4M0LA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus complexed with gdp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
414
structure length
412
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 91
structure length 412
sequence length 414
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m0lA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m0lA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m0lA01
2FFBA 2QT1A 2OXRA 1ZD8A 3ETLA 2AK2A 5KTYA 1NY5A 1T3LA 1F2TA 3K9NA 3ICEA 1EWYA 1E99A 1ETUA 2OTLB 1N3BA 1GWNA 1NSTA 1Z5ZA 1UF9A 4P32A 3T34A 3LQQA 5L3SA 1P2VA 4BLPA 1E9AA 3SQXA 1QVAA 4TYNA 1ZUIA 5KUTA 4QBGB 3L82B 3BD9A 1T91A 1TQ4A 2KBFA 1T5IA 2AFHE 3AGPA 1COWA 1QVRA 3AF2A 4WBSA 1FPMA 5AK0A 3RLFA 4CEHA 2DFNA 3THOA 1T0HB 4PZZA 4U9UA 521PA 4DLZA 1WBBA 2WVJA 3BXZA 5AR1A 1FNDA 3U3JA 3NBFA 3NBXX 3EX7C 4PO1A 4NYMQ 1W2BB 2GAAA 4DDWA 4MGYR 1E79A 2PLFA 5E3HA 4EDHA 2JLVA 4CT5A 1QHXA 2HT1A 3OZVA 4C0QC 5D3MA 2IYTA 4KVGA 3G71B 2B21A 1FUKA 4EQ6A 3GLGB 1TL7C 2MMCA 1UPTA 3TE6A 3VU9A 4TT3A 2IF0A 4F4CA 1KI3A 5CJ2A 3TR0A 3SFZA 3LA6A 5EE5B 1NKSA 1RVDA 4JLMA 2EFEB 4JLOA 4OJKA 4QOSA 1BYIA 4HB0A 2O8BA 2VTKA 1A82A 1A7JA 2O8CA 2RC6A 4Q03A 2DHRA 4YMVA 2QUZA 1MRSA 3CPEA 4DJTA 3LNCA 1G41A 1TLLA 1AQUA 2GZDA 5JLJA 2CNDA 4TLDA 4FK8A 2FH5B 3QG1A 1MO4A 1QG2A 4WXRA 4B3CA 1XZPA 2D06A 1GP2A 1P2TA 4U02A 3FOZA 4E07A 4HDOB 4DUGD 2R6FA 4JL5A 4IW3B 5J4HA 1Q0UA 2Q9CA 3LRPA 5KNDA 1JB1A 5HKKD 2PT7A 1CRQA 4TZ6A 1X8KA 2Q3HA 4DSOA 1VHTA 2JLSA 4AF6A 2OBLA 3LV8A 3OZXA 1FRNA 3VR1A 5CK4A 1Q44A 3SYKA 1TNDA 2CJWA 2GK6A 1US8B 2DWPA 4JVNA 3MHPA 1VG9B 1DAHA 1OHHD 1I4TD 1UBGA 3VX4A 1XTSA 2WPDD 1PVOA 3LVRE 5UKDA 4AYWA 5M04A 2IYYA 2EYQA 4QJ4A 5SZJA 2PJZA 4FXPA 1SZPA 3B9PA 1YZGA 1EXMA 2ZJYA 3ADKA 4IOJA 4JT2A 2VRWA 3D6TB 1N5JA 5HXBA 4NCKA 5E7MA 4GT1A 3PJRA 3U7EB 3HU1A 4CRWB 2PMDA 1N6NA 4M1YA 2AKAB 1II9A 1D6JA 3VHXA 4KJZA 4EPYA 3MJRA 3N5CA 5AJYA 2BOVA 2IYLD 2JGNA 4FMDF 4HB3A 4TL9A 1G17A 4TQUS 5J40A 2IXFA 3T35A 5JRJA 4D2IA 4XTRA 4A6XA 1VQ4B 5FPYA 1GJRA 2W2VA 4G1BA 2ZYVX 2GBLC 3LVBA 4HAXA 4EPTA 1VCMA 1ZMXA 4Q4AA 4PPQA 3E70C 2EIXA 4WZ6A 2W2XA 1UJ2A 2DETA 1II8A 2B5OA 4PC1A 4Q1EA 2C8VA 4C0SA 1W0KA 2PCJA 3LAWA 3TR5A 3AVOA 1E9CA 1EFHA 4DLWA 4IOKA 1OXUA 1VQLB 1KJYA 3H84A 2IXGA 4JKYA 4KO8A 3U3OA 4B3BA 2JLYA 4XVQA 2O8DA 2GEDA 3JVVA 2GKSA 1NSFA 4DEXA 4B3DA 4Y7CA 1ZCAA 5FPSA 4G1UC 1G5TA 4KYUA 1P72A 1E4VA 3SFVA 1M8PA 3P4YA 4TTQA 4AWXA 3I92A 1P2UA 4H9GA 1EFRA 1F3OA 2Z5FA 3ZVRA 3HYRA 2VYFA 2EU8A 3EC2A 3RS7A 2OO7A 1G9XA 1G8YA 3CRW1 4JBYA 3AVTA 5FOXA 2GAOA 2J7PA 4PXAA 4UJ3A 2WWWA 3AVWA 3RABA 1OSNA 2AFIE 1G7CA 1W2GA 5FR2A 4B35A 2DFTA 2FJUA 1FL9A 1YZNA 2J0VA 4Z1MD 5FBVB 1YZTA 5KDOA 2J0UB 1F2UB 1XCGB 2ZS7A 1DO2A 1E32A 3TSOA 2JAQA 2NPFA 3LXRA 3T5DA 1BX0A 3HR8A 2BMFA 3REFA 2H92A 2WZQA 3ECCA 4HDQB 4NL4H 5EP2A 2QGNA 2OBNA 4DIEA 1KOFA 3W6NA 4AG6A 1E6CA 2YWGA 2GILA 5D3MB 1M34E 4G5QA 4PPNA 5JCPA 1P61B 2QZ4A 1XMSA 1E2GA 1QRAA 3VU9B 3T1OA 1G21E 1NMXA 3UWKA 2QP4A 3QSYA 1CJMA 1EK0A 3AVQA 2YKGA 3O8CA 4F7DA 2D2FA 3QXHA 5DIFA 1ODFA 4Q9KA 3QBTA 1CF4A 4TWZA 1B23P 1Z8FA 2ASEA 4LCBA 4B3XA 3AH8A 1S2MA 4TYQA 2B7CA 1C4OA 3FPAA 3SBEA 1YU9A 4V0LA 2CXXA 3R9WA 1YJ5A 2F1JA 2YWFA 2FNAA 4Y0VA 3IGFA 2AD1A 1M2OB 2G6BA 1EWRA 4KAXA 5CIWA 3RRMA 3BH7A 4ESVA 1W7AA 2CL7X 5E4FA 1ZINA 4BZQA 2ZI5A 1DAFA 1M90D 3R9IA 1GL9B 4V03A 4LBZA 1GL7A 2YHSA 5FTLA 4PSAA 1IN8A 3OE7A 1R0WA 3ZQJA 4OHYA 3G4SB 1P73A 5GJWC 1XEWY 3GFOA 2J0SA 4D4MA 2GXUA 4IDOA 5JS8A 4C0LA 5CDFE 2PX3A 3JZMA 1Z2AA 1KJWA 3IEVA 1OPXA 1JQJC 4M1MA 1VHLA 3AM1A 2PX0A 3WBKA 5AJVB 3CCJB 1Z47A 3WP1B 3TQFA 3JQRA 3LFUA 2GJSA 3O8DA 4QGHA 5EP1A 4E03A 1HTWA 4IXMA 1N6PA 5FBRB 4LHXA 4DCVA 5J4VA 2GXSA 2ZRGA 3GMTA 2BEJA 2BVNA 2QTHA 2W6JD 2MMGA 4HZUB 4C4PA 1E1RD 3ICQB 1N25A 1T9HA 3THXB 4HLUC 3FDIA 2OAQ1 4N0EA 3GJ0A 1JPJA 2QMUA 2ZANA 2ZR0A 2RB4A 2ZRIA 4LC0A 4JLAA 3GPLA 3K0SA 3RAPR 4Q1BA 5H59A 4Q4AB 1ZUHA 4YONB 2KJQA 4DCTA 1SHKA 1Q86D 3FVQA 4LJ5A 2FU5C 4YXWD 1A4RA 4IFBA 1RIFA 5DYGA 2BF4A 3CCVB 1DPFA 5CLLA 1W4AA 2ZRJA 3REGA 1YHNA 2ODWA 3QKSA 1YR7A 1KI1A 4GOKA 2H18A 2VQSA 4AC9A 3KJHA 4DWJA 1QHHA 2QN6A 1W2HA 3I56B 1QX4A 1DAEA 5HPYB 4R7ZA 2BJVA 3ZH9B 1IOZA 1TEVA 1U0JA 2C04A 3LWNA 4JLPA 5DISB 1UAAA 4LK2A 2G0TA 4HSEA 4JT4A 1M74A 4QG7A 5CB8A 1KJZA 2MSCB 3PUVA 2J0QA 1E2EA 1SVMA 2Q21A 4CF7A 3VTKA 2XB2A 2X2EA 3RS5A 4N1AA 5F9HA 3I5YA 3K0CA 1X1RA 1YZKA 1QG0A 4Q4LA 4B43A 4UXJA 4HUTA 3Q3JB 4TL6A 3AEZA 4G5SA 1E98A 1WF3A 2ZJ2A 4JLKA 3SS8A 1JA1A 4IJMA 1U99A 2DFKB 3GJ7A 4JVMA 1R7RA 2ZUBA 3TAHA 4QC2A 2ZYWX 3KFXA 5CITA 1KHTA 3IIMA 4X8HA 4KITB 2AWOA 1YKSA 1NJGA 4RKEA 4AY2A 1QZXA 4LZZA 3QVUA 3PXGA 1EESA 1RC8A 2VNIA 2OESA 3EPKA 2ZAMA 3SBDA 2CHQA 2I1VB 3DO6A 1NN5A 3QF4B 5DNYB 3QPWA 2B7BA 3LX5A 3THWA 2QTVB 2DB3A 3WP0A 4I1OA 5JEEA 2ZJ8A 2P6UA 1NY6A 3P32A 1KDOA 1TX4B 4QBHA 1AKEA 1MOZA 2WTUA 1X6VA 3BB4A 4ZGQB 4M22A 3VX3A 3DOEA 4GDFA 3B8HA 2I1QA 1PJRA 2BC9A 5G3ZA 3SC3A 3W8RA 5C4MA 3OAAD 1KO1A 1Q1EA 2IYUA 3IO3A 1DVRA 3KKOA 3VFDA 1TVCA 1FW6A 1RRCA 3FMFA 3H2YA 1N8RD 2BKEA 3NHAA 5FFMA 1KI6A 2E87A 