3PENA

Structure of archaeal initiation factor aif2gamma subunit delta 37-47 from sulfolobus solfataricus in the gdp-bound form.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
403
structure length
403
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Structure of archaeal initiation factor aIF2gamma subunit from Sulfolobus solfataricus in the GDP-bound form.
rcsb
source organism Sulfolobus solfataricus
molecule tags Rna binding protein
total genus 101
structure length 403
sequence length 403
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3penA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3penA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3penA01
4P0TA 4Q4HA 5CITA 4PHFA 4A36A 4M1TA 4ZCLA 2F3RA 1TQ6A 1EFTA 2OEPA 4A8JC 1EWRA 1R10A 4EJSB 1X3SA 2J46A 4IOLA 3C7KA 1IN4A 1TX4B 2P6NA 2W2TA 5FOUA 5BQ5A 1OSNA 4JYCA 3HDTA 2MSEB 2OCBA 1W87A 3FMFA 4OQFA 5GJWC 1Z28A 4IXMA 1CLUA 1NN1A 1Z6TA 3H2YA 4Q9KA 1KAGA 1KGDA 4DEXA 5JZVA 3AP1A 3BK7A 3SFVA 3TAHA 1JR3D 1P60A 3LX8A 3R9IA 2OO7A 4EPVA 1OJLA 1Z0KA 4ABYA 3IEUA 1OH7A 2ZRIA 4Q7KA 3VR2A 3CNLA 4W7SA 2BHRA 2QGZA 3R8FA 1E2QA 1SVMA 4BFTA 3EPJA 4JL8A 3ASYA 2VNIA 4ZDKA 4MGZR 2ANCA 3CX8A 2IYSA 2MMGA 2OBLA 2A7QA 2X3UA 2IXFA 4IOKA 3A36A 4IDPA 4US2R 2R6DA 3HU1A 5TDHA 2RC6A 3A6PC 3T15A 1YZKA 1DADA 1U0HC 1M74A 4NCIA 2J7KA 2MMCA 3HJNA 3CMEB 2QMHA 2WM9B 1L4UA 5LDDC 2GETA 2BM0A 3CPEA 5EXPA 1JB9A 2IK8A 2IYWA 2G0TA 2B7BA 5CJ2A 2BMFA 4DZZA 2XOKD 1NF3A 4G5OA 5FBRB 3VFDA 4WVFA 4TYWA 3TLXA 3T06B 1XXHE 1LNZA 3MWKA 1CR2A 3AP2A 3WMFA 2VA8A 2FFAA 4L8GA 3AKCA 1DDGA 4NCHA 1AS2A 3GFTA 3QEOA 1P3JA 3MG9A 1VYUA 4IKEA 4Q1DA 2OSBA 1YZTA 4G1BA 5D3QA 4PAQA 4DCUA 1CRPA 1G7TA 2H92A 2ZJAA 3SS8A 4TLDA 1OH6A 2O8DB 1HE8B 4FD2A 2ZI6A 5LPNA 3LW7A 4Q00A 4XH9B 4XWAA 2DWPA 3ZIAA 3AVUA 4PX9A 3U3KA 5FPKA 4QKQA 1RRCA 2ODBA 2IUTA 4JLMA 1G3RA 4JL6A 2GEVA 5THXA 1VQ5B 1ZIOA 4Q9HA 4DSTA 3U60B 2OLKA 1A8PA 1KKLA 2R6CA 1ZINA 3K0CC 4FMDF 1E99A 4Q1CA 3I61A 4M9QA 3B5JA 3TKLA 4ARZB 1KNXA 5DE3A 1IJFA 1U98A 1EG7A 1DOAA 4O2RA 1T3SA 2CK3A 3RRNA 5FTNA 4EPRA 1KY2A 1EWQA 1RJ9A 3ND9A 1MOZA 1N5JA 3IKJA 4XSHA 4KVAA 1KJYA 5CIQA 3ZQJA 3CBQA 1OLOA 3UMRA 1OFUX 2HJGA 2CCKA 5L3VA 3FDIA 4EFNA 1T0JB 1GNPA 1G3UA 1T5LA 3RNLA 2BSAA 3KQLA 1PVOA 1G19A 1UM8A 5FI1B 2V1XA 2IYLD 4JJKA 3RS2A 4QM7A 1GRRA 2ZJOA 1WBDA 1RZ3A 3QENA 3QPVA 4E5UA 1EK0A 3I72A 1KK3A 1X8JA 1FRQA 3OZVA 1MABA 4XVUA 4EH1A 1RJ9B 1FPMA 1UFQA 1LS1A 3GEHA 4Y0AA 4TMVA 3LV8A 4TLCA 2XNJA 5SZHB 3SI7A 1R6BX 2ZTSA 1XPRA 3AQ4A 4EPXA 3D7MA 4PHTA 3W5HA 3BH0A 1GUAA 3HR8A 4DVGA 1QVRA 1VQ8B 5H68A 1HEIA 4EPTA 1ZD1A 5A5GA 2BV3A 2WJGA 4KSCA 1HUQA 3T12A 4AIIA 5KNDA 1Y3AA 1XPUA 3UK6A 4EPYA 2ONJA 2AX4A 2NGRA 2NG1A 1E64A 4PZZA 1MABB 1R5OA 4I99A 5FBQB 4YMVA 1W4CA 3QF4A 3R7WA 5C1BA 2C5LA 3TK1A 1KKMA 3LO5A 2JEOA 3WBJA 5JJIA 4TZ0A 5IT5A 2Q0HA 5CDFE 4FCWA 2P0EA 4ZKEA 1CJVC 2CJWB 1NVUQ 3ZVMA 3LA6A 3TQFA 3U7EB 5E7JA 1TEXA 4NL4H 4OHYA 2W6JD 4GL2A 3ICQB 2RH5A 3ECCA 3THWA 1FTNA 4KLNA 3WP0A 4QBGB 3HR7A 1N5LA 4QGFA 2AKAB 5C4GB 3P32A 1W5SA 4JLOA 2CXXA 1NLYA 3ZQ6A 4LCBA 4WZ6A 4CEIA 4PQFA 3PFIA 5AUQA 3IDQA 3T1QA 4YHBA 1W44A 2DWQA 3QF4B 2VQSA 1EFCA 3QBVA 2VHQA 5CIWA 3R7WB 3MWLA 3T35A 1J7KA 2JIZA 5J4KA 5JWRA 5AUPB 1AZTA 1YRAA 4G1VA 3CONA 3KB2A 4JVSB 3PQCA 4R98A 1NBME 1ZIPA 5FOWA 4F38A 4OQXA 3MSXA 1NIJA 3CCEB 4W5JA 1KI9A 3VR3A 2O8CA 1P2UA 4B6FA 1F6BA 1S4QA 2J0QA 4U9UA 3CCMB 2ZE6A 3G82C 4B2IA 3THWB 2QL6A 4AK9A 1YR8A 1CBUA 1XDBA 4CVNA 2XNSA 5AUNB 2C99A 1UKZA 4Q66C 4F7DA 2Z83A 1QFYA 5FI0B 3S1AA 3QPWA 4MQBA 4X8MA 3C4JA 3M6AA 3EC2A 1SVLA 4BRWA 1EWYA 1G4UR 4GP6A 2QRNA 2YZ2A 4DCTA 2NO6A 1NSFA 1YU9A 1Q1BA 4RD1A 3OIYA 4GI7A 5AK0A 2ZITA 1N0WA 1FUUA 1A1VA 1VIYA 2GZHA 3B7GA 3BB3A 2G9NA 3ADCA 3R9XA 4DQLA 1E2HA 1SVSA 3QG1A 2FEMA 2O8CB 3KFVA 4IEIA 5DN6D 1OH8A 4A9AA 3UPUA 4BZQA 4Q7MB 4IEEA 3CZPA 1N6HA 2CVFA 4PTLA 2ZR0A 2ZI9A 4TTPA 1TTTA 2VHTA 3LDAA 4BASA 5GADl 4L9WA 1D8TA 1VG8A 2EU8A 3DVLA 5BN5A 2CNWA 3K70D 3FB4A 4Q03A 2H7VA 2OCYC 2A3RA 3EC1A 2CRVA 2ZSEA 3GEIA 3TVDA 3W5JA 3AP3A 5JEDA 1MH1A 4X8LA 2RGCA 2ATVA 3TR0A 2WWIA 2ZUCA 1T5IA 2ZYTX 5SZKB 5L3SA 1JPJA 4HAYA 4HDQB 5KDLA 1XJQA 1IN8A 1FQJA 1Z08A 2GVZC 3GJ4A 2UZ3A 1N6IA 2VYQA 2FNAA 2VPPA 1XB2A 1U8YA 3KQUA 1TAGA 2O8FA 3AF3A 2WPDA 4JVMA 4TYQA 1TUIA 5B58C 1DPFA 1R0WA 4KI0A 221PA 3KKMA 2QU8A 3KXKA 4RKEA 2XSZD 4NYMQ 2REBA 1QHNA 4UKDA 1Q1QA 2O5VA 1G8GA 3QE2A 2RKOA 2ZJ8A 4RVCA 1XBTA 4U02A 4FINA 2GDJA 1EFHA 1XMIA 3VTKA 1D6JA 5IF9A 2VP5A 2FSGA 4URWR 3EZ6A 4DLYA 4CT5A 1QHHB 2KI5A 3GJ8A 3C5CA 5JJLA 3I8XA 2W00A 1UBFA 1U9IA 4E22A 1JECA 5FUWA 1N3BA 4A2QA 2FN4A 4AI6A 3RS0A 1MV5A 4Q1FA 4QHSA 1GITA 1GKIA 1ELOA 1J70A 3K9HA 4X8HA 1JR3E 3CNOA 3OFND 2Z6VA 1HY3A 1YR6A 3X1XA 3CPJB 5EMNA 4URUR 4B3DA 4GDFA 4FW9A 3E2IA 1DAEA 4OJQA 3W3ZB 1N6OA 1MO6A 2OXRA 2ZSBA 1JQLB 4EFLA 5DGXA 3F8TA 1QHIA 4KCGA 3CWZA 2OCAA 4JLKA 1QGZA 2QE7A 4NYJR 2GXAA 4QC2A 4NBSA 1WB9A 3CO5A 1RRPA 1FZQA 3ZVRA 4DDVA 1L4YA 3OEED 4BLOA 1ZNZA 3UMSA 1FX0A 2J0VA 4P4TA 5EXXA 2KBFA 1GRNA 2G0NA 3TRFA 4ESHA 2PIAA 4JLAA 4JBWA 2QTZA 1GKYA 4URXR 4ACAA 3EA0A 3K09A 1IJEA 4LX0A 