1KK3A

Structure of the wild-type large gamma subunit of initiation factor eif2 from pyrococcus abyssi complexed with gdp-mg2+
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
405
structure length
398
Chain Sequence
SRQAEVNIGMVGHVDHGKTTLTKALTGVWTDSEELRRGITIKIGFADAEIRRCPNCGRYSTSPVCPYCGHETEFVRRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTVAENAPIIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSFDVNKPGEKLVGGVLGGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGVGTKLDPYLTKGDLMAGNVVGKPGKLPPVWDSLRLEVHLLERVVEQELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIEVKLQIPVCAEPGDRVAISRQIGSRWRLIGYGIIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords eIF2gamma
publication title The large subunit of initiation factor aIF2 is a close structural homologue of elongation factors.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Translation
total genus 98
structure length 398
sequence length 405
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk3A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk3A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kk3A01
1I2DA 2Q0HA 1P5ZB 1XD2B 3TVDA 3QXSA 5KNCA 1JPNA 2YYZA 2CE7A 3M1IA 1F2UB 4XVRA 1KJZA 2OK8A 1WP9A 3AUXA 4JJKA 2QGZA 3I3SR 1NG1A 3R9IA 4UXIA 2PMDA 2CK3D 5CM8B 2DEUA 2QE7D 3RC8A 1QVAA 1UJ2A 1YQTA 1NSTA 1V5WA 3IQWA 4LV8B 4Q66C 3I56B 4TYWA 3RS0A 3L2OB 4PAMA 4BFXA 4IJMA 2KBEA 4XD7D 1TPZA 4TMWA 2BPOA 4UJ3A 4A82A 2QDXA 1KSFX 4I99A 2R44A 5C46F 1W48A 2JIZD 3CRZA 3UATA 4URXR 1ZM9A 5AN9A 4B2PA 4B76A 3GLFE 3W34A 1W0KD 3RYTC 4ZCIA 1Z08A 3OESA 3K70C 5DSZA 2J0UB 5EQTA 1N8RD 5SZHB 3B7GA 1KKLA 4KV9A 1N0UA 4F91B 4PHTA 2VL7A 4HLCA 3BWDD 1KHTA 3KB2A 1D6JA 1T0JB 3QF4B 2ZI7A 2SHKA 3LBNA 1YZLA 4XWAA 3C5HA 2FGKA 4TLBA 1XZQA 1Z29A 4IFBA 2OG2A 3KQLA 1BQEA 3TJZA 1R5NA 4V0OA 4HLUA 3H1TA 1VG0B 2GCNA 2ZRIA 4BWYA 4XWOA 2QTZA 1E9DA 4QBIA 1VECA 1G3QA 1W44A 2ZPTX 3WP0A 2BV3A 4QG7A 1E94E 4AIIA 1XPUA 1W7AA 1M1YE 5FI1B 1KO5A 4PANA 1KI7A 4NP6A 4CW7A 2XEXA 2RGEA 2P67A 1E0SA 4JYBA 2IYTA 3ZS9A 2AFIE 4FN5A 1EG7A 2QA4B 4WXPA 2GESA 2VPPA 1TMKA 2O8EA 2O52A 3AP2A 4FINA 3TAUA 5J4HA 3QFTA 2ATVA 3W2EA 1G8GA 5H1YA 4RD6A 2EFCB 1KSJA 5SZJA 2OBNA 1EGAA 1JJ7A 5FUVA 3IGFA 3JVUA 2PX0A 1KO1A 4EFNA 1BKDR 2QP4A 1KMHA 2GEUA 3SQWA 2CLCX 3EZ2A 3HYTA 1EFHA 3C8UA 5EJEA 5FUYA 2HUPA 4Q01A 1VDZA 3MHPA 2ERXA 2O8FA 3RS3A 1E9BA 4OHWA 3CZQA 3NG1A 4QHSA 1OIWA 1MKYA 2HXYA 4TTRA 2V1UA 3X1ZA 1DE0A 3OJWA 1VKJA 5EE1A 2OT3B 3VX3A 1GAWA 1JQLB 1JR3A 2MSDB 5HXBA 2CHVA 2DPXA 2KSQA 2NO7A 2VF7A 3QJYA 1A2BA 3P4XA 4RZUA 1QGZA 2QTHA 4S2EA 3AVPA 3SOPA 4D25A 4POAA 1XMVA 5DO9A 3MWJA 3DOEA 1NJFA 4RZ3A 5EXSA 1IY2A 4B44A 1J2JA 1S3SA 2OV2A 3VO2A 1E99A 1HYQA 1QF9A 2BJVA 4H1VA 4X8HA 2V54A 4UXHA 5JEDA 1NVXQ 1OXXK 2WKRA 2WWWA 3NIBA 4P0TA 3VR5A 3NEYA 1E2HA 1QRAA 3P4YA 1NJGA 1UKZA 3Q9LA 2HJVA 2OCAA 5KPJA 1EFCA 1Z0DA 1E2EA 4LHZA 5DI9A 2DCUA 3TK1A 2A5DA 1AS3A 2ZAMA 2JJ2D 4BZPA 1NBME 1RRPA 2GKSA 1KI3A 2XNDA 3K0CA 1ZW6A 4GNKA 2C2HA 3R9XA 1FNNA 1OHHD 1W46A 2GJSA 2ZJ2A 3MD0A 2RGCA 5TARA 5AUOB 3R7WB 1KDPA 1AJEA 4HAZA 2JLXA 2GXAA 3AVQA 4HB0A 4NTZA 4PC1A 2ZSDA 5THXA 2ORVA 3NBFA 1OLOA 2GRJA 4LUCA 5AK0A 5KTYA 2W0MA 2HEIA 1LVGA 1IJEA 1NBMD 2DHRA 1G4AE 3CPEA 4M9QA 3SU8A 1OFUX 3EIHA 1JA0A 1U94A 1UFQA 3CB4A 1UBCA 1T0HB 3CNNA 1P60A 2BMFA 3CLVA 3CRRA 2REBA 4TLCA 3UWOA 3EWAA 1OFIA 1B0UA 3DPUA 4JBXA 1R4AA 2QT1A 2DY1A 2PIAA 5CYOA 2CHGA 1UF9A 521PA 1MR3F 5LB2A 4TQ9A 1KZ7B 5J47A 3A4NA 2C96A 2JGNA 4I1SA 4BGDA 3KKQA 1GZSA 1YKSA 1W2BB 4LJAA 1R2QA 1WB9A 3CD6B 4F7DA 2QAGA 3BGWA 3OIWA 1F2TA 1W4RA 3QPWA 3ADKA 2CVHA 4Q21A 2LKDA 4U00A 2C8VA 5GJBA 3R20A 3N2EA 4OQXA 1CTQA 1IBRA 4Q7MB 5JWHA 1RJ9B 1KO8A 1GG2A 5E3HA 2JDID 1AMOA 1U9IC 3LBIA 3QBVA 5DISB 3TKLA 5KUTA 4MQBA 1U8AA 3QXJA 1UAAA 2Z6VA 2IS2A 2X19A 4TYYA 1TQ4A 1LF5A 1CR2A 2OCPA 3NC0C 2IEZA 1SKQA 1IJFA 4BFTA 1CEEA 1HT1E 1QUFA 4JLKA 4WZBE 3LH5A 3WMEA 1PVOA 1FL9A 1EWRA 2QU8A 1KI6B 3CWQA 1LB1B 1FRNA 1AZSC 1GVHA 4A15A 1JALA 3EZ9A 4PC7A 2W2TA 1LNZA 1TTTA 2Q21A 4RD0A 2GXSA 3U4QA 2AD1A 3GD7A 4KYIB 5CDFA 4M1YA 3B2EA 3BRWD 5HKKD 4TLDA 2PJZA 3IEUA 4BFYA 1I4LD 1IN4A 2D2FA 4BLRA 1ZCAA 1E2IA 1XTRA 1MRSA 1Q3HA 1XWIA 4A2QA 1P75A 4AKGA 5B30A 2VNIA 2A2ZA 4LYHA 5KDLA 2IUSA 4A0HA 2Q6TA 2QROA 3GFPA 1W36C 1RRFA 2GZAA 5KOYA 3QY0A 4GPTA 1HH4A 3PUWA 4FIDA 4YDSA 5L3QB 3VR3A 1XD2A 3KQHA 1Q12A 4YMWA 5IT5A 2VEDA 5FBLB 2DFTA 4LPKA 1F2UA 2G9NA 1G18A 1SVKA 3AVYA 2O0JA 3NXSA 4IDHA 1II9A 1YJWB 4ZCMA 1KC8D 1YZUA 1K9MD 4IEIA 5HCIA 3TUJC 3TQFA 1TAGA 3CCSB 1QHYA 3KJIA 3W2GA 2H18A 5BN3A 3CCJB 5LB4A 4DC9A 4FCTA 4Z1MD 2XXAB 2DFKB 1Z2AA 4GI7A 2OTJB 1KK2A 1IN8A 2F1RA 2L0XA 4HI0E 1Z2CA 2VSFA 1RW4A 1QZXA 4M2LA 1M2OB 1P2TA 1VG1A 1NSFA 2REOA 4U9UA 4URZR 1AM4D 1N6RA 1CR0A 4G1BA 1JA1A 2QORA 3GJXC 3LLMA 1VQ5B 2XGJA 4DDUA 4R98A 1N6IA 1G6OA 2AR7A 2RGDA 1WDTA 1N6HA 1OSNA 3E5HA 1GTVA 2J0UA 1QHIA 4TMTA 1RYHA 2B7BA 4KODA 3B82A 3I5XA 2P5SA 4WXRA 3RS5A 4Q4LA 3QF4A 3LX8A 2VYQA 1R5OA 4MRNA 2CNWA 2YOHA 4BLQA 2V6JA 3BK7A 5CB8A 1DG3A 1AGRA 4TT3D 4BPBA 2W6JD 3TE6A 1MT0A 3K09A 4QXAA 2O0KA 4HYYA 5C2JB 4YAOA 1KJYA 5EZ6B 2IYZA 5KNBA 3FYHA 2NZJA 3SNHA 2JLWA 