3PENA

Structure of archaeal initiation factor aif2gamma subunit delta 37-47 from sulfolobus solfataricus in the gdp-bound form.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
403
structure length
403
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Translation initiation factor 2 subunit gamma
publication title Structure of archaeal initiation factor aIF2gamma subunit from Sulfolobus solfataricus in the GDP-bound form.
rcsb
source organism Sulfolobus solfataricus
total genus 101
structure length 403
sequence length 403
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3penA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3penA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3penA01
1FNMA 1KK1A 2ORIA 3A1TA 2PCJA 1GL7A 2YC2C 2P67A 5H1YA 2IS4A 5FTLA 5FA6A 4NYIQ 3TE6A 3RRYA 2IX3A 3NH6A 1I4TD 4OK6A 4C0BA 4ON9A 4TQUS 2GF0A 3DZDA 4ZIRB 3H4MA 5KHOC 4ZV4A 3AP3A 5TV2A 1YR9A 1CJUC 1D6JA 5D3MA 5M04A 4PQRA 2FH5B 4YC7A 4TMKA 4DRZA 4LJ5A 2FPLA 4G3XA 4A8JB 4V0ME 5G3YA 5BQ5A 4OK3A 2YHSA 3U3JA 2Z83A 2ZSDA 2EFEB 2X8AA 5D3MB 2QL6A 1WF3A 1DAHA 1SKYE 3P32A 5FBLB 3K9GA 1XMSA 2MSDB 4B3FX 5KSZA 4OQFA 1YRBA 5JI3E 2CE7A 3WBKA 2XGJA 1TTTA 1ODFA 2NGRA 1F2TB 1ZM3A 4ZCMA 1GR1A 3T1OA 2W6IA 1KDTA 4PAOA 1VG0B 2GAAA 1FMLA 5AK0A 4JJKA 4QKQA 4MKFA 2IT1A 3RAPR 1J2JA 3F3YA 4PHHA 2ZVPX 3BFKA 1I4DD 1I4LD 2P6NA 4FW9A 1G8PA 3QF4B 4PO1A 4NBSA 2ZROA 3IDQA 2FPKA 1OHHA 2OFWA 2VHQA 3EZ2A 4LPSA 4BLOA 4ESHA 5CB6A 2LWIA 1QH0A 1NVUQ 4EJSC 3M4YA 3CC4B 2XXAB 1AZSC 2A5DA 5K8IA 2IF2A 3PUYA 3CF2A 121PA 1PV4A 1XB2A 2OTJB 3A4LA 3EAQA 5E7IA 3Q8XB 4Q4AB 5TY0A 2HXSA 2ERYA 2IYSA 2BBSA 3BWDD 3G82C 4D0NA 1QHXA 4Z1MD 3GLGE 3VR5A 3QPWA 3QFRA 3FFBA 1CJVC 1Q20A 3CCSB 3FE2A 1XXHE 3KJIA 3WP0A 2FOLA 2R2AA 1QHNA 2XZPA 4C0SA 2C99A 1LVGA 4HB3A 4P4UA 1DG3A 1HE1C 4NL4H 1Z47A 5CK4A 3W5JA 1VG1A 3L8ZA 1Z0FA 4LBZA 1NKTA 4BZQA 3AP1A 3LBHA 4MRPA 2GILA 3CCJB 2RGXA 1KDRA 1P75A 4JLKA 4HAWA 4B43A 1BKDR 3RVBA 5EUQB 4DIEA 1NKSA 1TU3A 4RD2A 2H1LA 1MO5A 4GT1A 5C1BA 3WMFA 1ZM4A 4RCZA 4AYWA 4G5GA 2QDXA 2IF0A 3RS5A 2WWHA 3RS0A 4MDEA 3RRMA 3MSXA 3W2FA 2R6FA 4AIIA 2IEZA 5GADl 3AVTA 1DG1G 2ZYUX 1DOAA 5J4YA 3WNCA 4IW3B 3REGA 4TTQA 3W6OA 4AYXA 2PJRA 1KKLA 2OXCA 5TR9A 4M8NE 3BIFA 1CNEA 3VO1A 5CM9C 5FUWA 3VR2A 2H57A 1D5CA 4CW7A 2JLUA 3K70C 1R6BX 2QAJA 2CHGA 3HYRA 1NNEA 1DAKA 5DI3B 3KTAB 2W6ID 4GPTA 5GJCA 4FCTA 4NDZA 4V02A 4A2QA 4GNKA 5KDOA 3QXJA 1P3JA 1SGWA 4GDFA 1NL3A 2C78A 1XBTA 4AKGA 2IUSA 5EJEA 4GP7A 4Q1FA 3IEVA 3W5VA 3AVWA 5BN5A 4JBYA 2BMWA 1DAFA 1EXMA 1WP9A 1S1CA 2GKSA 1XJ0A 1Q0UA 4Q9IA 3THWB 4FCVA 1OHHD 2BHRA 4J0QA 3EIHA 4Y7CA 1T8TA 1G7SA 2GXSA 4DDVA 3QPUA 4WW0A 2FFAA 4IEEA 1QHGA 3B85A 3W2GA 1U9IA 3PEWA 2NIPA 4TWZA 2QROA 3BXZA 3D31A 2AKAB 4DWJA 1CRQA 3QENA 4LGMA 2B8TA 4JLDA 1G8HA 4PGOA 2I3BA 3CC7B 2QMUA 3DOFA 1M90D 2YWHA 4KCGA 4TLCA 4HAZA 2ZTSA 2WSMA 4DQKA 5HPYB 3GEEA 4ZKEA 5BN4A 1QFZA 1G41A 1YITB 4YHBA 1P6XA 3K8YA 3I56B 3GJ8A 4AG5A 3U7FB 4CEJB 5JMTA 2HJGA 1NBME 1IN6A 3TAUA 2ZANA 1JQLB 2CLDX 2W00A 3HPQA 2Q9AA 4PANA 1GL9B 5LB2A 4L15A 2V6JA 1G5PA 4I1SA 5AUPB 3CPJB 2RGBA 1CQXA 3FOZA 4AYTA 3GLHB 4A6XA 1OPXA 3NTUA 4WXPA 1G7TA 3W5IA 1XTSA 2F1HA 3KJGA 3CUEF 4B33A 1MRNA 5TVKA 4KHZA 3MJHA 1E9AA 2P3SA 3KXKA 4QGGA 5AJXA 2VLIA 1ETUA 4LWZA 4OHXA 3ZDQA 3EPLA 5FR1A 3GFTA 2O8EB 2V55B 4ZI3A 4NYMQ 2MMGA 4E07A 3BGWA 1UDWA 5EZ6B 3ETLA 1KK2A 1KC8D 1PJRA 1QG4A 4MRRA 5LD2C 1Q44A 2R8RA 2HT6A 2IYRA 1P9NA 2ZI6A 1OW3B 1T91A 3AKCA 4YDHB 1E2HA 3U7HB 1EP1B 2EYUA 2GEVA 4BFUA 1ZJ6A 3E1YE 4RCYA 4AWXA 3RS7A 4LJAA 5EP2A 2G1JA 1RVDA 4UNNA 3PEUA 3D6TB 4ZDWA 1EWQA 3LW8A 1Q82D 4JLBA 3BRWD 4S2EA 1YU9A 1KY2A 4IXMA 3NWJA 2Z6VA 4NZYA 1TF2A 1SVOA 1IB0A 2ODWA 1QBKC 2D3WA 4QBHA 3ZVRA 2NZ8A 1E99A 2BBTA 2RGDA 1X86B 4IHQA 1K5GA 2RHMA 2O5VA 2QTHA 5JJLA 1FRNA 4WA7A 2PZFA 3BB1A 4QC2A 3KKOA 1OLOA 4Y9RA 3P4XA 2QN6A 1DAEA 3T5DA 1VQOB 3TUIC 4M2LA 1W44A 1VPLA 3LY5A 3VX3A 1H8EA 2ZR0A 2IBMA 4Q9LA 2NMVA 1VCOA 1Z08A 4IFEA 1N0VC 1SHZA 2ZJ8A 1E63A 5P21A 3CM0A 1WA5A 2CVFA 2XZLA 3W5UA 3ZD6A 2OFOA 2I1QA 4C30A 1GG2A 1M2OB 2XX3A 3GFOA 5CK5A 5LD2B 3CB4A 2AFHE 3RSLA 1KDOA 4N0DA 5FOUA 4L9WA 5K8TA 3D3QA 3NBYC 1OYYA 3AF3A 5DI9A 3OIVA 1OIWA 1SZPA 3CX7A 2H18A 2BIFA 1JAHA 5KO2A 221PA 1KKMA 3M1IA 5KNBA 1U81A 4DLTA 4HE5A 3OIUA 1S3GA 3LVRE 1OB5A 3KUDA 3T06B 2GWHA 4C4PA 2OILA 3AVVA 1G291 1R0YA 1JI0A 3Q85A 2OK7A 3EPHA 4DC9A 3A58B 1CULC 2VSOA 2ZS9A 1VQ4B 4RZXA 2BF4A 1M1YE 4OHYA 1XFAA 3L43A 5A4JA 3TVTA 3K0SA 4HAYA 3H2YA 1AZTA 1E2DA 4UXJA 4DIDA 3O8RA 2REOA 4F4JA 3A1WA 1GO2A 1ESNA 1W47A 1ZUIA 5JCPA 2ONJA 3TR5A 1SQ5A 3CRQA 2MMCA 1AN0A 3B1VA 3AVUA 2A30A 1RW4A 1SM4A 3Q9LA 3OAAA 1FNDA 3VNUA 2ZRKA 5FH9A 1DAIA 1DELA 1UAAA 2ZRGA 5CLQA 1IBRA 4EFNA 4EPYA 2XOKA 4PQYA 2PZEA 1XEWX 1N5LA 1E2EA 1IJEA 4UAJA 4ERNA 3WNDA 3IIJA 1KSFX 1KI4A 2CLSA 3QKUA 4M1OA 2V1UA 3DVLA 1A7JA 2ZJBA 4P4SA 2YWGA 4US0R 4FMCF 1FQJA 5KOYA 2EIXA 2WJYA 1DEKA 3SJAA 4N3GA 1A2KC 1COWA 3VKHA 4JL6A 2AL7A 4P4SB 2RHDA 2VH5R 4F4IA 3LWNA 4A6PA 1KQSB 3MMPA 3O47A 3ZS8A 2O8DB 2PLFA 2ZJZA 4TLAA 2ZU0C 4TSFD 3ADBA 2ERXA 4TYNA 4HAVA 1JA0A 3PV0A 1NMXA 1NJFA 