1IJFA

Nucleotide exchange mechanisms in the eef1a-eef1ba complex
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
440
structure length
440
Chain Sequence
GKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of nucleotide exchange intermediates in the eEF1A-eEF1Balpha complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords elongation factor 1-alpha
total genus 126
structure length 440
sequence length 440
ec nomenclature
pdb deposition date 2001-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ijfA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ijfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ijfA01
4IDQA 5AUOB 1ZU4A 4GOJA 2W2XA 2GBLA 2CCKA 2I1VB 3CX6A 2A5GA 4HUQB 1H85A 3B5JA 3SN6A 2NO6A 4HAWA 3H2YA 4MGIR 2Q3MA 1JB1A 2JLVA 4LJ9A 3E2IA 1Q86D 3X1WA 2O8CA 5DI9A 3LVBA 1TU4A 4OK6A 3ZLJA 1LS6A 3NEYA 1G17A 2D4HA 4QJ3A 2CNWD 1NL3A 4R71A 1P4SA 421PA 2CL0X 2Q9AA 3RYTC 5JFGA 1WB9A 1E4YA 4PC3A 1U98A 2WJVA 3B1YA 1QFJA 2QBYB 2OUKA 2XEXA 1II0A 3A1WA 4FK8A 1XD9A 4PSVA 3V9PA 4CT4B 5L3SB 2ZTSA 2ZE7A 4D2IA 4D0NA 2FDCA 5FUVA 4ZGNB 1W5TA 4ZV4A 1ZNXA 3LY5A 1NP6A 1MRNA 4A15A 4GBMA 3P26A 3RNLA 2WJHA 1AM4D 4PC1A 2BMDA 2XX3A 4TMWA 1L7VC 4B74A 1D6JA 4MUAA 2ZUDA 2RC6A 4YXWD 2IS2A 4H1UA 2DWOA 5AUNB 3S1AB 4LYFA 2BHRA 4TTRA 1GAJA 1N6IA 5EXXA 4DUGA 5JCZA 5DNYB 1A8PA 1OHHA 3K0SA 2GILA 4M1WA 2ANCA 2ECKA 4DZZA 1L2TA 4HUTA 1E2JA 1TUIA 1VHTA 1BIFA 2JASA 3IPXA 1FP7A 2DR3A 4OHVA 1HE1C 2A30A 2CCGA 2ZREA 3LXRA 1CNEA 1N0WA 1GRRA 4B34A 2AX4A 4BPBA 2G9NA 5KUTA 2QRNA 3FYHA 1E98A 5BW8A 4AI6A 1CQXA 5C1BA 4DB4A 3THYB 4A4DA 1Z83A 1GSIA 2A5YB 2Q3HA 4RJLA 1FPMA 4B6EA 4C0LA 3CM0A 2YJTD 5CM9C 1YRBA 2CE7A 2JLUA 5M04A 5SZIA 3TAUA 2ZVPX 1TU3A 3IILA 2FF7A 3Q3JB 5IHPA 1Z6GA 2IYZA 3CIOA 3U3MA 3BS4A 2ZITA 3IHWA 2XTMA 2V7QA 4B3DA 1L8QA 4AF6A 1X1SA 3R8CA 1G9XA 4URVR 5B57C 1W5SA 5A5GA 4HI0E 3R7WB 2W0SA 4XSGA 1VQNB 2AKAB 4F92B 1ZP6A 4PO1A 2W0MA 5KYKA 2PLRA 2KBFA 4HATA 4R2HA 2QENA 4NONA 4BLPA 3U4QA 1X86B 4BLOA 5TDHA 1S2MA 1XX6A 5FI0B 4G1BA 1BKDR 1Z06A 4N0DA 4OQLA 3K0FB 4KITB 1E2DA 2YWHA 2R6FA 2WKQA 1II8B 4PSAA 4YMTA 3CRZA 4MDFA 2IYRA 1I4LD 2OT3B 1SQ5A 4JL8A 4DLUA 2G0TA 3BGWA 3ADDA 1JAIA 1KO5A 1E2NA 1ZCAA 2A78A 2NQ2C 4BFWA 1Q81D 1P2VA 3GLIB 2CRVA 3EW9A 1QFZA 3RS0A 1N0VC 1UJ2A 5J40A 1W44A 4HYYA 3P32A 3K9GA 4TN1A 4Z8YA 3SJCA 3PENA 4U02A 1PLKA 2GF0A 3LBIA 4X8LA 2XSZD 2JLQA 1W4CA 2P5SA 5K8UA 4Y9UA 5DSZA 1ZCBA 4J0QA 2OFWA 1FFHA 2GVZC 2ZRIA 1J99A 1LS1A 4K1XA 1VQKB 1NN5A 4G5GA 4JKIA 1W7AA 4M1TA 4G01B 4RVCA 5CIQA 4Q18A 3TE6A 4IDHA 3FGNA 3PEWA 3NWJA 2QG6A 3SZRA 2CHGA 2WJJA 2L0XA 1KO4A 3KXIA 2GNOA 2OO7A 4KO8A 2QGZA 3FKSD 4DDTA 3QG1A 4PXAA 1IBRA 1P9NA 2VLIA 1N25A 5AUQA 4E5UA 1N5JA 3UG6A 4MKHA 1LY1A 4P4UA 5HKKA 3GLFE 4TZ6A 1PZNA 5BYJA 3ZJYA 3CPHA 4Q01A 4D6PA 1FL9A 3QFRA 4GMXA 4EKDA 2YWEA 1GL9B 3SS8A 4HAZA 1A82A 1Z6AA 1NJGA 1NSFA 2JLXA 2QL6A 3WHKA 3ZQJA 2HJGA 3NKVA 2HYIC 4N1AA 2WAXA 1CJTC 1U0HC 2ZQ5A 4N3NA 1JA1A 1CJUC 1XCPA 4K8OA 1I4DD 3WMGA 3I5XA 4IOMA 4TL7A 5B58C 4M1MA 3R7WA 5IK2D 2BDTA 1U99A 1VG0B 4OBEA 1XTRA 5FBRB 3RC8A 2PLFA 1SVOA 3KB2A 3VAAA 1IN7A 4QBFA 3HR7A 1IQPA 3TW8B 3TVTA 3K70B 1NBMA 1KI6A 1M7BA 2GAAA 2NPFA 2VP9A 2D7CA 3OEEA 4ESVA 4NP6A 2BN4A 2QE7A 3THXA 3QUSA 4QOSA 2EWVA 2IK8A 5EQTA 3GP8A 5EE0A 1VQ9B 3V76A 2YWFA 5KSPA 1NKSA 4GOKA 5EE5B 2ZJBA 2J59A 3CZQA 1N6HA 5B30A 5FTNA 4A0RA 3OIYA 2RB4A 2VTKA 4D0GA 1BX1A 3VU9B 2GHIA 2BVNA 1AGRA 5EE3A 3UWKA 2V8OA 2VO1A 2ZU6A 2H18A 4XVRA 5JEDA 1CR0A 1JPNA 2ZJYA 2O52A 4LSGA 4JVSB 3R9IA 2IX3A 2ZUCA 2QN6A 2ZRNA 2VQSA 1VYVA 3GLHE 4KBGA 1U0LA 4Q66C 1YR6A 2OILA 2OLJA 5JWOA 4NU0A 1TADA 4HB2A 2XAUA 1OB2A 2ZU0C 5HXBA 5AJWA 1OFTA 1W4RA 3RSOA 1OIXA 2LKDA 2G1KA 5L3VA 1P61B 4F4IA 1WRBA 3CH5A 2VPPA 4YONB 3KQLA 2NO9A 3C5HA 2HF8A 1DTSA 4DKXA 2ANBA 1JJ2B 2X1VA 3KKOA 2ODWA 2D2FA 2VA8A 1FX0B 3DZDA 4BEBA 3M1IA 5FUWA 4QBIA 2ZI6A 1Q1EA 3CRW1 1S1CA 4IDPA 4LJ7A 3W8NA 5GVSA 4IXNA 4JSYA 3AP3A 2VEDA 3H4MA 1QHXA 2W6JD 1NVVR 1M8PA 1GWNA 2WWHA 3K09C 2P65A 1VKJA 1RKBA 2F1IA 3GLGA 1KRHA 4ILEA 2QM8A 1NVXQ 3ZVMA 2O8DB 1CBUA 5AN9A 2BC9A 2IHYA 2RGNC 1CP2A 1YU9A 3EIEA 1GG2A 1Z6XA 3AF2A 2IUTA 2OFXA 2ZSAA 3BH6A 2ATXA 2O8BB 4PC2A 3QEJA 5DI3A 1TEXA 1E2GA 1PV4A 3WYFA 2GCNA 2XNJA 3QFTA 1OH7A 3T06B 4ZIRA 2D3WA 1A2KC 1SXJB 1G7RA 2FGJA 1Z29A 4QRHA 4TZ0A 2CLCX 1BMFD 2IYVA 1X8JA 2Q9CA 1N6PA 1JA0A 3FB4A 4AYTA 4UXHA 1AS2A 1NG1A 4HLUC 1QZXA 1AQUA 1KI2A 4QJ4A 3KX2A 3KKPA 5FOXA 4IEEA 3X2SA 4FMCB 4GI7A 5JLJA 2JAQA 5E7MA 5LBIA 2WKPA 4FMDF 4PPQA 2FN4A 3ZVNA 1M34E 1VQOB 1R0WA 1U94A 3W8RA 4ASUA 1GKIA 3I61A 2J9RA 3CONA 3TSZA 3Q9LA 5IF9A 1R5BA 4LJ4A 4LK2A 5FR1A 2NZ8A 4A2PA 4A8JB 4GPTA 3ZZUA 1I4TD 1TPZA 2KSQA 2VHCA 4GZMA 4KFTA 4AG6A 2J41A 3GJ3A 4LZZA 4BUJA 1YHNA 3AGPA 4IDOA 3TSOA 4K81B 2GEVA 1FTSA 1LF5A 1DAGA 4QFMA 1F2TB 4ESHA 2XTNA 3B1XA 1E9SA 3DMNA 3LW8A 4ZDKA 5TMPA 3ZD7A 1GM5A 1NDHA 4G5QA 1E9EA 3X1XA 2A2ZA 2CL6X 4A9AA 2WJYA 4O25A 3O8DA 3U6KA 3WRYC 4F38A 5EE9A 1AK2A 4AF7A 5GVRA 2RGCA 1IHUA 2VSOA 3LBHA 3U7HB 2QT0A 2W6IA 2QU8A 3RANA 3W5UA 1GL6A 3DDCA 3REFA 1IN4A 1XFAA 4YHBA 3EAQA 4QGAA 5JRZA 1GVNB 