3PENA

Structure of archaeal initiation factor aif2gamma subunit delta 37-47 from sulfolobus solfataricus in the gdp-bound form.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
403
structure length
403
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
molecule tags Rna binding protein
source organism Sulfolobus solfataricus
publication title Structure of archaeal initiation factor aIF2gamma subunit from Sulfolobus solfataricus in the GDP-bound form.
rcsb
total genus 101
structure length 403
sequence length 403
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3penA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3penA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3penA01
4G5GA 1XP8A 1HTWA 2ZRNA 2ZUDA 1NN0A 3FMOB 2Q3HA 1GG2A 2VSXA 3CXCB 3SS8A 1JAIA 3OESA 1GKUB 4FWIB 4WAUA 5ELXA 5CITA 3DHWC 4OHXA 1N6OA 2ZJ2A 1GDDA 2OZEA 3D8BA 2FPLA 3IILA 1ZNXA 1KO7A 721PA 3T34A 3W5JA 2RGCA 2FPMA 1GR1A 3FOZA 1LF0A 2SHKA 4OK6A 2D3WA 4MRRA 4TLEA 1HY3A 2IHBA 3SE0A 1ZC4A 3LAWA 1CR2A 2ZJOA 4M1WA 4P4SB 4M2LA 4IOLA 1Z28A 5ANRB 4NDZA 4PZYA 3RLFA 1P2TA 5FOWA 3OFND 3NTUA 4CT4B 2YZ2A 2O8DA 1F2UB 2O5VA 1K9MD 5DI3A 1TPZA 5FUVA 1PLKA 4MRVA 1CJTC 2DR3A 4Y0VA 1AIPA 2CHQA 4FINA 1M2OB 1P6XA 4HLUA 4DSOA 3LY5A 1Z6XA 1Q82D 5H70A 2NIPA 5KNBA 1D9XA 4DEYA 2WBLC 2Q21A 1IY1A 2QAJA 1NN1A 1XXHA 3VNUA 3FPKA 2DWPA 1E2FA 2H92A 2ZS7A 2MMCA 3JQQA 4ACBA 1XNJA 4TMZA 4RFSA 1Z47A 4UXIA 5FI1B 4MITA 5EUQB 1VQ6B 1KAOA 1NKTA 1FUUA 3IKJA 2J41A 1Z0JA 821PA 1NG1A 4IDHA 4UXHA 1J9ZA 3NC0C 4W7SA 1M1KD 1RZ3A 1N0WA 1XCPA 1E2KA 2V7QA 5IHPA 3WNBA 1AGPA 2FSIA 3GLFE 2OXRA 1G1MA 4NPHA 4KJZA 3UG7A 4A2QA 4HE6A 4B2PA 3TQFA 2P65A 2PLRA 3KKOA 4U7DA 4LJ9A 1SVWA 2B5OA 2C5LA 4KBFA 3DOFA 1E2NA 1GSIA 4CT5A 5KSZA 3ZC3A 2FU5C 1ESMA 4ZIRB 3QE2A 1XZQA 1LTQA 2IXEA 2RGBA 4M9XA 1ZM9A 4G01B 5L3QA 2ATXA 4LYFA 1N6PA 2I1QA 4MKFA 2L0XA 3T61A 3LRPA 1SVMA 4TWZA 4RD0A 3TRFA 1QG4A 2I4IA 3TVDA 1IN6A 2R6AA 2LWIA 1FRQA 3ADKA 3GLHB 3MUFA 4K46A 3C41J 3GEEA 2G83A 1Q1ZA 1BO6A 3SZRA 1ZUIA 5CK4A 3ZVLA 3PUWA 4QBHA 1P9WA 3CRMA 2XAUA 5CM9C 3JQRA 2BWJA 2CNWD 1Q1BA 3CC2B 1DG3A 3UATA 4EFNA 1TEXA 4Q5IA 3SU8A 1G8YA 3KJGA 2PH1A 3BFKA 1G4UR 1OYYA 2RGDA 2BN4A 2ZR9A 2CL7X 2XEXA 1RW4A 2AL7A 4DVGA 4EQ6B 2XB2A 2BGJA 4CDGA 4D4LA 4D6PA 4DLYA 3QKRA 4F7DA 2FWRA 3BB1A 4EDHA 4YMTA 4XVUA 3CPJB 4G0NA 4PPGA 2KE5A 2XOKA 1KZGB 2V55B 3E5HA 3LFUA 3U7EB 2W6JA 4QGGA 1P7CA 4P33A 2HCJB 3AVQA 4KFRA 4JSTA 1KDPA 3B1YA 2ZJZA 4PFSA 4R2IA 3L8YA 1X1RA 5G40A 4OI4A 4A0FA 2GHIA 1XMSA 1YR9A 4Q1DA 2QBYB 1H8EA 4GDFA 3LNCA 2R2AA 1G3MA 2ZI3A 4GOKA 4LPKA 1AS3A 4D26A 4WVFA 2ZSFA 4P4TA 4TMXA 4LCBA 3QE0A 3VR5A 4LV8B 3Q7PA 1VYTA 1ZP6A 2P6NA 2BMWA 1Q1QA 3N2IA 3K0FB 4M1TA 3MCAA 1XFAA 1P2VA 5A5GA 1DTSA 1G8GA 5KNDA 3CR8A 4FMCF 4NYIQ 3I92A 1TVCA 3LA6A 4UJ3A 4X8MA 3GLHA 1T6NA 2BC9A 4NONA 3O8CA 2FZ4A 1BMFD 4AF6A 5FR2A 2QRNA 1V43A 1US8A 1RRCA 2BEJA 2C9YA 2CLDX 1B2RA 4NHOA 5EZ6B 1P9RA 3K0EA 3SDZA 2PT7A 4JBYA 1B0UA 3ZS9A 4AYWA 1CNFA 4DLUA 1C9KA 3B1XA 1VQ8B 1N8RD 1T3SA 2VL7A 3KUCA 3GLFB 4O2LA 3K0SA 3LLUA 4A0HA 1E9FA 1E9EA 2UVQA 1TADA 1H42A 3FB4A 2ZR0A 2QEXB 4LV5B 2WSMA 3A1TA 1LB1B 4GNKA 4YAOA 3CCJB 3BB4A 3NBXX 1W36D 1N5JA 1W2HA 4PC1A 2ZXUA 2GBLC 2QM8A 5L3SB 3PIRA 3UXMA 2ZUBA 1XTQA 4DLZA 4EQ6A 1NMYA 3BAFA 1KQSB 4ZPXA 5TMPA 3EIHA 2JGNA 5TDHA 3BRWD 4Q00A 2IF0A 4URZR 1TTTA 2JJ2A 2WAYA 4NYJR 3R9XA 4ZKDA 3WBKA 4H1VA 3ZBUA 5EE9A 4OJKA 4V0ME 5FUWA 5E3HA 1CQXA 2X19A 2ZI4A 3QJYA 4LK2A 4J0QA 2WPDA 3OZUA 2WPDD 4DBLC 3T1TA 1N5IA 3DKPA 3OFNA 5LD2C 1KTVA 4YAWA 2YC2C 5JHHB 3U4QB 3HDTA 2ZEJA 4HAWA 3I4LA 2AK3A 3BGWA 2KJQA 4PAMA 3FHTA 4LI0A 3WNDA 2OLKA 4Q03A 4A2PA 3KTAA 1LF5A 3PUZA 2VYFA 1OH6A 2ZVPX 3H4MA 2GZHA 1ZVQA 4HZIA 1PUJA 1J99A 2ZREA 3THOA 2V4ZA 4D2IA 1SVKA 3G5UA 4WZ6A 3KKPA 1KY3A 4Q4JA 4PANA 4TYQA 1BMFA 1V5WA 2IYZA 1NY6A 4ESHA 2ASEA 4B48A 2DPXA 3FFAA 4TN1A 2W00A 4I1OA 2XZLA 5EXSA 3TLXA 2GEUA 4DQKA 1P5ZB 3MG9A 5EMNA 3MD0A 2H57A 2ZJ8A 5C1BA 4GMXA 2FGJA 5AUNB 2F3TA 4KO8A 4Q9KA 1G9XA 1II9A 3CBQA 1PVOA 5D3MB 4HE5A 4HAYA 3U7FB 4EUNA 1Z6YA 3WRYC 1UMKA 5J4HA 1JR6A 1OXXK 2O8BB 2ZRPA 1WRBA 4LHZA 4KVGA 2NG1A 2REBA 4OKSA 3A36A 1NN5A 2NGRA 2IYSA 3T35A 3VQTA 2XJ9A 5DHFA 4URVR 4LJ5A 4Q9HA 3OEHA 4F92B 1F2UA 1G3RA 3CF6R 2EU8A 1BQEA 2HLDA 4QGHA 1IXRC 2WJYA 2XZPA 1HE8B 4F38A 2BV3A 2D7CA 3SJZA 4TTQA 2OM2A 4BZXA 1UDXA 1TF5A 1NLFA 2PZGA 4D4MA 2QA5A 1ZD9A 3NDPA 1COWD 5THXA 2OBMA 3L2OB 1H85A 1U99A 2W0SA 5HTKA 2ZRGA 1K8AD 5CIQA 1Q1EA 1QHHB 1N5KA 1XBTA 4U9UA 4Q21A 5J5CA 3OZWA 2FN4A 5EXPA 4B44A 3O8BA 5CIWA 2WAXA 1QFYA 4YMVA 2OCBA 3FPAA 4M22A 2FX3A 2NPIA 1ZM4A 3MHPA 2VHTA 3ZVNA 3I8XA 1SXJB 1FFHA 1M74A 2JLRA 4IEIA 3SQWA 4QL3A 1W35A 3JZAA 4W5HA 4GFDA 2Q6TA 5KDLA 4MUBA 3I56B 2G77B 1B23P 1UKVY 1GM5A 1Z08A 3P27A 4I1UA 4OI1A 3NG1A 1UJ2A 1SVOA 4B73A 2ZU0C 3FE2A 2CJWB 3TKLA 5KO2A 3SN6A 1EX7A 4IFEA 1W4BA 2OTJB 1DAFA 3ADDA 2ODNA 3PEVA 2UZ3A 1XX6A 2OK8A 1KSHA 3A4MA 3U3MA 4BQSA 2ZSBA 3BXZA 2QG6A 1GRRA 3KJIA 4TQ9A 2HXYA 4QBIA 4V0MA 4PO9A 4PZZA 3GFTA 2VP9A 1VHTA 1S4QA 2HEIA 1KMQA 4P32A 3BH7A 1XZPA 1KZ7B 1UKYA 4DCVA 2IS1A 3K9HA 2UKDA 1UF9A 