2LZJA

Refined solution structure and dynamics of first catalytic cysteine half-domain from mouse e1 enzyme
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
112
Chain Sequence
EFGEEMVLTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARHGFETGDFVSFSEVQGMIQLNGCQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLPASLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR structural studies of the first catalytic half-domain of ubiquitin activating enzyme.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords Ubiquitin-like modifier-activating enzyme 1
total genus 22
structure length 112
sequence length 112
ec nomenclature ec 6.2.1.45: E1 ubiquitin-activating enzyme.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16190 E1_FCCH Ubiquitin-activating enzyme E1 FCCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.180 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2lzjA00
4P22A 4NNJA 4II3A 2LZJA 3CMMA 5KNLA 4II2A 2V31A
chains in the Genus database with same CATH superfamily
3VO2A 3H94A 4LBWA 4ZV4A 2HCJB 3CD6B 4PC7A 1UD6A 2VNJA 5TR9A 5A89A 3OZWA 1DARA 4FN5A 3VNVA 2Q6IA 1ZM2A 5HXBA 5B6IA 3CMEB 5TRDA 2QE7A 3PA1A 1N08A 1WU8A 3J81k 5F4MA 3BQJA 2VBTA 3NE5B 4ZGNB 1NRKA 4TMTA 4UZFA 4WWVA 1UD3A 2QTZA 4UZUA 3P27A 1WDTA 3CP8A 4RPDA 2B5OA 2FX3A 1UD4A 1V5VA 4ZCMA 3U2QA 1SKQA 4PC2A 2CC2A 2BM0A 3OP1A 3OZVA 4XONA 2D3LA 1R5BA 2VNHA 1IB0A 4B3GA 4M0LA 1BPLA 1YJWB 3A3BA 1CNEA 1VHOA 4P1VA 4ROXA 4X0CA 2DY1A 3GSIA 5EMNA 4YAUA 4XNFA 4PC3A 4HE5A 3VO1A 2JIZA 1R5NA 2QGGA 1KK2A 2ZBUA 3CTAA 4FK8A 1ZUNB 4XL9A 4TMZA 2VJIA 3BY2A 5GV7A 1QVGB 2B7CA 4YELA 4PC6A 2E1BA 2ZXIA 4ZCIA 2YWFA 1JNYA 5FNZA 4YAOA 4OPSA 4WZEA 2BSAA 3W2IA 1AIPA 3CXCB 2WJYA 2WPDA 4X7FA 1QUEA 3CRZA 3OFNA 4LC0A 4BPRA 4M1KA 3WNCA 4LBZA 3QE2A 1MRZA 1UD5A 4HE6A 4DNRB 5A8AA 1KTVA 1K73D 3QFCA 4TMVA 1S72B 3SLDA 1EFRA 5DS0A 4PC1A 2V7VA 2WSSA 4RPBA 4XLHA 5IYRA 1TVCA 2ZTGA 1PJ5A 2R9VA 1F60A 5J3OA 1QG0A 1U2RA 1KJZA 4YHBA 2JDIA 5F4JA 1TUIA 4N3NA 3OOCA 4NNJA 4WZLA 4QV2A 1W9XA 3Q3AA 4UAJA 4WZTA 2GK7A 2VBUA 4P6YA 4XD7A 1QGZA 2VJJA 1AMOA 2JN9A 2GK6A 4ASUA 1Q9SA 1B2RA 3B78A 1JB9A 3QSYA 4Z4RA 1KK3A 2D9RA 2WZPP 5BSYA 3MMPA 1D2EA 