4M0LA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus complexed with gdp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
414
structure length
412
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 91
structure length 412
sequence length 414
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m0lA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m0lA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m0lA01
2MMCA 3FHOA 2X1VA 4PAQA 4OI1A 3QPWA 3VO2A 1HT2E 5UKDA 1QVFB 2QA5A 5G41A 8OHMA 2QAGB 3CRRA 5CB8A 3AM1A 4TL8A 2PJRA 3BWDD 4PHHA 1K73D 2JJ2D 1QBKC 2F7SA 1TTTA 1IN4A 3IDQA 1GILA 1XEXA 2IS1A 3UG6A 1UBCA 2BKUA 1NBMA 5EP3A 1VQ7B 1P2TA 5CK4A 1COWA 2O0HA 1I7PA 1G7RA 2QP3A 1E62A 3AV0B 1AKEA 1BS1A 1YZGA 2TMKA 2DERA 1W35A 4A0GA 1OSNA 2ODEA 2ZJ8A 3VTKA 3WBJA 1E69A 2HEIA 2J9RA 3W3AA 2J7PD 5P21A 2IWHA 1HA3A 1OXTA 1JXMA 2RGNC 2LCFA 3CRQA 3T06B 3EXAA 2VSFA 2RGBA 4QM7A 2QTFA 5BN4A 4B2PA 1JPNA 1W47A 3RAPR 4GNKA 1KD1D 4A0FA 1U8ZA 4J0QA 3REFA 2AFIE 5JJIA 3EA0A 4Q66C 4B35A 2OG2A 4FMDB 4FIDA 3VKHA 3F0TA 1B0UA 5EE9A 2WKRA 1BJKA 3W5HA 2XOKD 3U6BA 3ZLJA 3S1AA 1VG1A 1L2TA 1E2HA 2BBSA 2GCOA 1L4YA 1XCGB 2Q3FA 5D3MB 2XAUA 1HE8B 1P6XA 2IYYA 2QGZA 2R44A 2GXQA 2EYQA 4BFVA 1DAHA 3FMFA 5J4KA 3K0FA 4CRWB 4S35A 1T9HA 1TQ2A 4WOPA 1Q86D 2H57A 1L4UA 3B6EA 4B2LA 2C9OA 4BUJA 3GLIB 2OFOA 1NN5A 1YR6A 3TGPA 4JYCA 1GVHA 1RFLA 4ASUD 4DDUA 3NHBA 1E2DA 4L9WA 1DAGA 1CJUC 1XF9A 1AM4D 4DXAA 4EAQA 3C5HA 3CRW1 4QNMA 1VCIA 1G9XA 1RYHA 3UMRA 1SXJC 4HAZA 1IN8A 3AF2A 4Y0AA 3KX2A 1N6IA 3B1XA 3GJ3A 2AXNA 4PQYA 2UVQA 3A1TA 3SDZA 3PQCA 4C4PA 3TAHA 5THXA 2F43B 3CX8A 4TN1A 3E5HA 5FPTA 4UNNA 2NZJA 4PXAA 4PGOA 4F92B 3TSZA 2EQBA 4HDCA 3B5JA 4XVRA 3EW9A 2O8BA 4B3DA 4LC0A 2RGNA 2IX3A 1CXZA 2RGDA 1GL9B 2FFBA 5JCZA 3QXXA 2J0QA 1X86B 3KJGA 2XNDA 4DLXA 1XFAA 3LQRA 4OBEA 1G3MA 2JLSA 2WSSD 5JLJA 3QY0A 6Q21A 4BZPA 3AP2A 1OKKA 1NDHA 3DEFA 3CCRB 3B9QA 3MAAC 5CJ2A 4AG6A 2FDCA 3AKDA 3QBVA 1TPZA 3Q72A 2ZSDA 5DYIA 2BMDA 2JA1A 4F4CA 5J47A 3K0EA 1GL7A 1TAGA 4YC7A 3LLUA 4LBVA 4QGGA 5CM9C 4HSEA 4B3CA 4BQSA 3W34A 3Q8XB 3CF0A 5FTJA 4US1R 4YAUA 4TYPA 3SE0A 2FU5C 1II8A 3IIKA 2H18A 1ODFA 4A6PA 3QJYA 3PENA 3CRZA 3KKNA 1AQUA 1NJID 2GDJA 4IXMA 1BQEA 2VA8A 4RKEA 2DB3A 2YHSA 3M1IA 1W46A 4ZKEA 3FFBA 3CCMB 1G5PA 2ZETA 3WHLA 2ECKA 4Z54A 1SXJA 3HDTA 2AK3A 4KLZA 4B3BA 2IT1A 4V03A 1YR9A 2BGJA 3QFCA 1MRNA 3AF1A 2XJ9A 3B1VA 1SGWA 4M1KA 1Z8FA 2OBLA 4LK2A 4NYIQ 3O8CA 2R6DA 2VP0A 1P9NA 1OH5A 4M1WA 3OW2B 4P3YA 1KO1A 1NJGA 1NVVQ 5G3YA 3ES9A 4KJZA 1W5SA 5LBIA 3TQFA 5BW8A 1E2LA 4RVCA 2BMWA 4OI2A 2Q9BA 1WBBA 2GJ8A 4D81A 3RYTC 1NLFA 2ATVA 1TQ6A 4EUNA 5HR5A 4HI0E 1E9DA 1VG9B 1LS1A 1GAJA 1KI6A 3GLHA 1NNEA 3THXA 1H85A 2GRJA 1GAWA 2HLDA 1GFIA 1M2OB 1YHNA 2FH5B 3ZH9B 1NKTA 1EFRA 3QXJA 4FCWA 2XSZD 4WVFA 5E95A 2DFTA 5EXPA 2XTMA 821PA 3H4MA 1H8ED 2ZANA 2IYXA 1E0SA 2UZ3A 1JQLB 1Z6AA 4LHWA 1FX0B 1OFTA 2CCGA 3BB3A 3E1SA 4IJMA 3ZIAD 5KPJA 1NI3A 3ZVMA 3BS4A 4U9UA 3GJXC 1X8JA 2ZUCA 1M34E 1NY6A 4II7A 4DUGA 2J46A 3A1SA 2ZRIA 5G53C 4HUTA 2BHRA 4NH0A 3R7WB 4BLPA 4B75A 4BRWA 4C0JA 5KYKA 3VKGA 1PUIA 2RB4A 2SHKA 4DLWA 2JIZA 4RZ2A 4UXJA 4X8MA 2V7QD 2YOGA 4YXWD 3GLGE 2FF7A 1IHUA 3CCJB 4RY2A 3AQ4A 4PTLA 2CL7X 5LPNA 4BFUA 1AIPA 3L0SA 4BEBA 1F5NA 1P61B 4DCVA 1XMVA 2AWNA 3NKVA 4TL6A 2BCJQ 3AF0A 5L3SB 2GA8A 1QFJA 1GWNA 5AJVB 1VQLB 2ZR9A 4LPKA 2PL3A 3TE6A 2A3RA 1H65A 2ZTSA 3K1JA 4LC1A 4AKIA 2HJGA 4IVQA 3W5JA 3CH4B 4B6FA 5BXQC 4QXAA 4B71A 3OIYA 5AUQA 421PA 2F1JA 1WB9A 2R8RA 2V6IA 4A2QA 3BRWD 4QFMA 4BWYA 1S3GA 2ZS8A 1OFUX 1JJ2B 1Z0IA 3M0EA 4M9QA 2QM8A 2O8CB 2WOJA 3THYB 4Z1MA 3DZ8A 4E09A 4Y9UA 3KJHA 1FW6A 2VL7A 1KDTA 3U3RA 4ZCMA 4FCTA 1HV8A 3CCSB 1KOFA 5FOSA 4V0ME 1C9KA 3LX8A 1QZXA 3QEJA 1OB2A 4LYHA 1FPMA 2OLKA 2C95A 2CK3D 1CP2A 3ND8A 4LJAA 1BMFA 3PG5A 4D80A 3F3YA 1V43A 4CEHA 1UKZA 2CVHA 4MUAA 1CJMA 4TTQA 1I2DA 1US8A 3Q85A 3ZC3A 4IEEA 4US0R 1E98A 2ERYA 1S8FA 3CMAB 1GTVA 4L4UA 1EFUA 2ZJBA 1KMHA 3I92A 3NVAA 4BLOA 4Y7CA 2VP2A 3TUIC 2PH1A 2XGJA 4O2RA 4PC6A 1Q1ZA 3K0AA 3TAUA 4XOIA 4CVNA 1W34A 3BD9A 2ZJZA 1F60A 1TU4A 4LV8B 1E99A 1KC8D 1X1RA 2XEXA 4CGZA 1FMLA 5FTKA 3OAAA 4FMBB 4TLCA 2DFNA 2CXXA 2ZVQX 5DN6A 3WRXC 4RZXA 4B33A 1OW3B 3GEHA 3IIJA 4XSHA 4MKIA 5EUQB 1FP7A 3GLFB 2WJIA 2GK6A 1CQXA 2P2LA 2XX3A 4IFEA 4KFTA 1JB1A 3B82A 1XWIA 1KJWA 3CO5A 1YRBA 4I99A 1M1YE 4DIDA 4LSGA 2G3YA 1MRSA 1ZW6A 1E9BA 3D31A 5HZKA 3KKMA 5DGXA 1SKQA 5TR9A 3T5GA 5KDDA 4ESHA 3HU1A 1S96A 2E1RA 1YJ5A 5FUYA 2HXYA 4L5BA 4LDJA 1R8QA 2AN9A 2BC9A 4O25A 1B2RA 3CZQA 4NCNA 4IRUB 1UJ2A 4UNPA 1T0JB 3MCAA 1LS6A 1A82A 1HY3A 1KO4A 1EFTA 1M74A 4F38A 3QE2A 1EG7A 4UQOA 3K0SA 3OEHA 4B4DA 2R2AA 4KXFB 5DO9A 2EFGA 4AD8A 4G01B 4V02A 1ZNXA 1GKYA 2ZITA 2E87A 2ZSBA 3NTUA 1MO4A 2HYDA 1E0KA 3GFPA 3OE7A 2XB4A 4GOKA 4W7SA 1UDXA 1XB2A 1H8HD 4B73A 4CT4B 3RS4A 2DFKB 4DCSA 4M9SA 1GG2A 4DBLC 3ZQ6A 1NJFA 4F7WA 3VHXA 1KK2A 1W4RA 2QUZA 1GO2A 1ONBA 2IL1A 5FOVA 3B1ZA 1M90D 2NGRA 4IDOA 1FOEB 4Q7KA 2G6BA 3BH6A 2V1XA 1IN5A 1VQOB 4EPXA 4W5JA 2QBYB 1KSJA 3SJBA 1S72B 5L8VA 2W6IA 5A4JA 4IDNA 2WTUA 1Q82D 