5IYNA

Protruding domain of gii.4 human norovirus chdc2094
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
305
structure length
303
Chain Sequence
KPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTTQLSAVNICNFRGDVTRVGISHDYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGLLTQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDGHQNEPQQWVLPNYSGTSGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDCLLPQEWVSHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVIPPNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Four decades of structural evolution of GII.4 norovirus
rcsb
source organism Norovirus hu/gii.4/chdc2094/1974/us
molecule tags Viral protein
total genus 69
structure length 303
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5iynA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5iynA01
4Z4SA 3SJPA 5KW9A 3R6JA 3RY8A 4QV2A 3BY2A 3Q3AA 3ASQA 2OBTA 4X7FA 4X7CA 3SKBA 4X07A 4OOSA 3SEJA 3PA1A 2OBRA 3ASPA 3Q39A 4Z4ZA 4Z4TA 2OBSA 5F4JA 4P2NA 4QVAA 4OPSA 4P12A 3Q6QA 4Z4RA 3Q6RA 5IYWA 3BY1A 3PUMA 3D26A 4ROXA 4X06A 4Z4VA 4P1VA 4Z4UA 4P25A 5J35A 4QVJA 4OP7A 5IYNA 5HZBA 3PVDA 5F4OA 4X0CA 4Z4YA 3PA2A 4P3IA 3SLDA 3PUNA 5BSYA 2ZL6A 4RLZA 3SLNA 5E6TA 5J3OA 5IYPA 4QUZA 4RM0A 3BQJA 4OOXA 5HZAA 2ZL5A 4RDJA 4RDKA 4X7EA 4WZEA 3ASTA 5IYRA 4P26A 3V7AA 4OPVA 2ZL7A 4OPOA 4RPBA 4WZLA 3LQEA 1IHMA 3R6KA 4WZKA 3LQ6A 5F4MA 4RDLA 5IYQA 4Z4WA 3ASRA 4RPDA 3ASSA 3ONUA 4WZTA 4X7DA 4OOVA 5BSXA 3Q38A 3ONYA 4X05A
chains in the Genus database with same CATH superfamily
1J9ZA 4YAWA 1IJFA 2BPOA 2XZPA 1PKVA 1QUEA 2VYQA 3RY8A 1CQXA 3A3GA 3QSYA 1TTTA 2DIEA 2AHOA 2ZBVA 2Q6IA 3GVJA 3ASQA 4KKTA 1E3ZA 3ISXA 3J81k 4PAAA 3W2HA 5A8AA 3WQZA 2NPFA 2ZBUA 4RD4A 3U6KA 4IW3B 2WJYA 4EH1A 1BPLA 3B82A 2JDIA 1T5EA 3AGQA 4U9UA 2R6HA 1KMHA 2ZXHA 4P12A 2LZJA 3Q6QA 3CP8A 2RC5A 2CC2A 2WZPP 1VF7A 3W2FA 4B47A 3BY1A 3OW2B 1NB9A 3PUMA 1BQEA 2JIZA 1AMOA 1P4MA 1AIPA 1YJWB 2JJ1A 4P1VA 3A3BA 4Q7JB 4RD3A 3VNVA 3I55B 1G7TA 3H9NA 1GVHA 1Q9SA 4Z4UA 1FNMA 2Q6LA 2XNDA 3AGPA 1VQ9B 3A35A 3WNDA 4GQNA 4FN5A 5GV7A 2XNCA 4DK1A 5KNLA 1Q86D 3H94A 1QFYA 1QVGB 1EFTA 4X8IA 1B2RA 3AVVA 4PC2A 2F1MA 