2ZUBA 1OYYA 2W6ID 1CNFA 1UBEA 2Q3HA 3CZPA 5FOUA 1T8TA 3C7KA 5DI3B 1AZTA 2J7KA 2BBSA 4P31A 4QBGB 4BLTA 2NMVA 3W2FA 4PQYA 1G16A 2A3RA 4C0AC 4MGZR 1E2JA 4Z8XA 4IXNA 1US8B 2OCYC 2FE4A 2ZRLA 4QJ4A 2RKOA 1T91A 2FJUA 1W4CA 3SBEA 3KQNA 3LQQA 3E1YE 2ZRGA 3CCRB 4YMVA 3GLIE 3NC1C 3KDSE 4JVLA 2WWYA 5AUNB 3TRFA 1N2CE 4AKHA 2EFDB 1ZM7A 5CB6A 1G20E 1XU4A 4NCJA 2RH5A 1IHUA 3HJNA 5JRZA 5CK4A 5FFMA 4QFMA 1VQNB 3AF3A 3A36A 2ZTSA 3MLEA 1CLUA 1TQ2A 1FPMA 2OAP1 3P32A 1L2TA 1Z6TA 3SE0A 3W8RA 4BASA 4HUQB 3BXZA 3EZ7A 4WZAE 4Q18A 1E0AA 4KFTA 1R10A 2RGNA 3B9QA 2GEVA 4Q1AA 3GLIB 2QN6A 2VYFA 1QBKC 2ZVPX 1QVGB 1OE0A 1QDEA 2JA1A 4HAYA 4EKDA 1M7BA 4FWTA 1KO7A 1X1SA 3VAAA 3U5ZB 3KQUA 2J87A 4P4SB 1S2MA 4U5XA 3FKSA 4YMTA 2ONKA 4Y0AA 2VLIA 1YIJB 1Z0IA 3J81k 2WJHA 1M1KD 2DBYA 3ND9A 4ZDWA 1CJTC 2IWHA 4TWZA 4A8JC 1R0YA 4BZQA 3U6KA 4AKEA 2ZANA 4Q4AB 1SVMA 2GNOA 2MSCB 4FW9A 2AWNA 4RY2A 4FXPA 2PZGA 4ZDIA 5K8LA 1KJWA 5FBRB 1BX1A 1GM5A 2ZSBA 3U2QA 1NVVR 1QGYA 1R6BX 1JQJC 3FMPB 5ANRB 1SZPA 4C7OA 1MOZA 4LBYA 2G83A 3ASYA 1W0JA 3DZDA 4I1VA 4AYWA 3GMTA 1T3SA 1SVWA 3CPWB 2ZE6A 3BH7A 5JHHB 3W3AA 4D80A 3QEJA 1ZJ6A 1E9AA 4QGHA 4OI1A 2HDNB 1T4GA 3HYRA 1XXHB 2Z5FA 3ZD6A 4FWIB 1U8YA 4QBHA 4CZ2A 2BMWA 3IDQA 1BIFA 2P6NA 1KGDA 2W00A 4GDFA 1E2MA 3I1FA 3VKWA 4O2RA 3R7WA 3G5UA 4W5WA 1UEJA 2E87A 2P5TB 2OTLB 1QFJA 3B78A 1UDXA 4AWXA 4EPWA 4PPFA 1IQPA 2W58A 4XSGA 1YJNB 2DR3A 3VX4A 1GIAA 5FBQB 3A4MA 4WA7A 1VQLB 4DQLA 1SHKA 3T12A 1IM2A 4BECA 2RHDA 3CF6R 1DAMA 5HE9A 3WBJA 2A5JA 3B85A 3MRSA 2WIAA 3BERA 1MO6A 4OI2A 2W2VA 1ZUIA 3B1XA 4NMMA 1Q21A 4BFUA 5C1BA 1NIPA 1NLZA 1P3JA 2V55B 5JJKA 3ADCA 3DVLA 3KFXA 2ZSFA 3OEHA 4AC9A 1Z07A 1HT2E 5KSZA 3QFRA 1OKKD 1P9NA 3CMEB 2WKQA 1VCOA 2WVJA 4OKSA 5AJVB 3OF5A 4GT1A 2GA8A 1BOFA 3CNLA 2ZRJA 2D4HA 5BYJA 1FQKA 1QFZA 3MAAC 4RSGA 3AM1A 4CF7A 3PV0A 3IKJA 2FSIA 1Q1ZA 5FTJA 1QHHB 1RJ9A 2V7QD 3V76A 3LBHA 4Q47A 4D0NA 2IYRA 2J59A 2ZRFA 1C1YA 2GVDC 2JDIA 1ZCBA 3VQTA 4CRWB 4B74A 3ADBA 1JR3E 2QI9C 1H42A 4EFMA 2X77A 3K9HA 4LBWA 5J5CA 5L3SB 2BSAA 1G1MA 1AS2A 5G3ZA 4C0KA 1UPTA 1S4QA 4US0R 1XTKA 5TXGA 3VO1A 5D3QA 4EIWA 1FNBA 1G5TA 4F4JA 1JR6A 2ZQ5A 2ZRPA 1ELOA 2IK8A 4R2IA 3Q85A 3W90A 3HR7A 3ZYCA 2NO9A 1JR3D 3B8HA 4F38A 3UPUA 1G5PA 2BCGY 4C0HA 1P2UA 5LD2B 1OH7A 4AF6A 3B13B 4TQAA 2JLSA 2RB4A 1J7KA 3PFIA 1IONA 3BD9A 2J0SA 2DWOA 2DETA 1CF4A 3N5CA 2FEMA 5TB5A 4PC6A 1KAOA 1CJMA 2JLUA 4HUTA 4HEJA 1KMQA 2XTNA 4DQKA 5L3QA 1Q81D 1GL9B 3I8SA 3THYB 4JMPA 2R6CA 2QA5A 5FOWA 3U3KA 3UIEA 3LQRA 3BIFA 1VYTA 2KBFA 2BEJA 4E5UA 1AK2A 4HAXA 4QL3A 4QNMA 5G40A 2ZI9A 1MO4A 4UAJA 1YR9A 3BFKA 3QVUA 1N5IA 1KI9A 4EPXA 3NDPA 4IW3B 2VP4A 2XNDD 1A1VA 6Q21A 2XXAA 2WOOA 2EQBA 2FSHA 3CBQA 1RC8A 5DYIA 2FGJA 2N42A 1Q57A 3R8FA 4PSKA 4DRZA 1U0HC 1E2DA 5DHFA 3DM5A 2H8KA 2HYIC 3C41J 1O3YA 1Q7YD 2UVQA 3ASZA 3TBKA 3V4FA 2JLYA 4H9GA 2CCGA 5JS8A 3FWYA 2ZRMA 4PSVA 1IY1A 3WRXC 4DCNA 1KTVA 1P72A 3P27A 3LX5A 3F3YA 4TYQA 2OZEA 1GUAA 1Q1BA 1M74A 1SVSA 1DARA 3ZZ0A 121PA 1DS6A 1E4VA 5EE5B 4F93B 2BM0A 5J40A 3LFUA 3VHLB 5F9HA 4A2PA 3DHWC 2OUKA 2WJYA 1DO2A 2QMHA 2ZE8A 2CMKA 3QPUA 4A92A 4W9MC 4DT1B 4DHEA 4NKRA 5TV2A 1P61B 4TMVA 3IBGA 2W0SA 2C77A 2FEOA 2BIFA 5BXQC 3EAQA 1XMIA 2VNHA 2QMOA 4ZGQB 3I4LA 4DCSA 5AUPB 4M53A 4V02A 1EFRA 4KSCA 1UKYA 1YZTA 3CIOA 3ETLA 5DI3A 4BFVA 3QE2A 1QH0A 1GL6A 4K8OA 1NY6A 1P2SA 2R2AA 1US8A 2WHXA 1D9XA 1GILA 4QBFA 4LI0A 4UNNA 5FPYA 1CRPA 8OHMA 1FDRA 5FR2A 4M1MA 4TTPA 4EJSC 1SKYE 3IBYA 1U99A 2X8AA 3ONWA 5EP1A 4B2LA 4KSBA 3QOFA 4IEEA 1OJLA 2P65A 3X1XA 4LYFA 4N0EA 4ACBA 4DEXA 1OGJA 2EVWX 1GJRA 4KO8A 5JCPA 1IXSB 3TW8B 3LO8A 2R62A 4QM7A 4RD3A 1S8FA 2EFGA 1FMJA 3OE7A 4HUQA 4BZXA 2GJAA 2XNSA 3QXHA 4ASUA 2GK7A 1IXRC 3W2HA 3E70C 3GLIA 1S1MA 2BOVA 3CR7A 3IIJA 4DLSA 4JVNA 4V0NA 3SBDA 1A8PA 2IF0A 3W2IA 2C95A 1TF5A 1PLLA 3QXXA 4P4SA 4LK2A 1I4TD 2DWPA 3MWLA 3Q5DA 1ZUNB 2OSBA 4XJXA 2QMUA 3PIRA 4GP7A 1JECA 3FOZA 3U60B 2WM9B 4IDOA 2PJRA 3T5DA 4KFSA 4XTRA 2ZROA 5CIQA 4JT2A 1VCNA 4Q4AA 3SEAA 4G0NA 1MRNA 2OLKA 3SI7A 3M6AA 4KITB 5J4LA 1JXOA 4L8GA 2X3UA 1VCMA 1Z6XA 1HTWA 3AQ4A 4DXAA 5FTNA 1ZM4A 4QKQA 1MO3A 1EWYA 2J1LA 2WTUA 2WWHA 3VR1A 2QENA 4URUR 4PPGA 3CPHA 3RWOA 4YAWA 1WCV1 1ZM2A 3WNCA 2EU8A 3LA6A 5FTKA 3T5GA 1A82A 1XXHA 5AJWA 3TNFA 5C4MA 3PEWA 1FUKA 1M34E 4JLBA 5BWMA 3BH0A 2WJIA 4DSTA 1QVFB 4KI0A 2B5OA 2RC6A 3CMAB 2GZHA 4NYIR 2IL1A 2LKCA 4OYHA 1CIPA 3EC2A 4B4DA 4FCWA 3AV0B 2J0QA 1WMSA 3QEOA 4QJ3A 2UKDA 2CNWD 2ORWA 3NVAA 2OFOA 5EZ5A 3KJHA 1DAHA 3G4SB 5GJCA 5TMPA 2ANCA 2DFNA 2QL6A 5A4JA 1ZU5A 4LV6A 4ZPXA 1XMJA 4C9BA 2Q3FA 1E9SA 1ZNXA 4CIDA 1LV7A 5FBWB 1VHTA 4MDEA 1NN0A 4V0KA 1CJVC 1WXQA 2F3TA 2C78A 3ADDA 4KAXA 3FFBA 5G41A 4HE6A 1NL3A 5IDVA 5JEEA 1NLYA 2WOJA 4GZLA 3HU2A 5FPKA 1X8KA 1GSIA 3W5VA 2XTMA 4MKGA 4IDQA 1OKKA 1WA5A 4RVCA 2VH5R 2HF8A 4LJ8A 1XTQA 2AFHE 1DBSA 1E9RA 2NO6A 4DDWA 3LY5A 3U3OA 1CULC 2I1QA 3A1WA 1P2VA 1II8B 4C0LA 1G8FA 2NTYC 4TN1A 4D4JA 2IA5A 4EDHA 5EUQB 5EP2A 2E9SA 1VG9B 4Q7LA 3C4JA 4Q7JB 2RC5A 4N3NA 1QHHA 1SGWA 4L16A 4Z54A 5A0FA 1DO0A 3ZQ6A 3CPJB 2V7QA 3G0HA 5EE9A 2JATA 4R71A 1LS6A 1G21E 2PCJA 4TMZA 2R8RA 1DPFA 4QRHA 2G6BA 2GWHA 3DEFA 1HE8B 3SJBA 5L3SA 1BX0A 1TU4A 1S96A 4BLSA 