1IJFA

Nucleotide exchange mechanisms in the eef1a-eef1ba complex
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
440
structure length
440
Chain Sequence
GKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elongation factor 1-alpha
publication title Crystal structures of nucleotide exchange intermediates in the eEF1A-eEF1Balpha complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 126
structure length 440
sequence length 440
ec nomenclature
pdb deposition date 2001-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ijfA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ijfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ijfA01
4M1OA 3CRRA 3CX6A 4HB4A 4DKXA 1Z0DA 1Z6YA 2QMHA 4OQMA 5BXQC 3X1YA 1AS2A 1VG1A 1KI6B 1TEXA 3RS5A 2ZU0C 2VP6A 3GJ6A 1VQKB 2QE7A 2P67A 4TYNA 2IS6A 4HB2A 3UMRA 1VQMB 2QTVB 4GI7A 2WIAA 4M1TA 1UBGA 4YAFA 4K1XA 3NKVA 4URUR 3AVWA 3BS4A 2DERA 5D3MA 4A2WA 5DISB 4EPTA 4RKFA 5AUOB 2QPOA 1G19A 3NH9A 1E69A 3WBJA 1K6MA 3HPRA 4IVRA 1MO6A 3FPKA 2IBMA 1KSFX 1E9FA 4HUTA 2WVJA 4AKEA 3FKSD 2DB3A 4QGAA 3KXIA 4QGHA 4DC9A 4Q7MB 1W34A 2BJVA 2RGNC 4QFMA 1QHHA 3TSZA 1FX0B 2QDXA 1NY5A 521PA 1JECA 1SXJB 2LWIA 3QKUA 4FCTA 4OKSA 5GJWC 3JZMA 3MWLA 2K5UA 3VR1A 4Q4AA 2Y8EA 3KUCA 3QBVA 4I1UA 4IOKA 1ZIOA 4C0JA 4W7SA 3ZGXA 3GLHB 4N0EA 3HPQA 3W3AA 4K8OA 4BRUA 4C0SA 4B4DA 3EPJA 3AQ4A 2GCOB 4C2UA 1F20A 1UBCA 3RS2A 1AK2A 2VP2A 4MYUA 3PEUA 1KDTA 3TNFA 3CX8A 3DZDA 2A30A 5L3SA 2J0UB 1LS6A 3AVXA 3MCAA 1EWYA 2GXSA 3I73A 2BGJA 4Q9HA 3LQQA 1VTKA 2ZAOA 4PFSA 2PT5A 3B60A 4JBYA 2HCJB 4Q19A 4JLOA 3KKMA 4AYTA 3OF5A 4NYMQ 3JVVA 1VQLB 3LA6A 3G82C 4HB3A 1VKJA 1WA5A 3KJEA 1YRAA 4N3GA 1A2BA 4LWZA 4Q1CA 4D25A 4DCVA 1FRNA 4RY2A 1DE0A 3GFOA 4JYCA 3JQPA 4O0MA 2PJRA 1FQKA 3CCQB 3ICQB 4F4IA 4URWR 3RRZA 1D9ZA 1ANKA 2NG1A 1Z5ZA 2Q0HA 1VG9B 4UQOA 3VHLB 2B5OA 2ZTSA 1E96A 5FOUA 3W3ZB 5AJXA 3A1VA 3AV0B 3W6PA 4XH9B 1W0KD 2PIAA 4B43A 5AJWA 1NJFA 4TSFA 4A0RA 5J4KA 1XPOA 1WXQA 2FPLA 1MH1A 2CJWA 3LWNA 2BMEA 2V9PA 2IYZA 1NG9A 5JMTA 2AK2A 1A7JA 4ZI2A 2NQ2C 1EX7A 3CNOA 4AG6A 5JJLA 1EX6A 1FMJA 2BKUA 4TYPA 1W7AA 5JRZA 2OAQ1 4OBEA 3K9NA 4IFBA 2W6JD 2WKPA 2VHTA 4G5GA 4D4MA 5AJZA 4CEIB 4IDNA 1GRRA 1QFYA 3EWAA 1YQTA 3IQWA 1OW3B 3WRXC 4EKDA 4Z51A 3UATA 3QUSA 5JLJA 2WTUA 1XBTA 1COWA 2CLDX 2ZYTX 4OQNA 1QUFA 1X6VA 2DWQA 1CP2A 3AGPA 2ODBA 3B9PA 1XD8A 3EWSA 2IYXA 3SYKA 4QNRA 3K9GA 1T91A 4V0NA 3KTAB 2JASA 4Q47A 4Q7LA 1QX4A 4GZLA 3K0AB 3GEHA 5JS8A 3TGPA 3H4MA 3GJ0A 3MLEA 4ZPXA 4BFSA 1YJWB 1R2QA 2NPIA 221PA 5EP3A 2IYRA 2F1RA 2WBLC 3K0CA 3BRWD 1JBKA 1SVMA 4BLSA 5JWOA 1Z2CA 4JLMA 1B2RA 4I1VA 4PAMA 2WJJA 2GPJA 1RRPA 1UDXA 1W2GA 4P4TA 5FI1B 1SVLA 3DOFA 4LCBA 4PC2A 1II9A 1UKZA 5LB2A 5JEEA 5FR1A 1RIFA 4L9WA 5G3ZA 4D2IA 3KKOA 2G6BA 2J45A 2C78A 3NTUA 3FKQA 4PQYA 2GQFA 1M8PA 1P2VA 5AUQA 2XTZA 1FMLA 3ZC3A 4RZXA 1KK0A 2DFLA 1MT0A 3W5JA 5B57C 1AN0A 1HQYE 2IYQA 5KU1A 1VG0B 1OXVA 2JA1A 2NPFA 3PR1A 4OK5A 1E2FA 2QY9A 4YC7A 1FOEB 4X8MA 4DDUA 1HA3A 1G1MA 1OT3A 2E9SA 2NO6A 5LB4A 1YVDA 3LV8A 5DN6D 2J1LA 3CPJB 1E2MA 2F3TA 3SJZA 5KNBA 1ZM9A 3CF2A 1VCMA 5LDDC 3I1FA 5EZ5A 4LDJA 2KSQA 2O8EB 1E63A 1Z0AA 4B73A 4FWIB 1KNXA 1AIPA 2A9KA 4MKIA 4A0FA 3CCUB 3ZLJA 2V6IA 2ASEA 1E2LA 2XJ4A 1EFHA 3A4MA 3JQRA 1ZW6A 3X1WA 2CE2X 2ZETA 5F9HA 1NF3A 4QL3A 1ZVQA 2CE7A 5FBWB 4B6EA 1OHHA 3NG1A 1UJ2A 1B0UA 4OQXA 5JJKA 3DPUA 4OI2A 4BECA 1Q20A 1TUIA 2KBEA 2YINC 4D4JA 1W5TA 5TXGA 3W5UA 4WZBE 1HY3A 2ORIA 4B47A 1RRGA 3VKHA 1VYVA 1CLUA 1G3QA 4JSTA 4PZLA 1M90D 5CLLA 1M7GA 1H85A 2JJ2A 4MUBA 2VYFA 1QVRA 4BPRA 4HDQB 4LJ6A 2O0HA 5KNDA 3B1XA 1IN7A 1D5CA 1KI7A 1Z07A 2NGRA 2VO1A 1NMYA 3CR8A 1VCIA 3U3KA 1G3RA 3AP1A 1ZM3A 4ERNA 1ZNYA 2KJQA 5TB5A 1U98A 1ESNA 2BCGY 2YWEA 3DO6A 3F8TA 3KJIA 4YMTA 3ES9A 1G7SA 5J4YA 3LW8A 4Q9KA 4MQBA 2P5SA 2C9OA 1QHGA 4U02A 4ZIRA 2RHDA 4PXAA 3PUVA 5E4FA 1XZQA 1X8JA 2PCJA 3AP3A 3Q9LA 2IF0A 4B32A 3ZZUA 1YR6A 2ZYWX 3CONA 1K5DA 2RGEA 2YNMA 2ZE5A 2GZHA 1T8TA 2IC5A 3U3OA 1IN5A 1D6JA 3AVTA 1E2HA 3KKPA 3L0OA 2RGAA 4MRSA 1KKLA 2ZRPA 5FL3A 2DY1A 2Q9AA 2OFOA 4HLUC 3SR0A 2QM7A 3SN6A 2YWFA 2QQ0A 4Z8YA 1NLYA 2WMNB 4WIAA 2HJGA 4A8JA 4NONA 3NBXX 3BBPA 4Q4HB 1KAOA 4LHYA 1GVHA 3VAAA 1MO3A 3SBDA 2OCYC 4JKIA 1S3GA 1E1QA 3FTQA 1DELA 3A1WA 1Q81D 2RGXA 1TLLA 4QM7A 4IHQA 3QY0A 4F7WA 621PA 1IAQA 1VCOA 1BX1A 1KO8A 1I4TD 4DLUA 2IW3A 4MYCA 1OGJA 5HR5A 1RC8A 2ZVQX 1OPXA 2CK3A 5LPNA 4DT1A 1FTNA 3OIUA 3OJWA 4LGMA 2J41A 4DLWA 3SJCA 1CNFA 1I4LD 4BZQA 1XF9A 4URVR 3EPHA 1XJCA 2GAOA 2ZE6A 2JJ1A 3K9LA 1S72B 1F2TA 2O8DA 2W2TA 4RCYA 3IQXA 1OHHD 1V43A 3B8HA 2IYLD 2QROA 4TQ9A 4DSNA 2ZRFA 3ZBTA 1NSTA 4P6VF 1NBME 4UKDA 3MGCA 2BPOA 3FPAA 3P20A 5DI3A 3KQHA 4XSGA 4AYWA 4F4CA 2ZXUA 4WZAE 4M22A 4JL8A 5GV7A 2QAJA 2YWHA 5FUXA 1XB2A 1RE0A 1E98A 1ZM7A 1KQSB 1YR9A 4PPNA 1YR7A 2CL0X 1Q1EA 4MKGA 4TTPA 3O47A 2OXCA 4FMDB 2JJ2D 1DDGA 1KTVA 2GESA 2P6RA 1LF5A 1EFRA 2IUTA 3RS7A 1Z2AA 4LBYA 2CCGA 2X77A 5CJPA 2AN9A 4PQRA 4C7OB 3W9YA 4F4JA 1XXHA 4PGOA 4XTCS 2P5TB 3W8RA 2OCAA 4GRAA 1KJYA 2Z4RA 3GCGA 1VMAA 2V6JA 5K8TA 4LUCA 2Q3HA 4CT5A 4XSHA 2PMDA 2GF0A 4FMCF 3A1TA 4JJKA 3PFIA 3CF6R 