4M0LA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus complexed with gdp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
414
structure length
412
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 91
structure length 412
sequence length 414
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m0lA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m0lA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m0lA01
1I7PA 3DHWC 2FEOA 4C0SA 3K9NA 1NMZA 2HLDD 2WV9A 1NNEA 4NONA 2B5OA 2H8KA 1AQUA 721PA 2BCGY 1AN0A 3G4SB 5HZHA 2IW3A 5CJ2A 2XNCA 2VP9A 4YLGA 2IWRA 1II9A 4LBZA 1Z2CA 5CB6A 1XTKA 4YMUA 1NLFA 3CX7A 5HCIA 4JBWA 4LDJA 5FTNA 4LWZA 4D6PA 3OEEA 3UWOA 3O8DA 3K0EA 4ZKEA 3NVAA 1MR3F 1XD2B 2BBOA 2C5LA 2QA5A 3A1WA 3MWLA 3RRZA 3SS8A 4BFVA 4EDHA 4BLOA 1JPJA 2BMEA 3CM0A 3I5YA 1FNDA 1KC8D 1E98A 1YHNA 3FTQA 1QFZA 1Q21A 3TSOA 3FOZA 3B85A 1KNXA 1U0HC 3CCJB 5LB2A 4DIEA 2WJJA 1ZU4A 1IXZA 5GV7A 1EFRA 2BBWA 3MSXA 4QBGB 4YDSA 2GCOA 3CONA 3M4YA 2HCBA 4IOKA 2W6JA 3OZWA 2TMKA 1W0KA 3E1SA 5LB4A 3J81k 3QJYA 3CX8A 2VSFA 1W35A 1N6PA 1Z0KA 2BOVA 3K0FA 3CCQB 4KBFA 4PSKA 5FUWA 4PHTA 1RRFA 3I4LA 4NMMA 1MV5A 5FFMA 1Q22A 2VSOA 3ONWA 3CRZA 4LJ5A 121PA 3CZPA 2P67A 1JB9A 1Z6XA 2PEZA 4DT1B 1DADA 1KOFA 3CF6R 1G3RA 4U00A 2JLZA 5KDOA 3TGPA 4DB2A 4FCTA 1KO4A 4IOJA 2Q3MA 1GITA 2BJVA 3DOEA 2ZJAA 2F3TA 3RRYA 1QHHA 1S8FA 3VHXA 2VNJA 5CB8A 4YAOA 5EP1A 2AD5A 3LX8A 5TARA 1XD9A 1ODFA 1ZUNB 2EFGA 2C04A 1S9HA 2N46A 3QF4B 1YZUA 1IBRA 2WAYA 2EW1A 4LRWA 4Q9KA 1ZJ6A 3DVLA 4KCGA 4D0GA 4MH0R 3PQCA 4PXAA 4WXPA 2A5JA 1BOFA 3CF0A 1P5ZB 1OGJA 2FSGA 1CKEA 3EA0A 4HAYA 1VG0B 1ZD9A 5FR2A 3PITA 2QE7A 3IIKA 1Q86D 4D81A 1QX4A 5FPKA 4G5QA 2XB2A 4P3YA 1M7HA 2BMWA 1Q82D 4KFUA 4FK8A 3CBQA 4MGKR 3T15A 3T12A 5JWOA 2WKQA 4TTPA 2F1JA 3NWJA 4QC2A 4US0R 3IBYA 5J47A 5EXSA 2GJ9A 1G16A 3D6TB 2JLXA 1RPZA 3CH4B 4NYMR 1M90D 3ETLA 4DLRA 1R6BX 3AVQA 3SHFA 3ZBUA 3SFZA 4I1UA 4TMZA 2H18A 3IQXA 3GP8A 2REOA 3M0EA 2IHBA 4BFTA 5L8VA 1BO6A 1KKMA 1G8GA 5FUYA 3VR5A 4JT2A 4NCHA 1I2MA 4UXJA 4HB2A 2ZRCA 1XEFA 1FNNA 2FOLA 1BQEA 5C18A 4Q18A 1KTVA 1HQYE 4Q02A 3U3RA 1QG0A 5JEEA 2J3EA 1E2EA 4FN5A 4PO9A 5TV2A 2GXQA 3KXKA 1GFIA 3QEOA 4AYWA 4F4CA 1XXHB 4LBYA 2NO1A 2G3YA 3ZZUA 4BEBA 4Q9LA 3QI2A 3MCAA 2QMUA 3RNLA 3VFDA 3W5IA 1HT1E 5K8LA 4A4DA 4EH1A 5FOVA 1H42A 3V4RA 2QBYA 1YJ9B 3AGQA 1OFHA 4YC7A 2G83A 4OJKA 2BC9A 3VQTA 4EIWA 3O8BA 4P4SB 3THYB 4CGZA 4ESHA 3AGPA 3I32A 2WBLC 3GEHA 1WBBA 2P65A 1M1YE 2ZRNA 5LPNA 1BYIA 3IEVA 3GLIA 4GZMA 2F1HA 1OT3A 2EQBA 2GDJA 4QJ5A 4TLDA 1E2FA 3K9HA 2Q21A 4RKEA 1SXJC 5IT5A 1J90A 1SXJE 2ZANA 1XPOA 1M7GA 3FE2A 1XEWX 1KI7A 1HURA 2OE2A 2WJIA 5FBRB 3LO8A 2QGNA 5CK4A 2IS2A 4GOXA 4PZYA 3IHWA 1EG7A 4ZDJA 2QRNA 5TXGA 3I62A 2LWIA 2X19A 5AUPB 4DSTA 4KSCA 4RCYA 5P21A 3K0FB 1FP6A 4JT4A 4KLNA 2P2LA 2WWHA 1NLZA 2JLYA 5DLQC 3Q72A 3AVWA 4LYHA 4FXPA 4JLVA 4TTQA 3VNUA 4YMTA 2CCJA 2I1VB 3QKRA 3O8CA 4TYQA 1EX6A 4LGMA 4C2UA 3Q8XB 2EYUA 1PLKA 5C46F 3LLMA 3OW2B 3ZC3A 1WQ1R 1S96A 1A5TA 4E09A 4LJ8A 2WKRA 3W34A 3X1ZA 2CDNA 4IDOA 3IIJA 1H65A 4OHVA 1B2RA 2GVDC 4PC7A 3OIUA 5E95A 2A5GA 2EFHB 3U60B 1MH1A 3GD7A 4URWR 4N0DA 2Z5FA 2QAGA 1QHIA 1KI2A 3RSOA 2OK8A 2IYLD 2HYDA 3OFNA 1G6OA 2R65A 2OG2A 4AD8A 2ODWA 3KFVA 2FJUA 3ZQ6A 5KYKA 3WYFA 4ESVA 2PLFA 4JJZA 4FD2A 4LX0A 2CEAA 3VR3A 4BASA 3EASA 3GJ0A 2V6JA 2PL3A 3NBZC 2EWWA 2RMKA 3QG1A 1Q0UA 4BLTA 4HAWA 3K09C 4AIIA 3EPLA 4LV5B 4EJSB 3U4QB 1RKBA 5JS8A 3CWQA 3T1VA 4YMWA 3R20A 1P9NA 3W6NA 3NKVA 4EJSA 2O8DA 3MWKA 2O5VA 3TMKA 4TMWA 1U9IA 4TSFA 5DHFA 1O3YA 3K9LA 1KI8A 1LW7A 5EUMA 2VHQA 3ZQJA 4GFDA 4F92B 1S2MA 1WXQA 3RRMA 4C7OB 1G5PA 1Q7YD 1ZM7A 4KLZA 1SGWA 4AKHA 4F7DA 1OB2A 4HAZA 4BZXA 5J4HA 1W2BB 4US2R 3OZUA 5JBQA 4HEJA 5B57C 3W3AA 5JRZA 2RGBA 4LHVA 3U6KA 3MWYW 1NSTA 3QFTA 1M2OB 1UMKA 1TL7C 2CXXA 3E20A 4WA7A 2R2AA 3GLGE 3NC1C 4NBSA 2AFHE 1ZM2A 2P6UA 3K0CA 3PUWA 2NPIA 4LZZA 3GJXC 3DKVA 2MSDB 1OKKD 4DDWA 2O0HA 2IUSA 2WSSA 3UG6A 4WAUA 1AM4D 1TVCA 5JI2E 1A2BA 1R10A 3OJXA 1UBFA 3OESA 2XXAA 2ZAOA 4XD7A 2F1IA 2J0SA 1L4YA 4ASUA 4LJ6A 4PC2A 1JAIA 2B8WA 5IDVA 1T6NA 5JCZA 2QEQA 5H5JA 2J5XA 1Z0DA 4HE6A 2CL6X 3MJHA 3ND8A 5H68A 2W2VA 5CYPA 5HR5A 3U7FB 1Z5ZA 4KFSA 4BPRA 1Z22A 4A15A 1BIFA 5EE9A 4HATA 1AS3A 3SC3A 3QSYA 1P61B 3WP0A 4A2PA 3PEUA 3M1IA 4B2LA 3LLUA 4WOPA 5CJPA 4YONB 4A0GA 1XPUA 1KSHA 3CCLB 2BJWA 4M1MA 2XJ4A 1WB9A 4WZ6A 1R0WA 1GO2A 3S1AB 4B3DA 1IY0A 5SZKB 3CNNA 5E7JA 4URYR 4B6FA 3REGA 1XEXB 4L4UA 1LV7A 4ZI3A 1UKYA 1KJYA 2FWRA 4BQSA 4NCIA 2YWGA 5LD2B 1VQNB 1OIVA 4JLOA 1KZ7B 4RY2A 1G9XA 2OK7A 3ZBTA 1F2TA 2BM1A 2YNMA 4EQ6B 1DELA 1GL7A 4OQMA 2IF2A 2PBRA 1R5NA 2IYVA 2X1VA 1W49A 5KSZA 4LJ7A 1W0KD 5DSZA 2J45A 1QDEA 4DLZA 2QEXB 2WSSD 1MRSA 4EQ6A 1NBME 1G6HA 5EMNA 1OH6A 1NIPA 3OHMA 1DO2A 2ZJBA 3FHOA 1W7AA 1CXZA 2RGGA 1N3BA 2WOOA 4M9SA 3W9YA 1VHTA 4RKFA 1NVVQ 2BN4A 5JRJA 1W36B 1ZNXA 2VYFA 4ASUD 1EFUA 2B6HA 2ZJ5A 5DE3A 2NO9A 3KJIA 1T4GA 2O52A 3TE6A 1SVKA 1UDWA 1CJVC 4QXAA 1U0LA 2A3RA 2QUZA 1JA0A 1S1MA 4LPSA 1W5SA 4XVQA 2WWYA 4HSEA 3HU1A 5AUQA 1E2HA 1BX1A 2PMDA 3G6EB 3VX3A 2QBYB 