1QGYA 1OPXA 3AVXA 2NTYC 4CW7A 4F92B 3K53A 2IHYA 1KC8D 2A30A 1KNQA 3I3SR 1YJWB 2R6GA 1G16A 1KHTA 2NIPA 2QNRA 1J99A 5KSZA 2FZ4A 4XD7A 2QSZA 3WYGA 3L8ZA 2G88A 2W6ID 3EX7C 4TSFA 2RC5A 4HB4A 2NO1A 3NDBB 4DCSA 1H8HA 2HLDA 1ZMXA 2JJ2D 3CRMA 3VR1A 3CCVB 1LB1B 2WAXA 3CPHA 3HU3A 3AVTA 2D62A 3AB3A 3BXZA 4LYFA 1BMFA 4FMDB 3TNFA 1H8EA 4DCVA 2VSOA 1J9ZA 2OAQ1 2ZUBA 1Q7YD 1NJFA 1G9XA 1NRJB 4DIDA 3PCRB 2R44A 1W0JD 1CIPA 3KB1A 4M1SA 1Z22A 2CHQA 4Y0VA 1T0HB 2P6UA 4NH0A 3ZZ0A 5JRJA 1GFIA 1NSTA 1XE1A 3NIBA 4HB3A 4DUGA 4F91B 3GP8A 4Q4AA 3I5YA 5F98A 3BGWA 3NC0C 4AC9A 4QBHA 1KTVA 1HV8A 4BFWA 4BLPA 4M0LA 1YHNA 5EE5B 4WAUA 1Q44A 1G6OA 1P2VA 2ODNA 2GEUA 4JLBA 2A5GA 4B32A 4DB2A 5A4JA 3SQWA 1BX1A 4L5BA 1D9XA 2XXAB 3CCSB 2H5EA 3A1WA 1MRNA 1AGPA 2QP3A 3GLIA 4URYR 3TIFA 2F6RA 1MT0A 5GVRA 3PVSA 2BBTA 1GL9B 1TADA 1Z2CA 2RGBA 3A58B 4DHEA 3P1JA 2OFOA 2CVHA 1QX4A 3KDSE 4B73A 3LLMA 1ZM4A 2Q6TA 4V02A 1WQ1R 2W2XA 5JS8A 1CRQA 1Q12A 2RGAA 2ZSFA 3EZFA 4NZYA 4LHWA 1BH2A 1PUIA 3DOFA 2QTVB 4DLZA 1A7JA 2CBZA 4IOMA 4P4SB 1G8PA 3U3MA 1QVFB 2JLZA 3QFCA 1P72A 2HV8A 3K0FA 1E9SA 4P32A 1OV4A 1ZM3A 3AEZA 2QBYA 1OXUA 4JLJA 1VYTA 2V4ZA 1GVNB 3H1TA 1WMSA 5FUYA 1ZVQA 3H4MA 5J4YA 4Q48A 2K5UA 4BPBA 1UEJA 2AD1A 1AIPA 4BGDA 1S1MA 1VQ6B 1R5NA 1WRBA 1VHTA 2BOVA 2E9SA 4IXNA 4KV9A 2ZRNA 2OE2A 2RHDA 4M9ZA 1TU3A 4KSBA 3U44A 2BVNA 1DDIA 3PUVA 4MRSA 3QSYA 1N6KA 1WA5A 3HPQA 1QHXA 4LRWA 2VO1A 4UXIA 4LV5B 1Q20A 1QG4A 1COWA 4JBYA 3E20A 5CYOA 2ZYVX 4TT3D 3GPLA 1G7RA 3N70A 1E69A 1EFRD 3SJCA 2IF2A 3K0FB 3QNUA 2QBYB 2ZE7A 3X1YA 4JT4A 2EWVA 1TL7C 2EFDB 2B8TA 4FIDA 1FP6A 1D1NA 3P27A 2WJVA 1VPLA 4JLDA 1X8KA 3A1UA 3THXB 3PUXA 3NTUA 4CIDA 3AVWA 1Z6XA 2ZI3A 4I81A 2JLQA 1D5CA 4IDHA 4F4CA 3LBIA 1PJRA 2UZIR 3H86A 3U44B 2EQBA 3OHMA 2OHFA 1KO7A 4Q4LA 5EUMA 5HCNA 3O47A 5J5CA 4NYJQ 1IOZA 1XTSA 3LXXA 4KXFB 3THOA 4DJTA 5IDVA 2MSDB 4NMMA 4B3CA 4C7OA 4PPQA 4UNSA 4TQ9A 4AKGA 2IS1A 1L2TA 4MKFA 3W2HA 3CZQA 1IQPA 2FSFA 1KSGA 3U4QA 4PHGA 3RRYA 1M8PA 4ZDWA 1VQLB 2V9PA 4PSVA 4NU0A 4Q9LA 2WMNB 3I56B 4BEJA 5TVKA 1IB0A 5JMTA 1GL6A 4AURA 2IYYA 1OXVA 1HYQA 4B2PA 4CEHB 3QVVA 3KJGA 3KKNA 3VU9A 1QH0A 3FPKA 4Y9RA 1K8AD 1MRSA 2A78A 1UDWA 4M1YA 4QL3A 4RFSA 3VKWA 1FOEB 2ORIA 4DT1B 1DE0A 4M53A 1F2UB 2J7PA 4PC1A 2ZSDA 4KU4A 4RZUA 2PH1A 2EYQA 2BGJA 1XU4A 4A6XA 2QMOA 4FWIB 1KI6A 1DO0A 1SHKA 1NNEA 5AJWA 1X6VA 4NCJA 4C43A 1K9MD 3BWDD 3R20A 3AF2A 4PO8A 3QF7A 3VU9B 4RFSB 2YWHA 1NMXA 4US0R 1M6NA 2RCNA 4D4KA 3CCUB 1DARA 2WV9A 2W58A 3C41J 1TVCA 2BMWA 1P4SA 4EKDA 2AD5A 1II9A 2XNDD 4TZ6A 3F3YA 2VF7A 4TWZA 1I4TD 3QXSA 2ZRBA 3RC8A 4HEJA 3E1SA 4HYYA 3JQPA 3QY0A 4A0RA 4JYBA 4B35A 1KK1A 3QKSB 4HE5A 2GRJA 3V4RA 3NDPA 2GVDC 2AFHE 1W47A 5L8VA 5DI3A 2BN4A 5EE3A 3KUCA 1U90A 2DCUA 2AFIE 4XSGA 4YC7A 1T8UA 1K5GA 4I1VA 1RVDA 3HYRA 1VECA 4ON9A 4HLQB 3DO6A 1YZQA 3VHXA 4E09A 1G21E 4Q1BA 4Z8YA 2ZVPX 1OGIA 1HT1E 4ZIRA 1NJID 4Q18A 2BEKA 3OJWA 1DBSA 1LY1A 4C0JA 3T1OA 4A6PA 1G8FA 2WSMA 2ZUDA 3NH9A 3B8HA 4A0HA 5LD2C 4TQAA 1VQ4B 1E98A 4DC9A 4GSYA 1AS3A 1NN0A 2XAUA 3QXCA 1CU1A 3KQNA 2C77A 1HE1C 4RZXA 2HXSA 2Q9AA 3WNBA 2YINC 1BX0A 4BEBA 3OE7A 2ZSAA 5JI3E 2C78A 1TF7A 5CK4A 1S1CA 2ZREA 2OAP1 3IBYA 1N0VC 1H85A 1KAOA 2F1IA 2XITA 1MO3A 3LQQA 5HE8A 2GCOA 4TMTA 4BRUA 5AUOB 5B57C 1BYIA 5HR5A 3A4NA 1A4RA 2CLCX 4P31A 4P3YA 2QEXB 5HCIA 3A1SA 2OK7A 2N42A 4MUAA 2EFGA 1HT2E 3ND8A 4HB0A 3W34A 3I1FA 1TNDA 3ZZTA 3JQQA 5CLQA 3NHBA 3JZMA 3ZDQA 3CRQA 4DRZA 5C2JB 3KX2A 3T5DA 5CK5A 1TLLA 3LNCA 2WAYA 1GO2A 1DAHA 3A4MA 1NI3A 2A5YB 2V7QA 3EIHA 3GLHB 4M22A 4OI1A 2ORVA 3PEVA 5BW8A 1NG9A 3GLGB 2FOLA 4I1UA 4RCZA 1XD9A 2GCOB 1DO2A 2A9KA 2B92A 2EFCB 5EP1A 3TMKA 1NN5A 5FFMA 3LVBA 1KI4A 1T3HA 3Q85A 3SN6A 3CCQB 5M04A 1NDHA 2WZQA 5JLJA 3DZ8A 3EW9A 621PA 2JGNA 1S96A 2OUKA 3SZRA 1NLFA 4RD4A 1SXJA 1QG2A 4LJ7A 4PZYA 3UATA 2VBCA 3SE0A 4JSTA 4ITRC 2ORWA 5DYIA 4G0NA 3M1IA 4GMXA 4D6PA 3IIKA 1ZP6A 2C9YA 4PC7A 2PLRA 3EG5A 3CRVA 4LV6A 5DISB 4JBXA 2BCGY 4Q4HB 3LRPA 4FMCF 1GZSA 1LF0A 3ONWA 1G5TA 1ESMA 4FWTA 5EZ5A 1GOTA 3NVAA 3DEFA 2WWFA 1VCMA 4NPHA 3W5UA 4BUJA 4DDTA 3AKYA 3U6BA 2BPOA 3W5IA 1SXJB 1Q81D 4RD0A 1VHLA 1XJ0A 1JXOA 4Q21A 4FCTA 2A5JA 2GQFA 4Z8XA 1FRNA 3EWAA 2DFNA 3CWQA 4V0NA 4V0MA 3U3OA 2ZQ5A 4WXPA 1PUJA 1Z8FA 2Z43A 4TTRA 3PV0A 2OXCA 1KI2A 1IY1A 1X1RA 2PT7A 3MJHA 3C15C 4AY2A 2WMOB 1M34E 5CM8B 2R65A 4ZDJA 2XJ9A 4EIWA 2OBMA 3LY5A 4LHZA 2GESA 3QKUA 1DEKA 5BYJA 4HLUA 3ZYCA 3ZIAD 5GJCA 4EQ6A 2JLXA 3Q5DA 4PGOA 2QM7A 5AJXA 2JLSA 3EZ7A 1TPZA 4Z1MA 4ZI2A 3K8YA 3L0PA 2QROA 5JSZA 4PO9A 1Z29A 4X8OA 3ZBUA 1P2SA 4OKSA 2JLWA 2DFKB 5FOXA 3CXCB 5HKKA 1E2DA 1UKEA 1XEXA 4BZXA 2I3BA 1I2MA 1OXTA 2X2EA 1CEEA 5A0FA 3ADBA 2ZRMA 2CK3D 1BQEA 3B1ZA 5KSOA 5LD2B 3WNDA 4FN5A 1KOFA 4AF6A 1YHQB 3ZS9A 2IC5A 3AKEA 3T1VA 1HH4A 2BKUA 5DHAA 3UANA 2PZFA 4PANA 3TUIC 3N2EA 2Q21A 4EQ6B 5B64A 1E1RA 3KKPA 4IDNA 1E2FA 4LBWA 4MKGA 4YMSA 1N5KA 4B74A 1WP9A 3BB1A 3LVRE 5DYGA 3EPHA 1ZM7A 5IRCD 1R8SA 3I62A 2BMJA 1UJ2A 4ZO4A 4B3BA 2D06A 2VL7A 2XZPA 4EUNA 1XEXB 2C03A 5FOVA 2OZEA 4N0EA 3CUEF 4W5HA 2SHKA 3NXSA 4YQFA 5GVSA 3T61A 4TL6A 4OHVA 2BIFA 3ZS8A 1E62A 1FQKA 2AWOA 3G5UA 1GG2A 