1IJFA

Nucleotide exchange mechanisms in the eef1a-eef1ba complex
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
440
structure length
440
Chain Sequence
GKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords elongation factor 1-alpha
publication title Crystal structures of nucleotide exchange intermediates in the eEF1A-eEF1Balpha complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 126
structure length 440
sequence length 440
ec nomenclature
pdb deposition date 2001-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ijfA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ijfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ijfA01
2QNRA 2W2VA 2DY1A 1PZNA 4G1UC 1IY1A 2ZSEA 5B64A 3ONWA 1HE8B 2J59A 1II9A 3CUEF 5P21A 1KHTA 4JBWA 1E9RA 1E63A 1ZCBA 4B47A 1OB5A 4IEEA 4IDHA 2OXCA 1NBME 2RGEA 3ZH9B 1W47A 3EA0A 3U7HB 3E1YE 3RS3A 4K81B 4M53A 3IO3A 1DAGA 1EWRA 1E0SA 3VHLB 1F2TB 4QXAA 2GEUA 1OIXA 1OE0A 4AWXA 5CDFE 3AVYA 3B1YA 1E62A 1WQ1R 2ZU6A 2QBYB 2JATA 1NIPA 3FKQA 2ZUBA 4E5UA 3BOSA 1N5IA 2J0SA 3FB4A 1CEEA 4NH0A 3ASZA 4N3NA 3I3SR 4JLJA 4V0MA 2QT0A 4IVQA 1KNXA 1S8FA 4TQAA 4CVNA 5TDHA 5A0FA 3CPWB 3VKHA 1WDTA 221PA 4IXMA 4YXWD 3EPKA 5BYJA 1CNEA 3BIFA 4GZLA 3C5HA 3R20A 3SZRA 1TUIA 3T1VA 2C5LA 2WIAA 1SHZA 4B3XA 2IA5A 1EWYA 4Q01A 1GRRA 1HT2E 1G3MA 2QMHA 5KPJA 1MO5A 4L4UA 4JVNA 1P2VA 1N6PA 1ZC4A 2FFHA 4Q4AB 4PAOA 3DVLA 4XD7D 1P72A 3AVOA 4HE5A 2P2LA 1GFIA 4QJ3A 3P20A 2GZDA 1NMZA 1OB2A 2YV5A 3GMTA 1TEVA 5IHPA 4A0HA 2IS6A 1E9AA 2VHUA 3MG9A 4ZPXA 2WBLC 1EFRA 2GNOA 4OQXA 4BLTA 3UPUA 1UMKA 5IK2D 5BYKA 3CW2A 5JSZA 3SQXA 1GIAA 5FI1B 3V00A 1IJFA 5JFGA 1OHHD 3THXA 4AIIA 1YVDA 4IOJA 4DSNA 3KKQA 4XWKA 2IHYA 4DLVA 2ZQ5A 2OM2A 1UFQA 3GLFE 2D3WA 2X1VA 4TWZA 1SVWA 1DG1G 4C0SA 4DCTA 1N25A 3SR0A 3KKNA 1GILA 2KI5A 4G5SA 3QKTA 1GL6A 2FJUA 3BRWD 2QTZA 4OI4A 4KXFB 2V6JA 3C5CA 2X8AA 1WB9A 4BFZA 3BD9A 2CBZA 2BDTA 4RD0A 3ZBUA 1W44A 3A4LA 3EZFA 2YJTD 421PA 2CMKA 2ZRNA 1CKEA 4HB0A 3ZQ6A 2J0UB 1Z83A 1M2OB 4QJ5A 4BZXA 3QG5A 3C16C 4LJ9A 4KAXA 1LW7A 3ZQJA 1XEWX 1NN0A 2G77B 3ZBTA 2GJKA 1QHSA 3QPVA 4QJ4A 4QNRA 2OEPA 3TAUA 2VHJA 2IS2A 4PQFA 1ESMA 5FBWB 1QUFA 3PCRB 3DO6A 1SKYB 2QGNA 4EPXA 2CE7A 4W9MC 5H59A 2QTFA 1EFCA 5SZIA 3CC7B 3OAAD 5HKKA 3FOZA 2W2TA 3SBEA 4YC7A 2XXAA 2QA4B 3VO2A 3TKLA 4AKEA 3HWSA 3ZD7A 2VHCA 2WKRA 5H68A 1OV4A 2N1BA 4GPTA 4DCSA 3CCRB 1L8QA 1RE0A 2KB0A 2NTYC 2PEYA 1E1RA 2CL0X 5D3MA 4PQYA 1NVVR 1VQPB 4DXAA 1GUAA 1N2CE 1OH7A 1LV7A 2OSBA 1JEDA 3EIEA 2W6IA 2HMAA 2BMJA 1JXMA 3JVVA 3OZXA 3O8DA 4Q9HA 1FMJA 3TSWA 3U61B 4Q1EA 1RW4A 4AKGA 3M1IA 4OQMA 1XXHA 2VA8A 3K9LA 1TU3A 1SVSA 3CBQA 3Q8XB 1BS1A 1DDIA 4JLOA 4DLUA 5L3RA 3VR1A 3U3RA 4BFVA 3KTAB 1H65A 3OIVA 1WA5A 4URUR 4P6VF 3THYA 2IK8A 2H18A 1LS6A 5AK0A 2FPLA 4G5OA 4OHYA 2DEUA 3P27A 1II0A 4L9SA 4PO8A 1VCOA 5EZ5A 2ATXA 1U90A 3DOEA 2ZRBA 1GO2A 4WXPA 4GI7A 1JPNA 3I5XA 4ESHA 1E2IA 1G20E 2SHKA 2ZJZA 4WQMA 1J8YF 4I4LA 2D7CA 1P73A 2BGIA 2FNAA 1P2UA 1R8SA 4PQRA 1YI2B 2QU8A 2ZI5A 4Z51A 3CX6A 2ZYVX 2YKGA 4CGZA 3KB1A 4DZZA 2EFEB 3T5DA 2F55A 4V0LA 1KO1A 1A82A 4PSVA 1N6LA 4TYNA 4D26A 1I4DD 1N5LA 3QI2A 1FNBA 3VAAA 2VP0A 3GLIA 3TW4A 2JLQA 4GRAA 2F1HA 3EAQA 4YQFA 2ZITA 1EWQA 3K0AB 1T3LA 3IPXA 4P31A 4BRUA 1K5GA 1RPZA 4M21A 4G0NA 5J4LA 3ADBA 1FOEB 2HDNB 1SVLA 3W2FA 1UM8A 5EXXA 4BECA 3AKCA 2AWOA 1EP2B 1E69A 2VQSA 3B85A 1VHLA 5KSPA 4C4PA 1S2MA 2XNJA 3EC2A 2F1IA 1NSTA 1G6OA 4YMSA 2BMEA 3T12A 2V9PA 2E9SA 3JZMA 3QFCA 3IHLA 4MRVA 1LY1A 1WE2A 2D4HA 4PC1A 2D2FA 4PHFA 4UJ3A 1QGZA 3U4QA 3QKRA 1X8LA 3GLGA 2ZRFA 3NG1A 1DEKA 1XEWY 5JHGB 2AHOA 2CCKA 5LD2B 1G8HA 1DAMA 2IL1A 2QE7A 2JCSA 3EXAA 4PAMA 2IX3A 1MV5A 1XNJA 2O8DB 2RC6A 2BC9A 2PL3A 3BAFA 4JLNA 4HYYA 1RJ9B 3OZUA 1VG1A 4V0OA 2QN6A 5K8TA 1D6JA 4TYWA 2WSSD 2IHBA 3R9WA 5GADl 1CIPA 3CF0A 1OFUX 1DAHA 2F43B 2AK2A 2GXSA 2NQ2C 3W5UA 3KJGA 3KXKA 3C14C 4IXNA 4KO8A 2QG6A 3LLUA 2CL6X 1YJWB 2IUSA 2J0VA 2FWRA 4EH1A 5FOTA 3L0IB 4XH9B 5HTKA 4DT1A 1U0JA 4LPSA 2UVQA 3LFUA 4EPYA 2P6RA 2GCNA 2QM7A 2YWHA 3G6EB 3FE2A 2V3CC 1TQDA 2D2EA 2EIXA 3A4NA 5LB4A 5HPYB 3PJRA 4ZIRA 4UNNA 3RYTC 1KK1A 1VQMB 3MSXA 3CNLA 3UMRA 1VMAA 3V4RA 1AA9A 4FMDB 4RD4A 2WKPA 3W3ZB 4DEXA 1QH0A 5ANRB 5DI3A 4QBIA 1Q21A 4C9BA 3NBFA 3K09C 3NHBA 3SJBA 1KMHB 2YOGA 3TVDA 2OLKA 4JLVA 5LBIA 3X1WA 4LK2A 4F91B 1KDTA 2DFNA 4PPQA 1M74A 4EQ6B 1RVDA 1LFDB 5EE5B 4FD2A 4GFDA 5JS7A 4OI1A 2MMCA 1YZKA 3THOA 4L15A 3THWA 2JLZA 5TY0A 3DZDA 4JYBA 4HZIA 5DLQC 1VCMA 5GJCA 2FV8A 1XTQA 4LX0A 1QHHA 3QXXA 3TE6A 5G3ZA 1UEIA 1G7RA 1JR3D 2HXYA 2GRJA 3LNCA 5LB2A 2PZFA 4UNQA 2GZHA 4DVGA 4CEHB 2ZYWX 4RJLA 1RIFA 2O0KA 2GF9A 3KFVA 3TSOA 4RCYA 3TVTA 3ZVMA 5JECA 2R6DA 1U98A 3UKDA 4DCNA 2P6NA 1XU4A 3CZQA 5HCNA 2BMDA 1U2RA 1DO0A 1Q1QA 5JS8A 4C0KA 4TMXA 2WOOA 2QMEA 3E2IA 4Q47A 3DHWC 1KSGA 5EE3A 1NVXQ 2BCGY 2J7PD 5B58C 2CNDA 4RFSA 2GF0A 4XSGA 4FMCF 3IQWA 4E09A 1FFHA 1ZM3A 5JCPA 3KUCA 4TT3A 1RKBA 4A8JA 1S96A 1Z6YA 3GJ8A 2ZR9A 4HZUB 3DKPA 1BQEA 2W2XA 3LVRE 4PANA 3RRMA 4KLNA 1KQSB 2P65A 3FMOB 1CBUA 1H8EA 4M8NE 1KJYA 1YHNA 5KOYA 3D7MA 4D81A 3IDQA 5HE8A 4A2PA 1E2LA 1TF7A 2YVUA 2WTUA 