3FYHA 5SZHB 3THYA 1KK1A 4AKHA 2C78A 2CK3A 2Q3FA 5FA6A 4NH0A 5K8LA 2FG5A 1DG1G 2WICA 4IKEA 4M1TA 4FMDB 2OK8A 3OEHA 3F5FA 4BPRA 2DWQA 5EXXA 4ZDIA 4US2R 2RHDA 5FUXA 5DN6D 3GLFA 4MGZR 3UIEA 3L0IB 5JEDA 1F6BA 4BZPA 5EXTA 3HU3A 4LYFA 5AJXA 4TMZA 4RJLA 5KNCA 5EE9A 3CRVA 3BORA 4AYXA 1G291 5EJEA 3EPLA 4LPSA 3X1XA 4MYHA 4EFMA 4LJYA 2G9NA 4HUQA 1UBFA 4URVR 5JWRA 5GV7A 1YQTA 3CWZA 3ND9A 4C7OA 4UJ5A 1EP3B 1N6OA 1RYHA 3LH5A 4EJSC 2QM7A 1KK0A 3B1XA 2FA9A 1W0KD 1K73D 3PUYA 2W58A 2PMKA 3UKDA 4UAJA 3BS4A 3I61A 1WA5A 4D26A 1A8PA 2O8FA 5EMNA 4QL3A 2XX3A 4GOXA 4ABYA 4Y9UA 2IYRA 2MSEB 1Q1QA 5P21A 3NH9A 3WRXC 2VSOA 4ACBA 4JLBA 1JR3E 1FQJA 3SJCA 4BFVA 4MRVA 2AWNA 3LLMA 2AL7A 3W2FA 2N1BA 1N5IA 2VP6A 1E2KA 1GL6A 2HF8A 1W4CA 3B60A 3QPVA 5L3RA 1DARA 3CCMB 1YJNB 4JKIA 4LOAA 1UMKA 2A78A 4H1UA 1D8TA 1QHHB 4PX9A 2H7VA 3QF7A 1Z29A 3W3ZB 3QVVA 3AP3A 3O8RA 4C43A 1K8AD 5CM9C 4JLJA 4BFYA 4W5JA 3MJHA 1U2RA 1IJEA 4CEIB 2BJWA 1JAHA 2XTZA 3EZ2A 4DLVA 4XWOA 2A3RA 5CIQA 2CCGA 5J4YA 1U0HC 2Q0HA 4IVQA 1II0A 2GNOA 2HLDA 1G8FA 4ILEA 3TKLA 4Q1CA 1Z3IX 1JPNA 1ZVQA 2C03A 4DUGA 1E9SA 1LS1A 4NCJA 5FPKA 1KO4A 3BFKA 5HKKA 1G16A 4DDVA 2WBLC 5JMTA 2DCUA 1QH0A 1NL3A 4JL6A 4LJ9A 3AF1A 3CLVA 3X1YA 3ZZ0A 1QUFA 1VMAA 1VQOB 4NYMR 2NG1A 3MUFA 1YZQA 3RS4A 3QFTA 1OHHA 2CLCX 2WPDA 1SQ5A 1FTNA 3W9YA 1OFHA 1E94E 1FMJA 4C0JA 2A2ZA 4LYHA 5AUNB 2HJGA 3P27A 3T1QA 1ZU5A 5HCIA 1K9MD 1NN1A 2QQ0A 4TTPA 4OL0A 2GZHA 2JA1A 4LBWA 4UNRA 3B1VA 1Q82D 1TEXA 3EWSA 3EZ7A 2H17A 1VIAA 2Z43A 1J8MF 1N6HA 1G6OA 2F1HA 3Q85A 1KIMA 2IBMA 2RC5A 1N5LA 1GITA 3MSXA 3QBVA 4MYCA 4Y9RA 1XPRA 3OW2B 4D6PA 2CNWD 1I7PA 2DWOA 4NBSA 4A2WA 1ZD1A 1R0XA 1KI6B 1KNQA 1XF9A 2K5UA 4RD6A 3OIWA 4FMCF 3THYB 4X8OA 1SXJE 5AUOB 4M2LA 1YRBA 3EXAA 3X1DA 1R10A 4IEIA 4P4UA 4KSCA 1G8PA 4KVAA 1SVKA 1Z28A 1GKIA 2VSXA 3WYGA 1QBKC 3CX6A 4PQYA 1OYYA 4QRHA 4D4KA 1XB2A 2EW1A 3J81k 3OJWA 1UKEA 4OQLA 2PZEA 2YC4C 4IFEA 2W83A 4MQBA 3X2SA 2PEZA 3H0KA 3N2EA 5C4GB 2GDJA 2GK7A 3B85A 3U61B 4MUBA 2QU8A 4TSFA 1NVVQ 4FCWA 1XBTA 4TLCA 1JAIA 1ZM3A 1LV7A 1Z6XA 4UXHA 4C7OB 1YJWB 2BIFA 1DAKA 1U8AA 4B4DA 2VHCA 4Q21A 4URUR 4DCUA 3GLIE 1Q21A 1NI3A 1P75A 3IBYA 1AM4D 3ZBTA 1GO2A 3CCLB 2O8FB 2QSZA 1JJ2B 4Z1MA 3TRFA 2EFGA 2FX3A 1TF5A 1M1KD 2ZUCA 3QFSA 1I2DA 4L9SA 2P5SA 3C5HA 4TMVA 4UKDA 1FDRA 4MGIR 4LV5B 2D7DA 3CMAB 5CJPA 3TVTA 1UKZA 4JS0A 1KZ7B 1ZNZA 1OF1A 4WZAE 3A6PC 1PLLA 4HAVA 2JJ8A 2IWHA 1IJFA 3RS3A 4RY2A 2BBWA 4US1R 1L8QA 3EA0A 1X8LA 4NYIQ 1GDDA 4KLNA 3P20A 3PEWA 2G3YA 1KC8D 1R0ZA 4POAA 4YQFA 1EWQA 1Z6TA 2VIIA 4O25A 3U7FB 2R6GA 2OCYC 1QVGB 1WE2A 2WOOA 2NIPA 1VQ6B 5HE9A 3QKTA 1GKUB 1XCMA 4BEJA 2WSSD 1KNXA 4AKEA 3VHLB 1PUJA 2XSZA 3TIFA 3LBIA 2ORVA 4XJXA 1US8A 2FV8A 5IK2D 1ZCBA 4PGOA 2VP9A 2C77A 1UEIA 3EZFA 4OQFA 3FE2A 3NH6A 1N6KA 2QM8A 2QEQA 1YZLA 5GV8A 4O2LA 3DKVA 2JDID 1G20E 1E2FA 3LXXA 4P6VF 1N5KA 4Q48A 2UVQA 3T15A 3C41J 1JR3D 2XITA 3QXSA 1KMHA 3BERA 421PA 3CZQA 2FGJA 4YAFA 3QI2A 3A1TA 4MKHA 1OLOA 4NZYA 3FGNA 3K1JA 1ZJ6A 4V0ME 2FN4A 4Z8YA 5FUWA 2RGNC 4S2EA 2WJIA 3EARA 4UNQA 1G3UA 3EW9A 2WV9A 4G3XA 3A1VA 4IDQA 4BLRA 3HDTA 4DDUA 2ODEA 1NLYA 1J99A 5EP3A 2C95A 3B78A 3I32A 3TJZA 1BIFA 3QKUA 3CIOA 4HDCA 3AVYA 4ZV4A 1EP1B 1XPOA 2W6JA 3GFTA 3DEFA 1QG4A 3GQBA 2J9RA 1E1RA 5BQ5A 3CC7B 4HLDA 2QAGC 4I81A 4LUCA 5EUMA 3ZS9A 1GAJA 1Q1BA 1ESNA 2NZJA 5CLQA 3WY9A 1NLFA 2WJJA 4GMDA 1NBME 2GXQA 3VR5A 3TW4A 4FWIB 1GFIA 3QE2A 4A15A 2OV2A 4LRWA 3NG1A 4YXWA 4FCTA 1RPZA 3LDAA 4AI6A 2FSHA 2IYSA 3PUXA 3WNDA 2GETA 4CYMA 2XNCA 2X1VA 2BCJQ 1E2HA 1AZTA 3QKRA 1OB2A 4KI0A 1XPUA 1GNPA 4HAYA 1FZQA 2PL3A 2IL1A 1T6NA 4A8JC 4C0KA 1ZBDA 2OLKA 2KE5A 1G4UR 4EFNA 2X2FA 2ZR7A 4IRUB 3TUJC 2XJ4A 4D0NA 2JLQA 2YWEA 1MO5A 1GRRA 4KYIB 3KQHA 2J0UA 1QGZA 1F2UA 3DM9B 3ASZA 2GEUA 2J1LA 2QQEA 4ASUD 4DEYA 2ZRBA 4A6PA 4Q7MB 3AB3A 1T3SA 1G7TA 2FPKA 3MLEA 1VQKB 1MH1A 4B6FA 1CXZA 1E0JA 1XZQA 5K8UA 3QXJA 1XTKA 1OJLA 2IS4A 3Q7PA 2QSYA 4Q01A 3OF5A 3W2GA 4LGMA 5C18A 3SQWA 2A30A 3RS2A 3PR1A 1SVIA 3QENA 5H68A 4OHZA 1OGJA 2RCNA 3PEYA 1SXJD 2B6HA 5FH9A 2BSAA 5EE0A 3B1ZA 3Q5EA 5L8VA 3W34A 4LBYA 2J41A 2NTYC 3O47A 2YYZA 1JBKA 4A92A 1F20A 2F9MA 1VQPB 1JNYA 1X1SA 1AN0A 4DT1A 2ZVQX 5JJIA 2HLDD 3GJ5A 5K8TA 1JQLB 1QFZA 1F48A 4LV6A 5DE3A 4BGDA 1GAWA 2WMOB 3ND8A 3W2EA 1IY2A 3U3KA 3FHTA 2FZLA 1IONA 1KRHA 1NKTA 1U81A 3OAAA 3HWSA 1TU3A 3VR6A 4EJSA 4UNNA 1AGPA 4OK5A 3UG7A 4QBFA 1HQCA 4PR0A 1E9FA 5L3QA 1H8EA 5H5JA 1S9HA 4MDFA 1JJVA 5TY0A 4MRPA 2WWGA 3SHWA 1SXJC 1YJ9B 4A9AA 4BRWA 1NN3A 4JBWA 4HAZA 3HPRA 1NF3A 4ZIRA 3RYTC 1DAIA 3CR7A 3OEED 2ZTSA 3EIQA 1J9ZA 3P26A 2OBMA 3DMDA 3SDZA 4EUNA 1KMHB 1SHZA 2J7KA 1VKJA 5DN6A 2IWRA 1SVSA 2FPLA 3CF0A 3CPJB 4FMCB 4PQFA 3OESA 2REOA 4HZUA 4Q9LA 4WZBE 3Q5DA 2GF9A 5LB4A 4CT4B 1ZD9A 1XP8A 2JJ2D 3A4MA 3WHKA 4BLSA 1CBUA 3P4XA 1FMLA 2AN9A 5KSOA 5J5CA 3THXA 1R2QA 4LHYA 4DBLC 5GVSA 1BMFD 1Z22A 2QL6A 1D2EA 1XX6A 3MWLA 4URZR 3PENA 1G3MA 4R9UC 1EFTA 4QGGA 1Z83A 3K9LA 3IO5A 1XXHE 2C99A 2YOHA 4UNPA 3W90A 1JECA 5J4LA 4PANA 4X8LA 3ASYA 2RHMA 1E2NA 2DFLA 1AIPA 2VYQA 3D7MA 4DLRA 4B3GA 3UMFA 4TLAA 1E4YA 4M21A 3ZDQA 1GAQA 