3MGCA 4EFMA 2ZVQX 5ANRB 4DB4A 2IXEA 3MJRA 1IY2A 3D6TB 1XFAA 2BWJA 4R71A 4XTRA 2ZI7A 2V1UA 1JEEA 2Q9BA 4M1OA 2CL0X 1BOFA 1QVGB 2WTUA 1DAIA 3LD9A 4O25A 5CYPA 2OILA 4NDZA 4NYMR 2ZRCA 3B85A 3BIFA 3TAUA 1YE8A 1YI2B 2QTFA 1JA1A 2D7DA 1LV7A 3IO5A 1KDPA 4EPWA 3BOSA 3AKDA 4Q02A 1XX6A 5JHGB 2RGDA 3MWJA 4Q1EA 4ZPXA 1CULC 4A2PA 4K1XA 2IYZA 2QAGA 1XMVA 2VTKA 3LLUA 4JS0A 1FL9A 2VHCA 1ZM9A 3NG1A 3AGQA 1M1KD 4B47A 3OIWA 1SVIA 3W5VA 1E79D 2GJ8A 1W4AA 1Q57A 2EVWX 4B2LA 1C4OA 2RGNA 5KU1A 4M1KA 3W2GA 2IXGA 2QM8A 3CX7A 1FFHA 3W8RA 3DZDA 1UEIA 3ES9A 4PR0A 2DEUA 2LCFA 2F1RA 4H1UA 1NKTA 1D2EA 1II8A 1S3GA 4KJZA 4LDJA 3TVTA 5IK2A 1D9ZA 5EE0A 3TSZA 3OEHA 3QFRA 4HUQA 4UQOA 3OZXA 2QAGB 1ZAKA 1DAMA 2WWXA 1M7BA 3L0OA 4JSYA 1N8RD 4KAXA 5CJPA 1NIPA 3TH5A 1E94E 5AJYA 2JIZD 4H1VA 1XMJA 4JIMA 3GJ6A 1R2QA 2GXUA 3TUJC 3U7HB 1T4GA 3RS5A 3WNCA 1TF2A 1E6CA 1KO8A 4L15A 1XCGB 3TW8B 5E7IA 2GBLC 1Z6AA 3LVQE 4ZDIA 2BJWA 4UNQA 3A1VA 1U9IC 1Y63A 1VQMB 521PA 3KXIA 2HF8A 4MA4A 3G71B 1F48A 1JXMA 1II8B 3B1VA 3SJBA 1ZD8A 4C2TA 1E1QA 1AQYA 1GAJA 3K9GA 5DIFA 3QFSA 2H16A 2OBNA 4HUQB 1O87A 1HQCA 1OFTA 4A2WA 2FF7A 1GJRA 1UADA 1PLJA 4TYPA 1LF5A 2OCPA 3KUDA 3FHCB 1G8YA 1JB1A 1QDEA 1XD2A 4HLDA 3TR5A 4XWOA 5FL3A 4II7A 1G64A 3VKGA 5HXBA 5DLQC 2VP6A 3EXAA 4Q5IA 3SEAA 4OHZA 3NEYA 1RFLA 4AKIA 4AKHA 3B60A 1KDTA 3G6EB 2ZJ5A 2I4IA 3PITA 5EXSA 4YAUA 4CEIB 2KBEA 2REXB 3G4SB 2CNWD 1IONA 2QUZA 1P62B 3GLHE 2BEJA 1RC8A 1KD1D 1A2BA 2GJ9A 2OFXA 2VP0A 3RANA 5CB8A 1VG0B 3K09C 3U3RA 3GLGE 3JQRA 1EXMA 3LH5A 4Z51A 3Q72A 4DKXA 2C98A 3GJ7A 3WY9A 1XD2B 5C46F 1CNEA 2OLJA 4E07A 2JJ1A 2J45A 2R2AA 3AH8A 4BLQA 2OFWA 3OZWA 5B2ZA 3ZGXA 2IL1A 3HWSA 2VSFA 1V43A 1F2TA 1LTQA 2AL7A 3VMFA 5H70A 1R5BA 4PFSA 2WPDD 3S1AB 4HATA 4HZIA 3SR0A 2ZJZA 2GZAA 4FK8A 3SOPA 8OHMA 2CE2X 4G3XA 2XEXA 1R0XA 4G5RA 4RY2A 3RHFA 2CEAA 1OIXA 3WHKA 4LJ4A 3DHWC 2AK2A 4G5GA 3ZZUA 2BBWA 4C0AC 2FEOA 2X8AA 1OFHA 3FOZA 4LK2A 3W2IA 4JL5A 3IBGA 4HB2A 1OHHA 2QQ0A 1ZW6A 1FNCA 1F2TB 3BERA 1XEWX 4BE7B 4LOAA 3BORA 1KO5A 2NMVA 3FMOB 2IHBA 2JA1A 1M7GA 2PCJA 4Q9IA 4TMXA 1P75A 1OFIA 1AMOA 1C9KA 2RMKA 2Z4RA 4NCKA 5EQTA 4KODA 4C2UA 4CEJA 1AK2A 1Z0IA 2V55B 1OH5A 5L3SB 4CT4B 2GBLA 3CIOA 2QE7D 4FMCB 4Q01A 4OQLA 4Q7LA 1NVVQ 1I4DD 1NLZA 2IA5A 5JI2E 3TGPA 4MUBA 1G8HA 4MITA 4N0DA 3E5HA 2O8FB 3MHPA 1E9CA 3FKQA 4B3FX 1R8QA 1P9NA 2GEDA 1T91A 4MGYR 3B1WA 4IRUB 2ZI4A 2GJAA 3A8TA 3CKLA 1GVHA 4NP6A 3EPKA 1FW6A 1KQSB 4K81B 1DVRA 2PCLA 4WW0A 3MCAA 3M0EA 2HJVA 3IIJA 4CEJB 1SGWA 2FPMA 3NC1C 4LYHA 4DSOA 4BFZA 2WJHA 1RYFA 2IS2A 3R8CA 1ZUIA 1OE0A 2QRZA 3QUSA 3IUYA 1PLKA 4XD7D 3FFBA 1B23P 2QMUA 2FJUA 4TSFD 4ASUA 1U81A 1N6RA 5G3YA 5C18A 1H8HD 5TV2A 4YAWA 1N2CE 1Z5ZA 2HLDD 2ZRGA 1FNNA 2Y8EA 1BMFD 2WKRA 1OXXK 1H8ED 4LJ5A 2HCBA 1OKKA 2ANBA 1H42A 2QA5A 4IVRA 1Z6YA 4PZLA 1TQDA 1U94A 5LBIA 1VKJA 2YNMA 1EESA 1NVXQ 5E3HA 2QA4B 1KSHA 1XWIA 3M4YA 3VAAA 4HI0E 1NMYA 4U00A 1W46A 5IHPA 1FX0B 2YOHA 5F2EA 4DUGD 4OJKA 3LO8A 4CF7A 4S2EA 3BB4A 1E2IA 4URVR 3CCRB 121PA 1UF9A 2YC2C 2XTNA 3PR1A 4HSEA 1ZU5A 2TMKA 5L3RA 3HU2A 5TMPA 2WKQA 2GK6A 5E95A 2AWNA 5K8LA 1VIAA 2JJ8A 3D31A 1ETUA 3OAAA 2PEZA 5F3WB 1HA3A 1IXRC 1DAFA 2UKDA 3LFUA 4PAOA 3B13B 4C0BA 1P7CA 5LB4A 2CE7A 3PIRA 1E2NA 1R0YA 4JKYA 4XVRA 3IQXA 1D2MA 2CMKA 3RS4A 1G7SA 3F5FA 5SZJA 1D2NA 5DHFA 1JNYA 2F55A 1Q3HA 4D25A 1G7CA 1TF5A 1T3LA 4ERNA 1FNMA 2HEIA 4LZZA 4NCNA 1ZYUA 2LKDA 1Z07A 1U99A 4H9GA 2WWGA 4O2LA 1JR6A 2ZE5A 3Q8XB 1UMKA 2H17A 1FNBA 3THYA 3R9WA 1Z6GA 4PSKA 2EFEB 1XCMA 2HCJB 2J0SA 4HAXA 2DBYA 2PJZA 2WWWA 5CB6A 1Z2AA 5J4HA 5TR9A 3SJZA 4UAJA 4ZCMA 1F60A 1QHSA 1QFJA 4YXWA 4B76A 4MRVA 3W2FA 2W6IA 2ZRKA 2PJRA 3ZJYA 3W9YA 2ZJYA 4LJYA 3CC2B 2J1LA 1I4LD 2CLDX 5L3QA 1US8A 1T8TA 3JVUA 2G1JA 2GJKA 4XJXA 1U2RA 1RPZA 2FA9A 4Q4AB 4YLGA 1IY0A 2DY1A 3X1ZA 2O0HA 4L16A 4R2HA 4DLXA 2G83A 2XB2A 2KE5A 3QI2A 3TE6A 2OTJB 5CLLA 4IHQA 3X2SA 4LJ9A 2HDNB 5FBWB 2AR7A 4I1SA 2XZLA 2R6AA 1G6HA 1JAHA 1G3MA 3THYB 1COWD 1W34A 1DS6A 2XNCA 1W48A 5GV7A 3RC3A 1IXSB 2J0UA 2L0XA 2GAOA 3L2OB 4BQSA 5FTLA 3GLIB 1XD8A 3B9QA 1OIWA 3H84A 3PEWA 2VRWA 2FG5A 1ZCAA 2KWIA 4TL9A 4KYUA 5HE9A 5L3QB 4N1AA 5G3ZA 1L7VC 2J9RA 2VNJA 2ATXA 2IF0A 1KJZA 4PPFA 4HE6A 4U5XA 3MAAC 1FP7A 1CKEA 2EIXA 1XEWY 3BFXA 1YRBA 2GK7A 3BH7A 5JEEA 3K9NA 2ZRDA 4NKRA 3SBEA 4B33A 1EP2B 4YMUA 3UWOA 4UXHA 1YZLA 2O52A 1W0KA 5JWOA 1YZNA 1Z63A 4B71A 1ZM2A 1WDTA 2D7CA 2Q9CA 2JCSA 4L9SA 4V03A 2DR3A 2IYRA 2VH5R 3KQHA 4RD3A 4YAFA 1S0UA 3V00A 4DLUA 3AVPA 2A2ZA 4NE2A 4YMWA 1AKYA 1UDXA 4QNRA 1FDRA 5B30A 2A5FA 5BN3A 3OZUA 2C04A 2KJQA 5H59A 5KYKA 3DDCA 4OK3A 4M9SA 1JJVA 4PSAA 3PG5A 2N46A 1BYUA 1DG3A 1OB5A 3K1JA 4TLEA 5FBLB 2J7PD 4BFSA 2VLIA 2LWIA 4M1WA 3REGA 5LB2A 5JFGA 2QPAA 4PQYA 1B2RA 1XTRA 2XJ4A 1WE2A 2KSQA 2ZM5A 1VTKA 3KTAA 1SZPA 1E0SA 2QQEA 5CM9C 2ECKA 3LQRA 1QHGA 1VQPB 3NBFA 1CS4C 3CRW1 4AF7A 3EA5A 3IILA 1W36C 1SQ5A 5FA6A 5KHOC 4TYNA 4HAZA 4D0GA 4ZI3A 4CGZA 5JJKA 4Q1AA 1EFRA 4KFRA 1W2GA 3GJ0A 4D26A 4JVNA 4F4IA 3IEVA 4FMBB 1YZUA 4C7OB 4DLTA 1XZQA 2Z4SA 5FUXA 4GRAA 1Z3IX 1ZNWA 4QXAA 2IS6A 2J5XA 2WSSA 1N0UA 4CYMA 4YDHB 3U4QB 4B75A 2VSXA 2PX0A 4P33A 3KTAB 