4M0LA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus complexed with gdp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
414
structure length
412
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 91
structure length 412
sequence length 414
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m0lA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m0lA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m0lA01
3SJAA 4AY2A 3AKDA 1OFIA 1XP8A 5FTNA 3F5FA 1KSHA 1G6OA 3LAWA 4FMDB 4BLTA 3CO5A 3WRXC 1N2CE 2UVQA 5JEEA 3LRPA 3TSWA 3QSYA 2DFTA 2GXAA 3FWYA 4LV5B 4EJSB 4D4JA 1ESMA 3CH4B 1E1RA 3TBKA 4WOPA 3W6PA 4W5JA 4Q7LA 2QGZA 3D7MA 1PV4A 4LBYA 1KNQA 1KI3A 4DXAA 1G5PA 3W34A 1RRFA 2VHTA 2QE7D 1NL3A 1KI4A 1U99A 4M9XA 4UJ5A 5EE5B 3D6TB 2V7QD 2GQFA 1I7PA 4YMUA 3A8TA 2AL7A 4A6PA 1BQEA 4Q48A 4HUQA 2H16A 4Q03A 3TK1A 1KK3A 1FX0B 1I2DA 1Q22A 1ZAKA 2JDID 3K09A 5EP2A 1AJEA 5JJLA 5THXA 2CCJA 2AX4A 3ADBA 5C1BA 2CDNA 1QUEA 1M7BA 3EX7C 4RD2A 3LY5A 3B1WA 2P65A 4JLAA 1VG1A 2VSOA 2AFIE 3Q7PA 1E1RD 2F1IA 2G77B 3IEVA 2O0HA 3BD9A 4O3MA 1GG2A 2BBOA 4TT3A 3EZ9A 2I3BA 5BYKA 2VP0A 3PG5A 1ZMXA 2ZETA 3R9XA 2ERYA 1Z06A 4LCBA 3UG7A 3ZQJA 5DYGA 4GZLA 3QBVA 1TVCA 1SVKA 2JJ2A 4ACBA 3RRNA 2GWHA 4HAXA 3JVUA 4XIGS 1NKSA 3K9GA 3NWJA 1DAGA 2FPMA 4O25A 5FH9A 5AK0A 1TLLA 4C0KA 1G4AE 4NKRA 4QNMA 3RAPR 4BGDA 1WP9A 3ZGXA 2O8EB 2NMVA 4O2LA 2OLKA 3JZAA 4DSUA 3RABA 2HMAA 1Q0UA 3B1YA 2B6HA 3BH7A 4LBWA 1Q1EA 3QXCA 1WRBA 3AH8A 4KYUA 5AJVB 1VG9B 4XVUA 1E9SA 1FUUA 1EP3B 4ZCLA 3OEHA 3FMIA 1KSJA 4D2IA 4JJZA 1T91A 2ZSEA 2WJHA 4MGKR 1Z29A 3KJHA 3RRYA 5GJBA 2JLYA 2W00A 3RS7A 3T1OA 821PA 1SVLA 2JJ2D 2OG2A 3CONA 2BM1A 3SJZA 2YV5A 2PT7A 1E4YA 4Q4JA 2BN4A 2HF9A 2XX3A 3DKPA 1XWIA 4PPNA 3NDPA 5DI3A 3SQWA 2QTVB 4PPGA 4DCVA 4M1TA 3TSOA 4QKQA 4A82A 5L3SA 2VRWA 3TRFA 5BQ5A 1DADA 1CXZA 3ECCA 4MGIR 5GJWC 3TUIC 4WZ6A 3CW2A 4PC3A 4N3NA 3FHOA 4D0GA 1T3HA 3KJGA 2WV9A 3GLHE 2J45A 1J8YF 4JJKA 1T5LA 4DT1B 3GLGB 2A5FA 3CBQA 3ZVLA 4QFMA 3U2QA 3T5DA 1KMQA 3WNCA 1U9IC 1XDBA 4KBFA 1D2NA 1H8HD 2PT5A 3AKCA 3B60A 2LWIA 2QAJA 2OK7A 1J7KA 2NZJA 4JLMA 4A0HA 4CEIA 4TYQA 4GPTA 3LVQE 3T1VA 4D6PA 1R10A 1W0JA 2H7VA 1KRHA 3KB1A 4A8JA 3VX4A 3BIFA 3G82C 3DM5A 1XEWX 2R8RA 3QF4B 2ANBA 1GKIA 3CIOA 2AKAB 3KKQA 2OCPA 5KDDA 3K9NA 1UEIA 1H85A 4EFMA 1E2HA 2A78A 4US0R 4TL7A 1SVMA 4DB4A 1KO7A 3WYAA 1Z2CA 2DR3A 3DVLA 3I4LA 5JSZA 1U2RA 2R6CA 2HJGA 2ZI6A 4DC9A 3W2HA 5P21A 2J46A 4WAUA 4DSTA 3PUZA 1H42A 3QPVA 1OV4A 5KUTA 1G3QA 3NIBA 4PAOA 3B7GA 3OZVA 2ZI5A 4PO8A 1ONBA 4XWAA 5CIWA 1MRSA 2D74A 4CT5A 5FI0B 3N2IA 2FX3A 2F9MA 5TR9A 3I73A 3FFAA 2XSZA 5LB4A 1UADA 4NYMR 2GCPA 3W8RA 4NHOA 3W3AA 1MO5A 1R0ZA 1YR6A 4QBHA 5CDFA 5JS8A 3QKSA 3H2YA 1UF9A 4JVMA 4Q7JB 3VR3A 1CS4C 1AZSC 2LKDA 2QAGB 4UNQA 5IK2D 1E69A 2J87A 3W8NA 1KI2A 1VQOB 3MD0A 3SQXA 3QXXA 1BX0A 1FTNA 2Q3HA 3BFVA 3MGCA 2ZU0C 2L0XA 4MITA 3U5ZB 1JXMA 2J9RA 4L5BA 4B3XA 1Q7YD 3LV8A 1X1SA 1QGYA 4TTQA 4B35A 1II8B 5DGXA 3NBXX 4KV9A 3I1FA 2CVHA 4PC2A 1AM4D 2EFDB 2IHYA 2B5OA 4DUGA 2DWQA 3QKRB 4UQOA 3P4XA 5FBLB 2OILA 1WDTA 1XMJA 2P2LA 4GRAA 1UKZA 4JT2A 4JT4A 1KSGA 3REGA 3VU9A 1KMHB 3NKVA 4MKIA 2F3TA 2ZE6A 2O8EA 5TV2A 1KDOA 2ODNA 3T5GA 5FOSA 5C2JB 4DQLA 1U0HC 4DLTA 3VFDA 5DN6A 2QTLA 3S1AB 3SFVA 4DQKA 4IDQA 2NO6A 4DCUA 4LUCA 1KI9A 3UXMA 2W2VA 3L0IB 2G3YA 1FL9A 4EPVA 2XXAA 2ZREA 1S9DA 3AF3A 1LY1A 2JASA 1FMJA 1S8FA 4R9UC 3W90A 3OE7D 2JA1A 1Q82D 3AVVA 1N6HA 3K0FB 4AG6A 3AGPA 3JQPA 2C2HA 2CE7A 1IQPA 2F43B 1UKYA 5DE3A 3GMTA 1MV5A 2CLCX 2OCBA 1OXXK 3K70B 1G18A 1J90A 1GRQA 2O8FB 1EG7A 3MCAA 4DLWA 1ZNZA 4M21A 3PJRA 1DAMA 3ZH9B 4RZ2A 5DN6D 4JLPA 2CCGA 3LH5A 1ZCBA 1NIJA 2RCNA 2X2FA 3RDPA 5IDVA 3VNUA 4XWOA 3KQKA 3IIKA 1XJQA 2WAXA 4HAVA 3JQQA 4HB3A 3TQFA 4B71A 4OKSA 4HAWA 5A4JA 3E70C 3FGNA 5FPSA 3SHWA 5C18A 3PFIA 1E2MA 3B2EA 3HU2A 5LBIA 3TSZA 2PZGA 2GJAA 5FR2A 1TQ4A 4JLNA 1M7GA 2XTMA 3OHMA 2H1LA 1R8SA 5E3HA 1E94E 1LV7A 2IYRA 4MUAA 2YOHA 3MFYA 5H1YA 2ZRLA 4B33A 3AGQA 3VTKA 3PR1A 3SC3A 1RKBA 4N0EA 2ATXA 5KPJA 2IX3A 4P4SA 5AUQA 4YONB 2R44A 2JLRA 1XD2A 2EW1A 5HE9A 2HV8A 1HYQA 3UMFA 1AN0A 3FKSD 1G3RA 4YAWA 2V3CC 1CTQA 4PO9A 2RHDA 2H5EA 1OFUX 5AN9A 1TL7C 2R6FA 1RE0A 2AD1A 1W36B 1GL9B 1QFYA 2JLUA 2PEZA 2ZJBA 2NO7A 1XNJA 3SJBA 1W34A 1ANKA 3FOZA 1IAQA 3RSLA 1OFTA 1W49A 2ZS7A 4IHQA 4YMTA 1VHLA 2QGNA 1DG1G 2BMWA 1YZKA 1Z6YA 2QRNA 4M9SA 2W6JD 1KDTA 1E9BA 1VQNB 1KK2A 4OJKA 2P67A 3KTAB 3LBHA 2IS6A 1KI8A 3A37A 4QGAA 2C99A 1W4CA 2Q21A 2QTHA 1KTVA 2P6NA 2Q6TA 2GBLA 4C4PA 2OBLA 3C14C 1CR1A 1YJ9B 2EFEB 4IEIA 2J41A 1D9ZA 1P73A 1G3IA 2MSCB 4H9GA 3AM1A 1JR3A 5FOVA 2O8DB 1SVSA 1QFJA 4GP6A 4MKGA 1F60A 4V02A 1IOZA 2FEMA 4OQLA 1FRNA 1HQYE 2J0UB 3OFNA 5FPYA 3EIHA 4HDCA 4HDOB 4TMKA 1QG0A 3OAAD 2Q3FA 5AJXA 4AI6A 4MA4A 3VHLB 2ODWA 3UMSA 1XF9A 5KSWB 3MWKA 3K53A 3KUDA 4P32A 4IVRA 4JLKA 3QFSA 1T3SA 3AVWA 1P2VA 4QM6A 3U4QA 1BMFD 2GZAA 1KMHA 1Z0JA 3T15A 4A9AA 4TTPA 4PC6A 3BK7A 5AJWA 3HJNA 3HP1A 1DTSA 1RJ9A 2ORIA 4R7ZA 1G21E 4FINA 2BMEA 5LD2B 4TLCA 4YHBA 4JZKA 1VTKA 2XOKA 3S1AA 4HLUA 2FSGA 2D62A 3W2EA 1XMIA 1EXMA 