2Z6BD 5F4OA 4DNRB 1VQMB 4X0CA 4HE5A 4LBWA 4AC9A 1IB0A 2B7CA 4E0FA 3JQPA 4UZUA 2ZL6A 3BCDA 1WOPA 1EFRA 2GK6A 2B5OA 1VLOA 3LVBA 2D74A 1Y0YA 1JJ2B 4TT3A 1PJ5A 2X3UA 3OJWA 1JA1A 4QUZA 4RM0A 1QFZA 1QVFB 4RD6A 4YXWA 1BX1A 3QFSA 4PC1A 2M5SA 4AF7A 2YWEA 1R5NA 4RDKA 4G1VA 4B44A 1B23P 4LBVA 3G05A 1WTHD 4P9SA 3CB4A 4H9GA 5JBQA 1N08A 4DK0A 1F60A 1FRNA 2DERA 1TLLA 1RQPA 2QTLA 4G1BA 1T6XA 2QTZA 2NV4A 4P26A 3KL9A 2DOGA 1ELOA 1SKYB 3ZPNA 3P26A 1KRHA 4M1KA 4ZV4A 5A89A 3LQEA 1SKQA 1IHMA 2YWFA 1ZM2A 4DNTB 3LQ6A 3V76A 3HAGA 3ZC3A 4AF6A 1VQ6B 5TR9A 2VJIA 3AVYA 2YWGA 1E1RA 1MABA 5CDFA 3ASRA 1W0KA 3WXMA 2BMWA 1EFUA 1HA3A 1YJ9B 3ONUA 3VO1A 2X6YA 4ZGQB 2EIXA 3CCVB 4P3YA 4K1XA 1FNCA 4B43A 3Q38A 5BSXA 3CC2B 4XONA 1UD5A 4XR6A 4PC6A 2ZTNA 3A8IA 2ZITA 2CRVA 4Z4SA 1KK3A 4M2LA 5TY0A 5TRDA 1QGAA 1ZM9A 1V5VA 4XORA 2WSSA 3JQRA 1I7PA 3E20A 3Q3AA 1KZLA 5FO0A 4X7FA 2XZOA 5THXA 1WP6A 3CW2A 1EP3B 4X07A 3LNNA 2VBTA 3GQBA 2EFGA 3Q39A 4XN3A 2HDNB 3T56B 2D9RA 1VQOB 2VNIA 1WDTA 1EP2B 4P2NA 5F4JA 2WYRA 1FX0A 4G5GA 1EWYA 1DARA 3A8JA 4WQMA 1H42A 2R9VA 4R71A 1G7RA 1W2BB 1KK1A 1KD1D 3OOCA 4ROXA 1EXMA 2YWHA 4X06A 4XD7A 2W6JA 3WBKA 1S72B 4DQLA 4Z4VA 4PABA 2V4DA 4P22A 3W5HA 3CCLB 2DY1A 1N05A 4G7WA 2ZZFA 3WYAA 1QFJA 1NBMA 4NBSA 2RC6A 1F20A 4HE6A 3OP1A 1XB2A 4TMZA 1XE1A 4Z4YA 1G7CA 3PA2A 3U2QA 3QFCA 3SLDA 3ZBUA 1H8HA 1WOSA 5BSYA 1BLIA 3NE5B 4C43A 4RJLA 3SJZA 1YJNB 1G7SA 3QE2A 1QGZA 3CCSB 3CCUB 3AVTA 3CD6B 5J3OA 5IYPA 1WSRA 2VJJA 1E64A 3BCFA 1ZM3A 3WBJA 1ZM4A 4ZCLA 5HKKA 1BJKA 4YEJA 3OW7A 4WZEA 1UD3A 3T51B 1E62A 1D8TA 1XQBA 4NNJA 2F1LA 4HIZA 3WY9A 4Y7CA 4FXUA 1HZEA 3A1PA 2VBVA 5FNZA 1N06A 5HXBA 1H8EA 3W2GA 4FWTA 3JU4A 5FIUA 3OZUA 2OTLB 5DSZA 5KSWB 2ZL7A 4OPOA 2X53S 3FJOA 4RPBA 4YALA 2WPDA 1V0EA 1OHHA 4RD0A 2PMDA 4Y9RA 3CPXA 3JQQA 1KK2A 3AVXA 1N0UA 3CCMB 4B3XA 4Z4WA 5FO1A 1UD6A 4RPDA 1EFCA 3OFNA 4FK8A 1OGJA 2OK8A 2E1BA 2P3MA 2DYIA 1QGYA 3ONYA 2VNHA 1WSVA 4X05A 2V31A 2BGIA 3GIRA 3ZUGA 3KEWA 3BC9A 1YX2A 3CPWB 3SJPA 3R6JA 3DDYA 2XOKA 2XGJA 4QV2A 3CP2A 1SM4A 3U6BA 4XL9A 1YHQB 2C2WA 4MYUA 1TVCA 4XMYA 3LO8A 1E43A 1YITB 2OBTA 4X7CA 2KVOA 2DEUA 4F7DA 1JNYA 2D3NA 2ZZQA 4NCNA 1JA0A 2CK3A 1VQ7B 3ZZUA 1N07A 3ASPA 