1KK3A

Structure of the wild-type large gamma subunit of initiation factor eif2 from pyrococcus abyssi complexed with gdp-mg2+
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
405
structure length
398
Chain Sequence
SRQAEVNIGMVGHVDHGKTTLTKALTGVWTDSEELRRGITIKIGFADAEIRRCPNCGRYSTSPVCPYCGHETEFVRRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTVAENAPIIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSFDVNKPGEKLVGGVLGGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGVGTKLDPYLTKGDLMAGNVVGKPGKLPPVWDSLRLEVHLLERVVEQELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIEVKLQIPVCAEPGDRVAISRQIGSRWRLIGYGIIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords eIF2gamma
publication title The large subunit of initiation factor aIF2 is a close structural homologue of elongation factors.
pubmed doi rcsb
source organism Pyrococcus abyssi
total genus 98
structure length 398
sequence length 405
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk3A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk3A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kk3A01
3TUIC 2QAGC 1Q1BA 2ZE7A 1VG0B 3WMFA 2JLWA 3NTUA 2NOAA 1S96A 4PQRA 1KJZA 2OXRA 4JL8A 2Z6VA 3LQRA 2IWRA 1W49A 2IXGA 1JA0A 1ODFA 3LLUA 2DBYA 4P32A 5JCZA 4IKEA 4K1XA 1XFAA 3LAWA 3K70B 1JB1A 4TYPA 1E69A 3K70C 1G3QA 4RD0A 1M1YE 2PX3A 3MWYW 2QSZA 4UJ3A 4AYWA 2QRNA 3ZZTA 1OKKD 1XP8A 1G64A 1B23P 2CVFA 2P2LA 3ZS8A 3GPLA 3I4LA 2JLXA 2C77A 1LB1B 2GTPA 1YHQB 2J45A 1GZSA 3WYGA 3TGPA 1XPUA 1EP2B 5JEEA 1E2QA 4Q4AB 2HEIA 2P6RA 4TQUS 3NXSA 2YC4C 4F38A 5J47A 2PIAA 3B5JA 1T0HB 4IOMA 4AWXA 1CP2A 4B3DA 5EMNA 4PPNA 4XWAA 1GO2A 4B2LA 1KYIA 4KAXA 4V02A 5FH9A 3LY5A 3AGPA 3MLEA 2PLFA 1Q22A 1TU3A 2HF8A 2VP4A 3H86A 4Q21A 4S2EA 5KSWB 5AUNB 5F98A 2RC6A 1EP1B 2VP5A 3EA0A 5FBLB 5FOSA 5HKKA 4ZCIA 3W6NA 4LJAA 2R6HA 4KYUA 5GJCA 3AVXA 1KHTA 1J99A 1YJWB 3WP1B 3U44A 3N5CA 1X3SA 2OT3B 3Q7QA 4R9UC 3W5VA 3AB3A 2QTFA 2V6IA 2V1UA 3D7MA 2VO1A 2GHIA 2BWJA 3A4LA 3GLIE 1WQ1R 5H1YA 4EFMA 4Q9JA 3GJ0A 2D2EA 1UKVY 1GRNA 1ZMXA 3IQXA 4FCWA 4WVFA 4Q1AA 1D9ZA 5EP2A 2P6UA 3AV0B 4JZKA 2ZU6A 4UNSA 4A0FA 1E1QA 4F91B 1KI2A 1F2UB 3M0EA 1QHYA 3OEHD 1WB9A 2QE7D 1JR3D 3QEJA 1GKUB 1S8FA 2OSBA 1D6JA 2Z4RA 1KIMA 2J41A 2X2FA 2J46A 4F7WA 1I4LD 1NJGA 1MH1A 4LJ7A 2YC2C 4NBSA 2OBLA 3B1VA 4KI0A 3K0FB 3K09A 2NZ8A 5DNYB 4HB2A 1NDHA 1QG2A 2XB2A 2RGBA 4DUGA 4FMBB 4MRNA 1DG1G 2IYWA 2J59A 3RRYA 1OT3A 4CEJB 3CD6B 4F92B 3ECCA 4DWJA 3AKDA 3UWKA 3HDTA 1N0VC 2F9LA 1COWD 1Z0IA 4LV8B 3RAPR 1S72B 3THYB 1Q44A 2D06A 2VP0A 621PA 2FPKA 3U6BA 3TR5A 2OFOA 3GFTA 1UBFA 4LPSA 4NU0A 2RGCA 3UG7A 3W5JA 2QI9C 2F43A 4HAXA 5KYKA 2CK3D 2WWYA 3G0HA 2C9CA 1QVGB 3HU3A 3KFVA 1OB2A 4MRSA 2N1BA 3LH5A 4D4MA 4MKFA 2B5OA 3QXHA 1RKBA 4HAUA 5JWHA 2C04A 5J5CA 3LRPA 5E7MA 3SU8A 4C0BA 4ZGNB 3SS8A 4LBWA 2B21A 1SHZA 3SFZA 4UXJA 1FL9A 1W35A 4DQLA 1IOZA 1T8UA 2RGXA 4OBEA 2ZANA 1KKLA 3KXKA 3CPWB 3GLFB 2CNDA 3B6EA 1VYTA 4A2QA 3ZS9A 3VU9B 5EE5B 2C96A 1LW7A 3B9QA 3KZ1E 1TVCA 4A92A 4B3XA 3DM9B 2ODBA 1N6IA 3NBZC 2ZS8A 2BN4A 1OYWA 3FWYA 4Q9HA 1TUEA 5BQ5A 1NMYA 3EWAA 4NHOA 3CF6R 2WHXA 2WJJA 3FKQA 3V76A 1VECA 2QEXB 3K9NA 1BOFA 1OH8A 1W4AA 5G3ZA 2VQSA 3G82C 3OF5A 4MGIR 3L8YA 4CT4B 4XWKA 2A30A 1RJ9A 1ZIPA 4NCJA 1HV8A 2D62A 4GMDA 1AN0A 5FUVA 5L3QA 1BYIA 3OIYA 4QGGA 4JKYA 1Z0DA 2R9VA 3D8BA 5KUTA 1S9DA 4QHTA 5FL7D 4MYHA 2REOA 3PVSA 4PO8A 4M4SA 1QGYA 1OXVA 2PJRA 1XMIA 4I1UA 4BUJA 2BMDA 3QJYA 4RZXA 3BIFA 1RYFA 3FB4A 3UPUA 2GXAA 1U90A 4GT1A 4O2RA 2CBZA 4A4DA 1G8HA 1YZKA 4KFUA 5KSYA 1KNXA 3RSOA 4B47A 1GAQA 1XF9A 2KJQA 5D3MB 3R7WA 4CRWB 2O5VA 4K81B 4U02A 1XTSA 2G77B 4ZIRA 1CJTC 4JLDA 2QMUA 4QBHA 4XTCS 5EP3A 3I61A 2AR7A 1KQSB 1QF9A 4OI2A 1RC8A 1FP7A 2A5DA 5LB4A 1N3BA 4C7OB 5J4VA 4WXPA 1W2GA 2QSYA 1QHNA 4LHVA 4ZV4A 3KKNA 2BBTA 2ZRIA 4LRWA 1N5JA 1HY3A 3P27A 4M53A 1RFLA 3GLHB 3AQ4A 2CL7X 3O8RA 3SHWA 1T3SA 1IJEA 3I5YA 1VQ8B 4IXNA 4NZYA 4GI7A 1WXQA 4URUR 4V03A 2PH1A 3QBVA 1N5KA 3C16C 2JJ2D 4Q47A 1G19A 1GUAA 3IBYA 4DLYA 2OCBA 2ZXUA 4EPXA 1E62A 5TY0A 1M1KD 3CX7A 3EARA 3H84A 4ITRC 1ZM2A 2ZROA 3CNNA 2AD1A 2MMCA 2QZ4A 1SKYB 3OEED 3PJRA 3T1VA 1NSTA 1C1YA 3I8XA 4MGZR 5SZIA 2ONJA 5HZHA 4A8JA 4DDWA 2DY1A 3DPUA 4QL3A 4EFNA 1QFYA 2IYXA 5LDDC 1UDXA 4B3BA 3H0KA 1NG9A 4TYWA 1L4YA 3W34A 3OFND 4Z8XA 4OQXA 2EFEB 5AJVB 2DFKB 3ZDQA 4MUBA 3RABA 1FW6A 4XVQA 3BBPA 3Q7PA 1RVDA 2GZDA 1W0KD 2W2VA 4Q02A 2IHYA 2XEXA 4Q03A 5K8UA 1GRRA 5CLQA 1GNRA 2ZI6A 3CM0A 4M1SA 2FZLA 2FFBA 1E3MA 2WWXA 1I4TD 2VA8A 2JIZA 2FGJA 3O8DA 1XTRA 2XSZD 4IW3B 2AFHE 4RFSB 2QMEA 1U94A 3QEOA 3KTAB 2SHKA 4JKIA 2BGIA 1FNDA 2WMOB 4KBGA 1E9SA 1T9HA 1TL7C 5DI3A 3QNUA 1EFRA 4TZ0A 4KFTA 3QG1A 3L8ZA 4QBIA 1U0LA 2QTHA 3DKPA 3EZ9A 1JB9A 3WNDA 3GFPA 1JJ2B 2UZIR 4L8GA 5HTKA 3AP3A 2X77A 2QDXA 1XCGB 3ONWA 2QT1A 1VQLB 3WYFA 1QFJA 5KNBA 3U4QA 2O8DB 3FPAA 2DETA 4GZLA 1WBBA 2OAQ1 1ZVQA 2NG1A 2HJVA 1UKZA 2YJTD 3L2OB 1VQ5B 3C15C 1DG3A 1P2SA 2FFAA 5FPKA 2RCNA 3RS3A 3WMEA 1EWYA 4JLJA 2FZ4A 4Q19A 1FX0B 1KDOA 1VIAA 3VR3A 4B75A 3ICQB 4OYHA 4F4CA 1HA3A 4PQFA 1OIWA 1FNNA 1RW4A 2Z43A 3VFDA 1E94E 2WOJA 3EXAA 1G4AE 3P26A 3W2FA 4YONB 2O52A 4F4JA 2PCJA 