3W5UA

Cross-linked complex between ferredoxin and ferredoxin-nadp+ reductase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
296
structure length
296
Chain Sequence
CSKKQEEGVVTNLYKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGKIPYREGQSIGVIADGVDKNGKPHKVRLYSIASSAIGDFGDSKTVSLCVKRLIYTNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSLAEKDGIDWFDYKKQLKRGDQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Concentration-dependent oligomerization of cross-linked complexes between ferredoxin and ferredoxin-NADP(+) reductase
pubmed doi rcsb
source organism Zea mays
molecule tags Electron transport
molecule keywords Ferredoxin
total genus 97
structure length 296
sequence length 296
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w5uA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w5uA02
1BX1A 4HE6A 1ZM2A 3I56B 2PMDA 3VNVA 3B8HA 5GV7A 4P6VF 4Q7JB 1N8RD 4C0SA 1JB9A 1QGZA 1S72B 3CC7B 1BQEA 3CCVB 1NJID 4M0LA 3QFRA 3ZZTA 2VZLA 4J0QA 2B5OA 4RD4A 3CB4A 1ZM9A 1IB0A 1VQLB 1QUFA 4AF7A 3CXCB 1GR1A 3MMPA 3WNCA 4LBYA 3U6KA 3AVXA 3QSYA 1YJ9B 1VQPB 1M1KD 4R71A 2OK8A 4TMTA 4TMWA 1DDGA 4AF6A 3G6EB 2VNKA 5TV2A 3ZZUA 1YITB 1DDIA 1G7SA 2AHOA 4G1VA 1SM4A 4TMXA 1K73D 2QTLA 4LBVA 3CCLB 1OB2A 2HCJB 3OZWA 2CNDA 2VNJA 3VO2A 1HA3A 4ZCIA 4P3YA 1M90D 2DCUA 1KJZA 4WQMA 1R5BA 4M2LA 1XE1A 4MYUA 4B3XA 1Q7YD 2VNIA 3G71B 1VQ5B 1SKQA 4K1XA 1B23P 2QTZA 1KD1D 4M4SA 3JQQA 1QFJA 1JA1A 3I1FA 2CRVA 3ZC3A 3A1FA 2HMAA 4ZGQB 2EIXA 1KTVA 1G7CA 2EFGA 2QN6A 1VQ4B 1FNCA 4YAWA 1JJ2B 2ZITA 1AIPA 3CW2A 1YIJB 2XNCA 1JNYA 2J7KA 4PC3A 4FN5A 3CCMB 2XEXA 4QHYA 5GV8A 1H85A 5HXBA 3I55B 4DQLA 1BX0A 4BPRA 1D2EA 1I7PA 1QFYA 4FK8A 3G4SB 1DG1G 1KK1A 2RC5A 4NBSA 2DEUA 1QGAA 3W5UA 1KK3A 1N0UA 1W34A 4B43A 1KK0A 3WXMA 1W87A 1F60A 3AVYA 4RD1A 2YWGA 1YHQB 5H5JA 4PGOA 3ZBTA 2DETA 2PLFA 1S0UA 3QFTA 4PC7A 3CCRB 2BN4A 4RJLA 1VQNB 4EH1A 1BJKA 3FJOA 1QH0A 2OK7A 4QFMA 1QX4A 3P26A 1GAQA 1CQXA 2RC6A 3CC4B 3MCAA 3VO1A 1G7TA 1FNBA 4H9GA 1N0VC 5THXA 3P27A 3B82A 3W2GA 1VQOB 3E1YE 1VQKB 1E62A 1F20A 3WBJA 1QFZA 3AVUA 4YAFA 4ACAA 2OTLB 3OJXA 4ZCMA 3CMAB 1CNEA 3AGQA 1EWYA 2VYQA 3LYUA 2C77A 3AVTA 1GVHA 4PC2A 1GO2A 2BM1A 1TUIA 2C78A 1GJRA 3W5HA 4RCZA 3WNDA 2QDXA 4ZGNB 2PIAA 4RD0A 3CCEB 4B44A 2BF4A 2BPOA 1H42A 1FRQA 2OTJB 1FDRA 4G1BA 4YAUA 1FNDA 3V76A 3OJWA 4HE5A 3VMFA 1D1NA 2B7CA 2DERA 1EXMA 1FRNA 3QFCA 1K9MD 4Y7CA 4ACBA 4AC9A 2R6HA 3OW2B 5TY0A 1KQSB 1GAWA 2GQFA 1G7RA 1WDTA 3W2IA 1TLLA 3CPWB 2NPFA 4Y9RA 3CCUB 2GPJA 5JBQA 1W35A 2D74A 1JA0A 3J81k 1OGJA 1A8PA 1QVGB 1IJFA 1EP2B 4TN1A 1ZM3A 4YHBA 3JQRA 3FPKA 1VQ7B 2B7BA 5FA6A 1KK2A 2BSAA 2HDNB 4M53A 3U6BA 3SJZA 2E1RA 2X3UA 1NDHA 1VQ8B 4YAOA 4N3GA 2DY1A 3CD6B 2YWEA 1ZM4A 4FWTA 1R5NA 3CC2B 4TMZA 2YWHA 4LBWA 1YI2B 4Y9UA 3LVBA 4F7DA 4ZCLA 4G5GA 2BGJA 1OGIA 3B78A 3CCJB 4RD6A 1U2RA 2BMWA 3QFSA 1J9ZA 2BV3A 1QVFB 2XNJA 2FX3A 5H59A 1QUEA 1FNMA 3ZBUA 1VQMB 3W2FA 5AN9A 3LRXA 4YALA 3E20A 3VNUA 3W5VA 3JQPA 2QEXB 2BVNA 4LC0A 4PC6A 1CNFA 1YJNB 1Q86D 1TVCA 2BGIA 3ES9A 3QE2A 4RD2A 1ELOA 1W2BB 1VQ6B 4NCNA 1ZUNB 4C43A 1K8AD 3AVVA 3OZVA 3CMEB 2YWFA 1KC8D 1EP1B 4RD3A 2BM0A 1XB2A 4LBZA 5EMNA 1YJWB 1E64A 4M1KA 3AGPA 3OZUA 1KRHA 3U2QA 4N3NA 1EFCA 4PC1A 1QG0A 2QMUA 3WNBA 1QGYA 3W2EA 1OB5A 4B48A 1EP3B 4MYTA 1DARA 4IW3B 4B4DA 3WYAA 4DQKA 4B47A 3WY9A 1EFTA 3W2HA 1VQ9B 1E63A 3LO8A 1IJEA 3CCQB 3ZZ0A 3CCSB 5TR9A 2QA4B 4TMVA 1TTTA 4ZV4A 4RCYA 3MHPA 5DSZA 5KSWB 1Q82D 1Q81D 1B2RA 3CRZA 3AVWA 1UMKA 1R5OA 2VNHA 1D8TA 1EFUA 1AMOA 3PENA 4UAJA 3WBKA 4U9UA
chains in the Genus database with same CATH superfamily
3V42A 2IIBA 1KPIA 5ERYA 3VTZA 1GZVA 3AHCA 5JUWA 1PS9A 3RCBA 4JP1A 1GQ2A 3ESXA 4NHEA 5JQWA 1NBMA 5A1JA 2FVXA 1K0FA 5F7ZA 3MVEA 3CHYA 3DPSA 3AINA 3OKPA 2DR2A 1BGXT 1D3AA 5AKXA 1SMKA 5FI1B 1H66A 1JWBB 3CYFA 4KOAA 2E18A 3MK31 2X8AA 3SIWA 2WF5A 3ZGOA 1N8RD 5FUWA 3QIVA 4M0UA 3FKQA 1FRZA 1HTBA 4LRUA 2I4NA 1E2JA 3O8CA 4IOLA 5CNIA 2PX4A 1VA4A 5ULLA 5JNSA 1UBFA 5AHKA 1LJ8A 2W2QA 1QTRA 3CW8X 3P0HA 1U7WA 1WNFA 3O0TA 1DKLA 1ZCZA 1PLJA 3I04M 1WUKS 3EQ8A 2P6OA 3ICCA 3N9IA 5A89A 3HB9A 3BIWA 2GLTA 3R5FA 1MRSA 4WD3A 3FF4A 4INOA 4RZUA 5CGZA 1PG0A 1PU2A 1XCLA 2NTEA 3FM9A 4Q3OA 1P5HA 1Z2AA 3KJIA 3P2EA 4JGIA 4JYMA 3O82A 3ZWPA 1O6ZA 2EP7A 3CB4A 4U4AA 3UJ8A 4DJAA 5JJBA 1E1CB 3H94A 1PSZA 3M4YA 2C00A 4EI2A 2O8EB 5CM9C 1VP3A 2NGRA 3S2ZA 4GF5A 2C29D 2PBLA 4HDOB 1JR3D 4X9XA 4HT3B 8ATCA 1M5RA 2QMOA 4F38A 2PIDA 3K6JA 1ZW6A 1ORIA 3A1VA 3BILA 3OOWA 2FPIB 1IVSA 1C3JA 4MRVA 5TT1A 1T0BA 3OESA 3H04A 4LJYA 2ZTMA 3GEEA 2RIRA 4JVSB 3AUFA 2JGAA 4N8EA 2ZIUB 1J5PA 1QYCA 1Z73A 2EFHB 2NXJA 3VUEA 4TUYB 1E60A 3ZQJA 4DJ5X 3PS9A 5C8YF 3FE2A 1M1YB 4TZKA 4F6RB 4R2XA 3QLUC 1UPBA 3ASSA 1ACMA 3UT6A 2O8DA 2QD2A 1PR0A 2K5UA 3FXAA 3CNOA 2WUDA 2C5EA 2G25A 3GEGA 1RWPA 3HLKA 4NBNA 4WKCA 1QDUA 2B9EA 3I4FA 3WB1A 5IW8A 2VBUA 4L5AA 5A5DA 1AURA 2J85A 4W6ZA 1SAYA 4XRRA 5FBLB 1W4CA 5BYAA 3EPJA 3FMOB 3G2KA 1E3SA 1YMQA 2R4TA 2H92A 3V4VB 5L3QA 1PT6A 4Z4EA 5KVSA 5GPBA 3OZBA 1T4GA 1AQYA 1VCHA 3OFJA 5JE8A 3CUVA 1BO6A 1WCWA 4BFWA 3WLFA 5TF0A 2GX6A 4OCZA 3CNBA 2P91A 4DIUA 1PL8A 3T1YB 