3I1FA 1QX4A 4QOSA 1D9ZA 2HCJB 2CJWB 1DDGA 2ZSEA 2WWWA 3BS4A 3LAWA 3Q3JB 5K8LA 2KJQA 4NPHA 1KNXA 5HE9A 3KJEA 4A2PA 1SKQA 5LBIA 1AQUA 2IL1A 3AKEA 4URVR 5J47A 3VR3A 5JLJA 2JLRA 4L5BA 3KQHA 1KI9A 4KU4A 2RAPA 3QXXA 4HLDA 1P2SA 3M6AA 4MKIA 4C0JA 2KBEA 4HZIA 1FX0A 2OT3B 1F48A 4UNRA 3B7GA 4IKEA 1ELOA 1YKSA 1MRSA 3ES9A 2O8CA 721PA 2ZR7A 2V54A 3GLFE 1SVSA 2GZDA 5EXTA 4JS0A 2HEIA 2ANCA 4PZLA 4TZ6A 2WPDA 2QBYB 3C5HA 2PEYA 2QPOA 3LXXA 1NMZA 2VHUA 4RFSB 4US1R 1GFIA 1TMKA 4DHEA 3KB2A 1IOZA 3U7EB 1EX6A 4YALA 3SOPA 4Q1EA 5SZHB 4RY2A 3VAAA 4ZDJA 1IAQA 3QKRA 1XZPA 3MG9A 2EFGA 3QFSA 4MRVA 5DO9A 3SQWA 2XOKD 1DARA 2EWWA 5KSWB 1W5TA 2G1KA 5EP3A 1PZNA 1AS3A 4Q1AA 1HYQA 3DMNA 4X8LA 1EGAA 1II0A 2QQ0A 1AGRA 2ATXA 3W8NA 1IM2A 2QAGC 2YV5A 2BM1A 1LTQA 2W2XA 2DFLA 4QBGB 1S9DA 2PT5A 1W4BA 4DLRA 1COWD 3PUXA 2J7PA 5J4HA 1FP7A 4PPGA 3NHAA 4K8OA 4JBXA 4K81B 2HYDA 2R6AA 5H59A 2CHQA 4BFXA 3U4QA 2QGZA 5AUOB 4O3MA 2O8BA 3KKMA 1VQ5B 3KX2A 4G5OA 2D06A 2GRJA 4UJ5A 2DB3A 3EARA 521PA 1TF7A 2PT7A 4LHVA 4Q7KA 2C5LA 4C0QC 3NBXX 2LKDA 4E03A 1J99A 2XNJA 3EWAA 3CZPA 2N1BA 4Q1DA 4KLNA 5FBWB 3OHMA 4BASA 1BQEA 4B48A 3K0FB 2QT0A 3B1YA 5J4LA 3V9PA 3JZMA 2ZI5A 4QJ4A 1Z0KA 2GJSA 4IEIA 5GV8A 1KNQA 1ZW6A 1SXJC 1Z5ZA 1ZU4A 1N6HA 1D2NA 1ZNYA 3UXMA 4CEHB 4RJLA 3MAAC 1R5BA 4GP6A 1M74A 2ZRCA 1VTKA 4HZUB 4YONB 3K1JA 1E98A 3CMEB 3BK7A 4UXHA 4EPVA 3QKSA 1NVWQ 2FEMA 1VYUA 2X2FA 2ZETA 3Q5DA 4IVRA 2X77A 3TQCA 2GK6A 4KFRA 4DT1B 2WPDD 5FOWA 2CBZA 2QAGB 1UPTA 4NYMR 5DH9A 3FPKA 1KHTA 1AQYA 4HDOB 4A15A 1W0KA 4LJ7A 2QMOA 1YZGA 5H8WA 2ONKA 2QORA 4A92A 1T0JB 5G3ZA 4ASUA 2RGNC 1XPRA 2YYZA 1A2BA 3NIBA 4G5RA 1VHLA 1YRAA 4LV5B 3NEYA 1R8SA 4KBFA 4DVGA 5F2EA 1RJ9B 3GLIA 3HJNA 4KVGA 1HTWA 2OBLA 2DETA 4BPBA 1U8YA 1H42A 4AC9A 1P7CA 1OGIA 3DOEA 1UBFA 3FKSA 3I4LA 1G3MA 1A8PA 2R6CA 4HLCA 3CO5A 4LSGA 2PCLA 2CXXA 2XNDD 1Z6TA 4DCSA 1SXJB 3ZH9B 4BZXA 1W4AA 1P2VA 1XP8A 2JJ2D 2J7PD 4I1VA 4TT3D 4IDPA 3FMPB 5FTKA 2DFNA 2EQBA 3K0AB 1FMJA 2QSZA 3A6PC 4MKHA 2JDIA 1XMJA 1D2EA 2DFKB 2F43B 1M7HA 3REFA 2ZUDA 1GZSA 2WV9A 3BAFA 1UBCA 4EH1A 2GZAA 5DYGA 5ELXA 5JI2E 3L8YA 2OHFA 1N6NA 2WOJA 4LC1A 3ZZ0A 3KKQA 1DBSA 3NH9A 1KI2A 2O0JA 4IVPA 5E4FA 3T1VA 3UK6A 5CDFE 3GEHA 1OIXA 4CF7A 4XSGA 5FTJA 4A0GA 1NLFA 2YJTD 2CCJA 2W0SA 2AFIE 1VQNB 4F7DA 1IXRC 1W49A 2ZJYA 2GCOB 1XD2B 1W2BB 3O8CA 3VU9A 4Z51A 2GVDC 2OZEA 4R9UC 2GQFA 1H8HA 2R65A 1DAMA 3CRRA 2OCPA 4RFVA 1S3SA 4PFSA 2NG1A 5AR1A 3V00A 2AX4A 1Z06A 2J59A 2HT1A 1FNCA 4AF7A 3SI7A 3L2OB 3PQCA 3ZGXA 3ZS9A 4DXAA 3I5XA 1W0KD 1QHYA 1GITA 2WWGA 3MWYW 3U3OA 2ZAMA 4QHTA 3JQPA 4TMXA 3CX6A 1R5NA 2WWXA 3P4YA 2REXB 4LYHA 2IXEA 4ASUD 5FBVB 2IC5A 3ZQJA 5FTNA 3SBEA 2GJ8A 4LV6A 5BYKA 1P2UA 2EFDB 4XWKA 3W6PA 4WXRA 4EQ6B 5DN6D 2OXRA 2XJ4A 5DHFA 1Z6AA 1CJKC 3ZLJA 4K1XA 4B3GA 3Q7QA 1Q1BA 1LS1A 3OZXA 2H17A 4QXAA 3X1ZA 4URXR 4KO8A 3E20A 3UIEA 1TQDA 2WWFA 3DKPA 3EC2A 2AHOA 2HF8A 2ASEA 4PHGA 4B3BA 2W6JA 1RRPA 1PUIA 4NHOA 3THYB 2GZHA 1KI6A 1EESA 4BRWA 4D80A 5JWOA 3VR6A 1KO4A 1QZXA 2DERA 3SZRA 2YOHA 3K09C 4QG7A 1E0SA 2PMDA 1N2CE 3IBYA 1X1RA 4Q66C 4XTCS 3A4NA 2JDID 4FI3C 5FUVA 4BLTA 3CWQA 1QG0A 1Q1QA 2GEUA 2FGJA 2ZRPA 1QHIA 2NO0A 5EXPA 4XJXA 3QVVA 2WVJA 5EZ5A 4W5HA 4DUGA 1Z2CA 1UDXA 4B35A 5HXBA 1GILA 2CLCX 421PA 1AIPA 1GOTA 1GRNA 1U8AA 4Q18A 1DPFA 4V0MA 4D0GA 3KFVA 1BJKA 3T5GA 5H68A 3IO3A 1WBBA 4CEIB 1XCGB 3F8TA 8OHMA 5E3HA 3BJIC 2H8KA 5A5GA 4LCBA 2J45A 2J41A 2OLJA 1Y3AA 1TU4A 2OM2A 4CVNA 4BFWA 4BFZA 4M0LA 4TQ9A 2JAQA 4JL5A 3M0EA 3AF4A 1SKYB 3WRYC 2ZI9A 2YINC 3ZQ6A 2IS2A 4TL9A 4V03A 1GKUB 1EFUA 4W5JA 4ZIRA 3PR1A 1A1VA 2E87A 3B1ZA 1S4QA 4GBMA 4UXIA 2DPXA 2FWRA 1XEXB 3L0SA 2QPTA 1XPUA 1VYTA 2C03A 3B13B 3W5HA 1T3SA 5AJZA 5AJWA 3AP2A 2QP3A 3BC1A 1FFHA 4CT4B 5E7JA 4B6EA 3PFIA 4OJQA 1BMFD 4A8JA 1N6IA 1OXUA 3JQRA 5JWHA 2ANBA 2QGNA 2ZE7A 4GZMA 4QBIA 1AM4D 2J0UA 2ZJOA 3DL0A 4B34A 1JR3D 1L2TA 1TQ2A 1Z6GA 2FJUA 4UQOA 5J5CA 4BFYA 1KAOA 3FYHA 1A5TA 1K5DA 2VHTA 3AEZA 3IBGA 3LV8A 3FJOA 1M7GA 2J0UB 3AB3A 1F2TA 3C5CA 4JL8A 1D2MA 1C4OA 1VDZA 2IXFA 1W2HA 2XSZA 5E95A 2QY9A 2IUUA 1WB9A 4LV8B 4PZZA 5FPTA 4B3DA 4G0NA 2GETA 1W2GA 4XD7A 3FHCB 4DEXA 1NMYA 4AKEA 1IJFA 3KL4A 3CCEB 3E70C 3QY0A 3GLGB 3O8BA 4UNSA 3QF4A 4U5XA 3BFVA 1XXHB 1IHUA 3LX5A 4EKDA 5JEEA 2FFBA 4TYPA 2WOOA 4BEJA 2QP4A 4NH0A 4EFMA 3F5FA 3H84A 1JPJA 1WMSA 2XXAA 1R0ZA 1RRCA 3Q7PA 3A1VA 2DEUA 2IUTA 2VHJA 2N42A 1CR4A 4DUGD 4HAXA 3PEYA 4OHWA 5B30A 2RGGA 1E0AA 4F93B 5DISB 4Q4AA 3CKLA 2FMXA 1E4VA 2H7VA 1T3LA 4UNQA 2BKUA 3EZ9A 3AM1A 1N6RA 2EYQA 3THXB 1HE8B 1P60A 4RZ2A 4JVLA 3OJXA 1HUQA 2OG2A 1ZIOA 3IEUA 2GESA 1R5OA 1HT1E 1NY5A 2KSQA 1G8GA 4TLEA 1EX7A 3VO2A 3TRFA 4F7WA 2OEPA 1YR7A 2W58A 1OV4A 2D7DA 1S9HA 3FTQA 4YLGA 3WRXC 1DVRA 4PXAA 1ZAKA 4UKDA 3WMEA 1W36D 1TL7C 2DR3A 2VP2A 3CXCB 2AD1A 3CONA 3QIAA 3WNBA 1UKZA 1S2MA 3RS2A 3CD6B 3VNVA 1JJVA 4NCHA 2FSIA 4IDNA 1R7RA 1Q81D 1M1KD 1M7BA 1FUKA 2NOAA 1JB1A 4C0LA 4E5UA 5C4MA 5FBQB 4Q9KA 2QA4B 4P4TA 3DDCA 1OH5A 5JCZA 4C7OA 3GJ6A 2Z4RA 3AKYA 3VMFA 1SVKA 1E1RA 2DWPA 2VNJA 4ZKDA 4BUJA 4PSKA 4FN5A 4W7SA 1F3OA 4B71A 2ZITA 2VTKA 3KTAA 5DI3A 1VHTA 2A7QA 2AKYA 3TMKA 4C7OB 