1IJFA

Nucleotide exchange mechanisms in the eef1a-eef1ba complex
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
440
structure length
440
Chain Sequence
b'GKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elongation factor 1-alpha
publication title Crystal structures of nucleotide exchange intermediates in the eEF1A-eEF1Balpha complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 126
structure length 440
sequence length 440
ec nomenclature
pdb deposition date 2001-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ijfA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ijfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ijfA01
5H68A 1YIJB 5CYOA 2BBWA 2ZRKA 2VP6A 1VDZA 4PR0A 5J47A 4A0RA 3CXCB 4C0LA 3ZD7A 1CR4A 2GZDA 4UJ3A 3CH5A 4WZ6A 1J2JA 4OHWA 1ZUNB 4KXFB 2H18A 4QXAA 1FX0B 4ZPXA 2HDNB 3GJ5A 1Q3HA 2F1IA 2V1XA 3TQCA 2ORVA 2YWHA 3TW4A 1XJQA 2QG6A 3W8RA 3DEFA 4RCZA 5BN5A 2CE2X 3CC7B 2Z6VA 3ZS9A 1C9KA 5KPJA 4A0HA 2H57A 2XB4A 3R7WA 2OCPA 5GJVC 3Q72A 4ZV4A 1L7VC 4A82A 4UNPA 2ZI3A 1K8AD 3QPWA 4I99A 1N5KA 4IDPA 2BBSA 4D25A 1U9IA 5JRZA 1Z63A 3WNBA 4DSUA 3SHWA 4LPSA 5HZKA 1VQPB 1QRAA 3MUFA 3K09C 1XMIA 3T5DA 1OGJA 1ZYUA 2ZI9A 3AVPA 3CMAB 3AKCA 4LX0A 2FSFA 3BH0A 4QKQA 1OYWA 3CC4B 3UIEA 4E5UA 5DN6D 4OK6A 2EWWA 4P4TA 1MR3F 1G3IA 1FPMA 1SKYB 3PCRB 5C2JB 1XPUA 4JKYA 4L9WA 4DIDA 5KYKA 1NMZA 1E2JA 4RZXA 3SQWA 1YR9A 4BLQA 2VHUA 3UKDA 1OT3A 3DKPA 3QEOA 1CRPA 1VHLA 4RKEA 2AFHE 3AGPA 1MRNA 2CJWB 1Y63A 2H8KA 1Q1QA 4A6PA 2NO1A 1P9NA 3REGA 1EWYA 2V6IA 3FE2A 2GXAA 5DHFA 4RFVA 3W5VA 1M6NA 1IM2A 1KQSB 3UMRA 3VO2A 3WHKA 4RFSB 4A2WA 4G1VA 3W2GA 1E0JA 1UEIA 1J70A 2GZAA 3ZDQA 2HEIA 4V0ME 3THWA 4JSTA 5FOTA 1PUIA 3NWJA 2FE4A 1G18A 4NCNA 3B1YA 3QF4B 5SZJA 4I4LA 4FIDA 1G5PA 4GPTA 3AP2A 3BB3A 5IHPA 4BZXA 4ZI3A 1SXJD 2BJVA 2WPDA 1CTQA 3JQPA 1KYIA 3PG5A 1HUQA 2IHYA 2ZYTX 2XNJA 2QP9X 4NKRA 3GPLA 1HV8A 5EXPA 4HLDA 4A6XA 4D4LA 4QL3A 3ZZTA 2VNJA 2GTPA 2ZS9A 5FTNA 4C4PA 4Z8YA 3WBJA 2ZYVX 5KOYA 3CR8A 1M34E 1TQ6A 1IN7A 1A2KC 1BOFA 2DPXA 2EQBA 4KVGA 2OM2A 1S3GA 4NP6A 1IHUA 1XP8A 2RGXA 2FMXA 1JI0A 1KMQA 1KMHB 1KDRA 3ASYA 3W6OA 3VR3A 1X3SA 4QBFA 3T15A 2AWOA 2CLDX 2XOKD 2KJQA 1L2TA 1X1SA 1EG7A 1CQXA 2G0TA 5L3QB 1YZNA 2F43B 1CJMA 1ODFA 1GITA 3K70C 4UNRA 2GA8A 4MRPA 4NCHA 4O25A 4RKFA 5TV2A 4JLBA 3MRSA 4BQSA 2QU8A 4KBGA 2GWHA 1EXMA 1U8YA 4PAMA 1NMYA 2ZSAA 4YDSA 3OE7D 4NH0A 3W6PA 1E69A 4G5QA 4MRRA 1GAWA 1GVNB 1MOZA 1WXQA 3OF5A 1ZM9A 3K0SA 1GR1A 2DFTA 2L0XA 3HR8A 1VYTA 3TW8B 1Z8FA 2ZJOA 4C0KA 1FNBA 3QI2A 4OK5A 1KAOA 4XSGA 5EE5B 2VO1A 1L8QA 4LHXA 4Y0AA 2ZTSA 5F2EA 4WZAE 1LV7A 4D81A 1P9WA 3R9WA 1YHQB 4JLNA 1QGYA 1R8QA 1EESA 2O52A 1MABB 4HB3A 4M9XA 4AIIA 4B6EA 2H92A 2P67A 3DOEA 1GNPA 2C03A 3EC1A 4NONA 2ATVA 5EE0A 3U3RA 4EQ6B 1T9HA 4BFUA 3BB1A 1LFDB 1XXHB 1UAAA 4KYUA 1RC8A 2QTLA 4XD7D 1UADA 1H8HD 1E32A 2LWIA 1SGWA 1Q86D 3FTQA 5FTMA 5J4LA 3WYFA 1S9HA 4B4DA 2J46A 3MCAA 1RFLA 1NY5A 2G1KA 2CCJA 1FFHA 2BGIA 4PSKA 3A6PC 1E2IA 2CBZA 421PA 3VKHA 4M1MA 4ZDIA 2GEDA 3KQLA 4KSBA 3PVSA 1Z2CA 2A5JA 5HKKA 5G3ZA 3DMNA 2CCKA 4LV8B 2AD5A 4R2IA 4Q5IA 1P61B 3DMDA 4TQAA 5JJIA 3C41J 1YQTA 3LRPA 4C0BA 3SBEA 2R9VA 1KY2A 2B21A 1G4AE 3LVBA 2V7QA 5HZHA 5B2ZA 2C2HA 2P6RA 3BFVA 3W34A 4QJ4A 4R98A 3LWNA 5KU1A 4IEIA 3CW2A 1P5ZB 4NYJR 3ND9A 3ZQ6A 3NG1A 1VPLA 1E9AA 1U0JA 2R6GA 1R0WA 4AYWA 1XPRA 3G5UA 3B8HA 3MD0A 1E2QA 2IWRA 4BFVA 1CLUA 2HJVA 1P6XA 2ZR7A 2R6DA 3AVYA 1SKQA 4DUGD 4DQLA 1VQOB 1JB9A 3HP1A 1E2GA 1GFIA 2EFEB 4ZDWA 3SYKA 1A8PA 1HQYE 3UATA 2IXGA 2BOVA 3KB1A 2OFOA 4HDQB 1F2UA 4PTLA 2G9NA 1VTKA 4JLAA 2C99A 3WMEA 1R7RA 3L82B 5KSZA 1NN1A 2JATA 3AUXA 4DCVA 5FL7D 3RSOA 5E3HA 2NPFA 3A4NA 4Q7JB 4ASUA 3SE0A 1QUEA 1IOZA 1DO2A 1T8TA 1DAKA 2LKDA 2AHOA 2ZPTX 1XMSA 4UNSA 3ZD6A 3G0HA 4MRNA 3R7WB 2ZJ8A 4IOMA 3ZZUA 2A9KA 4ZDKA 3NBZC 2BIFA 4KYIB 3KQNA 5P21A 1IJEA 3CNOA 1R0XA 4PHFA 4JL5A 3RHFA 3Q3JB 4OHZA 2D06A 2XTZA 5FR2A 4XIGS 4K8OA 4OQMA 2EWVA 1TAGA 2DR3A 3T61A 3K0CA 1OXUA 4ESVA 1W2BB 4DDUA 5CB6A 1VQKB 5KHOC 2PCJA 2PZGA 5EMNA 3CKLA 4G5RA 4RZ2A 2G0NA 3IEVA 1GRNA 1EFRA 1G7SA 4M9QA 1KKMA 3E70C 5HE9A 4B2IA 4FMDF 5JI3E 1S1CA 1TEVA 1QZXA 5TXGA 1ZNZA 1DEKA 4IFBA 3V4RA 3KKQA 3L2OB 3RC8A 2REXB 2O8FA 4QGGA 2ANCA 4ZGNB 4L8GA 2F3RA 2YZ2A 2P6NA 1GUAA 1RYHA 3FPAA 1OF1A 1D9XA 2QMEA 4L16A 1VQMB 1DELA 2ZI6A 1KO7A 3NH6A 3Q9LA 3QUSA 4KSCA 5DGXA 5FPSA 1JEEA 2BCJQ 4R9UC 5CIQA 4QGHA 3B5JA 1E9RA 4C2TA 1AGRA 2GXQA 1BMFA 3THWB 2MMGA 621PA 2C78A 1JQLB 4W7SA 2R2AA 1XFAA 4C9BA 2IUSA 2ZRFA 1DAMA 2XB2A 1KO4A 3JQRA 2BMWA 5FUVA 3AUYA 1ZC4A 2ZJ5A 2QAGC 1NBME 3ZS8A 1G291 4DLSA 5GV7A 4KFUA 3QKTA 2O8BA 1PLLA 2O8EA 5B58C 3VAAA 1GWNA 3RRNA 2CVHA 4GMXA 4U02A 4C0JA 5JWHA 4BLPA 1A1VA 4WVFA 2B92A 4MGYR 1Z07A 1TEXA 3QF7A 3CX7A 3IQXA 4Z51A 1ZUIA 4GZLA 2VBCA 2ZRNA 3AVOA 1YZKA 2P6UA 4TL7A 2YOGA 4KFRA 1YR6A 3LAWA 1XX6A 5FL3A 2FFAA 4I1UA 3HYRA 2VQSA 1K6MA 2Q6TA 2RAPA 3SHFA 3EZFA 3NDPA 4BLRA 4D4MA 3M0EA 4TT3D 2IA5A 4EH1A 1CNFA 1M8PA 1TF2A 2FOLA 1NN0A 2VTKA 4AC9A 1UF9A 3SFZA 2ZQ5A 4TTRA 2VP9A 5GJCA 1R5OA 4LBVA 3GJXC 1NY6A 3JVUA 3SR0A 1G21E 4R2HA 4JL8A 2YWEA 