1ESNA 5KSWB 2FSIA 2WKQA 3BFVA 1P9RA 4QGAA 4BLQA 1QHNA 4Q4JB 1U81A 5CJPA 2B5OA 3QOFA 1Q7YD 3UANA 2ZRAA 4ILEA 5EE5B 3W2GA 4TT3D 3V4RA 3TVTA 4K8OA 1T3LA 2JJ2A 1U8AA 5GADl 3KXIA 2EW1A 3EAQA 2ZSEA 1FQKA 1D9ZA 2ZRGA 4N0DA 3FHCB 5FI0B 1GNRA 2CLDX 2IXEA 4NCJA 4EPWA 3WNBA 1G291 4QBHA 2AKYA 5TY0A 1JBKA 4EFLA 3C16C 4OI4A 3R9WA 4TMWA 3CF2A 4TLDA 2WJJA 2VP6A 2AKAB 1P2VA 3ZD6A 3QIAA 3JVVA 2J7PA 2P5TB 4WZ6A 3DOEA 4TLEA 2KJQA 3RNLA 3I5XA 3A37A 3N2EA 1W36B 2PEZA 4KV9A 1DO0A 1JAIA 4DSOA 4PC2A 2ZE5A 1UBGA 2V6JA 5DI3B 3OJXA 1XMSA 3W2IA 1Q44A 2EFDB 2IYQA 2VF7A 2G77B 3DMNA 4JLDA 4RSGA 4YMWA 1IJFA 3GP8A 2IUSA 3A4LA 4A92A 1OXUA 4UNRA 1JEEA 4OHXA 3WRYC 2AXPA 1LFDB 4TWZA 3UG7A 3QF4B 1OLOA 3QKRB 4TMXA 2IYWA 2XOKA 1SULA 521PA 2IF0A 2N46A 1MR3F 4B34A 3ASZA 2HYIC 5DIFA 1PUJA 4NL4H 3RLFA 4EPRA 4C43A 1HQYE 2VIIA 2RC5A 1OJLA 3GJ4A 2NO7A 5C4MA 4QG7A 1LF0A 3AKYA 4PHFA 2Q6TA 5HKKD 3QPUA 4JT2A 1ZM2A 1GKIA 2UZIR 1P3JA 3N5CA 4Q1AA 4TYNA 2A7QA 2ZI4A 1N6OA 2G0TA 2CLCX 2YC4C 1II0A 2RAPA 3CXCB 4ASUA 4QJ5A 2VH5R 4DT1A 4JKYA 1A2KC 4IDQA 3UPUA 3CRMA 4AY2A 4N0EA 1OIXA 1DS6A 4M1OA 1G19A 4MDFA 3K09A 1GRQA 3THWB 3LX5A 3QXHA 1W87A 1YZNA 4HAYA 4XIGS 4A8JC 3P27A 3BH0A 1G8PA 1BIFA 2BJWA 4RCZA 2JAQA 3CCUB 2Z6VA 1E2QA 3WMEA 1E9FA 1K5GA 2GCPA 4AYXA 3AVTA 4JS0A 4P6VF 1QF9A 3K9NA 4MKFA 1KTVA 4JLOA 5TDHA 4F4IA 2K5UA 1R0WA 2JLQA 2FSGA 2Q9AA 4PO1A 1DG1G 1XZPA 2QSYA 4IXNA 3C41J 2GESA 4XWOA 2JLVA 3GEIA 4OJQA 4KCGA 4IVRA 1VYVA 3VKWA 5CK5A 4UKDA 1E79A 3I61A 2WSSA 2GVDC 3O8BA 1F2UB 1R0ZA 5JEDA 1DPFA 2CE7A 3OIVA 3U4QA 2RGGA 3KTAB 4ZGQB 1Q12A 3T5DA 4FW9A 1XXHB 4HLQB 5KSZA 3NH6A 1FNDA 4MGYR 1XEFA 3UXMA 1FP6A 2CBZA 2GJKA 2VNKA 1W2GA 1CJKC 1XD2A 4N1AA 4WW0A 4ZDWA 2OBMA 1VQ5B 2Y8EA 3L0OA 3U7EB 2D7DA 3LY5A 4Q1DA 2WMOB 3QNUA 3VR4A 3OFND 4EQ6A 2WV9A 3VU9B 3B13B 1PLJA 4HLDA 2FPKA 3AVWA 2HF8A 4E07A 2Q0HA 4G5QA 1NG9A 5H68A 1KI1A 3KJEA 3KQNA 1RRGA 2AD5A 2RHDA 1GL6A 5CLQA 5L3VA 3EPJA 3VR5A 1N0WA 4NONA 3IBYA 3LFUA 3CRVA 4QHYA 2BMFA 3A4MA 5K8LA 1IY0A 4QBFA 1QG2A 4A8JA 1UDWA 1YZLA 2NPFA 1ZP6A 2QT1A 1GNQA 5SZIA 3SJAA 1QHHB 4L15A 5AJWA 2VP9A 5AUNB 3C7KA 4F7DA 1TU3A 1YZKA 2RHMA 1G5RA 2H17A 3GMTA 4S2EA 2QZ4A 1UADA 5FR2A 3P26A 3T34A 1CS4C 3FE2A 3BORA 5AJYA 4JT4A 4P4TA 3H1TA 3FGNA 1DAEA 1P62B 2G1KA 3W6PA 1AKYA 4QJ3A 1XTQA 4L16A 4Q18A 4V0MA 4LJ8A 2ZYUX 2B92A 1VDZA 2IWRA 1VQNB 3EZ6A 4GOXA 4JZKA 2CJWB 1K9MD 4PSAA 4GDFA 3GFOA 1ZNWA 5J40A 1VQKB 2BCGY 3LBHA 2XSZA 2FE4A 4DLSA 5H8WA 4FK8A 4HYYA 4XVUA 1A8PA 3DOFA 3L0PA 4I4LA 1H8EA 1EESA 2JJ1D 1DAMA 5LD2B 2QY9A 1W2HA 4QNRA 1W4AA 4Q7JB 3OE7D 3HYRA 4HB0A 5FOTA 3HR7A 3ZIAA 4LWZA 4HZUA 3BK7A 3HR8A 4NYMQ 3UIEA 1TMKA 2FPLA 1T3SA 1RVDA 4QOSA 1EP1B 3SHFA 3EZFA 4DQKA 2FWRA 4D4JA 3AUXA 1ZD1A 2KBEA 2NPIA 2P0EA 2PLFA 4PPQA 1VG8A 5KSOA 1KKLA 1RJ9B 1S1MA 3NWJA 4NYJQ 4KSCA 4R98A 5FI1B 1GJRA 2OK7A 3PEYA 2PCLA 2NQ2C 2B8TA 4DDTA 2D62A 2FGKA 3SZRA 4Q4AA 2V7QA 4YXWA 5EQTA 1MO5A 2C8VA 5L3RA 4NPHA 2W6ID 3BC1A 3EWAA 1WBDA 2ZYWX 4AI6A 4UNQA 4B2IA 3FYHA 2NO1A 1XRJA 2ZJYA 4KAXA 3K70B 4AYWA 5J4VA 4G5OA 2VEDA 1QDEA 1CEEA 3NC0C 3ZVNA 2PX0A 4TMVA 3G5UA 3WYFA 4MGIR 1YJWB 1JI0A 1G7TA 1SVOA 3FTQA 4U7DA 2XXAB 1DE0A 4B48A 1ZUIA 1R5NA 3KZ1E 2R62A 1ZC3A 5KNCA 3PR1A 1XTRA 1QHXA 1TVCA 3AP3A 4CEIA 2JJ8A 1E96A 2IW3A 3LO5A 1E63A 4TYQA 1VCMA 3WMFA 2JLYA 2AWOA 2C5LA 3OHMA 2ZM5A 1NVXQ 2GJAA 3CBQA 2RC6A 3TMKA 1SXJB 2EIXA 1G3IA 1U90A 3MG9A 1Y63A 1CNEA 4RJLA 2ZRLA 3D3QA 1UF9A 4M1YA 5HTKA 1Z2CA 4YDHB 1YRAA 3X1YA 1AGRA 5AUOB 2FG5A 3Q7QA 4M1SA 4PPNA 4QBGB 1J9ZA 2ZEJA 4BLSA 5FL7D 1W0KD 2ZI9A 4URZR 4C0AC 4R2IA 4Q1FA 1WP9A 4H1UA 1CULC 3AVXA 2CK3A 1NG1A 4OHVA 4X8OA 3G0HA 2FNAA 4QM6A 3SC3A 4I1OA 5H70A 3FKQA 2DR3A 4OQFA 5EE0A 4CDGA 1IN7A 3QI2A 3PEVA 1XTJA 4KFSA 2OXCA 4QRHA 1KK1A 4W5HA 5KU1A 4YALA 2OHFA 4C0HA 3R20A 1D2MA 4POAA 1DAKA 3I8SA 2NIPA 2KSQA 1VMAA 1EX7A 2OZEA 2VYFA 4ARZA 2ZRCA 3QENA 1WMSA 4R71A 3RS7A 3CNNA 1GM5A 5L3QB 2G1JA 2RGXA 1YZUA 2HMAA 2IF2A 2HJVA 1G21E 3CWZA 1DADA 5EXXA 1FNBA 5JRJA 2FZLA 3P4XA 4PZLA 2BM1A 3B85A 4Q9KA 5C18A 3SN6A 5EMNA 1T0HB 5CIQA 2F6RA 2MSEB 3QVVA 3CX7A 2OXRA 1AA9A 2OILA 1P4SA 3A1WA 3K9HA 3TK1A 4LX0A 1CR2A 1HUQA 1T91A 2VP4A 2ZI3A 2OAQ1 4HUQB 1J8MF 4LJ4A 4AKEA 2A78A 4XWAA 5DHFA 2DYKA 4DLTA 2OUKA 5BYKA 1PLKA 2O52A 2ZRBA 1HQCA 2VBCA 2CHVA 3TW8B 1EK0A 721PA 4AG5A 2VSOA 3DPUA 4DDVA 3VR6A 4OHWA 3U5ZB 1IB0A 2IBMA 4MYCA 1GR1A 1JR6A 5CITA 1N5LA 2J87A 1JALA 1NSTA 2ORIA 4LUCA 3BBPA 4BLRA 1NLYA 3DKVA 4DRZA 2IS4A 1QG4A 2IHYA 3SFZA 3O47A 1G3QA 4ACBA 3OEED 2CL6X 4UNSA 2ONJA 2EYUA 4K1XA 3TRFA 4MGZR 1H8HA 4TLAA 2IXGA 4PQRA 2GEUA 3AUYA 4DB4A 1E79D 4XTRA 3NBYC 2BBOA 3BAFA 1FUKA 1E64A 4N3GA 2ZSAA 4OK6A 1SVSA 3VR3A 1KDOA 5GVSA 3FDIA 2WVJA 4URUR 4ZO4A 2QMUA 3KQHA 4NCIA 2NO9A 2QPOA 3L0IB 1W1WA 2XB2A 5FPYA 2GZAA 2DCUA 1E2JA 1MH1A 4Q4HA 2OESA 2J0UB 1LTQA 3UWOA 2AR7A 1XCPA 1W0JD 2GETA 1OYYA 1OGIA 3P4YA 3B60A 4ACAA 3C4JA 4JLMA 4LJYA 5EUMA 4LV5B 2I1QA 1IN6A 2QGNA 1D9XA 2WJGA 5EE3A 2R6GA 2ZUBA 2YOFA 1E2EA 1L7VC 1R4AA 1OB5A 1M7HA 1E4VA 2XNJA 5CIWA 5JMTA 2ASEA 2OAP1 3SR0A 4OKSA 3ZBTA 4TQUS 4TT3A 2F1HA 2QPTA 2J45A 