2ZU0C 1LF0A 4Q00A 5HKKD 2W0SA 1ANKA 3T15A 4GBMA 1HQCA 3PXGA 1UDWA 3QXSA 4ASUD 3REFA 1P2VA 1P61B 1QHHA 3RRMA 2OK8A 1CRPA 5E7IA 3DZ8A 4KFRA 2GA8A 3MGCA 3EIQA 1Z06A 4JLMA 3U2QA 4R98A 2VHUA 1ZP6A 2WSMA 2Q3FA 3MMPA 1QGZA 3TJZA 1AM4D 4Q9KA 1KD1D 4DEYA 2ZREA 4UXIA 2GXSA 4AKGA 4TMVA 4OQNA 1Q0UA 4BFYA 1IXZA 1AZSC 1M7HA 2KSQA 2XTMA 4FXPA 4GOXA 3L0IB 1M2OB 2MSEB 2EFCB 5DN6A 5JBQA 1GVNB 2R65A 1E1QD 4LV5B 1DAIA 1ESMA 4XH9B 5LBIA 2IF2A 1GSIA 3CNLA 2C9OA 4RVCA 3LFUA 2GCOB 2IYTA 1N6HA 1Z47A 3ZLJA 4QFMA 2JCSA 2BDTA 4ZO4A 4MH0R 2QROA 2V4ZA 5KHOC 1UEJA 3GLIB 1GOTA 4IXMA 3D31A 3LXRA 3OJWA 1NN3A 2O0HA 2QORA 4DUGD 3KKPA 4ZDJA 1RRPA 1JBKA 1XJ0A 2Z0MA 1ZINA 5DHFA 4Q18A 3KXLA 2OG2A 2J9RA 5IDVA 3CRW1 1GAJA 4EPYA 2ZRMA 3QKUA 4DLWA 5DGXA 1XCMA 2OXCA 5L3SB 1E2IA 4JBYA 4PFSA 4B73A 2FFQA 3FHOA 1NG1A 4IEIA 4YHBA 3OZVA 4HUQA 5IF9A 2PLRA 2WKRA 4IEEA 1R0ZA 3SEAA 2FSIA 1JPNA 2JLVA 5CITA 3C8UA 4Q48A 1G6HA 3VKHA 1SVKA 3F3YA 3KQLA 3KUCA 2P0EA 3ZJYA 3IHWA 2BKEA 2OFXA 1G4UR 3T1OA 4KITB 4JT4A 3CIOA 4ZCLA 2WVJA 1QHIA 2OO7A 1YE8A 2JEOA 2ZJYA 3U3JA 2ASEA 5FR2A 2RH5A 2R6FA 4DLUA 1A1VA 1SXJC 2ZVQX 2VTKA 1U99A 4EUNA 3CH4B 4ZKDA 2DPXA 3I56B 5J4HA 4YMSA 1ZW6A 1VQOB 1HYQA 1L4UA 2PT5A 3OIVA 4HDOB 1Z6XA 5FPYA 3I32A 3G6EB 4DT1B 4G5RA 1QFZA 2LWIA 3CX6A 4PC2A 3PG5A 4BFTA 1TQDA 2GCPA 1G7SA 3V4FA 4EIWA 2P5TB 4RY2A 5JS7A 1NVVQ 5H8WA 4D26A 2ZJ8A 3WHLA 3RVBA 1ZBDA 5FBRB 2B8WA 2EFHB 1XU4A 4NYMR 3OZUA 3RNLA 1DO0A 2OTJB 2ZRHA 4JVMA 1P60A 2F3TA 5CM8B 1MO6A 5DSZA 2BMFA 1YR8A 1T3LA 5JLJA 4AD8A 3CCUB 1TQ4A 2JA1A 3QIAA 5EXSA 5FTKA 3HR7A 2Z5FA 2A5YB 1YR9A 2F9MA 4LJ4A 2RB4A 5A0FA 3ZBTA 3CZQA 4B71A 2ZITA 1W7AA 4Q4JB 1U0JA 3CXCB 1P7CA 3CR7A 2XNJA 4P6VF 2RC5A 4M9SA 3PUVA 4OL0A 1CULC 5EJEA 4OQMA 4CEHA 1HTWA 1LFDB 3T61A 4LHWA 1XEXB 3LO5A 1VG1A 4AF6A 2YOGA 3LD9A 4AKEA 4LI0A 3W8NA 5JRJA 2C9YA 1Z6TA 1FMLA 2QT0A 2ANBA 4N0DA 2CK3A 2X19A 2CNWA 2E87A 1XEFA 2RHMA 1C9KA 3LWNA 3R9IA 4C9BA 4A0GA 1F5NA 1JJVA 1S3GA 2PJZA 4LCBA 5FA6A 1KI8A 3KKQA 3THWB 3AKYA 3BORA 5AWFC 3SYNA 3RS4A 2QM8A 3ZVMA 1XTIA 1E79A 1E2NA 1Q82D 4XTRA 1RE0A 1US8A 3HPRA 1XE1A 2IC5A 1N6KA 4ON9A 4E07A 5JFGA 4G5OA 2IT1A 1ESNA 4PO1A 1WBDA 4MGKR 4D4KA 1EGAA 1TNDA 4E22A 4EPTA 5KSOA 3TUJC 1KNQA 5AJXA 2ZRJA 4Q7JB 3CBQA 4M1TA 1OW3B 4M9XA 4YLGA 1HT1E 2W6JD 4Q1BA 4G5SA 1I2DA 4ZDIA 2WWHA 2NO7A 1NVXQ 3NH6A 1ZU4A 3BFVA 3RS5A 1A2KC 3TAHA 4UNRA 1FRQA 2XTNA 1IBRA 1KJYA 2KB0A 2IS2A 1XD2B 1U81A 3QXCA 4A2WA 3CO5A 2H18A 3EZFA 3TR0A 1VCMA 4P4SA 3K0AB 5BXQC 3GJXC 1IHUA 5FOUA 2VBCA 1Q3HA 3O8CA 1VTKA 2JASA 2O8CA 3BXZA 3IO5A 2XNDA 1N0UA 2ORWA 3R8CA 5KSZA 4ACBA 3REGA 2YWEA 5P21A 4FW9A 2JLUA 2PT7A 2VSFA 5FL7A 1A82A 3K8YA 3KJHA 4XSGA 3X1ZA 3DMDA 5BN4A 2D74A 3FHCB 4FWTA 3K0CC 4DSUA 4DEXA 4Q1FA 1N2CE 3NEYA 2BHRA 1CRQA 2ZETA 3KXIA 1KSHA 5FPHA 1SULA 4LSGA 3UMFA 1EXMA 4JBWA 1E9BA 3KQKA 3T12A 3HPQA 1R7RA 4QGAA 1S1MA 4G1UC 1Z5ZA 2DHRA 2IEZA 4FI3C 5FTJA 4EDHA 4XJXA 4UNQA 2E9SA 2ZSDA 4HLCA 1JR6A 4JLAA 4PSVA 3L0PA 1YHNA 2MSCB 2QQEA 5B58C 4BZPA 1XPRA 1EFRD 3LO8A 3BS4A 4W5JA 1F60A 2RGDA 2ZSEA 1M90D 3OZXA 4DLXA 5IT5A 4W5HA 3IEVA 5FUWA 1DAHA 1UADA 1CTQA 1OFTA 4TMWA 2ZS9A 3BH6A 3UIEA 5F9HA 2J0SA 1QG4A 4LYHA 2ODWA 3E2IA 3MCAA 1Z2CA 4BLPA 1SM4A 2RMKA 1OGJA 5HXBA 5EXXA 3EPLA 3SJCA 4DCVA 5EZ6B 2VHCA 3QI2A 1WA5A 1T0JB 1TEXA 4M1WA 4ZDKA 5GJBA 2GNOA 5EXTA 4X8HA 2XJ4A 4QG7A 1KK0A 4V0ME 5CJPA 1GM5A 3IKJA 1UKYA 4XIGS 5FR1A 2QUZA 2ZSFA 1ZNWA 3B9PA 2BVNA 1W48A 5B2ZA 2OAP1 3IDQA 3OEEA 3PUYA 2VYFA 1Z8FA 4FINA 4TL9A 5JSZA 3MHPA 4C2UA 3BFKA 4B3FX 1ZM3A 4JLOA 5CIQA 2J0UB 4S35A 3JQQA 4KXFB 4JIMA 4NYJQ 1G5TA 3GJ4A 1NBMD 4US1R 2J5XA 1OFHA 2QGNA 2KBFA 3FPKA 2AXNA 4B35A 3LX5A 5C4MA 2CRVA 4MQBA 3CCQB 4Z8YA 1NLZA 1LS1A 4JVNA 2ZYWX 4QGHA 3AM1A 2GBLC 4QHYA 3AGQA 1DELA 3K1JA 2O8FB 3W6OA 2RGNC 3LA6A 3T35A 3OIWA 4MRPA 3DM5A 3FMIA 4LUCA 3GLGA 3Q9LA 1J90A 2XX3A 2ZRDA 5DN6D 3IIKA 1J9ZA 4RD6A 1F2TA 2D3WA 4TQAA 2QU8A 2NPIA 4HDCA 4B44A 5EE9A 1E2PA 5BW8A 2OCAA 4URXR 3IO3A 1M7GA 2EVWX 2DFLA 2FPLA 1U0HC 2GEVA 3ZYCA 2IX3A 1HQYE 2CE7A 5BYKA 1N5IA 2GDJA 5BN3A 1GNPA 4C0SA 3KUDA 5DI9A 4DKXA 4I1SA 3SZRA 3I8SA 3NIBA 4MDFA 1AS2A 3W3AA 1II9A 4YMWA 4FD2A 1LS6A 4BE7B 3CCSB 1NIPA 2IYUA 2HXSA 4JYBA 4A82A 2BMJA 4JLKA 4PHGA 2JLQA 1FNCA 3E1SA 4Q4AA 2VHQA 3TH5A 4ERNA 4B6FA 4P4TA 1VQ9B 2JGNA 4Z1MD 2QENA 3F0TA 2I4IA 1ZNYA 2FWRA 4DCUA 4DZZA 3K53A 3RWMB 1HEIA 3OZWA 4TQ9A 5G41A 3HR8A 2FMXA 2ZVPX 1OH5A 3QUSA 4FCVA 1CKEA 1ZD1A 2FE4A 4PAMA 4ASUA 4BZXA 4TMTA 5EP1A 2IS4A 1VCOA 4GFDA 5KDLA 2GJ9A 3PEUA 2V7QA 2CXXA 3CR8A 3LW8A 2CMKA 2I1QA 3SE0A 2EU8A 3G4SB 5J40A 2Q9AA 2GEUA 4HI0E 4A0HA 1FQJA 3GP8A 2HYIC 2QAJA 5FBVB 4RCZA 3BERA 4WXRA 4YMUA 4E03A 2FX3A 1QGAA 2BJWA 4II7A 3KB2A 4PANA 4V0KA 3BB4A 3DEFA 2BF4A 1YR7A 1YI2B 1YQTA 1PUJA 2BCGY 2NGRA 2YNMA 4TL7A 1SZPA 1UBGA 821PA 2VSXA 2WWIA 5JCPA 4AC9A 2F3RA 1JA1A 1E63A 4KCGA 1F2UA 2FSGA 3CZPA 1II8B 3CPJB 5J4LA 3UMSA 1P62B 4M22A 3DVLA 4B43A 1QHGA 4C0LA 2F1IA 1CIPA 1SVLA 3HWSA 4M9ZA 2WJIA 4BPRA 2A2ZA 1FMJA 3FDIA 3IHLA 3K0FA 4JSTA 1W4RA 1P75A 2GJKA 1KY3A 1SXJE 3EZ6A 1RYHA 4JT2A 1E64A 1GWNA 3CLVA 3ZQ6A 4DDTA 4AK9A 1YZQA 2PMKA 4LJYA 4R2IA 5C4GB 4IOJA 4CEJA 2EIXA 1Y63A 1KSJA 5LPNA 