2XNJA

Crystal structure of an engineered ferredoxin(flavodoxin) nadp(h) reductase (fpr) from escherichia coli
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
255
structure length
255
Chain Sequence
ADWVTGKVTKVQNWTDALFSLTVHAPVLPFTAGQFTKLGLEIDGERVQRAYSYVNSPDNPDLEFYLVTVVYTNDAGEVVKGKLSPRLAALKPGDEVQVVSEAAGFFVLDEVPHCETLWMLATGTAIGPYLSILRLGKDLDRFKNLVLVHAARYAADLSYLPLMQELEKRYEGKLRIQTVVSRETAAGSLTGRIPALIESGELESTIGLPMNKETSHVMLCGNPQMVRDTQQLLKETRQMTKHLRRRPGHMTAEHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Swapping Fad Binding Motifs between Plastidic and Bacterial Ferredoxin-Nadp(H) Reductases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords FERREDOXIN NADP-H REDUCTASE
total genus 69
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2xnjA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2xnjA02
1EP1B 2CNDA 1QFZA 1D1NA 1GVHA 1ELOA 1VQPB 2BGIA 1S72B 3CCLB 3AVXA 1ZUNB 3ZBUA 3OZVA 1VQ8B 3E20A 4PC7A 4K1XA 1VQKB 3CCEB 1D2EA 2DETA 4AF7A 4RJLA 1VQ9B 4J0QA 4RD1A 1UMKA 1R5OA 3W2HA 1SKQA 1FNCA 1DDIA 1E62A 1VQNB 4IW3B 3PENA 3JQQA 4U9UA 3A1FA 4RCZA 3JQPA 3MHPA 2OK7A 1QVGB 2BV3A 2BF4A 2QN6A 3E1YE 4G1BA 1BX0A 4AC9A 1OGJA 1K9MD 3CC2B 1DDGA 2OK8A 4B44A 3QSYA 4YAFA 4M2LA 3SJZA 4N3GA 2VZLA 5TR9A 2NPFA 1B23P 2QA4B 2XEXA 1KRHA 1VQOB 2AHOA 4PC3A 4M1KA 3CMEB 3U6BA 5EMNA 4F7DA 1TVCA 3CD6B 3MMPA 1FNDA 3WNDA 1Q82D 1NDHA 1GO2A 1TTTA 2BSAA 3OZWA 4B47A 1YITB 4RD0A 1QVFB 2RC6A 3FJOA 4FK8A 3W5VA 4Y7CA 1S0UA 3U6KA 4BPRA 1KTVA 2VNKA 4M0LA 4EH1A 1FRQA 3P27A 4B4DA 3VMFA 3AVVA 1W34A 3AVTA 4NBSA 1OB2A 3W5HA 1QFYA 3P26A 1JA0A 3OW2B 3VNVA 4HE5A 5H59A 2BM1A 1I7PA 1EP2B 4RD6A 2B7CA 5TV2A 1JA1A 1R5BA 4HE6A 1VQ5B 4R71A 1JB9A 1H85A 1CNFA 4M53A 4UAJA 2OTJB 2QMUA 3ES9A 3JQRA 5GV7A 5DSZA 2FX3A 3W2GA 1U2RA 2YWFA 1QFJA 1WDTA 1YHQB 1W87A 2CRVA 2QTZA 3QFTA 4RD4A 3G71B 3VO2A 4B48A 3CCUB 2YWHA 4LBVA 1KC8D 3ZBTA 4YAUA 3VNUA 3ZZTA 1VQ4B 4YHBA 4ACAA 1ZM9A 3CMAB 4TMWA 1VQMB 2QTLA 2EIXA 2BVNA 2XNJA 1D8TA 3B78A 4AF6A 4PC6A 1OB5A 1N0VC 3W2FA 2HDNB 4LBYA 1QUFA 1Q7YD 2B5OA 5FA6A 2DEUA 3W2IA 4TMZA 2BPOA 1G7RA 4FWTA 4N3NA 3AVWA 2VNJA 3G4SB 2R6HA 2HMAA 4Y9RA 4ZGNB 4TMTA 3VO1A 1M1KD 1FNBA 1IB0A 1QGAA 4G5GA 2B7BA 1GR1A 1CQXA 4YAWA 4Y9UA 1SM4A 3W2EA 1ZM2A 5HXBA 3V76A 3B8HA 4DQLA 1QH0A 4WQMA 1YI2B 4LC0A 4YALA 4G1VA 3G6EB 1EFCA 3U2QA 4QHYA 1N8RD 1ZM4A 1JNYA 5GV8A 3CPWB 2VYQA 4RD2A 1DARA 1DG1G 3OJWA 1HA3A 3LO8A 4B3XA 1GAWA 5THXA 1G7TA 1VQLB 3CC4B 1KJZA 1KD1D 3OZUA 3CCVB 2VNIA 3QFSA 2BGJA 1H42A 4ZGQB 2PMDA 2DY1A 1IJFA 2J7KA 3ZZUA 1KK1A 1XE1A 3WBJA 3CCQB 4P6VF 4H9GA 3CRZA 1W2BB 2YWGA 3LVBA 1EXMA 1QG0A 1Q81D 4C43A 1KK0A 4ZV4A 1FNMA 2X3UA 5H5JA 4PC2A 1J9ZA 3WYAA 4RD3A 3CXCB 2ZITA 4PC1A 2YWEA 3CB4A 3FPKA 4PGOA 1G7SA 3AVYA 1QX4A 1M90D 1K8AD 1B2RA 3CW2A 1Q86D 3QFCA 2DCUA 4TMVA 4MYUA 4FN5A 1EFTA 1G7CA 1TLLA 3I56B 2C78A 1XB2A 3ZC3A 4LBWA 3I55B 1QUEA 1KK3A 2RC5A 4RCYA 2PIAA 1NJID 1BQEA 4M4SA 1R5NA 4TMXA 3LRXA 1ZM3A 4YAOA 3MCAA 1EWYA 1BX1A 3WBKA 2D74A 4MYTA 4DQKA 1VQ6B 2HCJB 2E1RA 3CC7B 1EFUA 1FRNA 1EP3B 2GQFA 3AVUA 3WNCA 1CNEA 1K73D 3WY9A 4LBZA 3LYUA 2PLFA 2EFGA 3W5UA 4QFMA 1IJEA 1KK2A 2GPJA 2QEXB 3AGQA 5KSWB 2BM0A 1KQSB 1W35A 3WXMA 3WNBA 3CCJB 3ZZ0A 4ZCMA 1TUIA 1QGZA 3OJXA 5TY0A 1GJRA 3QFRA 1F20A 1QGYA 1E64A 4TN1A 2VNHA 4B43A 4P3YA 2XNCA 4NCNA 4C0SA 1JJ2B 1BJKA 4ACBA 1GAQA 2C77A 1F60A 1FDRA 1OGIA 4ZCLA 2OTLB 4Q7JB 3CCSB 1AIPA 3B82A 3J81k 1YJWB 4ZCIA 1YJNB 1VQ7B 2BMWA 1YIJB 3AGPA 5JBQA 1AMOA 3CCMB 5AN9A 2DERA 1YJ9B 3I1FA 2BN4A 1A8PA 3CCRB 2QDXA 1E63A 1N0UA 3QE2A
chains in the Genus database with same CATH superfamily
4YCLA 1ZX1A 2P5UA 2CYBA 1QQBA 1NYRA 4HUTA 2X2FA 2ILVA 4RTJA 1CRPA 1C8VB 4MVJA 2RHTA 1U3WA 1TEZA 1SUPA 4LDAA 2VZ9A 1IN4A 1Z3CA 1QO9A 3CXRA 3DP9A 2QXTA 1R6XA 2VZ0A 3B52X 4ZEOA 4DTCA 4YR7A 1UDBA 3OT5A 2H51A 4HK4A 1WL8A 4PPNA 1U1GA 4PZAA 3ENKA 1C3LA 4HDMB 1RVV1 4AROA 5DASA 4LMRA 4PSDA 4UMFA 4ENQA 3QPAA 2KLBA 4QOHA 3RBAA 4X1IB 2I34A 1E1RD 3E20A 3EQZA 3LX4A 5CFZA 4I6GA 3OFJA 4U7PB 1UAGA 1IK6A 2G40A 2OZEA 3QU9A 4NG4A 3ZK9A 2D2XA 2QD3A 1CP2A 2CZGA 2EKBA 1J2EA 2JZNA 2IV2X 3G2IA 1WZCA 2W2VA 4X20A 2MSEB 5TB5A 4YLYA 1EE1A 1DAGA 3R5SA 1PIWA 1J5PA 1AQNA 1VI6A 5I9LA 3TKYA 4ZQEA 1CQPA 1BDMA 5CVJA 1FNSA 3DMRA 4UDNA 3K9HA 4ND1A 2GYVA 5F51A 5B7NA 2NV2B 2VT6A 2H7XA 4TZ0A 4KR3A 3ENQA 1JQBA 2QQGA 3QLVA 4QDOA 4DEVA 4WAUA 3K15A 4OV6B 4DRZA 4QHSA 4OO3A 5FI5A 3UAVA 2QSYA 2VRWA 4Y2YA 4H7PA 2DHEA 4A6DA 3ICCA 4WBNF 2W6PA 3EASA 5J2UA 2J8ZA 2BKAA 1E3IA 1LDNA 2C9DA 2HYDA 4G9BA 4L4YA 4C05A 5LN1A 3VH4A 3EE6A 1H0HA 4DJEC 1H69A 1V4VA 4ZT5A 1V95A 2JPDA 4RIFA 3C5WP 5K6TA 3OLWA 4IPTA 5LZ8A 1AV6A 4DS3A 1PP4A 1LDGA 3IUYA 1P7WA 4IHJF 1YCFA 1A9QA 3SJZA 2X40A 4I6EA 5IDYA 4B75A 1GAXA 1ESZA 1XMQB 3INGA 2WV7A 3O0DA 4OY3A 1COWD 2L17A 4TKLA 3GBVA 4NU6A 1M54A 1R12A 4KFSA 3RYHA 2WJJA 4GI2A 5EWJB 1BJRE 4Q9NA 1BXRA 2R96A 3OSZA 4XVCA 1JV2B 2VWPA 4JLUA 2YHAA 3T7KA 4GWGA 2B69A 3H18A 4I55B 2HCTA 1BW9A 4K0RA 3I2IA 3F1LA 4FMDF 5K0LA 4M1KA 3JAMA 1GCIA 1KY4A 1GCOA 1US8A 4G5RA 1LW6E 3WB2A 1EFPB 2RHRA 3HL4A 5BQPA 5BV0A 4PZLA 3O95A 3QEAZ 1JIUA 1HV8A 4RDLA 1XCPA 3KBOA 5LYJA 