1E9BA 1QBKC 4TLCA 3RWOA 3AVUA 4C0SA 3K0CC 2FPKA 5K8TA 1ZIOA 1NJFA 1XEWY 2O5VA 1XPOA 1OIVA 4Q4HB 4OK5A 4W5JA 2BIFA 4PHTA 1CRPA 2QTHA 1XPRA 1GNQA 1Q22A 4MGKR 1TQDA 3MWLA 5J4HA 4IFBA 1CJVC 3M4YA 1QH0A 3S1AA 4A6XA 1ZBDA 3KUDA 4ZI2A 2O8DA 4DCTA 1P75A 4WOPA 2D62A 4BZPA 1BYUA 2BGIA 2F3TA 2FFAA 1Z0JA 4Y9RA 1KC8D 1OGIA 1QHIA 3QENA 4G5RA 1DADA 3IBGA 1ZIPA 2KE5A 2C9CA 1KMHB 3M0EA 1AN0A 2XSZA 5FL3A 4KYUA 3CCQB 1PUIA 4QGFA 3SEAA 2UVQA 1WBBA 2QSZA 4L5BA 2C96A 1D9ZA 1R7RA 1EWRA 3RHFA 5LD2B 2GPJA 1QX4A 2GXSA 4Q7KA 2W6JA 3THYA 4YDSA 3TKLA 4V02A 3L2OB 3H1TA 3SR0A 4A0HA 3VNVA 3VX3A 4HE5A 2EVWX 4M1YA 3ASZA 5G3YA 2BCGY 1IJFA 2FX3A 1ESNA 1R4AA 1UF9A 3FMOB 4FINA 2ORIA 2CBZA 2O0KA 1G6OA 2VRWA 4KU4A 1NN3A 1SKYE 3WYGA 4YAFA 4B44A 1SXJC 4L16A 4JBWA 4HDCA 2JJ1A 1NI3A 4DJTA 4RD2A 2H5EA 5H1YA 3HU2A 3CCSB 1X6VA 3AVXA 1XDBA 1W48A 1GILA 4DLXA 5EP3A 4P4SB 4U9UA 2G83A 4BFUA 4UKDA 4LJ5A 1SULA 4WVFA 2ZRJA 3ONWA 3DM9B 4LBVA 1D9XA 3KXKA 4HAXA 2HT6A 3FHOA 4AIIA 3EPHA 3SC3A 5CITA 5KSZA 4GDFA 1CS4C 2CMKA 1JNYA 3DPUA 4KYIB 1E2QA 5IRCD 5J4KA 5JS7A 1VQ7B 4D0LB 3K53A 1MO4A 1KSJA 1DG1G 1ZMXA 1Z2AA 2HEIA 4RZ2A 3WHLA 2GJSA 2VHTA 1LVGA 3TJZA 3UATA 2I4IA 3KQKA 3B8HA 1F48A 4FXPA 2DYKA 1Q57A 2VSXA 4IVRA 4G1UC 3VR1A 5CK4A 3G0HA 2O8FB 1W36D 1II8A 2WOJA 3FE2A 3THWA 1G8PA 4D26A 5L3QA 4UXJA 4AC9A 2O8CB 5E7JA 3K9HA 4ERNA 3BORA 3QKSA 1KHTA 3NG1A 1FTNA 5KOYA 3V00A 2P2LA 4Q47A 1UKEA 2WSSA 2GJKA 1VCIA 3ICEA 3MJHA 2C03A 4TMKA 3IQWA 4CEIA 1W34A 2IL1A 5AJZA 2ZI5A 1B23P 1ZC4A 3IIKA 1G5RA 1W4AA 2FFQA 2ZYTX 3PUYA 4KI0A 4QNRA 3QXJA 4H1VA 4AY2A 5C18A 3RS7A 4DHEA 2HCJB 2VF8A 1E32A 2OXRA 4XWKA 4URUR 2PEZA 3RC3A 3CCEB 4A8JA 4ZGQB 2OBMA 4RY2A 1KO8A 3AP2A 5JEEA 2HLDD 2WJGA 4PC6A 1R5OA 4DSNA 1F20A 5KSOA 4YAWA 1GL7A 3OAAA 4YQFA 4DWJA 3HWSA 3AF4A 4GRAA 3LVRE 5AR1A 4V0MA 4Q7LA 2V55B 3RAPR 1KI8A 1E9RA 1N5KA 1XMSA 4EFMA 2XGJA 2QT1A 3UPUA 2FZ4A 1UDWA 3QKUA 1J8MF 4FD2A 3L0PA 1ELOA 2V6JA 2J1LA 1WF3A 1RRPA 3ZYCA 4UNQA 4JL6A 2FMXA 2I1QA 4V0LA 3AVWA 4G3XA 1VPLA 2EU8A 4GSYA 3D31A 4O2LA 3VR5A 4PPFA 2OAQ1 1DBSA 3NVAA 1J90A 4AURA 5CB6A 1OFUX 4QC2A 5TY0A 1G4AE 4LGMA 4M1OA 1G7SA 1IY1A 1HUQA 4FMCF 2PZFA 4IVQA 1PVOA 2FWRA 4WW0A 2QAGB 4TYPA 4KFRA 1BOFA 3B2EA 4B2PA 2ZRFA 4B73A 1OT3A 2O0JA 4TYYA 5EUQB 2QMUA 3ZBUA 3IUYA 3NH9A 4S35A 1TQ2A 3TQCA 5TV2A 1OFHA 3PFIA 4WAUA 1B0UA 1FNNA 2G3YA 1XMIA 2UZ3A 4F4JA 1RJ9A 3CH4B 1N5LA 4LHXA 2ODNA 5J4LA 2GXAA 3W2HA 1OV4A 2QROA 1GNRA 1G3QA 3PCRB 5BN5A 1XXHB 1NY6A 2R65A 2ZETA 1K6MA 1U8ZA 3QFSA 3WNDA 1BMFA 1ZNWA 3HP1A 2VNJA 3NC0C 5DH9A 1YR9A 1CF4A 1WE2A 4MYTA 1G64A 1OF1A 1RPZA 4KLNA 2ZRHA 1ANKA 1XTIA 2CHQA 1YJWB 1O3YA 1Z47A 2FSGA 4V0OA 5TR9A 5FPTA 2XZOA 3AV0B 4LJAA 2PX3A 4F7DA 3MFYA 4OI2A 3TR0A 3OIVA 4M9ZA 3PQCA 2PCJA 2GVDC 4TTQA 2DERA 1SGWA 2ZJOA 1M1KD 1CR4A 4MRNA 4PO8A 1S9DA 3RRYA 1TF5A 5EZ6B 1G3UA 121PA 5DISB 4UNRA 1RFLA 3CD6B 4LJ6A 5DYGA 5HCNA 3QXXA 3DMDA 4DSOA 4C4PA 3W5HA 1CR2A 2WICA 3LNCA 1IONA 1QG4A 4OHZA 2QMOA 1QGAA 3Q5DA 2DPXA 2WKRA 4A92A 4BLQA 3NIBA 2CXXA 2H57A 2WTUA 4HZUB 4P31A 1FX0A 3K0CA 2FSHA 4Q5IA 2H1LA 1OB5A 3QVVA 4DT1A 2VYQA 2OAP1 1UDXA 1YZLA 2F6RA 3UK6A 1VECA 1AZTA 1KY2A 3H0KA 1H8HA 1KMHA 1TLLA 1K9MD 3B82A 1DAEA 2WM9B 3D8BA 4P6VF 2A7QA 1QUEA 2GETA 2N42A 3HU3A 4X8OA 3AF0A 2V54A 2ZR7A 3I56B 1ZJ6A 1T0JB 2QRZA 1JJVA 3GQBA 5F9HA 2XZLA 2IUSA 1G8YA 3RS5A 4YXWA 3AKCA 1E1QA 1KI4A 2NO0A 1QFYA 5DN6A 1KTVA 1E6CA 3UKDA 2JLYA 1W2BB 1YR8A 3IO3A 1N6KA 4JYCA 1N6NA 1TAGA 2FPLA 2YVUA 4TWZA 4QGGA 4PHHA 1LB1B 1UPTA 3P4YA 4KVAA 2BKUA 1FUKA 2GCPA 3SJAA 1ETUA 1UKVY 1Q3TA 3JVUA 4BPRA 1KNXA 1VCNA 2YYZA 3IBYA 3MRSA 2ZI7A 3EASA 4PHGA 1DELA 3FDIA 1KIMA 1OPXA 4AKIA 1W36C 1AS0A 2QUZA 1VQ5B 1E2KA 4LV8B 5BWMA 5JS8A 1NF3A 1IN8A 3FWYA 4E22A 2YC2C 4TLAA 3KL4A 2OCYC 5K8IA 2CHVA 1JR3E 3JZAA 4G0NA 4FIDA 1FW6A 3I1FA 2J0VA 4G1VA 2KI5A 5LDDC 3MAAC 2ODEA 1YITB 4AWXA 1F5NA 5JJLA 5DYIA 2XJ4A 2GESA 3R9WA 3CWZA 3C14C 5DHAA 4CEJA 2R6GA 1XD8A 1E99A 1AIPA 2EYQA 1T5IA 2GK6A 1M1YE 3K0EA 2OCPA 2Q0HA 1OW3B 1EWYA 3LVQE 3FHCB 4DSUA 3KZ1E 2QP3A 4M1KA 2FSFA 2F7SA 3BFKA 4W5WA 5EZ5A 3U3OA 3OFND 5FTMA 4BRUA 4G5OA 1YIJB 5EP1A 5L3SA 2A5JA 2HF9A 4US0R 3MG9A 2JJ1D 3QE2A 2Z6VA 4XVUA 3CNLA 4JVLA 3ZGXA 2BPOA 3H86A 3THWB 3LD9A 1GVHA 5GJBA 3LQQA 3REGA 2NO7A 4CW7A 3BC1A 3VR3A 4IXMA 3GLFB 2C8VA 5KTYA 1QF9A 1FQJA 1ESMA 4HLDA 3ADKA 3I8SA 3IEUA 4DCNA 1XB2A 2PJZA 2QAGA 3T34A 3R8FA 4RZ3A 4B71A 3ZVLA 3JQPA 4LRWA 3A58B 1TQ6A 4FWTA 4V0ME 3L8YA 3EWAA 2GJ9A 4PZYA 5GV8A 3ZC3A 3EZFA 5KSWB 2Z4RA 4MQBA 3IDQA 2HYDA 2G88A 2GA8A 2V7QD 1YE8A 4CRWB 1N8RD 5BN3A 4Q4AB 1ZNYA 1UM8A 4CIDA 4UNNA 1Z28A 4C30A 3X1ZA 4ZDJA 1J2JA 2ZM5A 1T3HA 4L9WA 4BWYA 3C5CA 2WWFA 1P2UA 2G1JA 3O47A 2YWGA 2IEZA 4JS0A 4BLTA 2IYXA 1EFHA 1MO5A 3BAFA 821PA 1SKYB 3FPAA 4I4LA 4B43A 5FBLB 3CC4B 2J7KA 3WRXC 5JSZA 2JDIA 1XTKA 3GJ4A 4NCHA 3AEZA 2J46A 3EXAA 2V9PA 4MYHA 3TNFA 3AVPA 4JLKA 5CK5A 4Q1DA 4BE7B 3GJ8A 2NOAA 1M6NA 3DKVA 2CJWA 1TX4B 4DCUA 4Q9HA 3KFVA 2DWPA 1HY3A 2JJ8A 5D3QA 1GITA 3BB3A 2P6RA 1RIFA 4A2QA 2QNRA 2VHUA 1P72A 2BWJA 3RS4A 1MABB 2EQBA 3MWKA 2F1JA 3VHXA 3MUFA 5H70A 3PEYA 1FRNA 1MRSA 1FP6A 