3K70C 2CE2X 5FBVB 4Q4JB 4PQRA 3H84A 3PEWA 4M1SA 3THWB 4KHZA 1E79A 1TQ2A 4G1VA 2QROA 4IVPA 2AXPA 3EZ9A 4DRZA 4ILEA 2V3CC 2NO1A 5CJ2A 1GL6A 1CU1A 1P73A 1L7VC 3L8ZA 1WQ1R 5EE0A 1R8SA 4K81B 3LH5A 4KYIB 5BN4A 1UADA 1RRFA 1OF1A 1UKZA 3GJ7A 5D3MA 4AG6A 4N3GA 2W6IA 4GRAA 3QF4B 2NPFA 4Q1CA 5B58C 4XWKA 4YDSA 2B7CA 3H0KA 3W5HA 2VEDA 3WMGA 2XNCA 1G64A 1FP7A 4BPRA 3MSXA 3UMSA 1XD8A 5DGXA 3RANA 1NY5A 2FOLA 2P2LA 3QXHA 2XSZA 5DLQC 4DEXA 3W2HA 4JT4A 3VAAA 3VU9A 4I99A 4MYUA 4Q9LA 5EXXA 2KBFA 3G4SB 1YIJB 2IF2A 2AX4A 3S1AB 3GLIA 1L8QA 2H17A 4PC7A 3KQNA 2OEPA 3TR0A 1DG1G 5TXGA 2ZJBA 2P0EA 2IC5A 3IDQA 4B3BA 3W2GA 1IBRA 4G1BA 3ZIAA 4OHYA 3R9IA 5FTKA 4FI3C 5CYPA 1JALA 1KK2A 1G17A 1VCMA 1XWIA 2QAGA 1YI2B 3A58B 2Q3MA 2GCNA 2EWWA 5JEEA 4FMDF 1KI4A 3EAQA 4L9SA 4PXAA 1YZGA 3TJZA 1G16A 4PTLA 2ZYVX 1OYWA 3GLGE 1K8RA 1R6BX 3SHWA 2Z0MA 2C9CA 1ZD1A 2IL1A 2B92A 4US2R 2WKQA 1JAHA 1MO3A 3SJCA 1W36B 5F9HA 1G3QA 4V0KA 4BFXA 3M4YA 1W1WA 2A3RA 1OXTA 5L8VA 4C0SA 4U00A 1PV4A 3BWDD 1Z83A 2XXAB 3T15A 2PJZA 3ONWA 3RWMB 3QXCA 2G0NA 2WKRA 3CWQA 3FKQA 1AKEA 1HQYE 4Q47A 4F4CA 3L82B 2E1RA 3CMEB 3MWYW 2XNDA 4C0QC 3SBEA 1E0KA 4HYYA 2IBMA 3FMPB 3HR7A 1Q3HA 1F3OA 3DVLA 2HV8A 3IGFA 1G18A 3KFVA 3SYNA 2VRWA 2V9PA 3B6EA 2WVJA 4YONB 3THWA 2QE7D 4AKHA 1Q7YD 1GO2A 2FE4A 1DE0A 2N1BA 4WIAA 2GETA 1W2BB 3VR2A 3HJNA 2DFLA 3B13B 4EJSA 2HDNB 1R0XA 1SHKA 3AF3A 5EP4A 1RPZA 3PEYA 3BB3A 2ORVA 3QKRB 3S1AA 1MR3F 2OG2A 4P0TA 3EW9A 4RZXA 1CKEA 1U9IC 3T1OA 4B6EA 3KX2A 3H86A 1GNQA 4XVRA 1KO1A 1US8B 2FF7A 5CLLA 2YWFA 5TV2A 2F43A 3Q7QA 1ZIPA 2C78A 2VLIA 1CNEA 3KXIA 4WA7A 3ZH9B 2VNKA 4B43A 3EPLA 1SZPA 2GCOA 3VKWA 1E2LA 1FMLA 3VX4A 4IFBA 2IYRA 1JB1A 2TMKA 4IXNA 4BLSA 1W44A 1S9DA 3CX6A 4Q48A 1GZSA 2DWOA 1OXUA 1XXHE 1W34A 2FFBA 2G1JA 4DQLA 3JZMA 1Q86D 1TX4B 5DISB 1GJRA 2D7DA 1VMAA 2J7PD 4UNNA 1QX4A 2PMKA 4B3CA 5JS8A 2A5GA 4ASUD 1G7RA 5JLJA 2BEKA 4OK5A 2REXB 4OHZA 5F9FA 4QKQA 2LKCA 4H1UA 2W83A 4IDQA 4B35A 1MOZA 3EPKA 1ZYUA 5FPKA 2VA8A 1KDOA 1CTQA 1VCIA 4HB4A 5M04A 1FDRA 3HYTA 3O47A 3QBVA 4ZV4A 5TARA 3QNUA 4Q1AA 4OHVA 4B3FX 1UPTA 3ASZA 1SGWA 4KSBA 1SXJC 4Z54A 1FNDA 1VG1A 4QGFA 3SNHA 3OE7D 3QXJA 5GJVC 4C0KA 4D81A 1D2NA 1FL9A 1GTVA 4GP6A 4L9WA 1XEXB 2QPOA 1R8QA 3X2SA 3HP1A 4PC2A 3L43A 4MDEA 4Q4AA 5JJLA 4YHBA 3AEZA 3UANA 2QA4B 2AFIE 4M9ZA 2Y8EA 1VTKA 2FSFA 3W3ZB 1XEXA 1HH4A 1T5LA 3MWLA 1XD2A 4UNSA 2V6JA 4NTZA 3GLIB 2YWGA 2ZI6A 3DKVA 4JMPA 3G6EB 3P20A 1SXJD 3QBTA 4U02A 3UMRA 2CJWA 2IWHA 1H8ED 3CRZA 1JA1A 2XITA 2EQBA 1S2MA 2JLZA 1DDGA 1UBCA 2YV5A 3NIBA 4QOSA 1GKYA 1SVIA 2B6HA 4LJYA 2ODEA 2GJ9A 3UPUA 4NZYA 1I2MA 1NSTA 1OPXA 1JR3E 2NOAA 1A5TA 4D4JA 1KI6A 1U8AA 1EWRA 5GV7A 4C3ZA 1X8JA 1QVGB 3RS3A 4EAQA 1T3HA 1JJ2B 2QPAA 1DADA 1FP6A 3C4JA 3DMDA 3WY9A 4IDNA 4LSGA 5FBQB 1G6OA 1G7SA 3EIQA 4FMCB 4DT1B 1MRSA 5SZIA 1NMXA 1RIFA 2PT5A 4F7WA 4MGYR 1XJ0A 1NLZA 4KYUA 2FZLA 2HLDD 3EC1A 1DVRA 3Q5DA 2BVNA 1OJLA 4IJMA 3NC1C 3BH6A 3RRNA 1SXJA 2F9LA 1E1RA 3OAAD 4DJTA 4B4DA 1M34E 3U7GA 3OIUA 3O8RA 1D5CA 1G4AE 1XEFA 2JLQA 4RZUA 1W5TA 3PG5A 2F43B 1NBMA 1J70A 3KL4A 5LBIA 1NIPA 1NJID 1W4CA 4TSFA 3E20A 2ZYWX 1VYUA 2V1UA 2WHXA 1VG0B 3AF4A 3ND8A 3PV0A 4R98A 1Z5ZA 2R6FA 1NBME 1DARA 1WB9A 2YYZA 1UEJA 1YE8A 4TYNA 4BLOA 2IXFA 2HYDA 3JVUA 4TZ0A 3H1TA 2Q9AA 2FFHA 1R5NA 2WSSA 3GQBA 1N5LA 4A8JC 1ZNYA 4YMUA 1XTKA 2ZTSA 2ZE7A 3GEHA 1NP6A 1QG0A 3B78A 4B6FA 3A1WA 5B2ZA 3FMIA 4UNRA 2AN9A 3Q8XB 3PJRA 4Q19A 2X8AA 3RS5A 4FMDB 4BFWA 3R7WA 4BLRA 4O2RA 2CL6X 1U0HC 4LYJA 4LC0A 3CCUB 4ZGQB 2HF8A 2O8EB 1N6IA 5LPNA 1HT2E 4DSNA 3K0AA 3TH5A 5JSZA 1ZUNB 3O8DA 1M7BA 3MJHA 1E2IA 1VIAA 1SKQA 5CM8B 3LD9A 2CDNA 1R5BA 1N6HA 4JJZA 4QG7A 4RZ2A 1JPJA 1WE2A 3UKDA 1I4TD 1HYQA 2CMKA 4AF7A 3IBGA 2XZOA 1GNRA 3CWZA 2C96A 2F1JA 3AP3A 5FR1A 2Q0HA 4DUGA 3QI2A 4M8NE 2KWIA 2ORWA 3NWJA 1KI8A 1QHHA 3U3JA 1QBKC 1CIPA 1P9NA 2ZPTX 5TVKA 1IY0A 3FHOA 1NJFA 3BD9A 1AN0A 4DLSA 2CLSA 2XTNA 3AVOA 2OE2A 1R5OA 4I81A 2V1XA 1T9HA 1MT0A 2IS2A 1NVUQ 2CBZA 2GCOB 1K5DA 1XEWX 3I61A 2IYTA 2ZRDA 3ECCA 1OFHA 2BSAA 2AKYA 2FSHA 3SI7A 3T06B 3I1FA 3G71B 1Z07A 2YVUA 2I3BA 4S35A 4FIDA 1ZRHA 4PPQA 3OHMA 4IXMA 4LJ6A 1KO8A 4V03A 3ZIAD 3NDBB 5KYKA 3GJ3A 2BJWA 5FBLB 2REOA 2J9RA 4KITB 3BJIC 1DDIA 2XNJA 4KVAA 5EP2A 3QIAA 4WXPA 3T12A 4ZDIA 4UNQA 4B32A 2P6RA 5TR9A 1OH8A 2DYKA 4ACAA 2R65A 3EIEA 4AKEA 4LGMA 1U0LA 2WKPA 4Q1BA 2QAGB 1HA3A 2JJ1D 4OQXA 2GJ8A 1KSGA 1YR6A 3TSOA 3A1SA 3MWJA 2CRVA 4IKEA 4Q4HA 3TMKA 1GAQA 3NH9A 2O8CB 2GXAA 2WJVA 4FN5A 2UZIR 4XJXA 5BW8A 1YZNA 1NRJB 1ZCAA 3CCQB 1TU3A 3SC3A 3Q5EA 4PGOA 3KKQA 1XPOA 4F4JA 2EFHB 1KI9A 4BFSA 4F4IA 1VQOB 3NEYA 4JYBA 4YAUA 4AURA 1W48A 5KUTA 1YZKA 3ZD6A 4M1OA 4R9UC 3OJWA 3IUYA 2QP9X 2ZI7A 1QDEA 3FWYA 1EESA 5DN6A 2IX3A 2QENA 4B33A 4KI0A 2RGNC 3AQ4A 5E7MA 3W2FA 1H8HA 4D25A 4ZGNB 1E79D 2QL6A 1YKSA 2ERXA 4ZKEA 1Z6AA 2KBEA 5FH9A 4RD1A 4JS0A 4KAXA 4W9MC 2WTUA 1MV5A 4UKDA 4JVLA 3V9PA 4TLBA 3L0PA 3KQUA 1DAIA 3ZZTA 3ND9A 2QBYA 1EP1B 1GIAA 1NL3A 2G6BA 2O8EA 2CNDA 3BS4A 3HWSA 3T1VA 2QSZA 1Z2AA 2ZAMA 3IIJA 4W5JA 4DSTA 2OTLB 1G7TA 5E4FA 1VG8A 1QG2A 5AUQA 5P21A 4DXAA 1DBSA 1H65A 5JI3E 1RRPA 1E69A 4V0NA 2VHJA 1LS1A 