2XNJA

Crystal structure of an engineered ferredoxin(flavodoxin) nadp(h) reductase (fpr) from escherichia coli
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
255
structure length
255
Chain Sequence
ADWVTGKVTKVQNWTDALFSLTVHAPVLPFTAGQFTKLGLEIDGERVQRAYSYVNSPDNPDLEFYLVTVVYTNDAGEVVKGKLSPRLAALKPGDEVQVVSEAAGFFVLDEVPHCETLWMLATGTAIGPYLSILRLGKDLDRFKNLVLVHAARYAADLSYLPLMQELEKRYEGKLRIQTVVSRETAAGSLTGRIPALIESGELESTIGLPMNKETSHVMLCGNPQMVRDTQQLLKETRQMTKHLRRRPGHMTAEHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN NADP-H REDUCTASE
publication title Swapping Fad Binding Motifs between Plastidic and Bacterial Ferredoxin-Nadp(H) Reductases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 69
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2xnjA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2xnjA02
1QFYA 2BM1A 3QE2A 4FN5A 1S0UA 2DCUA 3CCQB 1NJID 4B43A 3AVVA 3WNCA 3CCUB 4AC9A 4EH1A 1G7SA 4YAWA 4LC0A 5TR9A 4PGOA 4YAUA 4P3YA 1JNYA 3B82A 3LRXA 1WDTA 5HXBA 1GO2A 1D1NA 1QFJA 1TTTA 4M4SA 4H9GA 2C78A 4HE6A 5GV7A 1M1KD 3OZWA 4QHYA 4R71A 1BX1A 2RC5A 2YWHA 5TY0A 3CCSB 1FNMA 1QGYA 4Y9RA 2OK7A 4LBVA 3CCJB 1SKQA 4ZCMA 3CCVB 1N8RD 3CCLB 3B8HA 2J7KA 4RD3A 1KD1D 3W5HA 4FK8A 4P6VF 3E20A 3LO8A 5GV8A 4TMXA 3CCRB 3AVUA 3AVWA 2VNJA 1KRHA 1GAWA 1QUFA 1EXMA 4YAOA 1D8TA 3W2EA 1IB0A 3G6EB 2PIAA 2CNDA 4TMZA 3WBKA 1CNFA 1YI2B 1QGAA 2GPJA 4FWTA 1CNEA 2VNHA 4G1VA 4RD0A 3CCEB 3WYAA 2VZLA 1FRNA 4PC7A 2BMWA 2BV3A 1GJRA 2BGIA 3VO1A 4RD1A 4PC1A 4N3NA 1CQXA 3AGQA 4ZCIA 1KQSB 1VQ4B 1KK0A 1EFCA 1EP1B 2QDXA 4C0SA 1H85A 3W2HA 1DDIA 2DEUA 2BPOA 2HMAA 5DSZA 1E63A 1JA0A 3AGPA 1QH0A 1R5OA 1FRQA 1EFUA 1QVFB 3WNBA 3ZZ0A 4BPRA 2QN6A 1VQPB 3SJZA 1W35A 2QTZA 1SM4A 4RCYA 5H5JA 1VQKB 2QMUA 1K8AD 5TV2A 4DQLA 4U9UA 1FNDA 3QFTA 1KJZA 3OJXA 1VQ8B 3I55B 1JA1A 3QSYA 1B23P 2B7CA 4N3GA 1IJEA 1VQMB 4B4DA 4LBZA 1JB9A 3MCAA 1W34A 1TLLA 1GVHA 1XB2A 4RD2A 1QG0A 2NPFA 3ZZUA 1ELOA 3V76A 5JBQA 4M1KA 1DDGA 1YJWB 3JQRA 3P27A 1YITB 3AVYA 1XE1A 1K73D 3QFRA 2BSAA 1U2RA 1G7RA 3CCMB 4QFMA 1JJ2B 2C77A 2XNJA 2PMDA 4K1XA 2RC6A 4WQMA 3QFCA 1YHQB 2OTJB 4M0LA 4MYUA 3W2FA 1ZM3A 2DY1A 3LYUA 3U2QA 2EFGA 1G7CA 2EIXA 4M53A 1D2EA 1E64A 1B2RA 3AVTA 5AN9A 4NBSA 1FNCA 3CMAB 4ZGNB 1YJNB 1OB2A 3E1YE 2YWGA 3W2IA 1QUEA 1W2BB 4YAFA 1HA3A 1EP3B 4Q7JB 4Y9UA 3J81k 1K9MD 1N0VC 2VYQA 4ZV4A 4LBYA 1F60A 1UMKA 3I1FA 4HE5A 3U6KA 3OJWA 1VQLB 1ZM9A 3P26A 1H42A 3CRZA 4UAJA 3OZVA 2YWFA 1DARA 2AHOA 4YALA 3WNDA 2D74A 2DERA 3CXCB 1J9ZA 3ZBUA 2QEXB 1VQ7B 1BQEA 1EFTA 1ZM2A 1N0UA 5H59A 1GR1A 4RD4A 3U6BA 3JQPA 3AVXA 1OGIA 1FDRA 1G7TA 1AMOA 4F7DA 4G5GA 2ZITA 1VQ6B 5EMNA 3G71B 4TMVA 2BGJA 1KK1A 1QGZA 1ZUNB 2YWEA 3I56B 5FA6A 4M2LA 4TMTA 1KK2A 3OW2B 2HDNB 4AF7A 3FPKA 4RD6A 1GAQA 4ACAA 1QFZA 4PC2A 1YJ9B 1KC8D 3B78A 1BJKA 2XEXA 3CMEB 3CC4B 4B47A 1W87A 1QVGB 1TUIA 1VQNB 2VNKA 2X3UA 4YHBA 2BN4A 2BF4A 2HCJB 2R6HA 3CB4A 3ZBTA 1Q82D 4RJLA 1F20A 4ZGQB 4PC6A 3CC7B 3VO2A 3WY9A 1KTVA 3CC2B 1A8PA 2QA4B 2DETA 1Q81D 1R5NA 4DQKA 1YIJB 4ZCLA 1Q86D 1EP2B 4RCZA 3VNUA 1S72B 3W2GA 1EWYA 3A1FA 3G4SB 2B5OA 3PENA 4B3XA 2OTLB 1E62A 4ACBA 2CRVA 2PLFA 4B48A 3QFSA 4LBWA 1OB5A 3FJOA 2FX3A 3MMPA 3ZZTA 4TMWA 1BX0A 1ZM4A 3W5VA 2QTLA 1M90D 1DG1G 4IW3B 4PC3A 4G1BA 4AF6A 3VMFA 1NDHA 2XNCA 2VNIA 1I7PA 1IJFA 2E1RA 1VQOB 4TN1A 1QX4A 3ES9A 3CD6B 3LVBA 3WBJA 3WXMA 2B7BA 3OZUA 4NCNA 1AIPA 1VQ9B 4Y7CA 3W5UA 3MHPA 1TVCA 2OK8A 3CW2A 4MYTA 4B44A 4C43A 4J0QA 2BVNA 3ZC3A 1FNBA 1VQ5B 2GQFA 1OGJA 2BM0A 5KSWB 3VNVA 1Q7YD 1KK3A 3CPWB 5THXA 3JQQA 1R5BA
chains in the Genus database with same CATH superfamily
1MAHA 2QZPA 1QFYA 3DV0B 3KKLA 4MWEA 4TV8F 3CZCA 5B3AA 3TZCA 2YZNA 4ZJYA 3BGDA 3MSCA 4FI3F 4NVRA 3ANYB 3H7IA 3T3IA 1VKJA 1KI3A 1EG2A 2H07A 4PEVA 1DRUA 2QD2A 4BKPA 5D00A 4Q7LA 3LWZA 4OF4A 2FPMA 3NHSA 1U0SY 1QNLA 3E0XA 3ND7A 4LRYA 3KQNA 4AC9A 2YR0A 3C6BA 4P0TA 3WIOA 1BYUA 1EH5A 3NO4A 3D5QA 4RPHA 3EH1A 2JAXA 3ZDFA 1EFLA 1FNSA 3NB0A 4ZU6X 1K0UA 4EQ6B 4US2R 1TVMA 3VZSA 2JJ2D 2X40A 1E0KA 1BD4A 4PGGA 4PGOA 2CYCA 1ZH6A 2WUWE 4UNPA 1HOTA 4YRGA 1LTHR 1M1ZA 1BDJA 4FGSA 3TIGA 3GEEA 2ZZEA 4DCOA 3U56A 4HPXB 1GNSA 4O4HB 3VC1A 1HTWA 2EDAA 4IYRA 1GAXA 5I9BA 3L7NA 3LRTA 2F4VB 2H9YA 4PLCA 5M5BA 5HOQA 4ZZ3A 2VNSA 1U9ZA 3EBOA 4QVIA 3A4NA 2PX0A 3E9ZA 3K0HA 1EG7A 3PV0A 5C1IA 3DCIA 3NIGB 1DEOA 2HBYA 4ENVA 5I7AA 1YS6A 2V96A 4GMHA 3QPCA 1WETA 2LKDA 2NXCA 3K09A 4CMKA 3VC2A 1RI4A 2RC5A 4PR3A 4Z53A 5K05A 2Z4SA 2XSZD 2JD2A 1HNNA 3EJ6A 3O1IC 4QYIB 4LXIA 4DHEA 2EC5A 4NP6A 5EJ9A 3CCJB 1Q6ZA 2Y1XA 4Y2XA 3CCVB 2V7PA 3DB2A 4N7RA 2C31A 3PFCA 3CVXA 3GVJA 3SFZA 4Y1EA 2KQUA 1XFDA 1MENA 4IDFA 1Z4JA 4ZI7F 1NFRA 1M8GA 4ID3A 4TTRA 2W0SA 5I9LA 3GJYA 1CW2B 1XTJA 2J3DA 4P08A 5MFZA 3CZRA 3L18A 1H94A 3PHLA 1O6CA 2BFPA 1QMPA 2HI0A 3RYHB 2BKUA 5EY5B 2XOXA 1D6NA 3COVA 2YHIB 3B9PA 4M7WA 5B6IA 3WGOA 4ARIA 5EQFA 1S2MA 3JQAD 3M4JA 3C3PA 2QP9X 5BR8B 1Z5WA 1F2TA 3B36A 3ZDRA 1QJ4A 3EIHA 5IJXA 2JFXA 5ALGA 3M6IA 3T3GA 1PCXA 1W59A 5C7OO 5MHTA 2C29D 3PUKA 2OD2A 4EBBA 3DDHA 1NXXA 2JCBA 2KX7A 2ZSDA 3ETCA 3USES 4D02A 4YAOA 3A9VA 4MS1A 4XM2A 3TW4A 3UKJA 3ZE0B 4WMLA 1ONBA 4EVIA 1QOPB 