3PENA

Structure of archaeal initiation factor aif2gamma subunit delta 37-47 from sulfolobus solfataricus in the gdp-bound form.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
403
structure length
403
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of archaeal initiation factor aIF2gamma subunit from Sulfolobus solfataricus in the GDP-bound form.
rcsb
source organism Sulfolobus solfataricus
molecule tags Rna binding protein
molecule keywords Translation initiation factor 2 subunit gamma
total genus 101
structure length 403
sequence length 403
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3penA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3penA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3penA01
4HZUA 2QAJA 4JMPA 4ZKEA 1CP2A 2DFTA 3QKSA 1TU3A 3IEVA 1OXUA 2RB4A 5FBWB 5FOUA 4DLXA 5CM9C 1ELOA 4EUNA 2AN9A 5C4GB 4BFYA 5TB5A 5B2ZA 3S1AB 3DOFA 3PUXA 4EQ6B 3NBZC 5FTLA 2IYUA 3HR8A 1A5TA 3HYTA 2GQFA 5ELXA 4DWJA 1Z6YA 1ZRHA 3H86A 4JSYA 2W6ID 1WRBA 1KY3A 1X3SA 3IEUA 2A9KA 1ESMA 3NH6A 3SBEA 1OGIA 4DDTA 5JECA 1HYQA 3SQWA 1N6IA 1SXJC 1GOTA 4EFLA 5JFGA 3R9XA 1VCNA 3OESA 4D26A 2BCGY 1D9XA 3G5UA 1E6CA 2GESA 2WSSA 1S1CA 1IM2A 1S72B 3X1ZA 2DB3A 3LXRA 4EPXA 2CL7X 5F9FA 1Q1ZA 5KYKA 1ZVQA 1Z8FA 2OXCA 4ZI2A 4OQNA 2KI5A 1KY2A 1XU4A 2QU8A 5CYPA 1NG9A 1VQNB 3PEWA 1CU1A 1Z0FA 1JQLB 4IFBA 2WPDA 1EK0A 2RKOA 4OQFA 1EXMA 5HCIA 4PSKA 2ASEA 3W3AA 1E1RA 1YR6A 2EWWA 2JLZA 2F55A 1OXSC 3K0SA 1U0HC 2CLSA 2ZI4A 2MSCB 2JLSA 1E9FA 2VIIA 4LHYA 2BV3A 1E32A 1QFZA 3EX7C 1WBBA 4JBWA 5G3ZA 1EFRA 4YHBA 1TU4A 2W2XA 5DO9A 1VPLA 4OI1A 1AS0A 4R7ZA 4WXRA 1QGYA 1FNBA 1C1YA 1W0JD 4ZGQB 2QG6A 1Z6GA 5FBVB 1GVHA 1Z06A 3EZ2A 3U3RA 1P9WA 3TIFA 1KI3A 2CCJA 2IXFA 1GG2A 4L9SA 2WAYA 4DLYA 1XD8A 1BJKA 1S96A 2XJ4A 3MSXA 1J70A 1UKEA 3AP2A 5TMPA 4YONB 5SZJA 5BYJA 4M1SA 3QUSA 4Q4AA 1JA1A 4IEIA 1Q1QA 1QFYA 1XCMA 1G1MA 3QBTA 3B9QA 3BIFA 2GCPA 1KK3A 3AVWA 1VQ6B 3LO5A 4PAOA 4QBGB 3W5JA 2FV8A 4TLDA 1U2RA 3VO1A 421PA 1BIFA 2J5XA 1D2MA 2GJ9A 3BOSA 1G9XA 4TLAA 4WAUA 1NN5A 3VR5A 4NCJA 4RD4A 2ZROA 1B2RA 4QM6A 2O8BA 2REBA 1FUUA 3ZC3A 3JQRA 1KAGA 1HE1C 2ZJZA 3VU9B 2VO1A 3AVYA 2GEUA 5DN6A 1SULA 3W6PA 1V43A 4YAUA 2IT1A 2R65A 3UMRA 1TADA 2IYSA 1SM4A 3QNUA 4HLUA 1FL9A 2VNIA 2V1XA 5AR1A 2ZRLA 1RZ3A 1KMHA 4M1MA 1KHTA 4DB2A 1UF9A 1XJ0A 1VQPB 3SYNA 2AK2A 2YOHA 4B2IA 3BFXA 2OAP1 3W5IA 4IOJA 3G6EB 3MWJA 4ON9A 1EWQA 2IYTA 1E1QA 2PJZA 2VHCA 1U0LA 1DO0A 1M1YE 1DG3A 3CW2A 2G0TA 3CCRB 3NHAA 1E1RD 3B9PA 5EE5B 5J4HA 3DMDA 2FU5C 3F0TA 3MG9A 1IN7A 2FZ4A 2NQ2C 1VQ9B 4II7A 4Y9UA 4D80A 2H5EA 1U81A 3AKDA 4URYR 2PH1A 1G5TA 1E9SA 5EP3A 3R9IA 2ODNA 1VCMA 3QY0A 1Z2CA 2JDIA 2WJGA 2VSFA 1G4AE 2ZE8A 1EG7A 4BECA 4DUGA 1N6LA 4XWOA 2X2FA 2ZRMA 4TMXA 3NDBB 1LV7A 4FK8A 4ZPXA 1IY2A 5AUNB 1KO4A 4YAOA 4PTLA 2YC4C 1XDBA 4A4DA 1BYIA 1P72A 1G6OA 5C1BA 2Q6TA 3B1WA 1RW4A 3FWYA 3TSZA 4NPHA 1YJ5A 4PC3A 4KI0A 5FTJA 2V7QD 5KSPA 5EJEA 2JA1A 2R6GA 3UWOA 3LQRA 3FHCB 4QGAA 4BLSA 4EJSA 1KDTA 4NMMA 5E7JA 3RVBA 3I55B 2ZR9A 2GXUA 2J0VA 4QL3A 4B71A 2A5JA 3GLFE 1OJLA 2AFIE 2GK6A 1QHYA 1TUEA 4QGGA 2ZJ2A 1TQ4A 3ADKA 2QTLA 3ZH9B 4BE7B 3REFA 2LCFA 4E03A 3RYTC 3CRRA 1J8MF 1ZD9A 4AURA 4JYCA 2DFLA 3RANA 1QHHA 4JVLA 1YQTA 4ASUD 3OFNA 1LTQA 1KI7A 4B44A 2UZ3A 2YNMA 1Z83A 4PC1A 5DNYB 2VSOA 5E3HA 4A2PA 1DVRA 4HB0A 1Z6TA 5K8TA 3ZZ0A 3K70B 3WXMA 1D9ZA 2OLKA 2Z5FA 4A8JC 1MO5A 2GNOA 4MYTA 2O5VA 3LBNA 2J7PA 3DOEA 2ZRBA 3ZZTA 3HPRA 1Z47A 3SJCA 4PHGA 4RY2A 2XZPA 4GZMA 5UKDA 2B7CA 1U99A 1XEFA 5BN4A 4JBYA 3VU9A 1RVDA 3BC1A 2VA8A 1E2NA 4Q02A 1E98A 4P32A 5H70A 1BX0A 2VTKA 4Q9IA 1B23P 1O87A 2J3EA 2YINC 1T3SA 3IIMA 1IONA 4ESHA 2F43A 1OB2A 3VR6A 3IQWA 2B8WA 1Z07A 4I1SA 1HUQA 1T9HA 1P6XA 2Q3FA 4Z54A 4H1VA 1AKEA 4QC2A 4QBFA 3U6BA 2NPIA 2GWHA 1L8QA 4NL4H 3CF0A 4G1BA 2WWXA 2WZQA 3IIJA 1W44A 3AVXA 2J1LA 3KJIA 4HLUC 2OV2A 4ZDIA 3SE0A 1MRSA 3BH0A 1E9CA 3UATA 3JQPA 1FQKA 2HJGA 2RGBA 2VBCA 4URUR 1S4QA 1E2LA 2F3TA 1T0JB 3CIOA 4B3GA 1KTVA 3K9HA 5FH9A 1ZAKA 2NO7A 2EFHB 4R2HA 4NYJR 1YZQA 4Q9JA 1A7JA 4MYHA 3ASZA 4JLBA 2CRVA 4GSYA 3HYRA 4W7SA 1B0UA 3GLHE 2AKYA 1QVRA 2BBTA 1XPOA 5JRZA 2YKGA 1SVSA 3I56B 1COWA 1TX4B 1JPJA 4D6PA 1FRQA 1Z28A 5CLLA 1YZNA 2VH5R 4BLOA 5BN5A 5HKKD 4HDOB 3WMFA 4DVGA 4WBSA 2AHOA 5AUOB 1HT2E 2I1VB 4WVFA 4FIDA 4M8NE 4B35A 3IKJA 3KFVA 1R0WA 1G7TA 2JJ1D 3BFVA 4KU4A 3EZFA 4QG7A 4XVRA 1W0JA 4HLCA 5GJBA 3KJHA 3OJWA 3GJ4A 3V4FA 1W87A 4Q7JB 4RD3A 3W34A 1JAHA 3A1VA 3FMFA 4DSOA 3WY9A 4NONA 2ODBA 1E2JA 4P0TA 3UXMA 4KSBA 1XEXB 1EX7A 5EMNA 1BH2A 3O47A 1ANKA 1RRFA 4IDHA 2ONJA 3E70C 3P27A 1NBMD 1K5DA 3CCSB 3K9LA 1II0A 4KVGA 4KO8A 3TVTA 1U8YA 4DCVA 2E9SA 2IYVA 3PJRA 2OO7A 1IXSB 3OHMA 2C2HA 1HQYE 2FSFA 1RKBA 1VQMB 2XOKA 4YAWA 1FZQA 3TAUA 2FPMA 1M7HA 1M90D 4O25A 1SXJE 3L0OA 5DN6D 4F92B 5IHPA 4ZIRA 2IYXA 2WBLC 3JVUA 5THXA 3K70D 2YOFA 3A8TA 5JHGB 4KBGA 5K8LA 3B1YA 1VQ4B 1NIJA 5JCPA 3J81k 3AF4A 2GXSA 1GVNB 2OTLB 1BQEA 2IUTA 1TMKA 4D0GA 3LY5A 4LYJA 4OQMA 4OBEA 4PC6A 1W48A 1AGPA 1VDZA 3QKSB 5DGXA 4F4IA 2OBLA 1KKLA 3RC3A 4TQ9A 3TKLA 1AQYA 1TF5A 5C2JB 1PUJA 5KDLA 1NVXQ 2IL1A 3VKHA 3GFTA 1FP6A 