3W5UA

Cross-linked complex between ferredoxin and ferredoxin-nadp+ reductase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
296
structure length
296
Chain Sequence
CSKKQEEGVVTNLYKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGKIPYREGQSIGVIADGVDKNGKPHKVRLYSIASSAIGDFGDSKTVSLCVKRLIYTNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSLAEKDGIDWFDYKKQLKRGDQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Concentration-dependent oligomerization of cross-linked complexes between ferredoxin and ferredoxin-NADP(+) reductase
pubmed doi rcsb
source organism Zea mays
molecule tags Electron transport
molecule keywords Ferredoxin
total genus 97
structure length 296
sequence length 296
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w5uA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w5uA02
2YWGA 4TMZA 3P26A 4QHYA 1GR1A 2EFGA 4P6VF 2EIXA 1AIPA 1DDGA 3MHPA 1B23P 3WY9A 1VQNB 4R71A 4ACAA 3QFCA 1GJRA 2FX3A 5HXBA 1QVGB 2RC5A 1G7SA 3CRZA 3CCUB 4F7DA 1YJWB 1QFYA 1VQ5B 1H85A 2PLFA 3OZVA 3B78A 4Y7CA 4FK8A 2QTLA 2VZLA 4M2LA 4ZGQB 4B43A 4B47A 3SJZA 4RD0A 2NPFA 4DQLA 3CD6B 1B2RA 2QMUA 2BSAA 1Q7YD 4LBZA 2VYQA 4RCZA 4Y9UA 3VNVA 1KK2A 2HCJB 1EXMA 4M1KA 1AMOA 2J7KA 4NBSA 4AF7A 2YWHA 3W2GA 4AF6A 1CNEA 5FA6A 1IB0A 1EP1B 5KSWB 2OTLB 3LYUA 1FRQA 1GVHA 4B44A 2QN6A 4TN1A 3CCSB 4PC7A 4M0LA 4G5GA 3OW2B 1KK1A 3AVXA 2QA4B 1OB5A 2QEXB 3W5VA 4RCYA 1JA0A 4ZCMA 2BMWA 1H42A 2E1RA 3A1FA 1G7CA 3B8HA 3QE2A 2YWFA 1TUIA 1XE1A 1D8TA 1W35A 3AVWA 3LO8A 3QFSA 2CNDA 2D74A 3CCJB 1EWYA 1FNBA 2XNCA 3CCEB 5THXA 4RD4A 3CCQB 1E64A 1K8AD 1G7TA 4PC1A 1KRHA 4MYUA 1OGIA 4ZV4A 1VQOB 4MYTA 4U9UA 1M90D 1DDIA 1FDRA 1R5BA 3CMAB 1KD1D 4RJLA 2HDNB 1NDHA 2B5OA 3QFTA 1JNYA 3W2EA 2VNIA 4ZGNB 1N0UA 2YWEA 3CC2B 1FNDA 4RD3A 4TMWA 1W34A 3WBKA 1QGYA 1VQ6B 4YAUA 2CRVA 3OJXA 4B3XA 1VQMB 3CCVB 1Q81D 4RD1A 1YHQB 1J9ZA 1ZUNB 2ZITA 1QFJA 4DQKA 2B7BA 3ZZUA 4WQMA 4ZCIA 1KJZA 4Y9RA 1VQ9B 1TLLA 1VQKB 1FNCA 4PC6A 1VQPB 1GAWA 3CMEB 3V76A 3ZZTA 3JQRA 1YJNB 2DEUA 5H59A 1K73D 4TMTA 2QTZA 1EFTA 1TVCA 2HMAA 2X3UA 4G1BA 4FN5A 3VNUA 1FNMA 1BX1A 3MMPA 4PC2A 3CCRB 1EFCA 4YHBA 1QGZA 3U6KA 3WNDA 3ZBUA 1F20A 1QH0A 2BM1A 4B48A 2VNHA 3CW2A 4Q7JB 4LBWA 3CXCB 5H5JA 5GV7A 1GAQA 3ZBTA 1JA1A 1KTVA 3W2HA 4ZCLA 1D1NA 1QFZA 4G1VA 2BF4A 3AVUA 4YAWA 1XB2A 3CCMB 3ES9A 1EP3B 1Q86D 1JB9A 1QG0A 1WDTA 1YI2B 1YIJB 2B7CA 3WNCA 1OB2A 1ELOA 1UMKA 1Q82D 4UAJA 1BQEA 3WXMA 4B4DA 5GV8A 3WYAA 1TTTA 3CCLB 1N8RD 1QX4A 4TMVA 1R5OA 3ZZ0A 1ZM2A 1KK0A 5TY0A 4HE5A 4IW3B 4EH1A 3FJOA 5TR9A 1QUFA 3P27A 4M53A 3W5UA 3G71B 1IJFA 1KC8D 4HE6A 2PIAA 1QVFB 5TV2A 2BM0A 3CC4B 3WBJA 1A8PA 1BX0A 1W2BB 2GPJA 3AGQA 3I1FA 1ZM3A 1SKQA 1E62A 3CB4A 1R5NA 1KK3A 4NCNA 4PC3A 1YJ9B 4AC9A 3VO1A 5JBQA 1EP2B 1VQ8B 4RD2A 2DCUA 1GO2A 3QSYA 4N3GA 3CC7B 2RC6A 3U6BA 3E20A 1F60A 4LBVA 1QUEA 2DETA 2PMDA 4YAOA 3ZC3A 2BV3A 2XNJA 1ZM9A 1K9MD 3OZUA 3B82A 4C43A 3G4SB 1VQLB 4P3YA 2C77A 2OK7A 2BVNA 2XEXA 1I7PA 3JQQA 1OGJA 3OZWA 1EFUA 3QFRA 2VNKA 2OTJB 3I55B 4YAFA 3LVBA 1YITB 2C78A 1JJ2B 2BN4A 1S72B 2QDXA 3U2QA 1G7RA 5EMNA 3AVYA 1CQXA 4N3NA 3LRXA 5DSZA 4TMXA 4PGOA 3G6EB 1SM4A 3I56B 5AN9A 1S0UA 3VO2A 4LC0A 2BGJA 1D2EA 4J0QA 3OJWA 4RD6A 4C0SA 2AHOA 1VQ7B 4BPRA 3AVTA 1IJEA 2DY1A 1KQSB 3MCAA 3E1YE 3PENA 4H9GA 3AVVA 2OK8A 4FWTA 4YALA 3J81k 1E63A 3W5HA 2DERA 1U2RA 1ZM4A 3VMFA 2BPOA 1CNFA 4QFMA 3W2FA 3AGPA 1FRNA 2R6HA 4ACBA 1DARA 2GQFA 1W87A 1QGAA 3CPWB 3JQPA 1N0VC 3FPKA 4LBYA 4K1XA 3W2IA 1DG1G 1HA3A 4M4SA 3WNBA 1M1KD 2VNJA 1BJKA 1NJID 2BGIA 1VQ4B
chains in the Genus database with same CATH superfamily
2W2LD 5EINA 2NZYA 3L8EA 3WLLA 4D45A 2UYGA 1GGMA 3BOSA 2OZKA 5IAGA 4QHYA 5H3CA 1SOAA 4DVJA 1J2RA 1R9NA 2PKXA 5LC1A 3TAUA 2F1KA 5A89A 1WZEA 1IPEA 5BRJA 3O0TA 4LE2A 1VL0A 2A86A 4MYSA 3BQ9A 1TMOA 3EUAA 4XEUA 1ESEA 3A9UA 1T9GS 1LPNA 2CCKA 1YMQA 5EJ6A 1CY8A 3NVDA 3BJZA 5E95A 1VRVA 3ZDAA 1Y63A 2ADFA 3EY9A 3RHTA 5IDVA 3RWOA 1XWFA 3OEEA 1C81A 2FX3A 1FUKA 4KUHA 4TLEA 1RBQA 1T4BA 1MX3A 4M1ZA 3NHLA 2OV4A 3OT1A 1G7SA 2OCBA 1EXNA 1FSZA 3OM1A 4G1UC 4OHVA 2FGKA 3JD3A 5JYDA 3EPLA 1DJPA 3UUGA 3CCUB 5AHXA 3KWFA 5DP1A 1P4AA 2R7KA 5E1OA 2D00A 4Q7QA 4TMKA 3NAGA 3ZE2B 5AVUA 4HLCA 3LVQE 3F4LA 4R3NA 4KDEA 5C8VA 3PLNA 2Z9BA 3IPLA 1JXOA 1SK9A 2ODQA 3BHNA 5TPZD 7AT1A 3WP0A 1Z4PX 4QTYA 1QU2A 3THXA 2SICE 2F1JA 3HN2A 4L5BA 3C5WP 1H1LB 3KL2A 4ALIA 1F06A 3QW4B 5I8ZA 1JFFB 1NQVA 3NHMA 3C5EA 2PZGA 4FK8A 4MUXA 3EISA 4X61A 4J0GA 1PG0A 4WCFC 4ZO7A 4J4HA 4M0UA 3K2IA 3L7LA 3ISXA 1EXDA 2YASA 4FOLA 1NV8A 5LZ2A 1TM1E 4ML3A 3D6MA 4B82A 1JG2A 1Q7YD 5AW3A 2OAGA 1ZICA 4FSDA 2QJRA 1Q7GA 1U3CA 1XALA 3ML1A 4FD2A 4K6CA 4ERNA 2PRJA 1WLSA 3T41A 2XCTB 2DR0A 1LCIA 3F6YA 2GAIA 3I53A 2Q8NA 3DE3X 2P1RA 1KJWA 3KJIA 1KK2A 3N2LA 4IWXA 3FVQA 3TR0A 1SG6A 2ZI7A 3MCUA 4IXTA 2V7QA 1HMPA 3AXTA 4I55F 2VDRB 3IKTA 3DNMA 3SGLA 3EAGA 1A72A 1DFGA 3ICPA 4EX7A 1D2AA 5IXYA 1CNEA 3SEJA 1Z0IA 1JMVA 4XJVA 1QP4A 4OXXA 1UDBA 4P25A 1JUDA 5JO9A 1GTRA 4FWBA 5HUJA 5FX2A 2V9CA 1KDZA 1H9CA 1CVRA 1T2DA 2WV7A 5FPPA 4IG9A 2O8DB 3PPVA 1NP6A 3GI1A 5DGXA 4B2YA 1H8ED 1E6WA 1P2DA 3AEUB 3MRVA 4ZRDA 2JARA 