4M0LA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus complexed with gdp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
414
structure length
412
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
total genus 91
structure length 412
sequence length 414
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m0lA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m0lA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m0lA01
2FSHA 1Q3HA 3THYA 2VNKA 3EC2A 3PV0A 2IS1A 2OAQ1 2BJWA 3W3ZB 2C9YA 3FHCB 4Q02A 4CEHB 3LVBA 4B6EA 4HDQB 4C0SA 3BFVA 1ZD9A 4AKGA 2VPPA 1HE1C 2KI5A 2OG2A 1IAQA 3DL0A 5KSWB 1ZCBA 4GRAA 2C03A 1U9IC 2WWWA 4QGAA 3K0CC 3K70C 5GVRA 1QGYA 4P4SA 2BEJA 1DAMA 4BZPA 4GZLA 3I55B 2XGJA 3C7KA 5HE9A 4OJQA 2P5TB 2ZU0C 3DZDA 1CRPA 3QXSA 1KJWA 3PJRA 1YR7A 4MRRA 4PZLA 2GKSA 4F92B 5G41A 1MV5A 2IXGA 1ZUHA 2IK8A 3E5HA 4DXAA 2IHYA 4LHWA 1CJKC 4XIGS 3SHWA 4A8JA 2CVFA 1TPZA 1YE8A 1XX6A 1Z8FA 3RRNA 4TZ0A 1WF3A 4BUJA 1DAEA 3DKPA 2QPAA 2ZRMA 3CF2A 5K8IA 4S2EA 2ERXA 1M90D 2G88A 5UKDA 1DAFA 3AF3A 3EZFA 1PUIA 1E9CA 5CJ2A 1XXHB 4NU0A 5H5JA 1E3MA 3GQBA 3T12A 5LB4A 1ZC3A 1EWQA 5DE3A 3CD6B 4LPSA 1OH5A 1Q86D 2NO7A 3QPWA 3RS3A 2IYRA 3BE4A 4CEJB 1PJRA 4Q7MB 3LAWA 2A3RA 3LV8A 4FW9A 3TQCA 3UANA 3UG7A 2QMUA 4Z8XA 4URYR 3A1VA 2OXCA 5AN9A 2JLZA 1EWYA 1SXJE 1XJ0A 4JYBA 4OQXA 4Q66C 5AJVB 1BOFA 4Q19A 1C1YA 4QNRA 2VZLA 2FSGA 3BD9A 1VTKA 4YLGA 4AYXA 1SVLA 5P21A 1AS3A 1CU1A 2JCSA 2J0VA 3Q5EA 1F2TA 2FOLA 4PHGA 5FTKA 2JAQA 1VECA 1MR3F 2PZFA 2J1LA 2WHXA 4E22A 1T5IA 2NPIA 1D1NA 2AX4A 2X19A 5TY0A 5DI9A 1BKDR 2O8EB 1YU9A 3AKCA 2W6JA 1KKLA 3CRRA 3WMGA 1VQ6B 1KZGB 1ZNZA 3QNUA 2OLJA 3HR8A 3UIEA 2PT5A 1MO3A 3AGPA 3CRQA 4PGOA 3CR7A 4UAJA 2EFGA 2Z5FA 4WZBE 1A2BA 3OAAA 4HYYA 1P7CA 1NN1A 1L7VC 1YITB 4CIDA 4TN1A 1QG0A 3GD7A 5EE1A 1OHHA 3CCUB 1M6NA 2ODBA 2QAGB 4ESVA 1E79A 3VKHA 4MUAA 5JLJA 4OQFA 4DBLC 1NJID 4DT1B 4BLTA 4PAMA 2ZANA 1WB9A 2OSBA 1Z22A 1LS1A 1GKYA 1P4SA 3N2EA 1U8YA 1G64A 3CB4A 4HI0E 1JECA 4IOMA 3LQRA 3GEEA 3BH0A 1JJVA 4HLUA 2GILA 3NEYA 5KNBA 2FPMA 2FWRA 4H1UA 4WXRA 3SR0A 2VHJA 3RLFA 2DWPA 2GCPA 3OEEA 2VEDA 4HB2A 4ABYA 4MYCA 1FL9A 3KUDA 5CYPA 3B85A 4G5QA 2Z4RA 2EQBA 4RD3A 1JAHA 1GL6A 4MYHA 4A2WA 3ZVRA 2QTLA 4DCNA 4O25A 121PA 1UFQA 5M04A 1XEWY 1Z63A 4Q18A 2DR3A 3NDBB 3KFVA 3GEHA 4B2LA 2ZEJA 1CJVC 1ZM4A 2FPKA 1COWA 2PL3A 4CZ2A 4AD8A 4XTCS 4FIDA 4TLDA 5HZKA 5H70A 2GZAA 2GAOA 2PBRA 1E63A 5DI3B 2O8CB 3D7MA 4KYUA 3MWJA 1R6BX 1P2SA 2ZROA 4D26A 2CE7A 4DUGD 1U81A 2GCOA 2ZAMA 1KQSB 3QIAA 2G6BA 3R20A 4TQUS 4IXNA 3B82A 3U6KA 2V9PA 4LHZA 2VNHA 4EPXA 1P6XA 4B71A 4MKGA 5K8TA 1XE1A 5L3RA 4IVPA 5KNCA 4X8LA 2MMGA 3SU8A 5FR2A 4C0LA 4LJAA 4TT3D 2OCYC 4WXPA 1ZUIA 2YV5A 4YXWA 1ZIOA 1OSNA 2UKDA 5JSZA 2F55A 4DLTA 1GAJA 3QSYA 1GZSA 1JPJA 3S1AB 3BFXA 3RS2A 1Z6GA 2BDTA 3K0SA 2IXFA 3DZ8A 5CM8B 2FFAA 1HH4A 4PO9A 1OYYA 4DCTA 5HTKA 1FW6A 5FTLA 2OUKA 2OK8A 3FPKA 2FFBA 3P27A 5D3MB 3EC1A 2AD1A 5A5GA 3BH7A 3GFOA 4NZYA 4Q48A 1IXZA 3K9GA 3LLMA 5IF9A 1Z47A 2GEUA 3AQ4A 3R7WA 1G6OA 2DEUA 1OFHA 2CCKA 1S1CA 1IN4A 3CO5A 5EMNA 2ZS7A 4UJ5A 5EJEA 2RGAA 4HATA 2Q9CA 4RFSB 2H16A 1W4CA 3CRW1 5H8WA 5DN6A 1GP2A 4QHTA 2HV8A 1EFRA 3L43A 4JLNA 4M8NE 1OE0A 1VG0B 4A6PA 4XWOA 2ZJ2A 3QXJA 4Q4HB 4LJ5A 2J87A 1TUEA 4B2PA 2GEVA 2J0UB 4L8GA 1E2FA 2A5JA 1SVIA 2Z43A 3CIOA 5K8LA 2ZI9A 1KY3A 2A9KA 2KBEA 4TL6A 3THYB 5JJIA 3QJYA 5C4GB 5TARA 1CBUA 3GLGA 3OZWA 3PVSA 4KJZA 3UWOA 4ZGNB 1G7CA 3MJRA 4XD7A 1OB5A 1HEIA 1KDOA 4BASA 2WAXA 4QNMA 1YHQB 4PSKA 2JLWA 2BMFA 2VHQA 2ZAOA 4UNNA 1WBBA 1KZ7B 1L2TA 3AUXA 4B2IA 1VQ9B 2ZS9A 1M7HA 5F9HA 1KO7A 2A2ZA 3VR6A 4ZDIA 3EXAA 3WRXC 2V6IA 1N5LA 3B9PA 1AS2A 4P4SB 1E0KA 4M1OA 3RC8A 4IOJA 1HV8A 5JEDA 1H8ED 2QENA 1KMQA 4HAUA 5FUWA 3WYFA 2F7SA 1P61B 1DELA 1R4AA 3ECCA 4D0NA 2Q21A 2C77A 1LF5A 2O8FB 4MQBA 1G21E 1Z0IA 4NYIQ 4A8JB 4BECA 4ZI2A 1TMKA 1R8QA 1NIPA 4W5JA 2ZI7A 3U7EB 2QM7A 3H1TA 2OEPA 5KU1A 1VDZA 5CYOA 3SYNA 1H85A 4M9XA 3TMKA 3GPLA 1T4GA 3IIMA 2VP9A 1UKEA 2X2EA 3SYLA 4GZMA 3I5XA 3CH4B 3FMOB 1TAGA 2OZEA 4OI1A 5AUQA 3VMFA 1C4OA 3FFBA 6Q21A 3LY5A 2ZSBA 2Z4SA 4B44A 1II8A 5AWFC 4XWKA 1AM4D 1MT0A 2GF9A 3OZUA 3GLHA 4PQYA 3DOFA 2AFIE 4PR0A 1PVOA 3VHLB 3PUXA 1XRJA 2RHMA 3AVXA 4GPTA 4OK3A 4D4LA 2FEMA 2ZPTX 3K0AA 3ND8A 2BBSA 4HDCA 5BN4A 1NVUQ 1F2UA 1E96A 2F9LA 3AF2A 4JLPA 4TMKA 4RCZA 1EWRA 1NBME 5DYGA 3G6EB 1Q3TA 3H84A 3TIFA 4HAWA 1F2TB 2Z0MA 3R9WA 1UAAA 4DDVA 3U5ZB 2ONKA 2BIFA 2V6JA 3KQKA 2BC9A 1UDWA 2BMEA 4JLBA 2FF7A 2VLIA 4MGKR 1SKQA 3QOFA 3B60A 4TMWA 2Z83A 1X3SA 2VNJA 1CP2A 1Z29A 2G77B 2IUTA 2QI9C 1VQLB 2BPOA 5EP4A 3LLUA 4NYJR 2F9MA 1KI7A 1WP9A 3ASZA 4PSVA 4TSFA 3T5DA 1OGIA 3KX2A 5JFGA 5KHOC 4PC3A 3I56B 3PUYA 1KKMA 3GMTA 1OLOA 2WJGA 1GKIA 5E7JA 3PQCA 2WWFA 1TNDA 4M1KA 1QFYA 3ZVNA 4FI3C 5HCNA 1M1KD 4MITA 2YOHA 1NP6A 1CJUC 2OM2A 1E1RD 5A0FA 1IQPA 1KHTA 5C2JB 2XJ9A 1U8AA 2ZE6A 5CLQA 3D31A 3OEHA 4F93B 3THWA 3LA6A 1UBGA 2ZRLA 1RYFA 1SQ5A 1S9HA 2IS6A 2BVNA 5J4VA 3CKLA 5JZVA 3FTQA 2BMWA 4LBYA 2OFXA 3W9YA 2B6HA 2BJVA 3PEWA 1QG4A 3ES9A 2ERYA 2WAYA 4GOJA 1GL9B 4QM6A 2BGJA 2DPXA 2BOVA 