4FCWA 4JLJA 4PAMA 1VQ8B 2A30A 2QNRA 2ZI3A 1JQLB 5B2ZA 4NYIQ 1H65A 4MKFA 3SN6A 2CMKA 2QP9X 3I5XA 1NBME 1P72A 1XBTA 2JLWA 4KI0A 2PL3A 3MMPA 4HAYA 3FKQA 1F3OA 3GJ5A 3ZS8A 1E79A 1J9ZA 4LJ5A 3B1VA 1AQUA 2MSEB 2KSQA 1IN7A 2ZM5A 1NN1A 2GK7A 4KBGA 2D7CA 2PZFA 4GFDA 4TL8A 1GDDA 4B6FA 4C0HA 4G3XA 1KIMA 1OXTA 1E9EA 2PH1A 4GL2A 1IJEA 3HPRA 1Z5ZA 5K8TA 4RZ3A 2VO1A 2GPJA 3HU3A 2AHOA 1YZNA 2WMNB 2ZRCA 3FB4A 2YYZA 1NVVQ 3U3JA 2WSMA 4EFNA 1EFRA 2PEYA 2NO9A 3Q5DA 3Q5EA 1J8MF 4F92B 4C0LA 3OW2B 2RGNC 3CM0A 3I61A 5GJCA 1QGZA 3I92A 4MQBA 1JPJA 2BSAA 1SZPA 1CEEA 4B3BA 2ANCA 2ZYVX 4QBIA 3K70D 1Z6XA 2C98A 4OHVA 1NIPA 2IUSA 1M1KD 3TH5A 2RGDA 4US1R 1JEDA 4RY2A 1RZ3A 1XMVA 3SBEA 4E09A 3BFXA 5JECA 5KYKA 3CXCB 2EWVA 3KFXA 3D8BA 2YKGA 4MRVA 2ZR0A 3KQUA 4BFYA 3VNVA 2RGXA 5FA6A 3OIWA 4HLDA 2IYVA 2VHUA 1EFRD 4BZXA 4Y7CA 1KI6A 5DHFA 4IEEA 1HT1E 1VDZA 4KFTA 5EP3A 5B57C 4P31A 2G9NA 1WXQA 4DIDA 3OEED 2PX0A 4MUBA 4EIWA 3WXMA 3A1SA 1YZLA 2EVWX 3EPLA 4BUJA 1M7HA 4S35A 1Z0IA 2XNDD 4OYHA 2WWGA 1UKEA 3PUYA 4B3DA 4A0GA 3KTAA 1X3SA 4QJ3A 1UBGA 3LX5A 1FQJA 4CT4B 1OE0A 2AK3A 2Q9CA 2CHVA 3T1QA 1P9WA 4XVQA 3C41J 2QA5A 4JIMA 4Q1AA 3W5JA 2YINC 4CDGA 2JIZA 1YHNA 2C5LA 3QENA 3THXB 1W36D 2GBLC 3G5UA 1YKSA 3CRZA 2J0UA 3M4YA 4KHZA 4OHWA 1SHKA 2P5TB 1G5RA 2ZSFA 3D31A 1OXSC 1Z6AA 2C8VA 4Z54A 5AR1A 2BM0A 3TR0A 2ZE5A 1Z08A 1UMKA 3IIJA 1XU4A 1OIXA 3MSXA 5FFMA 5EZ6B 5EP4A 2CLDX 5FPTA 2X19A 3AF1A 3SR0A 3BGWA 4LX0A 2J5XA 3WBKA 5IF9A 1R5NA 5KTYA 2YJTD 4BFXA 2VPPA 1U90A 3ZIAA 3A1TA 2VYFA 1YJ5A 1KJWA 5AUNB 1BIFA 4Q1BA 2JIZD 2QM8A 1EX6A 4KSCA 2FDCA 4W9MC 1MKYA 1VPLA 4RFSA 3ZVNA 2GAAA 5EZ5A 5IRCD 1M90D 3AF4A 3R7WA 5BN4A 4MDFA 1AMOA 5JRJA 4MGZR 4HLUC 1PLJA 4KODA 2ZRIA 3L2OB 2ZYWX 3GFPA 2H18A 4HB2A 5UKDA 2WICA 5EMNA 3T61A 5D3MB 4JSYA 5JJIA 2DETA 4C0JA 2WIBA 1DELA 3P4YA 1XEFA 4HUQB 5HCNA 1NVUQ 1T0JB 2FN4A 2OSBA 3K9LA 2JJ1D 4PPQA 1FP6A 1U0JA 2I1QA 3W5HA 1BS1A 3GLHA 3IGFA 4JLVA 2WWIA 4M1SA 1N5LA 4BFTA 2D2FA 4FK8A 1OGJA 2GCOA 4Z1MA 2W6IA 4CF7A 2CEAA 1Z28A 3QKUA 1SHZA 3QJYA 4PHTA 4NE2A 5J4HA 4IFBA 3FHCB 2ORVA 2Y8EA 4Z51A 2HJVA 1VQ7B 2IYZA 4LPKA 2ZSBA 2BMJA 4QGGA 1JQJC 2IUTA 3ZD7A 2VF7A 3AVUA 4D4LA 4UNSA 4AG5A 4DJTA 3QG1A 5J47A 2QU8A 3L0PA 4TLBA 1KQSB 4IOLA 1BO6A 2J7KA 5B64A 1ZNWA 4I81A 2VBCA 1P9NA 3RS5A 1L7VC 4XSHA 1P7CA 2CRVA 1QHXA 4OK5A 2XAUA 1KHTA 3VAAA 1NG9A 1FOEB 5D3QA 2QPOA 2ZR7A 4NDZA 3OESA 1E1QA 5JCZA 2XNJA 4ZKDA 1XXHE 3THOA 2ZSAA 4EQ6A 2AWNA 4C0AC 1JB1A 2YZ2A 1T3LA 1Z0KA 3EG5A 4DLXA 2W0SA 2ZJAA 1AQYA 5F98A 3AVXA 3U6BA 1CF4A 4HUTA 3HWSA 1O3YA 3TAUA 2WSSA 3PEWA 5DSZA 2P5SA 5DIFA 1EWQA 5J4LA 3MHPA 3J81k 2IL1A 4PSVA 4ASUA 5E4FA 4ZDJA 3V76A 1ZNXA 4B44A 3QPWA 4QHSA 4Q4JB 5SZKB 5JWOA 5EP1A 4R98A 1ZW6A 2WPDA 4Q9IA 1XJ0A 2KB0A 2C78A 2F1JA 2DB3A 1C4OA 1OB5A 1VQPB 1E1QD 3B5JA 1E2EA 4HB4A 3CWZA 2XEXA 1ZBDA 2AXPA 3T06B 5JZVA 5L3SB 3W2FA 4CGZA 4EFLA 2QTZA 1F20A 2O8BA 3ZVMA 4B6EA 2X2EA 1E32A 3THWA 1W47A 1K9MD 2IWHA 4NBSA 3A1UA 4AYXA 4P6VF 1WB9A 3BAFA 4M4SA 3ES9A 2OFOA 4PO1A 2VNJA 1BKDR 1KYIA 4ZGQB 1Q3TA 4PR0A 1OFHA 5HKKA 4QC2A 4NCHA 4NH0A 1XFAA 4QL3A 3PUXA 2DPXA 2QQEA 2AN9A 3I8SA 1HA3A 2FFBA 3UG6A 3LFUA 3DZ8A 4ASUD 1TQ2A 2GDJA 2QI9C 3LO5A 3SJCA 4CEIB 1KAOA 2ZRJA 4IOKA 1VYTA 3WHKA 5JI3E 4EPYA 3GP8A 4LV8B 4A8JB 3ZC3A 4RJLA 2HLDA 3FMOB 2X1VA 2IYWA 4KFSA 3P1JA 1ZD8A 3JVVA 4TTRA 5EE9A 3OIYA 2BV3A 1G64A 1QHGA 4MRPA 4JYCA 1ZM7A 2C9OA 1E2KA 2BKUA 2ZROA 5JSZB 6Q21A 1YITB 3LBNA 4DVGA 2Q3MA 1VQ4B 4BFVA 1RW4A 1G5TA 3F0TA 4V0KA 2YNMA 3AVPA 1E2IA 3MRSA 1W44A 2OAP1 4DLRA 5DO9A 4BEJA 3FFBA 4TN1A 3IUYA 4B48A 5D3MA 5JCPA 3B1XA 3AB3A 1OXVA 4B74A 2QT1A 2BBWA 1C9KA 2MMCA 2YC4C 3IBYA 5CJ2A 2QUZA 3ND9A 4ZI2A 2J0SA 4LC1A 4TSFA 2YWFA 3QKSB 3K0EA 1CJMA 1ESNA 2VEDA 2DFKB 4JYBA 5BN3A 1ETUA 4WZAE 4NCNA 1E2LA 1X6VA 3HDTA 1G3UA 2GXUA 2HXSA 4ZIRA 2BBTA 4NYIR 5TMPA 1J2JA 1Z22A 2OO7A 3LXXA 3QE0A 1QUFA 1N6IA 2CBZA 3B13B 5LB2A 3SU8A 3VR4A 1QG2A 2C77A 2BGIA 3IEUA 4WIAA 1JI0A 1U94A 3A1VA 3RHFA 3DDCA 1P2TA 4IRUB 4QGFA 1F5NA 3FMPB 3K0AA 1PLKA 2IK8A 3W5IA 4E22A 2ATVA 2G0TA 3TQCA 3KFVA 2B8TA 1TQDA 1Z0DA 3CRVA 3DMDA 3LNCA 3MWYW 2VL7A 3GJ3A 4LJAA 4V0OA 3L43A 4IDNA 1DEKA 4BECA 2QY9A 3VU9B 3AVOA 2D2EA 3BE4A 4IJMA 2ORWA 4GSYA 1HUQA 3GEHA 4RD6A 221PA 3Q9LA 3RS4A 4A0FA 3ASZA 2GJ9A 4RCZA 1CRQA 1J70A 2P6RA 1E2PA 4TT3D 2RC5A 1QGAA 1FTSA 1NVVR 4G5OA 1VQMB 3UPUA 1S9HA 3NBFA 3ASYA 4HLQB 4JLBA 1IONA 5BYJA 2DYKA 3UKDA 2XXAB 3GLFE 3BB3A 4QHTA 3QNUA 4TL6A 2ZJ5A 4NPHA 1Q1QA 3TW4A 1VYUA 1KZ7B 1S1MA 1OB2A 1FQKA 1TX4B 4HZUA 2ZS9A 4PANA 1X8JA 1AS0A 3CRW1 4KFUA 2V54A 4BZPA 3VO2A 4JSTA 3TAHA 3GJ7A 4EPTA 3KXLA 4IXMA 1N6RA 4E07A 1ZD9A 3CR8A 3CKLA 1ZRHA 1UJ2A 2ZJZA 3O8BA 2CJWA 3LO8A 2A3RA 3TW8B 2A7QA 2XB4A 1E0JA 1ZIOA 4LHZA 5FOUA 1OF1A 3OZUA 1SXJA 4HAZA 1F48A 4D82A 3PEYA 3OEHD 1XZPA 4A15A 1YVDA 5FUYA 3DHWC 2QMHA 2QTFA 4TWZA 4LC0A 2OHFA 2ONJA 3SZRA 2F7SA 2CXXA 1DAEA 4Q9LA 3FYHA 1UFQA 4OL0A 4PAQA 2HCJB 4F38A 5DYIA 1EFHA 3V4FA 2Z4SA 4LHYA 2I4IA 1GUAA 1UBCA 1JAHA 2BHRA 1B23P 3AKEA 3U3RA 1N6NA 1JXOA 1CIPA 2WAYA 5L3QA 3U44B 4DCNA 2ZRBA 4Q1FA 1QHHA 3CCLB 4II7A 1CLUA 