2E9SA 5F3WB 1E1QD 1G8FA 4HZIA 4EFNA 3F5FA 2CL0X 4NP6A 2QQEA 4R7ZA 5HPYB 1Z6YA 5H5JA 5FTMA 1KI7A 2BMJA 1E9CA 4ZV4A 3FVQA 3CMEB 2VQSA 2GEDA 1Q1EA 2QAGA 4G1UC 1TEXA 1TF7A 3D7MA 3ZQJA 4BPRA 4GMDA 2FV8A 3OZWA 1XD9A 5HCIA 2QQ0A 2ZRKA 4P4SB 3IILA 5E7MA 121PA 4B44A 2A5JA 1U2RA 2FEOA 1RRCA 3OZVA 2DBYA 3EA5A 4PANA 1JEDA 1DVRA 3EPHA 1W4BA 5CYOA 1EWYA 4QGHA 4URWR 4C2TA 1QX4A 2PMKA 1AZSC 5JWRA 1ZVQA 2QTVB 1XEWY 1XX6A 2Q3HA 4ZCLA 1QVGB 2ANCA 1NVWQ 2GXAA 1FMJA 5AR1A 4HLUC 3R8CA 2VNIA 3KQUA 3NBXX 4B3FX 4PAOA 3Q9LA 4JLAA 2WMNB 3C8UA 2FFAA 1W36D 4C7OB 4AKHA 4G1BA 4V0KA 1PV4A 3ZS9A 3EG5A 2P65A 2A9KA 1Z28A 4NYIR 2XZOA 3IO5A 2IYSA 5FBQB 5FUWA 4DZZA 2P67A 2RGAA 2OM2A 5HKKA 5K8IA 4M2LA 1MOZA 2JEOA 3RC8A 4C2UA 2WIAA 4HE5A 1T6NA 2QT0A 2XNCA 2QENA 3HPQA 5B2ZA 2QA4B 3CPEA 2YWEA 3WY9A 1E9RA 5E7IA 2ZIAA 1VQPB 2IS6A 5FUXA 4DHEA 3Q5DA 2HT1A 1FNMA 2D3WA 4CEJB 2GJSA 2IEZA 4RZUA 2VHQA 4V0OA 3KXKA 3L2OB 5F9HA 1D2EA 1OIVA 3FOZA 2FPMA 5G40A 1K8RA 2QP9X 1ZC4A 3BXZA 4EKDA 2ZRFA 4JMPA 4OK3A 1JJVA 2C03A 1JNYA 1KDRA 2LKCA 4HEJA 2KB0A 1SVKA 4D4LA 1FQJA 1G20E 2GWHA 4ZI2A 3ICQB 2F1IA 4RFSA 2KBFA 5JZVA 3EPKA 5BN3A 3AEZA 4BFSA 4JKIA 1P73A 1KY3A 4A6XA 5JHGB 3W2FA 2BKEA 4Q21A 1X1SA 1GP2A 2NG1A 3W8RA 1J70A 1HH4A 3CONA 4DKXA 1KAOA 1VQ4B 5GVRA 3SYNA 3L82B 3MWYW 2QEQA 4R2HA 2JLXA 2IYZA 1GNPA 4JBXA 2WJVA 4HLUA 1YU9A 1KI4A 3AGQA 2QAJA 3QKUA 2IC5A 3LVRE 2IUUA 1E0AA 3SJCA 1N6RA 1KK0A 1E2PA 3TNFA 1CJTC 2C9YA 2EVWX 1VYTA 1G8GA 1OH8A 1WE2A 2VRWA 4D2IA 1OF1A 4Q7MB 5JBQA 1HEIA 4PO8A 4DLRA 5C46F 3CW2A 3EZ7A 4WAUA 3UWKA 2KI5A 4FINA 3LD9A 4DVGA 1H42A 1D2NA 1FFHA 1S3SA 4LY6A 3OFNA 4MGKR 3IGFA 1JA0A 1CKEA 2HV8A 2ZRHA 4BECA 5FPKA 3VNUA 1FL9A 4AKGA 4PHTA 2CRVA 2WAYA 2P6NA 2VF8A 3D8BA 4RD4A 3IKJA 5EP4A 1Q3HA 3PV0A 1KI2A 4BASA 1BYUA 4DC9A 2O5VA 3AH8A 1ZYUA 1G41A 2GK7A 3DM5A 2CLSA 2DWOA 4I1UA 3ADDA 1J2JA 2F3TA 4TL7A 1IJEA 1MABB 4LOAA 3CCQB 1GOTA 2ODBA 2ZQ5A 3M6AA 3T1TA 3NBFA 4JSTA 4KFRA 4YLGA 3K8YA 2FZ4A 4RD1A 1N8RD 1R2QA 5FBRB 1Z0AA 3AVUA 1DEKA 2EWVA 2OEPA 4OQXA 1ELOA 3TR0A 2QG6A 4NMMA 5CDFE 1ZUHA 5JCPA 3T35A 5GJVC 2ZU6A 2WZQA 1F3OA 4IDHA 3C15C 4D25A 1U9IC 3P32A 2QROA 1P9WA 5KOYA 2PT7A 2NOAA 3DZDA 3E2IA 1OPXA 2RH5A 5LDDC 2YNMA 3ECCA 1WRBA 2ZR0A 2GAOA 1WQ1R 3T15A 3IEVA 4M1MA 1C1YA 1GDDA 3V9PA 1M7GA 4Q5IA 2W0MA 1JB9A 3W8NA 4DSUA 3SQXA 2AK2A 4KBGA 3H86A 3CC7B 4E5UA 3PVSA 2IK8A 2C2HA 1X8KA 3DO6A 5B57C 4JIMA 1NLZA 4FWTA 3A36A 3A4NA 4UJ3A 5CYPA 4KVGA 4IVPA 3U7FB 1YIJB 4B6EA 4DIEA 2VHUA 4Z8XA 1C4OA 3R8FA 3BERA 4UJ5A 2JJ1A 3KQKA 1N6PA 2YINC 3KJIA 1ZCAA 4JYBA 3LO8A 4FD2A 4A2WA 3LW8A 1N5IA 2O8FB 4E03A 1DOAA 3NHAA 2ZAMA 2ZRJA 3T1QA 3PUZA 4MRVA 5F2EA 1KSHA 2GF0A 2L0XA 4MITA 2WWYA 2D7CA 4HDOB 3MLEA 1G5TA 3CPJB 4KI0A 3AKEA 5GV7A 4LCBA 2IA5A 3ZZTA 4MRRA 3V00A 4YMVA 1SVLA 3U4QB 3GJ6A 2BMEA 2JCSA 1JECA 2HXSA 3MD0A 4KSBA 1N0UA 1RIFA 2BOVA 3OZUA 3U6KA 3KXLA 2D2FA 2IUTA 1XD2B 2ZE6A 4A4DA 4O2LA 2IEYA 4LHVA 1NL3A 1P60A 1CIPA 3R7WA 2OSBA 1NN3A 3IQXA 1ZM3A 3UMSA 3GLGB 4MA4A 2H8KA 1U9IA 4HB3A 2OT3B 3RSLA 2ZPTX 4QBIA 1VG0B 3NBZC 4LHZA 1XJCA 3RABA 1YR7A 3NH9A 2GTPA 3K70D 1I4LD 3L43A 3K09C 4JJZA 4Q9IA 4M9ZA 2J1LA 4ZIRB 4C0LA 5L3SA 2B7CA 3JQRA 1R0YA 3FKSD 4G5RA 3KKQA 1NKSA 5FA6A 2FSHA 1PVOA 5JWHA 1ZD9A 3AF4A 4XTCS 5C4GB 1OHHD 3SYKA 4LBWA 5FL7A 1N6HA 1F2TA 1W0KA 3K9LA 4QHSA 1PZNA 4IDPA 4MQBA 4YMSA 3GFTA 4CW7A 2O8CA 1XDBA 3THYA 3LQQA 3FMPB 3W5VA 2R65A 3W3ZB 1E6CA 1S9HA 2A5FA 1XP8A 2QMHA 4KHZA 4D0LB 1S9DA 1F48A 3KUDA 2O8EB 4B32A 1FUUA 3EIHA 3FPAA 4JLKA 4JL5A 3IHWA 5J4LA 1AS3A 1TX4B 3CB4A 5KHOC 1SVIA 4X8LA 1I4TD 3H2YA 4B3XA 5JSZB 1ZD8A 1Z0JA 1TLLA 2RGCA 2F3RA 4WQMA 1YI2B 1AS0A 4A9AA 3U44A 3AB3A 5JI3E 1TQ4A 1ZU5A 4B76A 5E4FA 4AF6A 4LYAA 1R5OA 4HAUA 2JLUA 2VLIA 3MSXA 2QEXB 3LA6A 3U7GA 4KYUA 3SBEA 4CF7A 3QFSA 2OFWA 4JL6A 4JLVA 2VP5A 4B47A 2AL7A 5E7JA 3ZVLA 1K6MA 1N6LA 2QNRA 3KUCA 3QG1A 5JRZA 3I73A 4WBSA 5IK2D 2O0JA 3X1XA 4PHGA 1W5TA 2V55B 3HP1A 4WZAE 2H16A 4HAXA 2ZI6A 1Q1QA 4EDHA 4QGFA 3GLFA 2ZRNA 2VO1A 3QFTA 5IT5A 4IOMA 2FFQA 3B1WA 1N25A 1YQTA 2BWJA 1XZQA 4PPGA 2G0NA 1GZSA 4URYR 4A0HA 4EPTA 4DLYA 1CR0A 1LVGA 5JS8A 4ZGNB 3V76A 2V54A 4Q9JA 1GUAA 3I5YA 4GP7A 2ZRMA 4H1VA 1Z6XA 3SNHA 2WWWA 3RWMB 5AUPB 4OI0A 5GJBA 2ZVPX 1SM4A 1UBFA 2Z4SA 2BDTA 4ZI3A 4TMTA 3CKLA 3KQLA 1OH6A 5FBVB 4DEXA 3BB4A 3OEEA 3R9XA 2Z4RA 3LW7A 4B74A 1CR4A 3HYTA 1IXSB 4G5GA 2WOOA 2XZLA 3WNDA 1XEXB 3IQWA 2ZS7A 3TKLA 3VR2A 1W2BB 1CR1A 2G83A 1S4QA 4HB2A 1OFHA 1W36C 4CT5A 4DCUA 2OCPA 2YYZA 4MYUA 2YWGA 3PEWA 1BO6A 1OYWA 3U2QA 3LDAA 5JS7A 3H0KA 1W0JA 2J7KA 3A8TA 3BFXA 3FHTA 3L8YA 4PC1A 1QVRA 4ABYA 5H1YA 3C5CA 4A82A 4TMKA 4KODA 5DH9A 5FH9A 2J3EA 4Y9RA 4BE7B 1ZBDA 3HU3A 1TADA 3TLXA 3TSOA 1EFCA 1ZNZA 4DWJA 2QBYA 3A58B 2XZPA 1UFQA 4NBSA 621PA 1KI9A 3MGCA 2O8DA 4BLTA 2KE5A 3ADBA 1DAIA 1E1QA 1Z06A 3RDPA 3S1AB 3I3SR 3JVUA 3EPLA 1TUIA 2GCOB 2BF4A 2C9CA 2RMKA 4Q4JA 4Y0VA 4B3GA 2ZJ5A 3B78A 3QXSA 4G5SA 5TARA 2DEUA 1DAFA 3CUEF 2ZI5A 1R8SA 3K0FB 4U02A 1BX1A 2BEJA 2HF9A 3KFVA 2XNSA 4JLBA 4JVMA 1QGYA 3U3OA 3EIQA 3UMFA 1NF3A 4NDZA 2OTLB 3HWSA 3GLIE 2NO6A 5G3ZA 1KZGB 