3LOPA 1SUCA 4FFOA 4ATNA 1JQLB 2BGTA 4KO1S 2XUPA 4I8DA 4L9RA 2IHTA 1TCUA 3QM1A 3RSSA 5JXIA 1S2MA 4EA6A 5DBHX 1QK5A 2LTAA 2PZAA 4Z7QB 3R0QA 3UJ7A 3DZIA 4NCXA 2HUPA 3IDAA 4IIXA 4XM0A 4DLVA 2HBYA 3EBPA 2PV7A 3D3QA 2XMBA 3Q7QA 2WOOA 3HFJA 3M6AA 4NSNA 1Q95A 4HTFB 3TUIC 5K0FA 4JVLA 2ZKLA 3I9NA 1USKA 1PFWA 2AQIA 2WM8A 1ISPA 3I2YX 4JYMA 4NPAA 5AOCA 2JAHA 1EBFA 3UEOA 3U7QB 2FUNB 5B4TA 2ZK7A 3F96A 3ADPA 4D6XA 5JDIC 3I01M 3L6RA 2QEXB 3QW2A 2M1ZA 1WCIB 4H17A 2POCA 2B92A 1DSSG 4S1WA 1WEHA 3V1KA 4K81B 3K9QO 1NVGA 3A6FA 5I9LA 2WVAA 1G4UR 2WB2A 1E2MA 1LB1B 2R86A 3K2BA 1OHHD 1E0KA 3VZQA 4Q3DA 2F8TA 5GJBA 5JPIA 3LUFA 3OHMA 1OTXA 4X20A 4FFNA 3LZCA 5JSFA 3NBUA 4XOUA 1RT9A 1YI1A 4JR1A 3VYVA 2LKDA 1ZK3A 3SHQA 1E18A 1ISGA 2PZJA 2WB4A 4FX2A 4FOTA 1M76A 4P4GA 1QQBA 1K68A 1T8RA 1K8RA 3IOCA 4CDGA 1NPTO 3AG5A 5HR5A 1YS1X 1LRJA 2CL5A 1ZJYA 3UT5A 2IE0A 3G89A 4ZVTA 3OZSA 1KS9A 3DE6X 1VC2A 1NB9A 1XZJA 4ROXA 1LNQA 2OCYC 2R5WA 1VZ2A 3TCXB 3WAKA 1ZSVA 3TKAA 1XZNA 1YCGA 1I4WA 1MV5A 2VP6A 2YYAA 3DE0X 1KDOA 3MS4A 2IPMA 1KRHA 1IUOA 3TIXB 5D51S 3HMQA 4MVJE 1WXIA 5I5GA 5IVIA 3HBJA 4MQFA 4ZOAA 5K0JA 3CRQA 2ODPA 4Z4EA 1NJ8A 3MWEA 1JT9A 2P4SA 1JSLA 1HT1E 2HR1A 1EDEA 5EC8A 3BC1A 3KO8A 3ENVA 1EWRA 2QHXA 5KHLB 1OIVA 3NH9A 2BEUB 3HZHA 4L5AA 3VUFA 4BCDA 2GHQA 2YWCA 1N4DA 3H87A 4JLDA 5EJ9A 2VAVA 3OO1A 1KYYA 4WKPA 4CG1A 1LRKA 1P44A 2IUTA 4Q34A 4M8KA 1UKAA 1NBMA 4FGLA 1YJBA 1JJAA 3K0BA 4XR9A 1XCBA 3K4QA 5CVTA 3VSDA 4LY3A 5TARA 1H2HA 4QJ3A 4PAMA 1OBHA 2EX0A 3Q0EA 3HR8A 1BCSB 5LA6B 3NPAA 2I2DA 3EASA 3U4IA 5DF1A 4IDFA 4J1TA 2O8VA 3FSGA 3I73A 4M7PA 5FUWA 4B34A 2GVZC 5ALDA 4KO8A 2I67A 3KZMA 3TM5A 4FBMA 1MT3A 3FH0A 5DTQA 1X1CA 2QRQA 2I03A 3SZMA 2GYUA 3H1GA 1RYDA 1Y7TA 1ZPDA 1IEWA 2MSEB 2E5WA 2NUBA 2WT4A 3LX5A 2GUWA 1T5HX 4P4TA 4XNFA 3SYMA 1PQUA 3WRXA 3CMMA 4QBKA 1M2OA 1ORWA 3K20A 1Q81D 4KGDA 2REQA 4NENB 1RWMA 2Q4BA 2H1CA 2QAGC 4IHJF 2P3QA 5ITWA 3MEQA 4L8WB 1W96A 4XSGA 2ZTGA 3GJYA 1E9AA 1FFHA 4HX5A 5KJEA 1DELA 1GCUA 3JD1A 1RM0A 8ATCA 1FVOA 1KP9A 2AOUB 2ECQA 3FGOA 1QTNA 3FD8A 4G7XA 2O4CA 1LGYA 1Q91A 2LW7A 4FIDA 4JCCA 5EIWA 5CJJA 2AG5A 1FFXB 1RIIA 2WNIA 2UU9B 2O2CA 1J0BA 4FXPA 4I1YA 5EI5A 1T5SA 13PKA 1AKRA 2P4QA 3ZGXA 1KRWA 3DC7A 5IJWA 1L7EA 4EO7A 2G9NA 5H59A 1XZQA 4FI3C 3QYPA 2Q8QA 1JDNA 4LHXA 2OCKA 4N9WA 2X40A 1IUKA 3LTNC 1U28A 2J9FB 2DHCA 4WOKA 4X90A 2HMAA 4DNOA 2J5RA 3CWQA 3VR4A 1IPHA 1D2CA 2JJ8A 4FN5A 4LSMA 5DH9A 1II8A 2G04A 4HH3C 1EX7A 1IM2A 1H66A 1CK4A 1OX4B 1S96A 1Z9BA 4TKLA 1JFVA 3MJDA 2BONA 2F3TA 5AJYA 2QTWB 3BRCA 1CG6A 3RSQA 4A3SA 3OF5A 4YMWA 2PUFA 5EZSA 1GZ6A 4FYIA 4XCXA 2HWYA 3QELB 3O93A 2P3SA 1QIGA 1RZUA 1Q7TA 3PXBA 1PX0A 4XQGA 4XIGS 1HZJA 1HRKA 3EXHA 3LYLA 1CJSA 3VZPA 3OKCA 1SOWA 1VBFA 2AC7A 1DBRA 1QV7A 2LV8A 2VUIB 3CQ9A 1TC2A 3ME5A 2HTEA 1HLGA 1RW4A 3AJEA 4H27A 4K6FA 2Z5FA 5L4NA 4X94A 4POOA 5JAPA 2IXGA 4B4UA 1FQOA 4MXDA 2AS0A 2ZZMA 2YWRA 2PRZA 4INAA 8AT1A 4PZEA 2HW8A 1DI0A 4PLZA 1T2VA 1GAQA 2CDAA 3CNBA 5CEEA 3GGSA 4G89A 3QHAA 4J7UA 5IWCA 2QTHA 1K5GA 1EVYA 3NWEA 5F98A 1O95C 4DRXB 4XLEA 1WUIS 4HZUA 5HUHA 5E4FA 1U3UA 1KMQA 3E4DA 4CM9A 3MJFA 1XG5A 1H3NA 4DYVA 5LKRA 1M10A 1ZCBA 1QE0A 2FK8A 3URMA 3I39X 3RVDA 4X5OA 3TD2A 5E6RA 1WDTA 2VHUA 2Q5JA 4IIJA 4IS2A 4CT0A 5B7PA 5JXWA 4LF5B 1MP0A 4MR9B 3ITEA 5EPOA 1EUZA 3ASSA 2JPDA 1Q1BA 1OFIA 1B4DA 5EXTA 3ZV3A 2A94A 1E3XA 3BMNA 3CKMA 4IIDA 2HT1A 5IYZF 3MUEA 5B37A 1AK9A 3GMIA 2X5XA 2QZ4A 5FKJA 1MC4A 4TL7A 1M8FA 1UMCB 3NX4A 3OX2A 5GAJA 1NWCA 4TMVA 4PAGA 5M5BA 3L04A 1U7ZA 1OZAA 2C58A 2VPPA 1R0LA 1OX4A 1ZM2A 3TL6A 4D9NA 3EXFB 1ZU5A 4F1WA 1P2FA 3RK4A 3CUSA 4UBIA 3DHWC 1T5EA 3VYRB 5CG2A 1NMSA 3D8SA 1W2HA 3F3MA 1ZHHA 1B76A 2FZWA 3G0BA 2GWRA 4P08A 2WSMA 3QVSA 4Y2JA 3SP1A 2WU1A 1YB1A 2HBQA 2PIAA 2D6FA 3CLSC 4QEDA 2PR7A 2J85A 4GG1A 5C3UA 2IU4A 2ZETA 2IH2A 2H11A 4R2LA 4MDYA 1Q84A 3T1QA 1C4KA 5EZ5A 2C2HA 5EYPB 2EBHX 3F9IA 5K4HA 4OX9Y 4CMCA 4EKGA 2D7JA 3VPXA 4Z4TA 1IULA 2JIPA 1UIMA 2ZW9A 421PA 3HCCA 3FIUA 1O03A 4Y2TA 3EVTA 3SC2B 3C1TA 3CPEA 5K8LA 2WTXA 4D0SA 4ZT7A 1TW3A 2C2MA 5CYPA 3NJRA 1S2GA 2H17A 2FW9A 1IZ0A 2JFFA 1JJBA 4NBKA 5EERA 3GLUA 3PGXA 1MX9A 5F2OA 1SVLA 3IX7A 5G2OA 1WG8A 3OLVA 4EG0A 1QV9A 1O6BA 3M2PA 3PL5A 1YBFA 2ODBA 2OZVA 3U4QA 1MAVA 4QBGB 1NXSA 1T6NA 2DGDA 2PG3A 5BVGB 2RGXA 1YR3A 1WCIA 4RH0A 1L4FA 2OUKA 1RD4A 3STYA 3TZHA 1T5BA 1LWOA 1YSCA 3TTVA 3W0LB 4EB6B 4YB8A 5JRDS 3PX7A 5E38A 4LMRA 1ECLA 5B4VA 3NGMA 3X1XA 1Z35A 2J9RA 3HKDB 5EQJB 4EL0A 4U7TB 4DJTA 5JSKA 1J56A 2R4UA 1NBMD 2E55A 4TRNA 2W42A 4HNGA 4DUZB 3BF7A 1IEXA 1E4EA 3FFBA 2GJRA 1T2EA 1WQ4A 1WTCA 3WADA 3HA7A 2G76A 3PHJA 4GI5A 4MA4A 1E2DA 2RC6A 3IODA 3NHZA 3QP9A 3E2PA 4LBVA 2DHEA 4MR8B 4BECA 5B2EA 1XJWA 5JC8A 3LL7A 2Z8YM 3ETEA 4LYHA 1XTQA 3RUIA 4EW1A 4YJ2B 5KTKA 5CCDA 1JIVA 4UMEA 4TGLA 2EEZA 2J3LA 4N18A 2NUPA 4PBRA 2XBLA 4L3VA 5F77A 2VA8A 3V8MA 2WHEA 1WXHA 4KAXA 4DNXA 5JI2E 5JZ9A 3TZLA 4ADSG 2AZ4A 3LFTA 2I7VA 4CU5A 2VQ3A 3L7MA 4IM7A 4DT1A 1ZBDA 2REOA 1ZBQA 4INJA 2FSVA 1YDFA 4IHKA 3LA8A 2C5GA 3KEQA 2X86A 3OQPA 3E3AA 2ES4A 2WTUA 4IAOA 3C39A 4QQ8A 3TECE 2CDNA 5E6UB 4CFSA 1SKBA 1NVKA 3MUOA 1QQTA 1G98A 2GCEA 3D3EA 3A1EA 