2XNJA

Crystal structure of an engineered ferredoxin(flavodoxin) nadp(h) reductase (fpr) from escherichia coli
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
255
structure length
255
Chain Sequence
ADWVTGKVTKVQNWTDALFSLTVHAPVLPFTAGQFTKLGLEIDGERVQRAYSYVNSPDNPDLEFYLVTVVYTNDAGEVVKGKLSPRLAALKPGDEVQVVSEAAGFFVLDEVPHCETLWMLATGTAIGPYLSILRLGKDLDRFKNLVLVHAARYAADLSYLPLMQELEKRYEGKLRIQTVVSRETAAGSLTGRIPALIESGELESTIGLPMNKETSHVMLCGNPQMVRDTQQLLKETRQMTKHLRRRPGHMTAEHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FERREDOXIN NADP-H REDUCTASE
publication title Swapping Fad Binding Motifs between Plastidic and Bacterial Ferredoxin-Nadp(H) Reductases.
pubmed doi rcsb
source organism Escherichia coli
total genus 69
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2xnjA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2xnjA02
1UMKA 4RD1A 2YWEA 2BN4A 3W2FA 2YWHA 4NCNA 1GJRA 1SKQA 1QUEA 1JNYA 2EFGA 3CCSB 1QH0A 4HE5A 4ZCMA 1R5BA 3AVUA 1I7PA 3QFRA 4RCZA 1TTTA 1ELOA 5H5JA 2CRVA 1VQ5B 4ZGQB 4QHYA 2OTJB 3CXCB 3W2GA 3SJZA 3J81k 3LRXA 1Q82D 1K73D 3CPWB 3OW2B 3PENA 4Y7CA 4DQLA 4ZV4A 1D8TA 4MYUA 4EH1A 2BF4A 3CMEB 2BGIA 3OZWA 5THXA 4U9UA 4ACAA 1KQSB 3OZUA 3CD6B 1KK0A 1TVCA 2PIAA 3AVTA 2VYQA 3WY9A 1E62A 3ZZUA 1VQ9B 1QG0A 3U6KA 4RD0A 3CCLB 3VMFA 3QFTA 1EFTA 4B47A 2VZLA 3B82A 4LBYA 4N3GA 5TR9A 3W5HA 2X3UA 4LBWA 4RCYA 1H42A 5KSWB 3AGPA 2PLFA 1CNEA 3WYAA 4YAUA 4TMVA 4ZGNB 3B8HA 4FWTA 2BV3A 1H85A 2HCJB 3CRZA 1EFUA 2AHOA 1W87A 3E1YE 1JJ2B 1BX1A 4LC0A 1ZM4A 3I56B 4P3YA 2QA4B 4TMWA 2BM1A 4YAWA 3G71B 4BPRA 3QFSA 3WNCA 1D2EA 3V76A 5GV8A 1N0VC 3W2HA 1HA3A 1ZUNB 1OB2A 3W5VA 2OTLB 2RC6A 2QN6A 3MMPA 1QVFB 1QFZA 3I1FA 1VQPB 1YIJB 3WXMA 1KJZA 2EIXA 3CCEB 1R5NA 1W2BB 1YJ9B 3VO2A 1G7TA 3W2IA 2ZITA 2CNDA 1M90D 1TUIA 1GO2A 5TV2A 3VNVA 1FNBA 1M1KD 2QTZA 1DARA 4Q7JB 1FNMA 3ZC3A 3QE2A 1KD1D 5AN9A 1ZM3A 2QEXB 3P26A 4P6VF 4TMZA 2BM0A 4G1VA 3CW2A 4B3XA 1Q86D 1VQ6B 1VQ4B 1JA0A 1G7RA 3E20A 3JQQA 1QVGB 4YAFA 3CCMB 1EP1B 3I55B 4RD3A 1JB9A 1KK3A 3LVBA 4FK8A 3ES9A 1IB0A 4M1KA 1KK1A 1YJWB 4YHBA 4AF6A 1B23P 2BMWA 3JQPA 2BSAA 1XE1A 1WDTA 4M4SA 1OGIA 4ZCIA 1N0UA 4K1XA 4R71A 3CCVB 2B5OA 4M53A 4HE6A 1FDRA 4B43A 2VNJA 4C43A 1KRHA 1YHQB 1E63A 4PC3A 4PC1A 1DDGA 2GPJA 1KTVA 2NPFA 2E1RA 2DERA 4RJLA 2B7CA 2PMDA 4AC9A 3OZVA 3OJXA 3U6BA 2DEUA 1EFCA 1EP3B 3AVVA 3MCAA 4PC6A 4G5GA 1GAQA 1JA1A 3FJOA 4RD4A 1DDIA 1F60A 1QUFA 3W2EA 2BVNA 3CB4A 2DCUA 2C77A 1IJFA 3LO8A 1NJID 1QGYA 2QTLA 1NDHA 3VNUA 1EXMA 2OK8A 3P27A 3CCQB 4PC2A 3ZBTA 4F7DA 2QDXA 4ACBA 3A1FA 1ZM9A 1QFYA 1J9ZA 4M2LA 1SM4A 4LBZA 1A8PA 4RD2A 4AF7A 3AVYA 3U2QA 1AMOA 4YALA 3B78A 3VO1A 3CMAB 1S72B 1IJEA 4Y9UA 2YWFA 2GQFA 1KK2A 1U2RA 1QGAA 2OK7A 1CQXA 1G7SA 1BQEA 2R6HA 5H59A 1XB2A 4B4DA 3ZZ0A 4TN1A 2DETA 4TMXA 4PC7A 1VQOB 1VQKB 3QSYA 2BPOA 2HDNB 1R5OA 1D1NA 1VQ8B 1Q7YD 2DY1A 5TY0A 1E64A 3ZZTA 2YWGA 1TLLA 4B44A 4UAJA 4ZCLA 3CC2B 4YAOA 1Q81D 4DQKA 5GV7A 5FA6A 1GAWA 3AGQA 4PGOA 3JQRA 1W35A 2C78A 1YI2B 4NBSA 2XNJA 1FNDA 1VQLB 3FPKA 1OB5A 1OGJA 2FX3A 3CCJB 1W34A 3CCRB 2B7BA 2XEXA 2RC5A 1KC8D 1FRNA 4C0SA 1GR1A 3AVWA 3CC4B 4G1BA 4FN5A 2BGJA 3WBKA 1F20A 2D74A 1EWYA 1VQ7B 4WQMA 4MYTA 1G7CA 1BX0A 1K9MD 1VQNB 1YITB 4N3NA 1QGZA 5HXBA 2QMUA 4B48A 1BJKA 2HMAA 3WNDA 3AVXA 1QFJA 1ZM2A 4J0QA 1YJNB 3QFCA 3W5UA 1S0UA 3WNBA 3WBJA 1EP2B 2J7KA 4LBVA 5JBQA 1AIPA 3G4SB 4Y9RA 3CC7B 4RD6A 1DG1G 3MHPA 2VNIA 4TMTA 1B2RA 5EMNA 1CNFA 4IW3B 1N8RD 1K8AD 3ZBUA 4QFMA 3LYUA 2XNCA 3CCUB 1GVHA 1FNCA 3OJWA 4M0LA 3G6EB 2VNHA 5DSZA 2VNKA 4H9GA 1FRQA 1VQMB 1QX4A
chains in the Genus database with same CATH superfamily
1WBJB 3QJGA 1BHJA 2LUOA 3HWX1 4X61A 4C4OA 4X6XA 4KIUA 4FB4A 4MPPA 2YWHA 4NCNA 2VF2A 1RHKA 3W5JA 3JQAA 5JROA 2DGDA 3OBIA 1W85A 2ZWIA 4KE9A 1EG7A 1NUSA 1NTOA 2QUIA 3FCAA 3FDXA 3CCSB 2OORA 4PF1A 1U0LA 1DO8A 3D0KA 4K8RB 1IUOA 4LI0A 4LQCA 2VXYA 4WCDA 4U5XA 3GEMA 4ZVRA 2QUAA 3BULA 3ZQKA 4YMIA 4C1BA 4BGDA 1G17A 4K40A 2WV9A 4GD3Q 1RTKA 4RTLA 4WNCA 4XN0A 1DV1A 3IEIA 4LNUB 4EL0A 3PQCA 4L57A 2H1IA 3U7HB 1R4NB 1FUIA 3FDJA 4OHMA 2VZ9A 1G20A 3Q3CA 2H4ZA 3A9UA 1YZLA 2JFZA 4AY2A 2E4AA 2P4QA 3W79A 3WDLA 2ODEA 2ZYWX 2JCXA 4HZUA 4HQNA 2CRVA 1LLFA 2ZAYA 1X1SA 2J31A 4ZGQB 1KKLA 2VBSA 2WKRA 4M49A 2PX2A 4M1WA 4RVHA 1GPH1 3U7EB 4RV5A 4MV3A 2GUGA 2UZ1B 4TKLA 4KNVA 4JSYA 4JA2A 2HDOA 5IN4A 2FW1A 4I9FA 1V5VA 1UZNA 2XUIA 3HY3A 4I55F 4A9AA 1UCFA 2VQFB 2OECA 2OV2A 2QPTA 3SC6A 4OLJA 5JAQA 3DE3X 2OEPA 4KRGA 2JFFA 3MTIA 2FZVA 1I0LA 4BNIA 1T8WA 2JCVA 3ANNA 4IEFB 5G3ZA 3HM9A 2HNKA 2RAFA 3IAS1 4J43A 5EWMB 3NE5B 4YRMA 3AEQA 1D2RA 1UJCA 4WXPA 2SNIE 4PHCA 3UXEA 3PDIB 1KYIA 2K4MA 3B52X 5ALNA 5A4KA 5F23A 1UK6A 2FZKA 4YJKA 1N32B 2D4HA 4A0HA 2H51A 4L2IB 5AVJA 2Q4DA 2XUKA 3EG9A 1YCDA 4LQ4A 3HCBA 1P4RA 2ON6A 1QH1B 3VSDA 1NURA 2O8VA 3H2HA 3R5JA 4L72A 3SVZA 3DVAA 3WS7A 4P4TA 5BNIA 3ZHTA 1S9DA 1ZFNA 2MR5A 3B5EA 2QRKA 1SRQA 3S8YA 4W9MC 4C2UA 4XI9A 4KO1S 5K3CA 1SXJA 2FSIA 3WDKA 5I4KA 1BXGB 1RWQA 5EXTA 3TGLA 3P0IA 1EVIA 3QU7A 2XUGA 3AHIA 4TS1A 4LBYA 4LOJA 5ERYA 3BMCB 5TR9A 3GOQA 4I3FA 4DQ0A 1REQA 1FJXA 4Q4LA 2VAXA 2B7LA 4RLZA 3HXOA 2V1UA 2DUMA 2PZFA 