4M0LA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus complexed with gdp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
414
structure length
412
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 91
structure length 412
sequence length 414
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m0lA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m0lA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m0lA01
1X8JA 1Z2CA 3R20A 3RLFA 4EPRA 3DM9B 5B30A 5BYJA 2FSFA 2Z4SA 5TY0A 2FG5A 3FKQA 1TQ2A 3K9NA 2QTFA 3EARA 2HEIA 2QY9A 4FXPA 3IIJA 5EXTA 5DIFA 4CEIA 3RWOA 4OJQA 4ZGQB 4UJ3A 4F4JA 1E2KA 1E1RA 1KO5A 4OI0A 4URYR 2IS1A 1KK3A 1VCNA 3HU2A 2B92A 1S2MA 1XEWX 4CW7A 1RC8A 3CCUB 1IXZA 1H8EA 1VG8A 3JZMA 2ZRCA 3U3RA 1C1YA 4HB0A 1ZD1A 4BRWA 1NJFA 4XWKA 4PHHA 2J0QA 2C9CA 3U2QA 1D1NA 4XOIA 3CCQB 1KGDA 4JVMA 2QRZA 1QH0A 2JLQA 5JJIA 5BWMA 1E2QA 4C7OA 5EP4A 1G3MA 2QM8A 1EXMA 1XX6A 2LCFA 4TYQA 2F7SA 2ZSFA 2OCBA 3SN6A 5JWRA 3HP1A 2F9MA 2H92A 3VU9B 1N6NA 1YVDA 3A1WA 1WE2A 3BH6A 1U90A 2KBFA 3X1ZA 1DG1G 4Q4HA 1DAGA 5JLJA 1MOZA 2I3BA 4OQLA 1G6OA 1PVOA 2GETA 3SHFA 1YQTA 5DISB 3W8RA 2ERYA 3KUCA 3CRZA 5F9HA 3VX4A 3PUZA 3KTAA 5CK5A 1T3SA 1XXHE 3I5XA 4PZYA 5FPTA 2D62A 2GAAA 3GLHE 2JLYA 2OCYC 4F4IA 4WQMA 2A7QA 5E4FA 1BH2A 1EG7A 1FNMA 2OE2A 4OI2A 4OYHA 3QPUA 1HEIA 1PLKA 4RKFA 2ZRKA 1W36D 2QTLA 5HZHA 1KY3A 2JLUA 2OSBA 4RFVA 3ES9A 1KD1D 1Z0DA 2HYIC 3KTAB 3UK6A 1TPZA 4A2WA 3CZQA 3AVOA 2C8VA 3ADCA 4LHZA 1OH8A 3OHMA 2OTLB 1E9CA 2X77A 4TWZA 3W9YA 4ZI3A 1P9WA 2V7QD 1PZNA 3R9XA 2VP5A 2G1KA 2NGRA 4TLEA 1QVGB 1QHGA 3OIUA 4XVUA 3FPAA 3AKCA 4GFDA 3TUJC 2VNKA 1Q22A 5K8LA 3BB3A 5KPDA 2YKGA 1C4OA 1JJVA 3OFNA 4JL6A 3EZFA 1KDRA 1Z0KA 4YMWA 2B8TA 621PA 3CB4A 2ZRIA 3JVVA 2OHFA 4NL4H 3ZVRA 5L3SB 1VQLB 1HT2E 4EPWA 3W3ZB 2O0KA 1WCV1 1U8YA 2BMDA 1U9IA 1KJYA 1XMIA 1SVOA 4I1UA 2JCSA 1G1MA 2UKDA 2ZRHA 5EZ6B 2HCBA 2N46A 2QU8A 4XJXA 4YXWA 4CEHB 3EWSA 1YHNA 2GBLA 4I1OA 5H5JA 1EFHA 2GQFA 2K5UA 5H1YA 4MKIA 4RD3A 1WA5A 1JI0A 2ZYUX 1LNZA 3LO5A 4A9AA 1K73D 3DMDA 1ESNA 1W48A 2R6AA 1BIFA 1KI9A 3CD6B 5E3HA 1QG2A 2NO9A 2REOA 5AK0A 3DPUA 1QHYA 1TU3A 4FCWA 1QHSA 3SEAA 5CM9C 1G41A 4ZIRA 3QF4B 4RSGA 2ZIAA 2ZU0C 4KXFB 1VIAA 1S1CA 2JGNA 2V6IA 4MRVA 4A6XA 3LH5A 2CJWB 2X8AA 3U61B 1KO1A 3GEEA 3V9PA 1W0KA 3KXLA 4YC7A 4QJ4A 5F9FA 5FFMA 1P7CA 2GF9A 1EP2B 3OZXA 3HDTA 3MRSA 1E2EA 5SZIA 5BYKA 4V0MA 4NCNA 1ZU5A 4L16A 4CF7A 3J81k 1MH1A 4KCGA 3ZVNA 1OFUX 1E1RD 1XXHA 2GK6A 2ODEA 1Z6XA 2XZPA 3FMPB 4I1VA 1KK1A 4MKHA 3TIFA 2CCJA 1KDTA 1G64A 2J7KA 4MGYR 1DG3A 2WKQA 2Z5FA 3FE2A 4E03A 1H8ED 3BJIC 3GLIE 3EZ6A 1Z0IA 2DCUA 4NYMQ 5FUXA 2BVNA 1IOZA 4IVRA 1WMSA 3OF5A 3RS7A 2H16A 4BFSA 2H18A 2VHTA 4XTRA 2DFKB 2R6HA 4TMZA 3I4LA 4AYTA 2CL6X 4JJZA 4Y0AA 2ZJYA 2IYZA 1N5IA 2NO0A 4A2PA 1JECA 3K0CC 2NOAA 1P9NA 4PPNA 1AK2A 2IWHA 3UWKA 3CC7B 4JS0A 4Q1CA 5H68A 4EUNA 4QGGA 2WJVA 1F3OA 2FZLA 4RD6A 1HQCA 3B6EA 1NLFA 2PZGA 4XD7D 3QF7A 1UDXA 4TLBA 3R8FA 1G8HA 2UZ3A 1Z22A 5C4GB 1SXJD 2ZS7A 5LBIA 2HUPA 4DHEA 3U4QB 2VQSA 3I1FA 2BCGY 5CYOA 3UPUA 1G5TA 1SKQA 1X8KA 2BDTA 2CVFA 3BC1A 5CJ2A 3RANA 4D80A 5A4JA 1BYUA 3BRWD 4MUAA 2ZYVX 2IUUA 1U0JA 3GQBA 3CX6A 1GM5A 2JJ2D 1KI6A 4FMDF 1TF7A 1D2NA 3DOFA 2EWWA 2NZ8A 1NN0A 2VF8A 1Q3HA 4TQUS 2WM9B 4BFYA 3I32A 4WAUA 3U3OA 2QP3A 1BJKA 1SXJB 5BQ5A 4RD2A 4HDCA 2YV5A 2V4ZA 1R0XA 3X1XA 3VO1A 3AV0B 5G41A 5BN3A 2WMOB 1A82A 2QA5A 3TW8B 1NVVR 2HJGA 2V7QA 1WXQA 3RRYA 5C1BA 4N3GA 4LUCA 2IYWA 4EPYA 1X86B 3CCSB 4I4LA 4QNMA 1S9HA 3SJCA 2ZRMA 1ZIPA 2IK8A 4KFRA 1CR4A 3AEZA 5GJCA 4C0QC 1XD2B 2W6IA 2FU5C 3A37A 3AQ4A 5FL7A 3BK7A 2CXXA 1FOEB 2OAP1 1DS6A 2IUTA 2QROA 1KO8A 3W5IA 3NHAA 2B5OA 3R7WA 4GSYA 4Q7JB 4B32A 5HKKA 1VDZA 4P31A 3PXGA 3CWZA 1G19A 3GJ3A 2RGXA 1US8A 2J7PD 2NIPA 3EW9A 3NG1A 4B2LA 3QKRA 3UWOA 1FRQA 2QBYB 1IN6A 2WTUA 4Q47A 1WF3A 2AKAB 1KY2A 2VO1A 4DDTA 2C95A 2BEJA 3KXIA 521PA 4DLRA 4A0HA 4TL9A 3AVWA 2BIFA 3H1TA 3I55B 2HJVA 2R6DA 3HPRA 3B9QA 5DI3B 5FTLA 3QXSA 3HU3A 1T91A 4PO1A 2RGNC 5HTKA 2O0HA 1IY0A 2WSSD 4QBHA 1CJTC 2ZRJA 4F91B 1XEWY 2IXEA 5DGXA 3GFTA 1D2MA 3CRRA 3B13B 1N0VC 1OKKA 3MD0A 2WVJA 1S4QA 4CZ2A 3ND8A 2NO7A 4C0SA 4BLRA 2LWIA 3CCEB 1KQSB 1AS2A 4MGZR 3A6PC 3L0IB 5TVKA 3DO6A 4QNRA 1NG1A 3KX2A 2VNJA 1NMZA 3AF2A 3NHBA 4KYUA 3FPKA 3I56B 1L2TA 2X2FA 4OHXA 4BEBA 3KB2A 3N2IA 1D5CA 1JXMA 1ZJ6A 2ZI6A 1IJEA 1JAIA 2OCPA 1OH5A 5AUPB 2VHUA 3WBKA 2BM0A 1N5LA 2H17A 4LJ5A 4NKRA 4CYMA 3X2SA 1NI3A 2CK3A 1GKYA 3W2GA 3BH7A 3CPEA 3I73A 4Y0VA 1MRSA 3RRNA 1OXSC 1EX7A 2ZUDA 4B74A 1YJ9B 3TH5A 2ZJBA 3TK1A 4IOJA 5JSZB 1EK0A 2WJJA 5JRZA 1CRPA 3A8TA 3BE4A 4LC1A 5GVRA 5DSZA 3PUXA 4MH0R 2PZEA 3PIRA 3TUZC 3EX7C 1Z63A 1G3IA 1D9XA 2BBSA 1II8A 1FDRA 3IEUA 1A1VA 1Z5ZA 3AVUA 2GCOB 3U5ZB 1RRFA 2OLJA 1QRAA 1QX4A 3WYGA 4D4JA 3OZUA 2ERXA 4YMTA 5CJPA 2Z0MA 4ZKEA 1AMOA 4JT4A 4IJMA 1BKDR 2XOKA 4IDNA 1UDWA 3SDZA 2ATVA 3TE6A 1GRRA 3JVUA 1T9HA 2BOVA 2OK7A 5FBLB 1Y3AA 4UQOA 4QBFA 1XPOA 3WNBA 3Q72A 1G20E 3A1VA 3TSOA 1YZUA 2R65A 4DCUA 1GITA 1DBSA 4MGKR 2GVZC 3A4LA 4XH9B 5C18A 2XJ9A 2Q9AA 4HUQB 1T4GA 3QY0A 5EXPA 1G8YA 