3OF5A 4FXPA 2PIAA 3IIKA 3B9QA 4LBWA 1NVXQ 1RVDA 1N0UA 4FMBB 1LW7A 1OGIA 1U94A 2P3SA 2ZE8A 4QHSA 3KJEA 4Y9UA 2GQFA 1E4YA 1Q21A 3LQQA 4HEJA 1D8TA 1BX1A 2DETA 1GAJA 1XTIA 2XJ4A 4O0MA 2DFTA 2Q9BA 5EE5B 3IEUA 4ERNA 4JLVA 3RSLA 1JA0A 1W5SA 1K5GA 4IVQA 1EP2B 2XX3A 1S1CA 2W0MA 4PC6A 2Z6VA 4CEJB 3I8SA 4CZ2A 3L0OA 1VQ4B 2CHVA 2WMNB 2J45A 4RFVA 1AZSC 2NZJA 3TE6A 4DB4A 2CEAA 3V4FA 1VQ9B 4LBVA 2XSZD 2VYQA 4HI0E 1YQTA 2OV2A 3CKLA 1KMHB 1NLYA 4KXFB 1QHGA 4A2WA 1QUEA 4G5RA 1DEKA 1S96A 2QP3A 1CXZA 3WHKA 1KDRA 4LHYA 3CCLB 3VNVA 3VHLB 1FNMA 2GNOA 1NIJA 1X1SA 2WWHA 2VZLA 4G1UC 1WBDA 4R71A 2GILA 3KQKA 1E9RA 1AM4D 1E64A 1II8B 2BMFA 1ZCBA 1YJ9B 2RB4A 4B76A 2JCSA 5A4JA 5DH9A 1KAGA 2Z5FA 2A30A 3B9PA 3B5JA 4XH9B 4EPYA 4NYMR 2Z83A 5C4MA 4ARZB 1W87A 2J3EA 3QKSB 4KV9A 4L16A 4TQAA 5JI2E 1T8TA 2E87A 1FOEB 1N2CE 1P61B 4LX0A 3CRW1 5CYOA 3TAHA 1S8FA 1W46A 2CLCX 1XMJA 3L0IB 5DI9A 3U2QA 4ARZA 1S3SA 1OIWA 4FW9A 1YZLA 4OHWA 1OHHA 3A6PC 2FGKA 2VP6A 1CRQA 4DCUA 3PQCA 1VQ7B 4AYTA 3KXLA 1ZM3A 1ESNA 1I2DA 5G41A 3U44B 1F2TA 3AP1A 2FH5B 3QFTA 1F60A 4A8JA 2IEYA 3IO5A 4NYIR 5EE3A 4M1MA 3V4RA 2WWWA 1NVWQ 4GZLA 2A5DA 1HV8A 3TAUA 3W6PA 4YXWD 3SEAA 5KU1A 1OH5A 4GPTA 2EYQA 1DPFA 2FEOA 1OFTA 2ONJA 4M53A 3KUDA 4GZMA 3KQLA 1R0WA 1KRHA 1UEIA 2D2FA 3IQXA 4PR0A 4AIIA 3K9NA 3ZDQA 3X1ZA 1MRNA 3PFIA 1BKDR 4II7A 4KLZA 1MABB 4UXJA 1W0KA 2RGEA 4MYHA 1DO0A 1R4AA 1L4YA 3QVVA 1KI2A 4CF7A 3FKSA 1J7KA 1GUAA 2VSOA 1ZD8A 5FFMA 4HUQA 5FUYA 4MKGA 4TMVA 2F6RA 2ZRHA 1YU9A 3P32A 4HLQB 1EGAA 3AKEA 1P72A 1KSJA 3KTAB 3SBDA 3GPLA 3D7MA 5E7JA 4QXAA 2RC6A 4ZDKA 3U44A 4JLKA 3C8UA 5HZKA 1EG7A 1OKKD 3FMFA 5J47A 3ZJYA 4BLPA 3TR5A 2QTLA 1LY1A 4NCNA 1FQKA 3A4NA 1VDZA 4JZKA 5C2JB 3R20A 2IW3A 5JRZA 2ZI9A 1Z63A 1E63A 1J2JA 4B47A 2Q3FA 1U8ZA 1A4RA 4DZZA 4LHWA 3U4QA 1OIXA 2BM1A 4C0JA 1EFUA 5BWMA 4HLCA 3LXXA 2IYQA 2MSCB 2GPJA 2HXSA 1G7CA 4JVMA 3CD6B 3NKVA 3SJAA 4QC2A 1Z0DA 2ECKA 2PL3A 2N42A 3WMFA 2JATA 3K8YA 3EPHA 5EZ5A 3QFRA 1UM8A 2GA8A 5HZHA 2YINC 3E1YE 4L15A 3EZ2A 1YZUA 1Z29A 3LX8A 2WWXA 1NF3A 2H16A 3Q72A 2ZUCA 421PA 3SYKA 1QVAA 2WV9A 4DDVA 2CCJA 3I5YA 2ZRCA 2OFXA 1LNZA 5KNCA 4OQLA 4CYMA 5HCNA 5JS7A 3NXSA 3GD7A 2A5JA 1AS0A 3ZVMA 4JSYA 3TNFA 1WDTA 1GVNB 2QEQA 2D62A 5BN5A 4B3XA 4ITRC 3CRQA 3VX3A 3CNLA 1VCOA 3ZYCA 3QEOA 4QJ3A 1E9SA 3K9GA 4P4UA 1MH1A 2D06A 1TUIA 2I1VB 1RJ9A 3B1WA 4EJSB 4P6VF 4ZDJA 3RS0A 1OLOA 1VECA 1FNCA 1TL7C 4JBXA 1IXSB 3CH5A 1KGDA 3FHCB 4N3NA 1CF4A 2ZRBA 1EXMA 4LZZA 4H9GA 2O52A 4GL2A 1KDTA 2W2VA 1X8KA 5H1YA 5H68A 4ON9A 1WCV1 1ANKA 1E2QA 4L8GA 4LBYA 2IS4A 1FPMA 1AGRA 1A7JA 3HU3A 3EZ7A 2JIZD 2QY9A 1KNQA 1W2GA 1SKYB 5JCZA 4TMWA 4TL8A 2OBNA 4C2UA 3MFYA 3GJ6A 4A82A 1DAKA 1P60A 3CPEA 3L0SA 5FPHA 1G6HA 3MAAC 1GP2A 3U3RA 3DEFA 3NVAA 5IRCD 2C2HA 2JLXA 2QU8A 4YAFA 2E9SA 2C04A 1JBKA 2F55A 1U81A 2J7PA 4NE2A 5GVSA 4TYYA 2KI5A 2P5SA 2QT1A 2ZM5A 1H8HD 5DNYB 4RD2A 1MKYA 2AR7A 3TW4A 2CCKA 2DWQA 2GXSA 4BFUA 1P4SA 4K1XA 1K6MA 2FA9A 5GADl 1L4UA 3VKGA 2WWFA 3FYHA 1O3YA 2GXQA 5KSOA 3FJOA 3GFPA 2FDCA 2VNIA 3CO5A 5FOUA 1KKLA 4C0BA 3VU9B 1ZMXA 3A8TA 3I72A 3HU1A 4HB2A 3ZS8A 1ZIOA 2IXGA 3QPVA 4C7OB 2W58A 3TUJC 4A15A 2ANBA 2J0SA 2FMXA 4LPSA 4QRHA 4NCJA 3FTQA 2IEZA 2RCNA 1NJGA 5F2EA 1JR3A 4G5SA 2QAGC 2QTVB 1DAEA 2B7BA 4KBGA 2WIBA 5L3VA 2G88A 4B3GA 1RFLA 3Q85A 4FK8A 1FX0A 4TLDA 3RAPR 4N0EA 3TQCA 3SQXA 4RY2A 1DAHA 4EH1A 5J40A 2PEYA 3A1VA 3VR4A 2ZYUX 5CLQA 5L3QB 5J4LA 4ASUA 2D4HA 2OT3B 4E09A 3U61B 4UQOA 3R7WB 1E2GA 3ADCA 3F5FA 3UWOA 1YR7A 3QF4A 1YZQA 2O8DB 5FL7D 1W0KD 8OHMA 2QTFA 3T5DA 2J0VA 2ZS8A 1PLLA 1BIFA 3QSYA 2NTYC 3AGPA 3QFCA 3VHXA 2VQSA 2X3UA 3BORA 5AJYA 1XJQA 1M7GA 5FOTA 1UAAA 2IYXA 5JWHA 2CVFA 2JAQA 2ZE5A 4Z51A 1JECA 4OJQA 4TLAA 3CF2A 1XD2B 5B57C 2HUPA 3RYTC 5HXBA 1W36C 4LJ8A 4DLRA 4RVCA 5CB8A 4X8OA 3HYRA 2BHRA 5DIFA 2JEOA 1ZC3A 4S2EA 1OSNA 2C03A 2OXCA 1WA5A 3ZD7A 1A8PA 1ELOA 4OK3A 4E5UA 3FDIA 1Q3TA 2JLSA 4JLAA 1N0VC 3ZZ0A 1Z0KA 1W7AA 2JLWA 2ZETA 3BBPA 1KJYA 4BFYA 3QKSA 4QHYA 2P5TB 1UDWA 4LJ7A 2RHMA 3OEED 4ZCIA 3D3QA 2QTHA 1IHUA 3MGCA 4JLNA 2OCPA 1M1YE 3RDPA 3MRSA 5JHGB 3R8FA 3IQWA 1GNPA 1R10A 3GMTA 2XNDD 1CJVC 4OI0A 1JQJC 1JXOA 1IB0A 1FNNA 2RGNA 1KKMA 1SVLA 4AWXA 4C4PA 1CBUA 2GWHA 3CRRA 3NBFA 3AP2A 1GVHA 1YHNA 1TUEA 4PC3A 4TT3D 2AD5A 1KC8D 4GOXA 4BEJA 1L2TA 2ZVQX 4JYCA 5FOXA 4KLNA 4LJAA 4LC1A 2QPTA 4IVRA 1VCNA 4BASA 1IQPA 3K1JA 2WICA 2BIFA 3IBYA 5GVRA 1A82A 3WRXC 4C7OA 2J5XA 2ZRFA 2BMJA 2NO9A 3ASYA 1IONA 3REGA 3TW8B 2CK3A 1C4OA 3I55B 4B2LA 1SULA 1KI3A 3W3AA 2QSYA 5IK2D 4Q18A 5CJPA 4AKIA 2VNJA 3RRZA 4BLTA 4DUGD 1Q44A 4HATA 5FUXA 2QMHA 4OYHA 1U2RA 5GJBA 1F20A 1LV7A 1WP9A 3WNCA 1BYIA 2F7SA 4HB0A 4X8HA 4C2TA 1D2EA 1DAMA 3PUVA 5FBRB 4BFTA 5J4VA 1OKKA 5TB5A 3TVTA 2A5FA 4NMMA 4URYR 3DM5A 3E70C 3TBKA 3PVSA 4Z8YA 4Y7CA 1G5TA 1KI1A 1VIYA 1VPLA 3NH6A 4PHHA 121PA 1RYFA 4BRUA 2NMVA 2BJVA 4NU0A 2PCJA 4TYWA 1NG9A 1KIMA 2WWGA 2CNWA 2GJSA 1D2MA 4QM6A 1YJWB 1T5IA 1G21E 2ERYA 3W5VA 4JBWA 4MQBA 1QGYA 2DERA 4Q7MB 2R62A 3UMFA 3EZFA 1JXMA 5HCIA 4CEHA 3PUXA 3RABA 3QPUA 3LV8A 1YR8A 1KYIA 2DEUA 1SXJE 1ZNZA 2W2XA 1S3GA 1ZJ6A 2WSSD 3EARA 5KSPA 2OFOA 1FX0B 3GJ8A 