5DGHA 2AJ8A 2HA0A 2NWQA 4NBTA 3K7EA 4B6OA 3P94A 4PZ0A 1ZOPA 3V33A 4XFDA 1AKMA 1HH4A 1T0BA 1VE6A 3ZNPA 2OD9A 3EIQA 3G0HA 3WGMA 1GQ2A 5EE1A 2O1XA 2ZDQA 2UKDA 3S29A 3RWMB 1WP4A 1TZCA 3G6KA 1GSOA 1P5HA 4QODA 3AWDA 3RTCA 3RJ5A 1G60A 3B8HA 1E6WA 2EHJA 1Z36A 4HQ6A 3E8MA 1ZK4A 4G1CA 1EEHA 3OO0A 4GVLA 1Q19A 4W7SA 2PS1A 5IC5A 3VPSA 4CN8A 4OQYA 4ZKDA 1JJ2B 1GKIA 1BX1A 1K5DA 4LC0A 1U8ZA 2VYCA 2G5CA 3D8BA 5KVQA 1GPWB 5T57A 4B5KA 3DBRB 3HVRA 3S2ZA 4YWJA 1WXXA 2H4FA 3R24A 3CUKA 1SCNE 1FNSA 2RHRA 1VHQA 2VOJA 2A35A 2YIJA 3LT1A 5FADA 4RF4A 5K3BA 4EABA 2J7PA 4NE2A 4YAWA 4YWHA 1ISHA 2PNJA 3N8IA 1OWPA 2DTEA 1R0YA 2FOXA 2HRDA 2M1XA 3U3RA 2W37A 3LVQE 3ZWOA 2Q3DA 1SPXA 2BBSA 4ID9A 3BVPA 3PPWA 8ABPA 2E3JA 3H1AA 4ZT5A 3M8KA 4UFNA 3TM5A 4M8SA 3ZOZA 3ZWKA 3LBAA 1R10A 3TOVA 2PU7A 3SFTA 1QV6A 6PFKA 1HFWA 1ULHA 1HVXA 4PO3X 4KYVA 4KLNA 5ECGC 4CW7A 3IAUA 5JXWA 2VDNB 4WBNF 2CV2A 3RC2A 4XPZA 5A03A 4O3FA 1OPXA 1ZINA 3WAGA 1IHDA 4NJEA 5B6PA 1HT1E 3BQNB 3ZS8A 5JU6A 2IP1A 4QOGA 4MWSA 3B5JA 3HGTA 5AJUA 3QKRA 2C5LA 1HORA 4X8OA 3MOIA 5ALRA 3AG5A 3QU9A 2P2NA 4RPLA 4MS1A 5GP1A 5AM3A 5AK5A 4BE7B 4KXQA 1ZA2A 1V5IA 1WRBA 4IQ4A 4JKOA 1C2YA 1S2IA 2I6SA 4KEAA 4RV9A 3IP5A 7REQB 4DR3B 3DDUA 1JEQA 3LGSA 3RAFC 4LF4B 3HKEA 2ODNA 2Z4TA 3COZA 4HWRA 4ETIA 3OUZA 3ZDAA 1DL5A 3G2KA 1O94A 1GA6A 4WINA 1MVLA 2F3PA 2I67A 3Q8KA 4QATA 1HMYA 2YQ5A 3KQHA 2F9FA 1L7PA 2GZDA 2LPMA 4D9CA 3NBQA 1T4CA 4EF6A 5KMGA 3L8ZA 1G0OA 4IO1A 2DKFA 2IEYA 4FHDA 1UDAA 5TF4A 1SEPA 1QP8A 3GLVA 3ETDA 4MB0A 1U8UA 1RYZA 4M9SA 4HGRA 1IRIA 3DOOA 2JLWA 1JR6A 1G2PA 1UFKA 2G07A 3ZHUA 4P3NA 2I2CA 5BUCA 3KVVA 5F33A 5JNVA 3OPYI 2YHBA 3KVRA 3UKOA 1Q86D 2FWMX 4EDHA 1K98A 3M82A 1TT7A 5E4TA 1Y1KE 1B6TA 1K4YA 3P2MA 5IJXA 3AR5A 5LC1A 1MX9A 1O97C 2ANBA 2H85A 4J3JA 1PK7A 1GQFA 1QOQB 2OCXA 3SJ7A 2VH1A 5ALDA 4EVSA 2HBRA 3JZMA 3P2JA 4OMCA 2C61A 2K2WA 5JTUA 2HWKA 2EWVA 4JC4A 4ESEA 1Q74A 3L1KA 3V8VA 13PKA 1QORA 4NPCA 2BP7A 3LFUA 3QX9A 2P40A 1NATA 3U81A 1K66A 2NO4A 1E1QA 1N5OX 1Y6GA 3BH7A 2XRMA 5IKPA 5AI4A 2A67A 1N8TA 2HSZA 3GNSA 3MM4A 4MP3A 2I1VB 3BJMA 4D8VA 3ZWMA 2B8NA 1FUUA 2FN8A 3PNKA 2GBCA 3KBBA 3M49A 2D3WA 1JQKA 2QWXA 3TB6A 3LUJA 4NMHA 4AMZA 3SY8A 1RXEA 3DE2X 3ICOA 4W5NA 1X9IA 3CUEF 3W5IA 3QF4A 4IP0A 2F1LA 2IYRA 4X60A 1L4KA 4HQFA 4WZZA 4AX8A 4DTIA 4R8SA 5HKLA 2RE8A 1II8B 3ZGZA 4XUGB 1SCDA 2PMEA 3MGGA 4OFXA 4N3BA 1WZ2A 3IR7A 1YX2A 4H7EA 1FVFA 4BFLA 5JRZA 2PWAA 1CVRA 2V4UA 5T4BA 1IM2A 1CY8A 3UGKA 4AZ3A 4RH1A 4HRVA 3IT2A 1FB5A 1K9SA 5B36A 1C8BA 5KYXB 3D1JA 1E0KA 1XRMA 5BWCA 3QTLA 4GWKA 2YHAA 1Z13A 3VO9A 1F7VA 4PC1A 3TIXB 4YRJA 3OPQA 1UD5A 2HB6A 2JARA 4DSOA 1UBGA 2VPXA 5LKAA 1B8OA 1PJ3A 1GSIA 3BX1A 3C5HA 1C3OB 4LJ9A 2J30A 2E4YA 1NBIA 3DMGA 3RGGA 2Y1LA 4P54A 4MO2A 3KETA 3DAHA 2JVJA 3A14A 3QVXA 3MCAA 4EK9A 3FGOA 2OBSA 2YXBA 4JI1B 3RS0A 1RTTA 1QFSA 3GRCA 3UAGA 1NW8A 1I6MA 1N6IA 4X1YA 5CLHA 4BWFB 4DV6B 3QKSB 2WYWA 4NV0A 1Y37A 1Q95A 2XCIA 1W1IA 1SD5A 3H5WA 4LOIA 3EPLA 1MUUA 3GL9A 1JHYA 4IL5A 4D8TA 1CY4A 3AY6A 3ULKA 1KJIA 1U2GA 4ND1A 2DCUA 3UAZA 5A4AA 3UATA 4B0PA 1O7JA 4BLVA 2W7TA 1KO7A 1ZAKA 2HZBA 3Q3IA 5GVRA 5KTMA 2O2ZA 2ZJ5A 4C6RA 1ZX1A 4LFAB 4F8EA 1NDHA 5LNK6 3QX7A 3HB5X 2OCLA 3BMXA 2EW8A 4FOPA 3I6BA 3TX6A 4UJ3A 2GCPA 2YZ2A 3ZEAA 5FPQA 4YYZA 2PH7A 5HZAA 2XCQA 3BSFA 4K3VA 4PIMA 5IYWA 3TM4A 4QM7A 4KE8A 1CEYA 2P2DA 2P7HA 1EGVB 1FBTA 1LRJA 4MPDA 2D5BA 4EPVA 4OP1A 4I08A 2WJ3A 4X1KB 2OP0A 5DBGA 2QXUA 1PS9A 4MV8A 3SJUA 1A9ZA 2IDMA 3GRYA 1RPJA 1WEKA 4TUYB 2CNLA 5T8KA 5AVSA 4KR3A 4KMRA 1O6GA 1T29A 4OL0A 4LBZA 3KQKA 3RRNA 3MFQA 3HCCA 1JTFA 5BUQA 3PJRA 1ZNYA 5IP5A 1RM0A 1S2MA 2BISA 4NK5A 3AKZA 2L69A 5K20A 4RLFA 3QP9A 4LYGA 5FYQA 4KKUA 1J20A 4PZDA 1TPYA 3E8XA 3G0CA 1LCIA 2DBVO 4GR4A 4MVJD 1K97A 1YL6A 2LDXA 1G8YA 2WPDD 4UHBA 5ALOA 3S2FA 3ZGLA 4F4HA 1MAAA 4PYRA 1KH2A 2MHCA 3A2NA 3CLRD 2XMZA 4ZICA 3U37A 4HFJA 1U5BB 4C9BA 1KMIY 3JD4A 1PLLA 1VI6A 4OO3A 4NCKA 4CLEA 4UPVA 3ZHBA 1JAHA 2Q7XA 1ID1A 2VJDA 2XZDA 3VBEA 2WSIA 1I32A 4Z7JA 2FN7A 2QSZA 2V8OA 6CHYA 4FN4A 3GG2A 4ZN6A 1C0KA 3HUFA 4B73A 2ARKA 2AW5A 1KXJA 3TF5A 3KDAA 2JC3A 4R8RA 3AHFA 3RVMA 2FNAA 3ZZ0A 1W48A 1A5SB 2BAGA 2D1TA 1OFIA 3BORA 1V95A 2KW5A 3EA4A 3GI1A 3RK1A 4AZSA 2BBTA 1XEWX 1Z47A 1ZSYA 2NTNA 3D0QA 3D4OA 3CKKA 4P4SB 2WM8A 2W2TA 3A1VA 3IXQA 1TKCA 3A1PA 3R2JA 1X38A 1O54A 1YV9A 4F8JA 1R5OA 4NU6A 2CUTA 2DPHA 4QA9A 5AIAA 1Q7YD 5CU7A 1QIKA 1K7YA 1K89A 1X0XA 3B36A 2G1AA 4FNMA 3P8ZA 1EU1A 1YMVA 2AYXA 2X3FA 1J2YA 4ENUA 4E70A 1DJQA 4BQPA 2C5AA 2ASEA 2ZWMA 4MW4A 2ANCA 1WSVA 3EE6A 2XCUA 3L0BA 4NATA 4CIXA 5A6VA 5LIRA 5H68A 1XCPA 1CUGA 2IBSA 2XCSB 1FUYB 2Q8PA 4C05A 3B1ZA 1DAFA 2JBAB 2AJLI 2ACKA 4OCZA 4HBGA 4OSEA 4EW3A 1K88A 5ALQA 2QI9C 4J0EA 3OEED 4XWOA 1GUFA 3EWAA 5TQ2B 1JA9A 1RPZA 2YRWA 2CLKB 3RT7A 2AE1A 2QRVB 5GV7A 4X0EA 1FSZA 2JEOA 1JWBB 2H2GA 4G5RA 1FTSA 3U7QB 2IIPA 4AJIA 1MXHA 3I2YX 3OCXA 2IEBA 4EF5A 3Q2KA 2VEOA 1EFDN 2IHBA 3BDVA 5KAMA 5G0WA 4DV1B 3V4RA 4EGQA 1ECLA 1PHRA 3E4CA 4KLCA 3O0TA 1AKNA 4YUXA 3L1UA 5KOIA 1ATIA 3V97A 3TLKA 4H15A 3O8CA 4KDRA 3RAJA 1YU9A 3DLCA 4KO4S 4Y9TA 3TIIA 1S3IA 2WE8A 1W0KA 2O23A 4X20A 3QPCA 4YGXB 1V9LA 1WOSA 