1W47A 3GPLA 4WVFA 4QFMA 3IPXA 2IXEA 1BMFA 2NG1A 3W5JA 5JSZA 1J70A 1R5OA 3QE2A 2BEKA 4JLBA 4A9AA 1N0VC 4QGGA 1HQCA 1QHNA 3A37A 4DT1A 5JLJA 1PV4A 3CRMA 5KPJA 1GJRA 2REBA 3I3SR 5KNCA 2VEDA 4Q01A 3FB4A 4NH0A 2QRZA 1VCNA 2GETA 2IT1A 2RHDA 3CC4B 4M8NE 1JQJC 4V0LA 4HUTA 1U99A 1U8AA 2CE2X 3THWA 1KO1A 2PMKA 2QM8A 3DL0A 4PAMA 3U3OA 3I73A 1XD8A 3C5CA 3CRRA 1V43A 4L8GA 4Q66C 2FFAA 3N2IA 4B3XA 5KDLA 1X86B 1XXHA 2ZVPX 1F6BA 2DBYA 1FNMA 1TMKA 3HU3A 4YQFA 4CF7A 1CU1A 1AMOA 2VZLA 1UBCA 3KZ1E 1OV4A 4LV6A 4RD0A 5EE1A 2ERXA 1MOZA 3B5JA 1FP7A 1NF3A 5AJWA 2IWHA 5JECA 2Z83A 2CBZA 3FGNA 4XTCS 3TSWA 421PA 3K70D 1FTNA 2DB3A 3BC1A 2NPFA 3UPUA 4DCTA 2O8BB 3LY5A 3QXCA 2MSEB 3I5XA 1S0UA 1Z47A 2DEUA 4Q4AA 5DN6A 3UATA 1ZD1A 4TMXA 3RRNA 5FL7D 3X1YA 3R9WA 4F91B 4LBWA 4JLPA 3TVTA 5L3VA 2ORVA 3BH0A 3X1WA 4MRVA 3O8RA 2O8FB 2GXSA 4GMDA 2CHQA 2IL1A 3LNCA 4I1VA 4R2HA 2DFTA 5A5GA 3FFAA 4A0RA 2ZSBA 4NCNA 3IEUA 3I8XA 4JZKA 4PQYA 2EIXA 1E6CA 4N0EA 4MA4A 1J7KA 3OIYA 3WMFA 1E2LA 3EWAA 4HZUA 3KUDA 3T5GA 1ZM4A 2XTMA 2W00A 5JZVA 3I56B 5FPYA 4DCVA 2D06A 3GFTA 4CEIA 3W8NA 5L3QA 4P4TA 1CR1A 2W58A 3B78A 3VNVA 2XZPA 1HT2E 3U44B 1DAFA 4RD4A 3CR7A 1KYIA 2FGKA 1ZUHA 2JEOA 2YC2C 4R7ZA 3D8BA 4CDGA 1GOTA 3R7WB 1YRAA 5EXTA 3GLFE 1OHHD 4QGAA 1E1QD 3NC0C 2GAOA 1H85A 3VU9A 2WM9B 3NBYC 1DDIA 2BBSA 3P4XA 3E1YE 5KPDA 3TAHA 5FH9A 1YKSA 3NBXX 4LHWA 4Q48A 1GNRA 2XGJA 2ODBA 2YHSA 3AP2A 4P31A 1CR0A 4TWZA 1T0HB 2ZRPA 5IK2D 4EPXA 1G18A 2BDTA 3LO5A 1X1RA 3PUXA 5G53C 3BOSA 3TAUA 1OE0A 3GLGB 3M6AA 4UXIA 5FOWA 1YI2B 3CPHA 5FUVA 4BFWA 2R8RA 3BORA 2F1RA 5G3YA 1OHHA 2GEVA 1ZNYA 4E03A 1SM4A 3V76A 4PSVA 1EESA 1C4OA 4NYIR 1KI3A 1Z29A 3A1UA 2VO1A 2ZI5A 5GADl 3B1ZA 4M53A 4GMXA 3UANA 1LFDB 3EW9A 2ZI4A 2FSHA 1H8HD 4Y9RA 1M74A 1QGZA 3LWNA 1MT0A 4I1SA 1XTSA 2IYWA 2YZ2A 3QXXA 1SXJD 3LRPA 4JLNA 1GIAA 2Q9AA 3QUSA 2NTYC 3UXMA 4TT3D 1FUKA 1I4DD 3RVBA 2DCUA 4A0HA 4B75A 4IEEA 3THYA 3WNDA 2L0XA 2WPDD 4M0LA 2ZYWX 3A1TA 3EZ9A 1G8PA 1AA9A 5B2ZA 3VKHA 4IDHA 3ZYCA 2QTLA 3RDPA 4B76A 2OBLA 2UVQA 2ZI7A 1T3SA 5DN6D 1KK0A 3BH7A 3RS4A 1XP8A 4JLDA 4FWIB 4Q1CA 3AVXA 3FMFA 4XJXA 4OQLA 3QPUA 1TUEA 3EZ7A 4KHZA 1DAHA 4GBMA 5KO2A 4CT5A 2YINC 3G5UA 1L7VC 2ZREA 3JZMA 4UQOA 3KQHA 3A6PC 1ZW6A 2IYQA 4BFYA 1T3HA 1J2JA 3EAQA 4MKIA 1OGIA 1KZGB 3GFPA 4PZZA 2FMXA 1S72B 3KKOA 4N3GA 2W6IA 1NI3A 3BB3A 3SJBA 5FL3A 4HUQB 2H7VA 1E79A 5FOTA 1XMSA 3UMSA 4DWJA 2GA8A 3HPQA 4HAVA 4IOLA 4URVR 3B82A 2H1LA 2PEYA 1H8EA 5GV8A 3EG5A 2EFEB 3PR1A 4B2IA 2NMVA 1D6JA 2OFOA 3ZVRA 2X2EA 5UKDA 1VCIA 2ZQ5A 3NH6A 4KFTA 5KSPA 2DPXA 2WPDA 4JLAA 2OEPA 4P4UA 4AI6A 3KKNA 3LQQA 4V02A 2WWWA 1E2DA 4II7A 1FNBA 3DZDA 1JQLB 1GP2A 3BIFA 3EZFA 4M1TA 2VP4A 2HLDA 1MO4A 3D31A 3DPUA 2AD1A 3NEYA 3NG1A 4G5GA 3W2HA 2VYQA 1NJGA 1GWNA 1VMAA 1UM8A 2W0SA 3KUCA 2BHRA 3QKSB 5K8TA 4TZ0A 3L82B 1QVRA 2WJYA 221PA 4Q7MB 4CEJB 3BFXA 1E0JA 1QHHB 2JLUA 4GNKA 1E2MA 3ADDA 1MKYA 5BW8A 5EZ5A 1JJVA 2JLRA 4ILEA 3D3QA 1GTVA 1D8TA 3H0KA 1LNZA 1P72A 2R6DA 4HYYA 1TF7A 2AR7A 4PX9A 4RFVA 3KTAA 3QFSA 3RABA 1KI6A 1W2GA 1KK1A 1HUQA 3EC1A 4MYCA 1R5BA 4M1YA 2ZRJA 1A7JA 3W2IA 2B8TA 4RVCA 2AXPA 3ADBA 2DYKA 4IOMA 3LAWA 5DYIA 1U90A 4C4PA 1PJRA 4Q7JB 3RLFA 1CBUA 1JEDA 5E7IA 1CULC 1N6OA 5JWRA 4LHZA 3PV0A 5IK2A 4H1VA 5GJWC 1W46A 1AKEA 4A82A 4OK6A 4HLUA 3ES9A 2K5UA 2Y8EA 1TX4B 4E07A 2OFXA 3QXHA 4URZR 4X8OA 2BWJA 4F7WA 2R6FA 1A82A 1EP3B 1GUAA 4B43A 2CE7A 2CLCX 2OAQ1 4DEXA 4G5SA 4PANA 2OHFA 1P62B 2RGNC 1VQ5B 1U9IC 3DEFA 3PG5A 4C0LA 1R8SA 2C78A 1NY6A 4KYUA 3V9PA 1YR9A 2G9NA 4DC9A 2AL7A 5EJEA 5FOUA 2QA4B 2YWFA 3AVVA 3CRQA 3L2OB 4FMDF 2REXB 1G7SA 2OO7A 1ZIPA 3IPYA 2FG5A 1LS1A 2XTNA 4K46A 2BV3A 1XJ0A 4GOKA 3CB4A 1M6NA 1SKYE 1T5IA 4GRAA 1GAJA 1CTQA 2VHUA 1QGYA 2GHIA 4AC9A 4JIMA 2GESA 4M1WA 3AP1A 2J0UA 1TPZA 4MRPA 3KKQA 2O8EA 1U0JA 5AR1A 3ZH9B 1WA5A 3KJHA 1DAMA 4PO8A 1JR3A 4HZUB 3RWOA 2MMGA 3HU2A 3T34A 1EX7A 2G77B 2Q9CA 4WIAA 4Z8YA 3PFIA 4IDPA 3VR1A 3FJOA 2OV2A 1G7CA 1FFHA 3QBVA 4OI2A 4OI0A 1W34A 2OLJA 1WE2A 2EU8A 5J4YA 1L4UA 5EUQB 1TLLA 2GEUA 2CNWA 4B35A 4RD3A 1II8B 1KGDA 4EPTA 5AJVB 3QBTA 3LDAA 2FX3A 4V0NA 5G3ZA 1VQ4B 2YV5A 2PJRA 1W1WA 3KQKA 3B1VA 1A1VA 2UKDA 1G64A 2ZRGA 4RZXA 2Q6TA 4BLRA 4E22A 1KMQA 4B3CA 1PLJA 3P32A 3MUFA 1SXJB 4X8LA 4HB4A 4C0BA 1E3MA 4DCNA 4QM6A 1E2QA 2QM7A 1E64A 3U61B 1KO7A 4DCSA 1XX6A 2RGCA 1CEEA 4YAUA 3C15C 3N5CA 3ZZTA 3K09A 4PSAA 4LPKA 3KKPA 2J7KA 1KSJA 3CR8A 4NTZA 5CLLA 4PGOA 3W5VA 4C0HA 5THXA 3T06B 3WMGA 3AF3A 1G19A 1NN0A 5FUXA 1Q20A 1K5GA 4C3ZA 3QOFA 2JIZA 3L8ZA 1E9BA 1QF9A 4HLDA 1HE1C 1Q1QA 1QZXA 4BFXA 4UKDA 5J40A 3GLFA 4HE5A 1GRNA 3LBIA 2QENA 4C9BA 1GM5A 4MRSA 4HLQB 1Z08A 4OI1A 4ACBA 1ZYUA 2IYTA 3AF4A 3JVUA 5AJZA 4A1FA 3PJRA 4ABYA 2VRWA 3KL4A 3Q85A 4Q1BA 3U3JA 4KITB 2HMAA 2A5YB 4HLUC 3TUJC 1I4LD 3RC3A 2JLQA 1X8LA 1Z0JA 4LYFA 1KMHB 3CPEA 2KI5A 3VO2A 2HF8A 2MMCA 1D2MA 2F55A 5GJBA 3LBNA 1S4QA 2O8EB 5FBWB 1WBDA 1FUUA 1LTQA 2GNOA 4UJ3A 4A92A 4MDFA 3K0CC 4PC3A 4QKQA 3QIAA 4PAQA 3K9GA 2AWNA 4D26A 4HAUA 3KJEA 1NJFA 1QG4A 1U98A 5BWMA 3CD6B 4DVGA 4DHEA 1TF5A 4GP7A 1NN3A 4CVNA 1ZIOA 2QTHA 3F3YA 4OI4A 4XTRA 