1TRHA 1W85B 1U4OA 2VJPA 5I9BA 4D80A 1OH7A 4R2WA 4CEIA 4N03A 4P3YA 4XNFA 9GPBA 1GNVA 1CZNA 3ETJA 2DU8A 3IUYA 2QAGB 2COKA 1O9GA 1WCIB 4FNAA 3RVJA 1DBWA 3KU1A 4BE9A 1BKDR 3BIJA 1T3ZA 1AH2A 3MT0A 4C5AA 3FWYA 1IDOA 1THTA 2WAAA 1XVLA 1B23P 3ZDFA 3Q6IA 4KFRA 4OJYA 4BAUA 2GXAA 4YRTA 3KE8A 3O4HA 2X5OA 5EXDA 2QJTA 1XRNA 2XWBF 3L02A 1QFJA 3A3YA 2VUSA 4MVJP 4PVCA 2Z43A 3NOQA 3BA6A 3CMCO 3LC0A 3JASA 4U5XA 2C42A 3NHYA 2AWNA 1CZRA 4HAIA 5K8VA 3FVVA 1E2MA 1WQ1R 3ORQA 5LZ4A 5MN5A 3HFSA 4ZGQB 1FYVA 4OGFA 5K6AA 3BTVA 1XEWX 4D9FA 1JIKA 4NCAA 2QUAA 1C2YA 1M2HA 2ZI7A 1ZJ6A 2VQEB 3V4RA 1RBZA 2Y2VA 1F8UA 4QNNA 3T5GA 3WMXA 1AK1A 5H3LA 5CJPA 2P11A 3PXEA 3D2CA 4M8LA 3NOOA 3ZE7A 2AOXA 3T1TA 3CF4G 3FPLA 4ZTUB 3PNQA 4UREA 2FHPA 3RC7A 2OILA 4QJ5A 5IM5A 4CUZA 1RJ9A 3CCMB 1L7MA 2QUHA 4RHFA 2R60A 3IQEA 4JHXA 3V8BA 1FUUA 4H3SA 4W1PA 3P9ZA 4K3UA 3TIXB 2FEAA 4ALKA 2QTFA 4RH3A 4ZEVA 4BEBA 3F73A 3SLNA 2JBWA 4WPGA 1U3TA 121PA 3AX6A 3VAYA 2XCLA 5GADl 3IURA 4WIAA 2X7XA 2GETA 5DNEA 3T7SA 4IEFB 1K86A 4EA9A 3HXOA 3FCXA 3LO5A 4K9SA 1VIDA 2J67A 3SX2A 4L5YA 1F38A 5KQMA 3AEXA 3L9WA 1UOOA 1L1RA 1QCCA 1A96A 2B1RA 2IE0A 1K5HA 1QGUA 3OZXA 4BV2A 4UEJA 3WZMA 5CUQA 3G4SB 2C96A 2OM6A 1V8DA 3MUEA 2R6ZA 3O3MB 1H3FA 4JMPA 4RZQA 1QVZA 3TQHA 2A14A 4B82A 3L4EA 4EG8A 3FOWA 2RHOA 2TRSB 4QGGA 4RHYA 5K7SA 4YR9A 5A2QA 3IRUA 2VQSA 1YVPA 4K6GA 3UJ6A 1J8YF 1QE3A 2NO5A 2ZAOA 3IIEA 1N0UA 5FORA 3HP4A 3N6VA 1XZHA 2QRMA 1YFKA 2A9FA 2BDTA 3V4PB 3WYDA 2VBGA 4QUHA 4UU7A 2P5YA 5EINA 5KI6A 4P36A 1LTHR 2NPIA 3KPJA 1U0NA 5LMUB 3P5BA 2QP3A 5KYXA 4X6XA 5ABPA 2IZ6A 2GD1O 4QRIA 4CR8A 1SUFA 2FZWA 1WW8A 5A06A 4GGMX 1KR5A 4LZNA 4XM0A 3FOCA 1T6XA 1E9AA 3LUPA 3NEPX 2WG0A 3BMQB 3EBOA 3ULKA 1SUCA 3OU7A 3VNBA 2EZTA 1PVVA 2YNMA 3EFOA 3EZ7A 1Z28A 4J07A 2F8TA 1F7UA 1T0IA 1I3MA 1QJCA 4IUCS 1DX9A 3PUXA 5CD1A 5EQFA 2H7XA 4OOFA 3GH3A 1CQXA 3IVAA 3OA0A 3TSWA 4BP3A 3CT4A 3MCAA 3U60B 3TKLA 1DJMA 1ECBA 4OJKA 3ZIAD 4B7XA 1Z3CA 1PVOA 4K3VA 2Z6BD 1ZGCA 3PR2B 5THXA 2OQIA 3AL0C 2PJZA 2ZBQA 3B82A 1K8ZB 1NV8A 3SVZA 2C9OA 1Z36A 1DMRA 2QW0X 3F5FA 3DE4X 1PDOA 3E0XA 5B58C 2N0SA 1AJEA 1WP4A 4R9SA 1ENZA 1L9KA 4M0KA 1SY7A 2KVOA 1WBBA 2Z1DA 1NWHA 2ZRDA 4OD0A 4DXAA 4L4XA 5JPDA 2Q7OE 3TBKA 3G0HA 3CMAB 3BWMA 3F7TA 3UWMA 3X1XA 2X0DA 4DC1A 1IQ0A 1QH1A 1F14A 2PANA 4N6OA 2HQBA 4IF6A 5AKLA 4IVQA 1F5SA 1YHYA 1TQ4A 1YTLA 2RGDA 3NPAA 3QK7A 3QNMA 4OK5A 5CLHA 1J97A 3KSAC 1E2UA 4PC2A 5LP6C 3ZWOA 4JR2A 4W7HA 3ZWQA 1NAIA 3UKOA 3VPFA 2REBA 3GP5A 2NO9A 1E7SA 1ZGGA 3M89A 3PQ5A 4F4CA 3RKRA 2XWSA 3MWJA 5IYRA 3LU1A 5J5VA 4ITVA 1S2OA 4CN8A 4WACA 4YRKA 4MJ7A 4RFSA 1E96A 1KBOA 3MILA 2NPOA 5FL3A 3ZUGA 1HL7A 4NS1A 2QRNA 3GGGA 4C7KA 4MUXA 1ZZGA 5DGIA 5JXIA 2FDCA 4LUCA 4LXUA 3HK2A 2H31A 3FPGA 2VDRB 3OIUA 1E9EA 3N76A 2INGX 1VHLA 3KQTA 5U4XA 4D4MA 4ZYLA 2WINI 4J76A 2YH2A 3GUCA 3QELB 4G26A 2PE3A 4PSUA 1X38A 2V3VA 2CUTA 1P2DA 1ZNXA 3NGMA 1SKYB 2Z0MA 3EW9A 4M37A 3S55A 1GL9B 4YAUA 1W48A 3OLZA 4HGPA 2PRIA 4MHOA 5GZ6A 4KXMA 4QT4A 5BV1A 4E30A 1BPLA 2W98A 1XPOA 2YVLA 3Q11A 3QLTA 2HK9A 4UCFA 5U1PA 2O5CA 1O7JA 3QYFA 4DLRA 4MP3A 4Q24A 3TMAA 4CIXA 1T9ZA 1I4LD 3G59A 2JCYA 3IAS6 5JSUA 2YXDA 5IFLA 1ISFA 2B21A 4X97A 3RPEA 2QPTA 3KOWA 1O0SA 3V2GA 1OFGA 1KVQA 1RAIA 1RRGA 3OMXA 4RW0A 2RHCA 2GCOB 3EYAA 1E2HA 3M4ZA 3LHKA 3B38A 4F9GA 2NPFA 3UWDA 4ZFNA 4F97A 3JZMA 1CJCA 1FRVA 1I6MA 1OYOA 4MRSA 2EHJA 4AN1A 2PZAA 4M8NE 3RBXA 1CSEE 4X7PA 3O8QA 3LQEA 1YJXA 2GERA 1Z4QA 4EPXA 2XVZA 3TXYA 3PU6A 4CMGA 1RAGA 2D0IA 2IUYA 4PW0A 4KIGA 1SZCA 3I6MA 4DM7A 2WSBA 1JKJA 1M5TA 1OTXA 1Y8RB 4XKJA 3KXIA 1WVIA 3TG2A 2JAXA 4UEQA 3JQBC 2XNSA 2GNOA 4HVCA 3K71B 1FYDA 2B9VA 1XN1A 2IPXA 2P9ZA 4LY9A 3G0BA 1UBHS 1MC4A 2ODEA 4RS3A 4YT5A 3TOCA 3CO0S 4U1RA 3DS8A 3RC3A 3UF0A 3ZOKA 1N7IA 4DBZA 5FTLA 1A3CA 1GKIA 3A05A 5JCXA 2VRBA 1Y0RA 2JN9A 1V95A 1E43A 1XMSA 2VAXA 4CV3A 2QMHA 1RWKA 4YUAA 3MT8A 3SXUA 1XTVA 4QYSA 3UWOA 3O4RA 5ISMA 4I4LA 3DT6A 3IOBA 4WZAA 1JILA 3COVA 3H1PA 4RE6A 3AOEA 3VTKA 3CURA 2AW3A 4NYIR 5EP3A 4MV1A 2YWEA 4U7PB 3QJ5A 5ESDA 1N7GA 3HV0A 4XYBA 4B40A 4K2AA 2B8TA 2JLAA 2AFIE 4G5HA 4B4KA 5EMLA 1PFVA 3I4CA 2VL7A 3LVBA 2ZZMA 1LDGA 1UL1X 3OQVA 2X42A 4ZAXA 4A6EA 2OP0A 1KSGA 1AKUA 2BE9A 2BI4A 4DUGD 2AG5A 1JECA 1E9SA 3B6ZA 1NQWA 2BFBB 3BGSA 1NVDA 4KK4A 4LI0A 2REQA 4Y2YA 2EKLA 4GI2A 3O84A 3N86A 2TSYB 2C1XA 3T5TA 1P0IA 2F43B 3X43A 4A6XA 4E07A 3CXRA 1O3YA 2C0QA 1TZJA 3EXFA 1UMBA 3GDGA 1GPAA 3GJYA 3QG5A 3QBDA 3QKSB 4YNBA 4CQMD 4QXAA 1Q1ZA 2W0SA 3RRMA 1VJ0A 3I5YA 3BDAA 1Z62A 4ZJYA 3DXFA 1KYZA 2QSZA 4JBLA 4N7RA 2ZAMA 1RLMA 4YDRA 4E5YA 2JGLA 2F3SA 5A3RA 3CWZA 1FP6A 1QFXA 2GSWA 1GNLA 1A8HA 4CV0A 4AY3A 5CTJA 5I8WA 1NLZA 1JEDA 2AZTA 3G0OA 5JBIA 4JLOA 1XPUA 1VTKA 2P7IA 2IZ0A 2Q4EA 3DV0A 4OLJA 4TV8B 1E0DA 3UJ3X 4XLEA 3K2IA 2YMPA 1RMYA 1YR7A 4ODIA 3VSDA 5IYZA 4IV0A 4JLWA 3U37A 1XDDA 3DLAA 1QO0A 3QJYA 2EP5A 2QEXB 3GN2A 4MW2A 5EP2A 3M34A 1QF6A 4K6CA 2BFDA 2GVDC 3SLGA 4R31A 2ESRA 3AG6A 3C5HA 3I37X 3SFVA 3KB8A 1BX3A 3ZZNA 4D4KA 4GKKB 1NN3A 4F0JA 1E6WA 4BKMA 1Z12A 5EIBD 1GN9A 4FSXA 3PGVA 3DCYA 4MAAA 1IB6A 3FYUB 1OLUA 5CYOA 4J0HA 1NXTA 2O07A 4CBVA 4EAAA 1TD9A 4JA0A 2NW6A 3DOIA 