1K06A 4Z0HO 2G9NA 3MSXA 2YCBA 3PWTA 2OFOA 3RIGA 1Z4PX 1GN9A 4TLCA 5CLGA 2AL7A 1W34A 4JYPA 5E2AA 1J9GA 5FOUA 2DTDA 2IUEA 1GY8A 4R54A 3ZCSA 3CPXA 3OOCA 4F6CA 3OFSA 4QVJA 3HKCB 4IFIA 4QXMA 2P9TA 1E9SA 3DNFA 4O2BA 4PQYA 3CRQA 3PDCA 1EWYA 1MNQA 1P2TA 3PR3A 1DBIA 1ZJZA 3V7FA 3EQ2A 4C21A 4D43A 1DEAA 2H1FA 3U4QB 4DKJA 2RGWA 1APBA 4KLRA 1N3IA 1DADA 4X06A 2AN1A 2MJLA 3EXFA 1IN5A 2JLZA 4TWAA 5FL7D 1NXTA 1SXGA 2ERCA 1N1DA 2ZYDA 1NVXQ 2FOIA 2CBZA 5B3KA 1CJSA 4NV3A 5KNCD 3WB9A 5JAZA 4YK7A 1QHHA 1WR8A 1UPTA 4NDNE 3TZKA 1TVKA 2ZANA 3AV3A 1ZLYA 1TMKA 2BY4A 2ZRMA 3C41J 2PZAA 3GEEA 4BKUA 4F1KA 3OZAA 3WNDA 4MXDA 2EOAA 4MR9A 5JQGA 2VJMB 3QFCA 2C9MA 2J7KA 2ZRKA 5F5XA 2MYPA 2OG1A 3VPCA 3HCRA 3MT0A 1P5ZB 3RTGA 3PYXA 4ESVA 3NXSA 3SXJA 4KVFA 3DOIA 5EMNA 1XYGA 4TVBA 4P3OA 1YCHA 3RBXA 5LDDC 4Q4AB 5BSFA 2Q4OA 2GZRA 3W0LB 2CB0A 3WLMA 4BNFA 1JHPA 1RP7A 3PLAE 4QNMA 2MSWA 3GNTA 1VIMA 3WO1A 1VHDA 2WT8A 3AZPA 4AY5A 1HLGA 1OI7A 3I45A 4NFLA 1OXVA 5JOQA 4OP3A 3WA7A 1ZM7A 5KHOC 4L5YA 2IGBA 3FYCA 4H9GA 4KZKA 2QE7A 2WW8A 1T34A 3SC2B 4GI7A 1M6HA 3IAAA 1SVMA 2BELA 4PV7A 1QX4A 3E7PA 1Z4MA 2BL4A 5JYCA 1NHWA 4MHTA 3A9CA 4DA4A 1WDLA 3IURA 2GCGA 5FAXA 1QUEA 1SBHA 3A9TA 1SJ9A 4GQAA 3IB6A 3MWYW 3DYBA 5H02A 1YRHA 5AKZA 2GAAA 2LIVA 3RY8A 4MWZA 3EVGA 4ARAA 2JK1A 4URHA 2EKPA 3R3SA 2I65A 4XLTA 4DLAA 1V7QA 4ZXFA 2B3TA 1N57A 3GRVA 2WPNA 3HP7A 5AXCA 2GAJA 4LRQA 1Z2EA 3AUJB 1Z6ZA 4Q3KA 2HU2A 2DFPA 3O3NB 1AS2A 2JVIA 4EFLA 1Q57A 2FG7C 3X2SA 5BWMA 4R2KA 5I45A 4O2AF 1JFSA 1CS0A 4KTVE 5DP1A 1YTUA 1QMGA 4QHYA 1PV2A 2H9IA 2XNHA 4YGYA 3OKFA 4ND5A 3LECA 2W58A 1O6CA 1P9NA 3K72B 3RJMA 4RA9B 3L06A 1M2WA 4GI3A 3NATA 2AVNA 2POQX 1FX1A 1FYDA 3KAPA 3NHAA 1ZZEA 1MNAA 4ZYVA 4H1TA 3RIEA 4UDNA 1CFZA 3L43A 4FLMA 4J0GA 2ZEJA 1VIDA 1Z17A 4ECEA 3HCEA 3FCYA 4QREA 2AZDA 1ZJ6A 2KPOA 4B3CA 1LTQA 3MJTA 2WJWA 3F9IA 4D0GA 3EZXA 5EVCA 5KWVA 1BE0A 4WAUA 2A9KA 3E84A 1CDZA 3BRSA 3AG6A 3Q87B 1RWVA 5L7YA 5JLJA 5JV5A 2LDBA 4N41A 2HPZA 3A6GA 3O21A 1HUQA 1PR1A 1WB5A 3E18A 4F71A 1P1RA 5EQTA 3KXPA 4JGIA 3VYWA 4YXWD 4PIPA 4YQYA 1O77A 3EPPA 2D06A 4RDKA 3ILXA 1CF4A 2O0KA 2E37A 2QMQA 3PJDA 4JHLA 3DMPA 1ZEMA 1US8B 5EEGA 3T7RA 1FQOA 3HG7A 4B8ZA 3KUKA 3KWFA 2HF8A 4LMPA 1G1AA 3MJHA 3WRXC 4F4FA 2OYSA 3PUXA 3NJ4A 4GNRA 4O1MA 4M1QA 4FFPA 3FRJA 4QUDA 3S28A 3UKJA 1E3EA 621PA 1RVDA 4NMWA 4X0CA 4AJ9A 4TV9A 1I3MA 4ZIRB 1UOOA 2ECFA 5DHQA 5ES3A 3PSAA 5DGIA 1PJ2A 2YRFA 1Y9AA 3BCDA 2CFOA 3SNHA 2BD0A 1NFQA 1FMFA 1T5LA 2GD0A 1JG2A 4M0UA 1RXVA 5DYNA 4TXMA 4L08A 5JFOA 4L5CA 4RF2A 2HNBA 3EF1A 4PPNA 1UFOA 1WMAA 2MSDB 2V9CA 3UGQA 2REQB 4G0PA 3EVEA 4HLNA 4R81A 4DY4A 4JODA 1DQZA 3GLUA 4AS3A 1J5XA 1YOBA 2ZK7A 1UXGA 5IN5A 3N8DA 3PEEA 2OL4A 1R8SA 1NJ6A 2EJUA 2IZ7A 3F8SA 1UAYA 1ZRNA 3IE0A 3PE3A 2Z6VA 2IF0A 1XPJA 1OH8A 1OXBB 3IJPA 2HF2A 3NCTA 4HDSB 2VP6A 1SQ5A 4G9EA 3GCXA 3QH4A 4IIYA 5DPMA 2WIFA 5IVDA 4R5MA 3RF7A 1DRWA 3HO6A 1W87A 2WVHA 1S4MA 3O1JC 2A5LA 3G2IA 1LBEA 3B3FA 1AK1A 5F76A 8MHTA 2ONZA 1ZM4A 1BS9A 1NE2A 2DKNA 2X9LA 3DO6A 3K94A 4MWGA 4QIHA 2VXOA 4EOGA 5CA0B 3PNQA 3G71B 2XT0A 3T5BA 1KI8A 4BZQA 1MABB 4QUBA 1DKNA 5AOVA 5I51A 3WYNA 3CLUD 5HBRA 1V5FA 1SD2A 4US2R 1SC4A 5F7JA 3S1AB 4W99A 1OC4A 1RJ9A 1Q3TA 3MQFA 5D5HA 5EJGA 4BLQA 1YB2A 3WYDA 1OVGA 5GIOE 2QX7A 3ZE0B 4KDCA 1SWVA 2WP8J 3F5SA 3AIIA 3UJNA 4DA0A 3CONA 3BXGA 5J63A 3BFXA 2VP2A 1HG0A 3ZV4A 2FPGB 3QWFA 4FE4A 1E9CA 3UJHA 4YRGA 3BKXA 2OBBA 3MJSA 1OH7A 1KMQA 1NUAA 3BNWA 2ZZKA 5BR8B 2AK2A 2RAPA 2UUBB 4UOEA 3VU3A 1Y1TA 1NVWQ 4DV5B 1XR3A 3L2OB 2CCJA 4KAJA 4OB6A 2O48X 3SQNA 4D9HA 1ZO8A 3PDUA 1A2KC 1OZFA 2XDQB 3P9SA 1W2BB 1E4VA 3MINB 4D3YA 1EUYA 1KIMA 3QYAA 6YASA 3VTKA 3CKYA 5L3VA 2ZITA 1U1EA 2A9QA 2M2IA 2OESA 1NN5A 3G1TA 1PTKA 1Q14A 4N48A 3QKRB 5D6OA 4E7OA 4MS3A 1RSZA 3M83A 1XWFA 1Y8AA 5FWYB 1OXTA 3KZCA 5AP9A 2V55B 4CLHA 3VX3A 1YS9A 1AKUA 1QIMA 2CNBA 4UBNA 1L1FA 3WK8A 3B6EA 4AZTA 3OAAA 1Q7GA 2K7ZA 3LUKA 3N86A 4J7XA 4OXNA 3X1DA 4UUMA 5DRTA 1EKXA 1HE4A 1YQGA 4DLNA 2AOVA 2VYVA 1WCWA 3ILHA 2J3JA 2YCLA 2BBOA 1ZK3A 2PRSA 4DREA 2ZXUA 1BCRA 1WVGA 2NZUG 4G0UA 3VV2A 4EYGA 1RLOA 4ENQA 3IB3A 2GQ0A 4P7JA 5C7YA 1VJ1A 3A3YA 5F7ZA 5JSZB 2AC2A 2B8JA 1NGSA 2H7CA 2XMSA 4B3XA 3RVPA 1KARA 1F2UB 1CXZA 4Q0MA 2PMBA 3QVMA 3LTEA 1JEOA 3AKYA 4MP8A 1KYVA 4Q1FA 1FP4B 1T8UA 2XRZA 1ZL2A 3DBLB 1WL8A 1XT6A 1I9GA 2WZCA 3D3WB 3NETA 2ZUBA 4BFZA 1Z4LA 2FUG6 2PPVA 4KVGA 4FEEA 3ADCA 1V2HE 1VKZA 3CNNA 3CR3C 5A0VA 3AU9A 1OBOA 1NV8A 5AW8A 3QMPA 1JHOA 1P73A 4XW2A 2WWHA 2FRDA 4RM3A 4Z8XA 3TE7A 5ICMA 1CZHA 1NASA 5AW5A 3SBXA 1EFVB 2GPAA 1KZYC 1L7OA 4L0MA 2VWQA 2FEWB 4WESA 3TGWA 1KK3A 1W1UA 5JADA 2C20A 2XUAA 4GSLA 4BGVA 1P4JA 1Z0ZA 2IEAA 3JQGB 1A95A 1E6UA 2VHVA 5AW9A 5AVWA 2BUAA 1BFKA 5JH7B 4DK1A 2FOLA 1R64A 2LP4Y 1PFQA 2KE5A 3UKDA 3ZIAD 4BQEA 5D5QA 1RWOA 2Z8YA 3G49A 4IWNA 3K2BA 4FBMA 4GIBA 3IOMA 5K03A 2ZB8A 1ZGBA 5KOJA 2PLNA 4G0ZA 1CE8B 1Q1QA 2JATA 2PNFA 2RKBA 4FS8A 4PYNA 2P65A 4X8MA 1UD4A 221PA 1L9XA 1M54A 3ANSA 2FFRA 2L2QA 4FFDA 5DHRA 5YASA 3WNVA 2WHRA 2YZKA 1N0UA 3VYVA 2V7QD 1L5SA 1KEEB 1ZIDA 3S5JA 1P6XA 2D0OB 2F48A 3Q5DA 3DE4X 3V1UA 1X7XB 5GONF 3AWIA 1OX4B 2RGDA 4M53A 1V8BA 3EFHA 