1UD2A 4NYMQ 1GCAA 4RJKA 2B0CA 1RKVA 3K70D 1FS4A 3GVCA 1SVIA 1A4IA 5KOJB 1Y9AA 4GMFA 2FOXA 3TSWA 3C6MA 5IWAB 4NYJQ 1TM2A 4OSEA 5L8VA 3J7TA 7REQA 1JDBB 3DV9A 3N75A 4UUMA 1Z9BA 1CW2B 2OSBA 3EAQA 2RC6A 2NNLD 1GSHA 3IOBA 4JITA 2F3UA 5M2QA 1GPAA 1N9GB 3AEKA 3H1TA 1L4NA 2Z2ZA 2I5PO 4QOJA 5K03A 3U4QB 1WSDA 5TF0A 3OJEA 2VJJA 3ICEA 3L01A 1WP4A 1LTQA 2IT1A 2ZVJA 3LFUA 5B4TA 3GH3A 5GOZA 2LDXA 2HIMA 5AQ1A 3QVGA 3GUYA 1PW7A 1PGPA 1Q6ZA 3GH1A 4YQYA 1QG4A 5BURA 1DCKA 2FV8A 2UZAA 4URYR 2QE7A 1YA8A 1KJNA 5JVDF 3CZQA 4M8NE 2XXAA 3ILSA 3DWIA 3BBLA 1XTSA 4O0MA 5EJAA 5L3RA 3MJSA 3Q1LA 5JNRA 4LZLA 1DO8A 3B5IA 1CYEA 2IV3A 4QBGB 1IXKA 4XSGA 2O19A 4RVHA 2EZ8A 3RDPA 2QLNA 4FILA 1QFYA 4A26A 5CXSA 2WG1A 3DNMA 3DULA 1JLSA 1Q12A 2WFZA 1XJQA 5CP8A 1S2LA 2P3SA 3WLOA 3OIYA 3Q7QA 4KUGA 5E8RA 1QH9A 3BILA 1DBRA 1GG9A 3Q41A 4R8SA 4UM5A 1V5FA 2HF8A 1GNQA 2ZVQX 2QUAA 4ZN6A 2CDNA 1H2BA 1T3GA 3OT1B 4DCPA 4INJA 3SYNA 1Q7GA 2ZKIA 1E43A 3O73A 4GLJA 4MR8A 5LB2A 4F5YA 3HM9A 1FU8A 3L9XA 4CLHA 1GG5A 5GVSA 1GDTA 1DG9A 3QKTA 2Z5VA 4X1KA 8ABPA 1X9IA 2GN9A 4MUXA 3TW6A 3K5PA 3W7BA 2B6HA 2RFLA 3GPLA 4QIHA 2F1MA 3FNFA 4XDZA 1AKVA 2WQZA 5E7IA 4U3JB 1VL2A 5IAOA 2WDPA 3HEMA 1JSCA 1DWQA 1OAOA 3A6LA 5IUNC 4L8GA 1QZUA 3D2AA 3FDIA 2OTJB 4CDMA 5JLJA 3X0DA 4NDNE 3DZFA 1YL7A 4ZI2A 3ESXA 5D5QA 4RIIA 3F9CA 3ZDFA 4RSRA 3D6UA 3FPLA 3GHHA 3WYDA 4OX9B 1YR8A 5E4FA 3WIEA 4BNNA 8AT1A 3K20A 5AHWA 4MWTA 2H1HA 1YIAA 2CYAA 3AEUB 4M1WA 3TINA 3KC2A 3BDIA 3M70A 2GM3A 3LX8A 1DQRA 3DMPA 3SX2A 1OBFO 3E6AA 4FBMA 5AW6A 2QZJA 3H42B 4X92A 4UEWA 4RPGA 5IBQA 5IXJA 1JPVA 4DCVA 2FFBA 4MITA 3BL8A 2NX2A 4B6JA 3O7MA 1J0CA 1V35A 3D4NA 2F1IA 2Z8ZA 3TZKA 1TZKA 3I9FA 2IF0A 1K0FA 5BXYA 1MJHA 3BA1A 3RYTC 1I8DA 2D3WA 5DK4A 4AUEA 4DR7B 4JNCA 4OF4A 1MQ8B 1ZM9A 2G4VA 3BD9A 2UYHA 1K4KA 2C9MA 4F6RA 2Y68A 3L7CA 1LDBA 2PA0A 1G8JA 3WMGA 1TYAE 1R6VA 5EVCA 4HPJB 1IHYA 4HPWA 4LJ8A 3NV9A 4HCJA 3PIIA 1DTWA 4KK3A 1XLVA 1Y8RB 3UN1A 3X2EA 2QRJA 1QVVA 3NR2A 3CH4B 3BFXA 1Q7CA 2CFTA 1NUUA 1L2TA 2O7SA 2YDYA 4WBNB 3MJDA 2V7TA 4EELA 2X0IA 4P4TA 5MGBA 3RUEA 1I3KA 3ZDCA 2VHQA 2HDNB 1TYBE 2E1BA 1UEIA 1VE5A 2UXCB 3W90A 2G28A 3EVGA 3N58A 3GJ4A 4JQCA 1GP2A 1CE8B 1CZLA 1SK8A 2CFCA 5F7ZA 2IELA 4K6MA 4G65A 1Y33E 2HHLA 2ZCVA 4LOHA 4POOA 3D3JA 5IM5A 5HQTA 4CGZA 4YMIA 5I9SA 5I6DA 2BMVA 3G4SB 1PNOA 3BH0A 3L7IA 3MFYA 3IEKA 3UHFA 4A0QA 1RCTE 2ZZNA 2GXUA 1O96A 4P5EA 1SOUA 5C34B 2BFAA 1DXHA 5F98A 3WP1B 4PQEA 1EHIA 2GASA 5IBPA 4HN2A 3A1CA 1JXAA 1JHZA 1OLSA 1T1IA 1QX3A 1MC5A 4Z4VA 2IBMA 1LUAA 2J67A 2W42A 3JALB 4PSVA 3QK7A 1C9MA 2AK3A 4GFDA 3CH6A 1MPTA 1CQXA 3GVLA 1BA3A 1UUFA 2PCLA 4FDTA 3LF2A 2H0RA 1YL5A 3UMSA 4E30A 2WTUA 3LYAA 4D3XA 1SNYA 2V9ZA 5GPBA 1SPBS 2EF1A 4DUZB 2QW0X 3THYB 4F9EA 2GM9A 2Y0EA 1U3VA 3JSXA 1FB5A 3K0CC 1PUJA 4JI5B 1KPGA 3SHWA 4EG7A 2ANBA 2BI7A 4HTAA 3A28A 2RH5A 4KMRA 4IQ0A 5LDHA 2XA9A 4B7AA 3KQWA 1XTZA 2C2XA 4HDCA 1J5XA 1SC9A 2ZPTX 3OZFA 2Q41A 4LDNA 1MO5A 4ME6A 2C4UA 5K3BA 2FEWB 5HKAA 5JDIA 2NYVA 1TAUA 1Q19A 2VYQA 2FZCA 2XOKD 2FTKE 2DWUA 2H63A 5LWHA 4GNKA 1R64A 3EK2A 1OU0A 2KQUA 3CVOA 4LRXA 3PS9A 4MVJG 4EYOA 2AXEA 2BH2A 1WZEA 3NC0C 4DZTA 1USKA 3GLQA 3H86A 2ZQ5A 5TEVA 1HA3A 3MYRA 4G56A 4L22A 4N40A 4J0HA 4ZYWA 3NC1C 1IUPA 2X9QA 3KLMX 4MUNA 2QB5A 3H7IA 4JC0A 2H9YA 1H2YA 5FFFA 1JBEA 2G71A 5FHQA 3MSCA 2J08A 3O75A 3S8EA 3LCVB 3SZ3A 3WAGA 3CC4B 4G5QA 4BCBA 3WGGA 1ADFA 1GUBA 3L6OO 3KIPA 3V1NA 1Z25A 5L3SA 4C6HA 2Q3CA 3DZJA 2P0AA 1JJBA 2VXCA 2QRZA 4N5LA 3RAEC 1YS4A 3R77A 2HF9A 4E5MA 3F8WA 1ZLYA 5C1PA 1VE6A 2A94A 4QJBA 2NO5A 1XRQA 1PNTA 4BMCA 4JGBA 5GINE 3GMIA 4GF5A 3CEHA 3MMZA 5F52A 1SR8A 1TB4A 3MLEA 9MHTA 5KNBH 2VF4X 4EHHA 1P3DA 4NARA 1J0XO 1WCXA 1ONNA 1WETA 1EJBA 1YE8A 2OB1A 2QVBA 2G1AA 3CCQB 1U94A 3VC1A 1PLJA 1C8KA 2ZUVA 3DUFA 3JWJA 4ZT4A 2DC1A 4PZDA 1N07A 3RHZA 2B1JA 2DXIA 1T5OA 1W47A 3BGIA 1SKMA 1C9NA 2E0IA 3GNSA 2HRZA 1EZZA 1FNMA 3AT1A 1IN7A 1HKUA 1KI6A 2GHIA 4GBMA 4R2MA 3U4MA 1LSJA 1VGRA 5JYDA 4L74A 2XUAA 3H8WA 3SN6A 4WKBA 4DSAA 3OAAD 1H8EA 3BE4A 4MS4B 1W29A 4DMHA 3A2KA 3Q5DA 4H4EA 3FCOA 4HDRB 4TUYF 8LDHA 2PMCA 4TYQA 4AY4A 3ABRB 1PJ4A 2G25A 5E95A 3PDWA 4EG6A 2TYSB 2EWWA 1OIVA 2HMWA 5CUQA 5DI9A 1XAJA 2XPCA 3SSOA 3A9WA 5A04A 1NQVA 1S8OA 2V03A 4GYJA 1Q0QA 4NYJR 2B3DA 1NKSA 1PZXA 1IXYA 5K2MA 3MZ0A 1L1FA 1WXXA 1NF9A 4Q37A 4ETNA 3NDBB 3HUDA 2WNIA 3TL6A 4X65B 2YY5A 2Z1NA 3NXSA 1L5OA 3QBJA 2A9VA 2Y9MB 3KJEA 4PHHA 1NM5C 1M8JA 2HCBA 3QVSA 2GXQA 3H1EA 4DJ5X 2EATA 3EWIA 1H1LB 3VNAA 2ZB2A 3R9WA 2XXJA 3R3XA 3VNRA 3CPJB 5MN4A 3H3JA 5HZMA 1Q0UA 2O7NA 4BJ5A 4P6YA 1DE0A 1IRIA 2Q7DA 1Z7WA 4MRVA 3C6BA 1CZNA 3QEMA 2RHMA 1PRYA 4PTYA 4RK0A 1OLSB 3VPAA 2XNDA 3SEFA 1IJBA 2ZBUA 2FQXA 3LUBA 4ER3A 2O59A 3FETA 1T5HX 2G17A 3EVNA 3QIAA 521PA 1Z4QA 3OKXA 2QYOA 2R6ZA 1DQNA 1IYZA 3O2JA 2J30A 1PK8A 1LQTA 3RS4A 1YDMA 4LSMA 2FSHA 2ZRJA 4RLQA 5EWMB 3HXLA 3T1TA 1SHTX 2FWRA 4BFXA 3FPPA 1QYIA 4X5OA 1GKKA 1WIWA 2GVNA 3EZYA 4LRYA 4MMXB 5J5VA 3RC7A 4BYMA 2A7QA 1Y6GA 2PLFA 1LA2A 4HYQA 1NW6A 4HAXA 1FTGA 3TLBA 1AA6A 5TT1A 4DB4A 2QHXA 1HVXA 3RSQA 1VL5A 3FPCA 4MUJA 4BNGA 1CWUA 5K2OA 1YJAA 3UMYA 3U7JA 4G4SO 3L7OA 1SCDA 2PZ8A 