1GDDA 1CF4A 1IHUA 1MKYA 2J41A 3SYKA 2E87A 3K0AA 5BN4A 3QOFA 3H0KA 1OYWA 5EJEA 1SXJC 2QSYA 2R8RA 3OIVA 2F3TA 1UPTA 2H57A 2CHVA 2YJTD 3IGFA 1JA0A 4EAQA 1KI1A 1UKVY 3EARA 2IYQA 1W2BB 1NKSA 1GAWA 1IM2A 3QKRA 4G1UC 3TBKA 2RB4A 3FKSD 4DLWA 5TARA 5FBVB 5EP4A 2AKYA 3PEYA 1A5TA 1KIMA 5KPJA 2VYFA 4ACBA 4JMPA 4LI0A 4WOPA 5G53C 2FPKA 5FL7A 1CJTC 2R9VA 4CDGA 1C1YA 2PX3A 1KI6B 3BD9A 1FUKA 3KKOA 3IQWA 1NG1A 1AJEA 1ONBA 3K0AB 2OV2A 4ZCIA 2ZXUA 1XPOA 2RGEA 1X86B 2W2VA 4LJAA 2VP4A 3UIEA 2ZRPA 1M1YE 3OE7D 1EX7A 2YOGA 2QT0A 1YIJB 1ESNA 1FTSA 2ZRJA 3EZ2A 1VQNB 3QKRB 2FX3A 5CDFA 4DQKA 4F7WA 2VP2A 3SJAA 4D0LB 3GCGA 2IYXA 4B48A 4Q9JA 3E1YE 4EDHA 4D4JA 3CH4B 3KKQA 1KI7A 1IAQA 1VCNA 1KJWA 1SVWA 3FPAA 3W3AA 4AKEA 2ZYWX 4PXAA 4AG6A 1IN7A 2VHUA 1KY3A 3U7FB 2V54A 4HLUC 5DI3B 1K5DA 4A82A 1P6XA 3GJXC 1E4YA 4DDWA 5AN9A 2JDID 1PZNA 2V7QD 3BAFA 5JHHB 3RSOA 4ZIRB 2CNDA 1NBMA 2VHJA 3QXXA 1QFZA 4QG7A 1OGJA 1NY5A 4IJMA 4ZV4A 2D2EA 1FMJA 2FFQA 3QVUA 4MGKR 4WZAE 4BPRA 1U8AA 1XNJA 1XJCA 2FGJA 5HTKA 3AUYA 4D4MA 4JKIA 3Q7PA 5FTJA 4LGMA 4BFUA 3O8RA 1Z0AA 2ZRAA 1W49A 1SXJD 2EW1A 3K9LA 1IXZA 1JQJC 2P5SA 5AR1A 1Q82D 4K46A 3GEEA 4DDUA 1ZU4A 1TMKA 1TQ4A 2B21A 3AVVA 3RYTC 1N25A 1E9EA 2QY9A 1EP1B 3LXRA 2BC9A 2IWHA 4EJSA 2BBSA 2Q3HA 4Q4JA 4OI4A 1T6NA 1KYIA 4FXPA 3AVYA 2H8KA 4WQMA 2F1JA 4HUTA 1UAAA 5FTMA 4MYTA 4YALA 3FHTA 1W36B 2ZJ2A 4HAUA 1VQOB 4M21A 4C0KA 3AM1A 4MRRA 3RRMA 2GPJA 1M2OB 2JATA 2ZETA 2DWOA 4QOSA 1DAGA 1BKDR 5F9HA 4I4LA 1J90A 4WXRA 2ZU6A 2RGXA 1VQKB 1CTQA 1SM4A 4C4PA 3C5HA 1XTIA 1E3MA 1XTJA 1SVOA 1VCOA 2QAGC 4LC1A 4Q4JB 1ZC3A 2J59A 1E2KA 1E2PA 3NBXX 3IPXA 4RD2A 1TU4A 3HYTA 2GJSA 4R7ZA 1G41A 1DAKA 2HT6A 4U7DA 3QEJA 2OK8A 3VO2A 2RGNC 3DM5A 2GCNA 4ZGQB 4MKIA 4Z1MD 1OYYA 5C4MA 3GLIE 4TYYA 1CJMA 1U0LA 4B6EA 4KVGA 4LHVA 5HKKD 6Q21A 3CMAB 4IOJA 4RD6A 4IVPA 4A15A 1EFUA 3I32A 2Z5FA 4DSUA 3RSLA 1CJKC 1P2TA 2BF4A 4G5SA 2AXNA 4V0LA 821PA 1II0A 4MKHA 3MD0A 1OB2A 2NPFA 1P61B 1OXSC 2ZPTX 3FJOA 2NOAA 4PAMA 4FCVA 3GQBA 1JR3A 2FV8A 3PJRA 1E1RD 2FMXA 1M7HA 2FU5C 2GWHA 3CF0A 3LX5A 4IDOA 1GTVA 4Y7CA 1GWNA 3EIEA 3IPYA 4R2IA 4OI2A 1E9FA 1XF9A 2C9CA 1RIFA 2NQ2C 3PENA 2RGGA 2WHXA 3SHWA 3CR7A 3AF0A 2D3WA 2P3SA 3FE2A 1R7RA 1YR7A 2HT1A 1XP8A 3JVVA 3Q7QA 1OIVA 4KO8A 2EFHB 2O8DA 2F9LA 3CR8A 4JT2A 4S35A 3W8NA 1Z83A 2H18A 1W4BA 4A0FA 2OTLB 2JLVA 3SYLA 3A4LA 4NHOA 3P26A 2J87A 5J4VA 2PZGA 2QMEA 3QG5A 4QHTA 5KNCA 1EX6A 5JCPA 1M90D 2DYKA 2HYIC 2PBRA 4I1OA 4TL8A 4O3MA 5JSZB 2YWGA 1JEDA 5HPYB 2QAJA 4ARZA 1J8MF 4KFUA 2ZRHA 3NH6A 3EPLA 5BYKA 3WP1B 2B5OA 1VCIA 3I73A 2IYUA 4GOXA 4QGAA 4B43A 2WBLC 4C0LA 3RS7A 3DMNA 4YDSA 3L8YA 2IUUA 2P2LA 1KK0A 2QPTA 2XOKA 3RWOA 1E63A 3CLVA 3CF2A 5FUVA 1E9RA 3KZ1E 4OHWA 4KBGA 5EP2A 3RLFA 3CCJB 2BJVA 3UG6A 2JLUA 3O8BA 2AK3A 2B6HA 2F9MA 2X19A 2ZR7A 1XEFA 5BWMA 3TUZC 4D0NA 2XB4A 1KDOA 3AUXA 3B1YA 3CC4B 1UBEA 1V5WA 3NBYC 3QXJA 4UXJA 5DH9A 3SNHA 3SFZA 2B7CA 3LWNA 3RRZA 3ZVNA 3VO1A 2GF0A 5TB5A 1Q3TA 4YONB 4K8OA 4CRWB 3RDPA 3GLFA 1UBGA 3VR5A 4WZBE 2VF8A 1MR3F 2J3EA 5IK2D 3KJHA 2PLFA 1S9DA 4A8JA 2E1RA 3ZLJA 3OEHD 2QP4A 1QGAA 1NVVR 3KJEA 3PUWA 3OW2B 2IYVA 1YKSA 1CJUC 4LJ8A 3ZD6A 5FOTA 3QKTA 2IW3A 3BBPA 4DIEA 1G3QA 2WOOA 4LBYA 3U2QA 2YOFA 3DPUA 4NTZA 3RVBA 2WICA 1XMSA 3CCLB 1HQYE 3GLFB 2B8WA 4QJ3A 1K73D 3FMPB 3BS4A 1IN6A 2WIBA 5UKDA 3IHWA 1W5TA 2OESA 1E1QD 1YJ9B 2VZLA 1SULA 3C14C 4A8JB 1G17A 5JS7A 3ASZA 2XGJA 2MSCB 3KFXA 3QQ5A 3OESA 4OL0A 3TSWA 4M4SA 2CJWA 3LAWA 2IEYA 2QTHA 3DMDA 3MMPA 2F43A 1YITB 421PA 1KK2A 3WYAA 3CRRA 4QBFA 3AGPA 1CR4A 3CNNA 3FMIA 4TMKA 4F93B 4WBSA 2ZS7A 3VNVA 3UMFA 3VHLB 4GOJA 4V0KA 4DLRA 3K70C 1PLLA 2G6BA 1OF1A 1ZD9A 4KITB 3V9PA 2YC4C 4B34A 1AM4D 2GHIA 3L43A 3O8CA 1CR1A 3FTQA 2O0JA 1QRAA 2HXYA 2ZRLA 1E79A 3UXMA 3NBZC 2ZU0C 1AN0A 4GP7A 4ESVA 3REFA 1R0ZA 4WIAA 2F43B 1WXQA 4Y9UA 5AJVB 3T5GA 3GJ3A 3T1TA 2JJ1D 2ODWA 4QGGA 3D3QA 1G5RA 3BE4A 2NPIA 3F0TA 3GD7A 3B2EA 3GMTA 1BIFA 1P9RA 3Q5EA 1BS1A 2QZ4A 3HPRA 1ZCBA 4AYTA 1KZ7B 2GTPA 1E2LA 1Z47A 2F7SA 3A37A 3O8DA 3SDZA 1JALA 3ZVLA 4BLTA 1KSFX 2W6JA 4A0GA 2DPXA 3K0CA 4L4UA 4AWXA 4AYWA 3ICEA 2ZAMA 4MRPA 2R62A 4OBEA 4KBFA 4W5WA 1Q22A 3EAQA 5FPSA 4M2LA 5GJBA 3ZBTA 3I92A 5FPHA 3OJXA 4N3NA 4HLCA 1KZGB 1LW7A 3ETLA 5H5JA 1RE0A 1W1WA 2XX3A 2QENA 3FYHA 1E32A 1OHHD 1F20A 3CB4A 1KDRA 5GJVC 3W6NA 1E9DA 1OW3B 4C0SA 2AN9A 3JZAA 3U6KA 3RS3A 3AV0B 4D80A 4RZ2A 4MYUA 4URZR 3QBTA 4XTCS 1K8RA 3BFVA 5JCZA 4A92A 3TQCA 1AQUA 4DWJA 1Z0JA 5TXGA 3I55B 2QGNA 3VX4A 1QHYA 4C0QC 3NEJA 3OF5A 4OQMA 2YWFA 4MYHA 3VR4A 2HUPA 1AKEA 4PHHA 1E2MA 4D2IA 5DSZA 4OYHA 1SXJE 4HAWA 1NP6A 4Q47A 1UKYA 3VX3A 3W6OA 1CNFA 2V6JA 3MFYA 1ANKA 1FNDA 2JLYA 1E0JA 1H65A 2EYUA 2REOA 3UKDA 5E7MA 4BFVA 5HZHA 4POAA 3P4XA 2ZJBA 3FWYA 3B1XA 2KB0A 4RZ3A 1QHHA 2NO0A 2ZI5A 3DKVA 5DN6A 1S3SA 3EZ9A 1SVKA 4DXAA 1O3YA 1GRQA 2QORA 1KMQA 2GF9A 2QTLA 4LBVA 2RHMA 5FR2A 4P6VF 1GSIA 1XCPA 2GXSA 5KDOA 2CL6X 1NN3A 4A1FA 2O8EA 1E2JA 3W90A 1Q21A 2OT3B 3NHAA 1QBKC 2BMDA 2C9OA 2P6RA 4ASUD 1J2JA 2W0MA 3EASA 4F4JA 1L8QA 4LUCA 4JVLA 1YZGA 5G40A 4MDEA 4TL7A 1SKYB 1ZNXA 4V0ME 3OIUA 5KTYA 2WJIA 4QJ4A 4GT1A 3DKPA 1GKUB 1OKKD 