1VQMB 3QVUA 1QHSA 3THYB 2ZQ5A 1M90D 3X1XA 3VR1A 2RAPA 3AKDA 4PQYA 2ZYTX 2YKGA 3AH8A 4GSYA 5FPSA 3ZBTA 3CC7B 3BH0A 1JEEA 4JLDA 4OI2A 5E7IA 2GXUA 1YJ5A 3ES9A 3OIWA 1NVVQ 4MGKR 4TTRA 1E98A 4WZAE 4MRPA 4GT1A 2CCGA 3JQPA 5JJKA 3ZQJA 3AKYA 2R6HA 5SZHB 3FGNA 4FCWA 5JCPA 4ESVA 4OQFA 4NCKA 3R9WA 2KB0A 2GRJA 2ZITA 2DHRA 3CW2A 4CEJA 3WBJA 1BYUA 1SM4A 4WOPA 1LVGA 1GOTA 1ZU4A 4HAXA 5CK5A 3CLVA 1BX0A 1MO6A 2VO1A 1Z2CA 1JB9A 3T5GA 5B64A 5JRJA 3AVTA 3GP8A 2WJHA 2F3RA 2GTPA 2OESA 2J46A 2O8CA 1OT3A 1ZU5A 3EXAA 4PO1A 1E1QA 2J7KA 1QHIA 2OLJA 4KODA 4C0AC 1SKYE 4YQFA 5IF9A 5KPJA 1QGAA 1KO4A 4CEIA 1HUQA 2NO6A 3OJXA 2RHDA 2ONKA 3CCEB 1WXQA 4QBFA 4DDUA 1E9DA 1M7HA 3D6TB 4BPBA 1JJVA 1NI3A 4XTCS 4BECA 5JJIA 1R0YA 2CXXA 2FSGA 3LBHA 3BC1A 3EA0A 2VHQA 4DIDA 4BE7B 2XXAA 3SYLA 1G3UA 1KO5A 4XSHA 2H5EA 5CB6A 2EW1A 5DHAA 1QH0A 4Q1EA 5L3SA 1QVRA 1A2BA 4EFLA 3EPJA 2VIIA 1Y63A 4L5BA 1OW3B 2IYUA 1N6LA 2NQ2C 2XNSA 1GAWA 1G3IA 4WXRA 2OHFA 4A4DA 4ZCLA 4BLQA 3AUXA 4BEBA 2IYVA 3IHLA 4U5XA 1EFRA 5C4GB 2JLUA 5BXQC 2J0UA 4TL7A 2YOGA 2IYLD 5B30A 3VO1A 4E03A 1U8YA 4MRSA 2DY1A 4RKEA 2J0UB 1D1NA 2IK8A 3GJXC 1XB2A 1JPNA 4NYJQ 1N6KA 1RC8A 2YWEA 2B21A 5GJWC 1D6JA 3DPUA 4G5OA 1FMJA 1W0JA 2RGGA 1AMOA 2WOOA 3B2EA 5J4YA 4Q4HB 2QMEA 3THYA 1F5NA 5BQ5A 2IWRA 4LYHA 2HF9A 4JLJA 1AS2A 5DE3A 3K70B 2G1KA 4Q4LA 5CDFE 1TU4A 2ZSDA 4D0NA 2ODWA 1N6NA 1EFCA 4MRNA 1OFIA 1IOZA 3LDAA 4IEEA 2R6GA 4Z1MD 1NVVR 2NZ8A 1YJNB 1N6RA 1ZAKA 2AWNA 5UKDA 2C98A 3LVRE 3TIFA 1ZW6A 2PCLA 1BH2A 1X6VA 3RWOA 4RKFA 2AHOA 4LHXA 5FTMA 1KNXA 1IXZA 1G8FA 3W5IA 4JL5A 1KK1A 3EZ6A 1XDBA 3ZVRA 2IT1A 1IJEA 1A2KC 1G20E 1Z6GA 4PHGA 5GV8A 3DOEA 4Q9JA 2N46A 3IO3A 3KB1A 3KJHA 2CHGA 4XSGA 2QQ0A 1QRAA 1OHHD 4RD6A 4V0OA 4IW3B 2GJAA 2HJGA 4TSFD 3RHFA 5DO9A 3NHBA 3F8TA 1F48A 4NCHA 4Q02A 5JECA 3ZZUA 4WQMA 3SFVA 1P2UA 4LYAA 1EFTA 4US1R 4DLWA 1WBBA 1E0AA 1XPRA 1E0JA 1Q20A 1D9ZA 2BKUA 1VKJA 2BDTA 3AF0A 3EASA 3SHFA 1A1VA 2X77A 3NBYC 3OIYA 4UNPA 5FL3A 2IYYA 3KDSE 3K0CC 3I5XA 5HPYB 3EWSA 4M4SA 4URXR 1YZTA 3PEUA 2JJ2D 1G8HA 2OILA 3CRVA 4CEHB 4RSGA 1GRQA 4JLBA 3AV0B 4X8LA 3GJ0A 2EIXA 1T91A 2MSEB 4IOMA 5FL7A 2QT0A 1ZUHA 2JIZA 3TUZC 1XXHB 2F1RA 3FKSD 5AJXA 3R8CA 2VHUA 3VMFA 3BK7A 1UBGA 2JLVA 1PJRA 2VPPA 4EJSC 3THXB 4PSAA 2ZRJA 2ZU6A 2QI9C 1CR4A 1CJKC 3AVXA 3QG5A 1KHTA 4PSVA 4Z1MA 1QF9A 1IN4A 2FPKA 3CCRB 2OO7A 4Q4AB 1FNBA 5L3RA 3RRYA 4I1SA 1UKEA 4AC9A 3AGQA 3CPWB 2ZROA 2OBLA 1F6BA 3M0EA 3RNLA 3WMEA 2A78A 5AWFC 2DB3A 4DDWA 4AY2A 2QQEA 2NO0A 1RE0A 3P26A 3N5CA 5G3ZA 2B8WA 3ICEA 1QFJA 4Q7JB 5FA6A 1F2TB 4K8OA 4IOKA 2VTKA 1DS6A 2AXNA 2EFDB 3C5HA 4BZPA 3OEEA 3RSOA 1DELA 3E2IA 1Q12A 3TSWA 1S9HA 2OSBA 3PUYA 3DO6A 4HAUA 1N3BA 4EPVA 4P4SA 4BFVA 1XJCA 3GLHE 2IA5A 1CS4C 1TF7A 1ZM2A 3P4XA 2G9NA 2LCFA 3K53A 2QMUA 1Z6TA 1TQDA 5HE8A 3U6KA 1XU4A 3CM0A 4M9SA 1QZXA 2WZQA 4M21A 4DC9A 3C16C 1Z3IX 3I3SR 4PO8A 2GF0A 2VF7A 4M1YA 1OH7A 1LFDB 3CH4B 2IHYA 2OAQ1 1HT1E 3SR0A 4XWOA 5J4KA 1RRGA 5KOYA 1E94E 2PZFA 1E6CA 2BBOA 1E96A 4GMDA 5CDFA 4V02A 3CZQA 1TAGA 4NBSA 3KXKA 3QPWA 4PQFA 4QHTA 1T0JB 1JI0A 4O25A 5EXTA 2ZRLA 5EJEA 4EIWA 4E07A 3M1IA 3FFBA 5E95A 3HPRA 4HZUB 3RVBA 3V76A 1DAGA 4JLMA 4OQMA 1BOFA 1KI6B 1E32A 2BOVA 1VQ5B 3OE7A 3W8NA 3PENA 2WJGA 1FRNA 2PLFA 1E9BA 1AQUA 2R9VA 5KSWB 2XTMA 4XTRA 3WYAA 4Q1FA 2VP2A 3GFOA 3RS2A 4AD8A 4EFMA 1AQYA 1X8LA 3BIFA 5DN6D 2O8FA 5IDVA 2B8TA 5FOVA 2HT6A 4EPRA 1E3MA 2G0TA 3BFVA 3VKHA 2GBLA 4LDJA 1OXSC 1UFQA 2JJ8A 3RS7A 2JJ1A 2WJIA 4O3MA 3BE4A 1EWYA 2QP4A 1YRBA 2R6CA 2XGJA 1QHYA 3LX5A 3DMNA 3AVVA 3K09C 3TUIC 3CCMB 1IN5A 1CR0A 2AK2A 1W0JD 1XD9A 2WMOB 4D0LB 1CJUC 2AWOA 1IY2A 4A9AA 2ZSEA 3LO8A 4YMWA 1TQ4A 2W6JD 3H2YA 2A2ZA 5EE1A 4DWJA 4HAZA 2EFGA 3QY0A 1TF2A 2QN6A 3UK6A 4DLVA 2F1IA 2GEDA 2GKSA 4GOJA 4OL0A 1E2EA 1FQJA 2R6DA 3P4YA 5AJWA 1E62A 3ETLA 4JJKA 4LHVA 1ZNWA 3GLFA 1C1YA 4DHEA 4PX9A 1Z8FA 4R2HA 1E4VA 3SFZA 3QKUA 2VNHA 3A37A 4XD7A 1MO5A 5EP1A 3U6BA 1JEDA 1SQ5A 2AFHE 2P6UA 5EQTA 3X1DA 5FBWB 3AM1A 3OZVA 1OIVA 3EA5A 3VO2A 4KU4A 4N0DA 5DYIA 4WZBE 4Y9RA 3K9LA 2VBCA 4ABYA 4I4LA 3A1UA 1CRPA 2PBRA 4I1VA 3B1ZA 1NMZA 4YMSA 3MWKA 4B75A 2BBSA 1G5PA 1UBEA 3LLMA 2BCJQ 3DZ8A 2HMAA 4KFSA 1AA9A 4A6XA 2QTZA 1S0UA 1X3SA 5AR1A 5H59A 3B7GA 4Q66C 5HE9A 1TMKA 4TL6A 3TK1A 3W2EA 4ZCMA 1YRAA 2C99A 4CEIB 4B71A 1Z06A 3ICQB 4PAQA 4IRUB 5LB2A 3RS4A 4DLXA 4A1FA 1GKIA 4W5WA 4XIGS 4BGDA 1ZM7A 1EWQA 2GF9A 2WOJA 2JDID 3QOFA 5FI0B 1Q0UA 2WIAA 1X86B 1PUIA 3U60B 4NYMQ 2GJKA 3JVVA 3PITA 3KB2A 4MKIA 4MKHA 2OK7A 3T1QA 3AUYA 1GILA 5G3YA 2EFCB 3X1YA 3PXGA 4RD3A 4PZLA 4IHQA 5H5JA 3CB4A 3WXMA 4US0R 3KZ1E 2O8FB 1II0A 1XF9A 2RH5A 2RMKA 1M8PA 4Z8XA 3PCRB 1EFHA 2RGXA 3QEJA 4WW0A 2BMDA 2XB4A 3NHAA 3LQRA 1FZQA 2QORA 3CCSB 4XWAA 4YDHB 1JNYA 5EP3A 3U3OA 4EPTA 2WWYA 3AKCA 3N70A 3TGPA 4QM7A 2YNMA 3BERA 1KK3A 1IN8A 1FTSA 4XVQA 1I7PA 4HUQB 4DCTA 4IDOA 3CX7A 4AK9A 4FCVA 1XRJA 5LB4A 4P3YA 2X1VA 4Q9IA 1E2JA 4QNRA 4AI6A 1S72B 5C18A 2PMDA 2FNAA 4D0GA 2ZRAA 2ZS9A 4Q01A 1T0HB 3AVPA 4OQNA 1TEVA 5K8LA 4JVSB 1XCMA 3K0FA 3AVYA 5KDDA 4QGAA 4HAVA 2DCUA 2DFKB 3GJ4A 3K70D 3AVUA 4ZDWA 3W5UA 3Q3JB 3J81k 1TLLA 5AJVB 1OE0A 3B8HA 1U0JA 