1E9EA 2CNWD 1QH0A 2AFHE 2D06A 4GI7A 3A1UA 1SVWA 3VFDA 2DHRA 4TTPA 4JJKA 3MJRA 3NDPA 1XPOA 3K9GA 3SHWA 1YZQA 4TLBA 2JLZA 4JLNA 2QRNA 1N0VC 4YAWA 4WA7A 1NY5A 2W0SA 3QFRA 5GJCA 3UK6A 2IYUA 1SHKA 4I1VA 3I55B 1UPTA 3RS2A 2ZUDA 5B30A 3VR1A 3N70A 4JVSB 1U99A 4OK5A 1KI3A 3TVDA 3VX3A 4DLZA 2KWIA 3B1YA 4P33A 5DI3A 3RANA 2W00A 2VSXA 3WMGA 1E2NA 4KFUA 4DSTA 2O8BB 3VMFA 4GOJA 4Q1EA 4A15A 1E2MA 1WXQA 4WZBE 4M53A 3ONWA 3QF4A 3QKRA 1DG3A 1XBTA 2QM7A 2Z83A 2PIAA 3FWYA 3NG1A 4URVR 4G1VA 5IRCD 3CH5A 4TZ0A 1KY2A 5KNDA 4CYMA 5KDLA 2YKGA 3SU8A 3J81k 1M1KD 3KKPA 2MSDB 2MSCB 2ZAOA 5JI2E 1OE0A 3G82C 1S0UA 3IHLA 5CDFA 3W6NA 4BPBA 4C3ZA 4ITRC 1J7KA 2D2EA 2RGEA 1UKYA 2W2TA 4DEYA 1E2FA 2OCYC 1GKUB 1G64A 1ZJ6A 1QHIA 3QG5A 2R6HA 2ATXA 3AP1A 4M8NE 4C9BA 1VQMB 1VCOA 2ZREA 2CDNA 3DL0A 4LGMA 2VZLA 1LB1B 1WDTA 1JR3D 2FSFA 2P6UA 1II8B 4M9XA 5DLQC 1UKVY 4RFVA 4OYHA 3A1VA 4YONB 3ZJYA 3THWA 1RRFA 1X6VA 2GPJA 1VQ8B 4NYMR 1EGAA 1JQJC 4A36A 1N6NA 5IHPA 1CF4A 5AJXA 4JSYA 1E9SA 2GVZC 4U5XA 4XD7D 1ANKA 4P0TA 4IHQA 3EWSA 3WBKA 1GITA 2W83A 4L9SA 4PR0A 3ZBUA 1SQ5A 2C99A 4D0NA 3FMIA 1Z0KA 1Z3IX 1XNJA 4Z8YA 4Q47A 4RD2A 1E2IA 3WNCA 1ZINA 2WWGA 1IONA 3E70C 1Q0UA 3ZDQA 3FJOA 3IIMA 3P1JA 2W2VA 4US2R 1A7JA 5FBWB 5JJLA 1UBEA 2P6RA 2JASA 3PUYA 1II9A 2A30A 3QVUA 4XWKA 3THOA 4D0GA 3KKOA 2QL6A 1KSGA 3TUZC 2I3BA 1SKYB 3JZAA 2WBLC 2QORA 3HPRA 2B8WA 1F6BA 2A5DA 4WXPA 1KZ7B 4Q19A 5SZKB 4HE6A 3CCEB 1T5IA 1F2UA 1UKEA 1KKMA 2IYRA 3QE0A 2WWIA 3GD7A 4PC7A 2X19A 2PX3A 4TTRA 1CTQA 1XEWX 3KTAA 2YZ2A 1Q1BA 3FMOB 5HXBA 4LYJA 4MRPA 5GV8A 5BYJA 1XXHA 1EP2B 1Z83A 2C96A 2W6JA 3RWOA 5TV2A 3K0CA 1P75A 1N5KA 3IPYA 1KI6B 3GLHB 2QRZA 5LB4A 4EJSA 5KDOA 3THXB 5LD2C 3I8XA 4JVNA 1E1RD 2GBLC 4BFTA 2XJ4A 3EASA 2FEMA 3KFXA 5CM8B 2QMEA 3OZXA 4QJ4A 3VU9A 2GKSA 1CNFA 4EPVA 3QQ5A 4Q4LA 5BWMA 1Q81D 4U00A 2CCKA 4Q1BA 1D8TA 3W2HA 2QI9C 1RZ3A 1KYIA 2WJYA 4A0RA 1GAQA 1MO3A 2XITA 4GSYA 3LBIA 2BBTA 3EC1A 3ADCA 3BIFA 1GIAA 5GJWC 3I56B 1VECA 5CB6A 3KB1A 1LW7A 1EXMA 2YJTD 2BGIA 3U3KA 3K70C 5AN9A 1JR3E 2ZYVX 1QHHA 2PCJA 2IS2A 3QUSA 5F98A 2ODNA 3CCLB 1U8YA 3DKPA 4DCNA 2J0VA 3B8HA 1ZRHA 2EWWA 5FOWA 3MRSA 2QAGC 1FRQA 3Q5EA 4F93B 2VPPA 2BN4A 2ZRPA 3EC2A 4MYHA 2DY1A 1FNCA 4AF7A 1D1NA 1K5DA 1W4CA 4RFSB 4V0NA 1DARA 1NMYA 3TUJC 3VAAA 2X77A 3VQTA 3X1WA 2BJVA 3MWLA 1Y3AA 2CJWA 2JDID 5JFGA 5JWOA 1U0HC 3P20A 4PFSA 1CJVC 4DJTA 2BSAA 4TMZA 2WICA 1Z07A 3QEOA 4IOLA 3SFVA 5KPDA 1Q21A 2CHGA 5FTNA 1ZM9A 3I1FA 2ORWA 2NMVA 4MUBA 2GBLA 3IO3A 1Z5ZA 1ZUNB 1RE0A 3OIUA 1JPJA 2DWPA 4PO9A 2WJHA 4A1FA 2CCJA 3PUXA 5DYGA 1FZQA 1S1CA 4YQFA 3Q7PA 3W90A 1EWRA 1VQ9B 2ZJOA 2CHQA 4G3XA 1RJ9A 1Z0DA 3G6EB 1VIAA 3RS0A 4CEHB 4JBWA 2N1BA 2X2EA 2ZJAA 5EXSA 1ZMXA 1QHSA 4EH1A 1US8B 2IXFA 3L8ZA 1GRNA 5JEEA 1U0LA 4GT1A 4GL2A 3W2EA 3EZ9A 4NKRA 1KMHB 1MO6A 1N3BA 1W44A 4I1SA 2OTJB 4TZ6A 2QTZA 4DCTA 1ESMA 1YR8A 1Z6TA 2WAXA 3CIOA 1YZTA 3IPXA 1Q3TA 3QKSA 1DDIA 3K0AB 3C14C 2OFXA 3BJIC 4NZYA 5DNYB 2ERXA 2OE2A 4DLUA 4LYFA 4BFZA 3FKSA 3BOSA 3DMDA 3UKDA 2YOHA 3OF5A 1VHLA 4LJ9A 3TQCA 2PZEA 4BFYA 4BGDA 1D6JA 1Z63A 3PEUA 4LV6A 3U3MA 2XXAA 5FBLB 4LI0A 3GLFE 1HYQA 3B7GA 1OHHA 2IYLD 4YAOA 1YJNB 2PZFA 3PCRB 4LRWA 4CZ2A 5DHAA 1IQPA 1NIPA 4MKHA 2HCJB 3ADKA 3CZPA 1IOZA 1E3MA 4TSFD 1E2KA 1YITB 2P5SA 4D4MA 4LPSA 3EX7C 3LAWA 4OHZA 4PQFA 3PFIA 4Q1CA 3WP0A 3H84A 4URXR 4TYWA 1ETUA 3BH7A 3TH5A 5KUTA 1J8YF 1V5WA 3OJWA 2GQFA 1QFZA 1OXXK 2WWXA 5A5GA 4BRUA 2QE7D 3TBKA 1NMXA 3Q3JB 3O8RA 2C04A 5SZJA 4W9MC 1FRNA 1ZAKA 2Q21A 1I2MA 3AVVA 4OQLA 4PZYA 1ZU4A 4FXPA 2J41A 1SZPA 1P2SA 4IW3B 4GP6A 2N42A 4RD3A 3IEUA 1LF5A 2G88A 5CLLA 3QSYA 1YVDA 3F8TA 1J90A 3BFKA 4HAWA 5AJZA 1NVVR 2ONKA 4PSVA 1LY1A 5BN5A 1Q20A 4Q9LA 1KMQA 1R6BX 5F9FA 1KO8A 3T1OA 2WPDD 1K8AD 1XE1A 2Q3MA 2JGNA 4O3MA 5D3MA 2O0KA 2ZE8A 4DUGD 5IK2A 2DWQA 3RS5A 1DELA 3MFYA 3ZZ0A 1NN1A 5L3QA 2LKDA 4P31A 4YHBA 1VQ6B 3RSOA 1KI8A 1TNDA 4Q03A 1N2CE 1NIJA 3U3JA 3GLIA 1VIYA 4M4SA 1MV5A 4QC2A 2BV3A 2OBNA 1UEIA 1NSFA 2HUPA 2PZGA 4PX9A 1Z0FA 1XPRA 2ZYTX 3NC1C 1R0XA 2R6FA 4HUQA 3CCVB 4KU4A 1XJ0A 1YKSA 1A1VA 2BEKA 1QG0A 1KQSB 2Z5FA 3T12A 3FFAA 3AVPA 3NXSA 4JLPA 5DISB 1D5CA 2BIFA 3E1YE 3SOPA 2H92A 2C78A 3DM9B 2WM9B 2CVFA 2F43A 2PLRA 4XSGA 4K81B 2GZHA 2OV2A 1QFYA 4NU0A 1FTSA 3RVBA 1CLUA 4OJKA 4C30A 1AGPA 1QUEA 1XTKA 4GZMA 4ZKDA 1JXOA 3O8DA 4C0QC 1FNNA 3ZVRA 1E2GA 4X8HA 5DE3A 5ELXA 3GJ8A 5C1BA 4HAVA 4YMUA 1IY1A 3W6OA 2I4IA 1F2TB 2YV5A 2BVNA 1AK2A 1G8YA 5H59A 2A5YB 2CNDA 4GPTA 1NBMD 3ZZUA 3D6TB 1TF5A 2DETA 1COWD 1F20A 4MRNA 4RKFA 3AVYA 5KNBA 4LBYA 2W6JD 3GPLA 3U7HB 4Z51A 2VHCA 4DQLA 1ZM7A 2IYTA 2VYQA 1P72A 2J0UA 5JJKA 3G4SB 1EFHA 4W5WA 2DPXA 2ODWA 2YC2C 5B64A 4FI3C 2VHJA 3NDBB 2NTYC 1Q22A 3VO1A 4UAJA 3BGWA 1BOFA 3ASYA 1G7SA 2J5XA 2JLWA 2ZI7A 3I62A 4P32A 5K8TA 3DDCA 2V1UA 3CR7A 1SVMA 3U44B 1P7CA 1Z6GA 2OK8A 2UKDA 1OXVA 1ZCBA 4MDEA 3AVQA 4GMXA 1N6KA 1OIWA 2GXSA 4E22A 1IAQA 4EIWA 1NRJB 1Z2AA 2H1LA 2V4ZA 1E4YA 4UXIA 2CNWA 3REGA 1DO2A 3W5IA 5EZ5A 4M22A 2VNHA 4GZLA 4DT1B 3BB1A 3UATA 1RPZA 1HTWA 1L8QA 1NMZA 3LNCA 4BZXA 2RCNA 5KTYA 4P4SA 3JQPA 2J0SA 1KJZA 2C98A 