4IRUB 3CPJB 3HJNA 4U7DA 2AFIE 1KI7A 3GCGA 4URWR 4URZR 1ZNZA 3QF4A 5L3RA 1CBUA 4ILEA 2P67A 1KSFX 1VCIA 1ZAKA 2F9LA 1T3LA 3P4YA 2A5JA 3VX3A 4DXAA 2NPIA 1TUIA 3W5HA 3CCJB 5G53C 1M7GA 4DUGA 4II7A 4CGZA 2WPDA 1OGIA 2ZI7A 4G01B 1FUKA 3K1JA 4N0DA 5JFGA 5GJBA 3SU8A 1XXHB 2XNDA 1VHLA 1VQ9B 2IEYA 2AXNA 2FGKA 4R7ZA 1AZSC 1E2FA 1MABA 2DWOA 2HT6A 2J0VA 2VP4A 1W1WA 2EU8A 5J5CA 4A8JB 5HKKD 1EESA 2QAGC 1N25A 3C15C 2CBZA 2JATA 1U2RA 1H65A 4NCKA 3QOFA 5AUOB 1FW6A 4O25A 4CEJB 1JEDA 2G0NA 2G83A 4YALA 3CCRB 3TQCA 5E7IA 5GADl 2BF4A 4P32A 4IVQA 2QTHA 2E1RA 2QPAA 3BFVA 4QM6A 2XNSA 4DLZA 2D7CA 4IFBA 3VMFA 3GJ4A 1GOTA 5JMTA 1GJRA 4RCZA 1I4DD 2BV3A 4PPGA 1OPXA 4DKXA 4LRWA 3MG9A 2RGBA 1GRQA 1E2GA 1OT3A 5DN6A 2FMXA 3W5UA 1CU1A 1DAKA 4RKEA 1IHUA 4N1AA 4TSFD 5KDOA 2IF2A 5C2JB 1LVGA 2J45A 2RGCA 2A78A 4M4SA 3W90A 2XB2A 5A0FA 4LI0A 3NDBB 1AZTA 1KRHA 1NL3A 5DHAA 1QBKC 4NE2A 3THXA 1XP8A 2WIBA 3OFND 3CLVA 1OW3B 1R2QA 1FX0B 4HI0E 4PHTA 1U9IC 2VSOA 3KQLA 4D4LA 1XEXA 4HZIA 2O52A 1JPNA 4PX9A 2PJRA 2PLFA 1W2HA 3TSWA 3T1TA 3CF6R 1VG9B 1KDOA 3THWA 1LTQA 1QHNA 2OFWA 4KLNA 1KO7A 4DSNA 4BLOA 1F2UA 3FKSA 1OFHA 3KUDA 3EZ2A 1OXUA 4QJ3A 2VP9A 5KOYA 1IQPA 1TUEA 1Z07A 1F2UB 4IFEA 4O2LA 1QVAA 5SZHB 1G3QA 5KTYA 4LJAA 4TL6A 2YZ2A 1KSGA 4Q4AA 2ZSDA 1BOFA 1E94E 2IYRA 5DYIA 5TB5A 4E22A 3MHPA 2P0EA 3QFCA 1LF0A 5DNYB 2DB3A 3RSOA 3BAFA 3SYKA 2NPFA 4WZBE 3F0TA 1W2GA 4EPXA 2UZIR 1QHHA 2WJGA 1OHHA 1EFCA 2B7CA 4FWTA 5CDFA 1PUJA 1UBGA 2PT7A 5EZ5A 2YYZA 1VYTA 1VTKA 1YU9A 5DO9A 1WB9A 2XNDD 4NPHA 3CPWB 3T61A 4JJKA 3MSXA 1U8ZA 3CBQA 4JLNA 3LRPA 1WRBA 1GVNB 3B9PA 4OL0A 1ZVQA 3RS5A 3W6NA 3L0PA 3A1TA 3Q8XB 1H42A 5ANRB 1R0WA 2W58A 4Q21A 5P21A 2DYKA 1NBMD 5L3QA 3ZS8A 3QUSA 4KODA 4Q00A 1M1KD 2CLCX 1YJNB 5GJWC 2GAOA 4DLVA 5KO2A 1N0UA 3MMPA 3VKHA 1CULC 3CRVA 2GXSA 3TUIC 1G17A 3EPKA 2A5DA 5FOUA 3SJZA 4HB2A 2QMUA 1HE1C 3CW2A 1XMSA 4PQRA 4E07A 3ASYA 1GO2A 2EIXA 4X8MA 2R62A 2NO1A 1TNDA 4XTCS 4KSCA 2QN6A 4TN1A 2A3RA 2ZITA 4KAXA 1P6XA 1PUIA 2EFCB 3KFXA 4HE5A 1CRQA 1Z28A 1Z8FA 3NTUA 2J3EA 4F38A 4P4UA 3GMTA 3GLGE 4FW9A 2YINC 2GWHA 2HMAA 1V5WA 3TKLA 2ZSEA 4B4DA 3T15A 3ASZA 3NH6A 3KKNA 4W5JA 3QG1A 4WXPA 3TW4A 2HDNB 3QKRB 5HZKA 4A82A 1E0JA 4QGHA 4I81A 1Q7YD 1GILA 2EVWX 3LD9A 1R5BA 1KZ7B 3CX7A 5G40A 4IVPA 4EH1A 3VR6A 3PEVA 3BOSA 2YOHA 3T5GA 2BMEA 1DAEA 4OQNA 2D74A 2L0XA 2JAQA 5FPYA 3U60B 1NVVQ 5FBVB 3JQRA 1NJID 1GAJA 4QFMA 2H7VA 3NBFA 3TAUA 2W2XA 2RH5A 4BPRA 3LVRE 1DO2A 3T34A 1R0YA 2ORIA 2GXAA 1P2TA 1E2LA 4DT1A 1H85A 3IPXA 1GSIA 1N6HA 2VIIA 5CLQA 4M0LA 3WYFA 2XTZA 4Z8YA 1COWD 3W5VA 2HF8A 4TLAA 1J9ZA 2QQEA 1CEEA 3CNLA 5JECA 5JS8A 4TYYA 3U7EB 2IS2A 1SM4A 1OYWA 1R10A 1KTVA 3D6TB 2WKRA 1CTQA 4MITA 5FI0B 4RFSA 4FCTA 4ASUA 2WMNB 2D2EA 1SXJE 1U94A 3CRMA 4O3MA 3K0FA 2GJAA 5AJZA 4D26A 4M1OA 4I99A 3NKVA 4IDPA 4EPVA 3QENA 3BWDD 4JYCA 2J7PA 2OTJB 5FTNA 3M1IA 2CVHA 3FYHA 4KBFA 4HB3A 4M9SA 4BZQA 2ATXA 3FKSD 1LW7A 1X1RA 1E96A 3BIFA 1EFRD 2ZEJA 2JIZA 4W9MC 4X8HA 5KNCA 1GWNA 4R71A 2JLSA 2PEZA 1IY2A 2VTKA 3FGNA 3THWB 4QM7A 1IB0A 4Q9KA 4ZDKA 1NG9A 4HZUB 4NCIA 2O8BA 3RWMB 4M1WA 3QKSA 4G5OA 3B2EA 2KBEA 2B21A 4PSAA 2R6FA 1N6IA 2V54A 4Y9UA 1P3JA 1E0KA 5CB8A 4QHYA 4B3DA 5CDFE 1UFQA 4ESHA 4F7WA 3VR1A 1G21E 2G6BA 1L8QA 4B48A 1N6RA 3DDCA 3ONWA 1LF5A 4PSKA 3SR0A 4PC2A 5E7MA 4YQFA 1YZKA 3AUXA 4HLDA 4AKIA 3ZQJA 4LBWA 4DCNA 1W2BB 1P62B 3IQWA 1NIJA 1YR8A 1OE0A 5DLQC 5EJEA 5GVSA 2RKOA 1KJZA 4YAFA 1XJCA 4IOKA 4HLCA 2RGGA 5FI1B 1KHTA 1NY6A 4X8OA 1JEEA 1LFDB 4R2HA 4EKDA 4ZO4A 3CC4B 3WY9A 3A1UA 2BWJA 2NZJA 3DHWC 4X8LA 2D7DA 2AHOA 3DVLA 2VNIA 4DB2A 3SYNA 5IT5A 1AIPA 2R9VA 1E0AA 2CJWA 1VQPB 2PT5A 4JBYA 4TTRA 4URVR 1ZUNB 2XXAB 3GLFA 2QA4B 1ZNWA 1Z0AA 3EPJA 3ZBTA 4HDQB 4L4UA 3WYAA 3GP8A 3EA5A 4P3YA 4TQAA 2IA5A 1XDBA 4LHVA 3AUYA 4DDWA 1IN7A 3PJRA 5EE1A 3NWJA 4HB4A 3B5JA 2G3YA 3CM0A 3THYA 4QG7A 2W2TA 2JLVA 2HT1A 5KDLA 1J70A 2BBTA 1Z0JA 1QHXA 1ZCBA 4HAVA 3QPWA 1BX1A 1E1QA 1KOFA 4TYWA 4DWJA 3AVXA 1KKMA 1DE0A 4CEHA 2FF7A 3RAPR 3O8RA 2XX3A 4P0TA 2XOKD 4EQ6A 1AA9A 4RVCA 2WZQA 3W2FA 2XZOA 1Z3IX 121PA 4PPFA 5L3VA 1RFLA 1N5JA 1KSJA 5AR1A 4TMTA 3REFA 3IIKA 4KJZA 3IHLA 2XXAA 5L3SA 1BS1A 2A5YB 2AD1A 4XVQA 1N8RD 5CYPA 5JCZA 3AF1A 2I4IA 1GRNA 2JIZD 3RRZA 1XZPA 2ZRGA 3KFVA 4DDUA 2ORVA 4AC9A 1F2TA 2R44A 1IBRA 2DERA 2W6JD 1GG2A 4N0EA 2CHGA 2AXPA 1K9MD 3QXJA 4B43A 3C8UA 3DZ8A 1Z2AA 1XD8A 5TARA 3VHXA 4A36A 4HZUA 1FNDA 1Z6AA 1OXVA 3K0AA 1OB2A 4NDZA 1WDTA 2P65A 2QM7A 1CQXA 2NTYC 2GCOA 4DZZA 4TQ9A 1GNPA 5LDDC 3P20A 4NMMA 3E5HA 1DAFA 1KNXA 1RRCA 5FOWA 3IPYA 1CIPA 4JLVA 2ORWA 4JLBA 5J4HA 1A2BA 4FWIB 1R7RA 3K9LA 2ONKA 1DELA 4HAYA 721PA 4URXR 1Z0FA 3H86A 1DTSA 4AKEA 1VQ4B 4MA4A 4W7SA 4JVSB 4HLQB 1W49A 2IF0A 3CR8A 3GEIA 3HR7A 1M6NA 4LJ9A 3KKMA 2JJ8A 4YAWA 4TTPA 3SI7A 3TLXA 4CVNA 4WZAE 1G8FA 1R4AA 4XWOA 1B0UA 4YLGA 1AS0A 2QZ4A 3ND9A 3VTKA 2KE5A 2QT0A 2Q3FA 3G6EB 2GPJA 1Z47A 4B3FX 2VYQA 3QBTA 4PC1A 3JQPA 2IYUA 3OE7D 4HEJA 1SZPA 5DI9A 1T8UA 1K6MA 1VYVA 3IUYA 3UANA 2GZHA 3GJXC 5DH9A 3T1VA 2PL3A 1QHHB 4JLPA 3T35A 4ZDJA 3A1SA 3I5YA 3TNFA 3QFRA 1XTIA 4GOXA 3OEED 1VQKB 4QC2A 