3UT0A 4NCIA 2HQOA 3WKAA 5DGTA 1DBSA 4F6LA 3S2UA 3V7FA 2GI4A 2VSYA 3NYRA 2JK1A 2QD3A 4O29A 1VG0B 2X77A 2E21A 2V54A 3RFVA 1QPZA 4KTVE 1QH1B 3ZQKA 2R4UA 3VNAA 2FXIA 1YJWB 4B80A 2IWHA 1MIOA 1JLMA 2ZRKA 4QVIA 2GJ4A 2O19A 4DXHA 5KC8A 1QYRA 3EVFA 3KHTA 3HI6A 1PX2A 4HC4A 2GEUA 1TJNA 1P9NA 2X5KO 5LQKA 1N3IA 4L5JA 3EIXA 3H1EA 3PLAE 5FL7A 1YRYE 3H11A 1RTKA 4J6FA 1CT9A 3OPMA 3TTSA 4D44A 3VPHA 5C0OE 3DUFA 4Z8YA 1FJXA 4EFLA 1XVVA 1Z63A 3EPHA 5KDOA 3NIWA 1DARA 1QDLB 2HNBA 2FNAA 5IK2A 1EJ0A 1H1DA 3H2IA 1KHTA 4WXMA 4XOIA 1B41A 3THOA 2B99A 3DGEC 3SSMA 2PAFA 3F4BA 3MOGA 3TE6A 3AQIA 5A6SA 3BCHA 5JNVA 4MQ5A 1XZNA 3FHOA 2NTJA 1PJBA 3BMQA 2Z1NA 3OTOB 1YUBA 1Y3AA 1BDBA 1DTSA 1PNRA 2DFPA 4CM4A 3RT1A 1JQ5A 1QM5A 1E63A 1SA0B 1VLHA 3NBFA 5FWXA 4FB4A 1QAOA 3SYMA 1GD1O 1N1MA 3HCAA 4NEQA 1NV9A 1V8FA 3HDQA 2QR2A 2Q8NA 4WADA 4A8JB 5BR7A 5TEVA 5ESRA 1UBGA 2ZSBA 1ZINA 5KTYA 2QX9A 3S7ZA 2D1QA 3E9RA 4WVFA 4V2IA 3ROPA 2C7PA 4NJEB 1Q1EA 2CMKA 2RG1A 4MRAA 3GUHA 3ZYCA 2VPYA 3ACDA 1AX9A 3HYCA 4F7WA 4I36A 2GZ3A 3EQ6A 5TRTA 3B3GA 2A9OA 1TFRA 1WXWA 5G0UA 1BFUA 1QWOA 4XGIA 4QTUB 5CB0A 3AB7A 2UXDB 1Y3BE 4UAJA 1GGEA 1HDCA 3DYBA 4K05A 3EXFB 2K2WA 3ET5A 2W43A 2FU5C 4OQEA 4N6GA 1C4OA 1VJDA 1PR1A 2WJPA 3QE3A 4J0DA 4BNNA 2P4SA 4Z9XA 1QIHA 3L77A 4E2WA 3NTVA 1OXUA 4V0LA 2V9CA 4D2IA 1RBQA 2OBSA 1H2EA 1P4AA 1JLLA 2PMDA 2FZ4A 2IZZA 2BZGA 3WNVA 5IDXA 4RQBA 5LVAA 1MZPA 5BSHA 3RAPR 2Z9BA 5BUSA 4ND2A 1CP2A 2QLLA 5BYBA 1NB9A 4UNRA 4LF6B 1T9BA 5DS0A 3VR1A 2PT7A 2XUHA 1RJEA 2Q5HA 2FSSA 4P32A 1QZXA 4C0SA 1WJGA 3ASYA 1JG2A 3U49A 2B69A 4PGFA 1CF2O 1GPJA 1P4JA 5JDCA 2E48A 1KO1A 2V3CC 4XZ3A 2UAGA 3ZLVA 1UFVA 2AC2A 1US8A 2DBRA 5E4YA 2IYFA 4U7HA 2H3HA 3KSBC 4Q1EA 3CY6A 4XUGB 3N53A 3LW7A 4PG6A 5DGHA 4TRNA 1JBEA 1Y1TA 5FBHA 3ZXUB 1P7VA 3BTOA 3OEYA 4GLJA 1G98A 3JWPA 1L5VA 4R3NA 3UJ7A 3H8SA 4YXFA 4I81A 3A3NA 1W52X 2UYCA 1N9GB 1TVMA 2EATA 1ADYA 2VXBA 3WDLA 4WCVA 1PGPA 2WI8A 5C1PA 3ZIAA 5JSKA 1U0BB 1NU8A 2ZSHA 4AECA 3V4LA 4LIPD 1RKXA 5A0FA 3MMPA 1XZDA 3KTFA 3MQ4A 5BWBA 1P8JA 1KFKB 1M6YA 4QUZA 2W6MA 4PGMA 1Z0IA 4TS4A 4DADA 2W4IA 3FPAA 1GWNA 2AJ8A 1R0KA 2YRWA 5EFZA 3JQ9C 2VTDA 4KPFC 3V8RA 3CEPB 2C94A 3DJYA 1D2RA 3GPIA 5HOQA 1J1UA 3QSYA 1IZ7A 2QTWB 2OZLA 4MWTA 3HUTA 1R8XA 5GM2A 3RSGA 2BCGY 5B2EA 1T91A 1KAGA 1NURA 2VSNA 2KBFA 1G5HA 1D1QA 3AKDA 4LPKA 3ZJYA 4BVJA 2IYOA 3HRKA 1NB0A 2OORA 2UVPB 3CGWA 4KACA 4DK1A 2ZUEA 3I9NA 1JVBA 1AKMA 1X8LA 3E7DA 2ABWA 3CKMA 5D5PA 4JT4A 5FA8A 1LDEA 2HT6A 4JS0A 5SZKB 1E9FA 2WIDA 3KYDB 4X5OA 2VNKA 3H8VA 3LIPA 4PN3A 4PR0A 4ZVLA 4DZTA 3CR7A 4RTNA 5KAPA 2ORVA 3L6UA 4HRVA 5DNWA 4B7AA 3JU4A 3LLSA 1DC6A 1F9EA 1U8AA 2OQRA 3KAQA 4MVYA 2NXEA 2PO7A 3JU3A 4ZCQA 3VSEA 5IUNC 2JFGA 4GE3A 1W8DA 5AUQA 4DIDA 2Z30A 5DRYA 1XAGA 4X91A 5C32A 5IXSA 1QZTA 4FILA 1OZGA 1XCGB 1B43A 1Y9ZA 2J3LA 1IAVA 3G9TA 4U3JB 3DFIA 4XWYA 3T9FA 4C2TA 3IUMA 3BK1A 5LMCA 5AW1A 2HF2A 4XTRA 3KJXA 4AP9A 4MV7A 1QRTA 1Q0SA 2OECA 3EXAA 5A4FS 1RKQA 3GUYA 1N4AA 4X8MA 3SC4A 4M2LA 1IJBA 5IYPA 3TCXB 5JQGF 3HNRA 4PZAA 4CT5A 2GTIA 2V9ZA 4RMJA 5BVGA 5J3OA 2VNIA 2CSUA 1AGPA 1SUIA 3D6UA 3QW2A 1ZI6A 3QWAA 4KQMA 2JGIA 5CM8B 4AJHA 5AW8A 4G0VA 3P0FA 1MGOA 4I6JA 5LCXA 3OWXA 1XMOB 2V7GA 4IHKA 2AI2A 5CX1B 3CE6A 3KQNA 1UJCA 3SIXA 4OB6A 2CCKA 5L3SB 3ASPA 2BMDA 4NZOA 3VNQA 1LPBB 5BPFA 3MLAA 1XNRB 2NXCA 3NKLA 3D31A 4JJGA 1PS8A 2OZVA 1Q7CA 4QA9A 5BQ3A 5K0CA 4MCAA 2PUHA 5ADUS 1WDMA 1MB4A 4ID9A 5JISA 1G7CA 4PO9A 2JBAA 2QJWA 4EENA 2NP7A 4PLWA 1KEKA 4JI0B 3L9XA 3GH1A 1PT8A 3PC8A 4RDIA 3UAZA 3GMDA 4ZMSA 3RROA 1R6AA 3QM1A 1JEYA 3DWGA 1JFVA 1AIPA 1JA9A 1Y1KE 3GJRA 3NH6A 5KSZA 2DR3A 4CG1A 2HA4A 2I6XA 2FVYA 4GI7A 2O6HA 5HF9A 5JH7F 1AMNA 4ZPXA 1J8VA 2J08A 3CG0A 1DLJA 2ACEA 2RGEA 1ULTA 2FPMA 4Q9AA 3LC1O 4U8GA 3T1HB 2H48A 4OHUA 1USUA 3OZCA 4BXOB 5LQMA 4C5BA 4JSTA 4BN5A 4A5OA 3EFOB 4DQLA 4ZJUA 1T3HA 1NQOA 2PGAA 3NPMA 3ZD7A 2X9LA 1CNMA 4E5MA 4KCGA 2GN1A 2PSSA 1NJ8A 4WLNA 4CMJA 3DOHA 5JVDF 4DYHA 3UJNA 1UPUA 2NUAB 3OF5A 4GNRA 4QV2A 3F1LA 4X90A 2VHVA 4BQRA 1Q7GA 5LOVF 3DLBA 2DTEA 2ATEA 2FUNB 1SKAA 3GLGE 1WSBA 3N0WA 3O92A 1BD4A 1UUFA 3MTAA 5ALNA 1SXQA 2EL7A 2JI7A 2ON6A 1RI4A 1W1IA 3C3JA 5CJ2A 5EKXA 3V80A 5LXTA 1RQ7A 4KPYA 1TM5E 1PJAA 1T5IA 2IQIA 1N2GA 2IJGX 1EGMB 3ZVLA 1G38A 1P60A 2DR0A 3NTOA 4OQPA 4AZ0A 4QDJA 1W6RA 3PNBA 3WXMA 1KBZA 2XOEA 2UYQA 4Y2HA 1HX7A 4G2NA 4BVLA 2WYOA 3MNFA 1ID1A 4MQEB 4EHAA 1YLOA 1VCNA 4PVDA 3AI2A 3PEUA 1YHQB 2NYUA 4O63O 5DU2A 2I91A 1UJ4A 2Y1GA 3KKEA 3JPWA 4MS4B 3JY6A 4CV2A 2RGCA 4EDFA 3ASVA 3KBBA 5LZ8A 3C5WP 3VDMA 2R65A 2VF5X 2GPWA 3WMWA 1M73E 3KFVA 3EX7C 1EFAA 2ZCVA 1N2JA 3C3MA 3KTAA 4QTTB 4KO1S 4MUJA 1FFYA 2G0AA 5HIAA 1QH0A 1QPGA 1XCMA 1GPUA 4C03A 3L84A 3HJFA 1QX3A 1IYZA 1L4BA 4DNOA 1DKPA 5F1YA 4IPTA 3AMVA 3PC6A 5B53A 5LD2C 4TYNA 4J2HA 4ZT3A 3CS3A 4LDQA 1G7TA 2ZIXA 1GU0A 1GL7A 1Y9DA 2ANCA 4K9KA 3HWRA 5FRDA 3RIMA 4GR9A 3VHRA 2JIMA 5TE9A 5KDDA 1MA3A 5C9ZA 2DH6A 3PXCX 1Y8QB 1M2OB 3KUCA 4RPLA 1I2DA 3LT4A 5E4TA 1NQAO 1I3NA 4A91A 1MCZA 3AVUA 4KQ1A 1IZ8A 4WRRA 1KIMA 2MSKA 2V58A 1Y1PA 4IWXA 4LYYA 4F2PA 1FNSA 1WB6A 4RSGA 1BS1A 4ZCMA 2R8EA 4FE4A 4DA6A 1CRQA 1N1EA 3IQIX 4E94A 2O8BB 