1KK3A

Structure of the wild-type large gamma subunit of initiation factor eif2 from pyrococcus abyssi complexed with gdp-mg2+
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
405
structure length
398
Chain Sequence
SRQAEVNIGMVGHVDHGKTTLTKALTGVWTDSEELRRGITIKIGFADAEIRRCPNCGRYSTSPVCPYCGHETEFVRRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTVAENAPIIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSFDVNKPGEKLVGGVLGGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGVGTKLDPYLTKGDLMAGNVVGKPGKLPPVWDSLRLEVHLLERVVEQELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIEVKLQIPVCAEPGDRVAISRQIGSRWRLIGYGIIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The large subunit of initiation factor aIF2 is a close structural homologue of elongation factors.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Translation
molecule keywords eIF2gamma
total genus 98
structure length 398
sequence length 405
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk3A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk3A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kk3A01
4MKIA 2W2TA 4LHXA 5TR9A 4I99A 5IHPA 4IDNA 5FUXA 4TMKA 1Z29A 3MHPA 1YVDA 4MUAA 1FX0B 2LCFA 4IDQA 1W7AA 1ZD9A 3B1ZA 2O8DA 3TKLA 2WJGA 4PX9A 4FMCF 1AS3A 4PPFA 1OT3A 3WP0A 2YWEA 4XIGS 1F2UA 4E09A 3AUYA 2QSZA 4C4PA 3PQCA 4LC0A 5DH9A 5DYIA 3ZVRA 2QP3A 2RH5A 3I56B 3QVVA 4OI4A 2PT7A 4F93B 2GXSA 5DISB 4TSFD 3B1VA 4G5RA 4DEYA 2G88A 4KSCA 1KYIA 3THYB 1M2OB 3IHLA 3TUIC 3X1ZA 4IVRA 1IN5A 1OSNA 2IYZA 2VSXA 1E2NA 5L3SA 2ZVQX 2P65A 4FI3C 1EK0A 1YR9A 4YMUA 2NGRA 2WJYA 1CJMA 5EJEA 3A1VA 3G6EB 4YDHB 4MGYR 4NONA 2C8VA 3ADDA 2ZRJA 4Q7JB 2E87A 2KBFA 1UBCA 2E9SA 3O8DA 1YHNA 4LJYA 1GDDA 1NJID 5FUWA 2OILA 2PX3A 1W48A 4A9AA 4EPTA 1NP6A 4PZLA 4DEXA 4JJKA 3GLGB 1OXTA 1EFRA 1II0A 3AQ4A 4FMBB 4ESHA 1G3MA 3AH8A 3RHFA 4GOKA 1WBDA 1G8YA 4BPRA 3RRMA 4TQAA 2HT1A 3QPUA 4URXR 1VCIA 2ZETA 2KB0A 3THXB 5B2ZA 4TT3D 3W2FA 1CS4C 4UJ3A 4PAOA 3U6KA 2YWGA 1IN4A 1CU1A 1F20A 2ODBA 1KY3A 5E95A 1EFTA 1TL7C 2NO6A 2QE7D 1JXOA 2ZUBA 5JWHA 1AN0A 2GPJA 2WTUA 4C0KA 4C0SA 2PT5A 1PUIA 2MSEB 2IBMA 5G3ZA 1JJ7A 1KIMA 3K9NA 3N2IA 1BX0A 1J9ZA 1SKQA 3BE4A 2W00A 1G8GA 3LV8A 2PBRA 1S72B 2WMNB 4OHYA 1IHUA 4YDSA 5TB5A 3DZ8A 1N5KA 4FCVA 4DDWA 3BH0A 4NCIA 4Q4JB 3ZZ0A 3CF0A 3QKRB 3VKHA 1R6BX 1CP2A 4JSTA 3KL4A 4HZUB 5J4VA 4G1VA 5KNBA 2QAJA 5KNDA 4IFEA 2R44A 2H5EA 4HAVA 4GMXA 4WZ6A 521PA 2J0VA 2D2FA 4NYMQ 2DPXA 3TIFA 2BM1A 1ELOA 2BCJQ 2ZRHA 4G5SA 1LFDB 1HT1E 3EIQA 1P5ZB 3SJBA 421PA 2C04A 4Q01A 3RC8A 1VCOA 5JJIA 1KI1A 3I4LA 3HPQA 4Y0VA 2PCJA 1W87A 4AY2A 1Q82D 2GJ9A 2IK8A 1SXJD 2UKDA 4ZI2A 2BKUA 2V7QD 1JQLB 1R8QA 2OE2A 2G6BA 2FSHA 3B82A 2B8TA 2ZJYA 3L8YA 2ZJ2A 4MYCA 1RZ3A 1OYWA 3IEUA 2O0HA 5JBQA 3U6BA 4Q00A 5FOUA 1MKYA 2BBTA 5CDFA 2VHJA 2ZS9A 3OZUA 3ZBTA 1YITB 1I2MA 1XFAA 3NC0C 4TT3A 4AYXA 4DLVA 4Z51A 1DDGA 1X8LA 1ZUHA 2BVNA 3QE2A 1Y63A 1TQ2A 4QHYA 5DYGA 1W0JD 1DDIA 2ZE5A 4DLTA 5C46F 2F9MA 4HUQB 4ZIRA 1W1WA 1QHSA 4DUGA 3EZ9A 2JLWA 4ASUA 1OJLA 3VO1A 3HP1A 4MYHA 1FNCA 2QGZA 2O5VA 2CXXA 2ZQ5A 1N6NA 4KSBA 2EYUA 2BPOA 3EWAA 4ZGQB 3WRYC 1FNNA 2ZREA 4CT5A 4XSHA 3GLGA 2IX3A 4IRUB 2QRNA 1U98A 2H18A 1QHIA 5G41A 3I73A 1G7CA 5FI1B 3SBDA 1VTKA 2CNWA 1E32A 3QKTA 4TYQA 3U3KA 2XZOA 1M8PA 3EARA 3NH6A 1TF2A 1W44A 1KO7A 4MDEA 1CR2A 3CB4A 1XMJA 4FMDF 5SZKB 4UNQA 4GZLA 4Q03A 1TQ4A 3C7KA 3T1QA 1ZUIA 3GEHA 1U90A 3K0FB 1PUJA 5KHOC 3EX7C 1ZM3A 3U5ZB 2ZJ8A 3GFTA 2JASA 4V0NA 2WSMA 3TSWA 2VP5A 4FWTA 2XX3A 3ZIAA 4TYPA 1RKBA 4ZO4A 2WIAA 5KDLA 2BMJA 1G3RA 1P72A 2ZUCA 4RVCA 3O8CA 1EP1B 4ACAA 1N6IA 3B1XA 1YJ9B 1XTIA 5F98A 1GFIA 3P27A 3FMFA 2XEXA 3GEEA 3QXSA 1E62A 4CGZA 1CLUA 1FZQA 2ZRDA 4UNNA 4W5JA 5E4FA 3Q9LA 2XNDD 2GAOA 2C77A 3MWYW 3C15C 4HLCA 4D4KA 3GFOA 4QOSA 1CR0A 2NIPA 1OHHD 4QGFA 3T35A 3TSZA 3RS5A 4B3FX 2C03A 2FPLA 2GCPA 3KUDA 3U3MA 4BPBA 3EW9A 3C8UA 1NVVR 3LX8A 4LPKA 2IXEA 2QTHA 1X1RA 2J7PD 3L82B 4FMDB 3AVTA 5TMPA 2RC5A 3I5YA 1RRPA 4TZ0A 4QBFA 1N0UA 1OH5A 5CYPA 4XD7D 3NC1C 2CNWD 1OH7A 1G4AE 3VFDA 5B58C 2ZRBA 1H8HA 1E4VA 4G3XA 1W36B 4LBVA 2HDNB 5KU1A 3NEJA 3D31A 3UWOA 3WBKA 2FJUA 5DO9A 1EP2B 3MJRA 2VIIA 4P4SA 2A5YB 3QXXA 4ZDWA 4B2PA 2GXUA 2BMDA 1UKYA 3WNCA 1P73A 1GKYA 2EYQA 3T5DA 2QE7A 4TL8A 3RABA 4ARZB 1WXQA 5E7IA 4DSNA 1XD8A 5CM8B 1J2JA 4Q4AA 3JQQA 2G0NA 1W4BA 1ZVQA 2W2VA 4AD8A 4FCTA 2RKOA 1S1MA 4I1VA 4DUGD 3OEED 2BJVA 1E2QA 2Z0MA 3CMAB 4HUTA 4FD2A 1E2HA 4F4IA 3R9IA 5JHHB 1X6VA 4P33A 2VHCA 4B3BA 1COWD 1ZCBA 1VQ4B 4JVMA 1S2MA 4K46A 2GRJA 1EFUA 2G1KA 1UBGA 2H8KA 1G3UA 1RFLA 1FNDA 2ZI9A 4AIIA 2IXGA 3B60A 2WIBA 5KPDA 3I5XA 3ICQB 1AQUA 3EZ6A 2Q9AA 2Q9BA 4JVLA 2FZ4A 2IS2A 2GCOB 1KDRA 3SYNA 4BZPA 2WMOB 2P6RA 2YHSA 4GZMA 1HURA 2IUTA 3GJ4A 4OHZA 3T1OA 5JZVA 1CJKC 2XXAA 1P3JA 3U7FB 2VO1A 3I62A 4BFUA 3CNOA 4W7SA 3BJIC 5JFGA 1H42A 2V54A 1F5NA 2XNJA 2F1IA 3RRYA 3TUJC 4QNRA 2G9NA 1T9HA 2ZAOA 3ZYCA 3QSYA 1E2LA 1BX1A 3O47A 3CH5A 4PANA 4KFUA 1NLFA 2OXCA 2AXPA 3ECCA 3LLUA 1E2EA 1A8PA 1IM2A 5HZKA 4QM7A 3VR6A 4OK3A 4Q47A 1V43A 4D4LA 1FL9A 4RJLA 4M1MA 2F3RA 3VQTA 2GCNA 5KSOA 1Z0AA 1UEIA 1D2MA 2BHRA 2O8FB 1VQKB 4D81A 3ZLJA 1P4SA 2ZRPA 