2DBRA 3H9UA 4YCJA 2W8BA 4B3IA 1KBZA 4JT9A 3TGWA 1OROA 2GK4A 3LKBA 5HQTA 1S72B 5JD5A 3UOWA 3QWBA 5GJVC 3VOAA 3TCNA 3DG9A 1YBHA 4BMCA 1Z7YA 2J87A 3FG9A 3H5AA 3UYKA 4OX9B 1W93A 1MXHA 3CBGA 2PEZA 2E4AA 3NGXA 4B8WA 1AGRA 3EVDA 2IYOA 2WPNA 5IZCA 3NRCA 3RYCB 5A6SA 1ZO8A 4TYYA 4YBZA 3TVDA 3QKRB 4BWGA 1B1AA 2KBEA 4I19A 4JBHA 1JV2B 3TQQA 5ALVA 2C61A 1MU0A 1JDPA 3BXGA 3EIWA 2I4RA 3T9CA 2BHLA 2ZJ2A 2O7RA 4EGFA 1G8HA 4DC9A 5JIBA 1WL8A 4QWWA 3N05A 4I4NA 5GONB 1XZPA 2P2NA 1FUEA 2HADA 1AZSC 1DBWA 4I0WB 2PTHA 3AEZA 4MKRA 2NSLA 3ASTA 2C88A 2VRCA 3C6MA 2D4AA 3EXEA 3GVIA 3OKFA 4I9NA 4ND5A 1U6IA 2O3JA 4U2GA 5A7HA 1XAIA 4DMKA 1GCIA 4PHCA 1GHTA 2RGRA 2VDNB 3OICA 1W0JA 4YMHA 1QHXA 1W76A 3RY8A 1E9SA 1V4VA 1K2VN 1Z5NA 4ZPXA 2QD1A 2GI4A 1PAUA 3ROQA 4QYMA 1FEZA 1FFCA 2RARA 1XMOB 1CPYA 3QXXA 2AG6A 5HZAA 7MHTA 3JQFC 2WJGA 4TUYB 4MEJA 1XD8A 4XYMA 5KOHA 4BP3A 3B60A 3UBTA 3L2OB 4FYXA 3TFWA 3A10A 3I4CA 5TVKA 4CMBA 1KC1A 1QFXA 1V1MB 1LF0A 1T8PA 3KEOA 4KMSA 2ZUDA 3LUBA 3JSAA 4LZJA 2R1TB 5CMLA 3V55A 2W90A 3RBXA 2GEBA 4BEBA 5K6TA 3QU7A 4BIMA 4REQA 2EIHA 3E53A 2WAMA 3WXBA 2GQFA 3DVAB 3REFA 4K9LA 3SAJA 1ZN2A 3I9V1 1YZUA 4ALNA 3FKJA 2GA8A 4F4JA 5BUZA 1A8SA 2BGKA 1V7ZA 2QU7A 4LV8B 4EHKA 1MG0A 4GH5A 4PYOA 2JJQA 3AR5A 3I4LA 5P21A 4ZCRA 5JV5A 1U8ZA 4ETWA 1BOOA 4M6WA 1X39A 3K70D 1NY5A 4NBNA 4PCUA 3WOVA 5LR6A 1A71A 2IZ7A 3DE2X 4KHPB 4MWSA 2WFLA 2WWHA 3ZLVA 5K0GA 5LP6B 2BGIA 5HE8A 3Q3AA 1SXJE 4LEIA 1L4MA 1UK6A 2EKLA 4BNDA 4ARBA 4G9GA 5CTJA 5DCYA 5JCJA 1AB5A 2OHFA 5KYTA 4Q93A 4G5HA 1K6XA 3EWNA 1LC3A 1M7GA 1G3MA 1DZIA 1UZLA 2A92A 3B1WA 3D4LA 4QYXA 3WL6A 4PHFA 1GZVA 1LPSA 1JSZA 2EERA 1M83A 2Y2VA 3MHPA 4BNKA 2Z09A 4JJAA 3DE1X 1VIDA 1WVMA 3E70C 3PE3A 1B42A 1BH2A 4UVDA 1ZJJA 4FIZA 3BG5A 4XJTA 3V33A 4WCFB 2J4FA 3SVTA 3HXQA 4EPVA 2WIAA 3K0KA 1N9KA 1P7PA 1WUTA 5CT4A 2ZI5A 1XQVA 2ISCA 2GK7A 3BJIC 1INLA 1JIXA 1GZ4A 3JQBC 3N07A 4Y6SA 3G2MA 3F7TA 2H48A 3HXKA 4BVEA 4EFKA 3V6LA 3IKVA 5GJCA 1D09A 4PLWA 1X1BA 4IQ8A 2KS6A 2VJMA 2O8FB 4H18A 4HGZA 4WLUA 4KE9A 5A4IS 4RBNA 1U9YA 4LQDA 5IKEA 4IP0A 1UZAA 4A8JC 1G66A 1YJWB 1M2OB 1OTYA 1ZMBA 3A32A 1ZUNA 1RRFA 4FYJA 4FZJA 5CDGA 1VLQA 5IEJA 1H65A 5ENDA 1I0LA 4JIMA 3LUKA 5LDDC 5KWIA 2JCXA 3ROZA 4MKZA 3PFHA 2QM0A 1CR2A 1Y6JA 3ABQB 4E1AA 2BKLA 4XX0B 4E5UA 1MB3A 3LVRE 4C14A 1FOEB 1GU0A 3QYAA 2DBQA 2RG1A 1JALA 3REOA 1UJ6A 2OHIA 3CA8A 3O3NB 3NHWA 1UD5A 4DQLA 1Z29A 3CD6B 4YJFB 3B6EA 4YCDA 3ISTA 1R8SA 3KBBA 1OOEA 5GPBA 3ZHVA 5A02A 2WWIA 2XNDA 3BHJA 3VV3A 1DC4A 4IZHA 5AK0A 5IT0A 3I9V6 2QY9A 2VYQA 1G5HA 1Y34E 1DEHA 3OJLA 4OBBA 3KG2A 1IOLA 4M37A 5TMDA 2YBEA 2HEGA 1SBQA 4MO9A 4LYFA 4YRTA 1DDOA 4TM8A 4UTVA 1UJMA 3I3SR 3MBIA 4I99A 1CUXA 3E3OA 4J49A 3LXUX 4C08A 2FPSA 1HSOA 2CJYA 2DFLA 4N5MA 4NBSA 3W2GA 3RC1A 4FDLA 4QEKA 4RFLA 5HFJA 3F1LA 4JB2A 4JLVA 2O8BA 2HHHB 3DH0A 1YL6A 4NZYA 5DVZA 3ZOKA 3QJ5A 5HMMA 4MVXA 4M49A 4DCCA 1P72A 4XVHA 1LD3A 4Q1DA 3ZDYB 3K9GA 3FZNA 3RFXA 3K9NA 4WT7A 2JJ2A 1YZKA 1UCFA 1VP3A 3GGCA 4MWEA 2WQ7A 1Q19A 4CGZA 1Z5WA 2QM7A 1Z0KA 3WO0A 1GYPA 4Q4AA 16PKA 5J2UB 2EGHA 3UVEA 3S28A 3WMXA 5KSOA 1C1XA 4JNKA 5AKIA 2DR3A 3L0SA 1K3UB 4RK0A 4WZAE 3T5CA 4AKTA 1BEUB 2AUNA 1Z6QA 5EWMB 4ZT3A 2QRHA 4TYPA 3BL6A 3SYNA 2WAYA 3BGSA 1ZK4A 1RI3A 3U9SA 2C99A 2XADA 1JU3A 1Y48E 3Q6IA 3ZCTA 4CL3A 2FSIA 5F73A 1CHDA 4BFLA 3VR5D 5BW5A 4A7PA 4CLDA 5C8DA 1BMFA 3SR4A 3IILA 3VISA 2QA4B 4D9KA 4RA6B 5BMVA 1SHTX 2Y1CA 1EG7A 1FMTA 1WE2A 1ZHFA 4KQ2A 4QDTA 2Z9DA 4FMCF 1WXFA 3NWJA 1X9HA 1Y8QB 4WLEA 3P0FA 2Z6VA 3QRWA 3G0OA 2XGOA 4RNDB 3UAZA 4ZI7B 2VS1A 4N7RA 5MGBA 4UAGA 5C2JB 1NULA 2H0RA 1W5SA 3FWPA 4IIJB 4UTOA 2ORVA 1C1DB 5DOVA 4ZV9A 1I94B 2C9BA 4UM9D 2XQJA 2GBPA 3E4CA 5FHQA 5DHUA 3UK1A 3P96A 4AZTA 3WAJA 4IOJA 4E15A 1D9XA 1VHTA 4UE3S 1WDWB 4G3XA 4J4BA 5DU2A 3WGNA 3U7IA 3NBQA 1GKKA 4Q1CA 1XQYA 3MCTA 1N33B 1BCRA 5CA1B 3ZDDA 2W48A 4BWYA 2R8EA 2WKPA 3M3PA 1SBCA 4Z3OA 1PTKA 4OQYA 4EEXA 10MHA 1UXKA 1Z3CA 4IGFA 1CS4C 1D8TA 4Q4LA 1C5KA 1HQYE 3LO8A 2GAJA 2O2DA 4OI4A 4D9MA 2Y27A 4IKPA 3PA2A 4XYLA 5AK5A 3E61A 4TSKA 3ZWDA 2IL1A 1CUSA 3V4ZA 3TW8B 3D7KA 3GNQA 4EW2A 5LQJA 4U00A 4XONA 2R66A 4UU7A 3ZV4A 3TJZA 3TR6A 1XD2A 4NR0A 3A1TA 1QPBA 1UD3A 2HPAA 4WEQA 5HTKA 1M90D 4KWHA 3Q6MA 1C8LA 1HORA 2OV6A 3A28A 1FTGA 1TJ4A 1NI5A 2FSVC 1Z73A 4IH1A 4LJKA 3ZE0B 4X60A 5CM9C 3UJHA 5CEFA 4MRMB 1FUYB 2R1VA 3S2GA 1VI5A 5J2UF 2XVZA 4U2CA 5BOSB 3CNQS 1YR1A 4MW4A 1FDTA 1LBIA 2VSNA 3MAGA 3ZW8A 2JANA 3DDSA 2ASVA 4BKUA 3GUHA 3C8MA 2VQDA 1T2NA 2BH2A 1SKYE 4WCVA 2PZFA 1ID8A 2IVFA 1JNYA 1TEXA 3W2EA 2ZIEA 4BVHA 4W6ZA 3DWEX 3GGJA 2ZCVA 2B1QA 3NUGA 3PVSA 4MVJM 4EBBA 1TFUA 2YWEA 3FWNA 1SVKA 2O6HA 2OXRA 4H4CA 3T5MA 5AJXA 3FCOA 3S2YA 3A8IA 2FI1A 5JWHA 3ENKA 5FJIA 3HBFA 1KP2A 2IIQA 3DLAA 3PEFA 2H1WA 4TMWA 3D1VA 1T2FA 1SOVA 3UO8B 1CUDA 3VR5A 3WWOA 3Q8KA 1WOOA 1VQ6B 4R98A 3NXKA 4MPJA 3LD9A 4OHWA 4HYQA 4UTNA 3NFRA 3PKIA 2PUAA 5IWAB 1YDHA 4W1SA 1Q0RA 4XR4A 2H2DA 4JJ4A 2XF2A 1L4LA 2WUFA 3OOEA 4H6XA 4MYHA 4YUZA 4PQGA 2REQB 4TUYA 4RIEA 1AMNA 3ZDBA 2DH6A 1ZW6A 2Z5GA 4ZCIA 3QF4A 3WKBA 4WD3A 5EWLA 1GFZA 1PQWA 1GIAA 3DOIA 3OMXA 4AKEA 3AUJB 1L5HB 1JDSA 1RI4A 3AILA 4GX0A 4L6AA 