1I4TD 2DWPA 1E0AA 3NHAA 1M7GA 1XD2A 4MUBA 1P72A 1P2UA 2ZJZA 4XWKA 4GL2A 1BYUA 4PHGA 1MT0A 1A7JA 2QORA 5DN6A 1EFHA 5FOSA 3GEHA 4KODA 3JQQA 2IYQA 4V0MA 3LBNA 3DVLA 3Q5DA 4UNNA 5FPYA 3V9PA 4EPXA 5CITA 4B44A 3HDTA 3UANA 3UXMA 2QY9A 3WXMA 4M1YA 2WWFA 1YKSA 2FNAA 1A5TA 2JLWA 3K9GA 4KFSA 4O2RA 4NZYA 5AR1A 2VSOA 3RAPR 2WWIA 1G3QA 5L3VA 3SQXA 3TGPA 2EYQA 5CM9C 3WYAA 2VP0A 1Z0KA 5E7JA 1G64A 4A36A 4D4KA 1N0VC 1BKDR 2GHIA 3ZVMA 1ZD1A 1UKZA 4CEIA 4BFYA 4L9SA 4YONB 4TLCA 3PJRA 3CCRB 2ZE6A 2C8VA 3EC2A 2ONJA 1HE8B 3W5JA 4QJ3A 1NRJB 1SXJA 4JLMA 4AI6A 1ZC3A 3EASA 4AF6A 5DYIA 4KAXA 1G8HA 3TVTA 1FL9A 3EX7C 3ZVNA 1AKEA 3LXXA 4B3GA 2JGNA 2FPMA 4Q03A 5CDFA 4M1WA 5HE8A 1KK3A 1D6JA 1LW7A 1E94E 1E1RA 4RD2A 2FH5B 1GVHA 2IF0A 2UKDA 3RC3A 5FBRB 1HT2E 2HCBA 3X2SA 3THXB 5E4FA 4PPGA 4HDOB 1KY3A 4FD2A 3RLFA 4MGZR 3IPYA 1XCPA 2PLFA 4EPVA 1P2VA 4B6FA 5JJLA 1WQ1R 4NYMR 3A1WA 2XOKA 5G53C 1F2UB 1G20E 2PEZA 2CL6X 2QL6A 4ZKEA 4Q01A 2O0HA 3T35A 3W5HA 1H8ED 1NLFA 1JPJA 3LH5A 3D3QA 1KSHA 2OZEA 5SZKB 2IBMA 2XX3A 3KUDA 3WRXC 3QE2A 4YAOA 3GLGE 4HI0E 4LV5B 3R8CA 1E2FA 1US8A 3OE7A 4LYAA 5CK4A 1IN4A 3MFYA 1OXVA 2QQ0A 1CJTC 1CULC 1QBKC 2HV8A 2KB0A 4KLZA 4Q7MB 3LV8A 5GJWC 1TQDA 3Q8XB 1E2LA 4HATA 1KI8A 2XXAA 4LK2A 4GOJA 1JNYA 1YRBA 4MGKR 4F93B 3KX2A 1JR6A 2QZ4A 2FSGA 3B2EA 5FOVA 1RYFA 1D2NA 3D8BA 4GP6A 1HE1C 4QBGB 2W83A 5TY0A 1Q1BA 2IYRA 2JLRA 2ZAOA 5AWFC 3CWQA 5CM8B 5TDHA 3L0SA 4X8MA 3A4LA 1W36B 1VQNB 4DVGA 4B32A 3IEUA 1OH8A 5A0FA 1CR1A 1KDOA 5CIWA 4BPRA 2C96A 1T0JB 2EU8A 1U8ZA 2VEDA 3P4YA 2NQ2C 4PQFA 4YQFA 1IQPA 1H8HA 5FBQB 3QIAA 3N5CA 4AG5A 3FFBA 5K8UA 4LBZA 3QPUA 5TARA 1XEXA 4DIEA 4JVSB 3W9YA 4ZCMA 1COWD 1E0SA 2CEAA 3OAAD 2V1UA 1WP9A 3B1ZA 1W0JD 2O8FB 1XZQA 5DI9A 1OIVA 4LUCA 3C14C 5L3RA 1W49A 4X8OA 1PLJA 4NTZA 1GJRA 2VL7A 1XB2A 3SFVA 1G7RA 2G1JA 2AXNA 1CS4C 3QJYA 3IPXA 4CW7A 4XTCS 3VHXA 1X8LA 2W2XA 4NBSA 2J7KA 1AZTA 2G77B 3Q85A 2W6ID 2GCPA 3NXSA 3SJBA 1XWIA 3CBQA 3TNFA 2QEQA 2R6HA 2QA4B 1DAIA 2RB4A 4G3XA 3VKWA 4OI0A 4B3DA 2JJ1D 4BFXA 4QGAA 3BOSA 2O8BB 3NBFA 3CIOA 5KTYA 1SVLA 4POAA 5FFMA 4CDGA 1ZUHA 4PFSA 2B7CA 4DUGA 1E4VA 4F4CA 3NC1C 3ZGXA 1KHTA 3RWOA 1IJFA 2PZEA 1Q21A 2J1LA 4Y0VA 1ZIOA 4LJ8A 2A2ZA 2RGCA 4IXNA 1T5IA 2CXXA 2YKGA 3B85A 3CRVA 3UK6A 4MDFA 4DLRA 4EDHA 1ZCBA 3ZBTA 4CIDA 4M1OA 1WE2A 4TL8A 3LA6A 3C15C 5FL7A 2GF0A 1VMAA 3SZRA 3VR2A 3AGQA 1JJ2B 3CNNA 4US0R 2PJRA 4C3ZA 3U3KA 1N6LA 1OE0A 3ADKA 4DSNA 2CLCX 3RABA 4DC9A 4ZIRA 4FW9A 5AN9A 3BFKA 1KC8D 1MO5A 2J3EA 3P26A 1W1WA 2IXFA 3C4JA 2DEUA 3EPLA 1SZPA 2VNIA 2BMFA 4BGDA 2BC9A 4V0KA 1XD2B 3TUIC 1RPZA 1I4DD 2BBOA 1EP3B 2BGJA 1DPFA 3I61A 1Z22A 5EE9A 2CDNA 1TMKA 2QSZA 4MGIR 3CM0A 3OFND 4YLGA 5FBWB 3MWLA 4F91B 2X77A 1I2DA 2QE7D 1SXJC 2FFQA 3OJXA 1KIMA 3TJZA 4HDCA 2AWNA 3KJGA 3E5HA 4P31A 2FEMA 1EFRD 1I2MA 1W2GA 1TU3A 3QOFA 3I55B 1ZM4A 2OK8A 1VCNA 3VR6A 1HURA 1F20A 2JLVA 1ZNYA 2GF9A 4GBMA 4IVRA 4DLZA 3TQFA 2IYWA 1FRQA 4DSOA 4TYWA 5AUNB 4TMTA 1NJFA 2D2FA 3KJHA 1XMJA 1JAIA 2F1HA 4LDJA 1D2MA 1CR0A 2XITA 4Q1FA 2A3RA 3THYA 2HLDD 2AKYA 5EP4A 1WCV1 5DH9A 1GDDA 1BO6A 1NVVR 1W48A 3I3SR 4GFDA 4C2UA 4CEIB 4Q1AA 4II7A 4TSFD 1NG1A 1R5NA 2ZRCA 4GMDA 1P2SA 2HT6A 2ZANA 5DO9A 4DEXA 1FNNA 3W5IA 4RSGA 5IK2D 4DB2A 1KSJA 3RVBA 1SXJB 2OESA 1M90D 2DETA 3FGNA 4AURA 4GDFA 1AMOA 2EVWX 1E96A 2CHQA 2GJ9A 2F55A 2ZUBA 1G6HA 1AA9A 3MWKA 1D9ZA 1N6PA 3N70A 3KXLA 3NBXX 1X6VA 4Q4JA 3PEUA 5B64A 2QQEA 3SS8A 2N46A 1E79D 2ZI5A 3SYLA 2YYZA 3BH7A 2Z4RA 4EFMA 4WIAA 2GAAA 3LBIA 4OHYA 2NO6A 2FDCA 3WNCA 2Q3FA 2YINC 1ETUA 3RRYA 3RS7A 4BLSA 4BASA 4YMTA 1OB2A 1IBRA 1N0WA 1OFUX 3KZ1E 5JI2E 1AQUA 3PXGA 1OLOA 3VU9A 3QFSA 3RS4A 3KXIA 3DHWC 1E9BA 4TT3A 4NYIR 4DLTA 3KB2A 4C7OA 3H2YA 1U0HC 4QJ5A 1TADA 3OZXA 3DZDA 2H1LA 2WWYA 2KWIA 3LW8A 4A2PA 3U6KA 2GDJA 2V3CC 2ZSEA 1W47A 2QUZA 4UXJA 3IBGA 1S9DA 3NKVA 4OHXA 1HEIA 2C9OA 1N2CE 1US8B 3A1VA 5C4MA 2HYDA 2O5VA 4DBLC 4HZIA 4FN5A 1EX7A 1U98A 2V55B 3GFTA 2ZI4A 2ODWA 1XDBA 4XSHA 4TYPA 5AJZA 2IX3A 4A15A 5FBLB 1VIAA 2KI5A 2ZRAA 3DZ8A 2XXAB 3T12A 3NDBB 2J59A 2RHMA 2WKPA 1ZMXA 1Z83A 5C4GB 5KUTA 5BN4A 1A82A 1II0A 2ECKA 4PO9A 1F6BA 3RRZA 1T91A 3TSWA 3O47A 3TLXA 2FJUA 1YR7A 1ZM7A 1UJ2A 1G8PA 2AXPA 2W58A 3BRWD 2ZREA 1W4CA 2JLZA 5EP1A 4JYCA 1JA1A 1HY3A 4AKGA 1Z08A 3BC1A 1QG0A 1NVWQ 3AP1A 4LI0A 2F6RA 5SZHB 2WV9A 1VQ8B 2GK7A 5JS8A 2QP4A 4K81B 5JEDA 2O8DB 4Z8XA 2YC2C 5H59A 1XEXB 5D3MA 4YMUA 4Q9JA 3MG9A 1UBGA 1P3JA 3K9NA 4TL9A 2QP3A 1LY1A 2ORIA 1NMXA 2PEYA 3O8DA 3VHLB 3QQ5A 1CEEA 1QUFA 5JWOA 3FMFA 1N6IA 3K1JA 2CNWD 2V9PA 4ITRC 1JA0A 1G17A 1SVSA 4DB4A 4G5OA 5FUXA 3GLIE 4HYYA 3ZIAD 1BH2A 4JIMA 1QHNA 4AKHA 4AF7A 2QTVB 2XTMA 1QVFB 4U5XA 1XPOA 1DOAA 2GETA 1BX1A 4KO8A 5AJVB 3TUZC 4FCTA 4EFLA 3ZH9B 3KQKA 2K5UA 2ZJ2A 3VMFA 2R65A 3LX8A 2RHDA 1E1QD 4F4IA 2GZHA 3LY5A 4V0NA 3D31A 1E1RD 1N5JA 2PMKA 3P4XA 4Q9KA 4JMPA 4DJTA 5IF9A 5GVRA 3CD6B 4HZUA 4JVNA 2GJ8A 4XTRA 4LRWA 2XSZD 2ZRBA 5CJ2A 1WDTA 1QFZA 2DCUA 3EAQA 1EGAA 5KNDA 1OXSC 2PJZA 4KHZA 2W6JD 4K1XA 3OW2B 4C0SA 1O87A 2WIBA 4IOJA 5FOXA 1E63A 4OYHA 4BLOA 2QDXA 2AK2A 1P2TA 2DYKA 1H8EA 2QAJA 2ZE7A 1YITB 3IUYA 3I73A 2FSHA 2GPJA 