4LJAA 5G40A 3RAPR 2VPPA 1E9AA 1EFCA 2JJ1A 4ZDIA 4IEIA 3A8TA 4M9ZA 1N6NA 4ACAA 2JCSA 2ANCA 1NBMD 2ZJYA 3SBDA 1CJTC 2QNRA 4G5OA 4QJ4A 5BN5A 1SZPA 2QMEA 2V54A 3FKSD 4H1UA 3LFUA 2ZUDA 4TMVA 3BFVA 4MGIR 1AIPA 2FH5B 4PPQA 3TH5A 1Z83A 2OBMA 4PHHA 1P9WA 3WHKA 4U9UA 2A9KA 1GKYA 3FKQA 2O8CB 1KDPA 3MD0A 1YIJB 3KDSE 3O47A 5KU1A 5JEDA 5L3SB 3RC8A 2FSIA 3X1DA 1AGRA 3FWYA 1RFLA 1DAKA 3SU8A 2BMJA 3JQPA 4N1AA 2FA9A 4QJ3A 3PEYA 4L5BA 3RS5A 3WRYC 2ZAMA 1MRNA 8OHMA 5TY0A 2ZUBA 2G88A 4LYJA 4O2LA 2VBCA 3D7MA 3NHAA 1ELOA 4IXMA 2VSXA 2VP5A 4OKSA 2Z43A 3EIEA 3ND9A 2ZS8A 3S1AA 1LF5A 4XWAA 2RGAA 2QTVB 3K0AB 4WZAE 2ZPTX 1CR4A 1GL6A 1ZD8A 1QFJA 2WKPA 1XMJA 4AKIA 3HYTA 2QG6A 1S9DA 3VKGA 3A4LA 3ZIAD 4TN1A 4FCVA 4BZQA 2GK7A 1T91A 2ZRKA 2HCJB 4V0ME 5E7MA 1GL9B 2CMKA 2XNDD 4CYMA 3H2YA 1DBSA 2ZRMA 3DKPA 1E94E 4MGZR 5SZIA 2QE7D 3OIWA 3WYGA 3OFND 3PUZA 4EPYA 5DH9A 5CDFE 1N6IA 2A5DA 4RCZA 2SHKA 5H70A 3RHFA 1VQ7B 1JA1A 1N5KA 4HLCA 2CLDX 4L9WA 2IUUA 5B58C 3LVQE 3THXA 2AK3A 2VP0A 1AJEA 2IYUA 3B7GA 1D9ZA 5DO9A 1NN1A 2WZQA 2W2TA 4FMBB 3K0SA 1EWQA 4PTLA 3E2IA 5SZHB 3CCSB 4JKIA 2OILA 3AUYA 3CCEB 1G8YA 3B9PA 3QPWA 4X8HA 3NH9A 1XTIA 3L43A 1XPRA 1G291 1FW6A 4NP6A 4DQKA 1AZSC 1NRJB 4B6EA 1E9RA 1BS1A 1TAGA 4B47A 1NY5A 1UKEA 2O0KA 4A36A 3FKSA 2V1XA 4DUGA 2GCPA 4W5HA 3CCMB 2QMOA 4O3MA 1UF9A 5AN9A 1JALA 2BM0A 3CCVB 2CHGA 2NOAA 1ZUIA 4XH9B 5HE8A 3PXGA 3TNFA 3AQ4A 1R2QA 5HZKA 5EXXA 2CRVA 4O25A 1E63A 1E2KA 1VTKA 5C4MA 1WMSA 1UPTA 2IBMA 2W0MA 3F8TA 1G7TA 4HUQA 1SHZA 4PPGA 5AUOB 5F3WB 4BEJA 3EA5A 1XB2A 2XX3A 4D4KA 3LD9A 1IN6A 5LD2C 3GMTA 4OQFA 4PHGA 1KSGA 4ZI2A 1JNYA 2ZJOA 4B32A 621PA 2ZETA 2ZYUX 4M1KA 4PC1A 3T1TA 1IY2A 5CM8B 1TEVA 1SVSA 3FFBA 2AN9A 2FZLA 4IDNA 4V03A 2ZE7A 3IQWA 2UZIR 4AK9A 4IDQA 1FPMA 2VIIA 4QBIA 3DZ8A 3DMNA 1GSIA 2QAGC 1GAWA 5CLQA 4Q21A 2ZRHA 1G5TA 5JWHA 5DI3B 2J0UB 4OHZA 2V6IA 4B3GA 1EFTA 1OYYA 1XDBA 2QORA 1YZNA 3AKCA 4FCWA 3HJNA 4BECA 4M2LA 5IF9A 5IHPA 1W0JA 1OXUA 1II8A 3OF5A 5DNYB 1XXHE 2AFIE 2WIBA 4M9QA 4C0JA 4DZZA 3ZS9A 1XZPA 4N3NA 1TTTA 2H5EA 1W36C 1FDRA 2BBTA 3R9XA 2R9VA 3ZDQA 4XOIA 1QFYA 1ZCAA 4P33A 4FW9A 2H16A 5FTMA 1UKVY 4PAOA 4RD6A 4CEHA 3TQCA 4EUNA 1FMJA 5JCPA 5K8UA 1G8FA 2FPLA 3REFA 3ASYA 3UMRA 3QVUA 3GCGA 4TYPA 4BUJA 2QN6A 4M4SA 1W4CA 4MGYR 1E96A 2ZS7A 2FV8A 1M34E 2F9LA 4FMCF 1ZC4A 1SVMA 4O0MA 4DSUA 4Y9UA 3AEZA 1Z6AA 2ODEA 5CYOA 1XWIA 3RS0A 1E0SA 1NVUQ 2GAAA 2VP6A 4P0TA 2RHMA 3GJ5A 2GWHA 4MQBA 2BCJQ 2G1JA 4Q9HA 4JKYA 3KB2A 4B73A 2NZ8A 2OCPA 1UBEA 5J4LA 3R8CA 4G0NA 1CJMA 2C2HA 4B44A 4YMSA 2VL7A 1K8AD 1FMLA 2DERA 4FMDB 3TVDA 1P6XA 3BH6A 1NMYA 4OK5A 4MYHA 4R2IA 2ZRDA 1QRAA 2WWXA 1D1NA 3B1YA 2RH5A 4V0KA 4AYTA 1KHTA 3LH5A 5L3QB 1NG1A 4LJYA 3EWSA 3SYKA 4P6VF 3W8RA 3CRVA 2C9OA 2D4HA 4P4SA 3K70B 1Q1ZA 4ZCIA 1GZSA 1ZBDA 4ZDWA 2WHXA 4ZDKA 2C98A 1CRPA 4G01B 4QHYA 1QVAA 1Z8FA 2CCKA 2ZYTX 3AVOA 2WAXA 5FA6A 1K8RA 3SJCA 3GLIE 2C8VA 4Q1AA 4XVRA 4PR0A 1UADA 3VTKA 2DHRA 1A8PA 2W6ID 3CCUB 1HEIA 2E9SA 2KSQA 3MWJA 1EK0A 1ZRHA 2YYZA 3EZ2A 3MRSA 3P20A 2FPKA 1QHGA 2ZRBA 2J7PA 1PVOA 3BK7A 5EQTA 3I1FA 1N6RA 1XTRA 4EPWA 2HV8A 2JDIA 1Q57A 4MRRA 4Q4LA 5H59A 1G41A 2A78A 2FGJA 3K0AA 2CLSA 2OT3B 2FEMA 2BGJA 1KI1A 4JJKA 4C30A 2IS6A 4Q7LA 1M8PA 1ZC3A 2IA5A 2NQ2C 2R44A 4PPNA 1PZNA 1GNPA 4QNRA 5CDFA 2P6NA 3IO5A 2PIAA 4NCKA 2QTFA 1EWRA 4IJMA 5JJLA 4ARZB 1Z3IX 1ZM9A 4JL5A 3GEIA 1E1RA 4US1R 3CC2B 3ZIAA 5JFGA 1AKYA 1VKJA 1EXMA 3G82C 2C9YA 4G1VA 1X8JA 2ZRAA 2W6JD 4HDCA 1ESMA 3MFYA 1W4RA 4NL4H 4YAFA 4A0FA 3C16C 2BSAA 1IHUA 3QVVA 2JGNA 1MO3A 4MKFA 4Y0VA 4RSGA 2AHOA 1E2IA 3W2GA 1YZLA 4Q03A 4POAA 5E3HA 1Y3AA 2VNIA 1P3JA 4DLUA 4LC0A 3T61A 1Z0AA 5A0FA 3AVPA 3GLHB 2JATA 2ZR9A 1GAQA 1AS2A 5FPTA 1N6KA 2PT7A 5FBLB 3K53A 4BRUA 1YRBA 1G8HA 3WY9A 3B60A 1P60A 1P4SA 2WSMA 3LVRE 3MLEA 4WW0A 3EARA 1OH7A 3GEEA 4UNPA 4MYTA 3L0PA 3AVUA 2YOGA 2JASA 4IVRA 2J41A 4QBFA 1OXVA 2JA1A 2XB4A 3FPKA 4PFSA 3B6EA 3HDTA 4B3FX 2E1RA 1KJZA 2QAGB 5AJXA 4C0AC 3F0TA 5EXPA 5C2JB 3OZVA 5D3MB 3BB1A 3H1TA 1NN5A 2W2XA 4TL8A 2WOJA 1E1RD 1KKLA 2XAUA 4Q47A 4DBLC 2R6CA 1GILA 4D4JA 821PA 3UK6A 4CIDA 4AF6A 1T0JB 1XEWY 2ZRFA 4QL3A 2CK3D 1JBKA 1MO5A 4LK2A 1IN5A 1FL9A 1HH4A 3Q5EA 1RZ3A 4OYHA 2FFBA 2ZIAA 4GI7A 1H8ED 2GK6A 4HI0E 1R0YA 4QHSA 2A7QA 1IN8A 2ONJA 1KD1D 2C95A 1VIAA 2WVJA 4Q19A 2WWFA 4KXFB 4CT4B 2ANBA 4HDOB 2HT6A 4CEHB 1WRBA 2DETA 2DWOA 4YAWA 4XSGA 3TRFA 1I2DA 4S35A 4QG7A 4Y0AA 1EP1B 1RRGA 3R8FA 5FTKA 5H8WA 1RRPA 2RGNA 3A4MA 2PZGA 3AKYA 4C0QC 1YJWB 1G21E 3IUYA 4Z1MD 2GJSA 2IYRA 1F2UB 5K8IA 1K6MA 2LCFA 4F4JA 1QGAA 1M1KD 2R62A 5DI9A 3QKTA 2NGRA 3CMAB 1KDOA 2P5TB 2ZJZA 4AY2A 1JAHA 2C96A 3SR0A 2OZEA 3GFOA 1P9RA 2CL7X 1S3SA 3U3KA 2HF9A 1P7CA 2XTZA 2ORIA 1U94A 1UBGA 3SZRA 2BGIA 1IN7A 4BLQA 1F60A 2A30A 2RGEA 3CMEB 4A8JA 4WZBE 4D0LB 5J4VA 4DQLA 3HR8A 1SXJA 4B74A 3EPJA 4ZV4A 2O8FA 1G3UA 1N8RD 1JR6A 5EE5B 3SNHA 1CJUC 2F9MA 3W6OA 2RGDA 3K8YA 2LKDA 2D7CA 4JVLA 1TQ2A 1JXMA 2WWGA 5HKKD 1KY3A 1N5LA 4LC1A 2VNKA 1YZKA 3SI7A 1R0ZA 3BGWA 1OIXA 4B34A 4RFSB 4QGHA 1LF0A 1BKDR 1G4UR 4XD7D 2GCOB 3A58B 2OM2A 1JB1A 3IKJA 1UEIA 3RYTC 1O87A 