1E2GA 2XMGA 5AVWA 1GT6A 2ZJBA 1SMKA 5FQNA 1AKEA 5JCOC 3W5BA 4KU4A 2GZ2A 2JGEA 4FHEA 5BY2A 2FEAA 2GD0A 1NW5A 4H60A 1VJCA 5SICE 4EHAA 4TTTS 2EZ4A 1L4EA 2HU5A 3MXOA 3EUFA 3EQ9A 2CUTA 1XQYA 4Q1CA 1YQWA 4PYMA 2C61A 1WOPA 2ORWA 3NCHA 5JC8A 1DBWA 1PWZA 4Z53A 1T8WA 2WP8J 4TSKA 1P9OA 2IXTA 3AUXA 2IHTA 3HACA 4NNPA 4OA5A 4PX5A 3GUUA 5JCZA 1C3OA 1B7GO 2HHHB 3BXOA 3V4PB 3NTLA 3TD2A 3QA9A 3VPGA 4DVGA 4J1NA 3NJ8A 4UZEA 2DPGA 3LLUA 4BB6A 4AQYB 3U13A 3E58A 4RPLA 3KKKA 2ECFA 2HNBA 4BGEA 5HKKA 2JGKA 5BUQA 1TK2A 2LRHA 2WD9A 4N9WA 4MA4A 3ZD6A 4UHKA 3N2IA 1WM1A 2Z56A 1PGJA 3KHKA 1Z2PX 4AWXA 5IUJC 5IX8A 2A1TS 3K7EA 4NMLA 1FFEA 4RLZA 1Z38A 3RAPR 4FIZA 3GEGA 2HA4A 4QFCA 4MB2A 2WIDA 4ZP1A 5FUYA 4V0OA 2V6BA 1M6VA 1TADA 5BN3A 3G5UA 3PC8C 4RPIA 1MX1A 4QLAA 3ZIAD 2GPYA 3QEJA 3OJOA 2PVPA 2G70A 1H3NA 2B30A 1NQUA 2OBSA 3KXDA 4B09A 3O84A 5AJHA 1QH1A 2V3VA 3V7WA 2XGGA 5BOSB 4B3TB 1L5LA 1NY6A 2IYTA 4XIJA 3QMMA 3ZBQA 4ENRA 2X3FA 4FR5A 1QIDA 4F3YA 3T52A 3VHXA 1ZXLA 3MT7A 2NXCA 1L4KA 1YJXA 2VYNA 1NJ1A 4WNYA 1LNQA 2NAPA 3P4XA 3UA3A 4RQTA 4DJFC 4LOIA 4X62B 1YJCA 4GM4A 4HYTA 4RX1A 2J3QA 2VP4A 2HTEA 3RRBA 3PDIB 1KY2A 1JIVA 2VUIB 3BEOA 3NJ4A 3WMXA 1SHKA 5KVCA 3WL6A 3NGMA 2Y92A 1A4RA 3R44A 3KVYA 3WLJA 3BULA 2ZRHA 3S3TA 5CDHA 1EMDA 2FEXA 4HWTA 3AOGA 2N75A 4BNDA 2I0FA 4REQB 1PT5A 4M0DA 4UZSA 4I4LA 3B1YA 4XB1A 5EJEA 1IMOA 4ANFA 3Q6IA 3IOYA 3L7LA 1CUJA 5HJ7A 2G72A 4IDAA 3UFBA 2H2FA 3UGJA 5JFOA 1A1SA 3W6OA 4J2TA 1E3LA 1NI4A 1MAUA 1Z2DA 4TTQA 1A8IA 4K2HA 4D9KA 3BXHA 3G9QA 1I5EA 3GPDG 4WXRA 2TSYB 4P38A 1N0WA 3ZHRA 4ENUA 3MELA 1LVHA 2B2NA 4Q03A 1ZXXA 2QL7A 2OXRA 4MVJH 3LBFA 5B1YA 3RRYA 2OILA 5JYBA 1S3FA 5JNSA 1D2EA 5ALKA 1C9EA 2A35A 2UYGA 1FTSA 4Z1MA 1SURA 2WMOB 1YI0A 2W0SA 3PQ6A 4BMOB 1RJEA 5TQJA 4ECEA 3TSYA 2J0UA 3A1EA 4P80A 1PS8A 3WZLA 1UMDB 1RC0A 1M2NA 3FWPA 4I8DA 1EGVB 2H5JA 4TQGA 2ORYA 5G4LA 4DZZA 3RVLA 1P19A 1ORVA 5HDQA 2AHRA 1IM8A 4LEIA 4MV5A 4KQ6A 3ISVA 3LP5A 4X84A 3SQLA 1MZVA 5FJIA 1JHDA 3B6KA 3EEBA 3PD7A 4MYRA 2WKRA 1W9XA 1SH7A 3EXG2 3GCXA 3LDFA 3HO6A 5FIUA 3LFTA 1IPFA 1XVLA 2BFOA 1OIWA 2YFHA 3EODA 3E1YE 2ZB4A 1HZZA 4BNXA 2IDZA 4QGGA 3QXHA 3AY6A 2I7CA 5AW2A 4A6PA 1ENYA 1WCIB 2WZDA 4QTXA 3U0VA 2P1DA 3EG9B 4R9NA 4JJGA 2A5YB 2JBHA 4HFRA 4WHMA 3TLKA 3A4VA 3K30A 3QRWA 4G0YA 4L3OA 2ZPAA 2UZ0A 1Z8FA 2Y76A 3MPUA 5D7BA 2Q4DA 1UQRA 5TEWA 1TMYA 3I2KA 2GN0A 1W59A 2FZWA 1KEEB 4EPWA 5FT9A 3S29A 1ZR4A 4DG5A 1I7QB 3ISJA 1M73E 5HGXA 3L0PA 1E3MA 4Y6PA 3LA6A 2PZBA 1NV9A 2QA4B 5FWYB 4AMVA 2D1RA 2YXEA 4R7GA 2AX3A 2Q4EA 3O4HA 3QI2A 4RIEA 1H8HD 3GLSA 1UMBA 1D7AA 4E7OA 5DBHX 1QE5A 3EDCA 1MAHA 2HBYA 1U2DA 3IULA 3KL9A 3K31A 4PTZA 1H94A 2OXFA 2ZULA 4KQ1A 4EHBA 4EYQA 5EUMA 3RUHA 2HM7A 3DAHA 1PBTA 4N5MA 4KVAA 1G8YA 5CIQA 3GOQA 4JEHA 3RSCA 3UOAB 5CXUA 3KG2A 1NASA 3E9DA 4NRDA 3Q15C 5EA2A 3HRHA 4QUIA 4XGKA 5JANA 4KZKA 2QK4A 2W2NA 3VJKA 1U02A 5J4VA 1NUPA 4H4CA 1TA0A 3E22B 4CMEA 4QQRA 2O3UA 1EFVB 4B3GA 3N39C 2GBGA 4UUBA 1E2BA 1AKNA 1TRKA 3INNA 3VHXB 3UV3A 5GIPE 5F2OA 2UYYA 2Q6IA 1TD9A 2N3ZA 4OPMA 3W4JA 4RD0A 1JN0A 4MIKA 4UXHA 1JH8A 4WK6A 5JXGA 2FQ1A 4EPTA 3FAZA 3BQNB 5BSEA 2O0KA 2BMEA 2C5GA 4XIFA 3FMVA 1ESNA 1GFSA 1WCWA 4YAIA 4HQ6A 4BPRA 1Z5PA 3DEJA 1VJGA 3P8ZA 5F4OA 1UM9A 2P2CA 1QGOA 3MG9A 3OQHA 4KXLA 1U5AA 1L5HA 1JWLA 4OUKX 1OE0A 2LBPA 2ZT8A 3KEOA 2IEGA 2IKSA 1XFOA 1WMDA 1GCGA 1W34A 3JYOA 4NBSA 3KOYA 1ZD9A 3PU6A 4DUPA 3S70A 2HY7A 1HZJA 5DPMA 4FU0A 1H8ED 1RHRA 1Y48E 1KDVA 3D59A 3ER8A 1B0PA 1Q9SA 1MJNA 3MCTA 4AG3A 1VMAA 3RVJA 2QTVB 1BS9A 2UVPB 3GRCA 4I46A 4CCYA 1DC4A 2ODQA 4C0BA 5DRYA 2P9ZA 1PZGA 1G8HA 4YECA 1JDBC 2DKNA 1UBCA 1VMIA 2WM8A 3AVPA 4K5QA 3T3EA 2VJQA 2XZTA 3WADA 5BW8A 1MC8A 1JEEA 1K9SA 5BP7A 2C88A 5I4IA 3GRVA 3EIXA 1AMUA 3FCSB 4RDCA 4RVUA 5CH3A 4B0PA 2AG6A 5K0TA 1P80A 3ZY5A 1XZJA 2AFIA 3QEOA 3MCZA 2RIRA 1PR1A 3O8LA 4MS3A 3OQVA 2PFGA 1FVOA 2P62A 4Y6OA 4N5DA 3RARA 3SDBA 1DO2A 3ES9A 4TWRA 3L0IB 5BR4A 3KQOA 2E37A 3R5KA 4WGFA 5F2EA 2E4VA 3WGVA 2JI7A 4U7WA 5IYZA 2FX3A 1XAGA 5EWLB 3L0BA 3L84A 1ZZEA 2O3RA 1NJ5A 3GB9A 4N49A 3P9YA 2G82A 1V3VA 2A9PA 1Y4ZA 1A9RA 1PR9A 2FPGA 1LH0A 3IO3A 1I18A 3PFNA 4BFUA 5GOTA 3F97A 1Z39A 4K6FA 4ESEA 3DDYA 3IBFA 5EIFA 2Z6UA 3DBOB 5LZ5A 5H02A 2XZDA 3S44A 3FKSA 1X7ZB 2JK1A 1RKUA 2JD2A 4Y1FA 3UG7A 1NG9A 4LMAA 3K72B 1F6WA 4IM7A 2CXOA 2D9RA 3U61B 1PJ6A 3AOEA 2CMFA 2ZAMA 4GE3A 4L2IB 4CLRB 1P29A 2AR9A 3B48A 4XVQA 3MIZA 4PZZA 3RUCA 1XVTA 1QCCA 3E70C 4BMYA 2XE6A 4HAYA 4RZSA 1L7AA 1W5BA 4L72A 3KZVA 1TKCA 1WA5A 3VOSA 5C7IO 1S1CA 3AHJA 4GWKA 4EYSA 1U04A 5AW8A 3PR2B 1N8TA 4I5DA 1CR4A 1KE1A 2PU5A 3S68A 5CEEA 4I1YA 1TEXA 2QU7A 1KH1A 4P7JA 4MQBA 5IWCA 4V2IA 3SVLA 3UW1A 1R8YA 2CZCA 3UPUA 1CUHA 1CUDA 3FVQA 3QH4A 1RZRD 3VOBA 3I5XA 2EYUA 4XUGB 3SF8B 3DTVD 1ZSNA 2CCGA 2H17A 2HQ1A 4XJSA 3LBIA 2HQRA 3RE1A 2B5OA 2PX3A 4UFOA 5F3DA 4UFNA 3MCUA 5ANRB 3D6AA 1H6DA 1NDUA 1RXUA 2WUEA 3VUFA 5J4KA 3W04A 1SBTA 1WDWB 1K6XA 4G97A 3G8DA 1QF6A 4MYDA 5FTJA 2HUNA 2NQ2C 3BGDA 3V9AA 4PGGA 1P6XA 3IIEA 1YH3A 3QXGA 2LCQA 1TMOA 2VTEA 3UATA 3COPA 4KGVA 4IIEA 4EHDA 3JQ8B 4OXXA 3G5MA 3RK0A 4Z2AA 3JAWB 5HQ3A 2P35A 4G0VA 1U9IC 3MQ2A 4EFLA 1X1BA 4ZTBA 