4MUAA 1W49A 4TL9A 5A0FA 3EX7C 3CC4B 4BUJA 2PZEA 1QGZA 2GDJA 1W4RA 3Q9LA 3CF0A 1FUKA 3KKMA 4F93B 1S1MA 2GAOA 2DFNA 3SOPA 4B2IA 3LW8A 5JEDA 2HJVA 3QQ5A 1U9IA 4ZO4A 1QUFA 1DO2A 3V00A 1U98A 1CJMA 4TLCA 3WP0A 1AJEA 2P67A 4DCSA 1GL7A 2CK3D 1R2QA 2OCYC 2W6ID 2QMOA 2O0HA 3ZQ6A 2YHSA 1E2PA 2CE7A 2QDXA 5BN3A 2IUUA 1GFIA 4KFUA 1XPUA 1VQNB 2VP0A 2BM0A 1BJKA 4TQUS 2YC4C 4TT3A 2GZDA 5SZKB 4Q7LA 5KTYA 3CPHA 4JT2A 3RC3A 6Q21A 4DDTA 5KPDA 1HE1C 1XTSA 4JKYA 3EG5A 4BRWA 1G19A 1ZINA 1P3JA 3B1VA 3CX8A 3QFSA 3I62A 5H8WA 2BGIA 4PPFA 1VYVA 4LRWA 4QNMA 3D31A 2GCPA 2IS6A 4DLTA 3IHWA 4LV6A 3ZGXA 3B85A 2PX0A 3MLEA 3E1SA 3QUSA 3WYFA 4JLOA 4RD4A 3VTKA 3CR7A 1BS1A 4N1AA 1COWA 4P31A 1AK2A 4AG5A 2ATVA 2JDIA 2AD1A 2EWVA 5K8UA 1G41A 1AKYA 4HDQB 2NO7A 2PEZA 4MGIR 2W2TA 5AK0A 5AUPB 5FTLA 2Z4SA 3CMAB 3IIMA 4DT1A 2RGAA 4LBZA 1RKBA 1II8A 1VQLB 2WM9B 4KFTA 1U90A 1ODFA 2BBWA 1KD1D 1EX6A 3MJRA 1AZTA 4HDCA 4HDOB 5LD2B 4FWTA 5KDOA 1RYHA 3GLGA 1FW6A 2KSQA 2XOKD 2Z4RA 2WWIA 2BF4A 2ZJ5A 3K0CA 4CVNA 1E2MA 1G8PA 5HKKD 2VHCA 1KY2A 2BKEA 3CZPA 2A5YB 521PA 2HT1A 2H18A 1PZNA 3P1JA 4LUCA 4D4KA 1E2HA 2ZSAA 4XD7D 4C30A 2F1HA 1QHXA 3U5ZB 4WBSA 2VP4A 1XMVA 2GESA 4TYPA 1Z0FA 3QF7A 1R0ZA 3TSZA 3W34A 2JASA 4CW7A 1OGJA 3IEVA 2FV8A 1CR1A 4IDPA 1P62B 2D74A 3GLIE 1Z0IA 5JWRA 3W90A 1IM2A 4YALA 3HPQA 2YOHA 4RCYA 1YVDA 2ZIAA 1XTRA 4JL8A 2O8BA 3U7HB 2BCGY 1VQPB 3UWKA 2IYWA 4QBGB 3HR8A 3W6NA 2J1LA 2ZE6A 3EWAA 221PA 2ZJAA 2GK7A 4EPXA 3AB3A 1QFZA 3MMPA 1WMSA 4ZI3A 1EFRD 3DZDA 4HB3A 4DIEA 3DL0A 2VH5R 1E1QD 2HYIC 2AKAB 4LY6A 4ZI2A 1E1RD 4POAA 1XE1A 4L4UA 1TNDA 4URWR 4YLGA 5KHOC 3CCVB 2X2EA 4LWZA 4DB2A 3DM9B 2QZ4A 3BFXA 4KCGA 5D3QA 1E9AA 1UBFA 1PLJA 2GK6A 4NH0A 2GAAA 3LVBA 3A4LA 4A6PA 2F9MA 2JLYA 1KOFA 1FTNA 2R8RA 4FD2A 4PHTA 3GLGB 3OIVA 1VQKB 2O0KA 2K5UA 2A9KA 1VHLA 2GVDC 4MA4A 1T4GA 4KSCA 2PX3A 1KMHA 2WJJA 1E0SA 4CRWB 1MO4A 1NDHA 4MYTA 5DSZA 3N2EA 1CEEA 1IJFA 5JBQA 1Z22A 4BWYA 2QGNA 4C9BA 1G291 5JWOA 3B82A 1HQCA 4A0GA 4AKGA 3EC2A 1E2DA 5FPTA 1R7RA 2H7VA 1KK0A 2YJTD 3ZLJA 1RJ9B 2MSDB 1KJWA 5SZJA 3VR6A 4Q7KA 2Z43A 2C8VA 4QFMA 3UG6A 4MGZR 4M9QA 4R7ZA 1KI7A 2VF8A 2QNRA 3LVQE 5FOSA 4C0HA 1NBMD 2FJUA 2BMEA 2ZAOA 5TY0A 3SJBA 3C7KA 3VFDA 5LDDC 3NEJA 3U3KA 3WP1B 3GJ5A 2IUTA 4LOAA 2CL0X 1W47A 2D2EA 2JA1A 4B34A 4EPWA 2PJRA 5DYGA 3G82C 3CNNA 2ODBA 1N25A 3KFXA 1JQLB 3GCGA 1SHZA 1YITB 1P2SA 2ZRKA 3NBZC 3VR3A 3W8RA 5FTNA 4LJ4A 3LXRA 3F0TA 3CIOA 1GRNA 1I4LD 1OB5A 2O0JA 4PHFA 4URUR 4PAOA 4HLUC 2RC5A 1Y3AA 2OUKA 5EUMA 5K8TA 2ZRMA 4NCIA 4JKIA 2LKDA 1Q57A 2IUSA 621PA 3G0HA 4V0LA 2J0QA 4UAJA 1OFUX 1WF3A 4RCZA 2V6IA 5JMTA 2OAP1 3UIEA 3OAAA 2GEVA 2V7QD 2V54A 3HU2A 3F3YA 3IPXA 2Q9CA 4FCTA 3QG1A 3GEIA 4A36A 2EYUA 3RRMA 5FTJA 5AJZA 1Q22A 1LS6A 4AYXA 1SVSA 3REFA 3C5CA 4TTPA 4D82A 4RZ3A 3OW2B 1XCGB 3OZXA 4UJ5A 1J90A 4QJ4A 4DCNA 2ZI5A 3CONA 2EFEB 1G5RA 2ZRIA 1JR3D 3QXXA 1GWNA 4YXWA 4TMTA 3KQHA 2ZR7A 3OEHD 2ANCA 1Q81D 4CGZA 2H8KA 2DBYA 2GVZC 3QXSA 4M1KA 1KSFX 3CUEF 4GBMA 1P75A 2QM7A 4HSEA 4C0LA 3BOSA 4G5QA 4Y0AA 4YC7A 1OB2A 4CIDA 4NL4H 5K8IA 1E99A 1VG9B 2FFAA 3I73A 2C95A 1OXVA 4RJLA 2FFQA 1K73D 5BYKA 4B74A 1CP2A 5F98A 2QRZA 2V8OA 2H1LA 1GL9B 3LW7A 1QVFB 4JLPA 4XOIA 5G53C 2YWHA 1XTJA 3K0AB 4GI7A 3WHLA 5JSZB 3AVWA 1O87A 4M0LA 2ZJYA 4F91B 1HEIA 2ZANA 2YOFA 1NNEA 2J87A 1EP3B 2BBTA 4JL6A 2BPOA 2QGZA 4JVNA 4ZIRA 4HUTA 1I4DD 1TQ6A 1ZBDA 3ADBA 3PR1A 4NP6A 2OCAA 3DDCA 5BYJA 4MYCA 5HKKA 1OV4A 1CULC 2C9OA 1T8UA 2CVHA 3B60A 3C14C 4HLDA 5KSYA 4TZ6A 2QUZA 2QE7A 4E22A 4TMKA 1DOAA 3LO5A 5JFGA 1IN7A 5IT5A 4DSUA 4G3XA 5AN9A 2FG5A 5AUOB 4GP7A 2FEMA 3QENA 2C77A 4A8JB 4OBEA 4DKXA 5C46F 4BFZA 4EKDA 3W2IA 4PPNA 2XTZA 4IOJA 5HR5A 3RC8A 2X2FA 1XEWY 2ORIA 3LBIA 3X1WA 4PSKA 1NSFA 4A92A 1Z0AA 3LWNA 3AF1A 4D80A 5JZVA 1ETUA 2G3YA 4JIMA 3W6OA 3QKTA 1J8MF 2VP5A 5IK2A 2MMGA 3I32A 5FPYA 2GZAA 5GJCA 1E9CA 3M6AA 1YHQB 1XMIA 4QJ5A 4B3DA 1W4AA 2HCBA 2J59A 4BZQA 1ONBA 1T3LA 4MH0R 3FVQA 5DI3B 1CLUA 3W9YA 4A0RA 3AF2A 4MDFA 1NKSA 3C15C 1KJZA 1JJ7A 3IPYA 1NN3A 1HURA 1MABA 3K09A 1GITA 4C43A 2A7QA 2RKOA 4HZUA 4RFSB 3CNOA 1IAQA 2VSFA 3THXA 1J8YF 3WYGA 2OFWA 5F3WB 4NKRA 1QHNA 2EVWX 2R44A 1M6NA 3LBNA 1EK0A 3KKNA
chains in the Genus database with same CATH superfamily
1A8SA 2ZRNA 2ZUDA 3UH1A 2OGSA 2Q3HA 1OYOA 3REOA 1XCBA 3FPSA 4TRMA 1FS4A 1VJCA 4LRYA 3OESA 4RVDA 4DHWA 1MVOA 4DG5A 3TYXA 2WQ6A 2OMEA 4O4LB 1LBEA 3FHJA 5FADA 5CEFA 2ZJ2A 4XLEA 3ZWQA 5JSQA 1XDGA 3D8BA 5I9LA 4UFNA 5DBEX 4DYHA 4D45A 4O2BF 3IILA 4YCJA 3WJAA 2L82A 2VXCA 5FQNA 2Y1KA 1KO7A 4OXQA 2GPNA 1FCJA 1LF0A 3U9SA 3PSHA 2P2CA 4BMNA 3E1GA 4KQGA 4NNJA 2X6XA 1RQRA 2YV4A 2QUAA 1J0BA 4M1WA 2ZJOA 2FVXA 3BMOB 3NYWA 3F7NA 5ANRB 4NDZA 4NXMB 3F96A 4TMYA 5EWMB 2LR0A 2AVNA 1XVUA 3NTUA 2YZ2A 2TMGA 2LP4Y 2O5VA 1JIJA 5L51A 1WVGA 1J42A 2PL5A 5FUVA 5CBPB 1WCWA 4XMYA 1PLKA 3I58A 1XVTA 5C8ZA 1CJTC 1E1KA 4G5FA 1B00A 2FN3A 4FINA 1XCLA 4HLUA 4PBRA 4XQFA 2PH7A 3PUMA 1Z6XA 2JFVA 2DSTA 2FUCA 1S6YA 2H29A 4JC0A 4F3RA 2BFWA 5LN1A 5DRYA 3U0BA 1IY1A 3I9NA 1Q0ZA 2JGAA 1FTWA 2RHHA 3FPKA 4GH5A 4HDKA 2YMQA 2H92A 3B5IA 4NOMA 5DGHA 4OD0A 1NE7A 4Z4RA 3URKA 5JROA 1XNJA 