2PL3A 2IX3A 3CW2A 1Z0FA 2V8OA 4IFEA 4LYJA 4OK5A 2C96A 3VQTA 2IBMA 3N2IA 2CHGA 4JLPA 4OHXA 2PT5A 3U61B 2PZEA 3L0SA 2ZROA 4O0MA 4UJ3A 3V76A 1XTQA 2ERYA 2FFHA 4GZLA 4DCNA 2NZJA 2O8EB 4LBZA 2ZRFA 1EGAA 4UNPA 4LYAA 3K70B 3AF4A 3Q9LA 2WOJA 4QFMA 2X77A 2XSZA 1CP2A 4QJ5A 1BJKA 1I2DA 4ZGNB 2D2FA 5DI9A 1E2EA 1UBCA 1E9BA 3P20A 2R6FA 1GILA 3IHLA 4WA7A 3I4LA 1G20E 1U8ZA 3WHLA 3OAAD 1A2KC 1NL3A 1NVWQ 4M9XA 4LPSA 1A82A 1P5ZB 3NWJA 3VR6A 1Z06A 4N3GA 2QEQA 5J4LA 2GAAA 1R4AA 2CLSA 5KUTA 1GNQA 4D82A 3E70C 4RJLA 4TN1A 3FVQA 3KQKA 3OFNA 4B4DA 4BWYA 3CM0A 4IDQA 4Q19A 2DB3A 2ERXA 2ZYUX 1AA9A 1MO4A 2G77B 4QM6A 1E2GA 2OG2A 2BBOA 1Q1ZA 3DL0A 3AF1A 4KLZA 4QBIA 4PQRA 3BFKA 1N6NA 2ZS9A 1J8YF 2XZOA 3WXMA 1JJ7A 4GPTA 1IN5A 2IYTA 3DM9B 1S9HA 4NYIR 4D81A 3CRZA 3U7GA 2PMDA 2HF9A 3OEEA 3FFAA 4LSGA 2GXQA 2P65A 4YXWD 2Q3MA 1GP2A 1S8FA 2DERA 2EWWA 2HYDA 3QIAA 4KFSA 3PEUA 2GCPA 3X1DA 1IBRA 4DBLC 1Z0DA 3PUYA 4MH0R 5EE1A 1CXZA 5H1YA 1X8LA 2QN6A 4QGHA 3ZC3A 2CL7X 2NO9A 1P9WA 4E03A 1VDZA 3CX6A 4CZ2A 2IT1A 4UJ5A 2FFBA 4AD8A 1ODFA 1S72B 2VP9A 4KHZA 4QHYA 3I5XA 2XXAA 3UG7A 4PC2A 1WCV1 3MLEA 2P67A 1YR9A 1JI0A 2GZDA 5JRZA 3GLFE 1E0AA 1W7AA 1KO4A 2QG6A 3L0IB 5K8UA 4PC3A 4Q7JB 2QT1A 5K8IA 2BDTA 1E4VA 2ZIAA 1QZXA 4HDOB 4ZKDA 3ZH9B 1LFDB 4TMWA 1Q1EA 5D3MA 3P4YA 4LY6A 2JJ2A 3MUFA 721PA 2WIAA 4LPKA 4BZPA 3CC7B 4LC0A 1YQTA 2LKCA 4GMDA 2V3CC 2WJYA 5KPDA 4P4SA 4PPGA 2P5TB 5F9FA 1OT3A 4GFDA 4LV8B 4KYIB 4NONA 5K8TA 2VNHA 1W0JA 4OK6A 1TUEA 2NO7A 4BFYA 4MRNA 2FGKA 3G0HA 1WBBA 1W0KD 4LHXA 5J40A 1WF3A 5KNBA 2YHSA 3CPWB 2CCJA 4C30A 1JAIA 2Z0MA 3WMGA 4IW3B 5EP3A 1YVDA 4P4UA 5D3MB 3K0EA 2AXPA 1DG1G 1US8B 1AGRA 1LS6A 2H1LA 5KO2A 4BFXA 1RRFA 1DTSA 2BKEA 3TSOA 4HZUA 1GNRA 3IO3A 2F1HA 2BCJQ 3QXHA 2WWHA 2XTMA 3WRXC 3GJ5A 2IUSA 2IEZA 5BXQC 4HDCA 5FOSA 4DLSA 5E4FA 3BJIC 4GZMA 3WBKA 2NZ8A 4DEYA 2PEYA 1VG9B 4C0HA 2WVJA 3LBHA 1JBKA 1XXHA 2J0UB 2O0KA 1ZBDA 2X2FA 1EP3B 3CH5A 4OQNA 3PXGA 3CD6B 4A4DA 3THXA 2ODEA 1G1MA 1BO6A 2I1VB 4C9BA 4MYCA 1ZUNB 3SBDA 3EWSA 4XIGS 2C95A 4RCYA 3FGNA 4HZUB 2Q3FA 3N5CA 1KRHA 2FWRA 2YYZA 4UNNA 2C8VA 3W6PA 5FPYA 5EE9A 2ASEA 1RKBA 2W0SA 1NJGA 2FSIA 3SC3A 4RKFA 3W2EA 4G5QA 3U3JA 4TTQA 1XXHB 2A5DA 2WSSD 1SKQA 2DFLA 1RW4A 2QI9C 3HP1A 4CEHA 2YV5A 2FH5B 2WKPA 2FSHA 3BH6A 1Q86D 1KI8A 1E96A 4QNMA 1NY6A 5KDDA 5KSYA 3RAPR 1LVGA 4DT1A 4JZKA 2ONKA 5G41A 3A1TA 4IVQA 2WWYA 4TT3A 1PV4A 2I1QA 2GA8A 1F2UA 2QPOA 4R9UC 3SHFA 5GV8A 1X1SA 3QFTA 4BLSA 2ZEJA 2V6IA 1S2MA 2W83A 2ZE8A 1I7PA 3IIMA 4TLBA 4YMTA 2R6HA 1VQ7B 1VG1A 3ADKA 4EJSC 2IWRA 3MWYW 3T34A 3VKHA 2AHOA 5FL7D 1DELA 2UVQA 3AVOA 4KFTA 5FR1A 1ZC4A 3UWKA 1QF9A 2ZAOA 2GILA 4IFBA 2XTZA 1JJ2B 1HURA 4B3XA 2IS4A 3GFOA 5ELXA 2DETA 4NYIQ 3QE0A 4TLAA 1ZUHA 3LBNA 2FE4A 1ZRHA 1W4RA 1XTKA 4J0QA 2FZLA 1QG0A 4BECA 4B3GA 1VMAA 1YJNB 2VNKA 2JLRA 5EZ6B 4TQUS 1AZSC 3FHOA 3QKSA 3TW4A 4QRHA 3BC1A 3ZD7A 1XZPA 5FPTA 5HZKA 4UNRA 5EXTA 1SKYE 2HMAA 1YJ5A 4Z54A 2WJJA 1G3IA 2ZANA 4D4LA 5P21A 3MRSA 2BMEA 2PMKA 4C3ZA 1VQ9B 2RAPA 1ZJ6A 1G5PA 5JWHA 3GFPA 4MGIR 4DLVA 2YVUA 3Q3JB 4JLNA 1Q0UA 2OM2A 4AYXA 4OI0A 3D8BA 1KSJA 3KL4A 5FTKA 1MO5A 3C16C 1CR0A 2CDNA 1KMHA 4XOIA 3KXLA 3SU8A 3WYFA 3ADDA 5DNYB 1W2HA 1NBMD 3NKVA 2G3YA 2YKGA 4V0OA 1HTWA 3LW8A 1GM5A 3SQXA 4FI3C 1FMLA 1E0KA 1TEVA 4RSGA 3B82A 2QP9X 2C2HA 3BRWD 4XVQA 2VIIA 3B6EA 1RYHA 5JBQA 1GIAA 2D4HA 3QPUA 3PUZA 3TJZA 1N6PA 1W36D 1QUFA 2GKSA 2JASA 3FKSA 5AWFC 1E9AA 4TMZA 5JECA 2XNDA 1VYVA 4YAOA 3SYNA 3VNUA 3B9PA 1XRJA 1JPNA 5DO9A 5SZIA 1KMHB 3AVQA 4US1R 5J47A 3L82B 4ILEA 1T9HA 4RFVA 2CCGA 2X1VA 4B44A 1NMZA 1KO1A 5H8WA 2DFTA 4BLRA 4PO1A 2GNOA 4M8NE 5KSWB 1P73A 1QUEA 2BM1A 4LHYA 4AG5A 1G291 5TY0A 3C8UA 4LWZA 3QJYA 1N6LA 3GLHA 4W9MC 3CF6R 3DOEA 4MDFA 3KJIA 1SHZA 2O8BA 3GLGA 1F5NA 1K6MA 2FPLA 2VEDA 1GAQA 3X1WA 5KOYA 1U0JA 2ZR9A 4GBMA 4JLVA 4JJZA 3RABA 2QDXA 5FH9A 2ZS8A 1G18A 3J81k 4HAVA 1GR1A 3WRYC 4DSNA 4PC6A 3B78A 4GNKA 2N1BA 3K0SA 1B0UA 3EIQA 1TQ2A 1CQXA 3I8SA 3U5ZB 4G01B 1ZNYA 1N5IA 1F3OA 1RRGA 3RWMB 2YWEA 4GOKA 2JAQA 2JDIA 4M1MA 1AS0A 1KI3A 1GL7A 4XWKA 2O8BB 5KSPA 1QVAA 4PPNA 2FDCA 2G1KA 2BGIA 1G4AE 3WMEA 2DHRA 3V4FA 1W35A 2D74A 5AJZA 5EUQB 4LJ6A
chains in the Genus database with same CATH superfamily
2J9GA 5ICCA 4Q4HA 3K2EA 4M1TA 4WPGA 4ZCLA 3STYA 5B3KA 2OEPA 5LVAA 1I7LA 5JPDA 1EWRA 3D43A 2J46A 3OQVA 1RWMA 1SC3A 3C7KA 2W2TA 3QUCA 3QVGB 2VUSA 5FOUA 4JYCA 4QAQA 5BQ5A 4ALKA 2MSEB 4B83A 1UOOA 4BNUA 4B3IA 2NAFA 4JGGA 3OQ6A 5DGHA 4E2YA 1QORA 4Q9KA 3MIIA 3T0IA 3KG2A 5IPFA 3SFVA 3TAHA 4C2BA 4IRXA 5EESA 4IQ8A 1P60A 5H80A 4D8VA 3KZNA 4FWBA 4GYJA 4MPTA 4LXTA 4EARA 3BTVA 4MEBA 3TINA 1Z0KA 5EHXA 3ZW7A 4UDXX 4ABYA 2BAGA 1DINA 1BEEA 3W04A 2ZRIA 1Y3BE 1UOPA 2QWXA 4GOLD 3WL7A 1LU9A 1TK9A 2BHRA 3EG9B 2IXTA 2QGZA 4IWXA 4NVRA 1E2QA 4PLHA 3R8FA 4MUIA 1ZN9A 3UPTA 4L9AA 3CEAA 4AECA 3NDRA 4QUJA 3ASYA 1HDOA 1C9JA 1I32A 2POCA 2VNIA 1A5BB 2I33A 4MI6A 3TEFA 3VZQA 4EJ6A 3K7EA 1T4MA 3I2GA 1KP9A 4OJYA 2G8LA 3WLHA 1EPUA 4IOKA 3U7QB 3HCAA 2OQ2A 2RHWA 5DTJA 2BM8A 2WJPA 2NT3A 1CZOA 1K6JA 2R6DA 3AZOA 3HU1A 5TDHA 3ZJ5A 4BLOA 1A8IA 4AS1A 4UBKA 1KXZA 1YR2A 4N01A 2MDTA 