1PJ7A 3E1YE 2F43A 4G7WA 2ZZFA 3W5VA 1COWA 3AVVA 5E6TA 3FJOA 2X3UA 3I56B 1VQOB 1T6XA 1IJEA 1EP3B 3Q6RA 3CCLB 2OK8A 2V7UA 2EFGA 1FNMA 4C0SA 1W0JA 4TKOB 2LZJA 4XLAA 5DSZA 5TV2A 1GO2A 4X05A 5IYQA 4RCZA 4KKUA 2ZITA 4G1VA 4DNTB 4RDJA 2DIEA 1YLOA 1OHHA 4NBSA 1NDHA 3ZIAA 1VQ9B 4P22A 1JJ2B 4PGOA 3CCUB 1FDRA 3R6KA 1N8RD 1BX0A 2VNKA 4TT3A 4X7DA 1E1RA 2XZOA 1Q81D 4F7DA 2PLFA 4LBVA 4OPOA 3WBKA 3WYAA 1I18A 2GREA 1E64A 2XEXA 4P25A 4II2A 4RD4A 2E1RA 1FNBA 1S4MA 1W0KA 2BGJA 2Q6LA 3LVBA 3SLNA 4XLCA 2JJ1A 5IYWA 4YAWA 1VLYA 2J7KA 4B43A 4X7CA 3QFTA 1QH0A 1EXMA 2V7QA 3ONYA 1S0UA 3CC7B 3ZZ0A 3PVDA 4QHYA 1CNFA 2WJVA 4LBYA 1W34A 2RC6A 1SKYB 4FWTA 1YJNB 5AN9A 3JQRA 1DDIA 4ZGQB 2F1MA 1N07A 2VZLA 3WBJA 4RD3A 1ZM9A 2X0KA 3CCEB 1GR1A 2PE3A 2DERA 2Q6KA 2VBVA 1I7PA 4J0QA 1M90D 3BNWA 4XR6A 2CBXA 3QFSA 2YWGA 3GIRA 2DETA 1G7CA 3FKSA 3WXMA 4ACAA 1EFCA 2V7WA 4RJLA 3ZBUA 2OBRA 1YITB 4Z4UA 4DK1A 1VQ4B 1WTHD 1QUFA 2C77A 1R5OA 3OJWA 4P3YA 2YWEA 4OPVA 4YEJA 4AVZA 1QFYA 4WZKA 3CCMB 4XKWA 1VQMB 1VQ8B 5KSWB 1WSVA 5KNLA 4TSFA 1E1QA 4Z4YA 3VMFA 5IK2A 3OPOA 3AVTA 3CCSB 3PUMA 1E63A 2C2WA 1OB5A 1VF7A 1YI2B 2QDXA 3CMAB 3W5UA 2ZXHA 1MABA 3W2GA 3CPWB 2HMAA 4Y7CA 1KQSB 1VQ7B 4QVAA 1VLOA 1XB2A 3LQ6A 1XE1A 3T56B 2OTLB 1KRHA 3KL9A 3AVXA 4G5GA 1CQXA 2GJPA 4EH1A 1WORA 1Q86D 3WNDA 1BMFA 3CCQB 3ZZUA 2OK7A 1NJID 4QFMA 4PAAA 4XQFA 3ZC3A 3E20A 1G7TA 2VBSA 5FA6A 3SEJA 1E3XA 1QX4A 1XFOA 4G6IA 4R71A 4YAFA 1H8HA 1NB9A 4GQNA 1FNCA 4U9UA 3A3GA 2GQFA 3WQZA 1YX2A 1YHQB 3OEEA 1EP2B 4AF6A 1WOOA 4H9GA 1T5EA 5CDFA 1H42A 3SJPA 1OGJA 1FNDA 4OOXA 1IHMA 4B4DA 4RLZA 3T51B 4RCYA 2ZL6A 2BPOA 3W5HA 5J35A 3WY9A 5JBQA 2QMUA 1VQPB 1I8DA 2C4UA 3BCFA 4P6VF 4B47A 1N0UA 4Z4ZA 1VHEA 1BQEA 3A8IA 4RD6A 1UD2A 1N0VC 4P12A 3I1FA 5FIUA 1K28D 2ZL5A 3OZUA 3A1PA 3CP2A 4Q7JB 4YXWA 3G6EB 1D8TA 2ZZQA 4TN1A 2GPJA 3W2FA 1E43A 3OAAA 4RDKA 2XZPA 1B23P 4OOSA 2NV4A 4B3XA 1W87A 2BN4A 5HKKA 1VJSA 4XOPA 1NBMA 2C5HA 4XLEA 4UZEA 1KK0A 1BX1A 4WQMA 2OTJB 1H8EA 2BMWA 5HZAA 3VR6A 3PENA 3CCVB 4Z4WA 1RQPA 3BCDA 3ZBTA 1QFZA 2V7TA 3CB4A 1SM4A 3VNUA 5GV8A 4Z4VA 4M4SA 3D26A 4P3IA 4XN0A 4N3GA 4XLFA 1UMKA 1BJKA 3CW2A 3GVJA 1FRNA 3GVLA 3SJZA 1VQNB 1HZEA 2WR8A 1YJ9B 1W2BB 4P9SA 3JQQA 3U6BA 