2IXEA 5GVSA 1T8UA 1L4YA 4P6VF 4L16A 3SNHA 2B8TA 4M1TA 1G5RA 4Q4LA 4BQSA 4IKEA 4LHVA 1W48A 3CONA 3RSOA 2WWXA 1P2UA 4URWR 421PA 1US8B 4LHXA 2HDNB 1YJ9B 2DBYA 4OHYA 5F2EA 2Q6TA 3K09A 5FUVA 2QGZA 3IGFA 2VL7A 4A9AA 4OJKA 3KQUA 1FX0A 1OB2A 1E2DA 2WM9B 2X8AA 2QTVB 3IBGA 3U4QB 3WP0A 3CM0A 1JI0A 1G20E 3AEZA 4B76A 2BV3A 3K9NA 1KSHA 4Q4JB 2GCOB 1A4RA 4B35A 5FPHA 2CLCX 1D9ZA 5LB2A 5DYIA 2EFDB 5LPNA 2RGBA 1VQKB 3Q7PA 1BIFA 3ADCA 3NXSA 1E9AA 1XEXA 2IUUA 1JBKA 1M1YE 4HSEA 5GJBA 5TDHA 4C2UA 3OF5A 4DIDA 4XOIA 2YZ2A 4BFWA 2ECKA 2ZE8A 3A8TA 1N6HA 1VYUA 4R2HA 1DEKA 4B74A 1Q1ZA 4IOKA 5JSZB 1EP2B 4CT4B 2R6HA 3IIKA 3QXCA 4GBMA 1P75A 3R8CA 2ZXUA 2NO9A 2PJRA 3TUZC 4RD4A 3CPJB 2VP0A 4OYHA 1QGAA 1Z07A 2MSCB 4BFXA 1Y63A 1H8HA 3ZC3A 5F9FA 4A0FA 2FPLA 4DLZA 221PA 3OIWA 4DB4A 1G16A 1E2IA 3NBZC 2ODWA 4GP6A 1NY6A 3TGPA 3OESA 1F48A 3R7WB 3TSOA 1J90A 4NTZA 1J99A 1FNMA 4KLZA 5JI2E 1XP8A 1ELOA 4URVR 2FU5C 3JQPA 2CHQA 3BWDD 3B1YA 5J4YA 2RGDA 3HYTA 3WYGA 2RGGA 4W5WA 5G3YA 4YAUA 1LVGA 3B7GA 4KSBA 1SHZA 2C9CA 2QZ4A 1R0YA 4H1VA 4EJSC 2H17A 3CPWB 1H65A 1NJGA 1U94A 2ZYVX 4EUNA 4BFUA 2AKAB 3QKRB 1YZTA 3CNOA 1KDTA 1YRBA 4S35A 4US1R 1YZLA 3KJHA 4Q7KA 4EAQA 4UNRA 2P65A 3U2QA 4DSUA 2QAGC 1W4RA 3U61B 1E2NA 2R6CA 4KFTA 3SQXA 2JLSA 3HPQA 1AKYA 2OE2A 1GIAA 2GA8A 1I4TD 4UNQA 4LSGA 3PITA 5KOYA 3ICEA 4P33A 3W34A 4BLRA 1WA5A 1K6MA 1LFDB 1HTWA 3L0SA 3QF7A 4V0ME 5KO2A 4OBEA 2JLQA 1KGDA 4B4DA 4Z1MA 1NMXA 3RNLA 1VYVA 2QDXA 2ASEA 3OJWA 2PCLA 2JATA 1E2GA 2QY9A 4IVQA 4KO8A 1R2QA 3F3YA 2J7KA 4DLWA 3SHFA 4O3MA 4GFDA 4FCVA 821PA 4Q9JA 1I2DA 1CS4C 3AH8A 3CC2B 2IYTA 1W2HA 4P4UA 3SDZA 3T1VA 4FMDB 5DH9A 2HJGA 2IUSA 3RRMA 3KB1A 2ZI6A 3W5JA 1PZNA 2HYDA 1Z0AA 4B48A 4LY6A 3WBJA 2OXRA 1IJFA 2QPOA 3AGQA 3DMNA 3CC4B 1VCMA 3LBIA 2V4ZA 4IVRA 3OIYA 4LV5B 4EPRA 3HP1A 1E2KA 4IEEA 4MGZR 3DMDA 3TAUA 1S3SA 1KIMA 2WOJA 4YHBA 1CKEA 1XNJA 4LOAA 4PQFA 1XTSA 3QVVA 2YINC 1II8B 3F8TA 5DGXA 4QFMA 1JQLB 4L9WA 2ZJYA 1JR6A 4GDFA 2OBNA 2ZITA 3WMEA 4F7DA 3ADBA 3BBPA 3CCEB 1T0HB 4PAQA 4RSGA 4IDOA 1JR3A 3K0AB 1KNXA 1OIVA 1V5WA 3NH6A 4EFMA 2BSAA 4M53A 1QUEA 1XCGB 4B47A 1F2UB 1G5PA 2CVHA 2P5SA 2QORA 2R62A 3AKDA 4ACBA 4QGGA 3EPHA 1P5ZB 2AK2A 1NMYA 4AWXA 4TYWA 2ZUCA 1N5JA 4HLCA 1IY0A 2ZRBA 1R8SA 2G0NA 4LYJA 2ORVA 3WMFA 2QQ0A 5J4KA 2JLRA 2QU8A 4HZUA 4L5BA 1OKKA 4ASUD 3CCVB 2E87A 3OIUA 3TQFA 1HQCA 4G5RA 5FBVB 2EWWA 1W0JA 2A5GA 3C8UA 4DWJA 2GEDA 1X1SA 2BHRA 4KBFA 5F3WB 5FOVA 1DAHA 4IDHA 2QN6A 4EPTA 3MG9A 5J5CA 5GV8A 2W83A 3EIHA 1Z0JA 1G17A 4IXMA 3LVQE 2HLDD 4LJ4A 3VU9B 2VP5A 1N6NA 4TMZA 2G83A 4A4DA 4BEBA 4QBIA 4Q9HA 4F38A 4GL2A 3KQLA 1OXUA 1DOAA 3RAPR 2J0QA 4J0QA 1H42A 2CL0X 2UZIR 3J81k 2AWNA 3HU2A 1ZNYA 3UKDA 3BOSA 3CBQA 3NIBA 1U8ZA 3KZ1E 4PAOA 3MAAC 2HJVA 5EE3A 4DEXA 5J4HA 3GCGA 4RD1A 2QE7A 2YYZA 4URZR 1Q1QA 1BMFA 5FFMA 3AVWA 2WJVA 4JLAA 2MSDB 1Q22A 1XEFA 3A58B 3OAAD 2CLSA 4L15A 3VKWA 3THWB 2CJWB 3T5GA 4BRWA 4M9ZA 4DQLA 4DLUA 4MDFA 1OHHD 3QG1A 2ZIAA 1RPZA 4LI0A 4XVRA 2AN9A 4HEJA 3ICQB 1Z0DA 4K81B 3UMFA 2QP4A 4YMTA 4PO8A 3NC0C 1MABA 3X1ZA 3G5UA 3UPUA 1E1QA 1GAWA 5AK0A 1F5NA 1W34A 5FBLB 1N3BA 3BB1A 4ZO4A 1TTTA 2BMJA 5BYKA 3OFND 2MSEB 2YC4C 4KXFB 5AJZA 1RRFA 3T1OA 1BX1A 3CZPA 4HAXA 4XVUA 2JJ1A 1QH0A 1G8GA 1IXRC 1E4YA 4ZIRA 3PCRB 4FD2A 2Z6VA 3M1IA 3QG5A 4AYTA 4JJZA 3RABA 2FDCA 4NBSA 1FX0B 1WQ1R 3PUWA 1OFTA 4V0LA 1ZJ6A 3DEFA 2W0SA 2FZLA 1XMIA 4AG5A 4KODA 4EQ6B 2CNDA 4Q1CA 1QDEA 3V4RA 1ZNWA 2NPFA 3AB3A 1XDBA 4DLVA 1OH6A 5GJWC 2YWGA 4EH1A 1HYQA 4IDQA 1QG2A 4K8OA 4OHWA 5E3HA 4ZPXA 4URUR 1KK0A 1SXJD 3QFTA 1PLLA 3N70A 1CNFA 5TR9A 4LYAA 2LWIA 3KXIA 1JA1A 4LRWA 3B6EA 1ZAKA 1Z5ZA 3SJAA 1W7AA 2FSIA 2PX0A 1YI2B 1XEXB 4BZXA 2CK3A 2N46A 4P0TA 1RW4A 3A4LA 1CXZA 1ZCAA 5SZJA 3UXMA 4JLVA 1FFHA 4QGFA 5JCPA 4YDHB 2GBLC 5EP2A 3I1FA 1T91A 4PSAA 1P73A 1RJ9A 1U9IA 4QGHA 1J8YF 1PLJA 3K0CA 1OT3A 1DO0A 5AJXA 4C43A 4DEYA 3U3OA 4O0MA 2A30A 4QC2A 3W6OA 1HA3A 5TMPA 3AVTA 2OCBA 4Q1EA 1E9RA 1GRRA 3BIFA 4A92A 2XB4A 4BFZA 4G01B 1R10A 4YMUA 3IIJA 4LGMA 3EPJA 3T61A 2X77A 1JPNA 4Q47A 3SN6A 1GILA 2R6GA 2J7PA 1K9MD 2AK3A 2ZE7A 3CWQA 1T8TA 1NRJB 3FVQA 2GJ8A 2HF9A 2BKEA 3MWKA 5FL7D 5C46F 2R2AA 4F4CA 2ZQ5A 5LD2B 3FMIA 1N25A 1P60A 2XXAA 3QFRA 4G5GA 1VPLA 4QBGB 2IT1A 2QUZA 4JT2A 3W5IA 5JRJA 2GK7A 4LBZA 4A0GA 5HZHA 2CDNA 1HT2E 4B3GA 4RCYA 4BFTA 5FA6A 3FYHA 2XNDA 1KMHA 2OFWA 3LX8A 1TX4B 4NPHA 3TNFA 4G1BA 1NIJA 4V03A 4OQLA 2Q9BA 2RC5A 1S9DA 4CGZA 3WNDA 2PLFA 1UBCA 4G0NA 4MRNA 2XNJA 1MRNA 3K1JA 3VTKA 1I2MA 2IYQA 3T35A 1UDXA 5TV2A 1IY1A 5KSZA 5HE8A 3CCJB 1E9DA 1AQUA 1UF9A 3NWJA 2QM8A 1AZSC 5AUNB 2GCNA 1W36B 2O8BB 1S72B 4FWTA 3CZQA 4YAWA 2BBOA 2V54A 3QUSA 4C0QC 4AKIA 1GJRA 4QHSA 1NN0A 2JLVA 5J40A 1XMSA 3LDAA 4DRZA 4B32A 3KJIA 2D7DA 2W00A 3OZXA 4TTRA 1HY3A 4M22A 1GVHA 4UXHA 5GADl 4ACAA 3E1YE 3NH9A 1DARA 4AK9A 3TE6A 1C9KA 5LBIA 4HLUC 4Q4AA 2QMEA 2G9NA 4JZKA 4XD7D 2ZRAA 3SYKA 3ETLA 4NYIR 3VR2A 4KHZA 5C4MA 3MCAA 2ZI4A 4NHOA 1NLZA 1II9A 2G1KA 2OHFA 2ZRPA 5IK2D 3N5CA 1J9ZA 2DCUA 3KKNA 3IQWA 5EQTA 1FNDA 2J3EA 5B64A 3R8FA 2ZETA 3B1VA 2ORIA 4LK2A 3TVDA 3G4SB 2ZYWX 5FUXA 