1S3SA 1UF9A 1GL7A 3GEHA 1CR2A 1G41A 3TIFA 3VMFA 4M1YA 4PZYA 4V0OA 1XD9A 4PTLA 3THYA 1Q1ZA 4MRVA 5FL3A 5F2EA 3KB1A 3N2IA 5FI0B 1GG2A 1U9IC 1EWQA 2CNWD 2PX0A 4MA4A 1N6LA 5BWMA 1U8AA 3FKSA 4GOKA 4NH0A 4DB2A 2J7KA 3QFTA 4IDQA 4DCTA 1LF5A 3B1ZA 1LV7A 3I55B 2HCBA 2VRWA 3TAUA 3THXB 2GQFA 3NC1C 4RD4A 1E79D 4FMDB 4C30A 3FOZA 3ZVNA 4GNKA 1JR3E 2BSAA 2F43B 2R62A 3VAAA 4DSOA 5CB6A 2O0JA 3ND9A 2WBLC 3RSLA 1DOAA 4QJ5A 1QHXA 3GLFA 4DQKA 1JJ7A 3HJNA 3VU9A 2ORIA 4CIDA 4IDNA 3AKCA 4RFVA 1N25A 1DVRA 2YWHA 1AK2A 4Y9UA 1IY0A 1T6NA 2FA9A 2GF0A 3RS7A 4D82A 1GL9B 3DL0A 2OM2A 4AYXA 3EC1A 1TU4A 1Q1QA 3E70C 1ELOA 2VNKA 5DISB 3C5CA 5KDOA 1R10A 1XXHE 2RKOA 4DSNA 1X8JA 4AG5A 2ZSBA 3ICEA 1E32A 2F1HA 2CE2X 5JJLA 5EP4A 3EPJA 2IW3A 1NLYA 4UKDA 3VKWA 1EP3B 3WHKA 2G1KA 3P20A 2XNDD 3PEVA 4DB4A 4NTZA 3T1TA 1T3HA 3TKLA 3WNCA 1S0UA 3AVVA 4HZIA 4JS0A 5LD2B 1XTKA 2BBOA 1KTVA 1UAAA 2AD5A 1N6NA 1I7PA 1E4YA 5LD2C 4FMCB 2QPAA 1KDRA 1NY6A 3ADKA 4EPVA 4MYCA 5G40A 1SGWA 2ZI3A 1RIFA 4MKHA 1SVOA 1XDBA 3JQPA 2GCNA 1DARA 2OCPA 3DKVA 3LBIA 3ZZ0A 3HYRA 2R6AA 4YAOA 5F3WB 3K9LA 5D3MA 1J7KA 3QF4B 4U00A 1XNJA 2QMHA 1VG9B 3S1AB 1KO4A 4HSEA 2YWGA 4B6EA 3O47A 4NPHA 5EZ5A 5JHHB 1OGIA 3C14C 1KO5A 1Z08A 3R7WB 2Q3MA 4LGMA 1NMXA 2YOFA 4C7OA 1DAMA 2ODEA 2B6HA 2JDIA 4Q1CA 1E96A 4PSKA 1D2EA 1KDTA 4JL6A 3JVUA 3PR1A 1XD8A 1SVMA 4MUAA 5GV8A 1J2JA 1PLLA 5AUPB 2C2HA 3P32A 2ZUDA 2AX4A 4YXWA 3X1DA 1AGPA 1ZUNB 2DWPA 2W6JA 1IB0A 1YZLA 3EIEA 1G6OA 5H59A 1BMFA 1H8HD 3CCMB 3CMAB 4TYNA 3OJXA 1N6OA 5K8IA 1TPZA 2AK3A 4E09A 2QBYB 2ZM5A 3SN6A 2IYRA 1G9XA 4WBSA 3I62A 2D7DA 4GP6A 5DO9A 1BJKA 3U6KA 5JMTA 1R4AA 2AKAB 2GF9A 1EK0A 1LNZA 4PPFA 5CDFA 3KQNA 3NG1A 1BX1A 4IFEA 4OQLA 1JXOA 4URZR 5KNDA 1XPOA 1KI6B 2HV8A 1G21E 4FK8A 4F7DA 5HE9A 1YRAA 4MITA 2EYQA 4KJZA 2VP9A 4Q4HB 1BIFA 2WOOA 2WPDA 2RHDA 5J4YA 1HE8B 4FMDF 2HYDA 3P4YA 4DJTA 3WY9A 1QDEA 2GVZC 2HLDA 2GJSA 2FV8A 2V1XA 4LY6A 3PUXA 1G16A 1X1RA 1Q21A 2H57A 2OCYC 1ONBA 1FRNA 4C0AC 1W4CA 3FMFA 3AVOA 2ZEJA 3LW7A 1TF5A 3EW9A 2NIPA 4F4IA 1MRNA 3NH9A 5EUQB 4JVLA 4OKSA 2QP3A 4RFSA 5KPDA 4DLZA 3PCRB 3WYAA 5JWRA 1OIVA 4NDZA 2G6BA 3SNHA 3KTAA 5AUQA 3X1XA 2IBMA 1Q20A 1VDZA 4HLQB 3TSOA 3BRWD 4HZUB 4PHTA 2QPOA 4I1VA 3NEJA 1DDGA 3N2EA 1FDRA 2ECKA 3K70D 2C8VA 4AKHA 4BLRA 1Q81D 1OFUX 4QM7A 1M34E 2H5EA 4P4UA 1VQ4B 5HR5A 2O8DA 4RZUA 2DWOA 1W36B 4LOAA 4YMTA 1Z22A 4FMCF 3RC3A 2HXYA 2ZJZA 1W36C 3CRRA 2GJ8A 3TSZA 1T4GA 3TVDA 1AMOA 4QC2A 5IHPA 2ZJBA 1Z6YA 4JJKA 2HT1A 3FE2A 3AKEA 2ZI9A 3SDZA 2N46A 4LC0A 4B48A 3KKOA 2ZI7A 1AIPA 1FX0A 4EJSB 5GADl 4C0JA 3L0SA 4EJSC 1FQKA 1MRSA 1VMAA 2GJAA 2BV3A 3MWLA 5IRCD 3CB4A 4YAUA 3NDPA 2YHSA 4TLDA 1Z83A 4C0QC 2C03A 1IN6A 1W2HA 3OW2B 1NBMA 4RKEA 1JECA 4IJMA 2HUPA 5CYPA 4OJKA 4POAA 1MOZA 1ZIOA 2V7QD 4XOIA 1ZM4A 2WIBA 3A1SA 2CLSA 2BM1A 2HCJB 2OTLB 1A4RA 1GILA 3SYLA 4OI4A 4U7DA 1WE2A 1P2UA 1NRJB 3SJZA 4UJ5A 2FU5C 3SBEA 1S1CA 4PXAA 4LWZA 4B76A 4M8NE 4U9UA 4KBFA 2VLIA 1S4QA 1LY1A 1VYVA 3AP1A 5H5JA 5CM9C 4RD2A 1II0A 3EWSA 5L3VA 4BFVA 3LVBA 4GZMA 3UANA 1QUEA 1W44A 1ZRHA 4NKRA 2RGAA 3I1FA 3EX7C 2W58A 5J4KA 1KK3A 1CF4A 3KKMA 4HATA 4DCNA 1OJLA 1TADA 3RDPA 4PC1A 1KO1A 4GL2A 2R6DA 3QKRB 3PITA 2QTZA 3E20A 2GK6A 3KL4A 3W5HA 5A4JA 1XBTA 2GCOA 2GILA 3KDSE 2ERYA 3P1JA 1W5TA 3FFAA 4DCSA 5HPYB 4L4UA 2O8EB 1PJRA 3A8TA 5K8TA 1KMQA 1NKTA 2ZRPA 3NDBB 1ZU5A 1MT0A 1VCIA 1OLOA 2XOKA 3DOEA 2UZ3A 1H8ED 3CH5A 4HB4A 2FF7A 4NCNA 2VF7A 4TT3A 4Z1MA 3DZDA 1E4VA 4NYIQ 1AGRA 4BASA 2XXAB 3ADBA 3LNCA 1H85A 4K46A 3AVQA 2Z4SA 4IOLA 5L3SA 4GP7A 1YIJB 1DS6A 2QMOA 4BLSA 2J1LA 1GL6A 2J87A 4HUTA 4QJ3A 1CJVC 1S2MA 2RGGA 3SYKA 1EFCA 4EH1A 4JVSB 2IUSA 1DAGA 4OHXA 3ZIAA 4IHQA 5JZVA 3BH0A 1CQXA 1U98A 4BECA 3B1YA 3FKSD 1WCV1 1SXJB 4HDQB 2JJ1A 2R44A 1QX4A 1MO3A 1ZD8A 1IN4A 4RKFA 4G1VA 2ZRLA 4LHXA 4NCKA 4KVAA 1G20E 4NCIA 2WM9B 3B1WA 2FGKA 1F48A 1PZNA 3CRZA 1AQUA 4V0NA 5A5GA 1QUFA 1XX6A 1CBUA 3VR2A 3VR6A 1L8QA 3H1TA 2XGJA 2QL6A 2G83A 1CXZA 3GCGA 1RZ3A 1E9DA 2CHGA 2W0MA 4DT1A 5IK2D 3L0OA 4LBYA 3ES9A 3PV0A 3WNBA 3W2HA 2XITA 3RHFA 3JZAA 5KDDA 1WP9A 3LX8A 1XWIA 5GVSA 3VX4A 2A7QA 3EA5A 3THOA 4M1MA 4M21A 2ATXA 3AVWA 3MAAC 3UATA 4RZ2A 3FVQA 4B33A 4C3ZA 2NMVA 3K0EA 4LK2A 4ZKEA 3EPHA 4N3GA 4RJLA 1QZXA 2IXFA 1YZNA 2B8TA 1WRBA 2ORVA 2VP2A 3NBYC 5TR9A 1QHSA 2BM0A 2OILA 2Q9CA 1Z28A 1XMVA 5DLQC 1CJUC 2UVQA 2Z83A 5FPTA 1QVAA 3T1QA 4EQ6B 2AWNA 2BMEA 5K8LA 4W7SA 1JEDA 3A4MA 4OHZA 1MABB 1XEWY 2VIIA 1Z63A 3I73A 1CR4A 1AA9A 2VNIA 3LVRE 2W2TA 3B7GA 2FJUA 1KI7A 3Q72A 4H1VA 4HLUC 4Q4JA 4D81A 5FFMA 4AI6A 5FOTA 4WIAA 1T5LA 1OF1A 1TQ2A 3IBGA 4BFUA 2YVUA 1KC8D 5L3RA 1XEXA 5AN9A 4EAQA 4ZI3A 1DTSA 1XXHB 5DE3A 2TMKA 1X8KA 2A5FA 2YOHA 5GJVC 1Z0KA 1P5ZB 3NVAA 3W6PA 4JSYA 4BEJA 1VCNA 5FUYA 4YMVA 4Z54A 1NI3A 2CDNA 2XJ9A 2WJGA 1JEEA 1R6BX 2QQ0A 4H9GA 4TMKA 2F1RA 1YITB 4RCYA 1DO2A 3MJRA 1J8YF 4PZZA 4D0NA 1M7BA 1OSNA 1P9RA 1W47A 1R5OA 3IUYA 2JDID 3P4XA 3THWA 3AVTA 1OB5A 1R8QA 3RC8A 2QM7A 4US2R 1MR3F 1W46A 5FBWB 1AS0A 1PVOA 3JVVA 2WMNB 4Q66C 1Y3AA 4YXWD 3LV8A 2Q3HA 4K8OA 4TLEA 4DDVA 4JYCA 3D3QA 4PGOA 4U5XA 1E9EA 5TMPA 2FN4A 3PEWA 1AS3A 1BMFD 3PUZA 3D6TB 2FSFA 2DR3A 1XEWX 3FTQA 2ZI4A 1ZJ6A 8OHMA 4O2LA 4LV6A 