1GSIA 1KNQA 1XJQA 3RRZA 4OQMA 2ZJ2A 5SZHB 4KO8A 3VHLB 4AK9A 2V8OA 3M4YA 1BH2A 2VTKA 1M6NA 4GBMA 3PJRA 3GCGA 1CRPA 1VCNA 3K53A 5AWFC 4L8GA 4D4KA 4DLVA 1KK3A 4V0LA 1TQDA 4D26A 2GNOA 1NVUQ 2NO0A 5FTLA 1Z29A 2REOA 2BBWA 4EFMA 1XD8A 4C7OA 2I1VB 4WIAA 1QGZA 2D4HA 1KO7A 3LVQE 4P4UA 1G16A 2GXUA 3T61A 1KHTA 1ZNYA 3TW4A 4EPYA 1XPUA 1EP3B 4ZPXA 5BQ5A 1O87A 1FX0A 4ZDKA 4JL8A 2B6HA 2W2XA 4TYYA 3WXMA 1NBME 1A2BA 2EU8A 2PJZA 3GEEA 4Q02A 1W7AA 1XXHE 4HB4A 2GJ9A 2OLJA 2ZRDA 4OL0A 2FFHA 2CE2X 5KO2A 4FWIB 1QRAA 4RD0A 2XNDD 4HLCA 4FN5A 1E94E 4ZDIA 3LLMA 1A4RA 4Q9HA 1PJRA 3CLVA 1T3HA 3EARA 1MKYA 1JR3A 1OKKD 1CBUA 3W9YA 1RRPA 1JJ7A 3CR8A 5J5CA 3HU2A 1ZIOA 4K46A 5AK0A 4MYTA 4EQ6B 4XVQA 2QN6A 3MUFA 3MWJA 4CEJA 1G6HA 3CPHA 1U98A 1NN0A 1KAGA 4FMCF 5HZHA 2V3CC 4BFXA 1R7RA 1AS2A 1QHGA 4G0NA 4OQNA 2FA9A 1P5ZB 4RCYA 1T8UA 1S2MA 1U0JA 4XD7A 2R6CA 3HJNA 1Q57A 2ZE7A 5IDVA 2ZSFA 2O8DB 2ORVA 2OCBA 3QBTA 4YAFA 1TEVA 2JLRA 2WIBA 3OIWA 4EJSB 4OHYA 1OXSC 3PIRA 5B58C 3TIFA 4BEJA 4Q01A 1YHQB 4A8JB 2XTNA 5HCNA 1OT3A 2OO7A 1QGAA 4O0MA 2G9NA 1GRRA 3VX4A 4QL3A 1KSFX 4BFWA 3X2SA 3JZMA 4LBZA 3IUYA 1JA1A 3AGPA 5EP1A 1VTKA 3SYLA 1IM2A 4UXHA 5HE8A 3WP1B 1SXJD 1BKDR 2F1RA 2IHBA 2QTLA 2GHIA 2REBA 3QPVA 4CIDA 2GEVA 1QHYA 3B2EA 1G7CA 3SI7A 1R10A 3T1VA 3U61B 1XMIA 2FGJA 3PUWA 4PSKA 1W48A 2Q9CA 1UEJA 5M04A 1JAHA 4ZCIA 4ON9A 1GVNB 1WF3A 4Q48A 4NCKA 2WWFA 1EX6A 1E1RA 3X1DA 1DBSA 2ZXUA 4IFBA 5LB2A 1SHZA 2FN4A 3LH5A 4BZQA 2F55A 5EE1A 1G3UA 4ZDJA 1OFIA 5IF9A 4AWXA 2HT6A 5FR1A 1M7BA 2GF9A 1J99A 2ZS9A 3GJ7A 2REXB 2CEAA 3N2IA 4I81A 2IYVA 4RD6A 3CF6R 4KBFA 5EP2A 4YMTA 2LWIA 1NP6A 4LHXA 5E3HA 4HZUB 2HLDD 4NTZA 4C0KA 3IBGA 1XTSA 2BPOA 1EFRD 3CNLA 4NE2A 1R5BA 4GFDA 1MABA 1ZIPA 4AIIA 4DDWA 1IXZA 3KL4A 1Z47A 2A5GA 1FDRA 5TVKA 1CRQA 221PA 1P2UA 1KIMA 3A6PC 2VHTA 3I72A 4Q4AB 4C0BA 1E32A 3LVBA 3CPWB 1E9AA 3G71B 5FFMA 1M8PA 1T5LA 3B9PA 5HE9A 2B21A 2EFEB 3DVLA 4Q00A 4RZ3A 2EFCB 1KRHA 2QMOA 5FPSA 4C0SA 4Q7LA 3ZS8A 3RHFA 4AURA 4F4JA 2JIZD 3TR5A 5FOXA 5FUVA 1LV7A 1G18A 4TL9A 3CNOA 5FPHA 4ERNA 3NIBA 3SQWA 1VYUA 2B7BA 2JDIA 4D6PA 4LJ6A 2W58A 2NZ8A 3LXRA 5JHHB 4KITB 5EJEA 4CEIB 3MMPA 1O3YA 3KB2A 2QSZA 1UAAA 1VKJA 1G4AE 1B23P 2EFHB 2Z43A 2ZROA 5EZ6B 1KDPA 1SXJE 1FTNA 1QUFA 3AF3A 3GJ0A 5JECA 5D3QA 2V9PA 3FB4A 4M1TA 4GRAA 3KDSE 2A2ZA 5ANRB 5K8UA 1N5JA 2O8FA 3TSWA 2WSMA 3RS3A 1G8HA 2QDXA 2F9MA 2GILA 3CC2B 1G1MA 1AJEA 1G6OA 1RC8A 5J4YA 1SKYE 5FOUA 4D82A 2QU8A 3DHWC 1KGDA 3SJZA 4Z1MD 2P3SA 4N3NA 2QTHA 1T8TA 4LHYA 2AX4A 2WWHA 1RKBA 2ZU0C 1KNXA 4FMCB 4KLNA 1OV4A 4KVAA 1IBRA 1Z08A 1IXRC 3GLHE 4B43A 2ANBA 2PMDA 3SS8A 3ZGXA 5TMPA 3CD6B 1AZTA 4F91B 2OCAA 1BMFD 2YVUA 4IKEA 2PBRA 3CX6A 2J59A 3LV8A 4HATA 4ARZB 3QKTA 4MKGA 4MH0R 5FL3A 3GLGA 1DDGA 2H7VA 4LJ5A 2X3UA 4XH9B 4PZZA 5TXGA 5DSZA 4FMDF 3WYAA 3E20A 2QP4A 2X2FA 3PXGA 2HDNB 2FJUA 3EIEA 4M21A 2PT5A 1HURA 1T4GA 4JBYA 3WYGA 4PC3A 5EXTA 3MJHA 4ZIRA 3CWQA 1TL7C 2AD1A 2YWFA 2WKPA 3QXCA 4JVLA 4TSFA 3U60B 2CMKA 3OAAD 3X1ZA 5DN6D 1YE8A 1RYFA 2X8AA 3CM0A 3VNVA 4TQAA 3RC3A 4WXRA 2C77A 1UM8A 1OH7A 2ZR7A 4FCVA 3PITA 1KJYA 1G3RA 3LBNA 4LJ7A 4PPFA 4DB2A 2WHXA 3R9IA 1XU4A 4ESVA 1BX0A 1AMOA 2H5EA 2QE7A 3MWKA 4KYIB 1X3SA 2FOLA 3NEYA 4NHOA 4PAMA 3ICEA 3LRPA 3FPKA 1ZM4A 4M0LA 5A0FA 3RRMA 3W5UA 1X8LA 1IY2A 5DI9A 3ZD7A 1AQYA 1VPLA 1HE1C 2O8EA 1TF2A 3AVOA 3MHPA 2F9LA 5KSYA 3ND9A 4IOJA 4JLJA 2AHOA 2FMXA 4NCHA 5TB5A 5JSZA 4DSNA 1DTSA 1WCV1 2GAAA 1I4DD 2WPDA 3K0CC 3QF7A 3TJZA 4EJSC 3PUVA 2PEYA 1U94A 1OGJA 3RRNA 4AC9A 4IEIA 1W49A 1Z22A 2MMGA 2GZDA 3LWNA 3LXXA 3OEHD 4R9UC 3JQQA 1YJ9B 1UMKA 2GCNA 3OESA 4IOKA 1BYIA 3I32A 3SBDA 2RKOA 3ZYCA 4AYTA 2D74A 2FX3A 2JATA 3ETLA 4H9GA 4TQ9A 3V4FA 2BM0A 3WHKA 5C2JB 5J4HA 1VHTA 2XTZA 1G17A 4Q4HB 2R9VA 1MT0A 1WA5A 2YWHA 3NEJA 1TUEA 1XCMA 1XTIA 3BE4A 2VNJA 1AN0A 4MRSA 4XJXA 4QHTA 1LNZA 1QVAA 3EZ2A 3AKCA 2Z0MA 4YDSA 3GJ5A 4QKQA 2HCBA 1HT1E 2QPAA 3SEAA 3I4LA 2DFLA 3GQBA 1RW4A 2R6AA 1EWQA 4HDQB 1G4UR 3CC4B 1CU1A 1A5TA 1XMJA 1E0JA 5KSPA 1PLLA 3RRYA 4LZZA 4A2PA 1KO5A 4NYJR 3QKSB
chains in the Genus database with same CATH superfamily
1ODTC 3DL2A 1IVYA 2PQ2A 1EEHA 3FHOA 3QUCA 3ESZA 4KQ2A 4X84A 2NUTB 4U7PB 1DL5A 1K7YA 2VZ8A 3PZBA 2DECA 2G71A 2HWKA 4P54A 4Y9DA 1LI5A 5TEVA 4BCDA 3RJ9A 4DGQA 3CRRA 1AXGA 4PBRA 4TL8A 2R79A 4L8JA 1EAYA 1GTMA 1LH0A 1ADFA 3I6QA 3H99A 1K73D 3VKFA 2QIPA 2JJ2D 1ZH2A 1QBKC 1T43A 5LP1A 3JCZA 2QVYX 1KOJA 3IDQA 2X86A 4CFYA 3W2TA 4GIBA 3A4YA 3IP6A 1UBCA 4FYIA 2BKUA 1Y6FA 3SX2A 1P2TA 2ACEA 2J3KA 5CK4A 3CS3A 3UK7A 2WIGA 1I7PA 4IXDA 4KQWA 4MAAA 2GAJA 2BI8A 1BS1A 1YZGA 3ILVA 2DERA 1QH1B 1T1JA 1OSNA 1XKTA 1ZRMA 3Q3IA 5SY9A 5EC8A 2ZBUA 4C01A 2MU1A 4FX2A 1AUXA 1OD6A 2FPXA 4RPKA 2BRUC 5KJCA 2J7PD 4L73A 2V7UA 3H0EA 1U65A 3LWDA 1HA3A 2RGNC 5F12A 2XXJA 3T06B 1ZI9A 2P9YA 2VSFA 3VPFA 3UGJA 4QM7A 2IW1A 4RETA 5ADHA 1FRFS 3GVCA 1EGVB 4FR5A 2DTXA 4GKVA 3P9NA 1EQAA 2O19A 1SC9A 3ANSA 3TL6A 1ZA2A 1GYQA 1DO8A 4HNUA 4FGKA 5E0OA 1U8ZA 1YBVA 4GZ5A 2PNJA 4DK0A 1TVKB 4Q66C 4QO8A 4ZQGA 2AJDA 2XVAA 5T3YA 5TQVA 1NT4A 3VH4A 3VKHA 2NP6A 3W5HA 2XOKD 2CYBA 1EFAA 