3IEUA 1CR0A 3L0IB 4EFLA 2MSDB 3BH0A 1W4CA 2IS1A 1G41A 2WZQA 1N6IA 3K53A 1XTRA 3KXLA 3WHLA 3K70C 3QFCA 5CDFA 1M1KD 2CCKA 3P4XA 4D82A 4MGKR 3IILA 4QXAA 4B34A 5JRJA 2C99A 2ZRKA 5JS7A 2EQBA 2IXGA 3W34A 4F93B 3GJ7A 1X1SA 1NIPA 3BFVA 4PHTA 4EAQA 2OBNA 4PANA 4MGYR 1ZC3A 1D1NA 1H8HA 1NVUQ 3PUYA 4YQFA 1TQ4A 4MITA 1IN4A 2BIFA 4Q02A 2VLIA 4BASA 5B58C 3NC0C 1T5IA 2Z0MA 1Z3IX 1JJ2B 1PJRA 3LLUA 5CITA 5KPJA 2ODWA 2KBFA 1IXZA 4DLZA 3VX3A 2FU5C 4UNQA 4TLBA 1R5NA 5KDLA 1HT2E 4XIGS 1AKEA 2XSZD 2C04A 3SBEA 1GG2A 4Z1MA 3W2FA 1E2EA 5THXA 1AA9A 2QA5A 3L0PA 4PC6A 1BIFA 1OFIA 1KSJA 1NVVQ 1ZUNB 2ZSAA 4IEEA 3OE7D 2D7DA 1JEEA 3AVVA 1BJKA 2QM8A 4TTRA 2UZ3A 4RFSA 5TV2A 1M7BA 1DOAA 2KB0A 5FOVA 1E79A 4ABYA 4CRWB 5L3QA 1VQ5B 1KZ7B 4DIDA 3ZVNA 4PAQA 2BBWA 4R98A 4KV9A 1GKYA 1XEWY 4B48A 1SQ5A 2O5VA 4I1SA 1A2KC 3AKYA 4KFRA 2ZI3A 1K9MD 1U90A 1QZXA 1Z0KA 2AR7A 4G5OA 2VHQA 4B33A 4KHZA 1UPTA 4IDQA 5DIFA 1E0KA 4Z8XA 3WP1B 4QBFA 1DG3A 3UMSA 3I8SA 3ZQ6A 2O8FA 2JGNA 3EZ7A 3MJHA 3MWJA 4C0KA 1R0XA 2OFXA 2ZJ2A 1K8RA 5HTKA 2FOLA 1Q3TA 3R8CA 5IHPA 3CH4B 3ZS8A 2OAP1 3KQNA 3WBKA 2D06A 3S1AB 3OZVA 2ZR9A 3BWDD 1ZAKA 1PZNA 1E2DA 2P0EA 5HZHA 1J99A 3X1XA 2YJTD 3K9HA 4HE5A 2WMOB 3W2EA 2JLQA 1LB1B 1ZNXA 3KX2A 4NCHA 3ZYCA 4DCNA 5KDOA 3QF7A 3VNVA 3D31A 3GLFA 3Q72A 1JI0A 1Z22A 4L4UA 2VF8A 2BMDA 3VQTA 2YC4C 3U61B 1ZD1A 2H5EA 4JL6A 1IJFA 2QI9C 3B1YA 4C0QC 4PC1A 5A4JA 4J0QA 1NKTA 4PC3A 2JLSA 1N5JA 5E7IA 1S9DA 4D6PA 1W48A 1E9RA 1JQLB 3X1ZA 1TQDA 5M04A 3UMFA 5EUMA 4G5RA 5DI9A 1BOFA 1U0HC 2P65A 3AVQA 5EZ6B 1TUEA 2EW1A 1WF3A 1OGIA 1G16A 1XMIA 3ZZTA 1UBEA 1LV7A 3DKPA 1US8B 1I2DA 4UAJA 1I2MA 3RAPR 2QAGA 3AKCA 3L2OB 1GOTA 2QTZA 1KKMA 1LNZA 2WWWA 3CWZA 3TQFA 1A8PA 2VH5R 2FGJA 2Q3MA 4E22A 4L5BA 1QRAA 2QMUA 2YKGA 1JA1A 3T1QA 1ZD9A 3EIHA 4HAXA 1N0WA 1SVWA 2D62A 2FN4A 1NN0A 4RD2A 2XJ9A 4QG7A 4A6PA 1II8B 3K0CC 1TQ6A 1G21E 1W2HA 1OJLA 1OIVA 4UJ5A 1DAFA 4LV6A 3CRZA 2ODNA 1JALA 4Q00A 3TBKA 3QKSB 3SFVA 4II7A 1I7PA 1D2EA 1N6OA 2IF2A 2VP5A 2EYUA 3VTKA 3PUWA 5FUVA 2CHQA 3AF4A 4LZZA 3RSOA 5CYPA 3RHFA 4P3YA 3WYGA 3CNNA 1KI6A 5AUPB 3MJRA 1JR3D 3EC2A 3DMNA 4UXHA 3G5UA 3L8ZA 5DE3A 3O8CA 1UBFA 4LHXA 1CR4A 1XP8A 5G41A 3EX7C 3BD9A 5H59A 2ZITA 1EGAA 4KAXA 4CW7A 3N5CA 3TUJC 3B6EA 1W0JA 4TMTA 2R44A 3TMKA 4PPGA 1XCMA 4TYQA 4D4LA 4DLSA 3CPEA 5GJBA 1W1WA 1DG1G 4AG5A 2VSXA 1LVGA 2ONKA 3ZDQA 3FMOB 1YZQA 4URZR 3F5FA 3TAHA 3NEJA 4A82A 2BMWA 2GDJA 4YHBA 4OI0A 3HJNA 4QBHA 1IONA 2VPPA 3U6BA 1NLZA 2JEOA 1SXJA 4PAOA 2HUPA 2ZUBA 1R8QA 3PJRA 3VO1A 4P0TA 1OXUA 1AQUA 3I56B 1FNCA 5FOSA 3CKLA 4AC9A 1P7CA 3LBNA 5EE0A 3ASYA 2G0NA 8OHMA 4A36A 1G7TA 2GCOA 1NIJA 4OI1A 4KLZA 1P2SA 3QXHA 2YV5A 4KVAA 1VDZA 1KI2A 2ANCA 1DAIA 1P9WA 3HU2A 1E4VA 5IRCD 1KYIA 4GOKA 5EUQB 2J0UA 4GFDA 3SU8A 4LHZA 2HEIA 2XX3A 1UMKA 5HZKA 1BX0A 1W5SA 3BOSA 2PCLA 2ZI5A 4LX0A 2IYWA 2R6HA 1Q1QA 1ZCAA 4P4SB 3SEAA 1MRSA 2BC9A 4DLTA 2O8BB 3LVQE 4TLEA 3TRFA 2JDIA 2ZJ8A 3BB3A 1G8HA 4YMVA 4HZUA 4TMXA 2QP3A 3Q5DA 2JLXA 2AXNA 3BORA 1ZC4A 1OFHA 1Q12A 1XEXB 2A5DA 1U8YA 3PUXA 4XVQA 2AD5A 1UFQA 4MYHA 1C9KA 1FUUA 1GKIA 5F9FA 4GOJA 1OXSC 2GJ8A 3ZQJA 4LI0A 3HU1A 1E32A 2EFEB 4LC0A 3LVBA 1YHQB 1L4YA 2V1XA 4KI0A 3ADCA 2VP9A 4TQUS 1WQ1R 2VNJA 3OZXA 1GNRA 4YXWA 1WMSA 4D0GA 3PIRA 1BQEA 4A92A 1NMXA 1R4AA 2B92A 2D74A 2LKDA 5G53C 5LBIA 2QU8A 1JAIA 2F43B 4PSKA 3CCVB 5FOTA 1AJEA 2YHSA 2GXQA 1RJ9B 4A0HA 5KSZA 3TQCA 1E2JA 3BJIC 5DLQC 4A8JC 4FW9A 3CM0A 4DJTA 2KI5A 1W87A 2QSZA 2QTLA 3AP2A 2GBLA 1EESA 1UM8A 2EFDB 4YDSA 3THXB 3PEYA 1QG0A 4WQMA 3CZQA 2ZUDA 1H8ED 1MR3F 1MABB 4HAZA 5C2JB 2BBTA 3CRMA 2G0TA 3R9IA 1W0KA 1QF9A 2NO9A 3DM9B 4OL0A 2GETA 3I32A 4Y9RA 2BF4A 1RRFA 3NHBA 4EUNA 5ELXA 3RS4A 1QVGB 2V7QA 3EA0A 3RSLA 4KYUA 1SXJD 3MG9A 3AVOA 5EMNA 1F48A 4EPRA 3MHPA 3C41J 3I55B 2EVWX 2P6UA 5BYJA 1W4BA 2PEZA 2OK8A 5JHGB 2FE4A 4B76A 3EXAA 4NYIR 2RKOA 1KIMA 2H92A 3C14C 3M0EA 1JA0A 2R2AA 2W6JA 5HCNA 3BC1A 2G83A 1QG2A 4LPKA 3T1OA 1X86B 5EP2A 5TY0A 2RHMA 1GAQA 3ND8A 1TF7A 1VQPB 4QRHA 4HI0E 1JPJA 2CHGA 3AVUA 1M74A 1BH2A 4POAA 4PR0A 2ZJBA 4XJXA 5J47A 3AF2A 4QGFA 2XXAB 4Q1AA 1J2JA 2BSAA 4NCNA 3W2IA 1XWIA 2J0SA 1PVOA 2FFHA 3R7WB 4M4SA 2WHXA 2JDID 3U3JA 3IHLA 4NH0A 2QTFA 4FWTA 1XD2B 1AZTA 1EP1B 4JLNA 3CZPA 4GDFA 1OYWA 1Z0FA 3LD9A 3T12A 1R6BX 1KDRA 3QEJA 4U5XA 1TF2A 2ZSEA 1H42A 2OZEA 4MRVA 1YE8A 4IVQA 4YMWA 3UG7A 1GFIA 4EDHA 1QUEA 2AFIE 2C9CA 4PZYA 1ZCBA 4TMVA 2PLRA 2QT0A 3CRW1 1KK1A 3OFND 3T5DA 3HYRA 4DB2A 2PT7A 2DCUA 4RD0A 2D2EA 5A0FA 2R6AA 2XTNA 4B3FX 1AZSC 2GXAA 3BAFA 2VQSA 2H7VA 3QXSA 3C8UA 5K8IA 5GV8A 2Z4SA 4AI6A 4U00A 1YRBA 2O8EA 4DQLA 2ZRJA 4HSEA 1I4DD 1OV4A 4YXWD 3BFXA 3GJXC 2QP9X 1Q22A 3NVAA 2QA4B 5G40A 1TL7C 3RYTC 4QM6A 1F60A 4G1VA 1XPRA 5JWHA 5FA6A 4TWZA 1FP7A 2WPDD 1S8FA 4HUQB 4G5QA 5CYOA 5D3QA 2FFBA 1R0ZA 2ZPTX 3GJ5A 4XOIA 2AXPA 4CEHB 2CNDA 3K0EA 1FTSA 2FSIA 5DN6A 4CYMA 3GLIE 1KI8A 2O0KA 1IHUA 4JVNA 3P27A 1GM5A 3I72A 3PENA 4R2HA 4ZV4A 4URYR 3RRMA 1Q57A 1SHZA 4XTRA 1E0JA 3QF4B 4HEJA 4B71A 1EFUA 4RD6A 4U9UA 3BH7A 2VNKA 4IFEA 2AFHE 4JLBA 4PSAA 2V7QD 4M53A 3EIEA 3AH8A 3OIWA 1NMZA 3Q8XB 5BWMA 5FOXA 3K0FB 3UANA 4A6XA 1W36C 