5KSOA 5IHPA 4M9ZA 4P4UA 5H5JA 1G3IA 4WZ6A 2RAPA 2XTZA 2VIIA 1ZC4A 1YE8A 3KJGA 4Q02A 4ERNA 3ZIAA 3AVVA 2VHQA 4NCIA 1SM4A 2F3RA 3FKSD 2HF9A 1FP7A 1Q82D 2R6FA 4LBVA 1FTSA 5JECA 3RLFA 1TF7A 2ZETA 1MH1A 4YXWA 5B64A 1ZC3A 4NYJR 2EIXA 5DYGA 3PJRA 3W9YA 3O47A 5H70A 1OT3A 2ZRCA 3PUXA 3W3ZB 3O8DA 1CR1A 1HY3A 1EP2B 3W6OA 3IPYA 4US1R 3CC7B 3A1VA 4NYMQ 1DELA 1ZIPA 2QAJA 1W0JD 3KUCA 4HLUC 3H86A 1YZKA 4L4UA 4NH0A 3THYA 1YRAA 4C7OB 1YJ5A 3D31A 821PA 3QXCA 2A78A 1CJUC 4G01B 2P6UA 2BDTA 3U7HB 3WNDA 2J45A 3A1SA 3KKMA 3KXKA 4E22A 3A6PC 3KUDA 5JS7A 3NBXX 4IOJA 2OFXA 1N3BA 3ND8A 2PEZA 5CYPA 4CT5A 4TZ0A 2YC2C 2AXNA 1PLKA 4MYHA 4LHVA 3UMSA 1HEIA 1JAIA 2ZRNA 1NI3A 2FFQA 2QPTA 2YOGA 1T5IA 1DAGA 1P4SA 4LX0A 2QEQA 1U9IA 2QGNA 4OK5A 2QQEA 1R8SA 4UQOA 4AI6A 4KFRA 4PSAA 1EESA 5BW8A 2IC5A 1AIPA 2IT1A 3LRPA 4QC2A 3CM0A 4CGZA 4TSFA 2XOKA 2OXRA 1OXTA 4PXAA 1J99A 5GVSA 1CQXA 1Q86D 4DDVA 2P3SA 2A30A 2TMKA 1T5LA 2JASA 2VTKA 1E9FA 2OE2A 3F5FA 2R6GA 1N6NA 4MA4A 4NYIQ 3K53A 3KKOA 3LDAA 2CL6X 1OIXA 1KI4A 3FMFA 3JZMA 4MGYR 4DSOA 5H8WA 4OJKA 5E7IA 4DT1A 5GJWC 3OEHD 4PPNA 3UMFA 1FTNA 2PZEA 1Q0UA 4OQLA 3I62A 4Q9LA 2GQFA 4OQMA 4O3MA 3AF1A 4A9AA 3SR0A 2F1JA 2GETA 3LXXA 1EK0A 1QHXA 3LNCA 1E6CA 4QJ5A 1E63A 2QTFA 4JT4A 4PO8A 5F9FA 2OILA 4FMCF 2WPDA 4AKIA 1JB1A 4M1OA 1KDRA 3FHOA 3T1VA 1E3MA 2HT1A 4ZIRB 1GRQA 3DKVA 4O0MA 3QBTA 1Z28A 5A5GA 1KSHA 4QHTA 3FHTA 5GV7A 1GOTA 1COWA 1KRHA 4D0LB 2GBLA 1K73D 2CCJA 3OJXA 3QQ5A 1A5TA 1Q1QA 2QY9A 1H65A 3SS8A 1N6OA 4EUNA 3K0AA 1ZNZA 3CRMA 4PAOA 3AKDA 1J8MF 1RE0A 4PZZA 3D7MA 4F92B 2C03A 5FUXA 1GKIA 2FA9A 2AKYA 2IYXA 1K8AD 3BS4A 3G82C 4NHOA 3AGQA 2ZUCA 1RYFA 2V6IA 3PEUA 1GFIA 1N25A 4JS0A 3TIFA 1NN1A 4DJTA 2OBLA 3EIQA 2OEPA 3HPRA 3RVBA 3EPLA 1VQ4B 1FMLA 1E2LA 4FMCB 3MMPA 1AQYA 1Z5ZA 4V0LA 3AB3A 4MGIR 2IXFA 2PEYA 2ZR9A 4ZV4A 4C0JA 2B8WA 3VR2A 4DZZA 3QPVA 1J9ZA 4HATA 4P33A 1GVNB 1KO4A 3C14C 1BYIA 2WWXA 2FSGA 4B3FX 1E2QA 1KY3A 1UKEA 3EZ6A 4D81A 1A4RA 2QQ0A 3OEEA 4IDPA 3A8TA 5J4YA 3LLUA 2AWOA 4XSHA 3IHWA 4G5OA 4I1OA 2NOAA 1TUIA 2FFHA 2QAGC 2V9PA 3GFTA 1VTKA 3KQKA 1SXJC 2YKGA 3NHAA 3L0OA 3GJ8A 3DMNA 2QM7A 3IIMA 3EPJA 2YHSA 4JLJA 1D8TA 2AK2A 2MMCA 1Z0AA 4I4LA 3TLXA 2WAXA 4K81B 4TYPA 3RS7A 1HQYE 5EXTA 5H68A 1XEWX 4OI0A 2WMNB 2GAOA 3MG9A 1TF2A 1OGIA 3LW8A 4KXFB 3CC2B 5EP4A 5KDDA 2GCOB 1E32A 4XOIA 3MWKA 2FZLA 4CDGA 4ZKEA 2YNMA 4F7WA 2H16A 3CW2A 4LC1A 3CF0A 2Z83A 3W5IA 5B58C 2QPAA 3OZUA 3ZVLA 1W34A 3OIUA 4OK3A 4Q19A 2ASEA 5CM9C 3W8NA 1EFRD 4UNPA 4NPHA 4FI3C 2IUUA 5LPNA 4JSTA 4LV5B 1W5SA 3Q3JB 4MRPA 2D7DA 4V03A 3RANA 3ZZUA 1Z83A 4IHQA 1ZP6A 5M04A 2XB2A 1P62B 3RRNA 4IRUB 4C30A 2OLJA 1RRGA 2YJTD 4OQNA 4ZCLA 1E0JA 1II8A 3BH6A 3KJEA 4LSGA 2WV9A 3NBYC 5EE3A 4LJ5A 2PT7A 1VPLA 1PV4A 1JI0A 1VCIA 4RZ2A 3AKCA 1KQSB 3GLGB 2QZ4A 4MUBA 1OB5A 1BO6A 4BE7B 3V4RA 2O8CB 4G5GA 1FOEB 1KNQA 2OESA 1YR7A 4HDCA 1ZD9A 4KBGA 5JI2E 2EWWA 4NU0A 1KYIA 3OE7D 2H1LA 4M1WA 4HB2A 2XZLA 4JVSB 4ASUD 3EPKA 2IEYA 1UKVY 4NDZA 3KKNA 4QGAA 1U98A 1GO2A 4OHYA 4M0LA 3K70D 2ZR7A 5K8UA 1KDOA 1LY1A 4MYUA 1CKEA 1TNDA 5FL7A 4ARZB 2ZXUA 3K70B 1TU3A 3SFZA 2JAQA 4G5RA 4OHZA 4DLRA 1F20A 3UK6A 4UNRA 1BJKA 3K0EA 2BM1A 1IB0A 1E4YA 1Z0JA 2IHYA 3A58B 3W6NA 2AK3A 2OCBA 2NIPA 1CU1A 4HAWA 5F2EA 3GJ6A 4TL6A 2ONJA 5JHGB 2JJ1D 1E2GA 1GNRA 2FX3A 1TEVA 1XXHE 2JEOA 3WHLA 4YQFA 2O8DB 4GFDA 3CCQB 2Z4SA 2ZSEA 4HLDA 5EE0A 3WMFA 1GNQA 1ZD1A 3FMIA 4WBSA 3T35A 4YDHB 2G77B 4OJQA 4BRWA 4YLGA 1SVLA 2CJWB 4D2IA 3W6PA 2PT5A 2YWGA 1JXMA 5IK2D 1OYWA 5FUWA 4E07A 3L8ZA 1XTJA 5SZIA 2A7QA 1BH2A 4Q48A 5TY0A 3NH6A 5FBVB 4C2UA 1QFYA 4CVNA 1T3HA 1HURA 4W5JA 3VR6A 2IHBA 1PUIA 3PITA 5KPDA 5DN6A 4DWJA 1QG4A 2UZIR 1OV4A 2D06A 5JI3E 4MYCA 1PLJA 4JL8A 3VU9B 1L4YA 1K6MA 5BN5A 2QUZA 3U6BA 1KNXA 3BORA 1B23P 3OW2B 2ZE7A 3GJ3A 4GOXA 2F1HA 1FNCA 3ZBUA 1OFHA 4MRVA 4OI4A 2ZS7A 4LRWA 4BUJA 2EW1A 3LAWA 4RFSB 2KE5A 3DDCA 2ZSAA 3PCRB 1CRQA 2EWVA 4ESHA 1RVDA 2BMJA 5KHOC 2F7SA 3AVUA 2RGNC 1X6VA 3MJRA 5FI0B 3RRMA 3ZD7A 1L4UA 4RJLA 4KYUA 3PXGA 3EX7C 2IS1A 3B1ZA 2V1XA 4R2HA 3BBPA 4E09A 1NMYA 3U44B 2XB4A 3M0EA 4A0RA 1FW6A 3ZVNA 3ZZTA 3F8TA 2JLZA 1LTQA 4AF7A 3I8XA 1QVRA 4Q4HA 3L82B 2F6RA 3EASA 3THOA 1XTSA 5DIFA 2H5EA 2VRWA 4LJ9A 1ZVQA 2ZUDA 1KDTA 3P1JA 1K5DA 4H1UA 1Y3AA 3RRZA 2ZRKA 3TSOA 4EPYA 1JEEA 3HPQA 4JKYA 3AVTA 4FD2A 5TVKA 4HLQB 1WBBA 1ANKA 4IVQA 2ZS9A 4TMKA 2G0NA 3FB4A 3WBKA 3RWMB 2ERYA 4ZIRA 4AY2A 3WHKA 4QOSA 3CCEB 1FP6A 3M4YA 4NCKA 4EFLA 4OHVA 4DUGA 2NZ8A 4ILEA 2XZOA 1X3SA 4Q7KA 3X1DA 3NHBA 1JBKA 4HE5A 1JJ2B 4JSYA 1M8PA 2BKUA 3GJ7A 4D4LA 3C5CA 2A5GA 3PR1A 3ZIAD 3S1AB 3IO5A 3CONA 1KI1A 3FGNA 3LXRA 2ODEA 3VFDA 5JZVA 1NNEA 1NRJB 4JL6A 4PO1A 4PX9A 3IEVA 3VKGA 3RC3A 2XAUA 4M1TA 2FU5C 1EP1B 3WXMA 4PR0A 5GV8A 1EX6A 4YXWD 1XJQA 1DEKA 1OF1A 2CE2X 1NIJA 3CF2A 1KK1A 4LY6A 1B2RA 3U7EB 1NKTA 3B60A 4JVMA 2R6HA 2BCJQ 1E1QA 3A1UA 4MKIA 2OHFA 3HU3A 2A5FA 2FWRA 2FNAA 1E79A 2ZR0A 1UMKA 3MSXA 4X8MA 3PVSA 5UKDA 4R7ZA 4F4CA 3FPKA 4OHXA 5AJYA 4G5QA 4YMUA 4CEHB 2RCNA 5GVRA 2GDJA 3KXLA 2KJQA 3L43A 4DLUA 4G3XA 3Q5EA 1EP3B 1WF3A 5C4GB 2REXB 1AQUA 4FMDF 3FKQA 1G7TA 4RCYA 3OFNA 2FH5B 4DLWA 2BHRA 4EPVA 2X1VA 1O87A 4JLVA 1EX7A 1D9ZA 3WRYC 4DLYA 1HUQA 