4ZCLA 1DDGA 3CPXA 3AVWA 4KKSA 1ZM4A 2DYIA 4P2NA 2CK3A 1FX0A 3AVYA 3CCRB 1DG1G 3CC4B 1WOPA 4DQKA 3MCAA 4M53A 2BGIA 1T6YA 2JJ2A 3GVKA 4E0FA 2BV3A 2C4TA 4P26A 4B44A 2KVOA 5F4OA 3G71B 2M5SA 4FXUA 1Q7YD 1M1KD 1J9ZA 2GJRA 3G05A 3DDYA 2QA4B 3PUNA 1OB2A 1JA0A 2BVNA 2D3NA 5A88A 2W6JA 3OEHA 2WYRA 4DK0A 1WP6A 4CQJA 1KC8D 3A8JA 3T53B 4K1XA 1G7RA 3OKXA 5IYPA 4DQLA 2WZNA 3OW2B 2ZZGA 3OW7A 2X85A 2XOKA 1KK1A 3JU4A 5BSXA 4G1BA 3FPPA 4XORA 1QVFB 5H5JA 5TY0A 1E62A 4RD0A 2DEUA 1PKVA 2Z6BD 2XNCA 2X53S 1W35A 2X6YA 3B82A 2QEXB 1JA1A 2CRVA 1N05A 3Q38A 2W6IA 4X7EA 2OYNA 2Q6OA 1EWYA 4AF7A 4RM0A 4X8IA 3CMMA 4M2LA 2P3MA 4XOTA 5FL7A 5FO0A 2ZZEA 3ZPNA 3MHPA 3ZZTA 3WNBA 2XGJA 3CESA 1K8AD 2NPFA 1Y0RA 3R6JA 3W2EA 4RD1A 1EFUA 2DOGA 2HLDA 4OP7A 2XZLA 5IYNA 2RC5A 2I1LA 3RY8A 2CNDA 4X06A 4XMYA 1GAWA 4QVJA 1TTTA 3AGQA 1A8PA 1VQ6B 3HAGA 1XQBA 2X6XA 2BM1A 4Y9UA 3B8HA 2PIAA 2DCUA 4HIZA 4QUZA 1GJRA 4PABA 2X6WA 1RQRA 3ASQA 1Y0YA 4XKVA 3BC9A 4C43A 3LNNA 4X07A 1KD1D 4Y9RA 2QN6A 3JQPA 1D1NA 2F4NA 3A8KA 4G7XA 1YIJB 4MYTA 4RD2A 1H85A 3OJXA 3G4SB 2R6HA 1GAQA 1OB0A 2OBTA 4TMXA 3ASTA 1E3ZA 1V0FA 3Q6QA 3SKBA 3CC2B 4B48A 1GVHA 3ASRA 3ASSA 2FVGA 3I55B 5H59A 2C78A 2GJKA 4IW3B 4KKTA 2VNIA 1OGIA 1T6ZA 3ES9A 2V7XA 1QFJA 1IJFA 4II3A 1QGAA 4TMWA 4Z4SA 1Q82D 3BH4A 1UD8A 3ASPA 2BF4A 2YWHA 1ZM3A 3P26A 3ONUA 5LMZA 1N06A 4L8JA 5DN6A 2ZL7A 4MYUA 2VYQA 4B3FX 3A35A 4NCNA 1G7SA 1K9MD 5HZBA 2QTLA 4Z1MA 1NB0A 2C5BA 2PMDA 2F1LA 1TLLA 3LQEA 3PA2A 4XM3A 2B7BA 3KEWA 2ZTNA 4Z4TA 4ACBA 1VQ5B 3BY1A 1WSRA 3LO8A 5L46A 2XNDA 4JMQA 1P4MA 2OBSA 3CCJB 2CF4A 3OE7A 3H9NA 1E79A 1HA3A 3AVUA 2EIXA 1HVXA 1PJ6A 4RDLA 2V31A 2HDNB 3ISXA 1EP1B 2D74A 3AGPA 3GQBA 1KZLA 4YALA 2AHOA 1EFTA 1QGYA 3V76A 1VQLB 4OOVA 3W2HA 4XN3A 1V0EA 1KMHA 2ZBVA 1WOSA 5THXA 1F20A 2V4DA 2CW5A 1VQKB 1WPCA 1BLIA 1FRQA 3FPKA 3V7AA 5KW9A 5FO1A 3U6KA 1ELOA 4AC9A 3ZUGA 3QFRA 2X8KA 3Q39A 2XNJA
chains in the Genus database with same CATH topology