3CB4A 2ZU6A 2BV3A 2GVZC 4RZUA 4CEJB 1A5TA 4C2TA 3FMFA 4MUAA 4CVNA 4EJSB 1KSGA 2XOKD 3THWB 2VIIA 3C7KA 4BQSA 2HCBA 3NXSA 4DSUA 4DBLC 5KTYA 1QBKC 2ODEA 2ZANA 4XWKA 1NDHA 4DLRA 4PZZA 4F92B 3RWMB 2WAYA 2CNWD 4IXMA 2E1RA 3EIQA 3UPUA 2ZRMA 3A1SA 2R9VA 5JSZB 4WA7A 2NO0A 3M4YA 1K8AD 3EZ9A 3NIBA 4AYXA 4C0AC 5GADl 4OHZA 3ECCA 3W6OA 1ZYUA 2GWHA 5UKDA 4DCTA 3O8BA 5DH9A 1JPNA 2ZYUX 2W00A 4FMBB 2GJ9A 3AM1A 2AWOA 2I1QA 2J0VA 5JBQA 1FW6A 1G6OA 2O8CA 3PVSA 4UNSA 3EA5A 4Q7JB 4NDZA 2FMXA 2WJIA 1TEVA 2GEVA 1YZGA 1E64A 1OF1A 4KBFA 1GTVA 1JR6A 1AGPA 3T34A 1U9IA 1HQCA 4PO1A 1ZP6A 1AS0A 3ZJYA 2BEKA 3CW2A 3E20A 2ZSDA 1CJMA 2AKAB 3W2HA 3WHKA 3ZIAD 2VSFA 2UZIR 1G291 2CXXA 1K73D 4C0BA 4B3GA 2I1VB 2YOHA 4RD4A 2OILA 2C03A 4QJ4A 1E1RD 4NYJR 4BUJA 2GCPA 3K70B 3DOEA 2IT1A 3M6AA 1ZNZA 3FFAA 3VR2A 4ZDIA 5D3MB 2W83A 5EXXA 2J7PD 3P4YA 4QGGA 3SZRA 3B7GA 4EPWA 1D2NA 4H1VA 1RPZA 3VR5A 2JLZA 5FBQB 4R9UC 5BQ5A 5IDVA 3SC3A 3A8TA 2IHYA 2IK8A 2QAGC 1F5NA 3W6NA 4DDTA 3NDBB 1ODFA 1Z83A 5E7JA 1YHNA 4B74A 1N0UA 5JJIA 4Q4AB 4E09A 2FWRA 3CC4B 1GILA 4V0OA 3W2GA 1LS1A 2ZSFA 3A6PC 1TU3A 1G7CA 4JT4A 3H84A 3VNUA 5LD2C 1KJWA 4E03A 4ZCLA 2IYUA 3SOPA 5DO9A 2ZM5A 3SDZA 3CNLA 4DLYA 2DETA 3BXZA 3I5XA 1TU4A 2VRWA 1E9SA 2JIZD 4D81A 1GDDA 3IGFA 4QBGB 4LJ4A 4AURA 2HF8A 3A4LA 3I4LA 4CZ2A 4P32A 2A2ZA 2WWYA 1KD1D 1LTQA 3U6KA 1QFJA 3TR5A 2ZE8A 1DAMA 4CDGA 4NMMA 1E62A 4JZKA 3KB1A 1XXHE 2E87A 5EE9A 3ZVRA 4ARZA 4DCSA 2Q21A 1S4QA 4EFNA 5J5CA 4BFUA 3V9PA 1SKQA 1IXRC 3TE6A 1EK0A 1OB5A 2CLSA 4GSYA 4GZMA 2B21A 3HYTA 1VHLA 4Q01A 5CDFE 1PLLA 2GILA 3B1ZA 3LXRA 2FGKA 5C4MA 1ZM4A 3HR8A 4Q1FA 1IM2A 4Q5IA 1SXJC 2QQEA 1DBSA 3RLFA 1VECA 1QGZA 4LYHA 2ZRBA 1J70A 1S0UA 1GNPA 2ZJAA 3ADKA 3W5IA 5EE3A 3G71B 3QG1A 4LJ5A 2C98A 5CM9C 2O0JA 3GLGE 3Q85A 3I3SR 3MAAC 2ZS8A 4XWAA 2OV2A 4NCJA 4L15A 3ZS9A 1RYFA 2V4ZA 1RRCA 1G9XA 2PZEA 4PTLA 3EPKA 2MMCA 4M21A 2R6DA 4A15A 1BMFA 2J59A 1KY2A 4B3XA 1N6RA 3IO5A 3QEOA 3CBQA 4Q18A 4TTQA 1P9RA 5J40A 4YAWA 1DAHA 1BYUA 3IKJA 1CR2A 2VZLA 2KE5A 2P3SA 1GRQA 2XSZA 5FUYA 2FH5B 1CNEA 1DTSA 1KY3A 3UKDA 4BGDA 5FL7D 5KNCA 4Y0AA 5DGXA 3U7HB 2QBYB 5JFGA 1JQJC 3OE7A 3RWOA 1G18A 2XZLA 4TMKA 4XD7D 2HXSA 2XNJA 3WMFA 1C1YA 3B78A 1PUIA 3ZD6A 4MRPA 1TADA 2F9MA 2OE2A 4LYJA 1J9ZA 2JLUA 3ICEA 3FWYA 4HLQB 3S1AA 1FDRA 3U2QA 4OK6A 1Z06A 3BK7A 2YWGA 2WWFA 4JLVA 2BGIA 1ZJ6A 1Q3HA 1VPLA 5AR1A 2FA9A 2RGCA 3TIFA 1TNDA 4KFSA 2ZRIA 4FD2A 3REGA 3TSOA 2A3RA 3N2IA 1XJQA 5KHOC 4GOXA 4ESHA 5JCZA 1P4SA 2OFWA 4ZCIA 1NKSA 1VQ9B 3H0KA 2C9YA 4PPQA 1NP6A 4EPXA 2REXB 3N70A 3RC8A 2H1LA 3IDQA 3CCMB 3GLFE 5KSYA 4C4PA 2PH1A 2VNHA 5EQTA 2GBLC 1CJTC 4FMCB 1E0AA 4EPYA 3NBFA 3U3RA 3RVBA 2WSSD 1W49A 3ZZ0A 1XE1A 2FFAA 2WJGA 2A78A 1XCPA 3QE0A 5FBLB 5DHFA 3SE0A 5TMPA 2BBSA 1Z6GA 1A4RA 2KWIA 4M8NE 2GTPA 1IJEA 3ZH9B 1LY1A 5HE9A 2R8RA 2WKQA 3SFZA 1M1YE 3LAWA 4YLGA 4R2IA 3TJZA 3GLIB 3B82A 3CXCB 1X1RA 2Q9CA 4JT2A 4JMPA 3UWKA 4PHFA 4D4KA 2BMFA 2MSEB 4AD8A 3BGWA 3L0SA 2C8VA 1UF9A 1X8KA 4ZKEA 2PX0A 3QVVA 2D2FA 3MMPA 1Q1ZA 2XEXA 4U7DA 1P72A 3MUFA 2DBYA 5HE8A 3FYHA 1JJ7A 3GD7A 4QJ5A 3QKSA 4KJZA 1P73A 2XNSA 3TUZC 1BMFD 3C16C 1P5ZB 1D8TA 3M1IA 4L8GA 3IIMA 4Y7CA 2XITA 2FSHA 3SJBA 4EQ6B 3KQLA 4LJAA 2DR3A 2UVQA 5HKKD 1E99A 5FTLA 1N5IA 5GJCA 1F3OA 4JVLA 2ZUCA 1F2UB 4QHSA 1GP2A 5JHHB 1ZUIA 2BVNA 3P32A 1KJZA 4GT1A 1P2UA 3OZUA 1XTIA 3B5JA 3Q3JB 5FI0B 3WNCA 1RZ3A 3QKRA 1CR1A 1KO1A 4GBMA 2CL7X 3EZ6A 2FSGA 2IXFA 2FJUA 4Q4JA 4KYIB 3QJYA 4B3DA 3DKVA 2W0SA 3AUXA 1LF0A 1ZU4A 1CU1A 1XEWX 3LBIA 3VR3A 4IVPA 4MKFA 4Q1BA 1CULC 3REFA 3W5HA 2RAPA 4LY6A 5IF9A 1VYTA 1JR3A 1JJVA 2BJWA 3DL0A 4I4LA 4MH0R 4GP6A 3AVYA 2CHVA 1QHSA 1OH6A 4RCZA 1KNQA 3QG5A 1Z29A 1ZMXA 2OLJA 3GFPA 2AKYA 3PUZA 4C3ZA 2HYIC 1U2RA 2VP0A 4PC7A 4L16A 3QSYA 1FNMA 4BEJA 1HE1C 4NL4H 4Q4LA 1OXTA 1TF5A 4IEIA 3THYB 3NEYA 3JVUA 4IW3B 3QPVA 2Z83A 2YVUA 2ZEJA 4NBSA 1GITA 2BMJA 4LJ8A 4FN5A 5K8LA 2X3UA 3A1UA 3LH5A 3L8YA 5FPHA 4MGZR 2HJVA 4LRWA 2FNAA 3KJGA 1A82A 2QORA 1DPFA 3QXJA 4B2PA 5EXPA 3TLXA 1Q0UA 1W46A 2O8BA 2OCPA 3R8FA 1N6NA 1XTSA 1NBMA 2CDNA 3SI7A 2QP4A 2NO1A 1JEDA 3K09A 4Z54A 3U44B 4D80A 2RC5A 1CBUA 1XEXA 3SYNA 1IN6A 1DAKA 1KK3A 3QKTA 2O8DB 3RS0A 1AMOA 1VYUA 2G1KA 4MDFA 2WWXA 1YJ9B 4WXRA 3MSXA 3P26A 1WBDA 1G20E 3C5CA 2B7BA 3RRYA 3QENA 5AWFC 3RRNA 3QFRA 1G5PA 1OXXK 2C2HA 3OZWA 1OH5A 2ZJZA 2SHKA 1OFUX 2ZJYA 4LPSA 2C77A 5H70A 2C5LA 1DO2A 1P3JA 2L0XA 3KQUA 2BEJA 3V00A 3V4FA 3MWKA 2P6NA 2QN6A 2WKRA 5F2EA 1WCV1 1KI1A 3SYLA 1RJ9A 1XXHB 4ACBA 2DYKA 4DVGA 4AY2A 3V76A 1U9IC 2ATVA 2XZPA 1DAEA 5A5GA 4TT3D 4HATA 3VR4A 5TARA 5CIQA 2F1IA 2F7SA 1XMVA 4R7ZA 1EFTA 5EE5B 4DHEA 3TAUA 1MO4A 3EZFA 821PA 3U4QA 2PEYA 1G7RA 1FNBA 1OKKD 2YC2C 1MABA 5KSWB 1CTQA 1U0JA 1E9AA 1T4GA 1Q7YD 3MRSA 4HB0A 4LSGA 4QC2A 2W6IA 3ZVLA 1IXSB 2VHJA 5DNYB 1UEIA 2FFQA 4HDCA 4M9ZA 1QDEA 3DHWC 1XEFA 2VL7A 2BM0A 3HP1A 2ZAMA 3NWJA 2F1JA 3PV0A 3CX7A 4V02A 2H18A 3B13B 4B3BA 1OE0A 4YAUA 1NN1A 3KB2A 2BWJA 4TL9A 2QNRA 1RW4A 1D2MA 1YZLA 3QBTA 3GLGB 1HYQA 2WICA 3U7FB 1H8EA 1QFZA 1ZINA 2OSBA 4QNMA 4TZ6A 2J9RA 5DSZA 2D4HA 4HAYA 5TVKA 2QL6A 4DEYA 1CKEA 2DEUA 4JBWA 1FX0A 4O2RA 