4FINA 1XE1A 1XX6A 2YWEA 2ZI7A 4M1YA 4EJSB 5LPNA 1KO8A 2VSFA 4L9SA 3BBPA 2J1LA 3ZIAA 3I62A 2VA8A 4D25A 4XD7D 3X1YA 5L8VA 2WJJA 4C2TA 2QM8A 1NVXQ 3MFYA 2G77B 2OK8A 3BH6A 4KITB 5KDDA 4D6PA 2FGKA 1N8RD 2VP0A 3THWA 2WICA 1VQPB 2HLDA 3LLUA 4X8MA 2Q3HA 2WWIA 4I4LA 1LS6A 1NBMA 3T34A 4B75A 4L8GA 3LBIA 4LRWA 3VFDA 2GXAA 1E0JA 2WJHA 3BB4A 1UEJA 1S72B 2F1IA 2GJKA 4OI0A 1GVNB 1XTKA 3TQFA 3I72A 2IYVA 4XVRA 2V9PA 1G7RA 2VPPA 4HDCA 2R9VA 5E7MA 2WBLC 2HF9A 2A5YB 2W2TA 2BEJA 2KE5A 1TF5A 4MYCA 3C8UA 2VBCA 1GKYA 1F5NA 3QSYA 4F91B 2H92A 1GRRA 2P5SA 5FPKA 4CIDA 1LFDB 4CYMA 3U44B 3WYFA 4F38A 4TZ0A 4GMXA 1NJID 3FWYA 3CLVA 4EPRA 1E9CA 4CEJA 1J90A 2NZJA 1EFHA 1D8TA 4PSAA 1CKEA 1FOEB 4G1VA 3CBQA 3GJ0A 3RSOA 1S1MA 3K70B 2WAYA 2AR7A 1KK3A 3AUXA 2V8OA 3QXCA 5FOSA 1UMKA 4Y0AA 4WQMA 3L82B 1GTVA 1ZNXA 4M9SA 3GLHA 3LDAA 3KXLA 1QHHB 3QEOA 4LZZA 5AWFC 1AKEA 2ZR9A 1G7CA 5DE3A 4ARZB 5JBQA 3BORA 5HE8A 3B60A 2IW3A 1Q3HA 1HA3A 3BB3A 2XEXA 3PENA 3MJRA 1BIFA 1YJWB 3NEJA 1J8MF 2F9LA 2RGEA 1P9WA 2O8EA 4EUNA 4US2R 5KTYA 1YHQB 4JLVA 1VIYA 3ND8A 1E6CA 1GWNA 4PAMA 3NHBA 4M9ZA 2GDJA 3P26A 2PMKA 3KKPA 4IOMA 5EXSA 3SYNA 4ACAA 821PA 2NQ2C 1QHSA 4UJ3A 2W0MA 2BGIA 1RZ3A 1YZLA 1G21E 2DBYA 3D8BA 3TBKA 2HLDD 3U60B 4DB2A 4DZZA 4M21A 4WAUA 3LVBA 2AWNA 3OESA 2P65A 4HEJA 5B58C 3VTKA 4MGKR 2CDNA 4BRUA 4LJ6A 2Q6TA 3UG7A 4IFBA 4EPTA 2ZI4A 1QFYA 1Q1EA 4JLJA 5ANRB 4GL2A 2IHBA 4MYHA 1E62A 4URWR 1CJTC 4B6FA 3U3MA 1KY3A 3NDBB 1N5JA 2DYKA 1NIPA 2ZE5A 4NKRA 3KB1A 4P33A 3CX8A 4LHZA 4D4JA 1X3SA 1IONA 3BOSA 2A3RA 3FB4A 3NG1A 3B5JA 3RLFA 1JXOA 2QTFA 3FPAA 2VYFA 3PVSA 3TJZA 5IT5A 1GAWA 3NC0C 4JLOA 4JSYA 3LO5A 3BE4A 5FPYA 4ZI2A 3EX7C 1AS2A 3RYTC 3CW2A 4NCNA 4GI7A 2R6HA 1XDBA 2ZUBA 2Z43A 4Q21A 3CZQA 4FXPA 2G6BA 1DO2A 3U3RA 2Z4SA 4KODA 3OW2B 3U3KA 3WMGA 2IA5A 1UKEA 4A4DA 4B3XA 2P5TB 3EC1A 2Q21A 4RKEA 2IS1A 2F1RA 4F92B 1G6HA 4BLRA 3SDZA 3BH0A 1VQKB 1N6LA 5HR5A 2WZQA 1UBGA 1L4YA 1KSGA 5DIFA 1KO7A 2ZYVX 1XWIA 2ZSAA 2VL7A 1EK0A 1VCIA 4URZR 2FFHA 3B8HA 2RC6A 2QNRA 2ZJAA 1FP6A 3SU8A 5KU1A 1FNBA 3IIMA 2YKGA 1QF9A 3U61B 4MITA 4DLSA 2JLXA 2GF9A 2OESA 3VHLB 2JLVA 3RHFA 5F3WB 2OE2A 3QG1A 1YR6A 2VYQA 3FDIA 4Q4HB 1OF1A 2DHRA 2F7SA 2ZRDA 2Q9CA 2EVWX 3DM9B 4LYJA 3L0IB 2WSSA 4XVQA 2QG6A 1H65A 3HYTA 4KAXA 4DLWA 4IOJA 1CLUA 3I92A 3VR1A 1YZNA 4M1TA 3EPKA 1LW7A 2LCFA 3RC3A 3X1XA 3TK1A 2JASA 2GVZC 2J5XA 1T8UA 3KXIA 4Q4JB 5CJ2A 4RD3A 4IDQA 5JJIA 2VP6A 1T5LA 5J4KA 1N0UA 2H5EA 1XCPA 4X8OA 4D2IA 1JJ7A 4URYR 1C9KA 1E79A 4LJ4A 2RC5A 1G8YA 2VRWA 2ZREA 3ECCA 4MKGA 5HZHA 1KMHB 5KSOA 2GEDA 1PUJA 2J3EA 2FSGA 1KOFA 3RRNA 2OLKA 5TXGA 4ABYA 3C15C 1KI8A 1L7VC 4JKYA 4D4MA 5GVSA 1K73D 1Z2AA 1J7KA 1F2UB 1Z8FA 3MD0A 4ZCLA 1OXSC 2O8DA 3TSOA 1K6MA 1MO3A 1E4YA 2CCGA 2BC9A 3OFNA 2QTZA 1H8ED 2J46A 1NDHA 1F60A 1OJLA 3IUYA 1Z0IA 3OJWA 2CMKA 1PLKA 5C4GB 2CJWA 3GJ3A 2D74A 4B47A 1M6NA 1P2TA 1TQ6A 5K8UA 3GLFB 5IHPA 2KI5A 2ZIAA 4PC2A 1TAGA 3LLMA 2G9NA 1HT2E 2B6HA 1W5SA 3OE7A 4WVFA 1G9XA 2VP5A 4YAUA 4MQBA 2J9RA 2IHYA 3CWZA 3MGCA 2Z5FA 4NP6A 1E96A 4PPQA 4XWOA 1DO0A 4POAA 3FHOA 1ZM7A 1Q3TA 3QBTA 1VQ6B 1E2QA 5IK2A 3C16C 3G5UA 2PL3A 2D7CA 2QBYA 2ZS7A 2O8FB 4RD1A 2XNCA 1LY1A 4Q9JA 3X2SA 2RGCA 4RFSA 2ZSBA 1E2JA 1VCMA 4O2RA 5LDDC 4C0KA 4Y9UA 5THXA 4AG6A 1QRAA 3AVXA 4JZKA 1SVLA 4D81A 1GSIA 5JS7A 4KYIB 4AF6A 1CXZA 4RSGA 4RZ3A 1NVVR 4A0HA 3GEIA 3U5ZB 5CYPA 3JZAA 3OAAD 2ZPTX 1Z0AA 1Q7YD 4X8HA 2NPIA 1Q86D 3THOA 2QMEA 3OEHA 3PUWA 1XZQA 2C04A 1F6BA 1ZRHA 3E1SA 3I8XA 4BFVA 2D62A 2IWHA 2BMFA 2CNWA 1G3QA 3HPRA 5F9HA 3I8SA 1E9EA 4M9XA 1YZKA 2MSCB 3SEAA 3R7WB 5JZVA 2BBOA 3PG5A 3WYAA 4Q48A 2QI9C 3KQLA 1FL9A 1QDEA 4LX0A 1N5KA 4FCWA 1HV8A 4Q5IA 3K9LA 4QHSA 4TYWA 2JEOA 2GHIA 4HB2A 1KK0A 2QTVB 3CNNA 5FR2A 1KZ7B 3K0CC 3SJZA 2OAP1 5GVRA 3TGPA 2JCSA 3KZ1E 1Z83A 1GL6A 1KO5A 2F3RA 3IILA 3SFZA 4DLYA 5KNDA 2IYUA 4H1UA 1BX1A 3K0FA 1BOFA 1R8QA 4PC6A 2GBLC 4A82A 4JLMA 2DCUA 2IYLD 4LY6A 1ZD8A 4WZAE 1B2RA 4PZYA 1KYIA 2NO7A 1XCMA 1GIAA 5BWMA 3DKVA 4PC7A 2HV8A 2QM7A 4DLUA 5B2ZA 4CEHA 3IHLA 1CRPA 3LRPA 4WZBE 4HZUA 5SZJA 4ILEA 3RDPA 1XTRA 3KFXA 1TQ4A 1KJYA 3AF1A 4NE2A 4BWYA 1QGAA 5AN9A 3DM5A 2REBA 3G4SB 3T12A 2VEDA 2XTNA 2QAGA 4DT1A 5IK2D 4DQLA 3I5YA 1MABB 1W4RA 2JA1A 3QE2A 1VQ9B 1HH4A 3CR8A 4XOIA 3DZ8A 621PA 2X19A 1V5WA 3PITA 1EP2B 5FI0B 3KQKA 4PHTA 4MGZR 3Q72A 3HU3A 2E9SA 5LB4A 4Q7LA 2XITA 2D2FA 1EFTA 3C14C 2J0QA 3G6EB 2CEAA 4JYCA 5JECA 3SNHA 1RJ9A 1EFRA 1QVAA 1UJ2A 3P20A 4AD8A 2HCBA 4OJKA 2AXPA 4GRAA 3DPUA 1E2GA 1G3RA 1P73A 1XRJA 2P2LA 2JJ1A 1NG1A 3UMRA 3OEHD 3W8RA 1FW6A 4GSYA 4QNMA 5EE5B 2B7BA 2CNWD 4NONA 2IYYA 1U99A 3RS4A 1SXJA 4DDTA 1KRHA 2BM0A 3HWSA 4F4CA 4L4UA 4R71A 4IJMA 4MUAA 2Q9BA 4JYBA 4RD0A 3K0AA 3SS8A 4QBFA 4HLUC 5AJYA 1K8RA 5CLLA 2FV8A 2F43A 1NSTA 3W3AA 3R8CA 5GV7A 3I55B 5EQTA 2BOVA 4DLVA 2F9MA 3S1AB 4IDHA 4YMWA 2Q3FA 5FL3A 4A36A 2VZLA 3EZFA 1RPZA 2UZIR 2QEXB 3OF5A 1G6OA 3H1TA 5CITA 2DWQA 1Z63A 2GNOA 4KLZA 1R0XA 2RGNA 2HJVA 1QFJA 1IQPA 1JEEA 1E9FA 3FHTA 1ZCAA 2GCOA 1ZBDA 2FF7A 1Q22A 1XD2A 3FGNA 2CK3A 5JHGB 3ZZUA 2DWOA 2EU8A 3HU2A 3PJRA 1Z6YA 1D1NA 4OHVA 2FFQA 5JHHB 1XD9A 1R10A 4FWTA 4LDJA 1JAIA 3IQWA 