3AKDA 1CKEA 1EK0A 1UM8A 2QPTA 2D2EA 121PA 3SU8A 2OO7A 2PT5A 3P32A 2EIXA 4IJMA 1DG1G 5FI0B 4ZIRB 3QKRA 5JEEA 2IYXA 3SEAA 2X19A 3PR1A 3IO5A 2J87A 3PEWA 1W5SA 4IOKA 2J0UA 2QTZA 1MKYA 3X1XA 1QVGB 3CLVA 4B33A 3TAUA 3I56B 4AKEA 3FDIA 5THXA 1OB5A 4QM6A 2ZM5A 3FMOB 2DY1A 1QF9A 3VX4A 1GL7A 3T34A 4TTPA 3X1ZA 1JBKA 3GD7A 3U5ZB 3PUVA 1GNQA 3LVQE 1KK2A 2MSDB 1HQCA 3CPWB 3G4SB 1VQ4B 1CU1A 2J7PA 3GJ0A 3I72A 4NHOA 4HLUA 4B3FX 5EJEA 1EX6A 1SHKA 2A5FA 1O3YA 4HLCA 4UKDA 4DLXA 5JHGB 4Y7CA 1D2EA 5AUQA 4LC0A 2HCJB 1COWA 4JS0A 3OAAA 1W0JA 5DYGA 4D0GA 1ELOA 1W44A 3GEEA 4HAXA 3PITA 1Q22A 1E9SA 2RKOA 4IKEA 2IXEA 2O8CA 1ZCAA 1GRRA 2ZSFA 4H1VA 4ESHA 3THYB 1OPXA 4I1OA 2ZIAA 4GSYA 4P3YA 4GNKA 1QHGA 4NU0A 2WTUA 4MRVA 2IYUA 1GL9B 2W6IA 1VG0B 3ZQJA 1ZINA 4G1UC 4PC6A 1YE8A 3J81k 1J90A 1IXZA 1G8FA 1KJYA 5FUWA 3AF3A 4IDQA 3ICQB 4LJ9A 1SVWA 4QNRA 3JVVA 2JJ1A 3ADCA 1J8MF 1Z3IX 4LHVA 3AKEA 2E87A 4PXAA 4FI3C 2QA5A 1Z6YA 2IK8A 1TL7C 3KFVA 2QMHA 2J9RA 2OILA 1U9IC 2GRJA 3UG6A 1SKYE 1EP1B 2PX0A 3Q5EA 4Q4JB 1X1RA 3ADBA 1Q7YD 1AKYA 2CRVA 1M1YE 1YVDA 1KD1D 1OXTA 4S35A 5L8VA 2ANBA 2FZ4A 2IYTA 4A2QA 1E2NA 3BGWA 2JA1A 1KK0A 1LF0A 1XTIA 4JLJA 3VU9B 5K8LA 3GFOA 3AP3A 1KI6A 1U8AA 4WXRA 4C7OB 3CRRA 5E7IA 4DRZA 4PPQA 3GLFA 1E9FA 1KSFX 3K53A 1MO6A 1NVUQ 4RCYA 1KAGA 2J0VA 3CPEA 4Q9IA 1QH0A 2NTYC 2NIPA 4A8JA 3I5XA 3TRFA 2GQFA 4US2R 3R9XA 4W9MC 1Z0IA 1U0LA 4JT4A 3U4QA 2W2TA 3F3YA 1QHSA 2BDTA 1TF5A 1ZRHA 1J7KA 3QXHA 1BIFA 5FTJA 3CF0A 1XMVA 3OFNA 2XNDA 1YHNA 2YOHA 1ZP6A 3B1WA 2QE7A 4BZQA 1N6KA 1FP6A 5EQTA 1H65A 3PENA 1G3UA 3KJIA 4Q66C 5G3YA 4AKIA 2VA8A 3CONA 3ZJYA 3FJOA 4NPHA 5EE1A 3NIBA 4YXWD 1YJWB 1XRJA 3QE0A 4Q19A 4JBXA 1NBMD 5D3MB 1ZD8A 5F3WB 1WMSA 5FOUA 4B75A 4B43A 3A37A 2HLDA 1L4YA 3BXZA 3U7FB 2F1RA 3C7KA 4BFWA 5EZ5A 1R8SA 4JLOA 4O2LA 5JZVA 4TSFA 1AJEA 2QSYA 2OUKA 2AN9A 4ACAA 1IXRC 1FRNA 4IVPA 2JLSA 3I5YA 1XTKA 5H5JA 5ANRB 4G1BA 2FN4A 4US1R 5IK2A 5KPDA 3K70D 4QBHA 5DI3A 4RZ3A 2OCYC 1BX0A 4K46A 1OIXA 5H70A 2IC5A 1TQ4A 1XEWY 4KBFA 2ZAMA 3OJWA 1R4AA 2OBLA 2YV5A 3EA0A 3A4MA 4IFEA 4JLKA 4X8HA 1E79A 221PA 2RH5A 2FSIA 3PUXA 1DDIA 3WYGA 1XZPA 2BEKA 3KL4A 3LLUA 2WSSD 1FMJA 1T6NA 4HZUB 5CK5A 2JJ2D 5LBIA 1XXHE 4HE5A 1N0UA 3LLMA 4HAZA 3O8CA 2QRZA 4B3BA 4LJ7A 4Q7LA 4XH9B 5EUQB 2Z83A 3PIRA 2HYIC 2ERYA 2O0JA 2Z0MA 1P73A 3TE6A 3MWJA 2IS1A 4PSVA 3GJ7A 1VQ6B 4HLUC 2DWQA 2GBLA 1E2KA 1FZQA 3PUYA 4KV9A 2HUPA 2IYVA 3OZUA 3PEVA 5K8TA 1S2MA 1WF3A 3UWKA 1Q3TA 1J9ZA 2PZFA 3E1SA 1AS0A 3GLHE 3PUWA 3W3AA 1ANKA 3TKLA 5J4KA 1DG3A 1KRHA 2GKSA 2DFLA 3RNLA 2R62A 3QKRB 5JLJA 4EKDA 2BCGY 2OAQ1 2XJ9A 4EFNA 4LY6A 1L4UA 4MH0R 4A1FA 2J0QA 1C4OA 1E9DA 5L3SA 5EUMA 2J0UB 2WICA 3QG5A 4PZZA 4EPRA 2A78A 1JJVA 4URYR 3BERA 3QVVA 1CXZA 4NYMQ 1CNEA 4HB2A 3QFCA 2OT3B 3B9QA 4O0MA 1YI2B 2YNMA 1FTSA 3NEJA 3CF2A 1SULA 2CK3D 3W90A 1KO1A 5C1BA 1QFYA 1QHXA 1PUJA 3CR7A 3X1WA 4AYXA 2JLYA 3OEED 4IOLA 5LDDC 2RGEA 4OJQA 3T1OA 2N42A 2EFGA 1OV4A 1CRQA 2IUTA 3ASZA 1AM4D 1FQJA 5JS7A 3FB4A 1NF3A 2QEXB 2BMJA 3GJ6A 2DFNA 2I3BA 3FHOA 2O8CB 2CNWA 3I62A 1G3MA 2R8RA 1K5GA 3ZIAA 2KSQA 2FV8A 2WOOA 1NG9A 1II8A 4NCJA 4Y9RA 3F8TA 4JT2A 2RGAA 3TR0A 5JWRA 1HYQA 4Y9UA 2Y8EA 1TNDA 3GMTA 3P20A 4U7DA 1ZW6A 3EIEA 1E1QA 4G5GA 1FUKA 4H9GA 3AVTA 4PHTA 4EPWA 2VNHA 4URWR 1X8KA 4IDHA 2V4ZA 4RVCA 1LS1A 1XF9A 1GSIA 2CHVA 1YZTA 2ZI7A 1QDEA 1QHIA 1UBEA 3LVRE 3LX5A 3MGCA 4LJ5A 2DB3A 2XSZA 3JZMA 5F98A 4M9ZA 4JLVA 3CRZA 5DE3A 1YZQA 2B8WA 1CJKC 5FA6A 4PO8A 4EPYA 2ZR9A 4TLDA 5TB5A 1IN8A 2C04A 2J5XA 2W6JA 3IHWA 3NEYA 2GVZC 1KKLA 3SJZA 2OTLB 4YAFA 4MDEA 5AJWA 3KJEA 3K0CC 5DLQC 3FWYA 1W36C 2GEUA 4TL6A 2QPOA 5J5CA 4M4SA 3LO8A 4CT5A 1OYYA 2YWGA 1KI6B 2FFHA 3GP8A 2W0SA 2FFBA 3AVUA 3DM5A 2WIAA 3LW7A 3GLFB 3T5GA 3QFRA 5EP2A 4DQKA 2I1QA 3QBTA 4UJ5A 5HCNA 5AUOB 4Z1MD 5D3QA 4A8JB 1P60A 2OBMA 3K0AA 1S72B 1W4RA 4BECA 1FQKA 4JSYA 3RSLA 4DT1A 2VYQA 1VKJA 3U7HB 1Z0FA 4ARZA 5HPYB 3BIFA 3CUEF 1I4LD 1G41A 2VP4A 3AEZA 3WHLA 4IVQA 1TTTA 3OESA 4QNMA 1P7CA 4IHQA 4DLYA 3QXJA 1XBTA 2IEZA 2WKRA 4MUAA 2EFHB 2G83A 3FKQA 3M1IA 2J7PD 3B60A 2NO7A 1G8GA 1FUUA 1XD8A 2YC4C 4M8NE 2P5SA 3UPUA 4TZ6A 1KDTA 4Q47A 2C95A 1ZIPA 2VF7A 1NLYA 1K5DA 3L0PA 1Q1EA 3N2IA 4B73A 3OIWA 1ESMA 2ZS8A 2ZJAA 2XZOA 5C46F 3LQRA 1D8TA 2AR7A 3BH6A 4JKIA 2BBTA 3SDZA 1DADA 3O8BA 2B8TA 3FMPB 2I1VB 1XTQA 2BMDA 4GT1A 3T1TA 4JBYA 1EFTA 1N5IA 1U90A 5JFGA 3OIVA 3VR1A 1II9A 4ACBA 2H17A 1JJ7A 2OBNA 4IDOA 3VX3A 4ILEA 4OKSA 3FOZA 1RRPA 4F7DA 1Q20A 5DI3B 1M1KD 5KSPA 4JZKA 4D26A 3EPJA 5DIFA 1P75A 2YHSA 1EP2B 3QXSA 3QG1A 4WAUA 4TMKA 2O8EB 3CCSB 1XD9A 2WWXA 2QI9C 3K09A 3QPVA 4AD8A 5J4YA 1ESNA 1JR3E 3DL0A 1IY1A 4YMWA 5FBVB 3AM1A 3LXRA 1VG1A 3TUJC 2N1BA 4PPFA 3AF1A 4PC3A 1W4BA 1Z0JA 4HUQA 3FPKA 2QMUA 1SVMA 2WBLC 1A2BA 4PX9A 2RGNA 4URXR 4DLVA 8OHMA 4HAVA 2QGZA 2C9YA 1RRFA 1AQYA 3U3JA 1KTVA 4MYTA 2YJTD 3W5UA 1KGDA 1RRGA 3QXXA 4LHZA 3OZVA 5LB2A 5FI1B 4O3MA 1QGZA 2ZJBA 4Q9LA 3ZZ0A 1UDWA 2Z43A 3A8TA 1TF7A 4DKXA 5EE3A 1Q12A 3CZPA 5C18A 3U7GA 2CHGA 4NCKA 2WWGA 2XNCA 4M1TA 1NP6A 4OQLA 3IDQA 2QROA 1ZBDA 3K0FA 4LHYA 4QHSA 3M6AA 4AK9A 3BE4A 3H4MA 2OE2A 2WJYA 4PAQA 1GKIA 3ICEA 4FXPA 