4BGIA 1H1LB 5JAMA 1JRLA 4ZJYA 1ZESA 4NCIA 2J7KA 3SIRA 3VMMA 1BA3A 1RCFA 1F06A 2FSVA 2NUBA 3AHDA 4O2AA 4BYGA 2GETA 3L1HA 1JZTA 3FB1A 3MW8A 4U3JA 5D2CA 4DNOA 3R7NA 2WUWE 3S44A 1QRUA 2HWKA 4AJIA 3ZU4A 5JNUA 3OQOA 3E9RA 2IK8A 3MWGA 4CQMD 3G6WA 3ZGVA 2QU7A 3R5KA 2BMFA 4DZZA 1KBQA 2WM2A 4AMGA 1YUNA 1T3ZA 1Y1TA 3GRRA 3FDZA 3C87A 5BSFA 5JYEA 3TLXA 5JQGB 1NULA 3SCZA 1ODTC 3LRTA 2FFAA 3A8IA 4XGKA 1H2HA 1AS2A 3GFTA 1RQGA 4IKEA 4WKBA 3PC6A 1YZTA 5AM4A 1PZHA 4G1BA 4EMUA 3IAEA 2I6SA 1ZHFA 1HZZA 3HVIA 3PC4A 2FG6C 2NUPA 1NM5C 3F73A 4EG8A 3TTSA 1GUYA 1G7TA 1WB6A 1SB8A 4NXMB 1TGYA 3FYUA 4P08A 4WCDA 3ZGNA 4Y18A 1EEHA 2OKCA 3SS9X 4FZRA 4OSPA 4ZAFA 2ZI6A 3RIHA 3ZIAA 1R6XA 1UXKA 4XH9B 4FSXA 4HS9A 3OQBA 5JZSA 1ECGA 4LQ4A 3JD1A 4QO8A 3V1YA 4HWTA 4LGYA 5A3QA 4IUYA 5EZYB 1W76A 4JL6A 1G8SA 5KINB 2OLKA 3JVIA 2R6CA 4IXTA 4WL0A 3K0CC 4B3RB 1YJAA 5AW7A 1NVKA 1Z2PX 4NBLA 4XKVA 1E99A 4R8KA 3VSAA 3O3MB 1P5FA 4UUBA 4BDTA 2IEAA 4GX5A 4LOJA 4F2DA 1KORA 5DGIA 2P69A 2B0JA 1A5SB 4FCCA 4XR6A 1L7XA 2R87A 4NDAA 5CJJA 3CVVA 1U98A 1DQNA 2NSLA 1T3SA 3L93A 1EWQA 4TKVA 1JPUA 1B7GO 1RLTA 3QIVA 3TEMA 2HN9A 3IKJA 5CIQA 1L7RA 3MMSA 3FTFA 1UFRA 2WLTA 3F4BA 3C7AA 5ELMA 2JHCA 3TZ6A 3UXEA 3V7YA 3ZQJA 4X6XA 4BAZA 1UKBA 1POXA 3WGIA 1XCJA 4QUKA 3VNSA 2RARA 1BMDA 1DEOA 3IP1A 4JXKA 4DDHA 4UVDA 1VQ1A 1WG8A 1NYRA 4M7WA 4OGKA 1YJXA 4BVJA 4EFNA 5ICGA 3GMDA 1PVOA 2BSAA 4MVJH 1IULA 3K94A 4OSEA 3RS2A 1MRZA 2JB9A 2O8NA 4MWDA 3WIEA 3WK5A 2PVPA 2EX1A 2XMSA 4J43A 5CB0A 4YCNA 2CVQA 3EUAA 3GFFA 3QPVA 1WBDA 4MVCA 3GT7A 1QAQA 1X8JA 3SM3A 4EY5A 2QS9A 4ZO8A 1FC0A 3DT9A 1QFXA 4GDMA 4GMFA 1RJ9B 4D9EA 5IJ9B 5G2OA 3F2IA 1UPXA 3RY8A 2NVUA 3PPWA 2C29D 4QAJA 1TC2A 3HN2A 3LV8A 3PE3A 5SZHB 1JKXA 1G2OA 2P9YA 2ZTSA 4REMA 2VXYA 3FN4A 4UFNA 2VBVA 2DUMA 4EPXA 1SBYA 5EHGA 5JZMA 1LK0A 3LOUA 1RHRA 1HG0A 3DTVA 4UU8A 2ES4A 3HR8A 4XQCA 5E2BA 1QVRA 3NDJA 5ISMA 3G6KA 1GCGA 2I6GA 3NXKA 5A5GA 1HT3A 4AXBA 5KNDA 1SZDA 5DMXA 4FS3A 3D26A 2QTAA 3WL5A 4ZOQI 1THMA 2NU8B 4M8IA 1JKFA 4J16C 4LDNA 4DRXB 3OQNA 3IPAA 1MDFA 2AX4A 2QYOA 1U2SA 3OKPA 3FTPA 3K96A 1MABB 3EGVA 4DPLA 1C7IA 3JQ8A 5ALTA 1W4CA 3R7WA 2BGTA 2C5LA 1KKMA 3FJYA 4BO7A 3LO5A 4GP9A 1XOIA 3DT8A 1DKPA 3EEFA 3ESZA 4TZ0A 2PR7A 3IEXA 4HN9A 4FCWA 1M54A 2PY6A 1CJVC 1DDOA 1FFYA 2Z9DA 3EQ9A 3TQFA 5EJ4A 1PWZA 3VHRA 4NL4H 2B69A 2W6JD 4X54A 4UU1A 4RK1A 4OHFA 5IAOA 3DWFA 3HR7A 4H27A 3PHHA 2AKAB 1QV9A 4DC1A 4EP1A 5KOJB 1L4HA 4JLOA 4LCBA 4KPGA 2FUKA 1EFDN 5HF5A 3GJSA 3KTOA 5KC9A 4YHBA 1PFQA 2FWNA 2X3FA 3BIXA 1N1EA 4WOKA 4EI8A 3KSMA 2F9FA 3CE6A 1EFCA 3TCNA 3X2FA 2JIZA 2WVHA 4ZTZB 1FX1A 1YRAA 4JVSB 5AOVA 4Y0NA 5K0TA 4UQLA 2WU4A 2WA1A 2OCGA 3TOCA 4BMPB 1MOQA 1RCTE 3VR3A 1HLGA 1KI9A 3JQ9A 1SXHA 4F86A 3OX1A 2OBTA 1V71A 4X7DA 4B2IA 5EJGA 3THWB 3R0JA 1YS9A 3G0BA 4AK9A 4BS9A 3Q38A 2FUG1 2FMKA 1SBCA 1VP3A 4B4OA 2XNSA 3MUOA 4TM8A 4UBMA 1QHEA 3THRA 3ZNQA 5AUNB 2QXUA 1U0SY 2C3PA 4RDKA 2QE6A 2W7TA 2Z83A 3BXGA 2BFCB 3DMFA 4G86A 3S1AA 1RVV1 1RU3A 3NHUA 3VKVA 2VDPB 4UASA 5C7YA 2DKNA 5E4YA 4BRWA 3AEKA 2NO6A 3H8WA 1NSFA 3LSYA 3OIYA 4HGOA 2ID7A 1BPLA 5AK0A 4RTSA 3D4IA 1QIJA 4NG5A 4AAYA 2VBFA 1KU0A 3VTAA 1VIYA 2GZHA 3SF0A 4X85A 3ADCA 1A1VA 2XKJE 3AOGA 4DQLA 3NAZA 1TM4E 4I6GA 1Z17A 3ZXSA 2V7EA 1UFKA 3DE1X 5A9TA 4Q7MB 3LPNA 2R7AA 1N6HA 3P94A 1KAEA 1LBSA 2OZPA 4NDNE 3WL3A 2ZR0A 2OQRA 2XGOA 4K9PA 2ZBQA 3LDAA 1U3VA 3WFJA 4PIMA 4ALLA 4IIJF 1D8TA 3DTTA 5JRDS 4QQ8A 3H2GA 4HQLA 2OBFA 4G0MA 3NIWA 5A4FS 3DMHA 1L5OA 3I9NA 1VMDA 4KQ9A 2A3RA 2CRVA 2AC2A 4EO9A 4GO1A 4CMHA 1GPLA 5JDIA 1OLXA 3KAPA 4J0HA 1HEYA 2OGUA 5ALFA 1CY1A 4XW2A 1X8XA 3TLCA 2WWIA 3JRXA 1T5IA 1CPYA 2NZYA 3D59A 2G09A 3QLEA 1JEJA 4HVAA 5KS2A 5L3SA 4RWZA 2X4IA 2H29A 4GPBA 3HE3A 3WG9A 3K1ZA 3DDWA 3UA3A 1T6XA 1UK8A 2Y68A 4KGZA 3QKIA 2FNAA 1XB2A 1MOSA 1U8YA 3R0VA 2WUFA 4ZGBA 1J9EA 2F67A 3D8RA 3AF3A 4FBLA 1SCUA 3DR5A 3WGMA 1NWCA 2IXDA 4KI0A 2Z2JA 4J0JA 1YZFA 3TG2A 3KXKA 1IAVA 4NYMQ 1CY7A 2Y6VA 1VHQA 1WPGA 2O5VA 1G8GA 2RKOA 1L4NA 3FX2A 4FINA 2GDJA 1T0BA 1XMIA 2B34A 5AKEA 5CFRA 2H54A 5IF9A 1BZYA 4R8RA 3EZ6A 2WMDA 2WDZA 4NBRA 3TBFA 4WBNB 1QGUA 4YHHB 1LWNA 3C5CA 2A0XA 5JJLA 1G21A 5FJIA 2W00A 2Y1XA 2HSZA 2IODA 2QD2A 3I1YA 1JWLA 3P9CA 2HA2A 3ZXYA 1TTPB 4ID9A 2FN4A 4AI6A 1BHQ1 1MV5A 2IHZA 3ELYA 1NOJA 3PNVA 1ELOA 1J70A 2ZULA 3K9HA 3WBFA 1DC3A 1LDMA 3OFND 4KPUA 1PWHA 3X1XA 3ESAA 3CA8A 4O4IF 2G1PA 2XOEA 3D8HA 5AI5A 1PR1A 1T2AA 3HJGA 1Z6PA 3L0CA 4F12A 3BCSA 2OXRA 3L01A 3PJFA 4L6AA 3KQMA 1QHIA 3AI2A 4NYJR 5FLYA 1QGZA 2QE7A 1NW4A 1WB9A 4B6GA 3CO5A 5CHEA 1RRPA 4OCZA 5EWMB 1HDCA 4R8SA 5TSDA 3OEED 4GX2A 1EK1A 3UMYA 3UMSA 3CLSC 4RVNA 3LLCA 3RJTA 3LQEA 5FOQA 2BKVA 2MYPA 3NASA 4ESHA 4JBWA 2QTZA 1H2AS 1IBSA 4O6VA 4WESB 4CLOA 2ICAA 1YS7A 4S04A 3RYIA 3K9QO 1ZGBA 2RBEA 3BXXA 3EA0A 4LECA 1Q11A 2A57A 2AQHA 1RWVA 3BILA 3IDSA 2NTYC 4PX2A 4II2A 4RTKA 2AZTA 1YDGA 2E49A 1HZJA 2V6MA 3WJ7A 3ZU5A 1KC8D 2P77A 3QW2A 4BVKA 3HP7A 3P2JA 4CKCA 4I4NA 2F1LA 5E3IA 1YJWB 2VP3A 1I18A 1YJQA 2R6GA 1KHTA 2NIPA 3D5QA 4CM7A 1SB9A 2QNRA 1J99A 2R5FA 4B84A 4OUDA 3D02A 1R0RE 2QSZA 5IYQA 3EX7C 1YAHA 4GQAA 2P7HA 1NSYA 1NBOA 5A4AA 