3MWJA 2ZRFA 5KPDA 3K0FB 3OJXA 3TQCA 3C4JA 2MSDB 2RGXA 4MKFA 2OEPA 5FTKA 3CCUB 4TLEA 4TSFD 4XVRA 4DQKA 3VKGA 2QNRA 3VO1A 2B8TA 3QKRB 4CGZA 1M7GA 2ZM5A 1XEFA 1CJVC 1W35A 5CDFA 3K09C 4PC6A 3W6PA 4B2LA 4PZYA 3G6EB 5JSZA 5ANRB 1QGYA 1HY3A 2WJHA 2WWIA 1VG8A 4HE6A 3FMIA 4G5RA 4OHXA 4HZIA 4Q19A 5E95A 4RVCA 3F8TA 3M4YA 2W0SA 4B48A 2RGAA 4Q4HA 1UFQA 2IK8A 4OQNA 1W36C 1KK3A 1Z07A 3UMRA 4JVSB 1FQKA 3W5VA 4OYHA 4DIDA 3CXCB 5JFGA 2ZU0C 3CRQA 3ZD6A 4BZXA 1FNMA 1E64A 2EFHB 3QF4A 5A0FA 221PA 2CBZA 4H1VA 4D4JA 4DRZA 1CU1A 2DYKA 2GCNA 2IS1A 3OFND 2V7QD 3TW8B 3LLUA 4TTRA 1NBMD 2OUKA 3W5JA 2CRVA 3WMFA 2CHGA 3U44B 2A5YB 4BFWA 4YAWA 4U5XA 4OHWA 1YR8A 2HDNB 2L0XA 1XXHB 1YIJB 4KSBA 4Q9JA 1Z6YA 4BFXA 1AK2A 1WCV1 3PV0A 4C0AC 3JZAA 3ADDA 2ZITA 1X86B 1YI2B 3RRYA 5EP4A 2VZLA 1QDEA 2W6ID 1D2NA 4BQSA 1QFJA 1OFTA 2V3CC 2R6DA 4DVGA 2R62A 1XMIA 2I4IA 2Q3MA 2ZS9A 4Q00A 1BX1A 1E63A 1E9DA 4DT1B 3B2EA 5JJKA 2XSZD 3I1FA 4RD0A 3TK1A 1XCPA 3A1SA 2D3WA 4GPTA 2HCJB 4IXNA 2XZLA 2J45A 2ZRMA 4LPKA 1XEWX 4QHYA 1E1QA 4RZUA 4EJSB 3FWYA 2YZ2A 2F7SA 1LS6A 4QKQA 2CNWA 3Q7QA 1EFCA 1S3SA 4UNSA 2QA5A 2QPAA 3VR4A 3ONWA 5L3QB 1VIYA 4L16A 3PUWA 3L8YA 5FOTA 5TV2A 2QEXB 3FPKA 3LO5A 1JXMA 4QHSA 3CF6R 2KB0A 2JLWA 1HURA 4YMWA 3KJIA 4ZIRB 1FFHA 2R2AA 4M8NE 4ERNA 2RAPA 1JR6A 1KKMA 4GMXA 4ZCLA 1OFUX 4X8MA 2AK3A 3DPUA 1JEDA 3IQWA 3WNCA 1IHUA 3GEHA 1VTKA 5FUVA 4A2QA 3QFCA 1FTSA 3ZZTA 4HAUA 5AJZA 1U94A 3OZUA 1E9RA 1VQ8B 4RCZA 1MR3F 1E2DA 4J0QA 3RS0A 5B58C 1G18A 2CCJA 2F43A 2QAJA 2WSMA 4MKIA 2IS6A 2NOAA 1OT3A 1LY1A 4M9XA 4Q47A 3ZLJA 1W0JA 1N0WA 3SYNA 3OIUA 3FJOA 4Z8XA 1SULA 2VBCA 5JZVA 2V6IA 3ZZUA 3IUYA 4C30A 2NPIA 3R20A 4GL2A 4A1FA 2LKDA 4ZI3A 1EX6A 4Y0AA 5FOUA 3AQ4A 1DDIA 2YV5A 4XSGA 1N6LA 1VECA 3B5JA 4UQOA 4Q4JA 5G3YA 2ZSEA 2QRZA 1T8TA 3SN6A 5DO9A 1P9RA 3VMFA 4LWZA 4M1SA 4GNKA 2IF2A 5KDDA 4CEIA 3PG5A 4PPGA 3TSWA 1WDTA 2O0JA 5BW8A 4TMTA 5JBQA 4YC7A 2GZAA 2OG2A 3BH0A 2O52A 3KQNA 5JSZB 1KI8A 2RGNA 2ZIAA 1UBCA 3T06B 3AKYA 3KTAB 3TMKA 4EAQA 2GJAA 1XDBA 4ZDJA 4L5BA 2P3SA 2EWVA 1RZ3A 1IY0A 1KMQA 1R8QA 1HV8A 2GF0A 3ZYCA 2QPOA 5HR5A 4Q4HB 3T61A 4DB2A 1KAGA 1OV4A 1NVVR 1JI0A 2WSSA 2DY1A 1VG1A 3FKQA 4P4TA 3NDBB 3KZ1E 5IF9A 4K8OA 4K46A 4KODA 2WOJA 3RWOA 621PA 3ZD7A 4ZCIA 3UANA 4NU0A 3IILA 1KSHA 2WKQA 2F1IA 1DBSA 1KI9A 5IK2A 2PIAA 1ZC4A 2QAGA 4B47A 1BKDR 3LD9A 4XSHA 5FTJA 4B6EA 2WWHA 1OXTA 4MYTA 4QM7A 4IDPA 3T1VA 2JDIA 4DLTA 5TB5A 3VO2A 2GTPA 3TAUA 3KUCA 1JR3A 5JWHA 2HJVA 4TMKA 3TUIC 4CZ2A 4PHHA 3PCRB 2GQFA 1NG9A 5A5GA 4HB2A 1YVDA 2PT5A 2LKCA 4JZKA 4C3ZA 2P65A 2FSIA 3QEJA 3RHFA 1TU4A 5IHPA 5FOSA 1M7BA 1CJTC 1NDHA 1QHYA 5TR9A 1EGAA 4EIWA 4A8JA 2H57A 4N3NA 4Q9HA 3KJEA 4NYIR 4FW9A 4BLOA 5LPNA 1AMOA 2QMOA 3RRZA 1H8ED 4NCNA 2BHRA 1S1CA 2SHKA 2HYIC 3LVQE 1NVWQ 2V8OA 3FTQA 1DELA 2HYDA 4LHZA 3ZIAA 3EZ6A 5SZIA 1BH2A 2GESA 1Q1ZA 1SVLA 3A4LA 4YMUA 2BMJA 2XZOA 2CHVA 5BYJA 1Y3AA 2ZE5A 1P9NA 4PO9A 1KI7A 2A9KA 2C2HA 1R5OA 4PAOA 4A82A 1R8SA 2R65A 3WYAA 3GJ4A 4DQLA 4LJ7A 1G1MA 1O87A 5THXA 1RJ9A 1RRFA 2CLSA 3N2IA 1UKVY 2YVUA 4RZ3A 4MYUA 3BAFA 4RFSA 3KKMA 3JVUA 4KFUA 4WIAA 5FR1A 3EIEA 1L7VC 3CNLA 1ZAKA 2PH1A 2ZI6A 4LHVA 3CH4B 2Q6TA 3L43A 3KXIA 3AUYA 2PEYA 5JCZA 2ZQ5A 3G5UA 3NWJA 1NIJA 2QMEA 1OGIA 3FB4A 4OI2A 2Z83A 1Q3HA 1E2IA 1HE1C 5G40A 2W2TA 3UWOA 4RD1A 3KKQA 3QIAA 4BE7B 2XEXA 3AKCA 3BJIC 5FTNA 1ZNWA 5FBLB 2F43B 3D8BA 4ASUA 3U60B 2CE2X 1KO8A 4PPFA 2GVDC 1FNBA 2WAYA 4URXR 1KAOA 1SM4A 4NYJQ 2WJGA 3TVDA 1GKYA 2WKPA 1H65A 2QTLA 2BGIA 1I2MA 3BOSA 4HB4A 3AVPA 3L8ZA 3KB2A 2ZETA 4XWAA 3ADBA 3U6KA 2VSFA 3I8SA 2ATXA 2GA8A 3KQUA 1CS4C 4P33A 3VKWA 1W48A 3JQQA 1N6RA 1SXJA 3M1IA 2A5JA 4TYPA 1CR2A 4Q4JB 3R7WB 2F3TA 4XIGS 3NDPA 2IYXA 4B76A 2JLXA 2JJ1D 2QY9A 1WP9A 3F3YA 2J3EA 4B2IA 3K70C 1AJEA 4QGFA 3WMEA 4HE5A 1QF9A 2JATA 3L0OA 1ZM2A 3MMPA 5EQTA 2HV8A 2P6NA 4KFSA 5LD2C 4PTLA 2ECKA 3R8FA 4JL8A 4Q7LA 1VCNA 3GJ6A 1NLZA 1DOAA 3DZDA 3GLHE 4DZZA 4RD4A 3CMEB 4LJ6A 1U0LA 5JI3E 3OIVA 2QG6A 2VP2A 4P4SB 1VQ5B 5BN5A 1ZM4A 1OXXK 2H1LA 3QXCA 4G5OA 2OCBA 2ZRHA 2V1XA 4GP7A 1OH8A 2GBLA 3QOFA 3SE0A 1G64A 4AF7A 1R0YA 1Q12A 2VH5R 2A5DA 1XRJA 3GLIA 4TN1A 1ZW6A 1K6MA 3KDSE 2BN4A 2VNJA 4PZLA 2OFOA 4AYTA 2QAGB 3PQCA 3U3RA 3DZ8A 3RC3A 3MWKA 3A36A 4DC9A 1MO3A 2AXNA 3E2IA 3M0EA 5LDDC 4D82A 3OEEA 2BBTA 4HYYA 3I8XA 3GEIA 1DTSA 2DPXA 4FI3C 3RNLA 3GJ3A 5JECA 1DE0A 1XMJA 1NJID 4YAOA 2FSGA 2ZSAA 2XGJA 4P3YA 3ES9A 2AKYA 4DLYA 4DDTA 1IN4A 1FX0A 4TYYA 1WMSA 2IYVA 2JJ2A 4XOIA 1VYTA 4AD8A 3CPHA 1E1QD 2ZJOA 2ZS8A 5B30A 4TL8A 4A8JB 3WBJA 3K09A 4WXPA 2D2EA 4Q1FA 5FTMA 1BMFA 1T3HA 3E5HA 4FIDA 4LHWA 5F3WB 4PSKA 1T5LA 1G8GA 1ZM7A 1DG3A 3U7HB 1FP6A 5DYIA 1GZSA 3MG9A 3ZVLA 4PC7A 1NRJB 4GSYA 4L4UA 4F4IA 4C2UA 1E2MA 2WM9B 1A2KC 2QP3A 1KZGB 1VQMB 2O0KA 4HI0E 3CR8A 5K8IA 2XOKD 5DSZA 2DBYA 1AQYA 2NQ2C 3HPQA 2WIAA 4LJ4A 1FNCA 2GVZC 1IAQA 3BGWA 1S0UA 4RZXA 3R8CA 3TNFA 1UEJA 1OKKD 4QM6A 5HZHA 4QXAA 4E5UA 3CCRB 1RJ9B 5JWOA 1W47A 4FMBB 2FFQA 2IA5A 4M9ZA 4RFSB 5CM8B 2X3UA 2KBEA 4U00A 1F60A 2H16A 4OK3A 4F93B 2QROA 1IBRA 1M1YE 2EFCB 3U7GA 2ZRKA 2FFHA 3I5XA 3CO5A 1E2QA 2PLRA 