1P9WA 4C30A 2BBSA 1SXJE 5E3HA 3BBPA 4C0AC 3SBEA 4ON9A 5D3QA 4DLSA 3LAWA 3L8ZA 2YV5A 1G291 5CM9C 5ELXA 3VHLB 3CC7B 1UKZA 3NXSA 1XBTA 3QEJA 4TTRA 2ZRGA 1U8ZA 2H17A 2OBLA 3GJ6A 4GP7A 2FH5B 5EE9A 2WJHA 3KZ1E 3ZD6A 4KLNA 3SYKA 1OXXK 2PMKA 4B32A 1O3YA 1ZM9A 2J0UA 3HPRA 3CCQB 2Z6VA 5L3QB 4XVUA 1MRNA 3DO6A 3KQKA 3ZGXA 3U44A 4URVR 4A0RA 4ARZA 5EXPA 1P75A 3GEIA 4DCSA 1QG2A 4L9WA 5FPSA 3V9PA 4DHEA 2IYSA 2ZROA 3VX3A 3GD7A 2B8WA 1G7SA 4URUR 2QAGC 1N5IA 4Z8YA 2R6CA 5GADl 1Z08A 2F43A 2CL7X 2OAP1 3R7WB 1KI4A 4NZYA 4US2R 3ETLA 5HXBA 3VNUA 4I1UA 1CF4A 4UNRA 1P2SA 4IDOA 4TTQA 1ESNA 2F6RA 2AKYA 3EC2A 2JATA 5JS7A 4B47A 1W36D 1WQ1R 4B33A 2GZHA 5D3MA 1TVCA 5FOXA 1N25A 1CKEA 2D62A 3R8CA 1G1MA 1KZ7B 2EU8A 3EZ7A 1VQLB 2P67A 1KSFX 1NDHA 1XX6A 2QMHA 3Q7PA 4US1R 5DI9A 2BEJA 3IBYA 4U00A 1ZD8A 4H1VA 2P5SA 5DLQC 2DBYA 1DAHA 4CVNA 2VP6A 4C9BA 5DN6A 5CIQA 3OZWA 2O8EA 4GMDA 5F2EA 2DFTA 4QBHA 4R2IA 4US0R 3THWA 4RCZA 3OIUA 4Q4HA 1Z63A 1TF7A 3CRMA 3PIRA 3FB4A 4NDZA 4U02A 1KOFA 1XTSA 1NI3A 4HAZA 4LC1A 2REXB 1SVLA 2IEZA 5KSPA 3CCSB 1Z3IX 4IXMA 4PQYA 4I1SA 5HCIA 3Q7QA 1R5OA 5F9FA 4PHGA 4MYUA 2VRWA 4XH9B 3HYRA 4TTPA 1AK2A 4X8OA 4URYR 2ANCA 4PO8A 1DS6A 3GLHA 1VQ8B 3K70C 3CNLA 4V02A 1JJ2B 1OFTA 1RYFA 2QN6A 5FUVA 2QU8A 2ZJAA 3LFUA 1E1RD 5DHFA 1SKYE 1UPTA 821PA 2JDIA 4YC7A 1YZQA 1K5DA 2WKRA 1Q3HA 4DDTA 1QX4A 4JLOA 4ZCMA 2WWIA 4GT1A 1BKDR 3GLHB 4PHTA 4RZUA 4ZKEA 1II8B 3LXRA 4D0NA 3SJZA 5A4JA 2R6DA 4MGZR 4DLYA 1R5BA 2YOHA 2GETA 4BUJA 4A8JB 2ATVA 3QFSA 2QBYA 1NSFA 3QY0A 1G7RA 3PXGA 2AWOA 3X1WA 4DT1A 2W58A 2EFDB 1XJQA 2ZR0A 4HUQA 3CM0A 4ZIRB 5GJCA 5BN3A 1DEKA 4LV5B 1W35A 1T5IA 3LVQE 3MRSA 3RS7A 2ERXA 4PO1A 4PSKA 1BJKA 2OLJA 3I1FA 4TLBA 4RY2A 4B75A 5EE5B 2FGKA 3FHCB 4GOJA 5LB4A 3PEYA 1FP6A 2ZJBA 4Q21A 3IO3A 4GBMA 1VQ5B 1KY2A 1JR3D 1MO3A 2I1VB 5CJPA 4LDJA 3T5GA 6Q21A 4O3MA 3MWKA 3K9LA 2IYUA 1XDBA 2QTZA 4PAMA 5J4YA 3NHAA 1Q86D 4HB0A 4V0MA 4U7DA 4IDHA 2QTFA 4RKEA 5C4GB 4IVPA 4LCBA 3C41J 4BQSA 1T3LA 2QPAA 1XB2A 1E96A 3MLEA 3UMFA 1NNEA 3RWMB 1TADA 3H1TA 4BFZA 1KZGB 2BMEA 2JLXA 4S2EA 5EP4A 1VECA 3Q8XB 2WOOA 3G71B 4G5OA 4TN1A 1M6NA 1UJ2A 3CLVA 4M8NE 4B2IA 5AJXA 1YR8A 1U81A 1VYUA 4HZUA 4DKXA 3U44B 4M1OA 4FIDA 4MA4A 5KDDA 2HCJB 4B44A 2NMVA 1BMFD 2VNKA 4BFTA 4Q4JA 3LO8A 4WBSA 3VU9A 1S1CA 5GV8A 3PEVA 4F7DA 4RD6A 1ZD1A 2ANBA 2P0EA 1NRJB 1KK0A 3BXZA 3IO5A 4XWAA 3I3SR 2ZSAA 3NBXX 1VMAA 2J45A 3U4QB 3CRQA 5ANRB 3BD9A 2XB2A 4Q9LA 3OE7D 4OQLA 4BECA 4XTRA 2V1XA 4EFNA 3NWJA 2JLVA 4PR0A 1N6HA 1OXVA 4B71A 5FL3A 4G1BA 1KJYA 5BW8A 3EG5A 3A4NA 1TUIA 1K9MD 3IIKA 3NHBA 2FFAA 2GK7A 3UATA 1XMIA 3ZH9B 1D2EA 1HYQA 1NLYA 3KJIA 2AKAB 2PEYA 4HB3A 3RSLA 4LV8B 4TL6A 2ASEA 1E2GA 4U9UA 3IKJA 3SC3A 1Q21A 1D8TA 2ODNA 1OF1A 1T4GA 3RRZA 4V0LA 1Q57A 1HTWA 1JR3A 4DLRA 1GO2A 1QZXA 1WA5A 2R6GA 3A36A 2ZM5A 1FW6A 4RZXA 1Z6TA 4I4LA 1JEDA 4KHZA 1DTSA 1T0JB 5J4HA 1R4AA 1E9RA 3QG1A 3SFZA 5FOTA 2N1BA 3DHWC 1QVAA 4V0OA 3P1JA 5FH9A 2XZLA 1DELA 1G3QA 3PV0A 3VMFA 1FP7A 3WMEA 2MMCA 3AB3A 4WW0A 4LHYA 2CNDA 4UXHA 4C0BA 4LZZA 1T91A 5FBLB 1XD2A 1Z2CA 4B35A 4I1OA 1SGWA 2DYKA 3D8BA 4MQBA 2EWVA 4DB4A 1Y3AA 5EE1A 1QVRA 4Q7KA 1K8RA 2E1RA 1G16A 1SXJC 1JAIA 4PZZA 4B34A 4J0QA 3OIYA 5DI3B 3FJOA 3BAFA 3TVDA 4TLEA 2L0XA 3LA6A 1D6JA 2PZGA 4NYIQ 5FPKA 5JS8A 3FTQA 3EWSA 4RD3A 4GOXA 3BGWA 4LYJA 2YZ2A 3AKYA 4OK5A 4QKQA 2GQFA 2ZTSA 1II8A 5JJLA 3OAAA 5HE8A 2X1VA 3TSOA 1KI7A 1XCMA 1ZNWA 2OCPA 4LJ6A 4CF7A 1WB9A 5H5JA 4BWYA 1AS2A 5FBRB 4L15A 4D4MA 1OIXA 2ODEA 2R6FA 1AZTA 3SDZA 3GMTA 2BEKA 3MG9A 5JJKA 3AVOA 1EFRD 4JS0A 4WA7A 4EPRA 1M34E 1W46A 5KSZA 2DFLA 4CEHA 3CX8A 1ETUA 3E1YE 1KO4A 1GRRA 4M53A 1QRAA 4NE2A 3AGPA 2BMFA 5CLQA 5FOWA 2QMEA 4YXWD 1E2DA 1WF3A 1SVKA 2LKCA 3D3QA 1DAMA 2WV9A 5J5CA 2QAGB 1SVIA 4OK6A 1MO6A 2J41A 1ONBA 4UXIA 4HEJA 4MRPA 1QFJA 2Z4SA 1KQSB 3TVTA 3CH4B 1GVHA 3RANA 3WYFA 3OEHD 2OXRA 4CRWB 1HY3A 3SI7A 2X3UA 4RZ2A 3PR1A 2HEIA 4Q18A 2VSOA 3DVLA 1DG1G 5H1YA 2PEZA 1P2TA 4HLDA 1Z6YA 1RJ9B 5FTKA 3QF4B 2QEXB 2GJ8A 5JHGB 2FSIA 1XF9A 3QEOA 4MRSA 1N3BA 1E9DA 2NQ2C 2QROA 1JALA 4OHWA 1VG1A 2RGXA 2VHQA 1YJ5A 3VR3A 4OQNA 3CZQA 5IDVA 1XPRA 1S0UA 2VHTA 3T15A 2IYQA 2JLQA 1G3IA 3TAHA 1PV4A 1GSIA 3SS8A 1RYHA 3EPKA 2WWYA 4NCKA 3WMGA 2GA8A 4JIMA 3W34A 1CIPA 4W9MC 2F7SA 3SZRA 3KJGA 3CKLA 1XCGB 2D7CA 4GI7A 4LHWA 1RPZA 2WKPA 4DB2A 1JEEA 4EQ6B 4NPHA 4BLRA 2Q3FA 3QFRA 2NTYC 4JLVA 3LBNA 1DAKA 1YZUA 2HT6A 5JEDA 5HE9A 3MSXA 4EPYA 5HZHA 1Z5ZA 1JPJA 1Z6XA 2CDNA 1VQ9B 1A1VA 2O8CB 4IOKA 1IONA 1XEFA 3R9WA 1E2MA 2DETA 3CR7A 4NCJA 1WDTA 1JPNA 1FPMA 3GJXC 2ONJA 3SQWA 1YZKA 2VP2A 1KMHB 4ZDKA 3W5JA 1D1NA 3KKMA 3EZFA 4KITB 1G19A 2GVZC 1CXZA 2V55B 3A4MA 4Z8XA 3T06B 4BEBA 3L2OB 1E1QD 3L0PA 1SVMA 2ZVPX 4A0FA 1Z06A 1A7JA 3LLMA 4IEIA 1E6CA 2B7BA 1NMXA 2PZEA 5FI0B 3IUYA 5FA6A 2XJ9A 3IQXA 3CR8A 2H7VA 4P31A 3GJ7A 2GHIA 5HCNA 1ZC3A 2V9PA 2VSFA 4B3DA 3DKPA 2BOVA 1JJVA 2H57A 2OT3B 2VP0A 3ICEA 1HEIA 1QFYA 4R2HA 2GTPA 4MGKR 3EC1A 4DIEA 2D74A 1AQYA 1S3GA 2O8FA 2YWHA 1ZMXA 1FUKA 3QFCA 4C43A 2EVWX 4MKHA 4PQFA 4PPQA 3QBVA 2IS6A 3KFXA 4QJ3A 1CNEA 5EXSA 4JVNA 3DOFA 3AF0A 3QG5A 4BFSA 5A5GA 1XWIA 2XNCA 3KQLA 1WBBA 1NBMA 3LVRE 3AP1A 2DWOA 3PG5A 4HDCA 4DIDA 3T1VA 