4OK6A 2A5JA 1BKDR 2PL3A 1O3YA 1H65A 1IAQA 5EUMA 1WMSA 3QSYA 4X8LA 1KI3A 2R6GA 4TTQA 2HDNB 1CR0A 2DYKA 2FSHA 3K0AA 4L9WA 1VQKB 2VSOA 2EW1A 1ZNZA 4PZLA 1QVFB 2XNCA 4BFZA 3QKSB 3K0CA 1CNEA 4A6XA 1GRQA 2OBMA 4Q9LA 5ELXA 3U7FB 2WPDD 3QE2A 3CF0A 4ESVA 4XVUA 2GAAA 4A0RA 2WJYA 2XZPA 2HLDD 1N8RD 3PUWA 3QKTA 1E2GA 4PAOA 3AF3A 2KI5A 3Q8XB 2H92A 4HB3A 3UMRA 1NVUQ 2I3BA 2R2AA 3SC3A 1KMHB 3SQXA 5JECA 3UWOA 4OHYA 5G3YA 1XJQA 2ZRBA 2J0QA 4MKGA 1PUIA 1ZC4A 1XJCA 3MJHA 1NL3A 1SVSA 2QN6A 1NN5A 4WZAE 3R20A 1IJFA 1NVVR 3GJ7A 4ACAA 4LZZA 4TL6A 3T5GA 2A9KA 1H42A 3ZZUA 1JXMA 1G3RA 1CS4C 4KLNA 4GDFA 4LJ6A 1CNFA 4Y0AA 3EIHA 4IOKA 2ZSAA 2ZE8A 5CJ2A 4IVQA 5TARA 3BGWA 4NMMA 3CRVA 5D3QA 4HE6A 2CCJA 5DIFA 2P6NA 2B7CA 4CEIB 4TWZA 1H8HA 1E2JA 3NWJA 4R7ZA 4BFXA 2OLKA 2KBEA 3CW2A 1K9MD 1E0SA 1D5CA 2PEYA 2DB3A 1T5IA 2AL7A 4XD7A 1NVWQ 4GMXA 721PA 1R0WA 4LDJA 4UAJA 3SI7A 1J70A 5TB5A 3AH8A 1KDPA 1KO7A 1B2RA 3FMOB 2QA5A 4OI0A 4JBXA 1P6XA 4JLBA 3TLXA 3I5XA 1ETUA 1Z3IX 4KSCA 3AUYA 3LXXA 4Q5IA 3TUZC 1DADA 5CK4A 3WRYC 2O8BB 5JI2E 1S9HA 2GRJA 4GSYA 5GJWC 3ZD7A 3FYHA 2J0UA 2ZAMA 4ZDWA 4QJ4A 5B57C 2DERA 2B92A 1OXXK 5CB8A 2P65A 1JQJC 5ANRB 3TK1A 3KJEA 2ZRNA 4IRUB 3AVPA 3ZGXA 3MFYA 4C2TA 1KRHA 1TF2A 4CZ2A 5C46F 1OHHD 1TF7A 1Z29A 1XTQA 3BB3A 2AHOA 4ARZB 2G0TA 2O8FA 1SVWA 5B30A 2RGNA 2ZUBA 2CJWB 3U61B 2A78A 2IYVA 3QBTA 2QAGA 3CKLA 1JPJA 2AN9A 3X2SA 1EX7A 4Q4LA 2ZS7A 2QG6A 1DAFA 2NPFA 5CIWA 4AY2A 1OIXA 4RD3A 2H7VA 1P73A 3VX3A 1JAIA 5FTMA 4ZGQB 3V4RA 3J81k 2QEQA 1KOFA 1F2TB 1T8TA 3KFXA 5JHGB 2WTUA 2ZPTX 4ZPXA 2J3EA 2PBRA 1E9RA 4J0QA 2ZJ5A 1V5WA 2V6JA 3ETLA 2XOKD 4D80A 3G5UA 3Q3JB 3VKGA 2AWOA 3LLMA 3SQWA 2DEUA 4TT3D 3VR5A 1JAHA 3R8FA 1K5GA 2ZIAA 1NBME 1NJID 3GEIA 5TV2A 1N6PA 3F5FA 2J7PA 2Q0HA 1OH6A 1YZGA 1ZD9A 2BOVA 3EZ2A 3T06B 4AIIA 2ZYVX 3V9PA 3ZIAD 4HAVA 1FZQA 4B34A 3QENA 1ZUHA 2FEMA 2ZRKA 4BZQA 4DLVA 5AJWA 4KODA 3ASYA 5EXPA 2GXUA 2BIFA 2JJ1D 3QXJA 4D0LB 4DRZA 3CC4B 4QKQA 3ZQJA 1KAOA 2WKPA 1EESA 4BFSA 4M1OA 3A1TA 4JJZA 2NO0A 3W3ZB 5C1BA 1SXJD 1KK2A 1UKEA 5FPSA 4YDSA 1U8ZA 4US0R 4NCHA 1KI1A 3GEEA 1IN8A 3HYTA 4OHVA 1TMKA 4TMZA 1OE0A 1JI0A 4XSHA 3U7HB 4MYTA 2JLSA 3U44B 2LKDA 4GRAA 1JNYA 2BBWA 2ZQ5A 4PPGA 1E2HA 4B32A 2GETA 1QVRA 2R8RA 3X1YA 3VO1A 1Q12A 3DDCA 4N3NA 3MRSA 4QGFA 3NKVA 1OXSC 3U3KA 3JZMA 4O25A 1KSGA 1D9XA 4QRHA 2VHTA 1II8A 2NO6A 2BEKA 4UXHA 1RPZA 5E3HA 4EPWA 3OE7A 4PHHA 3AF1A 3IQWA 5H68A 3CCRB 4D6PA 1G5PA 2JJ8A 1G8PA 3FGNA 1A7JA 1BX0A 1ZYUA 1VQNB 1W0JA 2GPJA 2A5GA 1H8EA 2CEAA 2OESA 3GFOA 3I3SR 1AJEA 4D4JA 3NBXX 2ZR7A 3KJGA 2FOLA 4NYJR 1EWRA 5GVRA 1NJFA 1UFQA 3BFXA 3K09C 1GIAA 2JLYA 1HH4A 2RGEA 3I72A 4G01B 5KNCA 4Q7LA 2D4HA 4O3MA 4Z51A 1U8YA 2VZLA 1SHKA 3W5UA 5EE3A 4NP6A 2FH5B 5KSPA 1YVDA 4R71A 4PR0A 4B3CA 3LBHA 2ZRCA 2ZRFA 4DC9A 5AUOB 3U7EB 3GJ8A 4TTRA 4B3GA 3MD0A 1FOEB 1OPXA 1HURA 1U9IA 1ZM9A 3RWOA 2REBA 1YJNB 2W2XA 4YDHB 2H1LA 3L82B 4NE2A 4YAWA 5C2JB 2C78A 2ZUCA 4DVGA 1R5BA 3W2IA 4L15A 2BC9A 3CMEB 2RAPA 3U3RA 1IXSB 3KJIA 2ZJAA 2NO1A 3UXMA 4BGDA 3THXA 1JALA 3BC1A 4HB0A 4L5BA 3IPXA 4P0TA 4TYQA 4LYJA 3A6PC 5JJIA 1G5RA 1UPTA 3SOPA 2K5UA 4MKIA 2B7BA 2IEYA 3PFIA 5IK2A 1G1MA 1GDDA 5JJKA 2QTVB 2FG5A 4H1UA 3R9WA 2YWFA 1XTJA 3ADCA 1Z07A 4BRWA 4CYMA 1Z6GA 3SBDA 3VQTA 3VNVA 3DOFA 1IQPA 2CLDX 2OHFA 4I4LA 3CUEF 2VEDA 1E9FA 2ANCA 2BJVA 4PSAA 4KYIB 4IFBA 2V8OA 3NHAA 1L2TA 2MMGA 1P72A 4QXAA 2AK2A 1G8GA 4I1OA 4LBZA 1D1NA 1TAGA 3PIRA 4O0MA 3C7KA 3JQRA 1CJMA 1UBEA 3CPHA 5THXA 2AKYA 2CL6X 3QE0A 4UNPA 5HE8A 1KKMA 2W6IA 2EQBA 2VNHA 4LJ9A 2GAOA 1DAEA 1X1SA 2CHQA 2WAXA 3QPUA 5CK5A 3GQBA 4B74A 2CVHA 4CGZA 1AKYA 1EFTA 1NF3A 4EPRA 1RJ9B 1CLUA 1G291 4HE5A 4QBGB 2GWHA 5L3QB 1Q7YD 4AKIA 1N5LA 3LBNA 4KV9A 1Q57A 2HMAA 1E2DA 3RRNA 2BPOA 4DBLC 1F6BA 3CPEA 4HEJA 2JATA 4OHWA 1A8PA 4URWR 4D2IA 5B64A 4TMXA 2GZHA 5HZKA 5JS8A 3K0SA 5HCNA 2Q21A 1Q86D 5FOXA 2BBSA 4M0LA 3W9YA 4G1BA 1AQYA 4IDOA 4N1AA 3RLFA 3ZC3A 4IDHA 3QXXA 3QPWA 3QF4A 2R6CA 1YJ5A 3S1AA 2I1VB 2J0VA 4WOPA 5M04A 2PMDA 1E1RA 1XMJA 5TVKA 1VHTA 1NIJA 4ZIRB 1XB2A 3WXMA 421PA 1EFUA 2VH5R 4P3YA 4OK3A 3GD7A 1QH0A 1UM8A 2YZ2A 2NQ2C 1UEIA 3WBKA 2KE5A 1KJWA 3GLHA 3ZD6A 1TTTA 2CL0X 1W87A 3VNUA 4FN5A 1GKYA 4LJ8A 2WIAA 5DH9A 1Z6AA 1YR6A 5DYIA 1GR1A 1E2FA 1FP6A 1FPMA 1ZCBA 2IYLD 4JLNA 4Q1DA 2MSDB 2YV5A 5FOWA 1E99A 4LBVA 5G53C 1Q1EA 2GZAA 4XD7D 5FI1B 1GP2A 4QM6A 2BMWA 3W2GA 3L43A 4W5WA 3MWJA 521PA 2QBYA 2WSSD 2WV9A 1KZGB 3V00A 4MGYR 1QBKC 2OBNA 2QGZA 4G0NA 2VNJA 2V55B 2AXPA 3CWQA 3R9XA 2ODNA 2C95A 5E7JA 4TZ6A 2WKQA 3NBFA 2CCGA 1D8TA 1KI6A 3X1WA 2DFNA 5DHAA 1VYUA 5AJYA 5L8VA 2ZYTX 1XZQA 2VHJA 4TSFD 3QY0A 1GFIA 4XVRA 4DSTA 2QTLA 2G3YA 3ZVLA 4ESHA 4Q4HA 1M74A 1FTNA 2JLZA 4A8JB 4V0MA 4A8JC 2XB4A 3TQCA 4D0GA 2NTYC 2VL7A 3VHXA 4BWYA 4JLVA 4CVNA 4TLBA 1UJ2A 3B85A 4ABYA 3CRMA 4B2IA 3ASZA 2DFTA 5FUXA 4PC3A 4KLZA 5KU1A 3QG5A 2WAYA 2W00A 4CT5A 3GJ3A 4WW0A 3A37A 4PX9A 3AF2A 1G3IA 1EFHA 1K8RA 2X2EA 4P31A 3TSWA 3O8BA 5UKDA 1P4SA 4KU4A 4F93B 3WP0A 4B2PA 3RANA 4HZUA 1X8LA 1F3OA 4KVGA 3C5HA 5TXGA 1Q3TA 5DI3B 3TQFA 3PEYA 1E9CA 2Y8EA 2DCUA 1YKSA 4ILEA 4BQSA 4E5UA 1FNMA 3QFCA 2VF8A 3TW4A 1D2NA 3CC7B 4N0EA 5BYJA 2UKDA 1UBCA 2XTZA 3U4QB 1NNEA 