4IXNA 1DVRA 1OIWA 5KNBA 3ZS9A 2WSMA 4LDJA 3BH0A 4HAXA 3IO3A 3I62A 4PTLA 2AN9A 5FBQB 2V9PA 2QAJA 4D6PA 1J2JA 1E63A 3Q9LA 3BFKA 4LHXA 4QHTA 3AF4A 2J9RA 4XVRA 1UMKA 2WWFA 3ZZTA 2VF7A 5EXXA 2JLXA 1KSHA 4TZ0A 4AYWA 5KSYA 3JQQA 3EIQA 3D3QA 3SS8A 2VNHA 1ZMXA 2F3RA 4KHZA 1KI3A 1XCMA 3OJXA 4Q5IA 5FUVA 421PA 3ZD6A 3I8SA 1Q44A 4Q4LA 5TDHA 5CM8B 4AKGA 3L2OB 1XTKA 2BGJA 1ZYUA 3WXMA 2OXCA 5JBQA 1Q82D 2YWGA 3PENA 3QE0A 1ANKA 1XTRA 2PCJA 3SFVA 1E2HA 3UMFA 3GLFE 2C04A 1W87A 4OI4A 2AL7A 3CRQA 3QPVA 1M8PA 1G8GA 3CNOA 4OQMA 4B3BA 3FHTA 2OV2A 5K8IA 4OQFA 2C77A 3A4MA 5J4KA 2XJ4A 1KJWA 3I8XA 4GOKA 3RHFA 4JZKA 2GNOA 4LY6A 4CRWB 1KC8D 1MKYA 2J0UB 4PXAA 3UMRA 1ZRHA 3K0AB 3CCLB 2ZS9A 4G5RA 1UADA 4WIAA 2XEXA 1GUAA 1KYIA 1VCMA 1G5RA 3KL4A 5TMPA 2X1VA 2YOGA 4LYJA 3PEYA 4UNPA 1ZM4A 1J99A 4MRNA 2GCPA 5DI3A 1L7VC 1ZBDA 3VHLB 2C5LA 5GJVC 4BFTA 3AP2A 4B33A 1UM8A 4NONA 1VIYA 4OJKA 4P33A 2QQ0A 2WBLC 1RYHA 2Z43A 1CR1A 2EFDB 4LOAA 4BLPA 4M2LA 4A1FA 4N3NA 3QKTA 4QGFA 2GCNA 2ZUBA 4MYTA 4FMCB 2AKYA 1R6BX 4G1UC 2WHXA 4W5HA 4LGMA 1US8B 3MUFA 3LLMA 3E2IA 2QTZA 4F92B 4ZKDA 1VG1A 2CHQA 3QSYA 4HUQA 1Z6TA 5H8WA 1D8TA 2PX0A 3LV8A 4KSBA 4PO8A 3OEHA 2IS4A 2VRWA 1NRJB 3BB1A 4IOMA 5EE0A 1GAWA 2WSSA 5LB4A 1S8FA 1E9SA 1TVCA 4YONB 1YR9A 4NBSA 5DHFA 3N5CA 2WV9A 4GZMA 1GNQA 4LSGA 1GFIA 3MWYW 5IHPA 2ODWA 1E79A 1M2OB 4LV6A 1E9EA 4NYIR 3F5FA 1P4SA 3O47A 4OK5A 2RAPA 4BLSA 4D4KA 3KJGA 3LFUA 1G16A 1JJ2B 2F3TA 1XEFA 1DADA 3CX8A 4Y9RA 2J0SA 1ELOA 3GFPA 3IDQA 5J4YA 4PC3A 1VCOA 2EYQA 1G3RA 4TT3A 3SNHA 3U7GA 3ZC3A 1R5NA 3UG6A 3RDPA 4MYHA 2BKEA 1CR2A 1W36C 4FIDA 1PLJA 1N6LA 4Q01A 4GZLA 4HLUC 1MV5A 4UNRA 4Q9IA 1OFTA 3A36A 2AK2A 4OBEA 1G9XA 1G7RA 4C0JA 1NMYA 4BWYA 3OE7A 1TEVA 2QP9X 3VO2A 5EE3A 3BXZA 4YAUA 2MSCB 4NYMR 5EMNA 4R2IA 4TLCA 3V4RA 1I2MA 3T1OA 2DHRA 1AQYA 1GKIA 1MRNA 1S3GA 2VHJA 5AJVB 3ZIAD 2QL6A 3O8CA 3CCMB 4KFUA 2D2FA 3WMGA 1Q3TA 2PH1A 4BASA 1JR3A 1Q21A 4V0OA 2JEOA 4IDOA 2ZS8A 1FUUA 2BBOA 3THXB 4FMBB 4WBSA 4PSVA 3PEWA 2HCJB 1KZGB 2ZU6A 1JQJC 3W6OA 3T06B 3EIEA 2J87A 2VYFA 3H2YA 4QHSA 1T0HB 3THOA 1FP7A 1E9DA 5TV2A 1U8AA 1Z83A 4C30A 4TYNA 1GVHA 1DARA 3NH9A 2AK3A 2N42A 2AWOA 3GJ7A 1FRNA 1N6OA 3KZ1E 2CRVA 4R98A 8OHMA 1F6BA 1Z6GA 3GLIA 4HAZA 3CNNA 3IQXA 4WA7A 2NG1A 4C0AC 4F7DA 1EFRA 1CJMA 1Q20A 4HSEA 4A0FA 1XJ0A 1UEIA 4ZCMA 2W00A 3G4SB 3E1YE 2ZQ5A 2O8CA 3D8BA 4Q18A 4XSHA 2J0UA 1DDIA 4FN5A 4MQBA 3TVTA 3FFAA 4JLAA 3MCAA 4A0RA 1XPUA 5JJLA 1R0ZA 3FVQA 3K09C 5FTJA 4RZUA 4BLQA 1G7SA 5IDVA 4JVNA 4AK9A 2REXB 4H1VA 3L8ZA 2FNAA 4LWZA 1E9FA 4US1R 1T6NA 5AJWA 3RS2A 5M04A 4ZV4A 5FOVA 4DIDA 4Q7KA 5CB6A 3TSZA 1N0WA 3QKUA 3K0EA 3BS4A 3TJZA 5JI2E 1N6KA 1KI8A 1YZLA 2VP0A 2R6GA 4KVGA 1T0JB 2IYVA 5FBRB 4KO8A 5J40A 5H59A 2IYLD 2W83A 5LD2B 2B8WA 1WP9A 1ZNYA 3AP3A 4Q4JB 3AVQA 4G3XA 4KV9A 3UXMA 3WP1B 4PPQA 4JLKA 3EC1A 1D9ZA 1AGPA 3L0OA 3AKDA 2ZE6A 2P3SA 4LBYA 2F55A 4DCSA 2FN4A 1P75A 1W47A 1JALA 1Z29A 3NEYA 2AD5A 5GV8A 1QGAA 4TMKA 4G1VA 1YE8A 4JL8A 1JA0A 1HE8B 4HAUA 3HPQA 1NVWQ 2QUZA 4PC7A 3QXHA 1KNQA 3VR2A 1OH6A 3K70C 1NF3A 4EFLA 2REBA 1FQJA 2X2EA 3LX8A 2IC5A 4MGIR 2WPDD 1F5NA 1BYIA 2H1LA 1KK2A 1I4TD 4HAWA 4JYBA 1ZCAA 2ZRDA 1W0KD 1JAHA 2IX3A 1QHIA 3IIMA 1NN1A 2XGJA 1SXJA 4JLMA 2H57A 2GXQA 3ETLA 1F20A 1E2IA 2HV8A 3UIEA 4EJSC 1MO6A 3LAWA 3C14C 4LX0A 3LVBA 4Q1DA 2GA8A 2W2VA 4B2IA 1NJGA 1U99A 1FNBA 4MYUA 3CC2B 2QEQA 1V43A 5TXGA 1ZU4A 2B7BA 3E20A 2VP6A 3ZZ0A 1TTTA 4IW3B 1LY1A 2QMEA 1AQUA 4TTQA 2R6CA 4DQKA 3W5JA 4QKQA 2GJ8A 4AI6A 1OB5A 5HPYB 2V1XA 3EXAA 2XNCA 3U4QA 4TL8A 1NBME 4C0KA 5EP2A 5KNDA 3ZJYA 3X1WA 3VKWA 4Q03A 3K9HA 4XSGA 4GMDA 3LW7A 3SYLA 1D2EA 1UKEA 1M34E 3DZDA 2Z6VA 4GP7A 3S1AA 5KDDA 1RIFA 4GDFA 4Z1MA 4DLTA 6Q21A 3WNCA 4IOLA 1ZNXA 5JEEA 4XD7A 3OZWA 1OHHD 2FSGA 4JT2A 3NDPA 1NVUQ 2R2AA 3MAAC 1XEXB 1TU4A 4IEIA 2GEVA 1E64A 4Q9LA 3DMNA 3ZLJA 1X1SA 4DLYA 5EXSA 1RRGA 1K5GA 1SGWA 2FEOA 2GJKA 2WOJA 3O8DA 5FUYA 4KVAA 5FPSA 4QXAA 4HE6A 1VQ8B 2XNJA 1G4AE 5KSOA 1IJFA 4LV8B 2QNRA 4BGDA 4B71A 5FOXA 3GLHB 2PJZA 1LS1A 3TMKA 4C43A 4OQXA 2OEPA 3BGWA 4IKEA 4TLDA 2B6HA 4MRSA 4Q1FA 4Q02A 1G3UA 221PA 1YR7A 3AB3A 4Q1EA 3CCVB 3L82B 2V3CC 4O0MA 2KSQA 2IT1A 2ZE7A 3B85A 2ZJ8A 1Q1EA 4LPSA 3VQTA 2W6JA 3KQKA 3CF0A 2OM2A 4AWXA 3U3JA 1S3SA 1NNEA 1SVWA 2OBMA 1P73A 1CJUC 1IAQA 4LYAA 4Q66C 4M8NE 3VFDA 3FOZA 2FE4A 1OF1A 5FTKA 1GNRA 2N1BA 3SJAA 4US0R 5HCIA 2MSEB 4K46A 2V6JA 3VNVA 1E2JA 1FMLA 4DIEA 4IDQA 2FSHA 3ADKA 3ZQ6A 2KJQA 3CIOA 2X3UA 2FJUA 3LDAA 1HTWA 2VL7A 1RW4A 3OESA 2RC6A 2DWPA 3ZYCA 4RY2A 1AN0A 3SOPA 1FPMA 2ZETA 1EX6A 2WWHA 4ZDIA 2GF0A 3OAAA 3GJ6A 1GAQA 1YZQA 2BN4A 2IWRA 4BZPA 3KJIA 3TR0A 4LJ6A 2A2ZA 5J4LA 3A58B 3PG5A 3SJBA 4D2IA 3D31A 2QT1A 3IBGA 1P2VA 3VNUA 2JASA 3VR3A 1ZC3A 2OILA 3UMSA 1QG4A 1GTVA 4HDOB 4M9ZA 1RJ9A 1W35A 2YVUA 4LPKA 5BXQC 1N2CE 1FX0A 3OZVA 1LS6A 2CHVA 4Z1MD 1E0SA 1W4BA 1TEXA 3LX5A 1K5DA 1GZSA 1XRJA 2KI5A 5AN9A 2GJSA 1I4LD 4A15A 2Q3MA 1W0JA 1ZIOA 4M1SA 5EE5B 1E2PA 3WMFA 5IK2D 3AVTA 4MKGA 1HURA 4M1MA 2HYDA 3VU9A 1TLLA 1Y63A 2IEZA 1RRPA 1E9BA 1L4UA 2QG6A 1FTNA 1SVLA 3DEFA 3QI2A 4URUR 1MT0A 2GZAA 2OFOA 