1MT0A 3OIWA 1BX0A 3FKQA 1U94A 1E9RA 4YMTA 4MH0R 5C2JB 4N1AA 1ESMA 1OYWA 2BMEA 1I7PA 3EZ6A 3A8TA 5SZKB 1OSNA 3NKVA 2P6RA 3X1WA 4MRSA 1JNYA 1XJQA 2VNIA 3AV0B 4PTLA 4EQ6A 4LYFA 4M22A 3GLIE 3ZYCA 3K9NA 1KJZA 3FMOB 1EFRD 2NO9A 5B57C 4JLAA 4LHYA 5F98A 1BYIA 1WBDA 1BS1A 5KSPA 1GP2A 4WBSA 1E94E 1Z07A 2FEOA 1RIFA 5EUMA 4PR0A 3V4FA 2QA5A 1UF9A 2BVNA 1SXJD 4QGAA 4C43A 5C18A 4MYTA 3CCQB 3ZBUA 3LBNA 4B73A 4U9UA 1ZNZA 3THYA 2R6DA 5TDHA 1QUEA 4TL7A 4DLZA 1IXZA 3FKSD 1JA1A 2RKOA 3TSZA 2G88A 4B2LA 4BLPA 4EIWA 1ZIPA 3QXHA 3QQ5A 1R2QA 4HUQB 2VNKA 2F6RA 2J87A 3BD9A 3NC1C 3R20A 1Z28A 3MUFA 3V76A 4RVCA 4RD6A 1G3IA 4DBLC 1JXMA 2ZS8A 3FVQA 4KI0A 1OB2A 3T1TA 2YWFA 4CZ2A 1HQYE 3ADKA 1OH8A 1W7AA 3CRZA 1T3HA 5AJVB 3QBVA 4YAFA 1UKYA 4EFLA 2AWOA 5FPHA 4YQFA 3ZJYA 3QNUA 3LA6A 4CEIA 1QGZA 1HY3A 2VIIA 1KIMA 3W2EA 2WM9B 1ZD1A 3LW7A 3AKDA 4GOKA 1YJNB 2V4ZA 1US8B 2CK3D 3QF7A 4HATA 4LBYA 3IKJA 4YXWA 4Q7JB 2BKEA 1P5ZB 1T4GA 2VP4A 1G16A 1W36C 2JLSA 3R9XA 1GNQA 2PX3A 6Q21A 5DHAA 1E1QA 1UADA 1G19A 1VG9B 1WE2A 1XEXA 5L3SB 5KPDA 4TN1A 1Q57A 3CF6R 4O2LA 1H8HD 4H9GA 4PC1A 2FX3A 2VQSA 4A9AA 1E2IA 1ZC4A 3TIFA 1JR3E 4TTRA 1NIJA 2ZM5A 3W9YA 3QUSA 2EFCB 4OI2A 3D7MA 3I32A 1OH6A 1OT3A 1T5IA 1U98A 3SFVA 1PVOA 3K53A 2ZRMA 4UNPA 2CE2X 4WZ6A 4P32A 1CEEA 3K0EA 1II9A 4YMSA 3TAHA 1AK2A 2F55A 2Y8EA 1XMIA 1N6KA 1G4UR 3B1XA 3EW9A 1XTJA 2IEYA 3N2IA 2OSBA 4P0TA 1GAQA 5G53C 3UWKA 5CIWA 4S35A 4Q19A 2ZVQX 1OXVA 2XZOA 4A1FA 3MWKA 4Q01A 1DE0A 1N25A 3GLGA 2BMJA 1FPMA 2W6JD 4XTRA 2C95A 3PIRA 3E5HA 1XXHA 2V7QA 3C41J 1ZM9A 3LQRA 3LX8A 1YE8A 3R9WA 2RMKA 1D9XA 1W36B 4GOXA 5AUQA 5HKKA 5DSZA 2KB0A 1UFQA 3EASA 5CIQA 3KJHA 3VKWA 3U6BA 4P3YA 4GFDA 3QFTA 1II8A 1Z3IX 4QJ5A 1QVGB 4NYJR 1E32A 3RANA 2CL7X 1IY0A 2JJ8A 3ZBTA 1CU1A 2QSYA 3E2IA 2C9OA 4N3NA 4FMDF 4E09A 4C9BA 3ZC3A 1LV7A 1II8B 1XNJA 4HSEA 1NG9A 4TL8A 4AKHA 1ZU5A 3BFXA 3THXA 4JIMA 4KV9A 1AGPA 2IYZA 3AVQA 3QKTA 1XPOA 1E2FA 5IDVA 2W2VA 4B76A 4YXWD 2NO1A 3F0TA 4KFSA 3GP8A 5TB5A 1OFIA 2UZ3A 2WTUA 4D26A 5DGXA 1E1QD 2MSEB 1CTQA 1H85A 1SULA 2QP9X 3N5CA 3TUJC 2IS6A 4LJ9A 4M1MA 3LNCA 1E2MA 4GMDA 4PPNA 1I2DA 3LH5A 2J0VA 4M4SA 5IRCD 2YOGA 3T61A 3TH5A 4M1WA 5EE1A 1NY6A 1IN5A 1NN3A 1JR6A 2GAOA 1G17A 4U02A 4KJZA 1E64A 1G18A 3NVAA 2HDNB 2JLYA 3HP1A 4N0EA 3BH7A 4MRNA 1GNRA 4OQLA 1VQMB 1VQ7B 1CR0A 1G20E 4CDGA 4EJSA 3RRZA 2VNHA 2WKPA 3PUZA 1DTSA 3ICEA 1T9HA 2CL6X 1W87A 2XSZD 2A78A 1WRBA 4KXFB 2C77A 1JBKA 1EFCA 2BN4A 1P61B 1N6OA 4PQFA 4R7ZA 5FUYA 2FA9A 3VQTA 3W34A 5FOXA 2V7QD 3RC8A 4HYYA 3HR8A 2EWVA 3CH4B 5J40A 5HKKD 2C98A 1Z0JA 2WKQA 2FPMA 3UATA 4DKXA 4DDWA 5JWRA 3CNLA 5G40A 1DS6A 1XF9A 1ZD9A 1WDTA 1J70A 4Y0VA 2BWJA 4JLPA 2ODBA 1NVVQ 5H5JA 1JPNA 3QG5A 1U9IC 3EZ7A 2FSFA 3P1JA 2HUPA 3PUVA 2PIAA 2OCYC 2QENA 1TNDA 4PO8A 1RRFA 2K5UA 3QOFA 1UKVY 2QU8A 3JVUA 2P0EA 3AVPA 2L0XA 1E2KA 2WHXA 1GVHA 4G01B 4B74A 1GAJA 4TTPA 2PJZA 3NDPA 4NCJA 3WHKA 3V4RA 1X6VA 1OFHA 3U44A 3GMTA 4JVMA 2CNDA 1S96A 4W9MC 3ZZTA 1YI2B 1KGDA 2F3TA 2CL0X 1W1WA 1XTIA 1R0WA 5FPSA 2PH1A 3ONWA 3ASYA 4U7DA 3I61A 2VO1A 2ZSFA 3N70A 4LHWA 2FZLA 3TKLA 2FSHA 2IWRA 3QI2A 2B5OA 3JVVA 3AVOA 4PX9A 4TYQA 1QHHA 2A5FA 4ARZA 3QPVA 3R9IA 2G3YA 4DSNA 4FK8A 3SN6A 3DEFA 4AURA 5FL7A 4BGDA 4IOLA 2UKDA 1X8JA 4TL6A 4IRUB 3WYGA 3CPEA 5FTMA 4MGIR 2R62A 2X1VA 3T35A 1KZGB 1TEVA 2AK2A 2B92A 3KKNA 4OYHA 4B44A 1ZUNB 1IN4A 4II7A 5DYIA 3TVDA 1K9MD 1TVCA 1E1RD 1KI1A 3OEEA 1DAGA 4ZGNB 1KAGA 2OV2A 3GQBA 4TQAA 1VG8A 5IF9A 3MCAA 5CJPA 4B2IA 1OXXK 3CRMA 4TMTA 4IVQA 3CH5A 1YJ9B 4LJYA 3C4JA 2OUKA 2V1XA 4ZDKA 5JRZA 3QEJA 4LHXA 1LNZA 1AMOA 1W46A 2Z0MA 1VYVA 3ZIAD 3GPLA 5BN3A 1ZYUA 1GNPA 4B4DA 1JALA 2CVHA 3OZUA 5EMNA 3PXGA 3LO8A 5FOTA 5JSZA 1OE0A 3B2EA 2AD5A 4TMZA 2ZE6A 2ZEJA 4JKIA 4BEBA 1MO6A 2AXNA 1XEFA 3CPWB 1ZUHA 1NBMD 2VF8A 5L3QA 2ZRAA 1Q12A 5JEDA 5JSZB 1X1SA 4DEYA 5C46F 2R44A 3EXAA 1HURA 2O52A 1OXTA 2WJGA 1HEIA 2XNSA 1RYFA 1KO1A 1FNNA 2QTLA 4B3CA 5L3QB 4JMPA 2C9YA 4M9QA 4A0FA 3CCMB 4GOJA 3IPXA 4OQMA 2A5GA 4G1UC 1NN0A 4Z8XA 3GJXC 4ITRC 5GJVC 3AF2A 2PEZA 4A0RA 1GJRA 3TUZC 2C8VA 3ND9A 1P4SA 4FWIB 4BE7B 4QJ3A 3OZWA 2QQEA 3AQ4A 3K70D 4YAWA 1U0LA 1FRQA 2XB4A 1GUAA 3GLHE 4OI1A 4G1BA 3GJ5A 4U00A 2BSAA 2IYTA 4C0AC 4BZPA 2A5JA 2XTZA 4DSOA 1ZM2A 1QUFA 1W4CA 5FL7D 1FZQA 4DCNA 2ECKA 3ICQB 2FN4A 2YZ2A 3AGQA 2GA8A 4FIDA 2V3CC 2IK8A 1Z22A 1I2MA 1FTSA 4Z54A 2ODEA 1AS0A 1KI3A 1P9RA 1G64A 3FMIA 1OGJA 2WAXA 3LQQA 1U90A 3OEED 4LUCA 3SYKA 1OH7A 1ZINA 2G83A 2JLZA 1IY1A 4Q4HA 1UM8A 5JS8A 4DSUA 3SYLA 3I3SR 3KDSE 4LPKA 3A1UA 5FUXA 2N46A 1L8QA 1E69A 3GJ7A 3EA5A 2BJWA 3GCGA 4DDUA 1NF3A 2BCJQ 1AA9A 4TSFA 3G0HA 4NYIR 2ZJ2A 4I99A 3ZVMA 4Q4LA 3A1SA 3TLXA 4TLBA 4TMWA 5DNYB 1RYHA 4CGZA 2ZRFA 5EE9A 4Q4JA 4NTZA 3AF0A 1G4AE 1U2RA 3A4MA 1OFTA 3TW8B 3UWOA 3VKGA 3C7KA 2H16A 1KMHA 4Q1CA 2ZRHA 4PC3A 1NI3A 1M8PA 2W83A 4R2HA 2JLWA 1SHKA 3OIYA 4MGYR 1B0UA 2G0TA 2FDCA 4CT5A 1F2UA 1HQCA 1DADA 1K8AD 5KNCA 1E2NA 5HZKA 1Q21A 3CRVA 1TX4B 2BCGY 3QXSA 1P72A 2PLRA 1E2PA 2GXUA 3PCRB 1BH2A 4I81A 3UPUA 1Q1ZA 1KMQA 2NO6A 2AN9A 3IGFA 3L0OA 4RD4A 1YR8A 5KUTA 2ZYTX 2IYWA 3CCVB 3GLFA 2RB4A 2OCAA 1LF5A 2YOFA 1VQLB 1ZVQA 