3RTCA 4GS5A 4J75A 4MQ6A 5DYYA 2ZRQA 1SZPA 4B3SB 1FUIA 2QNIA 2V4MA 1EE9A 2P65A 2YMLA 1FJXA 3ROZA 2CL6X 2XA1A 2JW5A 4LF8B 1SVOA 3VR6D 3LIIA 4M76B 2BUAA 4XTRA 3NP9A 3D5QA 1QB7A 2HA7A 1PG5A 4EJSC 5BMVB 1R66A 5TJHA 4QYTA 2OUIA 3ISTA 5I9TA 2G0NA 1JEQB 3QIVA 1KARA 3C1AA 4D4KA 3OJCA 1R6DA 4PX9A 4TMKA 3ABSB 2AZXA 3RF7A 3ONWA 1YQGA 2XOXA 1WZ2A 1UBGA 3G6EB 1OMOA 5LXTF 5A7FA 2JFHA 3BT7A 3CPWB 5H82A 2X1LA 2PGAA 4O2BF 1D0VA 2D1QA 2C5EA 2Q62A 5JZOA 2CF4A 1VYTA 2Q4OA 3TSZA 1E1RA 4YIKA 1M2OB 4ZQHA 2Z6BD 3OX1A 2HJVA 4PRYA 3WI7A 3SI7A 4YUZA 2COEA 1VIYA 3GEMA 2ZYUX 3E15A 1P2TA 4ZI7F 5K8IA 2H9IA 5I7FA 3DHVA 3BGWA 2SNIE 1NQ5A 3BIJA 3NHZA 1U1EA 3IAHA 3M8KA 2ZYAA 4BN4A 2K2WA 2FUKA 2NUTA 2GEFA 2ZSJA 3FDZA 4W5WA 3P9IA 3WL8A 2JIPA 4ZGQB 1ODKA 2QX7A 3DB1A 2HU2A 2PMDA 2Y1GA 1GPBA 1YMVA 3EZGA 2BGRA 2Y4OA 5D84A 2JN9A 2V54A 4O2AB 3JAKA 2OBRA 1P2UA 1IQPA 2R47A 3QPWA 4OLFA 3S2ZA 1XCBA 1E3QA 3LM8A 3Q3HA 4DT1B 4ODIA 1RM0A 1CQIA 2GX6A 1FYDA 3PVZA 1JEOA 3G9TA 2BDEA 1X8JA 1JG3A 1VSUA 4K2AA 3DOEA 5ALUA 3VGJA 3G6WA 4F4JA 4ITVA 1DC5A 3GJXC 2OHVA 5K05A 3EZLA 3A6KA 3L6DA 3JVVA 5T64A 1RYZA 2PU7A 1NB9A 2NVWA 2ZS9A 3WYAA 3H5RA 3LIPA 4RD3A 3Q2KA 4EZIA 3X43A 3ZLVA 2XJ9A 1U7XA 1X1AA 1AF7A 1NN0A 1S7CA 2EG9A 3E03A 2F9LA 4L4ZA 3LVRE 3P9CA 4ZV7A 2V7GA 3LUFA 1O5OA 3QG5A 4L4UA 3VPSA 1P1KA 1RI2A 4YCJA 5LB4A 3P71T 5DCYA 2FPMA 1U65A 3TIVA 3PZRA 4LVCA 1Q86D 5JSZB 1YR2A 2DCUA 3IDZA 2H1VA 4QU8A 1K8RA 4KDEA 2O2JA 3L1JA 3T7RA 3QE4A 3H1AA 3W79A 1ORHA 5ULLA 3NNDA 2RHGB 4BMDA 3I55B 4ZDWA 1K3FA 4LYEA 1M0TA 2FKNA 2Y0PA 5BO5A 1IXZA 3OOWA 4CT5A 1V2HE 2ORVA 4LZJA 2YNMA 2GEJA 1IXSB 4OQPA 2BONA 5J35A 3B9RA 1ZM3A 3ROQA 4PWZA 3HP1A 2ZZGA 5FL7D 4RTPA 3SS9X 1CD5A 4O1MA 2VLIA 1U1IA 1A88A 2WWTA 4LGVA 4YIHA 3WBKA 4YP0A 4JUDX 2J7PD 4R9VA 4NH4A 1R9JA 2H3EA 1TKRA 2R5NA 3AY3A 3SQXA 1U9JA 5DNEA 2X9GA 3VV2A 2WVAA 1FCJA 4YNBA 1EZ1A 2BCEA 2JHCA 3CN7A 1E3ZA 1XRRA 4XZ3A 3WY9A 2PUAA 3ENNA 2HA2A 3UAXA 5JJCA 3MJVA 1AOXA 2PGLA 1UEJA 3LYUA 3ROPA 3SS8A 5HP4A 2H85A 3P9NA 4HD8A 5FBQB 5AD1A 1HNWB 1OAOC 3VVBA 1C4OA 2GEBA 3A9CA 4LX0A 4MUBA 1S2OA 4U5XA 5E4JA 3RRMA 3PUZA 4CRWB 5HYVA 1MIHA 3N2NA 3QOFA 4I14A 1X92A 1XC7A 5CX1A 1M7BA 5DN9A 3GLFB 2PUDA 1CKEA 2QQEA 2RAVA 1WD7A 1RJ9A 1X7XB 1HLGA 3ZH9B 5EJ4A 3TGPA 2F55A 3D2LA 2HMTA 1CJBA 3MINB 1U9YA 2OQVA 2OPHA 4OD0A 3R0VA 2D5IA 1ND5A 1QIEA 2GPSA 3UAOA 3FFXA 5EPOA 2XW6A 4UVIA 1DMRA 4CM9A 2A9OA 2JH8A 1M2VB 2DVMA 2MYNA 3TR5A 4Q6WA 5LZ7A 2FFJA 2P75A 2QU8A 4OU4A 2ICAA 4M22A 4UD2A 3A6DA 1QGYA 4UC0A 1A04A 1CY7A 4OHRA 3CKYA 3CLVA 3HB1A 3QTTA 1HDEA 5H3LA 1XPJA 4CLDA 4EPVA 5AVUA 3N86A 3ZD9A 3AU8A 4QPNA 4I1PA 1NX6A 2JJ2A 1A5ZA 2NADA 5JO9A 4IGFA 4KR0A 1DSSG 1ZGCA 3DMFA 5A71A 4HSGA 1Y5RA 4Q4AA 1DBSA 5HCNA 1PV4A 2ISCA 3MGCA 3EARA 1VP9A 4WZAA 5LQKA 2J5QA 3TXYA 1PJCA 3LW7A 2FSGA 2AT1A 5JQWA 1RQ7A 4KIFA 4BKRA 1OGIA 2Q28A 5K1ZA 2PEZA 1ECCA 1KFBB 1ZP6A 5AH0A 2WU0A 4IHQA 5JECA 3C6ZA 3MWKA 1PDVA 5GJWC 4CQJA 2Z4TA 2PR7A 3PHGA 4AMGA 1W9MA 1E94E 4X60A 4BFTA 4RTQA 3QXJA 3TI9A 5J2TF 3QVJA 1ABFA 5ED0A 4FR0A 3JQ7B 1OWPA 4OATA 3OPQA 1G9SA 3VHRA 2R7LA 4B40A 1UPTA 2PX2A 3G05A 3GARA 3T94A 1LPBB 1WU7A 4EO9A 3D0KA 4FDUA 4QV2A 4WVFA 1U9ZA 5AHKA 3CF6R 1HL7A 1NP7A 4KE7A 2WSIA 3A9TA 1IM2A 4YXWD 3BKWA 3BSFA 1C3EA 1JE1A 3L18A 2HSDA 3GFTA 3EQ7A 5CIWA 5DP2A 5JRJA 3HV2A 5LDGA 1EQAA 4D6XA 3T3HA 3FH0A 4GXNA 1VFNA 3IQHX 3OX2A 5E1BA 3TNDA 5JS6A 4AL4A 3ZJYA 4C3ZA 3G0HA 5DLYA 1FU4A 2WJHA 5ALJA 3W4IA 1CU1A 1ESDA 2HN9A 3G0BA 1LB1B 3HDQA 4MP3A 3D4OA 1E4EB 2JH3A 1BW9B 3G3EA 4RKWA 5KYXB 1WZUA 1Y8CA 5JALA 1D1NA 3E7WA 1MVNA 2EKQA 2RGBA 1S8NA 1C1YA 5EP2A 4XQEA 5IM4A 3TBFA 3I42A 4ROSA 4EYEA 3I5YA 2XXBA 3I28A 4OIFA 3RVDA 4DVJA 5CK4A 1Z6YA 3P7MA 1GNTA 4Z9AA 2J3KA 3PEVA 4Y2HA 3Q8LA 2CSXA 2IPXA 1R37A 2JKVA 4JV5B 3A7EA 1DRJA 1CUGA 3OQIB 4Z8XA 2RCNA 4LJRA 1VQ8B 1QC5B 4PC7A 4YLGA 5BWLA 1W4RA 4HGOA 4GOJA 2F62A 1S9DA 3F46A 1NMQA 4GZ6A 4E51A 5KDOA 3ICPA 4MJXA 4LCEA 2O4UX 1R8SA 3P0FA 4CF6A 4NFHA 4YMUA 1HDYA 1V45E 3NM4A 1NXQA 4JA0A 4WN9A 3WB0A 5CB0A 4I50F 3ZWPA 2FWJA 4IIFA 5DO9A 2O06A 3HJFA 1RPZA 1R5OA 3UUWA 4BPBA 5L3QB 3D0QA 3GLGE 1BCRA 1DXQA 4DLRA 4UTZA 1RAEA 5HOEA 3JARA 3CVVA 2JAQA 2WK1A 4IF4A 4WNCA 3TNYA 3NORA 3RC9A 3P2KA 4ZRMA 5CFLA 3LZ6A 2RAFA 4NIMA 1TAGA 3TMYA 4FOSA 4C87A 3B7PA 1J33A 5DDIP 1XQWA 5EZ5A 5IAGA 1J00A 1UJ5A 6NULA 2IEBA 1OLXB 2OCYC 1CT9A 1OFTA 5MHTA 5IYRA 1Z0SA 2HQSA 3AR6A 5K01A 1E1MA 4UHBA 4AUMA 4HNAA 4DZRA 4RPBA 4QDTA 4YBZA 5FPQA 1NVKA 4X97A 4OHOA 4XH9B 4UHEA 5LLSA 4BKOA 1KYQA 2PH3A 3CG0A 1VLVA 1OZGA 4FSDA 4HT3B 5KYYA 1N7JA 2M1ZA 2R6GA 4E21A 4RAQA 4OHFA 3M6IA 3U4CA 4Z0NA 1F8GA 3CO5A 1O4WA 2AGVA 4NBKA 2YWDA 4OL9A 5JIBA 3LS2A 1NUAA 2RBGA 4L75A 3LBAA 3FYUB 3EXIB 2I2FA 1PQPA 4JELA 2NO6A 5JCXA 3WS7A 5JCOA 3PKJA 3TQOA 5KTTA 4D80A 3QEMB 2WA1A 2IYWA 1RKXA 4ZDIA 3RLFA 3G8BA 3ZGLA 5IDXA 1IY1A 4FMBB 1M1YA 1N7GA 2NT3A 1P1BA 2Y93A 5DBIA 3CMEB 2MU1A 3FIJA 4I5EA 1OX5A 5EFZA 1JE0A 1QIHA 3ZIAA 2F3SA 5EG5A 1HT1E 2OAEA 4Q00A 1PFGA 2J3MA 2P6PA 2ZU6A 3EFOB 5BSVA 4J7CA 1XZKA 5A7GA 2ZG6A 1GPH1 4J7XA 4CN9A 1T15A 3IE0A 1H3FA 2V45A 3CJTA 3OPMA 4FYYA 3K9BA 3D7KA 1JHYA 2OY0A 4ER0A 4ENTA 1M5TA 