  3OZU A;  3BCF A;  1YIJ B;  2X6Y A;  1ZM3 A;  2OK7 A;  2P3M A;  2XGJ A;  4TMX A;  4B43 A;  1QUF A;  1TUI A;  2R9V A;  1KK3 A;  1DDI A;  2XND A;  4TMV A;  4Y9R A;  1N8R D;  3BQJ A;  4WZT A;  3LVB A;  1FX0 A;  4XM3 A;  3AGP A;  4XR6 A;  3BNW A;  3QFS A;  1KD1 D;  5HKK A;  4P6Y A;  3BH4 A;  2Q6L A;  1FNM A;  3MCA A;  2ZL7 A;  1UMK A;  4XON A;  1SKY B;  3A8J A;  4Z4Y A;  2D9R A;  4B3F X;  4XLC A;  1H8E A;  4KKT A;  4PGO A;  3CCM B;  1YJN B;  4P3Y A;  4RJL A;  1JB9 A;  4YAU A;  2B7B A;  3AGQ A;  4AF7 A;  4ZCI A;  2ZZF A;  2HCJ B;  4OP7 A;  5FO1 A;  2HDN B;  1H85 A;  2PMD A;  4LBY A;  1VQ9 B;  1KK0 A;  3FPK A;  3AVU A;  1VLY A;  1QGZ A;  5BSY A;  2FX3 A;  1BX0 A;  4P9S A;  4TT3 A;  4ZCL A;  1JJ2 B;  1YIT B;  2ZZQ A;  3WQZ A;  2ZL6 A;  3I1F A;  3V7A A;  3A3B A;  1S0U A;  3T53 B;  1V0E A;  1AMO A;  1H42 A;  4UZU A;  4RD4 A;  3OFN A;  1GO2 A;  1PJ5 A;  3ZBT A;  3CB4 A;  3WNB A;  2YWE A;  2BVN A;  2J7K A;  2I1L A;  3T56 B;  1DG1 G;  2QE7 A;  1K73 D;  4KKS A;  2XOK A;  5F4O A;  4C43 A;  1GVH A;  2QTL A;  3QFR A;  2EFG A;  2BM0 A;  1CNF A;  1WOR A;  2GRE A;  4RPB A;  3ZZ0 A;  1QFJ A;  2ZBV A;  5TRD A;  4X7E A;  1J9Z A;  4RDK A;  2X3U A;  4BPR A;  3CPX A;  4X7F A;  3W2G A;  3WND A;  1R5N A;  1WP6 A;  4ZGQ B;  1WDT A;  1HZE A;  2F1L A;  2XEX A;  5KW9 A;  1Q9S A;  2F4N A;  4L8J A;  2ZXH A;  4X8I A;  5B6I A;  2W6I A;  3P26 A;  3LNN A;  3W5U A;  2AHO A;  2XZP A;  2WJY A;  3CCQ B;  3B8H A;  3CCE B;  4XN3 A;  4XKW A;  3FPP A;  4FWT A;  1UD4 A;  4MYT A;  3CD6 B;  4Z4R A;  1KZL A;  2GJK A;  3H9N A;  2C5B A;  3ONU A;  4J0Q A;  4H9G A;  2DET A;  1UD8 A;  1TVC A;  3FJO A;  3ZBU A;  1VQN B;  2OK8 A;  3BY1 A;  1EFT A;  4B3G A;  4LBZ A;  1GR1 A;  2V31 A;  1CQX A;  4RD2 A;  2CC2 A;  4NNJ A;  4TMT A;  2X6W A;  1VQK B;  4G1V A;  2VNK A;  1COW A;  4Z4T A;  3SLN A;  3PVD A;  4G7X A;  1YI2 B;  1NBM A;  3VO2 A;  4EH1 A;  5FO0 A;  3CP8 A;  4PC7 A;  3OJX A;  2OBT A;  1E62 A;  3GVL A;  4QUZ A;  3E1Y E;  5F4J A;  3OOC A;  2WR8 A;  4Z1M A;  5THX A;  3KEW A;  3GIR A;  1H8H A;  2CND A;  4UZF A;  1EFR A;  4XOP A;  1KQS B;  4YAO A;  1CNE A;  1QFY A;  5IYP A;  3VR6 A;  1G7S A;  1OB0 A;  4ROX A;  1W0J A;  1W35 A;  4Q7J B;  4YAW A;  