2C5EA 1A7UA 2YVLA 4HP8A 4L0CA 3U19A 2WKWA 4HN4B 1ECBA 4KXYA 4O2BA 4PRKA 2A0UA 2NADA 2EL9A 2P0AA 2V4UA 4MIEA 1OCEA 3O03A 2HJWA 2VJYA 2WKQA 4OYLA 1NQ5A 5CHEA 1MEOA 4JKYA 2QRVA 2FTKE 4BN5A 5LDGA 4RGBA 5T4FA 3TZCA 3K5IA 2WINI 1UD8A 2QTZA 1Q0SA 2PUVA 5C8XA 4HEJA 1SZDA 3BIXA 2XMZA 4JNCA 3DL0A 4RE6A 4XUEA 4RESA 4AL4A 4CWAA 2I3ZA 3MWYW 1NLUA 1AKNA 1U8FO 1OU0A 1TCBA 3Q85A 4HGQA 4HNHA 5ALKA 5TE9A 1QO0A 1FNMA 3SYRA 3UWSA 2HHCA 1J2EA 1IHYA 1QMGA 2LBPA 4CGYA 4ZYZA 4N8SA 3A1VA 2IUEA 3GV0A 2R1VB 2JIOA 4OP2A 5BN5B 1ENPA 2EFJA 2XMPA 3EGXB 1C3LA 3T1YB 3A58B 2V31A 1QQAA 3OZGA 3RROA 3AP3A 3H0CA 5J58A 2X0KA 1HFJA 3OO0A 1E79A 2C4NA 5D3QA 3WNDA 2WIKA 3GHYA 4PIPA 3T52A 5K8UA 1U02A 2ZZGA 3EK2A 3O26A 4RVDA 2B35A 2QR2A 4EIWA 3GXBA 3ZH2A 2O05A 2FZLA 2A1IA 2ERXA 2J9YB 3P0HA 4HTFA 5EXPA 5ETJA 5F76A 3WLIA 5JJ5A 4AICA 3UHAA 1XEWX 4C6TA 1DQSA 4RTNA 4FGSA 2E4UA 1E1YA 2VDOB 4Z6KA 3H0EA 4KXXA 1VTKA 3CXCB 3CCCA 4ROTA 1DKOA 4MUIA 1UDAA 5AQEA 3KR2A 4D1YA 3ILVA 3DTNA 4JI5B 3G82C 1Q0LA 2GN1A 3THOA 3WK4A 3ZBTA 3JQ8A 4P5DA 3WG9A 4Z4GA 1J22A 2QG9A 1EK5A 3F3YA 4PNZA 4DCNA 1M6VB 3KSZO 5FTNA 2R47A 3G7NA 3TSZA 1HZEA 4UUBA 3F3KA 3LZDA 2QA5A 3EGOA 3HVIA 5L4SA 3A1NA 3CBQA 3HCPA 3RS2A 4B6OA 3TEFA 4IVQA 5DGCA 4YJ2A 3A6EA 4LFCB 1UK8A 3PA8A 4KPYA 1FUUA 2XDQA 1JEJA 1Y7LA 2BBWA 1N1MA 4G86A 2B8JA 2ZM6B 3HB7A 3O4HA 4NG5A 3N3BC 2CV0A 1XGKA 3L5KA 4NYJQ 2R00A 4I9GA 1R4MB 3ZXIA 8MHTA 1RI5A 1XZLA 3ANNA 4ZEVA 3R77A 5GV8A 3VJMA 3T5DA 4EYGA 1TTTA 4HNVA 5I7OA 2QROA 1OT5A 2ZIWB 4P7KA 3DFKA 2A5FA 2J9FA 1EHYA 2FV8A 4YONB 5C7LO 1AKTA 4KITB 1AQNA 1I3CA 2SKDA 1CLEA 4KHZA 3CLSD 1C9JA 1TVEA 3MUFA 1HBJA 3RAPR 1CXZA 1GUFA 1CLUA 3DHEA 3GRKA 1B8UA 3C7AA 3FJOA 2QR3A 2W2QA 1WHTB 5THKA 3DD5A 4WFQA 4GQAA 1G2IA 5TGZA 4BFXA 5JXHA 2E5FA 2D0DA 4D02A 4M9CA 4D92A 1WUYA 3CRMA 2NZWA 3WV5A 1MGOA 2E4XA 4K9QA 1N8TA 4QD3A 1AQJA 1SHJA 4HEA6 3TRIA 2HLHA 3KOUA 3HDHA 5LU9A 3BBLA 4TZ6A 1LFAA 1CJBA 4HVTA 3L9WA 3NUZA 2JF0A 1JLMA 1XA3A 1ZD8A 1AT1A 1OH6A 4PCLA 1QKKA 1Y9JA 3DLIA 3QOWA 4QGBA 4WGGA 5FI0B 4BLRA 4COOA 1YFZA 1Z4IA 2ZU0C 4UOZA 1TU4A 3G6WA 3IUPA 4MW5A 3PD0A 1IWOA 3RNLA 2W70A 3KKQA 3KKZA 1ISSA 5AVOA 3NEAA 5HQ3A 1E3LA 1M75A 1SKQA 3E15A 4UUMA 4AJ1A 3NVKI 3GO4A 3F49S 2F43B 1Y4SA 2OHVA 2FN8A 3OIGA 3PR1A 4RMGA 4FHFA 4JC4A 2FLWA 4UD6A 4WN9A 2BISA 2KI5A 1YVEI 5BW4A 1EVJA 4PSVA 5ALTA 3KLBA 4TS1A 1A8HA 1XLTC 2YXPX 1T26A 1YQTA 2QM8A 2VHYA 3AUAA 2Z0MA 3RUCA 2MJLA 3A6DA 3QPUA 4FDTA 4L95C 3SOPA 4YR7A 1NVEA 3SE7A 3V1MA 2YMPA 1ML3A 3GLHA 2NO9A 4JGGA 3E1KA 1RQRA 4MLDA 5IM5A 3ELYA 2CXPA 4TXHA 3JQBA 5K8VA 1SBYA 1SQ6A 2DE0X 1RWNA 1WPGA 2A0YA 2HF8A 3E82A 3UJ9A 3CC7B 3VSAA 3K0CA 5KVSA 4KREA 2GDJA 1HNWB 1F60A 4JT8A 3U7QA 2GO1A 2HI0A 2QD5A 2OB1A 1XMPA 4GP7A 3BL8A 2BMAA 1HT2E 1FF9A 1FMJA 1ZY2A 2HU7A 2OO5C 3NTOA 4MTLA 5FUXA 3G4SB 3RYHA 1K7CA 1P2GA 2AC2A 1KBOA 1XXLA 2X0FA 5EP1A 1J0DA 5CX4A 1YNOA 4E5YA 4EPTA 1UJ2A 1Q7CA 2CSUA 5DTIA 4OG2A 1NFFA 2F62A 2HIAA 3FB1A 4MROA 2DTDA 2PU5A 4OOVA 5HS4A 1TNDA 2X5NA 4KQ9A 5KSZA 1P29A 1M0EA 5F4BA 2Z98A 1I7PA 4HNUA 4EHAA 2BE9A 2WFZA 2CDCA 3Q9LA 4V02A 3PXGA 4YUAA 3U7EB 2ZCUA 4G2TA 3ANXA 2BFBA 1CJUC 1XZAA 4P38A 1NNUA 3WLKX 4WCDA 4EUSA 1IG0A 4RLSA 4AN0A 4OHBA 1PWHA 4OSEA 3UWKA 4XVUA 5BWCA 1KOGA 2G9VA 1M2VB 1OR8A 5LLSA 3ZE7A 1QIJA 2OM2A 4JBIA 3QBVA 2P30A 2XPCA 2BP7A 4N3NA 3OPMA 1YS2X 2VZ0A 2X0IA 2FN3A 5F2NA 1DZ3A 2QTTA 4P3KA 4ZAWA 3ZCQA 4KP7A 3I04M 3T3EA 4WOCA 4IMRA 3H1PA 4B9AA 4NMWA 2EGUA 3BD7A 1J2YA 4IX9A 1QK4A 2V6MA 1U0FA 1DXOA 5CPBA 5FTJA 1P4GA 3GCZA 5HZGA 3RYCA 2XF8A 2OV8A 1ECPA 2LPMA 3TSAA 4RTJA 4FP9A 5JAOA 3PD7A 2PZLA 3AKEA 4NJEB 2J5QA 3OCVA 2IS1A 1MJGM 3CJQA 3BFVA 1IJEA 3H5IA 3CLUD 3EPRA 3H5OA 1Z7BA 1SVWA 2OCDA 1EGHA 3AHFA 1T3GA 1C0PA 3CRVA 3JPYA 1ZD1A 1VQ1A 4TZ0A 4RPHA 2XE4A 1VLOA 3AI7A 1UPXA 3W5CA 2XOKD 2WUGA 1CQIA 5GZ6A 1YR7A 4IWNA 3OU7A 1U9ZA 2CBZA 3R6TA 4JBYA 3RQIA 2W2KA 1GPNA 4KXQA 4DIDA 5JTTA 4AK9A 4JYAB 1F0KA 2Q1YA 1VIVA 1GUDA 1NLYA 1N7IA 1O96A 3L3BA 1RADA 3QF4B 4GT1A 4X92A 3RIXA 3S8MA 3MWKA 5BW6B 1GITA 1GLGA 2X9GA 4H08A 1GVNB 5A9SA 2L2QA 3P0EA 1UBGA 3W5HA 2JHPA 3CZRA 3GA7A 1LKZA 4WZBA 5DLQC 4F46A 2C5BA 1NKVA 1XFDA 5BRNA 2XV1A 1KR2A 4GOOD 4YRAA 3F8WA 3Q3VA 5EE9A 1MZPA 2AEJA 4PE5B 1E4OA 1MV8A 5EUCA 1L7DA 4FOPA 3VVMA 4II2A 2P4EA 2JGIA 3JQPA 3PXDA 3USCS 2VHWA 1R5JA 3M5WA 3CKYA 4Q9DA 1YS4A 1PSDA 3N2KA 1FUIA 4TN5A 1MHTA 4HKTA 1ORTA 2V1UA 2Y6VA 2HLDA 3R6LA 2PT5A 4LE1A 3FETA 2ZJ1A 4EELA 3TDNA 2VJCA 3WNBA 1M8JA 3MC1A 3LCJA 4M0CA 1YI0A 1Z6XA 4WWVA 3AU8A 4KSBA 1VQ4B 1DRWA 3BTSA 3P71T 5AJUA 4A8TA 3A2NA 3A37A 2FQWA 4WUTA 3ZIAD 3EZ2A 2UXDB 1NVWQ 3KD2A 4O4JA 5B64A 4YC7A 1SQ0A 1S2IA 1NOIA 1R6TA 4DBZA 2EIXA 2WF5A 2NYAA 2ZROA 4GXTA 2QQFA 4NZ9A 2H5IA 1GPKA 2XMQA 3WRWA 1DDGA 1H3EA 3NIBA 4E5PA 2AXNA 3WY9A 2FW6A 3L41A 1SOUA 4R1NA 5H4GA 2ZTLA 4Y6PA 2IWHA 1ZS9A 2H5EA 1L5MA 1LI7A 4LYDA 3CNHA 3A36A 2VDKB 1BH6A 4M54A 3H83A 2WAAA 5ES3A 1EUDB 4U7DA 5IJAA 1Z5VA 5K3OA 1LBEA 4IQ4A 2G4VA 3KLNA 3THXB 1ZD3A 1RYMA 4CQLB 1E1CB 5F12A 2E4VA 5A4FS 1SEPA 1V8DA 4NU6A 5ALQA 2BSQA 5GINE 2P79A 3BTUA 1F9AA 2AGVA 5ECYA 4QVJA 4QGGA 5FB3A 4Z7OB 1JYSA 1ZUD1 5AHOA 3EYAA 3LK7A 4HDMA 