3HPQA 3N70A 1E2MA 2Z0MA 2QROA 2G6BA 4RCZA 5TMPA 2OAQ1 4C30A 2QUZA 2XGJA 4DLTA 1KOFA 4MKFA 4O0MA 1KDOA 4GMDA 4B44A 4LJYA 3W34A 2D06A 1DG3A 1UKYA 1F6BA 2JEOA 3GLHA 2RGNC 1L4UA 2CLCX 2X3UA 4U9UA 3OIWA 4HDCA 2J87A 1KI6A 3CB4A 4YAWA 4TL6A 1Z6TA 2OV2A 1QHNA 1Z29A 4M22A 2QQEA 3G71B 2FMXA 3GCGA 2WZQA 3AVUA 3CPJB 1QF9A 1K8AD 3F5FA 3HR8A 3Q72A 3IO5A 1K8RA 3A6PC 2GETA 2OCPA 4QHTA 2IYLD 4LGMA 1N6RA 2FSHA 1D1NA 2B6HA 2UZIR 2XSZA 4CDGA 2CJWA 2P5TB 2QAGA 3T15A 1E9CA 4URYR 4N1AA 3GJ7A 1UKZA 4MH0R 3SQWA 1ZJ6A 4ZDKA 5FOVA 3ZC3A 1MRNA 2ZYUX 3CMEB 2O8FB 5FPTA 1GOTA 1IN5A 2ZE8A 1ZBDA 1TQ6A 5G41A 3T1TA 2GBLA 4B71A 5AUPB 1TUEA 4RKFA 3RRYA 3DMDA 1NN3A 2WIBA 4D0NA 1CRPA 5JRZA 5AUOB 2ONKA 1ZINA 1QRAA 4H9GA 1XMSA 1TAGA 2OG2A 4KVGA 4AC9A 2YYZA 3CCEB 1XTSA 4ZCMA 4Q48A 3X1YA 2JJ1A 3EC1A 1OXTA 1HA3A 3W2IA 1LNZA 3GFTA 3AVTA 1J8MF 2PMKA 3LW7A 5FTJA 1KIMA 4D6PA 1VYUA 3LH5A 2HUPA 1NLYA 3ND9A 5EE1A 2RGBA 1JI0A 5KSYA 5AN9A 1E2DA 3EZ2A 2P6UA 4YDSA 4A82A 5EJEA 4TL9A 1D2MA 5L3SA 2ZSFA 1PV4A 3AVXA 2IEYA 1G5RA 3RVBA 2BCJQ 2RGCA 3IGFA 5EP4A 1GWNA 2A30A 3AP1A 3AF0A 2BKUA 3LXRA 4LYHA 2OK8A 3AF3A 3EIHA 2A5FA 1GL9B 1CJMA 1JXOA 3BXZA 4G5GA 4LYJA 4M1WA 4LBWA 3CXCB 4IOLA 2JLSA 4WOPA 4G01B 3NDBB 1Q20A 4US1R 3UIEA 1BMFD 4GOJA 1KZ7B 5HZHA 4PHTA 3IEUA 3L0PA 5FUWA 4TMTA 5CIQA 1JALA 1NN1A 2VHQA 3UXMA 3QOFA 4JVMA 2IYYA 2EWVA 4MYHA 3UG6A 3CR7A 1JR6A 2L0XA 1X8JA 4QHYA 1DE0A 1VPLA 1SKQA 2JASA 3SYKA 1TQ4A 3IBYA 4I81A 2BBTA 4EFNA 3ZVNA 3NVAA 1XTRA 1E2NA 3U3MA 5JLJA 2C2HA 3KJEA 2BBOA 3A1WA 5D3QA 5FTLA 4X8LA 3OEED 1GAQA 3IILA 2WPDD 3LBNA 2BHRA 3D31A 3NEYA 4LHZA 3R7WB 3BB4A 4FXPA 4A15A 4JBXA 4JVLA 3PEWA 4HLUC 3CRQA 4ESVA 3UWKA 3RWMB 1SGWA 2IYZA 2K5UA 3RS5A 2AKAB 3VR6A 1JEEA 4OJKA 1XJCA 5DI9A 2GZAA 2Q3MA 1KKLA 1Q3TA 3GEIA 3KJHA 4BLQA 4PSKA 3QFTA 2IUUA 3X1XA 3EIQA 5KTYA 3K0SA 2Z4SA 1UBGA 4ACAA 1QDEA 4LV6A 4EFMA 2ZUCA 4M9SA 2XOKD 4PHHA 2O8CA 2QTLA 3PUWA 4MYCA 2WJJA 3P26A 2ZJ5A 3DM5A 3SNHA 4BEBA 3WNDA 2JJ8A 1DVRA 4MA4A 3DKVA 3ETLA 4DDTA 3TUZC 1JAIA 4P32A 2KE5A 2P5SA 2WSMA 3FHOA 4CEIA 2ZEJA 4XVRA 3FYHA 3ZZTA 4MKGA 2BPOA 2GKSA 1SVOA 3CR8A 1P9RA 3BK7A 3OIUA 1MABA 4UXJA 5K8LA 1R0YA 4EPWA 1K73D 3U7EB 2BJWA 1FTSA 1TADA 2ZROA 1E6CA 3A4MA 5DN6D 2HT6A 1E98A 2MSCB 3LD9A 4L8GA 3OZVA 3CRMA 5J4KA 3TGPA 1BX0A 3MHPA 1QHYA 3O47A 2GAAA 2BM1A 4IW3B 2AR7A 5FA6A 1GITA 4IFEA 3KKOA 1GRNA 1OSNA 1OGIA 1NMYA 1OH5A 3SFZA 2PZEA 1E9EA 4ON9A 2QBYA 4YDHB 3ES9A 5FTKA 4LSGA 4Q7MB 4V0ME 5E7MA 4GNKA 4RD3A 1YR6A 4HUQB 5FPSA 2KBEA 5GJBA 2HYDA 3GJ0A 4OHZA 3FHTA 2JLRA 1Q1BA 5CLQA 2CL7X 1VQ8B 5AWFC 4MDEA 1AJEA 5FBRB 821PA 1JB1A 2GXQA 2OTLB 3DZ8A 4Q4JB 3W5JA 4M1YA 1G3QA 1M8PA 1OKKA 4NCJA 1G291 1QFYA 3I4LA 4O25A 3H84A 3SYLA 4URVR 2OESA 2ZRPA 2X2EA 1G8YA 4NKRA 2PCJA 1KK3A 4MYTA 5JJKA 1CR0A 2XJ9A 3VR5A 3IIJA 3KB2A 4OK5A 2AL7A 2CNWA 3CPEA 2ZSAA 2ATVA 1T4GA 4LYAA 2ZXUA 3AVPA 4P0TA 1SVKA 2JLUA 2EFCB 2DB3A 2OTJB 2VLIA 1YR7A 3OE7A 2GEVA 3ZIAD 4TSFA 4Q4AA 4ZDWA 2GJAA 1XE1A 4XVQA 1VQ4B 1ZRHA 1XRJA 3DDCA 3MAAC 4MGZR 4AYXA 4B48A 1GG2A 3PEYA 2G3YA 4Q9IA 3AGPA 1VG0B 3QXSA 1EP1B 1NBMD 1XJ0A 3QF4B 4JLMA 1P3JA 3CWZA 3C4JA 2XNDD 4HB2A 5IT5A 4PO1A 2UZ3A 1B23P 4JS0A 4HAYA 4C0HA 4TMVA 2VP9A 2HLDD 5CB6A 1QUEA 2NO1A 1LF0A 2DFTA 2IYQA 3NC0C 4NCIA 1W5SA 3BH7A 1AS3A 1DTSA 4UQOA 4EKDA 3MFYA 2GQFA 1HH4A 1HURA 2QP9X 4KODA 1X1SA 4YAOA 2GCOB 1W87A 2ZE7A 3GJXC 3F8TA 2JLXA 4NBSA 2O8EB 1T3SA 4HDQB 2QI9C 4RSGA 2AWNA 5KDOA 2QRZA 2IYWA 3U6BA 1YE8A 3FFAA 1RYHA 3LX8A 3UG7A 5TV2A 2VF7A 2ZSDA 2PT7A 4NYIR 1NKSA 1WF3A 3EX7C 1G21E 5B57C 2QMOA 1W49A 2ZJOA 2JA1A 3X1ZA 2ZUDA 1FQKA 1SHKA 5KNBA 2J0UA 2VP4A 4A6PA 2IS1A 2WAXA 1IN8A 2CK3D 1W2GA 4MRRA 2VNIA 5H1YA 3PUXA 1TPZA 3VNVA 1XDBA 3KJIA 1OXXK 4QBHA 1R2QA 1IOZA 4NDZA 2XOKA 4DQKA 3WMFA 1H8HA 2WM9B 1AK2A 5JWOA 1KO4A 4GMXA 4Q9LA 1G17A 3AKDA 5CLLA 2WJGA 1Z0JA 4B74A 4QM7A 1Z0IA 1S3GA 3QEOA 1E1QA 1AGPA 1MR3F 2F3TA 3W6NA 2RB4A 1R8QA 1FP6A 2PX0A 1CF4A 3NBZC 2C98A 1VYVA 4N3GA 3QXHA 1II8B 5KYKA 2FDCA 4IDPA 2OBMA 3S1AB 4M1MA 4DB2A 3CCQB 4W5WA 1W36D 2R44A 1AZTA 2A5DA 4M4SA 2H16A 2IWHA 4YAUA 1XXHE 5DN6A 2F6RA 3TJZA 1XZQA 1R6BX 3BH6A 1YZLA 1Q12A 3EWAA 3SHWA 1OJLA 2WWFA 1X8KA 2N42A 3TMKA 1KI1A 2FGKA 4B75A 2XJ4A 4GP7A 1CRQA 2AFIE 3CLVA 1NP6A 3KTAA 3K9HA 2CHGA 1J90A 2BV3A 3UMFA 4WW0A 3FPAA 2EFDB 2N46A 2QENA 2LKDA 4WXRA 3VTKA 1KDRA 4OK3A 4JL6A 3VU9B 4FI3C 4U5XA 2X19A 3Q9LA 3HU2A 4ZKDA 4LY6A 3U2QA 2G0NA 2CLDX 2R6GA 2DERA 3B2EA 4B2LA 2BN4A 1N3BA 2C77A 2JLWA 1P2SA 1B2RA 3KL4A 4OQFA 2JJ2A 3AM1A 1XMVA 1D2EA 3CRW1 5KSZA 3GLIE 3QE2A 3NDPA 1I4TD 1SXJA 1XMJA 4FMCB 1D9XA 1XX6A 2NIPA 3E70C 1FMLA 4CRWB 3K70D 3N2EA 3O8BA 2NZ8A 1U8ZA 3K0CA 4A9AA 1UKEA 2P3SA 1Z2CA 4HI0E 2HF9A 2CLSA 4OHVA 3PV0A 4GDFA 2F9MA 3K0AA 1NG1A 5E4FA 1W4RA 2J7KA 1OXSC 3W2HA 1KZGB 1ETUA 2UKDA 1EESA 4KBFA 2XTMA 4Q66C 3KQHA 2IYUA 1OPXA 3R8FA 1DADA 2XNDA 4F4CA 1F48A 3QJYA 2QZ4A 1A8PA 2B21A 3BH0A 4PR0A 5CYOA 1XCGB 2QORA 4A0RA 4ERNA 2JIZD 1SZPA 3B1ZA 5FTNA 1Z2AA 3GLGE 3Q3JB 3W3AA 5J5CA 3EW9A 1W0JA 4D4LA 1ZNXA 1HY3A 2ERXA 5BN5A 1T8UA 2C8VA 2ZRCA 4ZV4A 3CH5A 1YZGA 3JZAA 2WV9A 1W2HA 2ZR7A 1VIYA 2B8TA 4JKYA 