3HU1A 1Q22A 2FWRA 2HXYA 4CEJB 2GBLA 1GVNB 5EP1A 2GJSA 3TAUA 1YZLA 1P6XA 2IXFA 2ONKA 3ADCA 1G7TA 2D4HA 3I61A 3K8YA 5JWOA 5TV2A 2QP4A 1IY2A 1UADA 2NZ8A 1VQ6B 3RVBA 5C4MA 4LHVA 1XTRA 2ZJOA 3RS2A 3VR4A 1GAQA 2XJ4A 1E63A 4AI6A 3FFBA 2C2HA 2RMKA 3CPWB 2OFXA 4BRWA 2IS4A 2X8AA 4OI1A 3UXMA 2ZRMA 3VR1A 3GJ3A 3AEZA 5KTYA 3DKVA 1U0LA 3N70A 2YKGA 1SHZA 3JVUA 4JVSB 4L4UA 4E03A 2SHKA 1OKKA 2V7QA 2OEPA 2FZLA 1VQNB 3UWKA 1OB2A 1W2BB 3AVWA 3GPLA 5LBIA 1YJNB 1FQKA 4D80A 1VG9B 5AUNB 2PMDA 1GR1A 2YYZA 1EWYA 1M7GA 4PGOA 4AK9A 1MV5A 3H0KA 4M9QA 4BRUA 2FOLA 2D06A 4N0DA 3L43A 1OLOA 5FR2A 4Q4AB 1VDZA 4LSGA 5EUMA 1VIAA 1N6PA 3G5UA 2ZR9A 4BLSA 3K0EA 4NYJR 2UVQA 1N6KA 4KXFB 2BMWA 1AKYA 1G21E 5CIWA 1E0KA 3V4RA 2IF2A 1RRFA 1GITA 1EWRA 4FINA 3THXA 4EFMA 3BK7A 2HJVA 5BYKA 4A8JA 1OFHA 2C9YA 3EXAA 4PFSA 5B64A 2IHYA 4RD4A 2FFHA 1HH4A 3O8BA 4JT2A 2ZRCA 3A58B 1E1QA 1M90D 1E79A 1G4UR 3N5CA 1IXSB 5GJBA 2DR3A 2XOKA 3PUYA 3CMEB 5BYJA 1D9ZA 5C2JB 1EGAA 1NVVQ 4U5XA 1LY1A 1TLLA 4IJMA 3KTAB 4TLAA 3SJCA 3WP1B 1FNBA 2J46A 2BGJA 2FG5A 221PA 3ZIAD 1FOEB 2IHBA 3HR8A 3IPXA 4KVGA 1CULC 1UMKA 1G41A 3CWZA 5JSZB 3W90A 3TW4A 1SQ5A 3GP8A 1KI3A 2FSGA 2G3YA 3ZVNA 4LPSA 2ZRIA 2QSYA 2QY9A 3U2QA 1DOAA 5H59A 3ZQ6A 4DJTA 3PJRA 2DB3A 2W6ID 3CC2B 4OJQA 1YR7A 2NO1A 4TYWA 2A5JA 1UAAA 5G53C 3NBZC 1F48A 4HZIA 2O52A 2OZEA 5CK5A 1PVOA 4DVGA 1Z22A 2PH1A 2OSBA 2WSSA 1QVFB 1F60A 2V6JA 2ZJZA 3K09A 4D0LB 2WJIA 4JLJA 4WZAE 1W4RA 1FX0A 4CW7A 3RWOA 1AZSC 2I3BA 3K0FA 1UDXA 1OXUA 3B5JA 2EIXA 4IHQA 2XXAB 2W6JD 1TX4B 2ZR7A 3LDAA 1KMHA 1X1SA 2OCAA 2NO0A 3I8SA 3B9QA 1DG3A 4KU4A 3JZAA 1H65A 3ZBUA 4X8LA 2DFNA 3A6PC 4ACBA 4P0TA 3K0SA 3GLFA 1LV7A 1JI0A 1TF5A 4RSGA 1GL9B 4B74A 2REBA 4TZ6A 5JCPA 4JL5A 1CNFA 2DERA 1KSGA 1ZNZA 1OH6A 3KKNA 3QXHA 3LY5A 5FTNA 3RS4A 2DEUA 2FU5C 3W2HA 1RRCA 1QG4A 3A8TA 4RKFA 3TW8B 1I4TD 2FF7A 4B43A 1YJWB 5C18A 3IPYA 4CEIB 4MRRA 2WBLC 4NYIR 2HF9A 4QC2A 1RC8A 2BGIA 2C9CA 4AF6A 1NN5A 4Y7CA 3KXKA 5FOSA 4D2IA 2QPOA 3FMOB 3FKSA 3AVUA 1IBRA 2FPMA 2ZRNA 1L4YA 2AX4A 1DADA 2J5XA 4CZ2A 1NL3A 1DAIA 3TH5A 2DWQA 1EFCA 4ITRC 1YZGA 2A7QA 2F1HA 2RGBA 3MMPA 1UM8A 2BCGY 1UEJA 2GWHA 1GNQA 1US8B 3LXXA 2WWXA 3DEFA 5TDHA 1NMZA 2ZEJA 3BB3A 4AKGA 1T8UA 2AFIE 3Q85A 5H70A 2W0SA 1SKYB 3A1UA 4M1SA 3VHXA 3K0CC 4B76A 3QE0A 5BN4A 3UG6A 1SZPA 2JLYA 1Z28A 1N6RA 1FMJA 2JEOA 3IBGA 4O2LA 3G4SB 4QGGA 1F2TA 4AKEA 4NH0A 2G0TA 2W6JA 3EPLA 2OFWA 3CCVB 2ZIAA 2R2AA 1B0UA 4B4DA 2VNIA 4D82A 1RVDA 4C2UA 4MKFA 3CNNA 1NKSA 2B5OA 2QMUA 5TARA 1FMLA 1CRQA 2Z43A 1BH2A 2KBEA 3CCEB 2O8BA 1T3SA 2R62A 5FUYA 2NG1A 1E3MA 5DGXA 5LB2A 2KSQA 4S35A 1TQ6A 2GK6A 3A37A 1MH1A 4BZQA 3ZVMA 1KHTA 1Q1EA 2ZS8A 4F4CA 3AVXA 1LS1A 1K6MA 3CPEA 4A82A 3FPKA 4IDPA 3NVAA 2QT0A 1CEEA 1KI6A 3KQUA 5JRZA 5KDOA 1T6NA 2KE5A 1II9A 2GF0A 3WHKA 3OAAD 1KAOA 4GSYA 5JI2E 2CHGA 5K8TA 2ZANA 4BLPA 1Z47A 3RDPA 2QEQA 2JJ1A 1TPZA 2GEUA 3QVUA 4KFTA 3SR0A 3QKUA 5KOYA 5CJ2A 2RCNA 3RLFA 3W5UA 4LJ4A 3AVQA 1IN7A 2YJTD 3C4JA 1KO5A 3BC1A 2BV3A 1KDOA 4OQXA 2GDJA 5FTMA 3MJHA 4Q19A 2WJVA 1FFHA 1K5GA 2ZYVX 2WKQA 2XSZD 2QTLA 1OE0A 1AS0A 2FGJA 3CPHA 3NEYA 4TL7A 4LK2A 3OF5A 4I81A 4OQMA 4KBFA 2CRVA 3GJ8A 3PITA 3K0CA 4JKIA 2RGGA 4OHVA 3I55B 1NG1A 1Q1BA 3BORA 3B8HA 2BBWA 3K0AB 3GFPA 5J4LA 4DCTA 4PPNA 2LWIA 1HE8B 1R7RA 1XP8A 1J8YF 4C2TA 2CE2X 1KD1D 4N0EA 4FMCB 1E79D 4AWXA 2A5GA 3KUCA 5LDDC 2IYVA 3KKQA 4JLMA 3I92A 1LW7A 3THYA 3GLIE 3IIMA 2QDXA 3LX5A 4YMTA 5K8LA 1CR1A 3KQHA 1AMOA 2BSAA 1ZNXA 2R6HA 1BOFA 3PEUA 4KJZA 4A8JC 4URZR 2BJWA 3CCJB 3QPVA 4RFVA 3OJWA 2B7CA 4EJSA 2FNAA 1YRBA 2CVHA 1UFQA 4MUBA 3OZXA 3E70C 4Q02A 4A0GA 3AP3A 2QENA 1JR3E 1P7CA 3VU9B 4GFDA 2CE7A 4Q9HA 1PZNA 2IYLD 2OAQ1 1Q7YD 4FWIB 5HKKD 1IXZA 2BIFA 2RC6A 4C0JA 5K8IA 2FA9A 2FV8A 3I32A 5EXTA 5HTKA 4EPXA 4R7ZA 3AF2A 2J7PA 4Q48A 5B30A 3EAQA 3PUWA 4JLNA 1N8RD 2NO9A 5A0FA 3LBIA 2MSCB 4YMVA 4LUCA 2R8RA 5AN9A 3HU2A 1Z83A 4OQFA 2PJZA 4PC1A 2JJ2D 4N1AA 5DNYB 3GLIA 4D6PA 1OH8A 4PC7A 3E2IA 2QP9X 2QRZA 1P61B 2Z5FA 2OK8A 2CMKA 2XSZA 4NYJQ 2ODWA 5JWRA 1YI2B 1O87A 2EWWA 4Q1DA 4YMSA 3FMPB 1SULA 2FFBA 2F1RA 3H2YA 1GRQA 1K8AD 1HT2E 2JDID 2QT1A 2WM9B 1HQYE 4POAA 4AC9A 5KYKA 3Q3JB 1RIFA 4MDFA 3U3JA 3ADKA 2J59A 2TMKA 3PEWA 1DBSA 1ZC4A 1S9DA 3KXIA 4TWZA 1S4QA 2YOGA 3IDQA 2C5LA 3AF3A 2F9LA 3FFAA 5E7MA 2VPPA 3MAAC 1KDPA 2IT1A 3T1TA 4CEIA 3VR2A 5AK0A 4OHXA 2FN4A 3BWDD 4BZXA 1EG7A 3HJNA 3KFVA 4LHZA 4KBGA 3TQCA 4DQKA 1JXMA 4WQMA 1G17A 1HUQA 5BXQC 1Z07A 1S96A 4V0ME 3VKGA 2HMAA 1NF3A 4A4DA 1IXRC 1B2RA 4LYFA 1QG0A 3AVPA 1E2PA 4KO8A 3QFTA 3TK1A 1C4OA 2IUSA 1TEVA 2W83A 4NBSA 3QKSA 1U99A 5FL7D 1CJVC 2GJKA 2ZJ5A 1N0WA 3QNUA 3BRWD 2NPFA 4HE6A 4AF7A 3NTUA 2B92A 2Y8EA 1XEWX 3SU8A 4GDFA 1EP3B 2J1LA 1M7BA 1SVSA 1ZJ6A 2QI9C 1KK1A 1M74A 1S3SA 3EPJA 2N46A 2ZSEA 4A6XA 1W5SA 3U7HB 2AK2A 3OHMA 3F5FA 4XVQA 1D9XA 3SEAA 3TR0A 1OKKD 1E69A 3W3AA 5H68A 3ES9A 3WXMA 3A1TA 4NKRA 3ZC3A 3E5HA 3VKWA 3UG7A 1CJUC 1KC8D 4G5GA 3F8TA 1YKSA 1WCV1 5AWFC 3TQFA 1AKEA 3GCGA 4JKYA 2XZPA 2BBOA 5AUOB 2GCOA 4NTZA 3WMFA 2J0QA 3UPUA 4RD0A 4Y9RA 1LS6A 3LRPA 1HV8A 1QDEA 4TSFA 5FPYA 1QGYA 4NCNA 4A6PA 1MR3F 4UKDA 1YZNA 4KAXA 3T12A 2G83A 4L8GA 1KKLA 2B21A 2ERYA 2X77A 4AURA 1RW4A 