1P9WA 4PC7A 1N6RA 1E6CA 2CLCX 3B82A 4Q01A 1TUIA 3RRZA 5SZKB 1BYUA 3EASA 4KHZA 2J7PD 4EJSA 4NYMQ 4QOSA 1ZCAA 2ZAOA 3BWDD 3FJOA 3AVUA 4Q7MB 2QNRA 4AF7A 4QBFA 1F20A 4URVR 2F55A 1ZC3A 1PLJA 4PO9A 1KZ7B 4G5GA 2IYQA 3W90A 5KOYA 2V3CC 3OAAA 3A58B 3AF4A 3C4JA 3M4YA 4X8MA 3QOFA 1ZNXA 4DLTA 1W34A 2V54A 3GLGE 1OHHA 1SVIA 2YKGA 2W83A 2HF9A 2X3UA 4BLQA 1AZTA 3CONA 3IGFA 3MG9A 1QHHB 3OHMA 3CCJB 2GESA 2ZE5A 3W2EA 1QG0A 3KX2A 3LQQA 1FFHA 3K9GA 1R0YA 4TN1A 1SQ5A 4YC7A 4TTPA 5CYOA 3GJ5A 1KO8A 5KO2A 3C41J 1KY2A 1K5DA 2IHBA 5E4FA 3CF2A 4QNMA 2IUUA 4DIDA 1RRCA 2VPPA 2PZGA 1GTVA 4LC1A 4TLCA 1I4DD 3QKRA 1JQLB 5JWOA 1OFIA 1K6MA 4EKDA 1DAKA 3OE7D 2JAQA 3BK7A 3GLIA 4Q1EA 4RSGA 3QVVA 3T5DA 4RD1A 4DHEA 2O8EA 3LDAA 4BFWA 2ZR0A 1W0JD 2HJGA 2OLJA 3IIJA 2CCKA 3AF0A 1E2MA 3IILA 1G8FA 2OE2A 1CU1A 1OYYA 1E0KA 1A2BA 1DEKA 1PLKA 4LYFA 1G17A 2QP9X 4A9AA 4W9MC 4FIDA 1OKKA 1U2RA 1IN5A 4V0LA 4MYUA 3U7GA 1IM2A 3PENA 2WWFA 5EQTA 2XXAA 1RRGA 3RYTC 5JI3E 1WF3A 3MWKA 2FEOA 1M8PA 3CCEB 2WZQA 1G3MA 3A1VA 4L16A 1MO5A 1IN7A 4WZ6A 4CF7A 5AR1A 1P2TA 121PA 4D4LA 1WDTA 1TQ6A 4HUQB 4Y0VA 1RRFA 1X86B 1G8YA 2ZTSA 1XZPA 3IIMA 4AURA 3B8HA 1DPFA 4BEBA 3WRXC 5F9FA 1SXJA 1W4BA 4G5QA 1MV5A 1NMZA 2DWQA 2NO9A 3HP1A 5FBQB 2FDCA 2AFIE 4Q7KA 1W5SA 2Q6TA 1YJ9B 1GVHA 4PC6A 3A4NA 2PZEA 2PZFA 5JRZA 5DYGA 3W8RA 2IS6A 1GJRA 2P5SA 2OK7A 1NN0A 4PQYA 5FTLA 5BN5A 4KSBA 5E95A 5HCIA 1NP6A 5JEDA 3ADDA 4C43A 4TYYA 4AG6A 2EFGA 1UMKA 1DDIA 2IUTA 3TE6A 4MDEA 5GV7A 3NHBA 3CC2B 1BH2A 2BCJQ 2EWVA 1G18A 4A15A 2IA5A 4A36A 1OXTA 1VQMB 3U60B 2GVDC 1NKSA 1TX4B 3KQUA 3BB1A 4G3XA 2LKCA 1XMSA 1CEEA 3A1WA 2IWHA 4KO8A 3OEHA 2H8KA 2H16A 2NZJA 2QE7A 2ZRAA 1JR3A 3AP2A 2IYYA 1W2BB 2V9PA 3DHWC 3T34A 4YAFA 2W6ID 3AUXA 3DMNA 4LX0A 2YYZA 3BE4A 4XWOA 4EQ6A 2QP4A 4GPTA 1MABA 4QHSA 4DLRA 4DIEA 2YINC 4HLUA 3UK6A 3KQHA 1EG7A 4UNNA 3WBJA 2VYQA 4M2LA 3CNOA 1IY2A 3HU2A 4RZ3A 2EFDB 2EWWA 4BLTA 1HT2E 1E2LA 4HYYA 2WICA 4EFLA 1G7RA 4BLOA 1XXHA 1MKYA 3EG5A 4CEHB 1PV4A 4I99A 3FHTA 3K9HA 1OH7A 4IDPA 4WA7A 2IS1A 2ZI5A 3TRFA 4PPQA 2ZJOA 4LHYA 1COWA 4AYTA 4C0HA 1LTQA 3B60A 2FPMA 4M1KA 2D2FA 3CCVB 2H17A 2ZYUX 1KI4A 2OZEA 1ZM7A 3BAFA 3H4MA 4I81A 4KFSA 3GLFE 1ZAKA 2GK7A 2Q9BA 4IVPA 1E1RD 1Z0JA 3MSXA 3ND8A 1VPLA 1DBSA 2GXQA 3AVYA 2KWIA 4FWIB 1VQ7B 5AJZA 4A6PA 5EE1A 3Q5DA 3B13B 1E2EA 4OK5A 1XCPA 1YU9A 3AEZA 1Z0AA 2WWGA 2OV2A 1G7TA 1E0JA 3IPYA 4CDGA 221PA 2ZE6A 4FCTA 4JMPA 1HUQA 2CHVA 3TVTA 1HE1C 1US8B 5SZHB 2OFWA 2XZOA 1KI9A 1DE0A 3QQ5A 1MO4A 3DO6A 4WZBE 2G9NA 3ZVRA 5FOVA 1R8SA 2G0NA 1BO6A 2C5LA 3B2EA 1YZTA 1TLLA 3G71B 4NL4H 1I2MA 1VQ6B 3ZBUA 1CR1A 2IXEA 2IYZA 4NYIR 4WAUA 5KTYA 2F7SA 1QRAA 1XD2A 1E2KA 3VHLB 1J8MF 3RS0A 2X1VA 2D7CA 3VR1A 3F8TA 3VR4A 4BRUA 4DXAA 1A5TA 2IF0A 1FUKA 1M6NA 4Q9IA 3TNFA 4URYR 1C4OA 3CX8A 1N0WA 2L0XA 2F6RA 4P4SB 1E0AA 2LCFA 2O8CB 4P33A 1D2MA 1G3UA 3QKSA 3WMGA 5SZJA 3U3OA 1R2QA 2N42A 4HAYA 2IYSA 1KAGA 1NN1A 2OEPA 2WJVA 3E5HA 2GKSA 1B0UA 3TW8B 2PCLA 2O0KA 2OUKA 3NC0C 1GITA 1L7VC 3BOSA 2BGJA 1K73D 2P3SA 3UKDA 3VO2A 1OV4A 1X6VA 2QY9A 3ZH9B 4JL5A 4C4PA 2REXB 4CW7A 3FMPB 1P3JA 2IK8A 2E1RA 1EX6A 3TBKA 2BEJA 3B78A 1KMHA 3QVUA 2BKUA 4Y7CA 1YZUA 3CRQA 3Q85A 3PQCA 2G1JA 1KK1A 1O87A 4B4DA 2C99A 3QFRA 3A36A 3GLHE 3SHFA 1NY5A 3B1XA 4DLSA 2JLRA 1GNQA 1IXRC 1T91A 1NSFA 2ZRGA 4LYAA 4MRRA 2F1JA 1R0XA 4PHFA 2JIZD 1YRBA 4YALA 1W1WA 3CCLB 2WWWA 3OIUA 3OESA 3Q5EA 2P67A 3QF7A 3SJAA 3QFSA 5TDHA 2QRZA 1P9NA 5H70A 1K8AD 1KSFX 2FFHA 3EC2A 3EPKA 1VQPB 4JLPA 2XZLA 2X8AA 1GKIA 2QA4B 3N70A 4UQOA 3CWZA 4ZCMA 3W5IA 4CEIA 4TL8A 5CDFE 1W36D 4R2HA 2A3RA 4L9SA 3IEUA 1SKQA 3EZ7A 4QNRA 1VIYA 4TLAA 4X8OA 1SKYE 3SFVA 2WSSA 3GMTA 1IY1A 3A1UA 3M1IA 1E9AA 3I92A 3UG6A 2FNAA 1FUUA 4OI1A 4DDUA 5AK0A 4A1FA 4YQFA 1CJKC 4ZI2A 3TMKA 3RS2A 2JJ2A 2G88A 4LHZA 1TEVA 5EE0A 4LJ5A 1IONA 4OQFA 3E1YE 2PEZA 4A2PA 5C18A 2QPTA 2IL1A 2XAUA 3VTKA 3EAQA 3H2YA 3FFBA 2C98A 3OAAD 1NLFA 1V43A 2O8BA 4TSFA 3U3MA 6Q21A 5JSZB 1VKJA 2ERXA 4OJQA 2EYUA 1VHLA 5KPJA 1Z2AA 4IVRA 4LPKA 1LVGA 1Z0FA 2ZR9A 3SR0A 3U5ZB 1FTSA 3LVQE 1FNBA 2GBLA 4Y9RA 1G7CA 3BJIC 4BPBA 5FTNA 3QPVA 1KGDA 2ONKA 4HLDA 1GAWA 2ZJ2A 2ATVA 3OFNA 1BS1A 1VG8A 4ARZA 5CLLA 1BQEA 4HAWA 4NONA 5LB2A 2CJWA 3BH7A 4HAZA 1E98A 1W0KA 2VP6A 1R5NA 3MUFA 1OXUA 2XNSA 4WQMA 3M6AA 3HU1A 3BD9A 4C0KA 3GJ6A 2WJHA 3SJBA 2HT6A 3GLGB 4D25A 1AKEA 1ZUIA 2XSZA 1XRJA 4GOJA 2GEDA 4M9QA 4PAQA 2QAGB
chains in the Genus database with same CATH superfamily