1CR2A 3KUCA 4D82A 1R4AA 4QGHA 5TMPA 2ZRNA 2ZU6A 5EE0A 3CCRB 1GM5A 3T15A 3CRW1 4DB4A 1N5IA 1QVRA 1U0JA 1T0HB 4FMDB 2ZE8A 2GCPA 4WOPA 2YVUA 2BBWA 2OBNA 4P6VF 2XB2A 4LJ8A 2O0HA 4JSTA 5KSYA 1YZQA 2Q0HA 5A0FA 1RC8A 2ZRIA 3CF0A 2D2EA 4LYAA 3LFUA 3GJ4A 3HU1A 1EP3B 2QT1A 1O87A 3SHFA 3UKDA 2JATA 2ZYWX 3SJCA 2O8FA 4XSHA 2WMOB 1T6NA 3CMAB 2OFXA 1B23P 3JQQA 2ZUCA 4JT4A 5B64A 1JB9A 1NN1A 1V43A 2KBFA 1KSHA 1RE0A 2NTYC 2QEQA 3EIEA 4V0OA 2WKRA 2TMKA 2ZXUA 4QHYA 4JLNA 3U6KA 1VMAA 3HDTA 1QG2A 2WSSD 2VHCA 2BGJA 3VX4A 3ZVNA 1MV5A 2GJ9A 1E2LA 1F20A 1WCV1 3RABA 2C9CA 1RKBA 5KPJA 3ASZA 1S0UA 1ONBA 1KSJA 2CRVA 1VCNA 4G5SA 5D3QA 4QFMA 1FUUA 4URUR 1E0KA 2C2HA 2R6GA 1A4RA 2Q3MA 1GDDA 3IHWA 4MA4A 5H70A 3KQUA 4R2IA 1BO6A 3AVYA 3A36A 4HB4A 4YMUA 4PPFA 4XH9B 4OI4A 1L4UA 3FFAA 3EIQA 1E79D 1TADA 5EP1A 2ZRJA 1OIVA 2GTPA 3R7WA 1W35A 2VF7A 3UG6A 1TLLA 3EA0A 3SHWA 2WIAA 1OFUX 2GCNA 4JVNA 4L16A 4O25A 4IXNA 1FX0B 3IIKA 5CYOA 1RFLA 1E3MA 4H1VA 3H0KA 2C96A 4W5WA 4DCUA 1ZP6A 3MLEA 1E9DA 4KFUA 2O8CB 2JIZA 4LBWA 5EE3A 1XTQA 2EFHB 4ACBA 3WXMA 4C0HA 4DLXA 3AGPA 4PO9A 2PZGA 3K9HA 4OQXA 1NJGA 4NYJQ 3T1QA 3OFND 2SHKA 2QRZA 3A37A 1NP6A 1XJCA 3IQXA 3TW4A 4AI6A 3NBFA 3B6EA 1Z0DA 3WBJA 2GJAA 3DHWC 4Q00A 3X1DA 1X8LA 1A82A 2ORWA 1LB1B 4HLQB 4NCKA 4BECA 2UVQA 1YIJB 3QFCA 4YAOA 2CHVA 1CR1A 4AKIA 4BFSA 3OE7D 1MOZA 2ATVA 3DO6A 3QKRB 3B82A 1YHNA 2WWYA 1TEXA 1BYUA 4JT2A 2BDTA 3U7GA 5FI1B 2QE7A 5TARA 2IYQA 1CJMA 3RWMB 1WXQA 1G5TA 1N6PA 1E9BA 2A9KA 2XNDA 4DCVA 2JJ2A 1MABA 5G41A 2ZJ5A 4BFTA 5L3VA 4LC0A 4V0NA 4ZGQB 4TT3A 4Z8YA 3Q5EA 2B21A 5FFMA 2IXGA 1YVDA 3LVQE 4EPXA 1KD1D 1M34E 4HUTA 2G0NA 4ZO4A 1IY2A 1FQKA 1MR3F 3MRSA 4G5QA 4RZUA 1C1YA 2JGNA 5KDLA 4C3ZA 5EXXA 2DFTA 2ZI3A 4HAUA 2HYIC 3NBZC 1XU4A 5CB8A 2BMDA 4FMBB 5FBRB 3U4QB 2O8BB 2QZ4A 3K0CA 4WIAA 1QVFB 4KVAA 2RCNA 4ZDIA 2QMHA 3IO5A 3U2QA 1OKKA 1CS4C 4EAQA 2J0SA 4KSCA 2A2ZA 2GBLA 2HMAA 4Q9HA 3R8FA 1YZTA 4HE6A 3CCLB 3OZVA 2BEKA 1W34A 3H86A 1CBUA 1PLLA 3CIOA 2ORVA 3O8DA 4BLQA 4OK5A 4DJTA 2WMNB 4ZCIA 1PLJA 1AKYA 1G5RA 2FU5C 5CDFA 2FG5A 1O3YA 1IN7A 2OCBA 4IDOA 3CPHA 1MKYA 1J8YF 4JVSB 3MHPA 5GJBA 4AK9A 3G71B 4A2WA 1ZC3A 4KBGA 4V0LA 1KDPA 2JIZD 1TUEA 4Q47A 1NLZA 1ZCBA 3QKSB 2EW1A 2P6UA 3EWSA 4HB0A 4Q02A 4BLSA 5F9FA 3RNLA 3W2IA 2ZAOA 2B7CA 3S1AA 1P62B 4QM6A 4M53A 1GRQA 4JBWA 4P31A 1S8FA 2GK7A 4TYYA 1YQTA 4LI0A 1JQJC 1LF0A 4DCTA 4KFTA 3J81k 4AY2A 5DN6A 4XVUA 1NN5A 3ADDA 4C2UA 4Q1BA 4XIGS 4V0KA 4OQNA 4MYUA 3AUYA 2PBRA 1XD8A 4OBEA 5J4VA 5JRJA 1EG7A 4PAQA 2VP9A 4M1KA 4O0MA 2QE7D 3W2HA 1SVIA 2KWIA 1W48A 3GLIB 4MUBA 3ADCA 2B8WA 2FZ4A 4XWAA 1N3BA 1YZUA 4YDSA 1KTVA 1NRJB 3CNOA 2IYXA 3LD9A 1G1MA 3UMFA 1XEWY 1CNFA 3UMSA 1CP2A 5BYJA 3QVUA 4E22A 3W90A 2FNAA 2PX0A 1FDRA 4BQSA 3P27A 4IOKA 3DMDA 2OAQ1 4HLUA 1KJWA 1CF4A 5FOVA 1UBEA 1YJ5A 2XAUA 1Z6XA 3IPYA 4I1UA 4LK2A 3FMFA 4HI0E 1W0JA 3B9PA 2O0KA 2OBMA 3RS3A 1NLYA 2X2EA 4K46A 1N0WA 2OTLB 4QNRA 1OKKD 3QE0A 1TUIA 1MH1A 4PHFA 1RRGA 2RGAA 1NSFA 3SE0A 3BERA 1VKJA 3CR7A 3ZD7A 1ZMXA 3VHXA 4CRWB 1DDIA 1SXJE 1SVWA 2HXYA 5GJWC 2DY1A 2LKCA 4YMVA 2GXQA 2AK3A 1JJ2B 1GKIA 3CCUB 2JJ1D 2WIBA 4TLDA 5HTKA 1SVMA 2QPAA 2E1RA 3SBDA 1VECA 5UKDA 2ODNA 3GFPA 4DSTA 4HUQA 2NPFA 5HCIA 1MO4A 3EPJA 3MWJA 4OHZA 1CIPA 3AH8A 3VU9B 2QRNA 2YNMA 3WHLA 4QRHA 3SR0A 4EPWA 1ANKA 3GD7A 4I1OA 4ZPXA 1AJEA 1EWRA 4B32A 1BMFA 1IN8A 1EWYA 5HCNA 2GPJA 4Q7MB 3W6NA 1J9ZA 4GZLA 2WJIA 1JR3A 4KSBA 4BPRA 1FTNA 4OL0A 5JJKA 3WP1B 2F1JA 2VSXA 1QGYA 3TSWA 1G8FA 2QUZA 2JLQA 3UANA 3MWLA 4D4KA 1E9SA 4QM7A 3W3ZB 5BXQC 1US8A 4D0LB 2X3UA 1IXSB 1JECA 2CCKA 4JJZA 4B2PA 1Y63A 3PEVA 5L3RA 4D4LA 4TMVA 4MDFA 2D4HA 3B9QA 1Z29A 1U0HC 2FE4A 4PSVA 5CM8B 2BV3A 2ZRBA 1U8ZA 1ZNWA 1TPZA 3SJBA 4NU0A 5L3SA 3B1WA 1UEIA 1VQ8B 3TNFA 3SQXA 2ZQ5A 3LXRA 2BPOA 4M1SA 4ESVA 5KYKA 2XJ9A 1JEDA 4RKFA 1KI6B 5EP4A 3B78A 4A8JC 2J7KA 4NCIA 3QJYA 1W0JD 3EG5A 4NMMA 5DLQC 2I1VB 2YC4C 3L0PA 3K09A 3VR4A 4R98A 1WQ1R 2OO7A 2XTMA 3RWOA 4FD2A 4LOAA 1VIAA 2WJVA 3NXSA 3HR7A 5BW8A 5SZIA 1G3UA 3I73A 4HDQB 2BJVA 1XMVA 2ZRLA 3TR0A 3ZVLA 1KI7A 4KYUA 5JFGA 3N2EA 3KQNA 4Q03A 3SC3A 3CC2B 3WY9A 4QL3A 4EDHA 4FMCB 2I4IA 4OKSA 4QGFA 2RH5A 4Z1MA 5AUNB 2V6IA 1X8KA 4LBVA
chains in the Genus database with same CATH superfamily
1FNMA 1KK1A 1SIOA 2ORIA 3A1TA 3CKKA 5A9RA 3N05A 3U4HA 1W9XA 4MK4A 2YC2C 1E1MA 3HG7A 1F8GA 3P9SA 4WGFA 4UBMA 1LBIA 5H1YA 4CEHB 1O77A 2XYPA 4NYIQ 4Z4EA 2IS4A 3NTLA 3RRYA 4DSZA 2IX3A 4OK6A 4BGIA 1HLGA 1NAIA 1GARA 2WJWA 4C0BA 4CFZA 1Y1RA 2GF0A 4ZIRB 3CLUD 5KHOC 4ZV4A 3IKMB 3FB1A 3VDNB 4EDFA 1D2HA 3HXLA 1CZRA 2JCYA 4XKJA 1CJUC 5D3MA 3VNQA 4WFIA 2QYTA 3R7LA 1VGQA 2FH5B 4JBNA 4MAFA 3N2GA 4YC7A 4RUKA 4D9NA 2MU1A 4IGEA 4A8JB 3A25A 1U1EA 5G3YA 5BQ5A 3KHKA 1VDMA 1E3IA 2YHSA 3A7DA 3AOGA 3F5QA 3FMGA 1HC7A 1SKUA 2QL6A 3KRTA 3NTRA 1UJBA 1O94D 1TCUA 1MAHA 3P32A 1K7FB 4ZJZA 5JY1A 3KQQA 5BN5A 1ZGHA 4OQFA 4NHEA 1YRBA 3THSA 4K86A 1QK3A 3PDWA 3STWA 1QE5A 4IILA 5JXGA 3QM1A 1ODFA 1EFAA 4K2HA 3WHPA 6NULA 4JV5B 1DBIA 4ZCMA 3IUSA 1K8ZB 2C31A 3VOBA 2VJBA 4ARBA 1GR1A 4RLFA 2XB9A 2Q1XA 5BNFA 1VG0B 1Z4MA 3FF4A 4FFVA 1QH8A 4GHWA 5JUWA 4G41A 2OC9A 4OU4A 