4ZKEA 2B21A 2FN4A 5H1YA 1ZUNB 1AA9A 1E6CA 3WNCA 1L8QA 1UEIA 1VCOA 1SXJC 4FMBB 2Q9AA 1XPUA 1OPXA 2CCGA 2LKCA 2IWHA 4NCNA 1JXOA 1QHYA 4WBSA 1FUUA 2Y8EA 2VRWA 1UMKA 2ZM5A 2ZJ5A 3GFTA 3MD0A 1V43A 5KYKA 4TMVA 3TW8B 1Q44A 3HU3A 3BC1A 3GLGE 1SVKA 1EGAA 1QFJA 1MO4A 1XCMA 1KI8A 1LW7A 2AL7A 2KBFA 2R6AA 2QP3A 5FBRB 1VQ5B 5THXA 3EZ7A 1F3OA 1DAGA 4MRVA 1XCPA 2WSSD 1BO6A 2E1RA 2QL6A 3CCQB 1M7BA 5FUYA 5JCZA 3MSXA 4HZUB 2OBMA 3QFSA 2JIZA 3H2YA 2X1VA 1Q21A 1OGJA 1S1MA 3NHBA 2GZDA 1JB1A 1FTNA 4JBYA 1Z0KA 3QI2A 2RGNC 2ZTSA 4XTRA 4BE7B 5FBWB 4K46A 4KV9A 1KDPA 2FEOA 4ARZA 1QGZA 2H7VA 3AVYA 3MWLA 3TK1A 1ZW6A 2PZGA 4JLDA 1FDRA 1D9XA 3THXA 1U90A 5CB6A 4MKHA 1VYTA 4H9GA 1XB2A 2RB4A 2J9RA 5KSPA 2WKQA 3GP8A 1OF1A 4AC9A 1OV4A 4B33A 1FQKA 1EFCA 3W90A 3I62A 1S0UA 1JALA 4RVCA 3CF6R 4LUCA 2VA8A 1U0LA 2B7CA 1GRQA 1VG1A 4D25A 4IRUB 4UNSA 721PA 2HCJB 4N3GA 3EWAA 2TMKA 3Q85A 4TWZA 1NL3A 8OHMA 1G7RA 4XSHA 2I4IA 3GLHE 2ZR0A 2DYKA 2YC2C 4QG7A 1KD1D 3W3AA 3T34A 4A0RA 5KDDA 4F4JA 1KO4A 3CW2A 1ZU5A 1RVDA 4HZIA 5KUTA 1Y3AA 2CRVA 3MLEA 2Q0HA 3NG1A 3RS0A 3TH5A 5HKKA 1DE0A 2OV2A 1X6VA 1YJNB 4Q1BA 2PMKA 1XU4A 2F1HA 1E94E 3QENA 2N1BA 1MABB 5FI1B 3I92A 3UMRA 1N2CE 4E09A 1SULA 2AXNA 3B9QA 4BLPA 1G8PA 3CMAB 5KNDA 2VTKA 1B23P 5FOUA 5BWMA 3KQNA 2IS4A 5B58C 3KKQA 1OXXK 4JVMA 1KI6A 4AF7A 4HB3A 3DO6A 2AFHE 4MA4A 2CHVA 4LV6A 2IX3A 1OH7A 2EIXA 2WJJA 3MWYW 4YMSA 2QSYA 4CEIA 4W7SA 4TYPA 1T3LA 3SBEA 1KO1A 3U44A 5L3SA 2R6DA 4QM7A 3F5FA 3BAFA 4TL7A 2QAJA 4ZKDA 3ZLJA 3NHAA 3LO8A 2V8OA 2AD5A 4HE6A 3TUIC 1G3RA 2DWOA 4YMWA 2D06A 3DDCA 2PIAA 4UXJA 3LFUA 3FHOA 2GXSA 1R5BA 2C99A 4NDZA 1XTQA 4Y9RA 1P2VA 4IHQA 5CITA 3FDIA 1NBMD 3HPRA 1EX7A 2C8VA 4QHYA 3CPHA 1NVWQ 2WSMA 1E9BA 4FK8A 1N6IA 3RS7A 4GP7A 5D3QA 5EP1A 2R44A 1XEWX 5G3ZA 1FP6A 3K70B 2ZSFA 2ZRHA 3WNBA 2P3SA 2V1XA 1T6NA 1XTRA 3VO2A 3AF1A 1S3GA 2WV9A 3CC7B 4NYMR 3FPAA 2ZRJA 2CNWD 2ZUDA 4TLEA 3TLXA 1YZKA 2HYIC 2K5UA 2WKPA 5CLLA 4FMCF 2XZLA 3WRYC 1KDRA 1KY2A 3HJNA 3TUJC 2FA9A 4KVGA 1Z28A 3KXKA 4MKFA 4U02A 1KSGA 1S4QA 4EKDA 2F1IA 2BCJQ 3A1WA 5DLQC 3MUFA 1G3IA 1LB1B 3KKMA 3NDPA 4NL4H 2V1UA 1GVNB 3EIEA 1QF9A 3EASA 2WIBA 3H0KA 5B57C 2IYUA 1G8HA 4YONB 1YJ5A 1EK0A 3L8YA 1KMHB 1H8HD 3KKPA 3U3JA 3ZVLA 2ZI5A 3C16C 2XTMA 4KVAA 1R0ZA 2NO1A 2P6UA 3I5YA 2ZYTX 3VNVA 2W6ID 4TZ6A 1GO2A 1A2KC 1KJZA 3QKSA 2EFEB 1G3MA 2KSQA 1UKYA 3BXZA 3CRVA 4JLMA 2QSZA 4JBWA 3CX8A 3AVUA 1E2MA 2OO7A 2RGXA 4LX0A 3JQRA 2EYUA 4LYHA 1XD2A 4P4TA 2ZRKA 1RZ3A 2GVDC 4IJMA 4B3CA 2BBWA 5L8VA 2DB3A 3A36A 3FFAA 2RH5A 3C5HA 2WJYA 4LJ7A 5A4JA 2PEYA 3QPUA 3U3MA 4D4MA 1TVCA 1J2JA 1KSJA 1ETUA 2VHUA 4PPFA 4WAUA 2L0XA 2XITA 4MRPA 2JDIA 3BERA 5BYJA 3SFZA 3C4JA 1P2TA 4FINA 3NC1C 1XTIA 3K9HA 5FOTA 1G9XA 2P0EA 4C0KA 2VSXA 1OIWA 3B5JA 3FKQA 1FOEB 3MRSA 1CQXA 1G3UA 4JS0A 1TU4A 3CWZA 4C0AC 4A2PA 2FH5B 4EPYA 3VFDA 5EUQB 3QKTA 3EPKA 1W36D 2UZ3A 1CR0A 1T9HA 3UWKA 5CIQA 2XB2A 1Q57A 1U99A 4EFNA 2I3BA 4UQOA 1Q82D 2IBMA 2J45A 2JA1A 2WKRA 1FMLA 4Q1FA 1EXMA 1FNCA 4HB4A 4Z1MD 2PEZA 4RD6A 3R9IA 2C96A 5CIWA 3TSWA 4ESHA 4Q7JB 4BLOA 1YIJB 3SBDA 4TMTA 1XPOA 3OZVA 4DDUA 1QHHA 4YC7A 4U9UA 1UBEA 4R2IA 1IM2A 4U00A 4KYIB 1RKBA 3V9PA 4XH9B 3P4YA 4KFUA 4CF7A 2QGNA 2P2LA 2ZRGA 3ZS9A 1NI3A 4BFYA 4DDTA 3RDPA 4HAVA 1XPRA 1GG2A 1N8RD 1VIYA 2GXQA 3QEOA 4DVGA 4QL3A 1GNRA 3P1JA 4FN5A 2XEXA 4K1XA 4EPVA 1NNEA 2QT0A 4B3DA 2FV8A 3OE7D 1E64A 2ATVA 4TMXA 4LBVA 3CF0A 4D6PA 2C04A 4NCHA 1H8EA 2DWQA 3KB2A 2IYZA 1AK2A 2XX3A 4D81A 4ZDKA 2DETA 1UKVY 3NVAA 1GNQA 2ATXA 3BB3A 4CT5A 3Q72A 1RC8A 3QPVA 2A5DA 5AJWA 2XTNA 2WPDD 5EUMA 3K0FA 2E9SA 3SC3A 3MGCA 3AKEA 3CPEA 4HUQA 4R7ZA 3W5UA 2ANBA 1KRHA 3QE2A 4CYMA 4LPKA 2NZJA 3V76A 4Y9UA 2ZS8A 2D2FA 3O47A 4GOXA 4CDGA 5J47A 3A6PC 1QX4A 1EESA 4JYCA 2QA4B 1G7TA 4N1AA 3A1SA 3TKLA 1GR1A 4WOPA 1IONA 1E69A 4BFVA 1P72A 1IN6A 2REXB 3LXRA 1AS0A 3ZH9B 4BLSA 1JB9A 1ZU4A 2VHCA 4BRUA 2WWYA 4IW3B 4LV8B 1J7KA 2NIPA 4NYMQ 2DY1A 4DLXA 3RYTC 1XJCA 1G7SA 4RKEA 1W0JD 5KDLA 4E07A 5L3VA 2B92A 1F60A 5JJLA 1MKYA 3KQHA 1XXHA 2FNAA 2FSFA 4M4SA 1W0KA 3D3QA 1AJEA 1CR4A 4R71A 2OCAA 1EX6A 1U0HC 1SVWA 3VR5A 1GM5A 1TF2A 4PC2A 1JR3E 1KAOA 2IEYA 2KWIA 2Q3HA 3EG5A 3AVQA 4HAYA 5JRZA 2O5VA 1ZD1A 3TW4A 4CEJA 5HCIA 1EP1B 3D8BA 4BEJA 3AP3A 2PZEA 4NONA 2D7CA 1EFHA 3EA5A 2O0HA 4C7OA 1SHKA 4KITB 4Z8YA 1MRSA 1VKJA 4C3ZA 1LV7A 2V7QA 2C95A 2DHRA 2QE7D 3K9LA 4G5OA 3GJ5A 1BMFD 3U60B 1W47A 4C0JA 4YMVA 2XOKD 4WVFA 1N6RA 3GJ3A 5KPDA 4LJ8A 1N6PA 4HAZA 2GVZC 1W36C 3HU1A 2IYXA 2QG6A 2RMKA 3GLGB 2F6RA 3GJXC 2YKGA 3C14C 4CEIB 4TL9A 1IY2A 2F1RA 3IILA 1UM8A 4WZAE 3X1WA 2JLYA 2H8KA 2GK6A 1T3HA 4PTLA 4B73A 5L3SB 3IO3A 3U44B 2O8EA 1XD9A 1E1RA 2GAAA 1ANKA 4AG6A 3RHFA 3SE0A 1VQ4B 1DS6A 4EJSA 2YOFA 1AGPA 1Q1EA 3PUVA 4A82A 5TVKA 2JJ2D 5EP3A 3DM5A 4FWIB 1W4AA 2WTUA 1E0AA 4Q1AA 2CMKA 2JJ1D 5CM9C 3ONWA 3X1XA 3ZZ0A 1B2RA 1Z6YA 3BORA 4IDNA 1W46A 4HLQB 2UVQA 2ZYUX 1M7GA 4DT1A 1UADA 1HURA 3IHLA 1AIPA 4M9QA 4M1MA 4HUTA 3CCSB 5HR5A 3FHTA 2VHTA 2AKYA 3LNCA 1KK3A 2VF8A 4Q9IA 3DOEA 2ZRCA 3SFVA 2VYFA 3RVBA 3T15A 3B13B 3ZYCA 1AN0A 1ZMXA 1YZGA 3TR5A 2RC6A 3OJXA 5G53C 