3PENA

Structure of archaeal initiation factor aif2gamma subunit delta 37-47 from sulfolobus solfataricus in the gdp-bound form.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
403
structure length
403
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of archaeal initiation factor aIF2gamma subunit from Sulfolobus solfataricus in the GDP-bound form.
rcsb
source organism Sulfolobus solfataricus
molecule tags Rna binding protein
molecule keywords Translation initiation factor 2 subunit gamma
total genus 101
structure length 403
sequence length 403
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3penA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3penA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3penA01
2B5OA 1SQ5A 2IXGA 4W5JA 2QTVB 5LB4A 2ANBA 2ZI4A 1DVRA 3LLUA 3K70D 1KY2A 4ARZA 4M0LA 4IKEA 2C9CA 4PQRA 3VR1A 2WAYA 2FFBA 5FBWB 3RS3A 5EXSA 5HCIA 4XWAA 1VQ9B 2XJ4A 1VQLB 3B5JA 3H0KA 1CR2A 4M1TA 4Q4JB 1NVVQ 2NZ8A 1Z0AA 3QF4B 4DQKA 2C04A 1CR1A 1ZW6A 5JCZA 2QTHA 3K0AB 4KCGA 2OCBA 3CCSB 1TTTA 4WVFA 2PCLA 3RVBA 1AS3A 2AK3A 3SQWA 2Q9CA 2WPDA 3RS5A 3G0HA 2ZI5A 4GI7A 3KJEA 3RRYA 4Z54A 1SXJA 4W5HA 1K6MA 2IYRA 2FV8A 5FFMA 2V6IA 1P5ZB 5JSZA 5AUNB 3NBXX 1RW4A 3FDIA 3D3QA 1EGAA 4XSHA 1G4AE 4F4JA 3AP2A 2AXNA 4DLUA 1G21E 5IK2A 1CF4A 3G6EB 3OJWA 3CB4A 4PR0A 4RZ3A 4G1BA 4WXPA 2D06A 4IDQA 4FCTA 5IF9A 4BLSA 3MSXA 2ZRKA 4POAA 5KNCA 4DUGD 3K0FB 2C96A 1E9BA 1KAGA 4F7WA 2XNDD 5SZHB 4BECA 5KTYA 4QJ5A 1S3SA 2GHIA 4JLOA 1FX0A 4KI0A 1DAGA 2HEIA 4OHYA 4UJ5A 1VQNB 1GP2A 1HE8B 3KZ1E 3QNUA 5IT5A 3LD9A 3PUVA 3EZ7A 4XTRA 2XGJA 2ZJZA 2FSIA 1OGIA 2ONKA 4RCZA 1MKYA 2IK8A 2ZYVX 2TMKA 3AGPA 5THXA 1DO0A 2ZR9A 3H2YA 4WA7A 1CEEA 4JVMA 1H65A 1VCMA 1XTKA 3OF5A 1VCOA 1JECA 1KIMA 1HURA 2C77A 2AN9A 2BGJA 3BB4A 1U94A 2K5UA 1CJMA 2BBOA 3MWJA 3AVXA 1XTQA 2WIBA 4TLDA 5F9HA 2DWQA 4Y0AA 4B3DA 2IYUA 1R5BA 3C5CA 3QQ5A 4W5WA 4B34A 1NLFA 5AUPB 2EIXA 3C15C 1GWNA 3K9LA 1PLLA 2VNJA 4NYIQ 3UK6A 5K8TA 4IOLA 4A8JC 4Q1AA 3CRMA 3UG7A 1W46A 1GR1A 1SXJE 2VL7A 2ZE8A 3IPXA 2GCPA 1KYIA 2GJ9A 3S1AB 3AF0A 1M74A 4B2IA 1XPRA 3ECCA 4BUJA 1VIYA 1EFUA 3QVVA 5DSZA 3RS0A 4DDWA 4OK3A 2FGJA 2BM0A 2Z83A 1II8B 2IL1A 3EG5A 4LWZA 3B9QA 2YC4C 4M22A 1EP1B 5DIFA 5DYGA 2RB4A 1Z47A 4QGHA 2R62A 5TB5A 2DHRA 3BOSA 4IXMA 2ZSFA 3QKSB 2FMXA 3GJ8A 3Q5EA 4YMVA 2GVZC 3AUYA 4IDHA 3PEUA 4BLRA 1XMJA 1R6BX 3Q5DA 1NBME 1TUEA 4IDNA 2QUZA 3K09C 3SR0A 3QPVA 1EESA 1CULC 1Z0KA 3IIKA 2J0VA 3W9YA 3H1TA 3IIMA 2BIFA 4QJ3A 4EH1A 1NVUQ 1E98A 4AWXA 1KTVA 1M7BA 3NKVA 2VQSA 4C0HA 1NIPA 3EIQA 1VYVA 3I8SA 4QBGB 3IO3A 3P4YA 2J0UA 4QGGA 1EXMA 3BFXA 5FUVA 2CNWA 1N3BA 1WCV1 3CH5A 5DLQC 1ZNWA 4V03A 4M53A 1UBEA 4HLDA 1K8AD 1TF5A 3H4MA 2EQBA 2FSGA 4QGAA 1XTIA 5CLLA 1KQSB 1Z5ZA 1Z0IA 3ZBUA 1E9AA 4IDOA 3U7FB 1EP3B 1IN5A 5CIWA 3I56B 2CNWD 1FMLA 4Q4AB 3VNVA 521PA 1XNJA 2BSAA 1EK0A 1G1MA 2J3EA 1O87A 1M2OB 4OJQA 3CRW1 4MKHA 1SVIA 3BC1A 3NH9A 3T61A 2AL7A 4HAUA 2BCJQ 2FPKA 3S1AA 1XXHA 2J87A 1W44A 2OFXA 3L2OB 4YMSA 4JT4A 2IS2A 2GJKA 5EE1A 1ZM4A 1OJLA 1N8RD 5HTKA 2I1VB 4P3YA 2NGRA 4B47A 4BLOA 4MDEA 1BX1A 2H57A 4MUBA 1E1QD 3BGWA 1VQ8B 4JLVA 2FWRA 3FKQA 4US2R 4BZQA 1NLZA 4H9GA 1MRNA 1KO1A 1NBMA 4XOIA 4LC0A 5K8LA 5J4VA 1NSFA 2GKSA 2A9KA 1N6LA 4MYCA 3R7WB 1MV5A 2JJ8A 1OH6A 3A1TA 4JBWA 2JDID 4CVNA 3V4RA 3BE4A 4JL8A 1GM5A 1I4DD 3V00A 3SC3A 4ZCLA 4MGKR 3U7HB 4TTQA 2FFAA 2O8FB 4JLBA 1CJTC 4U9UA 1R0ZA 1W35A 1XP8A 2ZRJA 1OHHD 2HLDA 3SEAA 3ADDA 1BO6A 2W83A 1V43A 1E9RA 2BCGY 2ZQ5A 3B1WA 4M9QA 3MWLA 4YAFA 1GUAA 3CCVB 4D82A 1GNRA 4Y9RA 4D81A 3AVWA 4QFMA 1RRPA 4NBSA 3C8UA 1QHHA 2D2EA 1JI0A 1NL3A 2KSQA 2ZE7A 3EC1A 3LFUA 1VG9B 4WZBE 5HKKA 4LBYA 3CPWB 2Q0HA 4M1SA 3K0SA 3OZWA 2P0EA 4IXNA 5JI3E 4NDZA 3CM0A 3VFDA 5JWOA 1BMFA 5KUTA 4QM7A 1JEDA 3JZMA 3ADCA 1MOZA 4U00A 5HCNA 2J1LA 3C5HA 4PHFA 4URUR 3OZVA 3PG5A 2W58A 2MMCA 4DCVA 4G01B 1NN0A 2EWWA 2A5JA 3DDCA 1ZYUA 5AN9A 2QA5A 4UNPA 4C7OA 4CDGA 2ZS8A 4OHXA 4KSCA 1RE0A 1HY3A 1U99A 2DBYA 2XB4A 2GZHA 2DERA 4K81B 4A0HA 5JS7A 5L3QB 2ERYA 1H8HD 1ZNYA 4GL2A 3ASZA 4NMMA 1ZU5A 2ZSAA 3CNNA 1DAHA 1KK0A 1K5DA 2IHYA 2JLVA 5FTJA 3U3RA 5BWMA 1BS1A 3SJCA 2ONJA 1KDRA 2LKCA 3VHLB 1NSTA 3FHOA 2AXPA 3B85A 2I1QA 3GLHA 2Z4RA 1FTNA 4QBIA 1BOFA 4OHZA 2J7PA 5FL7D 4PC6A 1UBGA 5E7IA 4PANA 2CBZA 4NYIR 2W6JD 1MH1A 4F4IA 4KLZA 3W2IA 2OZEA 1U0LA 3SFVA 3ZJYA 1MRSA 2VYFA 4TQAA 3B2EA 4Q48A 3ZVLA 2G6BA 4LX0A 2VIIA 3TGPA 1QHNA 3ZVRA 1OE0A 1UPTA 4QL3A 5GV8A 2RKOA 1IAQA 4BASA 4YXWD 3BH0A 4MITA 2GK7A 1H8EA 2XNJA 3SNHA 2NO6A 2WICA 2YOGA 5C2JB 4JMPA 4OJKA 1YZKA 2G83A 1W2GA 4Q4HA 2WSMA 3LXRA 4ERNA 1VQ7B 3UMSA 4K8OA 2FZLA 4TTPA 3KUDA 5M04A 1RRCA 4IJMA 3EARA 3IEVA 4BFUA 3M4YA 4BLTA 5DISB 3OFND 3DMDA 3HPRA 1W87A 1Q1EA 4AY2A 1SVKA 4BRWA 3ZD7A 3K0CA 3CC2B 3LW8A 1N0WA 2NMVA 3NDPA 3G82C 5G41A 1ZM2A 4LBVA 3PEYA 4DT1A 3MCAA 1AZSC 2OXRA 4EFNA 1YJWB 3U3JA 4OQMA 1QFYA 4L4UA 5KPDA 4EQ6A 2VBCA 3PIRA 1E2KA 2HV8A 3FE2A 3HR7A 4FCWA 1NY5A 2V54A 3QXJA 1I4LD 3RABA 4UAJA 4C30A 4GP7A 3B13B 4EPRA 4XVRA 3DZ8A 2VHQA 5DN6D 2J0QA 1VQKB 1JPJA 1F2TB 1M1KD 1LV7A 2WM9B 1E69A 3SU8A 5E3HA 3OIVA 4C2UA 4A6XA 