4C0BA 4P4SB 1PVOA 1FW6A 4U9UA 3SYNA 1XD2B 5L8VA 1EX7A 2GZDA 1NBMA 2GTPA 2WWYA 2W58A 4RKEA 4EQ6B 1MT0A 2FF7A 3PUVA 4DDVA 1GR1A 5G3YA 5DISB 1CRPA 1AKYA 4HLCA 5G3ZA 2JLXA 5G40A 5FTJA 3KQLA 2G1KA 5EUQB 2QN6A 3T35A 5K8IA 3G71B 1MO4A 2H8KA 5FTMA 4A1FA 4AF6A 1QVGB 3SYKA 3QFTA 3NDBB 3G0HA 2G83A 4BEBA 3EC2A 1W0JD 1XTRA 1ZM9A 4XVRA 4X8HA 1A2BA 3L0SA 2REOA 3CNNA 4D0NA 1XEWY 3SS8A 1NVXQ 4LGMA 1KNXA 3R20A 1NLYA 1TAGA 4MYTA 2JLQA 3SBDA 1QVAA 1W2GA 4XTCS 2A5YB 1DAIA 2VNIA 1JJVA 1QHNA 1FUKA 3NTUA 1GKYA 2OCAA 3C8UA 3I8XA 5KOYA 1N5KA 2F1RA 1KK1A 1VQ9B 1P2UA 4P33A 3RRMA 2CNDA 3LVBA 3LW7A 3SEAA 4ZO4A 3UANA 1IN5A 4QGHA 1T6NA 3RNLA 2DERA 1FP7A 4A92A 3GLIA 4RD4A 3QBTA 4Y0VA 4G1VA 2GXQA 2XSZD 1LF5A 1SGWA 4HATA 2EU8A 2FGKA 4I1OA 4Q4HB 4URYR 1U81A 2AD5A 2HDNB 1SM4A 2GILA 4DDUA 3A1WA 4BQSA 3U4QB 5F3WB 2IXFA 1W87A 4A2WA 2G0NA 3VX3A 3R9WA 2DCUA 4B2IA 5DI9A 5M04A 1B0UA 4B47A 1RJ9B 1P3JA 4V0LA 4FCVA 1UDXA 3SHFA 1W4RA 4M9QA 4G5QA 4YXWA 2YWEA 4Z8YA 4R2IA 5E7JA 1MH1A 1R7RA 2V6JA 4C30A 1P4SA 1VG8A 4ZGNB 1HTWA 2FFHA 2OTLB 2W0MA 3ZS9A 5KDLA 1OW3B 2PJRA 4QBFA 1GSIA 1XTSA 3ZQ6A 3AQ4A 1NP6A 4YQFA 2VA8A 4DUGD 2O8CA 5KDOA 4HSEA 1TUIA 2WKQA 4M53A 2E87A 3MLEA 4X8OA 1KZGB 4M22A 4URUR 3WHLA 2EFCB 1OYWA 1ODFA 3DOFA 2QMUA 3CZPA 2CL0X 5JJKA 4RFVA 3O8DA 1HE8B 3ZBTA 2OK8A 1PUIA 3H1TA 4NP6A 4Q01A 4AF7A 4TMVA 1XTJA 5F2EA 2PMDA 4MYCA 3TGPA 4OI1A 1NN3A 5GJVC 1LB1B 3QUSA 2RGNA 4QHYA 4JKIA 3ZZUA 4TZ0A 1SXJC 4DB2A 5FOTA 2DFNA 1U0LA 1I2MA 1IN8A 2A5DA 3PEVA 1HV8A 3OZWA 2E9SA 5LPNA 3B78A 4LHVA 2C96A 1ZUIA 3CR7A 4ZDWA 3WP0A 3U44A 4P0TA 4B4DA 1G9XA 2YVUA 2GEUA 1A82A 1KOFA 4JBYA 3NHBA 3G4SB 1SVOA 3X1XA 4LYJA 5CB8A 3W5VA 1SKQA 3L8ZA 5FR1A 1GWNA 1TEXA 2DEUA 3W2IA 5CJPA 1GKUB 1DVRA 3BERA 1GTVA 1YZTA 4C7OA 4YMSA 1FRQA 4HYYA 5SZJA 4B34A 3CMEB 1JJ2B 3B1ZA 2GVDC 3ETLA 5ELXA 1G8FA 2ZE8A 4MGYR 1XZQA 2GVZC 1W5SA 2P3SA 4OK6A 1KI6B 3EPHA 5A5GA 4GT1A 1KKLA 1KO5A 1ZU4A 1BH2A 1KDRA 2HF8A 1VCIA 2XTNA 2YOFA 3N5CA 4C3ZA 4F4CA 1T0HB 1Y3AA 5CK4A 3K0CA 4KFRA 1RRPA 4BFSA 3WNDA 1XPRA 3BH0A 2BPOA 2XZLA 3QG5A 2ZJYA 1TF5A 4CRWB 2ECKA 4BLOA 5J4KA 3B6EA 2ZRAA 1Q20A 3IQXA 2PCLA 1P6XA 4JL6A 3RC3A 4C0QC 5B58C 2NPFA 3ICEA 1XEXA 2CHGA 4OQMA 5E95A 3QVVA 1ZUHA 4HE5A 4EDHA 3B9QA 4Q4AA 3X2SA 2IUUA 3CWQA 5DNYB 4IKEA 1KD1D 1S72B 1OKKA 1COWA 1LVGA 3ZZTA 4POAA 121PA 1OSNA 5JI2E 2RHMA 4UXJA 2YWHA 1F2UA 2QRZA 4YDHB 1N0VC 4PSKA 1AS3A 2ZEJA 2ZITA 4N0DA 1G16A 2XJ4A 2A9KA 3IKJA 4UNRA 3GCGA 4Q4HA 1R5BA 3P20A 5L3VA 4PTLA 2J1LA 1OIVA 5CIQA 2VP5A 3UATA 3TUJC 4LBZA 5FOWA 3Q8XB 1OH6A 3D3QA 1UBFA 1JNYA 3WMGA 4F7WA 2RAPA 3AP1A 2HYIC 4A36A 2CCKA 1DBSA 3PQCA 4Y0AA 2AFHE 1JR3D 4OK3A 4AURA 5EUMA 5EJEA 2RGCA 3OFND 4UAJA 4RFSB 4G1BA 1Q57A 1Z2AA 4LBVA 3H86A 2ZYTX 1OLOA 2B8WA 3R7WB 1KDPA 2ZYUX 1N5IA 4ON9A 3CUEF 3EWAA 4LYFA 3U3MA 1R8QA 2QMOA 1JBKA 1VHTA 5CITA 3VO1A 1N6OA 2FSFA 1LTQA 2CNWA 2JAQA 1Q1BA 1GAJA 3QE2A 1OPXA 2CE2X 4B3FX 1G8PA 2WM9B 2WJYA 1D2MA 1KO4A 1G8YA 2BVNA 3PUWA 1LNZA 2GF0A 4WXRA 4G5GA 3BB4A 5FI1B 5KSYA 2J3EA 5G41A 1VCOA 3ZBUA 1ZM3A 4AC9A 3GLHB 4KYIB 1VQKB 1VQ6B 1YR8A 4LI0A 4OHZA 5TVKA 5FTKA 2RGAA 1F6BA 4NONA 4LV6A 2GCOB 2XOKD 4PGOA 4OBEA 3UK6A 721PA 2OZEA 4F93B 1JR6A 2QEXB 1G291 3R8FA 1LS1A 1NG1A 2FOLA 4HI0E 2J7PA 4IOJA 4C9BA 2ZU6A 2N42A 1XCMA 2ZRMA 3CCVB 2WHXA 2Z83A 5FL7A 1V43A 1L2TA 2GEDA 2VIIA 3RRZA 5AJYA 3GFOA 1TTTA 1GFIA 4U02A 4HE6A 4TMWA 2V8OA 3LQRA 1XTQA 1E79D 1NMYA 5HCIA 1NVWQ 2VZLA 2VHJA 2ZS8A 1T8TA 4I1VA 1AKEA 4Q21A 4BFZA 3WYGA 2PIAA 4DEYA 2ZUCA 1LS6A 3TIFA 4LJ4A 2A2ZA 4LSGA 3K0SA 3SFZA 3KKMA 4LPSA 3A4MA 2JLSA 4KCGA 3PENA 1QF9A 5CDFE 1GILA 3IDQA 3I32A 4F7DA 4UNNA 1P60A 2R6AA 2BF4A 3NXSA 4IXNA 3W2GA 2B21A 4L9WA 3VR5A 4BRUA 2QQ0A 2RGBA 2N1BA 1UEJA 1US8A 5KSOA 5FBQB 4P3YA 2I1VB 5FL7D 4ERNA 3IHWA 2YHSA 1TADA 3DKVA 4GOXA 3QKTA 5HTKA 2FE4A 2IYSA 1IJFA 1EFCA 2F9LA 1YIJB 2QZ4A 4OQXA 2ZJOA 5CM9C 2WZQA 1HE1C 1CJKC 5EXXA 2DHRA 3TVTA 5G53C 4GMDA 2ZI4A 1AIPA 3FPKA 4NZYA 1H8EA 2ZE7A 2ZRNA 4DWJA 1NJID 1EK0A 3K0CC 4KVAA 2V1UA 1E6CA 4EKDA 4J0QA 3LVRE 1E64A 4TYNA 1E9CA 4QBGB 5FPKA 4UKDA 4CW7A 1DE0A 1W1WA 3EXAA 4UNPA 4NU0A 2QMEA 3CNLA 3Q7QA 4XOIA 3EZ2A 3WRYC 4O0MA 2FWRA 4Q5IA 4W7SA 2O8BB 1VQ5B 4LYAA 2Q9AA 5L3RA 2H57A 1FMLA 5JHGB 3THWB 1IN4A 4GMXA 4DEXA 1D1NA 3W6NA 1XCGB 2V6IA 3I5YA 3MAAC 1IB0A 3LLMA 3VR1A 2OT3B 4DHEA 2R9VA 3HYTA 3M1IA 5KNBA 2CVFA 4CEHB 4FW9A 1G7RA 1CULC 2GJSA 3U3KA 3FVQA 1UKVY 4PHFA 1CU1A 3MJRA 4QG7A 2TMKA 2HT1A 1E3MA 2HT6A 1CNFA 3OIVA 3R9IA 2ZJ2A 3GEEA 4MH0R 5EE1A 5BW8A 1OT3A 3QEJA 3GLFA 1KY2A 3U7HB 2GK6A 4JVNA 4EUNA 4Q18A 3FMFA 4NL4H 4F91B 2VSFA 3CNOA 4M2LA 1RPZA 3F3YA 2ZRFA 4HB0A 1M1YE 3MWJA 1ZM2A 4LJ7A 2HUPA 4G5SA 4AYWA 1DG3A 3HR7A 1CJUC 4IW3B 4FN5A 3GLGE 2QDXA 3TJZA 1WE2A 4U00A 3AEZA 4Y9UA 4M8NE 2OAQ1 1EFUA 5FUWA 4I1SA 2YOGA 4MRRA 3ZIAD 4FMCF 5E7MA 3BJIC 3KKPA 1AK2A 1RIFA 5KSPA 2VNHA 2CLSA 1AA9A 3IIMA 1NMXA 4ACAA 3KXKA 1XPUA 1WF3A 3AKYA 1TMKA 4B76A 1IXZA 3AF2A 4FI3C 4MYUA 4G5RA 3KJIA 4ZIRB 1HH4A 2KE5A 2EFHB 2REBA 4BLQA 2JLVA 5JEDA 1KJZA 3G6EB 2G88A 2FNAA 4HDQB 3CPEA 1NN5A 3LX8A 1SVIA 4G1UC 1K8AD 1EP1B 