2RGAA 1IHUA 1Z6XA 3BBPA 5JWHA 2O8DA 1SVMA 3FHCB 5AJVB 3W5VA 5JI3E 1V43A 1RRPA 2ZRJA 3CF6R 1KRHA 1CS4C 1E9FA 2FSIA 3LX5A 4JJZA 4A92A 4F38A 3OEHD 4GOKA 4UXIA 1MRSA 1RJ9A 2YWEA 2WWXA 4LJ6A 1E2FA 4LC1A 3MMPA 3RRZA 3WYFA 3BB1A 4PPGA 3REGA 1ZP6A 3DEFA 3QFRA 4Q4HA 4UAJA 3HU3A 4KCGA 1KO5A 2F43A 3CPHA 1A2KC 3I8XA 1X1RA 2DWOA 3TUIC 4M1OA 4M1KA 4HE6A 2AD1A 2IEZA 1BKDR 1QVGB 2C9CA 4EFLA 3NH6A 1OF1A 3E5HA 1D2NA 5FI0B 2ZTSA 3ICQB 1B0UA 1QHXA 2O8BB 1A5TA 4YXWA 4X8HA 2IXGA 1KI2A 1HYQA 4AK9A 1JJ2B 1GTVA 1FNCA 2Q6TA 3ADCA 3GPLA 4DLSA 3THXB 5EE9A 4KSCA 5B30A 2GCPA 3ADDA 1W34A 4OHXA 4B6FA 4DBLC 4A36A 2W0MA 1W4CA 3CRZA 3HYTA 3RWOA 1E64A 1JPJA 3DMNA 4RD6A 4I1UA 2XB4A 2JLYA 2G1JA 2FFAA 2OT3B 1CTQA 4HAXA 3EASA 3I5YA 3WXMA 1KMHA 1G7SA 1T5IA 2JGNA 4XD7A 1IXZA 2EU8A 2R65A 3OIYA 1Q1EA 2ZREA 3QPWA 4EQ6A 4KLZA 4Q5IA 1JJVA 3PENA 5A5GA 3F0TA 1KKMA 3RNLA 4PPNA 1KSFX 3J81k 5IK2A 2FEMA 4JKIA 3HU1A 3QBTA 3JVUA 1G3IA 1KI7A 3HDTA 1TQ2A 4Z8XA 1OHHA 1NVUQ 1W35A 2NG1A 2VRWA 4CEHA 1ZM7A 4MRNA 3V76A 4BLPA 1RFLA 1XB2A 1J99A 3SI7A 2Q0HA 3OJXA 2QL6A 3EG5A 1ZAKA 4LJ4A 1PLLA 5GJVC 3RSOA 1RC8A 3CX8A 4G3XA 1RYFA 2ZRAA 4Q18A 2A5YB 3U3KA 1EP3B 3D3QA 4LC0A 2Q3FA 3BB3A 4OQNA 3SBDA 2ZR0A 5L3QB 1XFAA 2IF2A 2W0SA 4C0JA 1Z0KA 5DSZA 2GESA 1GRQA 4I99A 1J2JA 1NI3A 3RC3A 4POAA 4TLBA 4CEJB 3ZS9A 1GKIA 2Q9BA 3FVQA 3KDSE 1X86B 3LBIA 5GV7A 2JLVA 5K8IA 1M1YE 4QGFA 3OZWA 1AGRA 2RGNA 5IDVA 1XCMA 4KU4A 4TYYA 1NJFA 4F7DA 1FDRA 2QTVB 3LAWA 2QSZA 4UNPA 5G3YA 1VTKA 5F98A 4URZR 4DHEA 2GDJA 4TQUS 3DM9B 4D0LB 4D4JA 5DIFA 1F5NA 1HT1E 4NU0A 1VHTA 1KD1D 1VQ6B 3RABA 2ZI6A 3SS8A 1DOAA 1IN7A 2VBCA 3OAAA 5FFMA 2ZS8A 2I3BA 1F3OA 1QGYA 2R9VA 2GEDA 1KI9A 5AJXA 2R6CA 3I1FA 4Y0AA 3GLHE 2FSFA 5TR9A 3QF7A 2JIZA 2QPTA 2ZAOA 2WJYA 2J1LA 3KZ1E 4TLCA 3B6EA 1JQJC 2RMKA 2WMNB 4RZ2A 4DRZA 3X2SA 3GLFB 2F3RA 3L0SA 5DHFA 2C78A 3L82B 1ZUIA 1NN5A 4OJQA 4QC2A 4RD1A 1OH8A 1W36B 4Q19A 3UATA 4DCVA 1S3SA 2EQBA 5E3HA 2BMFA 1JNYA 3TR5A 2ZE6A 4HEJA 1U94A 3PIRA 5CYPA 121PA 1ESNA 3CNOA 3C41J 1XTJA 3LRPA 4ZGNB 2LCFA 1W48A 3HP1A 5SZKB 4L5BA 4BFYA 1LF5A 1P61B 4RFVA 4DUGA 1ZNWA 5IF9A 1P62B 4CIDA 1ZD9A 3B5JA 3LXXA 4QBGB 1CR1A 1E0KA 5DHAA 4IEIA 4GL2A 4Q02A 2O8FA 1W36C 4M9QA 3ECCA 4QRHA 2CDNA 2YINC 1U99A 1FX0B 4M2LA 1YRAA 4DLZA 4OQLA 4KV9A 1U81A 2ZRLA 3CKLA 3D6TB 4EPTA 1KY2A 5EP1A 4MGKR 4Q9KA 4HAVA 2LWIA 2BWJA 1NLZA 3AH8A 4JSTA 4R2IA 5FR2A 3A37A 4K46A 1ELOA 3PXGA 2Q9CA 2ZI4A 1XJQA 4BWYA 1BYUA 1PJRA 2DR3A 1QVFB 3K70B 1RRFA 3QKSB 1HTWA 4Q7KA 4W5JA 4Q1DA 2FPMA 3Q85A 4XIGS 2OBLA 1I2MA 3OHMA 2KWIA 1EX7A 4HSEA 4D80A 3V4FA 1NF3A 3LY5A 2C9OA 3G5UA 1AKYA 1XPRA 1U9IC 1N5KA 1N8RD 1Z28A 1D8TA 4Z1MD 1W0KD 4NE2A 2VL7A 1FUKA 3H0KA 1Q86D 1ZIPA 2BVNA 4S2EA 4YONB 1IY2A 4QGAA 4UNSA 4JLDA 4PFSA 1DAIA 5AJWA 1P2TA 3SYNA 2OZEA 5EXTA 2V1UA 1ZVQA 3AKEA 1FRNA 2DWQA 3P4XA 3MRSA 2NO7A 3K70C 1HUQA 5HR5A 1EGAA 4HLDA 4NYMR 2VF8A 4XVUA 2ZRDA 1N6NA 1UBCA 1ZU5A 1X3SA 1E3MA 1DS6A 1LVGA 4Q7JB 1XD8A 2GXUA 3AEZA 2NPFA 1F2UB 4HATA 4BPBA 4PO9A 1NY6A 4LPKA 4HLQB 3CRVA 1YIJB 2DFKB 4HLUA 4LJ8A 1Z22A 3QQ5A 3ZZUA 3K53A 5EP3A 4FCTA 1SQ5A 2ZJ2A 1OIWA 2AN9A 1QHIA 2B7CA 1CJUC 1ZNYA 2QA5A 2WSSA 2ZRKA 4IDQA 3SJCA 3HR7A 4LRWA 4H1VA 2AK3A 4PC7A 3CCLB 1KTVA 2FH5B 2ZJBA 4BEJA 1GAWA 1T9HA 2WWYA 1ZUHA 3TQCA 3ND8A 4JLKA 5BN3A 1N0VC 2YZ2A 4A2QA 4WZ6A 3MUFA 1HV8A 2O0JA 3THWB 4IOMA 2ZM5A 2GVDC 1COWD 1P60A 4O3MA 3A8TA 1TEXA 4V0KA 5FBQB 4D25A 4A0FA 1NNEA 2ZI9A 3QE0A 3QY0A 4IOKA 1IM2A 4ZKEA 4C0LA 2GAOA 1V5WA 3OFND 4YLGA 4KJZA 2YOHA 2WICA 3M0EA 3G82C 1NJGA 4NCHA 5BN4A 3IIMA 1BIFA 3A1VA 3IIKA 1OIVA 4NYIQ 1VECA 3BFXA 3RHFA 3WHKA 5EQTA 2PIAA 5FL7D 3SJAA 4EPRA 2XEXA 1ZD1A 4TTQA 1E2KA 1KK0A 2OO7A 3VX3A 3E1SA 5F9FA 4P4SB 3FKSD 3MCAA 2VNKA 1AN0A 5CJ2A 1M6NA 5CM9C 3WMGA 3WY9A 2H8KA 5DE3A 5B2ZA 3SN6A 2F9LA 3CCVB 1G16A 2H5EA 3FMIA 3QPUA 3TBKA 3ZVLA 1ZU4A 1U0LA 3LV8A 4ARZB 3TRFA 3KX2A 4QOSA 1G7CA 5KDLA 3QVUA 3R9IA 4P33A 5AR1A 1R5OA 1JR3A 2JDID 3KFXA 3GJ6A 1WP9A 2QDXA 2QEQA 2RGGA 2IS4A 1G7TA 4TYQA 2QT1A 1UF9A 4II7A 1UBEA 4JVSB 1XD2B 1VDZA 4DIEA 2XTNA 4OI0A 1ZC3A 2Z43A 2AXPA 3K0EA 2PMDA 4MGYR 5HE9A 1E2QA 1U8AA 1NJID 2ZE5A 1FUUA 1C4OA 4IJMA 1AQUA 1G41A 1G8FA 1M7BA 1Q22A 4HUQA 3GEEA 1US8B 6Q21A 4GP6A 4KHZA 4A8JC 2R62A 4IRUB 2J7PA 4MYUA 4Q4JA 3LO8A 2ZPTX 3GLHB 3QUSA 1TVCA 4HUTA 1PLJA 1VCNA 3SDZA 3WMEA 4MUAA 2OFXA 4O2LA 1KI6B 2W6JD 3DL0A 3W6OA 1AS2A 4IVRA 2WJIA 5KHOC 3OW2B 2V7QD 1E79D 2Z5FA 4JIMA 4OYHA 4TL8A 4AF6A 1G6HA 1W5TA 1N0WA 1YRBA 3ASYA 2J0QA 3EARA 3UANA 1XPUA 2FU5C 3WBJA 2EW1A 2BF4A 2ODWA 4K8OA 4EJSB 1F20A 5FBLB 4ZDIA 4FMBB 3NKVA 3QXJA 3FTQA 3FJOA 4Q7LA 1C1YA 2CJWB 4AKIA 2ZI7A 1GP2A 2FFBA 3AV0B 3FFBA 4BFXA 3T61A 4US2R 4HLCA 2V6IA 3RRNA 1ZCAA 4EAQA 1UDXA 2V55B 1EX6A 1ZW6A 4C7OB 1ODFA 3PUVA 4HAWA 3D8BA 3TW8B 3LDAA 4OKSA 4LYFA 5LPNA 1NVWQ 3H86A 3QF4A 2CVHA 1JB9A 1QBKC 3WP1B 4U00A 1YHQB 3DOFA 2IUTA 5AJZA 2GA8A 5BWMA 3U44A 4EJSC 5F9HA 2WJVA 5JMTA 1OH6A 1YKSA 4QG7A 1Q0UA 4M1SA 1R0ZA 5KPDA 2YOFA 1KYIA 2IYTA 4FMDF 5J4VA 1JQLB 1P4SA 1P9NA 5H70A 3A58B 4MKHA 1M90D 1SVIA 4DLRA 3ZDQA 4QGHA 4C2TA 1J70A 5KUTA 1Z0FA 2O52A 4ABYA 2GCOA 2J5XA 