3B1VA 3I1YA 3VH1A 1VLQA 4ZXFA 5IASA 2OYRA 1KI3A 2XWQA 3HA5A 1J22A 1A71A 2W2TA 1H6BA 3CSDA 3M4NA 2B36A 1GPMA 4WOCA 1I3LA 4R2HA 4XPZA 5E6RB 3L41A 3UXMA 1J23A 4DLTA 3WGTA 1SO8A 5DYWA 4J2OA 4F56A 4GOOD 5FNVF 3WJ1A 4H7JA 3ZHXA 1W93A 1KKLA 3UC9A 2NXWA 1BAPA 4WXMA 3CJQA 3MS2A 4RHYA 4X64B 3Q3AA 1HBJA 5B3LA 2I9PA 1JPJA 3PEFA 5IHPA 2GB4A 1KZ6A 3T3PB 4C6RA 3CH7A 3KYBA 5CB4B 1R6AA 1Z73A 3AVTA 4DL9A 3L4EA 4QBKA 4TOIA 4BP8A 1AUQA 1DAHA 2CNOA 1ESCA 1JQEA 2AUNA 1JDUA 2QYSA 1C3OB 3I4FA 3R2JA 2YBEA 3W5HA 2QW1A 2RDMA 4J0EA 5IVHA 1XNRB 3K2BA 5ESDA 3MJCA 5DM60 2HT6A 1TRHA 3ANSA 3L8GA 4B73A 3HP7A 4P53A 2FWIA 2VK8A 2M32A 2P11A 1R1DA 3KQMA 4GKBA 1OI3A 4IKOA 4XFDA 1DPGA 1H5UA 3UWSA 5L4LA 4MGKR 2JJ8A 4ROXA 4Q3AA 1LRLA 1LK0A 2C9ZA 2B7CA 2PRIA 3KKMA 1Z8HA 2ES4A 4NI5A 3S6JA 1BDIA 2VQSA 3NC4A 3A4MA 3FI0A 3RU3A 1H93A 1B41A 1CQJB 2YUIA 3DE2X 1H1TA 2HJ9A 1USVA 3EDOA 3KZCA 4MVWA 3F3KA 4ARUA 2OLEA 3ESRA 1JB9A 4LGYA 4UBOA 1T5SA 1ULSA 3L02A 3FVWA 2DUMA 4M53A 4Q1DA 2JIBA 4YCBA 2BFEA 1R8JA 1ILEA 1U8YA 4TTSA 2QX9A 3PI7A 3V2IA 2IIVA 1M34A 1E3DA 3F5FA 3AG6A 3ZHVA 3ZI7A 3BC9A 1PKEA 3I3SR 1Y0YA 1AUXA 1N5LA 2GZHA 4ZKDA 2OA0A 5T4FA 3SK0A 4P25A 2ZBRA 3WJ2A 4B2PA 2GHTA 1WDMA 3PXDA 3QYPA 2VWHA 4PAOA 1VHQA 5JJIA 2QMEA 4LXUA 4RHFA 1UPBA 4ESOA 3O0TA 2QTAA 3GIRA 3IAFA 1Z4PX 1GILA 1IH8A 1DXOA 3L8EA 4U2EA 2OQIA 3RPEA 1SKYB 3O5AA 4QJ5A 4GG1A 4H3SA 3CLSD 2P4SA 2WFLB 3VZRA 1M7HA 4UE2A 4QJ3A 3TK1A 6PFKA 3D8RA 1MX5A 4K7JA 2NTJA 3OFSA 1QYRA 4NS4A 3BIOA 1SCQA 4H0NA 3ZU6A 3EVCA 3AERA 5KOYA 3Q1KA 4M7RA 1VGQA 2R1ZA 2V9PA 2YZ7A 1PL0A 1YR6A 3E9CA 4Q1VA 1KQFA 4E07A 2V0GA 2C9CA 3I34X 2COKA 4W9MC 1NYQA 3JZMA 4HNHA 4P33A 5BWOA 4ZZ1A 1XKXA 2BL4A 3ZLJA 2JF0A 2A0UA 3R3JA 4LY0A 2ZI9A 4XE5A 3R7WA 3QE0A 4UVDA 4CM4A 3FN4A 1RIFA 3BRSA 5ALIA 4OREX 4RJTA 4H1HA 4MOWA 3VJMA 1AJEA 1XCGB 2VDLB 1YJ5A 2B92A 3ONVA 2ZCUA 4O4LF 4YP6A 1YA6A 3HO1A 4IO1A 3CRW1 2FQYA 3KSDO 4KH1A 1ISMA 4L7QA 4R8MA 4X3PA 1AURA 4IXMA 3WV5A 3ZEIA 3E53A 1GFIA 5HZAA 3EA5A 4QGHA 1N1MA 3G8AA 1NN3A 3OO0A 3ZW8A 4BMZA 4PIPA 3V1UA 4JBNA 4OKSA 3CESA 5DBEX 1YVPA 1U0RA 3EZ6A 3WRYC 1K8QA 4G8CA 4N3NA 1D0SA 1HNNA 5AVKA 4CIXA 2ERYA 2Q46A 2RJ3A 1HYBA 3GRRA 3L49A 4FVTA 1WBDA 1GYPA 1JI0A 1X7WA 3IRVA 5AW5A 3WQRA 1CX9B 1OTYA 4O4LA 1WXEA 3QOXA 2BHRA 2OESA 4FFOA 4DV3B 3A70A 1A1VA 1LWNA 2Z95A 2JASA 2XVZA 2OCIA 4GP7A 3CGWA 2HFKA 1ONBA 2OENG 3GROA 3HNRA 3SHOA 1GQSA 4LQCA 1PJ2A 2YQ4A 3ZNPA 1KBZA 2ZUEA 1NBME 2AX4A 2A0YA 3GP5A 4CL3A 3GVIA 1OXBB 3P9SA 4D57A 1FUKA 1Y9ZA 2QV0A 3DFKA 1J99A 2VAMA 1F2VA 1X77A 2DH5A 2R8ZA 3IYLW 4KSCA 2XDWA 4CODB 5HK9A 4XPIA 1TUGA 3OHSX 2D06A 3A3PA 1VHOA 2JI8A 1BN7A 2D54A 4C1NA 1RBMA 1NR5A 4K6OA 1LWOA 3TW8B 1HPLA 4ICIA 1HYEA 1QH0A 2X6QA 3QF7A 3ONEA 3KR1A 4KEAA 4ITUA 1WQ3A 4YALA 3WQZA 2VDNB 2WF9A 4WCDA 3CNQS 3A1UA 2VDRB 3G2PA 1BLIA 4FKBA 4AM8A 4YRRA 4YQFA 4C4RA 3IQGX 4C21A 5ESRA 2AA3A 4OMUA 4DQUA 4F5EA 4G85A 1AZWA 3R20A 4K6KA 2BI4A 2FFAA 3OZCA 2ODBA 2QGFA 1TI7A 4AO6A 4R1UA 2ZYWX 1M1NA 4A10A 3BZUA 2EARA 4L8VA 3B12A 3K16A 3L2OB 4R8VA 3MJFA 4BUZA 2IDMA 1FBTA 1QHXA 1UJ4A 4D0SA 3SF0A 4G84A 3IQWA 3A6PC 2Y66A 4YEDA 1FJ2A 1BXGA 3K0KA 2GAJA 3EXHA 2D0PB 3DO6A 4XDGA 2PMEA 2YJGA 3V4LA 5G02A 2AOTA 3ASUA 1QF7A 3S28A 3TAXA 4JFRA 3R6JA 1GNSA 5DHFA 1A27A 3GK3A 3M1IA 1LY1A 2ECKA 3ELDA 4XARA 2DY1A 2PKQO 1ZWKA 3PFCA 2J7KA 3AHFA 2GUGA 3SZOA 1PNVA 3U44A 2GJ4A 3ZUPA 1Z28A 4BZQA 2JFYA 3C8ZA 4F06A 5FBVB 1OBCA 3WGIA 3IX7A 1DFGA 4IJ6A 1Y1LA 4KXUA 1Y98A 3N5KA 4D5GA 4JROA 4EWLA 2VPYA 3VPXA 3A3YA 1YJBA 3PUWA 1JRLA 3UK2A 3C6KA 4HLQB 4AJIA 1OHHD 1VM6A 2PKWA 3IKVA 2AIRA 4BLSA 1SAYA 5C5CA 1AK9A 4Y6RA 3UCXA 4JS0A 2FOLA 3ZD8A 3TQSA 1Z2AA 1HG0A 4UU1A 2NSYA 3SFVA 1J97A 1O08A 1Q74A 3FX2A 3L6CA 3O9ZA 4OJMX 2QXYA 4UOEA 2EGGA 3H87A 3D4PA 1B8NA 3OWHA 4HDQB 3FPKA 4ON9A 3QI7A 4K28A 4Y2UA 3ROTA 4X6YA 3KPVA 4L02A 1GRVA 5F4MA 3KM0A 3IIKA 4CQMD 5JEDA 3CZ5A 3WYCA 5JAUA 2RE8A 4GOMD 1QF9A 1XZMA 3CSSA 4CBVA 4EW2A 2F67A 3UFXB 3LPCA 4C76A 3Q5GA 4EMUA 1YVEI 3MJ4A 5E2BA 3M6VA 2R8YA 4P35A 2HFJA 3BMNA 3AO0B 2DJIA 1N6PA 3DDZX 1DAKA 4MCAA 4I4TA 4OXIA 1PFVA 3Q98A 1W52X 5ENVA 2Y05A 1D03A 3JS5A 1P73A 2WUDA 3C39A 4BX0A 2CNKA 3L04A 3L0DA 4DWJA 1KU0A 1ZCAA 2P9CA 1T36A 1DRUA 5L3VA 4YAOA 2F64A 4ZOLB 2O8CB 2O05A 3HKDA 1PI3A 1XNHA 3NHWA 3BK1A 2AKYA 1QH1B 5BOSA 3FUTA 2DAPA 2XQGA 1KJIA 1NAHA 2JJYA 4GMDA 3WTBA 1SZJG 5K0SA 4MGYR 2I91A 2LZJA 1RYHA 4B45A 4WKOA 4AJOA 4Q9JA 5E9WA 4RY2A 5CDTA 3IH5A 3OZGA 1QFSA 2ZJZA 2GETA 3ASVA 3DE4X 4KFTA 2JLBA 4GZMA 1XMIA 2W2OA 5KTNA 2EFGA 1J1ZA 2VI5A 2QN2A 1QIKA 4R51A 3WKBA 4ZEVA 2ATVA 2ZGVA 4Z7NB 2I66A 5BW4A 2R66A 3TECE 2BKUA 2QAGC 4DDKA 4NV3A 2VUTA 2YQ5A 2FPRA 1ZIDA 3CEJA 4OQNA 2F43A 3TDKA 4CIVA 3LTEA 1XDWA 1ZD8A 4Z4SA 1QGUA 2R11A 2QNBA 1JFTA 3GRKA 4ZYUA 4B87A 3AGQA 1VB3A 3PTZA 4N65A 2M5SA 1T2EA 2DM6A 3TGLA 2AYZA 4KXYA 4QM6A 1AQIA 5A4KA 1ZH2A 3ZE0B 4IIJB 1QPGA 3IT1A 5DHSA 3UIEA 2QQFA 1LNZA 1C5KA 2VS1A 2I6SA 3IILA 1FS5A 5DCWA 1V2GA 4A2CA 3C3MA 4IX9A 1QTRA 3WWOA 1BXGB 4OFBA 3ZYZA 2ZAGA 1DAFA 2HQOA 3ZBPA 4UTRA 3M5PA 4IICA 4Z4TA 3NYWA 1E64A 2GBFA 1NM5A 5M7EA 4AZVA 3HU3A 3U1VA 3IEPA 3K0CA 3IHLA 2OFFA 2Y1WA 3AJDA 5TJ9A 