1VECA 4AKGA 1NMZA 4JL8A 2PJZA 3EA5A 2IYTA 3DL0A 2OESA 4D0LB 3I72A 3KKNA 3K0AB 2EWWA 2IYUA 2IWRA 2FJUA 1U8ZA 4TMZA 2QBYA 4Z1MD 1QH0A 4DLVA 2W6ID 1GJRA 2RMKA 3BRWD 2IXGA 2KJQA 3EZFA 2BKEA 3JZMA 2BEJA 2WWWA 3DPUA 1XB2A 2UKDA 1ZC4A 1MABA 4RZXA 4MRNA 5JWHA 4CIDA 2WTUA 1JR3E 1II9A 4EPRA 1K5DA 1GVHA 5KNDA 3HR8A 2XJ9A 5HE8A 1NDHA 2FSIA 1PLLA 1N6LA 1ZP6A 3M6AA 3RYTC 4HZUB 4XWKA 2VNKA 3GPLA 4YALA 1W0KA 2GESA 2OXCA 3PXGA 1G41A 1GNQA 4KU4A 4C2UA 4DLUA 1E9AA 5LDDC 2K5UA 2RC6A 3EZ7A 3UIEA 1S0UA 3U7FB 4Q66C 3ND8A 4PQRA 5A0FA 3V4RA 2LCFA 3NVAA 4BPRA 1IM2A 1EWRA 5JRZA 2WKRA 1OHHA 3AUXA 1ZJ6A 1E2GA 2CJWB 2CK3A 2OUKA 2WJJA 4P4UA 5FUVA 1JPNA 4E5UA 1K6MA 1SXJB 1GO2A 1T9HA 3ADKA 4LYHA 5KPDA 3SOPA 2FH5B 3BWDD 2IXEA 1Q44A 2WSSD 2JCSA 2JEOA 1XPOA 1WBBA 4DKXA 4CEHA 3C5HA 4MKHA 4KITB 4DDTA 1N0UA 3KQHA 3RS2A 2B7CA 4LHWA 1E9FA 1JECA 2KBEA 2R65A 4M9ZA 3AP3A 4AK9A 1PJRA 2WPDD 4Q7MB 4NTZA 3NEYA 5L3QB 2OBMA 3THYA 3ICQB 4ZCMA 1ZU5A 1A8PA 1K73D 1KSFX 3KB2A 1YZUA 3ZLJA 3IPYA 1QHHB 5K8UA 3E20A 4I99A 5KNCA 1OHHD 5H59A 2FMXA 4EAQA 4IOMA 2CK3D 2HXYA 4YAFA 3CMAB 4Q19A 1DAKA 2V55B 5FUXA 3NBYC 2QE7A 5GADl 3CX8A 2NTYC 3OZXA 4URZR 3QFCA 5HKKD 2V7QA 1W4BA 1SKYB 4OHXA 4Z8XA 4AYTA 3CB4A 1TU3A 4JBWA 4AIIA 4DZZA 5KHOC 3TKLA 2FZ4A 5H70A 1DS6A 1TQ6A 5C4GB 4D80A 1GZSA 1NSTA 3VR2A 1DDGA 4H1UA 4D25A 2BC9A 2JDIA 1OH7A 2PZEA 5DH9A 3T34A 4TYPA 4LY6A 1B2RA 1IXRC 5CB6A 4TYWA 2OE2A 2OXRA 1WMSA 2HLDD 5LD2C 1FDRA 3C5CA 1YRAA 3QFRA 4JMPA 1U8AA 2EFGA 1YR7A 2ZVQX 1HT2E 3QY0A 1E9DA 4KXFB 4FWIB 4Q9KA 4WW0A 3TNFA 3CF2A 5FBRB 4RD1A 1L4YA 4PHGA 1N8RD 1GM5A 4NCJA 3B85A 4Q1CA 3KUCA 2BEKA 3O8RA 2QL6A 1FFHA 2GRJA 3PCRB 4G01B 3B9PA 5EE3A 3BS4A 1NJGA 1HY3A 1SULA 3EW9A 3GLIB 3ADCA 3CC4B 4L8GA 3CH5A 5J5CA 2QPTA 1TF7A 1NI3A 3KKOA 1Z83A 2IBMA 3GFTA 3L82B 1Z3IX 1QZXA 3LBIA 2G1JA 2UZ3A 4TSFD 3CZQA 1RFLA 3CCEB 3H0KA 1CQXA 3A4NA 1GVNB 2C04A 3WMFA 2BGJA 2WKPA 1II0A 4A4DA 2CHQA 1EGAA 3KXIA 4DLZA 4ZDKA 3W6OA 2QEQA 1Z0FA 2IF0A 1NN0A 4GP7A 3OIUA 3LQQA 4Q02A 1YE8A 1G20E 3E1SA 1SVWA 2VP4A 2HEIA 2VSXA 4XJXA 1E0SA 1G1MA 3X1ZA 2H92A 1CNEA 1W5TA 1IBRA 4JLOA 2D3WA 4PHHA 4BZQA 1E63A 5JMTA 2O8CB 2P0EA 2BBSA 2IYYA 2X77A 4K81B 4IDPA 3B82A 3QXJA 3RVBA 3EPJA 2N46A 4AWXA 1W2HA 2ODBA 4MYHA 4PC1A 1NKTA 1BX1A 1M8PA 2R2AA 4KAXA 1G8GA 1ZYUA 1DAHA 2WVJA 5AUOB 1T8UA 2OM2A 4X8LA 2ZJ8A 4RD0A 4TMTA 2CL6X 4HZIA 1ZINA 5JBQA 4MRSA 1KGDA 4PQFA 3ZVRA 2QA4B 1QRAA 4FD2A 1T5IA 5JS7A 1H8HA 4KO8A 2WJGA 5JFGA 3I55B 3CRRA 4TLAA 5GV7A 1OJLA 2ZI9A 3RWOA 2KBFA 2VHQA 1XJCA 2WMOB 4JVSB 2C9YA 3BOSA 2GF9A 2WWFA 2EIXA 1G3MA 2BCJQ 1AGPA 2XZPA 4KLZA 5EE0A 1QDEA 1RC8A 4GNKA 4JS0A 3O47A 2OCYC 3Q85A 4FMDF 3KL4A 4ESHA 5J4YA 1GL7A 3A4LA 1LFDB 1N6PA 2O0JA 3QXHA 3CRQA 3FHTA 1YRBA 1Q86D 2RKOA 1FNNA 3EASA 2O5VA 4LRWA 1X86B 2A5JA 1Q1ZA 1SXJD 1ZD1A 3KQNA 4AD8A 3JQRA 3NG1A 4C7OB 3MG9A 2PMKA 5KU1A 4WVFA 4IDOA 1FNBA 2Z4RA 3LWNA 4TQAA 2R6HA 3PV0A 1WBDA 3RANA 4HAUA 4K46A 3VHXA 2IC5A 5C4MA 1KK0A 1XX6A 4BLRA 4XSGA 1S3GA 5EXTA 4EJSA 5IK2A 2WBLC 4A2PA 1TU4A 2QROA 4PC7A 1D8TA 3N2EA 1W2BB 1TF2A 4PFSA 3I62A 1XEXB 2VHCA 1NBMD 3TUZC 3EIQA 3CCJB 1YU9A 4L15A 3T1TA 4ZV4A 1QHYA 4Y9RA 4OQNA 4Q4AB 4JLDA 3CC2B 3ADDA 4JKYA 4TYYA 5TB5A 4QRHA 1VCNA 1DO2A 3FTQA 3Q3JB 1FX0A 1GNRA 1F2UB 1Y63A 2X8AA 5J40A 1JEEA 3WYFA 5TDHA 4A6XA 4D81A 2QORA 5IT5A 5SZHB 1QG4A 1C1YA 5CM8B 3K09C 1XXHB 4R2HA 3DO6A 1P61B 3TE6A 2QSZA 3SE0A 3ZDQA 4WBSA 1JA0A 3MUFA 2VP6A 1QX4A 3GJ0A 1VIYA 3ZZ0A 3RC8A 3NC1C 4LJ6A 2R6GA 3SDZA 1KJYA 5SZIA 1X8KA 4CYMA 1CKEA 2H17A 1XCPA 1R6BX 2RH5A 4NYJR 5F9HA 1NNEA 4DRZA 1R0WA 1ELOA 1IY2A 1E2FA 1N25A 1QFZA 2KI5A 1WCV1 2ZQ5A 3OE7A 4IFEA 1GRNA 3CX7A 4V0ME 1R0XA 2ZRDA 1TEVA 2HYDA 4BWYA 4B2PA 1VMAA 3KJEA 1X1RA 2GKSA 2HCBA 4Q9HA 2FU5C 3NHAA 2NQ2C 3U3OA 3VR6A 4AKEA 1UBEA 4BASA 3CX6A 4PZLA 2BCGY 3TMKA 5B30A 5BN5A 1P9RA 2FEOA 3A58B 4I4LA 5CK5A 4RVCA 2BMFA 5FL3A 4E03A 4QXAA 2JJ8A 3CCRB 3CRMA 4YXWD 4M1MA 621PA 2C95A 1MR3F 2DFLA 1DOAA 3X1YA 4GDFA 1NF3A 3OJXA 3CCMB 1G19A 4JVLA 3QPUA 2ZANA 3W9YA 3RWMB 1MO6A 1ZIPA 2VYQA 3TVDA 3LDAA 1I4DD 3U60B 2XGJA 4N3GA 4RKFA 3W5UA 2FV8A 4PZZA 2AR7A 2V4ZA 2W2XA 4OQFA 4W5WA 3E1YE 4YMWA 1KY3A 2XTZA 3LW8A 4BLSA 1GL6A 4D4KA 4ABYA 5AUPB 2WWHA 3FKSA 3AVYA 1IN6A 3AP2A 2VQSA 2ZIAA 4K1XA 1SQ5A 2G6BA 2ZRGA 4F4JA 1S3SA 4DT1A 3GLGA 3VKGA 3BH6A 2Z0MA 4Q1DA 1J99A 4YDSA 1FZQA 1W46A 1G7TA 1N0WA 3DMNA 1US8B 2VH5R 1FNDA 1GNPA 4V03A 5HXBA 3EWSA 2VP9A 3AV0B 3C16C 3RS0A 2W6JA 4RZUA 4CZ2A 3QI2A 2IHBA 5TARA 1E9RA 1AZTA 4YLGA 1E96A 3QF4A 4QNRA 5E7IA 1VG0B 2Z43A 3WMEA 2NZ8A 4A8JC 1MRNA 4I1UA 4KLNA 3CCQB 4EH1A 4CVNA 1Z47A 1R0YA 1CP2A 2NO1A 5HZHA 4QJ4A 2FZLA 4EJSC 1CJTC 2WWXA 1UAAA 2JATA 5CLLA 3RSOA 3QVUA 1FNCA 4LJ9A 3OAAA 1KKMA 3KZ1E 4NCIA 1QHSA 1RVDA 5KSZA 1Z63A 4GBMA 2DBYA 4OI0A 2F3RA 2PBRA 3C4JA 2GCNA 2ONKA 4LK2A 2Z6VA 2D7DA 1XD8A 4ZCIA 4GOJA 4ZPXA 1R2QA 2GXSA 3X1DA 4PSAA 5EQTA 1YI2B 4C0SA 1JA1A 1E0KA 2GA8A 3DEFA 5H68A 3RLFA 3KX2A 1E2JA 2ZI7A 1Q3HA 2ASEA 1BMFA 5AJZA 3CCUB 1XXHA 1ZM4A 2QAGA 4BLPA 8OHMA 2GETA 2SHKA 1JB9A 1Q81D 1OXUA 1PZNA 4HEJA 3ZD6A 1P5ZB 3ZJYA 4B73A 1YR9A 