3HU1A 4JL6A 5L3SB 2NZ8A 1VG8A 1KDPA 1KO8A 1FTNA 3C8UA 3JZAA 4UAJA 1F48A 4BE7B 3ZVLA 2XNDD 2GXUA 1M74A 2UVQA 2PBRA 3OHMA 2REBA 2IS6A 4RD3A 4N1AA 4IXMA 3RWMB 2D4HA 1NN5A 3QKSA 4FMCB 4A92A 2ZVPX 4DXAA 1X86B 3BD9A 5E7MA 1U99A 4PHHA 4DCUA 4YXWA 2DERA 1IY2A 3MAAC 1G7TA 1E2PA 1N6OA 3NBYC 4Q1CA 3TK1A 3AF0A 1AK2A 5FH9A 2D7DA 1B23P 2BN4A 1WA5A 4FINA 1NBMA 4TLAA 4L4UA 3ZC3A 1RRCA 1VG9B 3CPJB 3CCQB 4LWZA 4WA7A 2FEOA 2A7QA 5G40A 5JECA 5CYPA 3PEYA 1MH1A 1KOFA 2C9CA 1KK1A 2WZQA 3FHCB 1KJZA 5J4HA 2P3SA 2OEPA 5JMTA 2ODBA 2REOA 4EQ6A 4QHYA 4UQOA 1NSTA 2FPLA 1T3LA 2OG2A 2ZRDA 2D7CA 1II8B 3HU2A 4D2IA 2OXCA 4LJAA 2VIIA 3B6EA 3IQWA 4KFTA 4NE2A 2QMOA 2X2FA 5CB8A 2WM9B 4TYYA 1NLZA 4U00A 3OEHD 3AB3A 3DPUA 4Q48A 4GZMA 5EXSA 3TBKA 1QVAA 4CZ2A 4MYHA 3ETLA 3R20A 2C77A 3Q7PA 5FUYA 5IT5A 1NKSA 1AS3A 4IRUB 3IHLA 2CL7X 1XJ0A 1OKKA 4XWOA 3U44A 5KSYA 1D5CA 4Q18A 4XVRA 1ZAKA 2WSSA 3AF4A 3CF6R 3GLHA 2JJ2A 4BFZA 1H42A 3MHPA 2RGGA 4E22A 3PFIA 4TMVA 3QENA 3BBPA 1CP2A 4W5WA 1Q81D 1E0KA 5BQ5A 4M2LA 1GAJA 3BFXA 4OHVA 2WWHA 2P2LA 4LJ4A 4EPTA 1RW4A 2ZRMA 2ZRPA 2PLRA 1HTWA 4C43A 2Q21A 4PGOA 1VQLB 2VHQA 1K8RA 4LSGA 3TSOA 1WB9A 3F0TA 1FDRA 1OH7A 1CJVC 1OJLA 5JCZA 2B5OA 1GKUB 1N6HA 4WQMA 2AKAB 2JLQA 3EIHA 5CJPA 5KDLA 2QPAA 5HCIA 4OI1A 4FK8A 4J0QA 1J99A 2KE5A 1Q0UA 4WW0A 3W2FA 1T4GA 2IHBA 2HF8A 3RANA 4YAWA 4LC1A 3UWOA 1CBUA 3RS5A 3B1XA 2X3UA 4HB0A 1VCIA 3K9HA 3PUZA 3A1SA 1U94A 2GJKA 1S1MA 2XZLA 2IYLD 2FGJA 1KSGA 3K0AB 2P5TB 3MJHA 3VFDA 4DT1B 1YZGA 4RY2A 3T1QA 4ARZB 1KI9A 5EZ6B 4EUNA 2V54A 4KI0A 3CRMA 4QOSA 1DS6A 1MRSA 3G6EB 4D82A 4ERNA 3CCEB 2G88A 3RS0A 4KU4A 3FKSD 1YJNB 2CK3A 4HLQB 4URZR 3B7GA 2ZE5A 4DCNA 2VHTA 3DOFA 3KFXA 3UMSA 3OEEA 4WXPA 1JXMA 4AY2A 3BS4A 4IDNA 3LFUA 1R2QA 4MYCA 1OIWA 2F9MA 3IIJA 2UZIR 4V02A 5AJYA 3SJCA 1R10A 1UKEA 4YAUA 4LOAA 4NL4H 1R6BX 3HWSA 4OQFA 4X8LA 3CCVB 1UBCA 4I1VA 3CRQA 3X1DA 3U2QA 4DCTA 2RGNC 3DO6A 3F5FA 3CRW1 4Z54A 2NZJA 4D0NA 2F9LA 4WZBE 2A5GA 3EZ9A 4H1UA 2WSMA 3W2EA 3X1YA 3D6TB 1XTSA 1ZM3A 1KI4A 2G6BA 4TYQA 3IIKA 4PO1A 3W8NA 1AS2A 4TLEA 3K9LA 3OIUA 1E6CA 1DE0A 3ECCA 2RC5A 4PZLA 4Q4HA 5KDOA 2GVDC 3H86A 4B76A 2PT7A 4YHBA 3QY0A 3AVXA 1DO0A 1G7CA 4V0OA 1OGIA 1XU4A 4YC7A 5JRJA 2GEVA 3H84A 3GLGA 4BPBA 4TMZA 3LD9A 1SVIA 1TX4B 2ZROA 1FNMA 5EP3A 3SYNA 1PJRA 1ZJ6A 4HUQB 3CZQA 4XJXA 1E62A 2CMKA 1E4YA 3A58B 1S3SA 2WJJA 2O0KA 4P33A 3I32A 1IB0A 4OQXA 2PH1A 4TTQA 4LYFA 2IF2A 1DDGA 1SHZA 4P4UA 2NG1A 1F2TA 2NO9A 1AIPA 2D62A 2OHFA 2ORWA 4LJYA 4M22A 4PQYA 2FF7A 2BM1A 4QM7A 5KSOA 1LB1B 4V03A 2ZYUX 2HXSA 2JDIA 3NH9A 2CE7A 4MYUA 4QC2A 2ZXUA 3Q7QA 3AVQA 4TMWA 3I4LA 4Z1MA 5H8WA 1ZNXA 4NYJQ 2ATXA 3KUCA 2XAUA 3LNCA 2W2VA 3V00A 4D0LB 4DCSA 1PVOA 2P0EA 1K9MD 1DAGA 4GP7A 5GADl 3K0FB 4N3GA 2RGDA 1W4AA 1SXJE 3TH5A 1G5TA 4DDTA 2EFCB 1OFHA 2LKCA 3EARA 1Z6TA 1G5RA 5CDFE 2IS4A 2FGKA 1FP7A 3K8YA 4BFTA 3EIQA 1VHTA 1IY0A 2QAGA 3IGFA 4Q1EA 3NC0C 4RD4A 2BKUA 4MRSA 1BJKA 3MSXA 1ZVQA 3PV0A 3WMFA 2XJ4A 1TUEA 1XCGB 3QKSB 4IW3B 4BRUA 1NDHA 1KJWA 4TMXA 2JJ8A 2GXSA 4OK3A 3EG5A 1E9CA 2BMEA 2ZSDA 3FVQA 3WNDA 2Z5FA 2ODEA 1GZSA 1YJ9B 1NIJA 1UFQA 1Q1ZA 3DDCA 5F9FA 2E9SA 1WBBA 3H1TA 3GFPA 4TWZA 1RJ9A 1LTQA 5IRCD 4MA4A 2EYUA 1G1MA 1NN3A 4R71A 2CL0X 2J45A 2J0SA 1BS1A 1XJCA 2X1VA 1XTRA 1RKBA 3HPRA 1E9EA 1JR3A 1KNXA 2QENA 4HSEA 2VP5A 3B82A 4CEHA 4B48A 2IYSA 3QXCA 1P62B 4M1SA 4OBEA 3U7EB 4B34A 1OHHA 3QSYA 4JLPA 1CR2A 4HAWA 4M21A 4HE6A 2J41A 2AD1A 2AL7A 3LQQA 3VNVA 3K70B 1Z0AA 2PCLA 4L5BA 2H5EA 1Z6AA 3RS2A 4E09A 1E3MA 5FPTA 1ZU5A 1W0KD 4RZUA 4N0EA 1H85A 1QHYA 2AX4A 1W46A 2CVFA 4LCBA 4FMBB 1XNJA 1NKTA 4URUR 3GQBA 1ZD9A 2OLKA 2UZ3A 4LGMA 4C0QC 4IEEA 5BXQC 2WHXA 3U44B 1YRAA 1Q44A 1N6RA 4CGZA 1T5LA 1V43A 4LBWA 5G41A 3GLHB 3EZ6A 4GRAA 1T0HB 1ZU4A 4MKFA 4A9AA 3QVUA 3KKOA 2ZS7A 3RDPA 1CJUC 1Q57A 3A1TA 3ZVRA 3CX8A 2CCGA 5BN3A 3GCGA 5AJXA 5K8IA 3AVVA 2GESA 2QTHA 2ZU0C 4TN1A 1E98A 1W7AA 1R0ZA 4P32A 3U60B 1UDXA 2QNRA 4MKHA 1G4UR 4BEJA 3THXA 1QG2A 2VPPA 3GEIA 3LBHA 1QG4A 4NMMA 2X2EA 2HF9A 3W2HA 1X8JA 1OH6A 1W34A 2JIZD 4YMVA 1UKYA 1VCOA 3BAFA 5DNYB 2H16A 2VF8A 3L8YA 4DZZA 1QGAA 2DBYA 3THOA 1KI3A 3FYHA 4LYHA 3CO5A 2GCOA 4ZO4A 1FNDA 4MQBA 2WVJA 4V0LA 1IN5A 1PZNA 2ZR0A 4D4JA 4ZKDA 2BF4A 1F3OA 2IEYA 3R8FA 3VNUA 2LCFA 3EA5A 4Q9HA 4QFMA 5KNCA 4D6PA 521PA 1FOEB 1VQ5B 2F7SA 4M0LA 2NO0A 1YJ5A 5DSZA 1NNEA 1UEJA 1GTVA 2OK7A 3KXKA 1E99A 2BVNA 4HB4A 4ZGQB 5E95A 5LD2C 4LYJA 2JLXA 1G19A 4L15A 1VCMA 3QBVA 3S1AA 5GVSA 1LNZA 1CF4A 4HAYA 2XEXA 3FHTA 1XEFA 3NHBA 2F1JA 4TQ9A 2ZU6A 1D1NA 1E2HA 3CB4A 4FMDB 3CWZA 3ND8A 3CPHA 2G3YA 4Q21A 2GJAA 3AKYA 4FCVA 4PZYA 4TYNA 4ZCIA 1OFTA 3WP1B 4P6VF 3O8RA 2IS2A 1GRQA 3OEHA 2C98A 5TR9A 2PIAA 1XTJA 5GJBA 4DLWA 2R6FA 4DSTA 3MLEA 4F7WA 3EPKA 4Q4HB 5LD2B 1B2RA 3QFTA 3V4FA 2GJSA 2MSCB 1RVDA 1GOTA 2D3WA 4MKGA 1OKKD 4LJ6A 4P4SA 4F92B 4MITA 1QHHA 2OSBA 3N2EA 1J8YF 2QM7A 4NDZA 3GLGB 2E1RA 2FA9A 1DAFA 1OFIA 1Y3AA 3UMFA 1TLLA 5DHAA 2IW3A 5JSZA 1FW6A 1OW3B 2ZSBA 3C5HA 1NVXQ 1HH4A 5F9HA 4B71A 4BLTA 2Q0HA 4PSAA 2I4IA 3WY9A 4JLDA 4F38A 4M1KA 2ODNA 4A0GA 4YALA 2GCNA 1WRBA 1F2TB 2IYYA 1KZGB 2RMKA 3VKGA 1JQJC 4OI2A 3V76A 