2CB0A 4M1YA 4X92A 2NLOA 3N2LA 1N0IA 4M9UA 4MS1B 2R6AA 4OFXA 3L05A 1KFCB 3EQZA 3GCGA 2DUNA 3IYLW 1HORA 3DTYA 5G0WA 4H60A 5HGJA 3ZHOA 2CE7A 3RHFA 2X5JO 4ZQGA 3K4QA 5JTUA 4XARA 1CB0A 3AR4A 3CZAA 4IJ6A 1E1NA 2J0EA 1YDHA 3I8XA 1V5VA 3UM9A 3THYA 5F73A 3I3OA 3FIJA 3L4BC 4RF5A 2WBLC 1CUZA 1LS1A 3BTUA 5PNTA 3ONWA 3WNDA 4QTZA 1IQPA 2RGRA 5E9QA 4D74A 3C3YA 5G0TA 4RORA 1MTOA 3K94A 5FWXB 1QE5A 2CLSA 3TYXA 4J7XA 4EG5A 4CTMA 4NH4A 1A7AA 2OWEA 3K32A 3O4FA 4PLGA 1T4CA 4IGAA 1GSHA 5DEOA 3DMRA 3I2HA 2HJHA 3NBXX 2LCQA 4BGDA 1P62B 4UNQA 2QTCA 3V7WA 5HZMA 2XUOA 4KZPA 1NYLA 3SZ3A 1KHHA 1U2QA 4AJOA 5JQGA 1JFLA 4R9UC 1OWPA 4ZVNA 3K6SA 2P8SA 2HCTA 3PXDA 1NMQA 1WU8A 4HE5A 4GOLD 4OK6A 1YJ8A 1BMFD 4L0QA 1D6MA 2O8DB 2RIPA 2ZRQA 4EY5A 2EBHX 1R00A 5AOAA 4I9UA 3QFCA 3PQ6A 3FWKA 4GX2A 2ZZQA 4JP8A 3RTDA 1K7EB 1PQUA 1I18A 4AY2A 4RAOA 4UEKA 4UQLA 2D3NA 1P44A 3DNFA 4QBHA 3UB3A 1DKNA 1HZJA 3SBDA 4BNZA 8MHTA 2GQFA 1I1OA 3ESAA 5CDFA 1JG7A 3LBAA 5L95A 3W2IA 1LPAB 4E12A 5FWYA 2JJYA 1JMKC 2EG5A 5L7YA 5HQ3A 3IAS1 1XXLA 2W6PA 2CXSA 1APBA 3B2NA 5BVGB 3ER9A 1JXQA 4JCCA 3HY3A 2P9HA 5TGDA 4QPCA 1JB1A 4GI3A 2D74A 1LX7A 1JGTA 1VKRA 4P38A 2EF0A 2ZBDA 1YU6A 4RF2A 5CXXA 3DEFA 2Q6LA 2O8FA 2AUTA 4PFSA 2G76A 3P9RA 5T6BA 4KVAA 2IYWA 2HDOA 1LRJA 1PJLA 3CJRA 1VPEA 4R68A 2IHUA 1I4WA 1UK6A 2D00A 4L8YA 3TFQA 4DMGA 1SHTX 4LYGA 3FYUA 3T1VA 4M53A 4O2AB 1OI4A 4PQEA 5KYWA 2FWNA 2UZ1B 3U44A 4CLOB 1SVUA 4PSVA 1DEXA 4HAWA 1ZLXA 3SD7A 3BXFA 1HWYA 1UBMS 3JRXA 1Q84A 5C8XA 5DHFA 3T3GA 7AT1A 4W82A 3R5JA 3E4CA 3QUTA 4MUBA 1Z0JA 3DHVA 1KR2A 2CHQA 4L4YA 1YS4A 4YCMA 1W5TA 3SZGA 1K8XB 3IJPA 4ZVPA 1T9AA 1PAUA 1WSAA 4J0GA 1ORTA 3K0AA 4MI1A 3SX4A 3G2MA 4EAQA 3W8RA 3D59A 4J16C 1DFGA 4CKEB 4URYR 1V37A 1OXTA 4IRUB 3MJHA 4FXPA 9ATCA 1QP0A 2B4KA 3P0RA 4CKZA 4RY8A 4NZZA 3GFQA 1ZOPA 2PNFA 4Q7KA 2MMCA 4RACA 2CDAA 3NVMB 2X0EA 1J9ZA 3RS8A 4BRWA 5I7FA 3FNGA 5K99A 1XTZA 3FCEA 1DADA 4IIFA 4NIMA 1I33A 3L4BA 5AUPB 4JI3B 1UF9A 1TTHA 3I32A 2UV8A 3PUYA 3ZDRA 4D9MA 3I6ZA 1IU9A 3I3SR 3RYHA 2JJ1A 4CLXA 3CLHA 2MSDB 4IH1A 4QGSA 2IOYA 3DEZA 3L7OA 3B9RA 2IYPA 3RR2A 3R77A 3D8UA 1MG0A 4F3KA 3FUVA 3W5AA 4LZWA 4QDKA 2W6JD 5BPHA 3T1NA 3DXXA 1V43A 1CJVC 3IH5A 2PZGA 3DR5A 2GWRA 2YIVX 1LEHA 4N39A 4Z53A 5KJFA 1OBFO 5DM1A 1NXSA 1MO6A 1D2GA 4QBGB 2O7RA 4EG0A 1BXGA 4XUCA 3KKZA 1EE1A 4C3UA 3GHHA 2IHTA 3GJ4A 3DGFC 1BYUA 3ELWA 4XIYA 1V71A 1GU1A 4H0FA 1KDYA 5K03A 2DLCX 1QYVA 1Q95A 2GMWA 2OORC 421PA 4E2XA 2GUGA 1QIKA 1QP8A 2FFQA 1MV8A 3OX2A 3LKBA 1Y9JA 4HI0E 2BGIA 2H6EA 3OEED 2YUTA 1NTOA 2FZLA 4UOZA 1GM5A 4H35A 4TYWA 3AEUA 3Q7QA 4D5GA 3EE6A 4MRMB 3IDOA 3WWZA 3L1KA 4MQEA 4E03A 1AHIA 1PD1A 4UEWA 4EHJA 1TM3E 4UMEA 3E22B 2EZ4A 2FN7A 4YJHA 4EHBA 3IA7A 2C5GA 4IIXA 1B8NA 4XSHA 5T57A 1H94A 3V7NA 4IDHA 1KEVA 1NM5C 4GZ6A 2YTZA 2IHZA 4OOXA 3RSZA 3C7KA 1PP4A 1OA1A 5EYPB 3U7QA 3GFSA 4W99A 4TS9A 1E59A 2DC1A 2W2OA 1CJTC 2OMKA 3GV0A 4QREA 2H1RA 4BU0A 3PX7A 5TX7A 2GD2A 4B9EA 3ZV5A 4DR7B 4BMPB 4DA0A 1T3TA 3SDZA 5J4YA 3AJEA 3K6KA 3R2JA 5GOTA 3IODA 4JI5B 1YIDA 2EHDA 2WTXA 1P2TA 4PZDA 5EZ6B 1CY1A 3KL4A 4NDAA 5KINB 1XD9A 1O5TA 1J42A 1GTG1 3Q7IA 2ISSD 4YV7A 2GJAA 3P0JA 5IHXA 3U61B 4ETIA 1AF7A 2FFRA 3NZEA 1WUTA 2NV0A 1GGVA 2P5SA 3FYCA 5GONB 3JXEA 2WTUA 1YFLA 1UXKA 1QBGA 1VECA 3Q7SA 4IO1A 4P5EA 1S4QA 3SU8A 3EPPA 2E4VA 1NNEA 4RIEA 4YJ3A 3CRQA 5KWEA 1MJGM 4GM0A 4JLJA 1NVTA 1JAXA 1VBFA 3DUFB 4U2GA 5AJZA 1KP3A 2FDRA 3AFOA 3PYXA 2FR0A 4QIHA 4LZOA 3IEMA 5F3WB 4QOFA 5A2GA 4A8PA 3D8SA 5EJ4A 1KTIA 4FWIB 1NP3A 4HN2A 1VQ9B 1XA4A 3IESA 4MWCA 3ESZA 2AI1A 1Z6PA 2Z04A 2XBMA 2YNMC 3CCSB 1BKYA 2PGLA 1NJ5A 3PIRA 4FFBB 4K87A 3T4PA 4BE7B 2J3IA 2JVKA 4JASB 4XM1A 3ZWYA 5B57C 2Y76A 2QSYA 1J70A 2YICA 1GCGA 3FD8A 4BNTA 2RAVA 1P80A 4KI0A 3BGOS 3I64A 3NM5A 4X8IA 4IDBA 3KYJB 3BRSA 3U4MA 1U7PA 4PR3A 3MRSA 1PJSA 1AMOA 4QRDA 4JZYA 4D97A 4FD2A 2QK4A 4JLBA 4C6TA 1T8PA 4NC9A 2JDIA 3ZCQA 4WDQA 5KOJB 2HUNA 3T61A 3ZJTA 1EAMA 1O96A 3E9DA 3I09A 4B4WA 1A1SA 4ZDJA 1WABA 2C31A 2UUBB 3QG1A 1ZD9A 1P2SA 4WY8A 1GG2A 5D1HA 4UTVA 1A9PA 4BNMA 3UMSA 3W8FA 5ECYA 2JI9A 1EVQA 3PXXA 4QNMA 4UATA 3DSRA 2R97A 4UQOA 3E2PA 5TMBA 3W4JA 5B2FA 3CLSD 3HM2A 3KOUA 4P83A 4P6VF 1WZCA 1M8GA 3RYFA 2DFKB 5CNJA 3ZWWA 3IAFA 3THWA 4EYSA 1NUPA 2XDQB 4KBGA 5GIPE 1EVZA 4GMGA 4LOHA 4DILA 3ZQ6A 1O77A 5A6VA 3CNQS 1V1RB 3DBVO 1NSYA 4NJMA 4MGHA 5EHIA 3T52A 3TZCA 1VSUA 2ZYSA 4YJ3B 4CLEA 1IN8A 2UXBB 2FSUA 3NHAA 1OLOA 1QHXA 2PVSA 3E3AA 3TTUA 5K0JA 3L0BA 4UOEA 3PHCA 4CDRA 1PEYA 2PMWB 4EGFA 1H23A 3BFKA 5FYDA 4WX2B 2JATA 4LV8B 3GELA 2QOEA 1IL0A 1E89A 4GUAA 4QUBA 4RGYA 4RVOA 5E4FA 4LWPA 3H5RA 1DDOA 2WU8A 4TVBA 2FLVA 3WZLA 3MJ4A 2J6IA 1EU1A 4KMSA 4UXJA 3A11A 4KVFA 5EUCA 3VPGA 4U0KA 3WNCA 1E6CA 1PNQA 1SOUA 1QZ3A 3BQJA 1NBWB 1ZHHA 3G2NA 3P2OA 4OSOA 5IYNA 4LGMA 1OIXA 2O9JA 4BN0A 4R84A 3T3EA 3HCCA 3AIKA 3T4XA 4DOMA 2JGDB 1WMSA 2J46A 1PR5A 1VLQA 4LYAA 3I12A 5DYYA 2QIPA 1I1QB 3ZTWA 3GZJA 2CMDA 3DXYA 4AKTA 1YWGO 2OK8A 4N7MA 4R8SA 2IV2X 1E8MA 2ZBGA 3AR7A 3T5AA 4HVAA 4QPZA 3A6HA 4R7GA 1C4WA 5DK4A 3TCKA 3GRYA 2WWWA 2VTBA 4UHBA 1MLDA 1X7GA 5DHRA 4CG3A 1DRWA 1XTPA 1UKAA 3E6AA 1SBCA 1K63A 4WNAB 1PR9A 4ENQA 