2LZJA

Refined solution structure and dynamics of first catalytic cysteine half-domain from mouse e1 enzyme
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
112
Chain Sequence
EFGEEMVLTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARHGFETGDFVSFSEVQGMIQLNGCQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLPASLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Ubiquitin-like modifier-activating enzyme 1
publication title NMR structural studies of the first catalytic half-domain of ubiquitin activating enzyme.
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 112
sequence length 112
ec nomenclature ec 6.2.1.45: E1 ubiquitin-activating enzyme.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16190 E1_FCCH Ubiquitin-activating enzyme E1 FCCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.180 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2lzjA00
2LZJA 4P22A 4NNJA 4II2A 5KNLA 2V31A 3CMMA 4II3A
chains in the Genus database with same CATH superfamily
4X05A 3CD6B 4RPBA 1KK3A 5IK2A 3V76A 1G7SA 3ZC3A 2WSSA 2QEXB 2Z6BD 2C78A 1E43A 3AVXA 1F20A 2VYQA 4RD0A 2PE3A 2CRVA 4CQJA 4DNRB 4WWVA 3I56B 3VO1A 2CC2A 3ZBUA 4ZGQB 4X7FA 4RDLA 2VBUA 3LNNA 1D8TA 4RD4A 1FX0A 3SLNA 4Z4WA 1KTVA 3A1PA 3OW2B 4AF7A 2VZLA 3LQ6A 3VMFA 1OB0A 2E1RA 2JJ2A 3GQBA 2D3LA 1Y0RA 2PIAA 2QN6A 2XZOA 3G6EB 1S72B 4M53A 3CCSB 1KMHA 2BF4A 4G7WA 4TMXA 4TMVA 3U6BA 3WYAA 2OTJB 2OK8A 5DN6A 2HLDA 1IJEA 2Q6LA 4G5GA 3JQQA 3AVVA 2V31A 1N05A 2X85A 1ZM3A 3CPXA 1VQMB 4DQLA 4UZFA 2VNKA 1D2EA 2X8KA 4XORA 4G6IA 4ZGNB 3I1FA 4QV2A 1U2RA 5J3OA 2CK3A 4YAOA 4OP7A 1VQ6B 2GREA 4DQKA 2GQFA 2V7QA 1ZM2A 1N06A 1W9XA 1EFUA 2BMWA 1YJ9B 1KC8D 1QGYA 3CW2A 4F7DA 1E64A 1OGIA 3CCLB 1WTHD 2ZBVA 4YAWA 2CNDA 5AN9A 4TN1A 4B44A 4HE5A 2XGJA 3ZZ0A 1B2RA 3GSIA 1MRZA 5FL7A 3W5UA 4P12A 3SEJA 2W6IA 2BN4A 4B43A 4OPOA 1T5EA 1VQ4B 1WPCA 1BQEA 4RCZA 2ZITA 3H94A 1K9MD 1QUEA 3BH4A 5H5JA 2GJRA 3CMAB 2Q6KA 2XOKA 1G7RA 2OYNA 3CCRB 1BPLA 2OBTA 2X53S 4UZUA 2DEUA 3OJXA 1SM4A 1F60A 5HXBA 1EP3B 3T56B 1P4MA 4AF6A 