1CRQA 1E0SA 1AMOA 1KI3A 3GLHB 3H86A 4EIWA 2NO0A 5FOWA 1IJEA 4LZZA 2HCBA 4WQMA 1R0XA 2CK3D 2BGIA 1K5GA 3P4XA 4WA7A 3B1XA 4PHFA 1YR8A 3KKOA 2XNSA 5KDOA 3W8RA 3C5CA 1NN5A 3AVVA 1SZPA 1HQYE 4LJ9A 3SQWA 1CEEA 3W5VA 4QRHA 2EU8A 1OXSC 2JJ8A 3ZIAA 4QJ5A 1U98A 3AF0A 5G40A 1U0JA 1CNEA 2C98A 3IBYA 1TQ4A 4MUBA 2GESA 1YKSA 1QHXA 2EYQA 1WMSA 5EXTA 1WBDA 1FPMA 1XF9A 4A15A 2J46A 2IF0A 2A7QA 4C30A 3QKSB 4LJYA 3LXXA 4X8MA 2ZVPX 1DPFA 3F0TA 3RWMB 1W4BA 4DKXA 2FFHA 3MHPA 3KDSE 4OHXA 2QEQA 2XSZA 4JLJA 4KFRA 1ZD8A 2OAP1 4AY2A 3E70C 1N5IA 2ZUBA 4I99A 4WIAA 2ZRNA 3GLIE 2BM1A 3EPLA 1JNYA 3LX5A 2W6JD 1E62A 3Q9LA 3GLFE 4ZCMA 3PIRA 1NVXQ 1FNNA 3P20A 1IN5A 1F6BA 2P6NA 4Q1DA 3A4MA 3HYRA 3RSLA 4A1FA 3FKSA 1QUFA 1E2EA 1Z06A 3NTUA 3ZBUA 5LDDC 2FE4A 1XFAA 1P9NA 3E1SA 5KTYA 3NKVA 2YWHA 4MRSA 4A2QA 2ZE5A 4F91B 2NZ8A 1E79D 5DHAA 2H1LA 1ODFA 5SZKB 1Q0UA 4BPRA 4IFBA 3IDQA 5D3MA 3CMEB 1ZINA 5E7MA 3B2EA 5BN3A 1GAQA 4DSNA 4M9SA 4DQKA 3M4YA 3WBKA 2WBLC 1YR9A 2CL7X 3QVUA 5FPKA 3U6BA 1HT1E 3CCRB 1RFLA 3DKVA 1TEXA 4JL8A 1II0A 5B2ZA 2QTHA 4RFVA 3CLVA 5CK5A 5B30A 1G41A 5J4LA 4BFSA 5TB5A 5FTMA 4DLYA 4AKHA 2NQ2C 3LBNA 1KSFX 2BCGY 5JS7A 3JZMA 3OEED 3G82C 2GWHA 4JBXA 1DDIA 3CX7A 3FOZA 5TXGA 1KNQA 3I32A 4UJ3A 1DADA 1K8RA 3C15C 4A6XA 3TJZA 1R7RA 4I1UA 4RZXA 4D2IA 1G1MA 1KI9A 2AHOA 3I3SR 3LW8A 4JL5A 2NO6A 1CF4A 2GDJA 4MH0R 3HDTA 1XZPA 4CW7A 1N0VC 2D62A 4JT4A 1JA0A 3E20A 4V0NA 4M2LA 5KPJA 3EX7C 4X8HA 1KI2A 2GJSA 3QFCA 2H18A 1COWD 4LYFA 4TYNA 3ND9A 4G5SA 4A8JC 2IS2A 4JL6A 4TYQA 3K0FB 4NKRA 2IC5A 4OQMA 3P26A 4IDPA 4HUQB 5CK4A 2J59A 1X8JA 2BF4A 2DFTA 4NCKA 1NG1A 3GLIA 4Q9KA 1VG8A 2JLUA 3BGWA 1YZQA 2OTLB 3O8BA 3T1QA 5HXBA 1R5NA 1Z83A 1K5DA 1XMVA 3RRZA 3GLFA 2RGEA 4Q00A 2OBLA 3BRWD 1VHTA 3T06B 2O8FA 4C4PA 2JIZD 1A82A 4PZZA 1KO8A 2EW1A 4YAOA 3DHWC 5DIFA 1MH1A 1J8MF 4DLRA 3ZJYA 4D4KA 4US2R 1IN8A 4WZ6A 3VHXA 3MMPA 2J41A 4C0BA 3NEJA 1VQNB 1XD8A 2QP9X 4NMMA 1BYUA 3HR7A 4YXWD 4XSGA 2ODEA 2X3UA 3QXXA 1UEJA 2ANCA 2GBLA 1NSFA 2G1JA 5JEEA 1BS1A 3KFXA 1G8YA 2GRJA 3RWOA 2BWJA 3PFIA 2EVWX 3SOPA 1I4DD 3I8SA 3BJIC 3LD9A 3UG6A 5KSOA 1CR2A 2HT6A 2GXAA 1D2NA 4N0EA 3K8YA 4G3XA 3RRYA 3V4FA 3W2EA 1TL7C 2J0SA 1E9FA 4ASUA 2EWVA 1CJTC 2YNMA 1G4AE 3GFPA 2VIIA 3VAAA 1R0WA 4C7OB 1S2MA 1N6LA 3EAQA 4F4IA 1AKEA 3EA0A 3CXCB 1FZQA 4FCWA 4EDHA 1EP3B 2YWEA 1G8FA 1XBTA 2H57A 2HLDA 3GJ4A 2VYQA 5GV7A 1GFIA 2ZSAA 4P32A 4TQ9A 2O0JA 3Q5DA 5DHFA 4RD2A 5DN6D 3L0OA 5HKKD 1YRAA 4D0LB 4ZDWA 1EFRD 1YHNA 3THOA 3W6PA 3AV0B 4KU4A 5FBQB 1ZM3A 2FGJA 1P62B 1QVAA 1KK2A 4DHEA 1SVSA 1PUJA 2CCJA 4X8OA 1X1RA 5AJYA 4GOKA 4EJSB 1YVDA 4ZV4A 3VO1A 3I72A 1FMJA 2OT3B 2PMDA 1E99A 4UKDA 2I1QA 3D6TB 3GJ6A 4OKSA 4F7WA 3SI7A 3W2FA 1X86B 2YWFA 2XTZA 4QBFA 1UKZA 2ZJAA 2ZJZA 4OK5A 1TQ6A 4A0HA 4PZYA 4PQRA 2XJ4A 2Q3FA 1SVOA 2CXXA 3ASYA 5IT5A 4TYYA 4QJ3A 1NKTA 4E03A 4IOLA 5FTNA 3AKYA 4GI7A 1MOZA 2GPJA 2WWIA 3OFNA 2DFNA 1ZC4A 2WWHA 5KSYA 3O8CA 2FX3A 4R9UC 1P9RA 1I4LD 1Q20A 3FGNA 5AUPB 5BW8A 1P9WA 2F43A 4AKEA 3QF4A 3GJ7A 3L82B 3AM1A 3BK7A 1XTKA 3PEVA 1NVVR 3FE2A 1KOFA 1LF0A 2DFKB 4ERNA 4B3BA 4D4JA 3VNUA 4V0KA 1E9EA 1Z08A 4OQNA 1SKYE 1BX0A 4I4LA 1NF3A 1GNPA 2FMXA 2ZR9A 4WW0A 1GWNA 2RGCA 5C1BA 2OILA 2QBYA 5EE0A 3EARA 4PANA 1DAIA 3DM9B 1UBFA 4AURA 5IRCD 1US8A 2WICA 2JASA 3IO5A 1X8KA 1LTQA 2ZRIA 1M2OB 1SXJA 1RIFA 5GJCA 2B5OA 3CR8A 4TTPA 4G1VA 4DZZA 1Z2CA 4DJTA 1D2EA 1W35A 2ORWA 1FTSA 3PEUA 5SZIA 3U4QA 1A1VA 2GJKA 1W2BB 3FB4A 3W2GA 2HUPA 3L0IB 2F1JA 1Z2AA 1G19A 4UXIA 3JVVA 4PPQA 1VIAA 1GL7A 4Q4JA 4KSCA 3LVRE 4G1UC 4HDOB 1QHNA 2KE5A 3O8DA 3FMFA 2FFQA 3H4MA 1GSIA 4LCBA 4LHYA 2REOA 1NJFA 2CBZA 2I1VB 4JSYA 1VMAA 2F3TA 1NKSA 4JKIA 4C0HA 5CDFE 3W2IA 2QROA 1ZP6A 3PR1A 2RGNA 1NG9A 1WXQA 4TSFD 4NE2A 1DO2A 1W49A 5FL7A 3VQTA 4FCTA 3ZZTA 3W5HA 1DVRA 1MO5A 3QEJA 3ADDA 3B8HA 1A7JA 2PX3A 3CUEF 2RCNA 3B78A 5JI3E 3KTAA 3LWNA 4UNPA 4OHVA 4KBGA 2QQEA 4W9MC 3RC3A 4IFEA 4D0GA 4OK6A 1MO6A 1O3YA 1KC8D 1P3JA 1QZXA 2JDID 3L2OB 2A5YB 1XJQA 3SJBA 4B34A 3ZD7A 2VP4A 3W6NA 3OEHD 3I8XA 5JWHA 5DO9A 2IYVA 1QHSA 2QPTA 1CTQA 3NBXX 3ZDQA 1YR6A 1CULC 1NN3A 3Q7QA 4HLDA 1Q81D 3TAHA 1E2JA 2CE2X 5EE9A 4FXPA 3ZS8A 4BWYA 2W2XA 2G0TA 4TLAA 3QBTA 1NSTA 3TVTA 2RHDA 1Z0FA 2ZREA 4ZIRB 3B1ZA 4BPBA 2QA5A 1YQTA 3IUYA 3WXMA 1LY1A 5EXSA 3G71B 1EG7A 1GRNA 1ZM9A 3AVOA 4TL8A 3ADKA 1EFTA 2HF8A 3IKJA 3U3KA 1UJ2A 3QKRA 4YQFA 2VSOA 4BGDA 4PX9A 3U3RA 4KAXA 1M8PA 4ZCIA 2OCPA 4ZI3A 3U7HB 1TF5A 2ZJOA 4QJ4A 4RZUA 1G3QA 5DISB 1DDGA 2HT1A 2IF2A 1SM4A 1Q7YD 1Z3IX 3KL4A 2VP6A 2AXPA 4URXR 2VH5R 1R5OA 2AR7A 5IK2A 4IEIA 1EFUA 5ELXA 2NMVA 5EXPA 2DERA 2ZU6A 2V3CC 5BN5A 3JVUA 3SJCA 1W1WA 1WRBA 1IBRA 1OXVA 4PPGA 2ZVQX 1XWIA 1RJ9B 3GLIB 1YZUA 3PEYA 4E5UA 5CDFA 4POAA 3VKGA 2GZHA 1QVRA 1Z6AA 1E2LA 3MJHA 1FUKA 5L3QA 3GLFB 3AP1A 3VR3A 3K53A 2R6FA 1KO5A 1VQ8B 1FQJA 3I4LA 2REBA 4D82A 2LKDA 1NVVQ 2QNRA 4Y0VA 1OYWA 1W2GA 4A36A 2ZSDA 4JVLA 3DPUA 5EE5B 2GHIA 3LO5A 2WMOB 1LNZA 2WWGA 3M6AA 5C18A 5JHHB 4Y0AA 1RE0A 4O2RA 2IYSA 1GTVA 621PA 5F98A 1IB0A 4NP6A 4DUGA 4P31A 2XXAB 2EFCB 4GMDA 1PV4A 1KJYA 5JS8A 2WSSA 3EIQA 1NY5A 2O8DA 1I7PA 1A8PA 