3D8TA 3DZGA 5BN5B 5ADUS 4WPGA 1L2TA 1CUXA 2GCOA 4XRGA 1L4YA 2D13A 3FNFA 2Q3FA 1J0EA 4KZKA 4UREA 2XADA 3OTQA 4REMA 5KMGA 1I5EA 2IYYA 1M75A 1HDXA 2Y1FA 4RJ2A 1BDJA 4MUHA 3TRIA 4YRMA 4HJXA 3EIXA 3SQMA 4F3RA 3KKZA 3K0FA 5J4KA 4TWAA 1H2AS 4S35A 1QIHA 1T9HA 2P11A 2C20A 3H6KA 3NM6B 5HNKA 2H57A 1DMSA 2AC4A 2GF2A 2HMUA 3RTAA 4BBJA 4DNRB 5JAPA 4BUJA 1WXWA 3GCWA 3TGPA 1H5QA 1GVHA 2W2LA 2I34A 3I0NA 4CODB 2NTJA 4DS3A 1ZEJA 1AVTA 2OGTA 1E2DA 1SUAA 3NHBA 3OFKA 4TSRA 4TV9A 1XF9A 3UKJA 4ZEMA 1AM4D 4HJRA 3C98A 2Z6BD 4ZHQF 1RYHA 4GI3A 3EFBA 3TTSA 3HYLA 4EO4A 4HPXB 2MR6A 1Y9AA 5JZMA 3I2GA 4FLEA 3DAPA 3GJ3A 4IF4A 4WESB 4NG4A 3SM9A 1NE2A 4D9JA 1MIOB 2DLNA 4YR9A 3ZUGA 1IMOA 3IAM1 4R69A 1B3RA 2CJFA 5THXA 3ZEIA 4HH0A 2G5GX 1CUFA 3E5HA 4GSKA 2XHEA 4RSMA 4F92B 2QTTA 4YLEA 1YMUA 2G0AA 3WL7A 5FA5A 4HDCA 4GF5A 4EB3A 4CIYA 2BRUA 1VE5A 4F60A 1JDBC 2YJ4A 4L0MA 5DBOA 2XKAA 5L51A 2RGNA 1U9YA 3UCEA 4WZBB 3DMHA 4WA8A 1GL9B 4Z3KA 1J5XA 4J9UE 5HZAA 3SMQA 3VOBA 4FN4A 3IKMB 3LQRA 3JQ9C 2QV0A 3EDOA 1LTHR 1DEHA 3PNQA 3QY0A 4PW0A 4GR4A 4EX7A 1NDHA 1Z62A 3DEFA 1XTBA 2YMQA 1JDPA 3B9QA 3FLAA 4YJFB 4I5EA 2R0QC 3AKDA 1NXPA 1TPZA 2QE6A 3OT1B 4GG1A 1QE3A 4JBHA 4UHJA 3VSCA 3DLIA 3KSMA 3HVHA 3VVLA 3ZY5A 4E6EA 5J47A 4MQEA 1OLSB 1HL7A 4P7JA 1QRTA 2J0EA 3TKAA 3I52A 5CM9C 1GSHA 3E9QA 3GZTB 4XYLA 3Q8XB 3CF0A 4GSLA 4R3WA 2QLLA 4ARUA 2V98A 4TYPA 1IQ0A 3UJBA 1HFEL 1Z35A 3M4JA 4L8LA 1L8XA 3PRYA 4CQLA 2H18A 3JR3A 4HQKA 3GXBA 4QRIA 4CKEB 1NW3A 1NWCA 1QMPA 5BSMA 2VA8A 1SO8A 3RBAA 4AM8A 4MIKA 3H9CA 4AX4A 4RULA 1NM5C 2YHSA 4MR7A 3OCWA 1XCLA 1W46A 3FYUB 3OT4A 4HEHA 1VLOA 4MVJH 3AKZA 3WNQA 1G5PA 1V6CA 4PLVA 3C2QA 3HXTA 4FP9A 5BY2A 1E7QA 1M8GA 2AK3A 2AG6A 1KORA 1L5ZA 2D0IA 2O06A 4V03A 3NVMB 2BGJA 1MRNA 2MINA 2XJ9A 1B76A 1JFVA 4OB6A 4LTNA 1GTSA 2DX7A 2OBLA 3O8CA 4ZI7A 1LQTA 1P9NA 4TROA 1OH5A 1NUSA 4H0FA 4ITVA 5LMUB 3G5TA 4IO0A 1KO1A 1NJGA 1NVVQ 1QZZA 1Z4LA 2EDAA 4J7UA 4MCJA 2G08A 4BO2A 4DLAA 2P2DA 4S12A 5DPMA 4C07A 3K71B 1RI3A 5LBIA 3A05A 5I5EA 1VSBA 2HO4A 1E2LA 1YU6A 1RABA 3R4VA 3B1KA 1C81A 1JSLA 3P0IA 4D81A 1VKHA 4GDMA 3RYTC 2NV6A 1HZZC 1TQ6A 3JQ9A 1CEXA 2B69A 1MX9A 3G89A 1GAJA 1ORRA 1IBMB 4DLKA 3THXA 3EFOA 4KNWA 3U81A 3RYCA 3WLRA 2HLDA 1GAWA 1DC8A 4FGLA 3CZ5A 1GTJ1 3ZWQA 4DLLA 3SYRA 1KP9A 3LUDA 4EHNA 3A9WA 1VBFA 3LUPA 1B42A 4WZTA 1JMKC 2JB9A 2SBTA 2XTMA 3SF8A 2RI6A 821PA 2ZANA 4J94A 4KR6A 3A1NA 5GINE 2J08A 4EUKA 2CL5A 1Z6AA 9LDBA 1TIBA 1EJ2A 3ICCA 5I8WA 5LUAA 5BP7A 2NVBA 5JC1A 1E1LA 1X8JA 4LKOA 1XEAA 4FOOA 1KE2A 2V4DA 3H8VA 5I47A 1M34E 5EPOA 3V4LA 4II7A 1PUXA 2J46A 4MB6A 5C4IA 3A1SA 2ZRIA 3H5OA 3NOVA 4YUAA 1DLJA 2BHRA 4NH0A 1NM5A 2Y3IA 1H0SA 1FXWF 3CURA 1EAMA 3AT1A 3NHYA 3LWBA 4B75A 1VLJA 2NU6A 4CBVA 2TMGA 2FQQA 2PH7A 1T5OA 4X8MA 2YOGA 2B3DA 4HIZA 1Y5LA 1IHUA 4FYWA 2VJIA 4R1NA 4YS6A 1H1LB 1ODIA 3DV9A 3AQ4A 4X7EA 3QHAA 4FSDA 5DM0A 5LPNA 1B73A 2W4IA 2J6CA 3DHVA 3JALB 1JFSA 4ABTA 5HYVA 4NK5A 1CUIA 3BF8A 1WVMA 1P61B 5LNK6 4CQNA 3LZDA 4D56A 1KQ3A 4XGRA 4Y0NA 5AJVB 4DM4A 1FMFA 4IH9A 2NTVA 1KHHA 1KS2A 2GBCA 3P9RA 3QX9A 2A3RA 1G5FA 3NR2A 1DRVA 4JROA 4MWSA 4UTZA 4GECA 2ZTMA 4YNBA 3RF7A 4ZCRA 1RS0A 2P4QA 4B71A 1C3LA 5AW9A 1UMCA 3BD7A 3PQ7A 5AUQA 1FJHA 4EGAA 2OTCA 1WB9A 2IZ5A 1HZZA 4REQB 3VPDA 1SU4A 2Q5IA 3JS5A 4BWYA 3IMEA 1AHHA 3ONYA 1Z0IA 4M9QA 2O8CB 4D9CA 2C3OA 1JHMA 3GVJA 2HSEA 2J09A 3DZ8A 4FDMA 1OFVA 3Q9UA 4Y9UA 2OVFA 1THMA 3R1IA 2J3DA 3DFUA 4FYPA 4N5HX 3ZHXA 1ZUNA 4X1YA 1L9XA 1U7TA 3R6WA 1HV8A 1W581 4HNSA 4PBSA 4JXZA 2POCA 3R23A 4FDTA 2WF9A 1XJ5A 2HY7A 4L5CA 4AJHA 3QX3A 5A0VA 4IGIA 1GXSB 3RVDA 3F5MA 2PANA 1VKOA 1EX1A 1FPMA 1WUYA 4W1RA 2Y1OA 3ND8A 1BMFA 2OXEA 4ID9A 2LNDA 1NFFA 2JLCA 3IOCA 1DQSA 2CT8A 2OWDA 1U5AA 3M4XA 1US8A 3ZC3A 1YL5A 4UDNA 1E98A 1G6Q1 4B8WA 5IHXA 2R7AA 2RAFA 4L4UA 3EODA 2PXHA 3I92A 4BLOA 1BWQA 2VP2A 3DOOA 2Q50A 4FYKA 2RG7A 4RJTA 2EEPA 1G98A 4YPFA 3K0AA 4CVNA 4P92A 1W34A 4BKMA 2W42A 1TU4A 4RX1A 3ADOA 1NZFA 4Q4DA 1HFJA 4TS9A 1Q2UA 4CGZA 4LAFA 2WAAA 1YZYA 4AWAA 3NTOA 4FMBB 3EF0A 1C8BA 2DFNA 3WRXC 3C8DA 1NXQA 3ANYB 3D4OA 3GEHA 3IIJA 1YFLA 3W6ZA 5C35A 5EUQB 5KOJB 4KR9A 2FMTA 2Y1LA 3NTVA 4N6GA 2GK6A 3OIFA 1VXRA 4N40A 2WNIA 4GQBA 4XXHA 4ZO9A 4BIMA 4DC0A 1ZK3A 1XWIA 1J6UA 2AVDA 2IPLA 5K03A 1KJWA 3LOPA 1XDUA 3CC8A 1YKFA 4BO7A 1RKQA 2HIHA 4LSGA 4AN1A 1CDOA 5L53A 4J4TA 5C8YB 3D31A 2YW2A 4MHSA 5DGXA 1W4ZA 4EZBA 3T5GA 2X85A 2AOXA 3EVDA 3VJKA 4BVHA 5JPDA 1S96A 3R7LA 1YT5A 5IF3A 2LZJA 1L4BA 1YJ5A 2QX6A 2YDXA 1MNQA 1IPEA 3DFZA 2REQB 2D9RA 1MQ9A 4YBRA 2EKPA 5KYUB 3EH2A 3E8MA 2CNNA 4IRUB 3DE3X 1MP0A 3IJRA 4LK3A 4PWYA 3LX6A 3QYAA 1T0JB 2JAUA 3WYCA 3FUXA 1A82A 2RKBA 5FWAA 3HY4A 1YJ8A 5ILGA 4YAKA 4Z49A 3HSYA 4JHLA 4NBTA 2ZUTA 4Z4WA 3QE2A 1J0DA 1JDTA 1TC2A 1SQ6A 3G6KA 5G2OA 4AJJA 1F9EA 4KXFB 5DO9A 3RPEA 5K6AC 3EIUA 3JZFA 4NF2A 1ZN7A 1ZNXA 2YIDA 3FVRA 2JLAA 1O95D 3WB2A 3FOCA 1FLDA 3GFPA 4JYAB 1R6UA 4CM9A 1OTHA 4BKQA 3C24A 1QV7A 1FS6A 1L7QA 1XB2A 2NUPA 2RCYA 3DONA 3E4CA 4GR9A 1QX3A 4GX1A 4DCSA 4N7BA 1PP4A 1L7OA 4M9SA 4UASA 3FPCA 4HPJB 5FLKA 4DBLC 1AMNA 4F7WA 5ADWA 4KHPB 3W05A 1L4MA 