1UKVY 4PAQA 3AV0B 2I4IA 1P9RA 2O8EB 2JLZA 4DDVA 2FSFA 3HDTA 1PLKA 1KO8A 3P4XA 2VEDA 1G8FA 3GLHE 1JA1A 1NJGA 1PJRA 3UIEA 3M0EA 1C9KA 1QVGB 4RFSB 2V1UA 2QA4B 4HB4A 3V76A 3CF2A 4DWJA 2QMOA 4YXWA 4AG5A 2J0SA 1HA3A 3CXCB 1JB1A 3W5IA 121PA 5FFMA 2ZAMA 2ZYWX 1JECA 4ZCLA 1N6OA 3TJZA 3R8FA 5F3WB 3CO5A 3R7WA 1KSJA 1OYYA 2VQSA 3Q5EA 1XZQA 5FOVA 3RYTC 1KGDA 3TR5A 1E4YA 5CYOA 3DM5A 4PHHA 5GVRA 2CK3D 2IYTA 1S8FA 1HQCA 1ODFA 2BWJA 1R0ZA 3GLFE 3OZVA 3JQRA 5EQTA 4DQLA 1E9EA 4YONB 4PZYA 2I1QA 5L3VA 2F3TA 2LKDA 2J87A 2AK3A 2WHXA 2J0UB 4DLUA 1WMSA 2PJRA 1G6HA 1CTQA 1AIPA 2P6UA 3V4FA 4M1YA 2QQ0A 4LJ8A 4F38A 2C95A 2RAPA 3FHTA 4JZKA 4MGIR 4HAWA 2GF9A 3EA0A 3FGNA 2WICA 5IF9A 1H8ED 4DSOA 5HKKA 2YC4C 1W4CA 2HXSA 2BC9A 1C1YA 1YRAA 5FTLA 4ZCIA 4A0HA 1XU4A 1RRGA 2J9RA 3H86A 4HAYA 2GVDC 3B1WA 3IIJA 3UANA 3J81k 1E9FA 1R5NA 1I4DD 3W2GA 2IL1A 2CBZA 5AJWA 3F3YA 4PXAA 2G77B 4M1TA 4FCWA 2QL6A 4QFMA 4OYHA 3W2EA 1TEXA 1B23P 1GKIA 1OV4A 2EFCB 3QUSA 3Q5DA 3DM9B 2OBMA 4Q66C 3OESA 3U60B 3KQNA 3BOSA 1SXJA 1XCPA 1VG0B 1ZYUA 3DPUA 2QGNA 3B1YA 3CWQA 4K8OA 4YLGA 5EP3A 5G3YA 1N2CE 4B48A 3AGQA 4XJXA 1OGIA 4O2RA 1YE8A 2JLUA 3LW8A 3K70B 2KJQA 4O25A 3REFA 3BFXA 5SZJA 3QKSB 4A15A 2G1JA 1S9HA 1W0JA 3VR5A 4NHOA 5DIFA 3H84A 4XSGA 4JL8A 1W36C 4FXPA 4ASUD 4BEJA 3FKSD 2YNMA 4A2PA 5KUTA 4AKHA 2WWWA 1J7KA 4BLTA 5LPNA 2QBYB 2EFEB 2RGCA 4JBYA 2ZE6A 1IB0A 3BS4A 2Q9CA 4M0LA 2CHQA 2VHUA 2F1JA 2A2ZA 3JQPA 2XTZA 3W6NA 1X8JA 1YZTA 2DWPA 4DBLC 4ZV4A 5CLLA 4E07A 4YAOA 1ZNYA 5GVSA 1EFHA 1K73D 2D2EA 1R8SA 3ADBA 2ZUDA 4RD2A 3G82C 4RFSA 3CCRB 4TL9A 2IWRA 1W47A 2IYRA 4DLWA 4LJAA 1TNDA 2AR7A 5FTJA 4NYMR 1IAQA 3EPHA 1W4AA 2RGNA 4TMVA 1MABB 2ORVA 3FPAA 1BIFA 3K9HA 1G8PA 3CBQA 2FX3A 4YMWA 3AKDA 4BLQA 2ZRAA 1BO6A 4OL0A 1I4LD 2OG2A 4M9XA 2JCSA 2CK3A 4PSAA 1G6OA 4EPWA 4GL2A 3CZPA 4ERNA 5BN5A 3QJYA 4M22A 5FBVB 1TTTA 2XITA 1X86B 3KKPA 2PLFA 1IQPA 1FUUA 1N6LA 4PSVA 2REOA 3P32A 4LRWA 1VYVA 5AR1A 1GIAA 1GAJA 1KI2A 3GJ5A 2ZPTX 4KI0A 4B3GA 3DMDA 2HLDD 3LH5A 1G64A 4PTLA 2XGJA 3TE6A 1KAGA 1VIYA 2EFHB 4C0QC 3C5CA 1WRBA 1ZU4A 4DLXA 1XEXB 4M2LA 1R0XA 4QGAA 5SZIA 2FDCA 2CCKA 4C7OA 4QL3A 2Z83A 2XNDA 5JSZA 3THWB 4MYTA 5UKDA 5C1BA 1NY5A 5J4KA 1OIWA 1L2TA 2HJGA 4LBZA 1TU4A 1TMKA 1VKJA 1VQMB 4QHSA 1Z0DA 3DDCA 3WNBA 4IFBA 4CT4B 3CCMB 5J47A 1E2KA 1PLJA 2WPDA 3HYTA 1GTVA 2PLRA 4QM6A 1WP9A 1X3SA 4UJ5A 1YIJB 3OIWA 2CLDX 3NKVA 1EWQA 1W0KA 2QORA 3ZDQA 3B6EA 1CJTC 1KNXA 1E2IA 2ZI4A 4H9GA 3QQ5A 1IOZA 1P60A 3U61B 1W2GA 4FN5A 3SN6A 4IOMA 4CEHB 4MH0R 2D3WA 3LVBA 2CCJA 3RSOA 4DLZA 1EX7A 1GKUB 1G9XA 3LBHA 4BFWA 4TMTA 1OGJA 4AYWA 2ZE7A 3CRVA 3B7GA 3C14C 2IEYA 3A1SA 3KJHA 1W5TA 4OJKA 4WOPA 3DOEA 1QHHA 3BERA 4EUNA 5B57C 3LWNA 1T0HB 1ZP6A 3W5HA 3CRRA 5TXGA 1E9BA 3X1XA 4PPGA 2VH5R 2FPKA 1UBEA 1UBFA 4M21A 4ZPXA 3CRZA 2QM8A 5L3QA 2XAUA 3BB4A 1Q12A 2ZSFA 3UMRA 2OFOA 3KXLA 4Y0AA 1R10A 1MO4A 4YAWA 1GL6A 2IUUA 3O8RA 1Q81D 4QHTA 2ZE8A 1G5TA 1NY6A 1Q0UA 1XXHE 3TRFA 2VF7A 2W6IA 4BGDA 2P3SA 1AGPA 2O8CA 1VHTA 3OW2B 4KFSA 4EJSC 1N0VC 4D0GA 2H16A 4D4JA 5SZHB 5L3SB 1E0AA 1XJ0A 2HV8A 3KB1A 1GL7A 2CL0X 1ZW6A 2K5UA 3K1JA 1H8EA 1XD2B 3FVQA 1OFUX 3UMSA 1KRHA 2WZQA 3K09C 3TNFA 4EQ6A 2F55A 5EZ5A 2YINC 5KSYA 3TUZC 4XOIA 4NP6A 2WAXA 3UK6A 4XVRA 4DC9A 2IWHA 4TMXA 2CEAA 2JJ2A 3HWSA 2XNSA 2CJWA 2VP4A 2ZU6A 3GQBA 3OJXA 2PZFA 3ONWA 2WAYA 4M9ZA 2WPDD 2IYWA 5KO2A 2DHRA 3GJ0A 3QENA 4F7WA 3QF4A 1RJ9A 1ZINA 3RRNA 2WJJA 4EAQA 4OKSA 1OFIA 4Q1AA 4EJSB 1KJWA 4NCHA 1KI9A 4P32A 1XPOA 1U8YA 3IEVA 3CPJB 4R9UC 2AD5A 1XEWY 2GEDA 1PLLA 5FPTA 5HPYB 4HB2A 5IK2D 1NSTA 1U0HC 3FHOA 2QA5A 2WWFA 1VCNA 2GBLC 2IW3A 4A1FA 1VG8A 4DRZA 1U0JA 1EESA 2GILA 5BWMA 3CX6A 1E94E 4ZI3A 5BQ5A 1A4RA 1UF9A 3BFKA 4WAUA 4AYTA 2WVJA 2FMXA 4V03A 1MT0A 1E0SA 4M1WA 3EIHA 3VNVA 5AJYA 2OTJB 2JGNA 1VCMA 3K0AA 4JYCA 2QUZA 1XTJA 3D7MA 4CYMA 4EIWA 3JVVA 3F0TA 2VF8A 3LQRA 4RCYA 1KK2A 2BM0A 4URWR 2VA8A 3S1AB 2OHFA 3L0SA 3ZZUA 5HR5A 3ND9A 3AUXA 3PENA 1KNQA 4LGMA 4LOAA 4EFLA 1CQXA 1VQOB 1JBKA 3BH6A 3X1DA 2GJAA 4M1KA 3MWLA 2J7KA 2JLSA 1QGZA 4JYBA 2QM7A 1A82A 3CUEF 1YR6A 1RE0A 1SHKA 3TBKA 1OB5A 2GXAA 4UXJA 5L3RA 2JIZD 3OIVA 2IYYA 2JA1A 2FEMA 5CK4A 3PVSA 2OV2A 3AKCA 5AUPB 1DVRA 1NIPA 4P3YA 2GESA 3GLIB 3RS3A 3C16C 3GLFB 1UDWA 4C0HA 1MABA 3VTKA 5JRJA 1XPUA 1OPXA 2V8OA 2ZYUX 2ZI5A 3MD0A 1E2JA 3MGCA 1OW3B 4A36A 3SHFA 2BDTA 2MSDB 3D6TB 3EA5A 3RC3A 1KTVA 3S1AA 2O8BB 3X1YA 3B2EA 3Q72A 5EMNA 1E98A 1AGRA 2QG6A 2BN4A 1W34A 2OLKA 2UZIR 1E2FA 3A1WA 2OCYC 3NDBB 4GPTA 1M1KD 1KO1A 2Q3MA 2OCBA 2JLRA 4FW9A 2ZXUA 1SVWA 5KSWB 2FE4A 1QH0A 4M9SA 3ZZTA 1VQPB 4QNMA 3FMIA 1ZCAA 3ASYA 2EW1A 1KSHA 1VPLA 1FTNA 4F91B 4DZZA 1F2UB 3A4LA 1BS1A 1LNZA 1ZIOA 3IHWA 2P5TB 2ZI7A 4P6VF 1NLZA 2UZ3A 2BF4A 2C96A 2X19A 5G40A 2A9KA 4QBGB 2RGDA 4H1UA 4KCGA 1NBMD 3AP2A 3H4MA 4IOLA 5GJWC 3V00A 4LWZA 4TLCA 5EUQB 4TYYA 4HYYA 1IJEA 3KTAA 2XTNA 3TGPA 2OO7A 1XMVA 1E0JA 2VYFA 2XB4A 3OFNA 1Z6GA 4JL6A 5IRCD 3CC4B 1GJRA 1XXHA 1E1RA 4B3CA 3THOA 1FQJA 2FEOA 2HF8A 2JJ8A 3G0HA 5EXXA 2CJWB 3ND8A 2C78A 3PUZA 3SOPA 1MRSA 5EE3A 3VAAA 4JSYA 3QPWA 1ZRHA 2NZJA 3REGA 4IKEA 3W8RA 3LQQA 1JNYA 3QBTA 1G20E 2RHMA 1H85A 1OIVA 4N3NA 1Q1ZA 4PC2A 2V4ZA 3U3RA 3ZVLA 