1QG2A 2O8CA 4F4IA 4QM7A 3U44A 1KY2A 1PLLA 1QUEA 1C1YA 4JVMA 2JIZD 2BF4A 4IVQA 3GLFB 2ZI6A 4KI0A 4OQNA 2GQFA 2X77A 3ICQB 3OAAA 1PUJA 3QXSA 5FBVB 5BN4A 1FNCA 3GJ4A 4MKHA 2QSYA 5FOSA 2BMDA 2BKUA 1JJ7A 2D3WA 3KXIA 3SE0A 4DKXA 5EP2A 4HDQB 4UAJA 1COWD 1DAGA 2IEZA 3LBHA 3ZD6A 3RSLA 1T9HA 3I61A 1VQ6B 3QY0A 3SQXA 1GVNB 1JR3E 1NL3A 1JR3D 1D2NA 3ADKA 2HT1A 1TQ4A 1VYTA 2V7QA 3EC2A 1DE0A 3OEHD 2PZFA 4EFNA 3LVBA 2RKOA 1UEJA 2VTKA 4TMKA 5F9FA 3L0OA 2Q9BA 2OAP1 1RIFA 1VPLA 4Z1MA 3DOFA 3MGCA 4TQAA 1VYVA 4Z51A 1Z06A 3OE7D 4G5RA 1XMIA 1D2EA 5AUNB 1VG8A 1Q3TA 4RJLA 3RS2A 1GG2A 1Z2AA 4OHWA 3OE7A 1IOZA 1MABA 1YVDA 4UNNA 2PJZA 3B9QA 1WCV1 3CPJB 3ICEA 1AS0A 2J59A 3TK1A 4OBEA 1JPNA 3C8UA 4YALA 5EP4A 4YHBA 3W2EA 3QPVA 3FPAA 3I55B 4ZIRA 4GP6A 2ERYA 1CQXA 4DLYA 5B30A 3L0IB 2V7QD 4EPVA 2I4IA 1E9FA 1BJKA 4PC6A 4OHXA 1DDGA 3SHWA 1YR8A 4WXRA 2QT1A 1E9DA 4UJ5A 4RZ2A 2GF9A 4C2TA 2VHTA 5KDDA 3H4MA 5CK5A 2XNJA 3FMPB 3P4YA 2FF7A 1JI0A 1YHQB 2FU5C 3FMOB 4BFZA 1AZTA 2OUKA 3HR7A 1LB1B 3NHBA 3CRW1 2QL6A 5JJKA 4FINA 1HA3A 3AV0B 4B33A 2I3BA 2LKCA 2ZJ8A 3KX2A 3MJRA 1IJEA 4J0QA 2BMFA 4ZIRB 2A5FA 1Z6YA 3TKLA 2CHVA 5BQ5A 1P75A 4TMTA 3GJ7A 1TADA 3DMDA 3OZXA 5DYGA 2GPJA 1DO0A 3FVQA 2IHYA 3FDIA 1TU3A 3ZLJA 1IN4A 3PENA 1E0KA 1VQKB 2JJ2D 4A6PA 2DFNA 2PX0A 3UKDA 3CPWB 3BBPA 5ELXA 2J87A 1KQSB 4ARZA 1XU4A 1IJFA 3WBKA 1G20E 1VQMB 3N2EA 4M21A 2VF7A 1Y63A 1J99A 3HPRA 2QQ0A 2C77A 1ETUA 2ZVQX 3W5UA 2RC5A 1KK3A 4ERNA 5AK0A 2KBEA 3OAAD 4NKRA 1W36D 1FX0A 2B92A 4LHYA 1D9XA 4JLJA 2OTLB 3A1SA 4PPFA 5TB5A 4EPRA 1IM2A 1G17A 1FQKA 4HB3A 2BEJA 4EKDA 1E99A 2V3CC 2AWOA 3W90A 3P26A 2WJHA 4BPBA 1KI6B 1OW3B 4CW7A 3CIOA 2GTPA 4OQXA 4MDEA 3BXZA 3CCRB 2NO7A 1S1CA 4IKEA 4QHTA 1ZVQA 1NKSA 4CZ2A 1UJ2A 1VIYA 4MITA 1QHXA 3I8SA 4F93B 4NHOA 1T3LA 2IS4A 1FTSA 4JBXA 1ZNZA 1E2JA 1N5IA 3NBFA 3SEAA 4JL8A 4D82A 4KBGA 1FRNA 1F3OA 3ASZA 2ZR7A 2CL0X 2GCNA 2C03A 4OK3A 2R6AA 4FI3C 5TVKA 5KOYA 2IEYA 2F43B 1KDTA 1GR1A 2RB4A 4Q4HA 4H9GA 3PCRB 4JLKA 5FOXA 1N0WA 4JL6A 3ZZ0A 1VQPB 1NSFA 1QVGB 1CIPA 4MYUA 2QROA 4HZIA 4C0KA 1DG3A 1JEEA 1SVIA 1W5TA 2GRJA 4OHYA 1OJLA 5FPSA 1E9SA 1NKTA 2PCLA 5FTJA 2ODNA 1BYUA 1UAAA 1KAOA 3KJGA 4AG6A 5B64A 2FE4A 3HWSA 1G5RA 3E70C 2VH5R 2AK2A 4DLTA 1OH8A 5M04A 3ZGXA 1E62A 3NTUA 1WDTA 3QG5A 2W83A 1G1MA 5D3MA 4IHQA 5AWFC 1EWYA 1OSNA 2OESA 2YWHA 3W5HA 4IVPA 2JLWA 1GRQA 2VNHA 3THWB 1NIJA 3QNUA 5J5CA 4JVNA 5KTYA 1DEKA 5A4JA 4KO8A 1SKYB 2ZU6A 3WHLA 2J0VA 1DAEA 5FBQB 1XEXA 1NJID 3WMEA 1ZMXA 4ITRC 1IXSB 2FDCA 1XZQA 5JSZB 3JQRA 3OEED 3CZQA 4NYMQ 1K9MD 3PVSA 2C99A 4BFSA 2QAJA 2KJQA 3IDQA 1QVFB 3IILA 1S3GA 4TYWA 2G6BA 1QUFA 3LQRA 3QKRB 3SOPA 1YZQA 3VMFA 4GT1A 1GVHA 1VCMA 1W44A 5E4FA 2IX3A 1Q1EA 3TUIC 4DXAA 4DJTA 1VQ9B 3DO6A 4Q4AB 1RC8A 3AH8A 4JYBA 3PEVA 2OXRA 3B13B 3MHPA 3FHCB 1R0XA 2QTZA 2CVHA 1CP2A 4G1UC 1AK2A 2ZROA 1OKKA 1EFRD 1E4VA 4Q1DA 1RJ9A 2J0QA 4Q9JA 2EYQA 3R7WA 3TSZA 2PLRA 3NEJA 1OFTA 5CM9C 1E4YA 1RRCA 1YJ5A 4D0NA 2ZEJA 4D4MA 2QPTA 4LCBA 4R9UC 3E5HA 3LA6A 2YC4C 4KFRA 1W0JD 4JBYA 5FI0B 3CO5A 4KU4A 2VHCA 3BERA 4AG5A 4BE7B 4DSNA 1KAGA 3SBEA 3P27A 1KK2A 2IYSA 2F43A 1B23P 4KYIB 1HV8A 4B4DA 1RE0A 4Q4HB 4LOAA 3EX7C 1I4TD 3Q5DA 4LHXA 2NZJA 1FOEB 3WNCA 3I92A 2QP3A 1JECA 2Z4RA 3ZVNA 1E69A 1T8TA 3TR0A 2N1BA 1T5LA 3RWMB 1JXOA 1US8A 4KVAA 4PQRA 2DFLA 3QF7A 1SHKA 1JJ2B 3IIMA 3EIQA 3GLHE 1XMVA 1IONA 1Z6GA 2GXAA 4KJZA 2QZ4A 4XVUA 2GJ8A 3QFCA 1D5CA 4LUCA 4PZLA 1TU4A 4E5UA 3U3MA 4DCUA 3PUVA 1IB0A 1TEXA 4TTRA 521PA 4JVSB 4A8JC 4LSGA 5DIFA 1FZQA 1E1QA 2D2EA 5F2EA 2GXUA 2JJ1D 3VAAA 4CEIB 2GJAA 4XIGS 4LBVA 1XTJA 4IRUB 3WP1B 1W48A 2O0JA 2JDID 5DGXA 4D25A 1B0UA 4TL7A 3SYNA 4QGFA 5JI3E 1OFUX 3VHLB 1SQ5A 4XWKA 2J1LA 1VCOA 4ZGQB 2I1QA 4JMPA 4TLEA 4NPHA 2HXYA 3EXAA 1XCGB 2AXNA 2OXCA 1YZGA 4FIDA 2RGXA 3CWZA 2P5SA 4KVGA 4TLAA 1KNQA 2OCBA 1P2UA 4TYYA 4BFUA 2ZI9A 4L15A 1NP6A 3Q7QA 1TUIA 4PO1A 4RZUA 5L3RA 3TW4A 1FQJA 2ZE5A 4DLWA 3U7GA 2N42A 4UNSA 3OEHA 4BRWA 4I81A 4W9MC 2CJWA 1BH2A 4BWYA 3AKDA 5CIWA 2GBLC 2BPOA 1UFQA 3QENA 3U7EB 3ZVLA 3QQ5A 1KI4A 2CCGA 1G4AE 1DARA 4NCJA 3BS4A 3BJIC 1HTWA 1XRJA 1N2CE 1R8QA 2G0TA 3OIVA 4G1BA 3GJ3A 3KQUA 4LI0A 3AVTA 2ZSFA 2XNSA 1COWA 3PUYA 1N6LA 1XJCA 5G41A 1KO8A 4Q9IA 3UWKA 2ASEA 1F48A 1FRQA 2GZHA 5JMTA 2XNDA 3G0HA 1CF4A 1MABB 2GJKA 3G71B 2O8BA 2YOFA 5SZJA 4HB0A 4QNMA 4RZ3A 3UG7A 4BLSA 4JSTA 4BGDA 2OSBA 1E9EA 4Q1EA 1VHLA 1OB5A 1DTSA 1V5WA 2GVZC 2HXSA 1BX0A 2KE5A 4RD2A 2IYXA 4F38A 3SJZA 4GZLA 2DY1A 4TQ9A 1F2TB 3KTAB 3ECCA 4MUBA 5FTLA 1QHSA 4ON9A 5HPYB 2IYZA 2VP2A 1OLOA 1QBKC 3THXB 4PHFA 3VU9B 2JJ2A 4GL2A 1A4RA 5GVSA 3GLGA 4TZ6A 1NDHA 4ZPXA 2XJ9A 1XBTA 3HYRA 4M9XA 3X1XA 1XJQA 3GQBA 3P1JA 2WICA 4DDVA 3JQQA 5GJCA 4M22A 2PH1A 3A1VA 3C5HA 2O8DB 1U8YA 3KXLA 4U5XA 3KQNA 5F98A 2Z6VA 4TL6A 4D80A 1P2VA 5EP3A 5FPHA 2HYIC 4Z8XA 2ZSAA 3FHTA 2QDXA 4MKGA 3U5ZB 1Z28A 5DISB 2JLSA 3VR6A 2X3UA 4GOJA 2ZITA 3V4FA 4TYNA 2RCNA 1CJKC 1OYWA 1OXTA 4NYJQ 2ECKA 3WBJA 6Q21A 3JZAA 2EFDB 3W6PA 2WWIA 1A2KC 4DRZA 1XFAA 4TLCA 1OXSC 4W5WA 5EE0A 4DB4A 1US8B 3IHLA 1GKIA 1SULA 2XOKA 4UNQA 3AM1A 1E32A 1VYUA 2BVNA 1PUIA 