2FGKA 1QVFB 1JQJC 2GNOA 5FOXA 3QQ5A 1OH8A 1ZNXA 3QXHA 5FTJA 1K73D 1YJWB 3KJEA 2WJIA 3BFKA 4OL0A 1Q1BA 1QBKC 2D3WA 2PH1A 3R9XA 4D80A 3X1YA 3RS4A 2B8WA 4TT3A 3SJZA 1TQ2A 1KK1A 3IPXA 1ZRHA 1WE2A 4Y7CA 1M74A 4ZGQB 5E4FA 3VR1A 4B3XA 1W0KD 2QRZA 3GJ0A 1BYIA 3CH5A 3W8NA 1GKUB 1KAGA 3WY9A 4L9SA 5E7IA 5HPYB 3CNNA 1QHGA 2HXSA 2JGNA 4PFSA 5JWRA 4XJXA 3SZRA 4QKQA 3ZZUA 3EZ2A 4RZ2A 2PJZA 1E32A 2IL1A 4FMDF 2IHBA 3M0EA 2GQFA 4B43A 5FPYA 4DCUA 2V7QD 1VQ7B 5EZ6B 3OW2B 1K8AD 3REGA 3PENA 1TEVA 2GF0A 4MGIR 4I81A 4XVQA 2KJQA 4DIEA 2HXYA 5ANRB 4PC6A 3CX6A 2CLDX 4CRWB 3VU9A 5H68A 4Q4AB 3NBYC 2QMHA 3I61A 4PHHA 5FH9A 2QTFA 1ZIPA 4Q03A 1YZNA 1TADA 3LW7A 2ZJ8A 1E2HA 4W5HA 2B7BA 1PLKA 1QRAA 1XXHE 1OIXA 2C2HA 4Q01A 1G291 2MMCA 3TSZA 2WMNB 1FRNA 3KUCA 4EFLA 2NOAA 4ON9A 3EW9A 4U5XA 4Q9LA 3IQXA 4MYTA 2CJWA 4PXAA 2IWRA 3BS4A 2W58A 2RKOA 1DTSA 1FP7A 3K09C 1VCIA 2F43B 3A1UA 1N5KA 1OXTA 3QF4B 2YOGA 5JBQA 4I1VA 2VO1A 1IHUA 1JAIA 1WCV1 3JZAA 1GUAA 5E95A 5CB8A 2RAPA 3JQQA 4I1SA 4NCJA 4ILEA 2JLXA 3BB4A 3ZBTA 1JJ7A 2EFHB 1IOZA 2QBYB 3WHKA 4JLOA 3O8RA 2C78A 2PLRA 1DAKA 2VF7A 1CJMA 1W5SA 3OHMA 2FG5A 3QY0A 4XWAA 4CEHA 1E2PA 5AR1A 2G3YA 3AVPA 2ZSEA 1AGRA 1G5TA 1SXJB 3CCLB 2BEKA 3FJOA 3K0EA 4Q21A 2XZOA 4LBWA 1IN7A 3U7FB 3GEIA 3G0HA 1NBMA 2W2TA 4EQ6A 4KFSA 3RS5A 5IHPA 1JR3D 4OI0A 3ZD6A 2OFOA 3E2IA 4M1WA 4R98A 2HMAA 1L4UA 2GJ9A 3NBFA 4RKFA 3ZGXA 4ARZB 2BN4A 4M21A 3B1WA 3Q3JB 3THXB 4LWZA 3IEVA 3ZIAD 1OJLA 1XMJA 2V55B 4DCVA 3UATA 2ZJBA 1OKKD 3C41J 1JEDA 1LS6A 4Q7LA 2CNWA 4P3YA 3AP2A 4O2LA 4I1OA 1T3SA 1KTVA 2D74A 4MGYR 1W44A 5BQ5A 4DLSA 1GITA 1N6KA 2N42A 4V02A 4KI0A 2NG1A 2ZRDA 3RANA 1NDHA 1DG3A 4OI2A 5FL3A 4QXAA 5LD2C 1B0UA 4DC9A 5JJKA 2ODNA 4PC1A 4NCIA 2QEXB 1VG9B 1D6JA 4JJKA 2IYLD 1DBSA 2XSZD 3WHLA 1NLYA 3CCMB 4DB2A 1RRGA 3IPYA 4N3NA 3KTAB 1FRQA 5SZHB 3WYAA 2GXUA 4TLBA 2H92A 1Q12A 2IW3A 1G18A 2R9VA 3N2IA 2AWOA 2NGRA 4LJ6A 4C2TA 2WVJA 2W6IA 3OIVA 4OHZA 1TF7A 1BQEA 1ESMA 1N0WA 3FKSD 5DNYB 2P67A 2QMOA 1G4UR 1TLLA 2H5EA 2J5XA 1KI4A 2CHGA 3EWSA 1KI1A 2BBTA 1KI6B 4PO1A 1SKYB 1RRPA 1HUQA 2LCFA 2BM0A 3EZ9A 4GNKA 3VX3A 2VSFA 4FMCB 4KCGA 2PT7A 4QBHA 2A78A 3PXGA 1VCNA 3A4NA 1FNBA 1QVGB 1U2RA 3GJ8A 4DCSA 3IHWA 4B75A 4DDWA 2OLKA 1E1QD 3REFA 4BZQA 4Z51A 4LC0A 2GJAA 4KLNA 3QKUA 4II7A 2BKUA 3Q8XB 4NYJQ 4HB0A 5K8UA 2P6RA 3EZ6A 3CRZA 4DSTA 1ZVQA 1DG1G 2QAGA 2O8BA 4GT1A 4YAFA 5BXQC 2O0KA 2QTZA 4M0LA 1WDTA 3CRMA 4AIIA 2D4HA 1Z6TA 1NMZA 3QE0A 3ZVMA 5JECA 1T0JB 1W5TA 4RZ3A 1UPTA 3SEAA 4JKYA 2BMDA 2WJHA 2OK7A 1RYHA 2XAUA 1CIPA 5FPSA 1ZM7A 2C5LA 1TQDA 5L3QB 4ITRC 1XTJA 1KYIA 2YVUA 3FWYA 3V00A 4JLKA 4BLQA 2IEZA 4YDSA 3UK6A 1G6HA 4US0R 5JMTA 1VQOB 3AF4A 2XZPA 3A37A 3I73A 1J70A 2FJUA 3P32A 4RY2A 2R65A 1X8LA 2WZQA 1D5CA 5FPTA 1JJ2B 2GTPA 2YJTD 3OE7A 4B6FA 4C9BA 3K70D 4JIMA 1BJKA 2Q3MA 3ZQJA 4DSOA 4JVSB 2O8DB 1ONBA 1SVMA 1N0UA 2PCJA 4GSYA 3TBKA 1JXMA 3KXLA 5H59A 1RRCA 2KB0A 1F20A 2W2VA 3DVLA 4PC7A 1GDDA 2QT1A 2J7PD 1OFUX 2WPDA 2NTYC 4M1YA 1VQPB 2D2EA 4JSTA 1QHIA 4N0DA 1CLUA 4AI6A 5DI3A 2O8CA 4EPWA 4TTQA 2O52A 2IYYA 2WIAA 3AUYA 3WP1B 3PUZA 3U7GA 5IDVA 2OESA 5GJVC 1S96A 3BH6A 1D8TA 1ZYUA 2CEAA 4MYUA 1XD2B 2X2FA 3HWSA 1BH2A 4V0OA 1TU3A 1ZM2A 1N6OA 2ZI3A 1T5LA 1AZTA 3KJGA 1GOTA 2XNDD 2YHSA 3A1TA 521PA 1CR1A 3TRFA 1OFIA 2ONJA 2IYWA 1E9SA 1JEEA 2WOOA 4RD0A 3VR4A 4CVNA 3L0PA 4GMXA 2VQSA 2W0MA 1D2MA 1O87A 3LH5A 2QRNA 4LC1A 4L4UA 4TLCA 4JMPA 2DFLA 2OTJB 3CNLA 3FMPB 4Z54A 3S1AA 4MDEA 4MKIA 1W87A 3ZQ6A 2HEIA 2VP2A 1E0JA 4V0MA 4PHTA 4PPNA 3MFYA 4Q5IA 5DSZA 2ZR7A 5JHGB 1VQMB 1ESNA 4AYWA 2SHKA 4JVNA 2FZ4A 3VX4A 4YALA 2CL6X 5AUOB 2R8RA 4AF6A 2VNIA 3LRPA 1OW3B 1AQYA 3W2HA 1XZQA 4U7DA 2C9OA 4M1SA 1SGWA 5FOSA 3X1DA 3LBHA 3LQQA 4QOSA 4OI4A 1S8FA 3TR0A 1M34E 2IA5A 2XOKA 4ZDJA 1QHHB 1ZBDA 1TUIA 4RJLA 4NH0A 4RFSA 3L8ZA 5CJPA 2F3RA 3T1TA 5EXXA 1NLFA 2ZRFA 3SS8A 5JWOA 4HE5A 2JEOA 4ZCLA 1IXSB 1E98A 4TQAA 3QBVA 1QFZA 2XNCA 1E4VA 4LDJA 3X2SA 3PG5A 4Q4HA 1HE8B 2A5FA 1VHLA 2GETA 3UMSA 4B3FX 1Z6XA 2J0UA 2VBCA 5FI0B 5EZ5A 1A5TA 1E2QA 3IEUA 5FR1A 2JJ2A
chains in the Genus database with same CATH superfamily
1YB6A 3THYA 1Z4MA 2O14A 2VWPA 1NI4A 2A86A 3GI1A 4RDIA 3W3ZB 1XRPA 3QFHA 3V1KA 4KR7A 3TTYA 4OOFA 2VHXA 2NU9B 1TKAA 4C0SA 1I24A 2HBQA 2NUPB 2P35A 3E1GA 4I6GA 5AVZA 1L8OA 1HE1C 1PEAA 4W5RA 1J2UA 5KC9A 2GN0A 1IAQA 3H6HA 4LGCA 3IE0A 1CEQA 2EX4A 5KSWB 1ZCBA 1NRKA 4GRAA 1X7HA 2C03A 4UVEA 4IDEA 1SUWA 3RBAA 2WWWA 3HUDA 4C7MA 3O3MB 5DWDA 3WWCA 3K9WA 3ZW7A 4BNNA 4DANA 4ROXA 3HVIA 1XOIA 3M70A 4Q3AA 5IH7A 1HTBA 4Q39A 1V2GA 4BZPA 3R1IA 2AF3C 2CLMB 5GM2A 1B7GO 3RFTA 2UYCA 3P0HA 2I6SA 4MPPA 2QD3A 3E7XA 1VLHA 2G9UA 1M2JA 1ZD4A 4IJ6A 1YR7A 4K88A 5JS1A 3N53A 3NUGA 5G41A 4WFJA 1MV5A 1K2WA 2C0QA 2X8BA 3O73A 3GLVA 5CT9A 4A1OA 5JSHA 3E5HA 5G0TA 4N5DA 4DXAA 1KYQA 1MMFB 2IHYA 2XGGA 4A8JA 5I5EA 2D1YA 1OX4A 4UDYX 4BUJA 3ZW9A 4S2EA 4Z4VA 1OLUA 1R6XA 1P74A 4I1RA 3AF3A 3A27A 4QEDA 1X1DA 5H5JA 4HWSA 3T12A 2Z1NA 1ZC3A 5LB4A 3LHKA 1M66A 3S2EA 3OLWA 1UM9B 3BHMA 3T95A 1EWQA 3CD6B 1USIA 4R1TA 4Y2TA 5CLHA 4CEJB 3QPWA 3BE4A 3O8LA 2HSZA 3WB9A 2F1LA 