2NM0A 5EWJB 3KO8A 5K05A 4Q6WA 2J30A 1E5TA 2O1XA 1H8HA 3INGA 2CLOB 3CYFA 3S5UA 2B25A 3QPAA 3CRMA 3KEOA 4XQEA 4I3HA 2WAXA 1I5OA 5GVRA 4LYFA 4P2NA 3AVTA 2D62A 3AIOA 2X2OA 3CZ9A 4ILKA 5GONB 5B36A 3LP5A 1YVRA 1DBWA 2G71A 2ZUBA 1VPWA 3HCRA 3R74A 1L4EA 4G0UA 3PCRB 2R44A 2CNKA 3NKFA 2IRWA 3KWLA 4H7JA 5DLPA 1J20A 3GLTA 2NT4A 3MTQA 3OLZA 5JYCA 4ZCTA 3EXHC 5I9BA 5JH7F 1NSTA 3WLFA 3TTYA 3O4JA 1JN0A 4TWJA 4BN4A 5F98A 2XMGA 2P8SA 1H2FA 2W43A 4LDRA 4TRJA 4QBHA 4XIYA 5AHWA 1KTVA 5KQSA 4BFWA 2HFJA 4M0LA 5EE5B 4ENQA 4FZ3A 4MS1B 1G6OA 1P2VA 2ODNA 4EL0A 2GEUA 1SUSA 1YB7A 2PMBA 4JLBA 4B32A 3W5AA 2O9JA 1P1KA 4LOKA 1SOWA 4TKMA 4DB2A 1OB0A 5ALJA 1D9XA 3DB1A 1LJUA 1UMBB 5IBRA 3RHSA 4BOYA 2QZSA 1T2VA 3GDOA 3L7MA 3PGLA 4I1PA 2WHEA 3RK0A 1CS0B 1TXGA 4YUZA 4X91A 3IKTA 2V31A 1VI5A 3FPEA 3D6NB 1W30A 4ZYYA 4YJKA 1TADA 4EB6A 1KZ4A 3KVRA 4LZOA 3T7SA 4G0PA 5LLDA 3P1JA 1QX4A 5HKBA 3KDSE 4X97A 3LLMA 4ES6A 2Q6TA 3H1BA 2QMYA 5D87A 5KOHB 2W2XA 4CKYA 3KU4A 1CRQA 2IGBA 2RGAA 2QRMA 3ZDXB 4DV2B 4LN1A 3TNDA 3DOFA 4P25A 4L76A 4DR2B 5E6UB 1XRNA 3NCTA 4DLZA 4P4SB 2JLZA 3CE9A 1PD1A 1ZH6A 5JCXA 4P32A 3KCQA 1P8JA 4OD0A 1TB4A 3PK0A 1IMJA 1LBIA 2V4ZA 1GVNB 5FUYA 2FWIA 5B58T 3TO5A 4M0DA 2G5PA 4UAGA 4RGVA 4TMFA 1QBGA 2AD1A 4TTSA 4WXEA 3OF3A 4FSDA 4LWOA 3O90A 2JAPA 4Z4RA 2XTJA 2ZRNA 3GARA 1TU3A 5DU2A 5F2OA 5G1PA 5LA6B 2FRXA 4MRSA 3OICA 4OHCA 1M34B 3HPQA 1L7MA 3K4PA 1SBHA 1M66A 2Q1WA 2VO1A 3A2LA 3F6PA 2WQ6A 2ZUFA 5ITSA 1IQRA 3TB4A 4DNFA 3ZE6A 2ECOA 1MNAA 4TROA 1ZH8A 3T7CA 2EBFX 3MUNA 3R0XA 3HAGA 1M33A 1YMUA 1ZO8A 2AMFA 1XZAA 2V3WA 4QU9A 2EWVA 4O4JA 2J07A 5JVDF 4UARA 2O2XA 3WQHA 4BNIA 1FP6A 4I66A 3EGEA 4BMSA 2CXNA 3HZOA 5B3AA 3FF4A 1YVPA 5BURA 1AKWA 1GG5A 4UE3S 3NTUA 3THXB 1R6DA 1ULZA 5JC1A 3MJDA 1U7UA 1D5CA 1OTYA 2QUHA 3F9CA 5TX7A 1JE0A 1PEAA 1PJRA 4ZHQF 4E2XA 2EQBA 2WJ3A 4MAAA 3ISTA 1KO7A 1R8JA 2FHPA 3IKMB 4Q4LA 4L08A 2A9JA 1SCJA 3LXXA 3NAQA 5EIFA 4L57A 5K3AA 1D4ZA 1T8WA 1WKVA 3HO6A 1QE0A 4DQDA 4MR9A 3DO5A 3D1VA 4PVCA 1A77A 3A0RB 1DHRA 5K0GA 4C7OA 2XA9A 4Y30A 3K71B 3H3FA 5JZOA 1L2TA 4MKFA 3W2HA 3R76A 1D6MA 3UA4A 2WB4A 1KSGA 5DRTA 5EMKA 5DXAA 3RRYA 1VQLB 4Q9LA 4J6FA 4NU0A 1IB0A 2HXGA 4H7FA 1B6TA 1UZNA 1FJGB 3GGPA 4PLPA 4AURA 4GSLA 4MHOA 1OXVA 4B2PA 3QVVA 3U4CA 4BJ5A 2YIJA 4GX1A 2E6KA 2IU6A 4JX8A 3W5CA 3SSMA 1QYCA 4Y9RA 2GASA 1YI0A 1MRSA 2A78A 3H3JA 4M1YA 4QL3A 3QA3E 3Q1KA 4U7GA 1OZ0A 1PFYA 4JC4A 2UXCB 3WTCA 1YGPA 3PNPA 4BCDA 3PVCA 1BU5A 3RHZA 1DE0A 4MV6A 1EX1A 1H9AA 4O2BF 4E2FA 2ZSDA 3FTCA 1J0BA 1KGSA 2EYQA 2HLNA 3GGOA 1RZVA 2D5AA 4CNQA 2UV8A 2QMOA 2AUMA 4I8DA 4CF5A 1M5UA 1Z75A 3WLAA 4P7BA 1NNEA 1N1GA 2HV9A 4M9UA 1VIVA 4DMKA 1SMKA 1XVLA 4F2HA 1O5TA 4ZQHA 3Q8MA 3P5BA 4ZZ3A 1CJBA 1JDBC 3A1FA 4LGCA 2RCNA 1IK4A 4RQTA 3JTMA 4RJIA 4OHOA 4OB6A 4CR6A 2J33A 3C41J 1TVCA 2BMWA 4K26A 1KEVA 2AD5A 4NMWA 5E1OA 3H5WA 3TLKA 5F1KA 5JAUA 2VF7A 1I4TD 1H3NA 4J1TC 1K9SA 1P0PA 1E1CA 2R4QA 3MOGA 5AM5A 4HEJA 1R6TA 2C5GA 1MAWA 1DEHA 1JKIA 1ODIA 2X5KO 4HYYA 4TRRA 3VOAA 4A0RA 5KYTA 3WHIA 3KXDA 1JYFA 1K92A 3KYDB 5KWVA 3IC5A 1W47A 2FCAA 2W98A 2WT4A 5DEOA 1CY6A 5EE3A 3EZLA 1GU1A 1TJYA 1T6ZA 1N4AA 5KTTA 2AFIE 4XSGA 3VZPA 1E20A 1K5GA 3EMVA 4I1VA 4ON9A 4YLEA 3TLZA 2VPIA 3ST7A 3ZU2A 1U2TA 1DEXA 4Z8YA 3REFA 4UDOA 4Q18A 3NEPX 2B83A 4O29A 4L51A 1G2QA 4UVIA 1PJZA 2BEKA 3PQ7A 3OJWA 3WGJA 4C0JA 3BQNB 3BTUA 5JNRA 3HJBA 1GZ7A 1G8FA 2WSMA 1WCIA 2ZUDA 3NH9A 5ALDA 5K0CA 2O3UA 2Q2QA 4NMHA 4KXYA 3ZHSA 4GSYA 1NN0A 3SF8A 1TT5B 3WAKA 3KQNA 3EH1A 2Q4BA 5FNVA 4RZXA 3H5LA 3HB0A 5H82A 5JCOA 1RS0A 4NE7A 3U16A 2R1ZA 2WU3A 2QXYA 5CCBA 10MHA 5JI3E 1EA5A 5I7FA 6NULA 1QE3A 3B7PA 5CK4A 4PN7A 1C1HA 3W8FA 3RJ5A 3R41A 4RXUA 4ND7A 5JO9A 3WNVA 3LQQA 2XITA 2GCOA 3IMEA 4E5DA 5TJHA 4ENTA 5AUOB 5HR5A 1CEYA 1EXWA 1PZXA 4LK3A 4XWGA 1F4LA 2QEXB 1N3IA 3L9XA 4V0RA 1VKZA 1M5TA 4PLFA 2EFGA 1SH7A 3I1FA 1J4AA 2FDXA 1SOMA 2QRPA 1TNDA 4FGJA 4QICA 4Y1RA 3SYTA 4G89A 1CE8A 4D3ZA 4PQEA 4X65B 5CLQA 3U40A 1D03A 2XKBA 4A5SA 2R6ZA 3KX2A 3ONVA 3WLEA 1FTWA 4IJ5A 4HC4A 5HQTA 5F3DA 4HNRA 2X8JA 4YVFA 2V7QA 4CBVA 4M22A 4U2BA 3AOEA 3K1AB 3LC7O 3U4GA 2O2JA 1NNUA 2ZYIA 1JTEA 4DMLA 3O8QB 4I1UA 4RCZA 4HMPA 4GGMX 1XD9A 5DGTA 7AT1A 2A9KA 2DHEA 5CLJA 2EP8A 1TKAA 2DPHA 4QUAA 1YDHA 4RL6A 1Y1LA 3TMKA 4IIEA 4DXHA 3CNQS 2ATCA 4Z3DA 5I9LA 1D2AA 2AE1A 1EZZA 1KI4A 1T3HA 2WF7A 3AEUA 3C24A 3ITEA 3JD2A 4XN3A 4TS9A 1NDHA 3SN6A 3U81A 5M04A 4G8JA 2ZDQA 1TFRA 3EW9A 3IKVA 1VE7A 1S96A 3QVOA 2EGHA 1VXOA 2AXQA 2OUKA 3SZRA 1NLFA 1OXBB 3VU9B 4RD4A 2ZT6A 4C3VA 3OMLA 2H4XA 1Z68A 2A1TS 2JW5A 1L3IA 3QVXA 3O95A 1JIVA 1XZEA 2DWUA 1GZ3A 1BS2A 4YELA 2JHAA 4GMXA 4R8MA 2WIFA 4GPEA 4D6PA 3IIKA 5D5PA 4MPJA 3NBKA 1PJTA 4PC7A 1V3UA 4LV6A 3CRVA 4I19A 4JBXA 3NHSA 2E4WA 3HKCB 2PKYX 4FMCF 4TN5A 1IXYA 1XRRA 2Q50A 2SCUA 5KYUA 2VHYA 4DARA 3OKAA 5A6SB 1GOTA 3D3WB 3O5AA 2WWFA 3AQIA 1M1NB 5I01A 5T3UA 1Q81D 4LZLA 4R2MA 1XQXA 4WWVA 1J0XO 4LI3X 4NU5A 1MVLA 4HT3B 1FRNA 4V0NA 1ISHA 1HORA 3IIEA 3QTLA 4ZOLA 1E6LA 1X0XA 4AROA 2V9CA 2B4RO 3ABSB 3MBIA 1U5BB 1FEZA 3PV0A 4WZLA 4AG3A 5CFNA 2V7VA 1IY1A 1KI2A 1X1RA 3GQVA 4N5DA 5LQUA 1ARZA 1HG1A 2C88A 4KMMA 