1SXJC 1Y3CE 4XWTA 3RPEA 3UWOA 1JHDA 5EIEA 5JWRA 4IDDA 1X42A 2YX1A 3QMWA 3VVCA 1K6IA 2H5JA 2IOHA 2EBFX 4ZZ1A 5FL7A 2C92A 3K16A 5AP9A 5A0FA 3ACBA 2BFPA 2R0QC 4Z4SA 1LDMA 1MC8A 1YIDA 2I3BA 1YIAA 3FVRA 4RK1A 4EG8A 1A76A 1P9WA 2Q4DA 4WPGA 3TXAA 5AVQA 1UFQA 1QG2A 4PZPA 5KQSA 1LVGA 3K09A 3TB4A 2FVXA 4XX0A 3MWDB 1COWA 4YJ3B 1T1IA 1CUJA 1RRGA 1P31A 3B89A 4ZI2A 1U8TA 2L17A 5F5LA 4LOJA 5REQB 4LOKA 4LS3A 2JVIA 4EG5A 3UKOA 1OBFO 4HXGA 1Y81A 2RKBA 3I9MA 3D6VA 5AO9A 3IDQA 1W49A 5IW8A 2XW6A 2QQ5A 3VGPA 2CK3A 1XD2B 3B6ZA 3S8EA 2IS2A 1D4AA 1U5BB 1K8XB 1WNTA 2HRBA 3IHKA 4JQCA 3CPJB 1B0UA 3OH8A 5FWDA 5LP6A 1J8DA 5JFOA 1P8JA 1EXMA 2VHVA 3SG0A 4L6IA 1PGNA 4MRMA 4B80A 5J4LA 1TZJA 5GVRA 4X54A 1DMSA 1WS6A 4AJIA 3V9PA 4O2BF 4ZYVA 2QN1A 3IMGA 4EUKA 5E3JA 4OM8A 5TF0A 3KJZA 4D9IA 3M0EA 3PPYA 4DRYA 3AVQA 4YASA 2W98A 3D8HA 3NM6B 1CS0B 1YCFA 3AQ4A 3QY9A 3M6UA 4C7OA 1TI7A 3DCIA 4BC0A 2I4MA 2JCYA 2M2IA 3QIAA 4WESA 1XN1A 3CF6R 3PICA 4EY4A 4PC7A 1J9EA 4CKWA 2QTRA 5CP8A 3AG6A 5IN5A 3GLHE 4ITUA 4R8SA 5F23A 3EWSA 4FFMA 2Y1WA 2WFAA 3T5PA 1GRQA 3THYB 3EZLA 2F17A 2ZT5A 3W3AH 3W7AA 1I4OA 4MDEA 4D25A 4AZVA 1HT0A 3S8YA 5LBTA 3T4UA 4KH1A 2ZBVA 4QYIA 3UUFA 4WZAA 4EHFA 2A9QA 4GKKB 5HCNA 4B3RB 3GLRA 2A2ZA 5FUBA 4PYLA 4DR4B 2X7XA 1X0VA 1EK2A 1QOZA 2YUIA 1KEEA 2KB0A 3C4JA 1HDIA 2YINC 4KIGA 3F6EX 5J5CA 5IHXA 4QJ4A 4I3GA 4OQFA 3PQCA 4F91B 1K86A 1JFFA 1RZ3A 3KB6A 2OM6A 4Z0NA 3SQDA 3D6JA 3R20A 4OMDA 5AVWA 2FF5A 5KNDA 3AFOA 5GOZA 4R9UC 5JD4A 4CM4B 4XH9B 3IQWA 4S0ZA 4XVQA 2GBGA 2FE4A 4KLZA 3THSA 1QHSA 4AP6A 4B2PA 4EA7A 5INTA 2ANCA 3A7EA 1S2NA 4PRYA 1BZYA 1QZZA 1RCUA 2OVFA 3FPHA 4KLCA 3TL2A 4AMUA 4ARUA 4GYKA 3WYGA 2D8AA 4PTLA 1L5NA 3ZDFA 3QE2A 1QDUA 4AIRA 4B6RA 4BTLA 2B94A 2FX2A 3M3DA 3BULA 1UBNA 4D74A 2OV2A 1V5IA 3DFMA 2BKXA 1Z4OA 3OJOA 5C1DA 4UUQA 1I7NA 1NC1A 2G17A 4AY6A 1ZVMA 2ZI3A 4OQLA 3GMTA 4Q21A 1Y4ZA 4V0OA 3FDXA 5EXDA 1TK2A 4D8VA 1KAEA 4LDJA 3L1HA 4B4WA 1NJSA 3D8TA 3JVIA 3OEHA 2IEBA 3M9WA 4YECA 2B4TO 3B20A 1Z34A 3FRIA 4QXOA 3UJ3X 2IBTA 1X8XA 4BO5A 4ENVA 1MA0A 2IYAA 3EBLA 2NNWB 5TX7A 2PRYA 1A7AA 1DDIA 4OJYA 1WSWA 3MPOA 2FUKA 2WTEA 3ETLA 4I50B 5K45A 4FNAA 1P33A 2AOTB 2ZBGA 2KWIA 4OPMA 1P3DA 3OC0A 1UC5B 1NYQA 4CDNA 4RLHA 3VYTB 3BSYA 3FMIA 4M89A 1BEEA 2QY6A 4BO0A 3HWWA 4HDQB 4RVOA 1NRKA 5MFZA 2VXBA 1QCDA 1EK1A 1A5TA 4F71A 2CXXA 3L8YA 3R1IA 4WZAB 2VPWA 4KXMA 1JLLA 1MIHA 1C9KA 4DK0A 2QAGA 2XYQA 3UHJA 1D7AA 5LQNA 2MYNA 2NZUG 1DIBA 1L4EA 4JU9A 4R81A 2IEZA 4ZI5A 5IM4F 2XRZA 1GSOA 1TTPB 3QZUA 3FFXA 3F90A 2CN1A 2WWGA 4ZCQA 2EJBA 2NVUA 2D5CA 2LNDA 2ZBQA 121PA 3K32A 4P1ZA 4P0TA 5GGYA 8ADHA 1WXEA 3TRFA 1QHIA 4WZZA 1PWXA 2O1EA 1W36D 1DGQA 2AQHA 2AZXA 1XYGA 1QBKC 1LDGA 1VB5A 3NT5A 3T4EA 4DGQA 2RCYA 2IA5A 3CLTD 3DM9B 3HYCA 3NQ41 2OB2A 3HO8A 1LK5A 4KDCA 5AFSA 2AW5A 1VQPB 2GCPA 1SR8A 4DUPA 2FFQA 4C7VA 3PNPA 3KXPA 4N4AA 1J24A 1SU6A 1IM8A 3D7NA 4MKXA 4AJNA 4TXLA 2PA0A 1M7HA 2ZJ6A 4ZQEA 3VPDA 1G4HA 2DEUA 2RHBA 1C80A 2X1MA 3GFFA 3WWZA 1GPDG 3BXXA 3TEMA 4G8DA 2WEKA 4UFOA 2IYSA 1CKEA 1QRUA 3IH5A 5HRCA 4BU1A 1BXZA 2EZ9A 4DR1B 1PK9A 1J33A 2P5SA 2X3UA 1H6CA 1K75A 2D2IA 3PXUA 1MT0A 1A04A 2PYDA 4YUYA 3UG6A 1PHRA 4N40A 4EDHA 5TF4A 2FWIA 2L18A 3G9XA 1USGA 4AY5A 3ASVA 2FSFA 2LE0A 2P4HX 2WM9B 3CH6A 4OB8A 3L1KA 2PIDA 2GSDA 3MILA 4CMIB 2X6RA 2I7CA 3EIQA 5DMXA 1T0PA 1WKCA 4OU4A 3N2ZB 5KX5B 4Z1MA 2A9VA 4P7FA 2QLTA 1FFWA 3A25A 5FBHA 4KKXB 4F0JA 4YMUA 4L4SA 1XZCA 3PHCA 3HWSA 3FHOA 4ZZ3A 1E89A 1VJGA 1WPQA 2VHZA 2VP5A 1OFTA 3R0ZA 2IV7A 2C2XA 1EFHA 5BR4A 3A8JA 1ES9A 4XQ9A 4ER3A 2QYSA 4J75A 1N5OX 1NJ2A 1B8OA 1Q22A 3ROEA 4XKJA 1PV4A 3NORA 3C2QA 4OK5A 1W0JD 1CX9B 1QMPA 2OD7A 1JA1A 3HCRA 3WKEA 5AVKA 2B1IA 2IIBA 3IUBA 1EDZA 3AB8A 5E1DA 1O4WA 2FSHA 3O1IC 2VNSA 1XB2A 3CLHA 1HNZB 2YFYA 4S35A 1CEXA 5EE1A 3OSUA 4L3WA 4F06A 2PFKA 1GGKA 2DHQA 7REQB 3ZY5A 3N7TA 1TE2A 1FTWA 2AFIA 1EZ1A 2CEAA 5AMXA 5BSRA 3R7DA 4MW6A 4UATA 3AESB 4YQYA 3PLRA 1UMKA 1CULC 2A7XA 3KKNA 4K28A 4MVJA 4R9VA 2Q5QA 3AEQA 2ZP1A 5ALWA 5AYVA 4EYKA 2LDBA 4BTVA 1MIOB 4C20A 4GSKA 2OAEA 4KYIB 1E7YA 4CM4A 2ZZQA 2HFJA 3BE5A 3H2GA 4K1LA 1U31A 2ZI9A 3ZOZA 2XBMA 3KDSE 3ODPA 2R6GA 3OPYB 3D2AA 1OA1A 3P9QA 1JQAA 2WWXA 4JQOA 4H6VA 3NOVA 1D0VA 4PM4A 1UP4A 3TLBA 2H4HA 2HA5A 4K6HA 1M2VA 2VWGA 1WXDA 4GOXA 4N48A 2WHRA 4D96A 1RQ7A 2GAAA 3H86A 1E1KA 3PRJA 4G81A 3ESBA 3PBKA 1PF7E 1RACA 2PX2A 1M5UA 4JASB 4QNNA 4DC1A 3W9YA 2AF3C 2H06A 1FU8A 3JYLA 4R05A 5K3CA 3BZBA 4R8RA 3AYZB 1BVUA 4HNAA 3R9XA 4IIEA 3PXXA 1RLUA 3Q5EA 5EFOA 1H2ZA 2QZ9A 3H3XA 1YQUA 2AYXA 2NU6A 2VTBB 1CQPA 2C57A 2FWAA 1M1NA 4GFDA 2OXIA 5E2AA 4P3PA 4H3KB 2IZ6A 1K0FA 3GLFE 5F5NA 5JS2A 3CZCA 1H0RA 2Z5LA 4UE2A 4GIBA 4WY5A 2DLCX 4KB5A 3RC2A 1R0XA 2PMFA 4UCWA 3HKDA 3DNPA 3TOZA 3C8HA 4GX5A 2QX9A 1N36B 2P11A 4CR6A 1U0BB 1LTKA 1MH1A 2IFTA 2O20A 1IONA 3RARA 1O8BA 2IW1A 1O3YA 3DF7A 1PFQA 2XECA 4OP1A 3UUEA 1EVLA 4CCWA 3ELUA 1XJ5A 2YXDA 3AHJA 5JAUA 1U0OC 1LTQA 1FRVA 2FG6C 1NW4A 4JR0A 1R7RA 3WLAA 1XQ6A 3ONWA 4RKRA 2P9EA 5LSAA 4FC6A 1LQUA 3SPXA 3X2FA 3WWDA 4BNLA 4BPBA 3U81A 1GKYA 1CT9A 4L6CA 4RD2A 1E6EA 1V9SA 3ABZA 1RJFA 2IXFA 3I2GA 3EDOA 2N47A 4G1MB 4MR9A 1VBMA 3QSYA 