2V7QD 4JZKA 2BC9A 3T1OA 1ZM9A 1FW6A 3B8HA 3CF6R 2WAXA 4FMCF 2F7SA 4CW7A 2VSOA 4TLCA 1J8MF 3VKHA 4BZXA 2G77B 5B58C 2NO7A 4PZLA 3KL4A 1Q57A 4E5UA 5DN6A 5IHPA 1KMHB 1IJEA 1AS2A 2ZRCA 1F2UB 3VMFA 3FPAA 3QE2A 1FFHA 4MKFA 2G9NA 2VNIA 4AG6A 2ZSEA 2RGCA 1OIVA 4HLQB 4RFVA 4D4MA 4JBXA 2AWNA 5FBRB 2W2VA 2UZ3A 1N2CE 3I3SR 3AVPA 1W48A 2B21A 4HUQB 4JYCA 2OM2A 1M7GA 1XE1A 2ZYUX 3CX6A 1IXZA 5JJIA 2GWHA 5CM9C 3W2HA 3B1VA 4HLUC 5DI3A 3O8DA 2IWRA 4XVUA 3AVQA 3OHMA 1XD2A 3KUCA 3CCMB 4L9WA 4D0NA 5GJWC 4OI0A 2ZANA 1CXZA 1TADA 3HPQA 3TIFA 3CH4B 5KDLA 1II0A 1KI6B 3C16C 2BDTA 4OQFA 3F5FA 3EA5A 4R2IA 4CF7A 1O3YA 5BW8A 3KQLA 1OSNA 1OT3A 2CLDX 3PITA 1Q1ZA 3R8FA 1KDPA 3D31A 4GT1A 1GL7A 3GLHE 3L0IB 3QJYA 4G0NA 5EP1A 1NI3A 4KFSA 2DR3A 4ON9A 1ZIPA 1YRBA 2W2TA 3NHBA 3GLHB 5JZVA 3T5DA 3B78A 2XZPA 3LVRE 2FPLA 4OK5A 1Z83A 1XU4A 2ZTSA 3E2IA 5EP3A 5DO9A 4IDPA 1YHQB 1NN3A 1NY6A 2AWOA 3WHLA 1NG9A 1VPLA 1GVHA 4LOAA 3VU9B 4LZZA 4C0BA 2VP4A 2AD5A 1SVOA 1ZRHA 3GJ7A 4K1XA 3CXCB 1IN8A 3UMRA 4Q1EA 3IPYA 2OLJA 3WYAA 1D2MA 1TX4B 1W4BA 2OHFA 4AK9A 5EE5B 5A5GA 5L8VA 2V1UA 4F4CA 2EVWX 3E1SA 3THWA 4TMVA 5GVRA 2WJYA 1BKDR 1XWIA 3TMKA 3ZQJA 3O8RA 4KU4A 4MRRA 2JJ2D 1ZM3A 3AF3A 3D6TB 4GMDA 4A15A 1NVWQ 4BFYA 4G5GA 1VHLA 2HUPA 2QTLA 5FUXA 2QRZA 3IHWA 4LV8B 3EW9A 4O0MA 1E0AA 3EPLA 1XJ0A 2JLRA 3QXCA 4B6FA 4NU0A 2NPIA 2QP9X 5EXXA 4RD2A 3T1QA 3ZS8A 4GOXA 2B7CA 2OT3B 3WNDA 5FI0B 1OLOA 1OFIA 4NONA 4Q03A 2BOVA 1E0SA 4EJSC 3BERA 3GLFB 3UG6A 4NCNA 1FPMA 2WMNB 2ZE5A 2H92A 3ZZ0A 4WBSA 1DAFA 1SXJC 1XRJA 3CR8A 4XIGS 4P0TA 3EPKA 1T3LA 4FI3C 4JLMA 3QG1A 3PUYA 1N6PA 5H1YA 2GZDA 3MG9A 3KQUA 1QHIA 2IEYA 2OV2A 3BORA 3B1ZA 2GVDC 2OTJB 3OW2B 2HXSA 1XEXB 2CMKA 2VEDA 5KHOC 1HH4A 4ITRC 1FNDA 1R4AA 4CIDA 1LS6A 1QGAA 4R2HA 2IXEA 1Z2AA 3VO2A 1L2TA 2ORWA 1UDWA 2P3SA 2FG5A 2SHKA 1NF3A 4BEJA 1HQCA 5JHGB 3GEHA 5FOXA 2EYQA 1W5TA 4M1WA 4GPTA 2ZU0C 4QC2A 5CK4A 2BJWA 2F1JA 1C1YA 3IDQA 1E2QA 1F2UA 4B2PA 2CE2X 1X6VA 2YWGA 2ZJYA 4LJ6A 4Q4HB 1P61B 2XNSA 2NOAA 1KZGB 2OAP1 4KBFA 3FKSD 2KE5A 2J0SA 1KD1D 1Q3TA 1TUIA 3RS2A 5FPYA 2C9YA 1Z0DA 5K8IA 3CWQA 4DJTA 1LTQA 221PA 3RRZA 4E09A 1CS4C 1COWA 1D5CA 1EWQA 4B32A 2QQEA 4Q18A 1WBBA 2QNRA 5AK0A 1JEEA 2YZ2A 5EQTA 1CJKC 2DYKA 2X2FA 4YLGA 1VECA 1D2EA 1IBRA 3BBPA 3LX5A 4GBMA 1GKIA 2ZXUA 2OTLB 1A7JA 3WMFA 1XB2A 1XF9A 4UXIA 2GZAA 3QKUA 1FNNA 4PC3A 1ZAKA 3MMPA 3D8BA 3GD7A 4JLAA 2RAPA 5SZIA 4MH0R 3ICEA 3QENA 4JYBA 4URWR 2HCJB 4YONB 3TJZA 2C95A 4DEXA 3A1WA 4X8MA 3V76A 4RFSB 1KSJA 2ORIA 3CC4B 1N6HA 3DKVA 4G5SA 4A1FA 2VH5R 1RIFA 5FTMA 3A8TA 2WSSA 4M1MA 4DCTA 4UNRA 1R7RA 2HF8A 4H1UA 1CKEA 1KNXA 1EWRA 1L4YA 4ZDJA 3DO6A 4MGZR 1MO3A 1Y63A 1G4UR 1YQTA 2CL6X 4M9SA 2G88A 2CNDA 2ZRLA 4RJLA 1HA3A 1NNEA 4QJ4A 3NDBB 1TPZA 3U3MA 2RH5A 4LYHA 1H8HA 5BYJA 4TLBA 4LYAA 4X8OA 2BM1A 2QEQA 3BB3A 1E79D 2QAGC 2ZVQX 5BN4A 1FRQA 5TDHA 2AFHE 4KLNA 1KZ7B 1GRNA 1Z0FA 2ERXA 1L7VC 5FUWA 2XOKA 5KNBA 5H70A 1ODFA 1XTSA 4BFWA 4C0KA 4YMUA 3O47A 1TQ4A 3ZZUA 1Q7YD 1YZTA 2QTFA 3PUXA 1CJVC 2QRNA 2V8OA 1UAAA 1DELA 4A2QA 2DWOA 1US8B 5J5CA 3CRZA 1G7SA 4TTRA 4KV9A 4MDFA 1E79A 3GLIB 5FTKA 4TLAA 1OF1A 4HB2A 2FGKA 2O8FA 3PUZA 4C0SA 4AYTA 2BV3A 2R44A 1BH2A 1UDXA 4TQ9A 3E1YE 5JSZB 1G3QA 1ZD8A 1J99A 1OH7A 1TL7C 2QT0A 2A5YB 3CCEB 1PJRA 1GO2A 1YU9A 1YZQA 3EASA 3HR8A 3R8CA 1UKEA 5HKKD 1WB9A 2DY1A 4IHQA 1DPFA 2D2FA 4DEYA 4TSFA 2ZI9A 5F2EA 3A1VA 4US1R 5CB8A 4P4UA 1EFRA 3LBHA 2AKAB 4PPQA 3FWYA 4BWYA 5DH9A 4A82A 3ZC3A 2CXXA 3CR7A 3I4LA 1FP6A 1T8UA 3QI2A 1WDTA 4NKRA 5FOSA 2VP9A 3AVYA 2ODBA 2QQ0A 3LV8A 3TK1A 2WTUA 3KFVA 2V1XA 4HB3A 1QX4A 5KU1A 3VHXA 1L4UA 1QBKC 2GJSA 2J45A 2ZS7A 2OUKA 5EMNA 1P2TA 3EC2A 2CCKA 2RGAA 2QN6A 3QPUA 1IJFA 2FN4A 2ZAMA 3NBYC 4LJ8A 3BAFA 1KI3A 2BF4A 3PENA 2EWVA 1AN0A 2VP0A 3I8XA 5G40A 3IILA 4EPTA 4XJXA 1I2DA 1N6NA 3LVQE 2JLUA 4UQOA 3QOFA 5F3WB 3TQCA 1IY1A 1PVOA 4NH0A 1U9IA 3CIOA 3LY5A 4W7SA 4DC9A 3SQXA 2FX3A 3VR2A 4Q7MB 1P73A 1KO4A 2JJ1A 2QGNA 3BH6A 4RY2A 2CHQA 1XMVA 3KXIA 4JL6A 2QSZA 4G3XA 1TLLA 1G8PA 1W0KD 3EPHA 3KJGA 2H8KA 2OSBA 3QFRA 4DZZA 4PTLA 2JLSA 1U98A 4PHGA 5AWFC 2MSCB 4GDFA 1KI6A 3W8NA 2VTKA 1GTVA 1UKVY 2VLIA 4DLSA 4YXWA 4Q4LA 4B6EA 2N46A 4DLXA 4PSVA 1H8ED 3TSOA 2IYQA 3TUZC 1XD2B 2GXSA 1U0HC 3B82A 3K9NA 3PFIA 5BN5A 4D0LB 3OIYA 1Z63A 4HB0A 3CCRB 2REOA 2NQ2C 4M1OA 4BFZA 3CRRA 3VKGA 5JEEA 1VQMB 1W0JA 2GAOA 3LO5A 4UJ3A 4BFXA 3IHLA 2BMDA 4Q9IA 1S0UA 2NIPA 4M9XA 1D2NA 1LVGA 1TQ2A 3PJRA 3KDSE 1II8A 4HLUA 4L5BA 3ONWA 3SYNA 3FPKA 3MD0A 4DHEA 1A5TA 2WZQA 3DEFA 3QY0A 4AC9A 1G3RA 4FMDF 4L9SA 4PQFA 4G5OA 4JSYA 3TR5A 4ZDIA 2GRJA 1JXOA 1Q44A 1GJRA 3FFAA 1E1RA 4DSUA 2WKPA 3DVLA 2J7KA 2C99A 2QU8A 1DG1G 2PJZA 4LV5B 4DBLC 4Q7LA 1RPZA 3GMTA 1AS0A 1YIJB 4HDOB 1OB2A 4R98A 1YVDA 1COWD 4HI0E 2JAQA 2IF2A 3AH8A 4PPFA 4C0AC 1DO2A 3DPUA 4TYYA 5JWHA 3T1VA 2QP3A 2PLRA 2ZAOA 2QI9C 3EZ9A 3CKLA 2V7QA 1E2JA 1QUEA 2ZI6A 1FP7A 2ZM5A 1E9SA 5FOVA 5J47A 3THYB 1P7CA 4IFEA 1OIXA 4EPXA 2V6JA 1AM4D 5JJLA 2QSYA 3E20A 4OQNA 3U6BA 2WOOA 1K73D 3UKDA 3M6AA 3PV0A 3RC3A 2WV9A 3CW2A 1KMQA 2X19A 5CITA 5J4YA 2OILA 1T8TA 5L3RA 3X1WA 4M9ZA 1DE0A 1OIWA 2REXB 1PLJA 1T5LA 3CCQB 3BB1A 2OLKA 