3H94A 2XZLA 1K28D 4XMYA 3CP2A 4YXWA 1I18A 2ZZQA 4II2A 1UD6A 1E43A 3OAAA 1W0KA 2XZPA 3HAGA 4XLCA 2JJ1A 2X6XA 5HKKA 1VJSA 4XOPA 1NBMA 4XLEA 2QE7A 1VLYA 4HIZA 1H8EA 2X6WA 3NE5B 2V7QA 4XKVA 1NRKA 3BC9A 3LNNA 3VR6A 1UD3A 4UZUA 3CP8A 1UD4A 2WJVA 3BCDA 1SKYB 4G7XA 4XONA 2F1MA 2D3LA 4B3GA 4XN0A 1BPLA 4XLFA 3A3BA 3GVJA 3GVLA 1OB0A 4XR6A 1E3ZA 1V0FA 1HZEA 4XNFA 3FKSA 2JIZA 4XL9A 4KKSA 2VJIA 4DK1A 4YELA 1WTHD 2E1BA 2ZXIA 2CK3A 1FX0A 2GJKA 4KKTA 4YEJA 4AVZA 4XKWA 2WJYA 2WPDA 5KNLA 3OFNA 1E1QA 4II3A 4TSFA 5IK2A 3GVKA 2JJ2A 3BH4A 1UD8A 3OPOA 4E0FA 2KVOA 1UD5A 2M5SA 4FXUA 1VF7A 2GJRA 2ZXHA 1MABA 3G05A 3DDYA 4DNRB 4L8JA 5DN6A 1EFRA 2D3NA 2WSSA 3A35A 3T56B 4B3FX 4XLHA 2W6JA 3OEHA 2GJPA 2ZTGA 2R9VA 4DK0A 1WP6A 1BMFA 4Z1MA 2JDIA 3T53B 4XQFA 3OOCA 4XM3A 4NNJA 1W9XA 2GK7A 2ZZGA 3KEWA 4XD7A 2ZTNA 1E3XA 2VJJA 3OW7A 2X85A 2XOKA 3JU4A 2GK6A 4G6IA 4ASUA 3FPPA 4DNTB 2XNDA 1H8HA 4GQNA 4JMQA 4XORA 3A3GA 3WQZA 3OE7A 2WZPP 1E79A 3OEEA 1HVXA 1PKVA 2Z6BD 2X53S 2F43A 2V31A 4G7WA 2ZZFA 2X6YA 1COWA 3GQBA 1KZLA 1T5EA 2W6IA 5CDFA 4XN3A 1V0EA 1W0JA 4TKOB 2LZJA 4XLAA 1KMHA 3T51B 4KKUA 3CMMA 5FL7A 2V4DA 1I8DA 2DIEA 4XOTA 1OHHA 2ZZEA 3BCFA 3ZIAA 3ZPNA 2XGJA 3CESA 4P22A 1WPCA 1BLIA 1UD2A 4TT3A 1E1RA 2X8KA 2XZOA 2HLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P22 A;  4NNJ A;  4II3 A;  2LZJ A;  3CMM A;  5KNL A;  4II2 A;  2V31 A; 
#chains in the Genus database with same CATH topology
 3VO2 A;  3H94 A;  4LBW A;  4ZV4 A;  2HCJ B;  3CD6 B;  4PC7 A;  1UD6 A;  2VNJ A;  5TR9 A;  5A89 A;  3OZW A;  1DAR A;  4FN5 A;  3VNV A;  2Q6I A;  1ZM2 A;  5HXB A;  5B6I A;  3CME B;  5TRD A;  2QE7 A;  3PA1 A;  1N08 A;  1WU8 A;  3J81 k;  5F4M A;  3BQJ A;  2VBT A;  3NE5 B;  4ZGN B;  1NRK A;  4TMT A;  4UZF A;  4WWV A;  1UD3 A;  2QTZ A;  4UZU A;  3P27 A;  1WDT A;  3CP8 A;  4RPD A;  2B5O A;  2FX3 A;  1UD4 A;  1V5V A;  4ZCM A;  3U2Q A;  1SKQ A;  4PC2 A;  2CC2 A;  2BM0 A;  3OP1 A;  3OZV A;  4XON A;  2D3L A;  1R5B A;  2VNH A;  1IB0 A;  4B3G A;  4M0L A;  1BPL A;  1YJW B;  3A3B A;  1CNE A;  1VHO A;  4P1V A;  4ROX A;  4X0C A;  2DY1 A;  3GSI A;  5EMN A;  4YAU A;  4XNF A;  4PC3 A;  4HE5 A;  3VO1 A;  2JIZ A;  1R5N A;  2QGG A;  1KK2 A;  2ZBU A;  3CTA A;  4FK8 A;  1ZUN B;  4XL9 A;  4TMZ A;  2VJI A;  3BY2 A;  5GV7 A;  1QVG B;  2B7C A;  4YEL A;  4PC6 A;  2E1B A;  2ZXI A;  4ZCI A;  2YWF A;  1JNY A;  5FNZ A;  4YAO A;  4OPS A;  4WZE A;  2BSA A;  3W2I A;  1AIP A;  3CXC B;  2WJY A;  2WPD A;  