4V0MA 4TZ0A 1W0JD 2QMHA 2CEAA 3I4LA 1CKEA 1VYVA 2ODBA 3GD7A 1OH5A 5J47A 3B1YA 1NNEA 1CIPA 3UMSA 1R4AA 2P6RA 2ZU6A 5SZKB 3T5GA 3FFAA 3CRMA 2ANCA 4IDNA 1KSGA 4LV8B 4JJKA 2ANBA 4TYWA 4FWTA 4WW0A 3SZRA 1G19A 4YMTA 2B92A 5TDHA 4URWR 1S8FA 2HT6A 1AZSC 1XTJA 3I62A 4N3GA 3M6AA 1BJKA 1TPZA 2E9SA 2OFWA 2Z0MA 4FINA 4M1OA 1GM5A 4BPBA 4YLGA 1D2MA 4DB4A 1CNFA 3K8YA 1GILA 1QHSA 1IN7A 2G1JA 3OFNA 2V7QA 4Q5IA 1NBMA 4HATA 3ZQ6A 4NDZA 1U9IC 4Q1AA 1QVFB 4JSTA 1SXJB 4AKGA 2IUUA 1OE0A 1FRQA 1IM2A 1Z6GA 3IEUA 4QBIA 5E7IA 1OH7A 4AK9A 4QFMA 5GJVC 1CR4A 2CVFA 2PCLA 2WJVA 5BYKA 4F92B 3NHBA 2CL6X 1GRQA 3EG5A 1W34A 2BDTA 2W6IA 1W44A 2REBA 3HYTA 2ERYA 1JJ7A 4EFLA 2ZRLA 2PBRA 1AGRA 3BFVA 3AGQA 1OFIA 1Z2CA 4YALA 4R2HA 3IHWA 5KDLA 1QFYA 3TGPA 1XMVA 4TQ9A 4HLUA 2QI9C 4MDEA 2XNDD 1DO0A 5GJCA 1IXSB 4WOPA 2JEOA 1MT0A 1X8JA 4BFZA 1PLKA 1KO5A 3MFYA 3GLIB 4JBXA 4M53A 1CRPA 1TQDA 4M9SA 5C2JB 1A5TA 1W1WA 5FPHA 1D9ZA 3RC8A 1SKQA 2HEIA 4OJQA 5KOYA 3NIBA 2XAUA 3OIYA 1U90A 5KHOC 4O2RA 1E2LA 4ITRC 3NC0C 1YHQB 3FMPB 3AF3A 3S1AA 2VNKA 4KFTA 2NO0A 3K53A 2G77B 4PQRA 1LB1B 1XTRA 2HXSA 2VHJA 3DKPA 4LYAA 2QE7D 2DEUA 1ZP6A 2JLRA 2XB4A 4II7A 1TMKA 3NVAA 3FFBA 3ZIAD 5JJLA 1FX0B 1P9WA 2FF7A 2NGRA 2Z4RA 4GI7A 1UM8A 1WRBA 5GVRA 3WMGA 3BH6A 4C9BA 2A5GA 2QGZA 4AG5A 2ZE6A 2VP4A 4A4DA 2OZEA 1NN0A 2KWIA 4DLUA 3SHFA 1AS0A 2IEYA 1S72B 2PZFA 3K0FA 1ZYUA 4KBFA 3GLGE 1OH6A 1E0SA 2F9LA 1E0KA 1BOFA 3KJGA 1W36B 3TH5A 4V0NA 2DR3A 4HLQB 1SVWA 4CDGA 2FZ4A 1T0JB 2O8EB 1X3SA 4B74A 2GJ9A 2OHFA 5B57C 2IUTA 1Z0DA 3BB3A 2TMKA 2ZRNA 3DL0A 4Q18A 4ZDKA 3GP8A 4L9WA 2V55B 3P1JA 4F91B 1TQ6A 1N6IA 4G1VA 1P5ZB 4EPRA 2D62A 1T4GA 4I1UA 1LVGA 4B75A 4TMWA 1BYUA 1E2PA 4B33A 1XU4A 3L0PA 1A1VA 3D31A 3SJAA 4DCNA 2UZ3A 4LDJA 1E69A 2BBSA 4NKRA 1KDTA 3BK7A 2NO9A 3LW8A 1VYUA 2ZJZA 3IIJA 1Z0KA 3RSOA 3U44A 2G83A 2IHBA 3C15C 3SJBA 2RKOA 2ZSFA 2OCAA 4KLZA 1XXHA 4YHBA 2HF9A 2CL0X 2EFDB 5KO2A 1CQXA 4MRNA 2F6RA 3NC1C 1CR1A 4G01B 5EE1A 4BFUA 3GJ8A 3U4QA 2BPOA 2XNSA 2OXCA 4XD7D 3VR2A 2C98A 3EC1A 4OQMA 2GWHA 4S35A 3I3SR 5D3QA 2IW3A 2E1RA 2R9VA 1G3IA 2REXB 4G5GA 3KQKA 3B82A 1JEEA 1W4RA 2JCSA 2JIZD 5CB6A 1Z08A 2V9PA 5JRZA 1XTQA 4XWKA 2ZI3A 1A2BA 4QGAA 3PITA 3CW2A 1DS6A 2ZAOA 3CBQA 3E1YE 2GEVA 3CZPA 5DH9A 1WB9A 2FFAA 5TMPA 3F0TA 5BXQC 5GJBA 2CCKA 1XWIA 1Z06A 2WWFA 5DLQC 3VKHA 3NBZC 4GP6A 2R8RA 2ZRDA 5F2EA 1KD1D 1VQ7B 3BE4A 1PUIA 1OIXA 3AP2A 2VNHA 1XJCA 1XD9A 4RSGA 1OB5A 1L2TA 2F1RA 3K0AB 4D80A 1AS2A 2XTMA 4MA4A 3CRZA 1KK2A 2P2LA 1EFUA 3U6BA 1UADA 1W5TA 1TTTA 1XEXA 1XTIA 2XTNA 3G82C 3L2OB 3LY5A 4NCHA 2A5FA 2RGBA 4JYCA 4QHTA 3CCSB 4NONA 3A4NA 3S1AB 3PEVA 1R5BA 1YITB 1LF5A 3SR0A 1G7SA 2ZI4A 4OI0A 3TLXA 4GRAA 3SJZA 3JQPA 1MRNA 1Z0JA 3PVSA 1GNQA 1MABB 4B44A 1JB9A 2HXYA 5BN4A 1W36D 3CCQB 1HUQA 3PIRA 4RZ2A 5DHAA 4JMPA 1P6XA 3W2HA 3OZWA 1H8HD 1QHIA 1XJ0A 1KDRA 3BB1A 4V0OA 4ZPXA 5KPJA 121PA 4JIMA 5IT5A 1TUEA 3PUZA 2UZIR 2I3BA 2XZPA 2QENA 5FPTA 4PFSA 1G5RA 1SGWA 4FN5A 3DOFA 4FD2A 2OAP1 3B1WA 1H85A 4BLQA 1GTVA 1Y63A 3RVBA 2NO1A 2N46A 1TF7A 1HT1E 2V4ZA 3BFXA 3MWYW 2CDNA 3W8NA 4Q9IA 821PA 2XXAA 3KTAA 2JJ1A 1G7RA 3NTUA 1Q7YD 3X1ZA 2RGCA 3H1TA 5KU1A 4MITA 3DDCA 3DHWC 1IB0A 1LF0A 1B2RA 3IHLA 5BN3A 4M0LA 4ESHA 3GEEA 2ZE7A 5FOWA 1F2TB 1IQPA 4DXAA 1GIAA 3ZGXA 4KU4A 4UXIA 3HP1A 2R6CA 2PZGA 2RGGA 4EPVA 4D81A 5L3SB 2Q9AA 2Y8EA 1Q3TA 2Q9BA 2V6JA 2ZROA 4IVPA 3HJNA 4MUAA 2FPMA 5A4JA 2GHIA 3HR7A 3K0EA 3K9GA 4GZLA 4CEHB 5HTKA 5FL3A 4NYJR 4C0BA 4DKXA 4RD3A 2YINC 2YNMA 3UATA 1VQ9B 3MAAC 2XJ9A 3IKJA 2VP5A 1HH4A 3V9PA 3CONA 3LX8A 2GJ8A 4EPWA 4WA7A 5FOVA 2O5VA 2UKDA 3VAAA 3U4QB 1PV4A 4BECA 2OT3B 5HE8A 4AIIA 4EQ6B 3AF4A 2EWWA 1G6HA 3E20A 1J8YF 4NE2A 3ZC3A 1G8HA 3N70A 3RWMB 2QT0A 3EA5A 1XFAA 2CLDX 4QNRA 1OW3B 2O8BB 1Q57A 1VCIA 1VPLA 2O8CB 3C14C 3FKSA 2IYQA 3QXXA 3AVUA 5IDVA 3EPJA 5G41A 1CLUA 4DSTA 5HZKA 2LWIA 2IHYA 5FI1B 5H8WA 4LBVA 3RSLA 3NKVA 4TLBA 4EPXA 2IXEA 4IHQA 1ZIPA 2BM0A 1AA9A 1P3JA 2OM2A 2C9CA 2WWYA 1WBDA 2BM1A 1IN5A 2VHQA 2C9OA 2ORIA 5GADl 1RFLA 3EZ9A 2XOKA 1CR0A 3I73A 1DADA 3CCEB 2ZRPA 4DLSA 1QHNA 3V76A 1I4DD 3CC4B 2WIBA 1MV5A 1RRGA 1KYIA 1XEXB 1OKKA 3AP1A 4I1SA 4NHOA 2CJWB 3SI7A 4F4JA 1K5DA 1YE8A 1U9IA 3A37A 4K1XA 2VF8A 3W2IA 2ZJ5A 1V43A 3QNUA 4LJ8A 4AURA 5J4KA 2ZYUX 4JSYA 4QJ5A 3K70B 3SYLA 2D74A 2BMDA 1KGDA 4KV9A 1RRPA 1Z6AA 2J87A 5FBQB 3K9HA 2VHTA 3KB1A 3V4RA 5LD2B 1QUEA 4L15A 2WKRA 4OI1A 5KYKA 2IUSA 4URYR 1E96A 1OIWA 4BEBA 5FUYA 3BBPA 1XJQA 4HEJA 3C5CA 1BQEA 4O3MA 2VLIA 2JASA 4WAUA 3GCGA 3D3QA 4O0MA 4M1KA 5TVKA 3R7WA 3IBGA 1NG1A 2AXPA 1UDXA 3PFIA 2ZXUA 2AD5A 1II8B 1R6BX 1GNRA 2ORWA 4ZO4A 3QUSA 1LNZA 2ZSBA 3EASA 1J7KA 4PC2A 2C5LA 3V00A 1HEIA 5AN9A 5EUQB 3UXMA 1VDZA 4IOMA 3EWAA 3QG5A 721PA 1Q20A 2R6AA 2O8DB 2G1KA 3KXLA 4W7SA 3H4MA 1FUUA 1KI2A 3AVXA 4D0LB 8OHMA 2GRJA 3A8TA 4P4SA 4YMSA 2YOFA 3BIFA 3OHMA 3AV0B 3IQXA 3MRSA 4OI4A 5B64A 4ZGNB 1OXSC 1HA3A 1COWD 2VL7A 3IIKA 3ZS8A 4D0GA 3T1TA 4C0HA 2FEOA 1S9DA 4A0FA 4IOLA 1EP2B 2QPTA 4E22A 3B6EA 1W49A 4A0RA 5F98A 2XNDA 2FOLA 1XE1A 1E79D 3QPUA 1S1MA 4ZDWA 1FNNA 3CX7A 4KXFB 4CEJA 3NXSA 2VPPA 2GJKA 