4TVBA 2NUAB 1QLWA 4HXEB 1LWNA 2E6KA 3WX0A 4N3GA 4C4AA 7ADHA 3AKCA 5ALNA 2G80A 4XQFA 1E66A 3AF0A 3KZ1E 4KKSA 3ZG6A 4DIKA 1KDPA 1WPXA 1IY0A 3ZC3A 4WTOA 3N2KB 4RDHA 4DF3A 1K9MD 1XDWA 1DL5A 5A04A 4UKDA 4KXNA 4AXXA 2CNLA 4RW0A 3A26A 4POAA 1V0FA 1OA0A 4L3OA 3IA2A 4I9HA 2BW0A 5TQ2B 3WIEA 4FT2A 3OKXA 3RS8A 4NLLA 2EJUA 2V58A 5JFTA 4U2EA 3G7UA 3R7FA 1WHTA 2NPOA 3K0EA 2PD6A 3ZV6A 4RXTA 2XEXA 1G5RA 1TJ5A 1L0BA 2IHZA 4O5AA 2BGLA 3IQHX 3TEJA 3N8HA 3OZTA 4BFWA 4QNMA 1SVSA 1C9YA 4WX2B 2X9LA 1EFUA 3IVXA 1A9OA 4WASA 1LPBB 2VPQA 2Q7DA 5ICSA 7ABPA 4AO8A 3GUZA 4GLFA 3GJXC 3I55B 3S2FA 1YITB 2WNHA 1JI0A 1DX4A 4MP8A 1FXWF 1IVYA 1YE3A 1BG6A 3I6MA 4E32A 2K2WA 4KRYA 5HKKA 4KYUA 3C3WA 2H8GA 1NUSA 2GCIA 5LWHA 5KVCA 4HYYA 4ESOA 3GFPA 4J6EA 4D26A 1JVBA 2ECPA 2YMQA 4GR5A 3T15A 5JY1A 3OFKA 2PL1A 1TUBB 4NXMB 2VOEA 3R4CA 521PA 2C4WA 4QPDA 3RVPA 3ZV5A 1EDOA 4MB2A 4JGBA 2FSGA 4R41A 3RI3A 1RQLA 2H31A 4Q37A 4MKGA 1U3GA 4ZKEA 4LWPA 2BI4A 3PGJA 4OHMA 1DRJA 3P2EA 1JG6A 2QAGB 4ZICA 2V3CC 3CG4A 2GEVA 3IAHA 1MF7A 1YS7A 3SQWA 2G5GX 4Z0PA 3AVTA 4QEZA 4FMBB 3UXEA 1X7ZB 5LCXA 2I71A 3K0AA 5IJ9A 4EMTA 2EKPA 2QVGA 2AJBA 1AF4A 1O87A 3KOOA 1Y5NA 1WXGA 2IHBA 2R4TA 2YQ5A 1P80A 5J40A 2B4RO 4LRTB 4H9GA 1YJ8A 3BTOA 1EJ6A 3R5KA 3LC2O 2OK8A 3LWNA 2WG2A 3HUDA 1CQZA 4ES6A 3DW3X 3EGCA 4MLCA 1H23A 4Q1VA 4AZ0B 1NOKA 4DARA 4CE6A 2QZJA 3G1UA 3LC1O 3Q38A 3BM5A 2G7MC 2X9NA 3G85A 3OIVA 1FLDA 1AS2A 1X1QA 3WGLA 3EZ9A 3OHPA 4DNQA 1D2GA 4WADA 1QYRA 1E9BA 4N0DA 5BSFA 1CNFA 3ROXA 5CD9A 3HLTA 4DQUA 3O8OA 4H6PA 1Z0JA 4JA2A 3TS1A 1W87A 2HQSA 3K92A 3OI7A 4A73A 1TAUA 4RVCA 1W94A 4XRGA 4IUCS 2W6JD 5BRAA 3NIWA 3PIDA 4Q0MA 3DYIA 2ZYAA 3KM0A 5GMOA 2JLVA 1CNMA 2JCVA 3KJQA 3GIDA 4DCGA 1A9PA 3GLTA 4PPYA 1T1EA 2JFHA 4IBOA 4YDHB 2XSZD 2CVFA 4N3BA 4AX8A 1NLFA 5JHHB 2P90A 1M1KD 5U4QA 2PL5A 4URYR 2IH5A 3PKZA 2Q9AA 3LQ1A 1SIBE 1COZA 4X1IB 2VSFA 3VBCA 5GVSA 1Z5PA 4MLPA 1MOQA 1FQJA 2EFGA 1XEAA 2ACVA 2PSFA 3PQ8A 4O4LA 3S70A 2ZUUA 3ZGLA 1LTHR 3E84A 4JU8A 4LJ8A 3T7RA 4D3XA 3QY0A 1ZIOA 5C5CA 1DWPA 2OMEA 4QREA 1Q7BA 3KTAB 3WVNA 3FOWA 2IKSA 2ZQZA 3LY5A 1XRLA 3CH7A 3I0NA 3DWFA 3R8FA 1PJLA 2X1LA 3IXLA 1J49A 5K8IA 1F7UA 3MWGA 1RFLA 2NUTB 3HN6A 5A4JA 1H4VB 1D1SA 3QFCA 2R1UA 1L5RA 1GJRA 2ZSHA 4LVOA 1H2BA 4J7XA 1URPA 3HCWA 4D2IA 1S89A 5ESDA 4GPIB 4K9SA 2R1ZA 1E5VA 1A97A 2HV8A 2IODA 5CXQA 4QYTA 1G64A 3U61B 2G07A 4X8IA 1PCXA 1I3LA 4F7DA 3RRXA 1DEXA 4NBVA 3TW0A 1DO2A 4KQWA 5CJ2A 2OE2A 2BEWA 2ZS8A 1IY9A 3GLVA 4Q9KA 5GQSA 3ST7A 3H9EO 3R76A 4C78A 1SCIA 4WKCA 4X6UA 4ZTUB 2YYSA 1DIHA 1O89A 2GX6A 2ZL5A 1GEGA 2W4MA 4X8HA 5E3IA 1PZXA 4BMVA 4I2NA 3RIEA 2WYVA 4WBNB 2AFRA 3UFXA 4DLWA 5ABPA 2YXEA 2VHJA 1WX1A 4G37A 4XYBA 3RJ5A 1KIFA 4WK0B 3CX3A 4Y2GA 4XTCS 4F2PA 1A88A 4ZGQB 1KL7A 2OL4A 2ODTX 2ZI4A 3O8QB 4NEHB 4Z4IA 5LQMA 4RD0A 8OHMA 2K4MA 4HADA 3L7OA 2BEKA 5A88A 1KVUA 3SS7X 1STOA 4C22A 4E46A 1P19A 4GSYA 4YRFA 5KBYA 2A59A 3CT4A 4OU5A 2BFEA 4YP1A 4JLAA 3EIEA 2JN9A 1MLDA 1PJZA 2ZJOA 4EW6A 1MNQA 2ZE5A 4B17A 4LHVA 2WJPA 3H9CA 3T9AA 1KGSA 1F3LA 3LPCA 1Z45A 3NMUF 4QYWA 2H5LA 5JAZA 2OOKA 4FFVA 4ZPJA 3DR5A 3JRNA 4AF6A 2ZB8A 5B1SA 2WKRA 1LPPA 5T6BA 4KBGA 1Z63A 4ZVMA 4Z4ZA 1M72A 2FETA 4X00A 1GR0A 1QJ4A 2Y1FA 3ANTA 5I6DA 1DPGA 4B8YA 4FUQA 4GNRA 5AOAA 1B26A 3LV8A 4YQEA 3RC7A 4DAEA 4DREA 1XV5A 4EG4A 5BSTA 1VHLA 3R44A 5EIHA 3AM3A 4UZFA 1XK7A 4Y6GB 4YYEA 4A92A 4GS5A 5ALGA 3SHVA 4BFYA 3CRNA 2FE1A 4UBLA 4CCAA 5F9HA 3IQFA 1T0BA 1VRCA 4UTZA 3ZHSA 3WB1A 1B8PA 2NYVA 4M0LA 3GEDA 4QBIA 2ZWMA 4DQDA 3TUZC 4R2KA 3GGOA 4F3CA 1CQIB 1ZK0A 1WWKA 3MXTA 3O4GA 4JVOA 2ZR7A 3TBHA 1SQGA 2PLNA 1XFOA 4P4SB 5FNVB 3Q7RA 4OQZA 3PUXA 3UATA 1P4HA 3GMDA 4DV1B 4W5NA 4OQPA 5DNCA 1EFAA 1GZHB 3LHKA 4KQKA 4JUFA 1E9DA 1NG1A 3FNBA 3SSAA 2Y1LA 4ZP1A 3NT2A 4V0KA 3QNMA 3WFIA 4DA8A 3UC5A 1YQGA 1XVUA 4HRYA 3EX7C 3HBNA 3VR6A 1PJ3A 3EB9A 1QGUA 1SXGA 2L42A 3HFGA 1MG5A 2G28A 1JA0A 4JI0B 2AIRA 5KNBH 5EVJA 3VKUA 3L7KA 3K1ZA 2B1RA 3RHZA 5JJKA 3PP8A 3IMEA 4IGEA 1U98A 4DZZA 3KBOA 5L95A 4LXTA 3GR6A 2HA4A 4CV1A 1WZIA 3NPMA 3RKRA 3TH5A 2OLJA 5IJ0B 4DLBA 3N75A 3AQIA 2DH5A 5DCWA 3E5NA 4Q1EA 3KKMA 3WICA 2F8MA 4FFDA 2QPLA 3T12A 2W6ZA 1Y6RA 5T7BA 1KKLA 4M60A 2I66A 3OZ7A 2Z8XA 2B6NA 3OJ0A 1UKEA 3H3JA 5K0TA 3SR3A 4M99A 3OTOB 2EG5A 1PG5A 1WSRA 2JRLA 2IS4A 5AUNB 5FCDA 4JDUA 2NU8A 1VZ3A 3IUYA 4RZUA 1FP4A 2QMOA 1BWPA 1Q6ZA 1T10A 4RD4A 2QRKA 3OC6A 4O2AB 1K8AD 4PRLA 1UQTA 3VYWA 2PJRA 3D7SA 2OZPA 3H1TA 3C5HA 2PVCA 1A95A 4DXDA 2I3GA 3QXGA 2APJA 3RFVA 2VZ8A 3L43A 1GPAA 2CHVA 1N2OA 2XUFA 2RGGA 3ZXYA 4V0SA 4G65A 4ZVPA 2BDEA 1OC4A 2JI9A 4QTXA 1SD2A 1DUSA 3SI7A 4WXHA 3K0CC 4AN4A 2Q5LA 1A9TA 1GAXA 2JB9A 5K7SA 3ZJTA 1VYVA 3A0RB 1FYDA 4GUAA 4MINA 4QDUA 4X0EA 1VYTA 4XPIB 4KAAA 4FFWA 4QECA 2PN1A 1T34A 2YZ7A 5EIOA 2C2GA 1AA9A 4D56A 4CEJB 1J20A 5LNK1 4EGSA 2C8KA 5EESA 1NJ6A 2YW2A 4WFIA 2XCSB 4BLOA 1WVIA 4FZVA 2ZYIA 4V0NA 4KAFA 5DGHA 3R6GA 2D5AA 4ZOLA 5CK5A 2XXAA 2OQVA 2OORA 5HGJA 3OP1A 1IFXA 2A14A 2GD2A 3PFNA 4PAOA 3RRYA 1QGYA 2G6BA 5AVSA 3PHIA 2WPDA 4FDVA 3RHSA 3BEDA 5KVAA 3T1OA 4E5VA 4BNHA 1YVRA 1EEHA 1YHQB 4H7PA 4KTVE 3VKHA 4D6PA 4J16C 4DQKA 3MA0A 5B30A 4J4TA 3KQUA 3ZGYA 