1UAAA 1TPZA 2FDCA 4BE7B 3KUDA 2ZJOA 2XXAA 3VKGA 1Z6AA 1OFTA 2GF9A 1DAGA 1OB2A 3U5ZB 2WJYA 3EAQA 4JLAA 1T3LA 1NBMD 3GLHA 3Q7QA 3R7WA 2OLKA 3X1DA 1W36B 1XD9A 4Q9LA 4DWJA 3SHFA 4RFSB 2QSYA 5E3HA 1TX4B 2QZ4A 1CQXA 3OEED 1PLKA 3KFVA 1CJUC 2VP4A 5EXSA 3CD6B 1CXZA 4LHVA 5KPDA 4B6FA 2I4IA 5FUWA 3WP0A 2CL6X 1QH0A 2IYTA 1T8UA 1CF4A 3H2YA 1W4AA 4NU0A 2IUUA 1X3SA 2XTMA 4G01B 4X8OA 2BCJQ 1EWRA 4W5JA 1S3SA 1IBRA 1ZU5A 2NZ8A 2J7KA 1W47A 1SVKA 3AF1A 2IA5A 3JZAA 3QVUA 5JI3E 1HH4A 2FV8A 2QPAA 3WYAA 4BFTA 1QHYA 1U8AA 1S1CA 3N2EA 4UXJA 2LKCA 1XJ0A 1NSFA 2DFNA 2MMGA 2H8KA 3QPWA 3IIKA 2LCFA 2RGBA 3UG6A 1AM4D 3TSWA 3SNHA 2VEDA 1L2TA 2PLFA 2OESA 5FPYA 4AKGA 3U3MA 3BERA 4CEHA 3ONWA 2DPXA 2A5YB 3OFNA 2ZSBA 2QRNA 4C30A 1U94A 1FL9A 1KO5A 3GLFB 2X2FA 2QEQA 1YKSA 3CLVA 4Q66C 1KAGA 5FTMA 4W5WA 2JAQA 1S9HA 1OH8A 5AJVB 4QJ3A 1NG1A 1MOZA 3QF4A 3I62A 3E1YE 1HTWA 1DO0A 4OJKA 2GA8A 2BM1A 3HR7A 3OHMA 4M1MA 2W6ID 3LVRE 4OJQA 1SKYE 1KSHA 4HE6A 1VQ6B 1ELOA 1D9XA 3LX8A 5IK2A 3HWSA 2WPDA 2J46A 4E07A 3C5HA 4CF7A 5J4HA 4CEJA 2FF7A 3Q5EA 5AN9A 4EJSA 1DDIA 1T3HA 1G8PA 5K8UA 1G3MA 4JIMA 1AQYA 3ZVMA 1Z6XA 2JCSA 2OK7A 4M1KA 3FJOA 4BPBA 3T1VA 1FNNA 1G64A 4CEIA 3LRPA 2NO7A 2A5FA 2QAGB 2BDTA 1Q21A 4TL8A 1NVWQ 4X8LA 3HDTA 3CCRB 2GZDA 3LBHA 1J8YF 4KITB 2ZRCA 1M2OB 3FOZA 1R0WA 2N46A 4QHYA 2AX4A 4NYMR 1XTJA 4FINA 2PMKA 3KTAA 2PX3A 1DARA 3TK1A 1AGRA 2FEMA 4MRRA 2IWRA 2WJVA 3CO5A 3GEIA 1JB9A 3K0AA 4HLCA 5AJYA 5FH9A 3DDCA 3GQBA 1M7HA 1Z8FA 4WW0A 3WMGA 2XOKA 2Z43A 2AWNA 4JJZA 2ZQ5A 2QG6A 2QMOA 3B1VA 4OHVA 2VYQA 4YDHB 4TZ0A 3AVPA 1TVCA 1Y63A 5SZHB 4RD3A 2ZRAA 4DSTA 2DFKB 3IUYA 5C46F 2CNWA 1VQ7B 3FMIA 4TL7A 1YZNA 1EFCA 4ITRC 3NDPA 3LDAA 4TLAA 4MRNA 1JNYA 5FPKA 4BLOA 4PO8A 3ADBA 5L8VA 3NBYC 3CCSB 1TQ2A 1N0VC 1KOFA 4JYBA 4AK9A 1Q1BA 4JLKA 4PO9A 4UNPA 4H1UA 1MV5A 4JLJA 3DEFA 3PEWA 3RC3A 2HXYA 3TR0A 5TDHA 4OQFA 3PEVA 4NZYA 1XX6A 4S2EA 3ZIAA 4R71A 1YIJB 2OTJB 1ETUA 1UKEA 2R65A 4NHOA 4OI4A 5ANRB 3VKWA 2B8WA 4IDHA 1H65A 4Q9JA 2G77B 4OQLA 3GJ3A 3KL4A 1E1RA 2CRVA 1VQNB 2FPMA 1R5BA 4Q03A 2R6FA 2BHRA 4B35A 2R6CA 3IHWA 5FR2A 2GK6A 3CMAB 3NC1C 1WBBA 5G3YA 1CS4C 2J7PA 2XNDD 4BLTA 1GO2A 5H68A 1SGWA 3QIAA 3Q7PA 2PL3A 1LFDB 2HF9A 4H9GA 3BFKA 3P1JA 3VU9B 5IK2D 4F91B 2H16A 3OW2B 5BYKA 2OEPA 1BO6A 1GRNA 1Z28A 3JQQA 4JVMA 5EJEA 4LV5B 2V1UA 3K0SA 2PZFA 4PHHA 5GJVC 3AGQA 5J4VA 2GJKA 3EG5A 5KSOA 3SJAA 3J81k 3RNLA 4W9MC 4ZGQB 1G8FA 3IEVA 4BEBA 1GSIA 1T9HA 4EIWA 2HLDD 3AKDA 2IHBA 2IYVA 1GNQA 3OAAD 4HZUB 4S35A 4XVRA 5DYIA 2G9NA 2YOFA 2GCNA 2RH5A 4OHXA 2OT3B 1YZKA 2WWIA 2X2EA 1N8RD 3AF0A 4NYIQ 4ASUD 4BFWA 2J0QA 3THOA 1E2GA 4Q9IA 1W35A 1DVRA 2HT1A 2JIZA 4ZCMA 3EASA 1RVDA 1G4UR 3QFTA 3WY9A 2RGDA 4V0MA 4UNRA 2QGZA 2ZIAA 1ZD8A 3OEHD 3WYFA 6Q21A 5HCIA 3PITA 121PA 4AF7A 4JLDA 3UXMA 4BRWA 3O8DA 2ZVPX 2EU8A 1KGDA 2Q9BA 3KZ1E 4QBIA 1S1MA 3PG5A 3GEEA 3SS8A 4KLNA 1UKYA 5CB6A 1GAWA 1FFHA 1PLJA 4D0LB 3FHCB 4JS0A 3WXMA 3EARA 2FZ4A 5FPTA 2QE7D 1OH7A 2G3YA 2F9LA 2ZI6A 1NVXQ 1R7RA 3FGNA 1XMJA 5JEDA 3RABA 3K70D 4KXFB 1KMHB 1GIAA 1UDWA 3DMDA 3MD0A 1KDOA 1XTQA 2W0MA 5JI2E 4YALA 3LLMA 3LO5A 1W2BB 1YI2B 5F3WB 1Z0IA 2FPKA 4ESVA 4DRZA 2ZROA 1FP6A 3I92A 1YZUA 4BFVA 2X8AA 1CJVC 2W2VA 4Q4HA 3W8NA 1QGYA 4QKQA 5SZIA 2HV8A 4LJYA 4DCUA 3KFXA 2N1BA 4NE2A 5B2ZA 1HE8B 5E7MA 4C0LA 3WMEA 2FZLA 3FVQA 3SQXA 1GR1A 1NN5A 1RKBA 3IO3A 2IS2A 3K09C 4BFZA 721PA 2QBYA 1NY6A 2RMKA 4IOMA 4ZI3A 1N6LA 4HDOB 4BLRA 4DXAA 2CEAA 4US0R 1RYHA 2F6RA 2XAUA 1FQJA 1W4RA 2ZYVX 3D8BA 3E1SA 4N3NA 5H1YA 4TL6A 4I1OA 4PHGA 5EP1A 3ADDA 1UKVY 4A1FA 1N3BA 1SVOA 1TMKA 2ZI9A 4DQKA 1QHHB 2VBCA 2ZRHA 5FL7A 3EPLA 4G0NA 2QUZA 3TVDA 5JZVA 1BKDR 1FUKA 2WOOA 1Q82D 5FPSA 3T1TA 4G5SA 2PJZA 1N25A 5B64A 4JVSB 4XD7A 2CCJA 4IOJA 1VIAA 3QFSA 2J5XA 3CCLB 3CIOA 4A9AA 4HAUA 2QTHA 1YITB 4GNKA 4ILEA 2DWOA 2WWGA 1CIPA 3H1TA 2XB2A 5TR9A 4C7OA 4US1R 1N2CE 1HT1E 3TW4A 5L3SB 3WNDA 2C95A 3AKEA 2PZGA 3U7GA 2WJHA 4LBZA 3LY5A 2IUSA 4N1AA 3I5YA 3BE4A 1G4AE 2AL7A 1O87A 1PV4A 1G6HA 3T5GA 1AS3A 2FX3A 4DLXA 3GLIA 4BFXA 1WE2A 4MYTA 4TSFD 3T61A 4ZO4A 3UK6A 3OIVA 4QHTA 2HT6A 1NI3A 1G3UA 1M6NA 3TH5A 1Z47A 2RGGA 4HYYA 2GRJA 4QOSA 2OM2A 1E9CA 1XCGB 3RANA 1ZUHA 4GP7A 2FSFA 2F1HA 4PSVA 5KDDA 2WSSA 1O3YA 2IYYA 1JB1A 4Y9UA 3CRVA 2BKEA 4B3CA 1SKYB 1NJGA 2GKSA 2ERXA 4KSBA 1DS6A 4M9QA 1AKYA 2J87A 4NYJQ 1SVSA 1ZIPA 1COWD 3OJXA 2B6HA 2F3RA 3E70C 4EQ6A 4M2LA 1J90A 1XTKA 3CPWB 2EFHB 1SVIA 4RKEA 3PCRB 4OK3A 3FDIA 4NCKA 1F2UA 2CJWB 4ZDJA 2AHOA 3KJHA 1P60A 1MKYA 3T15A 2D3WA 2OBMA 2V8OA 2OXRA 1EG7A 2X1VA 2EFGA 1WRBA 4PPFA 1YZTA 4TN1A 3WNBA 1VG8A 2OCBA 5FBVB 2GVDC 3FMPB 2GEUA 4LV8B 4MGIR 5EE1A 4V0LA 3LW7A 4ZDKA 2ZRDA 4M1YA 1E3MA 1CEEA 5HKKA 1CRPA 2TMKA 2VA8A 4NP6A 4G1UC 4B2IA 3BB1A 1K5GA 1VCNA 3NH6A 4G3XA 1GZSA 3IBYA 1XPUA 2J3EA 3LX5A 4TLCA 4O3MA 2O8CB 2JLRA 2CVHA 4RFVA 3U7EB 3SHWA 2CBZA 3B9QA 4B44A 3CUEF 3QOFA 3LQRA 4ZKDA 3KKQA 3VMFA 4RJLA 1JR3E 1NRJB 1ZBDA 4IDOA 5AK0A 3THYA 4NTZA 1NNEA 2A5JA 4DEXA 2BN4A 4C43A 3G4SB 1G8GA 2OBLA 1E2NA 4JSYA 4X8HA 5CJ2A 1GJRA 4K46A 3VX4A 3D3QA 4MKHA 3U60B 1GAJA 2ZR7A 5GVSA 2JLYA 4JLPA 1E94E 1V5WA 4EH1A 3E2IA 4MDEA 