1VDZA 3CX6A 3KKMA 4XWOA 3BWDD 2X2FA 2IC5A 2OLKA 1L2TA 3GJ6A 5JS7A 3WXMA 2IK8A 1VQOB 1ZINA 4A2QA 1L8QA 2WIAA 3QKUA 5KNDA 3FYHA 3H86A 4IFBA 3U4QA 3F5FA 4I1OA 1KSFX 3MAAC 4EAQA 5HXBA 2VQSA 1CLUA 1Q81D 4UNRA 4Z54A 3LXRA 1OXXK 3UMFA 3CNOA 1CNFA 1VG1A 1LS6A 1ZCBA 2IYYA 5FI1B 2V55B 4Q4JA 2IXGA 2ZS9A 3WNBA 2GZAA 3VKWA 2OCAA 4AF7A 4EFMA 1R7RA 2P6RA 5CITA 1RJ9B 1NVXQ 1KJWA 2ZE6A 1ZM3A 3GLIB 2ZJ2A 2CK3A 1P2SA 3EZ6A 4S2EA 3A4NA 1G3QA 2IS1A 1YITB 2HUPA 5BN3A 2QU8A 5GVRA 4C43A 1SKQA 2UZ3A 4MRNA 3BAFA 1X1SA 2WJVA 3VX4A 1RVDA 1LY1A 1M7BA 3HP1A 1F20A 3CUEF 4BLPA 1E9CA 1SVLA 2BKEA 2DWPA 3RS7A 4ZKDA 4TT3A 3TQFA 5KHOC 3U7HB 2Z4SA 1F5NA 2XSZD 4YMVA 4DIDA 4QOSA 5CIQA 3H84A 4GPTA 4UXHA 5KNBA 5KSOA 4I99A 4Q00A 3SDZA 2D7DA 2HEIA 3ADCA 1MO6A 1OF1A 3TW8B 3U2QA 1J8MF 4YXWD 4BZPA 2AX4A 1ZU5A 3LXXA 2P0EA 3N70A 4DDTA 4KAXA 5FR1A 5JHHB 1H8HA 3SFVA 2YJTD 4B71A 1DG1G 2WJGA 3OJWA 2OCYC 1ONBA 4DLXA 2ZXUA 1W87A 3TBKA 5EE3A 4B3BA 2JJ8A 1NG9A 1EGAA 1KI9A 1FX0B 5JJIA 1G3MA 3CW2A 2QT0A 4WBSA 5HKKA 3AUXA 1YQTA 3QXJA 4MUAA 4NE2A 4WQMA 3DM9B 2Z0MA 2X8AA 4G3XA 4LJ9A 5F9HA 1C9KA 1Q44A 2QQEA 3CKLA 4AKEA 5LDDC 2ZSEA 1E2GA 3T5DA 2ZI3A 1CNEA 1VECA 2ZUCA 1X3SA 3CF2A 1YU9A 4JYCA 4M1OA 4U02A 2DWQA 3SYLA 4RD1A 3SN6A 1Z0FA 2YWEA 1YR6A 4TQUS 4YDHB 3L0SA 5DHAA 5HCNA 2FZ4A 4LYAA 3QFRA 1X6VA 2NO0A 3C14C 1G3IA 1X8KA 1U8ZA 3K1JA 4TLBA 4Y7CA 1QHYA 2GZDA 2ZRLA 3Q7PA 3ZVMA 1XF9A 1TF2A 4OL0A 2ZR0A 2GKSA 3AF2A 4TSFD 2G0NA 2CNDA 1T8UA 4OJQA 2XZOA 1DOAA 1YE8A 3LW8A 1NMXA 1E79D 1IAQA 1N5JA 3WYAA 5KSWB 1KIMA 4QRHA 4LY6A 5GJVC 3THOA 4CEJA 3CNLA 4RFSA 1GKUB 2E87A 2J7PD 4NDZA 1IXRC 2CJWB 2GILA 2ZYVX 2JAQA 4YXWA 4R71A 2G1KA 1EP2B 4KV9A 3MG9A 1E2PA 3T1OA 4DSOA 2XEXA 4CRWB 4O2RA 4W7SA 2QY9A 4ZCMA 2BIFA 2RAPA 3W3ZB 4U7DA 2JLVA 3T35A 2Q3FA 2HDNB 1DPFA 4K8OA 4NYIQ 2QMHA 2WMOB 3ZD7A 4DEYA 4A8JB 2KBFA 1NBMA 2QPAA 4AYXA 4JSYA 3BB4A 4JS0A 2XOKD 1DAIA 3BFKA 2YVUA 1WF3A 3C4JA 3TLXA 4EJSC 3JVVA 3AVYA 3KFXA 3RS3A 5TMPA 1GNQA 4R98A 2ONKA 5L3SA 3B1XA 4A2WA 2GEDA 2FPMA 2Q0HA 2IXFA 1NLYA 3AP3A 2VF8A 1Z63A 4B2PA 1CRQA 3X2SA 2FSFA 2EFCB 4DLVA 1W2HA 5LBIA 4W5JA 5TDHA 2ATXA 2ATVA 3NDPA 3K70C 3QEJA 3QE0A 2ZSDA 1DVRA 2B21A 3EIHA 1K5DA 2P3SA 2F7SA 3UIEA 4ZCLA 4PQFA 3T1QA 3KB1A 4DDUA 4IXNA 1TQ6A 4V0MA 3B2EA 2DFKB 3W2FA 1OFIA 2MSCB 4K81B 4FWTA 1UKZA 3Q9LA 2GF0A 2KB0A 3EPKA 1YZTA 2FNAA 1VG9B 3TR5A 2H92A 3L8YA 1ZAKA 2C9CA 1Q3HA 2AKAB 2QI9C 3GJ8A 2OFWA 3ZS8A 2YOHA 1RYHA 3LX5A 5D3QA 4Q5IA 1HE8B 1VQ8B 4URUR 1BMFD 2HJGA 5AJYA 1ZP6A 3I72A 2CNWD 2YKGA 1P73A 1TQDA 2B7CA 1R4AA 2NIPA 1J8YF 2QP4A 2V8OA 2FFQA 5J4KA 1N6HA 2PT5A 4IFEA 4LV8B 4ZGNB 2KWIA 3VR2A 1YR7A 2CVFA 1AQYA 3CXCB 1K73D 4P32A 5C4GB 3ZJYA 1Z07A 1IY1A 3VO1A 1XTQA 4FMCB 5DI3A 3WRXC 1KDRA 2PX3A 2QPOA 1KO5A 3LW7A 4HAXA 4KODA 4NZYA 2PCJA 2RC6A 1YJNB 2ZE8A 1XCPA 1N0UA 3PIRA 3VR4A 5BXQC 1UDXA 2V9PA 4XSHA 3AF1A 1E0AA 4IW3B 3AF0A 1W4BA 3BRWD 4B48A 2D74A 3R9IA 1IQPA 1SVWA 1U81A 2GBLA 4L9SA 4Q4JB 4D4LA 1XCMA 4Q7KA 4LJ4A 4L16A 2WMNB 2XXAB 2DR3A 5BYJA 4M1SA 2F3RA 3AB3A 4I4LA 2B7BA 2ZRIA 1XNJA 3C7KA 4AWXA 1OH5A 2J9RA 3AKEA 4NYJR 3DM5A 4QBHA 4K1XA 1J9ZA 5C1BA 2V4ZA 4AKGA 1XD2A 3C41J 2R6GA 1II0A 3TIFA 3NIBA 5H1YA 3TUZC 1LVGA 2OBNA 2XSZA 4V0OA 2Q3HA 4EFLA 1Z0IA 5KUTA 2IUTA 5TR9A 1W4AA 2R6HA 3NDBB 3IGFA 3MMPA 2H57A 2VLIA 3BE4A 5BYKA 3IO3A 5KSYA 2V1UA 2EWVA 2QSZA 3U6BA 2D2FA 3QF4A 3PEWA 2FFHA 2XITA 1Q12A 2ZTSA 4DUGD 3B1WA 5FL7A 3Q3JB 2VA8A 4A6XA 2OTJB 1Z6TA 1G7RA 2A2ZA 2F6RA 4GSYA 4URXR 1RW4A 5JHGB 5HTKA 3KQLA 2H17A 1KRHA 3CLVA 2VHJA 5EZ6B 4D2IA 5ANRB 3RANA 1OPXA 5HE9A 2ZM5A 1XE1A 3B8HA 1P2TA 2QGZA 1Q1BA 2IF0A 2HJVA 4TL9A 1GDDA 1WP9A 1KMHA 3LV8A 3CH5A 3SQWA 1NVWQ 4Q1FA 2ORWA 3FMIA 2PZEA 2AKYA 3A36A 4ZO4A 4X8MA 3BD9A 3TJZA 2D62A 1U2RA 1EFHA 3NXSA 3GLHA 4C7OA 3DDCA 3EPHA 3CC7B 1NVVR 1TNDA 2J46A 2NO6A 5IRCD 2WTUA 2XZLA 4KSBA 1N25A 3V00A 4GDFA 1HY3A 1VQLB 1QH0A 1CS4C 1RYFA 1ZNWA 1OIWA 4NU0A 2QP9X 1ESNA 3QKSA 4JLMA 1CR2A 1GRRA 2ZU0C 3SJAA 2FN4A 4AURA 4DLSA 1SVOA 1F2UA 2EVWX 3IBGA 1HYQA 1DS6A 1ANKA 1AGPA 1E2NA
chains in the Genus database with same CATH superfamily
2NV0A 3MJDA 2FUG1 3H9QA 4OA5A 1P6QA 1U2PA 4C0SA 4ABTA 1ETHA 1OAOA 2P75A 2WV9A 1X0XA 4H1WA 1HQKA 4NONA 4N6NA 2B5OA 1V16A 1AQUA 2GOYA 2BCGY 1H0HA 1RWXA 1UJCA 1Z35A 3LUHA 2VP9A 3PX3A 4N49A 5ESDA 2IWRA 5A5VA 2Y0PA 1PW7A 4KKSA 6REQA 3TIIA 3AW8A 1N5RA 3KL9A 5HCIA 4NHEA 3GGSA 4JBWA 4LDJA 4LWZA 4D6PA 3OEEA 5A1TA 5BSUA 5IABA 3O8DA 1U7UA 2IVZA 3AI2A 3NVAA 1P7VA 2CXHA 3I0NA 4WE3A 2P6OA 1XD2B 1K8YB 2QA5A 2YY5A 4WNIA 3RRZA 3UV7A 5KWSA 4RFLA 4HQ0A 2BMEA 3PUIA 2G06A 1IIRA 1PGOA 3KKZA 3U17A 1UPUA 1KC8D 3M83A 2LXNA 1IHDA 1QFZA 2Z08A 3FTQA 2HWYA 3ZVKA 1O9BA 4FDTA 5K3EA 3B85A 4BO1A 1WUYA 5ILOA 5AHKA 2ZZMA 4R31A 1F5SA 2CZGA 4WCVA 1FXWA 1WTHD 4HDRA 3GRAA 3LHDA 4YDSA 3W4IA 3M4YA 1MPTA 1S2NA 1NASA 1X80A 1W0KA 4H7DA 2ACKA 4KE9A 4LRSB 2HB6A 2IPOA 4EGCB 2D59A 1W35A 3NDJA 3AHFA 5JMWA 3K0FA 4KBFA 5K05A 2EL7A 3W79A 3E5RA 2Y1FA 3CZ5A 4NMHA 2J33A 2Q3CA 4URHA 5TEVA 4YUXA 1MW9X 1C7QA 3GD5A 3GVXA 2DY0A 2G1UA 2OKGA 4M7OA 4BIIA 2X6XA 4JY7A 1KOLA 1O94C 