4BRSA 2C3UA 2JJYA 4B3JA 5BV2P 4N9QA 3KOZA 2DLNA 3WL8A 4X91A 4TZKA 2VJQA 2DQZA 3MT9A 5DYIA 4YLEA 2COUA 4B35A 1RAIA 1T1SA 1Y7PA 2JGKA 2ZJ4A 3VO8A 4L8VA 1CUHA 3KB8A 5F3WB 1WUJS 3GAZA 1N07A 1T9KA 4LJ7A 2FR0A 4RELA 3K30A 4AF8A 5JLJA 4YMSA 3G2IA 4WY8A 4PXYA 1JQBA 4HNAB 2IF0A 5DYNA 5T3YA 5EIAA 3U4HA 2Y77A 4GOKA 3D54D 2KQUA 4J7AA 1X94A 1D1TA 1DBVO 1IHDA 3GJRA 2NAPA 1T3ZA 4P98A 3ZCXA 1TQ8A 4JK3A 1DX9A 1XELA 3E05A 1EFDN 4C4TA 4PC2A 2PGJA 2C5HA 1P45A 1RKXA 1QIHA 5CH5A 1EFCA 2QL5A 4IGAA 5KKAA 1MTOA 1Z4KA 4PGFA 2A33A 1FZQA 1I3MA 2N1BA 2PUTA 3O9ZA 1QGZA 4H3SA 4Q1AA 5KYWA 3TNYA 3B7WA 3ZBUA 1ODTC 4IJ6A 1CUWA 3THYA 1HMYA 4HPWA 4RYLA 1QH0A 5KNDH 4OGLA 2R2AA 4MW2A 4LG1A 1W1IA 4YJHA 2NYUA 1E2GA 3N9IA 4R1UA 4HDSB 4DTCA 3G2NA 4O59O 3RSZA 4C76A 4QC2A 2DPMA 2H7VA 1RLTA 3JAKA 1ATIA 3BY2A 3AY0A 3PPWA 4UDXX 5FWYB 3S2EA 2PKWA 5AKZA 5KKNB 1VRWA 3G2HA 2WFMA 3BX1A 1T8SA 4TKMA 5GIOE 1BDIA 1WDLA 2AOUA 2DT5A 3BAFA 4MGEA 5DX0A 3ZXUB 3GLGB 3L4KA 3UXMA 4XLAA 2A0WA 5A03A 2D2VA 4GXNA 3ZD6A 4X45A 3WLPA 3GZNA 5CX1A 3FSJX 4PO1A 4JI8B 1ZRHA 1TK9A 1NU6A 2A6PA 3RT7A 5LIRA 2FPGA 3OT4A 4IMPA 2NU7B 1SCDA 2RHTA 3K4HA 3OJFA 4XFJA 4XYGA 1ZH0A 3RYIB 3STHA 3R8XA 1FC0A 3GWGA 5A0VA 1Q83A 4HUQB 3UMVA 1H1TA 4CM8B 3GDWA 5GM2A 4LWOA 3ZD9A 1X1DA 3WB2A 3EOBI 3K9BA 1GRRA 1YULA 2XXBA 5TJHA 3FZYA 5EY5B 1ZCZA 2QMYA 4AKGA 2O5VA 1SUPA 5JVDB 1R8YA 1NQAO 2HZBA 2C7BA 1CRPA 4NFLA 1VPEA 3IPRA 2XWSA 1XQBA 3KU4A 4X1OA 3ZGVA 2RGBA 5G40A 3TNDA 3EQ2A 3F6CA 5BP7A 4C2BA 2P6MA 1RBZA 1T9HA 2Y1DA 3BYZA 3DMYA 3R75A 3GQBA 1BE0A 3DW1X 3LQKA 2OWDA 4C1BA 3PC8A 1E1RA 3PNMA 1U80A 3M5DA 2F3PA 4CKZA 4PSUA 2GN9A 1QH8B 1U9IA 4IW3B 4WBSA 2FSPA 4D4MA 4QUAA 1XKTA 2O7QA 5YASA 3S1AA 2QMEA 2ZUFA 3ZKWB 2XUKA 1K3TA 1Z15A 1L4GA 3HWRA 4FDUA 1QF9A 4HAWA 4TXJA 2MHCA 3QWHA 4J1TC 4YCAA 4YJKA 1RKBA 4RV4A 4F5EA 1UBJS 3GF4A 2BM0A 1GCAA 1U3VA 1KMMA 3PJEA 4G8BA 3WMFA 1G5IA 1CJTC 1ZD2P 2M6RA 2GS9A 1EUDA 2ZE6A 1W2BB 1V11A 1SEVA 4RS4A 2CL6X 3CNLA 1Z12A 3EXEB 4BX8A 5CIQA 2NP7A 1Q3TA 1G8KA 1PJRA 3TLKA 2AJ8A 2Q50A 4F4UA 1ZM3A 2CXRA 2PL3A 1KJYA 1HH4A 1NC3A 5CBPA 1KRXA 3IESA 2XUZA 3CIOA 2QUIA 1LFDB 3E7FA 4JI2B 1RAHA 1WORA 3K1AB 2E4ZA 1FFYA 1GNLA 2ZIGA 2IW3A 3BSSA 5AHWA 1T9CA 2QGZA 3GFOA 3T4PA 2YS6A 2ZTUA 2QF7A 4FZRA 5AVTA 5JQGA 1Q1GA 2J4CA 4KV7A 4X8MA 1EP2B 1G5FA 3ZU5A 1TCVA 2NZXA 4O63O 4PX9A 3TG8A 1CZLA 5F3DA 1ZKMA 3AEQB 1D2HA 2C42A 1ESDA 1VCHA 1IVSA 2EJVA 2FPRA 2W2VA 3D3NA 3VU0A 3ZHCA 5HRAA 2GETA 3DOFA 1CBUA 2VG8A 4RPCA 1XU7A 1IH8A 1E2UA 5ALIA 5F51A 1V2GA 2H9YA 5EPEA 2W6IA 4MIKA 4F72A 4C43A 1Q0PA 2ZVDA 4P3YA 3EGWA 3RAJA 4V24A 4EVQA 2X2FA 1ZUWA 2ZIZA 3GAMA 4GQBA 4NHOA 3KVNA 3RE1A 4D7AA 3RRMA 3QGMA 1L1FA 4EJMA 3KQQA 1UZNA 2F8LA 3IO5A 3PZRA 4R2XA 1GTSA 4B7UA 1XCJA 3ESQA 4HFJA 4RDXA 1A9SA 1KI7A 3F74A 3JQQA 2P4UA 4QSMA 1A8IA 1MJNA 2CFIA 1GNRA 1XZMA 5AI4A 1WUKS 1Y1PA 1CJMA 3GZJA 2XNHA 3H9BA 4UUOA 1U7WA 2VHTA 4FYYA 3NE5B 2BN4A 2G82A 3DS8A 2O8EB 1Z62A 5EMNA 2AKEA 4GUDA 4PICA 4UHFA 1PVOA 4L85A 2EBWA 3DBLB 3M4JA 4D44A 1DJQA 4HCJA 4ZKDA 4QL3A 2RGEA 3PUJA 4HB2A 3DMPA 4M76B 3P2JA 4JB3A 2PMBA 3SZUA 1GQRA 1E99A 1S1MA 1XBTA 2YRFA 1FDVA 1R50A 2EV9A 1QE3A 2IQ5A 4PEVA 4YP6A 3HCDA 1AXEA 3LC0A 1NYTA 4DSNA 5HQ3B 5IXJA 4A23A 1SXQA 4QYIB 1N0WA 4CR8A 1PZEA 4HYTA 3SDSA 2NU8B 4BLUA 4QZVA 1QNLA 1N2IA 1NURA 3CH5A 1JHUA 3BAZA 3G0CA 2FEAA 3EVGA 2R6FA 3ND9A 4ZVRA 5J5AA 5LXTB 2FR1A 1M8KA 1KEEB 4R5HA 3LIPA 2RHJA 2J5XA 4QGFA 3W9BA 2F9LA 2WWYA 2BFMA 4KYTA 3DOJA 3QQ5A 1YX2A 4W8GA 1KA9H 1ODIA 4G8JA 4BEVA 3HVRA 4XLHA 2GBIA 3J7AC 1RR6A 2KLBA 1I32A 1WNFA 2D1SA 2ACKA 1P1KA 5H80A 1OI2A 1KEVA 1SUEA 2CHEA 1P5HA 4ZYXA 3RU2A 2FDCA 4BGVA 4KLAA 1TJYA 3MIIA 1MMFB 5GOTA 1JBEA 2PS9A 2QN2A 2YV4A 3CLRD 5FA5A 1M6WA 1A9RA 1U1EA 4NYIQ 2HCRA 2QGFA 3K35A 4ND2A 3UW1A 3GLIA 1N7GA 4HH4A 2CJWB 4BO9A 2CLEB 4U8GA 3X1MA 2VQFB 2PRKA 1ENZA 3VH2A 5DNAA 5A05A 5KYXA 3CRRA 5KNCD 2PUDA 2XRMA 2P3OA 1E6UA 1NNSA 1TT5B 2IU6A 2VTDA 3G6KA 5D5HA 4KAJA 5TDHA 3EUEA 4P33A 1P7YA 4W7HA 4D4GA 5HILA 1U9JA 1KYQA 4R2IA 1WBDA 4PLVA 3CH4B 2G4LA 4ALMA 4PABA 1B3BA 4BYGA 4R40A 1KZHA 4LF7B 3ZY3A 5LQDA 4NU0A 3UN1A 2J09A 2P6RA 1N6RA 3RVKA 1RKUA 4OJMX 1WMBA 1FBTA 1UOQA 5HCIA 4RDJA 3OCWA 4B6JA 1O57A 1CUVA 3LMKA 5CCEA 4F45A 1V7PC 4I1SA 2JA1A 3F6PA 3LUAA 2Z57A 5DO9A 5G02A 3UY4A 5KKCA 4K6OA 3LDAA 1GYRA 4ZA2A 1KWGA 1ECJA 4I9FA 3IJPA 1P1CA 2WVJA 1W2GA 5NLLA 2UZ0A 3P0RA 5C8YA 3GL9A 4ENRA 4L0MA 3HZOA 3VUEA 1DC5A 1NMXA 4HUTA 2GK6A 3FUCA 1PSZA 1ZISA 4ACAA 2FP3A 1DKNA 1BW9A 4YTEA 2IF2A 3WQBA 4BASA 1RP1A 4MYDA 4HRAA 5DXAA 3IHTA 1PV1A 2I2CA 4L50A 2HYIC 1UWKA 3KIPA 1U90A 3L7DA 5TLSA 1QVGB 1JZSA 1HY3A 1MO4A 2IEGA 2VP4A 3HPQA 1UOOA 3IQZA 3LVFO 2OBSA 3B3AA 4JBWA 4LI3X 1YR9A 4QVGA 3WI7A 5BPHA 1EB8A 4RKWA 1C1HA 1L3BA 1JLRA 1FTSA 1NRJB 2P1ZA 5LOVB 3GLIE 2XTAA 1L8OA 2C83A 2FDRA 3D0QA 3SEQA 2FLKA 1NA5A 2CF5A 2HMYB 1UK9A 4YDSA 4LF8B 1GPMA 2OCXA 4KMMA 4BMSA 1QFYA 4KXWA 4PZYA 1BCRB 2WD7A 4RK6A 1NHWA 5AKGA 3OLZA 4TTAA 1PW5A 3ASZA 3G8AA 5K3AA 5CFNA 1P61B 4J90A 1WULS 1F4PA 5CK4A 3MJ4A 1WB5A 3DV0B 5JARA 3TVYA 5DN6D 1BS9A 2Z2KA 4WBNA 1W4RA 3F6SA 4HS9A 1TC1A 2ZXEA 4RX1A 2QTLA 4Z8YA 2YC4C 3V9AA 1TT5A 