1WVMA 3SC4A 3L46A 4F93B 5KQLA 2IPMA 3LP8A 2RB4A 1H0RA 4KXFB 5AI4A 3NAQA 5A5GA 4KRFA 1G5FA 3BCHA 2OO5C 3PNPA 1YVDA 4NCNA 1YT5A 4J9VA 1P9WA 1PJSA 1L5WA 4Q05A 3ONFA 1VRWA 3U3DA 5JJLA 3LT5A 4NWIA 3N3AC 3D4BA 5ADHA 3K71B 4WOJA 3DDUA 4E5NA 1KIAA 2WAXA 3IQEA 4MXDA 1WCV1 4AZ3A 1DELA 1ZOPA 3AVQA 3V8PA 2L18A 2FQQA 1L7PA 1MO6A 2NVUA 2PUHA 3FROA 4DABA 5B64A 3WA6A 1Y1RA 2QSJA 3AK4A 1J8YF 3H83A 4MA0A 1W0JD 1BE6A 3CVJA 1M6HA 2CB9A 3NJRA 3EIFA 7MHTA 1HDGO 1Y0BA 2IP2A 3QYAA 4DMCA 2HRDA 5FEUA 1E3SA 4OXRA 3VTKA 1JHQA 1VHLA 2HYIC 5ELXA 1R0LA 2VJIA 1N8NA 4NCHA 1MABA 3RANA 1KQ3A 2E4YA 2XMBA 3DUWA 4LMPA 3B2NA 1O57A 2H0AA 4FGWA 4FMDB 5U1PA 5SZHB 3I1FA 2YYAA 4GZLA 3C14C 5EE9A 2K7FA 2ZW9A 1PJRA 3TVDA 2PZGA 3N6XA 1CR2A 5I3ZA 3AHGA 1VHTA 5KYGA 1B2LA 3MQ4A 4FXOA 1ILWA 1Y89A 1UCFA 4KHZA 5FPTA 3WBFA 1H23A 1UFOA 4RA6B 2IE8A 1GVHA 5CYFA 1RXIA 1GUFA 1PJ5A 1EFAA 4ML3A 4KRGA 4G0XA 5HBGA 3DMTA 5HRCA 2J33A 4EA6A 1IN6A 1C8LA 2HSJA 2ZXEA 5DTIA 3TOXA 5K0FA 1K6IA 1C0LA 5LD2C 2KMLA 5G4KB 2O3TA 3QKSB 4MJ7A 1OXXK 2L19A 3W06A 3WLHA 4B6FA 2PLAA 4KHPB 2BFCB 3F7TA 1QJ4A 2I78A 4AWAA 5IKXA 4Z3DA 2XBMA 1YHNA 3IA7A 3NQ41 4BJ1A 3ENZA 1Z4NA 1BKSB 3G59A 4UBMA 1QVRA 3RKUA 5B2ZA 3TCKA 4JLWA 5KX5F 2YXPX 4WA7A 4QEDA 4LJ7A 3PGLA 5FP0A 2KBFA 2W00A 4AI6A 3QFFA 3GLIB 1E7MA 1YLOA 3HB9A 3D31A 4L9RA 2X85A 4KPEC 4MI3A 2JLVA 1FS6A 1JW9B 1L5HB 1CFZA 1SHZA 3A9VA 5JJ5A 2AG0A 3PYXA 4EVRA 1C29B 3IV9A 2I1VB 3Q9UA 4NABA 2LWIA 4N0EA 3LPNA 3IP8A 4WK4B 1X8XA 2HXYA 2VJPA 3LVFO 3MS7A 1HDXA 4C4YA 4LJ4A 3RQSA 1E3WB 2CXXA 3CW9A 2BDUA 3SQNA 3O2QB 3RSHA 1UKAA 3KZ1E 1JF8A 2GZRA 3AR2A 4GPIB 4RYDA 3F96A 1MJ5A 2HNKA 1XO1A 1X8LA 3DVRX 5HF5A 2SICE 3TNLA 1X0XA 3E18A 3ET5A 4FW9A 5KMGB 3CQ9A 4YAKA 1T9AA 2PT9A 2EBWA 3Q8XB 1N1EA 1WZIA 4OFZA 3FSJX 1L6IA 4OH1A 1C1DB 2ZBDA 4CE6A 4DBZA 3EYAA 5HDBB 3JAWA 3L05A 1RD4A 4LQDA 1FUUA 3O83A 4EMBA 3NTOA 5JE8A 3BJZA 4Z49A 4MHSA 5FA5A 3AEUA 1QK3A 5DM70 1U2DC 1EFPA 3E0XA 1RWBA 2QRHA 2E4WA 5FTWA 3VU1A 3SOPA 4YDQA 2GKGA 1A7UA 3OG9A 3Q4GA 3A37A 2FVYA 1VE7A 3T35A 3ZY6A 4DBLC 2I33A 3BE6A 3F3MA 1YULA 4LMBA 4NU5A 1FOEB 1W44A 3CM0A 1BWQA 2BZSA 3PPYA 5TQ0A 2QJOA 4RM0A 2VYCA 2VJYA 4IIJF 2GAFA 5EMNA 3O92A 5FHRA 2V3WA 1NC3A 1ZN9A 2AFIE 3PWSA 1M33A 1WD5A 4AXXA 5A02A 1P4GA 3E3OA 1Q82D 3D6JA 1GO2A 3D3QA 3GAAA 1VHDA 2I2XB 2JLQA 3E7PA 4YV0A 8ATCA 1YXMA 4IH4A 1Q95A 2PWZA 4QRDA 4MHOA 4U7FA 1JZQA 4HDOB 4DCJA 1D4ZA 4JVNA 1XCJA 3RREA 2Q0QA 5JI2E 2FWMX 3FSGD 3EA0A 5KSZA 2W6ID 2R1TA 3EXEA 1K7XB 4RPJA 4QOGA 1OZHA 4IZIA 1FVFA 3R7WB 3A26A 1G55A 3CUEF 5EXTA 1DWPA 3ZNNA 2D4AA 2Z2JA 4KWCA 3R9KA 1MB9A 4L5BA 4KRXA 4YROA 1RIIA 3OQJA 2J45A 4YRAA 1G3MA 1RZVA 1YOBA 2O2YA 4M0CA 1IBSA 2O2CA 3STWA 4GRAA 4MKZA 3VSCA 4B3FX 4V0KA 2KPOA 3THXB 2VNKA 4OP3A 3KPUA 2WJGA 3SIPA 1OA0A 1HE1C 2EKLA 1J39A 3MMXA 3PQ3A 4RLSA 4N47A 5C8DA 3MS4A 2L42A 1IY9A 1Q2UA 2BKEA 2UDPA 3SG0A 2FEPA 1JZTA 3E48A 2C82A 3HYLA 2GD1O 2REQB 5CVCA 4D9IA 1J8VA 3C43A 3TFOA 5BOVA 1PNRA 2JJ2D 2CUZA 1PYDA 5KPDA 2XTJA 1WOSA 1QVWA 1B6TA 5T8KA 3FTDA 3SSMA 4C08A 2O57A 2IYVA 5I7RA 3FFBA 3HWX1 4WESB 3ODPA 1Q22A 2NZVG 3FPJA 3W9SA 1RLMA 4FPXA 3KKEA 5FBKA 4NICA 4WRRA 2ZI6A 5KWEA 4D8VA 4MPRA 1VE9A 2J41A 2JL1A 2PS0A 4GZ5A 3PICA 1T0HB 4WT7A 5BRNA 1CJMA 3IP6A 2OPBA 1O9HA 2X0RA 1JA1A 2N42A 2VH1A 3WWZA 2G9RA 3JZIA 3USZA 3I2FA 1QK5A 2ILTA 1KZLA 1TQ4A 1H85A 4N0PA 2Q6LA 1E4VA 4CL8A 5EQTA 4DCNA 4CV1A 1E5DA 3PDHA 4KYTA 1CYDA 2WHPA 3UKJA 3MB5A 1W88B 1HFEL 4JQOA 4MW2A 5BN3B 4QEZA 3F1KA 1GTSA 3L1VA 4NMWA 3GFFA 2C0QA 1KOFA 2FSVC 4BY9E 3LUAA 4L0QA 3W3AH 3RJTA 2A4KA 3NB0A 3FM9A 5H80A 1FA9A 1C1XB 2KJQA 3ITNA 4WN3A 3RKRA 3I8OA 4DDMA 1BMQA 4EY5A 1XZHA 2JCSA 1NVUQ 2XMCA 3GLFE 3RYHB 3QGMA 3U7RA 2OG2A 5KHAA 5KCMA 2QN7A 3C98A 3U4GA 1Y4DE 5B58T 3DSRA 421PA 2NUBA 2RI6A 1ECLA 2WSSD 4PYQA 3EW7A 4Z4GA 2FSSA 4RYLA 1M0SA 2KS6A 3HWWA 4IDNA 5G0SA 5A0FA 2JLYA 1BE1A 5JRDS 3UB3A 2YTZA 1Z0KA 4KVFA 1KEUA 4KKTA 3ZZTA 3P4UA 1Q91A 3G8YA 2HRBA 4OK5A 3HJGA 3A8TA 4ARSA 1N25A 3OF5A 1TYCA 4TROA 5HM8A 4QOEA 3DL0A 3NDIA 5AUQA 2FHPA 3K1ZA 2YNMD 3T1NA 3UK7A 2H1FA 1VQMB 2IZZA 5EP4A 1J21A 3PC4A 2PWBA 1PFQA 3DB2A 4J8PA 1SQ6A 3CCCA 4NJMA 1B0AA 2D2VA 2GKSA 2WINI 1R2QA 1XJ5A 3OA2A 2FN9A 2UYOA 1EQUA 2Q9UA 4X7EA 4ER7A 1G6KA 4JUAA 2NUTB 1G0NA 1OXTA 2VFAA 3AEKB 5KKAA 4GU5A 1GPJA 3B5EA 4PLZA 3GNQA 3CEPB 3DBHB 2AMLA 3OZRA 1WVIA 4TYWA 1I8TA 4KG7A 4P84A 1LD3A 1ZCFA 3O2NA 4HEA1 4LBYA 3PRYA 1UQTA 3WQBA 4ZAVA 5AJXA 5A8AA 2CBZA 2ZSFA 3KU1A 3WISA 4BJ3A 1B76A 4X1YA 4CKCA 2BWJA 3NHPA 1X80B 4TWIA 1TZJA 4BVFA 2OBNA 3GMTA 4D4IA 3Q3EA 2EQAA 2X58A 3EWNA 3WR5A 4UQLA 3GNTA 3M9WA 4DA9A 4JHXA 1F1BA 2ZBFA 2LDBA 4WADA 3NOOA 3G2OA 1CVRA 5KAPA 2VKTA 2BEVA 5FH9A 2XUJA 4TT3D 5JD6A 2P9BA 1XYGA 1H2WA 2IV7A 4HH0A 1IWPB 1J0DA 3C1UA 3JWHA 4GDMA 2PBZA 3AR3A 4PZ0A 4HV4A 5M5BA 2PX0A 2LE0A 5I48A 2V97A 3ZDDA 4ZFNA 4CXMA 3PF8A 1OBOA 2BEJA 3S5UA 1KHHA 3A1WA 2Q2NA 4DV0B 3DT9A 5FO0A 2B8JA 2K6GA 2J5RA 5EIOA 3BFKA 2WU3A 1SKBA 3ZWYA 4FR2A 1FJGB 1SZCA 2P8SA 1PVVA 1UKCA 2UKDA 2XIJA 3L1HA 3R0XA 4Q4AB 5B1DA 1TT7A 2YC4C 1SJ9A 2QD5A 2QR5A 4UE3S 1LVGA 3LDGA 4IKEA 4EUKA 1MGPA 4HWGA 4K40A 2Y67A 4U3JA 3I9KA 5HQJA 3VISA 