4IICA 1U5AA 2VDWA 3SG0A 1MNAA 3KT3A 5LPNA 4CR7A 1VL0A 1SVKA 4D0RA 2V31A 4JJIA 1X1RA 2AW5A 3G88A 1K92A 3AKYA 3S8EA 1X2BA 4BGVA 5HQTA 1OB2A 4XX1A 3E82A 4KQCA 2GN8A 3F5MA 4OOEA 4N5IX 4BZXA 2WIBA 1L6IA 1JQDA 3STWA 2J48A 1GG5A 2WUEA 3HJTA 3NEYA 3PPYA 4XJVA 3GQBB 1O2DA 4GLLA 4B34A 4DR5B 1Y7IA 2PVCA 3ADOA 4NG5A 1JKMA 2X76A 3CW9A 1VZ2A 2WWIA 4B3XA 3QKUA 1WXQA 2WIKA 5DN6D 4O4JF 3RUEA 2PUEA 2PKCA 3ZWXA 4WZBB 3U0BA 1EK5A 4HEA6 1NPYA 3EWNA 5E7MA 3PFWO 4M8IA 3PYLA 4EKYA 2PL9A 2AC4A 1TEXA 4HQNA 1Q1QA 3ED5A 1ZR4A 3PZBA 1MP0A 3BGIA 4RVHA 3D7RA 4RKYA 1VF7A 1SKYE 5D3MA 3U1BA 1HNZB 3AKCA 1XTKA 2GYYA 1EXWA 1RMQA 2QL6A 5FXMA 1PV2A 2V6IA 3TOXA 2Z98A 5FQOA 2GILA 2OBBA 3ZC3A 4EPTA 4TLCA 4PIPA 2HMAA 5CAEB 2DPLA 1LRLA 3GR6A 1UPCA 3CPXA 3G6WA 4QDTA 5IKOA 2EIXA 5JAOA 5NLLA 4JJAA 1IEWA 3RUAA 3QKRA 1J22A 2WIAA 2BBWA 1U9YA 3DFFA 2VEDA 2XKJE 4YUVA 2H0RA 4YAWA 4C0WA 1NBME 1I3KA 5D3KA 5GOZA 1RWXA 2C9BA 2PZFA 4OHKA 2Q45A 4Z9AA 1XO1A 3WOHA 1D03A 2XYGA 1A27A 5L3QB 4RL4A 1OWOA 2XE8A 4O59O 1ADBA 1HE1C 2WA1A 2ZRBA 1VYUA 2E4YA 2QVZX 5MGBA 1NKSA 1M6EX 4UE2A 4YAJA 1X7DA 4Q4AA 1L8OA 9LDBA 1QGDA 4YRNA 1ZG3A 1EWVA 2PXXA 2QT1A 3QX7A 4WXHA 5H81A 5B3KA 2FETA 2WMNB 4K8RB 3PNLA 2VPZA 4US0R 1DC7A 1EX9A 2MR6A 3ZJ4A 3A4NA 4P1VA 3HUUA 5I8ZA 5CB4B 4ZODA 3QLJA 2PAAA 3JQ9A 4EHDA 5EE1A 3U9TA 2SKCA 1YZQA 2FW8A 4X66B 1LQ2A 3T5DA 1VYHA 2F4NA 1EH5A 1E3DA 1HDZA 1J2RA 2LZJA 1X6VA 4UMVA 1YR9A 2YCLA 1HQCA 2FCAA 4U0JA 2AWOA 2PT9A 4KFUA 3CXUA 3RS4A 1KEUA 1NJGA 2IYZA 2ONKA 5AR1A 3W6ZA 3WJ1A 2A30A 2J09A 4OQNA 4AQ7A 3TGPA 1GQSA 4ABYA 3N8IA 3Q39A 3W5UA 1YOVA 3ENKA 3LT2A 4HMQA 1AQUA 2FWBA 3L7JA 4DLUA 4D4LA 4IIGA 2AQIA 1CQPA 1Q22A 1LPMA 1H6AA 4JHLA 4KR0A 4GZMA 5CB6A 3AVPA 2BFCB 4BRZA 5JJ5A 1X42A 3VSBA 1U0LA 3CLTC 3IP7A 1R37A 4RDKA 4KGVA 3EOAI 1EXDA 2BHTA 3II6X 3PUVA 4BNKA 2RK3A 3DKPA 3ZI0A 2HT1A 3GJXC 1GUAA 4BLUA 3OQOA 4OB7A 3ELYA 1Y80A 2IY9A 2H9YA 3FBGA 4GKAA 4OMFG 1YJQA 1KQNA 3QY0A 4LRXA 5HK8A 4Z4HA 4XOTA 2OAP1 2YJTD 3JS5A 3U7HB 2VNSA 2DECA 2C1ZA 2XJ9A 3TL6A 2M2IA 3LCUA 5DLDA 1Z7YA 2G4CA 2OO7A 2ZR0A 3E9CA 4NNOA 5LMZA 4RMNA 5DPMA 1OREA 2RH9B 4AB1A 3U3KA 1TYDE 5EIOA 3TW8A 1B74A 4ARIA 4TL7A 5CGQB 5KMGA 1O6GA 5BT9A 1FU7A 1Y82A 3A36A 1KRWA 4DJDC 2YOFA 1EZZA 4I2VA 2H1CA 5C4IA 3DV0B 2HI0A 3DWFA 1E2IA 4JJZA 3GLTA 4L7VA 4X94A 3H0CA 2WWYA 2SCUB 3PUKA 4Q4LA 1MAVA 1OXKB 2YDXA 4I9HA 2D8MA 2D5AA 2OTLB 5AYVA 2DIEA 3D0KA 1RZUA 2Q9UA 4DWJA 4HAXA 4P3KA 2ZJ3A 3FTCA 4RVUA 3UHJA 5I51A 4J8PA 5DCUA 4FGLA 2HLPA 3BA1A 2V55B 2AXQA 4NICA 1QC5B 1PK9A 3B7WA 4X64B 2NO1A 3LQ2A 3L3BA 3LF2A 4ENVA 4ZREA 5KSPA 2CLKB 5KYYA 4TL8A 3D4BA 3VPXA 5JXWA 1JDZA 3L7IA 1NE7A 4YYZA 2HTEA 1H9BA 3BC9A 5J3JA 3U9LA 5IJ9B 2O23A 3BBLA 4BEJA 3BMNB 2R00C 2OEPA 5AJYA 2OYNA 2LIVA 3MJTA 3LVRE 4E46A 3Q3EA 1ZO8A 3TQCA 4L74A 4HPWA 5JXJA 3T8YA 2YXNA 1GPKA 1QRAA 3HFRA 3PUHA 2AXEA 4JXKA 1ZQ1A 4ILEA 4Y2TA 4G36A 3UK2A 2QRQA 2NYAA 2CLHB 3PJGA 4QYXA 3HBNA 4TTVA 3HB5X 4G4GA 3V1YA 4CQMA 2CYAA 2ZLBA 2ZYHA 3O6VA 5T4BA 1U5BA 4PWYA 4IHAA 5DGXA 1R0BA 5CW2A 2C2MA 2QAIA 3B6KA 4H3KB 4LJ6A 1SC1A 2HIHA 1BW9B 3N2GB 4EKIA 3G2QA 4M87A 2C7GA 1H8EA 4Y0VA 5EWLA 1P2FA 3CRW1 4RZXA 4O4JA 4UBNA 1NAHA 2G5GX 4HH1A 4MCJA 2PXAA 3T7JA 3HL4A 1WPRA 2QUZA 9LDTA 1D1NA 5JD4A 1YAJA 2O2GA 2QAGC 5IYZB 2JH8A 821PA 3GCDA 3ICOA 3HSKA 1MQ9A 4IH9A 4IYRA 4O0MA 5FR2A 4C22A 4XQEA 1DXHA 3A4YA 1HE4A 3P7MA 4Y6OA 4BKQA 3AUKA 4HDNA 3HDTA 1J5EB 4GQNA 4AC9A 2GTPA 2Y9PB 3JATB 5HUHA 1GZ4A 1DRVA 2EW8A 2VZEA 3P32A 4PAQA 1GAWA 2QLNA 5FFNA 1Z7EA 5FP0A 2M6KA 3JVVA 1LX6A 1PZGA 4R51A 3H9BA 4H1TA 4U7WA 4MLZA 3FJ1A 3HJRA 5EKDA 3ISVA 1JH9A 1DSSG 2VOEA 2YJ6A 5LDGA 3UHAA 3N7TA 4J0EA 5C7LO 3VNRA 1UKEA 2I4LA 4XN0A 1VMKA 4LXTA 5AUNB 1U7XA 1U99A 1FCJA 1Y6JA 2ZB7A 1VQ7B 1IY1A 1TK2A 3L8CA 4H3VA 4TWIA 4C06A 1L4FA 1IXSB 2YASA 3WIBA 2R6GA 4ZGBA 2FOXA 2Q4RA 1HRDA 2I29A 2CHEA 2QMYA 4CFSA 1G3IA 5JNRA 3H1BA 4ISCA 1WLYA 4I55A 1Z5NA 5DK6A 1OLXB 2FW0A 4EY7A 3EWAA 4L6AA 2FWJA 5AM1A 3NUZA 4J3NA 1KKLA 2Z4SA 3K0FB 3PGXA 1BLIA 1IRIA 5LZ9A 4HMPA 4DWVA 2FSVC 1IOVA 3SMQA 1ST2A 1RP1A 2ODTX 4N5NA 2UUCB 3BCUA 1GFSA 2RARA 4XR9A 1G3UA 1CIVA 5ALJA 3R7WA 2IS2A 2FN4A 2GA9A 3PCXA 4PG7A 4C4RA 1C2TA 4CMEC 1JEYB 3PPIA 3QXGA 5KC9A 5K6TA 1AGYA 2HKIA 3AXSA 4LBWA 1TLFA 3RFCA 4UBIA 3WLHA 5IKPA 1AQIA 1I36A 3ZE0B 4QU5A 3RSHA 3DONA 4B7CA 4DRZA 4AZ3B 2OHIA 4ND6A 5HIMA 1UBEA 3DZHA 3TEMA 5HG0A 1F8FA 2WP0A 1DBRA 3OKXA 1YMVA 1QCYA 1EZ4A 3B52X 3ONFA 4IDAA 5D5QA 3T41A 5C81A 1AKYA 5LQCA 2QG6A 1V3TA 5DHTA 4F9TA 1XVUA 4I08A 2AR0A 2UUAB 3K1AB 2GBCA 1TKRA 3CUSA 4ZZIA 4NXMB 1HYGA 2QVYX 3OO1A 4HPXB 3BXZA 4XQCA 5K8IA 5JMTA 4XWGA 3B3JA 3M6WA 1WXFA 5AKJA 3HDVA 4LX0A 4ZO8A 3HO8A 1JSZA 3F9IA 4RPJA 1QUEA 2H2HA 2ENWA 1XMXA 2D54A 4KV9A 1A9SA 4CZ2A 5AO9A 3H13A 1DAKA 4RA6B 4UHCA 5IYQA 1M6VA 1TYCA 4GM1A 1BMFA 2FGKA 5U9CA 1U2GC 3DLTA 3T7TA 2HHLA 1M2KA 4DCCA 4KR3A 2I6TA 4R98A 3ERCA 3IUPA 3QE9Y 2VT7A 4KLZA 2YRXA 4YBRA 3SC6A 3KQPA 1VJRA 2AFVA 2BRUA 4EFNA 3JR7A 4CN9A 1FLAA 3OT1B 3FTNA 3A8JA 1Z33A 4FYXA 5A7FA 1NW6A 3L8DA 5CVUA 4TKZA 1KI9A 4JIGA 4D92A 4E09A 1YS7A 5T64A 5ALQA 2PXHA 2B1GA 1YJNB 3EMVA 1XRSB 4ZWNA 3KZCA 5CLFA 3T9CA 4PPGA 