4BGDA 2QAGA 4XVQA 1YJWB 3CF2A 3TQCA 2OFWA 2ZVQX 2BVNA 1ZM4A 4JBXA 5AJXA 1F5NA 2QA5A 3CCMB 4RCZA 1GKUB 1LW7A 1FNNA 1QG0A 3I73A 3PUWA 2F3RA 1UKZA 1RJ9A 4JJZA 1A1VA 3OEHD 5LBIA 4IDNA 5M04A 2IYQA 1OE0A 4ZGNB 5A0FA 4Q5IA 3CC2B 4V03A 2B6HA 1QG4A 2A3RA 3FGNA 3KQUA 1XPUA 3SHWA 2GETA 3DMNA 3RRZA 1NIPA 2O0KA 1QHIA 4M21A 4LSGA 2F9LA 3MJHA 3WRXC 2BIFA 1FQJA 5TARA 3ECCA 2IC5A 3CO5A 4R71A 2QRNA 4JVMA 4WZBE 1UMKA 4OHZA 4NDZA 1GL7A 4OHXA 1QHXA 3GLGE 4DSTA 4KYUA 4AIIA 1UPTA 4PAMA 4Q9LA 5DISB 4JL8A 4RZ3A 2OCPA 1EFUA 1N2CE 3A1TA 4A2WA 2A7QA 4C7OA 2VSXA 3CONA 1KI8A 2UZIR 3LV8A 5EUQB 1E3MA 4L5BA 4Q1DA 4PQRA 1JR6A 4CDGA 1M8PA 2GZAA 4PHFA 2CNWD 3DHWC 3DZDA 4IDPA 3WNBA 4M4SA 1FX0B 1K6MA 1P2UA 1UBGA 2OZEA 1XB2A 2QENA 4UNSA 3U3KA 1E99A 1HURA 1FW6A 2HT1A 3H2YA 2C8VA 1Z3IX 1YR9A 3W5VA 2PBRA 1RIFA 1YRBA 2H18A 5KDOA 1WBDA 4PZYA 1J9ZA 3OJXA 1I4TD 1PJRA 1KSGA 2J46A 4Y0VA 3W2HA 3QPWA 3QSYA 2V55B 1K73D 1JEEA 4GZLA 5KPJA 2Q21A 5G41A 4N3GA 2YWFA 4QHYA 2VEDA 5HTKA 1IJEA 4DB4A 1W1WA 4ZDWA 2XNDA 3OIWA 3DO6A 5JMTA 1GAJA 2GJKA 4C0KA 1AA9A 4OJKA 1JNYA 1CLUA 2OT3B 4A2QA 1NVVQ 2VRWA 3QI2A 1TF2A 1GR1A 2IEZA 5C4MA 3IUYA 1CR0A 1KI2A 1E2DA 4CEJB 3ZVMA 3LXXA 1W4RA 2FOLA 2XOKD 5BWMA 5DI3A 1CJVC 5FR1A 4GOKA 1XTSA 2ZI6A 4ESVA 2ECKA 3K0CC 2OILA 4HAZA 5KNDA 3EARA 4IVPA 1E2KA 3OAAD 1EX6A 3BH7A 1U94A 2CLCX 2R6DA 4Y0AA 2P6NA 2Z43A 1P61B 3QE2A 2QZ4A 2IX3A 3H4MA 4B3BA 4GMDA 2PL3A 2X8AA 2W2TA 4CEHB 3Q3JB 1Y3AA 2C78A 3VNUA 2PLFA 2QRZA 3EG5A 1JB9A 2DEUA 1ZU5A 2EWVA 2CL0X 1EWRA 2D3WA 3QVUA 1O3YA 4KAXA 3WMEA 1GM5A 1M1KD 1UM8A 2OK8A 4MDFA 3X1WA 1ZJ6A 4PHTA 2Q3HA 1NP6A 5FI1B 2CK3D 4C0SA 4F91B 4DUGD 2QMHA 3QXCA 3CCLB 2W6JA 5AUPB 2ATVA 2W83A 1DDGA 2QDXA 1SVKA 3LVQE 3W5HA 2BJVA 4KXFB 5EE9A 2OCBA 4JL5A 2J7KA 2HT6A 5CYOA 3OZVA 3KZ1E 1OH8A 4ASUA 2A5GA 1II8B 1KJYA 1ZIPA 4JIMA 2H92A 3WYAA 3ZBUA 1HH4A 1JXMA 1NJGA 2IS1A 3D8BA 3MWLA 1WMSA 2NO9A 3CPWB 1AS2A 1YJ9B 2GVDC 1XCPA 2BEJA 2MMCA 3B1XA 3PEVA 3AP1A 3AGQA 3GJ5A 3ND9A 5D3MA 4LX0A 4A1FA 2J59A 3W2GA 1CEEA 3EPJA 3OIYA 3PITA 2OAQ1 4JVSB 1F2UA 4V0LA 4LC0A 3W6OA 4U7DA 1R6BX 2FPKA 4MKHA 5HR5A 2QTHA 2VHTA 4CGZA 3CC4B 3K9GA 2GBLC 4F4JA 3FPAA 5E4FA 1JJVA 2OXRA 3RS4A 5EXTA 4FD2A 1MT0A 2ZJYA 4XWAA 3SOPA 4CIDA 1II8A 3W2IA 3CX7A 1VMAA 2PCLA 5G40A 4KITB 1E4VA 4G5QA 4UAJA 4FCTA 4LHZA 5EXSA 3WP0A 5JJIA 3M1IA 5KNCA 4ITRC 4M9ZA 2EFDB 1G7CA 1LY1A 1AJEA 4PX9A 4UNQA 1MKYA 3K1JA 3SC3A 1LS6A 4YQFA 4WXPA 1U9IA 3QF7A 1CTQA 4QHSA 1DAKA 4LOAA 5L8VA 3VKGA 2D7CA 2C9YA 1QGZA 1OLOA 4DLWA 3E1YE 2R9VA 4MDEA 3ZIAA 4I1UA 1K5GA 4XTRA 4NHOA 2CL6X 1OYWA 3E20A 3AEZA 1EFTA 3NC0C 1WCV1 4ZV4A 3W2FA 1QVGB 2C95A 3A58B 5EUMA 1LS1A 1NN0A 4H9GA 1KO7A 1P2VA 1TQ6A 4Q18A 4QBHA 4RVCA 5AN9A 1G19A 3D3QA 4TYNA 4NU0A 5CB6A 2O8DA 2WWIA 1Q57A 3EWAA 2QT1A 3EZ6A 1QVFB 3G71B 1I2MA 5JZVA 4I81A 2ZYTX 3AVQA 4C7OB 4DBLC 4TZ6A 4N0EA 3THOA 5DSZA 4BFZA 3TR0A 1QX4A 1KOFA 3CPJB 1R2QA 2P5SA 3LLMA 1Q21A 3SNHA 4Q4JB 5H8WA 1T6NA 1N0VC 1G6HA 2GJAA 4FINA 1U98A 3QBVA 1KI6A 2GPJA 2ZYUX 3FMOB 1JA0A 3UG7A 2JATA 4A0GA 1S9DA 2DCUA 1G18A 1G3QA 1D2NA 1CKEA 1CRPA 3UMSA 1LNZA 2G77B 2YZ2A 1RYHA 5JSZB 3REGA 1VG1A 2P2LA 1G291 2OUKA 2HF8A 3DKPA 5TDHA 2GXAA 1VG0B 2ZANA 3B6EA 4PZZA 4C0AC 2NGRA 2ZEJA 1ZC4A 2DFKB 4D4KA 4ZCLA 2W2VA 4JLKA 4KSCA 2IYYA 4YLGA 3GQBA 3BBPA 3QQ5A 1SVWA 3EA5A 4BLQA 1S8FA 2ZJOA 1ZMXA 1Z08A 5JWHA 3CPHA 3TJZA 3DZ8A 1KO8A 3TW4A 4DSNA 2E87A 2RGEA 4LYHA 4B3DA 3SJZA 1ZNYA 1G5PA 3NH9A 2CLDX 1NI3A 1OF1A 3HDTA 2BC9A 2ZU6A 4UXIA 5J40A 3AP3A 2JCSA 3THWA 3G0HA 2FFBA 3KB2A 1N6KA 1X8LA 1E9RA 3LD9A 5D3QA 3SYLA 3RDPA 1XZPA 1GJRA 4O3MA 1AIPA 2GEVA 3OEED 1NDHA 4PFSA 1G3MA 4NZYA 1EWYA 4DRZA 3CPEA 2QEQA 4X8HA 2JJ2D 3VKWA 3RWMB 3IQXA 3C5HA 1IXRC 4IEEA 3QG1A 1WB9A 1GP2A 2JJ8A 3I3SR 5IT5A 1KZ7B 2BSAA 4F38A 121PA 3I4LA 1VYUA 3HU2A 1YR7A 1KD1D 3BRWD 2G0NA 4MRPA 1P4SA 4TL8A 3RHFA 2IS6A 1G16A 1OFIA 3TAHA 3TUIC 4ILEA 3RWOA 3TNFA 1DELA 2BKEA 1VQOB 4AKEA 1SHKA 4XSHA 3RRMA 4E07A 4B32A 1NY5A 2B8TA 2FF7A 1TAGA 3K09C 3LVBA 2L0XA 3Q8XB 1OB5A 3GLIE 4B76A 4LBVA 3IO3A 1LF0A 3NDPA 3LO8A 2O52A 4Z8YA 2G9NA 4A9AA 1Q20A 3KKQA 3HJNA 4NYJQ 4Q01A 1AQUA 2VF8A 4GP7A 5CDFA 5SZHB 2BDTA 1ZIOA 1G8HA 5HE8A 3SFVA 2FJUA 3OZXA 3BERA 2F9MA 4WZAE 3V9PA 3VTKA 3ZQ6A 2GCOB 4HAUA 1UEIA 2QM8A 1XP8A 3PIRA 2K5UA 3FFBA 3C8UA 4GDFA 2ZJ5A 1G3IA 2PMKA 1KQSB 2R62A 3QXHA 2GTPA 1XXHE 3WBKA 621PA 2D7DA 4DCNA 4JVNA 1X1SA 3QF4A 3OE7D 1FDRA 3THYB 1L7VC 4PPNA 2AL7A 2IXEA 1N0UA 4OL0A 1NL3A 4OK5A 3TSOA 3VNVA 2BBOA 4D4JA 2CMKA 5CIWA 5FPYA 1W36C 3RS0A 3ZQJA 1ZNXA 1XTKA 2OTJB 1SKYE 4B4DA 1VKJA 2VL7A 3K0CA 2EVWX 3C7KA 3TRFA 3P26A 3X1DA 4WW0A 2OE2A 3QFTA 1YHNA 4RD2A 1HY3A 3FE2A 3UKDA 3T12A 1XE1A 3ZBTA 2DHRA 3FMIA 1TEXA 1N6HA 3T1TA 1MO6A 3L8YA 3IO5A 2XNCA 1E96A 4B2LA 2ZI9A 5IDVA 1FMJA 4D0LB 4LJ9A 3A4MA 5J4VA 4TZ0A 2V4ZA 2VPPA 1KDOA 4L4UA 1QZXA 1EESA 4YDHB 4KVAA 5IK2A 3CNNA 3HPQA 4JSTA 1GO2A 1N3BA 1RRGA 4UNPA 2A30A 1W0KD 4LJYA 4MGKR 1XCGB 4HUTA 2ERXA 2ZAMA 4BEBA 1ZM9A 5KSWB 3WNDA 4P4TA 2D4HA 3WYFA 4UXHA 3B1ZA 2IUUA 1DOAA 4ARZB 1ZM3A 1IN6A 1P73A 2WWFA 2X77A 2HCJB 3W5UA 2H1LA 1Z22A 4PANA 3AB3A 3EAQA 1R10A 4DCTA 2PT7A 1SHZA 