3K9NA 2OHFA 1TLLA 3QG1A 3ZD6A 2R6AA 3U7GA 2FX3A 4MRPA 2PJZA 2P67A 1ZM9A 2GBLC 1XEXB 1W4AA 3FWYA 4WZBE 2WWIA 5TVKA 4CW7A 1KDPA 4D4MA 1T0HB 2VPPA 1E99A 1DO2A 5CK4A 4F93B 2NO9A 3Q7PA 1MO3A 2ANCA 3LA6A 4EUNA 1KI8A 1F2TA 1YR9A 2ZRMA 2IW3A 1WRBA 1N0UA 1NVVQ 2F1JA 2IC5A 5L3SB 2R6FA 1FTNA 1GKUB 1SULA 1XF9A 4IHQA 2XITA 2B92A 4LWZA 2BSAA 4PTLA 3NTUA 4RZ3A 4B35A 4BRWA 2V1XA 4DJTA 1GVHA 1ZM4A 1GNPA 1SKYE 2J46A 1KMQA 3CC4B 3JQQA 2QPAA 4BZPA 4URXR 3O8CA 4FWTA 2QP3A 1Z3IX 1VQLB 2MMGA 1LTQA 2C99A 2ZJ8A 3MLEA 4XSHA 3RS7A 1TMKA 3JQRA 5FUYA 3EPHA 5DYIA 4QNMA 4L9WA 1GSIA 2VH5R 1GL7A 1Z06A 5EUMA 1OW3B 4QFMA 4N0EA 2I1VB 2QGZA 2VIIA 4AYWA 4CYMA 4TMZA 4Y0VA 1XWIA 1G18A 1P6XA 4R71A 4YMWA 3TNFA 4A1FA 2B8WA 2OFWA 5J40A 5KDDA 1R0WA 4MGIR 4NTZA 4IFBA 1HQCA 4URWR 4AI6A 3LVBA 4LUCA 2HF8A 3S1AA 1KO7A 4BGDA 4QM6A 3A1SA 3U7FB 4JLAA 3PEVA 3DPUA 4GT1A 4Q4LA 4TTPA 1G5TA 4CF7A 4AF7A 5ELXA 4Q1AA 1R10A 4O2RA 3QIAA 5CB8A 2DCUA 4WVFA 4LHXA 1ZYUA 2FG5A 4GSYA 3KUDA 1BMFA 2HEIA 2RGXA 4Q1FA 4X8MA 4IVPA 3KQNA 4F4JA 2FEOA 3GJ5A 2CRVA 4PGOA 1P9WA 4IDOA 3HJNA 2BEKA 3CNNA 4AKHA 5GVRA 2D62A 3K0FB 1M1KD 2NPIA 1UADA 4DDWA 4JJKA 5EZ6B 4KFRA 3GQBA 1IY0A 4B76A 4A2WA 4DLXA 1I7PA 3B1XA 1LB1B 3VU9A 2BBWA 1E2GA 2HXSA 3WHLA 3W8RA 1EK0A 4TN1A 4RD2A 1W2BB 5CJPA 2PT5A 2J3EA 1XCPA 5FPHA 1U8YA 5TB5A 2C03A 3LW8A 1CJTC 3BC1A 1S9DA 2OCBA 5HCIA 1NRJB 4A4DA 4EIWA 3I32A 3OEEA 4U02A 4XOIA 3KXLA 2WPDA 4JL8A 1E1RD 1SXJE 3NC1C 4B4DA 4KBGA 4V03A 3SU8A 3IPYA 3WRXC 5AUNB 2W6ID 4CT5A 4BASA 3BJIC 3W2EA 1CULC 3MD0A 1VQ5B 4G5RA 3W90A 5KO2A 1GM5A 3B78A 1AMOA 1QZXA 3N2IA 1FW6A 3B82A 2DHRA 4WAUA 4ITRC 4MUBA 4JLPA 4BLSA 5FH9A 5DO9A 2GPJA 3I55B 5C4GB 3GJ3A 2ANBA 1KNQA 2YWGA 4KVAA 4KFTA 5FPYA 4XWOA 4QBFA 2HT1A 4B2IA 3I8SA 1P75A 3CIOA 2IYRA 1Q81D 5CM8B 5EXSA 1Y63A 3WNBA 4QHSA 4NYJR 1WXQA 2FSGA 2WHXA 3CO5A 2VHTA 2CCJA 2ZI3A 1OFHA 3C8UA 4Q21A 5THXA 4LJ7A 4B2PA 3B8HA 1N5JA 2NZJA 4HB4A 2NO0A 4D0GA 4ZCIA 2WJHA 4H1UA 4R98A 1VIAA 2KJQA 5C46F 1AIPA 3E20A 1BOFA 2VP5A 1EFUA 1Z0AA 1G1MA 4W7SA 3SFVA 3ADKA 1K9MD 1LS1A 5G53C 2QQ0A 4D4KA 521PA 4NCKA 3B1WA 2FPKA 1WBDA 1VYTA 2LKCA 2QEXB 3T35A 2VYFA 4M0LA 3L8ZA 3QVVA 4US0R 3MGCA 3K8YA 3LLMA 1TU4A 5E7JA 1Z63A 2O8BA 4TYPA 2EFHB 3LVQE 3BORA 1FL9A 2RCNA 3PEUA 5C2JB 1QG0A 1KSHA 5CIWA 1IAQA 2PZGA 2QY9A 4LBYA 1TL7C 3WRYC 2REBA 1E9BA 4RZXA 4E03A 2WVJA 4DB4A 4DEYA 4KFUA 3WNCA 1KO8A 3U3OA 3ZLJA 1UAAA 5J4YA 3ZZ0A 1FQJA 4E07A 3CONA 1BH2A 1UPTA 3ZYCA 4TMWA 1N6IA 3SJZA 2PX3A 4FINA 1IONA 3M4YA 1RRCA 2QE7D 2BKEA 4YALA 2VEDA 1CP2A 1VKJA 1Y3AA 3T06B 5BW8A 4FWIB 2ECKA 3ZIAA 2E87A 2BBSA 4F92B 4EPVA 3WP0A 1IN6A 3GD7A 4PHGA 3RC8A 4PPFA 2ZJAA 5EUQB 2RC5A 1KI3A 4BFSA 5FUXA 1CQXA 1KJWA 3GJ4A 1A4RA 1ONBA 1NBMA 3F3YA 5E95A 1XP8A 1UKVY 2AX4A 1BX1A 1X6VA 3CCSB 2GVZC 2ZU0C 4JMPA 4JYCA 4C2UA 3QSYA 4OHWA 4MITA 1A2BA 1M7HA 5JEEA 1IB0A 1KI4A 4DUGD 4G5QA 1BJKA 2OBNA 4V02A 5CDFA 4ZDJA 3U6KA 4LV8B 1E9DA 3PITA 5GJWC 2HLDA 2X2FA 3MWKA 3GFOA 1W7AA 5EP2A 1L7VC 3MJRA 3WYGA 3VMFA 1S1MA 1XD9A 4KI0A 2X77A 4HAZA 3WYAA 4YMVA 2XNCA 1Q82D 1CJKC 4PZZA 3UMSA 2EYQA 2FN4A 1IXSB 2ODBA 2VNJA 2CEAA 1S1CA 2OFOA 4XJXA 2BIFA 2DBYA 4B34A 4EDHA 3VKGA 3PR1A 5L3QA 3P32A 4A6XA 1ZMXA 2G9NA 4NYMQ 2HCBA 3B13B 1CXZA 3MWYW 3X1DA 1VQKB 1Q44A 1XZPA 2QSYA 4DC9A 5FL3A 3AF4A 4CEJA 1EG7A 1Q57A 3B9QA 1N6OA 2CK3A 2IF0A 4Q9JA 4GOXA 2OK7A 3K09A 2AKYA 4Q1BA 1GAJA 3GEHA 3K9GA 1ZD8A 4FK8A 4M9ZA 3SOPA 3AF1A 5JRJA 5JSZB 2FE4A 1G8PA 3EPLA 3O8RA 1XTKA 1OFTA 1YZNA 3PG5A 5TARA 1KAGA 4MRSA 2CCGA 2GJ9A 1FPMA 4NP6A 2IYSA 3CZPA 2D7DA 2CXXA 2QTHA 1NY5A 1GNQA 1XPOA 3HYRA 4WBSA 3W8NA 2I1QA 4TLEA 2PLFA 5EMNA 3CMAB 1MKYA 3AUXA 3RDPA 3VQTA 4WZAE 1Z6AA 2H57A 3GLFA 1E2PA 4B3GA 4DDVA 4BZQA 5M04A 4G1BA 1R7RA 4MDFA 1IJEA 2A5GA 2QM8A 5DYGA 1S72B 4PC3A 2MSEB 5FUVA 3ZVRA 4DLWA 4DSTA 3TIFA 1HQYE 2DYKA 3VNUA 4PX9A 5DISB 2YC2C 1T8TA 3EWSA 3LQRA 1GDDA 2WMOB 3K1JA 1OLOA 2C95A 1Q7YD 4FCVA 1E2JA 4TT3D 1SXJB 1E2HA 3L2OB 4DCUA 4PZYA 3I72A 4P4TA 4RVCA 2FZLA 3H4MA 1NG9A 4AURA 1JAHA 4ZI2A 2XZOA 4RY2A 2QPOA 2F1RA 2RKOA 1H8ED 3NEJA 4KFSA 2J41A 3VFDA 1D9ZA 1FNNA 621PA 1D5CA 3I56B 2GJ8A 4IKEA 3Q7QA 5DNYB 1E0JA 3P4YA 1N6HA 3TSZA 4TZ0A 1CJVC 4D82A 3TUJC 5JZVA 4K1XA 1FX0A 1T5LA 3A36A 4LBZA 2Q21A 1WBBA 1Z08A 4BLRA 4LJAA 3I61A 2XXAB 2A2ZA 1R0XA 1U9IA 2A9KA 1ANKA 2GTPA 2WWHA 4MQBA 1HEIA 1SXJC 3AVWA 1G4AE 2BOVA 5D3MB 4DWJA 2OAP1 3K0CC 4GBMA 4P3YA 1AM4D 3ZJYA 3IHWA 1DAKA 2GXAA 4LV5B 2AD5A 2GK6A 2RH5A 1YZTA 4TLAA 4HZUA 3QKSA 4F4IA 2R2AA 1ZUNB 2OXRA 3QBVA 4PSAA 1VG9B 4HDOB 2W58A 5J47A 1OYWA 4XWAA 2REXB 1XXHB 3KQLA 3V9PA 1W46A 3CH4B 2XSZD 3RANA 5JBQA 1WMSA 3AP3A 4KYIB 5JJLA 4Q4HB 4LBVA 1R5NA 2XAUA 3B7GA 1KGDA 4L16A 4NHOA 4DSUA 1BO6A 2IXEA 2H7VA 1J7KA 3W5HA 3THYB 2ERYA 3VKWA 1YR8A 1PLKA 5LD2C 4G1VA 1M7GA 2G83A 4R7ZA 4U7DA 2GWHA 2V54A 2ONJA 3BGWA 2VP6A 4QKQA 8OHMA 3ZGXA 1TX4B 5KNCA 3JQPA 4WIAA 4DLYA 1W4BA 1KJZA 1DBSA 1S4QA 4UXHA 1JA1A 1O3YA 4B73A 4XTCS 5JWRA 4NCNA 4Q03A 5SZJA 1F2UA 3QXCA 1UJ2A 4Y7CA 1UDWA 5H5JA 3QFSA 1T91A 3AQ4A 3OEHA 1IBRA 2IWRA 2IBMA 3Q5DA 1ZM2A 4C43A 1BYIA 3AP2A 3I92A 2JJ1D 2D74A 5AJYA 2VZLA 4V0NA 1G3RA 4OK6A 