2IU3A 4UFNA 4ZIRA 4M0PA 4RD2A 1KMQA 1ESNA 4Z4WA 2NXWA 4OPMA 1TZMA 2XNHA 2JI6A 1G9TA 2Z6UA 4FYPA 3V33A 3MUOA 3OZTA 5CT6A 3PE4A 3QEMB 3E9NA 1SG9A 4C43A 2OCXA 3TIFA 1K8AD 1ZGJA 2MR5A 4US2R 4WZEA 4YGXB 4MQFA 3RU2A 4G1MB 3OPNA 2AN3A 3UPTA 1PNVA 3FW1A 2GZSA 3IMFA 3D54D 2WU0A 2OZLB 1U9IC 2F4VB 2ZRIA 3I6BA 1RKVA 2BZ1A 3PUZA 1N2IA 4OAOA 3KDSE 3LOUA 4G5XA 4EKNB 4F91B 4YP7A 4K03A 1C30A 5EE9A 1G3MA 4QXRA 1D2AA 4EKEA 1RQGA 1RIFA 3NHJA 3M6AA 3VSAA 3VR6A 3QWBA 4IKEA 1FU8A 2ATIA 3I6IA 4TLMB 4N0QA 4F84A 1MJHA 1N1DA 4KX3A 4JL5A 5KTKA 4YJKA 1GTMA 1CY2A 2C2KA 4HWRA 5HIIA 1U7TA 4CM8B 4DCSA 4F71A 3W0LB 5IXJA 1OBHA 5C52B 4WCFB 1AGXA 5BSTA 2V6MA 3MWDA 2R6DA 5KWVA 2X53S 4H7DA 1O0BA 2X0KA 3OQHA 4P4NA 3D6JA 3WGMA 2W2PA 4B4DA 1ZMOA 2X8JA 1US8B 5EXSA 1MFZA 4F6CA 4Q9LA 1XLUA 3PX2A 1EBUA 1LPNA 3U3ZA 1JSLA 4EYOA 1VLVA 4XLTA 4C6SA 3BZWA 2SECE 3OBBA 5FWNA 2QJOA 4P5PA 5C80A 1D9XA 1MRZA 5JFGA 1GPBA 1KEWA 1ZIPA 2VUIB 4JLPA 2D7JA 4O3FA 1E1LA 1IJEA 4X05A 1E92A 3PFHA 1P0PA 5ESXA 4MARA 1Y0YA 3ZZ0A 2AI3A 3KL9A 1WBDA 1BDJA 1CQWA 4ILKA 1EFRA 3L1JA 3HBJA 1TJ4A 4KKVA 1M2JA 4IIDA 4DMRA 3BMNA 5TGZA 2A9KA 3GA5A 2FE4A 4EJ6A 3K8ZA 2X40A 4Z4FA 1NP7A 2HRQA 1GOTA 4XTCS 3ZVNA 3OF3A 2X0IA 3ZGYA 4B83A 2GZMA 4R81A 3IQHX 1QORA 3TH5A 4Q9KA 4O2BF 3PENA 1GILA 1E5VA 4COOA 5CPBA 2ECKA 1J1ZA 1EUCA 2D5LA 1AM4D 4MI6A 4QFBA 4WA8A 3D3KA 3VI4B 2XD4A 3K05A 2PR2A 2ZYRA 4ICIA 3EXEA 2IGTA 4M46A 3OY7A 4UU1A 3SOPA 3U3MA 4BB0A 1JHYA 1J20A 1B0PA 3F5DA 1WCIA 3JQ7B 1X14A 5YASA 5M29A 1NVXQ 2H1VA 4FWBA 5C35A 4KLNA 1TK3A 1OTHA 4ESOA 2TMYA 4HDMB 4NF2A 3C3AA 1SVSA 2IEDA 1HT2E 1ORWA 2YWXA 1ZD8A 3ESQA 3WBBA 4C3VA 4B84A 2DULA 3DNPA 4NQRA 1GHTA 2Y93A 3VKWA 2JJ2A 4HX5A 3SLDA 3PDCA 2EDAA 4W7SA 1ISIA 2CXOA 4YJGB 1TPZA 3BWVA 2EQBA 3IP8A 1I7QB 3JARA 5JAMA 2VYVA 2OC4A 3U0VA 1R74A 2RGBA 3DV2A 4UFOA 1JKXA 5KWIA 3CCVB 1RHQA 1JFSA 3CGGA 1DTEA 2BFWA 3RG2A 3SF0A 2WF9A 3VHQA 1JAIA 2V7EA 1Z56C 4QTXA 2ZXEA 1LW7A 2VHQA 4H08A 3AY0A 4EHHA 3AI3A 1KYWA 3SF8B 3UJDA 3AJ8A 3X2EA 2HWWA 4MKRA 5TMEA 1PF7E 1S2IA 4BC0A 1N2CE 4DSTA 4WWVA 4JL8A 1VQLB 2ORYA 2PBRA 4PM4A 4UCQA 1DPFA 4I50A 3RIHA 4LYDA 4BBPA 4DBVO 2DQSA 1L6RA 5JC8A 4F11A 2EJTA 1VPDA 2VHJA 1NRJB 4UM9B 4FT2A 1VJTA 1FTSA 4LBYA 3IDSA 4LGYA 4EMTA 5A1TA 1Y6FA 4MQBA 3A0UA 4LXXA 3NT4A 3BXPA 3K0HA 1DBVO 1RYDA 1XCOA 4ND4A 5ELMA 1GZ3A 5KJEA 5LB4A 3UV7A 3L6OO 1ENPA 4KQ2A 2Q6IA 1CUGA 2CK3D 2PS1A 3U19A 4GBGA 4JCOA 4RANA 5DIFA 4X8OA 5P21A 5KTMA 3OAAD 3E8XA 5EKTA 5TQ2B 1MABA 1CQIB 4H4EA 1Z5VA 5JNTA 2BHLA 1TM4E 4GP6A 4P2GA 4EI9A 3Q8KA 1DXQA 3WQSB 5JROA 1Z6XA 2BMJA 4HRAA 3FGNA 4IY1A 4Z49A 1IN7A 2GEDA 2FWAA 4CDMA 1WPXA 1NXVA 2QL9A 2VDPB 3GRRA 4NNPA 2GZ2A 1MF7A 1X1DA 3U4IA 1U02A 1Y1LA 2I2BA 3LQKA 4PXYA 4Y2JA 3U13A 5HKKD 4O1IA 5HR5A 1OF1A 2O1SA 3G1WA 3DL0A 4OQZA 1OFIA 3A2NA 2D5CA 3NFYA 4P7KA 5E9WA 1HNNA 2AEMA 4PHGA 4YBZA 1V4NA 3MJFA 3NWEA 4EELA 3GZTB 5CAEA 3L4JA 3CISA 4GI1A 1DAMA 4O2AF 4A8TA 2CMFA 2XRZA 1IEXA 1MPTA 4RA9A 4ZYVA 2WZCA 1Z2EA 3G7SA 3ZBQA 1M1UA 1JQEA 1WOYA 2GCNA 4JI8B 1ULHA 1AS0A 1DEKA 1THZA 2Y05A 3IILA 3U1VA 4UMDA 2WNSA 2GREA 4EB0A 2ZBUA 2MHCA 4IRXA 3EVCA 3WGTA 5BWCA 1W5AA 1YRBA 3L6CA 4PG4A 3RWMB 3I5AA 3JQGB 5EIAA 4P2BA 3THYB 3RS3A 3GJSA 5I4CA 1GLNA 3H9NA 1P0QA 3OJ0A 4GI5A 1PJCA 2YZGA 3DE5X 3PC7A 1WD5A 4WNYA 2WY2D 3SSOA 3G71B 3RS9A 2EJWA 3LPCA 4K1XA 2P6MA 5HCNA 4C05A 1AO3A 2RBKA 1CS4C 5F7XA 3UMBA 2JGMA 2ZU0C 3KLPX 1LDNA 3BFXA 3PQ8A 4MVXA 5ALKA 3JYQA 5EZQA 3H4VA 4P2NA 2C7VA 4DV7B 3HJNA 4WZBA 5JI3E 4DC0A 1M10A 1NPTO 1U1IA 4RTOA 2YWBA 1YV9A 4YRBA 4GOJA 4LDZA 1ECGA 4D45A 1GQRA 3L8GA 4GC5A 1SVMA 2PKXA 1XBTA 1ORVA 2XOXA 1Y8ZA 3IVMA 1NXXA 1L5GB 3MBOA 1J4AA 3WC4A 3ACBA 3H9EO 3G79A 4JN6B 4IBOA 4QQKA 2JFFA 2QN6A 1LZKA 4RX1A 3RV4A 4L7QA 1F9AA 2H8GA 4ZO6A 3MIZA 5FPTA 5CXSA 4RCVA 3SVTA 4WGGA 4RVSA 2OPHA 2IODA 4OK3A 4B6PA 4P0PB 3ROTA 1HDIA 3TDKA 3LQ4A 3TLGA 3D7SA 3B3QA 4NS4A 2FWMX 1A2KC 5DYTA 2PTHA 4ZZ2A 1LU9A 3D0OA 1T4DA 4EEXA 3SI7A 4D57A 3NDJA 2WMYA 2D3LA 2QD5A 4L51A 5DX8A 4H1UA 5HXBA 3R8CA 1X7XB 1WP9A 2QPAA 1SXJB 4L2IB 4BPRA 2GESA 3QPWA 5AKZA 5K0NA 4DA7A 3GCXA 4PSAA 3TD6A 4F2HA 4JENA 5A4JA 2UZ4A 1O97D 4YLEA 2LWIA 1PTKA 1V8OA 2C9YA 5F12A 1P0CA 5B7NA 2H11A 2Y92A 3AY7A 2KSQA 1MORA 3GVIA 5JIBA 4DB4A 1J0CA 1FSGA 2BEUA 4GLBA 2QRZA 2H4HA 3RIYA 2DEUA 3T9DA 4AVYA 4DUZB 3H2JA 4INZA 4HY3A 1S8NA 2C92A 3EULA 1JFFB 4RK7A 3MTDA 1T8RA 3KB2A 4L0MA 1SIUA 4IMJB 3H6HA 5AWFC 2FB9A 2HREA 3OKAA 2P6RA 3H1AA 1KF0A 2I7DA 1P61B 2ISQA 3N58A 4DNXA 2CUKA 1B6TA 4CETA 1WOMA 2YXEA 3E27A 5AXCA 3KOYA 1YJBA 4RIGA 6NULA 2XXAA 3K5PA 3URMA 3IIMA 4QOGA 3THXA 4NCKA 1T2CA 2OOSA 2YJ5A 4ZHQA 2VPTA 1ZWKA 2VZ0A 6CHYA 1I0IA 4BMCA 1TYBE 2AGVA 3AV3A 1Z07A 3T56B 1XL1A 2JAWA 4LPSA 2R7AA 5BV0A 3W78A 2PWAA 4J29A 2C4UA 5DCLA 3GFFA 2ZIZA 1XF9A 4QFMA 3WL8A 4B33A 2VJIA 1OLSA 3IIKA 4IDQA 4W5HA 4CXMA 2JAQA 1CR6A 1NI4A 2FG5A 3Q40A 3V8QA 2Q1UA 5FUYA 5GONF 1U2ZA 3VO1A 1RPNA 3DEAA 3QRWA 2AD5A 5FUBA 1JJAA 2A3RA 2WHXA 3CLSC 2QLTA 4QSHA 4X8LA 2AN5A 3DDWA 3LE8A 1I0ZA 1E62A 3EIUA 1KSJA 2Y0CA 2JHCA 4IL5A 2W2KA 3DCIA 1OE0A 1NBIA 3WLLA 4XR4A 2A5DA 5M2QA 1GNTA 2LDBA 3MOIA 4CGZA 3VOTA 4WOBA 3HJHA 3KJZA 