4GUDA 3IUPA 3OX2A 1NFQA 2JH3A 2O2IA 2AGVA 2VHYA 3LAWA 1O4VA 1NGSA 3LV8A 4Z8XA 3I2IA 3UG7A 1TGYA 1BCRB 5AN9A 1KQOA 1OI2A 2AI2A 2XWPA 4G9EA 4IQ4A 3WLJA 3I9OA 4JZYA 2FP3A 4Q66C 4QOHA 4JCCA 1BOFA 5KZMB 2VZLA 1EUDB 2FSGA 3K2EA 3NV9A 1ZVMA 2IUFA 1ISSA 1J20A 1CU1A 2JCSA 3VKVA 3WQHA 3L6OO 4ZK2A 1CDZA 1E61A 3O3NB 4AUMA 4OXRA 1K2VN 2G71A 2YRFA 5ER9A 2NVUB 3VSBA 2A57A 2AIRA 2KYRA 1DT5A 2OL4A 2VJMB 4JUFA 1XJ5A 1EUYA 1A27A 3JYPA 2RBKA 1NDQA 4FFPA 2DPMA 1MXHA 4RHXA 1XTUA 3IT1A 3WMGA 3CZ5A 3QNUA 1PL8A 2VDOB 4D3DA 1XWFA 3UIEA 2PT5A 1JHOA 1MO3A 4U3JA 5I4CA 5CGQB 3U1BA 2PMCA 1D6MA 3HCAA 1AVTA 4WZBE 1A2BA 3OAAA 3MBKA 4CIVA 2PLAA 3BF7A 1CWUA 1R18A 1NN1A 1XDGA 1YITB 1PEKE 2FSVC 4NBTA 3GA0A 1DKUA 4LQCA 2PZJA 3NRBA 1OHHA 4G56A 2B2XA 2ODBA 4NOJA 5I9SA 1NQTA 4ESVA 3W5AA 1PX0A 3T3NA 1DQRA 2YL2A 4OQFA 5JLJA 2FMTA 2N1MA 1BVYF 3W7BA 4BLTA 3LUGA 4L6AA 2EGHA 4HNAB 2FZEA 3UGJA 3Q8WA 3DOHA 2FWAA 1D4ZA 4XGRA 1L4LA 2LRHA 2OYNA 1Y5RA 1RQXA 1G64A 2HPVA 1QPGA 2FR1A 4HI0E 5CEFA 1JE0A 4INOA 3EBLA 3A11A 4NQRA 5LN1A 3BH0A 4L74A 3HB7A 4EG7A 1IOVA 1ENZA 5DGCA 4ARVA 5F3DA 2AT1A 4NBVA 1VZ3A 1QE0A 3GZJA 5H4HA 3STWA 2ID9A 1Z4IA 5A62A 1GV1A 2QRJA 4KWCA 3MF4A 5IDWA 3SVTA 3K1AB 4UTNA 1Q92A 3NCHA 3BWYA 4HB2A 1V8DA 4NAUA 4OVKA 4Y2SA 4MYCA 3LFTA 5ALNA 2BLNA 3RTDA 4ABYA 2OC4A 4KBYA 1L5GB 4B6SA 3KZNA 3ANMA 4MP3A 1GUBA 1QFSA 1GL6A 4MYHA 3GPDG 4RK5A 2QTLA 4UBNA 3BRCA 4A2WA 4F2GA 3J80A 1KFKB 4X54A 1KAHA 1SCAA 4QVJA 2DR3A 4OGFA 3NDBB 1WCIA 5T4HA 4B2LA 3F6CA 4CGYA 2H4ZA 3DDOA 2JW5A 4FHCA 1GUDA 2BFCA 2QMQA 4MW2A 1YV9A 2FPKA 4TKUB 1COWA 1ZQ1A 4LNAA 2ZB8A 1T4CA 1AXRA 4OGWA 2Z8XA 4G2NA 3FFXA 3B12A 3RUPA 3VH4A 1VSTA 5KKNB 4XTCS 2WI8A 3ENWA 5JXJA 1Q15A 5H70A 2GZAA 4G1CA 1YONA 1E63A 2R4QA 4OU4A 3ZTWA 2H1FA 3O95A 3D7MA 1JJBA 4JJ7A 2O8CB 1WCWA 1SCDA 2AH5A 3CMCO 1P2SA 3DOUA 4RLSA 4UCFA 5C3UA 4D26A 3BQJA 2CE7A 2GCOA 2R8EA 2ZAMA 4DPKA 5KOJB 2GJ4A 1IHPA 3CG4A 3AXTA 1JDBC 3QIAA 3LM8A 4FBGA 2K4MA 4LA4A 1GQYA 3EVAA 4MGEA 2W6QA 3R20A 2C61A 2A4MA 1W8DA 1QIKA 4NZPA 1AUVA 1O8BA 2VDQB 3JAKB 3NEPX 4GEKA 4LHZA 2PLNA 4NRDA 1P6XA 2QT9A 4MKGA 3RUAA 4EPXA 3NT5A 5K8TA 1AQJA 1MJGM 5SY9A 1WXGA 1HRDA 1M0WA 2PT6A 1WSAA 3AR6A 4KKUA 1ZUIA 1Z9BA 1G2OA 4A8PA 3DAPA 4RE6A 1JEQB 1WJGA 2UKDA 2YV4A 2Q5JA 1V7PC 4J2OA 3QHPA 1XKQA 3RS2A 1F8UA 5HMLA 3MTQA 1IK6A 5ABPA 2C7RA 1UH5A 5HFAA 2QL5A 3GN1A 3VV2A 2RJOA 4A3SA 1R0KA 1XF1A 2BZGA 3SYMA 4RNDB 3T7SA 3VISA 4X1KA 2WK1A 4ZV9A 3C7AA 3L6DA 2DUMA 1AXEA 1V8BA 1OYYA 1Q7CA 1QO7A 3GOHA 1FW6A 1HE2A 3D8RA 2FFBA 1ENOA 2OECA 4IUBS 4PLHA 1XT6A 2FEAA 5D3MB 4NZYA 5JHGB 4Q48A 3BPSA 2Y1KA 4RIHA 3F1LA 2FR0A 3K9GA 5BN3B 5TMDA 4JJAA 4DIUA 3N8GA 1V2HE 2COKA 3ZU6A 4FP9A 4AZSA 1OFHA 2DRIA 4BNJA 3JSXA 5IMBA 4UCQA 2Q1WA 3H97A 5F51A 3H17A 5J1SB 4HATA 2Q62A 1NBOA 4O2BF 4CF4A 5LA6A 1K28D 3TE7A 2H16A 1W4CA 4UBJA 4V0QA 5H8WA 1GP2A 4QHTA 4AY3A 2HV8A 4PV7A 2ZBVA 1J0CA 1VG0B 3O9ZA 3HDHA 2OV4A 1Z5GA 3LHDA 4A6PA 1FDSA 3U7RA 4LKOA 2J87A 1TUEA 5EJIA 1RQNA 3PRYA 2G17A 1K75A 4L8GA 1OLSA 3KVNA 5C37A 3PK0A 2Z43A 4LDRA 4EW2A 3U13A 4LZWA 5J43A 2E6UX 2VXOA 1X7ZB 2OVFA 3JVEA 4TL6A 1JVNA 1CBUA 16PKA 3GLGA 4TWRA 5E2BA 1LPNA 4XUEA 4X1IA 1GPAA 3P9KA 3WXBA 3KWFA 4HT3B 1SU8A 2POCA 3P9CA 4QNMA 5AXAA 3PS9A 4PSKA 2Q6OA 3RT7A 3QTLA 3WFJA 5L7YA 3LCRA 3RJZA 3SNKA 4XCQA 2QG4A 3I9KA 3WLKX 1M7HA 1O57A 2A2ZA 2CUZA 1PD0A 4MWGA 1UT6A 2P78A 1LBQA 1ACMA 4WFIA 3EXAA 2YVAA 4P5PA 4R9SA 5JARA 1N5LA 3N74A 1AS2A 1P31A 4UTXA 2YXBA 2JAOA 1HV8A 2WMDA 2X5NA 3SKYA 4HXYA 1KMQA 5FNVF 2WHPA 5JV5A 1BJTA 1XG5A 3HDQA 2B37A 4JUBA 1P61B 2VQFB 1DELA 1R4AA 3ECCA 3CINA 2FJ0A 3ZDXB 4YRCA 4Q6BA 4TVKA 4NYIQ 4MARA 3KDPA 1CZLA 1KL7A 4DMMA 3OPVA 2JGRA 4ZI2A 5DW3A 1ZWKA 1R8QA 1XDUA 4DMUB 4W5JA 1Z2EA 2IPXA 3FYCA 5G1OA 3U7EB 2QM7A 1RYNA 1VDZA 4FEEA 4WJKB 3DZHA 5CYOA 4EW6A 3GPLA 1T4GA 4EVQA 2X2EA 3SYLA 1YQQA 2G7ZA 4LOIA 1M1XB 2I6TA 1V5FA 2OZEA 1GZUA 3HBJA 4JKOA 1I0IA 2JJQA 4EY8A 1ISPA 3B5EA 3VMFA 1MAAA 3H9NA 3GQBB 3FFBA 1KP3A 2Y66A 2WU1A 2ZJ0A 2Q3BA 4K3UA 4L07A 5T6BA 5COQA 3C39A 1PYGA 4PS0A 1YD7A 1IVNA 4ZI7B 1KXJA 5ALSA 5K3CA 1CW2B 3LZCA 3DFFA 3PUXA 2RHMA 3AVXA 1PN3A 1CUYA 2ZPTX 3L49A 2BBSA 3CLTC 4AJOA 1UOPA 3CRNA 4TOIA 3DWGA 4V1CB 4I50A 3VAYA 2XMBA 5SYAA 4D5EA 3PUNA 3H5TA 3AETB 4KN5A 4JLPA 4ZAXA 3K9FC 4RCZA 1QIEA 2JFBA 4JI7B 1NBME 1YQUA 1TTPB 3G6EB 3OQOA 1NZDA 3H84A 3TIFA 4HAWA 4EO9A 3U5ZB 3EQZA 1DC4A 1EQUA 4L75A 2V6JA 2IYEA 5CU7A 1I2ZA 1MQ8B 4KJXA 2XMSA 3HDJA 2PYZA 2VLIA 4BNMA 1ECLA 3B36A 4OJNA 1G2IA 2BGWA 3ZWCA 1SKQA 1C7QA 3B60A 4PYJA 2G77B 4E5KA 4NYJR 1O77A 3WGQA 2OBFA 1RWXA 3WGVA 1TAUA 4ZAWA 4PSVA 4ZYWA 5CT5A 1OGIA 3D54D 3KX2A 5DM60 1F2VA 2CY0A 2ZBUA 1LW6E 2P9YA 3KV3O 5JT1A 4RTQA 5FJJA 1KKMA 7MDHA 5HHTA 4ENSA 4YREA 4AWBA 4UQPA 1TNDA 2M1ZA 4H7EA 2VJNA 2H11A 1GQOA 2HF2A 3U9LA 5TC4A 2Q1XA 4MQFA 3H11A 2NZWA 1NP6A 1CJUC 2RDMA 2VDWB 2WVHA 3CESA 3FR7A 1G42A 5ERYA 4BO0A 1IQPA 1NBEA 1RI2A 2PGIA 5EZYA 5DMXA 3ZPXA 2XJ9A 1Q2UA 1U8AA 1XO1A 2Z2KA 2ZE6A 1Q77A 3TI9A 3THWA 1G21A 3LA6A 3D8UA 1CY8A 2OLEA 3V7FA 1RYFA 5DLEA 4X65B 1USGA 4WZEA 2IS6A 5J4VA 3CKLA 3UHJA 4RHEA 