2QTZA 2YC2C 4I1VA 3V4FA 3C16C 1ZM9A 4TT3D 1E9BA 4Q7KA 4DLXA 4MH0R 3KUDA 2IEZA 5AUPB 5FBWB 3SOPA 1MO6A 1NMYA 4I99A 1KTVA 2J46A 3CNOA 1UDWA 4PAQA 1S3GA 2WWXA 1KSJA 3SEAA 3ZJYA 2YWHA 3EPHA 2RH5A 4M4SA 3CM0A 2NZ8A 3IPYA 1ELOA 3EAQA 3ADCA 3ZVMA 2RGDA 4LYJA 1TUIA 2QE7A 1OXVA 1QGAA 3W3AA 2A7QA 4Q02A 3W5HA 5DI9A 1IN6A 1GSIA 2FEMA 3LBNA 1KI4A 2XXAB 3LBHA 1AKYA 2BEKA 5F9FA 4ZKDA 4KBGA 5FL7A 2HCBA 2D4HA 2EYUA 2GPJA 1NMZA 1VG0B 4QNMA 3KKPA 1HE8B 2CMKA 1GVHA 2XNJA 4RCYA 3GLHA 3BWDD 4OK6A 4CW7A 4US0R 3WXMA 4NCIA 4E09A 1U8ZA 2Z6VA 1L4UA 1LW7A 3CKLA 1CJUC 4A0HA 3TUZC 2G88A 4A2PA 3WYFA 1P60A 2ZEJA 4KFRA 4DHEA 1S4QA 2WHXA 4XVUA 1CEEA 3A58B 2C9YA 1N0VC 3AF0A 2OILA 4V02A 5CYPA 3FMOB 1L4YA 1B0UA 1CJKC 1NIPA 2NO6A 2BWJA 4B2PA 1G3RA 3K70D 1F5NA 4PO8A 3LW7A 1R5NA 1WQ1R 3CNNA 3CUEF 5H1YA 1XD2A 2R44A 4CIDA 3LO8A 1ZUNB 4MRRA 2DERA 2G0NA 1CULC 2H5EA 4OQXA 1HYQA 1S96A 4GOJA 3CRRA 5AJWA 4ARZA 2F55A 2GCOA 5KNBA 2X19A 3CC2B 4B34A 1H42A 1W5SA 4Z54A 5JHHB 1JALA 2ZREA 4BRUA 3UPUA 1Z0FA 2YOGA 5JS7A 2QA4B 1NVXQ 1ZU4A 3B7GA 1KDPA 2IYZA 5KSWB 2WJYA 1W87A 5L3VA 3QFRA 2WAXA 4HLCA 2OE2A 3H86A 1DAMA 2JLZA 1KY3A 4ZCMA 5AUQA 5EE3A 4DSNA 3E1SA 3U2QA 1K5GA 2CVHA 2EVWX 4L8GA 3KQLA 1KO7A 5AWFC 1ZNYA 5KSZA 3B13B 5EZ6B 1JXOA 2VP0A 1QHGA 2X77A 3I72A 1E2JA 1IXRC 3NEJA 1DEKA 3CF2A 2QRNA 1Z0AA 4ZI2A 1OYWA 3C7KA 2OK7A 2B8WA 4LJAA 4B71A 2ZJAA 4TL7A 3Q8XB 2IX3A 4B32A 4LC1A 3IPXA 4LX0A 2ZUDA 1EFRD 1TAGA 1AS3A 4XD7A 3QKSB 3GFPA 3W5UA 2EQBA 4DSUA 4JYBA 1D1NA 5LB2A 2J7PD 2P67A 4MRSA 2ZPTX 2JIZA 3VQTA 6Q21A 1ZRHA 3KL4A 4PSVA 4NP6A 4A0GA 3VNVA 3U3MA 4PHGA 3FHCB 4K81B 4V0KA 4NMMA 5LBIA 1RW4A 3KX2A 2VEDA 2HUPA 4GZMA 3L0SA 1FP7A 1P2SA 4MGKR 5CYOA 1BO6A 5DI3B 2FDCA 3CWQA 1GR1A 4AKIA 4M9QA 3CPWB 2IS2A 3SU8A 4ON9A 3GLFE 3CB4A 2QBYA 4CEJB 1M6NA 3Q72A 2BCGY 4OHVA 3W5IA 1SVOA 1OIVA 2WMNB 2VHUA 4R2IA 2QP9X 4W5WA 5C46F 1U98A 1VQNB 1P62B 1NP6A 4DCSA 2BV3A 1CP2A 3MGCA 2ZE8A 1U8YA 2R6HA 4LI0A 1D5CA 2O0HA 3ZBUA 4GBMA 5C1BA 2BMEA 3VNUA 3IDQA 5KSPA 3MCAA 3FKSD 1KSFX 3QQ5A 4IEEA 1W4BA 3THWB 3WHLA 4XTCS 2LCFA 2W0MA 1GOTA 4LY6A 3RANA 2GCPA 5EXSA 2KI5A 5HCNA 1E62A 2F3RA 3QJYA 4YAUA 1TF2A 2Z4SA 1V5WA 1ZIOA 1Q81D 3AUXA 2ZI9A 3DM5A 1HQYE 2HMAA 3AKEA 5TXGA 2ZR9A 1H8HA 2BBOA 3WNBA 3GLHB 4D25A 3BRWD 4TQAA 2O8EA 3UG6A 4Q1DA 2ZJBA 5EZ5A 5DGXA 1KY2A 3OE7D 2FGKA 2QDXA 3B9QA 2P0EA 3RDPA 1J90A 3I55B 3BC1A 4WVFA 2OCPA 4R71A 3PEUA 5G53C 4QJ3A 4NPHA 5BWMA 3AVVA 1W46A 2P5TB 3A1UA 2IC5A 5E7JA 2BKUA 4FCVA 4F38A 1E3MA 1KQSB 2VF7A 1YZUA 4B73A 1XD2B 3GLFB 4RD2A 1SKYE 2VO1A 4NTZA 4BFTA 1EX7A 3KXKA 2YJTD 4ARZB 2QORA 2RGEA 1FOEB 3CH5A 4HAWA 2GCOB 1RE0A 3R9XA 1YR6A 5DI3A 3TSZA 4JLDA 2V1UA 3U5ZB 4HUQB 1N0UA 3RRNA 5H70A 1YR9A 4GFDA 4F7WA 2C96A 4MKGA 3WRYC 3C8UA 1J2JA 1C1YA 2ZRCA 3QY0A 4ZKEA 4BUJA 2FE4A 1LTQA 1MKYA 1UKYA 4WQMA 2GXAA 3NEYA 4EKDA 2BGJA 2CE7A 2FWRA 1PLJA 4M1WA 1P4SA 3HU2A 2J5XA 1XD8A 2OLJA 3GLGA 4PC3A 5KSYA 4JLVA 4XH9B 1ESMA 3EIHA 3X1WA 2AX4A 1D9XA 3DVLA 1UBEA 3GJXC 2ONKA 2IYWA 2JLUA 4PHTA 1G3QA 2D7CA 5JHGB 2H8KA 1O3YA 1IY1A 5DHFA 4A36A 4KCGA 5TARA 5JI2E 5ELXA 1CTQA 3UK6A 2ZSDA 2AR7A 2ZRAA 3G0HA 2ODNA 4JLNA 4OKSA 1I4LD 3K0AA 4W5HA 1ZNXA 4D4LA 3O8BA 4PAMA 4BASA 1T8UA 5EXPA 1E0AA 1SKYB 1YRAA 3QE0A 2N42A 1BS1A 1EG7A 1GG2A 1VCOA 2IT1A 2ERXA 4EH1A 2W00A 2QBYB 3AKDA 4KHZA 1JA0A 4RKFA 2FMXA 5FI0B 4JVLA 1DAGA 2ZYTX 4IVRA 3VR3A 1PZNA 4YDHB 4C2TA 1NVUQ 4LSGA 2BMWA 1C9KA 4N0DA 2FSFA 4Q66C 1RKBA 1MABA 2OTJB 2VA8A 1Z0IA 4RFVA 1DDGA 1Q22A 4JJZA 4P0TA 5FL7D 2V54A 4BLTA 1KKLA 2J59A 4W9MC 4CVNA 3KKNA 3DMNA 2ATVA 1K8RA 1XNJA 1ANKA 1P7CA 2RMKA 1ONBA 3K0CC 3QEOA 5B2ZA 4U7DA 3CX8A 3TBKA 3SNHA 3KFVA 2OFXA 4Z51A 1Z63A 1IXZA 1ZC3A 3Q9LA 2AHOA 2KSQA 2NO7A 2X8AA 2ZI7A 4B3FX 1GRNA 4PHFA 1G5PA 4ACAA 1N2CE 1RYFA 1LFDB 3CD6B 3A1WA 4BFSA 1CNEA 3LQRA 2CK3D 3FHOA 4P31A 1E9EA 1GVNB 1WXQA 5IRCD 4Q7JB 2NMVA 2ONJA 4R98A 4TMXA 4BWYA 3OEHD 4G0NA 1TADA 1HT2E 1NJFA 2OSBA 1J70A 2QTFA 4OBEA 2ZVPX 3NBYC 3MD0A 5CK5A 1GUAA 4IDHA 3T12A 4YDSA 3ZVNA 4I4LA 2PJRA 1M7HA 3W6OA 1TQ2A 1G4AE
chains in the Genus database with same CATH superfamily
1JIKA 2I33A 3N76A 1EWTA 3TQQA 4C4ZA 2VDJA 1Y6RA 1YS4A 3L7MA 3V97A 2IH2A 4AS3A 3PNLA 3DCNA 3N74A 3UV7A 3OO0A 4CM4A 5J58A 1E99A 1ETUA 1N3BA 3LT4A 4GMKA 1Z5ZA 4CQLB 4LFCB 4NULA 4QEDA 3LJKA 1E9AA 1YGPA 3SQXA 3TB4A 1FP1D 1O4WA 4L1KA 1ZUIA 4KQ6A 4I5FA 2E6UX 3Q8MA 2WJPA 1UJNA 2E2WA 2PSSA 3E9YA 2O07A 3JQ7A 4PEVA 4QBGB 4IILA 4X92A 5D2CA 1R6VA 1T91A 1TQ4A 2KBFA 3W8RA 5BSEA 2P30A 2V3WA 1FPMA 3SEJA 3KKZA 4JJEA 1HDRA 4K3VA 3SZGA 2WUVA 2BFDB 2IHZA 1Z5GA 2BGLA 2X22A 2QTTA 3KB8A 4XD2A 5TMDA 5BWOA 3L9XA 5AR1A 3RBAA 3NBXX 4HMPA 5EZQA 5LMUB 2GAAA 4DDWA 4MGYR 4I1IA 3A4IA 1WTCA 1RAHA 1EI9A 4OXQA 2JLVA 4UHFA 4KLAA 1JU9A 1JKJB 1ZWLA 2FW0A 2P40A 2RK3A 3AU9A 3MK31 1EDZA 1KYVA 4KVGA 3D5TA 4H3KB 3D6UA 2ABWA 2Q6LA 2MMCA 1E6WA 3VU9A 3VU3A 3D5QA 4KACA 4PIMA 4LISA 1KI3A 4GLBA 2Y0BA 4Y2YA 4S1VA 4PGGA 4RVFA 2NT4A 3B48A 3G0BA 4I46A 2J09A 4HB0A 1A82A 1IHOA 4JELA 4WASA 5JO0A 4E31A 1TUBA 1IATA 4ZAWA 2C9ZA 4Q03A 3VDRA 2HREA 4YMVA 1XPJA 4D9NA 3RY8A 5LQMA 