1AU9A 3WV5A 1Z0ZA 1XMQB 3V46A 2AR0A 3BMCB 2UYGA 3ZE8A 5G1NA 4DHWA 1PJ7A 1QANA 1NMQA 1SGWA 2XKAA 3Q98A 1P0MA 4JKOA 4TMFA 5FO1A 4IDCA 1K8QA 2GPTA 2WYRA 5FOQA 1M5TA 4LZLA 5DEIA 2ZRQA 1UKYA 4C89A 1PWEA 1IPHA 5I7UA 4KN9S 2Q4OA 1XU7A 1SRRA 2E55A 3NC4A 4MV9A 3DT8A 2X9QA 1VQ4B 1E5LA 2E89A 4PSUA 4N3CA 4TSFA 4E1AA 3CP8A 2WTMA 2BTOA 2HK6A 2DEUA 2P2GA 2QX4A 5BSGA 1RSZA 1E2MA 2BPOA 1EFKA 1SBQA 5FUBA 2WE7A 1XMOB 3I4CA 3AM1A 1NV8A 4Y2QA 3FPAA 4DMRA 3LQ2A 4RY2A 1W0CA 5D85A 3RTBA 5BVGB 4BKUA 4PAOA 3LF1A 4MWZA 1NKSA 1WMSA 1MORA 2R6DA 3DO8A 3JAWB 1SNYA 3NXKA 3OKAA 1PFQA 3VYUB 2VOEA 2ONZA 2UV8A 2OV2A 1XMPA 3OKFA 2N0SA 4FHFA 4Z4HA 4IFIA 1FEZA 4L5BA 3FCEA 4OOSA 5JHGB 3QKTA 2VPTA 1ITZA 2H00A 2X4GA 3TNJA 4FMDB 3T9EA 3NEAA 3NGMA 2E4AA 3U5TA 4UZEA 1B0UA 2IKSA 1W4BA 1EZ4A 3GZ4A 1GU1A 3FVWA 4JT9A 4MI6A 3UT5A 3RY8A 2WD9A 4EA8A 1T24A 5GJWC 1UJCA 4MJLA 5BUZA 1Y5LA 2QE7D 3TIXB 1S2IA 2YICA 1H0KA 3DM5A 4JQZA 1T29A 1ODSA 3K96A 4M0EA 4N5IX 2B5VA 3REQA 2AD1A 4A1OA 4AKGA 3Q6RA 1PW5A 2HGSA 3QKSA 4LWQA 4MZDA 2W37A 4HC4A 4WDRA 3WGNA 4DJEC 5HILA 2MDTA 2CMKA 2W6ZA 3BH0A 4L2IA 3NG1A 3VBCA 2FFQA 2XLCA 4GE3A 1H66A 3ON5A 2BT4A 4RTLA 5T8KA 5JOQA 5HS4A 1M6HA 5DU2A 2J31A 1G8YA 5KKNB 3KJXA 3FZGA 4KPGA 3HCWA 2ZANA 3C3WA 5FFMA 3VH2A 5E8JA 2WOOA 4LGVA 3H1FA 4ND8A 4UFNA 3UCEA 4H7IA 2QR3A 3GLKA 3KXLA 5F1PA 1P2DA 1PZFA 4AYXA 1X9IA 4J4TA 4CLOA 3U3MA 3UXHA 3KR1A 4REMA 3R6KA 1XZ8A 4CF7A 4LJAA 2AN9A 3GJ4A 4RSMA 3JQRA 2RCYA 2FEPA 4YQEA 3G2NA 5TT0A 1IYZA 3EQZA 3AVYA 3D8HA 3AK4A 1QK3A 2PGIA 1MAVA 1NBAA 1Q57A 1DINA 4OYYA 2H06A 3W6ZA 4JLOA 3PUZA 5A4MS 3Q7QA 2KLHA 3ZKWB 1ZOIA 1FTYA 2BFFB 2QNRA 3H1TA 3P2JA 3RJ9A 1QPZA 1KSFX 2BL4A 1E3JA 1UKZA 1BFUA 5CH8A 2D06A 3D8BA 4J2HA 5KNBH 4UQOA 2ADOA 3LC1O 4HAZA 4Z4RA 3V2GA 4LYHA 4BFWA 2ZRGA 2OLKA 2V7BA 3VNAA 3D43A 2H2HA 3SKBA 2XRYA 5U4QA 3HB5X 3ZNPA 2OTJB 4BZPA 4NCJA 3MBIA 4M9UA 4UATA 1AQNA 3BJEA 3P2IA 4QOSA 5U4XA 3W1WA 2EZ8A 1M7HA 4FOPA 3TSAA 2Q9BA 1GTZA 4QBFA 3W90A 3S2SA 5FL7D 1V3VA 3JQBA 3ZIAD 3Q4GA 1K7CA 3K2IA 4IQ0A 4IMPA 2ZCVA 1ZCZA 2C3YA 2QQEA 3ADPA 3HLKA 1NKTA 1NI5A 1E77A 4BLPA 3ZWYA 2EP8A 4TTPA 4EYEA 2LCIA 3F90A 1Z2EA 4TWIA 3DH0A 4X1OA 2FEOA 1BQ4A 1F48A 1H2HA 1Q0LA 1BE0A 3HA3A 4UMVA 4XLHA 1GQRA 1Z25A 4PTYA 3U4CA 3WQBA 2JJYA 2JI9A 3VRHA 1JGTA 1CQWA 1Y4DE 4H18A 1UR5A 1YWGO 4RXMA 3VDXA 3WB0A 4DNFA 4ED9A 5KJ6A 2W2KB 3HAGA 3LGSA 1RZ3A 4K81B 3QU7A 1B43A 2FW6A 3UWMA 4CI0B 2PS9A 4YA6A 2DTDA 5J1SB 2BHNA 5D3KA 1Y81A 3HGQA 3LLCA 3IAM1 4NMXB 4Z2YA 3STYA 4W5JA 4PSAA 3HR4A 2CT8A 5L3RA 3CMAB 1YVEI 2ZSKA 2QM8A 5JW6A 4MEJA 3GA7A 3ZYCA 3L0CA 3R7NA 4JBNA 2FPPB 2HHLA 5JHHB 1SUIA 4P3OA 1VE9A 2HBZA 4YV2A 2TMDA 4I36A 2ZL7A 3QI2A 1KXJA 1WSWA 1KKUA 1L4GA 3B5JA 3FYTA 5I4CA 4RMGA 1ML3A 5KQPA 1I3NA 3KQWA 4Q21A 1J07A 3Q2OA 2VYVA 2B0CA 1HWYA 2O23A 3IAXA 5CBPB 4H31A 4J94A 1TUGA 1FX1A 1ZH8A 3DHWC 3U3KA 3QY9A 1HR0B 4UBNA 1V71A 3DLCA 4U3JA 4J0DA 2YJ5A 1X14A 5JSZB 5INTA 3C5HA 3E9YA 1O5TA 1RBQA 1RQGA 1KJWA 3EXG1 2QVBA 3AESA 3LHDA 3CRZA 3OOWA 3IVXA 4UAJA 4X1IA 3CT4A 4YJ3F 4X20B 3TMYA 2GM9A 2V4ZA 2HD4A 2YWFA 1RWKA 4KQ1A 3A27A 1BO6A 3DWFA 3B6MA 4OY3A 4BNNA 1E7QA 2NSYA 4RTNA 4NCKA 1L2TA 3HYSA 4HS4A 4DIDA 1CYDA 3JRXA 1KIMA 1U0EA 4BB9A 2IUSA 3GVCA 3G23A 3ASUA 3RUPA 3LLSA 1J9ZA 3B1YA 1E9AA 3KSAC 2DR2A 3CXRA 1OROA 3RUHA 3N28A 2VRCA 4KQMA 2XZTA 1YRYE 2WJ6A 4H15A 5L7YA 1KMHA 1IUNA 3L01A 3QBVA 4L5JA 5FBRB 3LIIA 3C3BA 3U7IA 4FFLA 5CHYA 3OCCA 1G9XA 4ND3A 3IRUA 1EDDA 2DWPA 1VZ2A 1VI2A 5DNYB 1F1BA 2YZMA 3VU0A 5IMSA 1UEIA 1A69A 1GPNA 5KOYA 1KAGA 3M8KA 1XVTA 2AA3A 4JVLA 4G5GA 2ATVA 3ITEA 2WJYA 1JSZA 1RI2A 3PP8A 1UXGA 2P6OA 3LHFA 4QJIA 1Q1QA 2FQXA 4CEHA 3LUAA 3O82A 5A2QA 5CCEA 4HKTA 5C80A 1VLHA 2AG8A 5DMXA 1ZLYA 2XUZA 3KL4A 1JZTA 3K15A 1OKKA 3VYWA 3H2KA 2EP7A 2UYOA 5ALWA 1JXMA 1FVOA 4U1RA 2I8CA 1FDWA 4KO8A 4KVFA 3ZDBA 3X43A 3U4HA 3VR6A 2HDNB 1PJ3A 1LDBA 4UU1A 5L3QA 1NSTA 3UGQA 4EPTA 1V8PA 3ENKA 3EOZA 2C3PA 1UBTS 2EGUA 4L9WA 3TQIA 1E2IA 3L6EA 1TMYA 4D4IA 3K0EA 4FFVA 4LF4B 3QLVA 4GX5A 1ZN7A 4C3ZA 5HUHA 2VXBA 2GZHA 3QIAA 5GOTA 5KOJB 3O83A 5T4HA 1FYXA 2ODWA 2VUTA 4M0MA 1D0IA 4QOEA 4DCJA 1WX1A 4Q02A 2H29A 1AXGA 4E3ZA 4CIDA 5LA6A 1QF9A 3U9TA 2OT3B 4EOGA 5HE9A 5TJHA 4HGNA 4PRLA 5JQWA 1TU4A 1VQNB 2BC9A 3RU7A 4COOA 4WBNA 1OREA 2CJWA 3ESYA 2ENWA 4JYBA 1CR2A 4DDVA 3S29A 2FZKA 3VAYA 1K27A 3HMQA 4EO7A 3DLHA 1GKYA 3FM9A 4DDMA 2WKWA 3QVTA 1EE1A 1P1IA 3D8TA 3JQ7B 3PRJA 3CESA 2R6HA 5D3ZA 3MOGA 3HSKA 1KR2A 1OQAA 3ONNA 3FUCA 4GIBA 5EWJA 5F35A 1UBSB 4BO6A 1QPBA 1DC3A 4M7PA 3ZH2A 1E3DA 1POWA 4HLQB 2NVUA 5DP1A 5BV0A 1S5PA 3SX2A 3HBNA 4B76A 2FV8A 3G9ZA 4P58A 3KV3O 1G60A 4FFSA 4Q24A 2PMFA 5BN4B 1UZUA 2HLPA 3GLVA 4LSGA 1IEWA 1VG8A 2QG4A 2TS1A 1H6CA 1I0IA 1NUUA 2YUTA 4I9GA 5ALTA 1OZHA 1KL7A 2IYXA 2OYSA 1GU0A 4PYIA 5TC4A 3SS9X 2PSEA 4YGYA 4J7XA 4F85A 4YV0A 5HKBA 4OJQA 4QDKA 5EYPB 1O97C 2E21A 1BG6A 1XRNA 1R15A 4TZ0A 3E3LA 1G0NA 1JALA 4D4HA 5D5PA 2WKPA 3VNUA 1O96B 5L51A 1R0BA 2OO3A 4LRWA 4AKHA 1A7JA 1X7XA 1VJGA 3GJSA 4Q1EA 1RXYA 1W6UA 2VPXA 4U4AA 1CK4A 3UA3A 5ADWA 2ZRIA 3IXQA 3G82C 1ZMXA 4UNIA 1KZYC 1NPTO 4P7BA 3U26A 4LBWA 3BWDD 4YAKA 1BC5A 4JELA 4AJJA 