4YMTA 3IQWA 3V55A 1T2VA 1GARA 2V9PA 3AGQA 3JD2A 4DDMA 2EEPA 2ZDQA 3IPYA 4DZZA 5L3SA 2H0AA 1FDWA 3W3AA 3QI7A 1WXIA 4G1UC 5EG5A 4F96A 1XMQB 4RMIA 3KQSA 4J7CA 2QX6A 1T29A 2O06A 2OENG 1VE1A 1O9HA 1DWOA 3HPRA 2G17A 4RGVA 3WS7A 2LVBA 4GMKA 4WERA 4DT1A 2NNLD 4OLFA 1WZIA 4GQAA 4O5AA 4HRYA 1MNQA 5G02A 2VSFA 3QPDA 4GLFA 4POOA 3HXMA 1GZSA 1RYHA 3GEPA 4MITA 1O54A 3AUSA 3AR2A 4KUHA 2W2TA 3SKBA 3CWCA 4M0EA 4KDFA 1RXWA 4EO9A 1KOLA 2C5FA 3K70B 1L7EA 2RD2A 1OSNA 1R15A 3AIMA 3ZY4A 5CU7A 3PG5A 2O0KA 3PFBA 1FLNA 3DZKA 1I5EA 3EF1A 4QVKA 4BMOB 3FUCA 7GPBA 2R7LA 4G63A 4ZVQA 2GQ0A 4JR1A 4D7AA 4BJ5A 3IV6A 4XMYA 3A1EA 5IARA 3BH6A 3FPPA 3V2HA 5FO0A 4ZPJA 3OZAA 5ADHA 2J9FA 5DJ5A 2WPNA 2XQFA 3Q85A 4LX8A 1K6XA 1OLXA 2J33A 3CBQA 4WDRA 3BUSA 4D25A 1SIOA 2GCPA 1T15A 3JALB 1YVRA 2H85A 3WL4A 4DCUA 2PPLA 3GYBA 1H5UA 1HV8A 3DBLA 5MN6A 5L3ZA 2OG1A 2X23A 3BWCA 1VI2A 1WW2A 1E8NA 3T7CA 4DMLA 2NP6A 2IZ7A 2I4TA 2PX2A 2X6QA 3AP3A 1TDJA 4QULA 3TQRA 4DCTA 4EK9A 3ADBA 2P62A 3RE1A 4H1WA 1MAHA 1RJFA 3BE8A 2DWCA 3CPHA 3EDYA 1Z88A 4ZDWA 1Q1AA 4XGNA 1WOSA 2E82A 2NZWA 3EY9A 1SQSA 1NVBA 4IDNA 4GYWA 3CCUB 2XQJA 3RASA 1TAUA 3R0QA 4A2CA 3W2TA 2XJ4A 1HT1E 4Z0PA 1OGJA 4UVHA 1U3DA 1IJFA 4AZ3A 1YZKA 1EP2B 1GFZA 2CZCA 2ID7A 1SBTA 2G28A 2F90A 1KJNA 1VE9A 2D4HA 1G5PA 1F3OA 2PKYX 1UXGA 3HA3A 5THKA 5F23A 3R7WB 1IC6A 3RTAA 2BSAA 1ST3A 2OQVA 1KP9A 4HB3A 1I24A 4LWOA 2PBFA 1ZVVA 5BORA 1G6KA 3G2OA 4UASA 1VKNA 4MI9A 2JD0A 5KBYA 1D8AA 2ZYIA 3EG9B 5BRJA 3AB8A 4C21A 4IWYA 2H5JA 2HO5A 4LOLA 2VA9A 3EAQA 2ZZFA 3DZGA 2DY1A 1X74A 3NASA 4B6OA 3EZ6A 4FWTA 2FSFA 4JEIA 4DS3A 3PD0A 2VRNA 2XUZA 3GU3A 3D81A 2XXJA 3PRJA 4MTLA 1R0RE 4IO0A 4KSYA 5EJIA 3ZHQA 4AULA 1JFTA 2D06A 4NYMQ 1FW8A 4LI3X 4FYKA 3OE5A 3UK6A 4P4UA 3JAWB 5JFOA 4G5GA 1U7ZA 3DMDA 2CUNA 3HPQA 4N1AA 5TPWA 2I8AA 2ZYWX 1U2RA 4QLOA 1X9HA 2FPRA 4PIMA 3RB8A 4DREA 3OZGA 4NX2A 4WL0A 2O0LA 3G9UA 2G72A 3F96A 3TD2A 4ZHQF 4TRMA 3GY0A 2QLBA 1KO4A 4HDNB 3EDOA 4FP9A 5KYUA 2GO7A 1AUOA 2AEJA 1I9GA 3GG2A 3OFSA 3R3WA 4G4SO 4G3XA 4J1QA 1H6DA 2H63A 5EGNA 4DARA 3FCYA 5LWQA 2V8OA 3W2FA 1U7HA 3FTPA 3VA7A 2XCIA 5C7OO 3EGWA 5INTA 3VC3A 1TD1A 2O54A 2AN4A 3AP1A 4G8JA 3H17A 1EM8B 2E37A 1X7XA 3R8XA 5DM60 3UYLA 5JLJA 4KWHA 4BKRA 1P17A 2W00A 5EJGA 3O4IA 2MYPA 2DXIA 4HZIA 3U26A 1WS6A 1T5TA 4K6MA 4DLLA 1L5SA 1NXPA 4INPA 4N5MA 2XBLA 3IUEA 1C7RA 1JAZA 2FCRA 4Y6PA 5DDIP 3ZJUA 3U3DA 3JQPA 1NBHA 3GVKA 3RVPA 3LXUX 3BGWA 3SEAA 4A36A 2P0AA 4BLQA 1ZH0A 4MR9B 2J32A 4P82A 2P9TA 2YFYA 5DTQA 5K0LA 4F5WA 4JUFA 4MOWA 3UGJA 1WM1A 5BV2P 3RI3A 4EZBA 1PZEA 3M6VA 1L5LA 1KS9A 5AI8A 1XMJA 3T7RA 3WIEA 1N5KA 2ORED 4PPQA 2Q8PA 2ZVDA 3FMIA 2EX1A 3KOMA 4O02B 3KG2A 4GVLA 4Y6SA 3W5CA 3IAM1 5IAKA 1THGA 1M33A 3ZLBA 4RXMA 2BUAA 3TB4A 2A6PA 2C82A 2O5VA 3HJBA 1UT8A 3TRHA 1PJZA 3W8EA 2I8LA 1DJOA 3DE6X 3TQFA 1EUDA 2W83A 3QHQA 1ABEA 2AUMA 2RKOA 4RD3A 3VVBA 2RI0A 1AZSC 5KSYA 3D3WB 3C6KA 4PPNA 3KEQA 1RAEA 3ANLA 5I7EA 1E64A 2FPLA 4M1KA 1KDZA 3RGGA 3IE0A 5BNIA 4IX1A 4ZEXA 3HEAA 3N6RA 2FR8A 3RJ9A 2B4TO 4D3DA 2EL9A 3FAKA 3HJAA 2W5UA 4KRFA 4U7TB 1R4NB 4XR6A 5ANRB 2OXCA 3SC2A 3VI3B 4DTCA 4EQ6B 1G16A 2AN1A 4I46A 4EHKA 4RA9B 1PWZA 2QQFA 1ISGA 3KCNA 2YY7A 1B15A 1RDFA 4B48A 4TOIA 4WOJA 5LMNB 4JXXA 1G291 4IUBS 4JGGA 5ED4A 1ZM7A 4L5BA 3TSYA 2WAYA 5DXAA 3VAZA 2GEKA 4NYJR 4DAOA 3M6IA 1P2UA 4BO0A 2A0XA 4AKSA 3L0YA 3GLIA 2NOAA 4FE3A 4IM7A 2PZMA 5K51A 2IEIA 2VCHA 2QZPA 4HAVA 3IJ5A 4HOYA 4MMXB 3IBFA 4I5FA 4P86A 5JEDA 1EUYA 4Q9DA 2IH5A 1RYNA 7REQB 2JIRA 3JW8A 3R8FA 3M7IA 4W8HA 3QU5A 2V7WA 1HMPA 1QAMA 1E7MA 1C0EA 2QTMA 3DEKA 4PX9A 4AUEA 3P4YA 2O8NA 3HGQA 1CJUC 1ZUHA 4ZYWA 1TKCA 5IH3A 1AMUA 1Z18A 4NNJA 1NR7A 4KBFA 2A1TS 1J9EA 3JAKA 1JIQA 5IAGA 6YASA 4TMKA 4E14A 2EYUA 3JQ7A 1NG9A 1T0UA 1EDDA 4YRFA 1AQJA 3QPVA 4A0FA 3WIVA 1BNCA 4I2NA 2WW8A 1LK7A 3PCRB 4I3HA 1BX1A 2QLJA 1UK7A 5JY6A 2JKYA 3G8YA 1ZK4A 5C8VA 1H69A 1RCFA 1KP2A 4L78A 4XW2A 3H97A 3I34X 4OPOA 3DFZA 5CB4A 1K75A 1V7ZA 4IGIA 4FBGA 1ICIA 4YWJA 3V6LA 2POCA 1U0JA 3T99A 3IS3A 4NAUA 4GEKA 4L5IA 4BO8A 5D5HA 3BXGA 2AVNA 4KVZA 4NVRA 3W1VA 2IXDA 2Y0EA 2ZTGA 5AOBA 1VA5A 3L0DA 4AROA 2XTMA 4K9QA 2NZUG 2QPLA 4WWHA 3W34A 1D9ZA 3O3CA 4YRIA 4LNAA 4AKHA 5IVDA 4A6DA 1MOQA 4IX9A 4LXQA 4DLKA 2K7FA 4NYJQ 4FQ7A 1M1ZA 4C0LA 3VTAA 4D0LB 5HTOA 4CEJB 4FE7A 4DFDA 2BKAA 3D8TA 2GNAA 3Q7TA 4MWDA 2A0FA 4OLHA 5LC1A 3SXUB 2Q5OA 2IEYA 5I47A 4IV5A 3KQQA 1HFWA 4CF7A 4I4IA 2I1QA 1QIDA 3QQPA 1BE6A 2I03A 3JQEA 3LMKA 3RAJA 3WL7A 1EUQA 4B09A 2IGBA 1HETA 4IDGA 4R1QA 1KPGA 2D7DA 3IXMA 3QVOA 5G2OA 1SCUB 4B5KA 4AF7A 2Z08A 4FYVA 1UBTS 2VZ9A 4OI1A 2ZW9A 1UAAA 2PRYA 4G37A 1V35A 5JCZA 3L4KA 5DN9A 4J1TA 3FSGA 3U6KA 2W48A 5KUTA 1U0HC 2JNWA 3OLQA 5EKUA 2HA5A 3D1JA 2RCYA 2PZ8A 4BMZA 4E5UA 1B2LA 1NSFA 2BMAA 2VJNA 3G68A 2VRCA 3UJAA 4ZOEA 4C5CA 3ZDBA 3NHSA 3N39C 5I45A 2GYVA 4PV7A 3EXHB 1E2QA 1EDZA 4DJEC 3GQBA 3DTTA 3R6JA 2FI1A 3GT0A 1JWAB 2JFYA 4B81A 1DDGA 4QDUA 4JB3A 3T0GA 4AG5A 3MEQA 5BSYA 1G18A 4BQSA 3Q8LA 3VR3D 2B4QA 1Y0BA 3ZY6A 2E9SA 3FNIA 4PCAA 4AKEA 3SJPA 1JEQB 3ZX5A 1B6RA 2IQ5A 4B4OA 3LC2O 4P4SB 4Q18A 1QMPA 1YQ9A 3BFPA 4OKSA 2NUTA 3ILVA 2FDXA 5B58T 3R75A 4UPDA 3WB9A 