1UOEA 3ZWBA 4B80A 2WYRA 1JLMA 4R6WA 1I7LA 4URFA 4MKFA 3RAPR 5LYYA 2O1WA 3F3YA 2ZVPX 3MF4A 2ZJ6A 4LE0A 5E9QA 1XA4A 2XYRA 1BEEA 2RBEA 3SVZA 3HNRA 3QVWA 3MINA 1F06A 2P4HX 2ZROA 1B3BA 1F8FA 2VHQA 3N74A 4RC9A 3SS7X 5CB6A 5JPCA 3ZJTA 3BD8A 3ZBPA 4EJSC 2GI4A 3GCXA 3CC4B 4KC0A 3SP1A 3PUYA 4K9SA 5FWXB 1AGXA 4LKOA 1PV4A 4EATA 1T8RA 3EMVA 1XB2A 3A4LA 5E7IA 4GMHA 4Q4AB 1PQUA 4QSHA 3X1KA 4IIFA 5TY0A 2IU3A 2ERYA 2IYSA 2Z5LA 3BWDD 2PKYX 3G82C 2P40A 2JFUA 2NAPA 3WQZA 3BAZA 3AHDA 3CJQA 4RDIA 2EAUA 3GVLA 3O2QB 2ZCUA 3QFRA 2QQ5A 4ND1A 3C6ZA 3CCSB 1NW6A 3CZMA 1XXHE 4Y3UA 3QV1A 3P2OA 1RC1A 1LRKA 2XHEA 3SZLA 3WP0A 2R2AA 2H29A 3K94A 4P4UA 2XKAA 2J9FB 5LXTA 1DG3A 5CK4A 3W5JA 3HACA 4ZYYA 2FLKA 5DM2A 2PH3A 4LBZA 1AQLA 2B1QA 3BRSA 2J3KA 3N0WA 4MRPA 4QYIB 3K0BA 4K9PA 1O9HA 4YASA 1MJGM 2VDNB 5KJFA 3NR2A 1K7YA 4GT1A 1RLOA 1MO5A 2I6XA 4JA0A 5BSMA 3IUNA 1XDWA 5DNDA 3H1EA 1INLA 3TQHA 2ZBVA 1JVSA 2QDXA 1PJAA 1ZGGA 4ENQA 2DH5A 1WKCA 4ER3A 4PSUA 5CA0A 3RS0A 4KO2S 1MCZA 2PS9A 2IEZA 2Q4EA 1GZUA 1L1QA 2GWRA 1DOAA 2QRHA 3MN1A 4IW3B 3W6OA 1DJQA 1EDEA 1C1DB 1PEDA 1WMBA 4Y6GB 5C37A 1RPTA 5ICCA 4M8NE 1XFDA 2Q99A 1CNEA 3VO1A 1PEKE 5GZ6A 1MX5A 2H57A 2GN1A 2VHXA 4ZV7A 4CW7A 1NRKA 4UULA 2ZSJA 4P0QB 4M0EA 5JMOA 4MWBA 1W4LA 3KTAB 1T26A 2N0SA 3CVOA 1QE3A 4HRYA 4R1SA 4NDZA 3FLBA 2Z2ZA 3QXJA 1P3JA 1SGWA 2JAWA 1DC3A 5FNZA 2EHDA 3LWDA 5KHAA 2FZVA 4CG0A 3I0ZA 1XBTA 4EHBA 3R3JA 4A27A 4AAYA 3X1MA 5BQOA 3AVWA 4GBJA 4PPYA 3R4VA 3PQ3A 4MVJP 2APJA 2P9YA 2V7PA 3THRA 1WP9A 1IU9A 3DW1X 1S2IA 5EIXA 3ONFA 2BHRA 1KS9A 1HVXA 1T8TA 1XF1A 2EATA 4U39A 4C22A 1G7SA 2GXSA 4XCQA 1Y5NA 2FZEA 1O95C 4U2GA 3M83A 3SNKA 1I3NA 5K0JA 1U5BB 3W2GA 3B85A 1L3CA 5FIUA 3EDCA 4H7IA 1RI5A 1U0OC 3A11A 4MR9B 4O4IF 1Y4SA 3QU7A 3CTMA 3I0NA 1UP7A 1CUHA 4PGOA 1EKXA 4EKNB 3DBLB 2FG7C 3SR4A 3NBUA 2QMUA 2R00A 4X93A 4D9IA 3DOFA 3D0KA 4OIFA 5EMLA 1LBEA 4YB8A 3UJDA 3GEEA 3TEMA 4ZKEA 1C8LA 1ZD5A 2FFJA 4UHHA 1G41A 1HO3A 1EH5A 4JROA 2VWHA 4YHBA 4ZMRA 3ZK9A 5E2BA 4CEJB 2VFAA 1NNLA 5JMTA 1LPOA 1OVGA 3E9QA 1V1RA 3TAUA 2QTGA 2ZANA 4J9UE 2W00A 5BQXA 3WQSB 2YRFA 4D56A 2Q9AA 1GL9B 3VOTA 3JSAA 1RJGA 2I34A 3OKFA 4I1SA 1P4GA 3CPJB 3SZOA 3CNQS 2E48A 1XALA 5DX8A 5IC4A 3GZ4A 3B52X 3EDMA 1PX2A 1PQ4A 4WXPA 4MVJG 4L74A 1XQ9A 3ZW9A 1PTJC 4Q3LA 2Z3VA 2F1HA 3W5IA 2AEJA 1MRNA 3A3NA 1GLVA 1ZJWA 1GEGA 3OICA 3U4DA 3QBEA 3PYXA 4WESB 2PV7A 2PA0A 4BEVA 5AOVA 2EG5A 4UASA 3WIDA 2HSWA 4CUKA 4Z4WA 3BN3A 2VDLB 1OROA 3GFTA 1RAHA 3I42A 4N49A 2J33A 4NYMQ 3RV4A 5EZSA 1DX9A 1OWMA 1YCFA 3ETLA 3FNQA 3D8RA 1XP5A 2QN2A 5BV1A 2XDQB 3DXXA 3OX3A 3JQ9A 1I18A 3IFSA 4MRRA 2P4UA 3KXPA 3L4JA 2BFPA 2R8RA 3KJQA 4WN9B 5JQGA 1OW3B 2J3MA 1Y3DE 2XUAA 3IBFA 5K6TA 2O50A 2R48A 5K0LA 3KYBA 3N58A 1PJ4A 1IHPA 3O8OB 2PLNA 2PRIA 1T6YA 2PMEA 1ZJ6A 2AMLA 1YUNA 3G2IA 3DA8A 4BZWA 4BBPA 2WSIA 3MJEA 1M0TA 1I3LA 2QMQA 4LJAA 5EP2A 5F12A 3K30A 4UNNA 4BKPA 1T4CB 1SRQA 2VR1A 1XZHA 4H77A 3H9CA 5BOSA 1EWQA 1JSXA 4S2EA 1KY2A 2XQKA 1A9YA 3ZW8A 3D9QX 1TF2A 1WW8A 3GU3A 4C3VA 4IKOA 1QBKC 2QJWA 3GW8A 4QFCA 1Q0SA 4D9KA 1RQNA 4GE0A 4L50A 4IGKA 1B16A 1UBKS 1IYZA 1FRNA 1QQ6A 2QTHA 4QOIA 5EKXA 3RUAA 1GCUA 3SF0A 1JDVA 1L5SA 1T8PA 1OLOA 4Y9RA 2Z3WA 3AQIA 1SU4A 1V4VA 1Z15A 4HTFB 3T5DA 1F0NA 2RHHA 1R3DA 4IXTA 3T4UA 3TUIC 3VX3A 3FPCA 3TB4A 4JI4B 2FUCA 3I9NA 4NMHA 1SUEA 5DOVA 2BW0A 2XMPA 1N0VC 4GQIA 3CM0A 4CTKA 2C61A 2XCSB 1BDIA 2M1ZA 2OFOA 1IHOA 2I1QA 5ITVA 3VDQA 3GFOA 5CK5A 5LNK1 5KKCA 4DS3A 2AFHE 1UC4B 3Q8MA 3OJFA 1X42A 1Y3IA 2GN6A 2YMLA 3HO8A 4FC7A 3S1LA 4AJLA 3DCYA 5AVSA 3G8AA 5K09A 2O05A 3D3QA 1OYYA 5DI9A 3AWIA 3OIVA 1OIWA 2OCGA 2HLHA 1R6DA 3CX7A 3KKEA 2H18A 2CC2A 4IIHA 3RG2A 5CCBA 2HRRA 3GO4A 1U81A 4N5HX 4B9EA 4RL4A 3RKSA 5K6RA 2PT6A 3OKXA 3LVRE 1CZOA 3BC9A 1IQRA 2PMFA 3GGJA 2WUEA 3R3WA 4L6IA 3T06B 4JBHA 3KZOA 1ZRNA 2OILA 3AVVA 2CLHB 4KTVE 4DSAA 4PZDA 1NUUA 2R1TA 5G1NA 4K1LA 1ZMRA 5U4QA 3EQ9A 4RZXA 1M1YE 3ISTA 4OATA 3H5WA 1KA9H 5KEIA 4OHYA 1ID8A 2XUJA 4IWNA 2CEKA 1E2DA 4RX1A 4DIDA 2W4IA 5DLPA 1NW4A 1O4VA 3MD9A 3O8RA 3RV3A 2CBGA 3QPBA 4YRLA 2H1HA 3WGGA 1W47A 3D8SA 3HRKA 1JQEA 1AURA 4YRDA 2MINA 2ONJA 4CDRA 2YJ3A 3IULA 2MMCA 1AN0A 2BDEA 5K01A 3MQFA 2MTBA 4GMGA 2WTEA 3FRJA 3JWPA 1MG0A 4M0UA 4MVJA 4L2IA 2RHBA 2ACWA 3UXHA 2Q6OA 3UWSA 4EFNA 2XOKA 4PQYA 1Z56C 3CYFA 3QOWA 1X3LA 2RJNA 4ERNA 2QD4A 1ADJA 3DS8A 5COAA 2IE8A 3Q38A 4M1OA 1M1ZA 2V1UA 3DVLA 1A7JA 4QU8A 1TLFA 2YWGA 1XQ6A 2GLTA 4Z4TA 1JUDA 1M8KA 2H85A 3DTVA 4LMRA 3SZGA 5EGSA 4IUDS 4IHAA 2ATEA 1TZCA 3ORSA 1DEKA 1XEAA 4AJNA 1EK5A 1UD5A 2I55A 1Q7CA 2Z5GA 3H6GA 4JL6A 2GD2A 3KYDA 4CMHA 2YMMA 3SXJA 5CFNA 2IEDA 3SSAA 2O4UX 1KQSB 1KEVA 5CXXA 3O47A 3PL1A 1EUQA 4LF4B 1YBAA 2ZJZA 2W48A 4PX2A 3S99A 5JC1A 4IS2A 4U2FA 1MAWA 2OBYA 1ZVVA 1QO9A 1JA0A 3FVTA 3PV0A 4KUGA 5FO1A 1NMXA 1GGJA 1NJFA 4QOSA 2DGDA 3ANTA 1D9ZA 1RI1A 3I9KA 3QVJA 4Q7EA 4D42A 5CH5A 2CJWB 3NORA 1DDGA 2ZSEA 2IODA 3LAWA 3Q3JB 4NFHA 5K8LA 4NPHA 2FW0A 4BV9A 4IXDA 4KQGA 1RPNA 1V95A 3COSA 1AQUA 1Z18A 3LTEA 2R5FA 3M3PA 1BU8A 4URVR 4RIEA 1PU2A 2JCBA 3F6EX 4PLPA 5KHLB 3KQHA 3PKJA 3UFXA 2ZUFA 4HLDA 2FWAA 3FUVA 1AU9A 3QELB 4DQXA 4TROA 4MKIA 5IT4A 