2BMDA 2GVZC 1NVVQ 4KJZA 1BS1A 1NP6A 4JJZA 4CEIB 3BJIC 4AYTA 4XVUA 5JWOA 4A36A 1K5GA 3PUYA 3SFVA 3K1JA 1ZRHA 3O8BA 4A4DA 4TSFD 1TADA 1Z3IX 2WWFA 1OXUA 3X1WA 1WBDA 2XOKD 3T34A 4LOAA 2ZREA 1XEFA 1GKUB 1VQ8B 4Q9IA 1NVUQ 1QHSA 4V0ME 2QSYA 5TR9A 5FOSA 2NO1A 5F98A 1YZGA 4DDTA 5KDOA 1DDIA 1G7CA 3PENA 4JLAA 4B34A 2QBYB 2DWQA 2GCOA 3JVVA 1R5BA 5KU1A 1UDWA 4KLZA 2RGBA 1XPRA 2VP0A 2QTVB 2V4ZA 1SHZA 2VBCA 3BC1A 2ZRBA 4FMDB 4FMBB 2CLSA 4JLPA 3U61B 1IN6A 3QG5A 4QHYA 1GAQA 2BN4A 4RKEA 2B6HA 1CBUA 4Z51A 3NH9A 1W36B 1N5LA 2Z0MA 2O0HA 3BB1A 4LYAA 3REFA 2ZJ5A 1I7PA 1QX4A 3GLHB 1ZNYA 1W4AA 2WPDD 3JZAA 4EAQA 3VTKA 1XBTA 4GP6A 1OH8A 1Z6GA 4RZXA 4JYCA 4DCUA 1JNYA 2HLDA 2AD5A 4CEJB 3EPHA 1M7HA 3V00A 3T15A 2N1BA 4IOKA 5KYKA 3KKPA 1COWD 5IF9A 3RRYA 4S35A 4GBMA 2VNKA 3U3MA 3GP8A 2VHCA 4AURA 4TTQA 1QUEA 3SJZA 3LD9A 2O8BB 1T8UA 1F60A 2YC4C 4URWR 1Z8FA 1SQ5A 2ZVQX 3GLGA 1W49A 3K0AB 3QKRB 3FJOA 2O8CA 1ONBA 1SXJB 1VHLA 1G3RA 2JCSA 4Q03A 4MKHA 4XVQA 2VNJA 2JLRA 3P26A 4PHFA 2R9VA 4N3GA 2F9LA 2VO1A 1XJ0A 5DGXA 2BF4A 4ARZA 1EFTA 2VP5A 4P32A 2AL7A 2BWJA 1QGAA 3P20A 4J0QA 2P2LA 2RHMA 1R0XA 3TH5A 1H8EA 4C43A 1YRBA 2F43B 2QTLA 1D2MA 3GPLA 2A5YB 3EA0A 1E0KA 4DLTA 3THWB 1D2NA 3GJ5A 2BC9A 4US2R 1KIMA 2QT0A 2BJWA 2YVUA 4A0GA 2O8DA 2JJ1A 3T1TA 2D62A 3TQCA 5HPYB 1XX6A 4LJ6A 1J8YF 1XRJA 3OEED 3B1WA 1Q3TA 1ESNA 2YWFA 1OW3B 2BBOA 2BGIA 4QGFA 4MRRA 4W7SA 3TUIC 3QI2A 2OAQ1 3EG5A 3OIYA 1VQKB 4B35A 2CJWA 1G4UR 1G7SA 1W2HA 4OK6A 4K46A 2PL3A 2G1JA 2XNJA 1AA9A 4B75A 1KD1D 2ZJBA 1KSGA 4DLVA 5IK2A 3G71B 3LV8A 4HDQB 3CC4B 4QM6A 4OQFA 4ACAA 1Z0FA 2B21A 5CLQA 2YWEA 3C16C 4XTCS 5GJVC 3GJ0A 4F4IA 1TQDA 1S72B 3TMKA 4EH1A 1YHNA 4PZLA 4B2IA 4TL7A 1KK3A 1XEWY 4O25A 3VU9A 5FPSA 2C5LA 3DOFA 5EXPA 1S9DA 1UEIA 2J9RA 4Q9KA 4C4PA 1QHGA 5TDHA 4D0GA 5K8IA 4B3BA 1EXMA 1FZQA 2H7VA 4UJ5A 5CLLA 2JJ8A 1L7VC 4RFSA 2HCJB 1EFUA 1M90D 2FG5A 4KHZA 3AKYA 3OZXA 1YZQA 3H4MA 3UKDA 1Q1EA 1E2PA 3K9GA 1G8HA 2B8TA 5ELXA 1RZ3A 2VHJA 1VMAA 4W5HA 3QVVA 3RS2A 1X8LA 3B5JA 2GF9A 3U44A 4A8JB 3HP1A 1X8JA 2ZE5A 1N6LA 2ZJOA 2ZYWX 4Z8YA 2MMGA 5E95A 3E20A 3CRQA 5JBQA 2LCFA 4IDNA 3O8CA 2QEXB 3DKPA 1FX0B 1TX4B 3JQRA 3U3JA 4M4SA 4WIAA 4C3ZA 1OH5A 1E64A 1N6KA 4GRAA 3UMRA 1ZYUA 2WSSA 1YITB 1L8QA 4ZO4A 3WYAA 4LHWA 4JL5A 2GXUA 3FTQA 1LF0A 2GJKA 3FE2A 3GLFB 4YHBA 1HE1C 2VA8A 2VQSA 3BFXA 5BQ5A 3EZFA 4Y9RA 4ZKDA 3D6TB 1QG2A 3W5JA 2OBMA 4IOLA 4LWZA 1KAGA 1LFDB 3ZLJA 3RSLA 4GZMA 3THXA 4P6VF 3L0PA 3PQCA 4NZYA 4DCVA 4JIMA 4LBZA 3UANA 4NONA 1OPXA 1XF9A 5FL7D 1DAKA 1NMZA 4L15A 4DCTA 4DIDA 3E1SA 1W4BA 2N46A 1BYUA 3S1AA 3NDBB 4IXMA 1NN3A 3N70A 2F1IA 3BB4A 2W83A 1VQMB 2X2EA 2NPFA 1W35A 3NWJA 2IUTA 4M8NE 2H17A 3CO5A 1XFAA 2ZU0C 3T1OA 2IYLD 3B1YA 3FHCB 3W5UA 1VQ9B 2WSMA 3ICEA 1OXSC 4DKXA 2QG6A 4M21A 1P9RA 1IOZA 2IYQA 3D8BA 4AG6A 3A4LA 2B7CA 3G6EB 3PG5A 4GMDA 3I92A 3WYFA 1EWQA 3IQXA 1U0LA 3QFCA 2EFEB 2GPJA 4I1UA 1Z6AA 1GP2A 1E1RA 2D7CA 1KZGB 3BOSA 2IXEA 4Q9HA 3UXMA 2GTPA 4CEHA 3ZBTA 2ZU6A 5AJXA 2CXXA 2NGRA 4LPSA 4DSNA 4Q1EA 2ZM5A 1U90A 1GKYA 1N6PA 1LS1A 1D1NA 2IF2A 2GK6A 4LGMA 5JCZA 1DDGA 1GRRA 2IW3A 1OIVA 3CH5A 1IXZA 2IS6A 3EA5A 4JLMA 1NJID 2ZJAA 3GJ4A 4B47A 1C9KA 3RABA 3WMGA 1XD9A 2YOFA 5DN6D 2XZPA 2PH1A 2ZYTX 2IWRA 1Z6YA 221PA 3LWNA 1F48A 4B33A 4EQ6A 3CX7A 3N2IA 1S3GA 2ZYUX 4CEIA 1T6NA 2QPOA 3EWSA 2G88A 2ZI4A 1ZUHA 4X8LA 4ZI2A 2C04A 1TEXA 2CHQA 1WQ1R 2C9CA 2P0EA 4C0SA 4PFSA 4UKDA 5J4VA 1MO5A 3WYGA 1R0WA 2ZRDA 1R0ZA 1JEDA 4TLAA 4LDJA 1KK0A 5JSZB 3SYNA 5SZKB 2R6DA 4XIGS 2HCBA 3ZGXA 4A6PA 1UM8A 3FFAA 4M9SA 2QBYA 3AEZA 3DM9B 3QE0A 2PCLA 2QSZA 4U7DA 2WWIA 3HR8A 2OO7A 2IXGA 4PHHA 2MSEB 4KU4A 3SN6A 2YINC 1Q20A 1YZNA 4TL9A 4AG5A 2J46A 2FV8A 5DLQC 5JJLA 4BFWA 2PLFA 3CRVA 2D74A 2FMXA 3MWYW 3OAAA 3RDPA 4Q4HB 1AN0A 4GL2A 1GWNA 4TZ6A 5JJIA 4V0MA 4PGOA 3CCUB 1H85A 5JWRA 1XCPA 5LD2C 1XEXB 1GRNA 3GLHA 1WRBA 2J7PA 1Y63A 1KOFA 2Q9CA 1HA3A 1BMFA 1ZMXA 2Y8EA 2ZI6A 3AF0A 3NBZC 2AX4A 4CEJA 4JKIA 2LWIA 2K5UA 2QRNA 2YWHA 2NO0A 4DUGD 3SDZA 3AKEA 4LHYA 4R9UC 2D3WA 1H8HA 2GAAA 3QKSB 4OL0A 2FOLA 4PTLA 2O8BA 1OH6A 3ECCA 2DYKA 5D3MB 2ODBA 3K0SA 4YAUA 1T9HA 3Q72A 3QKRA 4N1AA 1SXJA 1ZAKA 2CVFA 2PMKA 3RHFA 1RFLA 2ZI5A 2EFHB 4G1UC 3T1QA 3QIAA 4M1SA 5DH9A 5FPHA 5L3VA 1PZNA 4D26A 1G9XA 3K0CC 2WBLC 1GITA 1UADA 2IYYA 5FH9A 1K8RA 4BEBA 1CXZA 1D2EA 2PZFA 3U7FB 4LZZA 2Z43A 4NL4H 3Q7PA 1DAEA 5FL3A 4TYNA 2VSXA 1E1QD 4Y9UA 5CJPA 4YMSA 3ICQB 1JAHA 1KI8A 4WAUA 4MDFA 5L8VA 3SJCA 1N0VC 2HV8A 1XE1A 4MITA 5FR1A 4DIEA 1VIYA 2XSZA 4M1KA 1E79D 3H84A 4MH0R 5EXXA 2F43A 3QENA 1VQ7B 1A7JA 5AJZA 3GFOA 4CT4B 3THWA 4LC0A 3W5HA 4B43A 2R65A 4II7A 4L9SA 4Y0VA 1DVRA 2GEDA 4BQSA 5HZKA 1CR4A 3FPAA 5K8TA 3OZWA 1MABB 1NLFA 3U3RA 2WMOB 3OFND 4NYJQ 2GILA 3BB3A 4Q4JA 4LCBA 1ESMA 1S1CA 4B48A 4CYMA 4E03A 5H59A 1GNPA 4B3DA 1TUEA 4RD2A 2HJGA 2J41A 4TQUS 3IILA 3QF7A 4X8OA 2WZQA 1G64A 421PA 1CS4C 4ZGNB 3SYKA 3H2YA 4D6PA 2FPKA 2A9KA 2F9MA 3SZRA 4EJSB 2Z4RA 3I72A 1D5CA 2EYQA 5FPTA 1VQOB 1NKSA 4I81A 2FFBA 721PA 3V9PA 1QHNA 5DNYB 2C9OA 1FRQA 3EARA 3FVQA 3C15C 2CK3A 1II0A 5E7MA 3REGA 2GBLC 1E69A 2QE7A 3K9LA 3QKTA 1GAJA 4HB4A 1F3OA 4RFVA 2G0TA 2VF8A 4JLNA 4ZDJA 3ZH9B 3DL0A 1XCGB 3WNBA 4B6FA 