4RCYA 1W87A 1GR1A 2BV3A 4Z4ZA 1CNFA 4TMXA 2OBSA 4Z4TA 4ZCIA 1VQ8B 1NDHA 2C5BA 2QN6A 2BM0A 1EP1B 4CQJA 4OPSA 1KK0A 1T6ZA 3OEEA 1KQSB 2XNJA 5IYWA 3FPKA 4UZFA 3VO2A 3OZWA 3GVKA 1NB0A 1BMFA 3D26A 2XZLA 1VLYA 4XKWA 2FX3A 2X8KA 1K28D 1UD4A 4YELA 1KTVA 1FNBA 5J35A 1N8RD 3VNUA 3CCQB 3ZZTA 4PGOA 2C78A 4G7XA 3P27A 4N3NA 2VZLA 4QVJA 3ZBTA 2VNKA 5LMZA 5IYNA 3W5UA 5HZBA 4QHYA 4XN0A 3QFTA 4PC7A 2JJ2A 3BNWA 4TMVA 3W2IA 1NRKA 3OKXA 2PE3A 4ZGNB 1OB5A 1S4MA 3MCAA 1DDIA 4XOTA 4P3IA 1M90D 3PUNA 1K8AD 2B7BA 1E79A 1Q81D 2V7XA 3QFRA 1MRZA 3W5VA 4RLZA 2VBUA 2CNDA 5E6TA 1WORA 1W0JA 2CBXA 3CCJB 1WOOA 4II3A 5GV8A 2XEXA 1HVXA 4YAUA 3ES9A 3ZZ0A 2QMUA 2ZL5A 2V7QA 4X7EA 2DCUA 2OK7A 3A8KA 1R5OA 3ASTA 1PJ6A 2GJRA 4YHBA 3T53B 3MHPA 4Y9UA 1TUIA 4ASUA 2BM1A 4RD2A 5L46A 1K9MD 5IYRA 2VNJA 4XOPA 4AVZA 5A88A 4OPVA 4QFMA 2X0KA 1W9XA 4XLHA 1YIJB 3ZIAA 4YAOA 2GK7A 2C4UA 3CMMA 2F43A 2X6XA 3GSIA 4XLFA 5F4MA 3CMEB 2BN4A 4RDLA 1GAWA 2ZZGA 1JB9A 4PC3A 4WZTA 1VQ4B 2V7TA 1N0VC 4B3FX 4X7DA 2BGJA 4OOVA 1KC8D 2HLDA 2FVGA 2X6WA 3OE7A 4LC0A 1Q82D 2E1RA 4UAJA 5KW9A 5B6IA 4B3GA 5AN9A 2W6IA 2BVNA 3BY2A 2GJPA 2WZNA 2GREA 3WNCA 1A8PA 2BSAA 2GQFA 3SKBA 4OOSA 1E3XA 2Q6KA 3SEJA 3PA1A 2HCJB 2OBRA 4DQKA 1I8DA 2V7VA 1QUFA 1M1KD 4G6IA 1VJSA 3OEHA 5TV2A 4ACBA 1QH0A 3CC4B 5IK2A 5H59A 3CCEB 1QG0A 4QVAA 2I1LA 5EMNA 3FPPA 3I1FA 1Y0RA 4M4SA 3W2EA 4Z4RA 4B4DA 1UMKA 2ZZEA 3Q6RA 4XLEA 4M0LA 1XFOA 4Z1MA 2DETA 4TMWA 1FNDA 3CCRB 2CF4A 2C5HA 2F4NA 2OTJB 1GJRA 1GO2A 2V7UA 1VHOA 3GVLA 4TN1A 1U2RA 1WPCA 4P6VF 4P25A 5FL7A 1H85A 2JN9A 5DS0A 4ACAA 2QGGA 1FDRA 4OP7A 3OZVA 1D1NA 1OGIA 2QEXB 2PLFA 3PVDA 3CESA 4RD1A 1VQKB 4KKSA 2J7KA 4N3GA 4RCZA 1COWA 2BF4A 3AVWA 1UD2A 1VHEA 4JMQA 4B48A 3PENA 1DDGA 3OAAA 1V0FA 4TKOB 4M53A 1I18A 4P6YA 3G4SB 5H5JA 4WWVA 3SLNA 1YLOA 2ZXIA 3E1YE 1VQ5B 3G71B 3CXCB 5FA6A 3I56B 3BQJA 4XNFA 1R5BA 2WJVA 4OOXA 4XKVA 1E1QA 1BX0A 3MMPA 3WNBA 1YI2B 1NJID 2PIAA 3CMAB 1VQPB 5HZAA 4MYTA 1W34A 3OPOA 4RDJA 4TSFA 2C4TA 1ZUNB 4J0QA 1D2EA 3B8HA 1KJZA 2QE7A 1VQLB 4II2A 2D3LA 4KKUA 2QDXA 1GAQA 3CRZA 1QX4A 4YAFA 1PJ7A 2OYNA 1UD8A 1FRQA 4ZCMA 1K73D 3AVUA 2V7WA 4XLAA 1S0UA 2CW5A 4LBZA 3CTAA 5DN6A 2VBSA 3G6EB 2WR8A 2GPJA 3V7AA 2GJKA 1W35A 4TMTA 1OB0A 1OB2A 3OJXA 3B78A 1E63A 4WZLA 3FKSA 3R6KA 4WZKA 2HMAA 3VR6A 2ZTGA 3CC7B 2Q6OA 1T6YA 4LBYA 5IYQA 4XM3A 1IJEA 4C0SA 4XLCA 1VQNB 3ASSA 2QA4B 1Q7YD 1WU8A 4BPRA 3BH4A 4L8JA 4UZEA 1RQRA 4XQFA 2X85A 3VMFA 2C77A 1CNEA 1DG1G