1VTKA 4LV6A 2IF2A 1FQKA 4BASA 3KJGA 1W87A 2XXAB 1QVGB 2OBLA 1V43A 1Z6YA 1NY5A 2RH5A 3AUXA 4MKGA 4C2UA 4LY6A 3TUZC 2ZEJA 4LV5B 2ZRMA 1G6HA 3IEVA 2OLKA 5TARA 1I7PA 1VCOA 4BEJA 1KAOA 4M1SA 3CRVA 1P9RA 3RS3A 3A4LA 4E07A 4ARZB 2B8TA 2X8AA 4TQ9A 1KJWA 2XNCA 3CCLB 1ZYUA 3UWOA 4MRRA 4NBSA 1VQLB 2WMOB 4JT2A 3GFTA 1GRQA 3IO5A 3TAHA 1N0UA 1YZGA 5FBWB 2GAOA 1R0XA 1QVAA 1R2QA 4A0FA 5BN4A 4RZXA 2CK3D 4XVQA 3OEED 1F60A 1MKYA 1HH4A 3DKPA 2GXQA 1JALA 3QI2A 4C0HA 3THXB 1QUFA 4UNSA 4QXAA 2J0QA 2YOGA 3UANA 3EPLA 4RCZA 3T1OA 4JLVA 4TSFA 1EWQA 4HAYA 2PJRA 1KAGA 1S9HA 3KKQA 4OHWA 3QF4A 2ZYUX 4OJQA 3NBXX 4XSHA 2VHQA 2RGNA 3LFUA 1ZD8A 1F6BA 1H8HD 1YZQA 1ZC3A 3WP0A 2PMDA 3DVLA 3QG5A 1TQ4A 4A0GA 1G21E 3CRRA 2HCBA 2WOOA 4RCYA 3GCGA 2FV8A 4KXFB 4UNPA 2XITA 4B75A 1KD1D 4JLBA 3NHAA 2OXCA 1TVCA 3F0TA 1J7KA 2C98A 2E1RA 3C16C 4ACAA 2ZI4A 3OF5A 3A36A 2ZPTX 4TT3D 4DIEA 4Q7JB 4EIWA 1OXTA 1W2HA 4LYAA 4CZ2A 2P0EA 2PZGA 4MA4A 1R8QA 2Z83A 2W83A 3B60A 4JBXA 4LHZA 4DCSA 1G19A 2D06A 4N3GA 2FA9A 4HE6A 1NKTA 3SFZA 5B64A 4II7A 1C1YA 3CX8A 5F3WB 2XJ9A 1FZQA 1Z63A 4TL6A 4Y0VA 5G53C 2BBSA 1G3IA 1Q12A 2WSMA 4MGZR 2GJAA 4MGYR 3HPRA 3T61A 2AWNA 2DB3A 1QG0A 1WA5A 1E4VA 3CB4A 1P62B 2ASEA 1IXZA 4IKEA 4EJSC 2DFKB 4HB4A 4IOKA 1IN6A 1DOAA 2ZI3A 1GJRA 1S72B 3LLUA 2OV2A 2UKDA 1W0KD 1IY2A 1RRFA 3QKSB 4JLNA 3K09A 2IT1A 5DN6D 1Q1ZA 1U9IC 1XJQA 5HZKA 1A1VA 1QHGA 1N2CE 1NLZA 1EP2B 3PUVA 3D6TB 1U90A 3EZ7A 1G18A 4MH0R 2X2EA 5CIWA 1US8A 1W47A 1S4QA 3OE7A 5LD2C 1G1MA 2UZIR 3IPYA 2XTZA 1E1RA 4US1R 3RWMB 3ZBTA 1IM2A 2QTZA 3CF0A 1E96A 1AQYA 1SZPA 2ZYWX 3ASYA 5DLQC 3VFDA 5JSZB 2OM2A 2HUPA 1ZU5A 5FPYA 3VQTA 3CCUB 3MMPA 3QKRB 3SJZA 4HLUA 5H68A 4DVGA 1Z22A 4B2IA 4S2EA 3C8UA 4L15A 1G16A 3K8YA 2BV3A 3SBEA 4Z54A 3PITA 3GD7A 1N6OA 4MYCA 4B3XA 4URWR 3TUJC 3EZ2A 1H42A 2D7DA 3W5IA 2QP9X 5HE9A 1P6XA 2XNSA 4FCWA 1CJKC 1W46A 3ETLA 2XB2A 3AP1A 3A37A 4C43A 3U4QB 1E0SA 3PV0A 2O8FA 3CCVB 1XEFA 4B4DA 3JVVA 1XEXA 1PLLA 2QTFA 4EQ6B 3GLHB 2X77A 2ZAMA 3ND8A 4B35A 2D2EA 2WWIA 3MWYW 5KPJA 3TSWA 4M53A 4OI1A 4TSFD 3CO5A 1KSFX 1ZD9A 2IYWA 3EARA 4RD4A 1NBMD 1QHSA 5JWHA 3U7FB 2Q6TA 4R7ZA 1E2LA 1T8UA 1NNEA 1G41A 2A5FA 4NCKA 5CYOA 2KB0A 2BM1A 4WA7A 5SZKB 1S0UA 4XD7A 3U2QA 1OHHD 3KXLA 3QNUA 5KSYA 2QPTA 1OH8A 2CL7X 4CDGA 2GEUA 3CPJB 5F98A 4GOXA 5AUPB 1NMZA 4GL2A 3MHPA 1XMVA 3UMSA 3ZIAA 2RGDA 1EXMA 4NPHA 1T8TA 2OEPA 1W0JD 5L3RA 3PEUA 1VG8A 3CR8A 3Q72A 4YMUA 3ND9A 3FJOA 2RGBA 4PPGA 2ZVQX 2NZJA 4QNMA 4QHYA 1EX6A 1ZM7A 2R6CA 3EIHA 3ZDQA 4M2LA 4DLYA 2FGKA 1SVSA 3W5VA 3B9PA 1R5NA 5AJVB 4YMWA 4LWZA 3I8XA 4WZAE 2FH5B 4U7DA 1VQ6B 5TXGA 3JQQA 2FPMA 1HT2E 1I2MA 4DBLC 4PAQA 5FBQB 3SYKA 1AMOA 4C0AC 2QSYA 1SVWA 1MOZA 3G82C 2RHDA 1Z8FA 3QKRA 1IXSB 1KDOA 1XMJA 3L0IB 2DETA 3N2EA 2IS4A 4D80A 5IT5A 1M2OB 4PTLA 5D3MA 4LYHA 5F2EA 2E9SA 3VKGA 4H9GA 1KDRA 1WMSA 4HDQB 4DLVA 3IQXA 1QGYA 2P6UA 3G4SB 1CIPA 2ZJAA 2ONKA 4JT4A 4Z51A 1IAQA 4BFZA 4FCVA 4NTZA 2WVJA 2DFNA 3U6BA 1FMJA 3Q5EA 4DEYA 4LOAA 3Q7PA 2VIIA 4RD6A 1HT1E 1KO1A 3CC7B 2BBOA 4KBFA 4LJYA 4PAOA 4Q1EA 1S3GA 2O8EB 4RKEA 2PBRA 4KFSA 3A1UA 1XWIA 3HR8A 4NYJQ 3LDAA 3ZH9B 2ZE8A 2QPAA 2J7PA 3PUXA 4LUCA 1XTSA 1RRCA 4M22A 2JA1A 5JWRA 2ZSEA 1A5TA 4PSKA 3X1YA 2C77A 3I3SR 2RGEA 1UKZA 4AK9A 1PLJA 4Q9LA 5GADl 2ZJZA 4OKSA 1ZVQA 4R9UC 2J87A 4V0KA 4W9MC 3BH7A 4TL9A 1UKYA 3KKNA 5SZHB 3BBPA 4LDJA 4C0BA 4L9SA 5G3ZA 2F43A 2YOFA 2ZE6A 4GP6A 3AVTA 3ECCA 5CLQA 3GLGB 2EIXA 3DL0A 1Z0FA 4TT3A 3HPQA 3AF3A 2QMHA 2ERYA 2BOVA 2VSFA 4M0LA 2ZUBA 4PQFA 4C9BA 1KK0A 1FRQA 2QA4B 3B9QA 1TTTA 4D4KA 2AL7A 3GJ6A 3K0AB 4AYXA 4BFVA 1BO6A 1NVWQ 3KTAA 4PQYA 4EFNA 5FL7D 4C0QC 2GBLC 5DGXA 5DIFA 3E1SA 1P5ZB 1IY0A 1N6RA 3TH5A 2J3EA 3CCMB 1SVLA 1BYIA 2BBWA 1J9ZA 1KQSB 2PT7A 3B7GA 1D2MA 3HJNA 4UAJA 4R2IA 3P4XA 3DHWC 1KMQA 1BQEA 3WYAA 3CXCB 3AF1A 3EZ6A 4NHOA 2I3BA 3X1DA 2HXYA 1Z5ZA 3CRQA 4HLCA 2IA5A 2C04A 3P20A 1XEWX 2GWHA 1YZUA 2JLWA 3K70C 3NXSA 4DDWA 1HV8A 2B7CA 1Z2CA 3U44A 3SQXA 3AUYA 3CNOA 4ZO4A 3UG7A 3BB4A 1RC8A 1MT0A 1YZTA 4UJ3A 2KWIA 3A1SA 2AR7A 2YINC 2EFCB 4KAXA 3C15C 3GEIA 3OHMA 4P3YA 4KJZA 1KI6B 3OJWA 2O0HA 3ZD6A 1E0AA 1XTQA 4V0NA 5JJIA 2N46A 3BK7A 1T5LA 5FTLA 2FFHA 3DOEA 1UBCA 1HYQA 1Q21A 2WIBA 3JZMA 3W34A 4QHSA 2GXUA 2IYQA 1NRJB 1Q44A 2FEOA 2IHBA 1ZNZA 1BJKA 4Q19A 1SKQA 3CLVA 3L43A 1WBDA 5JJKA 2GZAA 2AWOA 1GZSA 3CWQA 4QHTA 5FOTA 1C4OA 3SQWA 3T1VA 2AFHE 3CPEA 2YNMA 2OK8A 4K46A 5FPKA 4JZKA 4BZQA 2F43B 4AKEA 2IYUA 3U3KA 1WXQA 3VKWA 3RSLA 5LPNA 4CT5A 4Q9IA 721PA 2PL3A 2NO1A 2W58A 4US2R 1CU1A 1KSGA 1ZAKA 5C2JB 1BH2A 1ZW6A 2X2FA 1D1NA 2IUUA 1U0JA 1DARA 5FA6A 2RAPA 4RD3A 4BQSA 3QEOA 2QTLA 3OW2B 1DG3A 1Q20A 1HE8B 4TMVA 3FMFA 2Y8EA 4LHYA 1KOFA 4LC1A 4U00A 1GR1A 3F8TA 3I32A 2HMAA 2ZE5A 1W0KA 4XIGS 5KPDA 2F1HA 4C2TA 4EUNA 2QM7A 3WNCA 3VX4A 3EPJA 4YLGA 1DAMA 4XWOA 4Q02A 4AG5A 2FG5A 1KO7A 1N3BA 3LWNA 1UAAA 5LB4A 1VG1A 2Z0MA 3BD9A 4FN5A 3EA0A 3TQFA 2AN9A 4B3FX 3I55B 4IOLA 3EPKA 2QBYA 2IF0A 3N5CA 1LTQA 2XB4A 1W4BA 4DLSA 1E1RD 3Q8XB 4ZIRB 1OH5A 5JHGB 4DB2A 4QM6A 3MGCA 5EXTA 1CXZA 3UMFA 2WV9A 2ONJA 3ZZ0A 2CLSA 2IXGA 2EFGA 3U44B 3DOFA 5JI2E 4NCIA 3OEHA 4ZCMA 1FMLA 