1C9KA 1WE2A 1E2HA 4RCYA 2IYLD 1GKYA 3GJ0A 3JZAA 4HAYA 4ZPXA 1SHZA 2PBRA 2KBFA 1OGJA 2AFIE 2R2AA 2WWIA 1QHHB 3SJAA 3GLIA 2JA1A 4TMWA 2GCOA 2DFNA 1E4VA 3W8RA 4NPHA 1EX6A 1RYFA 2Q9AA 3N70A 4CYMA 3O8CA 3QFSA 1JALA 1W34A 5EE0A 1ZM7A 4HDCA 3SOPA 2VNHA 1MO4A 5ANRB 3NEJA 4HYYA 2PX0A 1QGYA 2YC2C 1D8TA 3DOEA 2WWGA 2VNKA 4LJ4A 3HU1A 4URZR 5FPHA 4DLVA 3R9WA 4JT2A 2WHXA 2ZRNA 3PXGA 5AUOB 1U8ZA 4YDSA 2KJQA 4JKIA 4IOMA 4LI0A 3AF1A 4CT4B 4QXAA 5D3QA 1RRFA 3WY9A 3UATA 1CQXA 1T4GA 4UNQA 2H17A 3UWOA 4A0GA 1KK1A 1R0WA 3CF2A 5EP2A 3U61B 3VR6A 4LHVA 2ZJ5A 1ETUA 1ZMXA 2ZRFA 3MWYW 4LY6A 4BLQA 1G19A 3BS4A 3KQHA 4CEJB 1CTQA 2BMJA 2AHOA 1GILA 3Q9LA 2QM8A 2W6IA 4HAZA 1LNZA 1J70A 4TSFD 4LGMA 1UBFA 5KDOA 4KFTA 2KBEA 2PMKA 1QG2A 4URVR 1S9DA 2VSFA 4HAVA 3FVQA 1IXSB 2RGXA 4A8JB 1E2FA 3E70C 1WBDA 1DBSA 2HYDA 3SBDA 3TVTA 2X2EA 4AF7A 2QEXB 3T5GA 1EWYA 1KC8D 2W6ID 2NO0A 3EX7C 1G5RA 4PQYA 3P27A 2P6UA 3ZS9A 3CUEF 1IB0A 1NKTA 2FEMA 1W2BB 4PO1A 3TW4A 4V0LA 3NXSA 3DZDA 1BYIA 3OE7D 4IEIA 1VMAA 4NYJR 1VG8A 4RZXA 1F20A 1X8JA 2ZSDA 5D3MB 3U44A 1FMJA 1FQJA 3KKQA 4I99A 1U0JA 4DLZA 3VX3A 1W49A 3LBIA 4PO9A 2QA4B 4WIAA 4E22A 5CJ2A 1TF2A 2GXQA 3GFOA 1FNBA 121PA 4NHOA 4TL7A 1YE8A 1ZD9A 5LB2A 3BFVA 4O2RA 4PC2A 1SVSA 1Z8FA 3WRYC 1R0YA 2ZI7A 5JFGA 2O0JA 3T1TA 3AVOA 2Q3MA 3Q72A 2C98A 4TL8A 1BQEA 2OO7A 2NTYC 3OFNA 1WQ1R 3BRWD 4MQBA 2VSXA 2GILA 2DFLA 1JA0A 1B0UA 4PHTA 2V3CC 4QBHA 2W2XA 4A0RA 1X8LA 1E2GA 2YWEA 1JPNA 4J0QA 4PC7A 2BWJA 1T91A 2A5DA 2VYQA 3X1XA 3REGA 5EP4A 2H16A 3UMFA 3T06B 5GJBA 5G3YA 1R8QA 4B3GA 3GLIE 821PA 2IBMA 1F6BA 1G17A 4DUGA 3ASYA 4JLKA 3AM1A 4LDJA 4TL9A 2FNAA 3CMAB 2CLSA 1N25A 2ZE6A 4N0DA 4X8HA 4NP6A 3SS8A 1JR6A 1WF3A 4LBZA 5CDFA 2VZLA 2GF0A 4HDQB 4I1OA 2A3RA 5FUYA 2Q3FA 3B60A 2CHVA 4DSOA 3MUFA 3V9PA 3KKMA 4RVCA 5JBQA 4TZ0A 1UBCA 2RGBA 3DKPA 1UKYA 2BKEA 1KO8A 1ZNXA 2OFWA 4FD2A 4EQ6B 3UPUA 2WJJA 3B7GA 3U4QB 2GBLC 3GFPA 5BYKA 4US0R 4DRZA 3AVUA 1ZUIA 3RAPR 4L16A 5KOYA 4DKXA 5LD2C 3GJXC 4YC7A 1JB9A 2HJGA 3RSLA 3U4QA 1ZCAA 3RHFA 2FSHA 1CR4A 3E5HA 2BMFA 2C03A 3R20A 2J5XA 3VR4A 4JLPA 2RC6A 3HYRA 1JR3A 2Z5FA 4FXPA 3SI7A 1UF9A 1YRAA 5G53C 3VR3A 3MFYA 1XCMA 1E4YA 2QMHA 5C46F 3VU9A 1FX0B 2AK2A 3K0EA 3F3YA 3L82B 3J81k 2HF9A 1G7TA 4WOPA 2H1LA 3SE0A 3ZQ6A 4BEBA 1ANKA 1YR6A 3IQWA 1T0JB 4WXRA 1Q12A 3F0TA 2REBA 4C2TA 3T35A 1RKBA 3HDTA 2D62A 1Z6GA 4O25A 5J40A 1JJ7A 2O0KA 1R5NA 2GEVA 3HYTA 1DADA 1G8FA 1XTJA 2F43B 2VP5A 1LF0A 1W4RA 1IY0A 5FL3A 5J4HA 3A6PC 1P9WA 5H68A 5C1BA 2ODNA 1Q1BA 2WWXA 5AJYA 1NJID 1NN5A 1PZNA 2BGIA 2F9LA 3IBYA 3ZVMA 3OAAA 2XTMA 3NTUA 3VTKA 2V4ZA 1Z06A 3FMPB 4NCKA 3OZXA 1SM4A 3A37A 4A0FA 2PEZA 3CC7B 2NZJA 4LC1A 3WP0A 3JVVA 4LYJA 1ZC4A 3NBFA 4DXAA 3VNUA 3V4FA 1BIFA 3CCUB 3FHTA 1TU3A 3GEIA 3N2IA 2YJTD 1OB5A 1RRGA 3PEVA 4OKSA 4Q4JA 1ZUNB 4HUQA 1D6JA 3TSZA 1KRHA 1G3IA 2RGNA 2F3TA 4TMZA 2HT6A 3K0CC 2BBSA 1YR8A 5J4KA 2D3WA 2P67A 5GVSA 3WNCA 2XNCA 3NC0C 4DB4A 4IW3B 1JJ2B 3I5YA 1EFRD 2IS4A 3LA6A 2J46A 4F7DA 3MGCA 3QE0A 4MYHA 1CU1A 1KKMA 1JR3E 2J41A 1R2QA 3EWSA 4KXFB 1KGDA 1LW7A 1QVAA 2CK3D 4IVRA 2XXAB 1UADA 4AKGA 4N3NA 3QUSA 4B74A 2QE7A 2GESA 3L0SA 1G16A 2LKDA 2QZ4A 1Z2CA 2CVHA 5KNDA 3R9XA 1E2NA 2C9OA 2W0SA 2O8CB 2ZRBA 2GPJA 1G6HA 1JJVA 3A4LA 1RJ9B 5A0FA 4YAUA 4RD4A 4A8JA 3WBJA 2XITA 3W34A 1G5TA 3OEED 2JCSA 2J0UB 4BQSA 1F5NA 1SHKA 2BMEA 3H84A 3N5CA 2E9SA 1Z6AA 2ORVA 4NTZA 3LH5A 4YDHB 2WWHA 3A1SA 1CRPA 3QPWA 3QVUA 5FPKA 3OE7A 3I72A 3LO8A 1OXUA 5EJEA 3BXZA 4D0GA 3LDAA 3KXKA 4KJZA 1NN1A 3KKNA 4H1VA 2A30A 4OI2A 3KQNA 1W0KA 5TY0A 1K5GA 2JASA 4KO8A 2YOFA 2QY9A 4IVQA 4OBEA 5FBVB 1AGPA 2VHCA 4O2LA 3X2SA 1FNMA 3OESA 2A5GA 2XTNA 4BE7B 4HE5A 1OFUX 3ZIAD 5CIQA 3QFTA 4PZZA 1SVMA 2ZSBA 2JDIA 4I1UA 1XTRA 2RGNC 2XB2A 3QG5A 1XEXA 1XXHE 3U3KA 4PPGA 1XEWX 1G6OA 4RD1A 4ZI3A 3VO1A 2JLQA 3H86A 4UNNA 1XXHB 1OHHA 2HLDD 5JWRA 2DCUA 2AKYA 1J7KA 1UFQA 3HU2A 2AD1A 3ZIAA 4D4LA 3K8YA 5L3SB 1D9XA 4LPKA 3GPLA 3WNBA 1AKEA 1XMIA 2ZRAA 4MRNA 3B6EA 4JSTA 5GADl 2EFDB 3AGQA 1FUUA 4A92A 2JEOA 2QPAA 4I1VA 1H42A 1F2TA 1QZXA 3UIEA 4C0QC 1KDOA 2ZPTX 4E07A 1E63A 3OIWA 3R7WA 1E1RD 4HE6A 1QHXA 1YR7A 4HLCA 4NZYA 4LSGA 4LJ9A 2QROA 1OH5A 1WP9A 3CBQA 5FPSA 4TL6A 1SXJD 1XFAA 4Q47A 1T9HA 4XTCS 1TQ6A 4LK2A 4EJSA 1OXSC 1W2HA 3AP1A 4MKIA 4AYWA 1BX0A 4P4SB 1X1SA 4AKHA 1GITA 2CEAA 4IFBA 1G8GA 1M6NA 2AR7A 4CEJA 2LCFA 5DE3A 2ODWA 1E64A 3THWB 4LJ5A 1GZSA 1KDTA 4PX9A 1J8YF 1GNPA 4C7OB 1PV4A 2P2LA 1ZCBA 3EZ2A 2GEDA 4AG5A 1E9DA 1DTSA 2DETA 1VQ5B 1GRQA 2GJAA 2JJ2A 3DL0A 2ZJ8A 5BN3A 4QOSA 2GJ8A 1KSFX 3CLVA 1B23P 1KSGA 5JI2E 4N3GA 4OQXA 2RHDA 4DLWA 1A4RA 5CK5A 4TQUS 1HTWA 1G5PA 1VYUA 2ZETA 4FINA 2PZGA 3K53A 1IOZA 2O8DA 2R65A 2W6JA 2XSZA 4EKDA 1SGWA 5GV7A 3CRVA 2ZS9A 4D4JA 2Q3HA 1AKYA 4UXHA 5HE9A 2R6HA 1V5WA 1S4QA 2J59A 3QSYA 2GCOB 1UMKA 1SXJB 4IRUB 2L0XA 3HP1A 1XJQA 4RKEA 2PEYA 4XSGA 1CP2A 5GJCA 4S35A 4KHZA 5E95A 3T12A 3AV0B 1KO5A 2LWIA 1GL6A 3RWOA 3ETLA 3W6NA 1JQJC 1HT1E 3GFTA 2RHMA 4I4LA 4OYHA 1QGZA 1RC8A 1R5OA 3UXMA 3CCJB 3W6PA 3KXLA 1NLYA 3LXXA 3LNCA 3REFA 2HYIC 1ESMA 4DIDA 1GNQA 1P3JA 1KSHA 2CRVA 1J2JA 1IXRC 2GDJA 2IUUA 4PC1A 2IW3A 4U7DA 1U8AA 4ARZB 