chains in the Genus database with same CATH topology
4Z4SA 3SJPA 5KW9A 3R6JA 3RY8A 4QV2A 3BY2A 3Q3AA 3ASQA 2OBTA 4X7FA 4X7CA 3SKBA 4X07A 4OOSA 3SEJA 3PA1A 2OBRA 3ASPA 3Q39A 4Z4ZA 4Z4TA 2OBSA 5F4JA 4P2NA 4QVAA 4OPSA 4P12A 3Q6QA 4Z4RA 3Q6RA 5IYWA 3BY1A 3PUMA 3D26A 4ROXA 4X06A 4Z4VA 4P1VA 4Z4UA 4P25A 5J35A 4QVJA 4OP7A 5IYNA 5HZBA 3PVDA 5F4OA 4X0CA 4Z4YA 3PA2A 4P3IA 3SLDA 3PUNA 5BSYA 2ZL6A 4RLZA 3SLNA 5E6TA 5J3OA 5IYPA 4QUZA 4RM0A 3BQJA 4OOXA 5HZAA 2ZL5A 4RDJA 4RDKA 4X7EA 4WZEA 3ASTA 5IYRA 4P26A 3V7AA 4OPVA 2ZL7A 4OPOA 4RPBA 4WZLA 3LQEA 1IHMA 3R6KA 4WZKA 3LQ6A 5F4MA 4RDLA 5IYQA 4Z4WA 3ASRA 4RPDA 3ASSA 3ONUA 4WZTA 4X7DA 4OOVA 5BSXA 3Q38A 3ONYA 4X05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4S A;  3SJP A;  5KW9 A;  3R6J A;  3RY8 A;  4QV2 A;  3BY2 A;  3Q3A A;  3ASQ A;  2OBT A;  4X7F A;  4X7C A;  3SKB A;  4X07 A;  4OOS A;  3SEJ A;  3PA1 A;  2OBR A;  3ASP A;  3Q39 A;  4Z4Z A;  4Z4T A;  2OBS A;  5F4J A;  4P2N A;  4QVA A;  4OPS A;  4P12 A;  3Q6Q A;  4Z4R A;  3Q6R A;  5IYW A;  3BY1 A;  3PUM A;  3D26 A;  4ROX A;  4X06 A;  4Z4V A;  4P1V A;  4Z4U A;  4P25 A;  5J35 A;  4QVJ A;  4OP7 A;  5IYN A;  5HZB A;  3PVD A;  5F4O A;  4X0C A;  4Z4Y A;  3PA2 A;  4P3I A;  3SLD A;  3PUN A;  5BSY A;  2ZL6 A;  4RLZ A;  3SLN A;  5E6T A;  5J3O A;  5IYP A;  4QUZ A;  4RM0 A;  3BQJ A;  4OOX A;  5HZA A;  2ZL5 A;  4RDJ A;  4RDK A;  4X7E A;  4WZE A;  3AST A;  5IYR A;  4P26 A;  3V7A A;  4OPV A;  2ZL7 A;  4OPO A;  4RPB A;  4WZL A;  3LQE A;  1IHM A;  3R6K A;  4WZK A;  3LQ6 A;  5F4M A;  4RDL A;  5IYQ A;  4Z4W A;  3ASR A;  4RPD A;  3ASS A;  3ONU A;  4WZT A;  4X7D A;  4OOV A;  5BSX A;  3Q38 A;  3ONY A;  4X05 A; 
#chains in the Genus database with same CATH topology