3HR7A 2YJTD 3DEFA 1U8AA 2AXNA 1BS1A 1EP1B 3CMEB 3DPUA 2XZLA 1NRJB 4LJ4A 5KNBA 2O8DB 4LDJA 3BWDD 1N5KA 3A4NA 1CJUC 4LRWA 1SVMA 2QMEA 2GILA 4EIWA 3VR2A 4IOMA 1ZD1A 2CE2X 4M2LA 5FI0B 2H8KA 5BQ5A 2R6FA 1W36B 3BH6A 2CHVA 2LWIA 2HYIC 1R8SA 4B43A 1R8QA 3I5XA 3HWSA 1PLLA 3WP1B 5K8IA 1FNCA 2CEAA 1KIMA 1Z5ZA 1Z2AA 4NH0A 2DY1A 1NF3A 1R5NA 1VYVA 2ZETA 2XXAB 5C18A 5AJYA 2QGNA 5EZ6B 2GVZC 2Q9AA 4W5HA 5KU1A 5DI9A 3RAPR 2I1QA 2WKPA 4DDVA 1II9A 1P9RA 4U9UA 3NXSA 2BMJA 4B48A 1CR1A 3GPLA 2QMUA 1QHGA 4YXWA 1GRQA 1Z0AA 1XZQA 3OZWA 1J99A 1G4UR 1M2OB 2OFXA 3G82C 3GJ7A 1IB0A 5DYIA 4ZIRB 2NO0A 4KFTA 3BXZA 4PQFA 4MUAA 5FUWA 4RZUA 4XIGS 3QXSA 2CCKA 4Q7LA 4R9UC 3SHFA 5JSZA 1R0YA 1EGAA 2A2ZA 2C5LA 3T1VA 2C98A 5GVSA 4P4UA 3CCEB 2DFNA 2C9CA 2WIBA 4B6FA 5DH9A 5J4LA 2PIAA 2ZQ5A 1OXTA 2O0JA 2RGDA 3K0FA 5E7MA 5L3QB 3X2SA 3RSOA 2RGXA 2VNJA 3OEEA 4Q9KA 5H68A 2WTUA 5D3MB 4BASA 3I32A 4JLVA 1P75A 2FA9A 2G83A 1TTTA 4Q1FA 4A0FA 1Z29A 5IK2D 3NVAA 1GSIA 1QRAA 4O0MA 3GP8A 4IFEA 3KJEA 4FMDB 2XTZA 2QA4B 4KLNA 3EASA 4PPGA 1QH0A 2FMXA 2PZGA 1ZUIA 2IW3A 1R5OA 4D4MA 2FSIA 1Z6XA 4PPQA 4LPSA 5KTYA 1FOEB 3VFDA 2XNDD 3NEYA 1DARA 1E0JA 2WKRA 3U3OA 1UDWA 1E2QA 2RGNC 3ZLJA 2IHYA 4LBZA 1H8HA 1WP9A 3N2IA 4MKGA 4TSFA 3ADBA 5P21A 2KJQA 4M1WA 4XWKA 4FWTA 4HYYA 1KKMA 1DAFA 2X2EA 2ZRHA 3VAAA 4L9WA 4HLQB 5J47A 2XZOA 1GZSA 2OESA 1HEIA 4ZO4A 4AKIA 3UANA 1XJQA 4N3NA 3U44A 5KPDA 1E2GA 2QPAA 3SJBA 3UMFA 3FOZA 2QTZA 1N6RA 1XJCA 1QGAA 3LW8A 1Y63A 2JLWA 1SVIA 3PUZA 1G41A 1XF9A 4CEJA 1L2TA 2GXQA 5FFMA 1YZTA 3FYHA 4M1KA 3A6PC 4U00A 1H65A 1Q1BA 2YWGA 1XX6A 2WKQA 3Q7QA 4POAA 5CITA 1GNPA 5CK4A 3AKEA 4LJ5A 3B60A 4PXAA 5FR2A 3DVLA 4NYIQ 5F9HA 1F20A 3MHPA 2O8EB 2RMKA 2ZUCA 4GL2A 2EYQA 5F98A 1G21E 3B8HA 5CDFE 3LQQA 1Z0KA 3M0EA 3VHXA 4TTQA 2QQ0A 3B78A 5AJZA 3L8ZA 3MCAA 4BLRA 3A37A 1WE2A 4MYUA 3U6KA 3U4QA 3R8FA 2CHQA 1W5SA 4A92A 1CS4C 3KKMA 2GAOA 4GI7A 3DKVA 3K0AA 2F7SA 3RNLA 4YXWD 1E2MA 2W6JD 3QG5A 2DWOA 2PZEA 4OHWA 1ZM2A 1W7AA 3I62A 2D74A 1NVUQ 1TQDA 1W46A 4GFDA 3ZD7A 1GIAA 2VP2A 2V6IA 1Q82D 1VIAA 3P20A 3RRYA 1CJMA 3WRYC 4QGFA 5E7IA 5TR9A 1Q81D 2WSSD 2ZI7A 4QJ3A 3H84A 4C4PA 5FPTA 3Q5EA 2WJVA 1GITA 4KODA 1E2EA 2FFHA 1NBME 4HAYA 1UAAA 4HB3A 1E2IA 1Z0IA 3B2EA 5CJ2A 4PC7A 1H85A 2HDNB 2WMNB 2IF0A 3SZRA 1KMHB 4D4LA 1NN1A 1G8GA 4MUBA 2G1JA 2FX3A 4EFNA 4YMUA 5DHFA 2RH5A 1DAIA 1TL7C 4MGIR 2C77A 1I7PA 2AK3A 2REOA 4Q7KA 3RLFA 4BPBA 1HQCA 4TMVA 2ZE6A 4QM7A 2J0UB 2DWQA 2WAXA 2AKAB 2GF9A 4OYHA 5L3QA 1W2HA 2ZSEA 1XMJA 2NZ8A 3K0FB 4XTCS 1Q3HA 3WHLA 4C2UA 3L43A 4HLDA 2H7VA 4P33A 3D31A 1W35A 3JVVA 1IAQA 3QE0A 721PA 2QT0A 3VHLB 1EFRD 4AYXA 1MOZA 1AZSC 4LGMA 5FBLB 2ZE5A 4MRSA 3RS3A 1KNQA 4BWYA 1FUKA 2SHKA 5DI3B 2X3UA 3OW2B 4EH1A 2RHDA 3LLUA 3M4YA 4V0ME 3WHKA 3PEUA 5KSZA 3MWYW 1E64A 5KUTA 3OF5A 2GRJA 4DXAA 5AWFC 5AJVB 4D0NA 1SGWA 4C0JA 1NLYA 2F1RA 4URVR 1BKDR 2ZJAA 3LA6A 3FKSA 5FUYA 3CH5A 5B30A 3TMKA 2RC6A 1OW3B 1M34E 1MR3F 2AD5A 1ZP6A 3A1SA 4Q19A 4M53A 1QDEA 5SZKB 3WYGA 3UPUA 1GL6A 1CNEA 1VG9B 4LHWA 4B3CA 5GV7A 1WA5A 5KO2A 4F7DA 2NZJA 2OCYC 1WQ1R 2WJIA 3ADDA 4B75A 1FX0A 4JKYA 1YKSA 521PA 2BKUA 3CWZA 1MRNA 4KV9A 2ZAOA 3T61A 5LD2B 1KJZA 4BPRA 1SQ5A 3MMPA 2BCJQ 4DT1B 5JWRA 3O8DA 4Q48A 2ZYWX 1GRNA 1L4UA 1NN3A 2ZRPA 5LD2C 1CJTC 1VG8A 3QXXA 4US1R 3VR3A 1TEVA 5JJKA 1E4YA 3MAAC 4JLPA 1H8EA 1OXVA 3GJ3A 2QAGC 1CULC 3LH5A 3VX4A 1ZNZA 4JLAA 1JXOA 1W2GA 4HATA 2R44A 1UEJA 5TY0A 4DLUA 1UKVY 1IN8A 4MRNA 3CZQA 3NBXX 3ND8A 1ZINA 2Y8EA 2WIAA 2OBNA 1UBFA 2Z4SA 1T5LA 1G3RA 1GFIA 4PPFA 5CIQA 4TT3A 4ARZA 2WPDD 1K8AD 2ZRCA 4ZCMA 1N6PA 1SXJB 3NWJA 3PFIA 5HKKA 1KK0A 1NJFA 1ONBA 2OK7A 4NE2A 3BB4A 2PLRA 5EE1A 3MD0A 4DIEA 3AF0A 2Z83A 8OHMA 4DEXA 1K9MD 1G3UA 3QIAA 2TMKA 5J5CA 1N6NA 4V0KA 4DKXA 4N0DA 1KZGB 2WWGA 5HPYB 2XNSA 5H5JA 4B3FX 5HZHA 4EPWA 1JJ7A 1M7GA 1BX1A 2NOAA 5CM8B 1OPXA 1QFJA 2C9OA 1TVCA 2HEIA 3TH5A 2J45A 2FFQA 5FOXA 2V3CC 3OZUA 2HJVA 4LY6A 2QGZA 1S1MA 3AVVA 4Q21A 3LWNA 1NNEA 4A36A 1VQ7B 4Q03A 1JALA 1VHLA 1NLFA 3CRQA 3QKTA 4WA7A 5FOVA 2CBZA 2IBMA 1RFLA 1EFHA 1JEDA 3CUEF 5F3WB 1CF4A 2R2AA 3X1YA 1QHNA 4DIDA 2PMDA 4EDHA 3PEYA 2W58A 2WJJA 3AV0B 4TN1A 2GZDA 2HCBA 2OHFA 3OIUA 1LF5A 3TR5A 5A5GA 4I99A 2WICA 2QPOA 2DWPA 2ZRIA 1D5CA 2XNJA 2J87A 1J8YF 1E0AA 1IJFA 3B82A 2ZR7A 2XXAA 3U61B 3C41J 1YITB 4RZ2A 3K70C 5A4JA 3BJIC 2JAQA 4JT4A 5EP2A 2D2EA 4BZXA 1DAHA 3ZS8A 4BUJA 1TQ2A 2BBSA 2GCOA 5FUXA 4BFXA 3CRZA 3NKVA 1NVWQ 4AYTA 3OEHA 1V5WA 4OK3A 4A0HA 3LFUA 4XJXA 4AKHA 1ZNWA 5FOWA 4GT1A 1E0KA 2QPTA 1HT1E 3P32A 1GL9B 1KSFX 1F6BA 2ZS9A 1BMFD 1KI6B 4TMKA 6Q21A 4DQLA 821PA 1XPRA 4V02A 5E95A 2NMVA 1TF7A 1KSHA 5HZKA 4V0MA 3FFAA 1RRPA 3AQ4A 4MRRA 4CT4B 2VP9A 3BD9A 4TTRA 3T1OA 1Q12A 2A5DA 4Z8XA 3V4RA 2IS2A 2WMOB 3QEOA 3UG6A 1BOFA 3KUCA 4L8GA 2OCAA 2QE7D 4TLEA 4NP6A 4RD1A 5LB2A 4UQOA 2WOJA 4P6VF 1RJ9B 3HU3A 4BFWA 4LJ6A 2IF2A 4IDOA 1W36D 3EC2A 2C03A 2QEXB 3L0SA 4RFSA 2WOOA 4YMVA 2DBYA 3THWB 2XITA 1X86B 2AXPA 4QJ5A 1P62B 1MO3A 3W90A 1Q22A 3R7WA 1N25A 4K46A 4D2IA 4BLPA 4P31A 2RGGA 1A2BA 3QF4B 1NJID 3TSWA 2HYDA 4TMWA 3TLXA 3ZYCA 3SFZA 1BYUA 2ZYVX 3KXIA 1GNQA 1P2TA 3RS7A 1QHHB 3U2QA 3EZ9A 3BB1A 