2XITA 2GEVA 4DBLC 3OJWA 1XD9A 1YJWB 1E0AA 2B7BA 1KI7A 3W3ZB 2W2TA 1VYVA 2QP4A 5H5JA 2NOAA 4WA7A 3GLFB 2W83A 1OH5A 4Q47A 5FOXA 1IY0A 4IDHA 1OIWA 1QVFB 1OKKD 1COWD 3MJHA 3FE2A 1II8A 3NEJA 4OI4A 4PX9A 4WQMA 1SXJE 1CR0A 3QKRA 4LOAA 4O2RA 2WOOA 3LD9A 2ZSDA 3KDSE 1E4VA 4S2EA 2ERXA 2QM7A 1HEIA 3EIEA 1YJNB 3CF6R 4Q9JA 2X3UA 5JLJA 4OI2A 3NH9A 3V9PA 1UM8A 2BJWA 1BYIA 1AS2A 2VLIA 3EZ6A 4L4UA 3AF0A 2AWOA 2JGNA 1E2DA 1QHIA 3QOFA 1XRJA 3U6KA 1ZCAA 1V5WA 2XNSA 3U7EB 3RS3A 3MWLA 2FPLA 3K1JA 3UWKA 2F55A 2VP2A 2GJ8A 4IVQA 2ZVPX 1TPZA 3PEUA 1NY5A 2BOVA 4B75A 3P26A 1N3BA 2QPAA 4D26A 1VIAA 3IO5A 2IF2A 3K0FA 4TZ6A 3CC7B 4QM7A 2IT1A 2F43A 3AVTA 1BYUA 1U8YA 5TXGA 1NSFA 1SKYE 2IS1A 4XH9B 1G8HA 2GZHA 3HPQA 2CNWD 1OYYA 5FBWB 4B32A 5J4VA 3GEIA 5F9FA 4C43A 2O8FA 4C2TA 5C46F 4FMCB 4H1VA 3E2IA 2VTKA 2ZPTX 2BMDA 1WQ1R 3CF0A 1WA5A 5CLQA 1NRJB 2XB2A 1CJVC 2O0KA 4LHXA 4EPXA 4OJQA 3H4MA 4TL9A 2EYUA 2ZUBA 2QBYB 1FPMA 5FPHA 2J0QA 5EXPA 3L8YA 1A7JA 1GOTA 1X8LA 1YHQB 2IYQA 4LJYA 1A1VA 2GNOA 1W35A 2WJIA 3CLVA 1YZQA 4LDJA 2IA5A 3P32A 1E99A 1GP2A 3C7KA 2J7PD 4DSNA 2GHIA 1AGRA 3PITA 2AXNA 4WXPA 2J59A 4ZKEA 2D4HA 5DLQC 1MABB 4DCTA 1UDWA 1Q21A 2ZTSA 3OEEA 4Q7KA 5K8LA 5HZKA 1P75A 5BXQC 3WBJA 1PUJA 4US2R 5HPYB 2C9CA 1GIAA 4R71A 2XNDA 2FFQA 1RYFA 1P62B 3BC1A 2AK2A 2EYQA 2ZRPA 3QEOA 3SNHA 3U7GA 2REXB 2XZOA 3HYRA 4RD3A 1DDIA 3GLIE 3IILA 3QF7A 1Z8FA 1F2TB 2KWIA 3IHLA 4CEJB 4ZDIA 1EWYA 1TNDA 1NY6A 3EAQA 3K9HA 4ITRC 4M1YA 4Q1EA 1W7AA 1NJFA 4PPFA 5IHPA 4DSOA 4UJ3A 3IPXA 2GJKA 4UXIA 1E62A 4KVGA 4B43A 4PXAA 2OV2A 1A5TA 2PLRA 5JHHB 5TY0A 3HU1A 5GV8A 1A2KC 1Q12A 2NIPA 4DLSA 2IS4A 3UWOA 1W4AA 3VMFA 3C15C 3Q72A 4F4IA 2QENA 3QXSA 4LZZA 4DCSA 4AKHA 1QVRA 2ZR9A 1E2NA 2FSHA 4FIDA 1XTIA 4D4MA 5H8WA 5CYOA 3I3SR 4X8MA 3EPKA 1H8ED 2D06A 1KO8A 2ZRKA 3ONWA 4TMXA 1M6NA 4B3GA 5GVSA 4V0NA 2NO0A 4N1AA 1D2EA 521PA 3VKWA 4QJ5A 1VKJA 4OHYA 2O8DA 3BFKA 1XMSA 2QAGC 4UXHA 3THYB 1ZVQA 1K5GA 2F6RA 1NLZA 1CR4A 3IBGA 3WNBA 3IQWA 1ZNYA 1HURA 2Q9BA 4P4TA 2RGGA 3BBPA 1M34E 4IVPA 1W48A 4LWZA 4TLEA 4ZI3A 1S4QA 2FPKA 2OLJA 3DZDA 3FDIA 4ARZB 2O52A 3NH6A 1QBKC 5BWMA 2F1HA 3BORA 3EA0A 5AWFC 1YQTA 3O8CA 3UMRA 4KJZA 3SYLA 2J0VA 3GD7A 2JJ1A 4TLDA 1T4GA 1Z6TA 1JAIA 4NYMQ 3A6PC 1Z6GA 1IXSB 1XTKA 2IW3A 4M1KA 4LJ8A 2ZXUA 1D9XA 2B92A 4L16A 1VQLB 3B8HA 1KO1A 2C03A 4ESVA 3BB1A 1YZGA 2RGEA 3LLUA 1P2SA 4DIEA 4WZBE 2WOJA 4EPWA 2ZUDA 2FG5A 2P6UA 1M74A 1G4UR 4M0LA 4JL5A 2UZIR 4FCTA 1EESA 2ODEA 2RB4A 3LA6A 4NYJQ 1N6KA 1TUEA 2IEZA 3V00A 4BRWA 3PIRA 2OBNA 2ZAOA 4M1OA 3FPAA 4BPBA 1ZUNB 1DARA 1IHUA 1BJKA 1EP2B 1S1CA 2OEPA 1VCMA 2PCJA 4W5HA 1E2QA 1JJ7A 3A36A 1L4UA 1CBUA 2V9PA 4JBXA 4NCKA 4DDWA 1I4LD 4BFUA 2Z5FA 4MDEA 1L8QA 1BOFA 4YAOA 1MOZA 2ZRHA 2WIAA 3K70C 4B3CA 4YMVA 1FNMA 2AKYA 2NG1A 4L9SA 1G7CA 1D6JA 2WJVA 2CL7X 2QSYA 4YAUA 4K8OA 3WP1B 2LKCA 3BXZA 4A2QA 2IYLD 4URWR 4B2LA 2V1XA 4YC7A 2A5GA 2JLZA 4PZYA 3VKHA 2DWPA 3E5HA 1Z07A 3ZYCA 3U61B 4AKIA 4RCYA 3LXRA 2R6DA 1A4RA 3GJ8A 3QIAA 2OFXA 4KSBA 4M1WA 3CPWB 3DM9B 1G17A 1NLFA 4DLYA 5ANRB 4XD7A 2FGJA 1R4AA 1S2MA 1E98A 4QOSA 3T12A 3X1WA 2IS2A 3GJXC 1MO3A 1N5JA 3OF5A 2BIFA 4U7DA 1EFTA 3P27A 3F8TA 1O87A 4XTRA 3GQBA 1KI1A 4Q00A 2DY1A 2OTJB 2FFAA 1G7SA 5FBVB 4BE7B 2BWJA 1F2TA 3CD6B 4CEJA 5FTLA 2NGRA 3R8CA 2ZAMA 2YWGA 3CCSB 1LF0A 4FXPA 4U5XA 5HR5A 1DO0A 3REFA 2XNCA 2E1RA 3H84A 3PVSA 3EARA 3EC1A 3TLXA 1LW7A 4PQYA 1W36C 3AVQA 3TR5A 3I56B 1HQCA 2QT0A 4A0RA 3FJOA 1KC8D 2R62A 3N70A 4XD7D 1RRCA 3QQ5A 1GAWA 3SI7A 4BFWA 1Z0AA 1DPFA 2IEYA 4FWTA 4URXR 2NPIA 2IYXA 1U98A 2EQBA 2Q0HA 3NBZC 4GI7A 2QP3A 3WY9A 4RSGA 5DI3B 1R5OA 4ILEA 2FA9A 1W0KD 2MMGA 1ZC3A 5KO2A 2DWOA 2PLFA 5EXSA 3THXA 3DOEA 2BDTA 1OGIA 4TQ9A 1K8RA 3CPHA 1D5CA 1DAFA 4TQUS 5CYPA 4G0NA 1XE1A 3AUYA 2PX3A 1GAQA 3L0OA 5DHAA 2OFWA 4V0MA 1G6HA 4GZMA 3IO3A 1CR2A 2MSDB 1S96A 3CPJB 3M0EA 4NMMA 1U9IA 3GJ4A 3NC0C 4FMBB 2VF8A 3GJ6A 421PA 4ARZA 1JALA 2GAOA 3K8YA 1RRGA 2BJVA 1OH8A 4Q4LA 3VQTA 1KAGA 1GITA 4GOKA 1M2OB 2YC2C 1IY1A 5GVRA 1RYHA 2QG6A 4URVR 1UPTA 1GRRA 5JWRA 1I4TD
chains in the Genus database with same CATH superfamily
3OQIA 4D9EA 4AY2A 3HXTA 4HNRA 1UDCA 1XP8A 1CEXA 3F5FA 3LAWA 3NUZA 3DE2X 4XARA 5I3ZA 3CO5A 1SXQA 1XALA 2I2AA 2MYPA 2O3JA 3W77A 1UT6A 3PHGA 2XLBA 4MCHA 2GXAA 2KS6A 5IT4A 4EJSB 2V7VA 1A27A 4NC9A 4Y2VA 5SYAA 1ESMA 1I3MA 1YQ9A 3IUQA 2NYVA 3W6PA 4ZTUB 1T5BA 2IHZA 5CH5A 4DXAA 2LD4A 4NDNE 2VHTA 1NL3A 1KI4A 1PJ4A 4YAIA 1U99A 1C0EA 4G8JA 4M9XA 4UJ5A 4Z4RA 3ZDZB 2GQFA 2BFFB 1I2CA 3A8TA 4A6PA 4KPGA 4ZOLB 1QQTA 3C1AA 3Q3CA 4HUQA 4IP0A 2DYIA 5K8VA 1FX0B 2HPVA 4ZZ3A 4DK1A 1NQ5A 2G28A 3GO4A 2JDID 2PSHA 2FK7A 3PNMA 3R1IA 4XPZA 3I58A 2CCJA 4Z49A 8ATCA 4LZLA 1T8PA 1EA7A 3UAWA 3V7AA 4B3RB 1QUEA 2Y0CA 1MJFA 5D3KA 3EX7C 4RD2A 3NIFB 2NTJA 4IIJF 4MWDA 4DLBA 5B55A 2VSOA 2AFIE 3Q7PA 1E1RD 4MIYA 3LDGA 3VZRA 2G77B 3PD0A 1W19A 4NFSA 5JTTA 5J2UF 2X0KA 3AM3A 3BD9A 3GVCA 4OREX 3RVMA 2OAEA 4NBKA 4UDXX 4A1OA 2DKNA 5ALNA 4ARCA 4W5TA 3S2EA 4ALJA 3EZ9A 3HSKA 1CUXA 3PG5A 1B14A 2PJUA 3WYEA 5BYKA 3UT0A 4XGQA 2FZCA 1ZGGA 2ZETA 4K9PA 1Z06A 4M98A 3H1PA 3G1UA 