2JLWA 1H2HA 4TKVB 5HIAA 3EC2A 3FDXA 5JYCA 1ZRMA 3OKPA 4LF6B 1E6KA 1X86B 3FYDA 2VPWA 1NRIA 3MCVA 1P45A 1PGNA 3GZ4A 1RW4A 4ZA2A 4M8IA 2XQVA 3K1AB 1NSFA 3ONYA 3O31A 1CEYA 2ZRPA 2PA3A 5JSUA 4CLOA 3QPUA 6YASA 1R9GA 3KFXA 2XE7A 1V11A 5GONB 4Q21A 5D3KA 3RG8A 1A7AA 2ZI5A 5ITZA 1C0KA 5DGIA 2FPLA 4BQNA 4B3XA 1Z45A 2C2HA 3NHUA 4LRQA 1KAEA 4WUVA 1I2AA 4FJ2A 2O54A 1U80A 4BATA 4O1IA 4EX7A 2DT5A 4QVAA 1O95D 2BZ1A 3IRUA 4QNRA 4BBPA 3HL0A 4HZIA 4KACA 1AV7A 1B3BA 2P2ZA 3BJEA 3C6QA 3ABZA 1J2RA 4FT4A 3LC2O 2FN4A 5HGJA 1BMFD 1CDDA 4G8DA 3SQOA 2NUAA 3O7WA 2J31A 4N7BA 4QWWA 4BVEA 2DX7A 3R3WA 5CD1A 1U8XX 4DR5B 1YS9A 2YWXA 3EZ9A 3PXBA 4N82A 4ESVA 3JQCA 3O9MA 2MOKA 3P0HA 1WO8A 4B33A 1JR3D 1TPYA 3CUYA 1JMVA 1GTZA 3IURA 1E9RA 2ZTSA 4WBNA 3OM1A 4G5HA 3HDJA 2XDQB 1KKUA 3MM4A 1VSQA 4G01B 4QGFA 2IH5A 2B83A 1VZ3A 3SR3A 1Q81D 1F0PA 4NS1A 1U2GA 3KL4A 3PNSA 1K3TA 5CGQB 3DBLA 5AHXA 3WOVA 5H3HA 2F1HA 1V6CA 2CVOA 4JJAA 3X1ZA 4YEJA 4QUAA 3EVBA 1L4FA 1M2VA 2YWJA 3ICQB 1HLPA 5FNVB 3H6KA 3LNTA 3JYQA 4CF4A 3V8NA 1G4UR 2ROQA 3ADOA 4WN9B 5HXAA 3DMNA 1F2UA 3JCZA 4MDYA 1A3CA 3IBTA 4L3WA 1C7EA 3DEYX 3C8UA 2HMVA 1L4LA 4YJKA 5AKKA 1O03A 5D3QA 1J70A 1VBFA 3RIXA 1P7YA 2GK4A 3WIUA 5GONF 4BQSA 4R81A 1I7LA 3E3LA 4XM1A 3ZNQA 1H5QA 2VQDA 3AP3A 3GYGA 5A4AA 1C7JA 2Y0CA 3BMXA 4O4HB 4CMAA 3L7KA 3OLXA 4CL0A 1OFHA 5JS8A 3U39A 1H2AS 1ZYUA 4IQFA 1K4MA 4CCWA 1KWGA 1X19A 4WW0A 4R84A 1CUUA 3C3JA 4LKRA 4OOVA 4WWHA 2WLTA 2GCNA 2BP7B 3NAGA 2H57A 2N0SA 2V4UA 2CF6A 3I8XA 5EUQB 2CMDA 3KQHA 2FQWA 3N8GA 2F3PA 2C04A 3LYLA 2QVGA 4PYIA 3SBEA 5B37A 1Q7EA 4MRPA 2IZ6A 5KNDH 4O63O 1OLUB 4RETA 4JJKA 1KH2A 4KBGA 1ZA2A 2Y1LA 3JRNA 1QYXA 4KL8S 3EBPA 1BD3A 2BKXA 2E1RA 3SJBA 4EGQA 5IJ9B 1GPNA 4XLCA 1EPUA 3KLBA 3NIDB 4TXLA 2R1UA 2AUMA 2IPLA 3OIUA 1CNEA 2MHCA 3NZEA 4KKXB 2DIEA 1YDWA 1E2KA 1Y81A 1L8OA 4XGRA 5AO9A 1YVRA 3DDCA 3ZLTA 3C3WA 3WO0A 3KOZA 4TWZA 1V16A 1M1YB 2HSEA 4PR3A 3A6EA 5IJZA 4DV6B 1VBMA 2YIDA 3AERB 5FBLB 4OXNA 3UJ6A 4B6QA 2RAUA 3DC2A 5DW3A 1SUBA 3AXTA 3USES 3JQ6A 1ZKMA 3U56A 4DNQA 1AKQA 3T5CA 3FTQA 1ZCBA 1IJEA 4QXMA 1EX7A 4DYDA 5JMOA 1OX4A 4O2BB 4XKJA 3T9FA 3U26A 2GPJA 1JVNA 4QOIA 4UEKA 2GFIA 3PWZA 2CDAA 2PYDA 1RLIA 3GEHA 2KI5A 2SKEA 3MRSA 5EMLA 3HC7A 3PC7A 4JLNA 4R1PA 4D4GA 2BUBA 1Q50A 3PC6A 1HETA 4LHYA 1KQSB 4C22A 8OHMA 1YZGA 4WOKA 4OHCA 4P0TA 1KPHA 5J2UF 4KR6A 2JFZA 3PJRA 2ODPA 1AHIA 2V65A 3T7DA 1VOTA 3B8EA 3UB4A 3FBTA 4DUYB 4KWTA 1XD2A 4E7PA 2C0CA 2MSNA 3GEEA 1ZGJA 3AHHA 4O08A 4BS9A 4WLNA 3AF4A 4OFXA 3AM3A 4TN1A 3EPRA 3EXAA 5FPHA 4Z4EA 1XHEA 3CRNA 4ARZB 4D98A 1Z07A 2FF7A 2PNJA 2JI4A 1GKIA 5EJ2A 4EJ2A 4Q4HA 4DW8A 2GK6A 1RE1A 2P1ZA 3LWZA 2P7HA 4WLVA 2XGOA 2F00A 2EFCB 3WGMA 1E8MA 2W6QA 3GJQA 2TECE 3QVTA 2C5HA 1M10A 4Y2RA 4B84A 4ZYZA 1SVUA 4LE2A 1JAIA 3UMFA 1EDDA 2CLFB 1ULTA 1FSFA 2QT1A 4NVRA 5HQ3B 3D7NA 2TRSB 5I7OA 5J4YA 2ZRMA 1E61A 2C98A 5F64A 2FGKA 2BE7A 3PNQA 2AC7A 2C29D 5L46A 2K5UA 2XECA 1EGHA 3JQFC 4ZVSA 3ILVA 4YT5A 2ZATA 5KDLA 4DXAA 5FNVA 5JAHA 4R2IA 2YRWA 1FQWA 5IEBA 3ETNA 3K05A 3ZDZB 1G2OA 1ANKA 3GJ0A 3M2PA 4ZXPA 5JRZA 1ODJA 4LZWA 3TW8A 3W5JA 3OUUA 5JBQA 4MVJF 4PQGA 3B3QA 4RC9A 3UJ8A 2Z9BA 5G0TA 4RQAA 1KO7A 2OV2A 4JXXA 2DGDA 4QPZA 3MJEA 4OBXA 1ZESA 5AN9A 1JR3A 4YC7A 3UCFA 3QITA 1AZLA 4OXYA 4DLLA 3EXIA 3QU5A 1T9BA 1ZN7A 2VHZA 3GRFA 3IEIA 4KO3S 4UW9A 2VZEA 4QU9A 5F9MA 4IHAA 3CCRB 5LBUA 3ZGOA 3SR0A 1CJSA 1KZYC 3GELA 1XQBA 1T2VA 3S8YA 4F86A 2NO7A 4P9SA 1GTVA 1BMFA 1GU1A 5C51B 1USWA 1QIIA 2IKQA 1OB0A 1JDPA 3LHDA 4RKFA 1HXHA 2DOGA 3FVTA 1H4TA 3PJFA 4P82A 1ELOA 5JUWA 4AY2A 1HWYA 2NZJA 1BFKA 5H83A 2VXYA 1O94A 2VR1A 2BMFA 3JR7A 4NAUA 2RGWA 2DHRA 2X86A 3OHMA 2LCIA 4Y9DA 2V9CA 3ZXYA 2CUKA 2VJMB 5IVPA 3ESAA 4M3NA 4KKSA 5FOSA 2RH9B 4NZOA 1RQNA 2JFOA 3LPLA 1NYTA 3AL2A 2A6PA 1TZCA 3KALA 5IANA 3ADCA 1XDDA 4GXQA 3I0ZA 4RM2A 4K1XA 3P19A 1XBTA 4CF3A 4U0KA 4G67A 5KOHA 2XVAA 4DMLA 2AYXA 4RANA 2HJRA 1UPAA 3MGBA 4AF7A 2P2GA 2WJYA 2MT9A 2D8AA 3W78A 1QHIA 5L53A 1HE3A 4GD3Q 4RJLA 1VJ0A 3W6PA 2ZI7A 1RZRA 3MLBA 4DF3A 3ZXUB 1KFEB 3L6RA 4P08A 5A06A 2JJ1A 2HTFA 3NETA 4JEUA 2KB0A 2UAGA 2R79A 4GVLA 4RFVA 1EDBA 2Z09A 4ARAA 2OBMA 2ONCA 2P6UA 3EH1A 2G0AA 3ILYA 3K0AA 3GT7A 2UVPA 4AULA 1Q1QA 1T4BA 3RWMB 1L7VC 2PKRA 1E5LA 1BHQ1 3I76A 4U9UA 1EK6A 1RLUA 2GOYA 2YS6A 1VG8A 1ZJJA 3IMGA 2IOFK 3LU1A 2P41A 3GUZA 3AI3A 1WXGA 4KXMA 1ODTC 1NXWA 5E3HA 1TUEA 2QN6A 2D3TA 3LMKA 4NHOA 1PWEA 2QZ4A 3QWBA 1FTYA 3S4YA 2P2YA 2XOEA 3LKBA 1YDFA 3RK1A 1I36A 1FP6A 1G21E 1N2OA 1XZNA 1FYVA 1Z4IA 1MENA 2NPIA 2Q1SA 2VRCD 3G0DA 3KOWA 2QN1A 1N2ZA 2OK8A 3UY4A 2OBLA 4JYPA 2VTDA 1WWKA 1KOLA 3S1LA 1F14A 1NG1A 1M1ZA 2ONYA 1I6MA 4AJ9A 4MUGA 2YHSA 1BH6A 1HR0B 5TR9A 3EGXB 2L69A 1JBKA 3UWKA 2A9FA 3LRTA 3O4JA 4A4DA 4CV0A 5LJIA 2VJKA 1ADYA 1Q17A 3H9QA 2JH9A 4LUCA 4OQYA 1ULHA 1MB2A 3ETDA 2IX3A 5EJ5A 3VH3A 3FTNA 3CGGA 5EAIA 3IVGA 2VTBA 3M3HA 1KL7A 3U81A 2V96A 1ZIYA 3FNRA 3ZQJA 5JXJA 3QWAA 1C3JA 1KYTA 3KYJB 4HGPA 2RK6A 5EOVA 5K8JB 5TVGA 5KYXA 4UCFA 3ONDA 3VYRB 3LL4A 4UPVA 2C2OA 3PQ7A 4H6XA 5U9CA 3JQGB 4MUEA 2IWRA 1LBEA 4CM6A 4RZIA 3GDGA 4RIHA 4WJZA 1UK6A 1FNDA 3MTBA 1QHYA 4ZOCA 1KZGB 1H2FA 4YCDA 1IL0A 