5BSRA 1Z7GA 4HZIA 4BGEA 2VJJA 2WU0A 2PFGA 5IJ0A 4ARUA 4EHKA 2HGZA 4UNRA 4UTRA 1QIIA 3CA8A 4A8PA 1MRSA 721PA 2X9NA 1ZQ9A 1YOBA 1SVSA 5EXTA 1NPDA 4JS0A 1EQUA 6AT1A 3U9SA 2ANCA 3VNAA 5KYTA 1FFXA 1GL3A 5CUQA 1YC5A 2Z2XA 3WB0A 1JAZA 5C7IO 3IB6A 3CUVA 3ORHA 6REQB 3AJ8A 4GU5A 4U7JA 5FF9A 1RIIA 4US1R 4DJ5X 5JW6A 1GFIA 2HHHB 4RJ2A 3AR9A 4YQZA 3TLEA 3U7EB 3V3TA 1E7YA 1EX6A 4UMVA 4RETA 4FBLA 3D54D 1KXJA 1NP7A 3EF1A 3GZNB 1XZPA 4BNMA 1JDBB 2EFGA 1A9TA 3E23A 4MRVA 1V2HE 5KVSA 3SQWA 3EGEA 3H2KA 2XOKD 2W2QA 1QLHA 1T3GA 1UT5A 3F67A 5EP3A 1PZNA 2IOHA 1KIAA 4DA7A 5CA1B 1PBTA 4X00A 4X8LA 1H2FA 3DTVD 5ARDA 1EGAA 4ZVLA 1IM2A 4JY7A 4P4NA 2YV3A 2BM1A 4N0QA 5FPPA 3V1NA 3NHRA 1FSGA 1IPHA 1MF7A 2XDYA 2IIBA 3PHLA 1RE1A 4I5EA 4KN8A 5J4HA 4ALKA 2D1QA 4IHKA 4K8OA 4K81B 4QDKA 3UPDA 1SHUX 3QWFA 4PRKA 5ALVA 2BSQA 5A62A 2Z2YA 5LMNB 3BTOA 2PX6A 2BFBB 4H7FA 4UJ5A 3B8EA 4EA6A 4E94A 3O1IC 4LHVA 3B51X 3CESA 4BOYA 1ZRSA 2EJCA 2LKDA 2ZYRA 4ZYUA 1QO0A 9ABPA 3VMMA 4Q3BA 3MXOA 4OVKA 5F78A 1BQEA 3TCXB 4IG9A 2X9GA 3B1YA 5C1OA 4OA5A 2XBLA 3JZMA 2CV0A 2O59A 1T9GR 2HWXA 1SPBS 1UANA 4UHKA 2GJSA 3DSRA 3HWX1 4TUYB 1JEQA 1KNQA 4YJ3B 1SXJC 1TCVA 5BVGB 4KZPA 1SG9A 2GN0A 1E3DA 2V96A 4C6TB 3PUIA 4JJIA 4OA8A 3WO1A 3FDFA 3HDJA 3EC7A 4AMGA 1EUDB 3GGOA 4HZUB 1Z38A 3SMQA 3FNGA 3R2JA 1RYNA 4FZ3A 4YRZA 5E4TA 3PXBA 3UOAB 1G5QA 1RMYA 4EPVA 4JGIA 3IA2A 2ONCA 4JJEA 1IRXA 2A84A 3ROFA 3OJOA 4HNGA 5FOWA 3V4OA 1KFKB 5DH9A 4MTCA 2O07A 1W8DA 4KJXA 4EI2A 1HORA 1KHTA 1AQYA 1GN8A 2QZJA 1XA0A 1GKKA 4YUYA 2QMOA 1A27A 1XZKA 4FGSA 5H8WA 3KVOA 2ONKA 2WUWE 2QORA 3AESA 4GGMX 5G3ZA 2RGNC 1A2BA 4F4HA 3NIBA 1YRAA 4LMBA 1R8SA 4KBFA 1GDHA 5HNKA 4DVGA 3IPAA 4X44A 5K3FA 1T9DA 3HJNA 3QX3A 2WTXA 3EGCA 3PHCA 1T1GA 2P5UA 1HTWA 5I4IA 2DETA 4EECA 5J43A 1H42A 1Z4JA 1ECBA 1O6CA 1P7CA 5KAMA 1RAAA 4JN6B 4DWVA 1KAMA 1B1AA 3FKSA 2BEWB 3NS7A 4KVFA 4P22A 1Z35A 2R6CA 4HLCA 4QPNA 5EHIA 2JKZA 3UB3A 2PCLA 2CXXA 4WKGA 1YL6A 3P0EA 2VBUA 2JHFA 1W4AA 3KYIB 2M5SA 3FPPA 1YR3A 3L05A 3MT9A 4EHLA 4I1VA 3BG5A 4FFWA 1H2RS 4ZQEA 3E3NA 3S28A 5JOQA 7MDHA 3AFGA 3BD6A 3RC1A 2OORA 1JLHA 4NE7A 3W8EA 3KVVA 4Z6KA 3CUKA 4OLAA 3D3JA 3NIGB 3WK8A 2DFKB 2F43B 5F5XA 1M7HA 2F90A 4UMEA 4LCEA 2M98A 1GZSA 2WV9A 1SC6A 3BAFA 3E48A 3REFA 5DYGA 4C2BA 3L8YA 4LC1A 4B82A 2XQJA 1HZEA 1J0XO 3O1HB 4P86A 3U09A 3R0ZA 3WL5A 4DRYA 1CUUA 3ZWAA 4ND8B 2H11A 3ZNNA 4EGCB 5CDFE 2KPOA 4UBJA 5KYUB 1ZRMA 1U2GC 4DWWA 1I4OA 4WFKA 4NK5A 4R0NA 3V8QA 3BILA 4IEFB 2XECA 3SHOA 5BMVB 2CCJA 4UM9B 3WIUA 2BRUA 3KL9A 4F7DA 1W49A 3JQGA 4DA4A 1W2BB 4B83A 1MFZA 1DKNA 3PICA 4GPD1 3LECA 3OQIB 5CT4A 3VU9A 5K3AA 5KOIA 3NI2A 5FRDA 1H8HA 2R7LA 3LT1A 1DAMA 3CRRA 5A0TA 1UINA 2JFNA 1S3SA 1Z06A 2J59A 3UJ7A 2HT1A 2QE6A 5IUNC 2CF5A 5F1PA 3SI7A 4FDUA 3ZS9A 3CXUA 4E1VA 5ITZA 1KEKA 4LNHA 2WWGA 4TMFA 4UBIA 3U3OA 4QHTA 4RKWA 2RE8A 3JQPA 2QLNA 3AI3A 5AHWA 4TMXA 1DQNA 4Z3OA 2WWXA 4LYHA 2REXB 4B5KA 1XMQB 2IC5A 3H11B 5LC1A 3SBEA 2GJ8A 1T5OA 4I4NA 4LV6A 3ZXUB 4YLYA 4IUCS 2EFDB 4XWKA 2GSWA 3JYQA 3Q3HA 4LA4A 4RPGA 1EXVA 2BELA 3ELUA 1Z6AA 5SYAA 3ZLJA 3HQ4O 4P38A 2QIPA 4XLAA 4CR6A 4M8SA 3TI9A 5HJ2A 3X1ZA 1ZVJA 4URXR 3LGAA 2CLIB 1NYLA 1RSZA 3UIEA 5FXMA 4EYKA 1E7SA 2WWFA 3EC2A 3L07A 2AHOA 2YHAA 5MN4A 3MIZA 1MH9A 3DQPA 1I13A 3C3DA 3WYEA 2WDPA 1PUIA 2VH2A 1J56A 4J0JA 2BH2A 1EWKA 1QU3A 3GNQA 1KI6A 3Q7EA 1XU7A 5JWOA 3VR6A 3V46A 1DZIA 1JKXA 4H6WA 4KXUA 4OGWA 2YOHA 4EL5A 1U9JA 3L8CA 1X1RA 2NACA 2P69A 4Q66C 4XTCS 3NOQA 1KAHA 3L7MA 1WV0A 4WACA 2QN8A 4FFBA 4YJKA 5KMGA 4X71A 3BXXA 2V5AA 1QG0A 1O9BA 2OHVA 3IVAA 2JK1A 4BMVA 4MUXA 3ZV3A 1HKUA 1RJFA 5EWLA 5JISA 2P11A 1LNSA 8MHTA 3D5TA 4DUGA 2ZUEA 2C83A 4JB3A 3TIIA 4UEKA 1QIFA 5IJAA 4R8KA 4BFXA 4MVJH 4EB6A 2GPYA 2QPLA 2G70A 2VTEA 4V0MA 4D0GA 1ZIXA 3SIXA 1DJNA 3T5GA 4QUGA 3ZKWB 1IWPB 4MW9A 1WZIA 1WBBA 4RJTA 2O1EA 1FVXA 4ZO9A 4ZOCA 4G8JA 4R5HA 4QFBA 1CT9A 3SIPA 3SX2A 2H8KA 3RU3A 5HKLA 4PSCA 1DUIA 1TAHA 2X2OA 3GL9A 3L4BA 4I5GA 4N0PA 4S1VA 1W2WB 4UARA 2I6QA 1L7AA 4KO4S 3UUGA 5AW2A 3AF4A 3ZQ6A 4B3RB 2YINC 4YRRA 4JI7B 4YYZA 4W5JA 4FD3A 2G72A 4Z49A 5IYWA 2VDQB 1J2RA 1J0CA 1ONOA 1V1JA 2FW7A 2OOKA 3PR1A 2E87A 2O3UA 1MPXA 4R1LA 8LDHA 4ZCPA 2DPXA 2YNMD 3L0SA 4DBVO 3LY7A 2P3QA 1S2OA 1GSOA 3W6ZA 3DD5A 4ITUA 1JJIA 2ZT8A 1FFHA 2YY7A 1X14A 4MA0A 5DTQA 1TM5E 3VDRA 1SUCA 1OXUA 1VL8A 4PNEA 4M1QA 4OG2A 5CXUA 3LCJA 1RTKA 3DL0A 3SSOA 3ANXA 3NPMA 1JR3D 1PG0A 3BMNA 5T8KC 1Z6GA 5FYQA 4UQOA 3V1UA 2X6WA 4CJXA 1KAOA 1HDIA 1ZH8A 3BL6A 3IBGA 3PXXA 1BEZA 3T7CA 1O8BA 3FFXA 1F8YA 4ZEXA 4YX9A 1KC3A 1Z5PA 2H4YA 3G79A 4NC9A 2NNWB 5DB4A 2P4SA 3ZU3A 3AB3A 4BKMA 1F2TA 1WPRA 5IAJA 4EHJA 1H3FA 4JL8A 1N7JA 2IXFA 2X6XA 1CFJA 1TDJA 4MUHA 4RANA 4AQDA 4O2AB 4EW2A 5LJLA 1WB9A 2V6BA 4AN0A 4HVLA 2LNDA 3AY0A 3QYPA 2W8BA 2ZIXA 2N3ZA 3E35A 4ZC1A 3SIWA 5DLDA 2O6LA 4BJHB 2PJUA 5ESWA 3VR6D 1NMYA 4OP1A 4D02A 3BBLA 5HGJA 1IJFA 1I5OA 3O92A 3QGMA 3SC4A 5DYNA 5IABA 3HMKA 4DR4B 3QF4A 3UAZA 3QBDA 3DMYA 1Q95A 3L7LA 3E1KA 5ECDA 3VDMA 4BBJA 4RPCA 3F5FA 1BKYA 1CG6A 3H84A 2XCRB 1WMSA 3K72B 3U4MA 3Q7PA 3A1VA 4MUMA 2FXIA 4CMJA 2N42A 1CR4A 1HRKA 3BL5A 4DUGD 1ZH0A 1E0AA 1TM2A 