5FFMA 1EFRA 1E69A 3PJRA 4RZUA 2MMGA 1Q1BA 1Z6TA 5AWFC 1Z08A 4IEIA 2Z43A 2GCOB 4FMDB 2GKSA 3EZ9A 1HA3A 4O0MA 5HTKA 1ZM2A 2FU5C 4HUQA 1XCGB 4NYJR 5FPHA 1D2EA 2R9VA 2C95A 4FCTA 2GZDA 2AD5A 1JBKA 1L4YA 2WAYA 1XZPA 2DFLA 5DHFA 4NE2A 4QBHA 1KYIA 4URYR 5J5CA 4LX0A 1HQCA 3CC2B 3LH5A 3GFPA 2WWXA 4R98A 3T15A 4DDUA 1P3JA 1T91A 4HAVA 1KY3A 5CM8B 3MSXA 1G4UR 1US8B 4YC7A 3AVYA 3EC1A 3MCAA 2ZRKA 3KKMA 4IRUB 2FE4A 2WZQA 1W2GA 2BKEA 2GRJA 2JEOA 2C5LA 4JLJA 1XXHE 2AFIE 2QAGC 4LBYA 2WBLC 4JSTA 1RRGA 5J4YA 3GJ0A 2OTLB 2GK7A 5JI3E 2NMVA 2BMEA 4M4SA 2YZ2A 1SVKA 4P32A 4BZXA 3B13B 1KDTA 4WQMA 2FZLA 5C4GB 2QQ0A 2W2TA 4KV9A 1W0JA 4OI0A 2BEKA 2JLSA 4I1SA 2NG1A 1UEJA 1OXVA 1ZRHA 1GRNA 4EPVA 2PCLA 2ZYVX 2OG2A 4HLQB 3W3ZB 4DRZA 3RLFA 2Z4SA 3L8ZA 3MLEA 4Q4HA 1AS3A 5GJVC 1MO3A 2PH1A 5THXA 4URXR 1Z0IA 5FUXA 4B6FA 2GTPA 1ODFA 2JIZD 3H84A 4ZI3A 1EP1B 2FOLA 3AVOA 3L0SA 4PO9A 2HLDA 2CLDX 2G0NA 3IGFA 4ITRC 3SHWA 5HZHA 1NG9A 4QG7A 1GUAA 1DS6A 4URZR 2IYSA 2H16A 3ES9A 2P67A 1QGZA 1R0YA 3FKSA 1VDZA 1XEXB 1KK2A 221PA 4BECA 5CB8A 2ZS7A 1CNFA 2FJUA 4DQKA 2C9YA 3WY9A 1E0JA 4RD1A 1M7HA 1FNCA 1JR3D 1GP2A 2VH5R 5SZJA 1T0HB 3NHBA 2OCBA 3ZVRA 1U81A 2WPDD 1AA9A 4TQUS 2LCFA 2EFHB 3W5JA 4Q03A 3BRWD 3FMIA 4DC9A 1NBME 1E2EA 4OHYA 3CR7A 4NCJA 5A0FA 1D5CA 1DAKA 5EXSA 3U61B 4W7SA 5FR2A 1H65A 1V5WA 2GEDA 4MITA 2X3UA 3AGQA 4OHXA 4F7WA 4MDEA 2OTJB 4JL5A 5ANRB 3ZZTA 4DLTA 4DLRA 4Q1CA 1NIJA 3NC1C 2IWRA 2JJ2D 1XXHA 1OYYA 3GJ7A 3K0FA 2OFOA 3FFAA 3SBDA 3CUEF 3WBKA 3OZWA 2DHRA 3HYTA 4C7OA 1VMAA 2MMCA 1YJ9B 1E9FA 2RHMA 3V4RA 5TVKA 4D82A 1G8FA 3AM1A 4QM7A 2XZPA 4AD8A 1KJZA 2REBA 1XJ0A 2ZANA 4B32A 2WWYA 3LAWA 3BWDD 4JLAA 4Q9KA 3FFBA 4QKQA 1COWA 4LPKA 1JXMA 1TNDA 3U7EB 1VIAA 1S8FA 5CYPA 2GDJA 2TMKA 5H59A 1GDDA 2KBEA 2BM0A 1QVFB 3QY0A 4PR0A 4IFEA 1YVDA 2ZR9A 3WMFA 3GLFA 1EFUA 4IW3B 1E79D 4MYUA 4Q00A 4YALA 1E62A 4XOIA 5D3MB 1OXUA 2AKYA 3SNHA 3T5DA 2P6NA 4JVMA 3SHFA 1YZKA 4JMPA 5HR5A 2ZJ8A 4NZYA 1GIAA 1T4GA 4WZBE 2ZSFA 3Q7QA 1DAIA 1XBTA 2F55A 4BLSA 2O8EA 2CEAA 1X1RA 2GQFA 2C9OA 1WP9A 2ERXA 2X19A 3L0OA 1PUJA 2GCOA 4Q21A 2NGRA 2H92A 3FOZA 4CEIB 1IXRC 1R8SA 1EG7A 1JQLB 3GFOA 4NDZA 1M90D 2B8WA 4GFDA 2HV8A 3A1VA 5JECA 3BOSA 2VHJA 5L3QB 1E2HA 3C7KA 2WHXA 3ADCA 4HEJA 5EMNA 5JZVA 1NJID 3OFNA 4JJZA 4MUBA 8OHMA 3TRFA 2AK2A 1UEIA 4MRPA 1YI2B 2OSBA 4ZDIA 3K0AA 4EPYA 5FBVB 4BFTA 3CKLA 1QVRA 1KI3A 2RKOA 4F4CA 1S1MA 4HAUA 1U2RA 4LJ8A 3F5FA 5G41A 2RC5A 2BMFA 1XZQA 4A8JC 3DEFA 4EJSA 2BMJA 3THOA 1Q7YD 1RYFA 4BFYA 4B48A 3T5GA 1NN1A 2QORA 3TLXA 4LC0A 4EPXA 3TVDA 3UXMA 1P60A 1JEEA 1Y3AA 4KODA 2IBMA 1X8LA 5FI1B 4LYJA 3GLIE 1U9IA 2D74A 3SI7A 5JCPA 1VQPB 2BF4A 4TMTA 1TEVA 4POAA 4O3MA 3FMPB 1KDPA 1KNQA 1FNDA 2YV5A 3QQ5A 3SU8A 1WDTA 1E94E 2VBCA 4M21A 4CVNA 1DAFA 2HDNB 3GMTA 4XTRA 2IWHA 2ZRGA 4ZKEA 4ZDWA 4NCNA 3GJ5A 4M9SA 1YRAA 4E03A 3O8RA 4BLRA 3HDTA 1GOTA 4EAQA 4NMMA 1KKMA 1ZUNB 1A7JA 4TLEA 4X8HA 5CJ2A 1KKLA 2PT5A 3E5HA 3VO2A 3VNUA 1KJYA 1NVVQ 2LWIA 1CR1A 3SOPA 2IYTA 4W5HA 2ZRBA 3CRMA 1KGDA 4DIDA 5J47A 3WNBA 2MSEB 2A9KA 3BXZA 1VQMB 1XTJA 3KQUA 3BIFA 1EFRD 4DXAA 3W90A 1TL7C 4D4JA 3OZUA 1OKKA 5EJEA 1NMYA 5FOWA 1FDRA 4B76A 4M8NE 1XE1A 1VYUA 1GAWA 5GV7A 4KFUA 3MJRA 3GLHA 2PX0A 2YOHA 5H8WA 5KU1A 1F3OA 2HT1A 2JLRA 5E7IA 4TTPA 1JR6A 3QFCA 4WXRA 3QOFA 4I1OA 1MR3F 2Q21A 4JVNA 2CNDA 1RVDA 2QPOA 1E2PA 4DDVA 2VNKA 1VQ8B 3B1VA 4MRVA 1X3SA 4HZIA 3BB1A 1EESA 3A8TA 1UMKA 5FOSA 3NBYC 1XJCA 1R0ZA 2IYYA 4FW9A 1AKYA 4I99A 4TYWA 3VMFA 3QJYA 3WMEA 4NL4H 3ICQB 3BERA 3EA5A 1YJ5A 4KSCA 1NVUQ 2EFDB 3TR5A 5EE1A 4B47A 3QKTA 4KVGA 3U3RA 1Z07A 2JDID 4MKIA 3TGPA 1Z0AA 1F2TA 4XJXA 3OZVA 4KSBA 4LBZA 1DVRA 3B85A 1G7CA 1XCMA 3IHLA 4Z1MA 4CF7A 4JIMA 4M9XA 4GMDA 4HDOB 2AXPA 2PMKA 2R6DA 2IYLD 4EJSB 4C3ZA 2J0SA 1JR3A 3AQ4A 5GJCA 3NBZC 4OK3A 1YHQB 3W9YA 1RW4A 2JGNA 4GZLA 3J81k 3OIWA 3QPUA 3T1TA 5TB5A 4OQFA 3IIMA 3I73A 3O8CA 1OE0A 2XOKA 1YKSA 5CDFA 2QAJA 5EXPA 4WZ6A 1F2UB 2R6HA 1SVIA 2VYFA 4Q48A 5ELXA 1OIWA 1UFQA 2CDNA 2VNIA 1MABA 1I2DA 2F3RA 3QXSA 5BXQC 3RRZA 2REXB 2IC5A 4P4SA 4X8MA 3KQHA 2CK3A 3VR6A 3E20A 1WQ1R 3NBFA 3QBTA 3T12A 1J70A 4EPTA 2XXAA 3QIAA 4JLMA 3L82B 2BJVA 4U5XA 1DO0A 1CRQA 5JMTA 2WPDA 3W2FA 1G7TA 4JLPA 4EFLA 4YDHB 5HE8A 1RE0A 3OESA 3KJEA 2ZS8A 4B33A 5KNBA 2N1BA 2IEYA 2P3SA 2MSDB 4Q9JA 1SHKA 3QF7A 1OGJA 2R62A 5AJYA 2HXSA 1ZM4A 5IK2A 4TYNA 2JLZA 1FNBA 1TF2A 4ABYA 1GFIA 1W36B 1HURA 1TUEA 4PX9A 1ZINA 1S96A 2WWWA 1DEKA 3W6PA 1XP8A 1OYWA 4UXIA 1D8TA 1M74A 2BEJA 3A6PC 2ORVA 5AK0A 3KTAB 4RSGA 2ZJ2A 3B1WA 1A4RA 4RFVA 1G5PA 1Z0KA 2W6ID 4UJ5A 1LNZA 2B5OA 1RZ3A 3IKJA 1W35A 1C9KA 1KK3A 1CKEA 4EQ6A 1IB0A 5HPYB 4A36A 3EC2A 1ZD1A 4ASUD 4B3GA 2XNDA 5FUYA 3WXMA 1DPFA 3BFXA 4TL8A 4Y0AA 1TF7A 3C41J 3NDPA 4NH0A 1ZM9A 1W1WA 2WSSD 3LV8A 4IVPA 4OQMA 4CEHB 4TMXA 1XD2B 2ORWA 2EW1A 3GEEA 3E70C 4MRSA 2QA5A 3R9XA 1KZ7B 3RS2A 2WIAA 4I81A 1K8AD 1T9HA 5UKDA 2QEXB 2VZLA 3BFVA 2ZRCA 2QTVB 3LW7A 3RRMA 5KDDA 1A2BA 3T1QA 1QDEA 2QGNA 4I1VA 1G5TA 3W6OA 3CZPA 4B3CA 1JB9A 5EUMA 3BJIC 1JAHA 1NMXA 3TIFA 2E87A 1G8GA 3LX8A 1XU4A 1DE0A 2GZHA 3O8BA 2J0UB 3OE7D 4JBYA 1O87A 1UADA 3ZS9A 1E9AA 1IJEA 1NN0A 