4KLNA 2AHRA 1DRUA 4GPAA 3PQ7A 3TXXA 1WY7A 3MXOA 3JQAD 5LU8A 2V7QD 4JFRA 4HF7A 2OBMA 1ODJA 2HRZA 2R5NA 2ZYDA 4G4SP 1CUZA 3NHBA 2MINB 1WQ3A 3F3SA 4MVYA 3SVZA 3W5AA 3AI2A 1HVXA 3LGXA 3WWEA 2R11A 1BA2A 4AYWA 1O9BA 1RE1A 2Q3DA 1IN1A 2I55A 4R2JA 3U3JA 3R9WA 1QG6A 3L40A 1TA4A 2YQ4A 4E21A 1TYDE 2G5CA 3BE4A 4KSCA 2WJYA 3NRBA 4FR0A 2DTXA 1USVA 4TWZA 3IQXA 2PUCA 1GLNA 3OMWA 3BCRA 4GPBA 4MV0A 4NI5A 3JZFA 1UPCA 4JGIA 3H16A 4FFLA 4MCJA 5EJAA 5B1IA 3VPFA 1CD5A 3HXLA 4F5DA 5F35A 5KTYA 4MW1A 3V8PA 5EP3A 1TT7A 3COZA 4LHYA 5IAKA 5L3QA 2HNAA 1M3SA 1IAQA 2GPNA 1EVKA 4KX3A 4B32A 2IZ0A 2H1OA 4WNIA 1W36B 2A1TR 1GA1A 5AXCA 3DYBA 2GSWA 5CB4A 3PHGA 2Y0PA 3V4PB 3VHQA 2CYAA 3BWYA 5AW5A 1ZH6A 4ECAA 4ZK2A 1XTVA 1P74A 2ZG6A 3JYOA 1IRXA 4PYMA 4JI6B 3G8DA 4ZOLB 2XXAB 2GLTA 3ILHA 2GVDC 4Q01A 4PZCA 5LD2B 2D7DA 1PRYA 4A5OA 2O8CB 1SVUA 1JKJB 2GZHA 2ZSKA 4M9QA 3ORQA 3B9QA 1XQWA 2N3ZA 1DO0A 1NMYA 2PX8A 4FJ1A 3JRWA 3WTBA 4EX6A 3K73O 3BHIA 1DBQA 5FYDA 3TBFA 4BMXA 2EX4A 1V96A 3RU7A 4YYZA 1BU5A 1OB5A 4EUHA 5IDQA 3NH6A 1Z6TA 1T36B 2WUWE 3AB7A 1XCGB 1ND6A 2BMFA 3QU2A 1R6DA 2GM9A 2PU7A 3BIOA 2H29A 3DFZA 3SD7A 5JNRA 4W5RA 1N2GA 1DB3A 1ESZA 4RVGA 1I2DA 2C3MA 5HDBB 4EY3A 1W48A 3KR9A 1TEHA 2WF7A 4RCYA 1JWBB 2JI4A 3KTDA 4WMLA 5DXFA 1TAGA 1KVSA 2GLXA 4NFYA 3SXUA 4QHTA 1ZC3A 2PAAA 4EO4A 2PSDA 4JJ6A 5E4YA 1Y6ZA 2XUJA 2Z3VA 3L1JA 1XNHA 3QF7A 2C7RA 5B58C 3B51X 4BBJA 4WLFA 5DRTA 4GVPA 3BD6A 3QXHA 3KEFA 5SZIA 2P6OA 5EXSA 2R96A 4HS4A 4P6YA 1ORVA 2I87A 2YXBA 4LVCA 4GXRA 5ITZA 1FXSA 1OAAA 2YHSA 4FYPA 2XMCA 3J80A 3GLIB 3LH5A 4EJSA 1MB2A 3HKCA 4RACA 4AUEA 5BSHA 1K08A 3ELBA 4RYDA 4EFDA 2ZVJA 2GPAA 3JQGA 1JKIA 3R5SA 2D74A 1VL1A 3A9RA 3OAAD 3VSCA 4RF2A 3HSYA 4W6QA 4NYMQ 5K8JB 3R9XB 2PWBA 2FXVA 5KYWB 4MVJG 1H6AA 2FUCA 4LOHA 3H2KA 3IYLW 4K0RA 4DR7B 4IJMA 4UXIA 2ZXHA 1HE2A 2IPOA 5EP2A 1SO8A 5AW9A 4RIFA 3W1WA 4DJEC 1JQDA 2H18A 1OI3A 3HXPA 1V5GA 1SCNE 1EWQA 4L28A 5HIMA 3R9KA 3QOFA 3EAFA 3CYFA 3KB1A 2VJDA 3LUJA 5HGXA 1AXGA 4O29A 4PSKA 3L8CA 1TU0A 2Q4OA 4MICA 1QZXA 2VL7A 4NX2A 3ITDA 1WZNA 2C0PA 4LC1A 3IIMA 4FMDB 4YXFA 3PTLA 3LY9A 5A5DA 2GD1O 2J0EA 2O0LA 3QKUA 3SSOA 1XPUA 4CR7A 5CB8A 2WMOB 5T8KA 2W11A 2BKUA 3GDOA 2FWJA 3O3CA 4FE4A 4LWZA 1XPOA 3IL2A 1LLCA 1Q57A 2RKWA 3ZTTA 2QGNA 2RG7A 3F8SA 5FBVB 4HUQA 4UOQA 1JKFA 2NV6A 4HEQA 5KNCH 4BX2A 1YFLA 2CMDA 2W7TA 3B1JA 5FR2A 2ZUSA 2PVSA 3PC6A 1ZGGA 1ORIA 3EVEA 3OG9A 1GQQA 2ZVQX 1RWBA 3DP9A 3LX4A 3QVTA 4BNMA 1JSCA 1GPLA 3FWYA 4Y3UA 2DG2A 5AKYA 3IOEA 3UENA 3WYEA 4JAVC 2RSLA 1KI4A 1KZ4A 4WVFA 1GUBA 2C96A 5C7IO 1C7FA 1H05A 1Y6GA 3ASPA 1THMA 2WD7B 3O4IA 2IXTA 3DMTA 4XOPA 1TLLA 2VC2B 3TGPA 1HTBA 3QEMB 2NTNA 4FLMA 1XL0A 5K6AC 1I10A 4OSOA 3GQBB 4R0NA 5DI3B 2ONJA 3H5NA 1H6BA 1I1NA 2CBGA 2OFWA 3HWX1 4G1EB 5I9IA 3JQAB 3ADCA 5LM3A 2XMGA 1C7QA 1U1DA 3IOBA 5CITA 1EGQA 1WP4A 2VT2A 2YZGA 4PCAA 3B1KA 1ZC4A 4AG6A 4CMIA 2ORED 2QLJA 4IDBA 1F0YA 1RHQA 3WLHA 2PX6A 3UB4A 1J2JA 4Q00A 2PM8A 1QHHA 5LL6P 2I65A 1Z16A 2IHJA 2CW5A 1ZONA 2P9YA 2YFHA 3ANSA 5FXMA 3CHYA 1XNGA 4GHWA 3I6QA 3LW7A 4O0LA 4YJHB 2H2WA 4YRCA 4ZC1A 3S6JA 1ZYUA 1PO7A 5KW9A 1Q92A 3CCRB 3RC8A 3MTAA 2AN3A 2V98A 1KJNA 2FN9A 1RAFA 5K3DA 4E2YA 1YGYA 2VDVE 4GMHA 3A6KA 3LLSA 4IINA 2W4QA 3EXG2 3HAGA 3K05A 4NZNA 3UK6A 3FM9A 2JFBA 4AY3A 3LPMA 1FFSA 5CA0F 2BM1A 2ROQA 2O8FA 2FGJA 5ES4B 3N70A 5D1HA 3JR3A 1UEJA 3QA3E 2XUDA 5GM1A 3V80A 5CFRA 3D64A 4GZMA 2XE6A 4O2RA 2QK4A 1OY1A 3ONEA 4D0GA 1YMVA 3INRA 3G5AA 3D31A 3IURA 2Q6KA 1NJ5A 2VRCD 4G97A 3ZLBA 3CFYA 3TMKA 2O7NA 5JJLA 4UFNA 4XZ3A 1I14A 2VSYA 2WTAA 5E6SA 1A9XA 2J3KA 3NTUA 1N6OA 1KARA 4K46A 3A3BA 3W2HA 1J5EB 4LF9B 1LS1A 3KVVA 4F4CA 2A78A 1IOWA 2FMHA 3AFIA 3IAXA 4CPDA 2NV0A 1JILA 1LC0A 1ZUHA 3DE7X 2I6SA 2JIBA 4M9XA 2XB6A 3WV4A 5C0OE 1KDVA 1P81A 1YI8A 1ZEJA 2WD9A 5JWOA 2G8NA 4PV7A 5CB0A 3WQQA 4MEAA 1YH3A 4EFNA 1R6AA 1PEAA 1Y9AA 1SWVA 2CFRA 5K0SA 4P3OA 1YIJB 3CLTC 3VPSA 2WIDA 3O1HB 4RU1A 3U13A 2W6JA 3TQOA 4HDCA 2C03A 2I9PA 1K06A 2ZRIA 3H05A 5L7WA 5L9AA 1T2CA 3KD3A 4QO8A 3TIFA 5BN5A 5A7FA 2XYPA 2LD4A 1A1SA 2JASA 3PFIA 4L5IA 1LQTA 5TS2A 5JZSA 2QD3A 3U7FB 2HLNA 3UAOA 3GCXA 1P1IA 1W5EA 2BRUA 2WLSA 2E4YA 3GUUA 3ZE8A 4ZI7A 3ZZ0A 4WOPA 1J7JA 4JA0A 2GM4A 4X24A 5DYYA 1KK0A 3TIIA 1VG9B 1W25A 2Q29A 2R97A 4WZEA 2ONKA 1TRKA 3I4FA 3IP1A 2UXCB 1YTLA 1KQGA 2H2AA 5TR9A 3HCAA 2H07A 2I2FA 1GYQA 5AJHA 1NR7A 1G42A 1L8QA 3E8XA 3M70A 3NC0C 2Q0QA 4W7SA 3NBKA 1XZ8A 2JAQA 4QUIA 5F1KA 3IERA 3S2SA 2CGEA 4B3GA 2A0FA 2G9QA 3VOTA 3ZW9A 4BQIA 2Q07A 2ASEA 1JPJA 3I5MA 2NO1A 4P0PB 3PUHA 1JXQA 3H94A 1QS0A 2C2OA 4NBUA 2ZT8A 4OV6B 1TJPB 3OUZA 3RC3A 3V2IA 3T61A 1NQTA 4ZYWA 3GARA 1A8PA 1BX0A 3WMWA 2GXUA 4J0DA 4O02B 1AMUA 4W7IA 2BF7A 3N3AC 1KAMA 1NNLA 3N0TA 3MRTA 5DM1A 1XVIA 3NP7A 3USZA 1BW9B 1MVNA 5LXTA 2SECE 2R00C 4F60A 1I01A 3QENA 5CT5A 3SDZA 4JLMA 5FBKA 3RTCA 3T7KA 4Z4UA 2FR8C 2AMJA 4BJ1A 2HGZA 5DM70 3A35A 3CX6A 3KAPA 4LRWA 2QUKA 2SBTA 3B3GA 2YH2A 5DX1A 4DWJA 4F1KA 1C0KA 1I30A 1JEAA 4AVZA 1SOMA 5E1BA 5KTRA 3K5WA 3E5HA 1E3IA 1RJDA 4EB0A 2O5EA 3AC0A 4LPSA 1O8CA 3P0IA 1CR0A 4KE8A 3VPHA 4J8PA 4HN9A 3U0BA 5E9JA 4KBFA 5FOTA 5DHFA 3RSOA 5AW2A 4Z2AA 4TLAA 1A4RA