3AM3A 5CM2Z 3ISXA 2DQSA 1YOVB 1FQWA 1OAOC 2QTGA 4MITA 2PL9A 1NKTA 3MC1A 1FUUA 4AS1A 1NG1A 3G9XA 2HW8A 1GNSA 4Z7JA 4PBSA 4XR4A 3TDNA 5IHPA 1E2KA 4GKKB 3WNBA 1MX1A 2OXRA 4LY3A 4NPHA 4B2PA 4HE6A 1FU4A 4J0KA 3KKOA 1N0HA 4UMDA 4ALJA 1O77A 2YNMC 5BSXA 1OI3A 1SVWA 2RGUA 4NZZA 1YDWA 5AKEA 5BPHA 2JFFA 3DOFA 4X20A 4WRRA 4CT5A 3ZC3A 3LL7A 1ESMA 4BMYA 1XZQA 3VO9A 4M9XA 2J3JA 3S3TA 3BJRA 3UAZA 4WY2A 2ASVA 3FDFA 4L4SA 2P3LA 4KQJA 1NJ5A 4LYFA 2I1QA 1NQTA 4MKFA 3LRPA 1SVMA 2WD7A 1GRVA 1JG7A 1FLNA 1HT3A 1NU8A 1IN6A 1QG4A 3TRFA 3TZKA 4RF2A 2LWIA 1F1BA 1K86A 1X8XA 3ANSA 3C41J 2DPGA 3GD5A 2AOTB 3H05A 3LT4A 2PRZA 4G85A 4I5DA 3VC3A 1LNQA 3OCXA 5A5VA 3RUAA 4L4ZA 1CCWA 1V25A 3CU5A 4BU1A 4P08A 4PLVA 1QJ4A 3R23A 3VGJA 2AJTA 3RAGA 1W19A 3EFOA 4C7BA 1TVEA 4KQMA 2CNWD 3W1EA 1Q1BA 5EJ8A 4RHEA 4AJLA 3R5KA 1SHUX 4JMQA 1V11B 2PH1A 1OYYA 2RGDA 3ESXA 5ITZA 4DDHA 2CL7X 2XEXA 1RHQA 2AL7A 2JHGA 4QLAA 4CDGA 5LVAA 2FX5A 4XVUA 2NUPB 3KNZA 1M2NA 1XVVA 3NETA 4PPGA 4XEUA 5ARCA 5G0TA 4C3OB 1V8BA 4MSUA 2XOKA 4KNVA 4FT2A 5J2TB 2HNAA 3GUYA 1JEQA 5IYZF 4QGGA 3DHYA 3U0VA 5SYNA 3KUUA 2HCJB 4REMA 4KFRA 4AZ3B 3SE7A 1Y89A 4ALKA 5LP6F 4EUKA 4G1FA 5BVGB 4Z4TA 3JWHA 1THMA 4R2IA 1X1RA 5G40A 3OT1B 2A0KA 4OI4A 4WKCA 4XSVA 5FWDA 4D9FA 3P9ZA 4OV6B 1YR9A 4Q1DA 2OKCA 4IM7A 2BEWB 3RRBA 1TJ3A 3NNNA 1H8EA 8LDHA 5I4BA 4CODB 1BFDA 4GOKA 1T2FA 5I9TA 4ZVNA 4CLHA 4H17A 1Z4MA 2ZSFA 4P4TA 4YJKA 2K7ZA 1YR1A 4LV8B 2LNDA 3AR3A 2AE2A 2P6NA 4GLJA 1S2LA 1Q1QA 1MDBA 2QHXA 2VJOA 1DTSA 5F1OA 1U9CA 2IX9A 3CR8A 4FMCF 2Q4RA 3C7DB 3LA6A 2OKGA 3HVJA 4TTTS 1TQ8A 1T6NA 2BELA 3GLHA 4HNAB 3DQZA 3LS2A 4NONA 4AF6A 1EI9A 1V43A 2PGOA 4X62B 3BJEA 1KR5A 2CLDX 3G68A 1RRCA 4ZJYA 1ONSA 1UT6A 3OCJA 4ZFNA 1XF1A 4F9FA 2GDZA 1T0BA 1B0UA 4JBYA 4PYKA 3L84A 3N59A 3P9PA 1CNFA 1GGVA 3GLQA 4DLUA 4FFLA 4HN9A 3VBCA 5K0JA 5JS2A 4J16C 1N8RD 2ILTA 4BV9A 2UUBB 2DHEA 1T3SA 2VL7A 4IRXA 1WU8A 5F64A 3OZFA 1I0LA 4A0HA 3HCPA 1E9FA 2QN1A 2F1OA 1E9EA 4HDSB 2I6GA 3P9RA 2B98A 4FGJA 4R8RA 5BV8A 4KN6A 1NYRA 2A9OA 3OWHA 3PP8A 2WSMA 3D5TA 4TXHA 3CCJB 1DCKA 3A32A 1DWPA 5A1TA 2JIRA 2QX6A 5BQPA 3HY4A 4G0QA 4N9WA 5A7HA 4BP9A 4RACA 3RYCA 1A7KA 3W5SA 4Y98A 1U2GA 2CW5A 1NI4B 3SDZA 1GTRA 2A0UA 5J2UF 1E6UA 3OJLA 2XGGA 1L5RA 1NMYA 3FLMA 3FCSB 3K32A 5TMPA 3VR4D 1FTGA 3V2IA 1PWZA 5TDHA 2RAUA 4GM4A 4X7EA 2IF0A 1MC4A 3GV0A 2OHOA 1DLJA 2OXFA 5FWAA 2HMUA 3HR4A 2C5EA 3F7OA 4XIYA 2K6GA 3G9UA 3TX6A 3QMVA 4NENA 4OJKA 4U7TB 5E3HA 1LSOA 4IILA 1O7JA 3A6ZA 2CDCA 1BCRB 1RCFA 2ZI4A 5IMSA 3I9V6 3RVDA 4EYSA 5HDBB 3OZUA 4YMSA 4Z4CA 2ZSJA 1MXFA 2O1WA 3BG5A 4G2NA 3NAMA 2VUSA 3IAS1 3F6BX 3SSAA 2WD7B 2AF3C 1Q11A 1H69A 1G2IA 2O9JA 1GPMA 2CB0A 1O89A 3I4LA 5AM1A 3BGWA 4AN4A 5K09A 4JH0A 4LI0A 4RH0A 3WNDA 2OLKA 4LW8A 2V8BA 4PVDA 2EF1A 3KTAA 5EXDA 4F8JA 1ESZA 1SUCA 2Q5OA 4D9BA 3IP8A 4IJ6A 1SVKA 5LOVA 2IBTA 3G5UA 3OOEA 3KKPA 1LRKA 1PT7A 2E6KA 3GZJA 3W6UA 1BMFA 1EE2A 4NBUA 2WTAA 5EI5A 5HW0A 1ECFA 4ESHA 3B70A 1RTKA 4B48A 1RI2A 3E7DA 3LKDA 3QIVA 2W00A 1CVIA 4I1OA 1TM4E 2XZLA 4HLNA 1T2VA 5HILA 3DDZX 5D1NA 2H57A 1E60A 1RXIA 1WEHA 2B82A 2FGJA 5C1BA 2WJPA 4P9SA 4MWTA 5HBRA 2H4JA 3W6ZA 2WSIA 1T1EA 3CBQA 3DB1A 3F47A 4MEAA 1PVOA 2D1QA 2VPZA 1ORRA 3EGOA 4OUDB 4EUNA 3R3UA 4QUAA 3A6EA 1IUOA 3WRYC 1LDEA 3A1NA 3SP1A 4JGBA 2GPYA 3ZGYA 3SBOA 2PVCA 2ZRPA 1CIVA 2PIDA 2NG1A 2RHOA 2ZJFA 3A26A 2G4LA 1FX1A 3L7YA 2ZVJA 4ZANA 5TEWA 4HNUA 1RHJA 1EVJA 2B61A 5DHFA 2VCEA 2XB9A 3RTAA 5LU9A 1G3RA 1E7SA 3DMYA 3G5LA 2EU8A 3IKLA 1I24A 2QJRA 2Z2YA 4MA0A 4OVKA 4PYLA 3SXUA 7REQB 2WJYA 1XYGA 3KWFA 3HJAA 1HE8B 4F38A 2D7CA 3SJZA 1KOJA 5EIOA 3UEOA 2G1PA 1C0PA 1ZGAA 3IKVA 1V8FA 3D43A 3PK0A 3UY4A 2Z1MA 1UDXA 3TOVA 1NLFA 3R5JA 5AI8A 4BWVA 1EQUA 2W43A 1X19A 1Q7EA 1ZD9A 2E48A 1COWD 2P27A 2C2OA 4KXMA 1H85A 1U99A 3COSA 2AH5A 2ZRGA 3A4YA 3PR2B 1DIAA 4M0FA 5F51A 4EZEA 1Q1EA 1QHHB 2QNIA 4Q21A 2FN4A 4B44A 3FAKA 2PBFA 2WAXA 4LRTB 2OCIA 4YAGA 4EBFA 4YMVA 3JALA 2ACKA 1ECLA 1C0EA 3ZVNA 1LPMA 3RIYA 3V8MA 1ILWA 4CIYA 3KOZA 1M74A 2RHGB 3UMYA 2IE8A 2ZDHA 3JZAA 3ADDA 1GYPA 1EGMB 3AEXA 4MUBA 2G77B 5CU7A 5D5HA 4J2HA 5KDLA 4D5EA 5EY5B 1GM5A 3AFIA 3P27A 1NJ8A 1OWOA 3FUUA 1U1IA 1KP3A 3CLRC 3Q15C 5KX5F 1N33B 1SVOA 1WKCA 2YCLA 3RAJA 3TL2A 1AF7A 3LDGA 2BFBA 3FE2A 4RA6A 4OXXA 3TKLA 4Z9FA 3SN6A 2PZLA 4IFEA 2X9LA 3BILA 3E9CA 1XL0A 5FJJA 1FFSA 5KKNB 1XX6A 2H00A 1KSHA 1YIOA 1PFGA 4V0NA 4D4IA 3QVJA 5K4GA 1XQWA 1SBYA 3EQ7A 2GB4A 2NT3A 2WU3A 3CXUA 1CQWA 4PSDA 2FXVA 1TEHA 2VDQB 1R0SA 2ZBFA 4QBIA 4F9GA 3ZDYB 1LJUA 3GFTA 3C3YA 5HMLA 3U3XA 2YIDA 1SH7A 3BE8A 3BH7A 4LXYA 4NPAA 2IS1A 1JJBA 2UKDA 3EGEA 1UF9A 3K70C 3E81A 1HTBA 2VXBA 3WLFA 4O29A 3JASA 4G1VA 1NV9A 1P9OA 3EZ9A 1I0IA 3D59A 3AMVA 5CJ2A 4BZWA 1I36A 2H2DA 1T1JA 5MFPA 1CU1A 1VHQA 1L7VC 3FYTA 3L8ZA 3DZCA 4M8LA 1M2KA 1R8SA 2ID7A 2V98A 2XH8A 1PQYA 2ZWMA 3IVGA 4K81B 1S2GA 3SDSA 1HSZA 2VCHA 5DOZA 4MUYA 3TJRA 4FFBA 2C20A 1H9BA 1X13A 4AUNA 5C37A 4OUKX 2BE9A 3C24A 5D3MA 5JDCC 3M1AA 4N3GA 1P8AA 3NTLA 3WYNA 5BV1A 4PNHA 3L7OA 4FCCA 3SM9A 3ZE1B 3MJSA 4C3VA 5IWCA 2Q8PA 1Y8RB 3SLRA 2WSYB 1Z4LA 3H0KA 4ZHSA 3E9YA 1J9EA 5ALDA 1ITZA 1WR8A 2XNCA 3R41A 