3KJEA 1L4UA 1Z0FA 2YC2C 4CDGA 1JR6A 4R71A 2AN9A 2O0JA 3KKOA 1LTQA 3K9GA 1GG2A 3BIFA 2HLDA 3DZDA 2DY1A 3PCRB 1XNJA 4TMZA 3W5VA 1IN8A 3SJAA 1E64A 4X8HA 4XWKA 1KI8A 4L5BA 2PX0A 4D26A 3LD9A 1AJEA 1M7HA 1ZAKA 1R2QA 1GP2A 4WIAA 4YQFA 1KI6B 3QOFA 1XD9A 1L7VC 2QZ4A 4LYHA 4TYNA 4LBWA 1A2KC 1DARA 3AVVA 2YOFA 4HDQB 4QXAA 5KNCA 3AM1A 4YHBA 2VLIA 1TQDA 4UNPA 1T8TA 3ZS8A 1NN1A 3U7EB 3MUFA 5H8WA 4XTCS 3NH9A 1W49A 2QPTA 1QHHB 4C3ZA 1LVGA 3VX4A 4E5UA 4RD1A 2IC5A 1DO2A 4P4UA 5JI3E 1XZPA 4QG7A 1T3HA 1YU9A 2OM2A 5CB8A 4A2QA 3DL0A 4KODA 3W8NA 3CONA 4YAFA 4JLDA 3SE0A 4HSEA 3KX2A 2QTVB 1Z0KA 5DE3A 3NG1A 2HYDA 4HAUA 1U9IC 2VTKA 3M1IA 1P2VA 2A3RA 2AXNA 3NIBA 1XE1A 2ZI3A 1LF5A 3WBJA 1DAEA 4LJ5A 4LI0A 4HDOB 3B9PA 1FRQA 4MRNA 4AG6A 2RGNC 4CEJA 2CLCX 5F9HA 4JLPA 1EXMA 1US8A 4ZGNB 1HE1C 3P4YA 4KYUA 3EZ2A 2ORIA 4PHFA 721PA 1NVXQ 2KI5A 4DCUA 4PC3A 2O0KA 4IXNA 3WYAA 3RS0A 4HATA 2ZSBA 3W9YA 4LBYA 3CX7A 3NBYC 4PO9A 5JECA 4Q1BA 2IS1A 4B2LA 3AF1A 3OEEA 3AVYA 1Q1QA 1QF9A 1XTKA 2AL7A 4XWOA 4Q4LA 1QGAA 1Q44A 4GNKA 4JLKA 2CHVA 2C98A 4A2WA 4Y9UA 1OHHA 2MMGA 1E9CA 5FL7A 3IGFA 5GV7A 1DAGA 3L0OA 3QI2A 1CR4A 4O0MA 3WNDA 2X2FA 1U2RA 3R20A 4L9SA 1IY0A 1JAHA 3X2SA 4Q4HB 2Q0HA 3FWYA 4JBXA 4RZ3A 5LD2C 4BASA 5AUQA 3VO2A 1GZSA 3E1SA 1N5JA 3PUVA 5AJVB 1BYIA 1TUEA 4WXPA 3SYLA 1KJZA 4QJ4A 4G1UC 4XD7A 1QBKC 2V6IA 1GILA 1MOZA 1J70A 4Q9IA 4ABYA 4F4JA 1D2NA 2PCLA 1BQEA 4LV6A 1M1YE 4LY6A 4HLQB 2ORWA 1ZM4A 1GWNA 3WY9A 5DHAA 2Q3HA 2GZAA 2ZS7A 1GOTA 4L16A 5EZ6B 3IILA 1QFZA 2C99A 2KWIA 1XRJA 4HE5A 4JLAA 2ZRLA 2F43B 1VQ7B 4N3GA 2ZRFA 2EFGA 1ZUNB 4Q9KA 4LX0A 2ZSDA 1ESMA 1NIJA 4M4SA 5CITA 4ZKDA 1ZBDA 3M4YA 1KKMA 2H1LA 1XMSA 2IA5A 4GP6A 4BFVA 4PQRA 2DCUA 1WE2A 3LNCA 4JBWA 1COWA 1KMQA 2O8DB 5TVKA 2BKEA 2CVFA 3MCAA 1N5LA 3T34A 3P26A 1NG9A 1QHXA 4HAXA 4P4SB 4DCVA 3U4QA 4BFXA 4NU0A 1VYTA 2R65A 3JZMA 4OI2A 4EKDA 5JCZA 2YVUA 1CBUA 2V3CC 1NBME 2VYQA 2GXQA 3ASZA 4Q9JA 2AFHE 1J90A 1CRPA 3WHLA 1KK3A 2OESA 4Q5IA 4UNSA 4DSTA 4YAUA 3QXJA 3T61A 2GZDA 5FBWB 2QAGA 3W6PA 3WYGA 3W2IA 2IF0A 1FTSA 4KYIB 1U94A 2RGAA 4TLDA 5K8UA 4Z1MD 1J99A 1T5LA 3ZQJA 2ZRKA 4NMMA 3OEHA 4IOJA 2GNOA 4KV9A 1BYUA 2ECKA 4Q1EA 1NN0A 4QRHA 4MRVA 4DDUA 5JMTA 3RAPR 1A5TA 4TQUS 1P2UA 4ILEA 4LJ9A 4B6EA 1DE0A 4GRAA 2R9VA 1XJCA 4G5QA 1XTQA 1OXSC 5TY0A 1FNMA 3PUXA 1NKTA 3K53A 1Z0IA 2DFKB 5DN6D 4W5HA 1NVUQ 1R0WA 2WSSD 4B3XA 1GM5A 2B6HA 4HI0E 3DMNA 4KLZA 2OBNA 4YALA 1E9SA 1NMYA 4E22A 2OTLB 2QQEA 4QJ5A 4BE7B 2ZU0C 4Q7LA 2A5FA 4DXAA 2PIAA 3KB2A 4K1XA 1ZIPA 2HCBA 3CW2A 3CF6R 3CCLB 2H92A 1P62B 1QHGA 4FK8A 2J3EA 2A5DA 3PFIA 5EP2A 4B73A 4JMPA 1D5CA 1LF0A 3N2EA 2QNRA 2D7DA 1G8HA 1U8AA 1H8HD 4LJ7A 3E20A 2R6AA 1EX6A 5LD2B 5FBQB 2P6NA 4Q1CA 3OFND 5J40A 5KPJA 4F92B 1TAGA 3B78A 2GEVA 3QXCA 4A92A 3BFVA 4UAJA 2VL7A 1YQTA 1Z6AA 4DCNA 1P9NA 1V5WA 4BFYA 3ZJYA 4CIDA 3LO5A 1SM4A 1GAWA 4TMWA 3IQWA 4QBIA 3SHWA 3TLXA 3SFVA 3W3ZB 5L8VA 2VZLA 1MO5A 1ZM7A 2X2EA 1ANKA 2XOKD 3MWJA 4Z1MA 4ZDJA 2WWGA 4UQOA 4X8MA 2ZYTX 1G18A 1LB1B 3R9XA 3UKDA 2HYIC 1E99A 4ZDIA 1DAFA 2AWNA 3I8XA 1GUAA 8OHMA 1FDRA 1R0YA 4V0KA 3OE7A 3I72A 3AKEA 3KDSE 3L0IB 1Z0JA 2VP9A 1E9AA 3LW7A 4JLBA 2CCGA 3QIAA 2HUPA 3C5HA 3FE2A 4NL4H 5GJVC 4IEEA 3FOZA 1I2DA 3NDPA 1FRNA 3CIOA 3BH7A 1G5RA 1SXJB 1X8KA 4JT4A 4P4TA 1QHYA 4K81B 621PA 2VNJA 2FFQA 2NO7A 1ZM2A 3AF4A 3FYHA 1KDTA 2GKSA 2AHOA 3QF7A 2CLSA 2PL3A 1XEXA 4C7OB 4WVFA 5THXA 1Z2AA 2JIZA 4BLOA 2RHDA 1JB9A 2YWFA 4JJZA 4MITA 2VBCA 5CB6A 4ESVA 1GNPA 1G5PA 2OUKA 3TMKA 5P21A 3SQXA 3U3OA 1L8QA 2IYXA 1GRNA 3P20A 1QUEA 3EASA 5DI3A 1DO0A 1F2TB 1Q20A 4WZBE 1IY1A 2W0MA 1NJFA 4G01B 3NBFA 5D3MB 3QKRA 1IJFA 1NVWQ 2RGEA 5IT5A 4IW3B 1F6BA 4HLUA 5EE0A 2XTMA 3W6OA 2EQBA 2VNHA 1U9IA 2ZITA 4II7A 1IN6A 5E7JA 4Z54A 1AA9A 4KVAA 1AM4D 3HU3A 3CCUB 1QHNA 2Q6TA 2RB4A 3B85A 5M04A 4EH1A 2WWHA 3BB1A 4OI0A 1J8MF 1BMFA 4Q7MB 5JEEA 4IVQA 4LYAA 5AJZA 3RNLA 4PC6A 2JJ1D 3FDIA 1DPFA 2NOAA 4Q1FA 2ATXA 3GLGE 4DSUA 1SVOA 2P2LA 3CD6B 3B13B 1Z8FA 1F3OA 2OK7A 3SNHA 4D25A 2ZI6A 3ZD7A 3K70D 4EDHA 2NPIA 4G0NA 1ZU5A 3WRXC 4W5WA 4DT1B 4KFRA 3U7GA 1W0KD 1TU3A 4C0LA 1JA0A 1GNRA 4WXRA 1YHQB 1A2BA 2W2XA 3CRW1 3HR7A 1JQJC 2GAAA 1NN3A 5FR1A 4EPVA 4B6FA 4MKGA 5DSZA 2A78A 3MFYA 4HLUC 5FPHA 2CL6X 3EIEA 1UKEA 2WOJA 4AKIA 5CDFE 1I7PA 2JAQA 2Z4RA 2AD1A 4OBEA 3ZS9A 4QGHA 1QUFA 1VHLA 1XXHB 3FKQA 4R98A 4TQ9A 5IK2A 5JLJA 2Q21A 1Q3TA 3M6AA 2A30A 2N42A 2C9OA 1W2HA
chains in the Genus database with same CATH superfamily