2V9PA 5KSZA 5HZHA 3F8TA 2OBMA 3K70C 3EIHA 2H18A 1N5IA 1P72A 5LD2B 1QVGB 3GLGB 1ZNZA 5F9FA 2G0NA 2QM7A 3QBTA 5KSYA 1A2BA 1E0JA 2P5SA 3CD6B 3MJRA 4ESHA 4KFUA 4L8GA 4Q9LA 621PA 8OHMA 3P32A 2YKGA 1Z07A 5KDDA 2FZ4A 3GLGE 1DAKA 3RC8A 3BD9A 4M2LA 3L8ZA 3FKSA 4ILEA 3RS4A 4BFVA 4D6PA 5HPYB 3K70B 3MAAC 2ZRMA 4Z8XA 2XZLA 2FU5C 3TSWA 4B4DA 1IN4A 2QL6A 5JS8A 1BYUA 1QH0A 3RSOA 4P4TA 3NEYA 4ZCMA 3U7EB 1N6OA 3LVBA 5CJPA 4C0LA 4YMWA 3EWAA 2BVNA 3ND9A 4CEIB 2ZUCA 2O8EB 3C41J 5EE3A 5LBIA 2RGEA 1DAIA 4R9UC 3GEEA 5DYIA 1II9A 1G291 3TLXA 2WBLC 4LRWA 1RZ3A 3ND8A 2X77A 4OHWA 4URXR 4CEHA 4LUCA 3C14C 2F9MA 1E0KA 3FYHA 4F93B 1E9EA 1MT0A 5K8UA 3C4JA 2WSSD 4NE2A 1IQPA 1XCGB 1GRRA 1P75A 3WYFA 1FNCA 3Q7QA 3BH7A 3AKDA 2BKUA 3W5IA 1E2LA 3TRFA 5HZKA 2Q21A 3LWNA 1JB1A 1VYTA 4P31A 2BN4A 3P26A 1N6IA 2JLZA 4OI1A 3FHCB 4G5RA 5EE9A 1J90A 1P2SA 2X1VA 3CONA 2F1IA 4QGFA 1ESNA 5FOTA 2ZJ2A 4OQLA 4ZDWA 2FA9A 4HSEA 1G8HA 2DFTA 1E99A 3AP3A 4U02A 1QDEA 1YZNA 2X8AA 1E2MA 3M1IA 3AUXA 3C7KA 4ZV4A 1D9ZA 1MO6A 3ADKA 1QF9A 4LHYA 3UWKA 3W3ZB 1GDDA 1PUJA 5EZ6B 4DIEA 1YJ9B 2A5FA 3A58B 3RNLA 1TU4A 1ZC3A 1VG0B 3FGNA 2HT1A 2QMOA 1ZBDA 1OW3B 2OK7A 3QEJA 4AURA 2VHJA 4MYTA 2P6RA 1QHSA 1LY1A 2R6FA 4IOKA 4G1VA 4RD3A 2IEZA 2WPDD 3A4NA 1KO7A 3IIJA 4NCIA 1EG7A 5C18A 3NIBA 3AB3A 4EPYA 4ZCIA 3TQFA 3ZYCA 5B57C 3W5JA 2P5TB 4Z1MA 4KAXA 4TZ6A 1M34E 3QXHA 1KKLA 2GXAA 3SDZA 4FN5A 3B1YA 3L0PA 5EXTA 2NG1A 3MRSA 1NG1A 3NBZC 2B7BA 5L3QA 4Q01A 3JQPA 3KKPA 1Q1QA 1TNDA 3FMIA 2ZJAA 4HZUA 4B35A 4RFSA 3CNOA 3CRQA 4KFRA 3W5HA 4YAOA 4JJZA 4WZAE 2JLWA 4DB2A 3NH6A 5JECA 3AVVA 1Z0JA 3CMEB 1VIAA 1AGRA 2ATXA 3G4SB 2O0HA 2VP2A 2FSFA 4Z8YA 1NRJB 1OKKD 2XX3A 1OH8A 4O3MA 1R10A 2RGGA 3TAUA 3WMGA 1NDHA 1G9XA 3A1UA 3K09A 3CPHA 1SKQA 5FI1B 1NVXQ 4JVLA 4Q00A 2QDXA 1S2MA 1U8YA 4JLJA 4AIIA 1NJFA 4UNSA 4DSNA 1N6KA 2PMDA 2HXYA 5JEDA 4LJAA 1Q22A 5E4FA 3TH5A 4II7A 3LQRA 3P1JA 1GL9B 3X1DA 1W36D 2QMEA 4CZ2A 4DCUA 5DI3B 2PIAA 2BBWA 2I3BA 2KI5A 3A4MA 5DNYB 3ES9A 3EA0A 3EAQA 1JBKA 5EUMA 3GQBA 4B48A 4GFDA 3U7GA 2NO9A 1A1VA 1VDZA 1NP6A 2R6AA 3FMOB 2N42A 2IC5A 1KAOA 3TBKA 1N0UA 1SVWA 3NWJA 4Q7KA 2WWFA 3EZ6A 5D3MA 3QXSA 5L3SA 1W0JD 4P6VF 3SN6A 6Q21A 2D4HA 4JVNA 2GBLA 4Q7JB 1EX7A 1FRNA 1ZINA 3KKOA 4PHHA 3X1YA 3G71B 4EFMA 3K9HA 3I32A 4P33A 1DAMA 2IYYA 1YJ5A 2ZRGA 4TYWA 2VHUA 5FH9A 4Z51A 1VCNA 4RSGA 1L8QA 3PEWA 1CR0A 3I1FA 4LCBA 1W36B 4TYNA 5ELXA 4D26A 5CB6A 2Y8EA 2WWYA 3THXB 3FJOA 1S1CA 2WIAA 2QG6A 1M8PA 1HEIA 2YOHA 3WYGA 4Q9HA 4A4DA 4DDTA 4BZPA 1X1RA 5JCPA 1OFHA 3A36A 3RDPA 1ELOA 3CF0A 4RKFA 4AI6A 2E87A 4PGOA 1B2RA 3QBVA 4G1UC 4HEJA 1VTKA 1CNEA 4B71A 3PUWA 1G18A 5H8WA 2UKDA 3QEOA 1S96A 4LYFA 4R71A 5FTNA 1WA5A 4A6PA 1M7HA 4E03A 1LS1A 3WRXC 4FMBB 1R8SA 1W7AA 5SZJA 2O8EA 3U2QA 2VO1A 3OEHD 2WKQA 1FQKA 2DB3A 2DEUA 2JIZD 5AR1A 2JLYA 2ODEA 3TVDA 3SJBA 4EAQA 3KQKA 4FW9A 4ZKEA 2CVFA 1J9ZA 4PAOA 2VF8A 1Z28A 2EU8A 2O52A 3BFKA 1VG1A 1Y3AA 2IWHA 5KSOA 4JKYA 2XXAA 1AQYA 1QVFB 3OEHA 2IHBA 1KI2A 2HDNB 3ZZTA 1Q0UA 4M4SA 2Q9BA 3L43A 2BEKA 3LRPA 2OEPA 1VQ4B 4TMXA 2OBNA 4WAUA 5B30A 2IS1A 1CLUA 3IGFA 1Q3HA 3VR5A 3GCGA 3GLFA 2IYWA 1XEWY 2A78A 5HR5A 5KO2A 4JLNA 4C0JA 3TW8B 3DM9B 1I2MA 4M8NE 1E2PA 2PX3A 3ZVNA 4KODA 4ZI2A 3AQ4A 4LBWA 1XX6A 1TAGA 3B1XA 3AEZA 4GNKA 4F91B 1QHGA 2BHRA 4JIMA 2YWHA 4LJ7A 1E2EA 4FMDB 3OAAD 3QKRA 3VQTA 3TE6A 4Q1DA 1VKJA 3W3AA 2WJHA 4D25A 3T15A 2GQFA 2YHSA 4ZIRA 2KWIA 1KK2A 3ZD6A 3SHWA 4DCNA 1E32A 4N0EA 1U90A 3FTQA 3Q7PA 3GJ6A 1JQLB 2IYXA 3SBEA 1XPUA 1WMSA 4DDUA 2ECKA 3CNLA 4Q5IA 2FH5B 2ZREA 5JLJA 3ICQB 2B6HA 2GF9A 4LHWA 3LBNA 1DARA 1NMYA 4MGIR 3LW7A 1AK2A 4KVAA 1GIAA 2EFHB 4BRUA 2AX4A 2D74A 2IYSA 2GK6A 3W2FA 1W4AA 4OHVA 4RZUA 3WP1B 4ABYA 3R9IA 3LQQA 2IYZA 5UKDA 2O8BB 4B3XA 4OK6A 4PSAA 2GETA 2P65A 3I55B 2C8VA 1GFIA 4DLYA 1S72B 2R6GA 1Z3IX 2A7QA 2H5EA 4PSKA 4GOKA 5AJZA 1A2KC 5FR2A 3THOA 1FUKA 1OYWA 2NO1A 3QIAA 4KYIB 1ZIOA 2CK3A 4QRHA 5CLQA 5AUQA 3WMEA 1RFLA 2OXCA 5G3ZA 3UANA 1HUQA 4KITB 4JVSB 5TR9A 2DWPA 1GAQA 1YHNA 1G7RA 1XD9A 2QE7D 2ZJBA 3DM5A 1M90D 1OXXK 3DMNA 1CJUC 1LFDB 3W2GA 4Q1FA 5FBLB 1E9FA 3KJHA 4TT3D 5B2ZA 3SYLA 5TV2A 1QHYA 3BK7A 4XD7A 4JJKA 3CPJB 4IEEA 3GLFE 1OYYA 4X8LA 2JJ1D 4W9MC 1VQ6B 4YQFA 1Z22A 4MRPA 2PCJA 2H7VA 2ZROA 1N5KA 4V0ME 1JA1A 1XD8A 1KOFA 2G0TA 2RC5A 5E7JA 5FR1A 4GP6A 1KI7A 4YHBA 2NPFA 3G5UA 3EXAA 4ZDKA 4TT3A 3THYA 3THXA 1HV8A 1HYQA 2IUTA 1R0XA 2B8TA 2XJ9A 5DHAA 4XD7D 4ZGNB 5CYOA 5P21A 4AKEA 1EFHA 1W47A 5AJXA 1P62B 2ASEA 2PT5A 5LPNA 3FMFA 5TXGA 2PZEA 2IT1A 1OXVA 1Q21A 1TF7A 3QKRB 2CCJA 2ZEJA 3U60B 2VPPA 1G64A 3W6OA 4WZ6A 1SZPA 3HWSA 4C3ZA 3I92A 1GOTA 1LB1B 2QT1A 4JBYA 5KSWB 1G20E 3W5UA 1P9RA 2QORA 3CX8A 3X1ZA 5KPJA 4M1KA 2C2HA 4EPWA 2O5VA 4CGZA 5E7MA 2X3UA 4QHTA 1N5LA 3RWMB 4QNRA 2F3RA 2CE7A 4NCJA 3GLGA 3KX2A 1OFTA 4XVQA 2UZIR 3I62A 1G3UA 1NJGA 3KTAB 4QKQA 4K46A 2ZR7A 4WW0A 5GJVC 2OCPA 2ZUDA 4AF6A 4BPBA 2ZRHA 1SVLA 1F3OA 3LLMA 4KSBA 1FTSA 1AMOA 3VAAA 2VA8A 2GAAA 1ONBA 3U5ZB 2ZVPX 4A9AA 2VRWA 1QFZA 3JQQA 1X86B 1U2RA 4AYXA 5IK2D 2CCGA 1C4OA 2W0MA 1UJ2A 3PQCA 3PCRB 3Q3JB 3AF4A 1E2IA 3P20A 3VX4A 4DT1B 4DDVA 3ZLJA 2R6CA 5DI9A 2ATVA 4L15A 2FFHA 