1HA3A 4OI1A 3K70B 3NBXX 1NIPA 3B1VA 1XD9A 4Q4AB 2ZRNA 3KJHA 1XB2A 1VECA 4C4PA 4RD0A 4US2R 1E99A 5C46F 3KJEA 1DO0A 2AX4A 2YWFA 1S72B 1XJQA 4ZI2A 2VBCA 4DSTA 3B8HA 3AM1A 4ACBA 2ZJ2A 2A30A 5AWFC 1B23P 3PCRB 1J8YF 1COWA 1TQ4A 1SULA 1UKZA 4PO9A 4D82A 2PLRA 3EAQA 2QTVB 4ARZA 4P6VF 2P5TB 1TQ6A 2D06A 2ECKA 2ZRFA 3NBZC 4JLOA 1Q81D 3WRYC 1J90A 5CIWA 1VPLA 4DSOA 2QBYA 4ASUD 2RC5A 3HYRA 4TZ6A 1IM2A 5LPNA 3GEHA 1N6PA 4JSYA 1QFZA 4I1SA 3I72A 2FDCA 4Q7LA 4FMDB 1G291 2ZVQX 2RGEA 4KU4A 1EWQA 1ODFA 5EQTA 5KU1A 2BJWA 4Z8XA 2UVQA 3SC3A 1TADA 4BZXA 4KLZA 1XU4A 5JI3E 5KUTA 1AM4D 3KB1A 3LWNA 5SZJA 2V1UA 1BQEA 3IBYA 1C9KA 2O8EB 3QEOA 4LBVA 4OHZA 4UXHA 2ZI9A 3QIAA 5TR9A 1G5PA 2BKUA 2G1JA 1W46A 5LD2C 5JZVA 2W0MA 2QRNA 3O8BA 3H4MA 1JB1A 2QAGB 4QOSA 1PV4A 1L4YA 2PCLA 4P4TA 2CNWD 1XFAA 5AUQA 4B35A 1E79D 3ZDQA 2G77B 1G7CA 2ZJAA 4ZCIA 3NVAA 2FGJA 1XBTA 2Q9CA 1VQ6B 2KB0A 3ZVMA 1JPJA 4QGAA 1XPRA 3NXSA 4AF7A 2Q6TA 3LQRA 3QVUA 4V0KA 4DDVA 2P6NA 1W4AA 5JWHA 4L9SA 3PV0A 1O3YA 1DOAA 5ELXA 4D25A 1Q1QA 2V8OA 3LQQA 4V02A 4RD4A 1Q0UA 1GDDA 1SVIA 2QE7A 3I92A 3KKQA 3QQ5A 1KIMA 4Z54A 5JHHB 2GBLC 2AWNA 5FH9A 4ZPXA 1E9AA 1M7HA 2BMWA 2C96A 2IXGA 5B58C 1QVFB 4AY2A 4JLJA 4RJLA 2MSDB 3K9GA 4Q19A 5DE3A 4WZ6A 5E95A 2BM1A 4BFUA 4DLUA 2OBNA 2YHSA 3CMEB 2X19A 4L5BA 4KFTA 4JBXA 3RRMA 1NMXA 2PBRA 4UNNA 4E09A 5HR5A 1G8PA 1KMHA 4YDSA 2WJYA 1JR3D 1E4VA 3MWLA 5HXBA 1CJVC 1ETUA 3MGCA 3DOEA 3Q7QA 1MO3A 1S9DA 2Y8EA 4EDHA 1OV4A 3IO5A 5FL7D 3ADBA 3NIBA 3U7FB 4Q4JA 3B1WA 2H5EA 1II8B 4B34A 4BFVA 5C4MA 2DR3A 4OHWA 2ZSBA 4YHBA 2OT3B 3ZGXA 2Q3HA 1F2TB 3L8YA 3W2IA 3M6AA 1EFTA 4LC0A 1R8QA 2ASEA 2ZJZA 3AH8A 1HV8A 4WW0A 2Q0HA 2WIAA 4C2UA 1U81A 4LJYA 4B73A 4IXMA 3WMEA 4LYFA 4C9BA 5JEDA 1TF2A 2HF9A 1GR1A 4C2TA 2O0JA 2Q21A 2BHRA 4ZIRB 1WBDA 2ZPTX 3L0SA 2SHKA 1OXTA 4FI3C 2XZLA 4Q9HA 2FEMA 4KBGA 4Z51A 1JA1A 2JJ1A 1E2NA 4CEIB 3MJHA 2VHCA 2P2LA 3SFZA 4JIMA 1BX0A 3FHOA 1XD2A 2G9NA 1JR3E 2ZI3A 3F3YA 3LO8A 5D3MB 3U3MA 2EW1A 3K0FB 1SVSA 4UXJA 5AUNB 3ICQB 5CK4A 1OLOA 2XITA 3W8NA 5HE9A 3R8CA 1UBEA 1SKYE 3H84A 1CS4C 3LXRA 1NBMA 2O5VA 4L9WA 5EP3A 2FOLA 1MO5A 4H9GA 4PAMA 2FA9A 1A7JA 1QGZA 3AKEA 3BERA 1NKSA 1HYQA 4A8JA 5KPJA 4U9UA 1KI6B 4AG5A 2OBLA 2OXRA 1A4RA 2C99A 1ZM7A 1S1MA 1HQYE 1YZGA 1XTQA 2ZYWX 1Q12A 2GVDC 2C9YA 3MJRA 1UPTA 5EUQB 4J0QA 2J5XA 3EZ9A 2CNDA 3T12A 3NC1C 3SBEA 4QL3A 2ONJA 4AD8A 4DJTA 3BD9A 4DCVA 3TR5A 2XSZD 2C98A 4LJ4A 1UBFA 4OHYA 2ZANA 3EA0A 2PIAA 2KWIA 3Q5DA 1UJ2A 1JQLB 4KYIB 4Q1BA 2GESA 3NEJA 1E9RA 2A5GA 5J47A 2EQBA 3P1JA 4EJSB 3RVBA 3GLFB 1BO6A 1X3SA 1ZD9A 3SBDA 1EP3B 1VHTA 2XAUA 4GPTA 1O87A 3TQFA 1JBKA 1NSTA 1SXJC 3M0EA 3WNDA 3OIYA 3VR5A 3FDIA 3IKJA 1KDPA 3CR7A 4LJ7A 4WVFA 3I61A 1XTJA 4UAJA 3CO5A 3U44B 4TMXA 3GJ5A 2WOOA 4BEJA 4PGOA 2QE7D 3BORA 2GEUA 3V4FA 3BB4A 4DLWA 3PQCA 1DAHA 2G88A 1AGRA 2CDNA 4NTZA 3PUWA 4L8GA 4FK8A 3SHWA 2QGZA 2ANCA 1VQ7B 4MYCA 1Z06A 2Q9BA 2P6UA 3IHWA 1YIJB 3LY5A 2YNMA 1G4UR 1FZQA 1KMHB 3OEHD 2YC2C 3HYTA 3HU1A 2V55B 3E1SA 5D3QA 1RPZA 5BN4A 4KITB 4NYJQ 4V0ME 3EWAA 4LYHA 3OW2B 1UKYA 2GJ9A 2IXFA 1OH7A 4G1BA 1OGJA 5KSWB 5L3QB 1NN3A 1FQKA 3K70D 1W5TA 3TVDA 4BQSA 2IS6A 1P60A 3FFBA 1FTSA 1T5LA 1T5IA 2FFAA 2JLWA 1HUQA 3E70C 3KQUA 1ZP6A 4UNSA 4EIWA 2MMCA 1X6VA 1E3MA 2PX3A 2ZVPX 1GKUB 2VSXA 2ZJ5A 1W5SA 2E9SA 4DSUA 4YXWD 5B2ZA 1J8MF 3PUYA 1K8RA 1UKVY 3FWYA 5FA6A 4BLTA 3QVVA 5FBWB 2FPMA 2WKPA 2IBMA 2ZTSA 2ZRBA 3N70A 4M1TA 1E69A 4GI7A 1P5ZB 1Q1BA 2GRJA 1HY3A 5E7JA 2ZROA 1GL9B 4CEJA 2RGNA 1ZW6A 5AJYA 4G0NA 4MKFA 3G0HA 4TSFA 4M22A 3QEJA 3WP0A 4AYXA 4A92A 2JDID 3LXXA 4B6EA 1NLYA 1M1YE 4Q4HB 4ERNA 3B82A 1VQOB 4HATA 1OIXA 2A9KA 4BFWA 4OK3A 4C3ZA 1QZXA 3GLIB 5FOTA 4BFZA 1W0JD 4K1XA 1KK0A 4WOPA 1NLZA 3U6KA 1T3HA 1MR3F 1M74A 2CL7X 1ZC4A 2D4HA 3B60A 1E2DA 1NSFA 4TL7A 5IK2A 1D6JA 1U98A 1CKEA 4FD2A 4ITRC 1I7PA 4EJSA 3W3AA 2QGNA 1R5OA 1FNCA 1KAGA 2EFHB 5J4VA 3W2HA 1IN5A 5G3YA 1NY5A 4C0HA 1II0A 4PHGA 1WQ1R 1U0HC 2YC4C 1Q1ZA 4POAA 1SQ5A 1VYUA 4IEEA 5IF9A 4EFMA 4B75A 2FX3A 1W4CA 1XMJA 5THXA 3GD7A 1QUEA 2F1JA 4IDHA 3TBKA 1J7KA 2ZRPA 3U6BA 1DPFA 3DKVA 3CH5A 4YDHB 2BMJA 2QP4A 2VSFA 2AFHE 5A5GA 2QSZA 2QMHA 2XTMA 4NCHA 3C16C 1IN4A 1W36B 2XSZA 2TMKA 1XF9A 1YJ5A 1TAGA 3IGFA 4D0NA 3REGA 3FHCB 2QDXA 3OJWA 1EWRA 4MRPA 1FL9A 5F2EA 3L43A 2ZM5A 4NHOA 2W6ID 3FTQA 1YI2B 3KKPA 2R8RA 3NC0C 1E1QD 5CIQA 3U44A 3T5DA 3A4NA 1GL6A 3C4JA 3RC3A 4CDGA 4ESVA 1E4YA 2OLKA 5CITA 5KHOC 1LV7A 1TQDA 3C7KA 4GMXA 4C0LA 2WWIA 2FFHA 5DYGA 4BECA 3X1YA 1QFYA 3K53A 4S35A 4OKSA 1W34A 2C03A 2O8DA 2JJ2A 2RHDA 2RCNA 5BN5A 2ZI5A 2EFGA 2EYUA 4LK2A 3CUEF 3LBNA 5H70A 1CJKC 5G3ZA 2I1QA 1RVDA 4JL5A 2BGIA 5UKDA 2JLZA 4E5UA 1KAOA 2IYXA 4ZDWA 2IYSA 4LJ8A 4Q48A 1OYYA 1DAIA 1MO4A 4DLSA 2QMOA 3AF0A 1E62A 1UBCA 1YZTA 1SHZA 5JWOA 2EWVA 1ZINA 4M1YA 1TF5A 3KQNA 4UJ5A 3RS4A 4JSTA 2NMVA 2HLDD 4UXIA 5CLLA 5FUWA 4NP6A 2CNWA 3WBJA 1OKKD 4IHQA 2ZRAA 3MFYA 3QKSB 4C0BA 4PHFA 4MRRA 3ICEA 4JVLA 3SQXA 2OO7A 1VG0B 3EPHA 3ZBUA 3P4XA 4PQYA 2VP2A 1KKLA 4PC6A 1GP2A 1ZUIA 4RZ2A 3P26A 2DEUA 2VH5R 4TYPA 4B3CA 1QGYA 2C78A 2GEDA 2O8FB 2FFBA 1MABB 2QAGA 2ZR7A 