4OL9A 4R05A 4U4AA 2X0EA 1FDRA 2HSGA 3WLNA 3DKRA 4NE9A 3FWNA 3LZDA 2A33A 4OHOA 5EHQA 1W36D 1KNXA 2QQ5A 5AJXA 1CG6A 3AESB 4QBHA 3UGJA 1HTTA 2QQFA 4ADSG 1E69A 1XQVA 3NHPA 2ONKA 2OQRA 1IHOA 4OOFA 4RX1A 4DN6A 1V0EA 2AB0A 2QMYA 5L3SA 4RJTA 2Z3VA 1QR6A 1KP9A 1UODA 4KAFA 3WTCA 5HRCA 3ZJVA 1ZMBA 2EKZA 5AVUA 1WQ1R 4CF5A 4E1AA 1X13A 3G5UA 1DBQA 1IXSB 1KJJA 3AY7A 4HDRA 4J0KA 5G1NA 1XSEA 5DNUA 3RYHA 5JBNA 5E3HA 2FGJA 2JHAA 4XSVA 2DEUA 2TMYA 4DLBA 2XYPA 2OXIA 1DAHA 5IYZB 1SURA 2GLXA 1WHTB 3MB5A 5AD1A 3KT0A 4IJMA 5JJCA 7YASA 1V4BA 2OAGA 4DC1A 2DUUA 2DMRA 1F60A 2BVNA 3DJFA 2CLDX 2W2NA 4EELA 4H3HB 3KZMA 5CFLA 4X44A 3NBXX 3WMFA 1G0NA 4KACA 4LK2A 4DT1B 1XRRA 3OVMA 2Y6VA 2I4MA 1EXNA 4S1OA 3K1AB 4KV9A 1YA6A 3Q88A 4QUHA 1OFHA 4TT3D 1XUOA 2ZL7A 2QTNA 2BGLA 4M1TA 3GVPA 5HG0A 3UQYS 1U1IA 2Q27A 1GEEA 3VZSA 2NVBA 2NNLD 3JALA 1RZRD 3BE5A 2ZYGA 3HNPA 1KSFX 2IHJA 5FYDA 2OHXA 3PFCA 1MRSA 5F73A 1G2OA 1ODIA 1E3LA 3AI1A 5CX1B 3VHXA 1Q1GA 5DXAA 5BSVA 4Q4JB 1QFYA 5K3FB 1XVAA 3OP4A 1A8UA 2OWDA 4XVRA 1H93A 5EY5B 2FETA 4X6LA 3ERCA 2DVMA 3TFQA 1D4OA 3IA2A 4UD2A 3RYIA 3LVFO 4C4YA 2I5PO 4UU1A 2QVYX 2XT6A 4P3XA 1UMBB 1DLIA 3G68A 1ES9A 2NO6A 1F0YA 3SIXA 3B78A 2B8WA 2QNBA 2IW3A 3RYCB 2I03A 3BZWA 5BO5A 3SE7A 3L4KA 4N5DA 4B17A 1Z73A 3ZZ1A 5ALXA 1NM5C 3ZXUB 3D8UA 1N7HA 5EUMA 5JPIA 3W4KA 1N92A 3K0AB 5LM3A 4KPUA 2G04A 4BX0A 1Z8FA 3OQOA 4UEJA 4IIJB 2EFYA 2GKSA 1CQXA 3L1JA 1YQQA 1EA5A 3NHFA 4RZIA 4UU7A 2UYOA 3HU3A 1MP0A 1W4AA 1O9BA 1OIWA 1H5QA 1Y1SA 2OC9A 2SKEA 4NYJQ 3DFFA 1JEDA 5REQB 1JKFA 1IXKA 3L8FA 2C95A 4YV1A 5DHSA 3LJKA 2R6DA 1WXGA 1C4WA 5DN6D 1T3TA 4CM4A 2GCOB 1R6DA 5KYGA 2NO9A 2WSYB 1J42A 3MMZA 3NAMA 5JISA 4MUNA 2B4TO 3EDMA 4UTXA 1C4OA 1S7CA 3AUXA 3QMMA 4PN3A 1Q6YA 1E9BA 1JDPA 1VLMA 2FEOA 3AFHA 1W9XA 1FFSA 2E4WA 2DY1A 4RPJA 1E64A 3PIRA 2HJSA 2F8SA 4PYLA 4RIHA 4C5BA 4F1WA 5LYYA 1FJ2A 1AQYA 1BFUA 3DUWA 4YMHA 1GRRA 1ZI8A 3FPCA 3NM4A 2DBQA 3T41A 3PUNA 1TADA 1YC5A 2YWXA 3D2CA 3OHMA 2HCFA 4HNHA 3T7AA 1RQ2A 4EMBA 1ZH2A 4TKUA 3CC2B 1TIPA 2J3QA 5IFLA 3JV7A 3RFXA 3CMCO 3PUIA 1J56A 1V16B 2OM2A 1JI0A 1NW6A 2F3QA 2EKLA 3U4HA 1RYHA 3IQXA 1ZG3A 4DQKA 2IH5A 1M83A 1U65A 3H13A 4G7WA 3R20A 4TZ6A 2NZ8A 1XDBA 3P9NA 1W2GA 4CG3A 1D6MA 4ZDIA 1UBSB 4L5JA 2EZTA 4FONA 5CXXA 3INNA 4FHEA 2II6A 4MEBA 3QG1A 4Z2AA 3DULA 3QVLA 2WM9B 4KIWA 3EXG2 3TBKA 4I1SA 4RIIA 1XXHA 4XEHA 5D85A 4KU4A 5FOXA 5KTOA 1JEYA 4TYYA 2OAEA 2WI8A 1PIWA 3P52A 4XYGA 2ZBDA 1ESZA 5I7HA 1P0FA 5C7OO 3CCJB 1Y9DA 4G84A 1VHOA 3MC1A 2C94A 2X23A 4YC7A 2KQUA 1TGYA 2ETVA 2QHXA 5HKKD 4CFZA 2I54A 1RAAA 2W11A 5HJ7A 1GN8A 3RNOA 4D92A 2R62A 4BVHA 1ZA1A 1KQ3A 3KTDA 4U7HA 5DBOA 1D03A 2ZREA 4O8ZA 3TZHA 4QU5A 2PZEA 2PH5A 3RHFA 3AF1A 3IXLA 3UMSA 1H2FA 1WKCA 2WWWA 1OHHD 1GRNA 3RFVA 3P20A 3VU9B 5D86A 4NPAA 3H9JA 1FVHA 1Q84A 1N3YA 1ZWLA 2A9RA 3IBTA 1G7CA 3QVUA 4IZIA 4PRKA 1NB0A 3KJNA 2DE0X 3W6ZA 4D96A 5KWEA 4QQRA 2CK3D 1FDIA 3WL3A 3L5OA 4NYJR 3DDNA 1KOLA 1K9MD 1CR6A 4QZVA 1SU8A 1NBMD 1NPTO 1J22A 4JN6B 2WOOA 5BSYA 1Q7BA 2FMKA 5AI6A 3FSJX 1Q21A 2CXNA 3ANXA 3EIWA 3KZOA 4PYIA 5HFAA 2B92A 3OT1B 3NUQA 2CJWB 2WU4A 1GILA 3HYRA 2I7CA 3ESDA 4Q3OA 2WF6A 4U39A 1OUMA 4H7JA 1FS6A 2PWYA 3O7WA 4ZI7F 3WK9A 1EP2B 3A2MA 2OD7A 3CFYA 5AKLA 1NVKA 4L9SA 4NOMA 1X80B 5FUQA 4P80A 2Q3LA 3HJBA 3U3KA 4HPWA 5KNDD 1ZOSA 5E95A 1R4MB 4ETNA 1DINA 1NR5A 1G8HA 4L07A 5F21A 2BGUA 5GQSA 2AXPA 2B9EA 4MICA 2XA1A 3ZWBA 2GM4A 1VQ1A 1FW6A 1OZGA 1NXXA 4TV8B 5JW6A 2QUZA 1HEYA 4OFWA 2BFCA 3E61A 3CCUB 4QGGA 1B16A 1N2HA 1UBFA 2WAYA 5TT0A 4IJWA 5HKOA 1ESNA 2K5UA 4RULA 3SYMA 3WL7A 2DWQA 4LMRA 3GY0A 2Z08A 2VBVA 4CCYB 1SXHA 5HQ3A 2O07A 2QD2A 1PNVA 4KLAA 2PZJA 5ED0A 3M1LA 1BTOA 3OESA 4FR0A 4LIPD 4RD1A 4TX1A 5AHOA 3YASA 4MRRA 1GCGA 4IHAA 5BYKA 3PTZA 2AQHA 3BQMB 1LSOA 2C2ZA 2W8ZA 3HCFA 4QSMA 1GARA 2VQSA 3A35A 4X05A 1O03A 1NUQA 2DF8A 2DQKA 3H11B 4N65A 4OGFA 4PVCA 1SCBA 1FXUA 5HQJA 3VR4D 2DR3A 4Z2YA 3W9BA 4XQFA 2XTZA 2YV2A 3H0EA 4CMIA 4Z9XA 1AS0A 4HVTA 4O08A 5KNLA 3FDFA 5G4LA 3VNBA 4NAUA 5LWQA 1N5KA 2O3UA 2O5VA 2XHZA 3GFRA 4ZOAA 2SICE 1DGQA 3U9SA 1U2QA 3W2TA 1GDTA 3B38A 1PZHA 1M6EX 2ZS9A 4WN9B 1TTTA 2IVFA 1OOEA 5BNZA 5IT9A 3H04A 4RVGA 1WJGA 3C14C 4KQJA 3P7MA 1J07A 4TLBA 4ZOEA 5C3UA 4B4UA 2CHGA 5FI5A 1ML3A 3WSVA 1WOMA 2FF7A 2ZJBA 4OHVA 1LY1A 5LP6C 1QRTA 3SEQA 5IUNC 4QNRA 4FM9A 4A5SA 4N12A 4ZZ3A 4RESA 1KNQA 1WTAA 1KEUA 4AW9A 3P2YA 1NMXA 4DAOA 3WSWA 4FCVA 1PQPA 5CD1A 5AK4A 3I4CA 5I7EA 4UMFA 2A0UA 2QEQA 3KPJA 3N2NA 4DA9A 4DVJA 5EJ5A 1GGFA 1NJGA 3P45A 1KDVA 4DWOA 2J09A 4DQLA 3JZAA 2FPXA 1DKPA 3SVTA 4ZV4A 3TTXA 3AVQA 3HP1A 3IUQA 3ZWWA 4ALLA 4CCAA 3M6FA 1UEIA 5JWOA 4X62B 3R9WA 4RPCA 1EGMB 1QG2A 1L1RA 4IDNA 3RVQA 3IL2A 1LLDA 4RBNA 1GCAA 2IXFA 1NI4B 1THMA 4B35A 7MDHA 3IE1A 2WSSD 2E5WA 4UMVA 2B25A 1OMOA 1TPZA 2FUCA 2L19A 2PIAA 3Q41A 2OVFA 4JUIA 4KQKA 5JI3E 1W4ZA 3AVTA 4DABA 1IXYA 1NJFA 4EMSA 3LUBA 3C8MA 3R0IA 2Q5IA 4LJ7A 5E1BA 5C31A 2OXRA 4QQKA 4G97A 1EK2A 1Y4UA 2EIHA 1XLTC 4RD0A 3BL6A 3BS4A 4P8RA 4L8FA 4KXWA 4LGYA 4C07A 1GQRA 1DIOB 4X93A 2NV4A 5L46A 2RD2A 2Y9PB 2BSQA 3ONUA 5E2IA 4GMKA 4RMGA 3NGXA 4LDQA 2X0JA 4M38A 3LT5A 3H65A 4RLQA 1PGJA 3ROKA 