5F7XA 4RFSB 1Z07A 4CL2A 2QZ9A 1M2OB 2JGRA 5FBHA 2D2XA 1PV4A 3FRHA 3I6ZA 2EBFX 1YZKA 2R60A 4L1KA 1XVVA 2CNOA 1EQUA 1CDZA 1E2NA 2PMEA 1UC9A 1LW6E 3SQDA 1S8OA 2HO4A 1EFPB 1MQ9A 1O77A 4XJTA 3RUCA 1HV8A 3AJAA 4DADA 2EU8A 3U4DA 1BU8A 1QCCA 1A77A 1GUAA 1PT9A 3KCQA 4P8RA 1P73A 4RLSA 2EL7A 4Q9JA 3TEFA 1PEYA 5F5LA 4BL5A 2PZJA 2HQOA 2C5LA 5FPKA 4P9NA 4DR2B 3A1UA 4WUTA 3SE7A 3JWJA 3ONEA 1OHHD 4QTZA 3RJZA 2C99A 4TZTA 3B6ZA 2IYOA 3KXPA 3HJNA 4ZQBA 4GMFA 5DYIA 3EJWA 5JXJA 1TJYA 4C22A 4AJLA 4A15A 4YCBA 4OQ4A 4UOQA 1WWKA 5DO9A 3W5UA 1JG3A 5FADA 3HB1A 2HQSA 2A88A 3MGBA 4GYJA 5KWVA 2LZJA 1Y8ZA 3LOUA 2XDAA 2NSLA 3O9MA 2WF6A 1UDRA 3KQTA 1EUCA 3LKBA 4G56A 3W6PA 3GMDA 4KKXB 4BFSA 5IYQA 2QRMA 3O84A 4AMGA 4E32A 4BXOA 3A37A 5TMDA 3H2IA 4B3GA 1QVVA 4NS4A 1J5PA 5T4BA 2ZATA 2ZUDA 1QRUA 4JMQA 3L1VA 5EWMA 2QJFA 5CB6A 2FEAA 1PJSA 3C1TA 1J7KA 3AJ8A 4GRDA 5G40A 4J3JA 3EWSA 3IO3A 4P0QB 1ZI9A 3EY4A 1CE8B 3H04A 3GEIA 5AK5A 1ACLA 1NU6A 1OCEA 2E4WA 3GRVA 4R9VA 5DX1A 5AVSA 3ILSA 3HYRA 3BX1A 5FH9A 2VPZA 1FBTA 4OHUA 2JEOA 2PVSA 2FF7A 4ZJZA 2C5EA 3OPNA 4JMLA 2ZRLA 4WBXC 1T6XA 2Z1DA 1JYFA 3ADOA 2TSYB 5LSAA 1UAGA 3VYSB 1SKYE 3WRXC 1W9MA 4OFWA 3WNCA 1OIVA 1VMAA 4F3RA 1SXJE 1QGOA 4YRKA 3OQBA 2H52A 1U3WA 4UM7A 2G82A 3F5DA 3M1LA 3SQNA 5BYKA 2H1SA 2JL1A 5LQNA 2DLCX 4MSUA 3BNWA 4YAWA 2IP2A 2GZMA 4G5SA 5ED0A 5BRAA 4HTFB 3BFJA 3DUFA 2I2CA 3G2OA 3T9FA 4ZOLF 4CN9A 3PX7A 1ZK0A 1DUIA 1NFQA 3DOFA 2R85A 4IHJF 3GMSA 2QZZA 1EGVB 1MA0A 3G0OA 3INNA 2EZ4A 2GCGA 3F4BA 1Y1QA 3E58A 1C1DA 2GILA 1IY1A 1GUZA 2VCYA 4N03A 1IRIA 4QOJA 1VE6A 4DCPA 3AUFA 4N76A 1R4NB 1M8FA 3LQ4A 4XOTA 1Z39A 2XUKA 1QIJA 3B1WA 5H81A 4C0BA 3GP5A 1D2AA 1F51E 3JASA 5JO9A 3FDZA 1XDWA 4BMCA 4I5EA 3NOOA 1EVEA 1J42A 3OIVA 1Q14A 2AFHA 1E2GA 2EX0A 4CQLB 4EDFA 2V7WA 3UF0A 1BX1A 1QYDA 1XZKA 4TM8A 3AHFA 1FVXA 1L4KA 3RYFA 3FNHA 3IJ5A 3WWOA 2BFCB 4LC9A 5IRCD 1ZO8A 2V7UA 3M7IA 1UBOS 3K32A 3NAQA 4N5LA 4RDHA 1EGHA 1G16A 1SBYA 2CB9A 2FZEA 2O06A 3GZTB 3LQRA 4TWZA 3D7NA 4Z7OB 3AVOA 1XTRA 1U90A 2PK3A 4F3NA 3B8HA 1JVNA 1Z2CA 5HR5A 2JIQA 2J46A 1V7PC 1HBJA 3NUGA 1YSCA 3A6PC 2YHSA 1E4EA 3A8IA 1J22A 1QKIA 3A4MA 1A9YA 3ETLA 5IM5A 3B52X 3P0EA 1YHNA 3O9ZA 2WWXA 2DAPA 3AFIA 2C94A 3E7WA 1BFDA 2VHTA 3RRYA 3KETA 3C8MA 3ENZA 5MDHA 3P9SA 4E4TA 3W3AA 1YFLA 2C2YA 3HUDA 3NHRA 3OTQA 3UV3A 1B76A 2R68A 3O3CA 2IEIA 3QNMA 4FYMA 3RTEA 4ZOAA 3D7MA 3NAGA 3OPYA 1W46A 2PIAA 3JD0A 4RSRA 3ZJ5A 3UK7A 1OZGA 3KCNA 4EHFA 1EK5A 2R84A 1DHRA 4Q19A 5CLJA 3FWZA 1XX6A 4FGUA 5H82A 2AEJA 5TGZA 1YR7A 3BMQA 5JNTA 3DXXA 4JD5A 2YMLA 1DKRA 2QU7A 2PWBA 2DQZA 3A9UA 4GMKA 5FTMA 1SVIA 1N33B 3D7SA 5E0OA 3AJ9A 3EDYA 3VPGA 3D2BA 4RD1A 3AONB 4R8VA 1YB4A 5KX5A 4KWHA 4I4TA 2Y0DA 3EIEA 4IX1A 1QAQA 2ZR8A 1GA4A 1G17A 3E4CA 3UNXA 1QX3A 3KWLA 1PVVA 1PJ6A 3JYPA 5L7WA 3W2HA 4UNRA 2J0QA 2AFIA 2QRVB 4LRXA 5L95A 3ODPA 4OLJA 2CE2X 2IF2A 5JS2A 5B1YA 4Q0MA 2EWVA 2IYRA 2PWZA 4ZOCA 3DKVA 2W71A 1I10A 3GUHA 1CS4C 2FW8A 3ZTTA 3LA6A 3LE8A 5HIIA 4NYIQ 2J32A 4W8OA 3JVDA 4ZMRA 2XW6A 3NM6B 2BGWA 1E6LA 3H5LA 5LQDA 2OY0A 5C4MA 1QOQB 2BUCA 2EP5A 1VKNA 1Q17A 2TECE 1GGJA 4BPRA 4PAGA 5E6TA 1I2BA 1IBRA 1L7QA 3EDQA 1PO7A 3L6CA 3RUAA 3UTCA 5CA1F 4LI3X 1X42A 1N57A 2G4VA 2B99A 2Q3CA 1J2EA 1PTJA 1CP3A 1K8RA 5JPIA 5G53C 5A7HA 1PZXA 5CDYA 1ISGA 3R0QA 4TXLA 2QN3A 5G0UA 4PZZA 5CLFA 3ZHCA 1OVMA 1YUNA 2BGNA 3C4QA 4PPQA 5CVEA 4LFBB 4BNGA 4ZMSA 1D9ZA 2P35A 4BFZA 4FHCA 4UTNA 5AD1A 3EODA 3EXIA 4EPRA 2DECA 2C7GA 3KQLA 1G3MA 3H2BA 4TV9A 3Q7EA 5FI0B 1FLDA 2HWYA 4BMNA 1Y33E 2NIPA 4YP0A 1KDPA 2CY0A 5H3LA 1KJZA 1V96A 3I55B 2ID4A 3CUTA 3ZY3A 3DVAA 4L57A 3VM6A 4KKTA 4K6OA 3F96A 2IVFA 4RANA 4C7BA 5IZCA 1JH9A 1BVYF 4FFBB 2AG6A 4HFMA 3TB6A 3UWSA 4CJXA 4JJ8A 4DBLE 3W5CA 1GY8A 2G25A 4WLNA 5JNRA 1I36A 2JBWA 4W9RA 4RNDB 3FCUB 5G4KA 3O31A 1BWSA 4A8TA 2NU7B 2VJDA 5KNDH 4CEIB 2QRHA 3R3JA 4HWTA 1VHQA 3MJTA 2P6NA 1JVSA 1NR5A 1BWRA 4LJYA 1WPCA 3RSLA 2HCFA 3VOAA 1ZINA 1NRJB 3CZAA 4J0GA 1CX9B 2D3LA 1DJNA 1PKXA 5HS6A 4G7WA 3GJ6A 4JENA 1LQUA 1J4AA 1SRQA 3H5AA 3D3EA 1MX5A 2I7CA 3A3GA 4HUQB 5K3EA 4D99A 2HMWA 1ABBA 1CPYA 1T5TA 3QI7A 1NBMA 5DBIA 1CD5A 1OTXA 2WMDA 4ZO9A 3TVDA 4JYZA 4HWSA 1MO2A 1Q95A 1AQJA 1WKVA 4PX5A 1G63A 2NXWA 4RPLA 4K86A 4BNUA 1HFEL 2HKIA 1QK5A 1Q1BA 2Q6KA 1UJMA 4Y67A 4HVCA 4L85A 1OFGA 5KJCA 2I4NA 5B58C 1RLUA 1JJ2B 1TK2A 1CRQA 4IGFA 3HVHA 2FAXA 3IBSA 5CGQB 2BDTA 1DBWA 1VGQA 3BZWA 4J9UE 1NBME 2Q99A 1KMIY 1FDSA 2C5HA 1MO5A 4X0EA 2EW2A 5REQB 2WDPA 5AK3A 3F5SA 3KSRA 1KO4A 1HYEA 4FLMA 4XFDA 1UJ5A 3PI6A 3DJYA 1N92A 3HP4A 4WIAA 1BS2A 3GVLA 1RZVA 3GRFA 1KSGA 2PX3A 4KVZA 1GCAA 4BYMA 3N0TA 3PXGA 3HU5A 1P44A 1ZGJA 1A9OA 3U49A 10MHA 3KTOA 3I9KA 5TQ0A 3FHOA 4Q93A 4DLYA 2VDVE 4X8HA 2FPKA 3OPYI 2Y0BA 3BSFA 1QHSA 1VTKA 2BFEB 2WLTA 3IURA 4RMNA 1FMTA 1UD8A 1K4KA 2CXPA 5JRJA 3EHEA 2JJ1D 3ZPXA 4D9FA 2ZK7A 3EBLA 2H7YA 1E64A 2YVAA 3OU7A 4MR7A 3UK1A 5BPFA 1UBJS 2ECFA 2V6BA 3L1UA 2IJGX 3LWBA 4PYLA 5BV7A 5AN9A 3T56B 3S7TA 2IUFA 2J9ZB 1JLLB 2OYRA 5DBFA 2FI1A 3MGCA 4EF4A 1P9WA 5HZHA 3VOTA 1A5AB 1G55A 2R1TA 1UMCB 2IPXA 1W4AA 2XPCA 2OVBA 1W2BB 3ONDA 3WC4A 1BGVA 1DAHA 1FVFA 2V59A 2YVKA 1GR0A 2NO7A 3GR6A 3G3EA 