1DVRA 2QGNA 1FNCA 3C16C 1U81A 2PL3A 4TZ0A 1JB1A 4AYTA 4QHTA 2DHRA 3L8ZA 3TSZA 2CNDA 1A4RA 2D74A 2MMCA 1DBSA 5LB4A 4WOPA 1IN6A 1S96A 1TQ2A 3LDAA 4UNQA 1YZLA 2A5YB 1UKVY 4KITB 4EJSA 2BEJA 2NMVA 1HT1E 3BB4A 3G71B 2ZETA 2R44A 4PQRA 2OFXA 1C1YA 2TMKA 2EFDB 2HT1A 3SOPA 1LF5A 5FTLA 2ZRLA 3AQ4A 1JXOA 2F3TA 1Z29A 2Q9BA 1GL6A 1QX4A 2QAGB 2ZRHA 3FKSA 3HPQA 4FWIB 4PPNA 3ES9A 3GLIA 3P1JA 5A4JA 2NGRA 4DEYA 4C0HA 2OTJB 1EFCA 2ONKA 2FPKA 4ZDJA 1NJGA 1IXSB 2QN6A 2OAP1 2X8AA 3RRMA 4B35A 4WBSA 4DWJA 2QT0A 4LPKA 5HTKA 1R0YA 2WWWA 1RJ9B 4A0FA 1YU9A 5KO2A 1P9RA 5ELXA 5B30A 1KO5A 1M7HA 3FMIA 4EAQA 1F5NA 3E1YE 2R6AA 5FR1A 1NJID 4B2LA 2BKEA 3KDSE 2WOJA 4CT4B 4W5JA 5CLLA 1T3SA 2BHRA 3DM9B 3L0IB 4CRWB 1ZNWA 4CEHB 3QEJA 1N5LA 4E07A 3REFA 1KI7A 1Z2AA 5JCPA 1Z6XA 3CNLA 4A4DA 4JJZA 4Q1DA 1Z5ZA 2VH5R 3BJIC 3PQCA 4Q4AA 2JLUA 1KNQA 1E64A 2FZLA 1OH5A 4OJKA 5EXXA 3TAHA 4M9SA 2VSXA 2A5DA 1Z47A 2R6CA 3HYTA 1SM4A 5H1YA 2P65A 4A8JC 4HUTA 1TVCA 4Q00A 2ZRJA 1IONA 2QTFA 3W3ZB 1N3BA 5BW8A 3KTAA 2RC6A 1NL3A 5JJKA 2CLSA 5KSWB 4B74A 4C0AC 4F4JA 5FTKA 2QT1A 4GOKA 1MV5A 1AN0A 1DAEA 1VQ7B 2FWRA 3CCUB 1EFUA 1TU4A 3ONWA 2JASA 1N8RD 3BWDD 1EWQA 1Z6GA 5BYKA 2JCSA 4KJZA 4CF7A 3M4YA 4CVNA 3EZ2A 4CEJA 4I81A 2WPDD 2BJWA 1GP2A 2QBYA 2V8OA 2BSAA 1KZ7B 2OFWA 3IBYA 1Z28A 3OZWA 1JECA 1P4SA 2Q3MA 3L0OA 1WBDA 2KBFA 5JHHB 5GV8A 1SVKA 4BEBA 2JDID 4RD1A 3TVDA 3CH4B 5M04A 1XCMA 2MSEB 3CCLB 2VZLA 2PMDA 3EW9A 4G01B 4Q1BA 5AUPB 5HR5A 4AWXA 1MO4A 3W6NA 3U4QB 1KI1A 1FX0A 5FOWA 4BFSA 1LVGA 4E03A 1GM5A 2GCOB 4BUJA 2OV2A 1JAHA 3HR7A 3SJAA 1S4QA 1N25A 1BQEA 2QRNA 3C5CA 1GAQA 1AZSC 1G6OA 1SQ5A 3H0KA 1Q82D 5A5GA 3KKMA 3E20A 4DDVA 1E2EA 3KQUA 3KKNA 5BYJA 4ABYA 4RD6A 2OLJA 3EWSA 2NPIA 2ZJYA 3E2IA 5JBQA 4R7ZA 1S8FA 3KQHA 3IILA 3AF2A 4HEJA 4Q02A 4D80A 2ERXA 2WJHA 4XWAA 3TR5A 1HA3A 4EIWA 5FPKA 3SN6A 4YDHB 5TMPA 3WMGA 3VR5A 2YWFA 3S1AB 1T3HA 2AK3A 2Q9AA 4C30A 2AFIE 4JJKA 1LS6A 2W00A 2EW1A 4LZZA 2IL1A 3A1UA 3B1VA 4LHWA 3ZLJA 1MO3A 1UPTA 2WMNB 4JVLA 1NIPA 2ZITA 3U6BA 3TMKA 6Q21A 3RS3A 4MKIA 1JR3D 2ZUDA 3QKUA 3U61B 4S2EA 1SVOA 2H7VA 3NVAA 721PA 1N6NA 2IYZA 1I7PA 2XNSA 2Z4SA 4XD7A 4TLBA 2ZRIA 4LBYA 1W5TA 1JPNA 3AH8A 2O8DA 3MMPA 1OHHD 2VLIA 4Q4LA 2GBLC 4CYMA 1W0KA 2XTNA 4N3NA 1IAQA 3TIFA 1NSFA 2CJWA 4UXIA 5BWMA 1TUIA 3AV0B 2XGJA 1RE0A 3UG7A 1RIFA 3L43A 3NTUA 2WKQA 1GIAA 1W35A 1PLKA 4URVR 1KI2A 2ZVQX 2GNOA 4RFSA 3SNHA 3VR4A 2WAXA 2VHCA 5DISB 1E2DA 1VQ9B 2B6HA 2WJGA 4P4SB 5EXTA 4EJSC 4BZPA 5HKKD 4FWTA 1QHHB 1XE1A 2NOAA 5SZIA 4JYBA 1ZM2A 1AGPA 3GJ4A 3QF4A 5KDDA 5UKDA 1R5BA 3FFAA 5FPHA 4PC1A 4QG7A 3T06B 3EZ7A 1TPZA 5JSZB 1NVVQ 1S0UA 1GG2A 3U3MA 3WP0A 2V7QD 5LPNA 3LO5A 3I1FA 4FCWA 3BK7A 2BPOA 2OCBA 2Q9CA 4W5HA 4NCIA 1OSNA 2HMAA 2A30A 3ZYCA 2YOFA 1G3RA 1QVRA 3B9PA 4LV6A 2IUUA 3EWAA 2KBEA 2JIZA 2OCAA 2VP2A 2ZYWX 4P0TA 2JEOA 5AK0A 3R9IA 2FU5C 2ZRGA 1B0UA 3HJNA 1VIYA 2ASEA 2ZUCA 2ZEJA 1KMHA 4XVUA 1GKYA 1GILA 1DARA 4M53A 4UXHA 4EJSB 3I92A 2IWHA 1M7BA 1W87A 5L3QA 2F43A 2SHKA 3D7MA 3VO1A 1VYUA 1Z0DA 3B13B 3MJRA 1E2MA 3I8SA 3VTKA 3SI7A 4NYIQ 4ASUD 1G16A 4TQUS 1DTSA 4BWYA 2GAOA 4QRHA 3OIYA 2VHJA 3GLIB 3CCJB 2B7BA 2HJGA 5J4VA 5KNBA 4YMSA 2BV3A 4PC2A 3WBKA 2RCNA 2VRWA 3GJ8A 5B57C 4B47A 1VYVA 4FMCF 2RGBA 4GI7A 4RJLA 1GO2A 4AG6A 821PA 3W2IA 4OQNA 1DAHA 2PX3A 1Z06A 2W0MA 3SC3A 3CMEB 3WRYC 1PV4A 5HXBA 4QGFA 1RZ3A 1JEDA 1MABA 4QBIA 1EWRA 3GLFE 2GILA 5J40A 1VECA 1XEWX 2DFKB 4RD0A 4B3XA 2C5LA 4KVAA 1W36D 2Q3HA 1QFJA 1G9XA 3P27A 4U9UA 1XXHA 4N0DA 4CEJB 2ZE8A 4I1SA 4OI4A 5IDVA 2WJVA 1UMKA 2WAYA 4G0NA 2VSFA 4JVMA 1ONBA 3IKJA 2BWJA 4DDWA 4XOIA 3IO3A 2JAQA 1K73D 3K0EA 2FG5A 3CX6A 5TVKA 4Q4AB 3QNUA 2FX3A 4PC7A 1V5WA 2DWOA 3T1VA 1NI3A 2WMOB 2IT1A 3BORA 3CCMB 4OL0A 1CIPA 2BM0A 1F60A 4HAUA 4BRWA 1FMLA 4Q7KA 3ZBUA 4ZI2A 1YZUA 2V6JA 3KTAB 4ZCLA 4KCGA 3EXAA 4DHEA 1YR8A 2VNKA 2GK6A 3G82C 2WJIA 2XZPA 5CLQA 4ON9A 3HU3A 3ADDA 4KLNA 1GNRA 2HXYA 3KKPA 3VQTA 2QM8A 1BMFD 3B78A 2OXRA 1BYIA 4B2PA 4DLUA 4PANA 4XVQA 2VYFA 1UBFA 3RYTC 3I8XA 3SBDA 1T8UA 1U2RA 4GOXA 4G5SA 4B3CA 3MWYW 1G8YA 3CC2B 1JALA 3A36A 4PAOA 3IIMA 3GJ3A 4JBWA 2QBYB 2YVUA 1W2HA 3AVWA 1M2OB 3EPHA 3U3OA 1OXXK 3DKVA
chains in the Genus database with same CATH superfamily
4X66B 3CP2A 3ANTA 5H68A 4ZVLA 1IWBB 2BBWA 3JD1A 1S2NA 2ZRKA 2RHBA 3QWBA 2XUKA 2RK6A 2XMDA 4A16A 5J47A 3ZY6A 4A0RA 4G0UA 4C0LA 2ZTGA 3D8UA 1CR4A 1EDDA 2DC1A 3BJEA 4FNGA 5CA0B 4WBNB 3RVOA 4KO2S 3A25A 1ZUNB 4KXFB 2H18A 2LDXA 1KFEB 1FX0B 3BHJA 4AN0A 3GJ5A 1ODJA 2J3HA 2F1IA 2XBUA 4IQFA 3OTQA 4BYGA 2PZJA 4P6YA 2V7GA 3D0KA 2OB2A 1XJQA 2QG6A 3QUBA 4MVJP 3DEFA 3QYPA 2XT9A 3TW4A 5BN5A 1MIOB 1X70A 2Z6VA 4TRNA 1C9KA 5KPJA 3FTNA 3V6MA 5CYGA 2H08A 2JK0A 2OCPA 1XMXA 2XUJA 5E1BA 5GJVC 3ZWWA 3ZGZA 2PY6A 1VC2A 4UNPA 3F8WA 3TZLA 1UT5A 1K8AD 4DPLA 3M2PA 2ZAIA 4I3HA 4KOAA 4GKKB 3A8JA 1RTKA 3OMXA 4YO8A 4DSUA 3SHWA 1BCSA 4IMIB 4UEQA 3GLTA 1QRAA 1MBZA 1E3SA 3G23A 3MUFA 1XMIA 1OGJA 1EZ1A 1GPMA 1N2IA 2ZI9A 3IBFA 4X95A 1EE9A 1K7EB 3GFSA 3VVBA 1TQ8A 5TJ9A 2C7VA 4KGDA 2II6A 1OYWA 3OZBA 5BV7A 4H0CA 4H6PA 4DIOA 1YVRA 1HT3A 1KYZA 1ZW1A 1CETA 2G1PA 4RPLA 4M6WB 1PR4A 