4ALNA 2JG3A 1Y89A 4U2CA 2ZQZA 1HE4A 3TD2A 1VG0B 2GBCA 2NOAA 2PTGA 4UVDA 2RIPA 3HDHA 1KP2A 4JC4A 4JU9A 2P1DA 2XADA 1Z3CA 4L9AA 4J90A 4S2UA 1JQDA 2PKWA 3SHQA 4EUKA 2EKQA 2IOQA 2UXDB 1JA0A 1ODFA 1W75A 3U3ZA 4UAVA 2GYUA 4TSRA 4TYPA 1B8NA 2W2LA 5FCDA 2QRNA 1RRMA 3B6JA 5B3JA 3ZS8A 3LTNC 1T1GA 4DSZA 3TGPA 1GZ5A 1YHQB 1YOVA 2M6KA 1QTQA 5DHTA 1E3SA 1MVNA 1E2QA 2HQBA 2P1RA 5JJCA 2HEIA 4LDRA 2LP4Y 3DF9A 2G6TA 1L8LA 1L7PA 3GRPA 1SBIA 3NXSA 2YC4C 4EJMA 3EGWA 1WXFA 5IUNC 4JP5A 1BE6A 1YZVA 3FBWA 4IOMA 3FCXA 1RQGA 4MTLA 5HJ5A 2D0PB 5EMNA 1VRVA 1QDLB 1VPVA 2BP7A 2IZOA 2J30A 3ET5A 3FA2A 4HQFA 4PPNA 3II6X 2EKLA 3MWFA 4B2LA 2W37A 4Q7QA 1GNSA 1IK6A 4V02A 4C29A 2IRWA 3MLEA 3VH4A 5L6MB 1TU3A 3OPQA 5BQOA 2LTAA 5F98A 5K45A 4GVPA 3E9YA 4LK3A 3ROTA 1IUPA 1PL7A 2VP5A 3GPBA 1EUCB 4OHMA 4ZCIA 3Q3AA 1GYRA 4H0CA 4F4FA 3HYLA 1QIEA 5EJ7A 3N0WA 4RTJA 1ZR4A 3GCDA 1SC1A 2YDYA 4KYUA 5FEMA 5GJCA 3NHYA 5CFPA 1J99A 4CHGA 4A73A 3WP1B 2VHEA 1FP2A 3UOGA 3BCFA 1X3SA 2Z3VA 2IY9A 4R9UC 4MARA 3W5VA 3AB3A 4CKWA 2O7VA 1XT6A 1ECPA 3CT4A 1TM7E 1O9HA 1QIFA 1PF7E 2GB4A 1MW8X 4O6VA 1NW9B 1RNLA 3LMKA 1ICIA 4AJPA 1IWBB 1LI7A 1WQ1R 2UYCA 1ZXXA 2X1MA 1UKVY 2AFIB 1OMOA 3IQXA 2A9JA 1ORVA 2WTBA 2YNMC 3AV0B 3QGMA 3UC9A 1M72A 2X6QA 2XZDA 4JZKA 1C7JA 1OY1A 1YGYA 4K8RB 4WCFB 1F2UB 1QHYA 4AN1A 3AM4A 4WBNF 4HH1A 1JR3D 1S8FA 5EFZA 1PL0A 4KN9S 1XO1A 1P9OA 2OSBA 2PKQP 3PPIA 4GQAA 4MV4A 1D6JA 1E6WA 4O4HA 1F7UA 1R0BA 4LJKA 1IY8A 5CVUA 2J46A 3SSOA 4D46A 2DM6A 3DEAA 7MHTA 1V96A 2IEAA 4U3JB 4P6YA 1DHTA 2BGLA 4LJ7A 4QJBA 3DOJA 2YC2C 5AKXA 2QF7A 4R1UA 2BZ1A 2ACEA 4ZU6X 4XB6B 1YF3A 3PKIA 4HB2A 2GFHA 3FOEC 3EF0A 4ER3A 5ALYA 4ZOAA 2RGBA 1J8FA 1V0FA 1D7AA 3Q9NA 4FMBB 2APJA 1LPPA 1DG1G 2C2BA 2IYWA 3OZSA 4MRNA 4BKQA 3PUHA 3WGUA 2J33A 2XODA 3RRYA 2IUEA 4F92B 1WEHA 1Y5RA 4Q24A 3RD5A 2YFKA 3NTXA 3CA8A 3GC6A 3AKDA 3W7VA 2G82A 1RT9A 2YRWA 3VZBA 3EVAA 1XYGA 1QFXA 3D6NB 2Y9PB 2D06A 1NUPA 5H4HA 3JQ6A 1WTCA 2FPKA 1Z62A 3F7TA 4AXBA 3TR5A 1MX5A 3EOBI 3UY4A 2OFOA 5KC8A 1TVKA 2NYVA 3GFTA 4RF5A 3ZDAA 2R97A 2CXSA 4IEFB 5KYYA 1EBBA 3W5JA 4GG1A 4HAXA 4YP7A 2CK3D 4UVIA 4WVLA 4MRSA 1Z5GA 4JITA 5HBRA 1EHIA 2N1BA 3PFGA 5E0KB 4NJMB 4RPHA 4IG4A 1UXJA 4BN0A 4P84A 2HA5A 2C04A 1B0PA 5J5CA 5E7MA 3AL2A 2RJ3A 1CVLA 2P77A 5GPBA 1WDKA 3A9VA 4UXJA 5CB4B 1FL9A 1W35A 4DQLA 1PZMA 2RGXA 3BHNA 4UQPA 2ZANA 3NIWA 5DBFA 2CNDA 1DC8A 4NECA 3WO1A 4A2QA 1NW7A 5JC8A 5JXIA 1FJGB 4XJTA 2Q6IA 3ZE0B 4TXHA 5CDSA 2YY7A 4QUAA 1FS6A 4RVSA 1QG6A 4FYYA 1J0BA 1XJ5A 4MDHA 1OAOC 3MTEA 1JG2A 4KE9A 1TUEA 1C7RA 1NMYA 4LI3X 1FYVA 4NBKA 2SCUA 3EDOA 4NHOA 4GXQA 1RWBA 2WJJA 4RF4A 4IUBS 3V76A 1QHEA 4K3UA 3I9MA 5ECGC 1V3TA 5CYGA 3OF5A 2EDAA 3GLVA 1EE9A 1W94A 3GGPA 4WZBB 3TJMA 4IBOA 2A30A 5COQA 2P9BA 1CWUA 1E7QA 4NCJA 1M8JA 3GRVA 3V8BA 4F6RA 3TZQA 4JKYA 3R9KA 1R3DA 1GTZA 2X0EA 5I4CA 1V1JA 1SD2A 2GUGA 2REOA 4F9GA 4RS4A 2COUA 3NM5A 3PVSA 2VDKB 2DOGA 4GYYA 3ONVA 3FPHA 4NS1A 4DJFC 2GD1O 4I1UA 5C3UA 1FFCA 3UUGA 2BMDA 3PD7A 3QJYA 1VLQA 1YXMA 3K4PA 3UPUA 2HSJA 2XDAA 4GT1A 4A27A 2ZZMA 4KFUA 1XF9A 3TSCA 1XQWA 2KJQA 1A27A 1L7NA 1M2HA 2O5VA 3OCZA 3QWFA 4U02A 2O6HA 2QMUA 5GQSA 2Y66A 2PWZA 5IN5A 5PNTA 3UW1A 4KE7A 1TQ8A 3N2LA 2F8LA 2AR7A 1KQSB 3AHJA 1Z2PX 3AY6A 1R8JA 2IDMA 5JS6A 1QP0A 3HMQA 4ZO6A 4QYIA 4I55F 4GNRA 1Y8QB 5HIIA 3IXQA 1QHNA 2FLWA 1EK5A 2O0LA 4ZV4A 2H4JA 1M1ZA 4RH3A 4D0RA 2BBTA 2ZRIA 1GGVA 1X42A 3DG9A 4M53A 2WYVA 1KZHA 2AJBA 2UZ4A 2NTJA 1CUEA 3IP3A 1IJEA 4O2BB 4GSLA 4Y2UA 1LW6E 2M32A 3LI2A 2OUIA 4YO7A 4X1YA 1FBNA 1G8MA 2NYAA 2FPOA 3IQFA 2PH1A 5JAUA 1SRQA 5AOAA 3C16C 3I01M 3JRWA 4IIBA 3TLJA 1CY2A 1G19A 3QZUA 5EJ8A 1VXRA 3GW8A 5JAIA 3LNNA 5DRYA 1DEAA 4JGIA 3V8EA 3TCKA 4ETWA 1OV6A 1ST2A 4HWPA 4ZVPA 1E59A 1MQAA 2DKOA 4EPXA 3VSAA 5CG2A 4YB8A 1VJRA 3DAGA 4CF3A 4BVJA 1MHTA 4DXDA 1V3VA 1SBTA 3TSYA 4B3JA 3QVWA 2YV1A 3OEED 2O7SA 1W30A 2EEPA 1NSTA 2PV7A 3I8XA 4TWBA 2CJYA 1AQNA 4DDWA 2DY1A 4PZEA 3IQZA 5CNMA 3NRCA 1UDXA 4B3BA 1G60A 3H0KA 1L4YA 2WUEA 3F6YA 4OQXA 3E05A 3A6DA 5AJVB 3W5AA 5TVGA 2BFEB 3R0XA 4YUVA 3Q7PA 1NNSA 4WUTA 3NXKA 1EINA 4DA0A 5A0VA 3WGJA 1W0KD 1X7DA 2XEXA 1F4VA 2IHYA 2K2WA 1ILEA 3C6ZA 5K8UA 2B1QA 1DU4A 3K5PA 1GNRA 2ZI6A 3CM0A 1GTL1 3OJEA 2FZLA 4QQKA 2VT2A 3OMWA 5AM1A 3IBTA 1J33A 1Q11A 2RHRA 2WWXA 1I4TD 2VA8A 3LCUA 3C6XA 4JX8A 4N0PA 5HKAA 1BZYA 3OMXA 2AFHE 4OP7A 2GBGA 1U94A 1WUJS 3G8CA 4QA9A 2SHKA 3EXEB 2IQIA 1XDSA 4GLFA 2BGIA 1LTHR 2WMOB 4FLEA 5CPBA 1QAQA 1FSFA 2P78A 3IELA 4H7JA 4QELA 3QNUA 4AULA 4TZ0A 2O2SA 3NP7A 3UOAB 2NVWA 2X0NA 3EZ9A 4MAFA 2FW6A 1J0CA 2PS3A 1V5VA 4R4JA 5IYZB 4GD3Q 2UZIR 4N3AA 4D8VA 3Q12A 2X77A 1XCGB 4UVGA 2F4VB 3U4QA 1P5HA 5DM0A 1WBBA 4GF5A 1Y8AA 2FFJA 3ROEA 4ZYVA 2HJVA 3G68A 2YJTD 3C15C 4GKBA 2FFAA 2P9CA 3HS3A 4FXOA 1P1FA 4IIFA 1AB5A 2R1VA 1LD3A 2FZ4A 5ESXA 3Q2OA 4JB0A 1JBQA 1KDOA 1VIAA 3VR3A 1JSXA 3AUJB 4N82A 4OYHA 2W7TA 3CNQS 1RW4A 3RB8A 4DJDC 2XR1A 3VFDA 3BRSA 1E94E 3CLHA 2WOJA 3EXAA 4L75A 1TC1A 3K9WA 4G9GA 1YLOA 1NZJA 1E8MA 1H6BA 2C61A 3P2IA 4G0PA 2HNKA 1EHYA 1FDIA 1LF0A 1Q0HA 4M0DA 4NU5A 4TM7A 4RO0A 1WSAA 1HQCA 1PZGA 2QLBA 5HKKD 5ICCA 1IXYA 1IUOA 2ZOSA 3REFA 1P2VA 1P61B 5A3RA 1CRPA 3DVRX 4DMKA 1QORA 4PCUA 3R6DA 5GZ1A 3MGCA 1UPFA 3MILA 2KVOA 2EL9A 4KRXA 4R98A 5L95A 3IP8A 1RQLA 3H97A 3A6LA 3F1LA 4BMVA 1E3WA 4EY3A 2V98A 4P4GA 4ALLA 3KOMA 2NTEA 4YWHA 1AM4D 4Q9KA 3M9XA 4EELA 3HJCA 4R5HA 1N4AA 2ZREA 4E2YA 3JQ8B 4IHJB 4HO1X 1RRKA 3P97A 4OQNA 2GZ3A 2ZSUA 3BWEA 3Q7SA 5EIBC 1Q0UA 3LLCA 2C92A 1FTQA 3LYHA 4JC5A 4HH3C 2F90A 4G7XA 3GRZA 4U2FA 2GERA 4XM2A 1XZNA 5L4LA 1E1QD 2Z95A 4WN9A 4EBBA 2W4QA 4FFBA 5LBIA 2IF2A 4D4GA 3NBUA 2IYFA 2Q6LA 2CXPA 2EKPA 2ZJ4A 3CGGA 1LZKA 2VH1A 1Z68A 2CHUA 1B8VA 5FKJA 3W6UA 5AYVA 5KHOC 1UEJA 4RUKA 4LVNA 4RTOA 4IXMA 2PXHA 3DUFA 3LKVA 2ODQA 3FMVA 4J0GA 4KW7A 3D31A 1NHGA 1OC4A 4L4SA 5BNWA 4ZRMA 4FR5A 3U48A 1DKLA 1FU7A 4JXKA 1MO2A 4D79A 5IKXA 4DUGD 2K7FA 2RH4A 1PQPA 3K2IA 