4F9TA 1WS6A 1SZCA 4K46A 4MTLA 4DNPA 1S89A 1L4MA 3BRWA 5IWCA 1A1SA 4JU9A 4RK7A 2QL6A 1VLYA 1W44A 3KKMA 2E87A 3BKWA 3DZFA 3Q3EA 1NQTA 1PN3A 1NXPA 2NVOA 4NKRA 2Q8NA 4U7TB 1P45A 4WLVA 4BNMA 5BMVA 3D4LA 4PCAA 2C5FA 2J3LA 3V9PA 1KO7A 2G06A 2NW6A 2Y1OA 1WMEA 3MAAC 3NONA 5L6LB 3U6KA 5EVJA 1E20A 1WDWB 3U9SA 2CXUA 1MJFA 1BRTA 3L7AA 1STOA 3NIFB 1Z8NA 3SKXA 2W6OA 3GLGB 3N8HA 4DR3B 2E6KA 4ML3A 1HL7A 1RDFA 1ZD3A 3H0KA 2WWHA 4YHHB 3G8YA 4RHFA 1L5ZA 2O54A 2R8ZA 3HDTA 2WFLA 3GAAA 3LWNA 4YRCA 3DEAA 5DNEA 5A3QA 4LXQA 2UVPB 5EG5A 4BMPB 5J2UF 3CISA 3BH4A 5B1EA 13PKA 4FD2A 4MA0A 3WHIA 1CUJA 1I8DA 1GA1A 4LYEA 1VFNA 1ZN9A 3LNTA 4NAHA 4ODIA 4D80A 4A0GA 1NQWA 2DERA 2LD4A 2UZ1B 3K53A 3RHTA 3ZCVA 2ZT8A 3O8LA 1NNSA 5IJAA 3QVGB 1PD1A 1SBHA 4UDOA 5KWJA 4CE6A 1EINA 5JCPA 4LYJA 2A5JA 3EDOA 3QLJA 4NWIA 2OPBA 4BNHA 3S27A 1UZMA 1A72A 1MVNA 3VZBA 1OD6A 3QPBA 2VDWA 4Z0TA 1XWFA 2QVZX 3ECAA 4PO3X 1CQIA 2COKA 2ECQA 3EVNA 4X93A 4HX2A 1A9PA 5AI6A 4D43A 1T15A 3W0LB 5FIUA 2RIRA 2Z8YA 4AWBA 3N2NA 4DPMA 1P60A 1P4AA 3RUFA 4LWOA 1JDSA 4O2AA 3RVKA 4OHPA 4JT2A 3TL2A 3VFDA 3HWWA 4XWKA 1UK7A 1A4IA 2XUFA 4MLZA 3I09A 4B4UA 4Y2HA 5IXYA 2QZJA 3I39X 5COAA 1SR8A 2HMYB 1J0XO 3SEQA 2ERYA 3R44A 5ALIA 3A3OA 1P6XA 1YJ5A 4P86A 1PYOA 2G4CA 5EFZA 3W2TA 1QRTA 4OOXA 4I1SA 4KR3A 3A2NA 2HC9A 3G59A 1ODTC 3PWTA 1XU9A 3P0FA 2ZAMA 1BE8A 1QORA 1LKZA 3N5CA 1MG5A 4AF7A 3VBEA 2DUJA 2OBNA 3QBJA 2LUOA 4K26A 3FPKA 1GAQA 4J1QA 3DHVA 4KBYA 4KR2A 2ODEA 1NXTA 1MQ8B 3DHYA 2GRUA 3QF4B 4FMCF 1CHDA 4FJ0A 4L28A 1U8ZA 4DUPA 2BFBA 3H97A 1EWRA 4Q34A 1D4FA 1NBWB 3OE7D 5P21A 2CNWD 1VHTA 4QODA 2V3CC 3L4BC 4PW0A 1VCMA 4CM9D 3Q1LA 3K9CA 3P94A 4TS9A 4DR5B 1T3ZA 4HSGA 1LGYA 4ZOBA 1QVGB 1NDUA 4D46A 1LTKA 1C0PA 2CZGA 4AAYA 4D8WA 4EABA 4I1IA 1VG9B 3EF0A 2GZAA 1Y9JA 4Y2SA 1WBBA 4UVEA 1K3TA 4AN1A 1POXA 3MA0A 5HCIA 1N2JA 2OG1A 3H4IA 3O2QB 3C6ZA 2X15A 5F33A 2NVWA 2GEBA 2QVYX 5JH7A 2BBWA 4HHEA 3TMAA 2WNHA 2Q07A 3H5OA 4QVGA 3N75A 2ID7A 4FCTA 1QIHA 4ZREA 2E1PA 2F7SA 3B6KA 2XAUA 3ZQUA 4RJKA 4MWDA 4R5HA 2QGFA 1SIWA 1CJVC 4JT8A 2WQ6A 3DWEX 5CM2Z 4YCNA 4N49A 1LD3A 4LKRA 5B2ZA 2OPHA 1JXAA 3AG6A 2QYOA 4GO1A 3A1WA 4ALJA 4NJMA 2ZUVA 4Y6OA 5ADVA 1QIKA 3MB5A 4ZCLA 2Y0CA 1HKUA 3EEQA 2GVNA 2Q5FA 4PFQA 4JKIA 4BGEA 2IHNA 4BHTA 2JLRA 2RE8A 1EZZA 3ZG6A 2CLCX 4QICA 3S28A 3TQQA 3HVRA 2B25A 1U2PA 2ZIUB 4CL0A 3OG9A 2H5JA 4JC5A 3B7GA 5DWVA 3S6JA 4CUJA 1A9RA 3V1KA 4JI5B 2Z9BA 1VJ1A 2G71A 3JQ8B 1HTBA 4KNWA 3WDSA 3TBKA 2GI4A 5HQTA 2AFRA 3CPXA 3ODGA 4O4IA 5F4OA 4AM8A 2O1XA 5K8JB 3FGOA 2C1ZA 3C3DA 4Q3EA 5THQA 3QVXA 5K4GA 4CEJB 1XTPA 2JANA 1TDJA 2X76A 1OYVA 2P8JA 4H4DA 1PEAA 5FV7A 3CMMA 1EFVA 4YAGA 1P5RA 3NHYA 4RW0A 2DULA 3WWDA 2Q5JA 1GEGA 3NTQA 2ZE7A 2SICE 4IW3B 1DRVA 1XVUA 4G1BA 4FXPA 4IJUA 3L41A 1SIOA 1X13A 1K2VN 2FCAA 3S3TA 1NDHA 3ECSA 2P9HA 3FPFA 1ZVKA 2E1RA 4DNTB 4MX8A 1C8BA 1NA5A 3I9MA 4R8MA 5F2OA 4HXEB 4WGFA 4ZI5A 1KI8A 5C32A 2BUBA 2MYTA 1XFOA 1L6IA 2KB0A 3ES9A 2ZUTA 1G9TA 2B36A 1XNHA 3LVBA 1NFFA 4BBZA 5AW2A 3HXLA 1PDWA 3IT3A 2XUOA 3HJRA 4QUDA 5LC1A 4CV1A 2WKRA 1VQ9B 1W29A 1NP7A 2WYVA 4LRSB 3F8SA 5DWDA 4M98A 5HF9A 3RYIA 4B7XA 1IOZA 1F17A 2FB9A 4ZK2A 5JYEA 1ULAA 5JI3E 1JBKA 2QUJA 2ZSEA 3DFKA 2WWVD 2AX3A 2IELA 4QVAA 1N2IA 4OM7A 4PX2A 3ZGNA 4NSNA 5BN3B 3H87A 5HZBA 3WMRA 4U39A 1ZWLA 1AUPA 2HDWA 2OV4A 2W2OA 3PX3A 4YRDA 3VPBA 1Y7HA 3WGQA 1JWAB 3ZC3A 2Z8ZA 4Y2RA 4XWWA 4TV8B 5DM2A 3EZ7A 2TMGA 3COPA 1D6JA 2WJ4A 1T91A 3FPSA 2ADFA 2O2HA 3N7TA 2AYZA 4BMDA 1MB2A 4BVJA 4D45A 4WNAA 4ASUD 1WUKS 2NN3C 4E1BA 4JOBA 3GUYA 3SR3A 3DOOA 3OPXA 3MGKA 5LLSA 3W6UA 1OLOA 1XTQA 2AFVA 2RB5A 3DDUA 3DV0A 5KHAA 3HRHA 4DRZA 4WNCA 4Z4FA 2NZ8A 4FKMA 3WGTA 1GL3A 4Z4YA 2R1UA 2E7ZA 4GZMA 4RZSA 4PHGA 2PZKA 2O2JA 1NVMB 4V0QA 4CV2A 1GHTA 4D9MA 3I04A 5HKKD 3VR3D 5CLIA 5A06A 2QPOA 5IMBA 1ZOLA 1DC4A 1RHRA 3Q0EA 4KE6A 4EBFA 3BCHA 2O9JA 5CDUA 5JNWA 3M83A 2IS4A 4CRWB 5IK2A 2PKYX 3BTOA 3L1IA 4QBHA 4X7RA 3DNMA 1QIGA 4OHCA 5DRTA 2O19A 1DJLA 4UREA 1UIRA 2UZ4A 2OMKA 5A6VA 3I2KA 1UXHA 2HIAA 3GHHA 2QAJA 5C8VA 4KJZA 3SLNA 3B13B 2BH9A 2HU8A 4RAOA 4EQ6A 2QD5A 4MVJA 2A3NA 1QB7A 5K0SA 2PZEA 4BX9A 1W0JD 4NATA 4NJEB 1NLMA 1Z5GA 1HI9A 3KVRA 4NECA 4J91A 3UMRA 4FEEA 1NF8A 1W25A 4BWFB 1UT6A 1U0GA 3DA8A 1JJVA 1XCOA 5CPFA 4EHAA 4IIHA 5DI3B 4XX0B 4E88A 5C46F 5CRIA 1KWKA 5AW0A 1T9GS 5AFSA 4MROA 3DF9A 2C07A 2JHCA 5T4EA 4EB6B 2QU8A 4GSLA 4MVJE 3HBFA 4AP9A 5FTLA 4LE1A 1ZR2A 5HMLA 1I01A 3CX3A 4RHCA 1YHZA 2BAGA 2GN6A 3H1PA 1P9LA 3Q8KA 3SDZA 3HWX1 1GZ7A 5A9TA 5HM6A 2E4UA 1R4ZA 2QL7A 4Y6LA 1SOAA 4L4UA 1WSAA 4BPBA 2HDOA 521PA 2FETA 1JHPA 2IODA 4TTAA 4ND5A 1PV2A 4MCAA 4QYIA 1HT1E 4LJKA 1GGHA 4OXRA 3CCLB 1ZH0A 5TF4A 4BO3A 3DTNA 1J9EA 3HXPA 2GKOA 2G77B 5AW3A 4HGYA 4F9EA 4HOYA 2QN7A 1WOSA 3EC2A 2B3TA 4IWXA 2J7KA 3PWSA 3OZFA 3RSCA 4L6AA 1U94A 3QTLA 4MRVA 3ZY6A 2QRJA 3D3KA 3E2PA 4RMJA 1WTHD 3HDGA 4LNUB 5DLEA 1QGED 4D96A 4DKXA 3RYHA 3IMKA 4G37A 4DOMA 2H51A 1RMQA 3KSDO 2W93A 2ZBRA 1A9XB 4ZMBA 4RSHA 4XM3A 1NB0A 5CA0B 4E7OA 1IBKB 1QLJA 4FVTA 1S3IA 4I66A 4JVMA 3NHAA 5F98A 4H3VA 1Z5UA 4IEFB 4HVAA 3B48A 3HEMA 2P4SA 4CKCB 5FOWA 5HMMA 1KY2A 4PGMA 3ROKA 1YONA 2J85A 3T34A 