3CWZA 4JZKA 1ZD8A 3K9NA 3CX6A 4XD7A 3VHXA 1VQ6B 3T61A 4D82A 1S9HA 1DTSA 3KL4A 1NMXA 1U81A 2JIZA 4BFZA 4YAFA 1YU9A 1F6BA 3Q7QA 2OFWA 1W0KA 4HAUA 3GLGE 1P73A 1KY2A 3JQQA 5DE3A 4PQFA 1VIAA 1P6XA 4A8JA 4C0BA 2ODWA 1ZBDA 4HZUB 2FZ4A 1G7RA 2HLDD 3KTAB 2NPIA 4RCZA 3L0SA 3EW9A 1FX0A 1GL7A 2FSFA 1ZINA 4QNRA 4MKFA 2WICA 2H92A 4PQRA 3PEVA 2FDCA 5HR5A 1RRCA 2ZAOA 3AF2A 3GLFA 3D3QA 5JMTA 2KI5A 1W47A 4TMXA 1DAFA 3I61A 2V8OA 1GDDA 4RKFA 1FQJA 3TSZA 3UWKA 1E96A 4BLOA 3SYLA 2FPLA 3ZS8A 5KSYA 2CLDX 4Q1BA 3TSWA 4U02A 5F3WB 2R6AA 4MYTA 1VQPB 1N0WA 1NF3A 1SULA 3VNUA 4YALA 3CCMB 3ZVMA 2F55A 3MJHA 1RPZA 2ZJYA 4P4TA 3NTUA 2AKAB 4HB3A 4URYR 1Q44A 2FPMA 5AWFC 1JPJA 2DERA 2WKPA 3Q8XB 1PUJA 2IYSA 3ES9A 2P6RA 4D4MA 4LHXA 2C98A 1FNMA 3DZ8A 3T06B 3VMFA 1H8ED 1E2NA 4D4KA 1ZM3A 5BYKA 1YR6A 3AUYA 4IFEA 3F0TA 1G8PA 1Z22A 3K0FB 3QNUA 5HCNA 4WQMA 4ZDKA 4UXJA 1R7RA 2GJ8A 2JLQA 2IS4A 1GR1A 1G19A 4DLXA 1SVIA 4BPRA 2CCKA 3OIVA 4M9XA 3GEHA 3ZJYA 2V3CC 5FOVA 1IN5A 2YZ2A 5EMNA 5CJ2A 5HZHA 5FOXA 4NCNA 3K09C 1T3LA 3EIEA 2ZRHA 4IVRA 4KCGA 1XP8A 3H0KA 4YONB 1NN5A 1XNJA 1FNDA 2HT6A 3TR5A 3IHLA 2HXSA 5E7JA 5FTMA 2FF7A 4IOMA 2HYDA 3LW7A 3VKHA 5FOTA 1P7CA 2I1VB 1G6HA 5HTKA 4K1XA 3TAHA 3CNOA 5JLJA 1FFHA 1FUUA 2XJ9A 1R8QA 2ATXA 4Q1DA 3A37A 5EUMA 621PA 4XH9B 5HE8A 1CNEA 3UG6A 1XPOA 1MV5A 4IKEA 1N5KA 1M6NA 3X2SA 4DEYA 2OK7A 2GJ9A 3DO6A 5EP3A 4A0FA 4B3GA 2QP3A 4OBEA 3RSOA 1CP2A 1E2KA 1U8ZA 2H57A 5JSZA 2BBTA 2XX3A 2VZLA 4WW0A 1X86B 3NKVA 1HQCA 3HDTA 3SJAA 4RD1A 3X1YA 4BFSA 5FTLA 2JJ2A 2G1KA 2CEAA 4B6EA 1I4DD 3TGPA 1P9WA 1W2GA 3L8YA 2QNRA 3AH8A 4L9WA 2GHIA 4PPQA 1OHHA 4LJ4A 1ZNWA 2D2EA 1OFTA 3EXAA 4AK9A 2IX3A 5AUQA 3WY9A 5L3RA 3SHFA 4UNSA 4KLNA 3HU1A 4NBSA 4ON9A 2ZI3A 2WSSD 1PJRA 2CBZA 2BBWA 3I5YA 5FA6A 4AYXA 3QFSA 2DFLA 2IYWA 1XEXA 1NBMA 2B92A 3GCGA 1CJKC 4PO9A 1HV8A 1E2FA 3AF4A 3NEJA 2I3BA 4AD8A 1X1RA 3AGPA 5G3YA 3B1VA 4BEJA 3ZQJA 2VP6A 4LJ7A 4ABYA 3GQBA 1G17A 4LJYA 4FK8A 4DB2A 1ODFA 2I4IA 2UZ3A 3BAFA 3QKSA 3THXB 3TVTA 2VHUA 3FDIA 4KVAA 3AVWA 1ZU4A 1YVDA 3QSYA 5D3MA 2O5VA 3LO5A 3IO3A 1Z06A 2ZJ8A 3OZVA 1V43A 3CXCB 4KBFA 3VNVA 4DVGA 5B57C 2O8EB 3CKLA 4HDOB 5CITA 3SQXA 4B73A 4EPRA 4PHGA 2X2FA 3MGCA 4JBYA 4Q00A 1VYUA 2YV5A 1RIFA 1AGPA 4WOPA 3BE4A 3I55B 2KB0A 3LVRE 2J5XA 2CDNA 3A1TA 2J3EA 2KWIA 3RAPR 4C0QC 1KMHB 4PAQA 5E4FA 5C18A 5KNDA 3CCVB 1XZPA 1YJ9B 1ZIOA 1G3UA 1JJVA 1TLLA 5JRJA 2WJGA 2QMEA 3TUZC 1DAIA 4GSYA 1E1RD 2Q9AA 3SHWA 2RGAA 2BKEA 1AS0A 1G3MA 3I73A 2O8FB 1KI6A 1G41A 3SC3A 1Z47A 1IY0A 2AHOA 5BN4A 4NCHA 1XB2A 4LYJA 1J70A 3IUYA 2ZIAA 5DHAA 2XNCA 1E9CA 1J90A 3BFVA 3CR8A 1MABA 4RD4A 1F5NA 2E1RA 3ZC3A 2OM2A 4DSUA 2BVNA 4IVPA 4G1VA 5HKKA 4HAVA 2ECKA 4JLDA 2C9YA 3ZDQA 1NVWQ 3B9PA 1NG9A 3KX2A 3PUVA 4TLEA 4B71A 3KZ1E 3KXIA 4NE2A 1VYVA 3VR4A 4EQ6B 4Q5IA 3HWSA 2NG1A 2IBMA 3TR0A 2CL0X 2PLRA 2QM8A 5LBIA 1W1WA 3B6EA 3RNLA 4C2TA 1C4OA 4EJSA 1AKEA 2DB3A 1RKBA 1U2RA 3CX8A 5G53C 4Q1CA 1OXVA 3WP1B 1G5RA 1IN7A 4TL8A 4GOKA 1LW7A 2RGGA 2BGJA 3AP1A 4B32A 2PBRA 4Q1FA 1XCMA 2BMEA 3AP3A 3GLHE 5KO2A 2ZJZA 1QG0A 3E2IA 4Z1MA 3GEIA 1S0UA 2CNDA 4ITRC 3R8CA 2WIBA 3CCLB 2WAYA 5J4KA 1E98A 1TVCA 4MGKR 2EYUA 2ZYVX 1XMSA 3EC1A 3OAAD 1Q22A 4A2WA 4BRUA 4DB4A 3FMOB 2FN4A 2AN9A 4Q9JA 1W36D 2VP2A 1NY5A 4DBLC 1DADA 4YC7A 3PEYA 2J7PD 1SXJE 4FCVA 4HZUA 1IAQA 2QRZA 3LVQE 3LVBA 1BMFD 3TW4A 4PC2A 3KTAA 3U7GA 3KFVA 5P21A 3OHMA 3QKUA 5KSWB 1TQ6A 4G5SA 2VP9A 1Z63A 1H8HD 2BEKA 3MCAA 3CUEF 4TT3A 1W5TA 5IRCD 2W6JA 1E9EA 2IYUA 2JLVA 2C99A 2WJVA 1A2KC 3MFYA 4ZI3A 1U0JA 1DOAA 2RMKA 2RGXA 1KI2A 1SXJD 1AKYA 1Z0KA 1WE2A 2PX3A 2QAGB 2W6IA 2XJ4A 4KFUA 1G291 4B3CA 1F2TB 5KSPA 4M22A 3JQPA 2ODNA 2J0VA 4JLOA 2FFAA 2VHTA 1G8YA 4XWKA 4P3YA 1UBGA 2ZRAA 2CL7X 3QG1A 1XDBA 4BLPA 1E62A 1ETUA 5CK5A 4ESVA 1NDHA 4PZYA 2XITA 2AXPA 4MRSA 5CDFE 2CRVA 2GZDA 4GOJA 4EPTA 4A1FA 3ZVRA 4HZIA 4GMXA 3QUSA 1YHQB 2NQ2C 1I2MA 2XSZD 2ORIA 4QGGA 5CIWA 2ZS8A 3L0IB 4L5BA 2Q9BA 1UBFA 3IPXA 4PC3A 3K0FA 3KB1A 4DLZA 1W87A 1KKMA 3AVOA 4JBWA 4WVFA 1M7GA 2G3YA 5B2ZA 2GF0A 2IYVA 2Q3MA 1XD8A 4HSEA 2HMAA 1SVOA 3CRW1 5LDDC 1YI2B 2GXQA 2WJJA 1XTIA 3K8YA 3PUZA 4N0DA 1OB2A 2WWGA 3RS4A 3U4QB 3R9WA 2GCPA 5GADl 2W2XA 3MUFA 2QP9X 4KVGA 4Q4JB 1DG1G 1SKYB 1TL7C 5AR1A 4A6XA 4B3XA 3AVXA 1YR8A 3GEEA 3I32A 1JB9A 2ZITA 2OXCA 1XJCA 4NYMR 2ANBA 3UG7A 5JFGA 3O8RA 4UNQA 3IIKA 2ZEJA 3CH4B 3DMDA 2VSOA 1N5JA 4O2LA 4URVR 1VG8A 4Y7CA 4MUAA
chains in the Genus database with same CATH superfamily