4DQLA 4PPNA 3GJXC 2QDXA 2V1XA 3BE4A 2CJWB 3VO1A 1VHLA 3B78A 3LXXA 4IDNA 1E79A 3AB3A 3GLIA 1XNJA 3PG5A 5E95A 3QPVA 2MSCB 4F91B 3I4LA 3KDSE 4LBWA 1CJMA 5K8LA 5CLLA 1KK1A 1MH1A 1QRAA 2FFBA 4WXPA 4B2LA 1BX0A 4RKFA 3NDBB 3W6NA 2GJ8A 3VR2A 3AVQA 4TQAA 2ODBA 3R20A 1K5GA 1P2TA 1Q82D 2QEQA 2ZXUA 2J7PD 2K5UA 4OQXA 1CLUA 3KJIA 5EP2A 3CF6R 3CX7A 4EH1A 4JLDA 5P21A 1LFDB 4PANA 3SYLA 2DY1A 3CCRB 3W3AA 3V4FA 2OZEA 4V03A 3CMEB 3QSYA 1JXOA 2H8KA 1ZUIA 3KUCA 3OJXA 3KJHA 4DUGD 2LKCA 521PA 2B92A 1OFIA 1GAQA 4YAUA 2JCSA 2PZEA 2RMKA 6Q21A 3P27A 5KDLA 3NTUA 2OK7A 1QHYA 3CPWB 4DT1B 2WJIA 4C7OB 1H8EA 1UBFA 1DO2A 3TUIC 5CDFE 2CCJA 4LCBA 2XNDD 3N70A 1OJLA 1K73D 1VG9B 3QBVA 1MO6A 4DEXA 2ZRPA 1J8YF 3B1ZA 1OXSC 3A4MA 4Q7MB 4RFSA 2V3CC 1YQTA 2F9LA 1OKKD 5BQ5A 3VU9A 4A1FA 1JJ7A 1KI9A 4ACBA 2B21A 4QGHA 5BYKA 4L8GA 4LHVA 4TLDA 4Q1AA 2RGXA 1E1QD 1RJ9B 2QMEA 2F9MA 3TK1A 1G8HA 5LB2A 4L4UA 1XD2A 2NTYC 3KQNA 4XD7D 3CCJB 2J0UA 3EG5A 4XTCS 3BH0A 2OE2A 3CNNA 3DM5A 1Z3IX 2ZAOA 1W49A 1AZSC 1U8AA 4Q4JA 3I62A 3TMKA 4A6PA 2Q9BA 2VP6A 4O2RA 4OQNA 3IIJA 4LHWA 4DCVA 5C4MA 1FUUA 3P1JA 3EIQA 4RD0A 2BCJQ 2QY9A 2R6AA 4C0KA 1SM4A 2XOKD 1NLFA 1DAHA 2V4ZA 2YC4C 2AD1A 5DO9A 5DE3A 4OYHA 3OAAD 3FHTA 3JQRA 4BFSA 5GJWC 3ZS8A 2ZJ5A 4HB0A 2Q3FA 1ZUHA 4DSTA 1IOZA 4F93B 2DEUA 1SXJD 3GLGE 4CEJB 2C78A 3K1JA 2IS1A 1K8RA 4OI4A 1F2UA 1P7CA 3HYRA 1CEEA 3ZIAD 2EWWA 4B3BA 1UBEA 2QZ4A 4GT1A 3LRPA 3PUZA 4DLWA 2O8BA 1E63A 3E1YE 4YMVA 1OLOA 2A5DA 1HQYE 1KSHA 1GKYA 1LF0A 5B2ZA 1BS1A 3LX5A 2EFEB 3DZ8A 2NPIA 4NYMQ 3SE0A 2RCNA 2C99A 5E4FA 2OHFA 3OZXA 4BRWA 1FOEB 4KCGA 3PXGA 3SYNA 3AVVA 3LO5A 4NKRA 3LLMA 3AKYA 3NEJA 2G6BA 4JJKA 1QHNA 1KI7A 5CJPA 4EPWA 4CGZA 1XPUA 3MWJA 1P2SA 2FEMA 1FNMA 4HSEA 3ZQ6A 1S3SA 4AKGA 3PIRA 1B2RA 4XH9B 2CNWA 2BGJA 3K9LA 2VP4A 1LV7A 1VYTA 4JKYA 3I5YA 1E9CA 1U8YA 3A4NA 3LA6A 4ZKDA 1GNPA 3K9NA 1AGPA 3M6AA 3C4JA 4Z8XA 4UQOA 4M9QA 3UIEA 4BGDA 2ZI9A 1T3SA 3N2IA 5FL7A 1L4UA 4GP7A 4D4MA 1G20E 4P4TA 3B6EA 4NYMR 1G3MA 3D3QA 3U7GA 3WBJA 1E2FA 1LW7A 2J45A 3HU1A 1GKUB 3UMRA 2BJWA 3A1TA 1EX7A 1N6LA 2RGGA 3PUWA 5AJXA 3CF2A 5E3HA 2F1RA 5G40A 3CBQA 2IS6A 3QE0A 3OIUA 3RABA 3G6EB 1EGAA 2DBYA 4ZPXA 2P5TB 1HTWA 3WP1B 4QL3A 3EX7C 4D25A 5H5JA 4WIAA 2BBTA 4IOJA 1SXJE 4TLBA 4YAOA 1JEDA 1WCV1 4ON9A 1QHHA 2PEYA 4D4LA 1OSNA 4N0EA 2R2AA 3LBNA 1CTQA 2DWQA 1AJEA 4EPRA 2QI9C 4A2WA 4WBSA 1HEIA 2KJQA 1E64A 5FTJA 1P9WA 4KHZA 1Q0UA 3F3YA 1GTVA 5KHOC 3G71B 2NIPA 2VP5A 2QE7D 5J4VA 1M7GA 5KNDA 2V1UA 5JHHB 5JRJA 3W2IA 2ZR0A 3FVQA 3D7MA 4LPSA 4EDHA 5L8VA 2OESA 5FOVA 1E3MA 4G5SA 2QQEA 3RVBA 4I1UA 1KZGB 2JIZA 2VNHA 2ZSBA 4TMZA 2CVFA 4ZCLA 2HJVA 4P33A 1T3LA 1ZM3A 1E0KA 4NYIR 3W2GA 1JQJC 1NIPA 2ZS9A 2G77B 4Q4LA 2RGAA 2REOA 3VKHA 1VQ4B 3FPKA 4AKHA 1RYHA 3FKQA 1II9A 5HCIA 5EP4A 3I72A 1GO2A 2R44A 4XWAA 4FI3C 1Q1QA 3KB1A 1P73A 2AXNA 1SXJA 2VL7A 3W2EA 2DCUA 3CW2A 1E9DA 1JI0A 1T6NA 1UBGA 2W2VA 3U3JA 4ARZA 3AH8A 4Q1FA 2Z5FA 4PFSA 3QVUA 1JPJA 1VCMA 1EP3B 1CULC 1ONBA 1KI1A 4E09A 4FMBB 1NSTA 4Q4JB 2V6IA 3SJBA 3LO8A 1YJNB 3VHLB 4Q1BA 2IW3A 5KO2A 4IJMA 3PR1A 5FPSA 1Q3HA 3U5ZB 1H8ED 3CMAB 5JBQA 4TYQA 3GPLA 5F9FA 1DDIA 1D2NA 1XRJA 5HKKD 3SFVA 2SHKA 4P0TA 1SVMA 1SHZA 3NH6A 3PVSA 2EYUA 1DDGA 1JECA 3OEHD 4MKFA 3QXHA 4PC7A 3DO6A 4HB3A 1YR7A 4NYIQ 2DFTA 2JATA 4QJ5A 2JJ2A 2QP4A 3I92A 1E2IA 3ADBA 3QXCA 4RFSB 3EWSA 2AHOA 3TW4A 4Z1MD 1Z0DA 2FNAA 2A3RA 4JYBA 3QF4B 1NLYA 3VR4A 4PQRA 2PIAA 2ATVA 1OH6A 1R10A 4ZCIA 4PGOA 1X8KA 2GF9A 2CVHA 5A4JA 5KNCA 1N5IA 2ZRLA 1EFTA 2H17A 1E2MA 3GEHA 2BSAA 2CE2X 1COWD 3AKDA 4PZLA 1EFCA 1TMKA 5KDOA 3Q85A 4D81A 1QHHB 4OJKA 1K5DA 2WMNB 3FTQA 2VP0A 3LQRA 4Q4AA 4IHQA 1MV5A 2ZIAA 5DI3B 2YHSA 3QPWA 2VP2A 1Y63A 2B6HA 4LI0A 3U60B 4CEHA 1G291 4AYWA 1XF9A 2WWGA 4GNKA 3KFXA 1QG2A 4DLZA 4HZUA 4QBGB 2ZRAA 3T35A 1R6BX 2FSIA 4Y7CA 4PHFA 2ZRDA 3RRNA 3TBKA 4OL0A 1IN5A 3VTKA 1EK0A 5IDVA 4BFXA 2J5XA 3K70D 2OCAA 3G5UA 2YKGA 1PJRA 4JLOA 5FOUA 5FH9A 621PA 1AKEA 4KLZA 4YMSA 2VF7A 3SDZA 1YZNA 2AK3A 4FWIB 1OXXK 2ZSDA 3MD0A 2W00A 2BMWA 3AKEA 2OBNA 4PAMA 2IXFA 3RDPA 5C46F 2C2HA 4PZZA 2B7BA 2IXEA 5FTKA 1G3RA 2H7VA 4CYMA 1VIYA 4A82A 2R8RA 2ZROA 4C0JA 3PEVA
chains in the Genus database with same CATH superfamily
3E84A 4FE3A 1DX9A 2R2GA 3TIIA 3VZDA 2G71A 4O3FA 1DX4A 1WHTB 5MGNA 4ZVRA 3IP8A 1CS0A 2A5GA 1C2TA 3CX6A 1SMKA 1H6AA 4HUQB 3ZU5A 4JVOA 4TZTA 5K05A 3G9UA 3WS7A 4MGIR 2Q3MA 2W4IA 3I5UA 1OWNA 3E2IA 3HSYA 5F7ZA 3G1WA 5T4FA 1DQYA 4NBTA 3RYCA 5KNLA 3NJ8A 4K9OA 2EC5A 4LXIA 3NEYA 2QX7A 3KOMA 2D4HA 5F33A 5CA0B 1SD5A 2I4LA 4J6EA 5HF6A 2CL0X 3K05A 4CWAA 2Q9AA 2ZIUB 2CNNA 2CZCA 1K66A 2BR5A 5ER6A 2JBAB 2Z2IA 1O8CA 3CSDA 5JFGA 3OZFA 3N76A 4P83A 2WJVA 2O19A 1CDOA 1IWPB 2XRZA 3GFFA 5F64A 1II0A 3A1WA 5BUQA 3L0YA 3LUBA 2HIGA 2EG9A 5KKCA 5GGXA 3UT5A 4RS4A 5L3SB 3TLCA 4C9BA 4OFBA 4R4JA 4D2IA 3OUTA 2FDCA 2ODQA 3H13A 4HWOA 4NXMB 4ZGNB 1ZNXA 3MCVA 3PFGA 4OPVA 4MARA 2JC3A 5DXFA 4A15A 5A3QA 1KEWA 2WJHA 1AM4D 2B4TO 4TMWA 4WLVA 5IM5A 1NYQA 1XUOA 3DAPA 3LGSA 1F6WA 3HRKA 3Q9UA 4MUAA 4OGLA 4MO9A 1NXWA 3TLJA 4D8TA 3ESCA 4YCBA 1PWHA 2DWOA 3A32A 3FJ1A 3VNSA 5JCJA 3WTBA 5AUNB 3ED5A 