4W5RA 4MK4A 3AG5A 1P3DA 4KJXA 1IZ7A 4RJJA 1VA4A 1T3ZA 4ND3A 1SD2A 2VAVA 3L0YA 2XOXA 4L0CA 5DLDA 4C4AA 2G1UA 1XD8A 4O4HB 1K6XA 2P2LA 1BDBA 1SBTA 1BOOA 2XSZA 3W2HA 3INRA 1Q6ZA 1UBSB 5TMEA 1BEEA 2ECFA 3M6IA 1EHIA 4HBZA 4D9JA 5EXXA 3GDFA 2KBFA 3G4SB 2IELA 4DZTA 3SC4A 3GP5A 2AX4A 2DLNA 1P7VA 2B37A 3MYRA 1MJHA 3I52A 3N87A 3CZ5A 3S1AB 3VYWA 5K2OA 4K9MA 1V16A 3RU9A 5YASA 2EL9A 1O8CA 1XC7A 3K15A 2VDLB 4JT8A 4PG8A 2HSGA 5KWSA 3ZNQA 4HDMA 3W2GA 4B3BA 1Y9ZA 5KCMA 3ZIAA 1JHVA 1H05A 4YUYA 4ZT7A 3MTIA 3R9IA 5KYUB 2O7SA 5CYPA 2DE0X 4QQ8A 1JALA 4K28A 4DGQA 1U2TA 3QTBA 2QW0X 3AYXB 3RFCA 2Q3MA 4MVYA 1SPXA 4UE6A 1B6GA 1QYWA 1R6AA 3HXPA 5K0BA 1KP2A 3C43A 3U62A 3QX3A 1KI4A 1TVKA 4GU5A 4KBYA 5BNZA 1XT6A 2ZTUA 2EERA 4PXAA 3T7KA 4RYDA 3HJHA 3TJZA 2DULA 3WMWA 2ZYVX 2Q7XA 1VHDA 3A28A 4MX8A 1K8RA 1QAQA 1TMGE 1W2WB 2NTVA 4FOPA 2X0EA 3S0JA 4M6WA 2C9CA 1ZD1A 2IL1A 2P9FA 5T6MA 3RD5A 3WL3A 3U4AA 1JAHA 2LDBA 2F00A 2PJUA 1R6UA 3SJCA 3I53A 1W36B 1PGJA 4V0KA 1FS6A 1K7XB 4BFXA 4RLHA 1T8YA 4MQFA 1GU7A 2UYOA 1ST3A 1EBFA 1Z83A 3BIWA 3BWDD 2PA3A 3RWMB 5MGNA 1XMQB 1T15A 2SICE 2V03A 4F4CA 2LUOA 2E1RA 3CMEB 3MWYW 2XNDA 3H9JA 5ITVA 4Q15A 4M0PA 1Q7CA 1E0KA 1U9YA 4N5DA 1H4QA 2PVSA 2V7BA 2I67A 1Q3HA 4TKLA 1PP4A 4RGYA 2R7MA 4YK7A 4WASA 1HL3A 3KFVA 4I36A 4GRIA 1BNCA 1R9GA 2V9PA 2VRWA 5LQCA 2PS1A 1OAKA 1G8MA 4PZ0A 4G4GA 2IPMA 4WIAA 2I80A 3MMNA 5ELMA 2DFLA 2VSQA 2YFYA 3WO1A 4EJSA 2HDNB 1G98A 1R0XA 3PNSA 5EP4A 3HKCA 4GPIB 3T0IA 5AESA 5KYXB 2ORVA 3WZMA 4MWDA 3EVEA 4TXNA 2VS1A 4P0TA 3O26A 1VLYA 4HNRA 3JWGA 3U13A 1WETA 2ON6A 4DW8A 4ADSG 5AH0A 3LZDA 2FUEA 1ZGCA 3WE7A 4BMPB 3GGCA 3RYFA 5EVJA 5IM4A 5FNVB 2F43A 1MENA 2VHVA 3IIEA 4CMEC 4W82A 1WLSA 2WVGA 1WCXA 2VNKA 5IZ4A 3EPLA 2C7GA 2GCOA 4HD8A 2O3SA 4R0MA 3ICOA 1I18A 1QKJA 1ULUA 4MUJA 1JB1A 5CFMA 3KWJA 2YL2A 10MHA 3G2OA 1V9SA 1W44A 3CX6A 4H1HA 2AI3A 2G9ZA 1NM5A 4Q48A 5BVGA 2DWOA 3DDSA 3M6FA 4YR7A 1NB9A 2G1JA 2HFJA 4DQLA 2D7DA 2XY4A 3RKUA 3UXEA 2B9VA 3CSDA 5DX0A 2VJYA 4PCLA 2AMVA 2A5GA 5JNVA 3PPXA 4AO6A 4ASUD 4FN4A 4EECA 2I7CA 3GUVA 1U7UA 4HVTA 4LF7B 1N9GB 2REXB 3Q2OA 5F9FA 3EPKA 4B35A 3FETA 3RUDA 4MMXB 3L4JA 4MI9A 4GW3A 4DCJA 5C8YB 1T9KA 2QUBA 4J3NA 4DLAA 4N5LA 4HB4A 1UWCA 5IJ0B 1FDRA 1T0IA 3O47A 2IXTA 4HTAA 3KQWA 2WP8J 4E4TA 4CMBA 5JSYA 4Y2UA 3QELA 4QQNA 2GS9A 3D1JA 3SNHA 3QXJA 3U3DA 4YO8A 4D81A 4A91A 4IP0A 5BY2A 5CPBA 3X2SA 4PC2A 5FBZA 2ZJ4A 1EDDA 3L43A 4Q4AA 3Q6MA 4GI5A 4E5MA 3K1AB 4XUEA 2FSFA 3C1UA 2OD2A 1A1SA 4TRNA 4LMRA 2WYVA 2WUFA 4B85A 1L5GB 2ZBGA 4YAIA 1DIBA 4P8RA 4JMPA 3DKVA 3Q7SA 4ZU1X 3ROQA 3QBTA 1SXJD 4U02A 4EG6A 2CJWA 2FY8A 4CG3A 3L6BA 1JA1A 3E9QA 1RQ7A 5A02A 3LL4A 5B58T 2H11A 1V7ZA 2R66A 4N12A 1UBCA 2RBGA 2YVAA 4M49A 3DD1A 1SQSA 1YOBA 2JFHA 4JHXA 4QOSA 3VV3A 3ROXA 1IU9A 3D6UA 2GJ9A 1ZRNA 1SCAA 4BE9A 1XRPA 1M8GA 2NOAA 2IU0A 1NW5A 3WFJA 1Z6ZA 3AY3A 3G2LA 1ND6A 2GBGA 4YIKA 1U8AA 3HZOA 2REQB 3O9ZA 1T3HA 1GTZA 1QNLA 1FP6A 1U7DA 2YASA 3DMDA 3WY9A 3HBLA 3JS5A 1NSYA 5FBQB 1G7SA 4FMCB 4DQXA 3KR1A 1R9MA 4DT1B 1NMXA 2PT5A 2UZ1B 4MGYR 5T4EA 2Z6UA 2UVPB 3GRAA 5B55A 1BQ4A 2YDYA 4KYUA 2HLDD 4QPZA 4CM8A 1AKMA 4M8KA 3PRKE 1L7NA 3CJQA 1DVRA 3DLIA 4AT1A 3ZJTA 2Q1WA 4G63A 1VLOA 4OQEA 3BH6A 3ESAA 3DTVB 2ISQA 3OAAD 4LNHA 4BCDA 4B4DA 4HEHA 5I47A 3ZIDA 1D5CA 1RQXA 3F67A 5DNAA 1TI7A 2G09A 2JLQA 4RZUA 1W5TA 3TTUA 3KAQA 1J70A 5LBIA 3VKFA 5BQXA 1W4CA 4U2GA 2IZ1A 3EZXA 4HJRA 2V1UA 2JIOA 1N3IA 3N6RA 4L0DA 4R98A 1NBME 3KEWA 3R6DA 1WB9A 1HOXA 3BGIA 4DM3A 4TYNA 1JE1A 7MHTA 1GEEA 2IXFA 1JQBA 4FOSA 1JBQA 1EG2A 1U1EA 1Y3FE 3MCUA 3ZU4A 1NQ5A 3SICE 2Q9AA 5FFNA 4A8JC 4YMUA 3T53B 7REQA 1RWQA 1IXKA 4LSMA 3JY6A 1XTKA 2BR4A 2C92A 3KS9A 2NU9A 5KQSA 2ZE7A 1BDJA 1PJCA 3GEHA 1OBVA 3B78A 2ZJ7A 5AVQA 4ZP1A 4R7TA 5B2ZA 1U8EA 2JB9A 4UNRA 3L5KA 2CDRA 4Q19A 1P5RA 2X8AA 2WEKA 2C8JA 4JUDX 3RS5A 4DA6A 1KDVA 4FMDB 4YV1A 1DAOA 2NLOA 5GAJA 1MAVA 1Q1NA 4O2RA 4XLFA 5KOIA 4LDNA 3KT3A 4LC0A 1KEPA 2XUPA 4X6XA 4TTVA 2B6NA 2VOEA 4BVFA 2E55A 4XX1A 4YCNA 2O8EB 3TH5A 2HU5A 1ZUNB 4PFJA 4PX2A 4CN8A 3V1KA 4WOCA 4EWLA 1JZQA 3UWPA 1VIAA 2QYHA 1YS9A 2A9QA 2GKGA 3LD9A 3N0RA 1BDIA 5B6IA 2CDNA 1EFPA 1FFDA 4D8XA 4QG7A 2G5CA 4G7XA 1JPJA 3DBVO 3R3SA 5FEUA 1KFEB 3KOYA 4M54A 4P2GA 1C50A 4XKJA 4AF7A 2ZWVA 1KVRA 1I5EA 4QXPA 2C96A 5DHUA 3AP3A 2H1WA 3PHBE 2DRIA 5FR1A 1MB0A 2Q0HA 3GDHA 1Z88A 2BFNA 3QI2A 4M8NE 3QM1A 2KWIA 3Q4GA 1KI8A 4N03A 5M2QA 1I14A 1P9NA 3NHJA 3ZI4A 4C7KA 3FHOA 4NHEA 3BD9A 4DLSA 4Z1OA 2HMTA 3GGGA 4AX8A 4P7BA 2Q3JA 4RM2A 2CLHB 2JGIA 4MW0A 2HSJA 1GG5A 3NATA 4QVAA 1TT7A 4UUMA 4IXTA 4LF5B 1XMPA 4PRLA 1Q77A 3GEPA 3O1JC 1TYZA 2IUYA 2ZRDA 1KMIY 1CRZA 3ECCA 3O4RA 2BSAA 2AKYA 2BI8A 3SI7A 2OQRA 1FYFA 3O7MA 2V0NA 3T06B 1VIVA 3G71B 1R1DA 2RB5A 3CVWA 2WZNA 2VN8A 1ZISA 3MPUA 4K86A 5DP1A 5JD5A 4MIOA 3PQ6A 4BEWA 2BJWA 1KEKA 1YRWA 2PTGA 2WF7A 5FBLB 2ZR8A 1MJGA 5E3IA 5EIHA 4KITB 3TRDA 3GEGA 2BKVA 2YHIB 4Q6BA 4DYVA 4KVAA 3OTGA 1KVQA 3FNIA 1Y8CA 3LGXA 3MMZA 4PPYA 3T12A 4WL0A 4CFYA 1OH8A 4XGRA 1ZQ9A 5JS1A 2MOKA 4KE8A 2GM9A 4R1OA 3TQSA 1EWVA 1ORTA 1TCAA 4WZEA 2WKPA 3MERA 4L4YA 1A0OA 1DC6A 3UV7A 1QNFA 3U7JA 4EY5A 5KYTA 1N78A 1RPTA 