4X7F A;  1QUE A;  3CRZ A;  3OFN A;  4LC0 A;  4BPR A;  4M1K A;  3WNC A;  4LBZ A;  3QE2 A;  1MRZ A;  1UD5 A;  4HE6 A;  4DNR B;  5A8A A;  1KTV A;  1K73 D;  3QFC A;  4TMV A;  1S72 B;  3SLD A;  1EFR A;  5DS0 A;  4PC1 A;  2V7V A;  2WSS A;  4RPB A;  4XLH A;  5IYR A;  1TVC A;  2ZTG A;  1PJ5 A;  2R9V A;  1F60 A;  5J3O A;  1QG0 A;  1U2R A;  1KJZ A;  4YHB A;  2JDI A;  5F4J A;  1TUI A;  4N3N A;  3OOC A;  4NNJ A;  4WZL A;  4QV2 A;  1W9X A;  3Q3A A;  4UAJ A;  4WZT A;  2GK7 A;  2VBU A;  4P6Y A;  4XD7 A;  1QGZ A;  2VJJ A;  1AMO A;  2JN9 A;  2GK6 A;  4ASU A;  1Q9S A;  1B2R A;  3B78 A;  1JB9 A;  3QSY A;  4Z4R A;  1KK3 A;  2D9R A;  2WZP P;  5BSY A;  3MMP A;  1D2E A;  1PJ7 A;  3E1Y E;  2F43 A;  4G7W A;  2ZZF A;  3W5V A;  1COW A;  3AVV A;  5E6T A;  3FJO A;  2X3U A;  3I56 B;  1VQO B;  1T6X A;  1IJE A;  1EP3 B;  3Q6R A;  3CCL B;  2OK8 A;  2V7U A;  2EFG A;  1FNM A;  4C0S A;  1W0J A;  4TKO B;  2LZJ A;  4XLA A;  5DSZ A;  5TV2 A;  1GO2 A;  4X05 A;  5IYQ A;  4RCZ A;  4KKU A;  2ZIT A;  4G1V A;  4DNT B;  4RDJ A;  2DIE A;  1YLO A;  1OHH A;  4NBS A;  1NDH A;  3ZIA A;  1VQ9 B;  4P22 A;  1JJ2 B;  4PGO A;  3CCU B;  1FDR A;  3R6K A;  1N8R D;  1BX0 A;  2VNK A;  4TT3 A;  4X7D A;  1E1R A;  2XZO A;  1Q81 D;  4F7D A;  2PLF A;  4LBV A;  4OPO A;  3WBK A;  3WYA A;  1I18 A;  2GRE A;  1E64 A;  2XEX A;  4P25 A;  4II2 A;  4RD4 A;  2E1R A;  1FNB A;  1S4M A;  1W0K A;  2BGJ A;  2Q6L A;  3LVB A;  3SLN A;  4XLC A;  2JJ1 A;  5IYW A;  4YAW A;  1VLY A;  2J7K A;  4B43 A;  4X7C A;  3QFT A;  1QH0 A;  1EXM A;  2V7Q A;  3ONY A;  1S0U A;  3CC7 B;  3ZZ0 A;  3PVD A;  4QHY A;  1CNF A;  2WJV A;  4LBY A;  1W34 A;  2RC6 A;  1SKY B;  4FWT A;  1YJN B;  5AN9 A;  3JQR A;  1DDI A;  4ZGQ B;  2F1M A;  1N07 A;  2VZL A;  3WBJ A;  4RD3 A;  1ZM9 A;  2X0K A;  3CCE B;  1GR1 A;  2PE3 A;  2DER A;  2Q6K A;  2VBV A;  1I7P A;  4J0Q A;  1M90 D;  3BNW A;  4XR6 A;  2CBX A;  3QFS A;  2YWG A;  3GIR A;  2DET A;  1G7C A;  3FKS A;  3WXM A;  4ACA A;  1EFC A;  2V7W A;  4RJL A;  3ZBU A;  2OBR A;  1YIT B;  4Z4U A;  4DK1 A;  1VQ4 B;  1WTH D;  1QUF A;  2C77 A;  1R5O A;  3OJW A;  4P3Y A;  2YWE A;  4OPV A;  4YEJ A;  4AVZ A;  1QFY A;  4WZK A;  3CCM B;  4XKW A;  1VQM