4DPLA 1D8TA 3M6UA 2IHBA 1N3BA 3EEIA 5IYPA 2W6PA 4EW2A 5ALZA 4AJEA 4FZJA 3UZUA 4OKIA 1K9VF 1UK6A 4J75A 5LMNB 5HUJA 5JD5A 2R8EA 1DIRA 3NBYC 3BMCA 1Q11A 1BNCA 3WYGA 1KZ4A 1RP1A 4BTEA 4ZGBA 5BSVA 2AEMA 1IZ8A 2O1EA 1UOPA 2HU7A 3HBAA 3Q3VA 3DHNA 2FRDC 2VZLA 4LDPA 4PHHA 5IHXA 4QJ4A 3VC3A 3FHCB 5J58A 1FSSA 4WASA 1VL1A 3L3BA 3KYIB 2YVUA 3KTAB 3TXAA 121PA 3KHUA 3VO1A 3R0ZA 4ILEA 4PC1A 4I1PA 2XUAA 1H2ZA 3T15A 4YT5A 3RHZA 3DEHA 1FZTA 1EWKA 2PT5A 2XI4A 3RJMA 3UAWA 3FN4A 1OYOA 4R8LA 4OMUA 4PIVA 4XR4A 3Q85A 5BURA 3E82A 1AKEA 1O0SA 4QQKA 3IDFA 1AXRA 5C1DA 2AGVA 4ND7A 4U7HA 4E7PA 2AQ8A 1E63A 2WWRA 3UQYS 2VVTA 3ORYA 4JQCA 1V26A 4LXHA 1XKXA 1WHSB 2F1MA 1YZVA 3KDPA 1TEXA 1MHPA 2ABWA 3HY4A 3TQOA 1YU9A 3OEEA 2VDOB 3G0IA 3WJAA 4V1CA 1PUXA 3S81A 4RA9B 5K0CA 4RMIA 5LP6B 2PJRA 1AKWA 3DDSA 3FHJA 5BVGA 1XQVA 4QUEA 3CNEA 5GGXA 1VYTA 2OV3A 3QITA 4EPWA 4QNRA 2ZM6B 3JAWA 2VPIA 5CXSA 3U9LA 3HXMA 5FLXA 3SJZA 4HNGA 3NHUA 3KEFA 2NSHA 1PT7A 1FFYA 4GVPA 1MO6A 2F6RA 2KS6A 2DH5A 3OUTA 1KP3A 1KJ8A 5FTJA 1OBVA 1ZL2A 4XUDA 5JYBA 3F9CA 1YFJA 4C0JA 5B12A 3MD9A 3UUWA 4NYIR 2QMYA 1YDMA 2CEAA 3WSWA 2A35A 3F71A 4XFKA 5DYYA 3T7EA 1OBOA 3TKYA 1CEEA 4M1YA 3DO5A 2PJUA 1FJHA 3GDWA 5DTQA 4UHJA 2YKGA 4ARZB 3OP1A 5KSZA 2VP3A 1HZEA 1I6LA 4OMDA 4E33A 2YFYA 1M74A 4ZHSA 2B6NA 4JJZA 4QDUA 2ZAYA 4QIHA 3ROQA 4PQYA 3WGJA 3QFTA 1Y5RA 3CO0S 3SD7A 2CBZA 4WBSA 4YJGB 4B7AA 4LGCA 4MDYA 5DNCA 4UUQA 2AHRA 1CY7A 1UXJA 5IFLA 2VUSA 1Y9DA 5F7OA 4O63O 1PYDA 1EEXB 2PBFA 2AXNA 4B4DA 4CF3A 3MD0A 4E13A 4KHPB 1ZD1A 2HYDA 3FOCA 2V55B 4QUHA 4KQ6A 3IALA 1E0DA 5K99A 3NVDA 4HDQB 4E11A 1RAGA 1V4NA 2RKOA 2ZJOA 3F7MA 2FSPA 3FR7A 5E7MA 5J63A 1ACMA 4MUXA 4OGGA 3ZWKA 4EUHA 3V7NA 3V7FA 3W8RA 5BSEA 4TUYF 1R10A 4AMUA 4C1BA 3RTGA 3KL9A 1KMQA 1S1CA 4HX5A 3PEVA 2P2DA 4AJHA 4EA9A 4Y1RA 2XBUA 2OBSA 4LGMA 1F2UA 2VDNB 3S1LA 1NXWA 4WNIA 5EMMA 3ESAA 2W00A 4B7UA 4YCSA 2BE7A 4CM4B 1L9XA 1JB1A 2P6UA 9ATCA 4CMIB 2HJ9A 2G5PA 4XVCA 4QTTB 5IC6A 4R2LA 3IUYA 3ZKWA 3PDUA 3PT5A 1QFMA 2R1VA 1Z0AA 2Q2WA 1U9JA 2D5CA 1IQUA 1L5YA 1LSSA 3UYLA 4PU0A 4BNXA 3RRMA 2PLNA 1ZH4A 4I9HA 4PO1A 5JS7A 1ZHOA 3FNGA 3FCSB 1FMCA 3F74A 1KPIA 1FP7A 3HDYA 4QXOA 3ZVNA 4C21A 2A67A 3T1TA 2VWPA 3AZQA 1FFSA 1Z8DA 3E3NA 1I4OA 4OB8A 3WGMA 3WLTA 2J48A 3WLSA 1C3JA 3NANA 1XLTC 4MINA 5DHRA 1YZYA 1T6BY 1IXRC 4JP5A 5D84A 1ZM3A 1OBFO 4HPJB 1KGDA 4KRGA 3LCUA 4Q03A 4EI7A 5DNWA 2QENA 1S01A 3S5UA 4RM3A 3QBEA 1OR8A 5JAQA 1Q7GA 4Y6PA 3VDQA 1A2QA 5HZKA 2EFGA 5FBZA 3G9QA 1V9CA 2QUAA 4HSEA 3TW8A 2Z1NA 1GQOA 1TU3A 3QVWA 4XSVA 5T5QA 2PL5A 1FSPA 1JJ7A 1X7WA 4FYPA 1U7UA 3JWEA 1KBOA 3BC1A 2CDRA 2E49A 4CCYB 1GNLA 3OF5A 4NFHA 4Q5IA 4QHTA 2W2KA 1KAQA 3GAFA 4RKQA 3RF7A 1RC0A 1CXZA 2DQYA 1KS2A 1UFOA 4RLQA 3CG4A 5SV2A 4MICA 1LY1A 1RWOA 4ARVA 4ZGNB 2QXTA 1YLOA 4MW5A 4QXRA 2GRAA 3K6SB 4CV3A 1JFVA 3ZDCA 1H3FA 1QUEA 2GM5A 1FFHA 3MEQA 4R16A 4TXMA 3VVBA 4F4UA 3ZEAA 1GZ6A 1LPBB 3RB8A 3ZJUA 3M49A 1B6TA 4NI5A 2ACVA 5LB2A 2FPPA 4IM7A 3ELWA 4P38A 1JAZA 3EGEA 1D1QA 4ZVMA 3RG2A 5CTAA 1BWPA 5D6NA 5E6UB 3ONUA 3INGA 3LK6A 4TLEA 5TVGA 2VYQA 2IHKA 1U9YA 2AXPA 3PEFA 1ESMA 2IYPA 4YDQA 1JSXA 3S7ZA 5CBPA 2OA0A 3VHXB 3F2IA 2WMNB 4BLUA 1QF7A 4F6LA 2E2WA 2NXNA 5CVTA 1ZM9A 2J9GA 2ZBDA 3P9KA 4RLHA 5JSZA 1C5KA 4OHXA 5CIWA 3OLWA 4X71A 1R0RE 4B4WA 1ZXXA 2CF5A 5ERYA 4WNYA 4FIDA 2J3KA 4MGZR 5KJEA 2VJOA 2D0IA 2FZCA 5DK6A 4A6PA 4BV3A 1RFLA 1T1RA 1Z75A 3AI3A 4G0PA 4X20A 1G66A 1XIVA 1NJ6A 3EG5A 3B2EA 2B8WA 1D03A 4CQMD 3NU1A 2XV1A 2AKYA 1LDYA 2PTGA 4YQZA 3FKSA 3LYHA 5CB4B 2X6WA 2EJVA 4HLUC 4X9XA 3RS0A 3FPLA 4AUEA 3OFKA 4ZOQI 5JZBA 2OBFA 4N18A 3FE2A 1BVUA 1YFZA 3DW3X 4GG1A 5EP4A 3ANMA 3ZWAA 2XTNA 2LVBA 3L0SA 4S1VA 4KXQA 1E1CB 1MAUA 3HFGA 2IYQA 3KELA 5DWQA 2W4QA 4C1NA 4DRXA 1JKMA 1OGIA 2BFWA 4QWMA 5CT6A 5ALRA 3G8CA 1ORIA 2CL5A 1FDRA 2A9KA 1W52X 4HADA 3E5MA 1U8TA 1XQWA 1VLQA 2ZPUA 3IODA 4TL7A 3BZUA 4G4SO 4L51A 2RB4A 2WT4A 4WHMA 5TMPA 1RJGA 1TAHA 2P27A 2RSLA 1H05A 1X7GA 1ZN2A 3OO1A 4DQUA 5CEFA 3P19A 3PEEA 3O4JA 1NL3A 3CTAA 2Q5CA 2PH7A 4UHHA 2GF0A 4R1NA 4D9JA 2BEJA 1DCKA 1GTG1 3DMGA 1WW3A 1NZFA 3LDHA 2CFOA 1CQJB 5HFAA 5L3VA 1NVFA 6Q21A 7MHTA 3WAJA 1ZC4A 4XRRA 4IFTA 2WE8A 4CI9A 1ZLXA 4Y8VA 2AMJA 2JFOA 2VT3A 2IEAA 5EIBC 2ZI4A 3NHJA 5KQSA 3QENA 2GYWA 2XWSA 1J0CA 2ZVJA 2G88A 4IJWA 4INAA 4C4XA 5BQOA 3Q40A 4G41A 1U11A 5IEBA 3COSA 4H17A 1E1YA 2FMUA 2WAOA 2UU9B 4IDPA 4CWAA 4KX3A 2HBRA 3GA0A 2V5AA 5KOJA 1RFGE 5DNAA 3S1SA 4Z6KA 1TUEA 3WMXA 1ST3A 2GK4A 4CM3A 5KTSA 3CQ9A 3EVAA 3OLVA 2OD7A 2VSFA 4ES6A 3JVVA 5KTOA 4DNRB 4D8TA 3DBRA 4E2FA 4HT3B 5HW0A 1XVLA 2QJRA 1DBPA 4JB2A 4MVJM 4FHDA 3SIWA 4HB3A 5AM0A 4HEHA 4S1OA 4WOBA 3ZD8A 4EGFA 1M75A 3ZQKA 5MGNA 1KQ3A 1Q0SA 2O14A 2Z9DA 1AKVA 3G49A 4QFCA 4V0ME 2L19A 2H4WA 3JQ7A 3EFBA 2R3SA 4CTKA 5ITSA 5E2AA 4UM8B 5DF1A 1MEJA 3QQPA 1RE0A 4N3AA 1LX6A 1ZESA 3W77A 4IDNA 3T9BA 3A6HA 1KTVA 3MJHA 2VDUE 3RK1A 4TTQA 5YASA 5BN4A 1GN8A 3LL4A 3NPAA 1CETA 4Y2GA 1PQ4A 1Z18A 2R7LA 3UA4A 3WK6A 2PFGA 4TKVB 4ZAFA 1G3UA 4Z9XA 1YGYA 3CRRA 4ISBA 621PA 3CX8A 3WIDA 1XF1A 3UH1A 1T9CA 1T1SA 4TWAA 5AOBA 1GNRA 3G4SB 1O96A 4L8VA 3V8PA 1WXFA 2X8KA 3OOYA 2WFAA 4G2NA 3SYLA 4D7AA 