3AJAA 1I2DA 2PX8A 3F97A 1V7CA 2J0EA 2YJGA 2Z1NA 1O6GA 4BFLA 4KAAA 4KJXA 3UEOA 2BKVA 1IVNA 3PNVA 1BMQA 3W2TA 3QXSA 2X86A 4N3CA 1RXCA 2YYZA 4KG7A 4XVRA 1IZ9A 1YBFA 5FA8A 1BHJA 4CUKA 1E3LA 3HKBA 1H94A 1MEJA 2ZXFA 3PFCA 1B8UA 1K97A 5IN4A 3A8IA 2EKQA 5JAMA 2CK3D 4YJ3F 1N5OX 2YXPX 2HCFA 5CM8B 4NFHA 1QVAA 1PR0A 3F47A 5TC4A 1NSTA 1BDJA 1YBVA 2HDWA 4LV8B 3I56B 4MLZA 5DNWA 3ZDDA 4TYWA 3A32A 2JW5A 3L2OB 3NM4A 5CVUA 3UH0A 2E5LB 3T4XA 5FIUA 5KVAA 2WWRA 4TS9A 2BGWA 4HWGA 1OBVA 2IDKA 1XUOA 3DNPA 4OY3A 3E9NA 3GNQA 1I14A 5CVCA 2C7VA 2YW9A 4I99A 1I36A 4L2IB 2JIZD 3UATA 4PLFA 2BY4A 4NJEA 4IM7A 5AN9A 1P0PA 2JNWA 1GQSA 3B1KA 4B2PA 3RYTC 3GLFE 1QTRA 3UCXA 4AO7A 1N36B 3HLTA 2IYEA 3N76A 2QKYA 1GQYA 3PTLA 4XYLA 1ZH0A 2E4VA 3FSGA 3HMKA 3B7GA 2HO4A 4QECA 4KV9A 4F3YA 5JAHA 4RACA 3GRKA 5LZ2A 2QR3A 1KHTA 2TS1A 2ZIFA 4NFLA 4ZVPA 1D6JA 4CCAA 3S8EA 1T0JB 3UAGA 3OOSA 1GYRA 5KVSA 2G1AA 1I1OA 2C5FA 3RIMA 3C5HA 4XDHA 3T3IA 1PV2A 5C31A 4AP9A 5KOJB 1Z29A 5DP2A 2DKNA 2GHRA 2FWAA 2OG2A 5I7OA 3KQLA 2Y1FA 4D3FA 4XKWA 3P2JA 1ECPA 5B3LA 3CZ9A 4NOKA 4WA8A 1ISIA 2INGX 3U7QB 4ESOA 4F8JA 1KQFA 1E9DA 2YMLA 4RQUA 1SCUB 1VECA 1QM5A 2PV7A 3AESA 2AH5A 2H2IA 1G42A 2MSKA 4QG7A 4UDNA 1E94E 4M0KA 4AIIA 4RDHA 4ENTA 4P98A 4OYLA 3K20A 4PAAA 5FI1B 4LTMA 3ZEIA 1KY4A 3OF3A 4PANA 2GK4A 3OKAA 1T6ZA 4MW6A 2W42A 1J24A 2RGEA 4L0CA 4W7HA 3MQ4A 3ZS9A 4IDAA 4FN5A 1L5MA 1JG6A 1VMDA 4QTYA 3DLBA 4P81A 2XKKA 2WHEA 3I9V1 4ND3A 3AP2A 4LOHA 5B6IA 5K3AA 2ATVA 1N1EA 2GN2A 3W2EA 4OP1A 3LCJA 2X9QA 4RIIA 1O96B 4CI0B 4F97A 1EGAA 2X8KA 2Y4NA 5FUVA 3CKKA 3UBTA 1QANA 1GTSA 4AXBA 1HDZA 3WLQA 3GJSA 1VSBA 2XYHA 5HF5A 1PL8A 5DBIA 3RSGA 1OBOA 1ZVKA 2CLCX 1S2DA 3MRTA 3EZ2A 3R24A 4FR5A 2WP0A 5L40A 1Z2PX 3NZEA 2VJIA 3QITA 3C8UA 2HUPA 3PHJA 2R4UA 3FTDA 3KZOA 5E8JA 4MWGA 2WP8J 3OT1B 2ERXA 2LVBA 1SFRA 3GARA 2O8FA 4MQUA 2ZTGA 3L92A 2WV7A 4JKOA 1EJ2A 1Q7EA 4BV8A 5JCOA 2FPSA 1D1TA 2P3OA 3I45A 1GRCA 3QMMA 1TK9A 3SBOA 3TMAA 3RPEA 3OJWA 1J2YA 3OQNA 1T24A 3HKDA 4I8XA 5BSUA 4YUVA 3MT0A 3TL3A 1B8PA 5IS2A 1YE3A 4FS8A 4DNRB 2MSDB 2DPXA 4NNPA 3H16A 2VF7A 3QJYA 4K9LA 3KELA 1A2BA 2O1SA 5ILOA 2HV9A 2X0RA 1JWAB 4RTJA 2DP4E 3SOPA 2HJRA 4PX2A 3V8PA 2PSSA 1XMVA 5B58T 5EIXA 1QG6A 1G0NA 5EXSA 4X9XA 4G36A 4B44A 1V6CA 4B4WA 1Q0LA 3STHA 1X7XA 1RQ2A 3VO2A 1E99A 1P5HA 1QF9A 1RWMA 2BJVA 2CZCA 1UFKA 2IHTA 2QRMA 1VSTA 1NVXQ 1OXXK 2V54A 2WKRA 3IP5A 3NIBA 4J16A 4P0TA 3NEYA 4S1PA 4TUYF 2C9MA 5IPFA 2W8BA 3GDGA 4Q3CA 4NZ9A 2O7QA 2AG1A 1A69A 1EFCA 1Z0DA 1MAWA 2PIDA 1WF6A 1E2EA 3PEEA 3QLVC 3MT8A 1AS3A 4D9KA 2J9FB 2JJ2D 1DC7A 3TQTA 1UJ6A 5E9WA 4J1SA 2ZBUA 1YVUA 1M67A 3K0CA 3KYCA 4GNKA 2OGSA 2QZJA 2A1TR 3JWEA 3BXXA 3N6RA 3EZGA 4M49A 4MKZA 2R6JA 3MD0A 5TARA 3VC7A 5AUOB 1FFWA 1R0SA 1Z38A 1KDPA 1KOLA 1KYXA 2JK1A 2OYCA 2FPPA 1I2AA 2JLXA 1P0FA 2C1XA 4WCFA 2UXBB 1JW9B 3E3AA 3ONYA 4R2XA 3WLRA 2I66A 1A2QA 5AK0A 5JATA 2PKXA 3A6JA 4OQPA 3ST7A 3VH2A 2HEIA 3C8DA 4RENA 1M6VB 3KR1A 1GPAA 2HRBA 3CPEA 4M9QA 3SU8A 3G2HA 3EIHA 1JA0A 1Q1NA 3SMVA 1Z5UA 4DA0A 2PWPA 3K0KA 4XLFA 3IEIA 3CB4A 2JANA 2BMFA 3UWOA 3CLVA 5JOQA 4W5OA 1VLZA 2VC2B 4WZZA 1RQPA 3Q1LA 4QO7A 1KP2A 2XD9A 1E3ZA 2DHDA 2Q5FA 2QT1A 4DA6A 2PIAA 1B8NA 1EFDN 1PNVA 2CHGA 4IIDA 5F5XA 2X5XA 3RQSA 4RJIA 1KZ7B 1R9MA 3SQLA 2HUNA 1QYDA 3RUPA 1D04A 4X95A 2JJYA 3HZRA 5C1DA 4LJAA 5L9AA 3QTTA 1R2QA 3L6BA 1EM8B 4FZVA 5IJ9B 1YBAA 1F2TA 1W4RA 4IS3A 3V8EA 4A0QA 5C81A 2PH3A 4S3MA 5BQFA 3QU4A 1X38A 2LKDA 3PUJA 4G1CA 4HDMA 1ZH4A 3DAGA 4Q21A 4Y1RA 3NCTA 5E8RA 1JTFA 3VSDA 5ES4B 3R20A 2XUDA 4NU5A 3RFVA 1KBQA 4O8ZA 4ZT4A 2NAPA 2X8WA 4EB3A 4YRMA 2ZIWB 1GG2A 3CKMA 2IYOA 4JLSA 1ZOLA 1POWA 3L3BA 1U9IC 3SAJA 1KPHA 5B6PA 3TKLA 1Q0TA 3T5PA 1K06A 5KUTA 3KBBA 4GBED 4H3HB 4H7KA 1UAAA 3QXJA 1CUHA 2JFBA 2G71A 1JFTA 1GEEA 2X19A 5KYGA 4TYYA 2IS2A 2RAUA 2VBSA 1T4DA 1YQQA 1WPGA 4H6PA 4WE3A 2ET6A 5TS2A 2ZIEA 4HGZA 3W1EA 1SCNE 3ELDA 2R7LA 2BKXA 4JLKA 4WZBE 4WNYA 3LCUA 3CWQA 4JODA 4QQKA 3RKSA 1FRNA 1TM1E 2ZGVA 1RT9A 4GQIA 1ZD2P 3HB0A 4YGXB 3PPIA 3ZHSA 4RD0A 2QX8A 4MIKA 3ZV7A 4H59A 4RF4A 1ORRA 4HC4A 4DN6A 2GBCA 3B48A 4C4RA 3TEFA 3B2EA 3BRWD 4PFJA 3NOXA 4FYHA 3VJLA 5JIBA 4P6YA 2PJZA 4UHBA 1K63A 4BFYA 1IN4A 4BLRA 4OIFA 1QZ3A 1MRSA 3B3GA 4OL9A 4RABA 3EGCA 3GPIA 4GGPA 3TXXA 4MW0A 5KDLA 2J85A 2BGUA 3QV2A 2Q6TA 2VDNB 3I34X 2GZAA 5KOYA 1TUBB 3TRJA 3WWCA 5AICA 3PUWA 1U28C 3VJRA 3VR3A 4B6RA 3AQIA 1P4GA 4PZPA 1ST2A 2GEBA 3PHGA 4YMWA 4FGUA 4OA8A 4PNHA 3RSHA 3OTHA 2DFTA 4GWLA 4XYEA 3HI6A 1SVKA 3NXSA 2O0JA 2FSSA 1YZUA 2OO5C 1K9MD 4ESEA 3TGLA 1K6XA 3VI4B 4JB8A 2ZB7A 1C2TA 1TAGA 2ZJ6A 3INGA 3KJIA 1SIWA 1I7QB 2H18A 3I9FA 1DQNA 3O4GA 3CCJB 3GLVA 3C5WP 3OZGA 1GNVA 4MGEA 2WNIA 3UV7A 4FCTA 2H4HA 2XXAB 2DFKB 3A1FA 1GARA 5T64A 4GI7A 4UUNA 1KK2A 4G5FA 3G2IA 3S8YA 2OTCA 4OGKA 5FI5A 4FWBA 2I78A 1RZVA 5JZSA 1K92A 2X4DA 2B9VA 1CJSA 3O03A 2FWIA 3DCYA 1T2AA 4URZR 5DPMA 4ZEXA 3ZNQA 3MTDA 1L4BA 1N6RA 1MB3A 2ZYSA 3COZA 3LLMA 2QORA 3NI2A 4L2IA 5ICFA 2IZ7A 4LSWA 2FKNA 3KAJA 3VSCA 1HE3A 4P7KA 3H7AA 1N6IA 1ND6A 4LCEA 4GKAA 4MROA 4UVIA 5TF0A 1N6HA 1OSNA 1ZK0A 2EZTA 5AOVA 1PGOA 4IR7A 2NWQA 5ITWA 2C3OA 3LNTA 4A03A 8LDHA 3KCQA 3RS5A 3A2NA 4J0IA 4Q4LA 1T29A 1C7IA 1I6KA 4MB0A 3GA5A 4Y8VA 1R5OA 1JQ5A 1ZSVA 2HA5A 2V6JA 5HIMA 4EX7A 2BFAA 5KOJA 1DG3A 1EQ2A 1L8AA 2JFQA 2W6JD 3NJ4A 3TE6A 1Y34E 3BSFA 1WZIA 4IWXA 3TD2A 5C2JB 1ZGJA 4GVXA 5DYYA 2IXTA 3U7QA 4KXXA 3OSZA 4RPJA 4F56A 8ATCA 5KHAA 1OYYA 1SCUA 1EAMA 1EFAA 2Q3HA 1Q74A 4ETIA 3BYZA 1R27A 4HGOA 3ZTYA 4P31A 2BBSA 4B7XA 2NMVA 2A1IA 1EH5A 2ADFA 3HJGA 5DLPA 5CCXA 3PF8A 1XTTA 3DVAB 4KWIA 3CNHA 4YRAA 4IXNA 1US8B 2OCYC 4QJ4A 1P9OA 1T91A 3JWPA 2Z6QA 1WXGA 3E1YE 1X2BA 2ZRGA 3UTCA 5KZMB 3CCRB 2BZGA 3NEAA 1J2TA 4H31A 4YMVA 5I7VA 3RTEA 3BWCA 4JVLA 4QO8A 5AUNB 4Z0TA 2WWYA 1N2CE 4IP0A 2GF2A 2EFDB 5CB6A 4DLKA 4ZVRA 2O7SA 4G6ZA 4K2HA 3NB0A 2OMKA 2JIBA 4OYYA 5L7WA 1B4DA 3PZBA 3VUEA 3BMOB 1EWVA 3HRIA 5BSEA 