2RCNA 1G3MA 1YZUA 4Z1MD 3CO5A 2G1KA 2FJUA 3HU3A 3U44B 2EFCB 1DEKA 2D7CA 1I7PA 4YALA 1Z6TA 3CCLB 1IN7A 1MABB 2I4IA 2JATA 1KK3A 3MJHA 4V0MA 1TEXA 4Q19A 3RRMA 2F43A 4DCSA 4HUTA 1HT2E 2N1BA 3QKSA 4QNMA 2G3YA 4ASUD 1GAWA 2CL7X 2F55A 1YZLA 1W1WA 2QBYB 1KI4A 1UEJA 1KI8A 3BJIC 4I81A 4D80A 3AVTA 3CX7A 3QKTA 4RD0A 4MUAA 1DOAA 1YITB 4NYJQ 2BEJA 2OAQ1 4F38A 1ZD1A 5TMPA 1ZVQA 3KFXA 2ZU6A 2D7DA 4QG7A 2HJVA 3KJIA 4FWTA 2XEXA 1OV4A 2YYZA 1E1QA 3I61A 1P2VA 1NMXA 5KSPA 1N5JA 1X3SA 4DQLA 3QXXA 3K9GA 1S3GA 2IF0A 4FCVA 3TAHA 4LHZA 2FEOA 4A2PA 1AJEA 2XTZA 2XAUA 2MMGA 4C9BA 2CDNA 3O8BA 4TYQA 4TYPA 2QGZA 1CRQA 1D1NA 4ACAA 1KJWA 1G8YA 3RS7A 3L0OA 2ZRDA 1OXTA 3NHAA 5HXBA 2PT7A 4FIDA 4ZO4A 4IVPA 1GAJA 1FL9A 4B3FX 1XDBA 4GMXA 3KB2A 4BPRA 2OFOA 2GXUA 4MA4A 4TMKA 4WQMA 4ACBA 4PAMA 2P6NA 2Z0MA 4Y7CA 1Q86D 4NYMQ 4Q9JA 2IA5A 4A2WA 2DPXA 1EFCA 2PZFA 5JHHB 4LV6A 4AKIA 4R7ZA 4RZ2A 4V0NA 1JAHA 1XCPA 2BJVA 4QHYA 3Q85A 3ZH9B 1MO5A 1BMFD 4Q02A 4TLEA 4CT5A 5C4GB 3TR0A 4YAWA 2E1RA 3NG1A 1RYHA 1T0HB 5IDVA 5FPTA 1I4TD 1UM8A 5IRCD 1CIPA 1EP2B 4Y9UA 5SZKB 1PUIA 3LAWA 2XZOA 2Z4SA 1EFTA 1UEIA 3BWDD 3L8YA 4MRSA 2QBYA 2OESA 1K9MD 2FPMA 2G1JA 4ESVA 2OG2A 4M1YA 1W4CA 1W5SA 4PZYA 4ZKDA 1YI2B 3WBKA 2J9RA 4PAQA 4B33A 1Q82D 4QHSA 4YMTA 1QG4A 1KY3A 4HB4A 2HCBA 2ZJOA 4B3BA 2ZITA 2WVJA 4RD6A 3CZPA 1XZPA 2OCAA 3JVUA 2XSZD 4LPSA 1T3SA 1VHTA 1XBTA 3OIUA 5JMTA 2VP6A 3WHKA 1Q20A 3WXMA 4ZGQB 3TUJC 4XWKA 3RANA 2VF7A 1YR9A 1BJKA 2GCNA 1FZQA 1FOEB 1SKYE 4DVGA 4C4PA 2ZYTX 2R9VA 3K0AA 1YZGA 2RGDA 4D2IA 1SKYB 2W00A 3ZDQA 2EFGA 4LHXA 3DHWC 4GZMA 4MGYR 2B92A 2FFQA 1S8FA 1AIPA 1A8PA 3QF4A 5AJVB 4EUNA 4EDHA 1T5IA 3MHPA 4MRVA 1IHUA 3FFBA 5JRZA 4GZLA 3ZGXA 4B3CA 4BFTA 2MSDB 5FA6A 4HAWA 1F48A 1KI9A 1GSIA 2YINC 4V0OA 2HMAA 3BIFA 2QPOA 2JGNA 1SULA 1YKSA 4JLDA 4EIWA 4DWJA 1YJNB 3CWZA 1K8RA 5F98A 2IXFA 4C43A 2Q6TA 1TQDA 4PPNA 3SZRA 2CJWA 2QTZA 3K1JA 1S9HA 5LDDC 1XEFA 2MSEB 3SYKA 4D4KA 4JS0A 4EPVA 1QFJA 1E9CA 2ZRPA 3JQRA 4Q66C 2KB0A 1NVVR 1QG0A 3AKCA 4HZIA 5FBQB 2GEUA 3LX8A 3DOFA 3TUIC 1IM2A 3W2EA 1U81A 1VCIA 5FTLA 4Q1CA 2WJGA 1KNQA 3B9PA 3IEUA 4TN1A 1KHTA 4URYR 3W90A 1TEVA 3MWKA 1KJYA 1MABA 2ZR0A 4Q21A 2BBTA 4UKDA 2OCYC 721PA 1U9IC 1VQOB 5AJWA 3ADBA 4LJYA 5JRJA 5CM8B 2IX3A 4JL5A 5FOUA 1IY2A 4QM6A 4XH9B 1Z6XA 4V02A 2F1HA 2QP4A 4BFSA 1LF5A 3TKLA 2XNDA 2OE2A 1E3MA 3T34A 3RRNA 1A82A 2WJVA 4UXJA 3RLFA 1GKUB 5TARA 2FF7A 1RJ9A 3IO5A 3IKJA 2PL3A 2R6DA 2QPTA 4M21A 4OI4A 1S1MA 3I73A 1QVRA 2DFKB 3KB1A 4Q9KA 4Y0VA 4HATA 3MLEA 2FE4A 5DHFA 1JR3D 1TMKA 3IBGA 4CRWB 3IQXA 2QAGB 3W5VA 2GA8A 2FDCA 3TNFA 3N2EA 4N1AA 3EPJA 2C5LA 1Z29A 5KYKA 3SJZA 2GNOA 2WJIA 4DLTA 2JIZA 4FK8A 1E96A 1DDGA 3K0FA 3AF2A 2O8BA 2F6RA 4OL0A 4NL4H 1WXQA 4TWZA 2IYTA 4NCHA 1XZQA 2CHGA 1X8KA 1NBMD 1IONA 1P9NA 4HZUB 1N0VC 1OKKA 3FOZA 1OPXA 2V55B 3P4XA 1F60A 1P4SA 1JNYA 3U6KA 3D7MA 4BGDA 2YNMA 2ANCA 4KBGA 1Q81D 2QAJA 3U3OA 5J4LA 3GJ3A 1HE1C 1NIJA 3GP8A 2QENA 3M0EA 1XMSA 2CLCX 1ZJ6A 3Q8XB 4B73A 4ZIRB 1P6XA 3AKEA 5H59A 3SFZA 2J7PD 5FL7A 2YWFA 2OBLA 3PVSA 5EZ5A 2XOKD 1ZP6A 2RMKA 5FOWA 4U5XA 2GTPA 3KTAA 1T6NA 3QF7A 4NYMR 3QFCA 4B75A 4GOJA 5DGXA 4KYUA 2JLXA 1M1YE 5JJKA 4AD8A 5CYPA 2IS6A 1KMHA 2ZI3A 1CBUA 2WWWA 2PJRA 1AQUA 1QUFA 3GJ4A 421PA 1XJCA 4GRAA 3IUYA 1US8A 1KI1A 2YV5A 4B44A 2WKRA 3ZBTA 2ZYWX 2OK8A 3CZQA 5EUQB 2YVUA 1FDRA 2C78A 1DS6A 4G5QA 2EFEB 3SHFA 2WOJA 1JXMA 4MKGA 4Q1BA 2WMOB 1E62A 2BMWA 4Q4AA 1KJZA 3RYTC 2QAGA 2Z6VA 4QBFA 2ZRIA 1H85A 1QRAA 4B76A 5A4JA 1DG3A 2BPOA 2UVQA 3I5XA 1N6RA 2CL0X 5B64A 3HJNA 1G7CA 2ZIAA 2QMUA 5HE8A 1GVNB 5BQ5A 3FB4A 4I1SA 2PH1A 3VKWA 1E6CA 2A2ZA 2EYUA 3CPEA 4EFLA 1ZUHA 4V0KA 1HQYE 4F92B 2ZUBA 2EW1A 1CNFA 3OZUA 1NKSA 1P2UA 4IOJA 1GG2A 1TVCA 3PR1A 4MYUA 1AZTA 3OJXA 5H5JA 4XWOA 4CEHB 1IN6A 4PXAA 2FOLA 2PLFA 3OEEA 5CDFE 4FWIB 1E2DA 4B43A 3NC1C 4FMCB 1NMZA 2R8RA 3EIEA 2VHTA 1PLKA 5C4MA 4S2EA 1RVDA 1ZU4A 2IUSA 4CEIA 4A36A 4P4SA 1XPOA 1DAEA 2IYVA 3EZFA 4PO8A 4HAXA 4EJSB 3AKYA 2O8DB 4KVGA 4P32A 1W36C 5L3VA 1JAIA 1UKZA 4B2LA 2O8CA 5TVKA 1DDIA 1AA9A 4GSYA 1Z6YA 2Z43A 1WRBA 1Z08A 2B8WA 4BLPA 2CJWB 5EXPA 1T3HA 4DSTA 3NVAA 1P60A 3GJ5A 1E94E 1G41A 4PFSA 4DLRA 1VQPB 1MR3F 5BXQC 4TMTA 2F1RA 4ASUA
chains in the Genus database with same CATH superfamily
4CQLA 2GA9A 1YBVA 4J1NA 4W5JA 3O95A 2ZI4A 5TEWA 2RD2A 1KY2A 4LF6B 4BNXA 1E3WB 2ATEA 3QLJA 4IIBA 3MJVA 4ZCPA 4HGNA 3L6BA 3B5JA 1VQLB 1EEHA 2BR4A 3H0KA 4F4HA 5IN4A 1Z0AA 2PH3A 3DDSA 5DBEX 1LSSA 2DH5A 2EEZA 1YBMA 3DOCA 1H5NA 2H4HA 1FXWA 2G9RA 1F3LA 2QTHA 4K3UA 5JCZA 3RSFA 3ABZA 4QYMA 3RVBA 1AS3A 3V3KA 3WRYA 1SBYA 2WPDA 2Q9CA 3RS5A 3SJUA 4LFBB 4KUEA 2CXOA 2Q46A 2GK3A 1RSZA 2PD4A 1UWVA 4B85A 5ALDA 5CG2A 2FV8A 4LE1A 4IJWA 3MMSA 1N2HA 1SH7A 3R6LA 4XE5A 3HCPA 4IO0A 1RW4A 3FDIA 4XB2A 4E08A 5FKJA 1WU8A 1WJGA 4F4JA 5HTOA 3EGIA 3FMGA 3AP2A 4FKMA 1YTUA 1E8MA 1G21E 2BH9A 3LXMA 4QYIA 1Q14A 5FUQA 4I3FA 4GECA 3IKVA 1WO8A 3ZWCA 2MR6A 4FCTA 2WABA 4PPYA 1ZUWA 1HEYA 2BFPA 3JZDA 1EFPA 1AG9A 4U9HS 5KMGA 5K2OA 3SSNA 3IAAA 4D4GA 4HEQA 3OWOA 4UTVA 1FP4A 4ZYWA 1JPUA 3K0FB 4NMWA 1E9BA 2A1IA 3TZHA 4MEAA 4TKZA 4X1KA 4QJ5A 4BNYA 1S3SA 2GHIA 2PMCA 