4Q7QA 1TVCA 1IPEA 4TPKA 3DZHA 3RRNA 4BO8A 3VSCA 1PJQA 3L7AA 4A6EA 3JVUA 2P78A 5DLEA 1CVIA 4F2GA 5AM2A 3G2LA 1NKSA 3PQ3A 2V6GA 1KKUA 3OMXA 4LRQA 1QIJA 4UTXA 3PQ5A 3WQQA 4BMSA 3IJEB 1DAGA 1SWVA 2FPMA 3HCBA 5AK0A 3SHVA 1QU2A 5JU6A 5JNWA 4CM7A 1UP4A 4A03A 4C0KA 5JVDF 1S2GA 5TGTA 3RAPR 2RHCA 4BGDA 3Q3VA 1JTFA 1MENA 3G8CA 4GI5A 3LUHA 3DW1X 3OPMA 4ZVSA 5ADUS 2OLKA 4DSUA 2GSDA 3RABA 2WTEA 3B1YA 2I4TA 4XVHA 3BH7A 4LBWA 5BN5B 1EUQA 1QYCA 5I4BA 3BUSA 4V2IA 4OQQA 5AJVB 2NU6B 4XVUA 2HNBA 4NIMA 2NUAB 3VOTA 5BV2P 1FUUA 1EP3B 2D1SA 2UV8A 2DTEA 3FPJA 1HFKA 3GUUA 3JVDA 4QIHA 1FBTA 3ZUGA 1QAQA 2FP3A 4RHCA 1R18A 1Z29A 4D7AA 1ONOA 2JLYA 2W00A 1OBCA 3K9FC 2EBFX 5A3QA 821PA 1SVLA 4ZQFA 4MAMA 2PVPA 5EMMA 1QFXA 3TX6A 5CYGA 3OKCA 1NW5A 5CAEB 3WS7A 2P3MA 1W5BA 1UWCA 2IX9A 5FV4A 1NPDA 1H2BA 4JJIA 4Q4JA 3TNYA 1LV8A 2HF9A 4IDGA 4UHHA 3PB3A 4MJLA 5IZ4A 2XX3A 3HU5A 3INTA 4PPNA 1ADYA 1G8MA 1IHPA 4Z9YA 5C8YF 3F97A 4AUNA 3TSOA 2D4AA 1ESCA 1ETHA 2EJUA 2VRNA 2XMGA 4FHGA 4JJ4A 3WLLA 2VRWA 4A82A 3EODA 2W90A 5HJ2A 4QKQA 5HM8A 3TUIC 1B0ZA 3FPCA 5EXDA 3FHOA 3WTBA 4D0GA 1NW6A 2EZ9A 5EMLA 1T3HA 2CXNA 3KZKA 1T25A 4Y2RA 2R0QC 1QP7A 1JFTA 4X7BA 4RK5A 1J8YF 1HFJA 4HVAA 1T5LA 4PG4A 3GLGB 3M9LA 3ZVLA 3G88A 4D9BA 4QFMA 2DSNA 2E5FA 4NABA 1GYRA 3IMEA 4OA8A 1XDBA 3FG9A 5TS2A 1D2NA 2IHVA 3B60A 3GJSA 3SEZA 4CMAA 4GM0A 5KAMA 4A0HA 4ENTA 1DKLA 1NBAA 4A2CA 4D9HA 1QDUA 1KTIA 4TYQA 1LVHA 4GPTA 4FP9A 3LKZA 3W8FA 1R10A 4DYDA 3R5FA 4NNJA 3KB1A 4A8JA 3CFYA 4P54A 1JTEA 1YULA 1GXSA 1EVLA 2WU3A 3QF4B 3QEAZ 4JI6B 1WL8A 3QX7A 2AKAB 3R0VA 2DQ4A 5KDDA 1E3SA 4EFMA 3M4NA 3F47A 3GFSA 2C9DA 4K5QA 2HK6A 4DB4A 1SVMA 3ASQA 4DK0A 1WNTA 1R4MA 3WYAA 3I4LA 2DR3A 4Y0NA 3DW3X 4KPFC 1KVSA 2BKXA 5DTMA 3ZZMA 2DOKA 1MNAA 2Q4EA 5AT1A 5CVTA 3SDBA 4CF4A 4MYRA 1GUBA 5HRCA 5TMBA 3OM9A 4DC0A 1ONBA 5CIWA 2VRCD 1MRSA 3QWBA 4CT5A 2YNMC 4HQNA 4YUZA 1EDZA 5FI0B 2DPHA 4KK3A 4R3UC 3ZY5A 3ICOA 4RY0A 2F8TA 1CY8A 1N2XA 1UKAA 4MR7A 3TLGB 3PGJA 4KQCA 4CKBA 3CEJA 2O05A 4HFJA 4EZEA 2WLSA 1Q77A 2NN3C 3H2YA 1UF9A 3N6VA 4LDPA 1TCAA 4L2IA 1EFVB 5KC8A 2LKDA 1QO0A 1UJ6A 2X58A 4N5NA 4JJGA 4UNQA 3GRKA 4RTOA 4LXIA 3W8NA 4ZJZA 3HFGA 4IV0A 2JL1A 1VQOB 3ZUPA 3JZIA 2GBFA 2D7JA 3ZCSA 3QXXA 2VUUA 1K28D 2BHSA 3AT1A 1CUJA 4MITA 4NJEB 3JQAB 1JXMA 4ITUA 4U5QA 1I4EB 1YONA 4L5BA 1ZR4A 2IH5A 2Y05A 1H2FA 2G5TA 2P9JA 3L7NA 3PXBA 5EA2A 1LLDA 4PF1A 4DCCA 3BWEA 3FF4A 5BN1A 3A6KA 1CG6A 4BQPA 4R9SA 4B35A 4KAFA 5DGXA 4KV9A 3P9XA 3ETCA 4ZVRA 1XKQA 2IHYA 2VDUE 3H0EA 3OBIA 2QYSA 4W6ZA 5G0TA 4DUGA 3H9QA 4ZEVA 3ZE2B 3SHOA 2NYUA 4Z0NA 5FBLB 3THOA 1XMJA 4GRAA 1TAHA 1UKZA 2BUBA 2JFXA 2VJOA 2WNIA 3E9DA 3IUEA 4PSUA 1LDNA 4M55A 5IBQA 2F3TA 2F67A 3UMBA 4ALKA 1T9KA 1KDOA 5GPBA 4K03A 1EQAA 4BNZA 1U0HC 5AW4A 1E1MA 2QJFA 4FLMA 3IBCA 1B42A 5I4IA 4FUTA 3ZY2A 4IDQA 2NO6A 3AUJB 1KI9A 3KB8A 5E1BA 3LLCA 3A9WA 1LH0A 1AKVA 1TMOA 1OXMA 2EV9A 2ID9A 2JCGA 3AY3A 2G3YA 3L0IB 4LVUA 4EPVA 3W5SA 1ITZA 3M7IA 1L4FA 1HWYA 5BXYA 2XXAA 2JASA 2Y1CA 4R9UC 2XIJA 5AI5A 3W90A 3WRWA 3AVVA 1JUDA 3O4IA 3ISTA 4AJ2A 3BYZA 4AG6A 3AGPA 3JQPA 5DVZA 2ZAGA 4ENUA 5B2EA 5BQ3A 1UKYA 1WHSB 2WHRA 5G0UA 1Z2DA 4XX1A 3TOZA 2G25A 5IDWA 4JXJA 4P5EA 1L1RA 5F7JA 1DBVO 1BSVA 4DLWA 3OETA 4JB0A 3RNOA 1EUCA 4CIBA 3PJRA 4FNOA 5CCXA 2HCTA 1PHPA 1ZVKA 3TAXA 3TW8A 3M4ZA 4PXYA 2NU8B 1JH9A 1L5YA 3LH5A 3R77A 1NF8A 1NIJA 3BKXA 2C20A 2EKPA 1BKYA 3NCTA 4HGRA 1XJQA 1VRWA 2JCXA 2Y77A 3NWBA 3FGNA 1QYVA 1UK6A 2ZUUA 5FPSA 1FK8A 3VYRB 4HQOA 1JVSA 4LOKA 5FR2A 3F9RA 3B6MA 2HRCA 3C7CB 3IRUA 1HF3A 9LDBA 1PJBA 4OHOA 2GBGA 2ZRLA 4B33A 2VH1A 3PR1A 3SC3A 4A91A 5KPJA 4Z7OB 3NKFA 3CKMA 1TYBE 5AUQA 1ZOPA 3V8NA 4FDAA 2Z6UA 1XD2A 3LTNC 3VTAA 1HYQA 4UM5A 1G3RA 2V3CC 1ONPA 5H3HA 1JHYA 4YCLA 5E4TA 3SSOA 3I83A 1QONA 2ZYAA 4QU9A 4ENWA 1RE0A 2AD1A 2QLTA 3V1KA 1I30A 3P0EA 4ICIA 1QFYA 4JYMA 5FBZA 5LZ7A 2JLUA 4K6MA 1XNJA 5CNMA 2FFRA 3KZMA 4GQAA 5IXJA 3SVTA 2VPWA 2ZFUA 1ZN9A 3FOZA 4DA9A 3RSLA 2ZS7A 5TE9A 4TZKA 2RI1A 2RKBA 2QGNA 3O1JC 1GCGA 3TSAA 3GFGA 5AHOA 3NOOA 1X1TA 4B6RA 3VZDA 4EI2A 5T4HA 2BSQA 4PX5A 1E9BA 4C2UA 4TWJA 4M6WB 2FZGA 3C87A 4OJKA 3U4HA 2HK9A 3P0FA 4QGAA 4IH9A 4TUYA 1HZJA 2CB9A 2FWNA 4XKVA 1KTVA 2NZVG 2ICAA 2Q21A 3MILA 2P6NA 3OLWA 3RYIB 3IA7A 2GBLA 1P6UA 5LDGA 2AZMA 3GCWA 1YS4A 2QR5A 3PL1A 1YJ9B 2EFEB 4S1NA 5I45A 2J41A 4RWZA 2EL7A 4H9GA 2E6UX 3KCNA 4LVNA 3MCTA 5CB6A 2JB9A 3OFNA 4WESB 3RYCB 4QDOA 2BD0A 3KJNA 4A23A 3F5QA 2ODWA 3I9LA 1XF9A 2HIHA 3CVYA 3MWKA 4UEQA 3C3CA 1JBEA 2PUJA 4IVRA 3WWZA 2FMFA 2WFAA 1ZRMA 2VDKB 2KHZA 4MTCA 3KYCA 1DCTA 2FPIA 1N32B 3WK4A 5K5EA 4AAYA 4JR0A 2IPMA 3SJPA 2VZ0A 1Q92A 4ZOEA 4YRPA 1GPKA 1Z0JA 2VUTA 4WLUA 2B82A 3HP1A 3JQGB 1DTSA 4R7ZA 4FINA 4RKWA 2BMEA 1M2VA 4JMLA 3BD6A 4EI9A 4TLCA 1QFMA 4JZKA 1VTKA 2XOKA 3BEDA 3FOWA 3KZNA 3JQAD 2XHEA 4HVTA 4RVGA 2DLNA 1DJLA 3DOUA 2VXOA 3EUEA 1EXMA 2FSVA 4FCWA 4R16A 1RYMA 1Z33A 2A30A 2BP7B 2WAOA 3N28A 5DM2A 2J8ZA 4OXRA 5D3ZA 5BO5A 3UB2A 3SN6A 1H3FA 3EGDA 1NXXA 2BFBA 2CMKA 2R8YA 4N40A 1P72A 1XBTA 1P0PA 4GPBA 3T7RA 1KYYA 4B45A 4KI0A 4ZCTA 1G38A 2MSNA 2PL3A 1SOAA 1U7WA 3IAXA 