4ZAVA 4KFCA 3B82A 2A58A 4O3MA 1W2HA 4BEWA 3ONEA 3AOEA 1W96A 2B1JA 3W77A 3ZE1B 5IDQA 3EVBA 4EO7A 1N05A 4RCYA 4DBLC 1HY3A 2E9SA 4YRNA 1RQXA 5DT9A 1C9JA 3UOWA 3UJ6A 4EAQA 1T24A 4X7CA 2BEVA 4L0CA 3T1YB 3GLHE 4CEHB 3HBLA 3QU5A 4QFBA 1C9EA 3MWDA 4MB2A 4NJMB 3WWPA 3R6GA 3UCFA 1L4GA 1MJGM 4NY1A 4RGVA 1G291 5EG5A 4XUCA 3ICQB 1Z0IA 1U3FA 1VB5A 3PYLA 3TL2A 4U2DA 3S2SA 3ZWAA 1HEIA 1I7LA 3OZGA 4JT9A 3TPFA 2OCPA 3GRKA 3PD1A 3T95A 1TXGA 3LUPA 1ZCAA 2CXQA 2MTBA 2W98A 3AF5A 4IQGA 4KN6A 2PKEA 2Z2JA 1ZSVA 2QM3A 2VTVA 4XWGA 5LB4A 4QXQA 2PGDA 4CIWA 4P3YA 4CU5A 1AA6A 1I4WA 1RFLA 2BCGY 3PVZA 1RWBA 2VYFA 1H2EA 2JKZA 3BM5A 4CV3A 1NUTA 1KYWA 4P7FA 1F2DA 2ADOA 4FE7A 3OLWA 4KQWA 4HPJB 4OXRA 1UFRA 1A69A 3PQFA 3GGOA 3R5KA 4R6XA 4DM3A 2GXAA 5DTQA 3AKDA 2PUAA 3HZRA 3VAAA 4XX0A 5AM1A 3VTAA 1X7DA 4B32A 8ADHA 2BM9A 4XASA 1Q17A 2MINB 3IUSA 2ZRDA 3L8EA 3QPWA 2ZT8A 4RZ2A 1PG2A 4CQJA 3FVVA 3N8NA 4C0LA 2BE9A 1N06A 1E2EA 1I1NA 2AFIA 2XQGA 2RC6A 4IDDA 2R8PA 3FVRA 3A9SA 3MMPA 5K0EA 2W2PA 3AX6A 4YLEA 4EHAA 1H2HA 5IARA 1QYXA 4HN2A 3J81A 3T3MB 4C4SA 1VCMA 5F2KA 3HVUA 3DDHA 3DHEA 3GAFA 3JQ7A 2C7VA 5LSAA 4KPYA 3IPXA 4YRQA 1OILA 4MQ6A 1EK6A 1SOUA 1QBKC 2VDVE 1M2FA 1GNTA 3O4IA 3LQFA 2REXB 1YDHA 3MWLA 1OWOA 4KGDA 4QRDA 1Q0PA 4NMMA 5DLEA 1V96A 3PNLA 4C1NA 1U4SA 1AX9A 1E94E 4U0JA 3N0RA 1I5EA 3WQHA 4ALIA 2BZSA 4R69A 5LXTF 5FWAA 3I83A 1T2DA 1C0EA 3OJFA 4AP6A 2XODA 1DARA 2VTBB 3C3BA 2BEKA 3ACDA 4LFBB 4K26A 1HDXA 2R8EA 3QI2A 5ELMA 4YEJA 1HDGO 2R3SA 1SGWA 3UEOA 2FPPB 3QLVA 4QJBA 4DSAA 1QPGA 2BGKA 4P7KA 3X1KA 3M70A 1CUDA 1RE0A 4MYRA 3G2QA 3KQWA 1VC2A 1ZN9A 2WVJA 4MVJE 5M3BA 4O4JA 3RKUA 4P6VF 4J90A 4RA6A 4AKSA 1LPAB 3NM5A 4F4JA 4XVQA 4JBNA 4ND8A 2BM0A 3PR1A 4AUNA 1U8AA 4LJSA 4TYNA 1YVUA 2FA9A 2OQ2A 1FE8A 5DLYA 1JIKA 1THGA 2DJ5A 4FGKA 3R7SA 3SBEA 2H3HA 1XTZA 1U2PA 3DMYA 2EKDA 1VQ4B 3FAZA 3F6PA 3UHPA 2AIRA 4WERA 1JA0A 2HNAA 4W7HA 2Q49A 4L3WA 1QVGB 4B3MB 2WG0A 3GMDA 3KOMA 2PCJA 5B3LA 1XJCA 2D00A 3REQA 4U7JA 5EFZA 3NFRA 3ED1A 3OUTA 4NHEA 4DEVA 4BYMA 4N39A 1DNPA 3S44A 5K8UA 5E9JA 4KK4A 5JXJA 1UBMS 2AH5A 1NVAA 3K70D 5CT6A 4MW9A 1T2VA 3O84A 3ZCVA 4Z6KA 1KRXA 2IXEA 3DXFA 1G6Q1 2VO1A 4E3WA 3MT7A 3VR5H 2A30A 2Z8XA 1JEEA 3G8DA 3BA6A 5JO9A 1DC4A 2PO5A 3IT3A 3OZIA 2E1BA 1QZZA 3Q3EA 3HHEA 3ZU2A 1MV8A 1NJ5A 2Q4TA 4YHBA 1P2FA 4AF6A 3LKVA 1IULA 4AMUA 4EUHA 4KQGA 2KYRA 5L51A 2O3JA 2D13A 1FTQA 3GVHA 5IAKA 1YS2X 2JHPA 4QOFA 3RHSA 3UA3A 1RM3A 3R6WA 5HF9A 3ASQA 1FVXA 1GZSA 1R27A 2Q1XA 3A27A 4INJA 4RANA 2CJFA 3ZXYA 4DQDA 5BP7A 4QNNA 1NU6A 3OTGA 4M36A 2X7XA 2I9KA 5EC8A 1QRUA 4FXPA 1XA3A 1HE3A 2FY8A 3SJPA 3AEZA 2I2WA 4JL5A 4BX2A 1KY3A 1C9KA 2AEEA 4FYVA 3U3XA 4RKEA 1Z0SA 1I3KA 2PUJA 1NW9B 4PW0A 4RMNA 2EP8A 2ZPTX 3AEUA 4XR4A 3O8NA 3R9KA 5FT9A 3GRPA 4D42A 3I39X 1RXIA 1ZSNA 4OMFG 3LGAA 4G1EB 1YKSA 1Y3AA 1IZZA 1X94A 4JQSA 4TQAA 1UC5B 2IT1A 4KNWA 5ALJA 3OCZA 2H6EA 4OHFA 2JJMA 5KOHB 3P0EA 3GA5A 2G4VA 3FJOA 4RD4A 1OAAA 4HDRB 2X0DA 2Q6LA 4D4KA 4N76A 1P1BA 5FNVF 5JCJA 5F7XA 5HVNA 2DHDA 3N3BC 2WKPA 3T56B 1T2EA 1LGYA 4PLPA 1JYFA 3G8YA 4LXGA 1GU1A 1HLFA 4IGAA 3D4PA 1T9AA 4AXBA 3MJCA 1LXCA 1TUGA 3ZKAA 2FSFA 1ABFA 4EG6A 4KSBA 3IUNA 5DYWA 2GRAA 3GDWA 4L9AA 1Z7GA 3FBGA 4EB6A 4ZJUA 2R11A 5BV0A 3ZWYA 4A2PA 4J91A 4OOVA 1LC3A 1A04A 2EJWA 1GPJA 3DFUA 4QTXA 4UBIA 4OX9Y 4HPXB 2DFDA 3EVAA 3JYPA 5BXYA 1XQ6A 1UXHA 1XL0A 1USGA 3D4IA 4HN4B 4U2KA 1R6XA 3WV5A 4FT4A 5G1PA 4QTUB 3OZDA 3CP2A 4NCBA 2ZKIA 3IR6A 2O3SA 3OOHA 3I05A 4R3WA 4U7TB 1JQEA 2PD4A 3GFSA 4P38A 3KLPX 3M2TA 3MG9A 2C5BA 2QT9A 1CIJA 2LE0A 5CK4A 4CQMD 4KL8S 4OPOA 3LWBA 4GRDA 3O2QB 3FR7A 4JVSB 1RQGA 3IP8A 4C01A 2B1IA 5EHGA 3TEFA 1YVDA 2C4VA 5K4HA 4RVCA 3DPUA 4JBGA 2H0AA 3OQJA 3UG7A 1HEUA 2XZLA 1JMYA 1DQPA 3CJQA 1HZZA 4PGGA 5KYUA 2B5VA 1PRYA 1QHFA 2GAFA 2JZCA 2G67A 2P8JA 3K92A 4J0JA 2J9XB 2Q45A 2QLLA 2GJ9A 4Q15A 3O2NA 2H5LA 5EKDA 1Q2UA 1KMHA 1XD9A 3KEFA 4DWJA 1RW4A 3ORYA 4M0FA 1EFPA 3TEJA 2IYUA 3T3IA 4OPSA 5HQTA 1GFZA 4JBLA 2BFEA 2F9LA 3AYZB 1VPLA 4GM1A 3E23A 2QLBA 1Z8NA 1JLLB 3NTRA 1WUYA 5T3YA 3DGEC 1COWD 2EARA 3BWMA 3WYCA 4H6XA 3SJAA 4TVOA 1XAGA 4Y9SA 4ENPA 4ZQEA 2VDMB 3O4VA 2O5CA 4RTSA 4OHXA 2JGLA 1BPLA 1G66A 4AJ1A 2OR3A 5K0TA 4L4XA 1SU6A 1Q92A 2R5WA 2RK3A 2OZVA 2V6IA 5CX4A 5DFAA 4KQMA 4XXHA 5IABA 4P5PA 1SQSA 4QJ3A 3C70A 5ADUS 3U16A 4HEA6 1KOGA 1COZA 3TAHA 1J2JA 1Y89A 5FUWA 3QVOA 4UAJA 2JASA 2QRJA 4HATA 4L1KA 3RS9A 2VA8A 3L8DA 4MS4B 1HC7A 2H9YA 3C7DB 1OH5A 1NF3A 2HV8A 1DFIA 4QYMA 5AUQA 4CIVA 4OM8A 2G1KA 2FSSA 4RH3A 3ONFA 4O4LA 4Y2GA 3IQZA 2OZLA 5DZSA 1F0PA 4BP1A 1WU8A 1M73E 2JGEA 5K7SA 1FMCA 4NXNB 2AMFA 1DAMA 3U0VA 1ORIA 2J5QA 1OLUA 1XF9A 3P2KA 2W70A 3L46A 3W8EA 1KBOA 3NKFA 3QLEA 4RMIA 4H60A 4CFYA 2VL7A 3L49A 2O7RA 3QKWA 5ADWA 2EQ5A 5CPFA 3ZVNA 2O4UX 3C87A 2Q3HA 3FJ1A 1J49A 1PWXA 4I4TF 4MINA 4S12A 3WZLA 1EX9A 1LSSA 3T1QA 2P69A 3DB1A 2E6KA 3D3KA 1U2DA 4H1HA 4BGIA 1T8TA 2PXCA 2X2FA 2QLNA 1ESDA 1QKIA 1N6NA 4W9RA 3O31A 4G5SA 4LV6A 2NACA 5FPPA 1U31A 2WNIA 4UJ5A 4X64B 4RPHA 4Y2PA 2Z6AA 5B58T 1H22A 4P92A 3DKVA 1R12A 3H7AA 5HE9A 3WHKA 1G19A 1I4EB 3AF3A 1ATZA 3WBKA 1NYQA 1T1GA 4N5NA 1GNRA 3VPFA 5C1PA 2OGUA 1BW9A 5HEKA 