3D02A 2IITA 3T3NA 4OHFA 8ABPA 2W2LD 4M3NA 1RJGA 3MWJA 3ZCTA 4QTYA 4Q4HA 4UBKA 4BATA 4LOHA 2O8CB 2GXAA 3NUZA 4RHUA 5CUQA 4B82A 2G9VA 4M1QA 5AT1A 1DQYA 2UZIR 3ANMA 1L5YA 1YZNA 1ZCAA 3BCDA 1KY4A 1TU3A 3F71A 3EC7A 3VC1A 4KLRA 4WNAB 3IAHA 3UHAA 1J23A 2XUJA 1E6EA 4BFSA 3VVLA 5HQ3A 4W7HA 2B25A 5KUTA 3LG2A 2F8TA 2XRZA 4GI3A 4O4JB 1U3TA 1TUBB 3QYFA 2OYNA 4M1OA 3IUYA 4O5OA 2QP9X 2ZI7A 3IP5A 4LGCA 3FWYA 4M89A 5ADUS 2IX3A 5FNVA 4ID3A 1NMSA 1RXCA 4KI0A 3T9DA 4EUFA 1WP6A 1H4VB 2XUFA 3DLPX 3IUMA 1TUBA 2RH8A 2Q41A 3OJ0A 4JLWA 4ZGNB 4DR5B 1CJCA 3ZD9A 3R3HA 2WFAA 2KBEA 2W90A 1CZUA 3BDIA 4IYRA 2PYDA 4JS0A 2AMYA 4KAXA 4NRDA 1W75A 2OCDA 2ORYA 3JRWA 3V7FA 5K0TA 1U28A 4R9SA 4UKDA 1JLHA 1UK7A 3B6KA 2GASA 1ND5A 4ZXFA 2J9ZB 1TVMA 2PM8A 1EEHA 1DXHA 1KAHA 3AYZB 4KZPA 1O97D 1IK4A 2ERCA 2WZPP 1EP1B 1M54A 1UXIA 4AAYA 1W29A 1GIAA 2G6BA 3GRFA 5F1YA 1ZIDA 5TRTA 2CNDA 1L5MA 2EGHA 2WFZA 3JQ8B 3O31A 3PUKA 4I6JA 3T1VA 5KKCA 3MGGA 2FOXA 3OG9A 1YDEA 4J9UE 5CVCA 1G7TA 3U17A 4DXAA 2XXJA 4J75A 1GUBA 3NFRA 4MUNA 3RBAA 1M0WA 5CFNA 4LTNA 2SCUB 1Z5NA 2DR0A 3DDYA 2VHJA 3KPVA 5AKHA 3B9QA 4XASA 4LBWA 1MORA 2WUWE 3DLBA 4J0FA 2JCVA 1D8AA 3BVPA 2YCBA 4RMHA 1OGIA 2UU9B 3EEBA 1W9HA 3QU5A 3KJEA 1JHQA 4QHSA 4Y9UA 2YZKA 4LE2A 3CLTD 3K73O 1CE8A 4G1EB 4P54A 4HEJA 1D8TA 2DETA 2Q1XA 2DFTA 1XDDA 3HCFA 5C81A 1NRXA 4OGWA 1H4TA 3A1FA 4D57A 1W5SA 1K5GA 3AWIA 4G9BA 2VPWA 1EP2B 2G5PA 4OOFA 2PUWA 4NULA 2NUBA 2FPOA 3A6GA 4YJGB 1GZ6A 1KQPA 3MUEA 1QV9A 2PO5A 2NZJA 3T7JA 5LWHA 2GR9A 3P0RA 4BKRA 2I3GA 3V4FA 5HJEA 2A6PA 1CQJB 2VYQA 1Q50A 1BU5A 3D8UA 3EGDB 2I0FA 1CDDA 4OAQA 4F6RB 1M2VB 2FQQA 3A9TA 5BOSB 1O95D 4LF8B 4XDGA 2NTJA 1I94B 3BCUA 1FLDA 4GLLA 1XGKA 2ZUFA 1Y6ZA 3FPBA 4GXRA 4XFJA 2COKA 5IYRA 5WRFA 3FOWA 4OLBA 1JQ5A 1KDRA 1J20A 5TQ2B 2CFCA 1GXSB 3WQQA 3EXG1 2BZSA 1NIJA 3PLNA 1UDBA 2VZLA 3CG0A 3EGVA 4G1UC 5GGYA 5HMMA 3D8NA 3KQKA 1OYVA 3NB0A 5FWXA 1XELA 5BRAA 1QYIA 4TV8A 2ZZEA 1E9RA 4M36A 5FXMA 3DZKA 3I1YA 4D9GA 3PR3A 2FR1A 4B3HA 4DA8A 3UPDA 3RJTA 4HXGA 3K1AA 4PO3X 2BMFA 1EGHA 2WTBA 2YYAA 1ZCBA 4BKMA 5IHXA 4XWWA 2JCSA 4L5JA 4ARCA 3K6SB 2BZ0A 3B5JA 4K6FA 5CHYA 3VTAA 3QNWA 5C4MA 3RTDA 3V8VA 4G81A 4ARZB 2J3EA 2XQKA 3MAGA 3PXBA 3QKSB 1ENYA 5DFAA 5JI2E 5J2TF 2E87A 1FOEB 5G4KA 3QOYA 3UHFA 1ABFA 1YQWA 4Z3KA 1SWWA 5CB4B 1NONA 5DI9A 2OXIA 3U2QA 4ARZA 2X0FA 3S68A 1Z39A 4OHWA 4R81A 1OHHA 2FGKA 2VP6A 3GO4A 4LDQA 3EDRA 1M0SA 4QDZA 3W8FA 4DCUA 4DIKA 5JW6A 4IV8A 3W77A 1A5ZA 2YV3A 5G41A 2C61A 1W96A 3U44B 1PWEA 3PD1A 4RMNA 1ML4A 2REQA 1F60A 3E7PA 3GYBA 4M37A 4NYIR 3V4RA 3HEBA 4M1MA 4D3DA 1NVWQ 1XU7A 4NAVA 2JG3A 3PVZA 3TOXA 4EP1A 3C70A 3PTLA 3AHFA 1C30A 2ZT8A 3DQPA 5KU1A 4E2XA 1R4NA 5E6RA 3B9BA 1YB4A 4CMKA 4FFRA 2FEPA 2I7TA 4UE3S 5HA5A 2P6PA 4V0SA 2GRUA 4XGIA 1EVIA 2O8NA 2VF5X 3FCYA 3IR7A 4PZUA 2VQEB 5F77A 1KRHA 5F4OA 1UEIA 2XGSA 1GQRA 3ODPA 3HZRA 4OLJA 4UZUA 1NUSA 2BFOA 3ISTA 2ADOA 4ZVLA 1MRNA 2KW5A 2Y1EA 2BEVA 2PSSA 1T2CA 4KLZA 3TTVA 1P6QA 2XA9A 4J0IA 1R4AA 1TAUA 3FYDA 4XYMA 3BQMB 3EMVA 3HY6A 4RDHA 4N0QA 2I87A 5FFMA 1M75A 5FUYA 4N5IX 4MVXA 4TMVA 3LWZA 4YP9A 4CQLA 3P32A 4H7EA 2C83A 3NANA 2YXBA 3GPLA 1KSJA 3Q0TA 3SBDA 1GTG1 2C9BA 5KYXA 2JS7A 4RLQA 4Z7QB 3QPDA 3D6VA 5EAIA 4QPDA 2BKXA 4QFBA 2ZCUA 1GY8A 3QBEA 4ITVA 4DY6A 4P5PA 2X13A 2Y3IA 5HZKA 4YJ2A 3CRNA 4MINA 4R1QA 3OQNA 3LQ1A 2I2BA 4G26A 1HR0B 2PXHA 4MUFA 4BJHB 2X5OA 5CRIA 3VR6D 2WT8A 3DL2A 1VDZA 1TK2A 4WXYB 1XZHA 2BJHA 2XTJA 1CV2A 4G0XA 2AZDA 5F1KA 4WECA 1RCTE 3R3WA 1VZ2A 1KFCB 2JD2A 2Q3FA 3AUSA 4IUCS 3OTOB 1CW2B 1OIXA 1KXJA 1ZCFA 3L0BA 4P3NA 3UJAA 4C0JA 4ENWA 3TTWA 2YXDA 2MSCB 2B4KA 2P11A 3EIOA 4I1YA 2VF4X 3A11A 3C6YA 4LQ4A 3CD6B 1XOIA 4B80A 4QAJA 3T5CA 2ATEA 2FVGA 3SJAA 4L5YA 4MVCA 3RSCA 5CFPA 1IWPB 4FFWA 2C3UA 1CUHA 5ESRA 4PNEA 1KA9H 2QK4A 1E4OA 4QELA 3JATB 1GPYA 1UXJA 4S1OA 4DXHA 3ZXUB 2GA8A 4ALNA 3C3DA 4MJ3A 4WFQA 2OTCA 3OE4A 3ZDDA 1SFRA 2GPWA 4GBGA 4R9RA 2WWRA 3BXXA 3TPFA 2WWXA 1NF3A 4A8HA 9GPBA 3ODGA 2IY7A 1XZJA 1V5EA 1P39A 421PA 4MUEA 2PLNA 5ISMA 1NAHA 3PXUA 1BN7A 4DDVA 2CCJA 3LHDA 2DY0A 3FTDA 3DMTC 4PYRA 3I5YA 1VLJA 4B0PA 2C4KA 2ZRCA 5AW8A 3L4SO 4EB0A 3DW3X 1QSGA 4JXJA 4OQLA 1B0AA 1RHKA 1W6RA 2ZP1A 2EJWA 4X7MA 4JQCA 4CF3A 5GIPE 2C2WA 2BHSA 4HGYA 1WPQA 4G86A 5DW0A 4ENSA 5L4LA 4ZVOA 4RORA 1XZFA 3ZVMA 3A8IA 1WDTA 2PUJA 1XZEA 3IYLW 4LNUA 4X6UA 2KQUA 4ITRC 1DC4A 3B6ZA 3T7AA 3CNLA 3VX3A 1WB6A 1E9SA 1ZGGA 1MH1A 2GH1A 2R7KA 4WKPA 4UEKA 4EARA 1SCIA 5F52A 3RVPA 4LJKA 1XN1A 2JW5A 2QYSA 3E53A 3WWEA 3G2HA 3ZK7A 4Y2TA 3RS0A 4YV7A 3EWIA 1C1DB 3I04A 1FNCA 2WC1A 4RA9A 1TL7C 3OUUA 2BLNA 1N5MA 4AN0A 3OLCX 4ZCRA 4C21A 4HNAA 1M1ZA 3UN1A 1EQ2A 2ZRBA 3GFQA 3CIFA 4J1TC 4HVAA 4H9GA 4KDEA 3L1VA 4LZZA 3TLEA 5KTRA 1PT9A 1X8KA 4KH0A 4NFSA 4ON9A 1WCV1 1ANKA 5E9JA 5I51A 1HFJA 3HDJA 2RG7A 2JAOA 2JZCA 3JCZA 2HBRA 4QU9A 4NPCA 5KIAA 3SXPA 1AGRA 1XZIA 3C74A 3OT1A 5E7QA 1L5LA 3HU3A 3N2LA 3NONA 4ZJUA 1SKYB 5JCZA 2HDHA 2SCUA 4DMGA 5CGQB 2C9MA 4C2UA 2DKOA 3EOBI 3GJ6A 1REQB 1Z5WA 3DBRB 3L79A 1IXYA 2SECE 2PFGA 3L0SA 4D56A 1GZHB 1JWBB 1SU4A 2QZSA 3VNBA 1BDHA 5LQSA 1NQVA 4DV5B 4AJPA 3CKKA 5IRCD 1F8YA 1HKUA 2QU8A