4TLCA 1AK2A 4DLSA 4ZI3A 5AK0A 2B7BA 1CR2A 2CVFA 1D8TA 2HUPA 2QP4A 2A5FA 4BEJA 4WIAA 3ZIAD 3ADCA 3W6NA 5FTMA 2JLQA 3T34A 4URXR 1R7RA 1SXJD 1E2HA 4O2RA 4DHEA 4FXPA 1DADA 4ERNA 2O8CB 1YR8A 4RZXA 4V0NA 2N42A 3CMAB 4B34A 3QKRA 1G7SA 1OGJA 4MH0R 5L3SB 3U4QB 4OHYA 5FL3A 2KE5A 1VQKB 4YALA 2P5TB 1RPZA 4TT3D 3JZAA 3LBIA 3CNLA 1S9HA 3KQHA 3AKCA 2KBEA 2QMOA 2D2FA 2X1VA 4HAWA 1YU9A 2PT5A 3CH4B 4LJ7A 4Q4JA 1F2TB 5EQTA 4HAVA 2AFHE 1E9BA 4TL7A 3EWSA 2V7QA 3QKUA 1T8UA 4FMDF 3CCJB 2ANCA 4G01B 3TK1A 4YMTA 2ANBA 5JHHB 1F60A 2DR3A 2QI9C 4PSAA 1NG1A 3SS8A 2XJ9A 3GMTA 2JIZD 4IRUB 1GAQA 2CE7A 4P3YA 1RC8A 2D06A 2ZS7A 1S2MA 4A8JA 4C0HA 5SZIA 3GLGA 1VQ5B 3CCVB 2G3YA 4IJMA 2WWYA 3AVOA 3KKOA 1XTIA 2JLUA 3CXCB 1IOZA 1Q0UA 4G0NA 4DC9A 3U7EB 1KK1A 2HXSA 4A15A 1KRHA 1IHUA 4Q00A 4MQBA 3LAWA 3BORA 3LX8A 1OFTA 2QQEA 1GILA 4G1UC 2MSDB 1C4OA 2YV5A 2NG1A 4K81B 3ZJYA 2N1BA 2HMAA 1E94E 1E9EA 2W6IA 4KYIB 2V54A 1PLJA 3CRW1 4BFTA 4K8OA 3AVTA 4URWR 2ZM5A 4FN5A 2ZXUA 3B85A 1EFCA 2YVUA 1NMYA 1E2PA 1W4BA 1ZU4A 3EIQA 4LHVA 2JGNA 1XTQA 5DIFA 1GUAA 2IEYA 5G53C 5LB4A 3T15A 1CNFA 1DTSA 2KWIA 3Q72A 4KFSA 4YAFA 4LWZA 1Q86D 1KDPA 1PLKA 3G4SB 4LCBA 3DM9B 4OK6A 1VIYA 2GHIA 2DETA 4PHHA 4C2TA 4OQLA 3IBGA 4GPTA 2B92A 3AUXA 1XXHB 5JI2E 1XFAA 2Q9CA 3KQLA 1T4GA 4G5OA 3ZVLA 3F3YA 4NBSA 1OIXA 5EXXA 1VHTA 4JT2A 4R2IA 1I2DA 1DDIA 2ZVPX 5JJLA 3FMPB 3N70A 3DL0A 1J7KA 1UJ2A 5BW8A 4NYMR 1P2SA 2GJ8A 4IVQA 5DYGA 4TYYA 4KJZA 2IK8A 3PUYA 3TUZC 2QSYA 1YVDA 2FH5B 3PG5A 1CR4A 5KSOA 5JEDA 1DG1G 1AS3A 4GOXA 1JBKA 3TBKA 2XB4A 1Z63A 3WNCA 1XBTA 2ZSAA 1JR3D 4JLMA 2QTVB 2V9PA 3KTAA 2R6CA 4H1UA 1KC8D 4TYQA 4DLTA 1OHHD 2RGNA 1YZUA 2XTNA 4I4LA 3SQXA 2NO6A 1Q3TA 4M0LA 2VHJA 2ZREA 4JJKA 4F7WA 1J90A 4D25A 4JLJA 2AR7A 3U5ZB 1WF3A 1U9IC 3T06B 3W8RA 1FMLA 3EA0A 3I92A 1W2BB 4PR0A 4Q47A 3NEJA 1W34A 2JLXA 3TW8B 3QENA 4B73A 3FTQA 1PV4A 3PENA 5JI3E 2WM9B 2WSMA 5FOTA 4PSVA 1F3OA 4YC7A 4AY2A 1SZPA 3GCGA 2JLVA 1NBMA 1VQLB 1FNDA 1KDRA 3CKLA 4RFVA 5J4YA 2QUZA 2DERA 1OH6A 3ZGXA 2NPFA 2XAUA 3VR4A 4BFUA 4C0BA 4LK2A 1T0HB 1GAWA 4D81A 3I8SA 2GBLA 2GJSA 4AK9A 3OIVA 4NTZA 4AD8A 1L4YA 3F8TA 4QGHA 5GJCA 3GLFB 3PUVA 1C9KA 1MV5A 5G3YA 4A8JB 3NHBA 3PXGA 4CYMA 1A82A 2OSBA 5FL7A 2FGJA 4TMZA 1X8KA 4IXMA 4ACBA 3L2OB 2HLDD 3NIBA 1GNRA 4NKRA 1E79D 3CRVA 1HE8B 3GJ6A 1N5IA 4CEIA 4IVRA 2QM7A 3H0KA 1US8A 4V0OA 4TL6A 2W0MA 1R4AA 4HE6A 2KBFA 2F1JA 4XH9B 4FCVA 2XTMA 3IPXA 5EE3A 3LBHA 4AKGA 3PR1A 1TUIA 1F48A 4MYCA 1VCOA 3GLFA 1VCIA 5EZ5A 2GCNA 1LVGA 2JJ2A 2ZSDA 3THXA 2EYUA 4XOIA 2QP3A 3T5DA 1OH5A 4TL9A 2ZR0A 4LV6A 4UXJA 1U0JA 4URZR 2J9RA 4A6PA 3KKPA 2ZITA 3BE4A 4S2EA 3W8NA 3U44B 4AI6A 1M6NA 4HB2A 1CRQA 2ZRKA 1HA3A 3EPHA 4CVNA 3WMGA 1XXHA 3DDCA 3KQKA 1G8FA 4RKEA 2FPLA 4DEYA 4HUQA 5EXPA 2ERYA 1ZC3A 4IDQA 2OLJA 4CEHA 1S3SA 2H57A 1PUIA 4M1OA 2BMEA 2RGCA 3BAFA 4DZZA 5JLJA 3R9WA 1W0KA 4DDUA 4L16A 1N8RD 5EP4A 3QFRA 4WOPA 5B58C 1P3JA 2J7PD 3FB4A 4B33A 4FCWA 2O0HA 4TMTA 1T91A 3EW9A 1KSJA 4C3ZA 2IS4A 3U7HB 4QBIA 2IHBA 2DPXA 1MH1A 2ORVA 2Z4RA 5KDDA 2PEZA 2VP5A 4MGYR 1YZGA 1A4RA 3GEHA 2CCGA 3JZMA 4F4CA 1N6OA 1A8PA 3KDSE 4DLVA 5JRJA 2QNRA 3FKSD 5J4KA 2MSEB 3FVQA 2XSZD 1G5RA 3KFXA 3C4JA 4G5RA 4PGOA 3O8RA 4OI4A 4LC1A 3SEAA 3CC7B 2ZTSA 3BFKA 2PEYA 3GEEA 2YOGA 2ZRDA 3NC1C 3U7FB 1MABB 2O8FA 1IY0A 4RD0A 4PAQA 3MGCA 4TQAA 4DCSA 2P65A 4NYIR 2GKSA 1SVOA 5ANRB 4A82A 4EPRA 1XD2B 1AM4D 4LYAA 3B13B 2AD1A 4DLZA 3MLEA 3CCQB 1Z0DA 1ZD8A 2V6JA 2VHUA 2GDJA 3KUDA 3AKYA 3PCRB 4TTPA 3MWKA 4PZLA 3UK6A 3T35A 3W3ZB 1NSTA 2NTYC 3CNOA 4XD7D 1E1QD 1H8ED 3CB4A 2ORWA 4FWIB 4HZUB 1OV4A 1XD9A 4JS0A 3RS5A 4UNRA 2WVJA 4MITA 4QHTA 3OAAA 1DEKA 2CXXA 3KKNA 3QKRB 5L3SA 1DE0A 2ZRNA 4EQ6A 2FSHA 3EPKA 3U3JA 1E0SA 1G64A 2ZRAA 2Q9BA 3Q9LA 5GVRA 5BXQC 1R5BA 1AN0A 5FOSA 4QJ4A 1KYIA 4ZDKA 1Z0JA 4LBYA 1Q7YD 1YE8A 2IYRA 3IPYA 3BK7A 2C96A 4EKDA 1JB1A 4E22A 4X8LA 2W0SA 4G5SA 3U3MA 3FHOA 5FA6A 1VYTA 3SI7A 1W49A 5HCNA 1FTNA 2DYKA 3K09A 3THYA 3GLHB 1R0ZA 4GRAA 1NKTA 3P1JA 1PZNA 4O2LA 5KOYA 3GJ8A 2BHRA 4B74A 3QXJA 3PV0A 3FJOA 4IXNA 3K8YA 2VP0A 3ZD6A 1JPNA 4TLBA 2V8OA 4MKFA 4MKIA 3QFSA 2UVQA 3IILA 4XD7A 5FL7D 2FSGA 3KJGA 1T5IA 3W9YA 3SBDA 1YZLA 5CLQA 4YMSA 5DE3A 1UKYA 1XEXA 1KO5A 3I5YA 1N0WA 4G5GA 5LDDC 4GMXA 1RYFA 3BB3A 5BYKA 2VLIA 1ZYUA 4JZKA 1KO1A 3EIHA 2GZHA 3A36A 1SKYB 4US0R 4YDSA 3LW7A 1X6VA 4QOSA 2BGIA 3CLVA 1VTKA 5EE0A 4BRUA 1KMQA 2ZS8A 2R6HA 2VZLA 4BZPA 3P4XA 4TQUS 4ZKDA 2ZIAA 4I1OA 2LKDA 1X1RA 1J2JA 3CCUB 3QFCA 4B3XA 3KXLA 1PVOA 3D6TB 4F93B 2R8RA 4Q4HB 2AX4A 4Z51A 2IUSA 5TVKA 4KFUA 2P67A 3N2EA 3ES9A 2O8CA 1WXQA 2J41A 3SYKA 2JASA 3KL4A 1NY6A 2X19A 4R98A 2IYWA 2EU8A 2NO1A 1GKIA 1P5ZB 3NTUA 4LYFA 4C0LA 4W9MC 1JAIA 4AC9A 4LJAA 2YWEA 5HXBA 2EFEB 3CF6R 3SU8A 3B1VA 4RKFA 3GLIB 4TYWA 4NCHA 4Z1MA 2BJWA 4X8OA 1ETUA 1E2FA 1OT3A 1AZTA 1U90A 5EP1A 1WDTA 4OHVA 3V76A 3C15C 4CW7A 1EP2B 3A4LA 3BS4A 3L0IB 1N5JA 3L0PA 2JEOA 5IF9A 4Q4HA 2IWHA 5C46F 2XGJA 2OFOA 3R7WB 2F6RA 4WQMA 2P6UA 4QNRA 221PA 1IN4A 1KGDA 2QE7A 3OFND 1W4AA 4G3XA 2REXB 2I3BA 4PO9A 4CT5A 2FEOA 4CF7A 2EIXA 1RE0A 2ATXA 1MABA 2CJWB 2ZSBA 2ODEA 1I4LD 4HSEA 2O8FB 2HF9A 4HDQB 4JLOA 1UBCA 