3RS4A 3VHXA 4Q1CA 3IQXA 1NDHA 4ASUD 3B1VA 4C0AC 3GLIB 1QX4A 2WWWA 5CK5A 5HZKA 1XBTA 4CZ2A 2ZVPX 3NIBA 2ZANA 1TF2A 4ZI3A 2CHVA 5KU1A 3W2GA 3CCUB 3T5GA 2ZYTX 2AXNA 4PAQA 2O0HA 5FOXA 2YWFA 1QHGA 5C1BA 3NH9A 2IT1A 5KSOA 4YAFA 1YJ5A 2A5JA 2DWPA 4I1SA 3BFVA 1PUJA 1E96A 3AUYA 3PUYA 4F7WA 5GVSA 4JZKA 5GV8A 2BEJA 1QFJA 4JLBA 1DARA 3FDIA 4PC6A 3U4QB 3QKRB 3GLGB 1E32A 5JI2E 1MO6A 1CR4A 3EZ9A 2C96A 1S9HA 2C9YA 1AS0A 3B60A 3KKPA 3TLXA 1G3UA 1QFZA 1E4YA 4B32A 2A78A 2VO1A 4P4SA 1TTTA 1KAOA 5F2EA 1J9ZA 4C3ZA 4DKXA 1KSJA 2RAPA 3QEJA 1JECA 1G8GA 4HAUA 4BUJA 4BFUA 3I73A 5HXBA 2OUKA 1JR3E 3W9YA 4ARZA 1GJRA 3AKYA 3G4SB 4I1VA 2ZVQX 1XTIA 1IQPA 4LI0A 1OXVA 1MT0A 4DT1B 1GNRA 2PEZA 2PLRA 5FOUA 1IXRC 1PVOA 5F3WB 4DIDA 3ICEA 4NL4H 2H17A 1UEJA 1XD2A 3PFIA 5TXGA 3TR0A 2BM0A 1S0UA 4DQLA 3MWJA 4ZIRB 1K5DA 3Q5EA 1MH1A 1DPFA 4LHWA 5IRCD 2XX3A 2HCJB 4Y9UA 4TL7A 5DGXA 3A1TA 1UBFA 3A1UA 2OCYC 3CRRA 1I2DA 1US8A 2NO6A 1Z07A 3CD6B 4RKEA 1KC8D 4NONA 2B5OA 4OI2A 4Q00A 3FPKA 2ZS7A 5DI3B 1H42A 1E4VA 1YU9A 2BMWA 3CWQA 4Z8YA 4ILEA 4HB3A 4QGGA 2VSFA 4ZO4A 3NBYC 1RZ3A 1G64A 1G4UR 3TAHA 4TLDA 1DAEA 1E0AA 2XTZA 1G19A 3R7WA 2E1RA 1JA0A 1XEFA 2KBFA 4B3BA 3UK6A 1A1VA 4FCWA 1QHHB 4EJSA 1OYYA 3LBHA 4R9UC 4R2HA 1OXUA 2QAJA 1MO4A 4B3CA 4UJ5A 4YMUA 4BQSA 1DDGA 3BERA 3SEAA 4AYTA 1QG4A 5FOWA 2Q9AA 4WA7A 4N0DA 4AD8A 5EE0A 5FOSA 2EWWA 4C7OA 2GHIA 1T3HA 3EA5A 4Y9RA 4UKDA 1L4YA 3LQQA 3TQFA 3OF5A 2B7BA 3RAPR 4B33A 3H1TA 1I4LD 1IN4A 4FN5A 5FR1A 2HJGA 2ZRGA 3MWLA 2F7SA 3LO5A 4MKIA 3CX7A 1QVRA 3TK1A 1U0HC 2ORVA 3N5CA 4BLOA 1VG8A 4RFSB 2DETA 1OKKD 4FW9A 1CNFA 4E22A 1AZSC 3KQKA 1QGAA 2V4ZA 1GVNB 5AUQA 4A8JB 1TF5A 3FGNA 1YJ9B 4ASUA 5C18A 1P7CA 2RHMA 2FA9A 3M6AA 2CNWD 5KSWB 3SHFA 2ORIA 1XEXA 3HPRA 3PQCA 4M1TA 1EFHA 4LDJA 4NYJQ 3RLFA 4LOAA 1NMXA 3VR3A 5BQ5A 3C7KA 3OE7D 3REFA 2REOA 4TSFD 3T1QA 3LWNA 3G0HA 3BFKA 4BFTA 1NLFA 1YQTA 1TNDA 5H8WA 1CU1A 1Z6GA 4LHYA 2GK7A 2ZJYA 4B3FX 4BE7B 2H1LA 4PXAA 2XZLA 1E94E 3ZS8A 4S35A 2H92A 3VO1A 4BFWA 2J9RA 3IEVA 4YMTA 3IKJA 4OL0A 1VQNB 2ZETA 2CE2X 4NZYA 3CCMB 3L43A 1FRQA 5DH9A 1GZSA 2OILA 2QMUA 5FPKA 1FNDA 1T6NA 1ZNZA 4LJ5A 4NPHA 4PZLA 5G40A 3QNUA 2ZRHA 1EXMA 2WKQA 721PA 1P5ZB 1OGJA 2EFGA 5JCZA 1H85A 1N6KA 4Z1MA 1W0KA 2QAGB 1QVAA 2EVWX 2VYQA 1FNMA 2FGJA 2A3RA 1O87A 2OLJA 2QP4A 2ZIAA 4FIDA 2J45A 2R8RA 3C15C 2WAYA 4UNRA 1RRGA 1GR1A 2FF7A 3AGQA 3VX4A 2WWGA 2TMKA 4ACBA 4LZZA 4YHBA 3KXIA 2HV8A 4A0GA 2FFQA 5J4HA 4TQ9A 1CLUA 3OESA 3T1OA 2XZPA 2VNHA 1VQ9B 1FZQA 3EZ6A 2A7QA 1DAFA 4JBYA 3SE0A 1Z47A 2QAGC 3FMFA 2ODEA 3K0FA 5C4MA 3IUYA 2CHQA 1Q3HA 4C0QC 1GKYA 2RGDA 5JHHB 1NSFA 3BWDD 3CM0A 3W6PA 3U3JA 1ZIOA 4TTRA 1G5PA 2IXFA 3U5ZB 1H8HD 2O8EA 1OT3A 4W5HA 5BXQC 2ZS9A 1PUIA 3RSLA 5SZHB 1Q1ZA 4AG6A 1E1QD 3EZ7A 2MSDB 4B3DA 2VSXA 4PC2A 1NKTA 4C0BA 3MJHA 4RZUA 4DSOA 4LHVA 1Z5ZA 1Z8FA 4P4UA 1COWA 2FZ4A 2Q3HA 3WBKA 4IDNA 2R6HA 1CR2A 2XB2A 3GFPA 4B6EA 4JL5A 3AB3A 1QG2A 3VR2A 4ZCLA 1A7JA 2ASEA 5JEDA 2PBRA 3NBXX 2Z6VA 2PCLA 4BPRA 4QL3A 4TZ6A 1NIJA 3OFNA 5EXPA 1MOZA 2ODNA 2WOJA 1EFRD 1XMIA 5UKDA 1R5BA 4KITB 2NMVA 4B43A 1DELA 2C04A 2GILA 2YC4C 3U60B 2PJRA 5E7IA 5FL7A 1WCV1 4KSBA 2G1KA 3NWJA 1YZUA 1NL3A 2ORWA 4J0QA 4D2IA 3T34A 2KSQA 5FBVB 3FKSA 2W83A 2Z83A 1M34E 5LDDC 1C9KA 1KY3A 2Z4RA 1SM4A 3R8CA 5KNDA 5JJIA 1K6MA 1OFIA 3VR4A 1YJNB 3FMPB 3AF2A 1II8A 1F60A 1L2TA 2DFLA 4KYUA 2FOLA 3AVVA 2NOAA 2P0EA 3L8YA 3PUZA 4X8OA 2G88A 3GP8A 3BE4A 5K8UA 2YHSA 1VQ7B 3B9PA 4JSYA 3CC2B 5L8VA 3KQUA 3QKUA 2Y8EA 2JDIA 1FP7A 5L3VA 2AFHE 2I4IA 2BGJA 2ZAMA 3IBGA 2OCAA 3L0OA 1YITB 2JJ2D 4GZMA 2CVFA 2OE2A 4AG5A 3SC3A 4OBEA 1EFTA 1W1WA 1JJ7A 2EYUA 1SXJD 2XNSA 2O5VA 3NHAA 4M9XA 3UWOA 3KKMA 3OJWA 5CITA 2JAQA 3CF2A 2RHDA 1VCIA 1YZQA 1G9XA 2V8OA 1VQOB 3AVQA 3QENA 2YNMA 1R4AA 4TMKA 2W00A 5FTMA 3BS4A 4NMMA 3PVSA 2GJSA 2VP2A 2IYXA 2QRNA 2HYIC 4AY2A 2VTKA 1E2EA 1AQYA 2ZRIA 2O8CB 4DDUA 4XTRA 3RS2A 1JBKA 4Z54A 5A4JA 3W5IA 5HKKD 3R9XA 1HE1C 2NGRA 3P1JA 2HJVA 3TH5A 1E9SA 1T0JB 3U44B 3H2YA 1KK2A 2W6JA 4CT4B 2VSOA 2PH1A 4I1OA 1AKEA 3RS0A 1Z0DA 2IYVA 3CCJB 1E79A 2V7QA 4LCBA 3I62A 4JT4A 4ZGQB 2DPXA 4CEIB 2BJVA 1W0JD 2G0TA 3NXSA 3EPJA 4JT2A 2ZSBA 1MABB
chains in the Genus database with same CATH superfamily
2QNRA 2J32A 2X0DA 2WINI 2Y9MB 3DONA 1UBLS 3AEUB 3PQ7A 2R1TB 4UUBA 5J3JA 3ONWA 2J59A 1Q0TA 4WADA 4GWKA 1F0NA 4B47A 2BEWB 2RAUA 4IEEA 1E3XA 2BFEB 1GUZA 1PNRA 3H94A 2OXCA 2NP7A 1B6RA 2RGEA 3F5MA 3ZH9B 4KXMA 1W47A 1YZYA 1DOHA 2QL9A 1PTKA 1RYEA 1EXWA 3RS3A 4BBAA 1ZVVA 1SIOA 4X7CA 3IO3A 1DAGA 4ZVKA 4ZANA 1Y6RA 1QAQA 1OIXA 1OE0A 5CDFE 3MYYA 1NV9A 4M86A 1KYYA 2NT4A 3FKQA 1ZMBA 2FZEA 3FNIA 3WX0A 1KZ9A 4F85A 2J09A 4C7OA 1FF9A 2B83A 3VR4H 2QTWB 3MIIA 4ICIA 2QT0A 1KNXA 4CVNA 3NDRA 1P0PA 3RRXA 4XLFA 3VKHA 5M2QA 1E58A 2GN8A 2X1MA 1MEEA 2V96A 4LFCB 1NUQA 1R3DA 1YU6A 3C5HA 3R20A 3SZRA 1MG5A 2VHEA 1SA0B 3WKAA 3TZHA 1MLDA 2WIAA 1M2WA 3O1HB 1EWYA 4GU5A 4H15A 1I9CA 3PJFA 4IHJF 3H9QA 4ZQIA 3JS5A 1MO5A 3FCCA 4ISCA 5MN6A 5IAEA 1KYXA 4JVNA 1ZVKA 4XLLA 5F7JA 1N6PA 4BE4A 2ET6A 4AF8A 2FFHA 3RANA 3UMGA 1K75A 2WT9A 1LDNA 2EZ9A 2ZT8A 3QWAA 4O63O 1A9QA 1C7FA 4RW0A 