4QXPA 4ZAGA 3KAPA 5E2AA 5JMWA 3QG1A 5DIZA 2O7SA 1U7HA 1MO4A 2JLBA 5T67A 4B3CA 1ZQ1A 5TLSA 3FOZA 5KOJA 1N8SA 3DVAB 2RBGA 4GZ3A 4E07A 3DNMA 4DUGD 3QEMB 5LQJA 4G1MB 4CLOA 2AQHA 3WWYA 2WJWA 1N1EA 3VZCA 1Q0UA 4DNRB 2Q9CA 4IMJB 3DVRX 3AHDA 4KWIA 1X2BA 3ZXYA 5U9CA 3DBOB 2PT7A 2WUWE 2NUTA 2VR1A 4DIKA 4TZ6A 4N8EA 4E15A 3L1KA 1M1UA 4NBVA 3ZLVA 4E5SA 4DSOA 3H5NA 4FJ2A 3CH7A 2I6GA 3KT8A 3OZXA 1SCUA 1BVYF 1ZXXA 3Q98A 4TTTS 3VR1A 3KK0A 3EEIA 5EMKA 2AV6A 2CJWA 2WDZA 4FNGA 5LVAA 2DVMA 4WBNF 1OHHD 3VX4A 1XTSA 2WPDD 1E6EA 1PVOA 1B43A 1KVUA 5ALLA 4G0MA 1NBIA 5M04A 2IYYA 3V80A 3JYLA 4F4FA 1BNCA 5AVXA 4I4TA 1UBOS 5SZJA 4DIFA 1SZPA 1I94B 3D8HA 3AR8A 3C1UA 4JT2A 5EHIA 1RHRA 3D6TB 3U7EB 4MWOA 2PMDA 5EIHA 1WETA 1NFRA 2CF4A 4QUDA 3G5MA 2RBKA 2AKAB 3D3KA 5AI0A 1T2NA 4Z4TA 1E20A 1QC5B 4KZPA 4B7CA 5JYBA 3A7DA 3IP9A 1LGYA 5ARBA 4EPYA 1B2LA 3V2GA 4YJHA 5AHXA 1ZL0A 4TL9A 3A3GA 3AFMA 3KKKA 1V39A 2FWMX 3GZNB 3OZFA 3T35A 4A6XA 2GBLC 1KMCA 1FXUA 1HYHA 1I36A 1VCMA 1W581 1ZMXA 3QYJA 3E70C 4M46A 4WZ6A 2W2XA 5HIKA 2DETA 4Q1EA 3CCFA 4TS1A 4C0SA 1W0KA 3H11A 3MQFA 4L8WB 1THMA 5EWLB 4BJ1A 4Y2XA 2XMZA 3S2SA 2ZIEA 4IOKA 1C9NA 1YUBA 2IXGA 3C97A 2JLYA 4XVQA 5AOBA 2F48A 5EXEA 3GRUA 3QPAA 2DIEA 3V4OA 2O8DA 3JVVA 4JBHA 3NFYA 4DG8A 2J5BA 2PT6A 1D2GA 1L7OA 3F6BX 3K96A 4GM1A 4B3DA 1J5EB 4UZUA 1DWQA 1MVOA 1CLEA 3OUUA 4IDGA 1E89A 1G5TA 1H0RA 5CA0B 5KKCA 1PL6A 3G85A 3PFWO 5GP1A 1ZZGA 2Q5LA 2M5SA 1OI4A 3I92A 1ZSVA 4I08A 4UU1A 1B42A 4YI5A 1CDDA 1LSUA 3GVXA 3ZDRA 4CL8A 5EFOA 1NQVA 3ICOA 3PDJA 1T0UA 1XCOA 2VKQA 4E4YA 5AVQA 4JBYA 3AVTA 1N2XA 1QPBA 1WXFA 2PXAA 2GAOA 2XUDA 3AR9A 3DEJA 3F90A 4NMWA 4TKMA 3WXBA 2AFIE 2MU1A 1G7CA 2XZDA 3ZTWA 1G42A 1W88A 2C42A 1QZTA 4X7MA 4N3CA 4P5EA 3LP8A 4HFMA 4MW0A 3UT6A 4UHHA 2JAQA 1MD9A 1VI2A 2G36A 2QG9A 3AXTA 3LXRA 4MPTA 3T5DA 4EEZA 1M76A 3C4QA 3U5TA 4BOYA 2NU6B 1EXDA 4WTOA 3ECCA 4RM0A 1EP9A 3R41A 4GZ5A 1P17A 2R1VA 5F2OA 1V3QE 1NRXA 2UVDA 4QUZA 4AG6A 3PKIA 1I7SB 4KPEC 1M0WA 5L95A 3K72B 1R9NA 2I7CA 1Q1NA 4J2TA 4AMBA 2P6PA 1EBBA 2QZ4A 3JD1A 3A9RA 4LF8B 1JQKA 3PXXA 3RH0A 1EFKA 2PGOA 4RQAA 2QP4A 2W4QA 3CG4A 4P7FA 3Q39A 3HB9A 1EK0A 5I8PA 3WLNA 3ROXA 1A0OA 3IE1A 2JFGA 2D2FA 1EDDA 4O4JF 3BXXA 5TJHA 1F9EA 1ODFA 2ZW9A 2OOSA 1SCQA 3QBTA 5B4TA 3IL2A 1CF4A 5K51A 3OWXA 4AMGA 1S2MA 4TYQA 4N5NA 1H69A 2DKOA 3A06A 1YU9A 4OXRA 1A2QA 2CXXA 3BA1A 4V0LA 4CMJA 1LBQA 3IUBA 1M2OB 2VQ6A 3RAGA 2WD7A 2VXBA 5IDXA 1X7GA 4EA6A 1PR3A 3K6JA 1GPJA 1TEHA 1XQ9A 2IPXA 4FUTA 3RRMA 5L4LA 3QVWA 3SR3A 8MHTA 3BEOA 5E4FA 3AJ8A 3M4ZA 4X65B 1KP2A 4S24A 5CT9A 3IPAA 3BHNA 4OMUA 3FY4A 3L04A 1XQWA 3G4SB 1P73A 3HJRA 1H4QA 1XEWY 3MOSA 4OXIA 1ZMBA 2OV4A 2GXUA 5C7YA 5COQA 4C0LA 4EUEA 4QUGA 1G6Q1 4EMBA 4A6EA 3GFVA 1JQJC 1TD1A 4M1MA 3U16A 1B6SA 2PX0A 1WZCA 3R4VA 2C07A 1UD6A 2OMKA 2KPOA 1K8XB 3WP1B 1C41A 2GJSA 4E03A 4QYTA 1HTWA 3IEKA 4IXMA 1WTAA 4C6TB 4LHXA 2EZ9A 4OUDA 2GXSA 5HX7A 2QLJA 1QPGA 1ODCA 2BEJA 2BVNA 2NSHA 2QTHA 3O2NA 3PPYA 1M34B 4I55B 3O8LA 1LPNA 1KFJB 3ONEA 4ZANA 4C4PA 4D8VA 5BURA 3FH0A 1JDVA 4KQ1A 2FP3A 2YVAA 3ABRB 5AKXA 3HRHA 3V2IA 3THXB 1U5AA 1SUWA 2OHIA 3V8PA 3A3BA 3IAUA 2FWJA 2ZANA 3MTJA 3I1YA 4G1EB 2RB4A 2ZRIA 3K0SA 5EQDA 4BKUA 1P29A 1ZVJA 5H59A 1ZUHA 3QE9Y 3WK7A 2KJQA 1IHYA 2O19A 1HYEA 4ND3A 5K3DA 1Q86D 3C70A 2KHZA 4KQXA 2PPLA 5LU8A 2Z5VA 2H07A 1TZCA 5FDFA 3W9BA 2ZRJA 3KCQA 2HW8A 3EGCA 5KC9A 1NJ2A 2PSHA 2ODWA 1ODJA 1N92A 2Z2KA 5A05A 1C7ZA 1YR7A 2FN7A 3NTXA 5JD5A 4N7MA 4HADA 1RI1A 1CJBA 1GDHA 1SG9A 3PFHA 3DLPX 2GFHA 3W3AH 2RHOA 2QN6A 4RESA 5IBCA 1QX4A 1DAEA 2XGMA 3GG9A 5HPYB 4P0QB 2YJZA 1EU1A 3R3JA 5ALWA 4J1NA 4GXQA 3WJ7A 1YSCA 2G0TA 2XYRA 3DEHA 4QG7A 4S12A 3QLUA 4H18A 5CB8A 2JK0A 2LCQA 4E46A 3LZ6A 2YHAA 1SVMA 2C5SA 5KTMA 4GI3A 4AWAA 3RS5A 1E7MA 2B94A 1HFJA 3JSXA 3UAYA 5LNK6 1OGYA 4IHAA 4Q4LA 4UXJA 4D3FA 4B43A 1LQ2A 1WVGA 4PLYA 4TL6A 4BNGA 2WVHA 3CT6A 4IVNA 5HS4A 1L5YA 4KQWA 4MGHA 4RA9A 1POXA 1U7DA 2FWAA 5KOHB 1DKRA 1U99A 2DFKB 1G9SA 3N39C 4X54A 2Q4EA 1NJ8A 1AZWA 1AQ6A 3GJQA 4IGEA 4DV4B 1RAAA 4AY2A 2ZIGA 3HZHA 4WXHA 5JU6A 3QVUA 4MQLA 3VAYA 2GWRA 1ZCJA 3ET5A 1FPQA 3KLPX 2CHQA 3DO6A 3EPKA 3ANNA 5BSUA 3R8XA 3QPWA 3THWA 3K1AA 5EKXA 5FNVB 3DW1X 2XUAA 5TJ9A 3WP0A 2HC9A 1NY6A 4PRYA 3UT5A 1CQIB 3UXEA 4QBHA 2BE7A 2ILVA 3C98A 3WL6A 1SOWA 4CIVA 2WTUA 2HFJA 4GD3Q 1N78A 3CLUD 3E23A 4IPTA 1DG9A 3DBHA 5IAKA 4BU1A 4QXQA 1Z6QA 4QULA 4R2KA 1HDCA 2H4JA 3DAHA 3F2IA 3NOQA 5J2TF 3VX3A 2DH5A 3QI7A 2ZYDA 4ZQIA 1P1HA 2PZAA 1PJRA 3JYHA 3JALA 1WJGA 4L75A 5C4MA 3OAAD 2IYUA 1DVRA 1PFYA 3KKOA 3VFDA 4EP1A 2WYRA 1FQOA 4LZJA 4IJVA 2TMDA 5DW3A 2FN8A 1RLMA 1E5TA 3C39A 1KI6A 5SZHB 3FYHA 1XRPA 1KMIY 2XCQA 4ZALA 3BBLA 3NS7A 3SIPA 2WY2D 2QRPA 3KLOA 5K8LA 1DHRA 3RVOA 4BE9A 3F9IA 1RQGA 5CNJA 4J0EA 4FMDB 2BMAA 2OK8A 4LZOA 5EXXA 1VPDA 2F1LA 3STHA 3UJ9A 2Q4TA 4US2R 4A5OA 4OGFA 4N41A 1JVBA 3IKLA 3VPBA 3G2KA 3TEFA 4BRSA 4C3VA 4EMSA 5JEDA 5TT1A 3OFSA 1T2EA 4LYFA 3KEOA 5AJXA 5LWHA 1R0LA 4IX1A 1M75A 4G5HA 1P2BA 1ID1A 2JC3A 2X58A 2YY6A 4IWYA 4ZVLA 5CCDA 2IP1A 3TRJA 2Q5FA 1UWCA 4LPSA 4Z3DA 4LJYA 3DH0A 4AROA 4URVR 1KDZA 