4ERNA 3FOEC 3N2KB 1FP4B 1G8AA 3IPAA 5HA5A 2PS0A 2YCBA 3IPLA 3PT5A 3RRJA 4CF5A 5LKRA 3IBCA 1GITA 4UE3S 2JAUA 2QUBA 4HTAA 4Y2VA 4MVJH 4RHCA 2PUAA 3COYA 1JMYA 2OAEA 2VTKA 3LAWA 4NPHA 4FMDF 3BZUA 2HCJB 3OZWA 4QX6A 4CM3A 2IPOA 1FSZA 5BURA 3CONA 4WUVA 2IBTA 2B36A 2WHQA 3WIDA 1HA3A 4UM5A 2P30A 2HHJA 1UXJA 4XYEA 2DCUA 4XGKA 3WA7A 3CF0A 4WW0A 3QBVA 1Z4LA 3RVMA 3HZZA 3HVRA 3D6HA 1VYTA 1E0AA 3GMSA 4TTTS 3FYTA 3U48A 4HQ0A 1GNQA 5KQPA 2ZREA 2NV6A 1NMXA 3KJFA 4XQ0A 6AT1A 4K26A 3OM9A 4P7BA 1I4TD 1V16A 5BUZA 1ZD2P 3Q8XB 3TTTA 1J5XA 2Y27A 5K4AA 2Q1SA 1G8PA 1WCYA 1BVUA 3GVPA 3MTIA 5F77A 2J0SA 3KR0A 3K8OE 3ZKWA 1IULA 2BC9A 2P4QA 5DT9A 3IHKA 2H8KA 4DDTA 5IF3A 5K4GA 2BGGA 4F92B 1JJFA 1SZPA 2C4NA 4GPTA 3E5MA 4E88A 4IFIA 2ZANA 1NKVA 2BBOA 4U2FA 1LSSA 1ZL0A 2VP9A 2Y67A 3RU7A 5BNZA 2FRXA 4GKBA 1A7KA 1P5FA 5T5QA 3RD5A 1RRKA 5A3VA 1ZUWA 3LY9A 1YRLA 3UMFA 1QK5A 2O3TA 1UXIA 3GLHE 1TF2A 2B1JA 3AQ4A 4UAUA 2X85A 2KPOA 5IC6A 2N9UA 2B94A 1I2CA 1N08A 3C98A 1ZJWA 4AKGA 3HUFA 4IGFA 4IHQA 3AM3A 4Q15A 4TXJA 5FTMA 3R7AA 5A4DA 4JJ6A 2BISA 3DPUA 3I4LA 4IZOA 1G2PA 1K3UB 3BMCB 3FZEA 1SWVA 3BMOA 2OV6A 4Q1BA 2Q49A 2UXCB 3LT1A 1ABFA 1KY2A 1V9LA 1RMTA 1WCXA 3A7DA 2GBPA 1CR0A 3UAWA 2UVPA 4IDCA 4C7BA 1GY8A 2D0OB 1AU9A 3DF9A 3H0EA 5KNDH 1QYDA 5G3ZA 2RHHA 1Z74A 3WSVA 4M7OA 3B7PA 3WLMA 2WA2A 4HADA 2IYSA 4PAMA 1KK3A 1G9XA 4R6XA 3ZDZB 5CA1F 3QWHA 1YRQA 1KK0A 1PI3A 2E4UA 2ZSFA 1EYZA 3DZ8A 3KQVA 2P6PA 3NI2A 3ZX4A 4OH7A 4EO4A 3CPEA 3VMMA 3AVYA 4OOSA 2W2KB 3B51X 4PAOA 2GN0A 4W5RA 4RD1A 4FYIA 1QK3A 4J6EA 4Z9FA 5FBKA 3RVLA 3S27A 4E51A 3EA4A 4L3WA 1FUKA 4D9BA 4ER6A 2I6QA 1U7DA 4M8SA 4NOMA 4YRLA 1WDKA 3FCSB 3A35A 3BSSA 3SC3A 1JZSA 4M86A 4BRUA 5JS6A 3HO1A 2AQKA 2VBSA 1BJKA 4CCWA 1B0AA 1HLPA 2I87A 2W2VA 5EWLB 721PA 3K35A 1YZTA 5HFAA 3OBIA 1BW9A 3N2GA 3P20A 1E1QD 3K0FA 1QFMA 4O1HA 4TM7A 3D2AA 2G9ZA 2WICA 3EGOA 4NMXB 5K8JB 4OHFA 1TO2E 1GZDA 2G6BA 2JW5A 4J49A 4OEHA 1H6BA 3L06A 2RDMA 1Z4JA 4HDKB 5LP1A 1E3ZA 1T36B 2A1UB 4KPUB 5JVDA 3O31A 1VQOB 1CUYA 4CJXA 4FKMA 1Z37A 1UEIA 2HM7A 2HRCA 3RC8A 1FVOA 5D84A 1KZ1A 5ENZA 1IHYA 3OEHA 1JI0A 2I3ZA 5CVDA 4BKUA 1UEJA 5EY5B 2BDEA 3ANYB 3HC7A 4B74A 3OD1A 5EXXA 5C7YA 3OJCA 4XSVA 3H5IA 3D3QA 1HG0A 2V7QD 1I7NA 3FNHA 1ZICA 4TXNA 1X86B 3QF4A 4XUEA 5D7NA 2WJAA 5SZHB 4FXOA 3U7EB 3JD3A 1DAGA 3Q9NA 1TYZA 4AMUA 3NOVA 2BTOA 4G1FA 3ANMA 3MERA 4HLUA 4LYHA 4WLEA 1J7KA 1LLFA 1G2OA 2IYUA 2ZS9A 3L7CA 1DJQA 1U3CA 3R3ZA 4B8WA 4CLHA 2C54A 4WKPA 3EPKA 4AT1A 4QQ8A 1NKTA 2NZ2A 4D1YA 2CLOB 4NJEA 3SXJA 2DLNA 2Y1WA 5JR3A 2XUKA 1GJRA 4CIBA 2EBFX 2QZ4A 1AHHA 3TB6A 4RCZA 1TM7E 4U2BA 1S7GA 3QPCA 4CODB 4X00A 2IYAA 1VL1A 3LA6A 1QHEA 2WDPA 3HU3A 1PWEA 2Q5FA 4I4TF 4MW4A 3RREA 3SEZA 4CMAA 3LT5A 4YCNA 2G9VA 1DBQA 3S2GA 3H4IA 4QARA 3DOOA 1LSOA 2VDVE 2ZRHA 4C30A 1F8GA 1U5BB 2IKSA 1RRCA 1X7HA 5E6SB 3I2GA 4NV3A 1WUIS 4RS4A 2G88A 2ZE5A 2RHDA 4JJ7A 4IZ6A 1B76A 4QHSA 3G5AA 4CG0A 1DRKA 1YU9A 3NH9A 1DAOA 2JARA 1FDRA 1FP7A 3MFYA 2HJVA 3UV3A 3OJWA 1Z26A 4H15A 2LP4Y 4RO0A 4G2TA 2H2FA 3GVJA 3GLGA 1DAPA 2H4ZA 2NADA 2PSHA 1XG5A 1XP8A 1SXJD 2EZ9A 4XD7A 1EK0A 5BW6B 4EKGA 3QENA 2QENA 1BYIA 4ZALA 4YONB 1K9MD 1TUGA 3FVRA 3TIIA 2VSQA 1UJBA 3KEMA 5B5SA 3LY7A 4PNPA 2ZXUA 2PQ2A 2UKDA 1ZEJA 4MR8B 2F48A 1QLHA 1RXUA 4L75A 1O87A 1C1DA 3V4SA 3VRHA 4F3CA 3L0ZA 1J39A 2HA6A 1MXHA 3AL3A 1XVAA 4IXMA 1TLLA 3KDAA 1XLWA 4EJ0A 3TLEA 3B6EA 1EFRD 2NSDA 3GJ0A 5JBQA 3KB6A 2X8WA 4TTRA 2R0QC 1N6OA 3FFBA 2VCYA 3ZWAA 4EG3A 2VHEA 3O2SB 3HCPA 2VUUA 3T95A 1VMEA 2PX5A 1XL0A 1STOA 2P9BA 4PF1A 4QYMA 2X9GA 3GNLA 1TU3A 1CZOA 1E1RD 2UVQA 3ZXYA 4HJXA 1L7RA 3KT0A 4M88A 1M7BA 3E9ZA 1R4MA 3QVKA 3WLQA 3M9LA 4MS3A 1NN0A 1NVVQ 2DKFA 1JHUA 1KK2A 2W7TA 4IDEA 4HXEB 4KQKA 5I6DA 3UA3A 3VTFA 1ODKA 1XFDA 2O8VA 2AG1A 4FX2A 4HQRA 4F6RA 4ARAA 4UHJA 3MWFA 1OYVA 3D1VA 2JFQA 1LLDA 2QTRA 3EXHC 2ZRLA 2BZ0A 3ZTYA 1JKFA 1Z7BA 1VQ8B 3I9FA 1Z7GA 7ADHA 5AMXA 1I14A 3GZNA 3M82A 5PGMA 2G7MC 3FKJA 4FN4A 3RHSA 1Q50A 3RTBA 2Q8QA 4O2AA 1COWD 1MTZA 3ZNQA 5KYWB 4JYZA 3ZHVA 3KWMA 1EWKA 1FUIA 3F1KA 3CA8A 4Z3KA 3F2VA 2UU9B 1QNLA 1N5MA 3KEWA 4YMUA 5JD6A 4JC0A 5LKAA 1KA9H 1BE1A 1KS2A 2YY5A 4P98A 5IAOA 2AYXA 3OPOA 4ZCLA 1EEXB 1FMTA 3PKJA 2EAUA 2OCLA 4DQUA 3IHLA 2P2DA 6LDHA 3COSA 3NGLA 2H2IA 1FDSA 5EERA 4DG8A 5A02A 3I92A 1D0VA 3O2NA 3OOJA 1WXGA 3WGYA 1XWIA 3CCJB 1H22A 3PPXA 3QPBA 1RHRA 2PXCA 3IIIA 2B4AA 2BEJA 4Q48A 3QKSA 3GAMA 3PJDA 1B3RA 1E2FA 2FUG1 3TRJA 3V97A 1E5XA 2YS6A 3EGDA 3U39A 1A5ZA 5I9NA 1JQAA 2FX3A 1A9OA 5JZVA 1JR6A 1AKRA 2VC2B 2F1LA 2ZRGA 1VQMB 2P41A 5G0SA 1PFKA 1S4MA 2FEPA 4XGRA 4Y6GB 4B5LA 1XEWY 4H7FA 3TAUA 3MXOA 4GPEA 3TPFA 1T10A 2AHRA 1REQB 3GEMA 5CH3A 3CU5A 4RXTA 3FCOA 1XPRA 1OGYA 3R7LA 3VOAA 3OP1A 3ZHRA 2QP9X 3OSUA 1I2BA 4A2PA 1LWNA 3O8NA 3KETA 2RSLA 1NULA 1KMCA 1CUSA 1HQYE 1VJCA 4P6YA 3I0ZA 3RVRA 4BY9E 2Q4BA 1K3FA 1O6FA 3AFNA 4YRPA 1O95A 2JCSA 1YB2A 3V4FA 1YNSA 5E2IA 1LS6A 2FY8A 5FTKA 4C6HA 4EYKA 5BXYA 3G1UA 4JQYA 5B4UA 3KTAB 3ILSA 4N18A 1E3EA 5C1IA 2DHRA 1R4ZA 4GBMA 5A5GA 4UAGA 4IMRA 3HO6A 1Q83A 1YZYA 1O8BA 1D1SA 2VJCA 4DHWA 3O3OB 5CYPA 5LWHA 3TPZA 3W6OA 1B16A 1IONA 1X3LA 4ND3A 1DKOA 1GKKA 3UHPA 3UWSA