2AT1A 5CB4F 4MUHA 2AJDA 1M9NA 1LZLA 1LVUA 2PMCA 4CKBA 3N07A 4UAUA 4FFOA 2LTAA 3W06A 4YDHB 1F5NA 4KXXA 5GTDA 2F6RA 4WJZA 2ZIAA 3R6JA 3TJMA 2BR5A 2VNAA 5KOYA 2C2XA 3IUJA 4CTKA 4NPHA 4PNHA 4DDTA 1WV1A 2YJNA 4RQTA 2R85A 4F3YA 2C96A 2FZWA 2J9GA 2Q3FA 1AGYA 3I37X 1R4ZA 5T6MA 1GPNA 4F3NA 3HSKA 2GREA 4J07A 3ABIA 3W04A 3ACBA 1KMCA 5EUBA 5JNRA 5HOEA 1E92A 1Q7CA 1KAQA 1MX1A 4F38A 1XD2A 1OXSC 4YEDA 2JAWA 3KOOA 3IA7A 3PXBA 1QZ3A 1A7UA 4MWEA 4U5QA 4BCCA 5B1YA 4GLJA 4CIAA 1B93A 1VJRA 1MOQA 1XHEA 1JDTA 4YCCA 2BFBB 4TWJA 4YJ2B 3KG2A 1DG1G 3MHPA 1JFLA 2WUFA 2Y71A 3NDPA 3U4AA 1RRCA 2IOQA 2OZEA 4X7DA 4PZAA 5AQEA 1A7AA 4FCWA 4ZOLA 4PXAA 1SA0A 4RABA 5FR2A 8AT1A 3T1OA 2AUTA 2G6BA 2XNCA 1XTRA 2QD5A 4DIBA 4TTIA 3PUKA 4XJXA 1ZW1A 4M9CA 4R1QA 3ITKA 2HWUA 3GVKA 4YV2A 5E6SA 3N58A 4YRCA 3LC1O 2VYNA 1FJHA 3KPWA 1MTZA 1D09A 2QTVA 4YV0A 4Q3DA 3CG0A 1PWEA 1ZCZA 4IXTA 5CT5A 4ZOCA 3GD7A 1CYDA 2P68A 4E12A 1M5TA 5IYPA 3A2LA 4IGFA 4MVJA 1G5FA 1H0SA 1V8PA 2QUBA 4PRLA 2FR1A 3VMMA 3ZTTA 4CFSA 4LG1A 1U7ZA 3VRHA 4QE3A 5KCZA 4ZVMA 3AHCA 1LK5A 1N78A 1VG8A 4R7TA 1NXVA 2QR5A 3U26A 2RH4A 4UE2A 4YHHB 3AVUA 5DWVA 2VJLA 4H6VA 5I7WA 3M1IA 4XQEA 2WUEA 1P91A 3KB1A 4LF8B 4GH5A 1GNPA 2C8JA 2BC9A 4O4HF 3UMGA 2D5IA 2UVPB 4YS6A 2YVUA 2XXAA 4DJDC 5AM2A 4Q6BA 3GAAA 3DPSA 5KTSA 2DC1A 5AOAA 1E8NA 3SFVA 1DTWA 2V8BA 2Q50A 2XTNA 3RRBA 3R0VA 1TLFA 3MJDA 4D3DA 3EXHC 5FAKA 4EYSA 1XNRB 2LZJA 1MGPA 1AGXA 3O75A 5J2UB 3SXPA 1DLJA 1G3IA 1NVFA 3BJIC 4IVPA 4J8PA 1XZ8A 3WTBA 3UMBA 5C1OA 1CUFA 4LRUA 3MCWA 1FQJA 3RU9A 2CE7A 3C3EA 4KXUA 2P5UA 4QSHA 4QO8A 2VT6A 3M5DA 3O1LA 4QGSA 5KDDA 3KOZA 1G59A 1MD9A 3TG8A 1KXZA 4EH1A 2BF4A 3I2JA 4JT4A 3FOFC 1WTHD 1QHGA 4B33A 1AE1A 2E87A 3GDOA 4LXTA 4U9UA 4Z3KA 5J4HA 2A5FA 1E2DA 3BA1A 4LOHA 3TMYA 3QUQA 2D0DA 1R5JA 3OZUA 2HWYA 3L40A 1UBOS 3SIRA 2XD4A 3SQXA 4QBKA 2UUPA 3AY3A 4RZQA 3SOZA 3TUZC 3K35A 1UPUA 9ATCA 1KI4A 4PICA 4PVDA 4IEEA 3QQPA 5DI3B 3OE7D 3CPEA 3HYSA 4YRIA 2VYQA 1VKRA 3OIGA 3QA9A 4K81B 3DM5A 2ZM6B 1ZQ9A 1DPFA 3EQZA 3KBOA 5JY1A 5C53B 1NY6A 1E18A 2DHQA 2BFPA 3GFVA 3MMSA 1NP6A 4YP0A 2W6IA 5DV9A 4NMXB 1U0JA 2WFZA 4ZGGA 4NU0A 5A2QA 3C98A 4HYYA 3HABA 1MIOB 2BMDA 2XV1A 3PQ2A 4MV6A 5AVXA 3PHLA 2XCRB 1CDOA 4EI9A 1MOPA 3TBHA 5CHYA 3T3EA 4BUZA 3KK0A 4JBYA 5CLIA 4CDRA 4XNFA 2C97A 3GVXA 2R7NA 5ALLA 2ABWA 2ZJ1A 1UC8A 3TBFA 4DLRA 4JC8A 2CJXA 4S1PA 2FI1A 1IHMA 1GV1A 3B20A 1CNEA 4DLSA 4M7RA 4RDIA 1KHTA 4YAUA 4JR0A 3L7BA 2ZAMA 3LCMA 4P33A 4X07A 5EGSA 2EFJA 4Z4GA 1JWLA 4I4LA 3NYIA 4HNAA 2EZ4A 3H2ZA 3DT9A 3IJRA 4NAVA 5FBQB 1IATA 1N2EA 4KPFC 4EZIA 3UMYA 5L7WA 4ZHQB 4WVLA 1GPLA 1QYCA 2BFOA 1X9HA 4Z4FA 2D62A 1EK1A 1N6HA 2I7XA 1Y1RA 1N77A 1GSHA 1SKAA 4BQRA 4D7AA 4EGAA 1NULA 1GG9A 4B7AA 3FWKA 2X2OA 4JP8A 4LSGA 4OI2A 4ROXA 4XVCA 4MUXA 4LMAA 2BTEA 3CLTC 2CFTA 2VRNA 5KWSA 4H4EA 1FP7A 1ZOLA 3QPAA 3LKZA 4NCXA 3HZHA 3IC5A 4PSAA 2RCYA 1D2EA 4QC2A 2H57A 3BIOA 5E9AA 5TIIA 1JF8A 1A77A 3NOOA 2LIPA 4K88A 2NZWA 3MXOA 4LX8A 3PG5A 5C32A 1WXHA 5M29A 3O8LA 1PG0A 5CITA 1PR0A 1VMAA 2ICAA 3EX7C 4Z8YA 4NU5A 2XDYA 2YMLA 5ARBA 1I6LA 2OLKA 1QFMA 1CRQA 4MI6A 5AXDA 4D8UA 2PYIA 4NENB 2BCJQ 2V4ZA 2GVDC 2ZT5A 3BD7A 4XR9A 3HU5A 4QD3A 2EIXA 4ZZIA 3WGHA 5LU9A 4B7CA 2HK9A 1FFCA 2E55A 2QGNA 2ZJ0A 1NMYA 2ZQYA 4TXNA 4PWYA 1THTA 1Z0UA 1Z34A 2ZR8A 3A9VA 3OEWA 3DF7A 2KSQA 1PJCA 4F8YA 1M90D 5DSTA 4F04A 4WLVA 1H6AA 1ZGGA 3MSCA 3UK0A 3GLGE 2BMAA 1OAOC 3N0XA 1KSJA 2JCGA 1YZFA 1OA0A 3DAFA 3SHFA 5C37A 3SZGA 4RPKA 1FNBA 1M1KD 2JG3A 4YCBA 5BRAA 1I6WA 1HQKA 1XTQA 4HSGA 4LPSA 3LCJA 4DDUA 1NKVA 1RQ7A 1ZRMA 3ZYCA 4LQDA 5CA1B 1K7EB 2D2VA 3AUSA 1KD1D 1XCMA 3AM3A 1MIHA 3C3WA 3LI2A 1G8MA 3NHJA 4NVRA 2SHKA 3S2YA 3UHOA 4F2GA 1N5LA 3MTAA 2PGLA 1UM9B 3RDPA 3VH3A 2QL9A 3TXAA 4JV5B 2GJPA 4YCDA 3I9FA 2JRLA 4EWLA 5F98A 5KKAA 2G1UA 2B2XA 1GIAA 4ASUA 5C8DA 1CB7A 5M34A 3THXB 3MN1A 1N8NA 3JD1A 5EPUA 3KYDB 3UTCA 3KL2A 2R47A 4G85A 2OFWA 3DMFA 3WG9A 3ZE8A 3CZ4A 2H7YA 3R09A 2ZR7A 1I14A 4G3XA 1G7RA 1XEWY 3E20A 4Q66C 4ND8B 1FTYA 4YJFA 3GFBA 2C1XA 1BA3A 2FMXA 5F3DA 3GFFA 3G5LA 4AP9A 4DSNA 5ICGA 1O0SA 4PGFA 4ARCA 4I9UA 2ZBUA 1UXKA 3I55B 5EXEA 4XZ3A 1TU3A 2ZT7A 2IV2X 1MO4A 4DM7A 3S1SA 4LXIA 1VP3A 2FSVC 2IU4A 3IUMA 1HT3A 2XNDA 3L7LA 3LVBA 4R84A 4XPIA 5IH7A 3HHPA 2IHUA 4RDXA 5TGTA 5BSWA 1TX4B 1YZQA 3GLFA 3A37A 2R86A 4AJ4A 1IB0A 1G9XA 4IDBA 4NDAA 1DFGA 1QE5A 2FP4A 3THSA 3LNTA 4TPKA 3AF2A 4WNAB 1YFZA 4WNIA 4F5EA 2P5TB 3WICA 5AVTA 2RB4A 4WY8A 4BAUA 5BVHB 4MV9A 1M2EA 3D43A 3G2JA 1TQHA 5BXQC 1XQ1A 1B23P 2BMWA 1U3GA 3EFBA 4HGPA 4XDGA 3K9WA 5FORA 3OZRA 1QKKA 4QLBA 4PR3A 1S4QA 1XMJA 4MB6A 1GZ7A 4WCVA 2MSNA 3B85A 4MX8A 3HM2A 4BP3A 5TRDA 4M8KA 1D2HA 4KAAA 2GNOA 1LPBB 3WKAA 3PHIA 2B8EA 5H0IA 1ZUD1 4Q37A 3VHQA 2HGZA 1P2SA 1EPUA 1YAJA 1UBHS 2R751 4BVKA 4HP8A 5FPKA 4GM4A 1IZ0A 1PJ4A 5HRUA 3JVDA 1ECJA 1GPKA 2E89A 2AUMA 2JI4A 3LWDA 4I5FA 5KTNA 3M81A 3F6CA 2X7JA 1CUVA 2VJCA 3DOFA 3U3JA 2VBTA 3RIXA 3EGDA 2C4UA 3NBAA 3PTLA 1KEZA 4FNGA 3RU2A 4I9NA 4BO4A 3IMCA 821PA 1D1QA 1SXIA 3INGA 3L7JA 3P9KA 5DNYB 2Q3EA 3SSOA 4CKWB 2VSQA 1RLTA 1UJNA 4ZQGA 1LLUA 4ZT6A 3R3HA 5CXQA 1GKKA 2DULA 4U9IS 5C1DA 1NLMA 4WK2B 4X66B 3JTEA 