1US8B 5JBQA 2WWHA 2A78A 5JEEA 3EIEA 4C9BA 3KQNA 2HV8A 1P60A 2V1UA 1OXXK 1OFUX 3DM5A 4OI0A 2RGAA 1KAOA 2OG2A 4NCNA 3X1XA 4E09A 3K53A 5HE9A 3FDIA 1KJWA 1SKQA 3CBQA 4RSGA 3QEJA 2CDNA 4AG5A 3T5GA 4US2R 3LNCA 5AUQA 3I61A 2BF4A 1IN5A 2F43B 3LVRE 1SXJA 1BO6A 2FGKA 5CB8A 1RRCA 1IXZA 1S3GA 2G88A 1T3HA 1UBEA 3RRNA 2JIZA 2FEMA 4M1YA 4HUQB 4UKDA 4QKQA 2RCNA 1QVAA 3FKQA 3VR1A 2QP9X 4Y9RA 5GJWC 4QNMA 2BWJA 2EFCB 3I1FA 3OE7A 1XMVA 1OKKD 3Q7PA 1QF9A 3LRPA 1XMIA 5GV8A 4N1AA 2YWHA 3ETLA 5FPSA 2IWRA 1ZW6A 2PX3A 3TVDA 5FTKA 2H17A 2RC5A 2A5YB 1QUFA 4C43A 2KB0A 3IDQA 4IW3B 4DT1A 1DBSA 3GJ0A 4Q1CA 3ZZUA 4EPTA 4ZDJA 3ZS9A 3K9NA 1FFHA 1AMOA 1XD2A 4Q4LA 5L3VA 1JR3E 3AF3A 2QTFA 4YMWA 3KXKA 1Z6AA 3GJXC 2P3SA 2OBMA 3N5CA 2F1HA 2EQBA 1FRNA 3AF1A 5FBRB 2MMGA 1DAGA 1IBRA 1XWIA 4HB4A 3ASYA 2GEDA 3AM1A 2YYZA 2WJHA 1XTJA 4E5UA 3THXB 1A2KC 1FP7A 3VO2A 1ZCAA 2ZRFA 4GBMA 3AVPA 5IRCD 4OI2A 1H8HD 2CNDA 4LJ8A 4B6EA 1GKYA 2VYQA 1DO2A 2GA8A 2VP6A 2WHXA 4UNNA 4D82A 3ICEA 1T3LA 4CZ2A 5FTNA 4DSUA 1COWD 1KNXA 1DAEA 2QBYA 2GAAA 3UWKA 5FUVA 3GD7A 2O8EA 2JDID 4LPKA 2FNAA 2ODWA 4FMCB 3RS2A 1TLLA 3GFOA 4ABYA 2IYLD 1JQJC 1QG2A 1U8ZA 2ZRGA 1N5LA 2PCJA 1IY1A 4FW9A 3VX3A 4G1VA 1NKSA 4JL6A 2FG5A 2PX0A 2ZPTX 4C0QC 1CBUA 1YRAA 2J0UA 1P7CA 3QOFA 3Q85A 5F2EA 3IIKA 2XX3A 2B21A 3BGWA 2GF0A 4M1TA 4U5XA 4LBWA 4QXAA 2G6BA 3TUJC 1M7BA 4HI0E 4AF7A 3EPLA 5B57C 4BQSA 1G8YA 4MRVA 5CJPA 2JLYA 4UJ5A 4JKIA 2RAPA 1I4DD 3AF2A 3CX8A 4BFSA 4DLRA 2ZI3A 3ZVNA 2ZUDA 5CK5A 2NIPA 4TSFD 3ICQB 1E69A 3CD6B 4GOJA 5FPKA 3QPVA 4IKEA 3UIEA 1T8TA 1P9NA 4S35A 2H16A 2Z0MA 3IBYA 3I8XA 1OKKA 2VNHA 4XSGA 4EPYA 2CHGA 5KHOC 3RABA 3PVSA 4CEIB 1GWNA 2C04A 2YHSA 3O8BA 2FDCA 2PZFA 2BMFA 4EJSB 1XTRA 1BMFA 4M9XA 2FN4A 1XNJA 3U7GA 4PO8A 1XMSA 3MFYA 1K8RA 4HZIA 2VNKA 3KX2A 3NBYC 3NG1A 4FMBB 3IGFA 1LB1B 5L3RA 5JCZA 3K0AB 1QBKC 2PJRA 3SR0A 1G20E 1W5TA 4KHZA 1F2UB 2ZRJA 2F1IA 5TXGA 3C5CA 4QRHA 3Q5DA 2Z6VA 2AWNA 5BN3A 1OIVA 1TNDA 5TV2A 1D6JA 2VYFA 2BMDA 4Q4AB 2E1RA 1LFDB 3A1WA 4DCUA 2BEKA 4AF6A 1EP3B 3TGPA 4ACAA 2CJWA 4Q1BA 5FBQB 3FPKA 4RJLA 3R8CA 3CZPA 3AVUA 4OKSA 1OSNA 3GLIA 4TWZA 4TYPA 2QN6A 2IA5A 2R6AA 4LV5B 1UFQA 3H1TA 2BM1A 5K8UA 2OM2A 4RCYA 2CVHA 2JLRA 1KI9A 4DJTA 3HU1A 1ZBDA 3P4YA 2C99A 1GRRA 1OYYA 1Q44A 2ORIA 4JLNA 1E79A 4W5JA 4Q7MB 4BLTA 3TQFA 3VMFA 4Q9HA 4GNKA 2BGJA 4EFMA 1FTSA 1NLZA 4P4SA 4HAXA 1OFHA 3VQTA 1KK2A 4LI0A 1VECA 4Q1EA 1XEWX 1D1NA 2XSZA 1ZM7A 4RD6A 3B7GA 2QROA 4PQYA 2FWRA 2BN4A 1KI4A 4K1XA 1E9AA 1ZCBA 3CX6A 4M9SA 2ZSFA 3NBFA 4LHXA 1E9DA 2I4IA 1GTVA 1YHQB 3CWQA 1QHSA 3CR7A 3KTAB 4A0RA 4NYMQ 2B5OA 1R0XA 3W2EA 3B5JA 2QBYB 4RFSB 2ZJ8A 1ZUNB 1CQXA 3EZ7A 3LDAA 3CRMA 3ZDQA 4HE5A 4EPVA 2ONKA 3F5FA 5H59A 2ZUBA 2G1KA 4M22A 5DHAA 1FPMA 2GK7A 2JJ1A 3AGPA 1ZUHA 4FI3C 1G8PA 3HP1A 3PQCA 1YZKA 2QY9A 2IYZA 4KBFA 4UJ3A 5H1YA 2O8BB 1S0UA 1H42A 1HTWA 2BBWA 2QSZA 4X8MA 1AGRA 1DAMA 2BOVA 2ZJBA 1DPFA 4PC2A 5DLQC 1E63A 3IHWA 4AG6A 5JS7A 2YC2C 4Q66C 3ZVRA 2QAGB 5KSYA 3AUYA 4Q1AA 3K0EA 3E5HA 4BFVA 4LZZA 3EXAA 1JECA 4LUCA 3GFPA 1TPZA 1XRJA 3RSLA 4IHQA 4JLDA 5GJVC 2FE4A 2Q0HA 3QPUA 2WWWA 2CK3A 3QJYA 5JS8A 3IHLA 4AWXA 4Y7CA 2LKCA 2BPOA 4B47A 2ZE7A 1ESNA 5AJWA 4MA4A 3R20A 3KB1A 1AKYA 1JI0A 1YI2B 4ZCIA 1NMZA 1JR3A 4GP6A 3V00A 2UKDA 1GDDA 1CXZA 2WJYA 3MRSA 4A6XA 4BZQA 2EFGA 1DS6A 2VHQA 3JQQA 4OQXA 5FPHA 3SN6A 1G7RA 1CIPA 4L15A 4EAQA 2XB2A 1G17A 2VP4A 2FZLA 2BMWA 4KCGA 2AWOA 2ZI5A 3AH8A 3U60B 1X8JA 1YIJB 2CNWA 3C16C 4DDWA 2Q3MA 1IQPA 2EW1A 4KLZA 1YJNB 1F2TA 4KFRA 3L82B 1M74A 4QFMA 3E2IA 3MJRA 3GLGB 1FNMA 1ODFA 1UADA 1W47A 2P0EA 2VQSA 4FMCF 4M9QA 4W5WA 4CRWB 4LV8B 2KSQA 3EC1A 3O8CA 1CJKC 2OEPA 3C14C 3E1SA 1OH7A 4IOKA 2N46A 1MO4A 4MGZR 1NVVR 2WV9A 3FHTA 2QL6A 3TE6A 1E62A 1SVLA 2BM0A 3MUFA 3CR8A 3CM0A 3T1QA 3D7MA 4XVUA 2FFAA 4HDCA 3M6AA 4B2PA 1Q1EA 1XEWY 4EJSC 1NSFA 1KI1A 4C30A 3WBJA 1HV8A 3SJAA 1VQ8B 3ONWA 4NCIA 5GADl 2D62A 2HLDA 2HXYA 4P4SB 2W00A 3SDZA 2J0SA 3RC8A 1D2EA 2RHMA 4DQKA 3GLHA 1OHHA 4WZ6A 3I72A 4Z1MD 4I1VA 4IOLA 1UDXA 2ZU0C 3QVVA 2XEXA 4HEJA 5LPNA 2J0QA 2QORA 4NCKA 4J0QA 1JJ2B 1W4CA 3GEIA 4JYBA 4U02A 4BRWA 1QUEA 1NMXA 3A1UA 4AYWA 4OJQA 1OIWA 3S1AA 5B64A 5JWOA 2VF7A 3LX5A 4PO1A 2P6RA 2IXGA
chains in the Genus database with same CATH superfamily
3RTCA 3L4BA 1XLVA 2BHSA 2NXJA 3DCNA 5EG5A 3ZV3A 2P7IA 4O4JA 4BRZA 3HJGA 3N0TA 3OTGA 1SUDA 5FOUA 1ELOA 4KPUB 1TD1A 1Z0ZA 1QHEA 2FWIA 2O14A 4BFYA 1ZEJA 3PC2A 4F60A 3ISXA 1RPJA 4HAIA 3ZTWA 4RGQA 4DXDA 1FTQA 4IZIA 3BD6A 3UJ6A 3HYTA 1NI4A 4D57A 2RHTA 3EFEA 1SCJA 3OUZA 3PUIA 4E31A 1IH8A 1YK0A 1SA0A 2W6QA 2W6ID 2X7JA 3H5RA 3PFCA 3HSSA 3PJEA 3OTHA 1X3SA 1XCLA 1ESMA 3DD5A 3O8OB 4RL4A 2PZLA 5JZBA 1ORTA 4K7JA 2PIDA 4KXNA 4EHFA 1OGIA 3OZAA 4REQB 4XJTA 5K3BA 4F2WA 1HYQA 1A7UA 4J1NA 1SWWA 1GOTA 4S1PA 3AIOA 3A06A 3JWIA 3OESA 3IH5A 1E6CA 4XONA 2AEJA 2WYHA 1QF7A 4HQ6A 3HVUA 3ZDDA 2NTEA 1UD3A 4B3SB 1EQ2A 1S72B 3X1ZA 4RWEA 3WK8A 1NFRA 1ZNQO 1GQQA 5L6MB 2F9FA 5F9FA 1Z26A 4ZT7A 4I8DA 1ZVQA 6ABPA 4ZYXA 4OQNA 1WEHA 5CYPA 4BC1A 3ASVA 1U31A 4CCAA 2ZM6B 1VQNB 1AE1A 5J3OA 2G9QA 3O93A 1CU1A 4OO3A 4UHEA 2NZVG 4Y2PA 5BMVB 4UHHA 3EEOA 3S8MA 4BNNA 