3PFIA 3PVSA 1OFIA 4WXRA 4DRZA 2DBYA 3R9IA 1JR6A 5EUMA 4GL2A 2YWEA 2YJTD 1DEKA 4G5SA 1H8HA 4A4DA 1A2KC 4A6PA 3VKGA 3GFOA 1IXSB 3ZZUA 2C9OA 2J1LA 2OAQ1 4JLDA 4LBZA 1QDEA 4NZYA 3X1DA 1QG0A 1Z08A 3FMIA 1YZNA 1W7AA 1VQMB 2HXYA 2CCKA 5K8TA 2CLSA 2EFEB 2IYTA 1UAAA 5JCPA 4QBGB 4DCTA 2FSIA 3QBVA 4F93B 4Q7MB 2GTPA 3C41J 4U00A 2GK7A 2WAXA 2ZSAA 2IHBA 2JDIA 3AKYA 821PA 3LW8A 1KI4A 1P61B 2RHMA 4D0GA 2QORA 5B64A 5FL3A 5BW8A 1FFHA 2MMGA 4HYYA 1QVRA 2F1IA 3D7MA 2ZYTX 4M21A 3THYB 4DEYA 4FINA 2OCAA 4K8OA 3RS3A 2BCJQ 2GXUA 3CKLA 2CEAA 1TMKA 2VA8A 2CMKA 3WHLA 1QUFA 1EP1B 1NN5A 4Y7CA 1YHQB 3G5UA 3K0SA 4NYIQ 1OXXK 1HT1E 1AKYA 1PLLA 3PUVA 1N3BA 4JMPA 5SZKB 4EPTA 5GV7A 1EGAA 4EFNA 3TGPA 1N5KA 2A5FA 4MDFA 3CWQA 4LHWA 1VMAA 1QF9A 3BFXA 1YITB 1RZ3A 1YRAA 2BEKA 1I2DA 1G6HA 5FR1A 2DFNA 2HXSA 4V0NA 1P2UA 3HR8A 4JBWA 2O8CB 1XZQA 2WJIA 4JKIA 3Q85A 3RABA 1K8AD 1QFJA 3EPLA 4AF6A 3CRW1 2DY1A 1G7TA 1LB1B 3UG7A 4GBMA 4RCYA 1NP6A 2GZDA 3VAAA 4BFXA 4DLXA 4B2PA 2ZAMA 3CF2A 3ZH9B 3Q3JB 1P9RA 1B2RA 3C5CA 2D3WA 1E32A 1XMVA 1VQNB 1ZD8A 3QXCA 3PEUA 1VKJA 3KXKA 4GT1A 1S0UA 3B1YA 3WHKA 4AG6A 3FMFA 3GJ0A 3P27A 2IHYA 1DDGA 4M53A 2QSYA 2C2HA 1S96A 2DPXA 4ZGNB 1AS3A 2PMKA 1R8SA 5EE9A 3R7WB 3M4YA 3RYTC 3F8TA 3QE2A 3G82C 1CNEA 2DETA 3CH4B 1YKSA 3QNUA 2IYYA 5JSZA 4LV5B 2BBWA 3V00A 2J41A 1E6CA 1YRBA 3U7HB 3KQHA 4UKDA 1RJ9B 4YAOA 4B47A 1M90D 1XTSA 2WWXA 2ZUCA 2IYQA 1JJ7A 1TX4B 3OAAD 2RB4A 3C5HA 1AKEA 2OUKA 4A2QA 2QI9C 2W0SA 3LVQE 4UNQA 4B3XA 2ODNA 2LKCA 4D81A 1ONBA 3LNCA 2GILA 3MWJA 1A8PA 2Z83A 3AVVA 2F1HA 4M9QA 1KO4A 2VHQA 3B78A 4GNKA 1YR6A 2BSAA 3P32A 3QXXA 3AP1A 3SQWA 3H0KA 1FMJA 5F98A 2ZAOA 2NO6A 5DN6D 3CMAB 2O8EA 4B44A 2JJ1D 4ABYA 2HLDA 2CE2X 2VEDA 4XWAA 3CXCB 3EIHA 1VQ5B 4PAOA 3BBPA 3ZIAA 4B6FA 3ZD7A 3QFSA 4C7OB 5FR2A 4DBLC 3W2EA 2IL1A 4AKHA 3MLEA 1F60A 4GP6A 2J59A 4V0LA 1W4RA 1CP2A 4P4SA 4QJ5A 3RS0A 1A5TA 4NYJR 1EFUA 1YJWB 3IEVA 3B1ZA 4A0GA 2VZLA 4BUJA 3GLGA 4ACAA 5HE8A 4B76A 1JXOA 4TT3D 2PMDA 1H8HD 4U02A 3LA6A 1II9A 2ZR0A 4JKYA 1ESMA 3TRFA 3Q7PA 2H8KA 2IUSA 4G5QA 3W34A 2ZRLA 2J46A 1EWYA 1W44A 3N2EA 4OK6A 4DB4A 2ZXUA 4KFSA 2ZE5A 2I1VB 3JZAA 4FCVA 4U5XA 1TL7C 2FFQA 5JRJA 4RZ3A 3GPLA 4NCJA 3GLGB 4BE7B 1AJEA 3CONA 5B57C 3NBYC 4LHYA 1KI2A 3SZRA 1F48A 1IONA 4P4SB 1CXZA 1CR0A 4NH0A 3AGPA 2YWHA 1WBBA 1ZM9A 5AJXA 2ZR9A 3B1XA 3W6PA 4GRAA 3ECCA 2DFLA 4MDEA 3EZ7A 3MWKA 3QG5A 5EP1A 4H1UA 3CZPA 4MUBA 2ODBA 4EAQA 4ARZB 3IILA 1BMFA 1XWIA 1XNJA 5KYKA 3G71B 2F43B 4PZZA 3AF3A 1IN8A 1JNYA 1KMQA 2GDJA 4M9XA 4ON9A 2CLDX 4AURA 1P2SA 3FMOB 4R9UC 2WWYA 5JHGB 3K8YA 4B3GA 5L8VA 2P6RA 3K0CA 3R9WA 4RZXA 1XCPA 3CPHA 4PAQA 3Q5EA 1OJLA 2CCGA 1SVKA 2FPKA 2ZREA 5K8UA 2AR7A 3WRXC 1CNFA 2BC9A 3TAHA 4DVGA 3SE0A 4EQ6B 4PR0A 5D3MA 2FH5B 3AVYA 1XE1A 4DQLA 2IW3A 2O8BB 1KI1A 2FZ4A 2YOFA 1NDHA 4O2RA 2ANBA 2RGAA 3HWSA 5JS7A 2BMFA 1FP6A 2RGDA 4PFSA 2GKSA 4OHVA 2WWGA 2GHIA 2WAYA 5FPKA 2FV8A 1GIAA 3PR1A 2F1RA 2FPLA 5FPHA 1OIVA 4PANA 2DFTA 3DL0A 2P5SA 3FB4A 1ZM2A 2QENA 2BPOA 2Z4RA 3KDSE 1M7BA 2O8FA 2E87A 1FNNA 5FTMA 3LBIA 3I3SR 2JLRA 5KSPA 3UKDA 3RSLA 1G18A 5LB2A 3ADDA 4CT4B 2VLIA 3GJ8A 3LBHA 3AVPA 2OZEA 4DC9A 2VPPA 2WWWA 1X8LA 2F6RA 1Q57A 3V76A 4KI0A 3AGQA 1SHKA 2DWQA 2G0TA 3EG5A 4FMCF 3QJYA 1ZUHA 3OIVA 4K81B 3UATA 3T1QA 5IRCD 4ZCLA 5FOSA 1T8TA 2FWRA 4S2EA 1RYFA 2QPOA 4Q9JA 3U3KA 1UEJA 1GL7A 2ZJOA 1SVMA 1ZM3A 3RNLA 2WJHA 3VR4A 4BRUA 4YMUA 1Q86D 2QPTA 4L15A 1SKYB 4V03A 1UF9A 4NU0A 5JJKA 4F4CA 4RD1A 4TMVA 3LLUA 3QFTA 5KSZA 4PQFA 1E98A 4YMVA 1RE0A 2XB4A 4D0LB 3DM5A 1XCGB 3PITA 5HCNA 3OEEA 4A8JC 2CL0X 1IY1A 4XIGS 2WICA 3OIWA 4BPBA 4G5GA 5F3WB 1BMFD 1CF4A 4RFSB 3KKOA 2XTNA 4D4MA 4GOJA 1P72A 2LKDA 1E2MA 4TMWA 2OG2A 4LCBA 4PZLA 4AIIA 2F43A 2OESA 2QEXB 4M1KA 4HLUA 3ZVLA 4QRHA 2OFXA 3EASA 4CIDA 3DKPA 2O8DB 1RKBA 4DT1B 3FJOA 2CK3D 3GLHA 1NKTA 3K09A 4Q1AA 3S1AB 4YMSA 2RMKA 4HUTA 2OK8A 2PEYA 3B7GA 1JB9A 4W5WA 1OSNA 1PJRA 4LZZA 1IXRC 1NVXQ 1DAMA 2ZE8A 2ZI4A 2PZFA 3RC8A 4QBIA 1U0LA 2JA1A 4CT5A 2NQ2C 2BJVA 2CE7A 4DUGD 1CLUA 3EC2A 1HH4A 4DEXA 1Z6YA
chains in the Genus database with same CATH superfamily
3BHIA 5JW6A 3H87A 5B30A 3DM9B 1W1UA 3F9IA 2Z4SA 4D6YA 1FU4A 4HAOA 1K3TA 2DFPA 3IEKA 2FG5A 3CUWA 4LXHA 3ZY5A 3O3NB 2C59A 2HEIA 3NANA 1UPUA 2NUPA 2WNSA 1V5IA 4Z9AA 4R69A 3IODA 1RYNA 5EXTA 2XCOA 3T52A 5B4TA 4FXOA 4CDRA 3KK0A 2YJGA 4OFBA 4URYR 4X71A 5A6VA 4JXXA 1Z36A 4F3TA 1XVAA 4CXMA 1MUUA 3OOWA 1TO1E 2B92A 4R8VA 4CW7A 5EWMB 1SKBA 1H8EA 3CCUB 1IXZA 1Z37A 2HNKA 1ZX1A 3E9QA 4ND4A 2RE8A 4P0PB 1UPCA 1LDYA 2FMKA 4IZ6A 3U3RA 1C1YA 3M4JA 3QLUA 4HB0A 1ZD1A 2XT6A 1NJFA 4XWKA 3PXDA 4GXNA 3EIWA 1QLJA 1ZCFA 1D1NA 5DX0A 3C8DA 8ADHA 3CCQB 1W5AA 2AJCA 3CSSA 4MKXA 9MHTA 3I52A 3B1FA 3SYTA 4N7MA 1EK1A 5BWMA 2I7VA 1I3KA 1DTWB 3V7NA 1XX6A 2W37A 2I6UA 1X7WA 1FLAA 1HDZA 3MJVA 1Q16A 4ZAWA 3FMGA 5C8ZA 4Q3CA 4OPOA 3DF9A 4OV6B 5HUHA 1YVDA 4UW9A 4Y0NA 1Y8AA 5F5LA 1WE2A 1V41E 2KBFA 3X1ZA 3WRVA 1DAGA 4LXQA 5JLJA 3PUNA 4IIYA 2C3OA 1G6OA 4R84A 1PVOA 3JD4A 4WXHA 1M67A 1FTWA 1YQTA 1WY7A 5I7RA 5BR8B 3L6BA 4HBZA 1PFWA 1OVMA 4JODA 1F14A 1U9ZA 3C5WP 5CK5A 