2B2NA 2H1RA 3NIGB 4JENA 1GSAA 1A1VA 3OP1A 1NW3A 3AEUB 4G5GA 3OJEA 5T4EA 1MF7A 3ZI0A 3D6VA 3JVUA 4FR5A 4PLGA 3UT5A 1Z35A 1JIVA 2FDXA 1NTRA 2FQQA 1G3UA 4AYWA 4JEMA 1RQNA 1YK1A 4LY0A 1BVUA 1ZD3A 2GZHA 3QE0A 1QCCA 1E3SA 4CKZA 3LO8A 1FS5A 2G5TA 1GTG1 2IYQA 4FYHA 3G85A 4G8JA 2IUUA 4CIDA 4RADA 2QTLA 2GFHA 1VHWA 1IH8A 4FINA 1XL1A 1L5MA 1MPXA 3KB2A 3PEYA 4KHPB 3K96A 3GJ7A 3GAZA 3E81A 3HZZA 4LDPA 1E1LA 1NBME 2DH6A 4DMRA 3ZW9A 3CUTA 4Q1CA 5CG2A 2P3SA 1GYQA 3TQIA 3EEOA 5B4VA 3D54D 1TIKA 1BWRA 4MGIR 2IE8A 5LA6B 2BH9A 4FJ2A 1UD2A 2IYYA 2AOTA 1ZD8A 4OQXA 2WMDA 5CJJA 3COVA 4J9UE 4F1JA 3MTDA 3RUHA 1H2XA 3LSTA 3PIDA 2CV1A 3VZPA 1F2VA 3PC2A 3E0QA 3KC2A 2X6TA 1BE6A 4PABA 2V7UA 1NONA 3LVRE 2Z5FA 1PR3A 1YJCA 5J2TA 5CLFA 3RS5A 3CF4A 3TVTA 3RTAA 1HZJA 2YIMA 5CYGA 4Q9LA 1IUNA 1LWNA 3RS4A 4HNUA 3SQMA 4XM0A 1PGOA 4X5OA 1Z0DA 3FCOA 3UJAA 1F17A 2AD1A 4UCQA 2Q6TA 2PVSA 4WKPA 1OBFO 1L8XA 4EECA 3BXEA 4NNPA 3RUCA 5CBPB 2ID4A 2BFFB 2P75A 3ILVA 5ELXA 2OCAA 4D3ZA 4XQCA 1B76A 4HX5A 3L93A 5FOVA 2VAVA 1UZMA 4RDCA 1YE3A 2CWDA 3C3CA 1NXOA 1WMEA 3E9QA 3EODA 4INOA 4WOCA 4D8WA 1DCMA 3S2UA 4A0RA 3SCZA 1FYFA 3D8SA 4XOIA 3BL5A 3Q9NA 3EF0A 4GSKA 3JRNA 4E2YA 1KJYA 3QTTA 4OUDA 2DQYA 4B7UA 2QVZX 2QW8A 3EEQA 3LPNA 1Y3CE 4CL0A 4CT0A 2WKSA 3JD0A 4KKSA 3TIFA 1ICEA 5I4CA 4QYIB 4ZT2A 4IRUB 1DKOA 1VDMA 2YN4A 4RIFA 1CVLA 2V3CC 3A1SA 1ZI6A 3FOCA 3PZRA 1EWVA 2NUPB 3HN7A 1U3DA 2GCIA 3UMJA 2WB2A 5IH3A 3TDNA 1PFKA 1V3QE 1X6VA 2PT6A 2H4JA 3IOEA 1O6FA 4HUQB 2DAPA 4LZLA 4QKQA 4ESOA 4MGZR 1IEQA 2OBLA 2F64A 5F2OA 2CHVA 4L51A 1JR3D 3OA2A 5L3QB 1OX6A 1AXGA 3ZNNA 3T9BA 5CH3A 3KQOA 5AT1A 3D8TA 2C9OA 1YWGO 2EVWX 2X8BA 3NYQA 4LNHA 4RSHA 1N2XA 1EQUA 4XWYA 1MPTA 1T0UA 4YRAA 3UJ9A 4PHHA 1T4BA 3R23A 3HJRA 1LBHA 3N75A 4MCIA 3EDQA 1L5HB 3C4VA 4KKTA 4X85A 1DO0A 3RGWS 5LYJB 3BSYA 2C78A 2ZYVX 3PWSA 4R0VA 3DTVD 5ENVA 2WFLB 1MGOA 2IYXA 4E07A 4D02A 3ELWA 2V7QA 1T5DX 3PJFA 3BG5A 3IEPA 3L7KA 3JAMA 5K4AA 4V1CA 3P71T 4OIMA 1LTKA 2WHQA 4LYAA 1B14A 2B4AA 2R7MA 2P9JA 5FCDA 1B2LA 1W75A 1O4WA 3OM0A 1TEXA 2D2XA 3DE7X 5DRYA 2PKYX 1K4MA 1DIAA 3LWNA 4EEZA 2Y66A 4R1MA 1Z2OX 1QOZA 5F7OA 3K9GA 3VZQA 1TF7A 3ZGXA 2YHIB 1V5GA 2AZ4A 1RDFA 3ITEA 5JPDA 2HJWA 1ZXLA 3GGJA 4FYMA 4QDTA 2JAQA 4QFDA 1Q83A 4U7WA 2ZUSA 1KFJB 1E6CA 1MB3A 1EAMA 3PHBE 3ZXSA 3UMCA 5ER6A 1UKZA 3MRVA 3MCZA 1U1DA 1N25A 2J33A 3EAGA 5GINE 3D4BA 4MUYA 3FWPA 2P9CA 4GE3A 5NLLA 1NQXA 2A78A 3KJIA 3OZEA 3V4SA 1Y6QA 1NDQA 5CGQB 5TJHA 4YMTA 4JYBA 1U90A 9ABPA 4HD8A 1VQNB 4RSRA 3ZX4A 4N54A 4O29A 4ZQCB 1W73A 2UUOA 3ONVA 4IX1A 5AM4A 3LUHA 1LNZA 4M8IA 2PQ6A 1GUDA 1WB4A 2PUGA 4MW1A 2EG9A 4N6OA 4ZU3A 4IHQA 2LCQA 2GN9A 2RHDA 3ISVA 3SF0A 2EZ9A 1U4NA 4EAAA 4WJLA 5BMVA 3BGVA 3GYGA 3NJ8A 4PZ9A 3BYZA 4BNTA 4Q4CA 5JBQA 5CH8A 1T4DA 3WMRA 2Y68A 2WKQA 2WRZA 3K0CC 3GT0A 4CMJA 1ZUNA 4HVLA 4GVXA 4TMTA 1JLHA 4J1TA 5BYBA 1XVUA 4O0MA 1B2RA 4RXMA 1WY7A 3PDWA 3ZDZB 1PVOA 1F48A 1KEVA 3LZ6A 1YFLA 3UANA 4JI2B 1XTJA 2XGOA 1ZKMA 4D9EA 2Z6QA 2IV7A 4TSFD 4KVAA 4PTZA 5LMCA 1CUHA 1NNEA 4D8XA 4M9UA 4Q02A 3OX4A 3SZUA 4ZVVA 5HUQA 2Q2NA 2G83A 1A50B 1YZKA 2XEDA 2QRGA 5AVKA 4C6TB 1M72A 4WOKA 3DJYA 3EB9A 4Q1VA 5TLSA 4O8CA 3AKCA 1PN3A 2WJYA 5ALPA 1Y9EA 2IHVA 3OCYA 4Y67A 1GUYA 5KC9A 1Y8QB 1KSHA 2YWEA 1ODLA 1VOTA 2WJAA 4IWYA 4KXLA 2OXCA 4RH0A 1ZJWA 2NUAB 5F2NA 1C9MA 3T38A 4P9SA 2AEFA 1ADCA 2V5UA 1E61A 2V58A 2CL5A 3HY4A 3DUFB 3NORA 4B81A 4CIYA 2FMTA 3W1EA 2ZM5A 3CW8X 4EGSA 5KI6A 1RXSA 4C7KA 1R0KA 2CJPA 2NU7A 5TF0A 5CG1A 3KEMA 4Q9KA 1JEJA 1TQ8A 1WHSA 3V7YA 1ONOA 3R8FA 4E31A 2G70A 3A8JA 5ESXA 3B9BA 4OUKX 1KRWA 2FJ0A 2HUNA 3BMOB 3O7MA 1KWKA 3V4FA 4BRWA 2AJTA 4BP8A 5HIJA 1YCGA 5L8VA 5FQNA 5AVQA 4GLOA 2AG8A 4XYLA 4GYYA 2FUKA 4BO9A 4EIWA 2C3YA 1XQBA 2FPRA 3NXKA 1F4VA 1HBJA 4IJKA 4ON9A 4QOHA 5AW7A 1MJFA 1AF4A 4P32A 4BASA 5ILOA 3IT0A 2PCLA 3C6YA 1YS1X 2GBGA 2GPNA 3IV9A 4UVEA 2V6GA 3K4QA 3CPWB 4CV2A 1LZKA 5L95A 3ZWCA 4IG9A 2GEJA 1GUBA 4Z3DA 1BGWA 2ZSHA 5A9TA 5P8WA 3VOSA 2CC2A 1ISMA 4JSRA 3MK31 1RQLA 3F8TA 3NBUA 2QTHA 3G89A 3IMEA 2VLBA 1DC3A 2ZT6A 5H8WA 1ZL0A 2VCYA 1DRKA 1JKJA 1UBTS 3IR5A 3NCHA 5KKNB 4Q3AA 2GMWA 4YP5A 3OU7A 1TUEA 4OLBA 2QENA 6LDHA 1L5ZA 2O19A 4AKTA 3T5MA 1SG9A 4GPTA 3RRZA 4TVSA 4MV5A 3PUMA 3H9BA 2FRXA 4ECAA 4Z4TA 2PUBA 4Q82A 3CLSD 1E79A 3FWYA 3KOUA 4UHKA 4PSUA 2IS2A 2B82A 3U6KA 4UZEA 2GEFA 3DCJA 4U1RA 3PQ5A 4OQLA 2ID8A 2XLCA 5DNWA 3T34A 4CF3A 4EPWA 3J80A 4UZUA 2QW1A 3LLUA 4JZYA 2WD7A 3EK2A 2AKYA 3RBVA 3K32A 3LQ4A 5F4OA 1LI4A 4BVAA 1GL9B 1GG5A 4NYIQ 1EFTA 1SBNE 3I12A 5EWLB 1BH6A 5HKKA 1YRLA 1Z12A 2FCRA 2HJRA 5LOVF 2H1SA 4MV1A 4H7DA 3SKVA 4K6GA 2J4DA 2GTIA 2P77A 3M4NA 2IUSA 3VKUA 1PR5A 3VKHA 1U8XX 3BXXA 3AJRA 2CLFB 4UTZA 3DB2A 4IMIB 2ONJA 1U7HA 4LGVA 2PLFA 1TZKA 2QTWB 1LQ2A 2UYYA 3PCXA 5BURA 2OGSA 1OHHA 1XKLA 3DP7A 4XD7A 2QY6A 3IE2A 2Q29A 3FOWA 1VDZA 3RUDA 2O8CA 3U4GA 3GJZA 4ZGNB 1IZYA 2VKQA 3ZWDA 4BTVA 5CB4B 3NEAA 2YBEA 1G42A 1ZIXA 3FDZB 3WP1B 4QDZA 2G80A 3EGOA 2NXJA 1D1SA 3PC8C 3C7AA 4C14A 5I6DA 3NHYA 4X3OA 5D7NA 4OXKA 5J40A 3SR4A 4BNMA 4DWVA 5LL6P 2O8FA 2WF5A 1MW9X 4LGCA 2LNDA 5BN3B 4TKOB 1X7WB 3UMRA 2XYHA 1NW7A 3U9TA 1GCUA 1JEAA 1V1RB 2HRCA 