4F2DA 1MR3F 1FPMA 3PCRB 4JKYA 1A4XA 4N49A 2MHCA 3F67A 3LGXA 2F8SA 2I3GA 1E5VA 1Y5MA 5H7XA 2CUZA 3EFBA 4IRXA 4PLHA 1FYEA 2VS1A 1M2GA 1LPBB 4J07A 3DKPA 1UODA 1HDCA 3FMVA 1PN3A 3IUPA 3PHIA 4RKEA 4CKBB 2AFHE 2O2IA 3PTZA 1GPNA 2H8KA 2OP1A 1Q1QA 1ZIYA 1AT1A 1SBTA 5DXAA 4A03A 3W5VA 4QYMA 5BUQA 3JU3A 3K9QO 3Q10A 2FXIA 3VO2A 2LDBA 3BMCB 4LQCA 1NURA 5JAUA 1ZJ5A 2VBIA 3SR4A 1XTBA 3W2GA 1PT5A 1TCUA 3DBRB 3JD2A 1W73A 4ZT7A 4V0ME 1S6YA 2C1EA 3TOVA 4DPMA 4QREA 1ZI9A 2FE4A 3B1YA 4NCNA 4FDMA 3MWDB 3WOVA 4A27A 3NTOA 2B1RA 4AZTA 2EBUA 1L4NA 3H8VA 1QIFA 4BZXA 1OR8A 1TMOA 5CFMA 1R6AA 4P35A 1AXEA 1IVNA 3JQPA 1HUQA 2ZYTX 2XNJA 2QP9X 4NKRA 5FA8A 4MS1A 2I8CA 1HV8A 1T9BA 3RR2A 3I9OA 2OAGA 4A6XA 3LL7A 2IOFK 1JFFA 3SZGA 2UUAB 3ZI4A 2GTPA 4E15A 5FTNA 1X3LA 2VSYA 2IDJA 1NMQA 4RPCA 1ENYA 2L42A 3W1WA 1ZOSA 5BVGA 5CD9A 2GO1A 2ZYVX 3RIXA 2HDOA 1JFRA 2X76A 3RBZA 1IN7A 3A6ZA 2O2DA 4KVGA 2OM2A 2P0YA 4W6ZA 4FP9A 1EVYA 3RRXA 2YCLA 1JI0A 3A8IA 2Q3EA 3IQHX 1CB7A 1RT9A 2VJIA 4MQ6A 3TOSA 1KMHB 3W6OA 4BBPA 1GQYA 4OOVA 3VR3A 3ELBA 3GPIA 4ER6A 1IE3A 3KDPA 2KJQA 2P1DA 3WJAA 1X1SA 5CDUA 1EG7A 2GZ2A 2G0TA 1T2AA 2DT8A 2O4CA 4FU0A 5HJEA 1THMA 3M83A 4GXNA 3RUPA 1IBMB 1J1UA 3AT1A 4X64B 4UNRA 2B99A 3Q15C 4NCHA 5LR6A 4MMZB 4Z4IA 3BWMA 5TV2A 1LXCA 3U1VA 1ENPA 1R4MB 2O06A 2GWHA 1WVIA 2YS7A 1K88A 1U8YA 3Q5GA 3NQ41 4MQEB 4NH0A 4GKJB 1E69A 1K92A 4L51A 2VDMB 4G5QA 1SHJA 2IIBA 2YJ5A 3K2BA 3KQYA 4QPDA 4DREA 3KU4A 2ZGVA 4G8JA 1WBJB 2K6GA 3TIVA 3ZIDA 3H17A 4UEWA 9MHTA 2B5VA 5DXJA 1QP0A 1W5EA 3GRZA 4XSGA 5EE5B 1RD4A 1O2DA 3RU9A 2BEUB 1VBKA 1LV7A 1U2TA 2IXTA 2WA1A 3L8GA 3KZKA 4D81A 2QG9A 4INZA 1GD1O 1EESA 3NYIA 3QMWA 1OLXB 4B6EA 4NONA 4I50A 5DKFA 3IMFA 2J6BA 3K94A 5BV0A 1M2NA 2X4GA 1XXHB 4G26A 1FA9A 1PQYA 4XD7D 1LDMA 1VXRA 4DCCA 3A3BA 2XE8A 1TKCA 2ENUA 1UADA 3RC1A 3RE1A 3TZQA 3WGLA 2J4FA 1SGWA 3NHSA 2ZOSA 2DP4E 2G67A 5FA5A 1RM0A 2VDKB 1JIVA 1Y1PA 3II6X 5D85A 3DL2A 1PYGA 1RFLA 2H4XA 2ZT8A 4HN9A 421PA 4M1MA 5K01A 4A8HA 4FFWA 4CG0A 1VPEA 4FM9A 1Z2CA 4KIWA 1RXSA 3N7AA 2FWBA 3K1AA 3DMNA 2WINI 3MYYA 2H1FA 4LV8B 5DIZA 5HQ3A 4R2IA 4JYAB 1EYZA 3DMDA 1HOTA 1N36B 1ACMA 4UTOA 4XPIA 1JKXA 4IFTA 3SF8B 3O8CA 3ASQA 2CB0A 4C0BA 4TYWA 4K9RA 4PWZA 5IYNA 1KY2A 2V7QA 4LXXA 1BVRA 4K6KA 2QVLA 2C4MA 3WMWA 1JF8A 3G7NA 3ZBPA 4Z4HA 3GH1A 4IEIA 4R8RA 4CIAA 3CW2A 3HB9A 3NAZA 3MB8A 4KQKA 3ZQ6A 5CA1F 4BE4A 3PC8C 1Z33A 3HSYA 1CY6A 2GO7A 3ELDA 2RH4A 3OPYA 2Q3LA 3MD0A 4F11A 3IP7A 3I01M 1VLVA 5NULA 4QUHA 1J8FA 4DQLA 3ZOKA 3M2TA 3HVIA 5IBPA 3O2SB 3RM3A 5K05A 1A8PA 3UATA 2F2TA 1YQDA 2H4JA 1U65A 2IXGA 4FOLA 4CUKA 3OEWA 4EF5A 1F2UA 2F1KA 4UFOA 3L82B 5HRAA 3ZCTA 3NIFB 3KQQA 1A2OA 3NYWA 4C6HA 2L18A 5KBYA 4EHJA 1EWKA 3NZEA 2QRGA 1PGOA 4MJ7A 1GPLA 5FL7D 3TFWA 3WWOA 3MZ0A 2HRQA 4CIVA 1MC1A 3GO4A 4ASUA 3SE0A 2P7HA 3ABIA 3KJQA 1T8TA 2LKDA 4DVJA 1XMSA 3ZD6A 3AO0B 3QBJA 3U49A 2C7GA 1MU0A 5IDXA 4NATA 3A6HA 2WUEA 5L95A 4AXXA 3KQNA 1PNOA 1XNGA 4XX1A 3PK0A 2PUHA 3BWBA 4LYYA 4RYLA 4EA8A 1IJEA 2ZYDA 1QTRA 5K3DA 1RZVA 2IV2X 2VF4X 3GRYA 4JL5A 1Q16A 4OHZA 1IHDA 1B42A 1H5UA 2WJZB 3QTBA 5BNZA 1C4WA 1TAGA 2DR3A 2G70A 1L7AA 2V7WA 3A0UA 1FSZA 3K0CA 4ESVA 2ZTNA 3ITKA 2QTMA 4EB6A 1Z9BA 1CUVA 5DHRA 2DR2A 4QDZA 5EMNA 4G5RA 5JV5A 4RZ2A 4M9QA 5ICFA 2AGVA 1ULSA 4MV1A 2B9VA 3K2IA 5AW2A 3H4TA 4B2IA 1AXGA 4KLRA 1T9GR 4QOIA 3RVDA 2GM5A 1Y3BE 4XOTA 3KKQA 3FOWA 1BWRA 1D1TA 4JQOA 1BDMA 3BFPA 3EOAI 3PFKA 2E49A 3HUDA 4QYSA 2Z6AA 5ADWA 1N7GA 3GEMA 5CDSA 4PNHA 1OF1A 2ACWA 4P1ZA 2F4NA 2VBFA 1XU7A 2ZI6A 3QUSA 2RHWA 1G2IA 4DM4A 3TNLA 4DF3A 1Q91A 3DYBA 4RAQA 5HRUA 3MF4A 1Z37A 2AC2A 1BMFA 4EP1A 4XQFA 1GTG1 621PA 1QNFA 2JJMA 2R2AA 2IUSA 2ZRFA 1DAMA 1XPJA 3N74A 4L6CA 1YDGA 3PXDA 2BMWA 4H35A 3AUYA 5FUVA 4B83A 5FNZA 5CM2Z 1NBME 4GR4A 4IDEA 3ZS8A 5E6TA 4DLSA 4KDEA 4IG4A 4I5FA 1PLLA 5EXDA 1JKIA 3VAAA 4MS1B 1V7PC 1PKEA 2CVHA 4U02A 1JFFB 3PC6A 4FR2A 4BLPA 2P9GA 4WVFA 3OJCA 4PTYA 3RF7A 1Z07A 5BVGB 3BL6A 1WDLA 1JIIA 3C6KA 1K28D 2CLHB 4GZLA 3AVOA 1RWXA 2Z8YM 3RS8A 2B1GA 2P6UA 1WKVA 1TEHA 4NZPA 4DDHA 1IIBA 4OXIA 2VHWA 1EUQA 1XX6A 3IKLA 5JROA 4I1UA 4NAUA 2VQSA 2YHBA 1NQOA 2Q6TA 1PAUA 2OMEA 4RLZA 2QB5A 1TJ4A 1PJCA 2AS0A 4EM6A 2Z9DA 3M0EA 2MYTA 2DMRA 3LQEA 1KYTA 1TF2A 3F9IA 4GRDA 2JHAA 5A0VA 5A3JA 1NN0A 2EL9A 1EI9A 1UF9A 2JPDA 2JVIA 3D8TA 3V7FA 5GJCA 4F9EA 3D4NA 1YV9A 4LBVA 4QJIA 1HK7A 3VGJA 4WUVA 3VZSA 3RPEA 4RQBA 3SZUA 3JVUA 1R64A 2WU8A 4KWTA 1Y7IA 1EGVB 1JR4A 1UINA 1U1GA 1G21E 2BGMA 2YYYA 1MF7A 2YWEA 1P91A 4P22A 2VBGA 2WF9A 3C7TA 5DNEA 4BO1A 4CU2A 4BQEA 2QWXA 1ST2A 1DIBA 1XD2A 3B3FA 3NDJA 1P72A 1YH3A 2CKMA 4MVJH 5CFQA 2XQFA 3FPSA 3RJMA 5JMOA 1BYUA 3T5CA 1NF9A 3ZXIA 4ALNA 2F8TA 1XL0A 4ND8A 3GEHA 3H1AA 3W5SA 1TD1A 2H1RA 2X58A 2A9RA 3WLSA 2LV8A 2YMMA 3RTGA 4V0MA 2KQUA 3LBNA 3Q5DA 5FPYA 4I50B 4UNNA 4W1QA 2VR1A 3HDTA 1BCRA 3LY7A 3V8RA 1YUBA 5DM70 3WXMA 1CIVA 2QUIA 2FNAA 1WSVA 3BILA 4OBWA 3AUFA 4BXOA 4W99A 3T3HA 4G07A 5L3VA 1XHLA 3K4QA 3PA6A 3QBDA 3TGPA 2EYQA 3D7SA 2W8BA 4PU0A 5CM9C 3I1YA 5TPWA 3ZE6A 3KR2A 4JCCA 5IP5A 3OZSA 4KN9S 3DAHA 4NBVA 4D4KA 3Q3CA 4MW1A 1BKDR 3D3EA 3G59A 5B2EA 5FQNA 3GVJA 3ZVMA 1L3IA 