4UVIA 5ALZA 2XUFA 5TE9A 4BP3A 2GZDA 3SJPA 4XEUA 1SZJG 3ZZNA 4BMSA 2KQUA 3BXGA 3PFWO 2IXAA 1T1GA 4M9UA 1E9AA 3SGLA 4GR9A 1RDFA 4YQZA 1IATA 1EFRA 3GH1A 3UPUA 1ZHHA 1GADO 3KTDA 1UMKA 3OOYA 1TAQA 3QLJA 5IK2D 2VRBA 5BYKA 1KP9A 1NUPA 4NY1A 3RB8A 4Z2YA 5JFGA 1X1BA 5E4YA 1W30A 1NAIA 1YVDA 4IG4A 5DT2A 5ALNA 3KKQA 3SDSA 3OU6A 1I1QB 2Y0BA 2ZQ5A 4FP9A 4J90A 2OZLA 3GLFE 1DG1G 4DM3A 2G5PA 2DXIA 2PUDA 4II2A 1L7MA 2DJIA 3L8FA 1FYXA 1T13A 1BC5A 4UMVA 3L1KA 4LHEA 3KKKA 2FJUA 5J2UA 1EIWA 4OI4A 4O2AB 5F78A 2X8AA 1KYWA 2HGSA 3BD9A 2NZXA 4M9CA 2Q3JA 5CXQA 4JDUA 2B20A 1W44A 3OTWA 4XRGA 3EZFA 3ZIUA 1T0BA 4B7CA 1R6AA 1BJTA 2ZRNA 3PNLA 1G21A 1TMOA 2Q4RA 2J0UB 3QJ5A 2OYRA 4BZXA 5A5EA 2HPAA 1EH5A 3HB0A 3G5AA 4YASA 4KQIA 4NBTA 2G77B 1NN0A 3GCWA 3IUNA 4OP7A 1QHSA 2C3MA 2NSHA 3Q9SA 4GLOA 4QNRA 5HDBB 3VI3B 4DLNA 2VHJA 4ED9A 5FBWB 1ESMA 3U1VA 1QUFA 2W2MA 1NYLA 3MBOA 1ZBQA 4RTLA 1TW3A 2HA3A 1V2GA 1DQYA 4W9MC 3EPRA 3K8ZA 5CT5A 2XMBA 3KR0A 4RK1A 4Y0NA 2C88A 3KD3A 3FOEC 4NZOA 5IZCC 4BZWA 3HWSA 2MCFA 4RX1A 2WKRA 4X71A 1JV2B 4GPTA 2A9VA 3GLVA 3CCRB 3F71A 1NMQA 1RE0A 1ZI9A 1HG0A 2KB0A 2NTYC 2ZUWA 3JRWA 3PYMA 4DNXA 5DNCA 4PQYA 1XCJA 1B43A 2QQGA 4LKRA 4MV0A 4EAAA 1OH7A 2Y2UA 4JLMA 3ONYA 3WGUA 1UBUS 2QX8A 4QDKA 4IIYA 1NVMB 1JXMA 1Z4LA 2QX7A 3D8HA 2EQ5A 3BCRA 3UW3A 4UE3S 2VDMB 1IAVA 1T1RA 3FI9A 4UBLA 3UUFA 1JW9B 1RW4A 4ZAZA 2CXTA 3KT3A 1ZHOA 1XXHA 3VV2A 2VA8A 3CLSD 3FWNA 2BJHA 2XQGA 1BS1A 5B55A 3ESQA 4BP8A 2DUWA 1MH9A 5L3RA 3VR1A 3U3RA 5KW9A 3KTAB 1Q1NA 4PYJA 3N6XA 4RORA 3HM2A 4EI9A 4IX1A 4B85A 2ZBGA 1UPCA 3PA1A 4OXYA 1Z74A 4PSDA 5EZ5A 6GPBA 1VCOA 3CJTA 3ZKWB 4I50B 1GO2A 4GI7A 3E9MA 3O2JA 4ESHA 1HZEA 5E4JA 3OFKA 1DBPA 2WQ6A 2XGSA 3PRJA 1OY1A 4II3A 5I5EA 2HPVA 2YXLA 3JVEA 4YIKA 4INAA 3ZWKA 3QRWA 2ZI5A 4DZRA 4MVJI 2F17A 1V7QA 4KG7A 1IDN1 3TEFA 3C5EA 4BNLA 4CGZA 3S0JA 1WKCA 4FZRA 1KO1A 2L18A 3B12A 3KEMA 3PTZA 1WZEA 3JQ6A 5LWQA 1RZRA 4TUYF 3LKDA 1N6LA 1YKFA 5H83A 1JKIA 5ARBA 1RNLA 1I4DD 1CV2A 1WMAA 5ALHA 3UM9A 3TTTA 3AERA 5LSAA 2OQIA 2XECA 4A8HA 2Q5EA 3V7WA 3EAQA 3EXFA 4A03A 4YQFA 3KEOA 4MB0A 4YMGA 2C2ZA 2XNHA 3EAFA 3K0AB 3TN7A 1NB0A 2YQ5A 3M6IA 4L2IA 4LRSB 1U04A 1H3NA 1K5GA 1RPZA 5BMVF 4FTWA 1TYEB 3IP5A 3PSHA 4RMIA 4BECA 3W2FA 2G9QA 4EO4A 1NFFA 2BSQA 4RPCA 4ZP1A 3DOCA 4G8CA 4R7TA 2AFVA 1FUYB 1N78A 2AQKA 3ICWA 5LR6A 4CMBA 1DKQA 4MQFA 1PX0A 2GZMA 2XNJA 1U65A 4TKVB 2F1IA 1KIFA 3K16A 2I6XA 1UINA 2E9SA 1PTJC 3QFCA 3RK0A 1WXDA 2FP4B 1LY1A 3UAOA 3U4QA 3QKRA 1X8LA 2PL1A 2ZRFA 1PL8A 3NG1A 1XEWY 2C2WA 3L8CA 5JHGB 5L95A 3WB0A 5LD2B 1DAMA 2WTNA 3ZXXA 2IL1A 4G0ZA 3P2OA 3HDGA 2XV1A 3KPWA 4HBGA 1X9IA 2B1JA 3P19A 2Z5GA 4JUIA 3C6MA 4EF4A 1VL8A 1V9LA 2RC6A 2GCEA 2YFHA 3EQ8A 4S12A 4ZPJA 2W43A 5LBUA 4IAOA 4HRXA 2YIJA 4HYYA 3OD5A 4WHMA 3OZUA 4BWGA 4DPMA 3PF9A 4HDSA 2A0KA 2FPIA 4JI4B 2CXRA 1D6JA 1I94B 1NVAA 3R9WA 4BIMA 3V7NA 1V0EA 4MPPA 3KXKA 4BMYA 1K7EB 3C14C 4KO8A 1BVUA 1NVDA 2QG6A 2OCIA 2YYSA 3LLUA 5ITZA 2JIRA 4XOUA 4EH1A 3L0IB 1NP3A 3FCSB 1WY5A 5HOEA 5IAOA 5JC8A 2LXNA 4N48A 1SG9A 2GCNA 3TW0A 2BI8A 3SVZA 4RESA 3GZNA 3BT7A 4HIZA 1XP5A 1JWBB 1TQDA 2CVOA 2D2EA 3A7EA 3ZJ5A 1Q84A 3A4NA 5I4IA 2XRFA 4CG3A 1ADCA 2GYVA 2IKSA 4U3JB 3PJRA 1ECJA 2YXPX 3DMHA 1CY0A 1GCIA 4UNNA 3TEMA 3VTZA 3QEBZ 1UBRS 3MFQA 2EX1A 2V0CA 2DLCX 1YOBA 3K0BA 1JTFA 2IZ1A 4RJTA 1C30B 4EELA 1GGKA 1GLGA 5BSYA 4FMDB 5LXTB 5EPEA 3NKFA 4DEXA 4RXUA 5KJCA 1NT4A 1NRKA 3QV1A 3WO0A 4BB5A 3MW8A 1WZ2A 5K09A 5ANRB 4K2HA 5JXWA 4QBIA 1WABA 2NUTA 3WDMA 1RYDA 1YC2A 2ZL7A 1YTLA 3K09C 4JIGA 3WLAA 4Q9DA 4FHCA 3I9V1 1ZH0A 1UT5A 1ZJWA 4TRNA 1IYZA 3FPPA 4LK2A 4F91B 3QVSA 1G8KA 3Q1LA 5ULLA 4EQ6B 1LFDB 4FD2A 5CVDA 4RMGA 1AHHA 2P1DA 2MMCA 3RC1A 3NXKA 1B7GO 4DR1B 4N03A 4JYBA 4HZIA 3KSZO 1XVUA 1XTQA 1H93A 5AOVA 1J42A 3QXXA 3EG9B 3CLTC 3MLAA 3CVUA 2R5WA 1OWOA 3U09A 1JR3D 1YBMA 5AKGA 2RHOA 3I12A 3O8NA 4ESOA 1YZ3A 2PZFA 2YJ4A 2DRIA 4ID9A 5FPQA 4AWBA 5EINA 5ICFA 4JOQA 4DVGA 3E6AA 3IE2A 4RJLA 3ND7A 4RTPA 4XYEA 4LF7B 3MD9A 3FM9A 4L22A 1T36B 5KYXA 5CH3A 5AW5A 1W9XA 3EF1A 3WWPA 1LTKA 3H5LA 2DP4E 3QFFA 3L92A 1YI1A 2WAAA 5L7TA 1U98A 4DCNA 1ZMTA 2J08A 2P6NA 2ZTHA 2DPGA 3CZQA 4Z0NA 3F9IA 3VOAA 2BMDA 1PQ4A 1U2RA 3ORHA 3WB2A 4OGFA 2QNIA 2V7EA 2FUG1 3GL9A 4B7ZA 2I4LA 4LVUA 5EE3A 1LPMA 3UOGA 1M2NA 3MC1A 2CNDA 4FFWA 1CF2O 4DMGA 2GJPA 4RFSA 5I01A 2GF0A 3OZDA 3M8KA 1ZEMA 4BO9A 4X62B 1JKXA 1FP4A 2GRUA 4XUEA 4A8JA 1S96A 2W6QA 3D0RA 3R8XA 5HSGA 2VDJA 4RJJA 3ZVKA 1GHTA 3DKPA 4C20A 4M0PA 3RRMA 1KQSB 4HVLA 1JXAA 4FNMA 1UL1X 1M3SA 1H8EA 2P65A 2PU7A 2SKDA 4IZ6A 1KJYA 3O3MB 3OQ1A 2Z6UA 3AR8A 2V7TA 10MHA 2ACWA 4KKVA 5K3AA 2YVUA 1UJMA 2ADOA 2FSUA 3AEXA 4P26A 1E2MA 3HPQA 1OA1A 3KAJA 4DABA 5G1OA 4EG1A 4OHPA 4RCZA 1VLVA 2I8AA 1RCUA 2OAQ1 5JOQA 1KOFA 1NNSA 4O0MA 2FG7C 1JKJA 1N57A 2QZJA 3EUFA 3W34A 4IIJA 2D06A 3U1TA 1HC7A 1Z17A 2H1OA 1SU8A 3N74A 3IPLA 3M6FA 1T24A 3GLHA 2NSLA 4PIMA 4GQAA 1U5AA 2WLTA 3A6GA 4U9UA 1GGVA 3IAEA 1NUSA 2BKAA 4JODA 5LUAA 1TM2A 5FA5A 5LM3A 3RUPA 2B4RO 3VZSA 4GE3A 2OV2A 3BCUA 3NHRA 1QHNA 2HU2A 4EY6A 1Z29A 4JCOA 4KACA 4M22A 5CDHA 2QQEA 1Y4UA 4CE6A 2WZQA 1K8AD 1SG6A 3HR8A 3P0JA 4WX2B 