1VHEA 3A2KA 1U2TA 4QYXA 4OY3A 3H13A 1MORA 2I6FA 1ONBA 2V7PA 2VPXA 1EYZA 2B20A 2IL1A 3I6ZA 2EEZA 3B1ZA 5EIFA 3PA2A 2NGRA 1XKXA 4POOA 2ZUFA 4IDOA 2EJVA 1FOEB 4JNCA 4NDNE 2VBSA 2WG2A 3DQZA 3LXUX 3GRCA 4HWRA 4M6WB 1ISJA 3BH6A 4BX3A 1VQOB 2QBYB 1KSJA 1ZKMA 3I9LA 1M6WA 4G89A 5JIBA 1NW4A 5IXJA 3GCDA 2G28A 1EHYA 3PSHA 2A0YA 1T1SA 4BNXA 2AS0A 3BFVA 3JQGB 3WNZA 1Z0UA 4BS9A 2MT9A 2NU9B 2VDRB 2FK8A 1U81A 1VBKA 1Y8ZA 1P80A 4JLSA 3IAXA 2B5OA 2JIOA 1Y5MA 3M5WA 1B8UA 1QIJA 2ONZA 2ZRAA 4ZT3A 3WWYA 1XCBA 1DB3A 4EGQA 3R0XA 4MW4A 1ZCJA 3V8QA 4BQIA 2Q27A 5JAIA 3DZIA 4GPEA 4OMFG 1U8AA 3TRDA 2ZSIA 3KXIA 1FYXA 2BGMA 3ZKWA 1TMYA 1YONA 3GVHA 1U31A 3EAQA 1D9ZA 5C53B 3DV0A 2LRHA 1BJRE 2WSBA 1YASA 2IXEA 4FS8A 4K2HA 4C20A 5LP6B 4EPWA 3WNBA 1G291 4GC5A 4QBHA 1KZ1A 4R8LA 5BQPA 4N8EA 1JBKA 5MN4A 3VTAA 2ST1A 5I01A 4KREA 1JWLA 3R9WA 4TMWA 2PU7A 3IP9A 4J0EA 5JTTA 4OA5A 4C1NA 5EZYF 2AKAB 1UOPA 4Q3AA 2EJBA 3JVVA 3H5IA 4O1IA 1CUUA 2JK0A 4UM9D 4B85A 1T2DA 2KJQA 2Q2QA 3RNLA 4DIMA 3N2EA 2X4IA 3GT3A 4LDQA 2D3LA 1BLIA 1DO0A 1JAIA 2PEZA 2Y27A 3ONVA 3KU1A 4PC2A 1XQBA 3DTVB 1UBGA 2V6JA 4XB2A 3A6FA 4G9GA 4BBAA 2VF7A 3DMNA 3W2IA 1RM0A 4L02A 4YMWA 2I71A 4JLDA 4G1FA 1WCXA 4JA0A 4QAJA 4O0LA 4J0HA 3A4LA 4LYEA 5DTEA 1QIKA 4R68A 4PNEA 2G8LA 3KFLA 3ZXYA 3QWFA 3PJGA 2YJZA 4TWZA 3QF4B 4FHFA 3TOZA 1NC3A 5LDGA 1SULA 3EXFA 2HSZA 1IRXA 4C4YA 4O4IF 2HYIC 1PK7A 1X0XA 3KJZA 1PUJA 3NXKA 3SBOA 3RLFA 3UY4A 4QVAA 4FSHA 4EPRA 4C43A 1HQYE 1XKLA 2RC5A 1FYVA 2BFBB 2OM6A 3GJ4A 2O2XA 3AW8A 3KB8A 5JYDA 1XVIA 4BBPA 4B3HA 2CXOA 1PS8A 2NO4A 2OORC 3H2SA 1P1CA 4I66A 4XR4A 2ZYGA 1JIVA 5GM1A 1SZDA 4DY4A 3NCHA 4FJ2A 4LE2A 1L5WA 2XYRA 1L1RA 2V31A 3O9VA 4TYNA 2X53S 1RXVA 3L0YA 2XA9A 2ZI4A 5JCJD 1O6FA 2YC4C 1II0A 4CKZA 3CXCB 4ASUA 2VH5R 3R7SA 2UZ1A 1C80A 3CEJA 4JKYA 2RHGB 1JIKA 3NFYA 4X0CA 1AUVA 5BMVB 1OIXA 4AY2A 2DQ4A 4EVIA 5E9WA 3IURA 5BRJA 1N1GA 4M1OA 4MDFA 3MLAA 4BNDB 4YJ2A 2NTNA 3THWB 1NF8A 4RY8A 2QL7A 2JNWA 3P27A 1JE0A 3BH0A 3G8CA 4QOEA 2JAQA 1DUIA 3CCUB 4MVXA 4WCFB 3VA7A 3FPEA 3G0IA 3GLTA 1E9FA 1R9NA 4O4JF 5KVSA 3AVTA 4P6VF 1QF9A 3SF0A 4BQNA 5CDGA 1WXHA 4U6SA 3TTUA 4UEKA 4F4IA 5K0GA 3VPBA 4F2PA 4ETNA 3VHQA 1RKUA 4F8JA 5IH3A 4AG3A 1XF1A 1R0WA 4R81A 2C1ZA 3DV2A 4RV9A 4B6JA 3EG9B 4B9EA 5L6LB 2QSYA 3MJCA 2OGSA 1T9ZA 4XWOA 2EW8A 4OJQA 5C8VA 4KCGA 3AETB 1E8NA 2V59A 2V58A 1E79A 4PGHA 3E0XA 1V3QE 4PNHA 5CK5A 5T4EA 4ALKA 2GVDC 3O8BA 4BE9A 3SQOA 5BXYA 4BNMA 1DPFA 3U4QA 1T36A 1ZUD1 2RGGA 2A67A 1MU0A 3HNRA 5EWJA 4ZV7A 3ML1A 4LQCA 3T5DA 2JHPA 5ALXA 1NXSA 2XY4A 4HLQB 2QRKA 4LDPA 5AKJA 3MTAA 1FNDA 4MLCA 2JAXA 5C34B 1XEFA 3P45A 2GJKA 1U28A 4EJSB 5CLJA 1XD2A 3PVDA 2LDXA 2QW1A 5HIMA 2XCLA 1VQ5B 2ZW9A 3L0OA 1COZA 3MOSA 3W7BA 1ECLA 1T3ZA 3R5FA 4EBFA 1T1GA 5JU6A 2O54A 1EWKA 4EQ6A 3IJEB 4YP5A 1OXBB 4KK3A 4JFRA 1FRVA 4UBMA 4FUTA 4Z0HO 2C8LA 2FPWA 4U2CA 3W06A 4G5QA 3NAGA 4N12A 4LVUA 2IKSA 5H68A 3PGLA 1YOBA 3KQNA 4FT2A 4QOGA 2MYPA 4FW8A 4X7DA 4Q3KA 4EATA 1ISMA 4X54A 3K16A 2RHDA 1HKUA 1RJGA 1FVFA 3EPJA 1WP6A 1N0WA 2A9RA 2FE1A 3QPAA 1IOLA 1I14A 3JZIA 4IS3A 3VR5A 2NSJA 4PG6A 3A4MA 4JXXA 2WHEA 5J3OA 3HEBA 3WHPA 1ZP6A 3PDHA 4U0KA 3OI7A 4FS3A 3UGQA 4D4IA 1FTWA 4WKGA 4MGEA 5B36A 2AE1A 2HIAA 1JQ3A 3R3YA 3QTTA 4S2EA 3WRWA 2VHYA 5B53A 5FR2A 4NX2A 3T34A 3U4AA 4I5IA 4L8WB 4GHWA 4WACA 3TLZA 3V42A 4P4TA 1OWMA 3H1TA 4KN5A 3FGNA 4BMCA 2X1LA 3A6JA 1Y42X 2YNMD 2ZWOA 4K9DA 2WFAA 1OX6A 1WTHD 2DP4E 3E9CA 4LJ8A 2XMDA 1VBMA 4UE3S 4E3WA 4ER6A 6GPBA 5JTUA 1SOUA 2WIKA 1VDZA 3AJAA 1WMEA 4U7WA 5HIJA 3RASA 3EZ6A 4D57A 1SEPA 4JZKA 2QN1A 1ZRSA 3MVEA 3LKDA 3CCCA 1QRRA 3KR0A 4ZVVA 2CJXA 1ZNWA 4QNNA 1VQKB 4EI9A 2R7LA 1CEQA 5KYXB 4YUWA 4U8GA 3IBCA 4DLSA 5H8WA 4FOLA 4AP9A 3AF5A 1WKCA 1RMYA 3L0PA 1S2LA 3IQEA 3T38A 1PN3A 4Y67A 1H8EA 1BD4A 1O6GA 5LD2B 4DNFA 3T5BA 1ENYA 4QNRA 3HYRA 5FOTA 4LWZA 4HZUA 4D6XA 1UKBA 4ARAA 2G7ZA 3UIEA 1O0SA 1EEXB 3P9PA 3R0VA 1RVDA 1AKTA 4CMKA 1NJ8A 1W30A 1T8SA 4S3MA 4RGVA 3AUXA 3GVKA 5D8DA 2XCQA 4RIIA 2WVAA 2P0EA 1NXOA 4PPQA 4DR7B 3RTGA 1KKLA 1RJ9B 4NYJQ 4QSMA 1FYWA 4KSCA 3EIOA 3UUGA 4F3KA 2OK7A 4B4VA 3MWEA 5BQFA 3OPQA 2FGKA 2QZPA 3SZRA 3R75A 2O2DA 4YXWA 2FLWA 3ET4A 2YFYA 3KQSA 4MWEA 3GA5A 3MCUA 4R1SA 3UYKA 4NPHA 1N2GA 2XDQB 2ZYHA 3BC1A 3EUFA 3EWAA 3NWEA 4NU5A 5EKUA 2X5XA 5M34A 1XDDA 1NYLA 4P36A 3W9UA 2F48A 5J4VA 4G5OA 4N49A 4QOJA 1OC4A 1I0LA 1N8TA 1QDEA 1YMQA 3B52X 1ECJA 3NC0C 1CEEA 2PX0A 1IY8A 1JN0A 1YJWB 3MQ2A 4UUQA 4WGGA 3CR3C 5CU7A 2ZTVA 2PS1A 1KAHA 1JNXX 2HO5A 1N0IA 2Q6OA 4JBGA 2XQFA 3V7YA 2RAVA 2NXJA 5KNCA 5LQCA 3PR1A 4AZVA 3HXMA 1QHXA 3D6UA 4BC1A 2IW3A 3LO5A 2BE7A 1VCMA 3OHMA 3KT3A 3T53B 1BC5A 1NVXQ 3AZOA 1CDEA 1MAUA 4WZKA 1K86A 3CBQA 2RC6A 4WWVA 2I33A 3A6LA 3C1AA 3FM9A 3DT8A 4QOHA 3HKBB 4IEFB 1G3IA 1U90A 1Y37A 4MWTA 3HVUA 4OBWA 4DF3A 4RJLA 3HYSA 1UF9A 2J9ZB 3DMTA 4H3SA 4RAQA 3O2JA 3OX2A 3W77A 1Z2CA 4C6TB 1YRAA 1JT2A 3X1YA 1AGRA 4D0RA 1BDIA 5AUOB 1B41A 3AUTA 5SY4A 2F2TA 2ON6A 1J9ZA 2FPGA 1NQAO 2HJWA 1UZLA 2VAXA 1SUSA 4QBGB 3ZUPA 4BLSA 4URZR 2YZKA 2V0GA 1YS7A 4R2IA 4Q1FA 5ECDA 2FCRA 1CULC 2CK3A 1OVGA 2FFRA 3I2JA 