1EWQA 3X2SA 1IN8A 1QHIA 1B23P 1NN3A 1F6BA 5L3VA 3BB4A 2GEDA 4KCGA 4UNNA 3WRYC 2W58A 4WVFA 5C18A 3U44A 4UJ3A 4A2PA 1NVVR 4EJSC 3CCEB 1GVNB 4W5HA 3LO8A 2NMVA 1W44A 1XDBA 2ZS9A 3A36A 2N42A 5EP4A 1YJ5A 1J8MF 1NLFA 1HUQA 2WV9A 3UWOA 3DVLA 1N6PA 1E2QA 1OIXA 5AUNB 3W90A 1SHKA 2XNCA 3CR7A 3HU3A 2HDNB 2ORWA 2REBA 1E2KA 1QHXA 4YMSA 3PQCA 5CB8A 3B1WA 3H86A 1US8A 3E5HA 1P9NA 2WIBA 2BOVA 4LJ9A 2RGNA 1HV8A 1YR8A 2ERYA 2Q6TA 1GWNA 4GPTA 3NBZC 2IYSA 2QEXB 2QPTA 3W5VA 2WWHA 2ZREA 1BS1A 4M1SA 5KYKA 4FMDF 1TTTA 4PQFA 4A4DA 5CIWA 5JCPA 3RS3A 4TYYA 3CC2B 4BLQA 4D26A 3GMTA 1II8A 2DFTA 1KI9A 5KO2A 3K8YA 3A58B 4YONB 4V0KA 1G17A 1JXOA 2IX3A 5FTJA 4DDWA 5C4GB 4P31A 5CM8B 2IS4A 4JKYA 2YZ2A 4DLVA 2QRZA 1OIWA 5JECA 3R9WA 3IPYA 3OIYA 4ARZB 3V4RA 3TKLA 5CLQA 1P75A 3KQKA 5KUTA 2JJ8A 4B75A 3A4NA 2WM9B 1P61B 2VNIA 3R20A 2MSCB 4BLPA 3A37A 1Z0JA 3CPHA 4TT3A 1HEIA 3LXXA 4TLDA 5FBRB 3C4JA 1KI4A 2EYQA 4GL2A 4C9BA 1WDTA 1KDPA 2OUKA 1XU4A 3GLGA 3PXGA 2AD1A 3VO2A 2NTYC 4ZIRB 4LK2A 3EZ2A 4Q1DA 1OKKA 2UKDA 4RZ2A 3KXKA 4KO8A 2HYDA 1E2IA 4TMZA 1U99A 3VHXA 3I61A 2P2LA 1E1QD 5CK4A 1ZRHA 1L8QA 4TQAA 2VHUA 4KSCA 3TW8B 3QE2A 2OO7A 1KO4A 4LOAA 1MRNA 3F3YA 3T35A 1WP9A 1KK2A 1T3SA 4ACAA 1FRQA 4NPHA 4FIDA 4P4UA 1L4UA 2CK3D 4TMWA 1P6XA 3FB4A 2FG5A 1Y3AA 3AEZA 3OESA 4IXNA 4KU4A 4FK8A 1R5OA 2JLVA 2V54A 4B2LA 5L3RA 4A2QA 1SXJE 1Z63A 2JJ1D 3G6EB 2ZRGA 4KODA 4A8JB 1U8ZA 4EPVA 4K81B 1YU9A 5BN3A 3IBGA 1VQOB 2BBOA 3GLHE 1FZQA 2I3BA 4HZIA 4O2LA 3K1JA 2V3CC 1IOZA 2EWVA 2ORVA 1OSNA 1N6KA 2JATA 4P4SA 4JBXA 3G0HA 1VQ4B 1JXMA 2OTLB 1S2MA 1R10A 4OHWA 4CT4B 4DT1B 4AKHA 1DEKA 1XFAA 4US2R 1EFRD 4RD1A 2G88A 1QVFB 4KVGA 1R8SA 3ZBUA 1Z6TA 3OEEA 1C4OA 2Z5FA 3QXCA 3B85A 1E9BA 3CC7B 1F2TB 3ETLA 2AK3A 2ZR0A 1XZPA 4M1WA 1IQPA 1SULA 2O52A 4FXPA 1L7VC 1ONBA 1FPMA 1UEJA 5DI3B 4DIEA 421PA 1JAHA 1GKUB 2H57A 2WSMA 2DHRA 3VFDA 5SZKB 1T5LA 4CIDA 1EP2B 2NOAA 3AUYA 1TAGA 4BWYA 2HMAA 5B30A 2XZOA 1N5LA 5FOWA 2XB4A 4URXR 2XGJA 4LBWA 3CCJB 2IL1A 5HPYB 4GMXA 1XNJA 1PUJA 4GMDA 1E2PA 1G8YA 2WAXA 4OHYA 2GNOA 4HAVA 4WZ6A 3LNCA 2YYZA 4AWXA 3O8RA 4I81A 2F43A 2ZRLA 3TUIC 3KKNA 1VHTA 3L43A 3AF3A 3LFUA 3NHAA 4LHWA 2A5GA 2H17A 2IEYA 4YMUA 2R62A 2RB4A 3BIFA 1H8HD 1N6HA 4RVCA 2NIPA 1R0YA 4I99A 1QG4A 5C1BA 2CMKA 2PBRA 2VF7A 3QPUA 2RC6A 4JL5A 1VIYA 1II0A 1OYYA 3THXA 1SM4A 4LYFA 4IOLA 4LC1A 4KBGA 1KRHA 1IY2A 1CRQA 4A0GA 1U81A 4EFMA 2ZE7A 3ZD7A 1IB0A 1RFLA 4LBVA 4Q48A 3QI2A 2QMEA 2EFCB 3GJ8A 4NCIA 1BYIA 2EIXA 2C96A 4M9SA 4Q21A 2GAAA 4WXPA 4Z1MD 4DB4A 3TVTA 2IXEA 4O25A 2OG2A 2EWWA 3DZ8A 5BN5A 2D7CA 5E95A 4FCVA 5FTNA 4CGZA 4OYHA 4LYAA 1IY0A 2ZJ5A 4DUGA 2IWHA 1CJKC 2IEZA 4IKEA 1W36D 2GJAA 1Q44A 3GJ4A 1GL6A 3D7MA 5HXBA 1NL3A 3RDPA 3CRQA 1G5RA 1E79D 2B8TA 2REOA 3CF0A 1KC8D 2OHFA 5JWRA 4UXIA 3IPXA 3GPLA 1IY1A 1XRJA 1DADA 1E9DA 4XVUA 1N5KA 2CLCX 2R6GA 2ANBA 5SZJA 3UIEA 3MFYA 1A1VA 1X8LA 4WOPA 2X19A 3AB3A 3IIJA 1OLOA 1QVAA 2ZS7A 4AIIA 3QKRB 1QHNA 2F55A 4N0DA 4DDVA 5EXTA 4BZPA 1XD2A 4F38A 1T0HB 4Q4JB 3DM5A 3R9XA 4KFTA 3SQWA 2GHIA 2ZI4A 4BFYA 5L3QB 2GXUA 4YAOA 2G1JA 1GL7A 4F7DA 4RSGA 3MWYW 3QQ5A 4FCWA 2JLWA 3QXXA 1WB9A 2QT1A 4RZ3A 1E0SA 1KO7A 5BN4A 1S96A 3F0TA 4HLDA 4NKRA 3ASZA 2O8FB 3FHOA 1SZPA 1QGAA 1GL9B 1P62B 4Q7KA 3CMEB 5F98A 2VHCA 2QENA 5GVRA 5FTKA 5DYGA 4DSOA 4Y0VA 1EP3B 4LJ7A 3VU9A 3QNUA 1ESMA 4HLUA 1Q86D 2ZI7A 1VQ8B 1ZM2A 1E9EA 2GZAA 3FKSA 4HUQA 1E6CA 3GP8A 1M34E 3ND9A 1T0JB 3D6TB 4ZDWA 2ATXA 4G1BA 4M9XA 1LW7A 4C0HA 1G3IA 1GUAA 4MA4A 4ON9A 5DHAA 2RCNA 1XMSA 2V55B 1KZGB 1T6NA 1KMQA 2YOGA 4KFUA 4M0LA 4HAWA 2XNDA 1EXMA 4D0NA 3KDSE 3K0FA 2ONJA 3CH5A 3I8XA 2B7CA 4FI3C 2QGNA 4PX9A 3EW9A 2Z6VA 5H5JA 4XWOA 4DUGD 2DWPA 1G5TA 4IRUB 5KOYA 3THWA 4Q1EA 5FFMA 5BW8A 2CVFA 2GJSA 2GK7A 3GFTA 3L82B 2Q3FA 4WAUA 1KI3A 5IT5A 1HURA 5KSPA 4AF6A 1NJID 4IJMA 4AKIA 3BH6A 4TYWA 4V0ME 1FNDA 1P2TA 2HLDA 1ZNWA 3OAAA 1U0LA 5JSZA 3FE2A 2ZRNA 5P21A 4ASUA 2A7QA 1J7KA 3FFBA 5CK5A 2W2XA 4L9SA 2VTKA 3C15C 4IDPA 1KHTA 4WBSA 2NZJA 1KMHA 2FEOA 4P33A 4BZXA 5LD2B 5J4LA 1MO5A 1W0JD 4ZGNB 3FHTA 4V03A 1UADA 3VR6A 1YJNB 2VSOA 2WOJA 3B2EA 3OEHA 5H8WA 1E4YA 1Z08A 3U4QB 2ECKA 4E5UA 3T06B 3EC1A 3CWQA 4DZZA
chains in the Genus database with same CATH superfamily
4EM6A 4H16A 2YFYA 4R5MA 1HWYA 2FMKA 4HB4A 3BREA 3ASTA 5BXQC 3S70A 4NNPA 3SWWA 5IXSA 2EQAA 1AS2A 2C4WA 3N8DA 3KT8A 5GZ6A 2VP6A 4XWYA 3Q7EA 2P67A 4YAGA 4LNUA 1HDZA 4PVDA 2HHAA 1Y9ZA 2FF5A 1NYRA 1PT5A 2NV0A 4HB2A 5EMLA 3A6FA 5I7VA 3OCJA 4IPTA 3TR6A 1VQMB 2O57A 1Z2PX 1PFGA 4U1RA 1DCMA 1FLDA 4YAFA 1LBEA 2HBZA 3FVTA 1G2QA 1IG0A 4IJUA 2QD4A 4EPTA 4IHJA 4X71A 1H2XA 1K1EA 1PJBA 2R8OA 4PSCA 5J63A 3R7SA 4AMVA 5AUOB 5HUQA 1G19A 2FQ1A 4J9UE 4MWBA 1B14A 3KLOA 3RHTA 5FA8A 1MO6A 2O2XA 3TEMA 5K3EA 4LSZA 1E9FA 1MTOA 1JKFA 1VP3A 1YULA 1AF7A 3FKSD 4MV9A 4AKEA 4EATA 5BNIA 2DB3A 2REQB 4YY3B 2R00A 2JH9A 4Q7MB 3V8RA 4G56A 2BJVA 4QYIB 4KOEC 5D51S 2OZPA 3VPFA 4ALNA 3O92A 3H3FA 1NY5A 3A4VA 5GM1A 4FCTA 1KR2A 2PM8A 4NBNA 2GZ2A 4YCJA 4Q4AA 3QBVA 4BCBA 4I1UA 1UBLS 5CDGA 1ZIOA 5EJMA 1DIOB 5EZQA 3GLHB 3OJFA 2PUWA 4G8DA 4N0EA 2D3NA 4K8OA 3VC1A 3SSOA 2R85A 4B4DA 5J3JA 3GJZA 