1G3RA 1OVMA 2JLZA 3AM4A 1JILA 2AOWA 4H6XA 4IOJA 1GITA 4MW9A 4EW1A 3DOEA 2WTMA 2I7CA 1S8FA 4ND2A 3VHXA 3V1NA 3WLPA 4CKBA 5CXXA 4EY7A 1V2HE 4TUYA 3E8MA 4L4YA 1ZUNB 2ZZGA 2WHEA 3IQDB 3KOUA 3SR4A 2A9VA 4KGDA 2BGRA 3UCEA 4BZZA 1Q0TA 3EEYA 3DGEC 3WLEA 4C20A 1QU2A 3RWBA 4Q9KA 2DFVA 4IIJA 4KCGA 1JLSA 4HVLA 5MFPA 1NXQA 1QKJA 3RU3A 1ISIA 5HVNA 3GG2A 1YR2A 2IHVA 3PQCA 4S1TA 1BOFA 2ZUUA 3O82A 1P5ZB 3I37X 3TX6A 4MVJI 1U4SA 4HAYA 1KYQA 2I1LA 2QE7A 2YHIA 3HB9A 2F8SA 2WHQA 4H4EA 3WICA 3PHCA 4S0ZA 4P3YA 4UFOA 2BMWA 5REQB 2EP5A 2O3UA 4MJLA 1A4XA 1R4NB 2RI0A 3NI2A 1TXGA 4TROA 5DGTA 3T12A 1E1CB 4TTPA 1W59A 2EWMA 1EGMB 2FHSA 4K9QA 4PQEA 5J47A 1REQA 2VAMA 2QUIA 4ESEA 5HRUA 2BISA 1GNVA 5D3ZA 5TS3A 4DLRA 2EBWA 2VDRB 2H48A 5LMNB 1BEZA 1NM5C 3A9SA 2UXBB 3JU4A 3RIMA 3ZBUA 4EA6A 4TMZA 3IQXA 3DG9A 2REOA 4Q3NA 1ZR2A 2BFOA 1NNSA 1KKMA 1G8GA 2EP7A 2P27A 5FUYA 1Q2UA 4JEIA 5F4ZA 4NCHA 4UHHA 3VR5A 1BGXT 2WUEA 1I2MA 4YRQA 4CQLB 3IJ5A 2CN1A 1XEFA 3HYNA 4XR9A 3BA1A 4Q18A 4CMBA 3KVVA 4HFRA 4Q02A 9GPBA 1QG0A 5JEEA 4J1QA 2JGFA 3DKKA 2WM3A 2FLVA 3MTAA 5IC6A 2JBAA 3CYFA 4BY9E 2FZ5A 4YXFA 1SA0B 4AYWA 1R6DA 1XXHB 2Q9UA 4FBLA 4KMOA 2NO1A 3O2QB 7ADHA 4F4CA 1NXOA 3TD2A 2RI1A 2Z95A 3AL3A 1ACJA 3MCAA 1Z18A 3L46A 2PUEA 4A4DA 3DDYA 1H42A 3NPAA 2FW8A 1YJ9B 1NJ1A 2HTEA 2VOEA 2ZR8A 3FY4A 3NX4A 4R0NA 3U0BA 1Z8DA 3GQVA 4YRZA 1BAPA 3IJRA 5KQRA 2C8JA 1CHDA 3H5NA 3L5KA 2FW1A 1YBAA 3O8BA 4P4SB 3KYBA 4ZCSA 5JC8A 1Z34A 5MFZA 1NLMA 4RUKA 1T6XA 2ZRNA 4CTJA 1BYIA 4MR9B 2Y1DA 3LUFA 4DIKA 3FCUB 4IQ8A 3BGIA 2ZQZA 1AURA 4X7FA 1A2OA 1OT3A 1MQAA 4TLDA 5I7OA 2V96A 5AXAA 5K01A 4I1RA 4RKEA 3WLNA 4HX9A 5IT5A 5CD1A 5IXYA 1J90A 1HG0A 4FGJA 2X41A 3AJDA 4JT9A 4GR9A 5BOSB 4W7HA 1HURA 1SBTA 2OE2A 1TVMA 2W2NA 4F8JA 2QGNA 4H0CA 2ID9A 2HRCA 3K71B 5CK4A 3EZXA 3GRYA 2QTCA 3KSRA 3GJQA 5JT1A 3I62A 4GOND 4GPIB 3CFYA 4KSCA 4R1UA 1Q7TA 3CVJA 3K0FB 4NSNA 4RVFA 3UOAB 1QF7A 3M4ZA 5IDWA 3WMWA 4QDZA 1HLDA 1ONSA 1ZNQO 2R8ZA 3GHHA 3LC7O 4JLVA 3ICCA 3VNUA 2BL4A 3C3JA 4O4IA 3F3SA 4TYQA 4XOUA 1I7DA 1K08A 3NJ8A 1CZHA 4LOKA 2UYCA 5I8ZA 1QOQB 3KQMA 3ZC3A 3RASA 1S96A 3SICE 1J0EA 5BSWA 2P1DA 4R05A 2P8SA 1EE2A 2HCTA 1WWKA 2AI2A 5JIBA 1B2RA 2FAXA 1U8EA 1I7SB 3U60B 1H1TA 2VPWA 2VI5A 3R5XA 2WLSA 2Z5FA 3ETDA 2OK8A 1JA9A 2ZYRA 5K0CA 2OP0A 2RK6A 1K4KA 4X6YA 1G6OA 5CRIA 2OG2A 3QELA 4AD8A 2IYNA 3DXFA 3ISVA 4MEAA 5F21A 5C8VA 3C5VA 4LGYA 1E3WA 3FOEC 1DQZA 1FNSA 3E9QA 4HNGA 1UXOA 3L06A 4BASA 3HFGA 1JHRA 4EBFA 1KARA 2MSWA 2PL3A 4G4SO 5E8JA 2EWWA 3QG1A 5CA0B 1A4UA 3C6XA 3FRJA 3SF8B 3L8CA 5EC8A 2YN4A 4BLTA 1NZJA 3LM8A 2H08A 5T6MA 3U4QB 1RKBA 4R9SA 4FC7A 3DLIA 4YMWA 1YULA 2XMCA 3R20A 4JJFA 4HWPA 3NKVA 4XLAA 4YJ2F 1TVEA 3ZY3A 3DSRA 3G8CA 4QOJA 1M6YA 2Z2KA 3TMKA 5LJLA 2XCSB 3KOWA 1VSQA 2FEKA 3D4NA 3PF9A 5T41A 1GXSB 2HOQA 4LVCA 1TD9A 4IDGA 1O96B 1O3YA 4YBRA 3RU9A 1C4XA 1MN6A 4MO2A 1SCUB 1S2MA 3FZYA 1G5PA 2VRCD 4WFKA 3WFJA 5IPFA 1SGWA 2WIFA 3AWDA 1OB2A 4HAZA 4J94A 1NVDA 1RXEA 4ZZ2A 1K6IA 3RVPA 1AGXA 3MWEA 3RB8A 3NALA 1DNPA 1J97A 4XM3A 3U6KA 4LZPA 1IUNA 1L5ZA 2XRZA 3TQIA 2B82A 5LZ7A 4ZI7F 5J23A 1BDIA 2HU7A 2CYAA 4JI5B 2F8TA 1CY4A 4N0QA 4PLPA 1ZM2A 4W1PA 3QTLA 2NPIA 3HN6A 1FVFA 4LJKA 2JZNA 1OKKD 1CB7A 1BVRA 1C3XA 3ROQA 3ZHSA 2IUSA 2O1XA 2P9EA 1LBHA 3DR5A 3N0TA 4YWHA 1ZX1A 2QSJA 5BQ3A 1TVCA 1XZJA 3ZCSA 4FOPA 3OESA 2XXAA 1I13A 1UBJS 3E9DA 2SECE 4X66B 1BE0A 2CBXA 4FZ5A 2BH9A 1DV1A 2P9JA 4PC2A 3E27A 3QPDA 4JD5A 4LJ6A 4BNMA 4X3PA 5F4OA 1JAIA 1NVMB 2X9GA 3QVOA 5EIFA 3ZCVA 5L51A 2AVNA 4LHEA 4ES6A 2ZLBA 4XEUA 3GDHA 2RHBA 2QEQA 4KUEA 2R7NA 1CFZA 3MJHA 5DU2A 3I39X 4RIHA 4X65B 5H68A 5CYPA 3U9SA 5HR5A 1JHMA 3U49A 1SRRA 5CVCA 3DTYA 3WGIA 3NETA 4KFSA 3A32A 1Z22A 3OE1A 4P35A 5EXEA 1C50A 2PLNA 3G1UA 4A15A 4XUCA 4HATA 1AS3A 1U3FA 1P61B 2PWPA 3WP0A 4A2PA 2DOGA 1Y48E 2ZB3A 3L4JA 4O33A 3R5HA 4G25A 4RZHA 4WOPA 4FXOA 1SKAA 1R88A 1XPUA 4KE8A 5AKXA 4L74A 1GO2A 2C1ZA 3S1AB 1M34A 3PCXA 1NHGA 4IMRA 3PQ7A 2DIEA 1UXJA 1V8FA 2GVNA 1D6SA 3VSAA 3O1IC 4M36A 4LF8B 2ZIWB 4L95C 1P17A 4URYR 1X92A 3G9TA 3L8EA 2QJWA 4Y7DA 4EY8A 4ZI3A 1GZ7A 5J2TA 1LGYA 1U1DA 5T3YA 3GFVA 2E18A 3PPYA 1OIVA 3R0VA 4RY2A 3ESXA 1JZTA 4EQ6B 3KR1A 1NSYA 3O03A 4OQMA 1EGQA 1AXGA 4RLHA 4UULA 4N3CA 2QRMA 4FGWA 3VO8A 1EUYA 3G2JA 1W0KD 1IDN1 2J45A 3KE8A 4JI1B 1JWLA 4MPTA 1ZMOA 3WMRA 5EMNA 5IAEA 2NZ2A 3DNPA 3MTEA 1W7AA 4DNQA 1CS0A 4QYWA 3GLUA 4KYVA 3AL0C 3FCCA 1JG7A 3A05A 4PLHA 1ZUNA 4KIFA 1KYXA 1YIDA 3HJFA 4I6EA 1QRUA 2BN4A 2V3VA 1EFAA 2IUEA 1JDJA 1F4PA 1M1NB 1YDEA 1AH2A 3ZWYA 4ASUD 1EFUA 2R1VB 2ZJ5A 3BHIA 4H1TA 4MUMA 4AULA 4CLOA 3A26A 1J1UA 1XMXA 1E4OA 1SVKA 5DTIA 2QUZA 3ROTA 2GWRA 3BJZA 1RHQA 4MO9A 2ECFA 4IIJB 2XUGA 3AB7A 1BX1A 2PMDA 5EZYB 2WMYA 2XD4A 2ADMA 3UTDA 1MRZA 2AN3A 3N9IA 3UYLA 5F9MA 1BMFA 2NG1A 3WLIA 5JSZA 4GI5A 5CT8A 4L6IA 4KRFA 2WC1A 3QE2A 1XQVA 1BD3A 1ZQ9A 3PPXA 2WJZB 1YFZA 3A37A 1EDEA 1C1XB 1W5EA 3WVNA 1C4KA 4DT1A 2OCGA 1C7JA 2P7IA 3CRMA 5KPJA 1AGNA 2CVPA 4RKYA 4QEZA 4Q01A 1U28C 2QRZA 1VCNA 3FPFA 4IH4A 4M8NE 1OXBB 4RDIA 3CUTA 5FPQA 2DUMA 3QMPA 4MV8A 3GX1A 3TPFA 1AQNA 4DV6B 1XNGA 1HPLA 