2Z4TA 1ZMRA 3VR4H 1ZINA 3ZDDA 5TNXA 3AR5A 2GCEA 1H2AS 3HL4A 3DH0A 5IDVA 4H4EA 4EWLA 4DLWA 3QKUA 2HQRA 3JARB 1XCMA 4G5FA 4MW9A 1A8UA 5K4AA 1P18A 2TMGA 2XBMA 1I6MA 2LIPA 3FHOA 3FCCA 4M55A 4P36A 2ILTA 3OP4A 5U4QA 1N9KA 4ND7A 1E1DA 1PJTA 2PLRA 3CN9A 4IEEA 1YVUA 2AQHA 5IF9A 1Q1AA 1JPNA 1UZMA 2QKYA 2ILVA 2PBZA 2R5WA 3C8UA 1CUIA 3DAYA 4KO2S 3DE4X 3KT3A 2ZDHA 4M7WA 1LJUA 4JYAB 5FLEX 3UGTA 3KQLA 3VKHA 2AQIA 4GI5A 5F12A 2PV0A 3QBDA 4GI3A 4UM7A 5KQPA 3QH4A 3JTEA 3LPAA 3CGWA 2WVJA 1QHIA 2B69A 2OO7A 2C4TA 2JEOA 1E3QA 2QK4A 2ASEA 1P7VA 5FR2A 3D6FA 1DDOA 4J0JA 1A1VA 4Y2JA 3ZJTA 2D0DA 3CH4B 3ER9A 3JZFA 3KRTA 2XMZA 4EQZA 5CMLA 1UQRA 3EK2A 1FE8A 1TJNA 2XZTA 4F8YA 2Z6AA 3KJFA 3WFIA 1PJZA 1QR2A 1ZW6A 2PT5A 3MJTA 4DT1B 1Z6XA 3A9SA 4FUQA 3RIGA 1E1LA 2ODPA 4X05A 1ILWA 1JQ3A 2HSDA 4PC2A 1PEDA 2PR2A 5BN5B 4YV7A 2GCPA 1RJFA 1NW8A 3OEYA 3OTIA 3V4FA 1G5QA 3Q6RA 2P5TB 2Q46A 1VMIA 2W11A 3E22A 3V4OA 1GAXA 1ZO8A 1Z8HA 2AG6A 3BF8A 4QE3A 2ZJ8A 4TS3A 1U3FA 1ZBDA 1HDRA 2UUPA 2Q6OA 1R6XA 1XU4A 3EUFA 1LDMA 1QIDA 3T7KA 3RNLA 4MR7A 4RK4A 2ZRHA 3E8XA 3RI3A 4EGSA 1ISPA 1FVXA 1N1EA 2BKVA 1MO6A 2IV7A 2BMFA 2EKBA 1YR8A 4E6PA 3ISVA 5H16A 4AD8A 4ZVUA 4WFJA 5AXDA 1JKJB 3BE8A 2DVMA 1PWHA 2A1IA 2Z8XA 3EGEA 1NURA 3IV7A 1SQGA 3PE3A 3QIAA 5EXSA 5FTKA 2RIRA 5U4XA 3V4PB 1O95C 4B3HA 4CHTA 1EMDA 1YR9A 2F9MA 2FN9A 4X7EA 4BQNA 4L0DA 2AR0A 1LDNA 2F62A 4J1TC 2ZQYA 3CZQA 2E4VA 3MBOA 5A0FA 3TNYA 3ZOKA 3ESRA 4B71A 1U0JA 1O03A 3B7PA 1I36A 3EXG2 4LRQA 4RIHA 2SKCA 1BE1A 4M9SA 2MYPA 2FWMX 4KQWA 3UH0A 4CL0A 3DDOA 4QDUA 3T61A 3AJRA 3LO5A 5IJ0B 4KNYA 2ZR8A 4UBIA 5EJIA 2Z6UA 1LLFA 1VPEA 4LI0A 3HKBB 5CA0B 5EQJB 1Z6TA 1U6IA 3CKKA 4K9PA 3V32A 3COJA 3LT2A 1KQNA 1PO7A 4P12A 1D7OA 3WLOA 2WZBA 3QLUC 1FSPA 3ROPA 3CSSA 3GGGA 1AKMA 3KG2A 3CN7A 3UCFA 3LIIA 2A6PA 3WZMA 3M5DA 3PGJA 1CERA 2ZTVA 2CDBA 5K3CA 4HAOA 1MJGM 2PJZA 2VYVD 5FA6A 1JFRA 1KI8A 3OFJA 5DLYA 3AKYA 1E9VA 4WDQA 2MSKA 1CFZA 1XTIA 4DLPA 5JPDA 1QS0A 5F7ZA 4XTRA 2Y68A 6AT1A 4DRXB 4ON9A 4QTTB 4GP9A 1UZUA 3DOHA 2P90A 4G5OA 5JFGA 2F3UA 5L51A 2A4MA 4YT8A 1WUKS 3RCBA 1WBDA 2LCIA 5AVZA 1EGAA 1TNDA 3PDIA 4NEHB 4E22A 2P5UA 2CF6A 3OD5A 3JQDA 2YJ4A 3NKLA 4ZP1A 3IVMA 3M6FA 4N40A 4YLGA 3WGLA 1Z36A 1RWMA 5C7OO 1G38A 2WWHA 2NO7A 3L5OA 1SXGA 4OQYA 1MAHA 3D5TA 1ZU4A 2QVCA 3BFVA 2JFNA 3H13A 4O4LB 3RS5A 5C81A 1FP1D 4K9MA 2XTNA 2QV0A 2I99A 2KB0A 3RFFA 3X43A 1U81A 2WD7A 1YFJA 1S3FA 2JBWA 3IQHX 4D9FA 2R87A 3HBMA 4YRSA 1Q3HA 1Z4JA 1UXGA 4UVEA 4BO6A 3IO5A 3ILHA 3E81A 5CFMA 1N0UA 2I34A 1PQUA 4ACBA 2OO3A 1SCJA 4GI2A 5P21A 2PT7A 2C00A 2VSFA 4OVKA 2F8TA 1ZMBA 2OORA 3LP6A 1Z6ZA 1YJQA 1NVAA 4FWTA 3K0CC 3OX4A 3C3AA 4Q1FA 1N2CE 2RAFA 2PVPA 2BHRA 1CRQA 1WZUA 4AROA 1UT6A 1KSHA 2J32A 4LQCA 5FPHA 1P1HA 1PJBA 1JDUA 2HMUA 3DO8A 3OPVA 4YRQA 1RD4A 1SULA 2CW5A 4OHBA 4JBWA 4FSDA 4XGNA 4H59A 4EK9A 3KQKA 1ONNA 3T12A 1OCEA 3HPQA 2EL7A 4MO2A 3AC0A 1MN6A 3DDZX 1D8AA 3MW8A 4QGAA 4TXJA 4WEOA 1Y6ZA 4IH9A 3A05A 2QVZX 5FTJA 2ON6A 3LFTA 4XJXA 4EDHA 4JJ6A 3I3OA 4DA8A 4UNQA 1UBKS 1SBQA 1YVEI 5G4KB 2YDXA 4ZAWA 1CYEA 3GHYA 4EVRA 2FVYA 4JD5A 4HLCA 4FDMA 1ZSYA 2XQKA 2II6A 3IJEB 3N7TA 4PSVA 4PXYA 4WESA 3FVVA 4WV3A 5B58C 2DQKA 2NYRA 5BURA 1XPRA 3D7NA 3LO8A 3FZQA 2GLXA 4NDNE 1U8TA 1F60A 3EQ8A 3OZXA 4MJ3A 4DLXA 3QVJA 3IEVA 3E0QA 1VPDA 4E14A 4HUJA 4NU8X 2FPIA 3L6CA 1REQB 1ZWLA 4YCAA 2TECE 3B3QA 4RGQA 1PJLA 4F2PA 4KR3A 3EA4A 3V5NA 1GZVA 3PGA1 4IIJA 2YZMA 5K6RA 5EXXA 1AHNA 2WIGA 2JAPA 2ZZNA 1R4MA 5DT2A 3QI2A 5GJBA 1TEXA 3OUUA 3V7WA 4ZDKA 1BNCA 3LPDA 1WR8A 4AN4A 4X8HA 2XJ4A 1GM5A 4BP1A 3IKJA 1TCBA 2R1TB 1WXHA 1E5QA 2CFTA 4OKIA 3ZV5A 5KAPA 5AQ1A 5TMDA 3ZWVA 3OM9A 4YI3A 1Z8FA 3I76A 2GZ1A 4DMRA 2PS9A 5JSZA 3TFOA 3MGKA 4S1VA 4C2UA 3DTTA 2JH9A 2O3RA 4Z7JA 4C2BA 4JMLA 1KPHA 3DV0B 1TRHA 4B09A 4KPEC 5DOZA 1EK1A 1NBMD 1C9JA 3FCAA 2J5XA 1OFHA 3L7AA 1DQZA 1GZDA 2WYUA 4B35A 3ZGZA 3L46A 3VH1A 4GX2A 2CRVA 3C48A 5CB0A 1NLZA 1Y4AE 3CXUA 3IPAA 2JCVA 4BN4A 4ZCSA 3AGQA 3CVYA 5B1SA 4PNZA 5B5SA 1JJFA 3ER6A 2ZTMA 1HETA 4FGJA 3NM6B 2FWPA 1HRKA 4N6NA 1UK8A 5DSTA 4ZQFA 3LL7A 2YMQA 3DTVD 4Z4SA 1BSVA 5MDHA 2ZRDA 5DN6D 1OASA 1HZEA 3HJBA 1GKLA 3LC7O 4EJ6A 4LZWA 4GPIB 4HDCA 2NPIA 3SZMA 3INRA 1E2PA 3KCNA 1BHO1 3WB2A 3MAGA 2RHBA 1C9DB 3IO3A 2ZB4A 2WDZA 2J9GA 5AOVA 3S2FA 2JVKA 3FIJA 4MIOA 5BYKA 1N5IA 3DHYA 3AJ9A 1NTRA 5DULA 2PZAA 3EVEA 1X1CA 2Q3EA 4K6KA 4R8SA 3C7TA 2H31A 1Y9ZA 4R16A 4RVHA 3TX6A 4WZLA 4ZJZA 2WU3A 2CGEA 4OYRA 4YMWA 2W48A 3DOCA 1AUVA 4PQEA 2Q8PA 3VBEA 5JYDA 3ZG6A 3NI2A 4BB9A 4PHGA 2JLQA 1AKNA 3SJCA 4ERNA 1GPH1 3FMGA 4Q9DA 3K9QO 4IF6A 1AXRA 1X1EA 3FW1A 4HX5A 3ZEIA 2EHJA 5B3JC 1DPGA 1FFSA 1U8XX 1EVIA 2FWRA 3EDQA 3K53A 4G2NA 4L5CA 4L4YA 3H94A 5ALMA 3Q8KA 1Q2UA 3FPPA 3KQVA 4FNGA 1M83A 2CHEA 5G41A 5K03A 4EHNA 4PW0A 4U6QA 1ZD1A 2C42A 2O48X 2IS4A 2H2WA 3RIXA 3VPBA 4CQNA 2PLWA 2P35A 1EUCA 2WAMA 4TXNA 2H2AA 5AOBA 1U65A 2I1QA 1FVFA 2PAAA 3G0IA 4LJRA 4G4IA 2Q9AA 2B30A 1TYEB 3L1JA 4HI0E 1P4GA 3AR4A 3D4NA 4JOCA 3B3GA 4O0LA 4EEKA 1DEHA 3AERB 5CBKA 2V5UA 4IIJF 1PWEA 5HGXA 3N3BC 4NOMA 4Q3KA 4FX2A 4QQ8A 1Y3BE 4FU0A 3C3CA 3MTJA 2FK7A 4QDZA 4RE5A 3KB2A 4X24A 1BTOA 2JFXA 3FNEA 4AO6A 5IT9A 2RH8A 3C3JA 3U7RA 2AFIA 