3C0KA 5EYPB 1K89A 3AQ4A 2O2DA 4C2UA 5BSYA 1IFXA 3RS2A 1Y3CE 3I9JA 3GOHA 1J1ZA 4Q1VA 4K6HA 3GVXA 1KDTA 4KPUB 1MUUA 1U7XA 2WU0A 3AV3A 2DPYA 3CX8A 1EVIA 2QN7A 1WOOA 1J9GA 3EGCA 4KQ2A 5IS2A 3ED5A 2YMMA 2X9LA 2GOYA 2PAAA 4JDPA 4KP7A 4Q15A 5ALHA 3TN7A 4FFSA 1M5TA 1KF0A 5IT4A 5B3JA 3TOSA 1ZVKA 4H7JA 2CFIA 4JLOA 4L02A 3EA4A 1DQZA 4AYTA 3HXQA 1UDCA 1BH6A 2X5KO 1CJSA 3G82C 1SQGA 4IL5A 1BDMA 3L7IA 4J1SA 1BRMA 3ANXA 2E7ZA 3DL4A 4J2OA 4KC0A 5LZ9A 3DB1A 4KR2A 4Q1CA 2ZTVA 2FX2A 2WG2A 4H4EA 4I1YA 4KE6A 5K9ZA 5CLFA 4O0MA 1DFIA 4MK4A 5ELLA 4MW4A 1R6TA 3QOYA 1DTWB 3RGGA 2O7RA 4URWR 1WMDA 2VZ9A 1ANKA 1EQAA 2NG1A 3RRZA 1H66A 2IP1A 1WOYA 2IVFA 1HKHA 3MFQA 5B4VA 1SG6A 3Q41A 4DBZA 1Q14A 3D3EA 5I7UA 5HQ3A 1RPJA 3G9XA 3G8DA 3BD8A 3PKJA 3SY8A 1M3SA 4C2BA 2ALJA 4LF8B 3PC7A 1I8TA 4EZEA 1T25A 4TSFA 3HDQA 5A0VA 1C14A 3RT7A 5YASA 1GZDA 1TJNA 4JB8A 3ROKA 1KS9A 2Y93A 3PUJA 4FFWA 3SZOA 2ZXEA 3ZJ4A 2IYZA 4MDHA 2EF1A 3T6KA 2JKZA 1Q6YA 2AK2A 1JQAA 3JQFA 2E82A 1XQ9A 3MOSA 2NQ2C 3C3XA 3OQ6A 4N6NA 5KQGA 4ZWNA 1KMIY 1FMJA 2BKUA 1OLXB 5AHOA 1WHSA 4NFYA 4OBEA 1QONA 2AOTA 2WSLA 5BVGB 2WKPA 3UB2A 2VHTA 4D4MA 4ER6A 2Q2WA 4XQFA 5AJZA 5KKAA 4IDNA 4UAGA 4CEIB 2ONCA 3HLTA 4GL4A 3H2BA 2JHPA 1WPGA 4GMFA 1XZEA 4R41A 2WU8A 3SQOA 1HLGA 2QPLA 3UV6A 3TECE 1DQRA 2UVDA 1DJQA 1ODLA 2RH8A 3GDOA 4AJ1A 2IYNA 3H1PA 4NU6A 3Q88A 5TJHA 3O95A 3CNEA 3ZNNA 3ZHUA 1VRVA 2JFYA 2IZOA 3QVJA 1J24A 3ZXYA 1RCFA 3Q0TA 3K0AB 5ER9A 3S44A 1EXWA 5JS8A 2J3IA 4CN8A 4KBYA 2JI6A 3V32A 4BFSA 7YASA 1R2QA 2V7UA 4CKXA 1KXZA 2VI5A 1R1DA 3ILHA 5EP3A 1SOUA 2YHIA 4JZYA 4WXYB 5BMVF 3EQ9A 3JTMA 4Z53A 1R0KA 3VYWA 1A2OA 2C9MA 4U2KA 1N08A 1Q0QA 3O7MA 4F0JA 3K6JA 5BR8B 1Z2CA 4JLMA 4CKWB 4HL6A 2LD4A 4YACA 1JJAA 1HFJA 2AOVA 2WJJA 4YYEA 4P4TA 1SVLA 1NRIA 3DOFA 1IMOA 3ME5A 2JBHA 2Z08A 3KNZA 5JEEA 2ZBQA 1RIFA 3IDZA 2YWDA 3P9CA 4L9WA 3IMCA 4RQAA 2PJUA 1ODKA 2O3QA 3O26A 5G3ZA 4QGSA 3FKQA 4NOKA 4PQYA 2NUBA 5B1HA 4CM4A 3JZDA 4HDNA 1WUYA 1K7EB 1Z0UA 3ZZ1A 5AUQA 5HGJA 2O1SA 3GAZA 1UXOA 2DFLA 3RTEA 3HE3A 4CWAA 4RHFA 5JANA 1DINA 2IYQA 2R8EA 1IIBA 1VG0B 5T8KC 4GVPA 1EBFA 2NPFA 1UZNA 4OK5A 2LZJA 2QY9A 4F4UA 3IUQA 3L40A 2W2LD 4XPIA 3DLHA 1XN1A 1C0IA 3LV8A 2J1LA 4J0HA 2AMLA 4C7VA 5EZYA 1PDWA 5KNBA 1M0WA 1WMBA 4Y0NA 3A6DA 4O4HA 1Q91A 3SSMA 2IU3A 2OGTA 2AEEA 3BMNB 1OI4A 5LMZA 3ZTWA 2A0UA 3QFHA 1OWNA 4FWIB 4IMPA 4UZSA 2IIVA 3KAQA 3N6RA 4RXMA 4CLRB 2BYTA 1TK2A 4RM0A 3A4MA 3JQRA 2VDWB 5F9HA 2IOHA 4N9WA 1SC4A 1OHHA 1ZXLA 2XVAA 4OIFA 3NORA 2XRZA 2JCYA 3NT4A 2Y77A 3AJRA 4OQXA 4ZYLA 2ZULA 5A7HA 1Q20A 2VF5X 2YXBA 4D4JA 1NM5A 2FN3A 1EM8B 1STOA 4MA5A 3W5UA 4G5YA 2J5BA 1K4YA 1I3MA 1GDHA 1E1LA 1RRGA 2YBDA 3VKHA 1CLUA 4JSTA 4W6ZA 5EWMB 1M90D 1U3GA 3KQSA 4CR7A 1RLUA 3AWDA 2GPBA 3E3MA 4NEHB 3AIIA 5K2OA 2R1UA 1ISMA 4K9SA 1KDYA 2W93A 5DLYA 1IUKA 2VKQA 3ZGLA 1KYZA 5TLSA 2NGRA 3ETEA 1G42A 1UMCA 2VO1A 3DMGA 4QT4A 2CV2A 2CLFB 1Y1LA 1DEHA 4ZZ2A 2R0QC 3VZQA 2RBGA 1SZCA 1B0PA 2WIDA 2O4UX 2WIJA 3AC0A 5AJUA 3O7WA 2E1PA 4GX2A 2P5SA 2HXGA 2OGUA 3E22B 2C3MA 1JAXA 1QHGA 1YS6A 4FGLA 4ZYUA 5A4IS 1X1DA 5KTTA 2RHDA 3NDJA 3GLQA 4LQCA 4KUHA 3WGGA 3PUVA 1TKAA 1SBIA 2PR2A 2DY0A 3EFEA 3Q9LA 3CONA 2RGEA 2GZHA 1T8TA 2IC5A 4XQ9A 3KQMA 1IN5A 4GWLA 3AVTA 16PKA 2V0NA 1JGTA 1UC9A 3P0IA 3ADCA 1ULAA 2RGAA 1A76A 1ZH6A 2ZDQA 4MRSA 3D54D 4COOA 4HC4A 4REOA 5FL3A 1E8MA 2Q9AA 1ZGCA 2GPTA 2ERCA 3E9NA 4RESA 1U7PA 3ZK9A 7MDHA 2P3QA 2H1OA 5GZ1A 1TAHA 4NONA 5AVVA 3EXHC 2XA9A 3WJ1A 1XDZA 3BBPA 4B81A 4BDTA 1KAOA 3BE5A 1IWOA 4LHYA 1XQXA 5TMEA 4F86A 1GVHA 1S3GA 1E1QA 3KXDA 3VM6A 3A1WA 2RGXA 3JRNA 3UJNA 1OASA 2A9QA 1IAQA 3HLYA 1EBUA 1LZLA 1KVRA 1YV9A 1AXEA 1JH8A 2FZVA 2IW3A 2V98A 3P9YA 4DLUA 4JXKA 1OGJA 4E32A 1RC8A 2QVBA 1OPXA 2CK3A 3DVAA 3FFXA 2N47A 2AJTA 3L0BA 2D0DA 3KV1A 3ZIUA 1TW2A 3OIUA 1I3OA 3KHTA 4JUAA 4QREA 4NJMA 3F71A 1A4UA 1J2TA 1Y48E 4KLCA 4BZQA 3LOQA 2VUSA 1ARZA 2GAOA 1JA9A 2D8AA 5B6IA 5B58T 2JJ1A 4R9NA 1PS0A 1BOOA 3V8EA 2O8DA 4RCYA 1GRVA 4G1EB 3UPDA 2G8NA 3ZBTA 2YQ5A 4P6VF 3BWBA 2X6YA 3M5WA 3RJTA 5FT9A 5CTAA 2QZPA 1VKRA 4Z4HA 5B4TA 1ISSA 1C7FA 1KZLA 1UC8A 1LUAA 3JQ6A 4ROTA 4MQFB 4LZNA 4XGKA 5FUXA 3ILSA 1L3BA 1V41E 2VK2A 1JTFA 1YR9A 4KDEA 1QGUA 3AIOA 3NGLA 1IQRA 4I9HA 1N2CA 1Q1EA 1QQ5A 1SB9A 1ZD3A 3Q6RA 3ABOB 5BSVA 2GN9A 1XU9A 2JJ2D 2GESA 2QMQA 3KZCA 2XYQA 2H7CA 1X7YB 1ZN9A 5IDQA 3L7BA 1SU4A 3LUKA 3WXBA 3B7PA 5FPPA 1X0VA 3DUFA 5L6LB 1RACA 4JWKA 1JV2B 5A2GA 1DEOA 3RB8A 4F4JA 2P5TB 3TQRA 3W8RA 4KRXA 2P62A 2Q3JA 3ORHA 3W6ZA 2B61A 2Z4RA 5K8TA 2Q3HA 4E1BA 5DCUA 5F7JA 4HDKA 4NAVA 3S8MA 1XNRB 4JJKA 4DNFA 1J5PA 1T29A 1CR0A 5EHNA 3AXTA 2C5HA 1L7XA 1Q15A 4XFDA 1AQNA 3BH0A 5FBHA 1Y3DE 2IS1A 3VDNB 4YAIA 1WD5A 3KE9A 4K88A 4I5FA 3EULA 3VBCA 5FOQA 4TUYF 1HE3A 1JHMA 3DWGA 3WHLA 4MI6A 2BP7A 5A5EA 1M1KD 2HSDA 3EQ7A 3NDIA 3Q5GA 4Y30A 5ETJA 1EIWA 3V4VB 4D82A 5JS7A 2IXGA 3W34A 4WN9B 2BZGA 5K03A 4ZMBA 3LSTA 3SZMA 2QKYA 1V3VA 4AWBA 1LDEA 1ZC3A 1H8HA 1D1NA 1O94C 3PXCX 5U1PA 2FI1A 3WK8A 5IZCC 1F7UA 5T4HA 1BC5A 2BIFA 2H31A 4ZK6A 5CITA 3I05A 2DRIA 3CZAA 5KPJA 2ODWA 4XVCA 5A0TA 3GGSA 2FU5C 3D6HA 5BURA 1BGWA 2C82A 3LYAA 4LRTB 1M9NA 