3ABZA 4J8PA 4PAMA 2HL6A 3GF4A 1P4JA 4GWKA 4RA9B 5HQJA 3U3OA 1XD8A 1KVTA 2J3JA 3BILA 4Q66C 1T5SA 4Z4RA 1GGNA 3WB9A 3FTFA 2GZ3A 1XXHA 2IIBA 1NRXA 2ZVPX 3KPUA 1FNMA 1TMKA 4GQNA 1XE3A 1Z0SA 2GMWA 1LDNA 3H1BA 2AGVA 3VA7A 5IAJA 3TLMA 2GFHA 4LV6A 2CDCA 5AKHA 2AE1A 2X1HA 1SELA 1VE5A 3QLVC 3ZEAA 2Q3EA 4MUHA 2ERXA 3DE2X 5D5PA 1FP7A 4UBMA 2WRZA 5AJWA 3CB2A 1TDJA 1EDZA 4FGSA 3CEHA 4LXYA 1LSUA 5F2OA 3RCBA 1T0IA 5KTKA 3BC1A 4UMEA 3K70D 5J2UB 2NPFA 1T5DX 2AQHA 1V3UA 1TA0A 3OO1A 1ISGA 2YZGA 3PL5A 1PEAA 1S0UA 1Z47A 2DEUA 3QVKA 1NHWA 3SSAA 1ZD1A 4CODB 2YVLA 3OUUA 3O3NB 5FL7D 2FW6A 3RRNA 4F91B 5KNCH 4LBWA 4XLFA 4JLPA 3TVTA 4I8DA 3NOQA 5HWSA 3U61B 1TD1A 3LKZA 4MRVA 4DPMA 3SQLA 3OUTA 3EXIA 5CNMA 4XNFA 3LNCA 1PYGA 3PGLA 4EUEA 3AO0B 5A5GA 5GM1A 2QV0A 1EVLA 1SRQA 3FFAA 2GI4A 4IF4A 4LX8A 3IEUA 4A0RA 2OBTA 3I09A 1FSGA 4GM1A 5I47A 3ZEIA 1ID8A 2C2GA 3NHUA 4PRKA 2RHJA 3DZBA 4E2YA 3IOEA 4K86A 1J7KA 1Z7GA 5CEEA 1E2LA 3DD5A 3EWAA 1JI3A 4GGMX 4KAJA 3G0DA 3ZV4A 2H6EA 2W00A 3P9ZA 4BMNA 5FPYA 3ZGYA 3LY8A 3KZXA 4GH5A 1HEYA 3GFTA 4CEIA 1CV2A 2VUUA 3A3OA 1TMYA 1LLQA 3H2BA 4XAQA 1QAQA 5A2QA 4GICA 3UUGA 4CIXA 2H7CA 4ZT6A 1RXYA 1QCYA 1KYIA 2ON6A 4B0OA 3LPNA 1HDIA 2JEOA 4IZ6A 4R7ZA 3W6UA 2QUKA 2YS7A 4GS5A 2IELA 3WB0A 4PCVA 1OHHD 2NSJA 2YMMA 1RWBA 3AFIA 1GD1O 1E3ZA 3KOMA 2VZ9A 2GAOA 4TQGA 2WM9B 1DIGA 2Q45A 1JXQA 1SC6A 3UHJA 4CM6A 2CXPA 1M2VB 2IYFA 3H94A 1DJQA 3I9OA 5FH9A 1YKSA 2YV2A 4LHWA 4CWAA 4JHXA 2H59A 3J81A 3FOCA 3M49A 2ODBA 1GN8A 1U3WA 5A3SA 3TKAA 1SD5A 1VBKA 2ZRPA 1UJNA 1TJ5A 4KQ6A 4GGPA 5LJIA 2BDTA 3CE9A 1X1RA 4V0SA 4RS3A 2VTBB 5G53C 1Z73A 2HDWA 3PEFA 4BP8A 4KR9A 3GLGB 3DCJA 3M6AA 3LNNA 4UBKA 1NQXA 2R8RA 2VXYA 4B17A 3BORA 3OEWA 5ALDA 4KQXA 2F1RA 1CF2O 1U7ZA 2FQ1A 1N3LA 5HHTA 1TZKA 3PDIA 1ZNYA 3P9SA 4BJ3A 2XCRB 4PSVA 2B8NA 4NDNE 2HY7A 2YHUA 4DM4A 2KVOA 5CFQA 2BFEA 2XADA 3CWCA 4ZC8A 3NB0A 4G23A 4LMPA 5KOIA 4ZN6A 2W6CX 4R1SA 1GA6A 4EI8A 4HAOA 2G70A 3EFBA 3P0IA 2X8BA 1U0BB 1FP4B 3KTOA 3LU1A 1YVEI 2HRDA 3C8ZA 3MCUA 4QVGA 2ZI4A 4AT1A 2FSHA 3D5TA 5L9AA 2PUCA 1EQUA 1M74A 4AN1A 3U37A 4DYVA 1ADJA 1OV6A 2OBSA 1EKXA 4PLCA 5ISMA 3K6RA 1CUBA 3FZQA 4O1IA 4IRXA 2OXFA 1X0VA 1XTSA 1DI0A 3O8NA 4IH9A 3QXXA 1SXJD 2OAEA 1GIAA 3QUSA 3S40A 4X06A 3VDXA 4YDQA 2NTYC 2P6RA 4TT3D 3M1YA 5FX2A 1L4FA 2PAAA 4O4JB 3UXYA 4WY5A 4B75A 3VPAA 3SC2B 4TV8F 1TT5A 2B98A 2XZDA 3CUKA 1NXSA 3EZ9A 3F4KA 4EHAA 1G38A 3TF5A 1L5MA 3VKHA 2J9GA 2C2BA 1QWOA 4DV5B 3ED5A 3ZYCA 4RAQA 4B76A 4H17A 4GPZA 3U56A 2NUBA 4BN4A 3BH7A 4DMRA 4Z0PA 1TGVA 4CKZA 1LV8A 5J2TF 3FMFA 3QPCA 4XJXA 1VMKA 1BDMA 1TUEA 1DAHA 4GBMA 4DNFA 5KO2A 4CT5A 4YRMA 1ZR4A 2ZREA 3JZMA 4HQKA 3BSYA 4L9AA 1ZCJA 4QGBA 3R6LA 4MKIA 4D5EA 5LA6F 3S81A 2WDZA 3B20A 2FMXA 1I10A 3D5QA 8ATCA 3QV1A 3V7AA 1IHPA 1TIBA 2M6RA 2W6IA 2DCMA 5DOVA 3ZWWA 4MWZA 2H7VA 1E79A 1BA3A 5FOTA 3X1JA 5DX8A 4C7VA 2X4IA 3E05A 4HAVA 4IOLA 4URVR 3B82A 3DKIA 3FTDA 3EMDA 3GC6A 3TJMA 1N33B 4JYMA 1UPBA 1H8EA 3AT1A 3HO8A 1ZXXA 1AD2A 2XZTA 4GEGA 2QTNA 2NMVA 2DE0X 1YJBA 4P0PB 2OFOA 3J80A 5EJ6A 3ZVRA 2POCA 4LJLA 3INTA 1VCIA 2ZQ5A 1ZK4A 1LPAB 5KSPA 5K6RA 3DCNA 2WPDA 2DPXA 4JLAA 4XIIA 4JUFA 1D0SA 3I1IA 2WWWA 1Z6QA 4JI3B 3DYVA 4AZVA 3RIGA 1FNBA 1K97A 4R6WA 1GP2A 4DMUB 1UZUA 3UJNA 1J49A 3BIFA 2RGRA 2VP4A 3GPLA 4OF4A 2IU3A 3C8HA 2VYNA 3NEYA 4LAFA 4BXOB 3A9VA 3NG1A 1LZKA 1O57A 3W2HA 1VMAA 1GWNA 4X1OA 3B53X 1XL1A 4BFCA 4QV2A 3GLKA 1P91A 5KIAA 2H9AA 2WYIA 3CVXA 3H1EA 3FNRA 2WJYA 2GT1A 1MDBA 1DTEA 1YI0A 1BW9B 4Q7MB 1XRNA 1HDCA 4W8GA 4ZVPA 3KUXA 1E0JA 1GR0A 1QHHB 2I78A 4R7GA 2JLUA 4NCBA 2BFMA 3X1KA 1MKYA 3D2AA 1PL7A 1DRUA 4JQSA 1XQ6A 5E2IA 1GYPA 2HKIA 3ZHYA 4ILEA 4FHGA 4BN0A 4M99A 3U4HA 1P72A 4B3CA 4PX9A 3KTAA 1CIJA 1KI6A 3NGMA 2GTIA 1UANA 1HUQA 1YB2A 3EC1A 4MYCA 5K0FA 1A7JA 3LKBA 4J0KA 2AXPA 3OZ7A 3ADBA 2DYKA 4IOMA 3REQA 1TCUA 3MGGA 2R86A 1OAKA 1X13A 4Q7JB 3GNLA 1CBUA 1UBHS 4BV3A 3K5HA 2Q99A 5KNLA 3IRUA 2AMVA 2H5LA 4RSMA 5HZMA 1QJ4A 3N8HA 4LHZA 1NV9A 2PSSA 3BSWA 4OK6A 3JRXA 1NGSA 1YH3A 4P80A 3NWOA 4R54A 3ZXSA 1GPBA 3QXHA 3VH3A 5B6JA 1S3IA 1DOHA 1SN7A 2P9FA 3FNHA 3KKKA 4X8OA 4B82A 2BWJA 5JG7A 1N1GA 1QONA 2R6FA 3TAXA 3LPCA 1A82A 5F5LA 2CE7A 1PAUA 2OAQ1 4BO7A 5JH7F 5DLPA 4CM9A 1GLGA 4I5IA 2GRAA 3A06A 4MVJH 1P62B 3L7CA 4O4HF 1VQ5B 4COKA 3DEFA 5AVRA 5JSUA 1EJ6A 1PR6A 2H4FA 4IILA 2C78A 1TUBB 2QJRA 3QX7A 2XDQA 4G0ZA 3CO0S 4DBVO 1OZHA 4KR3A 1YR9A 7MHTA 1YX2A 3DZKA 1UFKA 3L49A 4NJMB 3L2OB 1I51A 2EV9A 2QF7A 3UAXA 5T4EA 1G7SA 2OO7A 1ZIPA 2PO5A 2WVAA 4XASA 1LS1A 1JJFA 3MD9A 1XELA 4C0WA 2VXOA 4R2XA 5I7SA 2Z2JA 3QEMA 5BT9A 2BV3A 5LYJF 4DVJA 4OD0A 2B1QA 4CHTA 4I4TB 4X7PA 1T5IA 5J3JA 2AS0A 3DYIA 4CV2A 4RPBA 1CTQA 1GAJA 1SQFA 3UPDA 4MICA 3CKYA 4BVEA 4OP1A 4R3WA 1C3VA 1EB9A 1HDXA 4PCLA 4RZSA 4M1WA 4EW6A 3WLQA 3ZK9A 1ZJZA 3D8RA 4GYJA 2D1TA 4YJFA 4HMOA 1WA5A 2Y66A 4Q7EA 3M7IA 1JR3A 3H75A 1WU8A 4QQNA 5KQGA 3T5MA 2DQ4A 5IG2A 2G77B 3O1JC 1JAXA 3HTXA 4IDPA 2OV2A 4OI2A 1FFHA 1PDOA 2C0CA 2C9MA 3ANLA 3F7MA 4H35A 5EEHA 1WE2A 1Y42X 1RPJA 2CNWA 1P5RA 3R3VA 4OXYA 3D1VA 4IVNA 5A8AA 1XYGA 3TFQA 1USIA 5AJVB 3V46A 1G5FA 