2JAWA 3DD1A 2DPMA 2O3JA 2ZDGA 1TQ2A 3BD7A 1A7AA 3ANYB 4WUVA 1LPSA 4YCJA 5NULA 3K4HA 1Z6TA 4LY0A 4R40A 4BASA 3EZ7A 2GO1A 4WZAE 2VJCA 3CFYA 3B9QA 1KVTA 2QVZX 4OKIA 4X93A 2WA2A 3OT1A 2VYFA 3W06A 1FK8A 1QBKC 4K9MA 3UV3A 1QVGB 1G20B 1TEZA 1YCDA 2UUOA 3R6JA 3V4SA 1YJBA 2A0YA 2WIKA 3C7TA 4CCYB 1SXPA 3U5ZB 1P44A 2RDMA 5F64A 2I4LA 2J87A 3FYUB 4P4SB 1S2MA 1HQDA 1N4DA 3IT0A 4U5XA 1RAGA 1C1DB 1EWTA 1ZSYA 3JQ9C 3LVFO 2GEFA 2NQTA 1M1KD 2DBYA 4RHEA 4WFIA 5J2TF 2IWHA 1XA4A 4ZJZA 3N07A 5KNCD 3U6KA 2P35A 2QQGA 4RVFA 5GINE 1MHPA 1GPDG 4DCGA 3QUBA 1GN9A 4E1BA 4HQFA 1HDGO 5DK6A 4CQLB 2O3RA 4FW9A 3ZHQA 1EB9A 2AGVA 2CLEB 2PZGA 4JU9A 1DLJA 3UJ7A 1GM5A 5GOZA 3ZZ1A 3HA2A 1P5RA 3HXTA 2OOSA 3FMPB 3OJEA 4MWEA 1HNWB 3ZHBA 3ASYA 2G83A 3DZDA 1W0JA 1L4FA 5JHHB 1T3SA 3DCIA 3G0OA 4BKRA 1GZVA 1ZY2A 4U0KA 4E7PA 1T4BA 3P0EA 4I9UA 2PHZA 4DNPA 1JKIA 3MGAA 4TKUB 3WHIA 1NVKA 2J9FA 3GLUA 4K7JA 1HG1A 2DGDA 4RIGA 2K2WA 3IERA 4DREA 4I5IA 5TQ2B 3VBEA 1HLPA 1U0EA 2P6NA 3SXUB 4A7PA 4KO2S 2DM6A 5FNVF 1XDUA 3I1FA 2WD8A 1ZBQA 3HCRA 4O2RA 1FCJA 3WYDA 4BWFB 1FDSA 2P4UA 3G5UA 4ECEA 3CVOA 1OTHA 3D6FA 3D6HA 3MILA 4FYYA 3W6UA 2E87A 1QRTA 5CB4B 1QFJA 2PKWA 4HWPA 3B78A 4IHJF 1P4RA 4DA4A 2XUJA 4IL5A 4YRRA 1JEQA 2M5SA 1R8JA 2D2VA 1PNOA 5H16A 2DR3A 1M1UA 1OFUA 2H1FA 5CB0A 5DHPA 1M6VA 1T9ZA 3A4MA 2JHCA 2Z6AA 2PZ8A 1I9GA 3BTSA 2RHDA 3WBJA 3DZJA 1JBEA 2W90A 3MCUA 4BNXA 3B85A 1RJFA 1HEYA 1YZVA 2JA2A 2WIAA 2UUPA 4HVAA 3TN7A 5CXQA 2ZXHA 3H1FA 5HZMA 4JFRA 1KAQA 4OHOA 1P3JA 1BN7A 2V55B 2GTHA 1JDNA 2ZSFA 1F8YA 3AILA 3F5DA 3JWJA 5K4HA 1A98A 1HT2E 2DMRA 5AI0A 3DNMA 1CNMA 2Z58A 3PNBA 3WJ7A 1B1CA 1LK0A 4XMYA 1EM8A 1G1AA 2ZRJA 4TRMA 4YRQA 5IJ9A 3C0KA 4GE3A 1FQKA 3E8XA 3FNEA 4I4TB 4B7ZA 3BQJA 4XKVA 4RSGA 3AM1A 5I9MA 3PV0A 2BSQA 3IKJA 2J07A 2FSIA 1L3IA 2ZJFA 1Q1ZA 4EVIA 1VP3A 1QHHB 3OHPA 3E18A 4D0NA 1ZH8A 3AZQA 2QX4A 2CV0A 3AZPA 2BFEB 5CX1B 2GN9A 2JDIA 2GVDC 1V45E 2OOKA 4KSYA 5LR6A 2X77A 4I55F 4MHOA 2ID4A 3FIUA 2GX6A 5L3SB 2BSAA 2PNJA 1UIMA 1AS2A 2OBXA 1S4QA 5LQDA 3FDZB 4JMQA 1H22A 5DCLA 1DQZA 5JDCC 1DFGA 1RNLA 2F59A 3HSYA 5B5SA 2P9QA 4IGAA 3SLDA 1UBRS 3DT6A 1JR6A 1ELOA 4X84A 1V7PC 3EDOA 4MUEA 5LZ7A 3G59A 3HR7A 3AK4A 2Z2JA 4PR3A 1IY9A 4C0HA 2HTFA 1I18A 2KW5A 3S5JA 4M7PA 3ER8A 4IGKA 1PT5A 3KKEA 2OBFA 3B13B 4L6CA 3BDVA 2RB4A 2Z56A 2ZBPA 4BNYA 3H1BA 2J0SA 1LKZA 1C7QA 3N5CA 2FEMA 2B4QA 1XYVA 4D3YA 1KMQA 2EXXA 1TUBA 3IQDB 4F9GA 4O33A 1V5VA 5U1PA 1J8FA 1HPLA 3N9IA 4X1OA 3THYB 3P7MA 4JMPA 5HIJA 1N9GB 1JX6A 5ECGC 4MYRA 3UIEA 4Z6KA 4BN0A 4IDDA 4Q05A 2J67A 4YT2A 3HN2A 5IP5A 1U7TA 3GJTA 2ZT8A 2AZ4A 1AK2A 2B4TO 2OC9A 4KE8A 5JSQA 2O7VA 1MO4A 3KP1A 1XZBA 1W6UA 3DLTA 1VFPA 4BEVA 3C3BA 4N0PA 1N5IA 1RYBA 1W76A 2FTKE 3BTOA 1DKRA 2R8PA 5HG0A 1A1VA 2V74B 2XXAA 5A05A 5AI5A 4IGFA 5JXHA 3ACBA 3CBQA 4ZALA 1RC8A 1GT6A 2AZTA 2YV2A 4KQ6A 3SMQA 4MIYA 2FGJA 4G9BA 4GPD1 1Q57A 3V4PB 4XGQA 3NETA 4PBSA 4ZEMA 2IGBA 1LDEA 1S6YA 3CH7A 4ZYLA 4AMYA 1EMDA 3K32A 1JJIA 5CURA 3TF5A 2HYIC 3Q1KA 2UVQA 2JLYA 4HYEA 4YA6A 3ZDCA 2XVXA 1TMYA 2CCGA 1UJ5A 2ZRMA 3FWYA 1IY1A 4L72A 5KQPA 1BZYA 3WRXC 1GL3A 1HOTA 3MMXA 2HU7A 1K28D 4YRNA 3KUKA 3NANA 1KH1A 1GUAA 2W9XA 1M74A 1O97C 3OC6A 1DS6A 3ZZ0A 2QN9A 4F93B 1E4VA 2V9ZA 4ND6A 2BM0A 1IHDA 4HYTA 3DHWC 4UBKA 2WJYA 2H00A 2CMKA 3QPUA 4RANA 4WUTA 4DHEA 4H7PA 4NKRA 2ZZKA 3NONA 4V2IA 2Q27A 4ND8B 4Z49A 3FWKA 1HLDA 4TMVA 3IBGA 4J3NA 1NQWA 1YRYE 3PZRA 5B1HA 1ZXXA 1LI7A 2IHVA 4OXNA 3I4LA 5BO5A 3SICE 3ULKA 2XMZA 1JRLA 1EFRA 4ZQGA 3DA8A 3ETLA 2NM0A 2YYSA 4N49A 5GIOE 2OYRA 2HZ7A 1E2UA 1XWFA 4HRYA 2J3HA 1I7NA 4PIMA 5ALWA 3V4OA 4B46A 1QH0A 1TE2A 2E4YA 2OCGA 4HN4B 4X5OA 2YBDA 4JSRA 1ZQ9A 4ZVLA 5KQLA 1US8A 3BCUA 3BQ9A 3H5AA 3P9PA 4CLEA 1CG6A 3VI3B 4YCNA 5CFLA 1KZYC 2XYPA 1HF3A 2ZTLA 4S0XA 2OGUA 5LNK1 1IMJA 4M1MA 1RWXA 1OU0A 3DH0A 3GZ4A 4LDRA 4O2AF 5JTTA 1FP4B 1URPA 1QXSA 4LJLA 4B2LA 4IEEA 1YQXA 1OJLA 2VT2A 4FR2A 5CT9A 2XBUA 4ACBA 3BMOA 3KAPA 2FDXA 3EVTA 1U7DA 2WZBA 4WZTA 3ORQA 5REQB 4EARA 3HO6A 1PS8A 1FFEA 4GZ6A 4QM7A 1ML3A 4D98A 4RD3A 1MJFA 2CSXA 4AUKA 2EFGA 2UYYA 3ROFA 4DKJA 2XNSA 1NBIA 1DEOA 4L74A 1C3EA 4JXKA 3I1YA 1BGWA 5PNTA 3U19A 3CR7A 4D41A 1QQBA 3LLSA 1G20A 2F1LA 3SBDA 2P77A 3WK5A 1KMCA 4TRRA 2QXYA 1TF5A 3ZGLA 1IDOA 5C0OE 4QTZA 4HH1A 4P4SA 3VNRA 1KMNA 3LL7A 4BMZA 3ENNA 1MQSA 2DWPA 1ID8A 1C1DA 3Q5DA 4YJHB 1ZUNB 3NBAA 3TLJA 2OSBA 4BO0A 5CBPB 1XMQB 3LC2O 4ZJPA 4UBJA 3U60B 1QCYA 3RRJA 1W5AA 3T5DA 3WYCA 4KFSA 2PTHA 3IQGX 1O5IA 1T9GS 2PJRA 2WD9A 4ZZIA 2OVBA 4ZMBA 2P1RA 4HFRA 2P78A 1K8YB 2OBYA 4IY1A 1L5QA 4IIBA 4AECA 4CQLA 1FJGB 1QPBA 4KBYA 3RI3A 3SEAA 3SI7A 3UXHA 4BUCA 5J4LA 2J6CA 5JNVA 2PKYX 1VCMA 1Z6XA 3A31A 3H2GA 3M6FA 4RAOA 1O95A 3IL2A 2WF6A 2WWHA 5IUKC 3TRIA 1SBQA 1T1EA 2QENA 2VHEA 4URUR 4XKJA 3RWOA 4M55A 1ZM2A 3MTAA 3LA6A 5FTKA 5I9SA 2JL1A 2O2SA 4EMSA 4ZANA 1ZVJA 5DM2A 1XZDA 2P1DA 4TKUA 5AJWA 3RU9A 3IEMA 3PEWA 2NYAA 3CCFA 3K5WA 3O92A 1JSZA 3TLCA 4DV5B 3IPAA 4DJEC 5LQCA 5TQ2A 4DSTA 1C3JA 2I8CA 3IAM6 3MLBA 4WCDA 3CMAB 2DU8A 2VYVD 2J33A 4G5XA 3R2JA 4TMFA 3Q3IA 2OV6A 4RA9B 3GI1A 1ZL0A 3Q15C 1A96A 2YZKA 3AUJB 4FCWA 5CB4A 3G8BA 1WMSA 4CL8A 2WTMA 2EX1A 3ZY6A 5EJ4A 2FUG6 4X0EA 2UKDA 2CNWD 5EZ5A 