1EWVA 4PRKA 4LJSA 2Q7DA 3I12A 2YH2A 2IH4A 3NAMA 4DQ0A 3W2FA 1E2EA 2QA5A 1AA9A 5A88A 1L7AA 4W4TA 3E53A 3DLPX 1NVVQ 2ZSAA 1HDGO 1Q0LA 4NARA 3AVVA 4OQZA 2XVXA 1VHWA 5CXXA 3A1EA 3CX4A 5BWCA 1L1FA 1MAUA 3F73A 1UAYA 5JJ5A 2WE8A 2UZ3A 2P9QA 4QEDA 5EIOA 3SR3A 1WDKA 3DLAA 1BXGA 5FOVA 4ABYA 4CRWB 4OEHA 4MMZB 4DIDA 4ESEA 1DBWA 5LR6A 2BBWA 1GKYA 3VJRA 1JDSA 2NUTA 2O5VA 1SIWA 2R25B 3P5SA 4J0JA 1A2KC 1OZGA 1Z0KA 1QZXA 4MV4A 5KTSA 3GGCA 4CQLA 2W48A 4ZYTA 4KHZA 2Q5FA 5IDWA 1SKMA 1TTPB 2PUHA 4NE7A 4P58A 6PFKA 1HDYA 2O8FA 2JGNA 1CQPA 3MWJA 4HDAA 3ZDCA 1XYYA 2JIMA 4C4YA 4D7AA 4FYXA 3ESQA 2ZXIA 1IZYA 2P9FA 2VXBA 4OHPA 1PBNA 4HNQA 5IHPA 1H4TA 4Z7OB 2Q3EA 1CDEA 2EG9A 3WBKA 2D06A 2ZR9A 5G0TA 1KE2A 3VZBA 3HXLA 4PY2A 4Z4GA 3NASA 3R09A 3NTQA 1XL0A 1XQVA 2Q5EA 3BE8A 5DLDA 2WUEA 2JLQA 3DE3X 3BQJA 1WQ4A 3C3KA 4ZYZA 1U7WA 3U37A 3ZYCA 2UZ4A 4DCNA 4XUEA 1L5KA 3GLFA 2FQWA 4MR9A 3Q72A 4U7HA 1RCTE 3CMMA 1FFGA 1Z22A 4ZZIA 3DAGA 3AEQA 3HWRA 3FR8A 2Q45A 1MEOA 4PC1A 2CLLB 2D1SA 3BWEA 1NKTA 4KR9A 3T5CA 2JLSA 4LCJA 5E7IA 4DQVA 1IM5A 2IXBA 2QN1A 2QRQA 2X6RA 4JUCA 1YUNA 4YAEA 1K27A 1W48A 1K28D 4I46A 1ZY2A 1E9RA 1EUCB 1UWKA 1W25A 2GMWA 4JWTA 3CE9A 3TZKA 3ZKWA 2VJBA 4ID3A 1JQLB 1U1EA 2C2GA 2YVLA 3HYCA 4F9EA 1TQDA 3NTOA 4EI2A 5M04A 4EARA 2BFBA 2EQ5A 1BOFA 2FW1A 5ENDA 3PCXA 3AVQA 2OA0A 5JZBA 5KQSA 3A6KA 1VMIA 2IY7A 2ZSIA 1FSZA 3KUXA 1OGIA 3SC2A 2WT9A 3D7LA 2JIRA 5LA6B 5C8YB 1NLUA 1BU8A 3OP1A 1THMA 3K9CA 4I9FA 4TV9F 3N6VA 5EWLA 1KY5A 4S2UA 3AKCA 3HDVA 4JI5B 4P81A 2VDPB 3CWZA 3TQFA 5IMBA 3LYLA 3DXXA 2C2WA 5JADA 4L5BA 3AONB 3ER9A 3H4VA 3M5DA 2YKGA 1EK1A 1JA1A 3T5TA 3H3XA 3ROFA 3OEYA 4LDQA 4MQLA 1OR8A 3N2GA 3BZUA 1II8B 3C5VA 3GU3A 3OT4A 4EYKA 5MFZA 3R3UA 5EHGA 3ANLA 3N7UA 4GX5A 3S4YA 5BVHB 4JJIA 4L7QA 4NR0A 4P7FA 1DAFA 4ZCQA 4X90A 3CRZA 4I50A 4C89A 1WSVA 3E15A 1JALA 2P3MA 1NW6A 4Y9DA 1TCCA 3TBKA 1KFJB 2OVBA 4II7A 1XZGA 5IT9A 2JZCA 3UT5B 3QY9A 4QPPA 5EIFA 1D2EA 1K7CA 2XD9A 4KQGA 4QQKA 4UDXX 5DM60 2JK1A 2Z9CA 2ES4A 3HVRA 2UXCB 5TX7A 4LZZA 3RSOA 3WYGA 3RHFA 4Z3KA 1KI6A 2IPAB 4WNYA 3TQOA 4LOJA 5CBKA 1JR3D 5DV9A 3U56A 3WLAA 1PBTA 3UUGA 2EP8A 5AI6A 1S3FA 5CNIA 1H22A 1UBFA 5DE3A 1CR4A 1XP8A 3IJPA 4HNGA 5H59A 5EXDA 2ZWMA 3TUJC 1A9XB 4CW7A 2I4OA 2JIPA 2QTVA 2E85A 3WJAA 3EMKA 1XCMA 4PPGA 4DLSA 5HUHA 3V8NA 2XIQA 5IC6A 3NALA 1KFEB 1NP7A 3OSUA 4QECA 3FMOB 3ZJ5A 5BWBA 4AL4A 3TAHA 4PBTA 3JALA 3V6MA 3N2YA 3L8HA 10MHA 3FSRA 5E4JA 1SBYA 2CZCA 1AUVA 2XUDA 3NEJA 4CMHA 1P33A 1UOOA 2BGGA 3DLCA 3SQLA 4RH0A 1QVVA 3HR4A 1NDUA 2VPPA 4N41A 2SKCA 1SXJA 3EVFA 3Q8MA 1PR4A 1R8QA 4K9OA 4IBOA 3FLAA 1C30B 3E3OA 4LAFA 4Q3NA 4DABA 3TTVA 5FOSA 2FXVA 1K0UA 3CKLA 1P7CA 4IJ5A 3RTGA 1YQUA 3W5AA 3O3NB 5CAEA 5EWJB 2G0NA 4M1ZA 1SG0A 3EXIB 4EYQA 2FEWB 1LTHR 4BGUA 4ZREA 1IZ8A 4KK3A 1VDZA 3KEWA 1QO7A 3AI3A 1DAIA 1R8YA 3HU2A 3LCRA 1KYIA 1HDIA 2XX3A 4L0MA 3AR7A 2GEKA 1BX0A 2JPDA 1LBTA 3H5LA 3LUDA 4D8VA 3SEAA 1NXOA 2BC9A 3EVCA 4TLEA 5FF9A 2JDIA 3BB3A 4AXBA 1G8HA 4V2UA 4YRZA 4HZUA 3NPMA 1YGYA 4BNJA 1Q7BA 2QP3A 1VBNA 4HQFA 1URPA 3O2QB 4YRQA 5EPUA 2OV1A 1K3UB 1ZC4A 3R6TA 1Q12A 1XEXB 2R4TA 4TV8A 3L5OA 4XVQA 4ZVKA 3RSSA 4JJ4A 1UFQA 2QVYX 1GA4A 2C0PA 3L9WA 1UODA 2I3GA 1S6YA 2W6MA 4CKBB 5A5VA 1GGMA 3IDAA 2BI7A 2VYVD 3LCUA 5LOVA 3A8JA 1Z2NX 3V48A 3VR4D 4D0RA 2FAXA 3TBFA 2Q5QA 3WB9A 4ZYVA 2OD2A 4F6LA 4IRXA 4KXXA 2FPIB 3ZHVA 2EFEB 3HCDA 2QR5A 3ST7A 1GZ7A 4LC0A 1T9GR 1V7PC 2HQRA 2C8JA 3A8KA 2V1XA 2BEWA 2W37A 2WZBA 3CH6A 3QBDA 2YNMC 4Q05A 2VP9A 4C4OA 1NXSA 1YJCA 2G4VA 4OFBA 4ZI7F 5CFMA 4C4XA 1GNRA 1WMSA 4IIEA 3LWBA 4HZGA 2ZT6A 4A92A 3V7WA 2X41A 2GS9A 2ZL5A 13PKA 1R4AA 3AEYA 4FUTA 4K9MA 3JQAB 3V2IA 1SCQA 5G53C 1JAIA 1UBMS 4PSKA 3DDHA 1L7MA 3JWEA 1RJ9B 2XMBA 4GLFA 1SUWA 1E2JA 4HNRA 4UE2A 5JD6A 1Z8NA 2EX1A 3UXHA 2QSZA 2NU8B 1DBRA 1LWNA 2GBLA 4CM7A 3DOCA 2EFDB 4MWDA 2GPYA 1X7GA 5CVDA 4WQMA 1I3CA 2H63A 1H8ED 2EV9A 4E2XA 1SA0B 4HAZA 4PFKA 4CQMD 2BBTA 1NVDA 5C2JB 1PJZA 3KYDB 4Y2YA 1W0KA 4FR2A 1QF9A 2WDZA 3RVLA 3WL6A 1SBQA 2GETA 3F2VA 4MO2A 4H3VA 3KD2A 3RS4A 3D8UA 1DLJA 4A3SA 2QY6A 1EXNA 3SD7A 3COSA 5F3RA 1F48A 4QFCA 4N54A 4CR8A 3MHPA 3I55B 3LF1A 2EVWX 4ZODA 2VK4A 4DV3B 1DLIA 1W4BA 1E4EB 2PEZA 4K6CA 1CY0A 4MS1B 5JHGB 2I2DA 4ZEWA 2CSXA 1GN9A 1RP1A 1V35A 2H92A 2ACKA 2XYVA 3UC5A 3M0EA 1JA0A 2W6JA 4ECEA 4CLDA 5CXUA 5B36A 2VUUA 4HWSA 4LPKA 3T1OA 1X86B 1YQQA 4AJNA 5TY0A 5D2CA 2XCUA 3A3GA 2R6R1 3JWJA 1VQPB 4QRHA 3ISXA 3H5NA 3TFWA 1M74A 1BH2A 5J47A 1LTKA 3KAJA 1Z74A 3AF2A 3QWBA 1PR5A 2XXAB 1QCZA 3UUWA 3D3JA 3M3PA 2AYXA 3W2IA 1I0LA 3UFXB 3SIPA 4BO7A 2X7JA 4U3JA 3R7WB 2C7PA 2R1TA 4N39A 1IIRA 4P8RA 2H00A 3FGPA 3IHLA 1R12A 1AZTA 3WAJA 1Z0FA 4HDMB 4HNUA 2TYSB 2C2MA 3QEJA 3TQHA 4U5XA 3SF8A 3TIIA 3VPSA 1YE8A 1BFDA 3E23A 4IZHA 4IXTA 4QUJA 4RE6A 3ONUA 3SR4A 1LJ8A 1SRRA 4JK3A 4KK4A 1MGPA 4TMVA 2IUFA 2PLRA 2QT0A 2X6TA 3CRW1 3T5DA 5E0KB 1W6UA 5JIBA 5JY1A 5HA5A 2PT7A 2DCUA 1DO8A 4B3FX 2XTNA 1AZSC 3ZE1B 2H7VA 1F5SA 4F2WA 2H1IA 4AI6A 2AUNA 3P2YA 1JU9A 3DNMA 3K9FC 1I4DD 2O6HA 4KLRA 3HU5A 4XX0A 2C2OA 3U26A 2QLTA 2FW7A 3ZWKA 4YXWD 1XG5A 2XDYA 3DE2X 3GJXC 4Z4WA 1MZVA 1O97D 1UPUA 