5A9TA 2QJWA 3HTXA 3IO5A 1K8RA 3HJFA 2GETA 1EAMA 2IYLD 4DEVA 3WTBA 3WIDA 2FSHA 4B79A 5K8VA 5BUCA 4NIMA 5T4HA 3VPFA 2DBRA 1E9CA 4HKTA 3LQ4A 2GD0A 5TQ0A 1CDZA 3PC8C 5IW8A 2R7MA 1O97C 2QD5A 2RHGB 2YJ5A 3GDGA 4RFLA 3UK7A 1MGPA 5I7SA 2WSIA 3CMEB 2ODAA 2WVGA 5FPTA 1GOTA 1SELA 2M6SA 3OBIA 1ZBDA 4KDRA 4PYRA 3WIVA 1KPIA 3FR7A 1DMRA 4RK6A 3N2YA 4J29A 4PX3A 2TYSB 3E4CA 4LOIA 1K3TA 3ZIDA 5HFAA 1YI8A 4K9OA 3O2QB 3WL3A 3RRYA 4B71A 5HJEA 3OQ6A 3DMDA 3D4NA 1A4UA 3IDOA 5JRZA 5AUOB 4L6CA 5DM70 3DGEC 1QRAA 3HGMA 2OG2A 3ONEA 4AC9A 4MEAA 3CCEB 3N2KA 4FM9A 1YTUA 4RQAA 4ZCMA 1OZHA 2EL9A 3GDWA 1HA3A 3W2IA 3GFTA 2HSGA 4YJ3A 3M6WA 3WADA 5LQUA 1KIMA 2R6JA 1M0WA 5DM2A 4CQLA 2VOJA 3N76A 4NU6A 1M8KA 4UVDA 1E0DA 5ALFA 3R6LA 2OC9A 3C85A 5EE1A 5IVIA 1LJLA 2RGBA 5CEJA 5TIIA 1SMKA 5KSYA 3C3WA 5AN9A 2DHEA 3EZ2A 3SLRA 5LDHA 1NQXA 3LCMA 1L5VA 1TTHA 1YDFA 4TXLA 2VQ6A 2BUAA 1D2MA 1UFRA 2ZSFA 2V7XA 4NEGA 5LOVA 1KQ3A 3AVXA 1E3WB 1XDZA 1WNTA 3A1FA 5T7BA 3RVBA 2JI8A 5IDXA 2NXWA 1QYCA 3PFHA 2NW6A 3M33A 3P0IA 1I3MA 3LXRA 3PQDA 4LYHA 4RZSA 1RQRA 4IKPA 4JYZA 2A5FA 3I76A 1GL9B 3QY9A 1CJMA 3WIUA 1YC5A 2Q50A 3JRXA 1WMBA 4LBWA 3CXCB 4NFYA 4WOPA 4B3HA 4DVJA 4G01B 1UZNA 1J00A 3I01A 3NDBB 5JIBA 1XZDA 2G0AA 2QD2A 3OF2A 3UIEA 5TS2A 4BBPA 3HB7A 4BX9A 5IULC 1BMFD 1VI5A 2XWQA 2Z2IA 4PHTA 5DGIA 3IEUA 1ISMA 1WZIA 2DH5A 1AKMA 1X9HA 3L0PA 5FUWA 4EM6A 3GRYA 5ALVA 2I6QA 1O08A 1NJ5A 4ML3A 3RTAA 4GSLA 5C1OA 4HNSA 3WLEA 1F38A 2IYPA 1CUSA 1B2LA 3QV2A 2IYYA 1LQ2A 2EWVA 4JLSA 4KNVA 4P9NA 3UG6A 5FUBA 2IGBA 1JR6A 1WULS 5FWYB 4QHYA 2PRIA 3UJHA 3HBLA 4LIPD 3SYKA 1TQ4A 4IS2A 3ABZA 2FMIA 4YQYA 4EFNA 3FRIA 3ZVNA 2COUA 4ZVSA 1SBHA 3HXKA 4FHEA 1SR8A 1XTRA 4UZUA 1ZK3A 2PMFA 1D2RA 1L5ZA 2C2HA 5JLJA 3T5PA 1MZPA 4YAJA 2NAFA 3A1WA 5FTLA 5A6VA 3DVRX 4X8LA 5DHTA 4N7JA 2H4JA 3VO8A 2HIMA 4BN4A 2RJ3A 2XEDA 4I2VA 3BTUA 3R7WB 2FTKE 2GOYA 2ZK7A 4GBED 4HLUC 3CRQA 4RLHA 1DQNA 3R3ZA 4UDYX 3E0XA 4H27A 3UWKA 1SGWA 4N12A 3MOIA 2JIBA 2IDKA 1EE1A 3AZOA 3NIDB 5ABPA 5DI9A 1PX2A 2QXYA 3G8DA 1OREA 1WMEA 3LZ6A 2I8LA 2N0SA 4H6XA 1KKLA 1Q3TA 1ZCFA 1IHYA 4PSKA 3LBFA 2IUUA 5KTYA 1MX1A 2A84A 1VB5A 1UBGA 5BN4B 4ACAA 2D5LA 4LV6A 3HADA 4CTKA 4EFMA 3HFGA 4LXXA 2DOGA 3W9SA 3DZCA 5IWCA 3KR2A 2YS6A 1B8UA 2HMWA 1D6NA 1E6LA 2ETVA 3NJ8A 3RODA 2C7OA 4RNDB 1RFGE 2JJ8A 1K7YA 2P90A 4N3BA 5B4VA 1D2AA 3U7QA 4I4IA 5GONF 3T5MA 3HCPA 3KWMA 3F4LA 2FUKA 2P5SA 2WSMA 5LIPA 4L7QA 4RVFA 3FYHA 1K08A 1HTTA 4LHSA 2Y1LA 3TTVA 2GKSA 4LKOA 2HL6A 4J03A 4YA6A 1SVOA 4DR3B 4W6ZA 3ODPA 1P9RA 1D4FA 4QU0A 5JARA 2E5WA 1PD0A 3EVCA 4L72A 4OBWA 2AJDA 3I09A 3U7EB 4EPWA 3LQ6A 1OCEA 1TADA 2A59A 2R1TA 3AEUA 1E6CA 4I5EA 3S1SA 1DBRA 1QMPA 3A6HA 4IIUA 1JA9A 1E98A 1P7PA 1QLJA 2A3NA 2GFHA 3B1JA 3R2JA 4OEHA 2BEWA 2B2XA 2BFEA 3CRMA 1FMCA 4HEHA 4PYMA 3MT9A 3GK3A 4OG2A 1GITA 1H2BA 1WU7A 3EEYA 1EQUA 2H1SA 1NMYA 2PAAA 3LHIA 2WTMA 4KI7A 2H1HA 2P2YA 4OFWA 1B8NA 1XZLA 4JGGA 3IJPA 3QYJA 4OO3A 3DCJA 3AHGA 1S2OA 3OCUA 3K6SB 3ETGA 2HYDA 5JAZA 3VYRB 5CLQA 4EY8A 2OVFA 3FUVA 1OOEA 2AR0A 3WK5A 1AJEA 3CTPA 4HWPA 1G6KA 2OTLB 1C7IA 4Q4JB 2IFTA 5SY9A 2PNJA 1NNI1 2JFXA 3N1UA 1BD4A 1QFYA 3EOBI 5CR9A 4L02A 4GX5A 4DJ5X 2IH2A 1ZXBA 2X2EA 3JVDA 4RLSA 2GPAA 1F51E 2IYAA 2GCIA 2XE7A 4J7XA 5DULA 1CR0A 5ALQA 2XJ9A 4Z4RA 2CGEA 3IIJA 1R0LA 4Q9NA 2CNWA 2C5SA 2CMHA 3VR5A 4NENB 4WA8A 2CEKA 3PDHA 2NT3A 3DMPA 2H07A 4P0TA 3PUHA 1M0EA 1YA6A 1BFDA 4DFDA 2JLUA 2EFCB 2W2LA 1O5OA 1WOSA 5CURA 2X5OA 3G7SA 3Q2KA 3OE7A 3LK6A 4YACA 2INGX 4TSFA 3RHZA 1DI0A 2A9JA 4XVQA 4BUCA 2HO4A 1M54A 1JSLA 2LW7A 3NFRA 3D8SA 1ZRHA 4H1HA 1K3FA 4FYXA 4AYXA 1VIDA 4BEWA 5TMDA 3UC5A 3AGPA 4ZAVA 2OZKA 3JW8A 4HP8A 5BSTA 2Q28A 5BMVB 1EP1B 1XJ0A 3QF4B 4WGGA 3ROGA 1P3JA 3V4PB 2X85A 2M6RA 1ECCA 1U1DA 2O9JA 3TB6A 2CDRA 2PZJA 5CDUA 3FTEA 2GR9A 4HAYA 4G1FA 4C0HA 4C88A 3V8PA 3PGXA 2CXQA 5LLDA 5ARCA 1W5SA 3A2LA 4XM0A 1KP3A 1SBIA 2A92A 3DDWA 3RT9A 2FW7A 4QU8A 1BE0A 3WDSA 4HGYA 3UK1A 3QNWA 4E12A 1HH4A 3IQDB 3W79A 1X1SA 4YAOA 2C57A 2ZE7A 2PWYA 3CISA 3BD7A 3DTTA 4NBSA 3EMKA 5A6SB 2QSJA 2CDCA 3E8MA 3T0FA 3W6ZA 5KDOA 4L5AA 4X6UA 2IYWA 5CD1A 3IUBA 3U6BA 4O2AA 1YE8A 3ZJVA 1T29A 1TM7E 4ENRA 5TV2A 3O4FA 2BKVA 1NI5A 4R05A 3MEQA 4UE6A 4HNHA 1LNSA 2VRCA 4K28A 3OD1A 4C2BA 1SWVA 3LLCA 1DIBA 2OXFA 3NHJA 5IZCA 1PSZA 4MP3A 1T6BY 2X13A 2J31A 4NG4A 4PLGA 4OX9B 2XD9A 4RZHA 3HA2A 4XWTA 2X4GA 2J0UA 4A6PA 2IS1A 2VR1A 1IN8A 3L77A 4XJSA 4WKCA 3VNVA 4AROA 1M6WA 2ZUUA 3KJIA 4QVGA 2IXBA 2NYAA 4YRQA 3AM3A 1IIRA 5SYNA 5IYWA 1DQRA 3U4IA 4WOKA 1VPVA 3SBXA 1CEQA 1DAOA 1E8MA 1JHAA 1U0OC 2DZDA 3ZDYB 2XYQA 1FRZA 3V7AA 4DQKA 3R5TA 4L0QA 5JAQA 3VR5H 2YDYA 4YXFA 2WM9B 1UDAA 4YS6A 5JD6A 3NHFA 4MVYA 4YEDA 4P38A 4GOOD 2NX2A 3K72B 3CLTD 4B74A 2HV9A 2P4HX 1Z0IA 1S3GA 3EBPA 1E1QA 1L4KA 4G0UA 5B7QA 1ZSYA 2PPLA 1HO3A 2RB4A 2ODQA 1FP6A 2X9GA 3CLKA 4G1MB 4OMUA 3HKBB 1SK8A 1HDYA 1W0CA 3QXHA 2HLNA 1II8B 4LTNA 4NZMA 4HH1A 2EEPA 1L7PA 2VWHA 3OIGA 3QQPA 4M76B 4P2GA 2WWRA 2XB8A 2XRZA 1DRWA 4M4SA 1P1HA 3I01M 2V7PA 2J5RA 4C6HA 4DV5B 3DYVA 4BV8A 3BH6A 5HW0A 4NOMA 4CODB 5HRAA 1GSOA 2XT6A 3D8UA 4JENA 5DSXA 1X8KA 3G7NA 4LF4B 2N42A 1DHTA 