B;  1VQ8 B;  5KSW B;  1WSV A;  5KNL A;  4TSF A;  1E1Q A;  4Z4Y A;  3VMF A;  5IK2 A;  3OPO A;  3AVT A;  3CCS B;  3PUM A;  1E63 A;  2C2W A;  1OB5 A;  1VF7 A;  1YI2 B;  2QDX A;  3CMA B;  3W5U A;  2ZXH A;  1MAB A;  3W2G A;  3CPW B;  2HMA A;  4Y7C A;  1KQS B;  1VQ7 B;  4QVA A;  1VLO A;  1XB2 A;  3LQ6 A;  1XE1 A;  3T56 B;  2OTL B;  1KRH A;  3KL9 A;  3AVX A;  4G5G A;  1CQX A;  2GJP A;  4EH1 A;  1WOR A;  1Q86 D;  3WND A;  1BMF A;  3CCQ B;  3ZZU A;  2OK7 A;  1NJI D;  4QFM A;  4PAA A;  4XQF A;  3ZC3 A;  3E20 A;  1G7T A;  2VBS A;  5FA6 A;  3SEJ A;  1E3X A;  1QX4 A;  1XFO A;  4G6I A;  4R71 A;  4YAF A;  1H8H A;  1NB9 A;  4GQN A;  1FNC A;  4U9U A;  3A3G A;  2GQF A;  3WQZ A;  1YX2 A;  1YHQ B;  3OEE A;  1EP2 B;  4AF6 A;  1WOO A;  4H9G A;  1T5E A;  5CDF A;  1H42 A;  3SJP A;  1OGJ A;  1FND A;  4OOX A;  1IHM A;  4B4D A;  4RLZ A;  3T51 B;  4RCY A;  2ZL6 A;  2BPO A;  3W5H A;  5J35 A;  3WY9 A;  5JBQ A;  2QMU A;  1VQP B;  1I8D A;  2C4U A;  3BCF A;  4P6V F;  4B47 A;  1N0U A;  4Z4Z A;  1VHE A;  1BQE A;  3A8I A;  4RD6 A;  1UD2 A;  1N0V C;  4P12 A;  3I1F A;  5FIU A;  1K28 D;  2ZL5 A;  3OZU A;  3A1P A;  3CP2 A;  4Q7J B;  4YXW A;  3G6E B;  1D8T A;  2ZZQ A;  4TN1 A;  2GPJ A;  3W2F A;  1E43 A;  3OAA A;  4RDK A;  2XZP A;  1B23 P;  4OOS A;  2NV4 A;  4B3X A;  1W87 A;  2BN4 A;  5HKK A;  1VJS A;  4XOP A;  1NBM A;  2C5H A;  4XLE A;  4UZE A;  1KK0 A;  1BX1 A;  4WQM A;  2OTJ B;  1H8E A;  2BMW A;  5HZA A;  3VR6 A;  3PEN A;  3CCV B;  4Z4W A;  1RQP A;  3BCD A;  3ZBT A;  1QFZ A;  2V7T A;  3CB4 A;  1SM4 A;  3VNU A;  5GV8 A;  4Z4V A;  4M4S A;  3D26 A;  4P3I A;  4XN0 A;  4N3G A;  4XLF A;  1UMK A;  1BJK A;  3CW2 A;  3GVJ A;  1FRN A;  3GVL A;  3SJZ A;  1VQN B;  1HZE A;  2WR8 A;  1YJ9 B;  1W2B B;  4P9S A;  3JQQ A;  3U6B A;  4ZCL A;  1DDG A;  3CPX A;  3AVW A;  4KKS A;  1ZM4 A;  2DYI A;  4P2N A;  2CK3 A;  1FX0 A;  3AVY A;  3CCR B;  1DG1 G;  3CC4 B;  1WOP A;  4DQK A;  3MCA A;  4M53 A;  2BGI A;  1T6Y A;  2JJ2 A;  3GVK A;  4E0F A;  2BV3 A;  2C4T A;  4P26 A;  4B44 A;  2KVO A;  5F4O A;  3G71 B;  2M5S A;  4FXU A;  1Q7Y D;  1M1K D;  1J9Z A;  2GJR A;  3G05 A;  3DDY A;  2QA4 B;  3PUN A;  1OB2 A;  1JA0 A;  2BVN A;  2D3N