4YIKA 1F3OA 3GJ5A 4Z9FA 1F4PA 2AZ4A 1THZA 3O9MA 4QYTA 2F90A 5ELMA 4DV6B 4DM3A 2JI6A 2VRBA 4KC0A 2MSEB 3R7BA 4JJ6A 3W0LB 4EW2A 2GN1A 2VS1A 1PE0A 4UFPA 3DTVB 3KYIB 3AY7A 3EVNA 1BNCA 1LPOA 3ZW8A 1QX3A 1OWMA 2N47A 3CSSA 4RK0A 3FIUA 3T3GA 4Q3BA 4IX1A 2I67A 1OXTA 3B51X 1E9EA 4AECA 4GL2A 2FZEA 1BFDA 3U7JA 4UHKA 4UTZA 3S29A 3H17A 4RZ3A 4BBJA 2VO1A 2GPJA 1QH1A 1UDBA 5AQ1A 1NVVQ 2B36A 4EFNA 1EFRA 2PEYA 1WOOA 1J8MF 3K4PA 2AQ8A 2RGNC 3JQDA 3CM0A 5IJ0A 1N2CA 5GJCA 2BSAA 1XELA 5SYNA 2XODA 3ZE9A 4B3BA 4KNYA 4O4IF 1T2AA 1JLSA 4G0YA 4JBGA 4MTLA 1SCBA 3R6GA 1ZJZA 4UVHA 5G1NA 2C98A 4OHVA 1I9GA 3I1IA 3PHBE 2HA4A 4WY2A 5DULA 3G9XA 4IZ6A 3QEMB 3SJ7A 4ENRA 4RY2A 2ZWIA 2G4CA 3HMKA 2AC7A 1VLJA 1NVTA 3BFXA 5JECA 4G5FA 4RKRA 5BOSA 5JCXA 1URPA 2OCIA 5ALOA 4GM4A 5KYKA 4CXMA 2P4QA 1I24A 3KOUA 4YQZA 1XVAA 3LT1A 4L8LA 3KQUA 3WAJA 2IZ0A 1FLDA 4PFKA 4LWPA 4P1VA 1FEZA 3H5RA 4UEOA 4CKEA 3SOZA 3FZNA 3Q4GA 6PFKA 4HQKA 4G0WA 5CHEA 1Z16A 5EJ2A 2ZXHA 1NAIA 4PWZA 1RI2A 2IYVA 5IHXA 4Y7CA 4QOEA 2MDTA 3QPAA 5AI8A 2DHEA 4DA0A 4DJDC 1H66A 4MA0A 1VDZA 1ZS9A 5EP3A 4M86A 2I29A 2XQVA 1WXQA 3NYQA 4P31A 2V5UA 1OBVA 2GOYA 2QUJA 4RVOA 4XQCA 4YCDA 5C3UA 2UXBB 3A1SA 1YZLA 3PHCA 4CM9A 4P3PA 3QVGA 1WOYA 3GP3A 2QI9F 1SBTA 2AG5A 2WWGA 3ICWA 5BSVA 3KTAA 1J23A 1K68A 3JWJA 4EFKA 4UQLA 4RABA 3QTLA 2PGJA 3U4GA 2WZDA 2CHVA 1YV9A 4MLPA 4XVQA 5DWDA 3ODPA 2CMFA 3C24A 3H2SA 4AQYB 3O0TA 3TRKA 4J3NA 1R0BA 2C5LA 3THXB 2Z2IA 1OQAA 4R1NA 4F86A 3PICA 5EZYB 1FDVA 1P44A 2J0UA 1GUDA 2YV1A 4KHZA 3JZDA 4OHWA 2P5TB 3HFJA 3P52A 2FEXA 4M36A 4Y1EA 2ZBDA 2D13A 2DBZA 1TYAE 2H9YA 2WZBA 4EY7A 1GD1O 1KZYC 2BM0A 3DOJA 4UHFA 1FUIA 5FFMA 1OIXA 5DT9A 1PVDA 4ARVA 3KHTA 1I1HA 4H1WA 1U0NA 2J5XA 3WBKA 1PS8A 3KQTA 1M8JA 3HL0A 4I8DA 1XZKA 4J4TA 1ZLXA 3R7LA 3ELWA 4KN9S 5B3AA 5LWHA 2WILA 3OQIB 5AUNB 3O3OB 2QM8A 2XE8A 1PT6A 4R54A 2FK8A 1G8KA 1V8OA 2H06A 3P9IA 4W9MC 3IUJA 4LY0A 2C5BA 2GAAA 2AOUA 3FUWA 2G17A 1M90D 1L4MA 5G0WA 5IANA 1M8KA 3WLRA 3M83A 2FPSA 1E59A 2D3TA 4MGZR 3WBBA 1PLJA 2FVGA 4RS4A 2XV1A 2AN1A 1RS0A 5UKDA 1XLTA 4AO6A 4Q6WA 2JI8A 4HEA6 2W71A 4QUAA 3T61A 3QLUC 1Q2UA 2ZB4A 4J7XA 4PONA 5D3MB 1VHOA 1JDBC 2BELA 4UE2A 1KRWA 4HNQA 2RH4A 3QW2A 1PT8A 2LBPA 4J8PA 3P4YA 1RLJA 4HUQB 5HCNA 1XDWA 1T0JB 4PLVA 3IAHA 1GCUA 1RC0A 3DBVO 1AKTA 1TK9A 1MQAA 3FDXA 4GDMA 4HNSA 4KWIA 4OXKA 2W6ZA 2LR0A 4ZQEA 1YNSA 4PVDA 5HFNA 3GLHA 4J7UA 1JMVA 1Z5PA 3B5EA 4M1SA 5IJXA 3MJ4A 1QF6A 4R1QA 1FFBA 2W6IA 1DEAA 2CEAA 1WTCA 3IOCA 4L5IA 1R6VA 3SC4A 4DWWA 2X8JA 3QJYA 5HJ7A 4PHTA 2PL1A 3DDHA 2NVOA 4NE2A 5BW6B 5J4HA 4L75A 2IPAB 3JYPA 1C9DB 4Z51A 2HJVA 1OILA 2OBSA 2IYZA 2ZSBA 4LPKA 3ZD7A 4PFJA 3R5JA 2CVPA 2YHAA 3UCEA 3B3QA 5AHKA 4TLBA 5DRTA 1Z18A 4D9IA 3FX2A 1CV2A 1IEQA 4HQRA 1THMA 5B64A 2GH1A 2VBCA 3VYTB 3ASVA 4MYDA 3RS5A 1L7VC 2H51A 4X7MA 4EVIA 3I6QA 1P7CA 3L0ZA 4RENA 1PFWA 1UMBA 3AZOA 1UOOA 4E15A 3PUJA 3GBPA 3T9CA 3LT2A 2PUFA 1O5OA 2Y1KA 1KHTA 3DTVD 3BJZA 4TTVA 2IP1A 3RROA 5TT1A 3VAAA 4BMVA 5D3QA 3RSFA 2Z1NA 5H02A 1FYWA 4ETMA 2WFMA 3OESA 4LRTB 4QPPA 4B6GA 1XQ9A 1H2HA 1VYHA 1ZD2P 5DW3A 3T4EA 4LIPD 1XXHE 3WK8A 2EBHX 4QFBA 4BB6A 4HXGA 4BP3A 4EQ6A 2H4ZA 4IDEA 3X1MA 5T4EA 3I01M 1B8NA 3EG5A 4TMYA 3ADOA 2JGEA 2W0SA 2CXTA 2ZJAA 1AQYA 1HOXA 5TJHA 3TO5A 5HHTA 2ZJ6A 4GLOA 4ZK6A 2VOEA 3P0RA 4HUTA 2Q3CA 3TAUA 3P9CA 4B6QA 4ND6A 5FUBA 4WNCA 1EFPA 4BN0A 4MX8A 3AI2A 2WPNA 2P5SA 4ZMBA 3M6FA 2GNPA 9LDTA 4L8FA 3CTPA 5J4LA 1A0OA 2IL1A 4ASUA 2OUIA 4KRXA 4NULA 1E1KA 3MJTA 4Q4JB 4QVGA 4QHSA 2Q6KA 5SZKB 4PLGA 3WL5A 5JWOA 1ADBA 2CWWA 4AJLA 1ZW6A 4Q9IA 5A02A 1XJ0A 2G9VA 2XCUA 5GIPE 1C4OA 3B5JA 4LA4A 4EB8A 5ICSA 1QIKA 3DDWA 1HX7A 3WHIA 3SE7A 2AXPA 1UKBA 3FBGA 3JVIA 4CFYA 4EL5A 5A6SA 5JZVA 4IDAA 1GKKA 3B3AA 2AW3A 3D8TA 3HGTA 1A9ZA 3Q7RA 1F20A 1PFKA 2VZ8A 4RUKA 2J9GA 4U2DA 5D7BA 1T4DA 5EPUA 5WRFA 4B6EA 5CEEA 5FJJA 1J09A 3O9ZA 3ROQA 3T3EA 4DMGA 4NBSA 3A1UA 4IGFA 4ZT7A 2OXTA 3UV6A 3VYSB 1HVXA 4AYXA 1RYDA 4PO1A 2OFOA 3SKYA 4JT9A 3WOHA 1SKMA 5HKKA 4LNUA 2BFNA 1GFSA 1WP6A 4G81A 1CWUA 4NH0A 4HC4A 4BO5A 5JFOA 2YWXA 3PUXA 2NUPA 4OHKA 2IU0A 1BXRA 4ZO8A 1DU4A 4QRDA 3JAWA 5CA1F 4ZAGA 4DG9A 2LIPA 1Y1SA 2HXGA 2ZRJA 1VXRA 3M6LA 4IOKA 4R1UA 5IM5A 4B46A 3R24A 5CH3A 2Q5QA 4KPUA 5JI3E 2PYIA 4NH4A 3CLHA 4AB1A 4AMZA 4EPYA 3GP8A 5AHXA 1Z2EA 3TTWA 4A8JB 4UOEA 3ZC3A 1NOJA 2O6LA 2ZYDA 2C92A 2X1VA 1U8TA 1VLVA 3LUDA 4KFSA 3ZDBA 1ZD8A 4HWRA 5EE9A 1WXGA 1U28A 3T52A 2BV3A 1G64A 4CUJA 1QHGA 5T8KC 4D3XA 5DGHA 2FAXA 3F46A 4CMIA 2XDWA 3EPRA 2R1VA 2Q27A 5DWQA 3FLEA 3ET4A 1R4MB 4R0NA 4RHUA 1VQ4B 4YRAA 4BFVA 3ENQA 1NURA 2B1GA 1J97A 2GEKA 2YNMA 1OVMA 3AVPA 4FHEA 3TYXA 2ZUWA 3WIDA 2OAP1 4UBJA 4DLRA 5DO9A 3WBFA 1RHUA 4BEJA 3B1XA 2YJNA 2HU5A 3NGXA 1O08A 1USVA 1U11A 2PG3A 4X05A 1TM4E 5AKLA 1MZPA 5COAA 3SR4A 4EAAA 2BBWA 2VYNA 4ER0A 4R1LA 5BSHA 4DV0B 2MMCA 4BDTA 4PZ9A 2EJVA 2XUPA 3E7FA 1E1CA 5BT8A 3Q8MA 1IG0A 3DVAA 4RMNA 2P4UA 1RAIA 2J0SA 1JWAB 2Z8YA 2YWFA 2NACA 1XA0A 1C3OA 1YOBA 2BR5A 2C1ZA 3K0EA 4JYBA 4IXTA 3GT3A 4L2IB 4NCNA 4HNGA 3OUUA 3PE6A 1Z3CA 1TCBA 1XVTA 4KQGA 4OAQA 5LP1A 4KKSA 1XHEA 2GXUA 3D6NB 