3ZGNA 4IHAA 5FPTA 2CW5A 1LX6A 3M6VA 3RBVA 3L8DA 3GLHE 3RHZA 3SYRA 3WGJA 1ND5A 5KAMA 4F4IA 3I1IA 2C2GA 4H7JA 1IEQA 1P1KA 4OYLA 4O2AA 4RAQA 4RK1A 3RSCA 3ISJA 2G06A 1R74A 4M86A 4U0JA 4NF2A 2R11A 1BS2A 1FW8A 1D1QA 5LXTF 4E2ZA 1C0KA 2QE6A 2QTLA 1W36D 5B53A 3PRJA 3WADA 5FEUA 2Y6UA 1KY3A 5KIAA 4ZPJA 3NYIA 4PM4A 2HYIC 3K8QA 3OPYB 4DC0A 3M49A 4KQ2A 1VHQA 4FBLA 1O6BA 3OHMA 1E9CA 1XA3A 2CKDA 1QJ4A 3L07A 4N7JA 1X77A 1KVUA 2ZBFA 3BEOA 3B1KA 2V7QD 3K32A 1M1UA 2W2OA 2W98A 4UUBA 4ZI3A 2XUKA 2WYWA 4L9AA 3SS9X 1HNXB 3R9XA 3FTEA 2AFRA 3LIPA 2A5LA 3P7MA 4JDUA 1RE1A 1T3GA 2QGGA 1M6WA 3FPAA 2RHRA 3OX3A 3PP8A 1E60A 3KVVA 2YKGA 4QYMA 1JJVA 2LGJA 3A6GA 3OFNA 1K7FB 4PG6A 3E05A 4JL6A 3VR0A 4EGFA 4D5EA 5F77A 1V0FA 4AL4A 2P2DA 4MR8A 5DGIA 2LV8A 2ZYGA 2OCLA 1W6UA 4D9MA 621PA 3CB4A 1JWAB 1N77A 1BU8A 2Q1UA 4I5GA 5L3SB 3S0JA 2QU7A 2EP8A 1V5GA 1TUBB 2O0KA 1Z2NX 3EIXA 5HKLA 1GQFA 1U8YA 5B1HA 4UASA 3JZDA 4I1IA 3LMKA 1G1MA 3WMWA 1M54A 2DECA 1CV2A 1RMYA 1J8QA 1RYDA 2PSHA 3O7WA 3ZV5A 4XJXA 5HKAA 4FDVA 4C7VA 4CKEA 3QEKA 4I1OA 1B74A 2EHJA 1EFHA 2P69A 2K5UA 4X97A 5JFTA 3H1AA 3H9CA 4MKIA 4OXIA 1JI0A 3L7YA 1FFWA 5CFMA 5I7SA 3VDQA 4JBHA 2JLAA 2R6AA 3QEMA 5HUQA 3KPVA 1KI9A 1YK0A 4QOIA 1EINA 1QG2A 2NO9A 3IAFA 2FW6A 2VHWA 3DPUA 1QHYA 2OOSA 4HH0A 2JHAA 3V1KA 3R75A 4E1AA 5CM9C 1G41A 2R0QC 2J4FA 4S05A 3HXQA 1E1KA 3NWBA 4RSGA 4ALIA 2ZIAA 4BU0A 2ZU0C 4KXFB 3PTZA 1M6YA 1YZFA 4A6XA 3LH5A 3KSRA 3KTOA 1K0UA 3LQ1A 4G09A 2X14A 3QWFA 3U61B 1KO1A 3OBIA 4FHEA 1RQ2A 4D9FA 1WXWA 1UXGA 1I1OA 2CVOA 3G68A 3TTVA 1Z4OA 2IQIA 2D2VA 3NAMA 1EP2B 3OZXA 2O5RA 3HDTA 3IVAA 1ULBA 3MRSA 1MAAA 5ABPA 6AT1A 4YIHA 3CLHA 1O6FA 4ZREA 4CF7A 1I0ZA 1USVA 3ZVNA 4PGAA 1OFUX 2XZPA 1XXHA 3WLJA 4EGCB 1AQJA 3HVHA 3BX1A 5DWVA 4YR7A 3IIEA 3EXHB 2H5LA 4IMPA 1ILEA 1L5LA 2WKQA 2Z5FA 4M0MA 3MOGA 5F35A 5T57A 4KIWA 2M98A 3GLIE 1DRJA 1YOVB 2NV6A 3HUTA 2DCUA 3NU1A 5A6SA 4XW2A 4CLOA 3T7RA 4BMNA 1Q84A 5FUXA 2BVNA 3FNEA 1M34A 3W78A 1WMSA 4PBTA 3T3PB 2H16A 2V03A 4Q12A 4FEAA 2A0KA 3SSOA 2AMFA 2HPVA 4C4SA 2DFKB 1BNCA 2FZEA 2R6HA 4FFRA 4GAEA 1WB4A 3CINA 1F8UA 1I4WA 3P8ZA 1VBMA 4OREX 2FWAA 4TKLA 4X54A 1K4KA 2ZJYA 2IYZA 1N5IA 4Y0AA 1IVSA 2DWCA 2HL6A 4AVYA 3KJZA 4LSMA 1AK2A 1TYZA 2UUAB 4K9RA 3CC7B 2JN9A 1IYZA 4JS0A 4Q1CA 4ITUA 5T8KA 1PGNA 1QWOA 1RI5A 1RQLA 2WJVA 1SD5A 2PY6A 3RUHA 3B6EA 1A9YA 2EIHA 3ZLTA 2B4KA 4JWTA 1G8HA 4AW9A 1T15A 2W70A 2GRUA 4KO1S 1RBMA 4CIXA 4MEAA 1L7DA 3U4QB 2QI9F 4U2KA 5CYOA 3IP8A 4BMOB 1SKQA 5CJ2A 2CVFA 1WM1A 3RANA 3BRWD 1HLFA 2ZYVX 1U0JA 2G1UA 1ZL0A 3F2VA 3FFWA 2QN8A 1QGUB 5G0UA 4EJ6A 4YRGA 1OGYA 3NYRA 4FMDF 2O2EA 1YIDA 3B3FA 2EWWA 1NN0A 2JH9A 3ROMA 5DGHA 1JFTA 3DBOB 3U3OA 5JYEA 2YVLA 1BJKA 3REQA 3UJ3X 1IZ0A 2Q4TA 3D6VA 5MDHA 5AXDA 3I76A 3LKDA 5EWMA 3AV0B 1Q11A 3P2IA 1U3UA 2VJKA 3P9KA 4EY8A 1YRLA 3F6EX 4K9SA 1M5TA 1MQ9A 1VKOA 4N3GA 4LUCA 3PIDA 1H0KA 1VJGA 5ALTA 1KJJA 4LMRA 3SDBA 4GOOD 3SJCA 1ECCA 1ZIPA 3NGLA 1UZNA 1Z5OA 4I4TA 3MS2A 3VKVA 5GJCA 1UFKA 1XCLA 2W6IA 2I6SA 4LXXA 3PJFA 4MV3A 2FU5C 1VRVA 1UWCA 5JVDB 2Q4BA 3MILA 1QK3A 2Z98A 4AKSA 5FL7A 1DS6A 3DNMA 2IUTA 2X5OA 4FYPA 1PYOA 1I9GA 3KZKA 2D2XA 4QWMA 3QELA 3WWCA 2Z2KA 1Z39A 2B5OA 1G5QA 2Q07A 3K8OE 4ZRDA 3R7WA 4AZ3A 9GPBA 1RPAA 2JK1A 3PXGA 4CR6A 2HW8A 5CH8A 2CDCA 1US8A 2J7PD 2O3QA 1VXRA 3GLSA 3HACA 2ADFA 1XAHA 2NIPA 3EW9A 3QKRA 1FRQA 3BL8A 1K89A 5HGJA 1PR6A 2RAFA 4ZA2A 3RJTA 3HK2A 4HYTA 3HEMA 3IUBA 1B8NA 1T8SA 2C95A 2BEJA 5AXBA 4OTZA 1A27A 4P36A 1F6DA 4WOCA 2R6DA 4DF3A 5C7YA 4Q0MA 5FO0A 2ZL6A 2QK4A 2XVAA 3RVPA 2F3PA 1DP4A 4RSHA 2NVWA 3BA6A 3MCWA 2Q5JA 2FQXA 3F46A 3QWHA 1FSSA 2J3QA 3HU3A 3KYCB 4GLLA 2DHCA 3R8XA 3WICA 1UAGA 4OQPA 2O0HA 3TDKA 4DBVO 3I5UA 2WSSD 1CJTC 2ZRJA 3EVBA 5EINA 4KACA 3NJ8A 1XEWY 1UJ4A 2IYPA 5JARA 1GQOA 5JAMA 1LCIA 1D2MA 1T13A 2FQ1A 3CRRA 4GGMX 4GOND 5FFFA 3TQRA 4DEVA 3FGOA 3DBIA 3RC1A 2D3NA 2WYRA 1A8SA 1P6UA 1EUDB 1RADA 2GPWA 3ANYB 1S8AA 5CTJA 3O93A 5BUZA 2F3UA 2H1SA 5A3JA 5ICGA 4WUVA 1BGVA 3CCEB 1LBQA 1N2GA 2DZDA 2PUTA 3FZNA 4EKGA 3BC9A 1D0VA 1GGFA 2NXJA 2M6RA 7REQB 5I4KA 4CTJA 3L0IB 2X5XA 2I4MA 1ZGAA 3CA8A 3EYWA 4QNRA 4ZXFA 5CHEA 1V11B 1NMZA 2IZ1A 3NHBA 3MW8A 4L4YA 4ZI7A 1EM8B 3FPKA 4Z4VA 4OHXA 3ZV7A 5J2TF 1XLTC 1TQHA 1MTZA 2GLXA 4DQDA 4Z4WA 5K0LA 4MV1A 3P4UA 4RJ2A 2ZI6A 4KN8A 1JTEA 3CPSA 3E9EA 4YV2A 3RADC 4QZVA 1X1AA 1DT3A 1UOQA 3X2SA 4PS1A 3CPEA 2C2YA 4BKOA 1U31A 3ELWA 4Y0VA 1MRSA 4H6XA 3AEQA 1UWKA 1C8LA 1EX7A 3GRVA 2Y0CA 4L8VA 2HU7A 4EM6A 1YJ9B 3P0IA 5M5BA 2I3AA 2ZZMA 3LS2A 4RKRA 4KQ9A 4LRQA 3GD5A 2F4NA 1C2TA 1VE9A 3BE4A 4AMVA 5DSZA 5BN4B 4EHFA 4MH0R 2PUAA 1RNLA 3DAOA 3DMGA 1X9HA 3EX7C 1P91A 1HE2A 4GWGA 1FC0A 3OO1A 1II8A 1FDRA 2XWSA 2I34A 2PZBA 3IXQA 1WPCA 2OLJA 4D4JA 2O3RA 3WYGA 3OZUA 1HKHA 3RRFA 2Z0MA 3K9BA 4RK5A 3WG9A 1UM9B 2OSVA 1AMOA 3JVEA 1USUA 4IJMA 1TJNA 5DNAA 2ATVA 4RKYA 3JVUA 2Z6UA 1T9HA 4EYKA 1WETA 2Q50A 1XPOA 1BMQA 3LUPA 1GQQA 5IYZB 1RHQA 2R65A 2P9BA 1M1XB 4RZSA 1VPVA 1JEOA 1Z7EA 4MGKR 4GO1A 1PGOA 1Q7TA 4J1NA 5KJ6A 1EDOA 2XJ9A 1EGMB 5C8YA 1QIFA 2OV6A 4OIFA 2H4JA 3HR4A 3L7AA 3RWBA 4Q16A 1NVAA 5EXPA 4KR6A 