1V7CA 2J9ZB 5ALRA 3MMNA 1NKVA 1Z36A 2AG1A 5EGSA 5IC4A 3OQNA 3GVJA 1BRMA 1CQIB 1C0EA 5CGQB 2DFPA 1B8VA 1A8PA 5E6SB 3TM5A 4D96A 1SC1A 2DM6A 4W1RA 4G63A 2HF7A 1NP7A 5AQEA 3UMGA 1WABA 2ZCJA 3ZDEA 4HUTA 3EAFA 1TUIA 2O4UX 2NO4A 3IPXA 3B3AA 3PJEA 4HMPA 1FP7A 2DR3A 2GN0A 2J9YB 4Q1VA 3S2ZA 2JCVA 3R75A 2GO1A 4YLEA 4K9SA 5ALTA 5DSTA 3OEYA 4FE7A 4RXTA 3R0ZA 5EPEA 4DG5A 4BPBA 3G1TA 1M76A 2X0RA 4IUDS 5C1BA 3TM4A 4HX5A 3BCDA 4P35A 3RV4A 1V8OA 2FDXA 5HW0A 3JS5A 1O2DA 1T2AA 4POOA 1XTBA 1KC3A 1EHIA 4HXFB 1FPMA 3A4VA 1ZD3A 3MLBA 2B9VA 3WLQA 3UV6A 2FW1A 1YRBA 3FG9A 3G79A 4XLLA 2PKWA 1ZK3A 3BZBA 5SZIA 3WIEA 2Q99A 1TU3A 4M9CA 5CW1A 2Q5HA 1QF7A 1Z6GA 1QZZA 2IYZA 2P7HA 2WYWA 3CIOA 4F9FA 4B3HA 3WL8A 2ZITA 1AY0A 5KW9A 5K45A 4BLVA 2V7QA 3QE4A 2VXBA 3A9WA 4AF6A 1GCUA 2JAUA 3BQ9A 2HIAA 3CUTA 3DZGA 2AYXA 2Y0BA 3RC2A 1E4OA 4WKGA 2C9ZA 3H9CA 1BG6A 3CR3C 1VJGA 3R7WB 1WEKA 1DINA 1RJWA 1R15A 2OPBA 5C5DA 3OT1A 3L0CA 4ZQIA 1EJ0A 1R0CA 2KBFA 3F6SA 2ESRA 4J0CA 3OX1A 4NONA 3KQOA 5TDHA 4IXDA 1H0KA 3BTVA 4OQLA 3K0FB 3L8GA 3LTEA 3PGMA 4Q16A 4F86A 5HYVA 4B2YA 3E7DA 4I14A 4YRMA 5CVVA 1II8B 1DJNA 3RS8A 4L78A 2P7IA 3TN7A 1BCSB 1KQPA 1MIOA 2QR2A 2X8JA 4DLUA 3ZTWA 3DT8A 5HDBB 4F5ZA 2E5LB 1D4OA 2VZ0A 3QVLA 1LBSA 4MWOA 3LZ6A 3LU1A 1M3SA 2PV0A 3GLIB 2CRVA 3EW9A 1QFZA 1QE3A 3GLUA 1YKGA 3KOYA 4PG4A 5F76A 1UJ2A 3RS0A 4D4GA 5A62A 5L7YA 2PUCA 1W44A 2ZVJA 3K9GA 5D85A 1RWPA 1SXHA 3DV2A 3LBIA 5DTRA 1CF2O 2NTNA 3O4IA 2JLQA 4DYHA 2P5SA 5DSZA 4DANA 3IEIA 2OOKA 4K6OA 4J0QA 2XGMA 5TMEA 3UH0A 2LR0A 4M9UA 4A5SA 1DXOA 4B9EA 2Y2UA 1KETA 1UIMA 1STOA 1WW8A 2HNKA 5TF4A 5JBNA 3AM4A 1A8QA 2COKA 3ELWA 1A8SA 4G65A 1RPJA 5FX2A 5IG2A 1NQUA 1PUXA 2MT9A 3MLAA 2WA2A 4PX5A 4ZO6A 5E4JA 3SY8A 3T4PA 4G01B 5GONA 1HKUA 1W7AA 3O8LA 4S24A 4MI3A 1KZHA 5AKLA 5DNWA 4ARUA 3PEWA 3HCOA 3GCWA 2XZTA 3PDHA 1RHKA 4MVJH 1KH2A 2GM9A 2QKYA 2GNOA 1M2GA 4X7CA 3FKSD 1QPBA 1V8DA 3H9NA 1IBRA 4PXAA 1N25A 2YN4A 3SS7X 1RQ7A 4E5UA 4PYMA 2FW7A 3KAKA 4TKLA 4PIPA 5C8YB 1LY1A 3QUQA 2QN1A 4P4UA 4RY0A 5ADUS 2WQ7A 1QAOA 5IC5A 3GLFE 4R1QA 3FCUB 2G4CA 3EIOA 3V3KA 1O97D 4EZBA 4TV8F 2ATCA 4Q01A 5AOVA 1XYYA 3H05A 3N28A 4D6PA 2QN3A 3PKZA 5A4IS 3ETGA 3RSZA 2O2JA 5DSXA 2Y27A 1WOPA 1DIAA 1MEOA 1NJGA 3EQZA 4AG3A 1WQ4A 3TB6A 2QL5A 4BNXA 2JLXA 1F0PA 2GGSA 1FVHA 1P31A 3NKVA 3W1WA 2HYIC 4KR3A 3IBTA 4B7AA 4L08A 2V31A 3VSDA 1CJTC 4E21A 3D59A 2H2FA 1G5HA 1NAHA 1KQGA 2OBRA 3ZHZA 4F4UA 5CLIA 4QYWA 3OO0A 3SZ3A 3IODA 2QQFA 4ZTZB 1CJUC 4UQLA 5JRDS 1I4DD 5FV7A 1XCBA 3GZTB 3GZ4A 4AJJA 5LNK1 4LJKA 4L7VA 1VG0B 4L2IB 2NZWA 1WEHA 3BUSA 1PJ3A 1ZHHA 1QSGA 2FSVA 3HFJA 3RSFA 1A27A 3HM2A 1BVHA 4EG8A 1R0SA 3LIIA 3R3XA 3CKYA 3LPCA 4L6AA 4WN9B 4HWKA 1OAOC 3NU1A 2VP9A 3R24A 4OLBA 3DQPA 5F5LA 2BN4A 2FQWA 3ND5A 3T5BA 3IV9A 2VH2A 3QHAA 3WL3A 4MW7A 2IK8A 5EQTA 1QRSA 4NZZA 1VQ9B 4TVBA 2TSYB 2Z3ZA 1BTOA 2AT1A 4D9GA 4UW9A 1NKSA 3S55A 4GPBA 4ITUA 5BQPA 1NRIA 2RK3A 1EXDA 1L8OA 3LMKA 5DVZA 2ZJBA 2EF1A 2J59A 1N6HA 2X23A 3CZQA 3R5HA 3TB4A 4KN5A 4WRRA 7MDHA 1QH1A 4A0RA 1ZWLA 2QLTA 5J1TB 2FR8C 5JALA 1ZGZA 3DT6A 1RZRD 1DRKA 5GONB 2CJFA 3E1KA 3GFBA 2I6XA 4FDLA 1XK7A 3UWKA 4F2PA 1I0IA 1VOTA 2FZKA 2H18A 3F78A 4XVRA 4UM9D 5IH3A 4DN6A 5FWNA 2ADFA 2ZJYA 2FETA 3KKLA 4N49A 2JW5A 4D5EA 4LF7B 2WU1A 3O9VA 1RWKA 5JD6A 3GLHE 5AKYA 4Q66C 2XOXA 3IBFA 5IJ0B 1TADA 4EKNB 2JIRA 1W9HA 1ZMRA 5HXBA 5J2TF 2A6PA 1FTYA 1FDVA 2C9DA 4Z99A 4HVLA 2AZTA 1OFTA 1LW6E 3RSOA 3OTIA 5CM2Z 5JNWA 5L3VA 1P61B 1T6XA 3PFFA 1WRBA 2ZT5A 4YCMA 3ESXA 4K7JA 2HF8A 1NULA 4YRPA 2D5BA 5JQGB 4JFAA 2ODWA 1FX0B 2YVQA 4PZCA 3M1IA 3AY3A 4KTVE 4QBIA 1J20A 1XVLA 1YBFA 4TYMA 5EPUA 1S1CA 3V46A 2PRIA 3IT1A 3WGOA 3K15A 4IUYA 5BQ3A 3C87A 3COWA 2VDNB 3ADPA 3F90A 1HDOA 1U2QA 1UPBA 1Q95A 2GN9A 1P5JA 2P65A 2WWHA 1VKJA 4CF6A 1Y6GA 2F1IA 3GRCA 3IAXA 1NVXQ 3W5CA 3ZVMA 5ALIA 1KHHA 3IVXA 2X4LA 4XLZA 2IHYA 2RGNC 1CP2A 4F97A 3TINA 4OOSA 1YQDA 3G3EA 3QVGA 4DFDA 4WX2B 4P26A 3PXUA 5IS2A 4EF4A 2GBIA 2RSLA 5LZ8A 4CLXA 4PC2A 1UPFA 2XUQA 5HVNA 2IHJA 2H1HA 2W2KB 4MUMA 3WYFA 1Q15A 2ENUA 1T26A 1RYEA 4ZOLA 2D3WA 1SXJB 5KWJA 1G7RA 5B6IA 1PTJA 4HGYA 1Q0LA 1NNI1 4FEEA 2Q6KA 1Z29A 5AK4A 1R6AA 3I42A 3UJDA 2CLCX 4U2DA 2IHUA 5CPBA 1BMFD 5H3LA 2HMUA 2J4FA 2NU8B 2IYVA 3RHTA 1JA0A 2ARKA 1AS2A 2MU1A 2RH4A 1M9NA 4UXHA 1COZA 1RYDA 4XQGA 4EHKA 2JARA 3ZE7A 2WINI 5CH5A 4IH1A 1YQXA 3X2SA 4H17A 1U0GA 4IEEA 2YR0A 4KNYA 1KFKB 3U19A 2VVTA 1U1EA 3CXUA 1A4XA 3QEMB 1PFUA 1TM1E 4GGOA 1A7UA 4YI5A 5LBIA 4AVYA 2RJNA 4Z7NB 3ZVNA 4JENA 4QFBA 4NV0A 3ENWA 5H3HA 1VQOB 1R0WA 5ALVA 2R6JA 1DC6A 2IH4A 2B34A 1PDWA 3OBBA 1TYZA 4P2GA 4BFLA 1WY7A 1W5BA 3MIZA 2ZIFA 1QNLA 1WPXA 2BGUA 5KYXB 3G02A 4H0CA 3LDGA 4LJ4A 4LXGA 4A2PA 5AVJA 1C8LA 4TROA 4NFLA 3PT9A 3BSWA 5LLTA 1TPZA 5HXAA 1N75A 4OU4A 5LQDA 3QW4B 1MCZA 2ID4A 4LZZA 1I10A 3F98A 3AFHA 4NNPA 1YHNA 4ZAYA 3WMRA 4DV1B 4NG5A 4FFMA 3TSOA 2P4UA 2GEVA 1LF5A 4K81B 1EM8B 2R1TA 3CU5A 4L76A 3RJZA 1CY8A 1ZITA 2XTNA 3B1XA 3OX3A 4ESHA 1NVKA 3ZD7A 2G06A 1GM5A 3O8OB 1NDHA 1W30A 3OCXA 3Q7RA 4G5QA 2F64A 3X1XA 2VWQA 3M89A 4LJRA 5LL6P 1I1HA 1IWBB 1C29B 1QYRA 2IIVA 3BZWA 5DPMA 2PX5A 1KPIA 2V3WA 