4BQFA 4LHXA 4PO3X 4GWLA 3G79A 1RHJA 2YHIB 4G4IA 4TMKA 2GAJA 5FUXA 3SSMA 4RKRA 5EWLA 2XR1A 3PQ5A 5BR7A 1RQXA 2AYZA 4L75A 3WX0A 1YE5A 1YS9A 2WYVA 4GX0A 4MSUA 5DM70 3WP0A 1TKAA 3HHEA 1KE2A 3FFTA 3IV7A 3U9TA 4C4PA 3WGKA 5DYIA 5DH9A 2W2QA 3R3YA 5D5HA 2RH5A 4YRRA 3H16A 3FYUC 3KQWA 4OI4A 4IDFA 4BU0A 4EL5A 2RBKA 1P2GA 2XWBF 2BFPA 5BSTA 4F93B 4F4DA 3AETA 3A1PA 3B1VA 2A1TR 5EJMA 3WBFA 1PNQA 2P2GA 2FMFA 3FF1A 2DULA 2VWPA 1L7NA 3HSYA 2G1UA 3LKZA 1ZL0A 1V1MA 3GJSA 3IHLA 3TUIC 1PEKE 4IVRA 4NH4A 2CUZA 3WDKA 2IYZA 4HMQA 3HRHA 2AEMA 1D4OA 2P65A 4C5AA 1EK0A 3V8RA 2YHIA 4OU4A 5FOQA 1OI7A 1SA0B 1Y7IA 2OHVA 1H93A 3A1VA 5EI5A 3WS7A 3S1LA 4NONA 3UAZA 3Q7RA 3ADDA 1O03A 2ZRJA 3H1AA 2P77A 5F2NA 1NOKA 3G9UA 3QM1A 1GQOA 2R6ZA 3GT0A 5CAEB 3O8DA 1P1IA 4MV4A 1TT5B 1NJID 4HGPA 4X90A 3I9LA 4Z4TA 2I6FA 2Z57A 3PQDA 1UKCA 5FUWA 5BQPA 5IKOA 1HLPA 3H2SA 4X94A 2QXUA 4CMIB 1NP6A 5BR8B 3GLGB 4H7PA 2GBGA 3U49A 3WNVA 4FMBB 2GLTA 4RPIA 2CLFB 3RHFA 4RL4A 1G8YA 4BPRA 3ZDDA 1O97C 3QPUA 1RCFA 2JZCA 1JEOA 4IIFA 3LVFO 1FFEA 4YI5A 5IJXA 4O4JB 3DW1X 4UJ3A 4LOIA 2FSVA 4QPJC 3RGWS 3U6KA 5JAOA 2ODBA 1YQUA 3QKWA 4AJNA 4LVNA 4AJ1A 4MDYA 1TL7C 1AY0A 2OHXA 1JXOA 4KKXB 3E82A 5JWHA 1AN0A 4CLHA 1I33A 1D6SA 4AZ0A 1XL1A 2X0JA 1PUIA 1DUSA 1YK1A 2DH5A 3E9MA 2BKVA 4II3A 3F1KA 4J03A 1IBCA 2BONA 5I7SA 4FDMA 1DLJA 1UQUA 2BD0A 3NNSA 3PNPA 1J9ZA 3KXDA 4XQ9A 1N3IA 3LV8A 4M38A 2PBRA 2CF4A 4UHKA 5EYPB 4OHYA 3OTQA 3N8DA 4PXSA 4RWEA 2I54A 3DZ8A 4HCJA 3PA8A 1Z4JA 3Q1KA 4FDAA 2JI6A 2WU1A 2I65A 4MCAA 1FU7A 2FW0A 4I66A 4H1TA 3KL4A 5B1EA 1SMKA 1HFKA 3NNNA 5DIZA 4XWTA 4DW8A 2QAJA 5K3OA 2FUKA 1U0OC 1UK8A 2A59A 4P34A 4GNRA 2J0VA 2D2FA 3G2NA 1L7DA 3TIFA 4M46A 4I8DA 5G0SA 2ZRHA 4AY3A 3IAM6 2PY6A 4LXHA 4G26A 3DBHB 2WU8A 4IJUA 5CLJA 3ND6A 1BJRE 2UXCB 1HT1E 2WSLA 1L5MA 1RJEA 5IUJC 2DLDA 1MJHA 3M5PA 2IU6A 3JCZA 2C04A 2R85A 1VJ1A 5BN5B 3RJ9A 4BO1A 5JJIA 4XAQA 1T6YA 3I4LA 3O7WA 4G6IA 5F9MA 2PCJA 2ST1A 1Q82D 1FXWF 3WIDA 2QTMA 1MQAA 2FPSA 1ECCA 1ABBA 4X7BA 5TF4A 3E9QA 2G6BA 3V32A 3B82A 2AOVA 2YXNA 3GFRA 3ESZA 2OR3A 3L8YA 4ZZ1A 1WUIS 3LIIA 4MYCA 1OYWA 1Q7EA 3FCOA 3QWAA 2O0HA 3U6BA 1P4AA 5FOUA 2BBTA 4BXOB 3C3DA 4X0EA 5CDFA 4TT3A 2VHJA 3OZUA 1Y0YA 1T2DA 2SBTA 3TX6A 1C0KA 2GPSA 2OFPA 1X8LA 4OATA 1L5RA 3RF7A 3L8HA 3ZLVA 1J49A 5DYGA 4HDKA 3SEJA 2PNFA 4DLTA 1SUFA 2QXYA 4PYKA 1PS9A 3PXXA 1K7YA 3AJ9A 4HPXB 4M88A 5F4BA 1MVOA 3C6XA 4UHHA 1WSBA 3AY7A 3K6JA 4PSDA 4DUGA 2O2IA 5IW8A 3RG8A 4L6IA 3HP1A 4MYHA 2C5SA 1FNCA 3OY7A 3VDNB 3AILA 2WG2A 1E5XA 3P4UA 4QWMA 1C3JA 5HKOA 2QGZA 4K7JA 2ECPA 1N6NA 4KSBA 2EYUA 3CG4A 3A0UA 4Q39A 5HJ5A 2BPOA 1PYDA 4ZGQB 5D86A 1DCTA 1FBTA 4OXYA 4J1SA 4HYTA 5I51A 3D8SA 2B2XA 2Q8PA 5F1OA 2PR2A 3T3PB 2R84A 3GEBA 4FOOA 1EYZA 5F5XA 1GPJA 3I73A 1YL6A 3QVWA 1Y5NA 4KWCA 4TUYA 5DBEX 1ZJ4A 2COEA 2CNWA 3HDYA 2JD2A 4TYQA 5KTPA 2XZOA 4DWVA 1K89A 3EARA 1R0RE 2QJRA 1GU7A 4MDEA 1CR2A 1S8AA 3CB4A 1SOVA 4FMDF 1P1BA 2XB8A 5SZKB 4YGYA 2Y71A 3P2JA 1TQ4A 1YS1X 1P8JA 2WTEA 3C7KA 3EYAA 1VHQA 2DG2A 1H0RA 2XYHA 3ZZNA 4Q24A 2AX3A 1ZM3A 5KHOC 3EX7C 1XJ5A 3GFTA 4V0NA 5IBPA 1N1EA 2VP5A 4BFLA 2FPGB 3NCHA 4QVJA 3CUWA 2IXTA 2WUGA 3KELA 4WZBA 4N5IX 4Y2RA 5KDLA 1P72A 4NNJA 4J1TC 2EWMA 4NBLA 5DCLA 5F21A 1R6XA 2LD4A 3KWMA 4J8PA 3VOTA 5F98A 3JQ7A 4HWOA 1GFIA 2VTDA 2XQFA 1I32A 2WINI 1C7ZA 2R8EA 4RIGA 5ALYA 3TDNA 5HZGA 1FZQA 2PX6A 1NI5A 1XQYA 1P2DA 5K7SA 3HWWA 2FN8A 3Q9LA 1RQRA 5LZ4A 3NM5A 5J1SB 1PD1A 1TYEB 3IUQA 4AJJA 3NDRA 2QN8A 4QGFA 3OOHA 1PR2A 5TMBA 5A04A 4ICIA 4XIJA 2C03A 4BPBA 1FSSA 2V8BA 3ZHBA 1HDCA 1DKQA 5EKUA 4JA2A 1GZUA 5TPWA 3T6KA 3OJEA 1DBIA 4BO0A 4ALMA 4M0MA 1F6WA 2OG1A 3BL5A 1K8ZB 3FYSA 3R6TA 4J7XA 5JNSA 3L7MA 4X1KA 5EUCA 1OH5A 5CYPA 5IVIA 4WFQA 4JUCA 1MENA 1G4AE 3DMFA 2UZ1B 3VFDA 4G3XA 4PZAA 5JCOA 3DEKA 1PGPA 2IDKA 4LBVA 4BC0A 4J2OA 3D31A 3NDJA 4AO6A 3WBKA 2Q1XA 3QOXA 2O2YA 3B53X 4DIUA 1FFBA 5DU2A 4GF5A 5HILA 3AXSA 1IXKA 4KXUA 1BS2A 1QV9A 4P4SA 3AY3A 4D3ZA 5IT5A 3GBSA 2F17A 1TDJA 1UJ5A 3ZN2A 2I7VA 3D1LA 1JHVA 2EYQA 1MB2A 1KVTA 4E12A 1WXQA 2F62A 2R1UA 4DSNA 3CYFA 4JC0A 4BMXA 5IPFA 1EP9A 3SFTA 1WD7A 1J2JA 3HYLA 2Q5EA 3UHFA 4Q4AA 1HYHA 2G0NA 2W2VA 4F71A 2GPNA 4FCTA 3C24A 3NTQA 1Y3DE 1XZFA 2F1OA 2ZWPA 1ZICA 1N0IA 4DUGD 3RUIA 1B43A 3EE6A 3TX2A 1T0UA 5LQNA 4ZODA 4P8RA 2FPIA 4I2NA 4P33A 3MCUA 2VHCA 4IUDS 3DHYA 3A6FA 1HDZA 1RYZA 4IUBS 1QV7A 4R5HA 2GRJA 1EFUA 2IZ1A 5J5AA 4HDKB 4I8XA 4D02A 3GD5A 3MOIA 3ZWWA 2H8KA 3N2GA 4X1KB 2AFVA 1G3UA 5KC9A 2IEGA 4QBTA 3NBQA 2P27A 1JLHA 3ICQB 3I5XA 1ZD4A 2KX7A 5ERYA 1I5RA 4FM9A 4B3JA 2FZVA 1JMYA 1KDRA 4FB4A 2WMOB 4Y3UA 1NYQA 5KNCD 1I10A 3WHIA 2CFTA 2IUTA 4MUYA 1AKQA 4ROTA 5JZVA 3VMMA 3MT9A 4E3WA 2XXAA 5KQSA 1P33A 1G8JA 1X7ZA 4BX2A 2OZKA 3JTMA 2C9DA 1F5NA 3PNQA 4CQMD 4OQYA 3KTOA 4HJRA 4X71A 3TUJC 3VBEA 3ZYCA 3V4ZA 4K9MA 5E9AA 4PNEA 1GZHB 1GUZA 2GN6A 1TOAA 3INTA 4IMJB 5CD9A 1WQ4A 4REOA 1SZJG 2PTHA 3T7EA 1AGYA 3EOZA 3ZXYA 4KFUA 1OILA 4BNWA 1SK9A 3GLIB 4QM7A 3VR6A 3NM4A 4O59O 3GXOA 2JGDA 4K6CA 4MIOA 3NV9A 4TQGA 4E7OA 1OWOA 1W25A 2GCNA 4ILKA 5HW0A 1T5SA 4GSKA 4D57A 4WZBB 1D2MA 1RAFA 1SBCA 2VJAA 3KYIB 4WDRA 3HXQA 2E4XA 1LBTA 1MDBA 1P9WA 2EDAA 4G9BA 3RU7A 1SXHA 3UJ6A 1CEQA 3DMHA 1UPFA 2JFFA 3KJXA 2NU9A 1ACMA 3LZCA 3LAWA 4RK6A 4WN9A 5D3QA 4KOEC 2BKLA 5ELXA 5KMGA 3CC7B 2AE1A 4UBJA 2C0CA 2V96A 4QBKA 1BTOA 2ZRGA 1R4NA 4TRMA 4TTRA 2ZVDA 1MOPA 2FH5B 3I6IA 3TOSA 4D9HA 3KPUA 5EJ7A 1Q0HA 4OX9B 3SYKA 2PMKA 4BWFB 4Q16A 3U0BA 1ZPDA 2WM3A 4TUYB 3DEAA 4X1YB 3KQKA 1MHTA 2HGZA 3HEMA 1EQAA 1UP7A 4TKUB 2X8WA 4UCWA 3ZGXA 5B3KA 2WF7A 2P78A 1XRLA 3VDRA 3UK1A 2I9KA 4DSZA 4LE0A 1IQUA 2R86A 3ET5A 3GEIA 5DW0A 4ARZA 2E49A 3SGLA 2ODTX 2VZEA 3DMPA 3K16A 3MT0A 4GC5A 3VX3A 1G7SA 1H22A 3OTIA 4E31A 1U0RA 2P68A 1IH8A 3T4XA 2QAGC 3WKDA 2YWCA 3IUBA 2R6CA 4W82A 1CYEA 4IGIA 5GADl 3C74A 4PZUA 4FDUA 1ZLYA 5BWCA 2BJHA 3BJEA 1GPMA 4OEHA 5HZBA 4UNRA 4O2AF 1P2SA 2EF1A 4IDOA 4C5BA 2QVYX 