3WIBA 2Q5JA 1F4LA 4OB8A 3K1AB 3GJRA 3MYRA 3H6GA 2HW8A 1WPQA 1D8AA 2EEPA 4YONB 2HA2A 1RAGA 2HD4A 5HQ3B 1Y1TA 3HDJA 4FW8A 4S04A 3OLZA 2Q3BA 1LDGA 4NC9A 4E4RA 1HFJA 1B6TA 2PRSA 2WF5A 2Y05A 3LZCA 3W5JA 4QJ3A 5CEJA 9LDTA 3HSKA 3EASA 5DYIA 4X7DA 3DA8A 4OXRA 4D46A 5JCXA 2IITA 1ZEJA 3OBIA 5CDFA 1O0BA 4XRGA 1E94E 2P1RA 1LW7A 3NRCA 4RD2A 3V8MA 2FH5B 3I04M 4I1YA 1KMCA 2HWKA 2RB5A 1WP4A 4J4TA 4JXXA 2IF0A 1Q95A 3GCZA 2UUPA 4LDZA 5FBRB 3CEAA 4CLHA 1HT2E 1QO0D 3VHRA 5LUAA 3OPYB 3L7JA 4PPGA 2QTNA 4HDOB 4QNNA 1JEJA 2Z4TA 1FVXA 4HXGA 1Z4IA 2HJWA 2WYUA 4FD2A 4MGZR 3RLFA 2FUNB 5I9IA 1GUDA 3F4KA 3IPYA 5JJLA 4IJ5A 1NTRA 5AK3A 3WZLA 3FUCA 1DX6A 1FFAA 3A1WA 1LH0A 4TV8F 3A05A 4IVNA 4W7HA 1F2UB 1G20E 4X9XA 2CL6X 1N1GA 4C87A 1VKHA 4EHBA 1DZIA 1VL2A 4LWOA 4Q01A 5F4BA 4RPGA 4ZQCB 1H8ED 3ZJVA 1JPJA 1LZLA 1VGVA 2AC4A 1KJQA 4MHTA 2VATA 4KUEA 5K5EA 4NXMB 1DXOA 3KUDA 1UFRA 4HI0E 4LV5B 4XFDA 1US8A 1FSPA 3I5MA 1IN4A 3IX7A 3MFYA 1OXVA 2CYAA 5A03A 2HV8A 4KLZA 5LL6P 4P3XA 5LP6C 4MW6A 1TQDA 3Q8XB 5ALIA 4AB1A 4HATA 1DV1A 1KI8A 3BF7A 4DV4B 4LK2A 3WMXA 4GPIB 3M1LA 2X85A 1JNYA 1YRBA 2RHHA 3KPVA 2TSYB 3LYAA 3MNFA 4MGKR 2QZ4A 2FSGA 3B2EA 5KKCA 3R3VA 4DJAA 2LVBA 3N3AC 5F2OA 5ES4B 5TDHA 2JLRA 5CM8B 3L0SA 4PFQA 1KYQA 4EK9A 3HN7A 3NV7A 4EB6B 4R3UC 2JD1A 4R1PA 4G84A 3WLFA 1ZXLA 4C29A 2R11A 4EG0A 1OH8A 1KDOA 2RBKA 2W8ZA 3F78A 3UUGA 1DTEA 1TB4A 2WF6A 4UHHA 4S1NA 5ALQA 1U8ZA 2VEDA 2ZAGA 1QV9A 1XIVA 5FBQB 2ZYHA 3N5CA 4CM4A 4CMCA 4Y2VA 5FDFA 1XEXA 2OD7A 3L0ZA 3SE7A 4LF4B 1E0SA 3OAAD 2V1UA 3ZV5A 1BE0A 3LOQA 2NVOA 1TFRA 3F97A 1L6IA 2Q6KA 4HR7A 3MCZA 5IKEA 4DM3A 4ISBA 1IBLB 5H9VA 4B31A 3QX7A 4X8OA 4RM3A 4G0XA 4HQLA 2F8MA 1J06A 4YI3A 5J58A 1AMUA 1UBMS 2V65A 3NRJA 1XKQA 2QTVA 1MX9A 3IPXA 4CW7A 2XVMA 1Y0YA 3MRTA 4G81A 2EX1A 1VB3A 3AK4A 3FTPA 1AZTA 4GBJA 3PDIA 3Q85A 1NOKA 4U2KA 3U3ZA 1X39A 2RAFA 2AMVA 3ZR4B 1ZLYA 1QONA 2W6ID 1UAYA 4G37A 1X92A 1NXVA 1TAQA 3HJTA 1KYVA 2FWNA 4RVDA 1NUQA 4IH9A 1D2CA 4ID9A 3TNFA 4DSAA 1YRHA 4G3XA 1DAIA 3B7PA 2BFCA 2JJ1D 1WQ4A 3HE3A 5BVHA 2AJLI 3CGGA 3E9NA 4JNCA 1E2UA 1DQSA 2E5WA 2XYHA 3C3MA 4J8PA 3E3NA 2HBQA 3T3GA 4AJNA 1ZUHA 2CZCA 3FZYA 2B7CA 1JHDA 2YDXA 1W59A 1Y9JA 2A0YA 4E4TA 3T38A 1KHTA 3FCUB 4H17A 2YRWA 1IJFA 2H9AA 4IXDA 3ZGXA 2RHRA 2Z58A 4LJ8A 4MVYA 1DC3A 3S2FA 2N0SA 3V42A 2R0QC 4G9BA 3B85A 3B1FA 4B79A 3ICCA 3HU5A 3ZBTA 1BJRE 4AO7A 1RM4A 3PEFA 3JQ9A 3MPOA 4M1OA 4NICA 4YNBA 1OBCA 4GPBA 4N7JA 5IAEA 1HE2A 2Q1XA 5FL7A 4ZVPA 1VMAA 2XR1A 4W4TA 4EUFA 1JJ2B 3QKIA 4IYJA 2XGMA 2A14A 2QZJA 3B6MA 1ZRMA 1VKOA 2DY0A 3ACCA 1H6CA 5JU6A 4M76B 3SFTA 3LU1A 5TGTA 1DFIA 4QT0A 3W04A 2HJSA 2J9YB 1KJ8A 4IEFB 2CNOA 5CFZA 4RTKA 2FPIA 1A4UA 2O8VA 1E1MA 2IELA 4YRSA 4GZ6A 3WLJA 2VQ3A 5AVZA 2VOEA 1W1WA 1WG8A 5DEOA 4YR7A 5GPBA 3MMXA 2VDVE 2B4QA 3C4JA 2EOAA 3IIIA 1U0OC 2GD2A 3IMGA 1FJHA 4R1MA 4ZAWA 5I8ZA 1PFWA 4BGDA 4X0CA 1NUAA 1A2QA 1XD2B 3R3UA 5ALKA 3EGDB 3RU2A 5CX1A 2C29D 4YJ3F 2WLTA 4AMUA 1Y9ZA 1RWVA 2W43A 1DUVG 2NZ2A 4MPJA 3EF0A 1WMDA 2DGDA 3E4DA 4KPFC 1SC3A 3N2LA 4A2CA 1K06A 1YI0A 1Y81A 3GLVA 4ND8B 4P08A 5HA5A 1ZH2A 1PEAA 1E3JA 1KIMA 2J3QA 2PUVA 5F64A 2EP7A 1FQWA 2CXHA 4N7MA 1W2GA 4UPDA 2JNWA 4PCUA 1BCRB 1A04A 2SBTA 4E5KA 2I2DA 1I80A 1X1CA 2ZKIA 2DHEA 4PBRA 4XASA 2BR4A 2BGRA 2RHJA 2G04A 2QR5A 2GF9A 4OD0A 4M0CA 3PQDA 4TVBA 4IVRA 4V2IA 3KR0A 5JDCC 4ALKA 4BVFA 1KEKA 4X61A 2NSJA 1FRQA 1XEAA 1E89A 2AA3A 2W8BB 1U7HA 1XMJA 3KJHA 4J49A 1JAIA 2F1HA 2HQSA 2PYZA 5TPWB 1D2MA 3SEFA 1QFSA 4KMMA 2ZJ6A 3NJ4A 4B7UA 3OW7A 4DMCA 1JEAA 1BO6A 1NVVR 4DE5A 4GFDA 5P8WA 4Q1AA 3V8QA 3JTEA 1RYBA 5ALHA 5HOQA 2QUAA 1X14A 1ADCA 3EVGA 4EI8A 2ZANA 1SURA 5DO9A 3CH7A 2YMQA 3MS4A 1LBHA 1JXQA 1H2BA 1F4VA 1K9SA 1QYRA 4RSGA 3EEYA 5C5EA 5IK2D 2DPLA 2WJWA 3NUQA 4DB2A 1Z36A 1I9GA 1M90D 1ZRNA 1KJ9A 2VFAA 1L3CA 2EVWX 3L8EA 4ANFA 3FUTA 1WNTA 3N70A 3KQMA 2ECFA 1N6PA 3MGBA 3ZZ1A 1CHNA 2QTRA 3KXLA 3NBXX 3N59A 4Q4JA 2ODQA 3FZGA 1Z82A 4KGVA 5B64A 3IAM1 1NVTA 3L49A 3SS8A 3TKYA 1CZOA 1X42A 2ZI5A 3A4YA 2YYZA 4EFMA 1OXMA 2Z4RA 4KE7A 4Y3UA 1LPNA 5AJTA 5ELMA 2NO6A 3BXGA 5BSUA 2FDCA 2POQX 4HFJA 3RS7A 3SD7A 4RKRA 3LCRA 3LIIA 2B0CA 5KQGA 2G6TA 2L17A 1ATZA 1CUCA 1N8NA 5JCJD 2WG2A 2NTJA 4F3YA 5GIOE 5IJ9A 1N0WA 4HWRA 3BKWA 3P4UA 5LQSA 4CCYA 5I4CA 4O4JF 5JI2E 4K28A 3PXGA 4XX0A 2MSNA 3ICPA 1VE1A 2A4MA 4BN5A 1RPTA 5HM8A 3KXIA 3DHWC 1E9BA 1FDVA 2QLBA 3TRDA 4CKEA 4UCXA 4DLTA 3KB2A 4GMFA 3H2YA 1RMYA 2ACKA 3NIDB 3OZXA 4QJ5A 4YYZA 4C7OA 1KMNA 2E85A 2XI4A 5LOVF 2KWIA 3CG4A 1QPZA 3FG9A 4QVKA 3ZD8A 5BNTA 2INGX 2ZBQA 1ORTA 3U7JA 3CUVA 3WLEA 3N1UA 1CUZA 4G6IA 3IBGA 4CU5A 2ZKLA 2BUBA 4HQNA 4OHXA 2C9OA 5C4MA 1US8B 5FV4A 2RGYA 3L0BA 1UZMA 3OM1A 4E31A 2O5VA 3HN2A 1S5PA 4FN5A 1EX7A 1R12A 2FCRA 4I7EA 4IIHA 4WOJA 1F7VA 2FR8C 1WUHS 3GFTA 4M1EA 1L5VA 3BE6A 2HTFA 3GBSA 3JS5A 4ZJZA 2C7PA 5BUZA 1VIAA 4XIYA 1P0QA 2H2AA 5IKOA 3AI3A 2GI4A 3PHGA 1RS0A 3TDNA 3ABSB 5KUTA 4JP3A 1II0A 4RXMA 2CHEA 5DM1A 1KVRA 5K0TA 2NSLA 3AONB 2X3YA 1V3TA 3BRWD 1S2IA 4RH3A 3WHIA 3K71B 4JYCA 1HY3A 1NF8A 1XWFA 2I4OA 1Z08A 4L07A 4AKGA 2DFVA 1JAXA 2X5KO 2X86A 3AP1A 3MW8A 3A9VA 4LI0A 4Q37A 4ZT3A 4DTIA 