5ITZB 5JXWA 1Z5UA 3AJ8A 4TZKA 3U6KA 3LUKA 1V5GA 4R3WA 5KYWA 3B9RA 4LTDA 5EMMA 3W5BA 4JJIA 1JEJA 1IULA 3Q3CA 3LBHA 5I7RA 3U7HB 3K71B 5ALSA 2VPTA 1UXJA 4EY7A 1GL6A 3IURA 4IGFA 1HC7A 2ZTLA 4YHBA 1MA3A 1ND6A 2PQ0A 4N01A 1LA2A 3PQEA 4FB4A 3AVUA 1D6SA 5IYRA 3I28A 3EVNA 3BRSA 1CF9A 3GW8A 4HNUA 3PHLA 4OGKA 2BEWB 5K8TA 1ICIA 3KCNA 1NJ2A 1ZIOA 4W5RA 3TECE 1OIVA 5LJIA 3OICA 2BIFA 4K2HA 1YGYA 1XPRA 1TQDA 3L5KA 4IFBA 4MRAA 4KIWA 3M4YA 4WK6A 3DDNA 3KUDA 1G98A 2R1UA 2AF3C 3NHFA 3S5JA 3ZJ4A 5CVDA 3NHUA 3SVLA 4A8HA 4G8CA 4L8VA 3B6IA 5BRJA 1L5YA 1V45E 5DOZA 5BN4B 5JNRA 2DIEA 3D8SA 3IBGA 4K9RA 2Y93A 3LHDA 3F6PA 2C3PA 2L18A 4HADA 4NK4A 5LJLA 4KYUA 2O5EA 2UZAA 3BDAA 1WB6A 2IJGX 4P8RA 3NAMA 1EWRA 4XJTA 4CMGA 1W93A 5KU7A 2GPJA 5DYTA 4E4YA 4Q7KA 2W6JA 4BKMA 1V3QE 3GJRA 3H1TA 3SR0A 3AOGA 4QOFA 3MB5A 2WJ3A 1OLSB 1U0FA 2EVWX 3FJYA 4M1YA 5JVDA 5G3YA 2E6UX 1KZ6A 5I9IA 4J94A 1UF9A 2ZT6A 5JSUA 3VI4B 4L8YA 4NDNE 1R0LA 1BXRB 3JYHA 4V38A 4KU4A 1Z7BA 1R0KA 2CXTA 4O4HA 3BXPA 1I3CA 1M83A 5AM4A 4JT9A 1BMQA 1OCEA 4KREA 3OM8A 3KTOA 4DJTA 2VBFA 2PX2A 1S89A 4GZ5A 4XIJA 3ZHUA 1NUUA 4UEOA 1W48A 4XGKA 3C3EA 1CUCA 2WT9A 2QLFA 1SQ0A 3CWCA 3EQ6A 4P4SB 5KYWB 2G83A 4FILA 3ONWA 2PGNA 3DM9B 2OLEA 1RRMA 3KXKA 3OCWA 5E2IA 4DWWA 4YYZA 2B8EA 1A9RA 3FHOA 4I9NA 3EPHA 4NZNA 1BE6A 2BFAA 2CKDA 1EMDA 2CMKA 4LYYA 2EP8A 4Z4WA 2CYAA 3DEIA 3QV2A 5JS7A 1GGFA 2OXTA 1GSOA 1KSJA 1DG1G 1MO4A 2FN3A 3FHJA 4ZVMA 4BO5A 2IPNA 1JVNA 2IPLA 3JQFA 5H0IA 3TJZA 1U1IA 3E03A 1T9KA 3N8DA 1F48A 3UATA 3UAGA 1X7WB 2X2PA 4EO7A 1Q57A 2UUBB 4G1UC 2QNIA 3G0HA 4YH1A 4JXZA 2O8FB 2JJYA 4BMNA 3DCNA 3KD3A 3GEDA 1SURA 3WB0A 3ZG6A 4DLKA 4EJMA 2O8CB 2GMWA 2WF9A 3V8NA 4AP5A 3BORA 2QI9F 2C42A 4UE2A 1FTNA 2VG8A 5KOYA 3A6LA 4DJAA 2OECA 1K5PA 1KYWA 1MJHA 2GJKA 4DLPA 4CEIA 4OO3A 1RI4A 3WSWA 3G9QA 3OECA 3ZHVA 5G1PA 2ZI5A 1B23P 1EFLA 3LVFO 2FFQA 2AVDA 1QU2A 3E9MA 1DIOB 1QIHA 4INPA 5TQ2A 1FRFS 1W8DA 3H2ZA 3RSGA 3TTWA 1JTFA 1XRRA 2OXRA 3IFSA 1BLIA 1AHHA 1EWVA 1PS9A 4S1OA 4URUR 1ZN2A 5EAIA 3RC3A 3A9UA 5A3JA 4A8JA 4O2AB 4ZGQB 4BNVA 2OXEA 3I53A 4RS3A 1OBFO 1ISHA 4DSNA 1F20A 1KEKA 2C7RA 3KEFA 4YQFA 3OD5A 4RNCA 4DWJA 3BA6A 4NBRA 1K2WA 3KEWA 4YRGA 2B94A 1L7QA 4JN6B 3LBYA 2FW8A 1A5BB 5KC8A 1T1EA 1V3UA 1PSWA 1E7RA 3DVAB 1XMSA 1GNVA 3B5IA 3Q6NA 4DXDA 3WGHA 3AIIA 3WADA 5ARDA 1WF3A 4IWNA 4MUKA 3T3GA 1E3IA 1XJ5A 5J5VA 4UNQA 4CU5A 2FMXA 3JYPA 3VH4A 3IYLW 3PHIA 2EU8A 4PPFA 2H63A 2KPOA 3NVAA 5EN4A 2J67A 1OFUX 4MQMA 4QC2A 5TY0A 1EEHA 1G4AE 2DUUA 3FZYA 4HQFA 5DZSA 3B38A 2P2ZA 3KQVA 2JIPA 4LGMA 3WK4A 3DZBA 1HUQA 1V0FA 3HDHA 4FMCF 2PZFA 3IVCA 4R7GA 4EENA 4IVQA 1V8FA 2AC7A 4TYPA 4TYYA 4M46A 1NBOA 2AOVA 2G63A 1R1DA 1KR2A 2ZRFA 2R00C 3L4EA 3ORQA 2Q7XA 4MROA 1XCJA 2QS9A 3H5RA 4M55A 5CVUA 4CM5A 1O4WA 3TQCA 5TV2A 1AE1A 1OFHA 2ZIZA 3MYRA 3PFIA 2QD4A 4MZDA 3RNOA 3V8VA 1R4NB 4F4JA 2WU0A 2H2HA 3CH4B 3A4YA 2HHCA 2Q2OA 3W2HA 1ZO8A 5KQRA 1GNRA 1GGEA 1LPSA 2PANA 2R65A 3TLAA 3D8UA 4P3PA 4PG8A 1PJQA 5JDCC 3R09A 4D41A 3QFSA 1LSSA 2C59A 2CLMB 2HA4A 3HP1A 3OZBA 4CE6A 3PFWO 1WE2A 3UGKA 1G64A 1E6EA 1FLDA 1UZUA 1RPZA 1ANKA 1W5AA 1UFVA 1XTIA 4V0OA 2XZOA 5TR9A 1IHOA 1UZLA 1ORDA 4LJAA 4PYOA 3STYA 1NT2A 4DBZA 2PUBA 2J3DA 1SWWA 2H4XA 5COQA 3RCBA 1GUZA 1DJOA 2EL7A 3CUVA 1NAIA 3M2TA 2GZ2A 1R66A 2GVDC 1H2YA 1QO0A 1YQQA 2WF6A 1I1OA 4N65A 4F56A 3BJZA 4K3VA 2ZJOA 1CR4A 1QIEA 4PO8A 2QMZA 1TF5A 1ONPA 1RPNA 1JKIA 3AJ9A 3TQRA 3KQWA 5FEMA 4INJA 3W3AD 1J0CA 1MB0A 2O3QA 1EU1A 3ABRB 5HCNA 4C4PA 2F3PA 1Y1TA 1T9CA 4QA9A 1JYEA 2CVOA 4DEVA 1UBLS 2BFBB 1P39A 1WPQA 3KVYA 1EFVB 1JG7A 1N57A 2GPSA 5LYJA 4GEGA 4FYVA 1JJAA 4P31A 4RHXA 4XYMA 2EP7A 2FSHA 1P5RA 1SAYA 3PHCA 1NX6A 4N7JA 4LMAA 4BEWA 4J07A 4D9IA 4F1KA 1UDXA 3LQKA 2PRSA 1AZTA 1ZSNA 3BSSA 5IF3A 4KGZA 4UHHA 1DKOA 4GBGA 3ZLVA 1DAEA 2WM9B 3D8BA 3NNDA 4MV0A 3STWA 1QUEA 1WZ2A 3SC2B 3AF0A 2ZR7A 4G0OA 1ZJ6A 2QRZA 3GQBA 2XVYA 3LHIA 4D45A 4EWLA 4BNFA 4U2CA 3PA8A 4I7EA 5I9MA 3RS5A 1E1QA 1Q19A 2NO0A 2Q1TA 4JK3A 4R6WA 3UJ3X 1TKAA 1W2BB 4JYCA 1CEYA 1N6KA 1N6NA 2FPLA 2WLTA 4BVJA 2WYOA 4FYPA 5KHLB 4QGGA 3BICA 4YO7A 3E27A 2WDZA 2GCPA 5FYQA 5HX7A 1N7JA 5BN3B 3AIOA 1UKVY 3VDMA 4JWKA 1VCNA 2XMSA 1YIOA 3M3PA 1YBAA 3UEOA 4DIOA 2QUAA 1BCSA 1NXTA 2XDYA 1AS0A 5BN1A 3E3OA 4UOZA 1AUPA 4QARA 4YEDA 4J7UA 4LV8B 5BWMA 3OLCX 3T3HA 2Q1UA 4WCDA 1Y3FE 2VYNA 2BSXA 3QEMA 2XYPA 3TNLA 1N9KA 2OCYC 4TS3A 4PLZA 5K8IA 3TYXA 4Z1OA 2WZNA 2G4LA 3QEAZ 3AWDA 5A9RA 2XT6A 1KA9H 1QZTA 1PR4A 3NORA 5D5PA 1XQ6A 2IIPA 5KJFA 6ABPA 4MMZB 4NFYA 4AWXA 2ODEA 2QN9A 1F5NA 1IZ0A 2XJ4A 4WXYB 5DYIA 4D9MA 2GESA 4O1IA 1HBJA 3C14C 4CEJA 3BF7A 3V2GA 1QP8A 1BFUA 2C92A 3ITKA 3GRZA 4KIFA 1AIPA 2D9RA 2AFHB 2Y6VA 5E8JA 3ER6A 1YRWA 2Q0HA 4H6VA 4C21A 1EWYA 4R5MA 3VBCA 1OYOA 1JKFA 2M6RA 3FHCB 3VUFA 2QP3A 3WSTA 4EEKA 2PGDA 5JOQA 4YUWA 4CTKA 1XNHA 4ZMBA 1CV2A 3VUEA 1EAMA 1P19A 3GUUA 3L9WA 4OQ4A 5LYJB 3E58A 3UT5B 5L3SA 1T0UA 2R25B 4H3SA 3MG9A 3V1UA 1P1FA 1Y81A 2J9GA 3QNMA 2FX5A 2ZBPA 3CNLA 3JWEA 4MRMA 2Q07A 2AFVA 2FSSA 3F5DA 3RS9A 5GJBA 3REGA 3HL0A 2BT4A 3VR3A 5CBPB 3GLFB 1I0ZA 3DFUA 5KTYA 2SKDA 3IEUA 1CZOA 1EFPB 1RKVA 4HPWA 