4WVFA 1CUCA 4ZEVA 4UEJA 3KEGA 4OP1A 1U0OC 2G08A 4JLBA 2IH2A 3I2YX 3FTFA 3A4LA 3L0ZA 4MUFA 3N39C 5KKAA 4BRWA 1ESCA 1Q0ZA 3LZ6A 2QTTA 3ZZTA 3OURA 5DHUA 1ZM4A 4X97A 3I76A 3LDGA 3VR5H 4RFSA 5T6MA 4B81A 1NG9A 1P6UA 4TOIA 4M8LA 3FVQA 4NS1A 4IFEA 4KACA 1M2OA 4UVIA 5IBPA 1C41A 3N70A 1SCDA 5J5CA 2VT2A 2ES4A 2IU4A 2DFNA 1KDYA 4LDNA 2DHDA 3HC7A 1PSZA 2R8BA 3K4PA 1UD4A 1H0HA 1RXSA 3L7JA 3MT0A 1EFPA 1O9GA 2A4MA 4TS3A 1L7XA 5AI0A 3CCFA 2GMWA 4MB0A 4RXUA 2Y67A 4DG8A 5HKOA 1YQGA 1M9NA 4TN1A 1YCGA 4YP5A 5JSUA 1UJ4A 3H5WA 2AK2A 4OYLA 4XIJA 1XU4A 5F7ZA 3Q8LA 2BLNA 1EQAA 2O5CA 3LLVA 2DPYA 1C3EA 1Q9SA 3QE9Y 4R1QA 2B7BA 1T5BA 4A92A 1PG0A 1I5RA 2R44A 2YX1A 4FC6A 4D9KA 2DFTA 3VNSA 4EX7A 2HYIC 2YFKA 1N4AA 3CPJB 3STXA 1Y4SA 3HCCA 1LK0A 4MV5A 3A1SA 3F6EX 4CUZA 2VQ3A 4TWBA 5T67A 4N7BA 5D5QA 2Z09A 4PXYA 3C7KA 4B44A 4HBZA 4W9NC 3JS5A 1PG2A 2JNWA 1ABEA 3LY7A 4Q1AA 3EZXA 3RABA 5ESRA 1PVOA 1KYWA 2FJUA 4EDHA 2UZ3A 5ALDA 1AQLA 1VQ5B 4M21A 1MDBA 4RBNA 5J23A 1FU4A 2Y1KA 5LVAA 1Y80A 4PRZA 4FYWA 1KK3A 4LVUA 4KO2S 4TQAA 5THXA 1NVWQ 1Q0TA 5BP7A 4PIMA 2BKAA 4HPWA 4JROA 1VBFA 2BH2A 3D1VA 2C92A 2VHXA 1GQ2A 3QE2A 3R3HA 4YMUA 1CE8A 2ZBPA 1W0KA 1H4VB 1ZKDA 3OWXA 3NAZA 4P5PA 3W4JA 1QF6A 2FYTA 2B9VA 3R9WA 4Y6GB 1DJPA 1HEUA 1JF8A 4UDXX 5H3HA 4URXR 1R0ZA 2VAPA 3R8FA 2J6HA 4I3FA 3LA8A 5IKOA 4GXQA 4JLMA 4G4JA 4P93A 1CUUA 1T8TA 2WILA 3F97A 2GK3A 3PUYA 3WAKA 4RESA 4UBKA 3Q7TA 3EE6A 2FCRA 3TO5A 3QTTA 3VV3A 4B3BA 2VPWA 4F4JA 1XL1A 4IIXA 3T95A 3CGWA 2I65A 1Y8AA 3LKDA 3NTUA 5HYVA 1E6MA 4FNAA 3C3EA 2F1OA 2Q49A 4HTFA 4JL6A 2OCXA 2IV7A 3OC0A 4BLVA 4LSMA 1VHEA 1KHTA 4Z8XA 1GRCA 2C0CA 3PHGA 5GOZA 3DEFA 3UCXA 4R0MA 1E6CA 2XMGA 4WCDA 4MS4B 3QGMA 3DF7A 4MITA 5CDSA 1GO2A 5JFTA 3TTYA 2HF2A 1QFJA 3DZGA 3O7MA 1PKVA 1DE0A 1X1AA 3L9WA 5JXGA 1CUYA 1DIAA 1GXSB 2C78A 4LJ5A 1YTUA 1R4NA 3F46A 4P2GA 3RANA 4LXUA 3NP7A 2FZGA 1JE0A 3OETA 2OFFA 2BTQB 2C9ZA 1AB5A 1NJSA 3K70B 5I7EA 2EARA 3ZU6A 3NVKI 3OHSX 1TQDA 5ER6A 1TMKA 2FWIA 4LZPA 3U4GA 2VUUA 1NB9A 1DIHA 2J5BA 4CQLA 3H13A 1WMAA 5HGXA 1M34E 3IP7A 2BI8A 2X42A 1HDIA 3M6MD 4BY9E 2W98A 3H9NA 1JDJA 4FWBA 4CR6A 2D62A 2FUKA 2QAGB 3LS2A 4RK6A 5GM2A 3D7LA 4X1YB 3GY0A 1GZUA 3W8NA 4BNVA 3WJ7A 4CLEA 4LJ8A 4K9PA 3AUKA 2CLSA 2GAIA 4X7BA 3SQXA 3RE1A 2OM2A 1U8CB 5E9QA 5B2EA 3A6KA 3OLZA 2AKAB 3LO8A 3THSA 3OQMA 4OJTA 1B6GA 3QX7A 3WNQA 2HDHA 2ZETA 1U0TA 4TXJA 1ADJA 4CQJA 2JH8A 2AUTA 2GOYA 3GJ8A 2QLFA 1QFSA 2HXSA 2QVXX 2RAPA 2ZYDA 4L4XA 5IP5A 5B7QA 5IT4A 3WFZA 1RKBA 4HLCA 5IDXA 4S35A 5L3ZA 1QONA 3ZCRA 1COZA 3B3QA 5DLQC 4GBED 4N8DA 3W2EA 1Q91A 1JLRA 3NJ4A 3I2IA 3IAEA 3L93A 2FQQA 3TOXA 1NOJA 2PKXA 3P0IA 1RQLA 4RU1A 2FSFA 4B2IA 5IS2A 3I5YA 4R1PA 1E9CA 2B92A 4QRDA 2BWJA 2QQGA 5GAJA 1GQFA 3S1AB 3MCTA 4EY6A 2XB6A 2MYNA 2BEWB 3PL5A 4IILA 2GZSA 4QBIA 1GCIA 3EPPA 1HEIA 4CL3A 1Z17A 1V9SA 3R74A 3HKEB 1HOXA 5L4SA 4D9CA 4BO9A 3AGQA 4HDSB 3BHJA 4PLFA 1P5JA 2CJXA 2EFEB 3M70A 3SBEA 3VKFA 3LECA 4Q9KA 3UICA 1Q83A 1T5LA 1SKUA 4L8YA 4C6TB 5LOVB 3H9EO 2EG5A 3T0FA 3TTXA 2YUIA 4KZPA 3REFA 1NDQA 1KYTA 3S4YA 1EYZA 1UIMA 1ZIDA 2XB4A 3MTBA 2LPMA 2QRVA 4MYCA 1X1TA 4OQDA 1VE1A 2W4IA 3A1PA 2A57A 3V4LA 2B78A 4RTOA 3WTCA 3K1AB 1XYVA 2KSQA 2ZIWB 4YPOA 2W8BB 1KEWA 1QE5A 3H9QA 2M5SA 3Q88A 4LHWA 3T1HB 1BMFD 3DE6X 3QPDA 5A7GA 1EUQA 3Q15C 5IVKA 1VP3A 3AIIA 4UHBA 4HV4A 2R79A 3IOEA 1BHSA 1WA5A 5EJGA 5LUBA 1RTKA 4NPAA 4JCOA 2PMBA 3I34X 1NN5A 1Q21A 5LR6A 4YJ2B 1E1KA 2LCFA 4ZFNA 4V0OA 1ZIOA 4IUDS 1NRIA 4GL4A 4MVWA 1YJBA 2FPOA 3CNQS 5AHXA 1B8OA 1VOTA 4F38A 2L18A 4K9RA 5ALYA 1CYEA 2H7CA 2PSSA 5U1PA 3MILA 3B70A 1F8XA 2WTEA 5AKXA 4K9KA 3ILYA 3ZIDA 5J2TB 2OFOA 2PVPA 1YE8A 1PDOA 4GMXA 4Q4JB 5ECYA 4DY6A 1G5IA 3K94A 4A91A 5A1TA 3HLTA 2I6QA 1JMVA 2D2VA 4PG7A 4UCXA 1FQOA 1HE1C 4HDOB 5TVKA 2XDQB 4R40A 3RFUA 4J0IA 1G2IA 3UH0A 3ZQ6A 2JK1A 3A6DA 4D74A 3OD1A 1OXBB 4C87A 3B6JA 4TPKA 3FCYA 1Y34E 1YL5A 2I6UA 1C9MA 4XLAA 1LPPA 1ZRSA 1Y8CA 2BGLA 2OGZA 2QE6A 1UPTA 2V65A 3D2CA 1GNQA 3AHHA 4CLRB 4BLOA 3BE6A 1CY1A 3G5UA 5AVTA 2I87A 2J9XB 1QZUA 2AN4A 2OXFA 1EK0A 2PT9A 1XZNA 2J5KA 1X1DA 2NU7A 4EJMA 2RKBA 1GPUA 5I5GA 5D87A 3ESQA 2H0QA 3K9QO 1LV7A 3RVPA 3Q10A 5AJVB 5DZSA 3ZK9A 2RD2A 1AS2A 1XD8A 1C7EA 2FJ0A 4G5QA 4W7SA 4DRYA 3K70C 4M86A 5EMJA 4FE7A 3U31A 3SSOA 2OB2A 5FEMA 4H3KB 4HUQA 1X80B 2AL7A 4KFTA 4EUSA 4UXHA 5DLYA 3QMMA 4DUGA 1YMVA 1L5QA 3RV3A 2IA5A 2ZRFA 4OHBA 4L8LA 1IUPA 2XODA 1MIOB 2Y1EA 3GFTA 4FR0A 3LT1A 3KQPA 2AOTB 4IH1A 4BQFA 2ZOSA 5TGTA 2OYCA 3L4BA 3GLUA 3T4EA 3E84A 4EPVA 1O95C 1D0VA 2GS9A 2QQFA 4ND1A 3LI2A 2YNMD 1FTWA 2ZULA 2I66A 2ZYIA 3PX2A 4JJ4A 2MU1A 3GW8A 4P7GA 4RHTA 1YHQB 1Z36A 2WABA 3TLKA 1N1MA 4BKRA 2IDJA 3OIFA 4OO3A 4YAIA 2X41A 4QASA 3NNNA 4YWJA 4MQEB 1SCNE 4ZAYA 1GSHA 4PCVA 4B09A 4AY5A 1JG4A 3F4KA 1F0YA 3AFOA 1WZCA 3W05A 2X19A 1II0A 1IEVA 3WLJA 2NPOA 3HL0A 1YC5A 1Z0SA 1ONPA 5AKYA 4BV2A 1Z2OX 4BTVA 1Z6GA 3U2QA 3QOXA 1JH8A 2TRSB 2BHRA 3IIJA 1EAYA 2R9VA 3BK2A 4HWRA 3WWPA 2QG9A 4FU0A 4BMOB 3BXPA 1O94D 4OQEA 2BFEA 2COUA 6AT1A 4LISA 3TSZA 4H1WA 1BYIA 1ZOPA 4DLBA 1FLNA 3AEQB 2XBLA 1RKQA 2ZP1A 4JLAA 5BSRA 2VEOA 2YW9A 2P9JA 4RPBA 3AYZB 3EVBA 3MUFA 4HH4A 3B3FA 