 1J9Z A;  4YAW A;  1IJF A;  2BPO A;  2XZP A;  1PKV A;  1QUE A;  2VYQ A;  3RY8 A;  1CQX A;  3A3G A;  3QSY A;  1TTT A;  2DIE A;  2AHO A;  2ZBV A;  2Q6I A;  3GVJ A;  3ASQ A;  4KKT A;  1E3Z A;  3ISX A;  3J81 k;  4PAA A;  3W2H A;  5A8A A;  3WQZ A;  2NPF A;  2ZBU A;  4RD4 A;  3U6K A;  4IW3 B;  2WJY A;  4EH1 A;  1BPL A;  3B82 A;  2JDI A;  1T5E A;  3AGQ A;  4U9U A;  2R6H A;  1KMH A;  2ZXH A;  4P12 A;  2LZJ A;  3Q6Q A;  3CP8 A;  2RC5 A;  2CC2 A;  2WZP P;  1VF7 A;  3W2F A;  4B47 A;  3BY1 A;  3OW2 B;  1NB9 A;  3PUM A;  1BQE A;  2JIZ A;  1AMO A;  1P4M A;  1AIP A;  1YJW B;  2JJ1 A;  4P1V A;  3A3B A;  4Q7J B;  4RD3 A;  3VNV A;  3I55 B;  1G7T A;  3H9N A;  1GVH A;  1Q9S A;  4Z4U A;  1FNM A;  2Q6L A;  2XND A;  3AGP A;  1VQ9 B;  3A35 A;  3WND A;  4GQN A;  4FN5 A;  5GV7 A;  2XNC A;  4DK1 A;  5KNL A;  1Q86 D;  3H94 A;  1QFY A;  1QVG B;  1EFT A;  4X8I A;  1B2R A;  3AVV A;  4PC2 A;  2F1M A;  2Z6B D;  5F4O A;  4DNR B;  1VQM B;  4X0C A;  4HE5 A;  4LBW A;  4AC9 A;  1IB0 A;  2B7C A;  4E0F A;  3JQP A;  4UZU A;  2ZL6 A;  3BCD A;  1WOP A;  1EFR A;  2GK6 A;  2B5O A;  1VLO A;  3LVB A;  2D74 A;  1Y0Y A;  1JJ2 B;  4TT3 A;  1PJ5 A;  2X3U A;  3OJW A;  1JA1 A;  4QUZ A;  4RM0 A;  1QFZ A;  1QVF B;  4RD6 A;  4YXW A;  1BX1 A;  3QFS A;  4PC1 A;  2M5S A;  4AF7 A;  2YWE A;  1R5N A;  4RDK A;  4G1V A;  4B44 A;  1B23 P;  4LBV A;  3G05 A;  1WTH D;  4P9S A;  3CB4 A;  4H9G A;  5JBQ A;  1N08 A;  4DK0 A;  1F60 A;  1FRN A;  2DER A;  1TLL A;  1RQP A;  2QTL A;  4G1B A;  1T6X A;  2QTZ A;  2NV4 A;  4P26 A;  3KL9 A;  2DOG A;  1ELO A;  1SKY B;  3ZPN A;  3P26 A;  1KRH A;  4M1K A;  4ZV4 A;  5A89 A;  3LQE A;  1SKQ A;  1IHM A;  2YWF A;  1ZM2 A;  4DNT B;  3LQ6 A;  3V76 A;  3HAG A;  3ZC3 A;  4AF6 A;  1VQ6 B;  5TR9 A;  2VJI A;  3AVY A;  2YWG A;  1E1R A;  1MAB A;  5CDF A;  3ASR A;  1W0K A;  3WXM A;  2BMW A;  1EFU A;  1HA3 A;  1YJ9 B;  3ONU A;  3VO1 A;  2X6Y A;  4ZGQ B;  2EIX A;  3CCV B;  4P3Y A;  4K1X A;  1FNC A;  4B43 A;  3Q38 A;  5BSX A;  3CC2 B;  4XON A;  1UD5 A;  4XR6 A;  4PC6 A;  2ZTN A;  3A8I A;  2ZIT A;  2CRV A;  4Z4S A;  1KK3 A;  4M2L A;  5TY0 A;  5TRD A;  1QGA A;  1ZM9 A;  1V5V A;  4XOR A;  2WSS A;  3JQR A;  1I7P A;  3E20 A;  3Q3A A;  1KZL A;  5FO0 A;  4X7F A;  2XZO A;  5THX A;  1WP6 A;  3CW2 A;  1EP3 B;  4X07 A;  3LNN A;  2VBT A;  3GQB A;  2EFG A;  3Q39 A;  4XN3 A;  2HDN