1NW7A 2ZB8A 2JZNA 2XPCA 4DR6B 1J00A 4BLVA 5KQRA 1NVTA 2QYSA 2R7MA 5JS7A 4UZEA 4B47A 4B7UA 1WQ1R 5TQ2A 4B33A 1LQUA 2HGSA 4G8DA 4C03A 3FOAA 1NE2A 2QAIA 5HKAA 2V7TA 2YXBA 4CMIA 1EU1A 1C30B 1SCUA 4MW6A 3P71T 2EU8A 2OTCA 5DX0A 4FGWA 1KSFX 3DXYA 3FDJA 3OPMA 3PC8A 3W77A 4C4SA 4CMEA 5JS1A 3SJPA 4US1R 1ADJA 3IBYA 3P5BA 3ZHZA 1DAHA 1MB3A 4O2AA 4AY5A 4F12A 2DQ4A 4E1AA 3OZWA 2FRDA 4YRMA 4GMDA 3SICE 2PJUA 1KC3A 3TLJA 1S5PA 2VCHA 2VJDA 1WVIA 1LC0A 1IBLB 3JRWA 4BWVA 3EEFA 2WWVD 4GKAA 3PIRA 2RSLA 2QK4A 4U02A 3QNWA 4LC1A 4N5NA 3CP2A 1SVLA 1T2NA 1NJ6A 2H2FA 2IEZA 2PXCA 1BW9B 1NMEA 1Z3IX 3E0QA 3VV3A 4F72A 3CB2A 2VPWA 1QCDA 4K9PA 3M6XA 4NFHA 5KTOA 4I1SA 1R5OA 2DBRA 3JWHA 5F9FA 1YASA 1KP2A 4U2EA 3HYRA 5AI8A 4G1EB 1AK2A 2B98A 4X8OA 1U1GA 3E8SA 3NB0A 1AV6A 4JQZA 2Q6IA 3K92A 3CV3A 3OICA 2NX2A 4L27A 1EVKA 1P9LA 4NCXA 1RYFA 4YY3B 5JY6A 2QU8A 4QDTA 1IEQA 1TTHA 4S1TA 2Y0BA 1BXGA 4X6LA 4EL0A 3TQQA 2OL4A 1P18A 3GUZA 1MX1A 3LFUA 4LRYA 4RVUA 4DMKA 1C7QA 1NXXA 4H4EA 3BY2A 4LY3A 2IYPA 3L46A 2A9PA 4QJBA 5LZ8A 3WGGA 3G49A 4DDTA 5BSEA 4WZLA 4DA9A 1GUFA 4GT1A 5DOZA 1BKDR 4QOGA 3R6KA 4D9JA 4CL3A 5AKGA 3C1OA 3TGWA 2OYCA 4RZUA 5IAAA 5IF9A 1E7RA 1W96A 1N7JA 4ZKEA 1MAAA 4D0NA 2Z2XA 2VAMA 3SJZA 4QUJA 1Q0ZA 4UC0A 3UFXA 5A4JA 2R6DA 2YIDA 4MGZR 1V11B 3CU5A 1X94A 3FPCA 4CNBA 1XO1A 4NU6A 3G8BA 5AM2A 1YSCA 2Z9CA 2Y1GA 3SEFA 3ZCQA 4YR9A 1XHLA 1CDOA 2ZFUA 3L6CA 1G7RA 3QY0A 3TIGA 3LJKA 2AWOA 1E3ZA 1P19A 2EFDB 2D7JA 2JFZA 3C0KA 4H7EA 4HUQA 4K9SA 1DEKA 5GJCA 3WTBA 2Z1NA 4S1PA 1SB8A 2E37A 3RFTA 1L5HB 1QE5A 2M32A 4PO1A 1GADO 4GE0A 1E6UA 2IGBA 4FKBA 4B75A 1BHO1 5EE5B 1H4TA 2WYUA 3RREA 5A9TA 3FHCB 4GOJA 3PEYA 1FLAA 4C7KA 2H5JA 3D5QA 5IKEA 3LK7A 1JV2B 3BD8A 2BR3A 3T5GA 3PUHA 3H97A 1FDOA 1M2HA 5E9QA 3VKUA 2QTZA 2IHJA 4O3MA 4CCWA 1OTHA 3G2HA 4IHJA 4BNGA 3W3AH 5DWDA 5DT2A 1SBQA 2HWYA 1P1CA 4I5GA 4IVPA 4YUVA 3C41J 2WJ6A 4BQSA 4DMUB 1DBQA 2QPAA 1XB2A 1HI9A 3OM0A 1V9CA 3RU9A 3TRKA 1GN9A 4D8VA 3GT7A 4W1SA 1NNEA 1ZONA 2J9FB 1LBHA 3H1TA 1UMBB 4OHPA 3QY9A 3ZTWA 4Q93A 4QE3A 1RJDA 3JQCA 4RHYA 1WUHS 5EP4A 4NMHA 4B6GA 1SXGA 2GPAA 2WOOA 1REQB 1O96A 3Q8XB 5CNMA 2WLTA 5FBKA 5IN4A 3U5TA 3QEBZ 5J2TB 2RGRA 2QXTA 2Y2UA 2JKYA 4TN1A 1SFRA 1UJ2A 3DQPA 5DHQA 2GAIA 4B7XA 2LRHA 4BCBA 4DYDA 1C41A 1VYUA 1YR8A 3NFYA 4HZUA 1DX6A 4FIDA 5KDDA 2NMVA 4TRJA 4MUJA 5K0SA 1KYWA 4BFTA 3PDUA 3QWHA 5E6RA 2DY0A 5LQCA 1VXOA 2BGKA 2VDNB 3Q88A 4OA8A 5FHQA 4CCYA 2OYSA 3OFJA 4F7DA 4HTFB 3DC7A 2OY0A 2OO3A 3IO5A 1AB6A 1M72A 2OHJA 3MTEA 1WXHA 2BLLA 4DZRA 5IDQA 2JF0A 4P1VA 1TJNA 5CDHA 3QIVA 3CRQA 1ADCA 3WWCA 3UMMA 3KHUA 3FZGA 2DGDA 3CKMA 1C9MA 4BJ6A 1VQ1A 4Q9LA 1FYDA 1FW8A 1AF7A 4OQLA 4BECA 4DBZA 4N76A 4XTRA 5EIWA 2JHPA 2GN9A 3ZNOA 1M1XB 1L1FA 1CK4A 4G1BA 3HYCA 5FL3A 3W9SA 2CVZA 2GBFA 1QR2A 3EG5A 3M49A 5C7LO 3CHYA 3TBHA 2MINB 5AW2A 2FPUA 2FB9A 5E4JA 3NHBA 2FFAA 2MYPA 4JH0A 1D2EA 3KJIA 3OE4A 3ACCA 3ESDA 4QYMA 3L7CA 4Q0MA 4YCMA 1HSOA 3SC3A 3RPEA 2MYTA 4S05A 1JZTA 1NPTO 1XELA 3HVHA 3C48A 3CUKA 3MSCA 1JR3A 3LQYA 2R6GA 2A1IA 3A2LA 1FW6A 4LF5B 1P5FA 5FFFA 2AOTB 4AY6A 4MHTA 1Z6TA 3Q3EA 4KHZA 1DTSA 1T0JB 2Z3VA 3ZNNA 1R4AA 3H7AA 3T53B 3QG1A 4HNRA 3SFZA 2FHSA 1UINA 3VSBA 3ZX4A 1O1YA 2NV0A 4UEOA 1QVAA 2JNWA 4K9OA 4V0OA 1ILEA 2XZLA 3GJZA 3RTCA 4QSMA 2RD2A 1PJLA 3GCZA 4TV9A 1LDYA 3ZGNA 2R4TA 3AB3A 1V5GA 1TQ8A 6REQA 1PR1A 4MEBA 1QLJA 2AH5A 3QFFA 2F4VB 2IODA 2M6KA 4LZZA 1T91A 3IKVA 1M76A 4X6YA 1Z2CA 5KYUA 2E55A 1G60A 3ZK8A 2DVMA 2DYKA 5EL0A 1EE2A 4DB4A 1R00A 3O31A 1QVRA 3P9IA 1QCCA 3IKLA 3DG9A 2JFBA 2JLAA 2C2YA 4PZZA 2VK2A 1SO8A 4HPJB 2OO5C 4EHBA 1N2GA 5EIBC 3BAFA 3TVDA 1JKIA 4TLEA 4NYIQ 5LXTF 1FC0A 2JFVA 3FTQA 2X0DA 2OV3A 1CUGA 2F3PA 3IUMA 3WKEA 4RD3A 3B52X 4L6AA 4OK5A 1X70A 4QKQA 3A1NA 4IKOA 1N4DA 1VMIA 3U4HA 2Z4TA 2C3OA 1KXJA 3DMGA 5K0BA 3TSOA 3UMBA 5K0LA 3P9NA 4LJ6A 4CF7A 3BCDA 1YOVA 1UBNA 2OOKA 1I2BA 5DN9A 3M4XA 1HLGA 1NQXA 1EX9A 2EJCA 3JZDA 4WK6A 1A4IA 3V97A 3LBAA 2A67A 1V5FA 2OHIA 3GMTA 6YASA 1QWOA 1SCKA 1Y7TA 3HE3A 1RJWA 3AVOA 1EFRD 3PI7A 2J30A 2GX6A 3OECA 4JS0A 5JO9A 2DFLA 3GVLA 2FETA 3E1YE 2OCIA 2PSEA 4UVGA 1WO8A 5A02A 3SC2A 5A4IS 1QRAA 4YXWD 3AGPA 1XQ1A 3RYHB 1M2EA 2JARA 1U8XX 2ALJA 5HF5A 3O9VA 3BJMA 3C85A 1DAMA 1MB9A 3D3QA 4KWIA 5AKJA 5JD6A 2PH3A 4ID3A 2BGLA 2QAGB 3ZHYA 3RK0A 1GT6A 1L1EA 4UXIA 4DV3B 4MRPA 2IVZA 4XQFA 1KQSB 3OZGA 3GROA 1Z75A 4YQEA 4CJXA 1LSJA 1F4LA 2PGNA 2WHYA 1JSRA 1HY3A 2Y0DA 4ZV7A 3SZ3A 4CRWB 1QRSA 1A9XB 2SICE 3BWBA 3TO5A 1DDOA 1O6FA 2W4QA 4Q18A 1T4MA 4CCYB 4W5OA 3FPPA 1QP7A 3CA8A 4JEHA 1P2TA 4HLDA 4FKZA 5D84A 5LZ2A 4GYKA 3WK9A 1RJ9B 5FTKA 2VCYA 2GJ8A 4U7HA 3RJMA 2E4AA 1N3YA 2FSIA 1XF9A 5AKXA 5A6SA 2NV6A 1R88A 2QROA 1PKEA 3TCXB 4Z9FA 3FNIA 4TWRA 5KKAA 2KLBA 3V8VA 1O94C 3CZQA 5IDVA 4W9NC 3S55A 3SXJA 1XPRA 3CPXA 2IYQA 4BMYA 4RETA 3A6JA 2J3QA 1OR8A 2P6MA 1D2HA 1GSIA 1IHDA 4LNUA 5AVTA 3EPKA 1ZN2A 4HDSB 1O08A 4NCKA 4BMSA 4WZKA 2F7SA 1GG9A 3KJGA 1Q95A 3C98A 1VKOA 1XCGB 1J4AA 2A4KA 3MJ4A 4G1FA 3VZDA 3GGGA 1WP6A 1LK7A 3DR3A 4MULA 4RVGA 5TS3A 2BI4A 1DAKA 2HT6A 3LBNA 3UT5B 4YMGA 5JEDA 2W6QA 2BGWA 4UZSA 1D04A 1S4MA 3TNDA 5LKAA 2HDWA 4OYLA 5JH7B 4BNZA 4C14A 1VQ9B 3R9WA 4Q37A 5IF3A 3BMXA 2AEFA 2YJNA 