A;  5A88 A;  2W6J A;  3OEH A;  2WYR A;  4DK0 A;  1WP6 A;  4CQJ A;  1KC8 D;  3A8J A;  3T53 B;  4K1X A;  1G7R A;  3OKX A;  5IYP A;  4DQL A;  2WZN A;  3OW2 B;  2ZZG A;  3OW7 A;  2X85 A;  2XOK A;  1KK1 A;  3JU4 A;  5BSX A;  4G1B A;  3FPP A;  4XOR A;  1QVF B;  5H5J A;  5TY0 A;  1E62 A;  4RD0 A;  2DEU A;  1PKV A;  2Z6B D;  2XNC A;  2X53 S;  1W35 A;  2X6Y A;  3B82 A;  2QEX B;  1JA1 A;  2CRV A;  1N05 A;  3Q38 A;  2W6I A;  4X7E A;  2OYN A;  2Q6O A;  1EWY A;  4AF7 A;  4RM0 A;  4X8I A;  3CMM A;  4M2L A;  2P3M A;  4XOT A;  5FL7 A;  5FO0 A;  2ZZE A;  3ZPN A;  3MHP A;  3ZZT A;  3WNB A;  2XGJ A;  3CES A;  1K8A D;  2NPF A;  1Y0R A;  3R6J A;  3W2E A;  4RD1 A;  1EFU A;  2DOG A;  2HLD A;  4OP7 A;  2XZL A;  5IYN A;  2RC5 A;  2I1L A;  3RY8 A;  2CND A;  4X06 A;  4XMY A;  1GAW A;  4QVJ A;  1TTT A;  3AGQ A;  1A8P A;  1VQ6 B;  3HAG A;  1XQB A;  2X6X A;  2BM1 A;  4Y9U A;  3B8H A;  2PIA A;  2DCU A;  4HIZ A;  4QUZ A;  1GJR A;  4PAB A;  2X6W A;  1RQR A;  3ASQ A;  1Y0Y A;  4XKV A;  3BC9 A;  4C43 A;  3LNN A;  4X07 A;  1KD1 D;  4Y9R A;  2QN6 A;  3JQP A;  1D1N A;  2F4N A;  3A8K A;  4G7X A;  1YIJ B;  4MYT A;  4RD2 A;  1H85 A;  3OJX A;  3G4S B;  2R6H A;  1GAQ A;  1OB0 A;  2OBT A;  4TMX A;  3AST A;  1E3Z A;  1V0F A;  3Q6Q A;  3SKB A;  3CC2 B;  4B48 A;  1GVH A;  3ASR A;  3ASS A;  2FVG A;  3I55 B;  5H59 A;  2C78 A;  2GJK A;  4IW3 B;  4KKT A;  2VNI A;  1OGI A;  1T6Z A;  3ES9 A;  2V7X A;  1QFJ A;  1IJF A;  4II3 A;  1QGA A;  4TMW A;  4Z4S A;  1Q82 D;  3BH4 A;  1UD8 A;  3ASP A;  2BF4 A;  2YWH A;  1ZM3 A;  3P26 A;  3ONU A;  5LMZ A;  1N06 A;  4L8J A;  5DN6 A;  2ZL7 A;  4MYU A;  2VYQ A;  4B3F X;  3A35 A;  4NCN A;  1G7S A;  1K9M D;  5HZB A;  2QTL A;  4Z1M A;  1NB0 A;  2C5B A;  2PMD A;  2F1L A;  1TLL A;  3LQE A;  3PA2 A;  4XM3 A;  2B7B A;  3KEW A;  2ZTN A;  4Z4T A;  4ACB A;  1VQ5 B;  3BY1 A;  1WSR A;  3LO8 A;  5L46 A;  2XND A;  4JMQ A;  1P4M A;  2OBS A;  3CCJ B;  2CF4 A;  3OE7 A;  3H9N A;  1E79 A;  1HA3 A;  3AVU A;  2EIX A;  1HVX A;  1PJ6 A;  4RDL A;  2V31 A;  2HDN B;  3ISX A;  1EP1 B;  2D74 A;  3AGP A;  3GQB A;  1KZL A;  4YAL A;  2AHO A;  1EFT A;  1QGY A;  3V76 A;  1VQL B;  4OOV A;  3W2H A;  4XN3 A;  1V0E A;  1KMH A;  2ZBV A;  1WOS A;  5THX A;  1F20 A;  2V4D A;  2CW5 A;  1VQK B;  1WPC A;  1BLI A;  1FRQ A;  3FPK A;  3V7A A;  5KW9 A;  5FO1 A;  3U6K A;  1ELO A;  4AC9 A;  3ZUG A;  3QFR A;  2X8K A;  3Q39 A;  2XNJ A; 