1EK0A 3DEAA 4MO9A 1NQXA 3IAEA 4TRRA 5GZ1A 4S0ZA 4CFSA 2FW8A 1ISSA 3M6FA 3W3AA 3CINA 3E9QA 2HSWA 1OA0A 2CVQA 3ODPA 1M2EA 3IP1A 3TN7A 1U0HC 2CLSA 3H05A 1ZKDA 2JLSA 2VIIA 4YB8A 1Y8QB 3LP5A 4LHYA 2O20A 1UPAA 4I4NA 1NPDA 3GFFA 2XIQA 5E0OA 3WDLA 3COPA 3Q0TA 4YHBA 5G4KA 2ACKA 2D0OB 1VHOA 4LOKA 2ZUEA 1TJ4A 2AC7A 5BN3B 4BQEA 1WHSA 2QG6A 1W2WB 1IZ0A 1XZAA 2ZZNA 1Z06A 3NRCA 3U7QB 1J24A 2YWRA 3DWFA 3WL4A 3ME5A 1ULSA 1I80A 2Q50A 1J1ZA 1S2NA 2IXFA 4TGLA 4DV4B 4PVDA 3RUAA 2WAYA 1XD8A 3PJGA 1BCSB 1BJKA 2PUGA 1H2WA 1N8NA 5KNBH 4C3VA 5IDXA 4FR2A 3LPAA 4AAYA 1X42A 5BWOA 3AP2A 4HRYA 3OD1A 2E82A 4KYVA 4N5IX 5SZJA 1DI0A 3GELA 4M1SA 4M99A 5B2EA 4TTAA 3KT6A 3SSNA 3MWFA 2JGFA 1TDJA 3B9QA 4ODIA 4DXHA 2GCPA 1CCWA 5HF9A 3VHRA 1KK3A 4IWYA 1ADFA 4JITA 4PZPA 5KQSA 3BJRA 2FV8A 4TLDA 421PA 5JXHA 4N76A 3HBJA 3FI9A 1XQXA 1VB3A 3BOSA 4PTZA 1G9XA 4RVNA 4TLAA 3TGWA 2O8BA 4RD4A 1B2RA 4QM6A 1U7WA 5AESA 1VA5A 2PKCA 3VU9B 1DWPA 4EY3A 3U49A 1V43A 3ICOA 4FDUA 4YAUA 2R65A 4EY7A 1ZJYA 4UEKA 1TADA 1YB4A 2OV6A 5K8JB 2CNNA 4L4ZA 4V1CI 1IG3A 4RF2A 1V16A 1NT2A 2VPQA 5DS0A 3GROA 1UC4B 3EVDA 1RZ3A 3LPDA 5C1DA 1OJ7A 1B74A 3EGWA 3FOWA 1KHTA 3M33A 1RBMA 1J0DA 3OQHA 1K7FB 1VQPB 2AK2A 2J3LA 2A5LA 3LK7A 5FEUA 3BFXA 2OAP1 4IOJA 4MROA 1PVDA 1VSUA 3C6XA 4ON9A 2DBRA 5BRAA 2VHCA 3NALA 1DO0A 1IQUA 3GGDA 4D8WA 3CW2A 2B8JA 5B7GA 1L5HA 3OC0A 3H5OA 1RVV1 4QPNA 3WGZA 1PWXA 4R31A 1J6UA 4WWHA 2GN4A 3N07A 4II7A 4CM4B 4D80A 2MR5A 2H5EA 4K05A 3LBFA 1U81A 1NA5A 3OQPA 1M83A 2XE7A 1G5TA 1VOTA 2YQ5A 4IWNA 4CR7A 5CEEA 4C7VA 4CTOA 1E77A 3PFNA 5CVUA 1VCMA 3E4CA 2Z9BA 3PPIA 4FOTA 1Y4AE 1MFZA 2GTIA 3TRIA 4C22A 4UVEA 4XWOA 5DLDA 5IW8A 2X2FA 1U7TA 3P0FA 1ZIDA 5H83A 1XRLA 1GXSB 5ALXA 1HLFA 2O7RA 3OT5A 4XDYA 2BM9A 3NGLA 2A67A 1WETA 4RGVA 5AUNB 4WVLA 3KEMA 1BS2A 1A9TA 2A1UB 4ZAVA 3SQMA 3J7AC 2YC4C 1JWBB 2XBMA 4F3YA 2JFWA 2QDKA 3VKVA 1NW4A 1I51A 4X54A 4CF6A 5C1BA 2O2DA 2COUA 3W4JA 2WINI 4W9NC 5AW2A 1JPVA 2DOGA 1YJ5A 4WLUA 3K6RA 5EJEA 5CVEA 2R6GA 3GVCA 5BR8B 1TUBA 5HVNA 2Q3JA 3PXXA 1TJ5A 3S99A 2RG7A 2QJFA 4NBKA 3OMWA 5E7JA 4DG8A 2N9UA 1YNSA 2PX6A 2IVZA 3H9CA 3P9SA 2GXUA 5AW5A 1GPH1 2J0VA 4MHOA 2A5JA 2VJNA 4LC9A 4QDTA 4XIYA 1OJLA 3G2IA 1OU4A 4UBMA 2GK6A 4P2BA 5LSAA 3HM2A 4QGGA 3RVPA 4P3OA 2DIEA 2QTLA 1KHHA 3ZH9B 3ZCRA 4X90A 3REFA 2LCFA 1JFLA 2ISQA 3BTSA 1Z2PX 3W06A 3HA5A 1L7EA 1ZD9A 1YS9A 2BR4A 3GGOA 3GJRA 2DFLA 1J8VA 2EEPA 4G56A 1N2ZA 3W3AD 1Z6PA 2I99A 2H2HA 4R16A 4ASUD 1TVKA 4GVPA 4GEKA 5EN4A 2H1OA 3M6VA 1Z83A 1U02A 1JIQA 5L95A 2NYUA 1B7GO 5M29A 1LX6A 1UOOA 4LGVA 1HK7A 2QRKA 4HDNA 3ZZ0A 5K8TA 4N18A 1Z16A 2E48A 2ZZFA 3T1HB 1VYHA 3GFQA 3MPUA 2VAXA 5J5AA 4Z4YA 2HNKA 4V0RA 3N75A 4M1EA 3ESRA 3NDIA 2JFVA 1USVA 2ZRBA 3KKZA 1KRWA 2XZPA 1KDZA 1FFEA 4GZMA 3W7VA 1H6AA 1LBEA 2M98A 5MF6A 4AICA 1BSVA 1U99A 1UJ4A 5E9AA 5BN4A 4Q7QA 3ZV4A 5K3OA 2ZJ3A 1RSZA 1QOZA 2RBEA 1UDAA 1E98A 4LHSA 3VR6H 3OE4A 5H70A 3A6LA 2H1IA 4P9SA 4IHKA 2XLCA 4LXXA 5IN5A 3HHEA 2XKJE 3E1KA 1YA8A 1T3SA 2I4LA 1YR3A 4ESHA 2F43A 3OLVA 1OB2A 3VR6A 3SIXA 1E8MA 2R751 4I1SA 4RY9A 1HUQA 3G1UA 1P6XA 5DHSA 1P4MA 4H1VA 4HSGA 2IIQA 2I9KA 4MWEA 4QBFA 2H54A 2P30A 2NPIA 1UANA 2FCAA 3C3JA 4NL4H 2DX7A 2CXHA 5KPDA 4UHDA 3FNHA 1U9CA 1TTHA 3FPHA 2GN8A 4R6XA 5E1OA 3C8MA 1T9CA 2JZOA 5DLEA 3DVAB 3SE0A 4UQPA 4KWCA 1FEZA 4QWWA 2WYOA 3D5EA 3P19A 1J9EA 1DX6A 3PVZA 2VBCA 3T53B 4ENQA 1S4QA 3CNBA 1I3CA 3OBIA 1FSSA 2Z4TA 2O8VA 2ZBRA 5ECYA 3QV1A 4B3GA 1BS9A 1IEXA 1A9YA 1WHSB 1GLGA 2QL5A 2RH9B 3CIOA 1KTVA 1FFXA 4W63A 3E58A 3WQQA 5FH9A 2EFHB 1YZQA 4E5KA 4ZCQA 1ACJA 4MYHA 3TPZA 4JD5A 1JFRA 4KMSA 1MEOA 1OX4A 4KG7A 1VI5A 4NG5A 3HYRA 3NBMA 3AF6A 2HA4A 1F3LA 1MHTA 1RMTA 5KI6A 2FTKE 4NY1A 3JPWA 4J75A 2QSUA 3GLFB 4OLAA 3E23A 5CLLA 1IM5A 1F51E 1VKHA 3L7IA 4BLOA 3MMXA 3V7AA 2FWBA 4FGZA 4HDOB 4TRNA 3UB4A 4WBSA 4FYXA 1OI7A 3M2TA 4FI3F 4FIDA 4RSMA 1SKUA 3RU2A 3UGJA 1Q0HA 1RKVA 1Y3HA 2ZDHA 3NW9A 4MWTA 5F3RA 4ZVRA 3RSHA 8ABPA 1G7TA 1X74A 2Z5LA 3BFVA 3GLRA 4YCLA 3AX6A 3IP7A 1QZTA 3E0XA 4KXQA 4QG7A 4XVRA 4C4ZA 2AQKA 5GJBA 4PIMA 3OJWA 2O2HA 3F7TA 5A05A 3UGTA 2FQWA 2XTAA 3KTDA 1RYDA 3W34A 4DPLA 1VKRA 3HNRA 1XN1A 2QS9A 1NTOA 1CW2B 1M0TA 4P0TA 2R8OA 5AVKA 2PZAA 1Z7WA 4URHA 4LY0A 4CDMA 1ZK3A 1CJSA 1BH2A 1ICIA 2PGOA 3O47A 1ANKA 2BE9A 4IHJF 3QNMA 1E3ZA 4QOIA 1XRMA 1GQFA 1CJCA 3G2QA 2ZIUB 4UTRA 4B0PA 4LFBB 2Y1GA 4KR0A 2DBZA 2W93A 3EVCA 4KVGA 3O9ZA 5E0KB 2Q1UA 4DRXA 4ZN6A 4BFCA 3PJRA 2HW8A 4RJTA 2YWDA 2P5UA 1JE0A 3DMRA 1APBA 4DJ5X 1LA2A 4YAWA 5F3DA 3IVMA 2OQVA 3TAUA 3QVMA 4KSYA 4ND8A 5DCUA 2QIOA 1M7HA 5F1OA 2UDPA 2ZT7A 2VQEB 3CP8A 1COZA 2RGRA 4JYAB 4DADA 1QIIA 1GNLA 2BFMA 2F3PA 2I78A 2QRMA 4Z1OA 4QYXA 1IEQA 3F3MA 2IYXA 4ONEA 4WX2B 3V3TA 5THXA 4ARBA 1DJMA 2G08A 4PCAA 5BN5B 4NFLA 5F4OA 3Q5GA 2RI0A 1NIJA 3KV1A 3OQBA 4QFDA 3J81k 1UPXA 3KLBA 5JCPA 3OZRA 3JQ8A 2IXBA 3JQ9C 3WLKX 1P9LA 2OHHA 1G5FA 4I0WB 1BQEA 1V11A 4GGMX 1TMKA 3H42B 3C24A 2A3NA 4OBEA 4E6PA 3OX1A 1F12A 2IHKA 4HMOA 4ZU1X 3IDFA 3T52A 4QELA 1KKLA 4E5SA 3GG9A 4P83A 3EVEA 2C1ZA 3NT4A 3ILYA 1V6SA 2CJFA 4TWIA 5CLHA 4N7RA 5ES4B 5IAOA 3GFTA 5B3KA 3AUFA 4XVQA 3GJZA 4O4JF 1FCJA 4Z4UA 3CKMA 