1G8YA 2VJDA 3ZY3A 4QDJA 4YUZA 3EXIB 3R5FA 1KI7A 1RTTA 1ZNZA 3QF4A 2FZWA 3EGDB 2P67A 4KQHA 4ILKA 1SAYA 3EMDA 2NTVA 3P4YA 1LPNA 1SR8A 4N5HX 2NPIA 2QR3A 1OMOA 1D2HA 3A28A 5C53B 1VLQA 2ZYIA 3FM9A 2X86A 1QS0B 1M0EA 3I09A 1LSUA 4YNBA 2PA0A 3O8QA 5TGZA 1P81A 1OGIA 4EKNB 1QAMA 5T6MA 3R3VA 4AXBA 3FDJA 3SU8A 1L7XA 4CM9A 2XDWA 2IEYA 3GLUA 4G8CA 2FGKA 3RYHA 3IAAA 4IINA 2VP4A 1L5SA 1S5PA 1SK8A 3H8SA 4A8JB 5INTA 5L4NA 3H6GA 2HK6A 2VZ8A 1EESA 1GZHB 2HK7A 2IPNA 2REQB 3G49A 1U2RA 1H65A 4CHGA 3U40A 3UUFA 4D74A 2G0NA 2H0AA 3TQCA 3AY3A 2BF4A 2JGAA 3A1PA 3JQCA 4TGLA 3RRXA 5AI0A 3EQ8A 4BVAA 3BFVA 4RHXA 1RWNA 1BE6A 3L8HA 4IFBA 2Q3DA 3WLFA 4YK7A 2IUYA 1I4DD 2PNJA 4DKXA 5JPCA 4JEUA 3GRUA 5T41A 4KV7A 3UQZA 2RGBA 1E6UA 5DN6A 3B12A 2PUCA 4MIKA 1MJHA 4QXOA 4RESA 4M9RA 3ZTTA 5KDOA 2BEUA 4R2JA 2QTRA 1QXSA 2B0CA 2JGJA 1X14A 2RGCA 2A78A 4M4SA 2XKJE 1OLUA 3C6ZA 5A0FA 2XB2A 1U4SA 3T7KA 1KRHA 2FXVA 3ELUA 3O2NA 4PV7A 4RV5A 3WYBA 1QBKC 3OA0A 1TZJA 4JN6B 1XP8A 3OFND 4MYSA 5B6PA 1OW3B 4HI0E 1ZD5A 2FMUA 5I8WA 1WIWA 3ELBA 1Z4PX 5AXCA 1U9IC 2NU8B 1M0WA 1GUDA 2UZ1A 1JZQA 4D4LA 2BT4A 4FDUA 1PTKA 4N3CA 4ETMA 4W9RA 3TFQA 2EKLA 3KSBC 1JQBA 1LTKA 2YFHA 1VG9B 2VZEA 4QEZA 4RJIA 5E2AA 1J8FA 1LTQA 5E6RA 4DMLA 4KLNA 1N2XA 4BLOA 4TT8A 4WDQA 3F7MA 3PSHA 3KUDA 1GRVA 1QPGA 2GK3A 4PLFA 4UCWA 2VP9A 5SZHB 1QVAA 3ZV3A 1G3QA 1MXFA 5KTYA 3O3CA 5EOVA 1J0AA 2I67A 3VMMA 2X8JB 3AOGA 2GD6A 2GX6A 1UJCA 5DYIA 3MHPA 2P0EA 1ZRSA 3QFCA 1A88A 1HOTA 1R50A 2GPAA 3AXSA 1ARZA 1LJ8A 3FUWA 4FJ0A 4L72A 3RSOA 2PUJA 3PRHA 3ORHA 3HAGA 1N2JA 3A6ZA 2NPFA 1MEJA 1Q77A 1I9CA 2ZIEA 3SCZA 2CBXA 2XZTA 5BY2A 2UZIR 3USZA 4CQJA 4XMYA 2XMGA 1Y9JA 3IR5A 4KR0A 2YBDA 4BFLA 1U2PA 1Y6QA 4IXTA 1R12A 5EZ5A 4DMMA 2YYZA 4EK9A 5DNCA 1NC1A 1VYTA 4G1EB 4W5OA 1E0AA 2YHIA 3C1OA 1CLEA 1JKJB 1P18A 3GNSA 4JJKA 1CFZA 2HPHA 4G37A 1U8ZA 1UDCA 5IYZF 3IKTA 10MHA 3GL9A 1JG1A 4AROA 2AIRA 2ZYSA 3F5QA 2OQVA 4ZYZA 2XGGA 3L0PA 4UDOA 8MHTA 1R0WA 4Q21A 4C7BA 1JDVA 1NBMD 4WNIA 1USKA 4JXJA 4KODA 5IYZA 2CLCX 5GJWC 5A7GA 1QNFA 4L5IA 4YUAA 4R7TA 5CBPB 1N0UA 3G2JA 1CULC 1E5LA 4XE5A 5T7BA 3TUIC 2ZTNA 3V34A 4XRGA 3UYKA 2WTBA 2H54A 3U26A 1U2DC 3SJZA 3PNPA 1UZUA 3P2KA 3USES 4PZAA 3RUDA 4EMTA 3JRWA 3GJTA 3RI3A 1ZI8A 1OLSB 4ZTBA 2FWPA 4XTCS 2Y0PA 3EXHC 5K8VA 2YJNA 4MQUA 3WK7A 3JQAA 2BZGA 1NF8A 1P6XA 4PEVA 1X80A 3UQYS 4CQMB 4DA4A 2C1ZA 2R1UA 2YWJA 2FPPB 2AX3A 1IMOA 2JD0A 2Y1XA 3JVIA 4HEA6 2J3EA 4UM9D 4F38A 4BNHA 5A03A 1XDSA 3NVKI 1LD3A 2CUKA 2P3QA 2HMAA 3D8HA 4CTNA 2NAFA 3KYDB 2FDRA 2WKWA 5DWQA 3EBOA 2ZSEA 4MV9A 5CW1A 3GRFA 4ZI5A 1T5HX 3ZWPA 3AMVA 2SCUA 3H1EA 1XOIA 4N0PA 3CS3A 1NUTA 3U7QB 2D8MA 2M9MA 4W5JA 4WXPA 4YGYA 3LU1A 3QKRB 5HZKA 1N9GA 3CUSA 3JQBA 3PZRA 4I81A 1Q7YD 5HNKA 2P75A 2G36A 5DK6A 5G40A 2CVPA 1P7ZA 2EGHA 3E2MA 4M98A 4YIKA 5EKXA 5AVOA 3T5GA 3TLAA 3VJMA 2ZIFA 1SUIA 4ZCSA 4CHTA 1RP7A 3JQRA 2O1EA 1V3UA 4QFMA 1U2GC 2AFVA 2ZR8A 4RDIA 4XWYA 1QYDA 4YO8A 4BPRA 5ALIA 2MU1A 1RWXA 1JH8A 1E7MA 3LPLA 4QQFA 1K9SA 3S2EA 5JZSA 2GXAA 1P2TA 2J9ZB 2JAHA 3GGPA 3ML1A 4YT2A 2V31A 2ZZKA 5KVVA 5CLQA 2ZZEA 1X2BA 4RSRA 5F4BA 3V4OA 1U2EA 3W5VA 3H4IA 3X1KA 4C04A 3PA2A 1U5AA 3PLAE 2QQEA 3JALB 1SMKA 3MOSA 1NTOA 4FHGA 4GI3A 1R9GA 2JAOA 3U7EB 2QAIA 5CVUA 2WDZA 2WKRA 4YRKA 1MJNA 1CTQA 3KPUA 5K01A 2HTFA 2FWNA 2D2EA 1SXJE 5EAIA 3SICE 2V7UA 2GJAA 4OMUA 5AJZA 2QTGA 3S55A 2XVXA 5K09A 1DRKA 4M1OA 4Y2YA 3QLJA 4WOJA 4YHHB 4EFKA 3D6AA 4IDPA 3E6AA 5FTNA 4JCCA 2RGYA 1I8DA 4RA9B 5KAPA 1MU0A 2QUJA 2UVDA 4BZQA 4RK7A 1VLJA 2ATXA 3A8JA 4IILA 3SHTA 3LUJA 1H4TA 4REQA 1NUUA 2ZEJA 1UDBA 2RB5A 3UHFA 1JIXA 2VPZA 3H2GA 4QUAA 1KH2A 2GN0A 5JDCC 3FGNA 1M2EA 2VTKA 3Q6IA 4EF6A 1O54A 4ZVPA 2C9DA 2XECA 1SHJA 3IQEA 1NG9A 2QQGA 3F6SA 4HZUB 4NCIA 4A10A 4FCCA 1AKTA 3NUGA 4YV0A 4G5OA 2UUOA 3C6MA 4D4GA 4BVHA 2G5TA 4G23A 4M8SA 2V54A 4PSAA 2C7GA 2I4OA 3TOSA 4QHYA 2UAGA 2PA3A 3K4PA 2IY7A 5C52B 1H2HA 2CMHA 1JEAA 3I01M 4KJXA 1KAHA 2IXAA 5TX7A 2CVQA 4ESHA 5IWCA 3VR1A 2Z8XA 3IXMA 4HXEB 4DCMA 3DDCA 1N6RA 4BN5A 1C7ZA 4FHZA 5E7MA 4NIMA 1OPRA 2P2YA 2CSXA 1J09A 1M34B 1Y82A 4PGFA 3NYQA 5B7GA 3ZQJA 4LBWA 4F3NA 3VZDA 9ATCA 2N0SA 2Q2OA 3ZU2A 3NKLA 1P62B 1ZGHA 3IQWA 1NIJA 1YR8A 2QVXX 4X45A 4BNUA 3VHXB 3W3AD 1KJZA 5CCEA 5SYAA 3K6RA 4NV0A 2ORYA 2C97A 2W4QA 3DLTA 4N0MA 4W1QA 1YC5A 2L18A 3TQOA 3SQMA 4B82A 1YLOA 2CT8A 3WY9A 1J0DA 2MSKA 3B6MA 3IDZA 1R4NB 1GV0A 2BWJA 1NF2A 3RJ9A 3DHWC 1OXBB 3N8IA 1EJ2A 2VUHB 4L28A 3ZU3A 4HVCA 1C9EA 5TLSA 4NXNB 1RC0A 1K0FA 1A9XB 2DPHA 3WQQA 2CLOB 3OOYA 2HM7A 4MUKA 2IU6A 4URVR 2JBWA 4YPFA 1IIBA 4FMPA 4NS1A 5LYJF 2PDAA 1JYEA 1ZNWA 2HCRA 3KR1A 3QHQA 4Q6WA 1Z0AA 4R3NA 3VPXA 1AZWA 1G8JA 2CKMA 2O2HA 4HDQB 2Q1YA 3WYNA 5GTDA 4JGGA 1YS2X 2AG6A 2HAEA 2IA5A 3NONA 1XWWA 4LHVA 4P4LA 3T7EA 1L6IA 5EE1A 1JN0A 3PJRA 2E48A 4OBBA 4HB4A 4AZSA 1JQ3A 5T8KC 1L8XA 1NE7A 1GXSA 1R4NA 5JCOA 1YOBA 3DTTA 5CD1A 3S7ZA 2H4FA 4HAVA 4ZOLF 3DCIA 3IULA 4X20B 1QKJA 1KZ4A 4YRBA 4TYWA 1QRDA 4D9KA 4NJEB 1KJIA 4IDAA 4ZOLB 1UR5A 1XXLA 3FUVA 3OEYA 4EQ6A 2O3UA 3IV9A 4AJKA 1CWUA 1AA9A 4RVCA 2BUAA 6REQA 121PA 3JV7A 3ZXUB 2NQ8A 1DMSA 