2Z6B D;  1NJI D;  4Z4S A;  2JN9 A;  1YJ9 B;  2WZN A;  2C4U A;  3CC2 B;  1EXM A;  2WYR A;  2NV4 A;  4QVA A;  3WBK A;  1JA1 A;  2Q6O A;  4DK1 A;  3CTA A;  3U6B A;  4OPO A;  4YXW A;  3AVV A;  1VQO B;  2DER A;  2X53 S;  5FIU A;  2X0K A;  2ZL5 A;  3U2Q A;  1N05 A;  2W6J A;  3DDY A;  2XZL A;  2VZL A;  3A1P A;  1VQL B;  1KMH A;  4QFM A;  3ZUG A;  1E3X A;  5IK2 A;  4OOS A;  3Q3A A;  2V4D A;  1F20 A;  1KRH A;  2DIE A;  4XOR A;  2C5H A;  3W2F A;  2D3L A;  1KC8 D;  2JJ1 A;  3PEN A;  4G6I A;  2XNC A;  2OBS A;  1FDR A;  2VBS A;  4ZCM A;  1WOO A;  4AC9 A;  4B48 A;  2FVG A;  1K8A D;  4ZV4 A;  3ASP A;  1QGA A;  2V7V A;  4RCY A;  4XN0 A;  4XQF A;  3ASS A;  3LQE A;  5FNZ A;  3CCV B;  3WYA A;  3ZZU A;  1G7R A;  1W34 A;  2GJP A;  1R5O A;  3ASR A;  4X07 A;  1RQP A;  1ZM4 A;  4Z4Z A;  2BV3 A;  1EWY A;  2R6H A;  1I8D A;  4LBV A;  1VQ4 B;  1Q81 D;  4DQL A;  3VMF A;  3OW7 A;  1EFC A;  2Q6I A;  5IYR A;  3CC7 B;  3U6K A;  2ZTN A;  3W2I A;  2CK3 A;  3VNV A;  5L46 A;  3MMP A;  3CCS B;  3P27 A;  4FN5 A;  2GQF A;  5TV2 A;  4F7D A;  5HZB A;  3R6K A;  4PAA A;  1D2E A;  4ACB A;  1Y0Y A;  1SKQ A;  4ASU A;  4II3 A;  3WY9 A;  3CES A;  1MRZ A; 
#chains in the Genus database with same CATH homology
 4Z4R A;  3ONU A;  4OOV A;  5IYQ A;  4X0C A;  3BY1 A;  4P2N A;  2OBR A;  3LQ6 A;  4OOX A;  5F4M A;  4RLZ A;  3D26 A;  4QV2 A;  4Z4T A;  4P3I A;  3SLN A;  4P1V A;  3PVD A;  3Q38 A;  4X06 A;  4X7D A;  4OPS A;  3Q6R A;  4Z4V A;  4QVJ A;  4P26 A;  2OBT A;  4QUZ A;  5F4J A;  5IYN A;  3SJP A;  4WZK A;  3BQJ A;  4WZT A;  4OPV A;  5IYP A;  4RM0 A;  4ROX A;  3SLD A;  2ZL7 A;  4X05 A;  4Z4S A;  5HZA A;  4Z4Y A;  4QVA A;  5J3O A;  4OPO A;  4OP7 A;  2ZL5 A;  5J35 A;  4X7C A;  4OOS A;  3Q3A A;  3ASQ A;  3PUN A;  5BSY A;  4RDJ A;  3AST A;  4RDL A;  3RY8 A;  2ZL6 A;  3V7A A;  3ONY A;  2OBS A;  5E6T A;  3BY2 A;  3ASP A;  3ASS A;  3LQE A;  3PA2 A;  3Q39 A;  4RPD A;  3ASR A;  4X07 A;  5F4O A;  1IHM A;  4Z4Z A;  3R6J A;  4RPB A;  4P12 A;  3SEJ A;  4X7E A;  4RDK A;  4P25 A;  3Q6Q A;  3SKB A;  4Z4W A;  4X7F A;  5IYR A;  3PUM A;  5BSX A;  5KW9 A;  3PA1 A;  5HZB A;  3R6K A;  4WZE A;  4WZL A;  4Z4U A;  5IYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...