4H7HA 4C7OA 2C20A 4XR4A 4BO6A 4ZVVA 4BB0A 1VQ1A 3DUFA 5CA1B 3MT7A 2QM7A 3B1XA 2W2PA 4MR9B 1W0KD 1A95A 1M3SA 1HDXA 4DYDA 3Q6RA 4C6HA 721PA 4NLLA 3RU7A 3BS4A 5JUWA 1A8PA 3ROGA 3OUTA 4ZQCB 3FDXA 1KEWA 2XX3A 1H2YA 4GOXA 3D8SA 4KUGA 2MSEB 4H7IA 2GN4A 3PPVA 5P21A 3WKCA 4ZZ0A 2KM1A 1FQJA 4DV7B 4BAUA 4BFVA 4WCFB 1Q2UA 2IE8A 2AL7A 2DCMA 1N5IA 5DBIA 1TU0A 1GL6A 3QVSA 3TEJA 1Z5PA 1H2XA 1RZRD 1W4CA 4Q3BA 4Q24A 4RPLA 3VXKA 1DARA 2DQKA 3HBLA 3JAKB 3P9YA 3PWKA 4LOAA 1UMKA 2ID8A 3I42A 2UZAA 3QF7A 4EW6A 5E0KB 3VC3A 2RIPA 2BFEA 3KWMA 3B51X 3LPAA 2XW6A 3B1JA 1JJBA 2DHQA 2GNAA 1P1RA 1HMPA 2UYGA 1JEJA 3CGGA 4DLVA 1Q9SA 4MAFA 2CCGA 5DWDA 5J4YA 1II0A 1VE3A 3SOZA 4CQNA 3I0MA 4QDXA 5MN6A 1F7VA 5JNSA 2Q50A 3MMXA 1KYTA 2C5BA 1MG5A 4K40A 4EG4A 2DQSA 3ZHZA 4TMYA 2XKBA 1G16A 3GUYA 1T2CA 5IKOA 2WBLC 3R76A 1DC7A 1TO2E 1NL3A 3IMFA 3N05A 3CVVA 3OW7A 3UH0A 1MJGM 3LP6A 3PRHA 4JOSA 2FPPB 4TLLB 3MWEB 3X1YA 3ORHA 4DLAA 4TWIA 1VMAA 1SXIA 1LA2A 2CLFB 4DYVA 2DULA 4EYQA 5A4MS 4K6GA 2JH8A 3W9YA 4UHKA 2YH2A 2O9JA 1IUPA 4CPDA 1E94E 3RAEC 1FMJA 5EYPB 2N1MA 1V1MB 2HJGA 1EGMB 4K2HA 2QQ0A 2XH8A 3C6BA 1U2TA 2GZHA 4IQ8A 4OL0A 1PFUA 3B1VA 3EZ7A 3N7AA 1PWEA 2H17A 3KRTA 3QPCA 2Z43A 5T8KC 3AL0C 1AC5A 1UBJS 2WIKA 4JQOA 4OQQA 1G6OA 1QKJA 1OXBB 3DJYA 2XLBA 5DX8A 4YJ3F 4LWQA 1WUIS 2ROQA 3ST7A 1LPAB 4F3TA 1XPRA 3KXDA 2G09A 2LXNA 2P9EA 3I9JA 3HM2A 1PFWA 3NNSA 5FB3A 1Z0ZA 1R0XA 1XF9A 1JX6A 1FBTA 1EX1A 3OIWA 1E7QA 4BLVA 3THYB 4G9GA 1U7UA 3KPUA 4FS3A 5BVGA 5HQ3A 1BCRA 2I76A 5LMZA 1YI0A 2ZUTA 3S40A 3WFZA 1QU2A 3AEKA 1RS0A 1YRBA 1N06A 4OB8A 1R10A 3IAS1 2XUFA 4KSCA 1FVFA 5L40A 3OKAA 1GKIA 3WYGA 1BDJA 1QBKC 3CX6A 2WKSA 4PQYA 3QX8A 3I58A 4MVJF 5K0EA 3WQHA 2EW1A 4WGGA 1LI5A 3U9LA 2X0EA 4XMYA 1QMGA 1U8UA 3RF6A 2WZPP 3WV5A 4IFEA 3B9RA 4JB0A 2V6MA 4KRGA 3Q7SA 5GQSA 2AOTA 3B85A 3HXMA 1XNQB 3U61B 3NTOA 1ATIA 4TSFA 1NQAO 1Z0UA 3LQ4A 2ZDGA 2AE1A 1XBTA 2EERA 1LV7A 1YAHA 4UXHA 2C5AA 5EJ5A 3K2IA 2JGEA 3JQAB 1M2FA 2VNSA 5A7HA 2I2FA 4IKOA 4R1UA 1BS2A 1DC3A 3II6X 4MQ5A 2ENWA 2I54A 2VHCA 1A8QA 2FMIA 1YFKA 4C04A 2PXXA 4PLCA 1CUWA 1VL6A 4UUBA 2CLKB 4KXXA 3PUKA 5K0ZA 3TG2A 4NEQA 3CCLB 2AR0A 4M54A 2B2NA 4PX3A 1N2CA 3DEKA 3EXG1 2HZBA 3K8OE 1PDWA 3C5HA 4KUHA 4L02A 4UKDA 3TO5A 2G4CA 1FDRA 2H2FA 3SE7A 1WUYA 1YL6A 2Z9DA 2D7DA 4XEHA 4DL9A 1BDBA 3ESBA 3D59A 4LOKA 1YQWA 4KP7A 4WZAE 3LTNC 1DBRA 1LBSA 4AICA 1OLUB 5DNEA 2XYHA 1FUIA 2CGEA 5EKTA 4Z6KA 3DEIA 1PKXA 4LE0A 2IZ0A 1A4IA 1GDDA 1XQBA 1GTJ1 1XRSB 2ZVJA 3UKJA 3LVFO 2IXTA 2BDUA 3P20A 3PP8A 4KLNA 3ULKA 2GYVA 4LGCA 5B6IA 4YQFA 1R0ZA 1NGSA 2NU9B 4F5DA 2VIIA 1KVSA 1XA0A 3EVTA 1QVGB 1WE2A 1INLA 2WOOA 2XUIA 2JEZA 1NNSA 1GKUB 3O3OB 3QV2A 1M8JA 1WV1A 4J4TA 1YLOA 3I9LA 4QXOA 5C3MA 4YUYA 1OXMA 4KEAA 4FYIA 4DM4A 1TAHA 1V2HE 3PHLA 4RGYA 3DMGA 2XSZA 3L7AA 1LTHR 4K5QA 4PPYA 2ORVA 1NXXA 2QUIA 5BMVF 2FV8A 4C1NA 4LSMA 1XV5A 2VP9A 2AFHA 2C77A 1XRMA 2YZGA 5C1IA 2I6FA 5BMOA 2YWRA 1OLXB 4XLLA 3FE2A 5HS6A 1JG4A 1QYWA 2QM8A 4MV4A 3B5EA 5BN5B 7YASA 5JSUA 3VU1A 4DQ0A 1FJXA 4YCSA 4GYWA 1UL1X 4TRNA 5HP4A 4Q48A 2UVQA 1AHNA 2ID7A 1KMHA 3Q0EA 4NI5A 3FWZA 4P1ZA 2B37A 4YAFA 1C30A 3I6ZA 5TGTA 3NHLA 3OX4A 2H2IA 5KJEA 3DE5X 4ZHSA 4L3VA 3FGNA 1ZJ6A 2I2BA 3ENKA 3R5KA 4J0HA 1MIOA 4IS2A 4NJEB 1XU9A 3EW9A 1LNSA 1J2RA 4JQCA 4E30A 1NLYA 1V11A 1P9OA 4EY5A 1HE3A 4DNXA 2W6OA 4BNIA 4YV7A 3JYOA 3T5BA 1RPJA 2E4XA 2HA2A 2H59A 3KZKA 2C4NA 3W8DA 4AY4A 4ZV4A 2NU7B 1QG4A 5AW3A 5IHPA 1E1RA 5LOVF 5CLGA 3BWVA 2IEBA 2QAGC 4LUCA 3ZS9A 4OX9Y 3SIXA 3CE9A 2NZJA 1E5LA 3GCDA 3WY9A 1F51E 2X5XA 5F4MA 1RU3A 1K63A 1WCIA 2GXQA 1WZEA 3E7DA 1GFIA 3DFUA 3FLMA 1UPAA 1FLVA 4IINA 4ZOBA 5A6VA 2GN8A 5HUJA 5FTWA 3L7YA 5KMGB 1X7WA 3USCS 5C80A 1Q83A 1RPZA 4ZYWA 3WGLA 3WNDA 3SXUA 2QYSA 2X1MA 4CYMA 3OU7A 1F8XA 4N0MA 2XNCA 4PW0A 1E2HA 4KR0A 3BDIA 3JQGB 1XRLA 1OBOA 4Y30A 4YIHA 1TZ2A 5LXTF 2JIOA 3RC7A 1PR5A 5AK6A 4NU5A 2EG5A 1JLLA 1DUSA 1ZBDA 4BNFA 2OLKA 4ECEA 5HKOA 3FYUA 1YJ8A 4EFNA 3M9WA 3FR8A 1ACMA 1K7YA 4MO2A 4OA8A 2BEWB 5DT9A 5HJEA 3JQ9C 1MO5A 5KQGA 3O9ZA 2QUJA 2ZT7A 4KQKA 2NV2B 4X20B 1QGZA 3U48A 2IY8A 3ZGZA 5KNDH 3T6KA 2GPWA 2QQEA 1KH2A 3FMGA 4DEYA 4ARCA 4I5GA 4GLJA 1C3OB 3DDNA 3ZK7A 2A3NA 4EUKA 3A6ZA 5A5VA 4WZBA 1MH1A 2FTKE 1UXOA 4KH0A 1NW9B 3ODPA 3P0JA 3QXJA 4GVPA 4ZQHA 3Q7PA 2Y0PA 3OF5A 3W2GA 5LZ2A 4W8OA 3QUCA 2ZIWB 4JP5A 2A30A 5E1OA 2P2CA 3SQWA 4PGMA 3LX4A 4CMBA 4MLZA 2JJYA 4OHZA 2RCNA 1VZ2A 2J3MA 1G6KA 5DTQA 2BSAA 3HWRA 2ZAIA 3JYQA 3IQDB 5BWLA 4MPRA 4MVJE 2V96A 3JQ8B 1M2WA 1CZLA 4LBYA 1L4BA 2EHDA 1HTBA 2NTYC 1UK8A 5HWSA 2YYZA 4CF6A 2HK6A 4DMUB 2WLTA 4N7BA 4A92A 2HMWA 4G85A 5EI5A 1IRXA 1BFUA 1GSHA 1MJ5A 3KR1A 4DXHA 2V31A 4LHEA 4MLPA 1VLOA 4DMLA 1QQAA 3E5MA 1XF1A 1LPSA 1WSWA 1OOEA 3ONUA 3I8OA 1QR2A 1F48A 4NU6A 3EZYA 3ZDZB 3VC1A 4P98A 2H85A 3D8NA 3DCYA 3ZVKA 4Y1EA 1P0QA 3W2EA 1ZN7A 2B20A 3HA7A 2YXLA 4N12A 3EOBI 1MEOA 4U39A 1UMBA 3UC9A 7MHTA 2NYVA 1IONA 3R0IA 3T9CA 4D9CA 1U81A 3HKDB 4EOGA 1TU3A 4ATNA 4UNNA 2G5CA 3FW1A 1KYWA 4F46A 2ZZNA 4QBFA 1HQCA 2E7ZA 1CDEA 4PR0A 2ICAA 5LZ4A 2HU5A 3OO1A 4YY3B 4TKOB 3DAYA 4FFLA 3Q7RA 3F6PA 