3QBTA 2FP3A 1DRKA 5JW6A 4V0NA 4O63O 3HM9A 3HCCA 1OWOA 4GUAA 4CV1A 1A1VA 2FVXA 2UKDA 5IANA 1YKGA 2ZVJA 5DGDA 3DEIA 4BLRA 3NATA 4WK4B 1KMQA 1RU3A 2FSVC 3MUFA 1M2OA 4X8LA 3MBKA 4HNQA 2Q2NA 2O19A 2FN3A 3KOZA 3CZMA 2GDZA 1E64A 2GYVA 2QM7A 2X4DA 1NJ6A 4QE3A 2YV1A 3Q8WA 1CEEA 2PAFA 3ZZTA 3K09A 3B3GA 1PJSA 3ZOZA 5EJEA 3JAKB 5KNCD 1KSJA 1JHXA 1YHYA 5THXA 2JHAA 3WMGA 5JYDA 4LWQA 3U0VA 3JZDA 1KR5A 2P2DA 4M76B 1B74A 3AF3A 5KVQA 4PWZA 5FUXA 3ZDFA 5MN4A 1TYDE 1PGJA 3IBCA 4QELA 1CWUA 1VLOA 2F1OA 2H2IA 2H2WA 4M3NA 4NS1A 4UKDA 3CGWA 2MTBA 2AG5A 3FGOA 1GM5A 3JQAA 5J9FA 4RDKA 1T3GA 3RIHA 3VYUB 5KNBH 3CLSC 1Z08A 4OI1A 4JOBA 1H3NA 3H97A 2D2IA 3JVUA 3NT4A 5CLIA 2DTDA 4QTYA 4G0UA 3PJRA 2VRWA 3KL4A 1SVUA 3JYLA 3FUCA 2AOUB 5HF6A 2PH7A 3C0KA 1G98A 1RWNA 2QXTA 2VJMA 4CMCA 3OM1A 3NYQA 2IEBA 3P45A 4RAOA 1ZN8A 2HJHA 3NRCA 2JLQA 4WERA 3RC3A 2ST1A 1QNLA 2JGAA 4CLRA 3X3HA 3CPEA 3VO2A 1L4BA 2CUZA 2MMCA 3GRKA 4JB8A 4JDUA 4QA9A 1LLFA 5AT1A 3GGCA 3RT9A 2C4TA 3UGQA 4F3NA 1E3QA 4J4TA 2DFDA 3F9CA 4HSGA 5CAEB 4DL9A 3OO0A 2XRYA 2AWNA 2RIPA 2GJPA 2FI1A 5F1OA 3SIXA 4AL4A 5JJBA 1ZESA 4D26A 4PLYA 3NAQA 2PTGA 4CG3A 1Z4NA 1YRHA 3ZZNA 4OJYA 1S4MA 1O4WA 1ZIOA 3F3YA 4G4GA 2BTQA 1B6GA 2ENWA 2QN8A 3UK1A 4EYOA 1M8JA 5EZYA 2VPPA 3INRA 4ZAZA 1EFCA 1JEQA 2I4OA 2NTEA 4JBNA 4BOYA 4IEIA 1GUBA 4PWYA 2QAIA 1XLWA 5JYCA 1DWUA 1EFDN 2ANCA 4HQFA 4MB2A 2HA7A 3TW6A 3WGLA 4F9EA 3VTZA 1RRVA 5BN5A 3FKSD 3T4XA 2FE1A 1TT7A 4QPZA 5FBHA 1KQOA 2A0UA 5A1JA 2PNJA 4TMVA 5TNXA 5IYRA 3T95A 4MV0A 1OMOA 4H16A 3UJ9A 2OHXA 3ETEA 3GZTB 2E85A 3DEJA 3SLRA 3NWBA 1P8AA 1YR3A 2VJBA 4RU1A 3TH5A 1E6KA 1Z83A 3UK7A 2WR8A 2LVBA 1GU1A 2RHCA 3LWBA 1P9WA 3WHKA 1XHFA 4U9UA 4LF7B 1JHVA 3PC8A 3HK2A 1Z5UA 1V1RA 2EKPA 2IDKA 2OHVA 1CQJB 3KDSE 2PUWA 5KU1A 5L3SB 2HLHA 1G8KA 2JI6A 4GYWA 4LVOA 4ZQEA 4LWPA 3SSMA 3T8YA 3RC8A 3QVTA 4QVJA 4NI5A 3O9VA 2JGIA 1PT6A 1JHDA 4HNAB 4Z86A 3PEYA 4L5BA 4BMXA 4QSMA 1CDEA 2UUAB 3KSDO 4J1TC 3Q7TA 3RS5A 1WZIA 3D6HA 3OICA 2DPYA 3TM4A 2VBIA 3ISJA 4C01A 3ANTA 5ER9A 5I6DA 1YOBA 3VH1A 1HK7A 1J42A 4UTZA 4HRAA 3K9FC 3EIEA 1URPA 3QU9A 4TPKA 4URFA 4U2EA 4I46A 3UKJA 3EGWA 3TXAA 3K32A 4QRDA 1H05A 2NTNA 1ZK2A 1GL6A 3N6VA 3OA0A 2I76A 4U1RA 1XMJA 2XUZA 2VCHA 2QG6A 1THGA 3FTNA 1YZFA 4P3OA 5DK4A 3OJFA 1KPIA 4FCVA 2E21A 4OUDB 4Q0MA 5E7MA 4ZI5A 1GL9B 4IUYA 4PYIA 1XA3A 4QQ8A 4I55A 4WOCA 3H2YA 4DDMA 1UZAA 2IHJA 4BXOA 1E94E 1VGRA 3KDAA 1JNXX 4FFOA 4KX3A 4OLFA 1X7WB 2ZPAA 1DINA 4OPVA 3BXXA 3SHVA 5LP6A 2JJYA 3F47A 2C3YA 4NZOA 3RSFA 1KMMA 3JQFA 5CDFE 2NU8A 1AU9A 1WZUA 3LC2O 2FXIA 1ND5A 3EZGA 2UZ1A 5H70A 3OZCA 1K5PA 2FR0A 1N5KA 1KVUA 4L9WA 4X60A 1P9OA 4PG7A 2IUUA 3TI7A 3WV5A 5B58C 2JFBA 3JSAA 1AJEA 4NBWA 1D9ZA 3KZNA 2I7TA 1QLHA 1QVWA 1M0TA 4WHMA 3PD7A 3ASVA 3MW8A 2H3EA 4N6OA 4E12A 3CCEB 3KLOA 1JIKA 2GPSA 2HRBA 2VNAA 4ZQHA 5GZ1A 4ZHQB 5ESRA 4KDEA 1XR3A 4KQWA 5JAIA 1N3IA 4PE5B 4LQ4A 1CF9A 3TPCA 1FW6A 3BD7A 1WSVA 1NRJB 5LYJA 1TAGA 3NTQA 4B47A 1NY5A 1UKEA 2O0KA 3V8PA 5E3JA 2V1XA 2JKZA 2VWPA 3CCMB 3CURA 4C89A 1T4DA 1J09A 1UF9A 2FZEA 2VQEB 1V5IA 1JALA 3CCVB 1HI9A 2CHGA 2IHNA 2X0IA 3ZGLA 2B9EA 2XA2A 3HCWA 5M3BA 4BKUA 5B7QA 1RZUA 2DTXA 2G0AA 2RKBA 3GXOA 3Q7SA 3W8EA 3S27A 3GEDA 1NV8A 3AQIA 5K3AA 1TYEB 1CFJA 1VTKA 1ZD3A 3IXLA 4FUQA 4IAOA 8ADHA 1M34B 3F8TA 1UPTA 2IBMA 1HF3A 3PQ4A 3RTBA 2QRKA 2X40A 3U39A 4IGEA 3ONUA 1SO8A 3QEKA 4KVZA 1MJFA 4MIYA 2VJKA 4KREA 2P35A 3KQVA 5LD2C 1UZMA 4OQFA 3OEYA 5EGSA 4ENVA 2PIDA 3NVKI 1N5MA 1GG9A 1T9GR 2C9BA 2IZ0A 2R6JA 1V8DA 5C1IA 4PC1A 5KWEA 1IY2A 3RYIB 2X15A 1B8OA 2WINI 3I04A 5HQ3A 3AIOA 1VCHA 3COZA 4FE4A 4MQFA 5I9NA 1J06A 2FZLA 3HCNA 4GLFA 4HDKB 2ZBUA 5CLGA 1T9BA 1BE8A 4IDQA 3FR7A 3USZA 1FPMA 4DPKA 2LE0A 3DMNA 2EEZA 3EVDA 1ZI8A 1E9VA 5JWHA 4FLMA 2BR4A 4O8CA 2V9ZA 4B3GA 1EFTA 1F4VA 3FVVA 1N57A 3QOWA 4J0GA 4M37A 2QORA 2OC4A 4L7QA 1CE8B 1IOLA 4YJFB 2CFRA 4WY2A 5FWXA 1N2BA 4ZD6A 5DNYB 3GOQA 5AM2A 5HRCA 4C0JA 4EJ6A 3GDWA 1T3TA 4S12A 1XZPA 4E30A 3CIFA 2VJOA 1J20A 3ZPNA 3IUMA 1FDRA 3R74A 3U4IA 4ME6A 3COPA 1SA0A 1XTBA 3LF2A 1QFYA 3AILA 3R09A 1BHQ1 2FMFA 2YJGA 2XQGA 2HV9A 3NANA 1KJNA 3A7DA 1M66A 4NECA 3RVNA 3L77A 4IGIA 1ONPA 4O4LB 3ZDQA 1K9VF 3TQCA 1FMJA 2BFFB 1O77A 3RHSA 4MWBA 2FPLA 4XLLA 2XQKA 3AMVA 3T7CA 3UMRA 4RMHA 4DJFC 4C2AA 4QUIA 5EINA 1K63A 4M4SA 4MGYR 1ZLXA 5BSFA 2ZS7A 1NW8A 4GMKA 2F9LA 3KCNA 3Q3CA 4FMCF 2X1LA 4KAAA 4XB1A 4O0MA 5EIOA 3V7YA 4Y9UA 2J30A 4G4SP 1XVAA 4CFSA 1C0IA 4PICA 3RS0A 3OLYA 3ODPA 5JROA 3GLTA 2GAAA 5AVWA 4E6PA 4RGYA 5EFOA 1LK0A 1YXMA 4O59O 4RPLA 3DH0A 5DM2A 3S44A 4TLLB 1Q0RA 1WIWA 4NV3A 4ENUA 4G0NA 3GIRA 4BVKA 3K6KA 1KZYC 4S05A 1RI5A 2QZJA 4J29A 2Z04A 1WY7A 1RI4A 4L3OA 2DERA 1LBSA 1M8FA 4FMDB 2VQFB 1RZRA 1ULSA 1P6XA 4MGHA 4OK5A 1GTL1 1X3LA 2NZWA 1D1NA 3K16A 1DC5A 2RH5A 2UAGA 3M4NA 3LH5A 4FC6A 4MRMB 4V0KA 4ZO6A 5TF0A 3ROGA 3UWPA 2CF5A 2J9FB 3JD0A 1P8JA 3SYKA 4DYHA 5AW3A 1TKRA 3W8RA 2R79A 3NFYA 4BLUA 3OFJA 3VGPA 4GI1A 3GRVA 1Q1ZA 2NVWA 3K70B 4LZOA 3FJ1A 4FFSA 4D8YA 4ZDKA 1GN9A 1UEXC 1V3VA 2C98A 3G0BA 1YCGA 3D4BA 3R24A 5FRDA 4IG4A 2JHFA 2Z3VA 3CKMA 3SVTA 5D6OA 3AUTA