4YO8A 4ZIRA 3VDQA 2BBTA 1RBYA 5C9ZA 1T9GS 2FUG6 4MR8A 4DBVO 2E89A 4OU5A 1DBWA 2WYOA 5A9TA 4P86A 2ACWA 4TROA 3QE0A 4GI2A 1N3LA 3JPWA 5DMHA 4TTAA 3VR4A 4QDXA 2W22A 4CF3A 1MVNA 3WGJA 3RQSA 1IPFA 4IH4A 3RHFA 5D85A 4G6IA 3JWHA 4IRUB 4BKOA 2B4AA 3FMPB 1PLKA 4MJ7A 3RF6A 1DXHA 2H59A 1IIRA 3KUKA 1KERA 1Z0DA 3C6MA 3GJYA 3LNCA 4QXPA 5CVCA 3TB6A 3IKTA 3QVKA 1C3VA 1U2TA 2QY9A 1IWPB 4BMOB 2HHLA 3AVOA 4WOJA 4I1RA 1VA5A 1VJTA 3N0WA 1HUQA 1RRCA 4RD6A 1V3UA 221PA 2XCRB 1UD5A 3ASZA 5AM0A 3I28A 2WY2D 2HR1A 3ZDAA 3F7TA 2P6RA 2FWPA 3OQPA 4QPJC 3QU5A 1UXKA 3P9KA 1QGAA 2ECPA 3EF1A 2PZMA 1LRLA 1VQMB 1NE7A 2B4TO 3AC0A 3LNTA 5ULLA 1A3CA 1OBHA 3DTYA 3NBFA 3DT8A 3ASYA 4CG0A 4I0WB 3D64A 4JLBA 2NUBA 1O8CA 3MBOA 2R3SA 3UKDA 4QHTA 1O1YA 1J2UA 3G3EA 1CUBA 4RSMA 1JE1A 4F5YA 2UUAB 1ACMA 1JE0A 1Q1QA 1KZ7B 1VYUA 1KJNA 3DXXA 1S1MA 3A2NA 5JMPA 3WGVA 4MCIA 4QXMA 5KOJB 4PANA 4RVHA 4NMWA 1GZ7A 4UHBA 4MV0A 4LFCB 3GG2A 1AS0A 3UQZA 4RDCA 2DQKA 2IVFA 3L6BA 4JSTA 3GQVA 3L7LA 4YECA 3AUTA 4ENQA 1UBJS 1KC3A 2QU7A 4FS8A 1H4SA 3IT3A 2X9VA 3C3YA 3ODGA 4IXMA 2OCGA 4MKZA 2JD1A 3ECSA 2BE9A 2J4FA 2GPTA 5DFAA 4O6VA 1U4SA 3RJ9A 4IIHA 1FJHA 3T7AA 1EUCB 4OAPA 1KS9A 4M0PA 5AK6A 5H3CA 3WADA 1WV0A 2XWJI 3TW8B 4Z4SA 4NZMA 4AT1A 2G1AA 2Q5EA 5K8CA 1SWWA 4C78A 3OZUA 1TD9A 1WPGA 1JG1A 4D82A 4XAQA 3E48A 5FUYA 3MTJA 2YVQA 3AFGA 3DHWC 1L5WA 5FV7A 3C6XA 2GD0A 2QMHA 2BEVA 5ERXA 1ZIYA 4HFRA 2ONJA 2OHFA 2X22A 3O1HB 5ELLA 4JVOA 2R7KA 3WLMA 2MR5A 1JDZA 2OKCA 3FYHA 2ZZNA 4KQFA 3KJZA 4TTSA 2A94A 3JW8A 4JR2A 4NENA 5DYIA 2Z4SA 3T0FA 4DMLA 2B5VA 1JAHA 2BHRA 3A0UA 3C3EA 2FFJA 3T95A 1HRDA 4CKXA 1NJSA 3ZDCA 3AY6A 4BU0A 3FUXA 3UGKA 4Y6SA 2UZ1A 3LC2O 2AI3A 4U9UA 1A2OA 1D4ZA 3SYNA 1XD2B 5G0VA 1WBJB 1EX7A 3LX4A 2GTPA 1CRWG 3QNMA 4J2OA 2GZ1A 1ZOIA 2W58A 5EHQA 4KTVE 2BGKA 5DT2A 4DUYB 3H2IA 5HZAA 4YYZA 4HLCA 5J2TA 4MRMA 4ND5A 2WFLA 1SCAA 3ZG6A 3SZ3A 4CFZA 2XYVA 1MO4A 2BTOA 3LNNA 1QVGB 1E1NA 2CLIB 2XVZA 4LKOA 3USZA 1NP7A 2YIDA 5K0BA 2XCSB 1GDHA 2G83A 5TNXA 3EC2A 4C4SA 4KWEA 1W8IA 4EWLA 3THRA 3T3OA 1NBIA 3UYLA 3G2MA 3L3BA 1AQ6A 1VOTA 4D0NA 2XRFA 2Z9BA 1ZN8A 1TEHA 3RYHA 4RLZA 1NVXQ 1DV2A 1B16A 3PYLA 4LGMA 3DF9A 3R20A 5EIEA 3DV2A 3BA6A 3R5XA 1OZFA 5IJ9A 3HB7A 2JLQA 1NU8A 4UCXA 3RQIA 1X87A 1ZA2A 2BZGA 4UHEA 3ZHXA 1GPUA 1QHNA 3K16A 2PMEA 5KOYA 1GKYA 4YAEA 3DMTC 4NMXB 1P2UA 3GWZA 2CNDA 4DZRA 2AG8A 1FDIA 3OOCA 2IOQA 2IVZA 2OY0A 4L0DA 3UGJA 4HEHA 4QGHA 2PSDA 4QYIA 3PCTA 2ZCJA 2DERA 4H7JA 4P4LA 3KOOA 4U6SA 3NTRA 4FSHA 1TLFA 2GXQA 1ESEA 1XLUA 2X7JA 3CEAA 4JOSA 3AJ9A 2FGKA 4Q4HB 2AD5A 2QIPA 3CX4A 3L1HA 3LCCA 2HDNB 2MSKA 3KYCB 2FPIB 3DP9A 1IK6A 1Q9SA 1D09A 1QQ7A 1ULSA 1YCHA 1T4MA 4Q3OA 1YF3A 1W87A 1LPSA 1YDFA 2G0NA 4YQYA 3ZCUA 1BCSB 3CVUA 4IS2A 1QO0D 3MW8A 4Z4ZA 1TLTA 3KOZA 1YVEI 1UPCA 3UBTA 1YS2X 1M2VB 1SQGA 4JEIA 5HFJA 4KXLA 3HSYA 4UEKA 4JQCA 6ABPA 1P7PA 3G0OA 3CPSA 5CXQA 4OQPA 1U4OA 3KOYA 2YWEA 4Z8YA 1XQ1A 4R2IA 1MH1A 4UOZA 3EIWA 1KFEB 3COJA 4MVYA 2NZUG 4GXNA 4Q24A 3UJHA 3I2YX 4QBFA 4TWRA 2BFBB 3NFRA 3DEAA 3JASA 3WTCA 3ZQ6A 1Z12A 2P3QA 1GGHA 1LJ8A 3ZE1B 4MQEB 2JC3A 3OX4A 1NC1A 4DUGD 4HSEA 3PPXA 3SJUA 1LA2A 5JS6A 3I9MA 1ULAA 3REQB 2YBDA 3LUGA 3ANXA 2YVAA 3U3XA 4YX9A 5ICMA 3RBXA 1X2BA 2EFCB 2QWXA 3KPWA 1RZRA 1VPWA 4GR4A 4ZRDA 4IQ8A 3E7DA 3KYDB 4I55A 4RFVA 5JMOA 3H65A 2R6R1 1M34A 2JFFA 2YQ4A 1RYEA 3NE5B 4E6PA 5JIBA 4Q01A 2QK4A 2YUTA 4PNHA 2PMDA 2Q3LA 1TU0A 3AX6A 3MT7A 4MP6A 2P9GA 5CLGA 1SC1A 2H4XA 3BKWA 3JAKA 3IERA 3QUSA 5GJVC 1PR5A 4QJBA 2RGNA 4QHYA 3MINA 1B7GO 4JKIA 4TZ0A 1E60A 3BVPA 3DZJA 5A5FA 2CYAA 4YB8A 3L46A 3NUGA 4P80A 1ZG3A 4EY5A 4YBRA 3BTOA 4MHOA 2A5DA 3IHKA 3E9RA 3H6GA 3D1VA 1Z2PX 5IJ0B 2XGGA 1N2CB 3B78A 2P75A 2C3OA 4IFTA 3CR7A 1Z5UA 1X42A 3U44A 1ZXLA 2Z09A 4YJ3B 2HB6A 1K6IA 2GEUA 3A2LA 4JUIA 1A82A 3SPXA 1KOFA 1QCDA 3NHBA 3G4SB 5KJ6A 1EM6A 4WZBA 5L7TA 4ZJYA 2O3RA 2OGTA 1SUEA 4H6XA 2XMQA 1SKQA 3L8ZA 2W6OA 1TEXA 2CN1A 4EHLA 4LXQA 3W2IA 3F5DA 4ZPJA 4J1SA 4GEKA 2DTXA 3BERA 1VKHA 4LGYA 4BNFA 4R9RA 4EELA 3EXHA 2AYYA 2H7YA 4RY9A 3TPZA 3CYFA 3L4JA 4P3NA 5D6OA 3ETLA 2EERA 5MFZA 5ELXA 1Z0SA 1LQ2A 4WZLA 2B1IA 3AW9A 1XZQA 2P3SA 4TS4A 1PN3A 5B53A 5IAKA 5D8DA 4YV0A 1DQRA 1NMSA 5A5GA 1KKLA 5B1SA 4XOTA 1W29A 2JIOA 2YDYA 2YOFA 3N75A 5KTKA 3N5CA 1CERA 4M0CA 1YE3A 3JRXA 1Y3AA 5CK4A 1CQZA 3QBDA 4KFRA 4KXMA 2H1WA 4O2AF 4QARA 4Z3DA 1XPRA 4PVCA 3QVGB 4KXVA 4S1WA 3QG5A 1QP4A 1TF5A 4EW6A 5AK3A 4GO1A 2ZRAA 3RC3A 5B58C 2QXYA 4Y3UA 3OT1A 5JZMA 3D4LA 4FHDA 4G1EB 4OLJA 3QVVA 3QA9A 4CMBA 4EDHA 3H5NA 2EJTA 2IYNA 4Q4AA 3NVKI 1F51E 2IUUA 3X2SA 4WKPA 2MR6A 4RZSA 2HV9A 3ZV4A 4AJOA 1WETA 2DX7A 1JSXA 2JCVA 4AX4A 1COWA 1JKJA 1LVGA 3SS7X 4D9GA 1OSNA 1AKNA 2O7QA 3KR0A 1F2UA 4IHKA 4KUEA 2OC4A 4YDHB 3FFTA 2BHNA 2W2QA 3IP7A 5T4BA 3TNLA 4OF4A 3HB9A 3V4ZA 2ZITA 4N0DA 4CUZA 5K0LA 5ALVA 2A58A 1SY7A 1R5BA 4PXSA 3PNPA 2WU1A 1KJ8A 3BWCA 2VP5A 3KT8A 5REQA 2X5OA 4AQ7A 4D2IA 3TUJC 4LBZA 1VJGA 2PKEA 4J07A 5FOWA 1OH6A 1AB5A 2XXAB 1UBFA 1SIWA 5JXHA 2D9RA 1YUNA 2CCKA 1PK7A 4IJUA 3OM0A 5FUQA 3LQEA 4DKJA 4OK3A 5B4VA 4NNOA 2Y0EA 5EJEA 4KQ9A 3KM0A 3OFND 4UAJA