1O95C 4FWBA 4P7BA 1P1IA 2FGKA 3KQWA 4XGIA 2P9ZA 5AK3A 2OHGA 2VKQA 4HS9A 1XZJA 4NC9A 4A6DA 4B75A 4UTNA 5JCXA 4M87A 2WYUA 2AFIE 3KTAA 1QYXA 3TLBA 2YXBA 2X6YA 2BV3A 3D26A 5K3EA 3GQBB 1B74A 2AG5A 3FPAA 2EFDB 2N46A 3PB3A 3PQ8A 4PAWA 4WW0A 5HF8A 4G0VA 4YRKA 1CUIA 1EDZA 2GZ3A 3KUUA 1QBGA 4JL6A 4OK3A 4I50A 3ZKWA 4BAUA 3T3NA 4BDTA 4INOA 4JGBA 3RF7A 4YX9A 2YWCA 3HU2A 4ZKDA 2WSYB 3PFBA 1TA0A 4NV3A 2M32A 2DERA 4XL9A 4NOJA 3GFQA 4FEGA 1Z15A 2X7HA 2IH5A 3OKPA 2JLWA 3KUXA 2WFMA 3OSZA 2FOIA 1Y7TA 4J3JA 5DNWA 1KEPA 2OOSA 1XMVA 1V6SA 3LL4A 2JAUA 1KU0A 2YNMC 1GCGA 3I6MA 4Q3AA 4HDRB 3GLIE 3NDPA 1SXJA 2IBSA 1HDEA 4JU8A 1N2ZA 2NIPA 3QNMA 4J0HA 4L1KA 1PTJA 4X45A 4CRWB 3K70D 2EARA 3X1JA 2MOKA 3PHLA 2Q6KA 1UKEA 2P3SA 4RA9B 4A9AA 2Q1UA 2CLSA 3ESAA 3PV0A 4GMHA 4PLTA 4JCCA 2F9MA 2O14A 3K0AA 2PG3A 5E4FA 1M8FA 5C8ZA 2X8BA 1KZGB 1YQWA 1EESA 4JWKA 2ZYGA 4EL0A 4KBFA 2HRCA 3T8YA 4EJFA 2R8XA 4RYLA 1QX3A 1DKNA 4O5OA 5H9WA 4XDGA 5LJLA 3FCYA 2QR2A 3OZRA 5CYOA 4PIPA 2W6ZA 1E6KA 3EEBA 5FWDA 3IAS6 3ZU6A 1SZPA 3Q88A 5H80A 4A0RA 4TKVA 4LXYA 5FTNA 1Z2AA 3GLGE 1P33A 2CLOB 3W3AA 4CQMD 2OBFA 1M34B 2IODA 3KQYA 1O97D 2H63A 1W0JA 2FP4A 1HY3A 1GKLA 2PGDA 3L7OA 2C8VA 4E1AA 1B4DA 1RM5A 2WV9A 1QGDA 1T4BA 1W2HA 3BE8A 1F2DA 4JKYA 2RGAA 3GO4A 5H81A 3JYPA 5K3DA 1Z2EA 4E33A 4HNVA 1USIA 3FHCB 3W5VA 5JI3E 4RTRA 4JJZA 3VYSB 2IW1A 3KAPA 4F38A 2B8NA 3BXPA 2AFHB 2WWXA 4LJ6A 2H2GA 3A06A 3RRZA 1I3OA 4YCMA 3JAKB 1ZP6A 5MDHA 1LA2A 3ANTA 4FFDA 4CI0B 3L1VA 2C54A 1U2DA 1BA3A 3PD7A 4FNOA 4G4IA 2ZWAA 1KO5A 3CPHA 4F1JA 3I8XA 2Q45A 1X1RA 5L6MB 4DNOA 5BNWA 5EKXA 4M1KA 4HE6A 3BSFA 4F9EA 2ZR8A 1D6SA 1RXCA 5IVDA 4R31A 3IP3A 2HIAA 4BVLA 1SQ0A 3FPHA 3E5HA 3O91A 4ZMBA 1QHXA 2ZQZA 3K2EA 1PWYE 2FSVC 1A5TA 3UOWA 3QU9A 1L4NA 1Z26A 4YXWA 2XHZA 3S5UA 3UJBA 4AICA 1KI2A 1JJ2B 2P6OA 4U3JA 4UFPA 2AEJA 2DC1A 3AIKA 1PJ8A 3AY0A 1JQEA 2XCLA 3G2LA 4KSCA 3Q3AA 4TVBA 1W34A 2DTXA 4B6FA 1C30A 5KVAA 4RETA 2JFGA 2W0MA 3MQ4A 2JAOA 3S70A 3OTIA 3A9TA 1TM3E 3HYTA 3MJTA 4CJXA 3W7AA 1KOJA 1JYEA 3DMNA 2AJBA 2IEDA 2OKCA 2G1JA 4ABTA 1C7JA 1N34B 3DW3X 1CTQA 3ERCA 3EASA 3I5YA 3G02A 2ENWA 2YCLA 1QRDA 1DFIA 2WUFA 1IXZA 2A67A 3DP7A 1FP2A 2NYUA 3L5KA 4L78A 3VZPA 2R65A 4BMCA 4C01A 1NDQA 3QPWA 5CFZA 1U3WA 2EAUA 2DULA 4KLZA 3I4CA 3RKSA 2JIMA 3T56B 4EQ6A 3GN2A 4AN4A 3Q11A 3D7RA 2P40A 2X0IA 1XNRB 4MCAA 3DULA 5DGDA 4JKIA 3U40A 2VPXA 1XKQA 4HGRA 3EG9A 1ULAA 1GQFA 1G3IA 1J0CA 3TQQA 3W3AH 2IYFA 2HU7A 1NUUA 3LTEA 3R7BA 3WGVA 1GCAA 2NG1A 3D3WA 3OVMA 2VRWA 3TO5A 3G49A 3U4HA 2PE5A 1RJGA 5LP6F 1WHSB 2GFIA 2Q0HA 4DV3B 2XF8A 3EG5A 1LI7A 5IH3A 4K5QA 1C9MA 1GGHA 1T36A 2HI0A 5THKA 3PDWA 3L4KA 1RYFA 2HFKA 4Z4IA 1ZOPA 4BAGA 2A5YB 3JU3A 2JFBA 5LQDA 2J6HA 1HEYA 3BQ9A 3L4JA 1FJGB 2IHZA 1EGVB 1MAVA 2VAMA 2Q3FA 3HCAA 4F9GA 2IP1A 2ZR0A 4OIMA 4UOEA 4C0JA 1Z0KA 1Y0YA 4X85A 1Q0RA 4POAA 4DLLA 1GKIA 2Q9BA 5CW1A 4U7JA 5HJ2A 1W9MA 2GQ0A 3KDSE 4ZOQI 5T4FA 3TIIA 5JXJA 1BE1A 1JHUA 2EOAA 2EBHX 4FE4A 4UASA 3SX0A 4E21A 4QGFA 3OZWA 1RJDA 2WJPA 1ZUD1 3TLYA 1NJ8A 3DAPA 4F5DA 2OV3A 3FPJA 1U7DA 3BNWA 1Y1PA 1O9BA 1QK4A 3LAWA 2OP0A 2PGIA 3DJFA 2C92A 1QNFA 3ONUA 3LVFO 4N65A 2B8EA 4URZR 4ITUA 4E46A 1KD1D 1Z34A 3AK4A 1O7JA 3B5IA 1A7UA 4RV9A 4KTTE 3SS8A 1DOAA 4DQDA 1IN7A 3H7IA 1PE0A 3C70A 2X40A 1F3OA 3DUWA 4J2TA 2GEDA 5CDTA 1TCAA 3I1FA 2H8GA 2I8CA 5HUJA 2O8VA 3S7TA 4FJ1A 2WJYA 5B7NA 1EVIA 1UXHA 2JI6A 4G2TA 4IDFA 3MM4A 4KE8A 4S05A 1YL6A 2PS9A 2WMNB 1I4EB 4YRRA 2PRJA 3PC8A 3SSMA 3VH4A 3X2SA 4DREA 3L0SA 1GTSA 5HGJA 3E7DA 3ZWBA 2C78A 5EN4A 1ZUIA 1EPUA 3DZJA 4QC2A 1IHXA 4G41A 1WM1A 4QXQA 5TMEA 3SEFA 1SQGA 4WZAA 3RBXA 4NS4A 4DCVA 5K0EA 3I0MA 2Q07A 3TOCA 3V46A 1RQPA 1JNYA 2YN0A 3TR5A 5GONB 2X6RA 2QM0A 3PIRA 4EK9A 1TRKA 1XZHA 2XUDA 4ZYLA 4TMFA 1ESNA 2YZ7A 5CH8A 4GHWA 3CNOA 3K20A 3LRPA 2LCFA 1XA4A 2MT9A 3EIXA 1JS1X 1NQTA 3URKA 1ITZA 2VH2A 4DUGA 3PGMA 3RAGA 1RLTA 5C8YA 4P0QB 5IUNC 3X1MA 2O05A 3QH4A 4AMYA 1CR1A 2AZ4A 5DHAA 4GL2A 1P2GA 3INYA 3M9XA 1IQ0A 2C61A 2VF5X 4M9QA 2A86A 4AZWA 1YBVA 3ECCA 1U0NA 2WZDA 3G2NA 3LSYA 3RIXA 4RK0A 4ZO6A 3BHNA 4E5YA 3RV3A 1GZ4A 2Z8ZA 4PS0A 4KWHA 2Z4TA 4OQLA 4XASA 4AW9A 4KV9A 2DBVO 2N3ZA 4IICA 3KYDB 2I9PA 2PRZA 4ZT4A 5I7UA 1Q1AA 3O9ZA 2EF1A 2JGJA 4RKQA 4Q9KA 5K4GA 1VSBA 1MJNA 3EMBA 4JSTA 3PXXA 4KQ1A 3HYNA 2I62A 4IG9A 1DQZA 5D7BA 3JD1A 1WXHA 1ELOA 4K46A 4EF6A 5IKEA 5C8VA 3OO0A 3H13A 3HFJA 4BWYA 1PJRA 3ORRA 5TVGA 4Z0HO 4NU5A 4CFSA 4UAGA 2Q1YA 1PR3A 3QKSB 5FYDA 3U16A 1F0PA 1JU9A 1UP4A 2FPMA 1WNFA 3C0KA 1UXOA 3PRKE 4S1NA 4HSEA 1K06A 4D80A 1NF3A 1T8PA 2VJQA 3IDAA 3KQOA 3PHCA 4ZI7F 4L85A 1XPRA 2BKLA 1BDBA 3ELYA 1Z28A 4HHEA 1D8TA 4Z1MD 2I7CA 2HLPA 4MPTA 2VL7A 4XB2A 1E3WA 5EZQA 3WRVA 1XLTC 1FUKA 2DUNA 4RSHA 1D1QA 3N59A 2YCBA 3MWDB 2A9RA 3SQNA 4YONB 2OCXA 4V2UA 1IY2A 4UNSA 3IFSA 2MYPA 3D7SA 3LOUA 4D9IA 1QR6A 1B42A 2QRPA 4QOHA 5C34B 4A73A 2GTHA 1YO6A 3NRJA 3PPIA 1YUBA 3MRSA 2NO7A 1HUQA 2DQZA 4PU0A 2GSWA 5DBIA 4HLDA 4K6CA 3VAYA 4G37A 4MQ6A 4DK0A 4EARA 2P30A 1N6NA 1SIUA 4QBKA 3FF1A 1AY0A 1BWRA 4P25A 1XZIA 1LVGA 2VUIB 4Q7JB 1XD8A 4FQ5A 3EXHC 3RTBA 4YUXA 1E3MA 1RPAA 1FJ2A 2WHYA 1J49A 4HATA 5KCZA <