1EK2A 1YR7A 3BMQB 5T8KA 1PT7A 1PUJA 4TL7A 4EF6A 1SZPA 1UBGA 4OOSA 1G5HA 2P9EA 3EOZA 1ZL0A 4RZQA 1GARA 2LPMA 4AC9A 4EEXA 5ELMA 4WCFA 4BNGA 2X3YA 5JCPA 2B8JA 1P0PA 1F2UA 2D8AA 2FSGA 5TQ0B 4X7CA 3CZPA 4EB6B 3L1HA 4LRUA 3INYA 2WKSA 4J43A 3UMSA 4I08A 4CM3A 4QOGA 4IS3A 4XI9A 4PN3A 3LY7A 3PC8C 3ZWPA 5KEIA 3DVLA 4QU0A 3RS8A 5LU8A 1O89A 1G6Q1 2VWQA 4U3JA 1Z7EA 5TQVA 3SIRA 1CIPA 2R3SA 1SVLA 2XKKA 3PFFA 4BPRA 3IHLA 1FMJA 4RACA 1T2CA 1W4RA 2XPCA 3IE0A 4MEJA 4PPYA 4RZSA 4XZ3A 1Y1RA 2JH3A 3V7AA 1ZN2A 1OTXA 4X63A 1GWNA 3CLVA 2W43A 3IAS6 4FYWA 4JELA 4AUNA 3R75A 1PVDA 1XFDA 1IOLA 2EZ4A 1MPTA 1PK7A 2PMKA 3NQ41 2H4HA 4IG9A 4R2IA 4Y2HA 5AW3A 3A0UA 5BNZA 1V11B 4FGKA 1VL8A 1ZH6A 1KSJA 2WMDA 3LGSA 4ZA2A 5LPNA 4KO4S 1UF9A 3F1KA 1CT9A 1KVUA 2XQGA 4GR4A 3TIFA 3HFSA 3VMFA 3HNRA 1N92A 1OUMA 1QVZA 1UH5A 1HFJA 2VRCD 4AJOA 5IJZA 1RI3A 1A76A 2OMKA 1D6MA 1QDUA 3BA1A 2PX0A 3WJ7A 4W1PA 3TCNA 2VJIA 1Z7BA 3AFMA 4GOKA 3SBOA 2CDRA 3QFTA 2CDAA 1XI2A 2FZGA 3RUEA 5F5LA 4Y1FA 4KI7A 1XTUA 2VRWA 1BJTA 2ZVJA 2QNBA 1J24A 3AILA 3KE8A 1OA1A 3O4VA 4NJMA 4RHYA 4B4WA 3AO0B 1G98A 3MLAA 3G1TA 4Y9TA 1P17A 3THRA 4EG5A 4C30A 4FGLA 3IV9A 1EEHA 4GNKA 1EEXB 2AQKA 3IP5A 2H2DA 4BC1A 5CB4A 1T0BA 3ND9A 1CUWA 2WBLC 4QJ5A 5K0LA 4F5ZA 4J4HA 3U40A 2VQFB 3GVJA 3HJNA 3KSDO 3WQQA 1T6YA 4DK1A 1K2VN 2ORIA 4CIDA 5JTTA 2IVZA 4W7IA 4BQOA 1JSRA 1XDWA 1DVRA 2CY0A 2YWHA 4BO4A 2RG1A 2W4MA 3UPDA 1LEHA 1Z0SA 1BN7A 1NC3A 1VM6A 1V35A 1CSEE 2AZTA 3IAS1 3VPXA 4DSAA 3J7AC 1TU4A 2H00A 5CM2Z 3UMGA 1HOTA 2G7MC 4ZV9A 2D1FA 3E70C 4Q6BA 3IODA 5IAEA 1WXEA 3O93A 2B3DA 3C5CA 1SCDA 1B1CA 1P7ZA 2VT6A 3O8NA 2WJ3A 4NQZA 4PLGA 3IL2A 1NW3A 4JGBA 1THMA 2VAMA 2CE2X 4AJ2A 5EP4A 3IUBA 3EPJA 4WZBA 2WE8A 3KLNA 4EVQA 5T5QA 4AJEA 1UOEA 4R8RA 3O0TA 2H52A 3T1TA 5FI5A 1T3HA 3HEMA 3WNCA 1A8SA 3OMLA 4HN4B 4O8ZA 1Q1GA 1TB4A 4FBLA 2X85A 4FMCB 4EMBA 3HJHA 2UUAB 1XC7A 4YRMA 1KFBB 2HJHA 1NI4B 4HTFB 4IDEA 2HSWA 3EHDA 4X64B 2EG9A 1RIFA 1SVOA 5ALHA 3N2NA 1M8FA 3ZTWA 2VJKA 5EWLB 1WZEA 1N4DA 5HUHA 3CUTA 3TD9A 2QW1A 3HYRA 5JANA 4IV0A 3PQ2A 3AR2A 5F3WB 3I5AA 2NACA 1Z7WA 2W90A 2YS6A 3FF1A 3W77A 3CO0S 2FDRA 3QF4B 1FYWA 2OV4A 4XIJA 1KO4A 3P19A 4HSEA 2HU8A 1P5RA 1KJNA 4B6EA 5EMMA 1JVNA 2VTEA 3O47A 1JFTA 5EZ5A 5AJHA 1M0SA 2F17A 1GGJA 1OGIA 1SK8A 3H18A 1IQRA 3MCWA 1KO5A 5EGNA 5AKHA 5J9FA 5I9NA 1IHXA 5J35A 5HF9A 1U8FO 4ZK6A 2I5PO 1JTEA 2ODEA 2B6HA 1VBKA 1Y8QA 2H3EA 4LOJA 3V1LA 5I9LA 3PR1A 1ZY2A 2C84A 3AI7A 4AM8A 4C4OA 2PRIA 3OU7A 1OREA 1ZCFA 1AX9A 4LWQA 3WE7A 5GV8A 1A5BB 1CQWA 1H2BA 1DAOA 4IIVA 1AGPA 3ENNA 4RK5A 4WY2A 2Z6QA 4O2BA 1XRPA 3EIEA 3ORHA 1BMFA 3IFSA 3FUTA 3U56A 3CMAB 1GQRA 4UHEA 4EFDA 3ORQA 3WWOA 4UUMA 3DO5A 3A4VA 3SN6A 3E7WA 3N0RA 4FEEA 5T67A 2IYRA 1G9XA 1UPAA 3U1BA 2Q5FA 2D7DA 3NETA 5JAQA 2DUMA 1WOPA 3IHTA 2QI9F 2BGGA 1EK0A 3NG1A 1BX1A 5B1YA 5IG2A 1NT2A 5F51A 5KNDA 1XPOA 3ZE9A 1KI6B 3DZJA 5DX1A 5G02A 4DDHA 1G21E 4OAQA 3SY8A 3RSSA 2AZDA 3EYAA 5E6TA 3LWDA 1MOPA 4B3SB 2QTMA 3P45A 3MNFA 4KJZA 4KXMA 4CTKA 4BNJA 1TM5E 3GMSA 1VLZA 2WPDA 5CB4F 1MTZA 2RHDA 4OF4A 2CC2A 1QZZA 5EERA 2E5FA 4FMDF 4FIZA 3WY9A 4R84A 3PRYA 4WK6A 5LP6C 3CZ5A 3WYNA 4MW1A 1JWAB 2ZWPA 1ADJA 1G16A 1NBIA 4IFIA 5EESA 4BMZA 4Y7DA 3H5NA 3HKEB 3WNVA 2G80A 1SOMA 2AN1A 2CLKB 3FMFA 3LW7A 5H80A 2XB9A 2NIPA 1MRNA 2CMDA 3INGA 1R6DA 2XQIA 2HPAA 1JZQA 3G7SA 2LRHA 2JLBA 2RHOA 1SRRA 3EXEA 1UJNA 4KKXB 3NV9A 2IBMA 5HJEA 1CF2O 2FSUA 1Y9JA 3EGXB 3ZV7A 2YTZA 4ZGWA 1N07A 1DJQA 3ESQA 2QPOA 4AVYA 3EB9A 3OPYB 2WFMA 1RPAA 3N2EA 4X84A 1SUFA 2UAGA 1Q0SA 3G5AA 1SUBA 4FX5A 4HKTA 5GAJA 2YXEA 5M34A 2H5EA 4F9TA 1VQ4B 2KX7A 5HR5A 2EZTA 2BGTA 2QN7A 3BKXA 2DWOA 4FHEA 4LXYA 4LOAA 2C2XA 5FBKA 1KDZA 2HXYA 2ZJZA 2R96A 4XPZA 2D9RA 4O29A 3TSZA 4FB5A 4D9CA 3TVDA 4M7RA 2J9ZB 4M0UA 3ETJA 4QC2A 5IHPA 3K1ZA 3X1MA 4KO1S 5GGXA 4LC0A 3KKOA 3BN3A 5LYYA 1YQDA 4N4AA 4A23A 4BY9E 1ULBA 1MP0A 3L0SA 1IHPA 4EJSC 2GJAA 3MWLA 4M9RA 3CB4A 3MUOA 5FWNA 1P0QA 3D2LA 3D43A 3MJFA 3V33A 3WGVA 3R3SA 5D6OA 1W2HA 4ZAXA 1MVLA 2BEWB 4RKEA 4XWWA 1QHFA 5ALWA 2WV7A 1IBCA 3UH1A 3D7SA 4OJKA 1X7YB 5ADHA 2QHXA 1MOZA 1LWOA 3KZMA 1EYZA 2L42A 3EGOA 2ZWOA 2EZ9A 2I3DA 4BNWA 1CRZA 3SYLA 2OTLB 1GILA 4BNZA 4QU8A 2GN9A 4U7DA 1P2UA 5BUSA 2G0AA 4L2IB 3SBEA 3M6LA 5C35A 4PXAA 3OHPA 2XXJA 3HHPA 3OUZA 1LY1A 1YDFA 4O2BF 2EZUA 1M5RA 1Z4NA 3EWSA 4OXYA 1NNI1 4I36A 3WX0A 3F6EX 4BFVA 4Z0NA 3JQ8A 4IHJA 5DP2A 1A2OA 2BL4A 5KHAA 3TECE 5FA8A 4TWJA 2BTEA 3I1FA 3P71T 3GZ4A 3EX7C 3IAEA 2I65A 4X6LA 2WD8A 5HK8A 4C5AA 3T1YB 1CF4A 1VSQA 3KKMA 4XM0A 1TADA 3A6JA 5TT1A 4WASA 1RYBA 4EYQA 5H9WA 3QKRB 3AUFA 1I3LA 4JFRA 4MQMA 4ZVTA 3W5HA 4N03A 2ZSKA 5E4JA 2UV8A 1G2OA 3AWDA 3BPSA 1U7WA 3KDSE 4K9DA 1OAAA 1W5TA 2HX1A 4RLFA 3ZNPA 4IJKA 1QK5A 4L4UA 3TZLA 4HD8A 5CPFA 5K8TA 4FHFA 1L4KA 1KMQA 2PJDA 3BXGA 5G2OA 1GLGA 1MT0A 1OLOA 3ENKA 3LSYA 1RZRA 2FMIA 1JL3A 3H4VA 5TSDA 2ZWVA 1H8ED 4ZQIA 4G7WA 3OA0A 4TT3A 4Z1MA 1ZGGA 2PO5A 5AI4A 2BFCB 2Y0CA 1P1JA 2XXAB 4X6UA 4PFJA 3KAPA 1R8YA 4XUDA 2YV4A 3JARA 3AVQA 4JI5B 2ECOA 1PQWA 2FWAA 2Z4SA 2H1HA 3NALA 5CLFA 4QJ3A 1O0CA 1ZJYA 3LWBA 2DJIA 2VYNA 2Y6UA 4EVIA 1HYHA 8MHTA 1WEKA 4N41A 4JDPA 2ZUTA 4OHXA 4F84A 3ABSB 1B00A 1Z75A 3PI6A 4RULA