3PFWO 4H1UA 4NMHA 5AVOA 3IHKA 3UFXB 1P45A 2BMVA 2ZXFA 5TRTA 5TGDA 3SC3A 4I1OA 4CDGA 4LF4B 2DR3A 4YCJA 5EE0A 1IN7A 1F4PA 2O50A 3PEVA 4DY6A 4L07A 3GF4A 3SE7A 1C0IA 2Q29A 3PL5A 2OXCA 4QRHA 4CL3A 1M0SA 1PDOA 2OV1A 1P7VA 4GUDA 1RQNA 5C8XA 2WHRA 2VJPA 5AVXA 4XFJA 4MOWA 1KPIA 2XD4A 4POAA 3R40A 1Z36A 1K97A 2J9FA 2NIPA 3I8SA 1WUJS 2X9VA 1VMAA 4WFJA 4ZAVA 1OZHA 1VSTA 4UAVA 3BTUA 3DCNA 1ZW1A 1AOXA 1PDWA 4MEBA 1DAPA 1WMSA 2FN8A 2WUEA 1SOWA 4XSVA 4R71A 3BE8A 3CNNA 4RHTA 1LC3A 2O2JA 3AONB 4Q3NA 1GM5A 2G1JA 5K0ZA 4WUTA 2BT4A 3E3LA 5U4QA 3FDFA 3HXLA 1QSGA 4QODA 5BOSB 3CWZA 3B7WA 1FNBA 5JRJA 2FZLA 3P4XA 1P74A 5DTIA 3REQB 2A3NA 1I6WA 4TTSA 3SN6A 1V2GA 1T0HB 1NTOA 5AI8A 4YUYA 2F6RA 3QVVA 2QD5A 5DNCA 3CX7A 1AA9A 2CGEA 3DOUA 3JV7A 3IXLA 2YN0A 1FLNA 1RHUA 4OH1A 4LX0A 1IC6A 4UUNA 5CEJA 2VP4A 2FDXA 2ZI3A 3L7OA 4HUQB 2H7YA 4KO1S 1P1HA 3WMXA 5BSKA 2RKWA 3I37X 1E3IA 1I32A 3KLOA 1CS0B 1TA4A 3DC2A 4OV6B 4R40A 4Y6RA 3BWBA 1PLKA 4BX9A 1T2FA 2O52A 3QE9Y 1HQCA 1YVUA 3PJEA 4A2CA 3FFTA 1EK0A 3O4JA 4QUAA 3O38A 3DPUA 3T4UA 4LDAA 3WZMA 4P93A 2IBMA 4O5AA 4B5LA 1SK9A 4ND4A 4BLRA 5CITA 3GRZA 4Z0PA 5BSVA 2H00A 4J0GA 4PYOA 4ENPA 1VI5A 2VHWA 1LK0A 5B58T 2C3PA 2I03A 2XWJI 4OEHA 3WQBA 2WQ6A 1JEYA 3O47A 2NUAA 3N1UA 4UNSA 3VO8A 5L6MB 2ONJA 3U48A 3O0DA 4ROXA 2OP0A 4R7GA 1H8HA 1WSBA 3H11A 5F1OA 5LYYA 4LQLA 3ZV3A 4XONA 1E79D 2IP1A 3VNSA 1Y6ZA 3E82A 3PS9A 1SR8A 4RGBA 3NBYC 4LXXA 5J1TB 4KWHA 1KDOA 2JAPA 2FUG1 1ZJZA 1ZITA 4Y1EA 5FFNA 5GVSA 4URUR 3EVTA 5HJ2A 2HA7A 4DQ0A 1E1CA 4S1WA 1T2UA 3MTQA 3OURA 2QPOA 4YAIA 1XLTC 3BKWA 3CHYA 2JCGA 3WFJA 1CY8A 3JQEA 1PL8A 1U0RA 2YZNA 4I4TB 4R0VA 2P9JA 1J07A 1BXGA 1D6MA 1XNHA 1OYYA 2XYVA 4IIJB 4S05A 1RU3A 3B60A 4JLMA 4NFHA 4N5IX 1OTXA 5GONF 2QRGA 1IN6A 3KR2A 1DC3A 4BEWA 2WJGA 5EE3A 1K28D 1WXGA 2ZUBA 2YOFA 1L7VC 4B33A 4OPSA 2VT3A 2YXPX 3FOAA 3ZZMA 4HRAA 3PXDA 1I7QB 2UYGA 4EECA 5KREA 1WOMA 2L42A 2QGFA 2H1VA 4LXYA 1A4IA 2IELA 4RANA 1M8JA 1O0CA 4FMPA 2WFLA 4D96A 1NULA 2GBGA 5J2TA 2JCVA 3DTYA 3G13A 5I7AA 1IU9A 2XVMA 4HEA1 4ZO7A 3HKEB 5F3WB 1GUFA 1E1QD 2KQUA 4KXXA 3DDNA 5K51A 3UMGA 4EFNA 4R54A 5IZCC 2NTEA 3KJQA 1KI7A 1XAGA 1E9CA 1P1FA 2BMJA 2XD9A 3FVQA 3CMEB 1U1FA 2WYIA 4G0OA 2RHHA 3CLTC 1JHRA 4DVJA 3NQ41 4WCVA 2PJDA 3ZQJA 2H11A 4RKRA 2WD7A 1L9KA 5AD1A 4N0PA 5B7QA 4EARA 3IILA 2QJTA 5AK5A 2WKWA 1U0OC 1VL2A 2CNBA 4FDUA 3L49A 4MWGA 2A5JA 4PVDA 3L02A 2E89A 3SLKA 5CYGA 1RRCA 4PANA 4KR7A 2EJCA 4L8YA 1WU8A 3PDIB 1MX5A 3PB3A 1W4BA 5MN5A 4LVCA 4UTPA 1U0NA 5IVPA 3PU6A 2PRSA 5D5QA 1INLA 1QX4A 2PMKA 5G4KB 3V6LA 1WWKA 3VYUB 1GSOA 2QTVB 1QH1A 2QLTA 2Q1SA 3GBVA 3KM0A 4YRIA 4NCAA 3HTXA 1H05A 2O2SA 4RGQA 2ANCA 1J0BA 3RAJA 2GXAA 3O92A 5K4AA 5AR1A 4DUZB 2P6OA 4PAOA 3V8MA 4JLAA 4C7OB 3GAAA 2WZNA 3G0BA 1A1SA 3QJGA 1XLTA 4PN3A 4IKOA 5IKMA 1NZJA 2HU5A 4WJLA 4UMDA 3WA7A 5IAGA 4BP3A 2QR3A 3NCTA 3FVVA 4NYIR 3RG2A 2X4GA 1GQOA 3L7IA 4U6NA 1KA9H 4LXHA 4DFDA 4ZGWA 5FKJA 1GZVA 3HJFA 1TVKA 5FUWA 5BV8A 3JX9A 4AUEA 1HDEA 1EM8B 1KZHA 2RGAA 2OM2A 1Z4NA 3E9YA 1BWPA 1LVHA 2Z2ZA 1L4NA 1WABA 4HE5A 2ORED 3QVWA 3HPQA 2QENA 1DKRA 2GEJA 3G5LA 3GEGA 3PC4A 2DR0A 5KNDD 2YH2A 2DRIA 4TN5A 5EAIA 1VQPB 1JEOA 2XOXA 1HDOA 3PXBA 5FUXA 4E14A 5BNIA 2UUBB 3DEZA 4BB5A 1FB5A 2COKA 3M33A 4CEJB 1E4EB 4ZAYA 2BKXA 1D2EA 1YRWA 3E18A 2Y0BA 3L3BA 5GIOE 2ZRFA 2C7GA 4OF4A 4OK3A 4XDYA 1Y6GA 2IUYA 1Z5WA 1QCDA 1TI7A 1XNGA 1RM4A 1OC2A 2LKCA 2KB0A 3RVJA 3FYUC 4AS2A 1M10A 1XZBA 1PJ5A 5T3UA 1G20E 3BH4A 1LZLA 2GWHA 3AI1A 2X4DA 4I9FA 4HVCA 1LXCA 3KXPA 3IEMA 4TV8F 3T9BA 1WB5A 3EPKA 3GMSA 2BFFA 4JKIA 1P73A 2HADA 1B2LA 4A6XA 5LMZA 1JLHA 3A2LA 4GLBA 1QU2A 5KYNA 2P75A 2QL5A 3KPYA 4WESA 4D44A 3L1JA 2WAMA 1E5TA 3A26A 3GFSA 2M6KA 1HH4A 4DKXA 2QX4A 3P9IA 4ML3A 3UAYA 4WY2A 1MEEA 4E30A 3L82B 1WOSA 4KLAA 2QEQA 5B6IA 1O8BA 2HJSA 1GNPA 2IYZA 5ESXA 4BO4A 2JLXA 1WW3A 2R1ZA 4UCFA 3FNQA 2BI7A 4WZBA 3GRRA 4OHKA 1X1CA 3K3PA 1E0AA 1E2PA 3HBAA 4X6XA 5INTA 1ZD3A 2WSYB 3LPAA 2Z04A 2WJAA 5HF6A 2EZ9A 1G8GA 5KB3A 1WE2A 1OH8A 4W5NA 2PYZA 5JBQA 2RHJA 3L6DA 3CW2A 3EZ7A 1V25A 3UWKA 5LR6A 4F3CA 2BH9A 3WWCA 3R6LA 4ZAZA 5CFMA 2H4XA 2Y77A 1O97D 1D2NA 1H2HA 3T9AA 2O57A 2COUA 1JA0A 2ZRHA 4BECA 3SS7X 4YJFA 1SQGA 5A04A 3VNUA 1PR6A 3OT1A 1WPRA 4PHTA 1F51E 1R9JA 1PJBA 3ORRA 2VF8A 1OLSA 4P82A 1I94B 2IFTA 1ODKA 4JUFA 1AMUA 1F6WA 1ZI6A 2ZXEA 4U5QA 3L6EA 2RJNA 2OPBA 3GZJA 4FB5A 3UUFA 3NAQA 3AH8A 3WDMA 2A88A 1YCHA 4G25A 2HA3A 2G5TA 4I1UA 1NQ5A 4I9UA 4LS3A 3ADDA 1SUPA 1ENPA 4OYLA 3LM8A 4TL7A 1MABB 2AR9A 4LOAA 4IRXA 3CCQB 1GOTA 2ODBA 3M6AA 4RMIA 4CKEA 3HL4A 1B8VA 1GPUA 1Z3CA 3G2LA 5ALDA 3SP1A 5DM70 4NV0A 1R2QA 2AN5A 4G5HA 1RAIA 4P35A 3HJHA 4HNQA 3FYUA 4ENWA 4DA4A 1QOZA 1A7KA 1EVJA 2YJGA 1Z8HA 2ZPAA 1T5DX 1YBFA 3TS1A 3WDKA 5BR8B 2LW7A 3IUEA 3T35A 1R12A 3CSDA 4XJVA 2WZQA 1F3OA 5DGDA 3C15C 3WYEA 1U9IC 2OBXA 5IWCA 1MAVA 2QROA 5IC6A 3MUNA 4JNKA 3E2IA 1LD3A 1JLRA 4UBOA 5LDDC 4E94A 1DXYA 3ECCA 2ZUWA 1IQRA 2G1AA 2NM0A 3V5NA 2AUNA 4XIIA 1KP3A 4PRKA 3V9PA 2AXQA 1X80B 3D3EA 3WL5A 4DGSA 1JB9A 1YRYE 5EXDA 3H86A 1XDGA 5TQJA 4DV7B 2UVPA 1J1IA 2IK8A 4K2AA 1X8KA 5B57C