1F2VA 1YS4A 1ZDMA 1UQUA 2HWYA 1H2BA 1JBQA 1H9AA 5AR1A 2WWVD 3REFA 3CU5A 4UTRA 2A5YB 2AD1A 5CYPA 2WF9A 1Y4AE 5TT1A 3SHOA 4BNWA 4CFYA 1EBUA 2JIZD 1XZPA 2ETVA 4AC9A 1RWVA 2JJMA 3ICVA 4TV9A 2DERA 1H1DA 1HZZA 1VLLA 2J33A 1GG2A 3KPJA 4B17A 4QGBA 2VXYA 1K9MD 1DC8A 5KREA 3N0VA 4A36A 3VHXA 2P3MA 3EVAA 1FNDA 1V25A 4JR1A 1OB2A 1WMEA 1WDTA 1THTA 2P65A 3D6FA 5IDQA 5CW2A 2NTYC 3QITA 1LNQA 2JCVA 2AUNA 4KBYA 4RS3A 1FEZA 2R47A 4G0UA 3WV4A 3E5HA 1DAFA 1KNXA 2VC2B 3IPYA 4P3NA 1CIPA 1JJBA 2EEPA 3EVDA 3IX7A 4FS3A 3A14A 1A2BA 5FP0A 3O03A 3U5TA 1HNZB 3PNMA 2MDTA 1LEHA 3T7TA 4HAYA 4KPFC 5DULA 4ZZ2A 1ORHA 1FYDA 3ICCA 3HBJA 3A2LA 1W49A 3GEIA 3HR7A 5IDYA 1M6NA 3IB3A 3KKMA 3SXUB 1DGQA 2FUNB 3K5IA 3CH6A 3U81A 2R8BA 2GGSA 2O2CA 1JDPA 2H1HA 5TRTA 1XYGA 2B1GA 1H3FA 3G9XA 3B53X 3WGGA 1B0UA 1H5QA 4RIIA 2V0CA 1AS0A 3I9FA 2DG2A 3SS7X 2CHUA 2KE5A 3NTXA 4U7WA 5LUBA 1WUKS 4D43A 1TO6A 1S2IA 2AZTA 1VPWA 4BO1A 2IELA 2VYQA 1CZNA 4TLMB 3QBTA 1OI3A 2P41A 3EDQA 4G5FA 4BUCA 2IYUA 3NFRA 1TZMA 1SZPA 3IDOA 1ZN2A 3V8MA 4GLOA 5DNUA 4G1CA 2B9EA 3GJXC 3HM2A 1ZSVA 5FWYB 2ZFUA 3HXPA 3IAXA 3M33A 4PQGA 3TRHA 3RYIB 2C94A 4D9IA 1T10A 2E5FA 1QP7A 1AKMA 1G42A 2DKFA 2V7BA 5EQJB 4ZVOA 5LDHA 3TNFA 4F9FA 1T9CA 2WUFA 1XTIA 5FWXA 2W2LA 4GOXA 3QPBA 4B4VA 1RQ7A 4FHFA 4IXNA 3ZS9A 3B48A 4IWXA 4LDJA 3I0NA 4R1UA 2C82A 3C7AA 5COAA 5BSTA 1P5RA 5FBQB 5JNSA 1N9GB 2QAJA 1YDFA 3ZK8A 4W5QA 1J2JA 3DJYA 3Q9LA 1JGTA 3BFKA 4LHXA 1AV7A 3AF4A 2O1SA 4MVCA 2C5SA 3ZZTA 4WZLA 5EXXA 4XPIA 3ENQA 1W59A 3FVWA 3KP1A 4E2YA 1VMIA 1VL1A 4EG0A 5KINB 2D1QA 2PKQP 2F3RA 5FUVA 421PA 1KI3A 5KYUB 2C5BA 4AP5A 2R00A 4DWWA 3ELYA 2OXCA 3WXMA 1BVRA 3LCUA 1DHTA 5JBQA 2YWGA 2ZJ1A 1KETA 3QE0A 1BSVA 2QTBA 2PX5A 3PQ4A 1T5TA 1KE2A 3CRQA 3JYOA 3ZXIA 2NU6A 4KXMA 1EFLA 4D96A 4KXUA 3CNOA 3EWIA 1WHSB 3QMPA 2C77A 3A4MA 5J4KA 2B36A 4AJLA 1RSZA 3NI2A 4C21A 1Y5MA 2FUG1 3A3BA 1I80A 4CCYA 3JRXA 1HFEL 4JZKA 1T4CB 2GNOA 4ARAA 1MKYA 1SUEA 1VJ0A 2JVJA 4FOTA 4PXAA 4BRZA 2O5CA 1JG6A 3CCLB 3SZGA 1UADA 3TKYA 2BR3A 1QYVA 1DOZA 1G5RA 3GZNB 2FSUA 2RH9B 1ZM4A 2V74B 2E4AA 4MW4A 4N8DA 1ZBDA 5DI3A 5G4KA 5GJVC 5CDHA 3AP2A 5LR6A 3Q8LA 3AEYA 3BICA 1E3TA 3TLZA 4JUAA 1RYHA 2Z43A 4QXMA 4V2IA 4BLPA 2WU1A 4HHEA 3NHRA 4MWEA 4YMIA 4N3NA 3X2FA 4ROSA 3BG5A 2ZUBA 1I13A 4ZQGA 4IDEA 3W8FA 1JEYB 1R6BX 3I9V6 4W5HA 4RV9A 4LGMA 2NZWA 3LC2O 2J9YB 3E2IA 3UFBA 3DFMA 4BLWA 3H5AA 3U9LA 4ZKDA 4LKRA 2ZB4A 1NYTA 7ADHA 2RHLA 1R1DA 4GH5A 1Z6TA 5A2GA 4EA6A 4YA6A 2QF7A 4KSBA 4L95C 4PO8A 1YGPA 3IHTA 5I8PA 4L8YA 5ENZA 1ICIA 1K6IA 1UMBA 1RHKA 1YKGA 1S8FA 2TECE 1TVCA 2BHNA 1YR9A 5JJCA 2V7EA 2DH6A 2NYAA 3DZHA 4PGMA 4PVDA 3MRTA 4XB1A 5D8DA 2VQEB 2G1PA 3U3DA 4GC5A 2HU5A 4GF5A 1EGQA 1ITZA 1E79A 1M2OB 2C3UA 3D7NA 3TCNA 1DHRA 3KJFA 3TBFA 3O47A 1XELA 4BLSA 2RAPA 2O19A 1EVKA 2PAAA 2RHBA 2PSJA 3UXEA 4DM7A 2NZVG 2ZT8A 4POOA 1B8UA 4DAEA 5L40A 1RHRA 3L4BA 3LPCA 4N12A 2NT3A 2NV0A 3CX8A 3KXPA 5J43A 1D03A 4F4UA 4PC3A 1UMDB 3D6UA 4FP9A 1G3RA 1P39A 4RIHA 5ESDA 3SNHA 3RLIA 3RDPA 1CR6A 1PT5A 1XQ9A 3N0RA 2ST1A 1AGYA 4UPDA 3FWZA 1LV8A 1PLJA 2ID7A 1EPUA 3ANSA 4PCAA 1AY0A 2PD3A 2IYOA 2FY8A 2EAUA 4P38A 4Q9IA 1QR6A 3A36A 1DQPA 3LL7A 4KNWA 3PWZA 4O63O 1PR2A 3I2HA 1DMRA 3TZQA 4IH9A 5MF6A 1T43A 1M33A 2OB1A 1XV5A 4HEQA 1QOPB 2JD1A 4L8LA 4BWYA 1B16A 2QY6A 1UL1X 1GZ7A 3K2QA 3DB2A 1L1QA 1LU9A 1G21B 3I1JA 3FXAA 3R6DA 4BQRA 1U8EA 1XFDA 2Z30A 4YAGA 4R2IA 5B2FA 1IL0A 1P4JA 5CVEA 4KO2S 4OU4A 3QVGB 1I2MA 2PH5A 4Z9XA 2DHRA 4F3RA 1S3GA 1WEHA 2OMKA 2HPZA 2R6ZA 2VHJA 4KKXB 4BN0A 4JUBA 3ZIAD 2I2AA 5B37A 3GH3A 3CCMB 5KEIA 3O8CA 4M38A 2D2FA 13PKA 4XIFA 5F4MA 2O2DA 3A9VA 3FBGA 3OTGA 1R64A 2JW5A 2JEOA 3Q7SA 2C1EA 2ZS8A 4QUJA 4QVJA 1T5BA 1UZLA 1U0GA 2C7RA 4UVEA 4PSVA 1ORRA 4GLJA 4NU8X 4MINA 2HCJB 4RORA 2ZU6A 1JQJC 4TKUA 3U7QA 3JR7A 3EIEA 3H2YA 2XUZA 1FP7A 4LRXA 5TQ2A 3C4VA 2H7YA 4TYNA 2QIPA 4GQAA 1GVHA 2XDYA 2AK3A 3J7TA 2DULA 2N42A 1M2WA 2AWOA 3GJ7A 4KWEA 5KJEA 1YB2A 1L3IA 5GM1A 1TDJA 2INGX 4DTIA 2CHEA 2X8BA 1ZAYA 2B8NA 1C3XA 2XADA 4HAZA 3CNNA 3IQXA 2PSEA 2JFWA 4PAWA 3CUUA 1EFRA 3D2LA 4FGWA 2AVDA 3UMJA 3IERA 4O3FA 4CG0A 2EJWA 3IQDB 5DCUA 1ONSA 2PBFA 5K3BA 2J0UA 3F6PA 3ZK9A 3FFAA 2PZMA 4E70A 2I2DA 2R4UA 4XLLA 2HUNA 3SZUA 2PL5A 2IYNA 4GBJA 1XPUA 3IA7A 1KU0A 1PTJC 3FVQA 5KI6A 1CZHA 2Z04A 5FTJA 3WBBA 2Q4OA 2KLHA 4YP7A 3E7XA 4JVNA 3BIJA 2REXB 2QLNA 4H1VA 3L8ZA 4PYOA 1F2DA 1E9FA 4R40A 1EX1A 5FOVA 4F4HA 1B6TA 3M5DA 3TSZA 5A88A 3U3ZA 1N6KA 1SC6A 2P2SA 3NTOA 4H35A 1RAHA 2HIGA 1YQUA 2Z2ZA 5FBRB 2QS9A 4KO8A 2IYLD 5DBHX 5GZ3A 2D6FA 3E15A 3AP3A 5C34B 4FYIA 4AY4A 1D4OA 4BQQA 4G3XA 3OZFA 2IHZA 1B1CA 4PPQA 4JLKA 3S40A 1V9CA 1D9ZA 5E8RA 2JFGA 5CFRA 2ZSUA 4LBYA 5ENDA 2F55A 4N9QA 1MEEA 2PFGA 3DW3X 4YS6A 1H4SA 3NEYA 2AD5A 5GV8A 4IIDA 2VTVA 4G1VA 3HB5X 3VDRA 2DTDA 1JIKA 2RSLA 1HE8B 3WKBA 3ZNPA 4JT9A 4TROA 1KNQA 1XZHA 2X0NA 3B8EA 1EVQA 2REBA 1FQJA 1V47A 3MT8A 1EQUA 3T9CA 3O4RA 5ALJA 4EAAA 3QYJA 5CB4B 2DHQA 4X7RA 3OP1A 4FS8A 1C3OB 1SZDA 2ZRDA 4HAWA 4IHJA 4PX2A 2OY0A 2IXBA 3OD1A 5K3OA 3HCRA 1CRZA 1O94A 1NBIA 3R6LA 1QKKA 2LDBA 3JQ7A 4ZQEA 2H57A 4WMLA