1KZLA 3CCMB 4Z4TA 3W2FA 2LZJA 5TV2A 5B6IA 3OZUA 2QE7A 3AVWA 2DCUA 4TMZA 4L8JA 4BPRA 4G1VA 3AVUA 2X3UA 3CB4A 3LVBA 5DS0A 1Q7YD 3R6JA 3B78A 5IYRA 4B3FX 4KKSA 2GK7A 4RDJA 1UD2A 4B3XA 1BMFA 2R9VA 4Z4UA 1E3ZA 2GJKA 3ISXA 2XEXA 2QA4B 1KK1A 1EWYA 2WYRA 1W0KA 2VNIA 4LBVA 1G7TA 5KSWB 2QGGA 4R71A 4QVAA 1OB2A 1H8HA 1WORA 1E79A 3OPOA 1QGZA 4RD2A 1VQ8B 4Z4SA 4M1KA 3PA2A 3OE7A 1TLLA 5TY0A 3WNBA 2VNHA 2J7KA 4ZCIA 2EIXA 1D1NA 1GAWA 4TSFA 1VQKB 4PC2A 2CF4A 4YEJA 1VQ9B 4Z4VA 2DYIA 5IYPA 1W35A 2ZL6A 1CQXA 2E1BA 1BX1A 4IW3B 1W0JA 2QTLA 5F4MA 1AIPA 3KL9A 2OK7A 4X8IA 2NV4A 4P22A 1XQBA 4C0SA 1W34A 3ASRA 1I8DA 4B47A 4B48A 4MYTA 2OBRA 4DNTB 4Z4ZA 1FDRA 1JJ2B 3QFSA 2W6JA 3OAAA 4XOTA 2D74A 4P6YA 1QFYA 2AHOA 1DARA 4LBYA 3JQRA 3U2QA 4FN5A 1QH0A 4TMTA 3OKXA 4YELA 3BCFA 4RPDA 4RLZA 4P3IA 1ZM4A 2C5HA 4FK8A 1YIJB 1E1QA 1KRHA 2D9RA 2WJYA 3OOCA 2D3NA 1CNEA 2RC6A 2XNCA 4LBWA 4UZEA 4XLFA 3WY9A 3D26A 1EFRA 1I7PA 5HZAA 2OBSA 1KK2A 5H59A 4OOSA 1WU8A 1M1KD 1WOOA 1WDTA 3OJWA 3W5HA 1OGJA 3CPWB 1VJSA 3CCEB 3PENA 2BGIA 4P3YA 1JNYA 2HMAA 1W87A 1K28D 1Y0YA 1VQLB 2V7WA 1OB5A 5J35A 1E3XA 3OEHA 4HIZA 1EFCA 1H8EA 1VLYA 4H9GA 1WSVA 4ROXA 4UAJA 2ZL7A 2VJJA 1SKQA 3W5VA 4RD3A 2NPFA 1QUFA 1PJ6A 1YJWB 3VNUA 2ZZQA 5EMNA 3VNVA 1EP2B 4PABA 5FA6A 1VQNB 2C5BA 4G7XA 5KW9A 1MABA 1N07A 2WZNA 3AGPA 4NBSA 3CCUB 3OEEA 1ZUNB 4AVZA 1N8RD 2R6HA 2VJIA 4ACAA 2YWFA 1T6ZA 4PC6A 3HAGA 4B4DA 1QVGB 3VR6A 4Z4YA 1K8AD 1GR1A 1HVXA 5F4OA 2BV3A 1H85A 2VBTA 4Z1MA 4P26A 2F1LA 2ZXIA 3NE5B 1S4MA 1WOPA 2C4TA 2PLFA 2QMUA 2DERA 4LC0A 2ZZGA 4QVJA 3SKBA 1VQ7B 1PJ5A 1VLOA 1DDGA 4XQFA 3Q39A 5IYQA 1IHMA 3MMPA 1E62A 3A8JA 4N3GA 4RJLA 4X7DA 5THXA 3U6KA 1W2BB 3PUMA 2VNJA 3ONYA 3SLDA 1XB2A 1PKVA 4OPSA 2BSAA 2ZBUA 4ZV4A 4YXWA 1FNMA 2JJ1A 4WZLA 1T6YA 1R5OA 3DDYA 3ZPNA 3OZWA 1FRQA 2BM1A 1WOSA 3W2IA 3A3GA 4MYUA 4RDKA 2ZZEA 3G71B 1M90D 4P6VF 5CDFA 5BSYA 2DIEA 3MCAA 4RD1A 1PJ7A 5FNZA 4XN0A 1EP1B 3PVDA 1H42A 2M5SA 3BY2A 3ZUGA 3OZVA 1Q82D 4OPVA 2B7CA 1V5VA 4PC7A 4PGOA 3QFCA 1UD3A 1UD6A 3R6KA 2BM0A 4XN3A 2DETA 3CP8A 1V0EA 5F4JA 3CESA 5LMZA 4JMQA 