2QA4B 2PKQO 1TL7C 2R79A 3BDVA 1E92A 5G40A 3GR6A 5BR7A 5JUWA 3ZDDA 4QM6A 5FA6A 3T3HA 4NMLA 2ENWA 4Y6QA 5AVQA 3V34A 4G5QA 5AJTA 5D3QA 5CCXA 1UDBA 2ZPTX 4RTJA 3K0EA 3R5TA 2FPOA 4TM8A 1UZAA 1UP7A 4DK1A 1RIIA 5KWJA 2X5NA 1KI8A 3P27A 1ECPA 1YRHA 3WLNA 2IKQA 3EFOA 3ET4A 5L7WA 4BNDB 4DDMA 1NI4A 1JKXA 4URYR 4PZDA 1O89A 3EXEB 3GZNB 4XTRA 5G2OA 4I66A 2YQ4A 3DMTA 4HEJA 4A6DA 2J9FB 4ITVA 1WXHA 2GD1O 1RI5A 5HJ7A 2VNKA 3NBUA 4IFEA 1H2RS 4PSAA 3Q8XB 4M53A 1P0MA 5E38A 5BWMA 1M0TA 1GZ3A 3K0FB 3PQ5A 3H5VA 5KYYB 1PNRA 1J0CA 4WOBA 3RHSA 1A5TA 3ZR4B 2DIEA 1X7XB 2Q0XA 2SKEA 3QYPA 4GXQA 3CKMA 4RENA 2RAFA 3KSUA 1NB0A 3I9FA 2XHEA 3THWB 4WMLA 2VIIA 3C7KA 3II6X 4MVXA 3DWEX 4DBLC 2OCGA 1QBKC 1CPYA 1NTOA 4P98A 2D5AA 5HF9A 4BAUA 1NDHA 4F92B 1YDWA 1G21B 2WAYA 3MWDB 4XXHA 1EPUA 2E1RA 3G5MA 3H5IA 4KB5A 5DFAA 3UPUA 2R9VA 1UZUA 2R8ZA 3UW3A 1W96A 1CC1S 2NO0A 1K8AD 4HPXB 3IP3A 4P2GA 5ILGA 4BX0A 5KU7A 1Q7RA 1A88A 1Q0PA 3ECCA 3H83A 3JTEA 5DH9A 1JPNA 2ZYUX 2W00A 3MUNA 4Y2VA 4N4AA 1VHEA 5IJ0A 4K2AA 2XQIA 5JBQA 1U8UA 4UCXA 4N47A 1G6OA 1CY4A 1F6WA 2I3ZA 5EIHA 2O8CA 2BLNA 4H77A 3ULKA 1K98A 2FMXA 4ZICA 5IFKA 3R6JA 4DJEC 3P5BA 1E64A 1GUZA 1O8CA 1OF1A 2JARA 2NVUA 1JR6A 3ORFA 4RGVA 3T34A 3E05A 4D9JA 4ZXFA 1AS0A 3ZJYA 4O2BF 2BEKA 3TLMA 3V8MA 1GQ2A 1CJMA 1D2RA 2GM9A 1BGXT 4RQUA 3WHKA 1ETHA 2FKAA 2UYGA 2VQEB 2R5WA 2XYPA 3ZTTA 3RRXA 4LMPA 2GD0A 1J22A 5CHEA 3H13A 5E1OA 1D1QA 2I1VB 2YASA 1ENOA 4RD4A 1RLJA 2PWPA 1UXJA 1VPWA 3HAGA 2GQ0A 2W98A 1F0KA 3E5NA 3BMCA 2IT1A 2E4WA 4M6WA 5EKSA 3K71B 2RGRA 1O57A 3M6AA 5AW8A 1NZJA 3JRXA 5GONB 3VR2A 2QZJA 4BOYA 5HZMA 5ECWA 5D3MB 5EXXA 1J00A 3ZDYB 3DT6A 3EH2A 2IBSA 3WGHA 3ZU2A 1MFZA 3SZRA 2G1PA 2EP5A 4EPWA 4ZOQI 4RMJA 4YP5A 2VHZA 4FS8A 1ZOLA 4N65A 2TRSB 3VR5A 2C7VA 2HR1A 2PH5A 2JLZA 5ILQA 1GKKA 1QOPB 3HZZA 4I08A 1RHRA 5BQ5A 3UTDA 3SC3A 3I9NA 2IHYA 4L75A 1Q17A 2CNLA 5JSKA 4MEJA 4DDTA 1BG6A 3OW7A 2I2XB 2ZBGA 3FSEA 1I4EB 2B2XA 4YN3A 3H94A 2XDQA 1TJPB 2BFFB 3IQFA 3OX4A 3B3JA 1L4GA 3EK2A 2QLBA 4DCCA 4BV3A 4PAGA 4LC9A 2ZB8A 5JNTA 2C5SA 2JGRA 1G7CA 5CA0B 1UJ4A 1ZCFA 2GTIA 4OYYA 2HHLA 3RSHA 4E1VA 1R4MB 4E03A 4W5QA 1C50A 3SOPA 4BMNA 3ANSA 3CNLA 4KL8S 3WMWA 2EZTA 2ZM5A 2A9FA 1TU4A 1Z7BA 2VPIA 2QL9A 5BQXA 1E9SA 4J6EA 1GDDA 2P5UA 1L3IA 2RI0A 4LJ4A 4XEUA 4AURA 2QNIA 4YJ2F 2HF8A 2JEYA 2H2DA 2R4UA 2P77A 3WLIA 3UY4A 5KVCA 4F85A 2JVKA 5EPOA 2I62A 1LTQA 3G2IA 4NJOA 4C6SA 3GX1A 5KW9A 1DAMA 1QB8A 3WGIA 1A5AB 4NMMA 1NOIA 4Z4CA 4B3RB 4FFLA 2ILTA 1PP4A 3NKFA 3KZMA 4N8SA 2CXUA 1WKCA 2B4TO 3KOXA 1IHPA 4JBNA 3OOSA 3A0RB 3CYFA 3WGLA 1CS0A 1NSYA 2PXHA 3N0RA 4H3SA 4O4IB 3T9DA 4LFAB 4RTQA 2Q21A 2YMPA 3UT0A 3H9JA 2HLHA 4U39A 4YUYA 4S1OA 4TT8A 4XCXA 5J5CA 5B6PA 2A4MA 3PE4A 4ZT3A 1IXRC 2I4MA 4KWHA 3TE6A 4Z2AA 2FPPB 2JFNA 3OECA 4MI3A 2X7HA 1V1RB 2B21A 3AMVA 3DV2A 1M2WA 3WLSA 1VHLA 3UXEA 3S2SA 4Q01A 1E0DA 5HUJA 5FADA 3IAHA 4BNLA 5CDFE 3K0KA 1GNSA 3WK9A 1ZM4A 1BPLA 1FVOA 2NWQA 4WFKA 2I78A 1AQJA 5KTPA 3DZKA 4LZJA 4Q5IA 4CUKA 2JAHA 5DGIA 1MCZA 3RLFA 1VECA 2O5EA 4JQYA 3ASUA 1QGZA 3LDGA 1J70A 1GNPA 3D4PA 2HO5A 3HB7A 2ZPUA 4LYEA 4O63O 1INLA 1VJ0A 1TM1E 2QVCA 3MMXA 4OXYA 3UV7A 4EELA 4L95C 4ZCTA 4LJ5A 1WW8A 2F8MA 1T5TA 1CIVA 2O0JA 4RPLA 4ND1A 3RVDA 4L5YA 3UNXA 3L7CA 4DAEA 2JGDA 3FCSB 2ZS8A 3QRWA 4RO0A 4XWAA 2FWJA 1KA9H 2OV2A 2Y1FA 1V4BA 4H17A 4AAYA 3H1AA 4L15A 3ZS9A 1H2BA 3QUTA 3U4HA 1G9XA 2PZEA 3VRHA 3B3GA 4ALIA 1LRKA 3ILYA 4M21A 4UVGA 2IYAA 5J2TF 5TQJA 1Q9SA 3MOGA 2X3FA 4JV5B 1T6ZA 4IWNA 4Q18A 4X64B 1E6KA 1P9RA 2PRJA 2EW8A 3LK6A 3D2BA 4QPNA 1I4OA 3O93A 3IKJA 1NC1A 2KE5A 2OD7A 3U4CA 2G09A 4Z7QB 1CNEA 4OMFG 3UKDA 4BGDA 5HXAA 1B41A 3L4BA 4P86A 1F8FA 4IZ6A 4Y0AA 3SXJA 1YJBA 2WHEA 3A8IA 1QF7A 5JFGA 3PTZA 3P7MA 2EW2A 5T57A 3DOUA 3G0GA 1EDZA 4XD7D 1YX2A 3A10A 5DBGA 4GF5A 3WMFA 1C1YA 3B78A 4WCFA 3ZD6A 4HQ6A 1TADA 4MRPA 2OE2A 5AW4A 4MHTA 2AG6A 2ZSJA 3CEPB 4FLEA 1O95D 4HLQB 5EHZA 2QS9A 2JAOA 3U2QA 4OK6A 5FEUA 1Z06A 5DM4A 2R60A 2YWGA 5CT4A 4L73A 1DPGA 4EHDA 1CUEA 1YCDA 5E6RB 1CUHA 3HCFA 3K2EA 3R24A 4H4DA 3FSJX 1WXEA 3TSOA 2ZRIA 3N2IA 3NP9A 1G5QA 4BL5A 5A6SB 3FNIA 2OFWA 4X6YA 1QCCA 2C9YA 3VR4H 4Z4FA 3C1TA 2BUAA 1NP6A 3HFJA 2XBMA 3HO6A 4D1YA 3RC8A 4MUEA 5IN5A 3WJ7A 1TECE 2J33A 5EAIA 3Q3EA 4TKUB 5F4ZA 3CCMB 3UAXA 4UOEA 3RAEC 3AM3A 3AY7A 1EUZA 3VSEA 3M9LA 2WJ3A 1E3QA 2FPWA 2I2BA 5KSYA 2PH1A 2J3HA 4NOMA 4QOJA 4V39A 4XD2A 5JVDB 1CJTC 4QZVA 4FMCB 1TM4E 3U3RA 2FCAA 4DCPA 2WSSD 3OKPA 3S28A 5HZGA 3UGJA 3FPPA 4YGYA 2WJGA 3L8FA 3TD2A 2G9ZA 4WZTA 1SC6A 3GSIA 4DV2B 3UK2A 1Z6ZA 1A5BB 1L8AA 2NU9A 3F7TA 1AB6A 3R3XA 2GM4A 4JITA 4M8NE 1SCDA 4GM0A 1M2KA 3DSRA 5B3LA 1DT3A 2O3TA 2F8LA 4HGYA 5TT0A 3OO1A 1UPAA 3GLIB 1KC1A 1UJCA 3B82A 3HCOA 1X1RA 4JT2A 2Q9CA 4KTVE 5CG2A 3L8DA 2OHHA 4FHGA 4XFKA 1V9CA 3BWMA 4D4KA 2HU2A 4XKJA 5AVUA 1SU7A 1ZN7A 1IMJA 3BGWA 3H6GA 2WM2A 2C8VA 1UF9A 4MMYB 4OFZA 3RUEA 1LRLA 1Q19A 3U4DA 1VLJA 3G59A 5ICMA 3I0NA 5C5IA 1Q1ZA 4IRMA 3SZLA 3TGLA 1Y3IA 4JCOA 3VISA 7ABPA 2GDZA 4FBMA 3TOCA 1WZCA 2L82A 4KJZA 3NJRA 3KWMA 3C16C 4BJ3A 3HRIA 3K5HA 3FTPA 4PGHA 4KMOA 4FFBA 4RJTA 5AVTA 3GV0A 1E3ZA 4Y7CA 1YNOA 2GH1A 4G4IA