B;  3T56 B;  2D9R A;  1VQO B;  2VNI A;  1WDT A;  1EP2 B;  4P2N A;  5F4J A;  2WYR A;  1FX0 A;  4G5G A;  1EWY A;  1DAR A;  3A8J A;  4WQM A;  1H42 A;  2R9V A;  4R71 A;  1G7R A;  1W2B B;  1KK1 A;  1KD1 D;  3OOC A;  4ROX A;  1EXM A;  2YWH A;  4X06 A;  4XD7 A;  2W6J A;  3WBK A;  1S72 B;  4DQL A;  4Z4V A;  4PAB A;  2V4D A;  4P22 A;  3W5H A;  3CCL B;  2DY1 A;  1N05 A;  4G7W A;  2ZZF A;  3WYA A;  1QFJ A;  1NBM A;  4NBS A;  2RC6 A;  1F20 A;  4HE6 A;  3OP1 A;  1XB2 A;  4TMZ A;  1XE1 A;  4Z4Y A;  1G7C A;  3PA2 A;  3U2Q A;  3QFC A;  3SLD A;  3ZBU A;  1H8H A;  1WOS A;  5BSY A;  1BLI A;  3NE5 B;  4C43 A;  4RJL A;  3SJZ A;  1YJN B;  1G7S A;  3QE2 A;  1QGZ A;  3CCS B;  3CCU B;  3AVT A;  3CD6 B;  5J3O A;  5IYP A;  1WSR A;  2VJJ A;  1E64 A;  3BCF A;  1ZM3 A;  3WBJ A;  1ZM4 A;  4ZCL A;  5HKK A;  1BJK A;  4YEJ A;  3OW7 A;  4WZE A;  1UD3 A;  3T51 B;  1E62 A;  1D8T A;  1XQB A;  4NNJ A;  2F1L A;  4HIZ A;  3WY9 A;  4Y7C A;  4FXU A;  1HZE A;  3A1P A;  2VBV A;  5FNZ A;  1N06 A;  5HXB A;  1H8E A;  3W2G A;  4FWT A;  3JU4 A;  5FIU A;  3OZU A;  2OTL B;  5DSZ A;  5KSW B;  2ZL7 A;  4OPO A;  2X53 S;  3FJO A;  4RPB A;  4YAL A;  2WPD A;  1V0E A;  1OHH A;  4RD0 A;  2PMD A;  4Y9R A;  3CPX A;  3JQQ A;  1KK2 A;  3AVX A;  1N0U A;  3CCM B;  4B3X A;  4Z4W A;  5FO1 A;  1UD6 A;  4RPD A;  1EFC A;  3OFN A;  4FK8 A;  1OGJ A;  2OK8 A;  2E1B A;  2P3M A;  2DYI A;  1QGY A;  3ONY A;  2VNH A;  1WSV A;  4X05 A;  2V31 A;  2BGI A;  3GIR A;  3ZUG A;  3KEW A;  3BC9 A;  1YX2 A;  3CPW B;  3SJP A;  3R6J A;  3DDY A;  2XOK A;  2XGJ A;  4QV2 A;  3CP2 A;  1SM4 A;  3U6B A;  4XL9 A;  1YHQ B;  2C2W A;  4MYU A;  1TVC A;  4XMY A;  3LO8 A;  1E43 A;  1YIT B;  2OBT A;  4X7C A;  2KVO A;  2DEU A;  4F7D A;  1JNY A;  2D3N A;  2ZZQ A;  4NCN A;  1JA0 A;  2CK3 A;  1VQ7 B;  3ZZU A;  1N07 A;  3ASP A;  4RCY A;  1W87 A;  1GR1 A;  2BV3 A;  4Z4Z A;  1CNF A;  4TMX A;  2OBS A;  4Z4T A;  4ZCI A;  1VQ8 B;  1NDH A;  2C5B A;  2QN6 A;  2BM0 A;  1EP1 B;  4CQJ A;  4OPS A;  1KK0 A;  1T6Z A;  3OEE A;  1KQS B;  2XNJ A;  5IYW A;  3FPK A;  4UZF A;  3VO2 A;  3OZW A;  3GVK A;  1NB0 A;  1BMF A;  3D26 A;  2XZL A;  1VLY A;  4XKW A;  2FX3 A;  2X8K