1LZKA 1OT5A 3ABRB 1YR2A 3GUZA 4RBNA 4OHYA 4UJ5A 1MLDA 2C0PA 1HE8B 3KZ1E 4D57A 4DV5B 1A5ZA 2Z9BA 5IT5A 2HKIA 1O9HA 2QIPA 4Z9YA 1EAMA 3PUVA 4CR8A 5K03A 2ZJZA 4M6WA 1T43A 4KGZA 1OGIA 1B2LA 4RCZA 1MKYA 1XVAA 4X7DA 2ZYVX 4RF3A 1OCEA 1NZDA 1ZOSA 1NONA 1ZJYA 3DWEX 3EH1A 3G2HA 4EB8A 4QYXA 3HJBA 2YJ4A 3RASA 4DC0A 4Y2YA 3OQOA 3HDYA 1P39A 1KEPA 3OF5A 1SUPA 4KDRA 2H1FA 4HPWA 1QAOA 1PAUA 4A73A 1AQJA 2AN9A 3ETNA 3OX2A 1H9BA 1U94A 3FROA 2QZ9A 3LCMA 1GFWA 2BBOA 2ILTA 3DMGA 2WWVD 3HV2A 1NV9A 3MXOA 4CDRA 2OCGA 2OXTA 3D6MA 3DULA 1BA2A 4FB4A 1A8QA 2ROQA 2VYVD 3MD9A 4YJ3F 5E38A 3QQ5A 4B3DA 4Z6KA 4H59A 3CTMA 5HQ3A 2QV0A 4QLOA 4B34A 5KJ6A 3QH4A 1QBGA 1Z0ZA 1GWNA 1KVUA 3RS9A 2REQB 3PFFA 1R4MB 1JJIA 4YGYA 2VNJA 4LQCA 4GPEA 2XLBA 1IIRA 3PPVA 1P1RA 3QMPA 4TX1A 3RD5A 3UG7A 4S3MA 2VA9A 3DDNA 1KYIA 1SCAA 4MQ6A 2XE4A 3HZHA 3S1AB 3GAMA 4ENVA 4MLDA 1FY2A 3AHHA 5C8YA 1CUIA 1EM8A 3RTCA 8ATCA 1MG0A 4IFTA 3QVVA 2XF2A 5DSZA 1J49A 5DGDA 3TDMA 4OK3A 5HIKA 4HUJA 5EUCA 2VZEA 2BM0A 4YMGA 1QRSA 2IL1A 1U3FA 4RE6A 1EP1B 2IH4A 1MA3A 4B9AA 1P44A 1S01A 3R9KA 1JBQA 2UZ4A 3H0CA 4W7IA 5DM0A 2A1TS 3DVQX 4OHPA 4BC0A 1TAQA 5LQDA 3WYDA 3L92A 2FMXA 5DWDA 2GVZC 1R74A 3N59A 4BLRA 1JHVA 2PSDA 4AJOA 1XMJA 1ISPA 5KIAA 4BNDA 1W88B 3IHTA 2EX1A 4AP6A 1TUEA 2L2QA 2QUZA 2ZKLA 2GNAA 3K09C 1VJ5A 3ESYA 3QPVA 4M0KA 4B6GA 1CULC 1EESA 1Z0KA 3ORSA 1DIGA 3H1TA 2EKDA 3EEYA 3G2QA 3RSHA 3GXOA 2EL9A 3KJFA 3M33A 5AK5A 3N2GB 3GI1A 1VGRA 4IHAA 3D9QX 2VQSA 1MW8X 3NBMA 3JQAD 4XA8A 4FNOA 5JASA 1VYVA 2BJHA 1UWKA 3RK4A 2JGLA 4PG8A 2J0UA 3L8EA 2BFAA 4FDUA 4HNHA 4QGGA 5FUVA 4QTYA 1VGVA 3ASRA 1IY8A 2GN9A 2IHZA 2V6GA 2WINI 1BWSA 2YHUA 4H4CA 2XD4A 3DD1A 1TF5A 1QK5A 1RLJA 1PR1A 2OZKA 3WRXA 4C29A 2MHCA 1IXYA 2IYPA 2ZTLA 1P31A 2ZXIA 3TMAA 1KQSB 3ZBUA 1QVVA 2AN5A 1GXSA 3WJ1A 4IDOA 2NU7A 4FYMA 2X1HA 3U7FB 3LGXA 3I56B 1FC0A 1ARZA 1DBWA 1QK4A 4FSDA 1WMFA 4TYMA 2SKCA 1KVTA 3E9QA 521PA 1O9BA 3ZBPA 5CFPA 3HYSA 5BRAA 2PGJA 2BCEA 4INAA 4C87A 4RYDA 1G1MA 4XARA 3LPAA 4S0ZA 3ZWKA 3KSDO 1M2OB 4OJQA 5ALZA 1QCCA 2YRWA 3GEGA 3C39A 3KZXA 1P5HA 5FNVB 4MARA 4EX6A 2RAUA 3EEBA 2AL7A 3ZX5A 1Y8QA 2NSDA 5K8VA 4NFHA 3L2OB 2FDRA 2XMBA 3ANSA 3OQMA 2IS2A 2CLLB 2GJKA 4UUPA 2I03A 1DEXA 2O2DA 1A4IA 4N7JA 5CVDA 1RQLA 4CV0A 5IULC 5L95A 3HTXA 1IMJA 3DA8A 5HTKA 1WSVA 1BX1A 3IEPA 1OC4A 1RP1A 1ATZA 1X1DA 2PVSA 1ENZA 3GEBA 4XB1A 5ECDA 4P3OA 4BZQA 5A4IS 3E7WA 3GPIA 2IY9A 4JZYA 3A9CA 4MW1A 4M0FA 4XOIA 5CP8A 1T1JA 4HDAA 4HHEA 4LC0A 4A91A 4C5AA 5J4VA 2GKSA 1XK7A 3DVSX 1N6LA 4MYCA 2V8BA 1KFKB 1GQQA 1MV5A 2JJ8A 4Y67A 1O96A 3CW8X 4XB6B 5CGZA 3S1SA 3LUAA 4MGKR 1YL6A 2FW0A 1QCDA 3PGLA 3TR6A 1TYEB 4DJFC 5ITZA 1H69A 1LX6A 2YXPX 2COKA 1LEHA 1R0ZA 1W35A 1XP8A 4HLNA 2HLDA 1OHHD 3BHJA 3O94A 1BO6A 1JDSA 1V43A 1L8OA 1E9RA 2BCGY 3B1WA 5TE9A 2MSNA 3CCVB 1PBTA 1PG0A 2AJLI 3FRIA 4M86A 3SWWA 4Z4VA 4QFMA 4GM0A 5F23A 4NBSA 4G4JA 2XD9A 1I13A 2D2EA 3K6RA 2QRVA 4PSCA 5HF5A 2IX9A 4QUEA 2OOKA 1JP7A 1VG9B 1XTZA 2BFEB 4KN6A 4WZBE 4FJ0A 3HE3A 4XYMA 8ADHA 4DV6B 1TUGA 3OZWA 2P0EA 2PUJA 4IXNA 1ODCA 1NQXA 5AXCA 2G72A 5TX7A 3VFDA 4YB8A 5JI3E 5KUTA 3O38A 4C89A 3BF8A 4O4JA 2J1LA 1DMSA 4PHFA 3RIHA 2I6TA 4EY8A 2I87A 3FDJA 2EWWA 3M9WA 4JP5A 4FQ5A 5EIWA 2OMKA 4FEGA 3DDCA 1ZYUA 3OM0A 2HA3A 5AN9A 1AHIA 2I8LA 4HFMA 4UNPA 1DBVO 2PDAA 3I3OA 2ZS8A 3LSTA 4BVKA 3ZE9A 4KNYA 3VVBA 4LZWA 3GEMA 5E6UB 2XB4A 4PVCA 5JNSA 1A5BB 3MQ2A 4K81B 1BRTA 3BGVA 3FCSB 4AL4A 3FTDA 1V7PC 1X7ZA 5J35A 2FKAA 3DEYX 1I51A 3NHUA 3EFOB 4MVXA 4EI7A 2QR3A 5IBRA 1H8HD 2E5LB 3HHEA 4MXDA 4NMMA 3JQFA 3ONYA 2ZSAA 1U0FA 4WKBA 3QMWA 3OI7A 3OOSA 4OD0A 5K0CA 2IIBA 1QJCA 1T15A 2H65A 3L02A 5DMXA 2CYCA 2ZTNA 5K6RA 4DR1B 1YONA 2ZJ1A 4ARCA 1XG5A 3HV0A 2RARA 3Q8WA 2ZBRA 4MQFB 1BS1A 2M5SA 3U3RA 3ZWWA 5A04A 1RPJA 2RBKA 3U26A 5FWXB 2ONJA 1KDRA 4G0WA 2LKCA 4RF4A 3JD2A 1JG3A 3DFMA 2E4YA 1RYBA 3N7TA 5G4KA 2AXPA 4WY5A 3GLHA 1H1TA 3IEKA 4Y6QA 4OHZA 2ETVA 2WMYA 2Q2NA 3D6HA 1GQYA 4AUEA 4BQIA 2QQGA 4E4RA 1UBGA 3LOPA 4UBKA 4P83A 1ZJ4A 2W6JD 2WB4A 4F4IA 3W2IA 2OZEA 3PT9A 1ID1A 1FBTA 3QUAA 4HWGA 1U5BA 3BN3A 3P0JA 1CFJA 3JYHA 4MW2A 4AZWA 4X9XA 1H1LA 2HZ7A 1JR4A 3K1YA 5INTA 2OENG 2V3VA 4U4AA 2MSWA 2RHTA 3SNHA 3RVDA 1P80A 4EG6A 2FPPA 4FFWA 1CR6A 1T4CB 1W2GA 2V45A 1R5JA 4Y30A 1FDIA 4A03A 1G66A 4ERNA 1GG8A 1M2VA 3AG5A 4IJMA 2ZB8A 3CE6A 5HZBA 4LSMA 4BFUA 4J0DA 3B5IA 3M70A 3QK7A 7AT1A 5DISB 2NXNA 1E18A 4IH4A 4RO0A 4UM7A 1JAYA 4IO1A 3RYFA 3KQMA 1T1IA 3WLAA 1N0WA 2AR9A 4RGYA 1RM5A 3EGEA 4JC8A 5JOQA 1HE4A 2V59A 3KT3A 3G82C 2BI7A 4GAEA 3GUUA 4BFLA 4EG7A 3SJPA 1FSGA 2H0AA 4I50F 1AZSC 3UJAA 3DH0A 5EJAA 1QRTA 1IZYA 1U04A 4YRGA 4DUZB 1U02A 2EQAA 5DF1A 4A5SA 5EKUA 2RG7A 2VBCA 3FCYA 1NQWA 1OASA 3PIRA 2DLDA 4DWWA 3Q8KA 3FE2A 4CKWA 2ONZA 1YB2A 4FU0A 3PGJA 4GQIA 1NJ6A 2Q4DA 1I4LD 3RFFA 1O94D 2VAVA 4C30A 1W9XA 1W8IA 3B13B 4XVRA 1P3DA 3ZI0A 4RMIA 2NVWA 1GAEO 4L28A 4KACA 3CZRA 2WHPB 3FTPA 5BPHA 2LV8A 2IPLA 2O1XA 3OIVA 3KNZA 5FWAA 5TRTA 3LK6A 3LUFA 4DF3A 3DBLB 3NAGA 2BC9A 2AVNA 1S6YA 1FW6A 1RPAA 4YASA 2NYUA 1AUPA 2F7SA 1PDWA 4FHFA 3RYIA 3E9NA 1O94A 1E8DA 3JALB 3ASSA 2G77B 5A0VA 5B58C 1OAKA 1TO6A 5TF4A 3RYHA 