4I1OA 5KCMA 3ZJTA 4RH0A 1X70A 3E6AA 1XCGB 2VBIA 2WIAA 1JLLA 3DKIA 3E9NA 2YIMA 1UZNA 2YN4A 3B7WA 3E9DA 3EVTA 3PPYA 4CKBB 2YTZA 2DLNA 3M5CA 1ID8A 1VYHA 3ICVA 1KOJA 1UKVY 2WV7A 4OQFA 1OSNA 1UMCA 4QATA 5LQRA 2WWYA 1B16A 3EUWA 1P4SA 3BXEA 3OOHA 3A70A 3GLTA 1DJOA 3L5KA 1NGSA 4B85A 1ZEMA 3PICA 4LMPA 2QTMA 2R8PA 1ECLA 2GHQA 4EFKA 2K4MA 2HR1A 1DKNA 4MW9A 2QN1A 3GRPA 4WZ6A 3HNRA 2JVJA 3Q3GE 4MIEA 1DMRA 1JVBA 3ZLTA 2IZ6A 3I1FA 2DJIA 4HMOA 5JAPA 1J49A 4OAOA 1AQIA 1VQLB 1XTTA 1TCAA 3I0NA 4KWTA 1GDTA 2J0SA 3SXUB 3I61A 1C0EA 2RG1A 2L42A 3TZBA 1HSZA 5GY7A 4O4JF 3WK4A 3V34A 4DILA 2SKDA 1OA1A 4N5HX 3LBAA 4BVFA 3GLGA 3MRXA 4IGKA 4QDZA 1OX5A 4HB4A 4J4BA 1QVAA 2P1ZA 2DBRA 3P9YA 3BQ9A 4OCZA 3QMWA 2G17A 4R01A 5DULA 3B38A 2OBRA 3KR2A 4TS1A 1N8KA 2UVPA 3ZDZB 1XQ9A 2GKGA 2RAVA 3WL8A 1M8PA 4F3TA 1HRDA 1WZEA 3HVUA 5EHGA 4C5AA 2X0NA 2PHZA 1THGA 4UNSA 2EAUA 1DC7A 2UZ1A 1X19A 1V5FA 3GN2A 1K68A 1TCBA 5I4BA 4RLZA 3EVDA 1SOUA 2LBPA 4KXYA 2P3OA 2H9IA 2B4AA 5EQDA 5IFKA 2P7HA 4JT4A 1W9XA 1J1UA 4JZKA 1S1MA 3U13A 3A9RA 3SHTA 3TEJA 3U6BA 2E4YA 3JR3A 4D9HA 7ADHA 3KZCA 1LRJA 3HO6A 2X85A 1IM5A 1FS6A 3GXOA 4LYDA 5FWAA 4BJ6A 1E43A 2J3HA 2J9FB 3FKQA 2XGOA 1OVGA 3K7EA 1UP4A 3TZEA 4CZ2A 1Z3CA 1Z5NA 1ZSNA 1NVTA 2A33A 4DLNA 1T8PA 1UQTA 1G2OA 2IZ1A 2O5VA 1DFHA 3FSGA 2ZSIA 3IQZA 3A7EA 4Q4LA 1T2CA 3UKOA 2ODPA 4F4FA 1C50A 2VQEB 1Z16A 2GESA 5DXAA 5GTDA 3IFSA 4RZQA 5LDHA 4C2UA 3L7DA 1ZUNB 1U0RA 4DA4A 3E27A 1VCHA 3VXKA 1NVGA 4L3OA 4UFOA 2F59A 4Z2AA 2DPXA 3K05A 4IH9A 1L5GB 3L4JA 1G8GA 4LXTA 3OW2B 4KAFA 3H18A 1H6BA 2GEUA 4Z9YA 1Y7TA 5A6SB 1WXXA 3WIBA 1WVGA 4MJXA 4WK2B 2XOKA 4RD6A 1Z08A 3GI1A 1MD9A 5BWOA 1EEHA 1VZ3A 2IRWA 1FFDA 1PQWA 4MPTA 5EEHA 4B3MB 3D8SA 3KQMA 4WXYB 4IXMA 1HE2A 1BJKA 2R8YA 4WKBA 2ZI3A 3MYYA 1CUEA 3QF4A 1PS8A 1U3VA 4Q4HB 2AW5A 4UVGA 3N3BC 4EAAA 4MW6A 1PX2A 3VR0A 1PWHA 1BJRE 2F3SA 2INGX 1EWVA 2O48X 1W87A 1TU0A 4YJFB 3SEZA 4G36A 3V3KA 5KNCH 1GPKA 1G8SA 1U4SA 3EXFB 4P98A 4DMUB 1WB4A 3EY9A 1XI2A 5I7SA 1I0ZA 3GD5A 3G8BA 3FVRA 4ZEWA 3H94A 2GO1A 2O3QA 3B51X 3L7YA 4LE2A 4X54A 4EJFA 3CNLA 4YIHA 2NYUA 2G07A 1B15A 3HEAA 3OZIA 4OA8A 1SC4A 3LX8A 3UWDA 3AEYA 2H5LA 5IN5A 1T5IA 1WIWA 3IE2A 4JP8A 4TYNA 3OUZA 2ADMA 3CB4A 2WAYA 4U2EA 1XLWA 1L4UA 2PX2A 5GADl 1AF7A 2OCAA 3ZDAA 3WGIA 1UD6A 3DXFA 3UQZA 4B35A 2YC2C 2X22A 2ZLBA 1FS5A 4J76A 3T9DA 4GUAA 1U0JA 3VH4A 3IQGX 4UC0A 1EX1A 1J1IA 3FNEA 5WRFA 1YKFA 2QXYA 1FDUA 3PR1A 4RHYA 1UBLS 1TGYA 3CEMA 1L5SA 1ISPA 4AB1A 4LJ6A 4DYVA 1P77A 1R5NA 2WR8A 1HDGO 3WL7A 1RPTA 4CFSA 1TJPB 5CJJA 1ZGZA 1EP2B 4RCZA 1Y1LA 1XTVA 1BXZA 1YNOA 3GEHA 5EIHA 2Y68A 1NZDA 3G5MA 2W6ID 3FUUA 2KE5A 1CVRA 1HF3A 4ZEMA 3T3MB 4EY3A 3DMNA 4RV4A 4PTLA 2B5OA 3PUXA 1QCDA 5CVDA 2VPPA 3GVXA 4H6XA 4ZVSA 4B48A 2HADA 4CM5A 1BW9B 2ZU6A 2VHQA 1ZNWA 3FJOA 3JQ8A 5BWMA 2VA9A 3G2QA 5EPOA 3V8BA 5J3OA 1E9BA 2EBHX 3IHTA 3UAVA 5KDOA 3QWBA 5TIIA 3IP6A 3W5VA 2WFZA 2IWHA 1AKUA 1C7IA 2RHOA 2XGMA 3N0XA 5D01A 5A1JA 5KNBD 2F3TA 2ZUEA 4HGQA 3ZX5A 4KQJA 1R0YA 5D51S 4RZXA 3G1WA 4NU5A 1VCIA 2PEYA 3D3QA 3F1LA 4GNKA 4AF6A 2FWRA 4UBMA 5CVUA 4MWBA 3VO9A 4DJAA 4YELA 3HCPA 2FSUA 4QGFA 4K03A 2GCEA 5DN6A 3VPAA 2AX4A 1OFVA 3O2SB 1XHFA 4FILA 2WAAA 2FRDA 2IXFA 2RHMA 2XH8A 2ZYHA 1D2CA 3H2HA 3O0DA 3P9PA 1ZUWA 2GCOB 5FOVA 5HF5A 4V03A 4AK9A 1LPNA 2FW0A 2LKCA 1RIIA 2O0JA 2GZ2A 4EPYA 2VSXA 1Q19A 1ZK3A 5L3SB 4IP0A 5LFAA 3MJSA 1SG0A 5ALUA 5CDHA 3BWCA 4CN8A 3IOYA 1SBNE 2AC7A 1JHUA 3KOOA 5JBIA 3GBSA 1RJDA 1Y8QB 3T99A 1DQPA 4DS3A 2PIDA 4V0NA 1ECFA 5JIBA 3MHPA 1PLLA 1WXHA 1YZNA 2YIVX 3GUUA 4BFYA 1GYRA 2H4FA 3V1LA 3W9BA 1BKSB 2BMAA 1QGUB 2B35A 3KEMA 4KWCA 2UUOA 3MMSA 4L16A 4E4RA 3H3XA 3WQRA 3AR4A 3K71B 5HDQA 2BFAA 2UZIR 5LB4A 4EG6A 4YRAA 1NJGA 2BVNA 1YL6A 3KEOA 2GT1A 3UUEA 5BN3A 2H18A 2R6FA 3PR3A 2O3TA 3GLQA 3RARA 3EVFA 4MVJP 5KUTA 4C2TA 5TE9A 3H1AA 1L7AA 4Q7EA 3UK2A 3IJRA 3EUFA 4GP9A 1ZVMA 2DBZA 3QNUA 4WW0A 4CDNA 5AVXA 1YI0A 4WD3A 2CW5A 1WXDA 3FFTA 1XV5A 5BVHB 2RHTA 1W47A 4FN5A 1J00A 1ZUIA 3QXSA 4CKZA 3CLKA 2SKCA 3FF1A 1WABA 2VCHA 2VHYA 4P4TA 2C2ZA 4AROA 4B87A 5AM4A 3VA7A 1OU0A 1SVMA 2AIRA 4GF5A 1FDOA 3CUUA 3HN2A 2G9UA 2I78A 3K31A 4XYEA 2IGBA 1H2AS 2GDZA 3CCUB 1SXJD 3BF8A 1VE5A 3LM8A 2LDBA 1YOBA 1NI3A 1TD1A 2O6LA 2QROA 4KXVA 1H9AA 3QRWA 3FUTA 4H7KA 5FR1A 2IEGA 4QNMA 4KCGA 1WAMA 1F1JA 5FUWA 1IHPA 3SX4A 3OF3A 4GI7A 3ZE6A 4ZALA 4B8YA 2C9DA 5CURA 3UJ3X 3KVVA 3OTHA 4P3YA 3GIDA 1VLZA 1CR6A 2V6JA 3X1MA 4AKTA 4ROSA 3TL6A 2PTHA 5JYCA 3TR6A 2CVOA 3L6BA 4NJEA 3VZQA 1Z0KA 2HV8A 1I7LA 3PUWA 3PNPA 2GN9A 4M8SA 5FOXA 2BOVA 5GV7A 2HRDA 2FE1A 1XRMA 3PHJA 4FGKA 4Q3OA 3LO5A 5DI3A 4XX0A 1DRWA 4BO5A 1PTKA 2XCRB 4EFNA 5KKCA 1E89A 1BQ3A 2L0XA 2VJLA 3MN1A 3CZPA 3O21A 4FDMA 4JU8A 5F4BA 1HDRA 3JVUA 4AS3A 4EB6A 2I8AA 4ZZ1A 2ZRAA 1R4AA 1W5BA 3L07A 4Y9RA 1EHYA 5TNXA 4DC0A 3MVEA 3W1EA 4PAAA 2KM1A 3HHPA 3WZMA 2ZYRA 2F8TA 2OQIA 4KMOA 3IDSA 4U7JA 2ROQA 2GEFA 2XHEA 1Y4AE 2HZBA 2MT9A 4FJ2A 5A5EA 2VTVA 3ZJ4A 1P1RA 5D7BA 4JFAA 5JCJD 1WB5A 4GMDA 1NMSA 1NVXQ 1N5LA 4P25A 1OX4B 3W5HA 1KYQA 1WB6A 1LQ2A 1X74A 1BWQA 1ZDMA 1DMSA 2FW7A 2NTJA 4OHOA 4G0NA 4OM8A 2PZMA 5AKGA 3TAHA 4MLDA 1EZ1A 1NVVQ 2VHZA 2EZUA 