2WMOB 3A2MA 1U04A 4BFLA 2O7QA 2JH9A 2OBMA 4YBRA 1BGVA 4U7FA 4V38A 1K08A 4C14A 4AICA 4F4FA 3PWSA 3COJA 1A4XA 1NW8A 1P7WA 3M5DA 1WXEA 3K2IA 5GJCA 4IY1A 1WXXA 3Q5DA 4PGOA 1GPUA 1UBUS 2C9ZA 3HCWA 1KEWA 1WSWA 3K8YA 3O7MA 1JQ3A 4QIHA 5T57A 3B36A 1W59A 1HQDA 2G5CA 4OKSA 3KJXA 2JLWA 2DFKB 2G9UA 4QU8A 4AFNA 4BL5A 1VJDA 2IUEA 5JD3A 2X0EA 3HVRA 3UYLA 4V2UA 4YJ2B 1TMGE 3RLIA 5HIKA 5GMOA 2A0UA 2I3BA 4NBKA 3AY0A 2X2EA 4W63A 4DV7B 4UEWA 4GXQA 2NZUG 3B1ZA 2V6BA 2WHYA 5D8DA 1KOFA 4AF6A 3OQIA 3BMXA 4ROTA 1Y0YA 1USKA 3GRPA 1LLCA 5JROA 1E3JA 3DOHA 1GN9A 1X94A 3H1EA 4HQKA 2BFFB 2BKUA 4M7RA 2PZFA 4H0CA 4PIPA 3T5BA 4ZAWA 4EQ6B 5KYWA 2MJLA 4IDNA 3U19A 3WWPA 3IOBA 3D6MA 4XA8A 4XDHA 3ZCSA 2I7TA 2GUGA 2YZKA 3BB1A 3LVRE 3RCBA 5EHZA 5IRCD 3EGWA 3Q6MA 4MUMA 1XEXB 3D4NA 2G6TA 1VB3A 5FOVA 2OZEA 3RGWS 4EI7A 2R00C 4PV7A 1N78A 2SHKA 3NXSA 5D5QA 2XWQA 3IE2A 3IQIX 2UZ0A 2WZDA 4OHVA 3ZS8A 4WJLA 3GVJA 4PZCA 1C7EA 2AI2A 2O2CA 3MGCA 3N8DA 2ZVQX 2ORYA 2R2GA 2BGKA 3QVTA 3HYNA 5BV8A 1VL5A 3HQ4O 2CXUA 3BEOA 1E6MA 3FETA 5KJEA 2V1UA 3DQPA 4J3JA 2Q9BA 5J35A 4ND3A 1BOFA 3PXBA 2WTUA 3JALA 3CZAA 5CYPA 4E4TA 4ENPA 1ZRMA 2PUWA 2WSIA 4NYMR 2ZRCA 5D85A 4DUZB 1J2TA 4JCOA 2WHPA 1NB9A 2CNBA 4F04A 4KIFA 1YI2B 1NVGA 2QTFA 2RKBA 2VAPA 2HHLA 5DOZA 3IO5A 1HI9A 1MOPA 5KWIA 3USES 2I2DA 3BOSA 4Q02A 2RGDA 3T3IA 4HPJB 3F90A 2W71A 4Q1EA 1YE3A 4HFNA 4ZPXA 3UZUA 1CEXA 3L6DA 4S05A 2YV3A 3BTOA 3LCRA 1ISSA 2YWCA 3OX2A 4JS0A 1DT3A 1FL9A 2HRBA 3AGQA 3O0TA 4RKWA 1ABFA 4OTZA 4B47A 1ISRA 1SVIA 3Q9NA 3W5VA 1V8DA 5HF8A 2EVWX 3KQTA 3ECAA 4XM2A 1C4OA 4N0QA 4B17A 4BNJA 1ULBA 2WG1A 2QX9A 1ZPDA 3LDUA 3OPMA 5FWDA 5LIRA 2JIQA 2WQZA 3CX7A 1PV2A 1WZCA 1Y5NA 3O84A 3W8RA 4ARUA 4LE1A 4MW0A 4B82A 1E58A 1UEIA 2D0DA 2IZOA 3C6MA 4KQ6A 5IULC 3URMA 2HO5A 1AHNA 2KHZA 1S3GA 3LUPA 4LNHA 2NYVA 1TYBE 5E7QA 1PJ8A 2ZWOA 1ISIA 5F35A 1D9ZA 3RFVA 3UFXA 5D3KA 5IXJA 1PQUA 2A14A 3PGA1 1GN8A 1JKJB 4QUBA 4EHDA 1YB2A 3QLVC 1KFBB 4L0MA 1GCAA 3EOBI 4UQOA 5EVCA 3WGQA 4D9IA 4TGLA 5AHRA 2XKKA 3B1FA 1N8RD 4JSYA 3TH5A 2AH5A 4WXMA 1E94E 2E4ZA 1ORTA 1ZUWA 4FFRA 4JIMA 2IHNA 4B9EA 1V16B 2G08A 3LYHA 3Q9SA 3U7HB 4M38A 3RS5A 4IUBS 1XXLA 2PBZA 1WU8A 3BPSA 1CUXA 1XCGB 4L15A 3VNBA 1J42A 1PSZA 2GBLC 4MUJA 4RV5A 4LISA 2BJWA 3FM9A 4ZDIA 5ADVA 2QLFA 3FBWA 3GDWA 5FD8A 5KHLB 1V37A 1Y63A 4G9GA 4LXHA 4CM4A 1Z74A 2M6LA 3G71B 1F48A 3B1VA 3WKBA 1XZFA 5HX7A 4NAVA 4C2TA 4XB1A 3VSBA 1XDZA 3TD9A 3E84A 2BH2A 3N6XA 3K9GA 3ZHYA 4GE3A 3EQ8A 1F38A 1QK3A 4LWQA 3JQGB 4QPDA 5CVCA 2OBNA 4HUQB 4A91A 4NZPA 4ER0A 1UZMA 2FF7A 5FUQA 1Y7IA 1OGYA 1C7RA 5KB3A 5HF9A 1MVOA 2ADFA 1G8YA 4PCVA 2QL5A 1XD2A 3R3UA 5EERA 4XOUA 4Z99A 4PLCA 5JMWA 3VKGA 4CLEA 2VP6A 3M3HA 3Q11A 3SEAA 1Q7TA 2HL6A 3V2HA 4L2IA 2YJ3A 5LQDA 3RG2A 4L8LA 4DJDC 4AKHA 3H9GA 3SMVA 1KDTA 4FXOA 3FA2A 5K2OA 3A4VA 2I4IA 2R00A 1TJ5A 4X7CA 3GRFA 4GRIA 5BWCA 2FWBA 1VFNA 2KBEA 3GLHE 4QRDA 5JZVA 3I6BA 4RF2A 4UDYX 3LF1A 3PLRA 1KEEB 1FSFA 2VK2A 2VK8A 3HLTA 2OFXA 4JMLA 2VP0A 3TPCA 4BWVA 2R5WA 4KLAA 1H5UA 3K09C 4JBGA 5TT1A 3CTAA 3JQRA 4BV2A 1NTOA 4DC0A 4XVCA 3LYAA 1EXMA 1ZFNA 1PL6A 4IH1A 4L28A 2W8ZA 2ZCUA 3Q72A 1VJ0A 2C98A 3FOBA 3WY9A 4F9TA 2A67A 5C46F 2I87A 2OLJA 4X24A 4E07A 3PHLA 3PTAA 2PUBA 1JWAB 2ZCJA 1ZGHA 2R2AA 1MF7A 4X41A 5DP1A 2X1LA 2Y1WA 4BLQA 5AVSA 2IL1A 1ADBA 4UUQA 1BKYA 3HWSA 3S99A 9ATCA 5EHNA 1ORVA 2IZ7A 3B5EA 3PNLA 3ZTYA 2AN3A 3ICCA 3JSAA 4NJMB 1R5BA 2E4YA 4TWBA 4XX1A 5H70A 4RORA 2ISQA 4RPGA 4OMUA 3SR0A 4P3OA 3RGGA 3VAZA 1KZ9A 4FK8A 3G85A 8OHMA 4RA9B 4C4YA 3NRCA 2YFHA 2PXAA 4DG9A 2XEXA 1R0XA 4X5OA 3LNNA 4CL3A 2WFAA 2CEAA 3C8ZA 1GGEA 4DK0A 1OIXA 3R0QA 3WDKA 1I2ZA 4P7KA 4TXNA 4C01A 1WF6A 2E37A 1A4IA 4ZCRA 1D1QA 2WG2A 1RM5A 1CX9B 1A72A 3TNYA 1P1BA 2X8AA 1XQVA 1OFHA 2WIKA 2ZIFA 1XDWA 1K8QA 1N2HA 4ER3A 5J58A 1FIUA 5EUBA 4HB2A 2QQ0A 3GPBA 4I3FA 4UTPA 1FNCA 5K6AA 1MJ5A 1PX2A 1VKRA 1W1IA 4OGFA 4UVGA 3BORA 3S4YA 1B6GA 1ESDA 4JI6B 2NU7A 3WWYA 4LF8B 2JA1A 4TMXA 1P75A 4HX5A 5I3ZA 4LYDA 3DWEX 4BN0A 4K2AA 3A1PA 1AMOA 1VB5A 1C9KA 5REQA 4MRMB 3EXIB 3GCDA 5FWAA 4KODA 1T1SA 2PRKA 1Z0IA 3CUSA 3KRTA 4AJPA 1A9PA 4Q7QA 5LP6F 3USCS 2Q46A 4P5EA 5EKSA 5ALZA 3A3GA 1REQB 4X93A 3CXRA 4EECA 4Y1EA 2GBLA 4LRYA 4MROA 1RZRD 3CH7A 4Q01A 4ZI7A 2MU1A 4QYMA 4Q7LA 4QNNA 1PJ7A 4L8JA 2IA5A 2XNKA 3OA2A 4KKXB 4MUBA 5E1DA 3ZJUA 2BY4A 3MJVA 4N0DA 1PGNA 1BFUA 2JFHA 3NU1A 4YP6A 4ZV9A 3VYUB 5KOIA 1UXGA 3FKQA 4B3FX 1N2SA 1OQAA 4BBPA 4MGYR 2ZTUA 2L19A 3PEEA 5J63A 4KXMA 5CXQA 3IQFA 4K81B 1DVRA 3LK6A 4WW0A 3MCAA 4QXRA 3IEMA 4FYHA 3M0EA 5DOVA 1Y5MA 5BSHA 4CEJB 1FCJA 3NC1C 2Z8YA 4CG0A 1W0CA 5CB4A 4FEGA 1M1YB 2WJHA 3BCRA 2P30A 4OLHA 1O89A 1RYFA 4IVNA 3G2PA 2GD6A 1ML4A 4I5IA 2QRZA 3IUYA 3KV1A 3QMMA 5ESXA 4CIBA 4X66B 5COAA 5BT9A 2QX8A 3MS7A 4PRKA 2AG5A 5MGNA 1U7DA 3ZDDA 1N3YA 4JI0B 1MX9A 1JHDA 3PKJA 4F4DA 1PGPA 3EPPA 1U9ZA 3GT3A 1X7XA 4KO1S 4S1OA 1EUYA 2WKRA 3PXXA 1H8ED 2H31A 4FMPA 1OKKA 4NENB 5I48A 1CZRA 3HSKA 3ZU6A 4YRKA 5ICEA 4BMVA 3OTWA 4HGZA 4U1RA 5LBIA 3GA5A 2YNMA 2PX8A 4O4LA 1OAOA 4MI3A 3GJZA 1NQWA 1U0TA 3P9RA 4JP5A 1NVXQ 2XCQA 4HI0E 1NMYA 3ORHA 1YBMA 4WDRA 3I9V1 3TTVA 2GI4A 1LX7A 3KB6A