3NO4A 2X4DA 3CU5A 3D9QX 4S04A 4MR7B 1HNXB 1U0OC 3S4YA 5DIFA 3TSCA 1I7SB 1KH3A 1NQUA 1JIXA 1H2YA 1PGPA 2GVNA 3K5PA 1ORHA 4EHLA 2H2FA 2Z5GA 3ILYA 2YR0A 5IBCA 1FYEA 3AXTA 1J21A 1V5EA 4ND6A 1YR7A 4Q9IA 1TIBA 3SICE 4AMBA 2CLHB 4B6JA 1VSQA 4PYJA 2HC9A 1EHIA 3CUUA 3HGMA 3LBYA 1QR2A 4H1WA 5GV8A 1FZQA 1M0SA 2DY0A 2R4UA 3LLCA 1MJGA 3CN9A 4IFEA 4BO1A 1EGAA 1YOVB 5F4JA 2YY5A 2Y1EA 1E4EA 2W8BB 3ABQB 5LIPA 1MX5A 5FOTA 5JYBA 4KCGA 3UMFA 3V9AA 1CQPA 2UVQA 2ZSEA 3N2KB 3PGMA 5G4KB 4YUVA 4RELA 2R6ZA 1Z26A 4C7XA 2HHCA 3H5RA 4L8GA 5F51A 5THKA 4UVHA 1E2HA 2ZWVA 2HRQA 4X00A 1L7NA 1SCAA 2H2WA 3L6CA 1D9ZA 1PAUA 3GMTA 1EM8A 3EOZA 3FAKA 5FI3A 3Q6RA 1YJ8A 4K05A 3NG1A 1KIFA 1X7ZB 3I4FA 4JLDA 3EZ2A 2DLCX 3F78A 1ZD1A 1Z45A 2VJPA 3EIXA 4REOA 1DAKA 5EZ5A 4KPEC 5ERXA 3TOZA 4RK4A 3C1UA 1YZHA 3GGCA 5ESWA 5TDHA 2FKNA 3KHKA 3OUUA 1ZUWA 4B6PA 2JHGA 3BBPA 1IC6A 5ICEA 1Y1QA 3ESQA 3OD1A 4UFOA 4FSXA 2MSEB 3R41A 3PXUA 4PO9A 4L02A 5H9WA 1XKTA 4WEOA 1TKBA 4HH4A 5BQXA 1MB9A 2ZSUA 3JQAD 1TI7A 5AN9A 1PTJC 2VH5R 1DIBA 3B1XA 3HJUA 3MNFA 4PTYA 4P9NA 3P26A 2JFNA 1ZQ1A 3K05A 4YJ3F 1OE0A 2AXQA 3I9V1 3P2EA 4OGGA 2I6XA 3D3EA 3FUCA 3QX3A 2GPBA 3ME5A 4D0LB 2XCOA 3C3YA 4WKOA 3VNSA 1A9SA 4S1WA 2D1QA 3PZBA 3Q7RA 1VPEA 2WR8A 4H77A 5DHFA 3ER8A 1SUBA 2HEIA 3GCZA 3S7TA 3P0HA 2ZBEA 4FMBB 1GPDG 1YRYE 4ZI5A 3IIIA 3JYHA 1WCXA 4I55B 5JCXA 3WYGA 3PR2B 4LRYA 5JZMA 3NVDA 5DTMA 1E7MA 4GO1A 2JLXA 2BGWA 5K8LA 4AROA 5BPFA 3AERA 3M2PA 4WXYB 1Z63A 2F00A 5D87A 1PZMA 2QLFA 3SEAA 2JNWA 3B6JA 5ULLA 5C8YF 5DSXA 3TW6A 1OU0A 3QEMA 1T15A 4B6SA 3FUVA 1EBUA 1ECCA 3PHJA 2WSSA 1P77A 1N6PA 4HT3B 4XVHA 2A8YA 1KK1A 1MHPA 1GFSA 2UYQA 4B7ZA 1Q1NA 4RS3A 4XUEA 4DCUA 4H6PA 4OV6B 2ZUCA 3V4ZA 3JR7A 4Q3EA 2ZB2A 2MR6A 2F1JA 2RH5A 4K2HA 1EGHA 1WDTA 5CLJA 4RFLA 1DXYA 3ENNA 5FLEX 3GJSA 5L3ZA 3U4MA 1RQRA 1OYWA 1PJAA 3II6X 1WPRA 4CKXA 1UZUA 3JARA 4HWGA 4MAMA 4OSOA 3CCVB 4UXHA 2DT8A 5A71A 3OFNA 5AQ1A 4DSZA 4CKCA 1M2VA 1FVOA 4WZKA 4P3IA 3GROA 4BJHB 3FTCA 4JBXA 1BQ4A 1USIA 2G63A 3FY4A 2X4IA 4BXOA 1ACMA 1HZEA 4IXWA 1SXJD 1CB0A 4F6LA 3OTOB 4KJZA 4F12A 4W82A 5BW5A 3OMLA 4JP1A 1KFBB 4OA8A 3ZZNA 1IIBA 2GPJA 2D5CA 1M2GA 1XP5A 3FVTA 4LXUA 2AEJA 2X5KO 4PSVA 4YP7A 2XVZA 4MKXA 1EI9A 5A02A 2Z83A 5IU6A 4H16A 4NICA 2P11A 3WLAA 1BG6A 1CEQA 1SBCA 2B7CA 3DA8A 2FRVA 4N8DA 3SKXA 4ZYXA 1IHXA 3LY8A 3PFNA 3LCCA 3DDZX 1TTHA 1KIAA 5A5DA 5JVDA 2V9PA 1G6KA 1J00A 2QN9A 2H2HA 4B6FA 2HU8A 2QK4A 5MFZA 1NDUA 1L4MA 1MO5A 1JQJC 2X6QA 4D1YA 4RHEA 2A0WA 5B4UA 3Q3GE 1KWGA 5HDBB 1J8YF 1MTOA 1Y5LA 2PKQP 2X8WA 4D9NA 3C5VA 3I4LA 5BNWA 1XEXA 1ODJA 1SC6A 4UD6A 5GM2A 2OFXA 3ADOA 1ORVA 4V3CA 3T3GA 3WLQA 4L73A 2E0IA 1K7SN 3A70A 3CB4A 2IPOA 2OCGA 3LW7A 3OPXA 1LJLA 4EHFA 4AD8A 2X58A 4GZ5A 2BEWB 4LHEA 3EBOA 4YBZA 1LB1B 2W83A 2LWIA 4ZT4A 3H9NA 1VBMA 3F7OA 3SU8A 2YXNA 3AF4A 1ODCA 4IQFA 4IUBS 4XUDA 1A72A 3NV7A 2FVXA 2J7PD 4X8HA 2G25A 1AGRA 1U81A 3BB1A 5A4JA 2IQIA 3PPIA 3TX2A 2FZGA 4BZXA 1UMCB 1ZC4A 3WGGA 3R44A 2V3WA 3L07A 4DZTA 2O0LA 1J0EA 3K2EA 4I0WB 4JK3A 3RC8A 4ACBA 3CEHA 1E1CA 2J6HA 5EINA 1IDOA 4G4GA 1RNLA 2HRRA 4WBNB 2RJOA 2AFHE 4M88A 1HGXA 3VNRA 5C18A 1J9ZA 5F4ZA 4P35A 1QAOA 1USKA 4IFTA 1P0CA 4REMA 1KYXA 3LP5A 4M1YA 3LDUA 5CDFE 5IAOA 2OB1A 4XLFA 4U0KA 3AONB 3HKDB 1G5TA 1XAHA 2O7VA 4BUJA 1WXIA 4JJEA 4WGGA 3V9PA 2WJZB 4JBWA 1CRLA 3OBBA 1J7JA 1W0CA 2OXEA 4NBUA 3FHTA 4AULA 4JJIA 2HCRA 1E3ZA 4CETA 2C4MA 3BCSA 4D80A 3UPTA 2ZZMA 4IPTA 5H81A 4F5YA 1M34A 2CFCA 2QRHA 1T1EA 4OKNA 5EIWA 3W8FA 5DNVA 1T36B 4TLDA 1UJ2A 3I72A 1E9DA 4ALJA 1UOPA 1LBQA 4AJOA 3HN6A 1NC1A 3TRKA 4I1YA 2FPIB 3EXIB 5EHNA 3TZQA 3TTYA 3Q7IA 3R1IA 2EFCB 3UG6A 4EY7A 2ZPAA 3SPXA 1DS6A 4JU9A 1W59A 3LOPA 4M7PA 2XNSA 3TW8B 1SC9A 2I1LA 1WP6A 4QUKA 5EKTA 4X8LA 3AETB 5K09A 1OZHA 5BN4A 3L1IA 2W6CX 1G21E 3TJRA 3N5CA 1ZH4A 1QDLB 3PQ3A 4JC5A 3NDJA 1THZA 1E60A 1Z6QA 3EWIA 5JLAA 4WZAB 4NKRA 2HDNB 2I55A 5J43A 1M6VB 4DMLA 1RCFA 4X8IA 3D6UA 4GPIB 2QVCA 1QPZA 2BKUA 4DLPA 4E0FA 5KYWA 4X7RA 1N2BA 1QQ6A 3GUZA 4OUDB 5ALEA 3EGVA 1WEHA 5FWNA 3WFIA 2AVDA 5IJ0B 2QP9X 3A0UA 3X1ZA 3SAJA 1KI1A 1M8JA 2CF4A 3GLIA 2X85A 4ITRC 4CM6A 5B37A 2FFBA 3F6BX 2I4LA 4TKVA 2GD6A 1R50A 4EF4A 5K3SA 3TCXB 3LUAA 4Z9BA 4UU0A 4PZLA 4JEIA 2C99A 2J85A 1RYMA 2JA2A 1YH3A 1EBBA 2VRCA 3ZDCA 3GJTA 1PEKE 4MIEA 5C81A 3EGIA 3RIHA 1OXUA 3G1UA 4QUGA 1LEHA 1E1QD 1SC3A 3U3OA 3GJRA 5AESA 1F38A 2VHWA 1NXQA 3MAJA 4TKMA 3FOZA 3HWSA 3ZK9A 2QMHA 4YFYA 4CG1A 3HYTA 3O0DA 3I62A 3JWEA 3HKBA 2ZUTA 3N39C 2CXHA 1PD0A 1FFHA 4FZ3A 2XF8A 5K5EA 4M99A 3L5KA 2ZIWB 3O9MA 5K8VA 1OB5A 3PKJA 4WUVA 3DFZA 1W5EA 4GQBA 2PBLA 2D6FA 1VJSA 3RUIA 4KQFA 4Y1RB 5ALGA 2P2GA 2HIGA 4R9NA 2I3AA 2JGDB 2P6OA 4FD3A 2JJ8A 3EFOB 4JSTA 1NE7A 1HSOA 2YXDA 5ESDA 2O8BB 3RLFA 1GRQA 1W4CA 4X97A 3JD2A 2YVQA 4K2AA 5CB6A 3EPKA 1W47A 2EP7A 2V0NA 1PJ7A 1H6CA 4ML3A 1K3FA 5T67A 3R7BA 3T7TA 1L1QA 1ZISA 5E6RA 5BV7A 5FA8A 3I5AA 4TLMB 1U1FA 3U3DA 3ZGYA 2IP2A 4ER6A 1L5RA 1RHMA 3ICCA 3OJOA 2AD5A 1OGYA 5I9LA 2F8MA 2EEPA 3DE1X 5GMOA 1PNTA 2QVXX 5BR1A 2YIVX 4GKBA 5FHRA 3HRHA 4YRPA 4MI3A 1ESCA 5DXJA 2OCKA 1YITB 4N3NA 3FRHA 1SBTA 2J08A 5CFZA 4HEJA 3EISA 3MS4A 4G4SP 4L4UA 4WFKA 2QMUA