2NSDA 2D5LA 3M5PA 4LBYA 4K86A 2B6HA 5BSTA 3F47A 2ERYA 2JCGA 3E15A 4LZAA 4NIMA 4ND8B 3OLXA 1V16B 2NQ8A 2XXJA 3D4PA 5CR9A 4N49A 3PEFA 5GVSA 1T8UA 2CLOB 2HV9A 3L6RA 3G7NA 1CFZA 5K3FB 4EG5A 3HK2A 4MV3A 2C9MA 2H29A 2XYPA 3SVZA 3AHCA 3HO8A 3LLSA 1UD3A 4LECA 4TYMA 1G5RA 3JWHA 4OP2A 4LHVA 1WDMA 1ZXXA 2XI4A 3K5WA 4KW7A 1CX9B 5D86A 3RSOA 2QN9A 1SKBA 3BJRA 3CF4A 4AQYB 3LQ4A 4LHXA 2GPBA 5FWDA 2DBYA 1QZTA 1IEVA 4WGGA 1YCDA 5B3AA 1DUSA 1LH0A 2A9VA 2VL7A 3K31A 4G85A 1WU7A 2L2QA 2OHHA 1MZPA 4CLOA 3HY4A 1GLGA 1RI1A 2H2FA 4V2IA 5J2TA 1Q17A 4PSUA 1E2DA 3C3AA 5DOZA 4MZDA 4Y2HA 3U4QB 2FR8C 2VOJA 3H1EA 3EE6A 1T6BY 4YCMA 1JI0A 5CLIA 3A1PA 4Z9FA 3AEZA 4B76A 3ELWA 3MS7A 2V45A 2BV3A 1XZKA 3K9NA 3F6BX 2A9FA 3H5RA 5AFSA 1G0OA 1V9CA 1CE8B 5FPHA 3GVCA 5LYJF 1V71A 3VOAA 4DYDA 3HY6A 3G6WA 3E27A 2RGBA 3NM5A 3P2EA 3Q7PA 4LDZA 4PRLA 1BXGB 5AI0A 5F4ZA 4CTJA 1LQUA 2PZKA 2OC9A 3C1AA 4J16C 5HRCA 1XRNA 4WZBB 3GRKA 2J6HA 4BXOA 4DIDA 1U0EA 2DF8A 1FVHA 2V58A 3CH7A 1IEQA 4FEGA 1W9MA 3T41A 1E5VA 4DARA 4BFWA 3Q6MA 1I1HA 1N6HA 2H2IA 1DEKA 1SCNE 4JK3A 4IOKA 5F33A 5JSZB 4KYVA 3IELA 1TOAA 3QXCA 4A0QA 1FJGB 2Y1EA 1RXIA 1DXYA 4YPVA 2ZXUA 1ADYA 5FWAA 3OQIB 2VP0A 3NTXA 5CNJA 4QXQA 4E5SA 2MSCB 4GD3Q 1G8SA 1V7QA 3WC4A 3GUVA 1H8HA 3UPDA 3UUWA 4G09A 3Q8MA 1UMCA 3CX3A 4IIUA 2FPLA 4DLZA 1EK1A 1HDRA 5ES4B 2E5WA 1E2IA 4GP6A 2ODWA 1E3DA 7REQB 3TGPA 3OESA 1VPTA 1KEEA 2QVYX 1G1AA 5J9FA 3HC7A 2QD1A 3N87A 4G26A 1JQAA 4TKVB 1A5AB 4DN6A 5E9AA 4NK4A 8ABPA 4HYQA 3N0RA 1GNTA 2C83A 3KVRA 1ELOA 4FGSA 2BFWA 2CHQA 3I45A 5EGNA 3MRVA 4UHJA 4OXXA 3CTMA 2C5HA 4J7XA 2V7BA 3KWJA 4KQIA 3WYGA 2RGGA 3ZDRA 4BV3A 5A3JA 4ITUA 3OJEA 2IYOA 4YAUA 5IJ0B 2IV2X 1LVGA 3NOQA 3BXFA 1SHZA 5JAOA 4EJSC 2OD2A 4YPFA 2QM3A 3PWSA 3ZDEA 5BSYA 2ZYVX 2QF7A 1FIUA 2YS6A 2WU4A 3PCXA 4ZHSA 1U8EA 3FAZA 4CKCA 2DVMA 4IGEA 1NM5A 1CY4A 3DW1X 4X1OA 4YBZA 4IIHA 3U2QA 2FP4A 4MQMA 4YAEA 4E6EA 3ZDAA 3N0VA 1UFKA 2R6CA 5KX5F 1VHQA 3SQXA 1SBZA 2GH1A 1AKYA 3USCS 1GIAA 1G20A 1RBYA 1I4TD 1A7KA 3DBLB 3H0EA 1U7HA 3PITA 1AHIA 4LSGA 3V34A 5KOYA 2NU6A 2RHCA 1YMVA 4E15A 4DILA 1HTWA 4UDOA 4FKBA 2V31A 1M54A 4NEHB 4YCAA 1NMXA 2X1LA 3T3PB 1TC1A 1QIDA 1VYVA 3F78A 1CZKA 3FGOA 1PGQA 3OJWA 2PCLA 1E2GA 1YJAA 3FIUA 1AQLA 2X13A 4FLEA 4XX0B 3UMGA 5JVDF 4P2NA 1PG0A 2DFDA 4CFYA 1CS4C 2Q6VA 3CC2B 2IYTA 1W2HA 3OE4A 4JQSA 3FYUA 1EBFA 2HJGA 2IUSA 3RRMA 2ZI6A 5AM3A 2A67A 4P5EA 2G06A 2Q4RA 3W5JA 5FLXA 3AFGA 8MHTA 1Z0AA 1R9NA 2XR1A 1QV7A 3F3SA 3WBJA 4LY6A 5THQA 4DYHA 4W8GA 1UQUA 2FETA 1EAMA 4BO7A 1DXHA 5L6MB 3DMNA 5AHOA 3CC4B 3GCWA 5D8DA 3LCJA 3RC7A 5EMHA 1PR0A 3JATB 4MQUA 4QDJA 1QLJA 3OIYA 2AOUB 3BJEA 4E2YA 3HP1A 1E2KA 1PJ3A 4MGZR 2QSJA 3DMDA 4RV9A 3DBRA 4LOAA 1XNJA 3OM8A 3W1VA 5LU9A 4PQFA 3IKTA 3L93A 3ZDFA 1TO2E 5CFLA 3F8TA 1RZUA 3DCNA 4QFMA 1SO8A 1JQLB 3KAJA 4TM8A 2YXNA 4RY9A 5FQNA 1Z5UA 2NU8A 1JR6A 4JBLA 2IFTA 3ADBA 1ZLXA 4GDFA 3OTWA 3A7EA 3R9XB 1T0HB 4PAQA 4EUHA 3L0CA 4KRYA 4N7MA 1JR3A 1KNXA 1V5WA 3E48A 4EFMA 4M53A 4DWVA 1T5DX 2QORA 4G6IA 5A4FS 5ESXA 4ACBA 4RF4A 3DEJA 2OCDA 1I5EA 1NMYA 1H9CA 4G0YA 1BE8A 2ZUCA 5DGDA 1OTHA 1RQGA 1XK6A 3GCDA 2PRIA 2Q0SA 2VATA 3F5DA 4CF6A 1NC1A 1X70A 5HWSA 4YJHA 4KR3A 2QYOA 1BN7A 2I2XB 2OGSA 1CUVA 3UHPA 3AO0B 2FDRA 1TMOA 2C29D 3EVNA 4B84A 3HNPA 2ZPUA 4DWJA 2GEDA 4KBFA 3I9V6 3A9WA 4URHA 2QN6A 4EPTA 3MG9A 4TWAA 3OJFA 2MOKA 3ML1A 1H6CA 3EIHA 3ICOA 1Z0JA 1C41A 3L5KA 3OE1A 4QTZA 3KHKA 4WZAA 3VDMA 4LJ4A 1OWPA 3VU9B 4EW1A 3QU5A 1WXWA 1WAMA 3KBBA 4MR8A 2N0SA 2G83A 5LFAA 4EX6A 3HJFA 3V8RA 1JDSA 4X0CA 3RCBA 4ZMRA 3SF8A 4GL2A 3EVTA 3FOBA 5E0KB 3J81k 3O7WA 4OLJA 1ZNYA 1N1EA 3PE4A 2XD4A 4Z2AA 3QLUA 1W75A 3KZ1E 4RAOA 4PAOA 2XVAA 3K6SB 4ZO9A 4MCIA 3AUUA 2HJVA 4I1PA 3P5BA 3IAM1 1EX1A 1BRTA 5J4HA 3O0DA 5DTRA 1IBKB 3GCGA 4P1VA 3UAZA 3HTXA 4RD1A 1DC6A 2YYZA 1F0NA 4URZR 4Y1EA 4CLRA 1BMFA 3OQHA 4XIYA 4H3VA 3DMYA 3OOWA 1YB1A 3H2JA 2CLSA 3DV0B 1FFAA 1TT5B 4L15A 1SKAA 3T5GA 2AMFA 2IHZA 4H08A 4DABA 3D8HA 4LDQA 4MDFA 3QG1A 2X8KA 4R7GA 2HK7A 4E1BA 2AN9A 4AN4A 4I55B 5FT9A 3TZHA 5A5EA 3ICQB 1Z0DA 5KREA 1BOOA 2FQXA 3VVBA 2E85A 4PO8A 1RYMA 3QPCA 3X1ZA 3G5UA 5KNCH 1HNWB 3O4JA 3CG0A 1B8NA 1N4DA 2C92A 3NCTA 4N01A 1P5HA 4OP1A 3TPCA 2XIQA 4QDOA 1MC4A 2BMJA 1Z15A 2QL9A 5BYKA 3PX2A 3CZ4A 2LDXA 5CM2Z 1S2NA 2YC4C 2GSDA 3EBPA 3ABOB 1NUAA 4OXKA 5AJZA 5WRFA 1RRFA 3T1OA 3VPAA 5CEJA 2KLHA 1G8GA 1IXRC 1JI3A 1OMOA 4XI9A 3E9RA 3MT7A 1B0PA 3PCRB 2CYCA 4FFBB 4CM4B 4CM8A 4HL6A 4KI7A 3NAZA 4ARUA 4AYTA 5HKLA 2P1ZA 3DG9A 2NTVA 3E7FA 1T3TA 4IDGA 4BLQA 4BE9A 4V0LA 3DEFA 4BRWA 2FZLA 1XMIA 1URPA 2LV8A 3N2NA 1FCJA 4HDNB 4KODA 1A9SA 3B6KA 1UJ6A 4J6EA 3ZG6A 5JZMA 1L7MA 3FOAA 1XDBA 1NRIA 3HN7A 3T3IA 1OH6A 1I9CA 4EYEA 4J91A 2YWGA 3L7JA 4JBGA 1WKCA 2C8LA 2EP5A 2P41A 3FNQA 4IDQA 4C7XA 5CFNA 4DV6B 4B4OA 1GPKA 1ZD5A 4UFOA 3V97A 2R87A 3LMKA 1SBHA 3E9QA 1IG0A 3GRUA 3F96A 4URUR 1CEXA 1SXJD 2C59A 2CW5A 3DUFB 1CNFA 4LYAA 1JA1A 1Z5ZA 1T10A 3KZOA 3JPWA 1YI2B 3RFCA 2HHJA 4KX3A 1LNQA 1TA4A 3FA2A 4F12A 3MINB 3LPCA 3PE3A 2E6KA 4I4NA 5EQJB 1P73A 5T4BA 2WIJA 1U9IA 1UFRA 3GNQA 3MJEA 4QGHA 3ZE0B 5IZ4A 