4A8TA 5CT5A 2Z6BD 3TQCA 3KYDB 5A6SB 2ZVQX 3D2AA 3EVNA 4BEWA 3ENVA 4IS2A 5G02A 1EJBA 1LW7A 4Z2YA 3DZCA 3ZD6A 2PGDA 1NURA 3I73A 4HL6A 4K6FA 5JD6A 4V38A 5H80A 4UARA 4QYWA 1RJ9A 3ON5A 2MT9A 4DBZA 4BNYA 5LBIA 3IYLW 2JFHA 3ZV5A 5JQGA 4U3JA 2QGFA 1OE0A 4ZGNB 7AT1A 4V03A 2B6HA 2G5TA 5LU8A 4KPFC 4RVGA 3KQUA 3H2HA 1U2SA 3DMNA 3KQTA 2BUCA 1QHIA 3MIIA 2F9LA 3G49A 3WWZA 3G7SA 1FQJA 1LBQA 3T6KA 1T9AA 2OP0A 10MHA 5J35A 4EO9A 5AM2A 2QJRA 2GPNA 1GL7A 4KKXB 3ITEA 3WGGA 2ZT5A 2HB6A 3GI1A 4OHXA 5ENZA 4RH1A 2M2IA 3KU4A 4KQ1A 1T8RA 1JWAB 1SHLA 3P2KA 4M8KA 1HI9A 2D8AA 2PS9A 4PAMA 5LUBA 3QVJA 3HCWA 1PZMA 1EFUA 1N2CE 2H63A 3LQEA 3IAFA 4HDKB 4QUEA 4RBNA 2NU8A 4NVRA 3HH8A 2Y71A 3PWTA 4UM9D 5EUQB 5FBHA 2IPAB 2VHEA 1YOVB 1IMJA 3IULA 3TL6A 5TJ9A 3P0HA 1TZKA 4LF9B 2XCQA 3G5LA 4Z5XA 3JAKA 3T9DA 2ZBFA 2LV8A 1JLRA 3LKZA 3SC4A 4P84A 3IOCA 4FUQA 1P8JA 1YCDA 2C5HA 4HEQA 1MO2A 2OZEA 4WDRA 5D1NA 1P91A 1E99A 3GDWA 3HJUA 3IOMA 4ZHSA 1EVJA 4OUDB 3K9CA 4J0GA 4JGIA 1Z3IX 5E1DA 1FSGA 1Z8HA 2PBRA 1JMKC 1RIFA 3DGEC 4MPTA 3LHSA 4PZYA 2Q27A 3EOAI 3M5CA 1PJRA 3O26A 1GZ7A 3QLUC 3ZW7A 4TPKA 3X2FA 2V55B 1E1KA 1RKXA 1ZMRA 2PE5A 2GO7A 5DW3A 5BXYA 1G2IA 5B1DA 4G07A 1OAKA 3BJMA 5G41A 4C14A 3A6JA 2NZYA 4EKNB 3FROA 4FGUA 1WULS 1AXRA 4BQQA 3HXPA 1Y8RA 2J3MA 2ILVA 1DBRA 2PXXA 3MCWA 1SOVA 1SQGA 3DO6A 3F1KA 4KWIA 1GAJA 3RJMA 5FX2A 1AA9A 5JMTA 1CLUA 1FFXB 2QZPA 2DR0A 4MS3A 4A2QA 2P2ZA 1TKCA 4N3CA 1YXMA 1F1BA 1R6UA 1TAHA 3HWX1 4HWPA 1EX9A 1ACLA 2W9XA 1FFGA 3QI2A 4G7WA 4RS4A 1KQNA 2OB1A 3NIFB 3B8EA 5DCLA 1TOAA 3ABZA 3IUYA 1CR0A 3PIIA 1E2DA 5TJHA 4DRYA 3USES 4YV1A 3LXXA 1R3UA 2B30A 4YRIA 1ESZA 1FLDA 1XTSA 3O5AA 4I50F 1MDBA 3ZCSA 4ESVA 3ONYA 3AUKA 4ZAGA 1GQRA 1U7OA 4HAZA 2MWMA 3F4KA 3MPOA 4JYZA 1EX6A 1V5IA 2CLCX 1KIFA 4GZ6A 3HKDB 3LI2A 1IJBA 1QWSA 1CUVA 4HXYA 4D96A 1P61B 3QE2A 2QZ4A 4WFQA 3VH2A 1O6GA 4H7KA 4DGQA 4B3BA 2JRCA 1IC6A 3Q39A 2VT7A 4EHNA 4W7IA 2PL3A 3K8OE 4KDFA 4XA8A 4S2UA 3Q3JB 2W22A 1UOPA 4RPDA 1YRHA 1R0RE 1N34B 3EG5A 3VNUA 3F3KA 1JB9A 1KTIA 1WCIA 2EWVA 4TV8B 4RTOA 2CL0X 2D3WA 3QVUA 2A4MA 1M1KD 2QZJA 1QDUA 3D6FA 1XK6A 1V1RA 5DGIA 3X1WA 3H8JA 3ZTTA 4EGSA 2XCTB 3F9RA 2GREA 1KS2A 1NP6A 2LTAA 4GX0A 3HLTA 3RRXA 4F91B 2ETVA 2QMHA 1H6CA 3KR1A 3LYLA 3KTFA 4L8LA 1PR6A 1LDMA 1FSPA 1B26A 5KIAA 2ATVA 1B0PA 2W83A 4F9GA 3SYTA 4WN9A 3EHEA 3TM5A 2QDXA 4YS6A 2O0MA 3W5HA 1A71A 2C92A 3UWPA 5HYVA 1SUPA 3PGXA 4IZ6A 3T0GA 2YR0A 2Q6IA 2BCEA 4JL5A 4UD6A 5T4EA 4EQZA 6CHYA 3OZVA 1ZOLA 2Z1MA 5JC8A 3ZHCA 1TECE 4BX2A 1II8B 3JWGA 5D5QA 4P3XA 4YRPA 4XWGA 1VIDA 1DIRA 1JXMA 1NM5C 4XJVA 3SC2B 2XGGA 3DP7A 2I6UA 4FNAA 4Y6SA 4KQWA 4KQJA 3ONDA 4XM1A 2NO9A 3KBBA 1AS2A 2GVDC 3P0IA 3B1XA 3PEVA 3OICA 5FNVB 3TINA 3H75A 5BSUA 1OVMA 2J59A 3E2PA 3KALA 5SY9A 3N3AC 1G21A 1THTA 4A1FA 1CEEA 3VDXA 3OP4A 2OAQ1 1XZHA 3PITA 3IP8A 4JVSB 4V0LA 1FYWA 1RU3A 2PSDA 3G2MA 4LXQA 2FPKA 4U7DA 3AOEA 2YZNA 4MKHA 2Q5IA 3O7WA 4JBNA 3K9GA 3DZGA 4NK4A 1I3MA 1MIOB 1OROA 1L4MA 1RFGE 2P9GA 2PKEA 3DW3X 3FPAA 4FLMA 2OXRA 4ZODA 1E20A 4KKVA 5DBEX 1MT0A 1XFOA 1NVAA 2VYCA 3SOPA 2BEVB 1VMAA 2WZNA 2HADA 5JJIA 1PKEA 4Y1RA 4DWWA 3M1IA 3J81A 4O4IB 3AONB 4NZMA 3PZRA 1SCNE 2VWQA 4ZVTA 2FEKA 4HVTA 1BU8A 2WY2D 5H4GA 1BG6A 4NFHA 4ZO9A 3WSWA 1AJEA 4HLNA 4RZSA 3SC3A 3MAJA 3CEMA 1AO3A 1Z25A 1X0XA 1U28C 4WXPA 4ZVMA 5E6RA 1PG2A 4EYGA 5AFSA 2DC1A 2VOJA 1TKRA 2MSNA 3NORA 4OAQA 3VKGA 3BY1A 1BEUB 2C9YA 2DHDA 1OLOA 4DLWA 2VDVE 1LBIA 2AE1A 4FD3A 4WBXC 5B53A 4B4VA 1XJ5A 5AW6A 3ZBQA 4H7IA 4ZYYA 2L19A 4NHOA 1I1NA 2QXUA 4H4EA 3K1YA 1KU0A 1CPYA 4BQNA 2ZSUA 2QU7A 4EY6A 1TO2E 1OTXA 3MT0A 4TLLB 1P0MA 1NN0A 2CJPA 4H9GA 1O97C 3GW8A 1ZJJA 2NADA 1SBTA 4D9NA 4P58A 4WLOA 4XIIA 3GUHA 3VR4H 1LFAA 4JHXA 1EK6A 3D3QA 5HGXA 1F7UA 1EVLA 3QYPA 1EAMA 2AI2A 2GFQA 3F6BX 4J90A 4MKZA 3SXUB 3T3GA 4ENTA 4P0PB 1XVAA 3IXQA 1FYDA 4P25A 2OHIA 4MPPA 2ENWA 1VC2A 1Y1PA 3HV0A 2ETXA 3EZ6A 1QVFB 4JR1A 4IMIB 3E8XA 4JXXA 1D4FA 1LLQA 1EDZA 2ZYTX 4XPIA 4C7OB 1CEXA 5KYUB 4TZ6A 3RGGA 1Q1AA 4N0EA 3W5DA 3EH1A 4BFZA 4BYMA 3TR0A 2O3SA 3ULKA 4A0QA 5CB4A 5AI8A 2VK2A 3UWSA 2OCGA 1CB7A 1JKJA 3LLMA 4DF3A 5JBNA 3PLAE 2ZZEA 1T6NA 1G6HA 1GPMA 2VQ3A 2QTAA 4FINA 5BWLA 3P9YA 1U98A 3QBVA 2XIJA 4X6LA 3X1JA 2ZYUX 1JA0A 2FN3A 4ND4A 4RV9A 1PGOA 3NGXA 4UBIA 4DHWA 2DCUA 4JC0A 3DO8A 1G3QA 1DIGA 1T2DA 2FN8A 2YVLA 4QQRA 3AJ8A 4UPVA 2A9QA 4BX0A 1Q17A 1VG1A 9MHTA 4TKLA 3DBHB 2HF8A 1YE3A 5TDHA 4HBZA 5E6TA 5FFFA 5JPDA 2ZEJA 2EDAA 4GMFA 2JZNA 4K6HA 3MRVA 1U9YA 2VK8A 1J21A 1CZOA 3EMDA 4TM8A 1P4JA 2IYYA 1AKWA 1BFKA 2PRKA 2XF2A 3KR2A 4YLGA 4BVJA 2Q0QA 3BBPA 1A8QA 1RXUA 1SVWA 2PFSA 2BSXA 2P90A 2HU2A 4RK4A 1CERA 3PE4A 2OBFA 3CEHA 1Z08A 3AI2A 5CG2A 3TJZA 1AHHA 3K0HA 4BNUA 4HQOA 1R8XA 1G5PA 3NH9A 2CLDX 3HDTA 4JB3A 5J40A 5KNDD 2ZU6A 2FCRA 4CL3A 2BH9A 3L49A 4OKIA 1X70A 1IL0A 4MLZA 2PXAA 1E9RA 4JP5A 1X2EA 1O57A 1NYQA 3FMVA 3PWSA 2GM9A 4FDVA 4RAOA 5GWXA 4I8IA 1TPYA 1ZBQA 5H82A 5LQSA 2H1CA 1EWYA 2HWKA 4AY4A 1AHPA 1WHTA 2R7AA 3VKWA 1G9TA 3RWMB 4ED9A 3PFGA 2RHGB 3BMCB 2UV8A 5LKRA 1PR5A 1CEYA 1GP2A 3TNYA 2WNSA 5IAEA 2AEFA 1J2YA 3OWOA 4AS3A 3EE6A 3IKLA 5EZQA 1J5EB 3DQPA 3H1AA 2QW8A 1IY9A 