3T34A 3P0HA 4HN2A 4I3FA 2A58A 2WHQA 1Z35A 2C84A 5D8DA 3FKJA 2NT3A 4LYGA 5BMVA 5DGDA 4WA8A 1R8JA 2G72A 3K2BA 2Q4EA 3Q1LA 4IRMA 4OB6A 1X80A 4X3OA 4K9QA 4PZYA 3BPSA 5GV8A 4WKPA 2JGDA 4DPLA 5F5XA 4XLAA 1YJAA 1VHEA 1UH5A 3UK1A 5AI8A 1X7XB 2D1TA 2VUTA 3E22B 3OLYA 1CUHA 1DHRA 3NANA 2X1HA 3UAOA 4C07A 1EX9A 1ZNYA 3O3MB 4EGFA 4UNNA 4C4TA 1N2IA 3GCZA 5B2FA 4WTOA 4WLOA 2L42A 2X8WA 4PRKA 1VIVA 3A6DA 1QIDA 2Q3LA 3IT2A 2XECA 4U8GA 1HNWB 1J2JA 4D8WA 2ZM5A 1XZIA 4HS9A 2WWFA 2G1JA 3O47A 1P0IA 2IYXA 1H69A 4M8LA 3BAFA 2P5YA 2LZ0A 3FPAA 1L9KA 4B43A 2Z9CA 4I4LA 5FBLB 4CQLA 2HMYB 5CX4A 4ZJZA 5EJ4A 5JSZA 4ZA2A 4HDKB 3AEZA 1B8NA 2HF2A 4XAQA 1WUHS 3HCBA 3GJ8A 3PGXA 1X1QA 1DL5A 3MRVA 2W6QA 4TXLA 1HVXA 4Q9HA 3KFVA 2DWPA 4RYLA 4HFRA 4JT8A 2H6EA 5D3QA 1ZA2A 3KU4A 3P2IA 2R48A 1QS0B 2BWJA 3F2IA 1Q91A 3HDVA 5THQA 2F1JA 3HKEA 1U11A 4IIJA 3E7XA 5JD3A 4YYEA 5AJTA 2R4UA 1KQFA 3GMDA 2CHEA 5CIYA 3UNXA 4BASA 3KJGA 3CZ5A 4UE3S 3G2HA 4Y0VA 4Q3LA 4BMCA 3CPSA 1FYFA 2UAGA 5GY7A 1N1DA 2AG8A 3U40A 3AUFA 3KWMA 3TUZC 1GZUA 3OCYA 4HTAA 4B9AA 1G6HA 4FGZA 4HDMB 4QO7A 5DGTA 4H77A 4BEJA 1U8FO 2YWDA 4RQUA 3OZIA 4Z4GA 3RV3A 4DNXA 3O2NA 1HYGA 1YRHA 3A4LA 4E07A 4GLLA 4L7QA 4ARZB 1GD1O 1L7DA 3GJQA 4P4LA 1CJBA 1KJWA 3OKFA 5K3DA 1G63A 4BL5A 1Z26A 2WUEA 3K16A 5FPQA 2YQZA 3GFTA 1A98A 1UJ5A 1N0UA 2OCXA 1XZEA 5BWBA 5I8ZA 1DX6A 1QVAA 1R2QA 2DKNA 3BEDA 3PHBE 4KXVA 4OH7A 4RZXA 2CK3D 3V4SA 3X44A 2NACA 3E81A 4M0PA 1HH4A 3D3WB 3NV7A 3QI7A 2FY8A 3QI2A 2Z6QA 1VLOA 5I5EA 3K5HA 2BUBA 2R7NA 4QDOA 1SJ9A 4JP1A 4UNSA 4DLBA 2HIHA 4TV8A 2YOGA 4JUDX 2B37A 4RCZA 2DHDA 2CXUA 4WKCA 3UUWA 3T1OA 5AW1A 4QUJA 1NPTO 2I4TA 3FZNA 1B6RA 1KAGA 2H4ZA 2ID8A 2YICA 4RESA 5CR9A 3UPDA 1V1RB 3NBXX 4JFRA 2VHQA 3RKRA 4YT2A 5M5BA 1YZQA 2GOYA 1ZC3A 3FW1A 3ZR4B 3CEMA 2B99A 4QU8A 1Y82A 1DGQA 2O07A 2P6OA 5TPZD 4JI7B 1LNQA 2W6ZA 1DXYA 4UUOA 1LBIA 16PKA 3OZTA 2FX2A 2WOOA 4RCYA 1JQAA 1NBAA 3I0MA 3KHKA 3GCGA 2AI2A 4KXFB 4D3ZA 2F2TA 4D6YA 3BGDA 2DUMA 4RA9A 2GPAA 1LDNA 1U7PA 3K30A 3NHAA 4JLBA 1TVCA 1H6DA 5ADVA 3OF5A 2E1RA 1MOQA 2OHHA 4I5EA 4NOKA 5K3SA 5TQ2B 3A36A 3UUFA 5K03A 1GNTA 1OXTA 1PSZA 4LYAA 3OG9A 2WHRA 2PZGA 5EVCA 5BSXA 2ZAGA 3VC7A 5B53A 3ONFA 3WHIA 1IDN1 4B8WA 2D6FA 1CUBA 3NHMA 2CXPA 4JBXA 5EWJB 2D06A 2FA9A 1NJ1A 1YOBA 2PUWA 4II7A 2FZWA 2E89A 4FFBB 3WL5A 2O1EA 2XJ9A 1AX9A 1F17A 4Z4HA 1YE3A 2FG6C 4R8LA 3WDSA 4E3WA 3R3JA 2DY0A 2O14A 4AN4A 1XU7A 2QDKA 2R1TB 1L5ZA 3MNFA 5I01A 3HPRA 3ENNA 4C4ZA 3UKOA 1XAIA 1VQ1A 2VN8A 4X95A 3VC2A 3C7DB 3PHHA 1E4VA 4WD3A 1VF7A 1XXLA 1OUMA 2DFKB 4HB4A 2OYRA 2FPUA 4BVEA 5KTOA 4YJGB 3RREA 4EHFA 1K3UB 4PPYA 3HEAA 3QUCA 4DPMA 1O08A 4JJGA 1NUSA 3L79A 2OV2A 1PS8A 3QOXA 2UKDA 2XKJE 1W0KD 1IY2A 2HPAA 4OPOA 1RRFA 3DLAA 4ZAXA 3RB8A 4YP1A 4NOLA 3ZX5A 4ML3A 1Q1ZA 2QMQA 3DL7A 4IEIA 1I32A 5I7UA 1Q7RA 1UJMA 5D87A 3PICA 1PWZA 3TTSA 3HDGA 1N2CE 1NLZA 4BRSA 1U90A 2BCEA 2X40A 1G18A 2GNPA 4PRLA 2P6PA 3WLJA 4AIRA 1T24A 2X2EA 4X7FA 1WXWA 2V3VA 1W47A 1S4QA 2NSLA 4RVSA 4XQ0A 3ZNNA 1HDZA 3L1VA 4NJMB 1E1RA 3U4AA 1DT5A 2XKKA 4ZCSA 1RNLA 3T9CA 1V8PA 4YCCA 1IM2A 3AJAA 2QTZA 1LNSA 2GFIA 1PJ4A 4KO2S 4ZQFA 3VDXA 1AQYA 5E1BA 2ZYWX 2FKAA 4ANFA 5JSZB 2OKCA 2Y99A 2QMYA 2OM2A 1BEZA 4UCXA 3O31A 5B7PA 4AXXA 1ZH2A 1NQVA 7AT1A 3RT1A 5ILOA 2IP1A 2GYUA 3H42B 5EHXA 1C8BA 3SJZA 3KBBA 5H68A 4DVGA 1Z22A 2CFCA 5KNCH 3HV0A 4BYGA 2IPMA 1ML3A 2I78A 1DV1A 3HXPA 3PITA 3M6IA 2A33A 1Y7PA 4X24A 1FS5A 1Z33A 5AK5A 4FQ5A 5GZ6A 3Q2OA 2V7VA 1H42A 4QRDA 2AC4A 3GYGA 3TQTA 3LS2A 2C3OA 3ZXXA 4NCAA 2V5UA 5HE9A 2V5VA 1P6XA 4FKMA 3HEMA 3RTEA 1KYYA 3S28A 4M7OA 4CM4B 4DQ0A 4EUFA 4YASA 1VJDA 2I8CA 5F1PA 3T53B 4GBJA 4P84A 5AM3A 4B4DA 5IN4A 3F7TA 1XEXA 1J07A 1TFUA 3BY2A 1VLHA 2QTFA 4KKVA 1WB4A 4U7TB 3ZWAA 4DNQA 3GLHB 4ZV9A 4EJ6A 2Y2VA 2ZAMA 3UB4A 3WIOA 5CB4B 1PHRA 2FOIA 4UBIA 2Z6UA 3A9RA 1PJTA 3IPRA 4TV9F 4TSFD 3K0HA 5ECWA 1WF6A 2YY6A 1E3DA 4GXNA 3A04A 3EBLA 4V2IA 4BTEA 1GEGA 1NLUA 1PG5A 4O59O 3FTCA 2HV9A 1G41A 1MOPA 1N3YA 2R1VA 3K8ZA 3L6OO 4YAJA 4C4AA 1PQUA 5IVHA 2BM1A 3U2QA 1OHHD 2I76A 3QNUA 2ZTGA 2BHSA 1JILA 5C53B 3AM5A 2WWRA 5LDGA 2PTGA 2X22A 2YXNA 4BQOA 3NAQA 3UXYA 1PT8A 1N2JA 1EXMA 1TK3A 3O94A 2OEPA 3FGZA 4MKZA 1JEOA 5JFOA 3S2SA 3EF0A 3BCUA 1VG8A 3CR8A 3CN7A 1C3JA 2RGBA 3SVZA 5BPHA 2PT9A 4YUYA 1ZM7A 3EIHA 3FIUA 3QPCA 5JSYA 4CM7A 1ZGGA 2VCYA 1SC9A 1BXGB 1I7QB 5AJVB 2FSUA 3HJGA 3EXIB 3OJLA 3X0DA 3INRA 1PL6A 2VPQA 1RE1A 5D01A 3VOTA 5TXGA 4R3UC 4B3TB 2XGOA 1HI9A 2FPMA 3PDIB 4OBBA 1ZQ9A 4OSPA 4BKQA 5DBFA 3HAGA 4W82A 2ETVA 3SYKA 5A6SA 3KVVA 3LCRA 1W1UA 2QB5A 1HG0A 3DB2A 1XNQB 3ILSA 2H11A 5HM6A 4DV3B 1UJ4A 3FPGA 2QJOA 4HH1A 2E5WA 4C08A 1C3LA 4GZ6A 3WO1A 6LDHA 4D80A 3C97A 5IT5A 4GG1A 1SHUX 3PC6A 5D3MA 2EKZA 2JVIA 2Y67A 3CKKA 2E9SA 3VKGA 5KAPA 4CM3A 5LN1A 1TUBB 2HPVA 1TB4A 2Q29A 4F2HA 1NJSA 1OZAA 1I7LA 3G4SB 3AILA 3DE7X 1Q11A 3N9IA 5SYMA 4IV8A 1EUDB 2RHHA 2VF5X 4JT4A 5IJXA 3GLTA 4M7WA 4NTZA 2XEDA 1XMQB 2JAWA 1MH9A 3E0QA 3N53A 3RJMA 1ZGAA 4DEYA 3IOMA 4GLOA 1IZ7A 3DLTA 3W8EA 4RD6A 3FNFA 5G53C 3L4JA 5AI9A 2C88A 1E3JA 2XTJA 2OBSA 5F1OA 2DF8A 3I12A 1IMOA 1VLZA 3SEQA 3HR8A 4M6WA 2JBHA 5LP6F