3L4SO 1QHHB 3CURA 4MYHA 5T7BA 4IGIA 3GDHA 3G2JA 4LNUA 2VDRB 5B30A 1AC5A 1ZJJA 3N6XA 1RJWA 1XLTA 4LJ7A 4Q9AA 1X9HA 3W7AA 4FQ5A 4YMHA 1I1QB 1OT3A 2AR9A 4FSHA 4P36A 2XBMA 5CXUA 1A9XA 3I0MA 5AR1A 1OI4A 1PX0A 2ASEA 3JU3A 1KY3A 1RWPA 4NBKA 2C7RA 4KK4A 2E5WA 4LV8B 1EX6A 1T2VA 1KY4A 3ZZNA 4WCVA 5ENZA 4BATA 2ZXUA 3KYDB 1BDMA 3V33A 2AV6A 1HL3A 1GCUA 1R27A 2R86A 3PLRA 1IMOA 4MO2A 3CTMA 5CW1A 4R3NA 4BMVA 4L4RA 4WA8A 2XB2A 3ZNOA 2BM9A 2HMUA 1U3UA 1MU0A 3ROPA 4PZEA 3ZXSA 3VX4A 1CNFA 1EIZA 5LIPA 4M0FA 2DWOA 1QGAA 2BZGA 2G3YA 3KPVA 5KTMA 3GOHA 1SOWA 2LE0A 3E7PA 4DVGA 4Z7QB 3WYAA 5C52B 3Q6IA 3CN9A 2E1BA 4P33A 4RFVA 3T8YA 1XKTA 2JRLA 1CEXA 2C58A 1A5BB 1DS6A 1AUOA 4ZYZA 5LJLA 4L3WA 3KTAA 2OSVA 5CA1A 5K0JA 2ORVA 3RIEA 2ZRMA 4QDTA 4DDKA 3PRKE 5AH0A 1UDAA 3A6GA 3KJQA 4QGBA 4HXYA 4GI2A 2Y6UA 4ROTA 3UT6A 1M33A 2YXEA 1P4GA 4HNQA 4I19A 1GCGA 4HMQA 2D2EA 4CUKA 3IQFA 5FUQA 2HA6A 4JH0A 4ZKEA 1W4CA 1JA0A 2ET6A 4BP3A 1IAVA 1WHSA 4H4EA 3ZGXA 3QG1A 2BP7B 2R11A 3EZFA 1AV7A 5FHQA 2P4EA 2PUVA 3D59A 2XIJA 4AKEA 1UWLA 3DMPA 3THXB 4RA9A 1D2HA 1TLFA 1LPOA 3FZNA 3TNYA 5LP6A 2RONA 2HMVA 4ZVRA 2FWAA 1DQZA 1LBIA 1QRRA 2HQ1A 4P3XA 4Z8YA 1LX7A 1R6XA 3AIMA 3GFOA 4PZAA 1GKIA 4HLDA 2GN0A 1KJJA 1G8HA 1UAYA 3AT1A 5DXJA 5IF3A 4EZIA 4RCYA 1Q3TA 1JFFB 3O3NB 2I91A 3WLOA 5DN6D 2QLLA 2FPUA 3AKEA 3R3VA 4UTVA 5DTIA 1UJBA 1Z06A 3ENWA 2JBAB 5C8YB 4RHXA 3Q7IA 2Y9PB 2C1EA 3DOEA 2YWJA 4FZ3A 3CWCA 1GL9B 3CNBA 4XARA 4YBZA 4DXHA 5KWEA 3GZJA 1S3SA 2ZI5A 3N5KA 1CULC 4HLUA 1D2RA 2A0KA 1AXEA 1HURA 2CLHB 3DVQX 3MJRA 3OHPA 1CFJA 3FCXA 3X2EA 1MTOA 4ARZA 3BAFA 5DGDA 5FUXA 1TK9A 2VHCA 3WLFA 4LJRA 1WXWA 3WLQA 4F84A 1DJMA 4TROA 1DWQA 4YJGA 4KOEC 4FGZA 1BIFA 1E8NA 1Z2DA 1TM2A 3PF8A 1NI4A 1DG9A 3KDAA 4CKXA 1WXQA 1ID1A 2HK9A 2YMPA 1E3SA 1E1QA 1Y7IA 2Q5IA 1RYDA 3IEUA 4PIPA 3UJHA 3UYKA 5BN1A 3IBYA 4B3SB 5I8PA 5HCUA 1QG0A 1NAHA 1SMKA 4FFPA 1X38A 3VU1A 1P5HA 8ATCA 2VYCA 5CEJA 1N5KA 2PUEA 5EN4A 4YONB 1BDHA 4RCVA 3PVDA 3V76A 1VJ0A 1Z68A 1WD7A 2IP1A 1C7JA 1CY0A 3AVQA 4JHXA 2YC4C 3BRCA 5JCZA 1OGYA 1EFRD 3Q3HA 1W2WB 3PPIA 4KEAA 3K8ZA 4JWTA 2EKLA 3DT6A 1V41E 4Y18A 3QIVA 5H80A 5JY6A 1QHEA 3VKVA 1W5AA 4HYTA 1PJ2A 3JQAB 3QWAA 5CU7A 3D0OA 3HJGA 4CM4A 4CETA 2VHJA 5FI5A 1N2BA 5TARA 4CMIA 4GDFA 1N5OX 1JHAA 4DQXA 1WY5A 3F9RA 4DTCA 1P91A 1YNSA 2XUDA 3THOA 1ACJA 1N2XA 1NR7A 2XWBF 3Q0IA 4AX4A 2H1HA 5EHZA 4CMHA 6REQB 1GT91 2Y76A 4EY5A 2FFHA 2RI6A 3KBOA 3OCZA 4ETIA 2OGWA 1UOQA 2HA0A 1DFIA 5DHTA 5IJZA 1CF4A 3GF4A 1ZSYA 3I53A 4IAOA 3HE3A 4NV0A 4WJZA 4B40A 3RAJA 1HE3A 2XDWA 2XXAB 3CZMA 4X44A 4KSBA 2A5LA 1SKAA 4FD3A 4NABA 3U4QA 2VF4X 1UWVA 2XHZA 1PQYA 5IM4F 3KX2A 3F4LA 4O08A 3MTDA 2X8BA 4JODA 3W34A 3TSCA 2YWBA 4EW3A 2Q6VA 1EDOA 1GZ3A 1U2DC 2H3HA 5DCUA 5B3KA 3ADBA 1SD2A 3QTBA 2JGJA 4N7MA 3SS7X 2HLDD 4ZV9A 2DOGA 4P0PB 4UBJA 1I13A 1D7AA 1GQSA 1MG0A 5ITWA 2O2GA 4RL4A 4YP9A 3WZLA 1FNCA 3DE7X 5ILOA 3DVRX 2WT9A 4QFBA 5KAMA 1DAIA 1O6GA 4JCCA 4JB8A 2ORED 1BA3A 3ZV6A 3NWJA 1NUTA 2NTVA 4CFZA 3BKXA 6CHYA 4RTRA 1NN1A 2XGSA 3Q5DA 5BNWA 2QIOA 4PCLA 3K6SA 3KJNA 1HA3A 1E7MA 2OKCA 3S55A 4KN5A 1KWGA 1ENPA 5ARCA 1ZGAA 4RZUA 4Q7JB 2DFLA 5B64A 4RTPA 1RABA 3QUTA 4POAA 1N0VC 4L8WB 4Q9DA 5DLPA 1Q92A 5AM3A 3PZBA 3ZHVA 5HWSA 2JIZD 3IBCA 2ZBUA 3ICOA 3NDJA 4MW1A 4OIMA 3STTA 3PVZA 5E6UA 4ZO4A 1G1MA 3GPCA 2Z98A 1RM0A 3PKJA 4A8PA 2JFVA 1RRCA 4NLLA 2F9LA 1RLTA 4ZCRA 3OJWA 1YIAA 3EIWA 4BE4A 3T7CA 4C0WA 3VHXA 3TRFA 3PUHA 1DAPA 1OUMA 3I6YA 4WECA 1QU2A 3IQHX 1DLIA 4KE8A 3ZDDA 1XN4A 5E8RA 1SUBA 5BV8A 1EVQA 2CHQA 2ZJBA 1TF7A 4O2RA 2WSSA 4F11A 2OR3A 2IUUA 2A5FA 3SM9A 1IG3A 1XDUA 2B3DA 4MR9B 1XRPA 2Q50A 4HY3A 3C45A 5JNVA 4KGXA 3H2YA 2D2FA 4GLFA 5DYWA 1K8ZB 1Y1PA 2DKFA 4Z4TA 4CL8A 4ZYYA 1ETHA 2Q2NA 4QRHA 1XQXA 5C7YA 4Z4GA 1MH1A 2I29A 3A0RB 5CB4A 1R12A 3TJRA 4XX1A 1YZTA 3LC2O 4AIRA 5BNFA 1E2DA 1ZSVA 2D13A 1CR1A 2B7LA 4XLLA 1C4XA 1ZI8A 2OV8A 2YJGA 3IBFA 3IERA 5TSDA 1E4VA 4QDOA 1DV1A 2ZUWA 2F9MA 2QL5A 4W9NA 4HNAB 3WNVA 5CFNA 1IBLB 3AFHA 2C4KA 2VP2A 2NU9B 3CJTA 3VR4H 1G3RA 1XK7A 1BTOA 3DGFC 2GJRA 1E1CA 4FDVA 1YE3A 1WUTA 4F97A 3GWZA 1EXNA 3GIRA 3LY8A 5LD2C 5B3JA 2ZITA 1JDNA 5EQTA 1OLSB 1C0KA 3E3AA 3W7BA 4U9HS 3I9OA 721PA 2GK7A 3HTXA 3O8DA 5HIMA 1CRZA 2HUPA 4X06A 4K9OA 2CLLB 4QUZA 2ZCUA 3A1TA 1WCIB 3DEJA 3OM8A 4CLXA 3AKCA 5DCLA 3ZUPA 3FYUB 4QTXA 1QRAA 1ZH2A 3A9TA 1EB9A 3LDUA 3OFSA 3W3ZB 1TTHA 4YV7A 5K20A 1HLFA 2FX2A 1CQJA 2WVHA 3PTZA 2XYVA 4GLOA 4MKIA 3U7JA 2OHFA 1L8QA 1UDWA 4MQMA 4Y30A 3V32A 3UJCA 1G59A 1A9TA 1UBFA 4TLCA 5AI5A 3NIBA 4EUNA 3RYTC 3CG0A 3ZHUA 3P2OA 2YRWA 1R8JA 4E5DA 3CC4B 1WPRA 2C4VA 2O2SA 5FA5A 1FUKA 3M4XA 4A9AA 2XCIA 5C1BA 2VAWA 3CRMA 1YE5A 3GVPA 4UCQA 4IIVA 3AUSA 2ZSAA 3ACDA 5D1HA 4WFQA 3GNSA 1YCFA 1KRXA 1KYIA 2WJGA 2I76A 3O2NA 5L46A 2G8NA 2XA2A 3E5RA 3E53A 3F6RA 3R41A 2W2QA 2ZROA 5IDWA 3TNLA 3GLIB 2SBTA 1HMYA 3U3ZA 3A3NA 3PA1A 4ZYVA 2L17A 3H11B 4QG7A 3RBXA 1OT5A 1TC2A 2NTYC 2HCJB 1WSBA 4LZNA 1HDYA 3EW7A 2EOAA 2XMSA 4MMXB 4MS3B 2DH6A 4K6GA 4ABTA 4OXQA 3OZTA 2CFCA 2PJZA 1T4CB 3UVEA 4NCAA 3AJEA 3V4VB 2Q21A 2GDJA 3BA6A 3UMGA 4LHYA 1M0TA 1RYMA 1HK7A 3CC7B 3C3XA 4GSYA 3V1UA 5C53B 4U7WA 2AF3C 2XY