4CNBA 2I7DA 2FZEA 1JEJA 3Q6IA 1TXGA 1KD1D 3C3BA 2FR8C 3QLVC 2ZTMA 4H7FA 4Z3KA 4MRPA 5IZ4A 4GLOA 4DMCA 1OFIA 3CH6A 3JQCA 3TAHA 3TUIC 5HDBB 1K8ZB 1SHKA 1ECJA 1TUGA 1ZL0A 4L4XA 4XSHA 1A1SA 2BGMA 5DEIA 1NY5A 3K09C 4A73A 1UZAA 3JD1A 5IF3A 3GLIE 2ZDGA 3IO3A 4RO0A 1L8XA 3CLRD 1X7YB 1G8SA 3I09A 4N47A 1Q20A 3HJNA 4Q01A 1IWPB 1U0BB 2HA7A 4GP7A 3RBVA 4I5GA 2REQA 3FCEA 1SN7A 5K0FA 1XZCA 4M0KA 5FT9A 3WIBA 2ESRA 2OGWA 3H11B 2GCOB 2X22A 2K5UA 3GLQA 1DFGA 4LXIA 4QU9A 3TOXA 2ZJ5A 4I1YA 4LNHA 4O5OA 3TEJA 1Y4SA 4XM2A 4PFJA 4S1TA 4D99A 3C7DB 1WF6A 2QQFA 3DNMA 4PNZA 4DCNA 1XTZA 4E21A 621PA 5IJAA 3THYB 1FDRA 3HN7A 5AW0A 5AW1A 1RM0A 3RVNA 2BBOA 4EUEA 2CMKA 1W36C 4R4JA 4TTJA 1YK1A 2XD9A 5IKXA 2V6GA 5EEGA 4I50A 3DPSA 4GLLA 1K63A 3K0CA 4B4DA 2PQMA 2XYRA 3X1DA 5THKA 5EKUA 4Y0NA 5ALYA 3RAEC 5JG7A 2V97A 1YQWA 2ZBQA 3IR5A 4N41A 1F5SA 3TAXA 5AI0A 4JAVC 2KMLA 1N6HA 1Z3CA 3L8YA 4JB8A 1E96A 4O2AB 2WTNA 1JHUA 3ILHA 4B2LA 2JFPA 1W1UA 5IDVA 1FMJA 3A4MA 4TRJA 4H60A 4TZ0A 1JHRA 4L4UA 3V8RA 4JUAA 4J6FA 2AE2A 4KVAA 4XYGA 3UN1A 1X80A 1H3FA 1BHQ1 5C8VA 4JSTA 3T8YA 3BWBA 3L5OA 1N3BA 1RRGA 2B6NA 1E43A 4K6CA 3R41A 5G4LA 4DMRA 5C8XA 5LM3A 3CF4A 2QV0A 4IIDA 5FA5A 2GYYA 2FRVA 4MGKR 1ZUWA 1RC0A 2W2PA 4TUYA 1OB0A 2R79A 3UKJA 3KXPA 1BTOA 2V4DA 2ZAMA 1CUSA 3HXTA 1UDCA 4MAFA 4MARA 5ALOA 4GM1A 4P4TA 2D4HA 4G84A 4UXHA 3A2MA 3ELWA 3B1ZA 4HS9A 4E5MA 3LY9A 2FR1A 4UCWA 4U6QA 1JN0A 5TT1A 4E1BA 2WWFA 3IDZA 1M9NA 1TKBA 5KYWA 3W5UA 2H1LA 4F11A 1P17A 4O1HA 1SO8A 2RI6A 4UBJA 4EVRA 4Z53A 4AUMA 1LPBB 1ZD4A 1R10A 2X9VA 2Q2WA 3FGZA 2W6OA 4MUFA 3BZBA 3HR7A 2GEBA 4O8ZA 4I5DA 4XGRA 3HZHA 2AXNA 3UGQA 2O1SA 3NASA 1CQIA 5L40A 2OENG 2UZ1A 1NRJB 1T36A 1WW2A 4S1NA 5KNBA 4BKRA 4BO3A 2O8DB 1HOXA 1N5KA 4TRMA 1CJUC 1SKMA 3PE6A 3NHMA 5E9JA 4IOMA 1I9CA 4M2LA 4AJNA 2H8KA 2BGRA 3FH0A 2LWIA 3PGKA 5F2KA 2I66A 4GWGA 1X38A 1R8QA 2GM4A 1WPQA 1L4LA 5K8IA 2XHZA 3RHSA 2COKA 1FLAA 1Z2AA 4YT8A 5LBTA 4QXQA 5IULC 1OXBB 1SY7A 1HZEA 2ZETA 3WWYA 1EK2A 2J9FB 4Z4EA 3EEBA 3DFMA 3I9MA 2E0IA 3EXG2 2GVZC 4KWHA 4W5HA 5T4BA 2I1QA 3ITDA 5K3FA 1LU9A 1JDJA 2OWEA 2VG8A 3LPLA 5JIBA 3NXSA 3GPCA 4B48A 1ID1A 4NEQA 2PY6A 5BY2A 5JQGF 1CB0A 3JY6A 2QMUA 3GPLA 3VKUA 3E7XA 4PG8A 3C4VA 4QUGA 3OZWA 1XZQA 3G82C 3KPWA 4G1CA 5JSZA 5DASA 3CVOA 1TO1E 1W581 2VHYA 3TQSA 2D0PB 2IZ0A 3BXZA 3CV3A 3H97A 2EJWA 2GUGA 3EJWA 5FUWA 4KIGA 4A03A 2UYOA 4Q7LA 5HHTA 1Z62A 1WBJB 2HGZA 3P2YA 4X1KA 3GZTB 5F4BA 5SYAA 2C5LA 4WK2B 3U39A 2C98A 1Z2NX 5C5EA 3NVMB 4OGKA 3KEWA 3CCEB 4P4UA 2C9CA 1O0CA 3HRKA 3EYAA 4OU5A 3GDGA 4TXLA 3K0FA 5KC9A 2OOSA 1MW9X 2ISCA 2FYTA 3OEEA 2VNJA 4OFXA 2YRXA 3F78A 2ID8A 3F96A 1BROA 1C0LA 2Q3BA 2QMZA 2W7TA 3R3SA 2H5IA 4HWSA 4JLVA 5T3UA 3SXJA 4MQ5A 3DE1X 4YMIA 4A0FA 4G5HA 5IK2D 1KEKA 4RMIA 3NVAA 4O0MA 2AF4C 4DPKA 3OJCA 4GPBA 4DCTA 4RHFA 4FMDB 1V1RB 2XTZA 2QA4B 1L1EA 3EASA 4RF3A 4ZU3A 4OOFA 3I53A 3S5JA 2JCXA 1YO6A 3V1LA 1ZUIA 2P3OA 4YRNA 1R5OA 3C39A 3CC8A 1M8FA 4YP7A 1UFKA 1G42A 2EERA 4AF8A 2D2IA 3OY7A 3HO1A 5AJTA 1GCGA 1WUIS 2XF8A 1E2QA 2RGNC 3BL8A 3QMVA 4LRTB 4LBZA 1H8HA 3U5TA 3N2IA 2WM8A 3R5SA 2PH7A 4M0MA 3PYMA 4JVOA 4ZI7A 4KVFA 4WBNA 3KVYA 4L07A 2OC9A 3G59A 4XWKA 1E60A 3ZY5A 3Q6QA 3FLEA 4NBVA 3VAAA 16PKA 4HLQB 1OX6A 3VHXB 2XZOA 1A9XB 5MHTA 2YY5A 1Y82A 3UANA 3UMFA 2QPAA 5K05A 4HPWA 4RK0A 1XJCA 4HDSB 1KU6A 3AI7A 1Y6GA 3L7MA 2JLWA 1AVTA 1G41A 1QH9A 2P4EA 4YCBA 4LJKA 2IV3A 2PUBA 4GS5A 1CVIA 2GXQA 3AUTA 3PHJA 3FYHA 4EZBA 2AEMA 3A6PC 1QC5B 1WPCA 1Q1BA 1PWEA 1W9XA 3Q7QA 1AU9A 1T9KA 1GNPA 5J2UA 1ATZA 2V59A 3RU3A 2IIPA 1PGPA 1T0PA 2X8JA 3EIWA 2P9YA 4JQZA 4PXAA 1S2DA 5FR2A 3UMYA 5F9HA 1F20A 3MHPA 4HWOA 4XX0A 2O8EB 3L8MA 1SXQA 4Q9NA 4Y2TA 3F3SA 3HUEA 1G21E 3K2BA 4HCJA 2H48A 5CDFE 3A9UA 1YR2A 3M0EA 3P97A 3B78A 1DJOA 1CQJB 5E6SB 6REQB 1YJ8A 3R9KA 3U6KA 3U4QA 5HMLA 1ECFA 4BNZA 1MB9A 2V96A 4A8PA 2IIBA 2JEYA 2X4GA 4LZAA 4W1RA 1UXKA 2J30A 1GZ4A 2GAOA 2EX4A 2WUEA 3DKVA 3V4LA 3NAZA 5J23A 3T5AA 2PGLA 3H9QA 4YXWD 1L7DA 1Y0YA 3IEXA 3UYLA 1Y3CE 2P9ZA 2PZEA 3F6CA 5CX1B 2CBXA 1W7AA 3I62A 1W46A 5EGSA 2PX2A 4GFDA 2G09A 3MEQA 3M4ZA 1GIAA 2VP2A 3RYIB 3CO0S 3WOVA 4PG5A 4CLHA 4DLNA 4V1CB 3P9RA 4OHRA 2C2WA 2ZAYA 3O1JC 1A27A 4YJ3F 4ZOBA 3WRYC 1YBFA 5TR9A 3EWIA 5E7IA 3H84A 7MDHA 1TT7A 4GBJA 5FPTA 3NWOA 2WJVA 3WR5A 1E2EA 2C29D 2QV7A 4R1NA 1K2WA 5LZ9A 4HB3A 4NCXA 5LQNA 2C4HA 2L42A 1E2IA 5JAZA 2JBAB 2C4UA 3GH3A 4PC7A 2E4WA 3H4VA 1NE7A 4D3SA 2ZJ4A 3LT1A 2IF0A 4P7JA 1KMHB 2AOTA 5CYGA 2XCRB 4UBKA 1PJSA 4KGXA 4MUBA 5CRIA 2UXBB 4GECA 3HLKA 3TQHA 3RLFA 2C77A 1I7PA 2AK3A 2REOA 2YN2A 3ANYB 3C3MA 4GGPA 4CUZA 4DR3B 7REQB 1KAQA 1T1EA 2WAXA 1JI3A 1D04A 2AKAB 2B4KA 1CUFA 1Q7TA 1TYEB 2Y27A 1XMJA 2NZ8A 2OORA 1V4NA 2ZSEA 4OB7A 4XN3A 3MF4A 2H7VA 3AEQB 1W35A 3QE0A 1IAQA 1H2XA 2BZ1A 3IEPA 4IVNA 3FW1A 1NRWA 4QTZA 4LSMA 2X3YA 1VLOA 3VHLB 4Z86A 1CV2A 2QJOA 5FBLB 2ZE5A 4ZO6A 3BZUA 2IHVA 3UMCA 3ZPNA 2JIDA 2GSWA 2WU1A 5BW6B 1I8TA 4HRVA 3WHKA 2X3UA 1DJNA 1L9KA 3M4YA 1AURA 3WDMA 3MWYW 1T5OA 2GRJA 3VC1A 1KVUA 3KYBA 1ZXLA 4DXAA 2XMGA 3DUWA 3JZIA 3OPOA 2QQGA 3EN0A 3MQ2A 5E7QA 4FT2A 2ZJAA 4M9CA 1G4HA 4J2TA 1VRVA 2H52A 1U2PA 1M34E 3DULA