#chains in the Genus database with same CATH homology
 3H94 A;  2XZL A;  1K28 D;  4XMY A;  3CP2 A;  4YXW A;  1I18 A;  2ZZQ A;  4II2 A;  1UD6 A;  1E43 A;  3OAA A;  1W0K A;  2XZP A;  3HAG A;  4XLC A;  2JJ1 A;  2X6X A;  5HKK A;  1VJS A;  4XOP A;  1NBM A;  4XLE A;  2QE7 A;  1VLY A;  4HIZ A;  1H8E A;  2X6W A;  3NE5 B;  2V7Q A;  4XKV A;  1NRK A;  3BC9 A;  3LNN A;  3VR6 A;  1UD3 A;  4UZU A;  3CP8 A;  1UD4 A;  2WJV A;  3BCD A;  1SKY B;  4G7X A;  4XON A;  2F1M A;  2D3L A;  4B3G A;  4XN0 A;  1BPL A;  4XLF A;  3A3B A;  3GVJ A;  3GVL A;  1OB0 A;  4XR6 A;  1E3Z A;  1V0F A;  1HZE A;  4XNF A;  3FKS A;  2JIZ A;  4XL9 A;  4KKS A;  2VJI A;  4DK1 A;  4YEL A;  1WTH D;  2E1B A;  2ZXI A;  2CK3 A;  1FX0 A;  2GJK A;  4KKT A;  4YEJ A;  4AVZ A;  4XKW A;  2WJY A;  2WPD A;  5KNL A;  3OFN A;  1E1Q A;  4II3 A;  4TSF A;  5IK2 A;  3GVK A;  2JJ2 A;  3BH4 A;  1UD8 A;  3OPO A;  4E0F A;  2KVO A;  1UD5 A;  2M5S A;  4FXU A;  1VF7 A;  2GJR A;  2ZXH A;  1MAB A;  3G05 A;  3DDY A;  4DNR B;  4L8J A;  5DN6 A;  1EFR A;  2D3N A;  2WSS A;  3A35 A;  3T56 B;  4B3F X;  4XLH A;  2W6J A;  3OEH A;  2GJP A;  2ZTG A;  2R9V A;  4DK0 A;  1WP6 A;  1BMF A;  4Z1M A;  2JDI A;  3T53 B;  4XQF A;  3OOC A;  4XM3 A;  4NNJ A;  1W9X A;  2GK7 A;  2ZZG A;  3KEW A;  4XD7 A;  2ZTN A;  1E3X A;  2VJJ A;  3OW7 A;  2X85 A;  2XOK A;  3JU4 A;  2GK6 A;  4G6I A;  4ASU A;  3FPP A;  4DNT B;  2XND A;  1H8H A;  4GQN A;  4JMQ A;  4XOR A;  3A3G A;  3WQZ A;  3OE7 A;  2WZP P;  1E79 A;  3OEE A;  1HVX A;  1PKV A;  2Z6B D;  2X53 S;  2F43 A;  2V31 A;  4G7W A;  2ZZF A;  2X6Y A;  1COW A;  3GQB A;  1KZL A;  1T5E A;  2W6I A;  5CDF A;  4XN3 A;  1V0E A;  1W0J A;  4TKO B;  2LZJ A;  4XLA A;  1KMH A;  3T51 B;  4KKU A;  3CMM A;  5FL7 A;  2V4D A;  1I8D A;  2DIE A;  4XOT A;  1OHH A;  2ZZE A;  3BCF A;  3ZIA A;  3ZPN A;  2XGJ A;  3CES A;  4P22 A;  1WPC A;  1BLI A;  1UD2 A;  4TT3 A;  1E1R A;  2X8K A;  2XZO A;  2HLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...