3ZJTA 1HZJA 4C43A 1VHDA 2XHEA 2VSQA 2WF6A 2A30A 2WNSA 1ONNA 4Q3BA 4KX5A 1XZFA 1QG6A 4WBNF 1YL6A 1E9RA 2H00A 3BIFA 4FFOA 5CNIA 2Q8PA 4ZYZA 1R10A 4WBXC 2YNMC 2EGUA 4YMUA 4FC6A 4WK4B 1EB8A 2BFFA 2HLPA 3T61A 1JPNA 3K8OE 2R6GA 1K9MD 2ZE7A 4MW6A 1YC2A 2IOHA 4JJ4A 3GZ4A 4WDRA 3T38A 1S8OA 4C6TB 4PGGA 1L4BA 2GJ8A 2BKEA 5C46F 5LMUB 5J63A 5AI8A 1TGVA 4NZNA 3FMIA 1N25A 2XXAA 4JITA 3M34A 3EULA 1VPLA 4KQFA 4QBGB 3P94A 2QUZA 3W5IA 2FFJA 4DA7A 3FTEA 2WD8A 4LBZA 3DXXA 1BHSA 4RCYA 1E92A 3FUCA 4YBRA 2OGZA 4BFTA 3DWIA 4NPHA 4DK1A 1YHZA 3E2PA 3BGOS 3T7JA 3TNFA 3DXYA 3HCRA 4M76B 4V03A 5BNFA 5EVCA 3Q3EA 3D0OA 1O94A 1QRUA 2Q9BA 1S9DA 4H15A 5LBTA 2QX6A 4PG6A 1UBCA 1CUCA 2CLEB 2MTBA 2O48X 3B3AA 1MB4A 2NTJA 4G0NA 4JGGA 3RJMA 5CDUA 1W581 1F8GA 2HA5A 2WYVA 2AYZA 5D3ZA 2GGSA 5CRIA 7AT1A 1Q74A 4KPGA 2VUSA 3T35A 4KQGA 1IY1A 1QOPB 3EH2A 2WWRA 2O2YA 2E82A 3EA4A 3HM2A 4EUEA 1KR2A 5HQ3B 4YGYA 1ZVVA 1FSSA 3S27A 2O2HA 1DEHA 4YAWA 3QUSA 2MWMA 2RGYA 3IKVA 1GJRA 4QHSA 5JO9A 1XMSA 2XD9A 4B32A 2J48A 3HB4X 4G5XA 3CUWA 2W00A 4PR3A 1NBHA 2OYRA 4JYPA 2D7DA 4RLHA 1GVHA 1SUDA 5IEBA 3GEPA 4EHBA 3TLMA 3FDZA 4JYMA 1QIJA 1C9KA 3CE6A 4HLUC 4Q4AA 2IOQA 3Q6NA 3PYLA 3CEJA 3UXHA 3JAMA 3MBOA 2G9NA 1UP6A 4XD7D 2XCUA 2ZRAA 4QYTA 4NYIR 1TD1A 4XXHA 2FYTA 3UJPA 1DJMA 4QULA 2ZI4A 3MQ4A 5F52A 3HUTA 2G1KA 5IK2D 3N5CA 2IHUA 1CZHA 3WFZA 1JDPA 1EDZA 4FD3A 1FNDA 1U5BB 2J3EA 3HL4A 2Q3DA 5B64A 5ICMA 3R8FA 2ORIA 4LK2A 2QW8A 4K2HA 4W9NA 5JD4A 2BTQB 4ZU6X 4Q0MA 3HKCA 1IK4A 5FUXA 4ZKEA 1JTEA 1LPAB 1V0JA 3VKWA 1MAVA 3ZJVA 1ZUNB 1DQZA 5AI4A 1AA9A 1VCOA 2RHHA 2OOKA 1JLHA 2SKDA 4ZYLA 4ILKA 4IV5A 2Q9AA 4MIKA 5DVZA 3ICCA 4OAOA 4U2DA 1OPXA 1R0BA 3E22B 4H18A 4I1YA 2C4UA 4M1EA 1QHYA 2AOTB 1O89A 2VRWA 1UMKA 2R11A 3HKEB 3WIVA 4TMVA 2AZMA 4MI1A 3PQFA 1NAHA 5JPIA 5JXHA 2VUIB 4JOBA 3GLGE 3OCZA 1XCMA 1EVQA 1EGAA 4OJKA 2QLJA 1LW7A 1ZD2P 4P34A 4C0XA 2Y9PB 1MGPA 4D9EA 2VCEA 1VHOA 3QHQA 4J76A 4U7FA 5K0NA 5PGMA 1YAHA 1N8KA 1E58A 1XZNA 3PC8C 3CCQB 1QORA 1T8WA 1SCJA 3OQVA 3QTBA 4OMCA 3W77A 3BRWA 4HZUB 4BWGA 3QFSA 3COZA 1CQIB 4F5ZA 4NQZA 1Q21A 1PJ7A 1V1RA 3ZHCA 4PNPA 4JBYA 4BNIA 1XCOA 4K05A 4CQLA 1VFPA 3QI2A 2RGNC 5E1OA 4EFKA 2VK8A 5FBWB 2F8LA 2FEOA 3F7MA 2R96A 3MWLA 3ZQUA 4KVZA 5BW5A 2PZGA 2VHEA 1EM8A 5IAKA 1BS9A 4MKHA 1J0XO 1RMYA 3JALB 1XB2A 1Y9EA 2P3QA 2QRPA 2J9RA 5KSPA 4KGXA 3HLTA 3BGIA 1GU1A 1H5UA 3IV9A 4D25A 5EHXA 2B7CA 3VUFA 4IRUB 2VZEA 3N2LA 2HCJB 2VPZA 4IMJB 5BW4A 3M89A 3Q85A 3HP7A 2ATIA 4L5IA 4TWZA 1NL3A 3IT3A 2W43A 8OHMA 4J6FA 2PKWA 3EGEA 3PDWA 2BH9A 2X1HA 3PFHA 1EXNA 3WGJA 3TX2A 2ZTLA 3PXAA 1YJBA 3T34A 1ATZA 1S2DA 1VLLA 5C34B 4A0RA 5KYUA 1MC1A 3C24A 3CW2A 1RVDA 2JK0A 5KUTA 2Z09A 1ISRA 2DR2A 1ZL2A 2GNAA 2GPYA 3PHCA 4XCVA 5KJFA 4P3OA 1PDOA 2VS1A 2OV2A 2WV7A 4RK1A 4ZC8A 2BFNA 1EUCA 3L79A 4K03A 4ZGBA 3C45A 1MABB 5FI1B 4QUKA 3UJNA 1OGYA 2X8JB 9MHTA 4XGQA 2OFPA 2VG8A 5AK3A 4DE5A 3W8DA 2W90A 2ZBEA 2F1MA 3CMAB 1G8PA 1PG5A 4HLNA 3GPCA 1IAVA 1N1GA 1QGOA 3A9RA 4OXNA 4PLCA 5FOUA 4F06A 1V5GA 3VOSA 4ZZ1A 1C9MA 4JEIA 4JVMA 3DGFC 4P12A 2VJQA 3DO6A 1NI4B 4MA4A 4LV6A 2PN1A 5IJWA 1OH7A 4YMSA 3HBFA 2QSYA 3O2NA 1T4BA 1HWYA 5F4MA 1WVGA 2C1EA 4YPOA 4ZYUA 3VPFA 1THMA 2X6XA 4QOEA 4QM7A 3LZDA 2AB0A 3DAGA 2JI9A 4TL7A 4DSAA 3IP7A 4KMSA 5IVIA 3ZLJA 3NHAA 1L4MA 2AD5A 4G0PA 4G36A 3BKWA 4LDAA 3DMFA 4XVCA 1VJCA 1MO2A 2FZKA 4YMWA 1YBFA 3ASVA 5M7EA 1WHSB 3DDCA 6AT1A 4UXJA 5FEMA 3IAHA 3C1TA 3LFUA 4IM7A 4PYQA 5T5QA 2J4FA 1V4VA 3OOYA 3SS9X 4J0HA 2B82A 4DREA 2HK6A 3PNYA 4HEA6 4NDZA 4LZPA 2Q27A 3JQFC 3PT9A 4Y9RA 1P2VA 2QTCA 5FNZA 2AJ8A 2JIOA 1YNSA 2IU4A 2PKEA 2RSLA 4PY2A 1BMDA 1OX4B 2C8VA 2NTEA 3T4XA 3WTCA 3CPHA 2V7XA 3SHTA 3L4KA 4YP9A 3NETA 1E9BA 4D02A 4FK8A 2BR3A 4OJMX 2L82A 4GP7A 2OBSA 5D3QA 1OLUB 5EP1A 3RF6A 3RS7A 3SS7X 3G17A 2E4YA 3PNQA 1XEWX 4YH1A 1GAEO 4RUKA 5G3ZA 3PTLA 1FP6A 3K70B 2ZSFA 4NENA 4XCXA 1Z13A 1UL1X 2F1KA 2OBYA 2VF5X 1JDZA 1T6NA 1XTRA 3AF1A 1S3GA 3IPRA 4O2AB 5LP6A 2CNWD 3E35A 2AN5A 3G8BA 4QBKA 1YZKA 2HYIC 1ZK3A 1MOPA 2WKPA 3H3JA 4QSHA 2GD1O 4D97A 5CVTA 4O4LA 1PG2A 3C3YA 3HJNA 5HK9A 2BFDA 4E88A 4KVGA 4JIGA 5D1HA 3KXKA 1KSGA 1S4QA 1XYVA 4I5IA 1X7GA 1JAXA 1RWNA 2F1IA 5L53A 4BS9A 3MUFA 4B6JA 3EUWA 4GLFA 3RR2A 4NL4H 4QQ8A 3UJ3X 3CTPA 1YOVB 1IQRA 4OPOA 1V1MB 1QF9A 1WPQA 3EASA 3G0GA 4KIWA 4PZ9A 4ROSA 4AL4A 3OOCA 1UOQA 1ZPDA 5AVKA 4Z4CA 4EB3A 5B57C 2HBRA 3LJKA 1YJ5A 3L8YA 2FW0A 3Q6RA 2ADOA 2NO1A 5CVCA 1W59A 1IMOA 2CSUA 5G4KB 5M3BA 3ZHXA 3VNVA 3LHFA 4KOEC 1CY1A 1A2KC 1LKZA 4H6WA 2EFEB 4DRXB 3BXZA 4JLMA 3I28A 4ZOBA 4G84A 4BMVA 4F3KA 2HEGA 1ODIA 2UYGA 5EHZA 2IPAB 3AVUA 2CVPA 4NPCA 2RGXA 4IZOA 4LX0A 2EYUA 3TLBA 3B3GA 2ZRKA 5CB0A 2GVDC 1ENPA 5HNKA 4B3CA 3LQ6A 1U3GA 4GXQA 2DB3A 4S1VA 4BFLA 2PGNA 1HNZB 5ARCA 2VUTA 1GA1A 4R69A 4FE4A 5AW0A 4JOQA 4LJ7A 1FSZA 2GBGA 4JP3A 5A4JA 2PEYA 1GAXA 3NVKI 1J2JA 2HQRA 2VHUA 4PPFA 3WRVA 2D5CA 5BSFA 1BGXT 2XITA 2X9VA 1C5KA 4IGIA 1E8NA 2PZBA 2ZATA 1XTIA 3NW9A 4CNBA 4F04A 5JDIC 1AUQA 1WQ4A 2G8LA 1G9XA 4M36A 4DQ0A 1VBMA 3MRSA 4JWTA 4X60A 1N92A 4ARIA 4A2PA 4EPYA 3VFDA 4DHWA 3EPKA 4KQEA 3EMVA 1CR0A 4R1UA