1F6DA 4FFPA 4XX0B 3CKLA 1TCBA 3T5AA 1SXQA 2WR8A 5H7XA 2BGWA 4X84A 3U5TA 2NVOA 1QH1B 1T36B 3EZ9A 3AM1A 1N6RA 1VA4A 2QRUA 4J4TA 2EYQA 4NOKA 4J7UA 5AQEA 1NBWB 3OF2A 2WQZA 1ESZA 5F35A 1IBKB 1ZIOA 2B5WA 4HFJA 3ZU5A 1GXSA 4YFYA 2O2EA 3A6FA 5KTRA 1PKXA 2X8BA 4CFYA 1HT1E 2BM8A 1EX7A 2J09A 3TRFA 4F7WA 5HSGA 1ECJA 3VNRA 2ZYDA 1YR7A 3ZGOA 4PQGA 1KOJA 1OV4A 1S9HA 2QVZX 3VXKA 2D7DA 4RMHA 3S3TA 4FYJA 1E43A 1TL7C 2BEVA 2H1IA 2RK3A 2XWQA 3KHSA 3WNBA 4CTNA 3RS2A 3KOXA 2AEEA 3ST7A 3HMQA 4TKLA 4HNUA 4XOTA 1NGSA 2VPYA 4WCDA 4IDDA 1MB9A 2JLAA 3KT3A 1Q0HA 4Q16A 2PX2A 3JVDA 1M1KD 1B15A 5T7BA 1EUCA 1PV2A 1GU7A 2V7VA 5IBQA 2AB0A 4P4TA 4PYIA 4BO7A 3AF5A 4KYVA 4BE4A 4DE5A 5JCZA 4Z53A 3GJ6A 1FFYA 3HCFA 3VMFA 1QMGA 2A9JA 4ID3A 1E1RA 3LT5A 2QG4A 5DU2A 3IYLW 4PSKA 4AJKA 5DMHA 4FN5A 3N0VA 3ZY3A 1ZGAA 3VYRB 4CMGA 3PGJA 2ZITA 4E4TA 1U7DA 3GA0A 1VHTA 5ALTA 2A7QA 4QQKA 4C7OB 4QECA 4M1YA 5LPNA 2YWEA 2VPQA 2W2KB 1HMPA 3FCOA 5I4CA 2VSFA 3HCCA 2VZEA 4JBLA 2OBFA 4ETWA 1A0OA 2WJJA 4XUDA 2F3SA 1Y3FE 2J31A 3GROA 4Z4ZA 3PNOA 3MFYA 3PE4A 4E5VA 2PWBA 2QRVA 3GVHA 5FQOA 3SE7A 3IE1A 4KITB 3U1TA 1KC1A 1F2VA 1ZMBA 1QIKA 3U17A 4LZLA 4LI3X 3FY4A 3THWA 2GM9A 2HLDA 2VPWA 3I01M 3W6UA 3FSJX 1K6XA 2Q3HA 3IELA 2YVLA 3ZWVA 1N7IA 4I4LA 1NBMA 1E1CB 2V0NA 4L8GA 2V0CA 3OZ7A 1M2NA 4PAAA 3LBIA 4LRWA 2A0KA 3NT5A 2X85A 3VFDA 3BB4A 4UW9A 4AZSA 1UEJA 2E82A 2JEYA 2GJKA 3B5EA 2AYYA 4FEYA 3GT7A 1GU1A 2IYVA 4XVRA 1XA3A 2C4VA 2V9PA 4XWTA 8ATCA 5E7MA 3E9CA 2WBLC 2HF9A 2A5YB 2C82A 2W2TA 3TTXA 1QHFA 5T3YA 4P0PB 2P9JA 3JZIA 4AX8A 1GKYA 3QYAA 3QSYA 1D6MA 2DZDA 3VJKA 2I7DA 3FX2A 1GRRA 4K3UA 4M8LA 1NQVA 4W5RA 2PY6A 2DMRA 1LFDB 2GFQA 4ZEVA 3QUCA 3TAXA 4EPRA 1E9CA 3N9IA 3NHLA 5A4DA 3CP8A 3DUWA 3IPCA 4PSAA 1CKEA 4XZ3A 4WZEA 3NEPX 4BQNA 4HNRA 3CLRD 4NQRA 1S1MA 2PNFA 2XHZA 4R8LA 4MUGA 3K05A 1UMKA 1IHMA 4WQMA 4IX1A 1ZNXA 2KLBA 1O6FA 3LDAA 3H8SA 1IZ7A 4TKUB 3TS1A 1FBTA 2C4KA 1G7CA 3O2JA 5JBQA 1GQ2A 3GRVA 3NAGA 4TWJA 1ZS9A 4GLOA 4RIFA 1YDGA 4L8YA 1Q3HA 1U65A 4C4YA 2BGTA 2DECA 4AROA 3PENA 3TIGA 1RLUA 1O95A 1IEWA 2V4DA 2JJQA 4K9KA 1J8MF 2F9LA 2RGEA 2HMUA 2O8EA 1SK8A 3QWHA 4IV8A 4YP1A 4QUIA 2J4CA 5K6AC 5KTYA 1VIYA 3ND8A 3SPXA 2CD7A 3B20A 3AHIA 4NENB 1WABA 1Y34E 3D7RA 4PAMA 4RHEA 4EGAA 2CXTA 3GQBB 5EHGA 3NHBA 1RWKA 3GD5A 3H5LA 1ZZGA 1HG0A 1SBIA 1U7XA 2NTNA 3JATB 1HLDA 1SBHA 4GW3A 4IIXA 3Q6RA 3KKPA 3BGOS 3K6SB 2H1RA 1NONA 3JYOA 1WB5A 4D4IA 3ULKA 2WZNA 2ORED 1I14A 4DPKA 2WG0A 1YZLA 2DBYA 2HLDD 5LIPA 3PC3A 3MT8A 4M21A 3WLKX 2J32A 1KMMA 1GPWB 4WAUA 2F8MA 2E3JA 4BFCA 1RADA 1VBKA 5B58C 4MGKR 3RYCA 2NU9B 4YRCA 4UEQA 4RULA 2Q6TA 4MVJI 5LP6C 1EM8B 3UG7A 1F0PA 3AU8A 5J58A 5F7ZA 2VT6A 4EPTA 2ZI4A 3FIJA 1QFYA 1Q1EA 3U1VA 3KPVA 2OYCA 5IJXA 3BNWA 4GL2A 3MFQA 4MPJA 4MYHA 5DSTA 1WIWA 4BLUA 2SKDA 2WM2A 3F8WA 4URWR 1CJTC 3U3MA 1Y6GA 2RG7A 4MYDA 4HNTA 4ENSA 4EJ6A 2DYKA 2R11A 2X5KO 2ZE5A 3QJ5A 3WGMA 2FSSA 3IQDB 5BMVF 2XI4A 4I50A 5JZ9A 2X14A 1YKFA 3BOSA 2WF9A 2K2QB 2XB6A 2A3RA 3RTGA 3FB4A 3PHBE 4ZAVA 5A9SA 1JXOA 5CURA 3UMMA 2R84A 3P94A 1UWLA 2OV4A 1GR0A 3K8OE 4M7PA 1Q0LA 1AS2A 2QV0A 4H31A 3LOUA 4XSVA 5ILQA 3RYTC 2NXJA 4KGVA 3VR6H 2R6HA 4ZI7A 5A1TA 3AFNA 1XDBA 2ZUBA 2Z43A 2DR2A 3CZQA 4FXPA 3CKYA 1S2DA 2Z4SA 3N8KA 4PV7A 2Y9PB 2IA5A 3CZRA 4O2BB 4HGNA 5EMMA 1NXTA 2VUIB 2P5TB 4I66A 1T0IA 2Q21A 4QPJC 4RKEA 2OGWA 2AI3A 1G6HA 2GUWA 3W0LB 3GIRA 3OCZA 1NB0A 1P2FA 3LX6A 4EUFA 4TSKA 3ABZA 2ADFA 1KSGA 1UBGA 2COUA 4YTEA 2WYIA 4XB2A 1YFZA 3LP5A 1YDMA 3VKUA 1XWIA 4TMYA 1R4NA 2YZNA 3EVFA 3DF7A 4PZCA 2QNRA 2B36A 1FP6A 1W52X 1ZHHA 3WNVA 1FNBA 1PL7A 4B85A 5KU1A 1K27A 1H9BA 4RE6A 5AHOA 1WW3A 1BHJA 4DLSA 4DV2B 1KFJB 4CLXA 5F3WB 3QG1A 2G80A 5D5QA 5CDGA 3KSRA 1RAIA 1YR6A 3MELA 5GGYA 4GLFA 2C2XA 4X85A 4EABA 2UXCB 2DHRA 2F7SA 4PM4A 2ZRDA 2VDRB 2V59A 3BULA 3KSBC 2P78A 5G4LA 2Q3BA 3K1ZA 4LYJA 3M2TA 2WSSA 1GGVA 1A5SB 1H65A 3R0QA 3HYTA 4YRMA 3CE9A 3A3BA 3S7TA 4DLWA 2D1SA 4FDTA 4JGGA 1YA4A 1R6UA 3V7NA 1CLUA 4DK1A 4BO4A 4X62B 1VGRA 5IH3A 1YZNA 1MC5A 3EPKA 1NJ6A 2F3QA 3BHJA 4GEKA 2RBGA 4HT3B 4RDXA 3AF6A 1FTWA 3ZW7A 1LDGA 1XRRA 2ENUA 4Q1VA 3WQBA 1DG9A 1GPAA 1Z0UA 2GZRA 2QZ9A 3ZU2A 5J4KA 1N0UA 3R0JA 3L18A 1TIBA 3V5NA 1QANA 1C9KA 3GDOA 4FT4A 1MW9X 2ZREA 3ILXA 3PCTA 4LJ4A 1N2JA 5HZHA 3O83A 3R3ZA 2JD0A 3ZNOA 5KSOA 1F7VA 1YB4A 1V8DA 2JGIA 1PUJA 3BWMA 3SCZA 2OLKA 3ECSA 4ABYA 1FIUA 4B46A 1XZCA 5BVHB 5JXIA 2ZDGA 5BP7A 2VK8A 2ZDHA 4DM4A 1P2BA 2MIIA 3EVTA 2O8DA 5GQSA 5AXCA 4X7CA 1PO7A 1HF3A 3P9KA 1H8ED 1EINA 2C2MA 1NDHA 2J46A 2UZAA 1MORA 4N9WA 1PLKA 2XRZA 1SN7A 4W4TA 1M6NA 2C2YA 3K0KA 5K8UA 3ZCRA 3KYCA 1THZA 2VBFA 5IHPA 5MGNA 4JBIA 2KI5A 3UV6A 5CG1A 3SX0A 1DBRA 1HT2E 1KBZA 1W5SA 2B6HA 3NV7A 1P0PA 1X1AA 3EXIA 4LGYA 5LZ7A 1G9XA 4EY8A 1RHKA 4E0FA 4J2OA 3TJRA 2VI5A 1JTEA 2Z5FA 4NP6A 4EF4A 1ODTC 2CXHA 1DTWA 2OKCA 2VF2A 4ALLA 3OOCA 3MCTA 2NSLA 1Y48E 1CDEA 1WXIA 3LP8A 1QFSA 1H5QA 2V7EA 2EKLA 3BCHA 4EHNA 1Y4AE 1EXNA 1Q6YA 1ZM7A 3K4QA 1EVZA 1C0EA 3L6RA 4PYNA 4X1IA 1FF9A 5IK2A 3C16C 4OBWA 2O3JA 2D7CA 2QBYA 4B4UA 4XL9A 2ZYHA 4RD1A 4D97A 4MWSA 2JARA 3EFHA 4PO3X 4Q9JA 4ZT6A 1P17A 3V2HA 1RM4A 2RGCA 3TPCA 2C5GA 2VPXA