1LPPA 1FPMA 3G9XA 4MVJP 3TOZA 3H1FA 1YZKA 2VP2A 1Z13A 3DE2X 4R1TA 2Z3WA 5ESDA 1HE5A 3EA4A 2FWJA 2IDJA 3EGDA 2YV1A 3F46A 1LLUA 3IBSA 4HUJA 4YQZA 3SIRA 4DILA 3W5BA 3KKMA 1G19A 1WOSA 1JFVA 2GVZC 2X2OA 2X4IA 2ZQYA 3A4MA 3EFHA 4ZK2A 4G24A 2ZVPX 4EZEA 4JJ7A 4A0FA 1WHSB 4TKMA 2ISSD 4YREA 1E6CA 1JIIA 2B7BA 1S7CA 3LGXA 4KGXA 4M9CA 5AM0A 2VHXA 4PAWA 1P2FA 3CR8A 2VAVA 2PGIA 3GJ7A 4PXYA 5LLDA 2BFCA 4W9RA 5HCNA 4MKXA 4X06A 4B3DA 2WSBA 1O57A 2JIRA 4GR4A 4QQ8A 1HEIA 1OU4A 2PKXA 5HOQA 1BWRA 3EDYA 1U8UA 3R5SA 4OMFG 3DW3X 4MGKR 1M8JA 4DIEA 4FFOA 1AQYA 1S3GA 2O8FA 1L0BA 1FUKA 4C43A 1RACA 2EVWX 4XYLA 5H80A 2X5JO 2XNKA 2DFPA 5EHQA 3RNOA 1D1PA 2Z1MA 2DUWA 4JVNA 1SVNA 4K86A 5LN1A 1TUGA 3AF0A 1HZZC 2J67A 1XWIA 3I39X 4PCVA 5BT9A 3RYFB 1O94A 3VC7A 2QRJA 3L7YA 3LVRE 1KOGA 3KQPA 4IGKA 3GDFA 4PRZA 4WZAA 4HDCA 5IABA 1BEEA 1CY1A 2AGVA 1IDOA 3E05A 3ONYA 1GT91 3K05A 5EC8A 3LUAA 3TAUA 3TIVA 1YZLA 5IBRA 2Q07A 1G7TA 1ISPA 3OM9A 4DIOA 4HYEA 5TV2A 3PPIA 2GN0A 5C4MA 4D8XA 1XTRA 1ZGBA 1YB1A 2KHZA 3GG9A 1XZCA 3QX7A 3UQYS 4HDMB 2NUAA 2W2LD 5AW6A 1E63A 3WC4A 3RVOA 1OYOA 2C2HA 1FQOA 1DINA 2IQIA 2RMKA 3A05A 4LJSA 4R8MA 4XX0B 4BRWA 3TFOA 1N78A 2X8AA 2VDQB 3UXMA 2Q7XA 1A5ZA 3KJNA 4MGHA 2ZRMA 1KQGA 1U4OA 3GJ3A 3LDHA 2C4MA 5DSXA 5IT0A 3N70A 3WLSA 2GA9A 2G76A 1GLNA 2X3FA 3NJ8A 2VXBA 4LZOA 1IEVA 1SKAA 2FUG1 3AEUB 4CKYA 5JXHA 3ZGZA 2SHKA 1OKKA 2V7QA 3VSCA 1BXRB 1OA0A 2FZLA 1VQNB 5JUWA 4O2AB 3ZKWA 3AVWA 3QUTA 1G42A 3FR8A 4D80A 4UUBA 2PMDA 1GR1A 3P45A 3ZUPA 4AK9A 3HCDA 3NTLA 3NGMA 5H3HA 1TW3A 4RZIA 3H04A 2CXTA 3NASA 2A9FA 1OAOA 3C6KA 1OLOA 2J5BA 5KOJB 1VDZA 5EUMA 4C4AA 5DGDA 4IQ0A 5TQ2B 4P26A 4CG1A 1XDUA 1N6KA 4Z0NA 1UD6A 2PWZA 4Y1EA 2YW2A 1NI4B 5HKBA 2Y0EA 1G2OA 4MW1A 3SS7X 1BX3A 3KC2A 3V4RA 2IF2A 2AHRA 2FOIA 5K2OA 1WSRA 4Z3KA 1MRZA 3DWIA 4J4BA 4GX1A 5ILQA 4C78A 1T2AA 3ND7A 3AYZB 1GNSA 3BMCA 1OFHA 3DBOB 4GLLA 4ZAGA 3FFXA 5DLEA 4G4SP 4XDHA 5YASA 4EBFA 5B64A 2HHJA 2HJSA 2WJPA 2CHFA 2JCVA 1C3VA 2FDXA 2CZCA 2L17A 5CNIA 4RD4A 1V0FA 4L8JA 2ZPUA 2FCRA 2MCFA 4IXWA 4KRFA 1G8SA 2VUUA 4B4VA 4QXRA 4WLNA 3HFJA 5F5NA 1M90D 1OI4A 5JAMA 1IXSB 1YHZA 2DR3A 5BSKA 1Y7HA 4RMGA 1LK0A 3A3GA 3CMEB 3PRJA 3ROTA 4EELA 1JH9A 1D9ZA 2IX9A 5C2JB 3ASSA 1R3UA 1TLLA 1DRUA 1M0SA 1NW3A 3G85A 3URMA 3WHPA 3QUQA 5J3JA 3IXMA 3MCVA 3ABRB 3WP1B 1RAIA 2J46A 1N9ZA 2FG5A 221PA 2BH9A 1UMKA 3F5QA 2YJ5A 3WGTA 2V0NA 3LYUA 3TW4A 4PG4A 4E2ZA 4G0OA 4XCXA 5JXJA 2H4JA 3L7KA 3IMFA 3HB0A 2QY9A 3U2QA 1DOAA 5H59A 3OFVA 4EYEA 4A6EA 1PT9A 3T1NA 1YR7A 2NO1A 3GZNA 2A5JA 1M66A 4TYWA 3RVSA 4JCOA 5NLLA 4WE3A 3R3WA 4GGMX 4GZ6A 1C1DA 4KLAA 2BFCB 4FSDA 4DVGA 2WSSA 1ZOSA 1ZKDA 2NZYA 2QTCA 4J90A 5EWMA 2V6JA 2ZJZA 1F0NA 5IMSA 1Z2DA 1THZA 3G2IA 2WJIA 3AK4A 3IMGA 1KBQA 3PUKA 4X1OA 5FEMA 3D9QX 5CW1A 1FX0A 1IOLA 4YRQA 3TW0A 4DV7B 3DDOA 2VH2A 3DD1A 1MVNA 1Q14A 2NNWB 1U3DA 2XXAB 1TX4B 4BX0A 1TEZA 2MOKA 3DVAB 1YB5A 3GLRA 3H3XA 1BA3A 2ZXHA 1LPNA 3FSGA 1T3GA 3I8SA 3JALB 4M3NA 4RH3A 5DHPA 3RE1A 3SK0A 1KZ6A 1T1SA 3JZAA 5FEUA 1HR0B 5M2QA 3MJSA 1ZN9A 3PPWA 4HX9A 4HNHA 2DFNA 5AK4A 2NVWA 3UMGA 3RFUA 4FX2A 4JOBA 3A6PC 4ACBA 4C08A 1RHKA 3OPYA 2PPVA 3R44A 1JI0A 1TF5A 1DI0A 4KH0A 1ULTA 4NJEB 1UQTA 2REBA 4RSGA 1NJ5A 4B74A 5JCPA 2Q8QA 2DERA 1DRVA 3H9JA 1ZNZA 2AVNA 4ZI5A 1VSVA 1ZW1A 1AURA 4G25A 1KSGA 5JPCA 2FHPA 5FTNA 1QO0D 1OX4A 1U4SA 2IOQA 5HEKA 2ZUSA 4TV8F 3R7LA 3UB4A 1G9SA 1X7WA 3A8TA 3ZDZB 2PN1A 4YQYA 4Q4DA 3HKCB 1ES9A 3ZU3A 3K1AB 5KVVA 4B43A 2R1ZA 3C3MA 5C18A 1EJ0A 2HDOA 4M87A 5T67A 4ZK6A 3BIWA 3BVPA 4QUEA 1JQAA 4QC2A 4LXTA 2O19A 2E0IA 3AI1A 4ENQA 1NN5A 3KJFA 4XEHA 2ZSHA 2W8BA 1VHWA 1DOZA 3FKSA 2QPOA 2UVDA 1OZHA 2FPMA 2ZRNA 4KH1A 4ZI7A 1OV6A 4L2IB 3LK6A 2Z5GA 1YAJA 1I1HA 3AHEA 2I2CA 4EHIA 3CF4G 5E6TA 3KPYA 5H16A 4YJHB 3ZW8A 3D7KA 3KV1A 3HACA 3MN1A 3JQ9C 4R1QA 1W52X 4REQB 1UWVA 1RWMA 5IAGA 1C3EA 1DQPA 1RI4A 3LXXA 5AW1A 3AO0B 5TDHA 3E61A 3BB3A 3T5TA 4DL9A 5K5EA 2AFIE 1Z25A 4UVEA 2W0SA 1P0MA 3A1UA 3A4VA 2P1RA 2XE8A 3L6BA 4RPDA 5E4YA 1PW7A 3VHXA 3L8CA 4GR5A 2GMWA 3HA7A 1SZPA 2FEAA 2R11A 3H42B 3JSAA 4OFBA 4PLFA 2I91A 1N6RA 1RDFA 4L72A 3IBGA 4RJ2A 2SKEA 3OURA 4UBKA 4AKEA 1F2TA 5L7WA 4Z1OA 4NH0A 1SPXA 1J9EA 2V7XA 1QHEA 5CU7A 4CMKA 4PRYA 2R2AA 4Z4SA 3IVCA 4UBMA 4CHTA 4B4DA 1NYLA 2VNIA 1YUBA 1J7JA 1EVLA 1XSEA 3S5JA 1RPAA 3A32A 5TARA 4YRPA 2FVGA 3X44A 2Z43A 3ZY6A 1CQIA 1DKPA 3L8GA 4U7FA 1QC5A 1FRVA 5IDYA 1KJJA 3CCEB 3OPQA 1T3SA 1UK7A 2BTQA 2D1QA 4B8YA 3R5JA 1K4MA 2DIEA 4IX9A 5FUYA 3GJTA 4DJFC 1JAZA 1IZ8A 1ZO8A 5LB2A 5BSYA 4S35A 1TQ6A 3AW9A 4DMGA 1MH1A 2VDWA 2NV2B 3PFBA 1HNNA 3E15A 4PWZA 1KHTA 1LS1A 3CPEA 3W7AA 2DBVO 5T3UA 1XZJA 4D99A 3A11A 2PSSA 4FFPA 3VPXA 5JRZA 3VTZA 3KQUA 1MZPA 1C2TA 1F2DA 1T6NA 2QRUA 4GPAA 2NU8A 1NONA 3VR6H 5IJZA 3M82A 5K8TA 2RONA 4GSYA 2WIDA 4X66B 5F4OA 1VHJA 1EGMB 5IBQA 2BFEB 2FG6C 1K6IA 2BDUA 1XJWA 1CZKA 3R5KA 2JJ1A 2GEUA 3AIOA 3QKUA 5CJ2A 2ZZEA 3WB1A 5F12A 2ZDGA 3JSXA 3WYCA 3VOSA 1VP9A 2O06A 3C4JA 4DNTB 1KO5A 3HC7A 4WSOA 2PKEA 2WK1A 4OB8A 4GQIA 3WDMA 3W8RA 6REQB 1GZ7A 3EF1A 2KPOA 3LZ6A 2PXAA 1MDFA 4Y2UA 1JJAA 4W7HA 4U9HS 3ED1A 2ZYVX 3JQ9A 3P2YA 4YRGA 2WKQA 5KX5F 2XMBA 2QTLA 1AS0A 2WTMA 1EUZA 4YUYA 3NEYA 2AUMA