5E6TA 2NTNA 3Q3GE 1WX1A 3KJHA 1QONA 3MWFA 4JT9A 4A8TA 4EJ6A 2VCEA 3HB9A 5K0CA 5TMPA 1M34B 1IXYA 1DKMA 3IBTA 5KNBD 4R8RA 2GTIA 4IV0A 1H69A 1KJ9A 3OICA 2M32A 1XMJA 3IAHA 5B12A 3S55A 2QOEA 3GFBA 3TZ6A 4B5LA 1LV7A 4BO2A 1VHTA 1YULA 2PN1A 5ICCA 1WXQA 2F3TA 1RLMA 3ADDA 5G41A 4XLCA 4S1VA 2XYGA 4HE6A 3HWRA 4LJRA 4B0PA 1PJBA 4ZHQF 5JEEA 3KOUA 4GZLA 5DSTA 3ZZNA 4GYJA 2F17A 3W5VA 3FRIA 4IDQA 1WA5A 4HYQA 4RVCA 1ZI6A 5K09A 3ADPA 3R23A 1RQNA 4DDWA 2XHEA 2BUBA 3C6KA 5IAOA 5JPCA 3UKOA 1ONOA 4I4TA 5BR7A 5BSMA 4EDHA 4TN1A 1AQIA 3QWIA 3FM9A 4BYMA 2E9SA 1K6IA 3DBVO 3HGMA 3Q7TA 4N3NA 1QHHA 1SGWA 1R6AA 3TLEA 5A1TA 4QUEA 4QUIA 2V7QA 1M2WA 2JFHA 4L5AA 5D5QA 2BFEA 3K2IA 4R71A 1LS6A 5CX1A 3JWGA 3TYXA 2OZPA 1EAYA 3E81A 2R8RA 3ER6A 1XCOA 4U4AA 5FADA 4QRHA 5JQGB 5AHWA 2POQX 4MZDA 4WDQA 5L3SA 2P27A 5A03A 1SOWA 4L5IA 5KSOA 3MTGA 2RAPA 2VIIA 3FDZA 2C58A 3PA6A 1IHPA 3KJGA 4ERNA 2PXHA 4YP0A 3A35A 2VHQA 2YMQA 5JZ9A 4NCIA 1SM4A 1L7BA 4JI5B 3TX6A 3FKSD 3NHSA 5BR1A 1FP7A 1GG9A 2F64A 1CJBA 5BOVA 3MJSA 2FX2A 1A9QA 4IRMA 4ND7A 1RWNA 5JR3A 5K99A 2Q5HA 1MH1A 4Z4TA 5B64A 3DDYA 4NYJR 4AQYB 1CEQA 3B9RA 3SM9A 2XKAA 3A4VA 1ISRA 2FR8A 3GZTB 4N03A 4UCWA 3VZQA 1O58A 2WF7A 2C1EA 3LLCA 3PUXA 2X0DA 1CR1A 2KQUA 2ZPUA 2FK7A 5EEGA 4N5IX 3T53B 2YL2A 4US1R 1NW5A 3UMCA 5I47A 1KIFA 4HLUC 4KRYA 3PC3A 3THYA 5COBA 4C7OB 4K9PA 4ZP1A 1N9GA 3S2ZA 4AKTA 5THKA 3SOZA 3W3AD 3D31A 3ZXSA 821PA 1SHJA 5I45A 4WD3A 2A78A 4F5EA 5KOIA 4L3VA 5KQMA 2P6UA 1JHYA 3U7HB 1L5VA 2IIVA 2YZGA 3T3HA 1HDOA 2NZYA 3CLRD 1ZI9A 2Q2NA 1TU0A 3OY2A 3QQPA 5JS7A 2O5CA 2FFRA 3C5EA 5HHTA 2N75A 3ND8A 4WJLA 3PUMA 1XNGA 4CT5A 4TZ0A 4CXMA 3WLPA 3REOA 5DRYA 3FTEA 3TBHA 4ZAGA 1V8DA 5A5EA 1CUYA 1KKUA 1AXEA 1PLKA 5BSHA 4W1RA 5BSKA 1XQ6A 1NI3A 5JNWA 2ZBDA 1DAGA 4OK5A 3ORRA 3NCHA 3PX3A 1CJCA 2QQEA 1UJNA 5M3BA 5CFNA 2FQYA 1HORA 2YJZA 5BN5B 2WT4A 1Y6QA 2XUKA 3HZZA 4RVGA 1EESA 3GZJA 3MCTA 3MTEA 2IT1A 4P2BA 2ZJ4A 3CM0A 4TSFA 2JF0A 1RIIA 4CTOA 4WLUA 1ZESA 2G06A 4HQ6A 3O90A 1P19A 2WHYA 3KT6A 3RBAA 4PXAA 4E46A 3PR3A 4YIHA 3EZLA 3FNBA 1T5LA 3ABQB 3KTOA 3ZUGA 4KQ9A 2OE2A 1TM4E 1Z25A 3F5FA 3E3OA 2X9NA 4HBGA 4XVCA 3DDOA 2ZUWA 2P41A 4UE6A 2KX7A 5GJWC 4EHJA 3BILA 1RI4A 1FTNA 3FTFA 2I62A 4ND8A 1U8UA 4OQLA 1A9ZA 2YFKA 2RIPA 3DWIA 4PG5A 3DFIA 3IXMA 1AOXA 2EP7A 1HLGA 2PH5A 2XF2A 1KVRA 4BKPA 2J4CA 2Q49A 3D59A 3HN6A 4HIZA 5U9CA 1WY5A 4LXUA 1RTKA 4BNHA 2G63A 4JT4A 1WPRA 5F9FA 2I7CA 1E3DA 2OILA 2EC5A 4HDSB 3PGA1 4ZU6X 4HR7A 3UICA 3ROPA 3AW8A 4LOKA 3V7YA 4NOLA 3FHOA 1E3MA 3QX8A 4FNGA 4CF4A 2QG4A 2NPOA 4CLDA 4XR4A 1HOXA 1I1NA 2VRCD 4HDAA 5ALGA 1DHTA 4DBLE 2QUIA 4UM7A 1KSHA 4P0PB 5GV7A 5DTIA 1SWWA 3WGIA 3OJXA 1BVHA 2VQ3A 1FP4A 5AVVA 4RO0A 1DC4A 2JJQA 3OCYA 5DXJA 3SS8A 3T4UA 3A6KA 3DL7A 3RT9A 3ILHA 5CVVA 4UC0A 3CG0A 3CRMA 3ONNA 3AKDA 1RE0A 3SEQA 3NTLA 4MVJE 4PZZA 2HQRA 5REQA 2C03A 4X7EA 2QG9A 3EBLA 4FIZA 5HBGA 1K8AD 3WLTA 1DBPA 4HWTA 3ZWBA 1CUXA 2XDAA 2XI4A 3SYRA 3NHRA 1SU7A 4WWHA 4YREA 1C0EA 2V6IA 1NUSA 1LD3A 3OZFA 2NT3A 1GNLA 1NN1A 4O29A 4XM2A 4DJTA 1L7AA 5F7XA 2HW8A 2OEPA 4BIMA 3IEXA 3NR2A 4CV1A 4C76A 3PXBA 5JYDA 3L46A 2NXJA 4FMCB 2F3SA 3L9XA 4N18A 2I67A 4WESB 5G1PA 4J9UE 3PE4A 4PINA 4LF5B 3BEDA 4YJHA 1ZUNA 2YVAA 5CBPA 1K66A 1W1UA 4YQYA 2NNLD 2G6TA 1JT2A 4YS6A 1MG0A 2ENUA 4DZZA 1T8RA 4NJOA 4P33A 1GVNB 2BAGA 2AVDA 3H4TA 1FS5A 1KO4A 1G9SA 1XO1A 1GGKA 1FTQA 3HKCB 4GUDA 1AURA 3L7AA 4AY5A 4YP6A 1BVUA 2QN8A 2O20A 2VQDA 3OEEA 1T5BA 1TJPB 1J9GA 1DWOA 3DVSX 1RXWA 4YRGA 2G04A 3HVHA 3RBZA 5LMNB 2AWOA 5D6OA 3KPJA 1PK8A 1KR5A 3IHWA 4E5NA 1T43A 1GPWB 4I5GA 2NOAA 1NF9A 2QAGC 1IOVA 2IODA 1VTKA 3D3JA 3MTQA 2I2BA 2YKGA 1Q17A 3DF9A 3IIMA 2YHSA 5HTOA 1Y1SA 4JLJA 2WTBA 1D8TA 1TAUA 1HYGA 2MMCA 2R7MA 3CLUC 2OXFA 4HAOA 1NRIA 4O0LA 3B51X 4D4IA 3HVIA 3MZ0A 1YS2X 1IJBA 2IEIA 4K81B 5J63A 3HC7A 2O9JA 4TYPA 5EZYB 1SK8A 3NASA 3PU6A 4Y2RA 1N2HA 3RS7A 3VYVA 5H68A 3WL5A 2VXYA 4OI0A 4IQGA 5IXJA 4KQXA 4FDMA 3D6AA 4QGBA 4HX9A 2JIMA 4MUHA 5HFJA 1DBIA 1Q2XA 2P9EA 2OV8A 4XOIA 5KDDA 1VYHA 1THGA 3RQIA 4HNQA 2JHAA 3ZJVA 4BB9A 1M34A 2FMHA 1RHMA 3L4SO 3MS2A 2JGIA 2ZIUB 2RHLA 1BHQ1 1S7CA 2AEJA 3K2EA 3OZUA 2JGRA 4P12A 3C3DA 1ZK4A 1BKSB 3CEHA 3JQDA 3OIUA 4Q19A 1BEEA 5CM9C 5EN4A 2NSLA 4PCUA 2D1SA 3CT6A 3ESQA 4NPHA 1MXFA 5FAKA 1ECBA 1Z6QA 3QX9A 1J25A 2PDAA 5CGZA 3BAZA 4YR7A 4P36A 1W5SA 2WLTA 3TZBA 4ENVA 5J2UB 2UYGA 1NBWB 4Y98A 1L7DA 2D7DA 3DDUA 1E1CB 3DEIA 3GZNA 3FD8A 2V7PA 3SHVA 5CHEA 3HJCA 2V96A 2BGNA 2VF2A 2XNHA 1Y3CE 3P8ZA 3RRNA 2XB2A 2TMGA 4OQNA 2G36A 4XQGA 1E0JA 1VJDA 3RIYA 4G07A 1FDWA 3KYJB 5INTA 2ETVA 4ESHA 3NBYC 2PT7A 1JHDA 1U9YA 1R6DA 1JI0A 3H75A 2P11A 3DOCA 3N0XA 3R3JA 3U3ZA 1TJ5A 4EA6A 1KQSB 1U3DA 2RI1A 2R8BA 3L4BC 1BO6A 3W4KA 2OESA 1G98A 3R3UA 5ETJA 4GI3A 3NUZA 3Q6NA 3LT2A 2MINB 4RHFA 2DBRA 4M1WA 3SEZA 4X62B 4OP7A 4C4SA 3E03A 3EPKA 3R6KA 3KKNA 4TSRA 1GO2A 3FTNA 4C6RA 2JFVA 2AEEA 2ZR7A 3QU2A 3GL9A 3GLRA 4ARZB 5FL7A 2PYDA 1G55A 3M3HA 3VAYA 3WE7A 5JY1A 4G9EA 3BWYA 3FPFA 4GH5A 2GR9A 4KX3A 3CF4G 1RHRA 4B4UA 3E53A 3ITKA 3SIRA 4UNRA 4CF3A 2P2CA 3ZG6A 1QBGA 1E4YA 3UENA 4NMXB 3RR2A 3NIDB 1OBHA 3EIUA 1UXHA 4D02A 1ORTA 2Y1KA 2RG7A 3EXIA 3K0BA 4TL6A 2JJ1D 1ULSA 1XXHE