A;  1K28 D;  1UD4 A;  4YEL A;  1KTV A;  1FNB A;  5J35 A;  1N8R D;  3VNU A;  3CCQ B;  3ZZT A;  4PGO A;  2C78 A;  4G7X A;  3P27 A;  4N3N A;  2VZL A;  4QVJ A;  3ZBT A;  2VNK A;  5LMZ A;  5IYN A;  3W5U A;  5HZB A;  4QHY A;  4XN0 A;  3QFT A;  4PC7 A;  2JJ2 A;  3BNW A;  4TMV A;  3W2I A;  1NRK A;  3OKX A;  2PE3 A;  4ZGN B;  1OB5 A;  1S4M A;  3MCA A;  1DDI A;  4XOT A;  4P3I A;  1M90 D;  3PUN A;  1K8A D;  2B7B A;  1E79 A;  1Q81 D;  2V7X A;  3QFR A;  1MRZ A;  3W5V A;  4RLZ A;  2VBU A;  2CND A;  5E6T A;  1WOR A;  1W0J A;  2CBX A;  3CCJ B;  1WOO A;  4II3 A;  5GV8 A;  2XEX A;  1HVX A;  4YAU A;  3ES9 A;  3ZZ0 A;  2QMU A;  2ZL5 A;  2V7Q A;  4X7E A;  2DCU A;  2OK7 A;  3A8K A;  1R5O A;  3AST A;  1PJ6 A;  2GJR A;  4YHB A;  3T53 B;  3MHP A;  4Y9U A;  1TUI A;  4ASU A;  2BM1 A;  4RD2 A;  5L46 A;  1K9M D;  5IYR A;  2VNJ A;  4XOP A;  4AVZ A;  5A88 A;  4OPV A;  4QFM A;  2X0K A;  1W9X A;  4XLH A;  1YIJ B;  3ZIA A;  4YAO A;  2GK7 A;  2C4U A;  3CMM A;  2F43 A;  2X6X A;  3GSI A;  4XLF A;  5F4M A;  3CME B;  2BN4 A;  4RDL A;  1GAW A;  2ZZG A;  1JB9 A;  4PC3 A;  4WZT A;  1VQ4 B;  2V7T A;  1N0V C;  4B3F X;  4X7D A;  2BGJ A;  4OOV A;  1KC8 D;  2HLD A;  2FVG A;  2X6W A;  3OE7 A;  4LC0 A;  1Q82 D;  2E1R A;  4UAJ A;  5KW9 A;  5B6I A;  4B3G A;  5AN9 A;  2W6I A;  2BVN A;  3BY2 A;  2GJP A;  2WZN A;  2GRE A;  3WNC A;  1A8P A;  2BSA A;  2GQF A;  3SKB A;  4OOS A;  1E3X A;  2Q6K A;  3SEJ A;  3PA1 A;  2HCJ B;  2OBR A;  4DQK A;  1I8D A;  2V7V A;  1QUF A;  1M1K D;  4G6I A;  1VJS A;  3OEH A;  5TV2 A;  4ACB A;  1QH0 A;  3CC4 B;  5IK2 A;  5H59 A;  3CCE B;  1QG0 A;  4QVA A;  2I1L A;  5EMN A;  3FPP A;  3I1F A;  1Y0R A;  4M4S A;  3W2E A;  4Z4R A;  4B4D A;  1UMK A;  2ZZE A;  3Q6R A;  4XLE A;  4M0L A;  1XFO A;  4Z1M A;  2DET A;  4TMW A;  1FND A;  3CCR B;  2CF4 A;  2C5H A;  2F4N A;  2OTJ B;  1GJR A;  1GO2 A;  2V7U A;  1VHO A;  3GVL A;  4TN1 A;  1U2R A;  1WPC A;  4P6V F;  4P25 A;  5FL7 A;  1H85 A;  2JN9 A;  5DS0 A;  4ACA A;  2QGG A;  1FDR A;  4OP7 A;  3OZV A;  1D1N A;  1OGI A;  2QEX B;  2PLF A;  3PVD A;  3CES A;  4RD1 A;  1VQK B;  4KKS A;  2J7K A;  4N3G A;  4RCZ A;  1COW A;  2BF4 A;  3AVW A;  1UD2 