3DLPX 3NALA 1KMHB 1PFWA 1YASA 2H4XA 1EH5A 2R8ZA 1IJEA 1AS2A 2FQYA 2ZRCA 3FPEA 5CDTA 3NCHA 2H9IA 3FPAA 4AG6A 1FFHA 3W1VA 5CTAA 5KCZA 3SSMA 1ZGBA 1Z5NA 1G20B 4HLQB 2XQVA 4RFVA 4GHWA 3W9UA 3QXGA 1A9XA 3ODGA 3ABSB 4MB0A 4S04A 4YRCA 2UZ3A 1HTTA 2VJJA 2HY7A 2WU4A 1JWLA 4HUQB 2CFIA 1K9VF 4JYCA 2GM9A 1XSEA 4YBZA 1M7GA 4YRPA 2ZYUX 1KE2A 3CX6A 3T5BA 1IXZA 4ZRNA 1BDHA 1GHTA 5CM9C 4EJ6A 3QNWA 2H4FA 4HLUC 4CMKA 5I9NA 4HWPA 4XVUA 3AVQA 1POWA 1XD2A 3KUCA 3CCMB 3OC6A 3OHMA 4L5YA 4LW8A 1M83A 4CE6A 4D0NA 5KTMA 3UFXA 4Z4WA 1F06A 1I9CA 2FUEA 3HPQA 3TIFA 1USIA 3K8ZA 5CB4A 1KI6B 3GUCA 3C16C 2BDTA 1X74A 4OQFA 1JEJA 3FJYA 1CY2A 4CF7A 5IVKA 4DYVA 3QA9A 4I2NA 3TLAA 1MT3A 1OSNA 4OA5A 5AIBA 5GWXA 2PL9A 3PITA 1Q1ZA 3ZY6A 4AU1A 2BUBA 2WTEA 4DWVA 4FYHA 3R8FA 1KDPA 4GT1A 3GLHE 1K0FA 5CB4B 4CKYA 4RNDB 3UYLA 1QTNA 1MX9A 2DR3A 1GU1A 4OJNA 1ZIPA 3TTXA 1YRBA 2CFOA 2HPAA 3IV9A 5CT4A 3MGAA 4B46A 1HNWB 3RVLA 3G9ZA 1YS2X 3DVAA 3GRZA 1B93A 5JNRA 1I6KA 3STTA 4KMMA 3EVFA 4QNNA 1GVHA 2WSBA 4LOAA 1IWOA 4LZZA 2YUIA 3C0KA 5TJHA 3B51X 4DIOA 2AD5A 5EHZA 1B15A 1W0CA 4FR0A 3HVHA 3CXCB 3V6MA 3ZV5A 3EISA 3UMRA 4CQMA 5AVUA 3EFBA 4BXOA 2NTJA 3ENZA 3M6VA 1W4BA 3IAHA 4AK9A 5EE5B 3KXPA 4RK7A 2QV7A 4WN3A 1XAGA 2AJBA 1TTHA 2VZ0A 3ROGA 3TMKA 3NBAA 1IQ0A 1N5OX 2GBPA 3O8RA 1TA4A 4KU4A 4MRRA 3DP7A 1Q50A 1J9GA 4BU1A 1EB8A 1XYGA 2V0CA 3IRVA 5C8XA 3FCEA 1VKZA 3D6TB 4L8FA 4LFCB 4WD3A 4EY5A 1JHDA 1TUBB 5IT4A 1VHLA 3NJRA 5FUXA 1Z12A 3EW9A 3LCUA 1FS5A 1NXPA 3EPLA 1T10A 1X1CA 1XJ0A 4PFQA 1JFTA 1MVNA 1YS1X 3Q9SA 2FW8A 3M4ZA 4FFMA 5HG0A 2J5BA 3ZVNA 3R8XA 1EBUA 1XT6A 4MWGA 4FIZA 4Q03A 2VCEA 5J1SB 2PX5A 1E0SA 4Y6SA 4MI6A 5T6BA 4NCNA 3KBOA 4WESA 3DVAB 3DWFA 2WMNB 5B7GA 4IKPA 4A8HA 1XRJA 4IV8A 3RM3A 3UV3A 4GGMX 1O6ZA 2D00A 1E6EA 2X4LA 1T8RA 1H5UA 4RHFA 4CUZA 3E3LA 1N6PA 3ZY2A 4H18A 4QPCA 2QYHA 1SUWA 1ZO8A 3PNPA 1KYWA 1FEZA 4OLBA 3RG8A 2OTJB 5EZYA 1XVLA 1K7SN 4LECA 1Z8DA 1Z36A 5FV7A 3ZN2A 3CGWA 4BP1A 1DQYA 1R4AA 1GN9A 1QYIA 5IAGA 1T5DX 3WIEA 4CIDA 1QGAA 3FOCA 2IXEA 3O4IA 1M6EX 1Z2AA 1T3GA 4LNUA 4D8VA 2XI4A 2QUKA 1NF3A 4Y2VA 2X23A 3WYNA 1J1ZA 5JHGB 3FGPA 1JSLA 2EYQA 3GEHA 3M4NA 5FOXA 5I7AA 1FFAA 1UBOS 1JUDA 3MOSA 4YUVA 1RR6A 2RJOA 4I4IA 1JDJA 1GRVA 3HCAA 1OA0A 1GADO 2BJWA 1C1YA 2F1JA 3IC5A 4R54A 4DVJA 1SIWA 1E2QA 2QMQA 5IABA 4GPIB 1SA0B 3NT4A 4PX5A 1CK4A 4QULA 1PZHA 4BGEA 4LY3A 4D7AA 5CDYA 1F8YA 1KZGB 3IYLW 4FEEA 1LDMA 4O29A 3FKSD 1HBJA 4PSUA 1AURA 5KHAA 4ZEVA 4PU0A 2A84A 2W2MA 6REQB 1Q3TA 3CLKA 5K8IA 2W6OA 2C9YA 1Z0DA 3O93A 5FPYA 1H2WA 4DJTA 4W5RA 2BGKA 3AJDA 2HUNA 3ZXYA 1ZGGA 4UU7A 3MQFA 5M7EA 3NEAA 3TZBA 3PLAE 1JIQA 3AFHA 2HO4A 2G1UA 3AFGA 1KH2A 2O7RA 3AC0A 3FB1A 4QTXA 2D59A 1JEEA 1ZMTA 2DQ4A 2YCLA 2YZ2A 2VZ8A 2YQ4A 3OCVA 4FDTA 2PS9A 4OAQA 4O4LA 4XJTA 2I6XA 2X2FA 3WNVA 5JYCA 1UC9A 1GYQA 1PZFA 1E5QA 3RJZA 4HFRA 3WGLA 2PYZA 3ZXXA 4UQLA 2GMWA 2MDTA 4TT8A 3WAJA 2OTLB 3KZOA 1NXSA 3WMFA 3ZCPA 1YZFA 4AO6A 4CF3A 5BMVB 2OFPA 1NBAA 2AE2A 1WX1A 3KOWA 5AHKA 3D8BA 4BNGA 5JTTA 2RAPA 3AR3A 3A6GA 1P91A 4MS1B 1T1RA 4KC0A 2C95A 2YQZA 3A1WA 5ADHA 1L7MA 1T0IA 2VC2B 1M6VB 4I2VA 4QATA 5FTMA 4KR3A 2Y27A 4WX2B 4M1MA 4DCTA 2F1KA 3HBLA 2IHTA 1X77A 3VHXB 1EWRA 1TTQB 4WFJA 5E9WA 1JMYA 2W4MA 5H80A 4ZDJA 3GAFA 5F76A 1T2NA 4X6LA 5EQJB 4N9WA 2FPRA 1MO3A 3IX7A 1Y63A 1LGYA 1HKUA 3DTVA 1PR4A 1OMOA 1YQTA 3ZU4A 3HB9A 4MVYA 2ZRLA 4RJLA 5FLEX 1NNEA 4QJ4A 4M0PA 2F8MA 4ZAWA 4MIEA 3U3MA 4D1YA 1QZTA 3ZJ5A 1A0OA 1ZFNA 1KEEA 4J6FA 4TLBA 4UMFA 3R5FA 5IVHA 3PZRA 3SC2A 3PU6A 2ZVQX 4K6HA 2XDAA 4L27A 5TDHA 5BN4A 5ELMA 1Z0FA 1GRNA 2IHUA 2HBYA 4EKGA 4J16C 5HP4A 1EI9A 1ODFA 1AKTA 2EP7A 1RXUA 2QR2A 1C3OA 3TOXA 4FYXA 3CR3C 3WIBA 3PUXA 1GZUA 5E2IA 4E88A 1UAAA 1EVYA 3UMVA 1DELA 5KOJB 2ESRA 1CWUA 2R1VB 3S8YA 1US8B 1Y6QA 1PDVA 2FZVA 3A6DA 5J5CA 4Z49A 4G7XA 4HXFB 1QKKA 3DT9A 3EMKA 3GLIB 3FLMA 5AK6A 1Y34E 2WTAA 1TCVA 4G1FA 4OUDB 2JHCA 1RVV1 1VRWA 4TQ9A 3RIGA 3R7AA 1ZD8A 1KP3A 3BSFA 5JSZB 1AH2A 2COEA 2KVOA 2A5YB 5J43A 5EQDA 2R8BA 4XN0A 2V9ZA 3C8ZA 3LCCA 2B4YA 2AFRA 4RA9A 3V1NA 4G0VA 3MT8A 3HGTA 1DJLA 3A1VA 4KV7A 4CCSA 2A4MA 5BW6B 1WULS 4QPZA 1EFRA 4UVDA 4UAGA 3FKJA 3MOIA 4BWYA 4EF4A 1QVZA 1U3TA 4TM8A 3VI3B 4F60A 5B7NA 1VLYA 2VRCD 3TBFA 2HA5A 3VZPA 1WDTA 1N7HA 1WSAA 3P9SA 5A1TA 3AVYA 1AT1A 3LV8A 4MEJA 1GTRA 4OSPA 3AOEA 3KFVA 1U0TA 5BVHB 1NMSA 3DO8A 2EG5A 2PS3A 1SY7A 4W9NA 2OUKA 3M6MD 4CI9A 1P2TA 1D2RA 3SEQA 5JNUA 2HNBA 4YO8A 3VR4H 1Q16A 5DYYA 4A16A 2EW8A 2I62A 4IWNA 3Q2IA 4CMJA 4AJ1A 3PQ8A 3ZWQA 3C87A 1O57A 3IPAA 3HKEB 2WHPA 4L22A 4WK4B 5LQKA 4YQYA 4QUIA 1H0HA 2Q1WA 3TRDA 4EPTA 5C7LO 2WJ4A 2OBYA 1DXOA 2WTMA 4XJXA 3RGGA 3WL3A 4I8XA 3QOFA 5CJJA 2AYXA 2Z1MA 3IVRA 4X95A 3P8ZA 1BPLA 1BWRA 5HKBA 3ZHQA 1TCUA 3CIOA 3AUFA 1DB3A 5HQTA 2FX3A 3UH1A 1OU4A 4WXHA 4B8WA 2CD7A 3CF4G 4IRMA 1DRKA 4H7PA 1MQ9A 4RY2A 1VLVA 5B1SA 2Y1XA 3HRIA 3P71T 1W0KD 1G8PA 3EPHA 1CIVA 3WWOA 3NONA 3EMVA 3NYQA 1ZJZA 3GFQA 4JU9A 4QOFA 4U9IS 5AWFC 4JH0A 4AN0A 3PGKA 1PWXA 2X7XA 4MVJG 1EWKA 1GTVA 3OZBA 5KB3A 3CUKA 2C4UA 3ITNA 3Q7TA 2ZIEA 4K6FA 2WQ7A 1R18A 1JFFA 2N46A 1SD5A 4PSVA 2O3UA 3OKFA 1T2FA 3KQOA 4U6NA 2C3UA 4DLXA 1EIWA 