1QP0A 1CRZA 3H2ZA 4F6CA 4CDNA 4QGAA 4W9RA 4V1CA 4ZCRA 4R3UC 5ETJA 3UC5A 3QX3A 3PC8A 2JLAA 3H9EO 4LRTB 4TV8B 3BFJA 5B7GA 3DS8A 4BNYA 1RP7A 1PQWA 1V5VA 2FA9A 3GAFA 4RMJA 4J0IA 3TSOA 3KUDA 4D4JA 4MIYA 1CC1S 2H4JA 4FK8A 3TVTA 5KJCA 1XEWX 5IT5A 5EIAA 3FMOB 1A77A 2D6FA 4TX1A 4L5IA 4NNJA 3SD7A 2D5LA 4IO0A 2ECPA 2XQIA 3EDRA 4BDTA 5A7HA 1MQ9A 1NR7A 3A10A 2Z8YM 3LQ4A 4TUYA 2XNKA 4H3KB 4EFKA 4RULA 2O07A 3NKFA 4NENB 1Q3HA 3IP1A 5JAIA 1PR6A 2EEZA 2IXFA 3QKRA 4BRZA 4ZHSA 3ILHA 1USGA 1APBA 1U63A 3THWA 2FMIA 4IWXA 4IJQA 2CCKA 4EX6A 4S1OA 5JATA 3LC0A 1ZUNA 3GJ6A 4FE3A 2CYCA 3B60A 4GPZA 4U8GA 3ABIA 3HKBA 3H6GA 5JD3A 1AGXA 4C07A 1UWKA 2Z1DA 4FNOA 3GFBA 2GO1A 1OF1A 3PGXA 5WRFA 4YRIA 2I1LA 2G08A 4FZJA 4RIGA 4XSVA 4OPOA 3PCXA 3RODA 1EA5A 1D4AA 5H1YA 4PCAA 5H7XA 3O3MB 5BSWA 2EQBA 1G66A 3DDOA 3ROEA 1E77A 1GU0A 3C70A 1WXWA 2EBHX 2H4FA 1PLLA 4I0WB 4MMZB 3OIFA 2QTHA 3RFTA 1ORTA 3RSLA 2PQ0A 3KQVA 3OCXA 1CNFA 4C7VA 3UHPA 1M6NA 1OW3B 3FZEA 2W5UA 5EWLA 3PE6A 5DTQA 3LWDA 4AICA 4PLWA 2FWPA 2Q3MA 3OPYA 2F4VB 4FHGA 4U2BA 1T6YA 1HT3A 2OCLA 4CKXA 2PLRA 4MRRA 4WZEA 4YMTA 1W30A 2OCKA 3K6JA 4PZ9A 3X2FA 2IS2A 4OYHA 2NUPA 5A4DA 2W2KB 1SHJA 4RMNA 4H7HA 1W87A 2OO5A 2HO4A 3HFGA 3RHFA 1Y6QA 2HXGA 5K0GA 3OE7A 4B48A 2CVPA 4PW0A 1UMBB 3AWIA 5I9IA 3KDPA 4Y2TA 1RJFA 2DBZA 1SQ5A 3KVVA 3GVJA 2BAGA 1WUHS 2XTMA 3UW3A 2CEAA 5LDDC 2G0TA 4YRMA 5JTUA 5IABA 1QHEA 3U4HA 4AQ7A 4YY3B 4M83A 1B42A 2WYHA 1H4QA 1GGVA 2O8VA 3CPSA 3L0YA 3T3NA 1E5TA 3ZGZA 2FUNB 2XUDA 5L40A 1UADA 4JAVC 1FFHA 1KO8A 1P75A 1FFCA 4ADSG 2G88A 5JSFA 2QJRA 1MLDA 3IOCA 1D2CA 1WKCA 1XX6A 3DLIA 2YIJA 1G8SA 3QPDA 2MCFA 3R5FA 4JOCA 2I3DA 1XZBA 3HCPA 4HQNA 2D2EA 4YDRA 5CT4A 3AF2A 4D9NA 3B7WA 3BAZA 4ZYTA 3ZCPA 1OX6A 4D4HA 3ROGA 1E0SA 4MUYA 3E84A 4IIXA 2UZ1B 3MEQA 1EBBA 4PX3A 2R62A 1NR1A 1Y3HA 1HLDA 3QW2A 4UD6A 4R40A 1O97C 2JI6A 1B93A 3P0EA 1M2FA 2BFCA 4B34A 1Q1EA 5ALPA 1IUNA 4DFDA 4LQ4A 3GCWA 2WQ6A 2J4FA 3CC8A 3V4OA 3K2IA 4DCCA 2QD2A 3RVOA 1WTAA 4NYMR 3A4TA 1VIAA 1ODLA 1XYYA 3ASYA 3OUZA 1BZYA 2W2XA 4U8HA 3EVAA 3O91A 3HCEA 4MYCA 3GPBA 5DULA 1G60A 4J7AA 4PBSA 3UM9A 5HHTA 3DBVO 4KNVA 5ECGC 3AJRA 1JQKA 3KKNA 4UMDA 4GLOA 2RI1A 1BCRB 1NOJA 3LPMA 3WKCA 4JBXA 1QV6A 2Q5EA 3FZYA 3M0EA 2IIQA 4Q4CA 5D51S 1CHDA 2OZKA 1F1JA 3JD2A 1L4MA 4OHMA 1A7KA 5BN5A 1M1KD 5BYBA 1L4HA 1BGWA 1MHPA 5EN4A 3KZKA 4RK4A 2ONJA 5I7VA 5JTTA 3BTVA 2PH7A 4US2R 4B85A 2WOJA 1QWOA 1YL6A 3BXEA 2ST1A 1WB4A 2B8NA 3BH4A 4DXHA 3QEKA 1PJ7A 1XT6A 1UXJA 4PYOA 5EWJA 3SMQA 4EVSA 3LXXA 5F2KA 2FPIA 4HZGA 1UKBA 1E9CA 5E6SB 2ZUFA 2J9FB 3H3FA 3PJDA 1Y3IA 4HX9A 4OHXA 2PUCA 3L77A 3M1YA 4RDIA 5G3ZA 2Y9PB 5AXBA 2ECQA 1R4NB 2OYNA 4BDSA 4C4ZA 5JZSA 3QLUA 3O8CA 3MK31 1C1DA 1JFLA 3IAAA 4K03A 1V7QA 3OETA 3K1JA 3NI2A 4J4HA 4LYJA 5HF6A 1KMHA 5T7BA 5JY1A 1G63A 3PQ4A 4UARA 3IVMA 1DJMA 1U0FA 5KTKA 1YHZA 3AIKA 4FFDA 4BECA 2VTKA 1SCNE 4JLAA 4A0GA 2FP4A 2R5FA 1IZ8A 4KNWA 5B5SA 2NG1A 3L92A 4K9RA 4C4TA 4D9HA 5FV4A 3Q7PA 3VKUA 2JB9A 3ED5A 1VG9B 4GSLA 3UQYS 2VJOA 4L28A 7REQB 3I0MA 2ZL5A 1YE5A 3AF1A 5EZSA 4BE4A 2HBZA 3EPPA 5B4UA 5FAKA 3COZA 2YFYA 1YFZA 3K9CA 7YASA 2LVBA 5B1EA 2X8BA 2WHRA 3FDZB 2QOEA 3FOWA 2ZIUB 4O4JF 2ZRFA 3C3KA 4BCDA 2G9ZA 1KI4A 3I9NA 3DKPA 1SGWA 2ZVPX 3CZRA 4UBKA 2Z3VA 2QD1A 2ZIZA 1WCYA 4ES6A 3PFGA 5DS0A 4COOA 4CLRA 3W6NA 2ZIWB 4ZOEA 1NQWA 3AEQB 3EIUA 5L6MB 1AQLA 1G3IA 4AIIA 5F33A 2ZXHA 2E85A 3ONNA 1B16A 1SKUA 1JZSA 4Q1AA 5IF3A 5BYAA 1TE2A 1KK1A 4UCWA 3DMHA 4RUKA 5EJFA 4MW6A 3THXA 2I1QA 3GP8A 1D9ZA 1TU4A 2QVLA 4NQRA 1ISHA 1RHUA 1O6CA 1U5BA 1SBIA 2WJZB 3AV3A 5K3AA 1G3RA 5L7WA 4PPQA 5L7TA 2MYTA 2BFBA 1YZ3A 2X5NA 3FLEA 1Q0LA 3ORSA 3QPCA 1EXMA 4AO7A 2X8LA 4C43A 2QMZA 4BE7B 4MLCA 2HAEA 1KYVA 4Z0HO 1O6FA 2EZUA 2HWWA 5JBIA 2C9BA 1WCIA 2Q7OE 2D0DA 2GPNA 2WB4A 2CD9A 2DKFA 1D2MA 1GVNB 3QKUA 1VJDA 4QVJA 3SQMA 3AVYA 4P0PB 1EFRA 3NXKA 3RI3A 3C74A 3P94A 1GCUA 1ST2A 1T6NA 2NP6A 1Y6ZA 1UBTS 3NTVA 2P4HX 3IVXA 3IVCA 5K3SA 3UV6A 1R50A 1W5SA 2FEKA 2I8CA 3IKJA 1WP9A 3JQ8A 5CFPA 3G0GA 3KP1A 3LHFA 4ETWA 2WPNA 3R41A 3MLAA 3I56B 3EIQA 2C5BA 1HKHA 3NKVA 1NSYA 1YK1A 3A3GA 3A04A 3UK6A 1Z5GA 1N06A 2Y1CA 3P9PA 3WYNA 1M8KA 1JR4A 1RBZA 3L40A 4GMGA 4L7VA 1P1HA 2N1MA 3VVCA 4M4SA 1KS2A 1Q0SA 3H8VA 3BWVA 3GZJA 4MRSA 4TYNA 5GJBA 2RHOA 1ESMA 1QYDA 3CUWA 1M72A 1JG1A 1RQLA 2JJMA 1EG2A 4Z2YA 4FBGA 2EG5A 2HNAA 1PR2A 1P7ZA 2ZZFA 2IX9A 3RNOA 2ZUSA 1Q44A 3NT5A 5C0OE 2W98A 1T9CA 3DWEX 3OSUA 2UZIR 4XKWA 4KPFC 2XCLA 2WVHA 3GL9A 4Y1RB 3BCUA 4C04A 3CIOA 4DYHA 5KHOC 4RMGA 3CC7B 3TS1A 3CRQA 4NZZA 1FRNA 2RHLA 4O4IA 4BEBA 3DXZA 2GQFA 3AVUA 3WNCA 2AOWA 4L27A 1Y8QA 1PUIA 1QDUA 3UO8B 4XGIA 4LBZA 4FYPA 3GBSA 4CM9D 2Z6QA 1VA5A 2EHDA 2WSBA 1OFGA 4B3JA 2SCUB 2AR0A 4YRPA 3PDJA 2W90A 1MB3A 4H7EA 4M8KA 1ZIPA 1UANA 5AW4A 1MHTA 1VLJA 2QNRA 2OD9A 3DXXA 3V1MA 1C0PA 4A1OA 1VZ2A 1QYCA 3OFKA 3NYIA 1PTJA 2XUZA 4PPGA 4M1MA 2P2DA 1PGOA 3ANMA 1IAVA 3GT3A 4FNAA 5B30A 5K6RA 2FG6C 1ODFA 3PFBA 4LWPA 4EG4A 4M36A 4ZO4A 1E1NA 1T8RA 1XQVA 2V5AA 4Q93A 1P4SA 3BMOA 4YBRA 5AR1A 1E89A 2R60A 3ZJ5A 1VLZA 2JD1A 2ZB8A 3K09A 1FDUA 3Q6MA 4ZI7B 3X44A 1POXA 5L3QA 2O1EA 4MK4A 3AJ9A 4F9GA 4LPSA 3Q9SA 2R6CA 3WTCA <