2GK7A 1JH8A 2QP4A 5JEDA 3BGDA 1J1ZA 3TTUA 3OQBA 1G8AA 2IFTA 1NYQA 1SK9A 4CM4B 5JCOC 3UPTA 2GA9A 1XEXB 3AFNA 1O5IA 3BVPA 1R1DA 3K30A 4J43A 2EIHA 1PT6A 4OREX 5D3MA 1KZ9A 3U17A 4MV3A 3L77A 3MCVA 1OGYA 3VV2A 3IA2A 1NMXA 1FB5A 2N47A 2ZR8A 1DDOA 3GW8A 4RH1A 3L4BC 1EIWA 3BNWA 3FMFA 3QMPA 4V2UA 5H3CA 3E23A 1JG6A 4P34A 1AZLA 2WNHA 4G5OA 3AR9A 5JLAA 3G6KA 2ZJ7A 4WFQA 2GBGA 5DM0A 4N8DA 2Z6QA 2ZP1A 3EMKA 5DTJA 2QTVB 4TTIA 4ARSA 3GAFA 4U5XA 4AMZA 4CG1A 5IFLA 4F4UA 1PR6A 3NHFA 3PDIB 3B3QA 1NNLA 4FCTA 4ERXA 2QNIA 4ZQHA 3ZHRA 1G20A 3L6DA 2CVZA 3LKDA 2R65A 4N76A 2GZHA 2J3JA 5AVUA 1ACJA 1YHYA 2JLCA 2BFCB 3GJSA 4WI1A 1U3FA 3LY5A 2H1VA 3WIEA 4D9IA 3QLTA 3R75A 5BVHB 4IGEA 2PMKA 1T9CA 2G36A 3REOA 4L4YA 4YCBA 2NSDA 2PUJA 2Y2VA 4BO4A 3JZIA 1NR1A 4HN4B 1IEWA 3OX2A 1RP1A 3DEKA 1TUGA 4GU5A 2Q2NA 4O4IF 2PJZA 4RGYA 4KHZA 2W6JD 1M2KA 5DNCA 2WIBA 3T5AA 3LQ1A 3ED5A 2E4ZA 1HE4A 4BLOA 2QDXA 3RSZA 1OFVA 4M99A 4XYMA 2BRUA 2CC2A 1OAKA 2RJ3A 2PBLA 4FWBA 4WASA 5LJIA 1H8EA 2QAJA 3NTQA 2G9UA 4RX1A 4HTAA 2EG5A 4FS8A 2HK9A 5H82A 1OI7A 5IXYA 3M70A 4XUDA 2R8EA 1LK0A 1EK0A 2D2EA 5A9RA 3BTVA 1GUZA 3NP7A 1CX9B 2FPIB 1N2SA 3C3EA 3EVAA 3QKRA 1OX6A 1I2AA 1UQTA 2XMGA 3G0BA 1JLSA 1JG2A 3RVNA 3SEAA 2X19A 4I55A 7MHTA 3W6UA 2J87A 2NYUA 1LD3A 1B6RA 2B61A 3LT5A 2JBAA 4I9NA 4JELA 2O3RA 1JAZA 4URFA 5JADA 5K6AA 4JQCA 1ZS9A 3SMVA 2CXSA 2KYRA 2VBSA 5CX1B 3TLJA 2Q6IA 2PZ8A 3KCQA 3WGNA 4B0OA 5CXQA 4LF5B 1YQXA 4TTPA 3X1ZA 1LGYA 3HGQA 4PM4A 3M5WA 3U5ZB 3PUVA 5ILOA 4BOYA 4OAPA 4OP2A 3IKTA 2BTEA 2MSDB 1KAEA 3CPWB 3G4SB 1VQ4B 2MTBA 1V1RA 2WEKA 3I72A 3OM8A 4UVDA 4AU1A 1GA6A 1SHKA 1SZDA 1EDBA 3T51B 1YK1A 4UKDA 5EMKA 4JQYA 3E22A 4D7AA 5BNIA 3EEOA 5I51A 2HCJB 3OA2A 3OAAA 3N0VA 2Q99A 3E5MA 3IOEA 3PPYA 4QAJA 3U62A 1KS9A 2FMTA 2BR5A 5IJAA 4D0GA 2EZ8A 2EW2A 4REMA 1KRWA 2YWJA 1MEEA 4YEJA 1Q22A 3NOVA 2RKOA 2IRWA 1QIDA 1VLHA 4W6QA 4CLOA 2O8CA 1D0SA 4P53A 1B41A 4H1VA 3VSEA 4ESHA 3KL9A 2WIFA 3IP3A 4UW9A 1OPXA 4F04A 1TPYA 1QHGA 4GNKA 5EKUA 1H6AA 4EW3A 4YP1A 3O4GA 1C3JA 4XB1A 1YBVA 1U5AA 3RKRA 2W6IA 4KQ2A 1VG0B 3F3SA 4DMLA 3RJ9A 2QN1A 3Q7EA 4Z7OB 1TCCA 1XZBA 2CMHA 3J81k 2NXNA 5A9TA 1IXZA 4FLFA 3BJZA 5TGZA 3AF3A 3L7NA 3UT5A 4M7WA 5A4IS 1YDWA 1X7HA 3EJ6A 3R0ZA 4LJ9A 4BMYA 3JVVA 4ZCTA 5KYNA 2JJ1A 1V8PA 2VJQA 1Z3IX 3DWIA 3MA0A 4G0QA 2B98A 4MI1A 3QU7A 4G89A 5FUBA 4ENSA 4KRFA 1V6SA 1TL7C 2PTGA 5KX5A 1LK5A 4BP8A 1WZNA 2AR0A 2DF8A 2QMHA 4LSWA 1U9IC 3UG6A 4Q4JB 2YFKA 1RXUA 4JR2A 1GYPA 2FZVA 2FX2A 1XU9A 4TUYA 3TZKA 4WJLA 1YVDA 3DE6X 4K40A 4P7GA 1P1FA 5H4HA 1UKAA 2V7VA 1X1BA 4R6WA 3SHVA 4Y2GA 2FZ4A 4P4GA 3WGKA 1OWOA 2P2CA 3KM0A 1E2NA 5FLYA 1G8JA 2JA1A 5IJ9B 1KK0A 2NAPA 4BLVA 1NZDA 1XTIA 1QOZA 2QLMA 4CCYB 4HK4A 4DNPA 2RONA 4XX0B 1M76A 4EUEA 5FQOA 2PXHA 3CKMA 3PYMA 3AP3A 4CKEB 2B82A 4C7OB 3HCRA 3ZQ4A 3CRRA 3LBYA 4OHPA 4BNLA 1UWKA 3CLUC 3LM8A 4J29A 5DBFA 4N3CA 2P11A 3RJZA 3FYTA 2GPAA 1MO6A 2OD2A 4Z4FA 2FMHA 4RCYA 1R15A 1SHUX 4GVPA 1ZD3A 2J0VA 3C39A 3ZI7A 3K6RA 4F5EA 1EXDA 1VPWA 1JQ3A 2A0KA 2NTYC 3VPFA 4A8JA 4XR6A 5FADA 4US2R 3E6AA 3R9XA 4X3PA 1Z0IA 3BF8A 1ULAA 1W30A 1SB8A 3V48A 3U4QA 4UQPA 3GCDA 3RTDA 1AKWA 4KX5A 3NOQA 5J1SB 4FI3F 3QXHA 1GPH1 2WRZA 1GTRA 1NV8A 1ONSA 3P94A 1SEVA 3OU7A 3QSGA 5FTJA 1XMVA 2XNDA 1A50B 2HHJA 3HZRA 1PJ6A 5ER6A 2UXBB 4EHIA 1YHNA 3CIFA 2YOHA 4MW9A 1QCYA 3B1WA 4BZQA 1YK0A 2QUJA 1FP6A 3A6EA 3OUTA 4XJTA 3PENA 3F96A 1LDEA 3SHTA 2DRIA 4FHFA 4R8LA 3M5PA 1Y5NA 4DA7A 3HXTA 3HYCA 2VT2A 3AOGA 4ZT5A 5EE1A 3NIBA 3WGYA 4YUVA 5ALTA 5H02A 1CUIA 1JZQA 2C92A 1J5XA 2XB9A 1JI3A 4LC9A 1QCDA 4Q6BA 1SWVA 2V3WA 3ZU6A 3UAYA 3GNTA 1H22A 1N5OX 3IAXA 2AJ8A 4QASA 5D3MB 4O1MA 4W8HA 3T4EA 3SCZA 1JBEA 5DHQA 3KQOA 3MJ4A 3NM6B 5F7JA 4HIZA 2IIVA 3U7FB 1YGPA 2F1RA 3C7KA 4OXXA 1QB8A 2O57A 4RK0A 2CY0A 3PDCA 1UC4B 2OUKA 1EXNA 3DMRA 4RY8A 3ACDA 2OSVA 2I99A 1FRNA 3I5YA 3FPFA 2QJTA 5K0GA 2HWUA 4UU7A 1RWMA 5EESA 2FN4A 3FW1A 5IK2A 2ZSIA 4QXPA 1FSSA 4GRIA 1UXKA 4HPXB 5H81A 3T1YB 4F3RA 2NV2B 5DI3A 2BDEA 3ANLA 5JXJA 1CRWG 2XUGA 5HTOA 1G20B 2IC5A 2R6JA 3H6KA 4L4ZA 1XF1A 3OJOA 4KBFA 2ZAMA 1U2ZA 3LLCA 1U4NA 2AZMA 2OBLA 3A4MA 5EKTA 1KXZA 2RH5A 3AJ8A 4E70A 2FPWA 3CU5A 2D00A 4X65B 1QU3A 3WYGA 3VC7A 1UDAA 2BEKA 5ESXA 6REQA 5KQPA 3B2NA 4RE6A 4R84A 5JCJA 1AF4A 3JQ8A 4GP9A 2P4EA 4UHBA 3TXAA 5BWLA 1N0UA 1GLGA 2QVYX 4G24A 5DT2A 4EI9A 3LLMA 2XDAA 4L5IA 1PJLA 1Y89A 2AXQA 4EVRA 2QRZA 5C31A 2JFOA 4OSPA 5I7AA 3L5KA 1Z5VA 1JHRA 4XH9B 1GKLA 5EKXA 4D42A 3PIRA 1QGDA 4E51A 3MWJA 4CPDA 5J43A 3LUBA 2ZM6B 2IS1A 1X7ZA 3VH3A 3GJ7A 1UBUS 2UZ1A 1YB6A 4OP1A 5SYAA 1MDBA 1E2KA 1N2HA 2HUPA 3HY3A 2NXEA 2X4IA 3HL0A 4PR3A 4YRQA 5TIIA 2FZKA 3KU1A 1IK6A 5KJ6A 3EMDA 4YMIA 3WWYA 5F3RA 5L6LB 2VJJA 1DG3A 4WH0A 3RNLA 3JAWA 1NFRA 2P4UA 3QKRB 4AECA 2XJ9A 4R2JA 3GJQA 2MOKA 3HSSA 4HX5A 1DJNA 2FR0A 3GFFA 4I55B 1C4OA 4RIFA 3WAJA 1GTSA 4JT8A 5BSTA 2JBAB 3R7BA 5FO1A 4PZZA 3RUCA 3HVJA 2DOGA 2X22A 1PX2A 1Z4OA 4QRDA 5MFPA 2RD2A 1CXZA 1CNEA 5CDGA 3BRWA 4HB2A 3B9QA 2IZ7A 3G1UA 4YRNA 1FMCA 1HO3A 4Q34A 2Q50A 2BFOA 3CVUA 5DMHA 3S2SA 1SULA 1V1RB 2Y77A 3N53A 5C8YA 5HHTA 2DWCA 1J9EA 1JH9A 1J0CA 1C8KA 2PH3A 2Q27A