3K9NA 4ZTUB 4MQUA 9LDBA 5BN5A 4GXRA 2VKTA 1KFJB 4MW4A 2ZK7A 1YZVA 4J0IA 4N5LA 4BV3A 3V8MA 3EOZA 1XWWA 5A4DA 2UXBB 4OMFG 5AK4A 1TFRA 3LHSA 5DGTA 1I2BA 1UFOA 5JEEA 2GAOA 3N0WA 1I0LA 1F17A 2OWDA 4PCVA 3HJUA 3NWBA 1YQ9A 1U0RA 2NIPA 4M9XA 4Q9IA 2X3FA 2G5PA 4EY4A 3F6RA 4KXLA 4CIXA 2QUIA 3ONWA 3FPKA 3D6AA 4U2KA 2I0FA 4YEDA 2WZQA 3NLLA 1ZGHA 2ZUUA 3FF1A 1AZWA 1L3IA 4AC9A 2O3JA 1GTL1 4BO2A 1P6UA 4MTCA 2GRJA 5CGQB 1W73A 5MFPA 2D5BA 3DWIA 3DVLA 1V39A 3MB5A 3H2BA 4RIHA 3K5HA 4D99A 3G0GA 3NEPX 1L6IA 2ZIUB 1L1FA 4DBLC 3MJ4A 1TJ5A 1VFPA 1ZICA 2ZOSA 1KBOA 3GFGA 3SD7A 2HMWA 3PXDA 2VWPA 1VE9A 2HQBA 3FR8A 3G59A 3MTEA 1V8DA 3ND5A 4BBPA 1ZSYA 5FJJA 2BFFB 4X64B 2GCGA 5C1OA 1ZK3A 4F3NA 3K9CA 3HCFA 3T1VA 2JF0A 1B74A 5DYWA 3WMRA 4AZ0A 3G1UA 3B38A 4F2HA 3CKLA 4B4UA 2Q5HA 5FBHA 1QUEA 2VHYA 2ZM5A 1FP7A 3K6JA 1ZRMA 1P7CA 3TZKA 1Z0UA 2IUEA 1QG6A 5E6TA 4R31A 3I1JA 1AM4D 3DTYA 5CEJA 5CFLA 4KRXA 3BCFA 3BXPA 1ISJA 4WK0B 5JJLA 1QIEA 3S3TA 2ZUTA 4F5EA 2O2IA 4YCCA 1VA5A 4QPJC 2Q3LA 1THGA 2DUMA 2VH1A 2ZUVA 3PV0A 2V6MA 3QW4B 4BDTA 2FKNA 3CW2A 4JQZA 1L7PA 5CITA 2GPSA 1U5AA 1T8TA 2OILA 3K8QA 2P91A 4R1PA 1DE0A 2EF1A 2IKQA 3R40A 4KB5A 5D51S 3WLSA 5IZ4A 2DR2A 2REXB 1SHJA 3CCQB 1WV0A 2FFRA 2OLKA 1WE2A 3UK1A 5CLFA 5IKMA 3JZAA 5JY1A 4R2MA 5LQUA 1NI5A 4ZPXA 2BRUC 3NHMA 4OP7A 2R2AA 2Y71A 1KU6A 1IN1A 3OO1A 2WWIA 4MUJA 2FQ1A 4IG9A 4HYQA 1K28D 2HK9A 2GCOA 1UDBA 2DFNA 3G17A 3HEMA 4S2UA 1RYFA 5AVZA 1DI0A 4N01A 3O8CA 4H3SA 3QFSA 4DG5A 4ER5A 3L1HA 4QRIA 1ZM7A 3FZYA 4IGEA 1T6XA 5BR1A 2QYTA 3FWKA 1JFVA 2JGRA 2R97A 5KOHA 5JYDA 1E6LA 3LL7A 2HQRA 2P2ZA 5KNBD 4PV7A 4ZPJA 3FYTA 5DNUA 1TRKA 4EHJA 3UJ8A 1LW6E 4HYYA 1DAOA 2PX0A 3BFPA 2IV2X 2WWGA 2VNKA 1PT6A 4NE7A 4R3UC 4W6ZA 5EIBC 1VHWA 4UD2A 1WHSA 5LFAA 3R9WA 2DBQA 2WF8A 4HXEB 1U8ZA 1ULAA 4LI0A 4IOMA 1HVXA 2AEMA 3AF1A 2FPIB 3H97A 3LT0A 3OQIB 3OT1A 4QXAA 1RRFA 3EEIA 4BO7A 1CQXA 5EIHA 4MW7A 4MUHA 4UNQA 1FYXA 4RWEA 1Z17A 3WB1A 3ZDEA 1EUCB 1HLFA 3W6UA 3DV0B 4FJ2A 4V39A 2HDHA 2P2SA 3ZHXA 1WUYA 3PUMA 1ZMXA 5JAPA 2AFHA 5FULA 1G19A 2JL1A 3ZI7A 4UHBA 3AJAA 2GOYA 2AHOA 2FZKA 7ADHA 2W6IA 4HAZA 1LNZA 3MWDA 3MTBA 4TSFD 4K05A 1PYOA 1V1MA 1UBFA 2WE7A 3ZE0B 2KBEA 3K7EA 3OOJA 3B3AA 4TRRA 4W5QA 2QRMA 3E9EA 2O2EA 1UM9B 3GVCA 1E3ZA 2QQ5A 3K1AA 4C4TA 2CXNA 1B3RA 4DMCA 5CFQA 2H1VA 1KVRA 2YZGA 4A8JB 1I3NA 2QVCA 3L7MA 3E70C 1ZKDA 2X2EA 4AF7A 4XWGA 3UCFA 3WRWA 4UDNA 3T5GA 3OZEA 3OETA 2W6ID 3GWZA 3NAQA 2NO0A 4K0KB 4X84A 2GCEA 4KAJA 1HDCA 2IV7A 1JDUA 1QOQB 3NNDA 1Y8RB 2B35A 3CUEF 3BCDA 4RVOA 3TW4A 4PO1A 3B1KA 3BKXA 3NXSA 1NP3A 2Q4BA 3D4OA 4ZTBA 3TTYA 4E13A 2NZXA 1RWNA 1VMAA 4Q3KA 5F64A 3C3XA 1VG8A 3ZK7A 4OYYA 1NUPA 2W71A 3WKBA 1R15A 1XR3A 3GD5A 3H11A 5D3MB 2W11A 3B36A 1SUDA 3H8WA 1WDKA 1FMJA 4REQA 3KKQA 4DLZA 1VCHA 4B5LA 2B36A 1GUDA 3KE9A 4FPXA 3VX3A 3LBIA 3TKYA 3D3JA 2QA4B 2ZJFA 4D4HA 4I4NA 2OO5C 3K3PA 3NORA 4BNKA 4E22A 4INZA 5HKAA 2B1QA 4K9KA 3E48A 1SD1A 5HUQA 3RUHA 1LBEA 2MJLA 3CZCA 4TL7A 3ENVA 1GNTA 4DMMA 4Z2AA 1MB3A 4Z9BA 3D8HA 3EIOA 1VLOA 1GGJA 1GV1A 4IH1A 1YZHA 1CB7A 1NJ1A 1QGOA 2C0QA 5EWMB 4LF4B 4XFKA 2LUOA 3VO9A 1IBLB 4B7CA 2TECE 3TRJA 1PX0A 2RHHA 4KKVA 3VH2A 4RF2A 4B7ZA 3INRA 3Q72A 3PTZA 1H0KA 1XL0A 2YHIB 1E59A 1BQEA 2OO7A 2IYOA 4QWWA 2QD1A 2I2FA 1PJSA 3KPYA 3A2LA 2EFJA 2IDJA 2GILA 3HWRA 1V7QA 2C9ZA 3IERA 3NBKA 4MQBA 4QYWA 2WHRA 3VC1A 1CUCA 5E6SB 4H1WA 3WGHA 4UTRA 1B1AA 4PC7A 1ULTA 2A5DA 4PLHA 4ZYXA 2H9YA 3HSSA 4QVAA 4HH0A 1DHRA 3CIFA 3REGA 3T4EA 3I52A 3CYFA 1WV1A 1NW5A 3FBGA 2E1BA 3MWEA 3LY8A 5GZ3A 5CRIA 1H6CA 4WNAB 4P12A 1WXDA 2Q0XA 2FRVA 2IY7A 3DT8A 4PBRA 4XDYA 3STWA 4Z0HO 3TZCA 4ME6A 4JLKA 1O95A 1PDOA 2VJKA 4RIGA 2W2PA 5A4MS 5A0TA 3C1AA 2CLSA 5BV2P 3RWBA 5L45A 2WUVA 3QX8A 4X8HA 5D6NA 2PWPA 3BX1A 3HUDA 5CW2A 4L2IB 4BNUA 1HT3A 3IKLA 3IQFA 4M0MA 1FDWA 4CV1A 4XM1A 3GT7A 3PFBA 2QIOA 1W2WB 4IQFA 4OH1A 1RTTA 3B60A 1LKZA 3EBLA 3KKMA 4FZ3A 3UKOA 3G02A 4FB5A 3D6UA 2R66A 2R4QA 4EQ6B 4BIMA 1F9AA 1KO8A 4FD2A 1VSTA 1ZNXA 3ZLTA 3HKDB 4ZK2A 1WG8A 3DG9A 2GBLC 5TNXA 2VK1A 4JUFA 3CA8A 1MUUA 1XDUA 5BYKA 1ZUIA 4L16A 4J0CA 4L8JA 4DKXA 1MPTA 5IYZA 3EGXB 2VF5X 3GJXC 3SXUB 2NT3A 3U4QA 1ZCAA 3GJRA 1YNSA 3TNJA 4LAFA 1E7MA 1C9DB 1CR4A 2FSHA 2BMFA 1UEXC 2PZBA 2ZIVB 3R20A 1TD9A 1XVIA 2BKVA 4JLPA 3HYRA 4HQFA 5DP1A 2Z5FA 2J3KA 3SI7A 1UF9A 1DC3A 1IRXA 4GKBA 3BDIA 3VR3A 4BKRA 4UUAA 3MFYA 1E4YA 1FVOA 5KVSA 3VU9A 2PIDA 2DSNA 1I30A 3F3YA 1QZ3A 2PXAA 1YDMA 3QX7A 4CR6A 2HF9A 2FZWA 2WVAA 1KH3A 5FP0A 2C7PA 2KYRA 5DLDA 3UB4A 1UJ5A 1HC7A 4OUKX 2X5KO 2YS6A 3HDTA 3JPWA 4O25A 3HRKA 4P5DA 2O0KA 5IAJA 3LYAA 1DADA 1YF3A 2F43B 1VIDA 1Z4PX 2ZTVA 1BN6A 2J4CA 1LF0A 1W4RA 3A6PC 4D8TA 2ADOA 4B7UA 1WKCA 5C1BA 2ODNA 1Q1BA 2R85A 4DV2B 2HJ9A 3U17A 1NN5A 1R6TA 1SEPA 3OC0A 3VSDA 4RTLA 1SCUB 4QASA 3ZVMA 4DOMA 4EYKA 4Z7OB 2PA0A 1I3OA 5KNLA 2V4ZA 3PE6A 4NCKA 4A0FA 1VJRA 3OO0A 3JVVA 5AOBA 1CY0A 1PR0A 1ZC4A 5EZQA 2GN6A 3NBFA 5I9SA 3VNUA 2YHAA 1IEXA 2I66A 2PNFA 4KL8S 3VPAA 3I0NA 3CZMA 3GEIA 1VLZA 3N2IA 1MU0A 2C4MA 5HF6A 3KSBC 2A86A 3QWIA 3D5EA 4YV2A 5LXTF 2D3NA 4HUQA 1KRHA 3HXMA 1G3IA 4D96A 3JXEA 4UUOA 4X3PA 3LUKA 5F5LA 1V25A 3K0CC 2BBSA