A;  1VHE A;  4JMQ A;  4B48 A;  3PEN A;  1DDG A;  3OAA A;  1V0F A;  4TKO B;  4M53 A;  1I18 A;  4P6Y A;  3G4S B;  5H5J A;  4WWV A;  3SLN A;  1YLO A;  2ZXI A;  3E1Y E;  1VQ5 B;  3G71 B;  3CXC B;  5FA6 A;  3I56 B;  3BQJ A;  4XNF A;  1R5B A;  2WJV A;  4OOX A;  4XKV A;  1E1Q A;  1BX0 A;  3MMP A;  3WNB A;  1YI2 B;  1NJI D;  2PIA A;  3CMA B;  1VQP B;  5HZA A;  4MYT A;  1W34 A;  3OPO A;  4RDJ A;  4TSF A;  2C4T A;  1ZUN B;  4J0Q A;  1D2E A;  3B8H A;  1KJZ A;  2QE7 A;  1VQL B;  4II2 A;  2D3L A;  4KKU A;  2QDX A;  1GAQ A;  3CRZ A;  1QX4 A;  4YAF A;  1PJ7 A;  2OYN A;  1UD8 A;  1FRQ A;  4ZCM A;  1K73 D;  3AVU A;  2V7W A;  4XLA A;  1S0U A;  2CW5 A;  4LBZ A;  3CTA A;  5DN6 A;  2VBS A;  3G6E B;  2WR8 A;  2GPJ A;  3V7A A;  2GJK A;  1W35 A;  4TMT A;  1OB0 A;  1OB2 A;  3OJX A;  3B78 A;  1E63 A;  4WZL A;  3FKS A;  3R6K A;  4WZK A;  2HMA A;  3VR6 A;  2ZTG A;  3CC7 B;  2Q6O A;  1T6Y A;  4LBY A;  5IYQ A;  4XM3 A;  1IJE A;  4C0S A;  4XLC A;  1VQN B;  3ASS A;  2QA4 B;  1Q7Y D;  1WU8 A;  4BPR A;  3BH4 A;  4L8J A;  4UZE A;  1RQR A;  4XQF A;  2X85 A;  3VMF A;  2C77 A;  1CNE A;  1DG1 G; 
#chains in the Genus database with same CATH homology
 4Z4S A;  3SJP A;  5KW9 A;  3R6J A;  3RY8 A;  4QV2 A;  3BY2 A;  3Q3A A;  3ASQ A;  2OBT A;  4X7F A;  4X7C A;  3SKB A;  4X07 A;  4OOS A;  3SEJ A;  3PA1 A;  2OBR A;  3ASP A;  3Q39 A;  4Z4Z A;  4Z4T A;  2OBS A;  5F4J A;  4P2N A;  4QVA A;  4OPS A;  4P12 A;  3Q6Q A;  4Z4R A;  3Q6R A;  5IYW A;  3BY1 A;  3PUM A;  3D26 A;  4ROX A;  4X06 A;  4Z4V A;  4P1V A;  4Z4U A;  4P25 A;  5J35 A;  4QVJ A;  4OP7 A;  5IYN A;  5HZB A;  3PVD A;  5F4O A;  4X0C A;  4Z4Y A;  3PA2 A;  4P3I A;  3SLD A;  3PUN A;  5BSY A;  2ZL6 A;  4RLZ A;  3SLN A;  5E6T A;  5J3O A;  5IYP A;  4QUZ A;  4RM0 A;  3BQJ A;  4OOX A;  5HZA A;  2ZL5 A;  4RDJ A;  4RDK A;  4X7E A;  4WZE A;  3AST A;  5IYR A;  4P26 A;  3V7A A;  4OPV A;  2ZL7 A;  4OPO A;  4RPB A;  4WZL A;  3LQE A;  1IHM A;  3R6K A;  4WZK A;  3LQ6 A;  5F4M A;  4RDL A;  5IYQ A;  4Z4W A;  3ASR A;  4RPD A;  3ASS A;  3ONU A;  4WZT A;  4X7D A;  4OOV A;  5BSX A;  3Q38 A;  3ONY A;  4X05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...