4YRAA 5JH7A 4HAZA 3WYNA 3PE3A 1UJMA 2JF0A 3BMXA 3EGDA 3CUUA 1NF3A 4RYDA 4BRZA 1DAIA 3CR7A 3PGVA 1JGTA 1YRQA 3DMDA 4O2AB 3S1SA 1YB7A 4YP5A 1SVUA 2PN1A 2J7KA 5DN6A 5JSKA 1CK4A 3R7LA 1DQYA 3N0VA 3ZCXA 1AKMA 1R0CA 2FX2A 2D1TA 1O95D 4O4HB 3OY7A 5MFZA 1YHZA 2C29D 3B9BA 1OY1A 4L95C 2XDQB 4GX5A 1OBHA 4WZBE 3PQFA 1LU9A 1ORHA 2FPRA 4JX9A 4GVLA 5JPCA 2VJNA 1QH9A 1XVIA 4QOIA 4BLSA 3EEQA 3P4XA 5KSOA 3WGQA 4PAWA 1YB6A 4B7XA 1J8QA 3IBSA 3L07A 4YJFA 1HZZC 5GVSA 2AKEA 4CWAA 1DXYA 3MWLA 4IKPA 3ZE8A 2JZCA 1EDBA 3PENA 3WL5A 2LRHA 1HLPA 1ZGGA 3UWSA 6CHYA 3K1ZA 4XARA 4WV3A 1E9VA 1U2GA 4AZ0B 5TRTA 3ZDXB 4N6NA 2EZTA 2CMHA 1XXHE 1RVV1 3OLZA 5U4XA 1YNOA 5J4LA 4PANA 5JZOA 3F6EX 2AJLI 1E2NA 2VKTA 2CN1A 4HDKB 2JI4A 2PUEA 3FKJA 3KVOA 4DLNA 3LQKA 3OM9A 2ZRFA 2AOWA 5B3LA 2CFIA 3DLAA 4BX8A 5KPDA 3I04M 4XPZA 1Z5VA 2OEPA 3HNPA 3WMRA 4TSFD 1OX4B 1VHQA 2Q07A 4XVRA 1WP6A 2UYQA 2XWSA 2WG2A 3ZWDA 5EVCA 5KYYB 3A05A 2PQ0A 1LRKA 2ZM5A 1U7ZA 2QX8A 4ZHQA 3UMMA 3ONNA 3E7XA 2ZFUA 3W6PA 1LNQA 3BF7A 4B2LA 1GQ2A 1O6CA 3KOXA 4PX2A 5F5LA 1BE1A 1ETHA 4JXJA 3SICE 5JSZA 1Q7GA 2F8MA 3DMHA 4HZIA 3B36A 3OPYI 4Q19A 3M4YA 3O9MA 1WULS 1VE6A 4HNRA 4KO2S 4M89A 5H3CA 3RR2A 3VPHA 1P8JA 1IIRA 1UFQA 2JCYA 5F7JA 1T1RA 3H9JA 2SBTA 3QWFA 3FCYA 4I66A 3DCIA 4IBOA 4KE8A 5DGHA 1HE2A 5T8KA 5DNUA 4KX5A 4G07A 4MUEA 5M2QA 4JVSB 2FK8A 4OYHA 2QI9F 3VBEA 3ZE0B 1JE0A 4DIDA 4JUCA 4K87A 4JXZA 4S1PA 1OT5A 3I83A 1OZGA 3AJ9A 4PYQA 1XG5A 2EFHB 3HY6A 3ZU3A 5K03A 4W1PA 2CBZA 1EGVB 1JJIA 1YMUA 2AOUA 2DYKA 3E22B 3FDJA 2GEKA 4P4LA 4JXXA 2IS1A 1FVXA 4M87A 2GD0A 4Y2VA 4ZGWA 3U0VA 2XBMA 3U44B 1N7GA 1T6BY 4MA0A 2GS9A 2Z8XA 3UK2A 3DT6A 4YA6A 3O6VA 3ADDA 1Z6YA 1AK2A 4TN5A 2ZITA 3RVRA 3DD1A 3UFXA 5C8YA 5EP4A 4ABTA 1H2EA 3KV1A 5HOEA 1D2NA 1E0DA 1IPEA 4Q00A 2ZS9A 4XWTA 4XKVA 4ARVA 4YRGA 2XSZD 3I1FA 5JLAA 4X71A 3CTAA 4F60A 3V8NA 5FKJA 4GPTA 1Y5NA 2PRYA 4IXNA 4QXRA 2XZLA 3S2ZA 2C31A 4EL5A 1NZDA 1HM5A 4G26A 2CVPA 1HQKA 4EW1A 2ALJA 3I2YX 3D02A 5CB0A 1QLJA 2DF8A 2E85A 4RZUA 2J30A 2YYAA 3PQ4A 3FWYA 4EJSB 4ZC1A 2HCFA 3O3NB 1PNRA 2WWRA 4QKQA 4V1CA 1IAVA 1KJ9A 1YS2X 3DZCA 4DMFA 4L16A 3CINA 2MDTA 5EHZA 1NI4B 4O4IA 3G1TA 4TYMA 5T4HA 5FOTA 3V1UA 5TV2A 1Q0QA 3QLVC 3T54A 3FOEC 2AUNA 3PXUA 4QHSA 2ZTNA 1ZOPA 5IJ9B 3CF6R 3LPLA 4RJIA 1N5OX 1YS1X 4UREA 2WIDA 3F3SA 1ML3A 2R2AA 4M8NE 3RYCB 2RAPA 1JR6A 1KKMA 2HWUA 1RWBA 4ZCLA 4ZYXA 4H3SA 1K08A 3ANLA 5AFSA 4ARSA 5KTNA 1SQFA 1SOVA 2F4VB 1M33A 2OHHA 3A1PA 3DFIA 4MVJD 3IQWA 2VAVA 3WNCA 2ZBGA 4MS1B 4Z2AA 2EEPA 3DZKA 1GEGA 5THKA 3SEAA 5ES4B 4N48A 3BFJA 1OBVA 3K5IA 4BEWA 3DR5A 2VJOA 4HPJB 4QOFA 2C2OA 4YJKA 1M6EX 3FRHA 1R9MA 3QY9A 1E9RA 4RCZA 3WWEA 4G09A 3TPFA 2QN9A 3P45A 1WY7A 3RSFA 4G7WA 1I1HA 1TTHA 4F6LA 2UU9B 1YWGO 4MJXA 3WWZA 3ZLJA 1XVAA 2RG1A 4FZRA 4Z4QA 5EQJB 4Z8XA 2EGUA 2JW5A 3WKBA 3OQ1A 4NENA 1T0BA 3RVMA 3WKDA 4D9EA 3BMQA 5G0VA 2HA5A 3C3KA 1T3ZA 2PE5A 1QU3A 2I2AA 1EX6A 2A4KA 2B82A 4Y0AA 1XAHA 5IJAA 5K3EA 1WBJB 2R3SA 2OYNA 4UBMA 3KR9A 2YY5A 4XSGA 3B5JA 1SUCA 4Q4JA 4RHFA 4DNFA 2O06A 2K7FA 1ZI6A 4L8FA 1LFAA 5DO9A 4TVOA 1P9RA 4ZCQA 4QPCA 4H15A 4NOJA 3ESXA 4GNKA 4NOKA 3WX0A 5KDDA 4CEIA 1DX4A 3PG5A 5G2OA 3VC7A 1YXMA 3IPCA 4HV4A 1FA9A 3P0RA 5BW8A 4TMTA 1T13A 4YC7A 3Q7TA 1H05A 1VZ3A 1LLUA 2XY4A 1KI8A 1NJ1A 2WLSA 4MR7A 2FZKA 2G72A 1UBCA 4O5AA 4ONEA 4UOQA 3TMKA 4KC0A 2GJAA 1XDBA 3HC7A 4RM2A 5CR9A 1PR9A 1OAKA 2PWZA 5AHRA 4Q4HB 4WERA 4J7UA 1NVVR 1DJPA 5HVNA 2WSSA 1DEHA 5AI8A 1BGWA 3KZ1E 5IF9A 1SU7A 4K46A 2WOJA 1V95A 621PA 3ZD7A 1PJ6A 4ZCIA 3C6KA 3EVEA 3W06A 5FRDA 4NU0A 2FPUA 1KSHA 5SY6A 4B85A 2F1IA 5IK2A 1RM0A 2I2WA 2QAGA 2G9QA 1BKDR 2VTEA 2E49A 3V7FA 4EBFA 1D7OA 2WWHA 2D5BA 4HYTA 5DHRA 4DSZA 1OXTA 2C9BA 3NDIA 3PWZA 2P2GA 4ER7A 3G6KA 4DLTA 5JT1A 4LQCA 2D7JA 2JAUA 2BP7A 4YJ2B 3QTLA 3VO2A 4PLWA 1B26A 1JW9B 5C32A 1X9HA 3N0WA 4CZ2A 4PHHA 4ZOQI 5JAIA 4AJNA 1NG9A 5CX1A 2V59A 3KPYA 1UJ4A 4GXTA 2QLLA 1Z0SA 2I34A 1SC3A 1YVDA 2PBLA 3KZCA 3QOYA 1EMDA 4LG1A 4ZOEA 2P65A 1MORA 1R8JA 2FSIA 3NHMA 3T3DA 2DPGA 1B1CA 5F7ZA 4EIWA 5TR9A 3OETA 4O5OA 1DV1A 2H57A 5LKRA 1H9BA 1J0CA 3ET4A 5FAKA 3VGJA 1Y8RB 3GEBA 4KX3A 1V16B 3N3AC 2BHRA 2SKCA 3O4FA 3UJ6A 2HYIC 3VNQA 1NVWQ 5I7SA 3KEGA 5KQPA 2WTMA 3JQEA 3WIEA 1PQYA 3O1HB 3ZIAA 3EZ6A 3LHSA 1GYQA 1ULHA 2DUWA 4ZMBA 5MGBA 4P80A 2HQ1A 1EH5A 1ESZA 2GESA 4H17A 1L7BA 5AHKA 4W6QA 4Q9NA 2C8JA 4G56A 3FRJA 3BWBA 4OB6A 1N2HA 1J7JA 4XCVA 3NIGB 5BYJA 3M6UA 3RQIA 1UBSB 2ZBFA 4AVZA 3ANSA 5BQOA 2C2HA 2P62A 2FFRA 4LKRA 3C3CA 3R75A 1BJRE 1G1MA 1O87A 5THXA 1ICEA 1RJ9A 3AL3A 2GN0A 4MZXA 1UKVY 3G2LA 4RZ3A 5DRYA 4MYUA 1JSCA 4TVBA 3NI2A 3SS7X 4KFUA 5FR1A 3H1GA 1HDGO 4HCJA 1L7VC 4J0IA 4NJOA 4TOIA 4F21A 4BNWA 4Q82A 2PH1A 2X8WA 2ZI6A 3IDFA 4ARIA 4RETA 5LSAA 2I22A 2Q5EA 1F8UA 1QAOA 1TOAA 2Q1SA 3FFXA 1FVHA 2ZQ5A 4RMIA 1NIJA 3ME5A 2ADMA 3TE7A 1RQRA 2QMEA 4B8WA 4BO0A 2QN3A 1EXNA 4OI2A 1U6JA 5BNIA 2RGWA 2NXWA 1WZUA 3ESAA 4O4LA 5CXUA 2VXYA 2W2TA 1EWKA 5IM4A 1RZVA 2FHSA 3KKQA 3LYUA 4OH7A 5AJHA 1JHAA 4XDGA 4BE7B 5I6DA 5FTNA 1YVPA 5ERGB 1GRVA 1SOUA 4HQFA 3FCCA 3SX4A 4AF8A 4ASUA 2NAPA 3R6TA 1KO8A 4L5YA