1YX2A 2FVGA 2XNDA 3ONUA 1QVFB 5GV7A 4X0CA 1JA0A 1S0UA 2WPDA 4YALA 4ASUA 4HE6A 1VHOA 1HZEA 3T53B 1COWA 1J9ZA 3P26A 4ZCLA 4KKTA 2BPOA 1B23P 3B8HA 3A35A 5A8AA 4WZEA 4XONA 4RCYA 4KKUA 1Q9SA 3LO8A 2JIZA 2EFGA 1NB0A 3CTAA 4PAAA 4XMYA 3WNDA 2F1MA 5JBQA 3I55B 4C43A 3Q6QA 1YJNB 3JQPA 3JU4A 3OFNA 3WBJA 4XR6A 1Q81D 1EXMA 5GV8A 4P9SA 5BSXA 3G05A 1UD5A 1AMOA 2OTLB 3OP1A 1YI2B 4II3A 2QTZA 3P27A 4E0FA 2HCJB 1N08A 3QE2A 4EH1A 3ES9A 4QFMA 3CRZA 2GPJA 2XNJA 3WXMA 4Z4RA 3Q3AA 4ZCMA 2JDIA 4FWTA 4OOXA 2I1LA 3T51B 3WNCA 2WR8A 2F4NA 1GO2A 2ZXHA 1NBMA 1FRNA 4X7CA 3CC2B 2JN9A 1ZM9A 4AC9A 4K1XA 4XLHA 2X6XA 3BNWA 4XOPA 1I18A 1DDIA 1FNBA 3E20A 4XLCA 4X06A 2X0KA 4QHYA 5A88A 1IJFA 3WBKA 3V7AA 4N3NA 1NDHA 1BX0A 4RD6A 2CW5A 1E63A 3AVYA 2P3MA 4TT3A 1KD1D 2QDXA 3QFRA 2GK6A 4P2NA 5TR9A 3ZZTA 3A8KA 5TRDA 1RQPA 1E1RA 3CCVB 1Q86D 1XE1A 4XLEA 1VQOB 3ZIAA 1QGAA 1UMKA 2V7VA 1ELOA 3BCDA 1XFOA 2XZLA 1HA3A 4P1VA 1YHQB 1SKYB 1BLIA 3ASSA 3ASQA 2WJVA 3QSYA 1UD4A 1IB0A 3SJZA 1VQPB 1QFJA 1V0FA 2V4DA 5DSZA 3Q6RA 4FXUA 2X6WA 4M4SA 5FIUA 3AVTA 3PUNA 3CXCB 2XZPA 4G1BA 2C77A 4DK0A 3CCQB 2RC5A 1WSRA 4Y9UA 4WZTA 4X7EA 4XLAA 2FX3A 3BY1A 4P25A 4WQMA 1NRKA 4Q7JB 3H9NA 4XNFA 3E1YE 2BGJA 5IYWA 2Q6IA 1KJZA 4PC3A 3CC7B 5HKKA 5HZBA 1VF7A 2B5OA 2C2WA 2X6YA 3KEWA 4YHBA 2YWGA 1UD8A 3FPPA 1VQ5B 3CMMA 4OOVA 3G4SB 1G7CA 3ASPA 3GVLA 4XM3A 1K73D 3FJOA 1RQRA 1N0VC 2WZPP 1WP6A 3ASTA 4M0LA 3LQEA 2C4UA 1GJRA 3W2GA 4B3GA 3QFTA 3ZBTA 2B7BA 4TKOB 4TMWA 1EFTA 4X07A 1YITB 2YWEA 3CCJB 1JB9A 1R5BA 3W2HA 4II2A 4ACBA 5KNLA 4LBZA 4YAFA 4Y9RA 1TVCA 3OW7A 4QUZA 2VBVA 2V7TA 4PC1A 4U9UA 4GQNA 3VO2A 3FKSA 3J81k 5FO1A 3W2EA 4J0QA 1GVHA 1NB9A 1FNDA 3GIRA 3BC9A 3GVKA 4XKVA 4XL9A 3A3BA 1TTTA 2DOGA 3GVJA 1N0UA 1NJID 3SJPA 1YLOA 1CNFA 4XKWA 2ZL5A 4RM0A 1FNCA 1GAQA 3CP2A 4XD7A 2CBXA 2DY1A 5L46A 1TUIA 2YWHA 3CMEB 3PA1A 1OHHA 2V7XA 3WQZA 4YAUA 3BQJA 1KK0A 2HDNB 2ZTNA 1QG0A 3A8IA 3RY8A 1QFZA 4DK1A 1JA1A 5E6TA 3ZZUA 3AGQA 2BVNA 2PMDA 4WZKA 1QX4A 3FPKA 2KVOA 3CC4B 2ZZFA 4NNJA 1VHEA 5A89A 2V7UA 2VBSA 5FO0A 4NCNA 2F43A 2Q6OA 5IYNA 1A8PA 3Q38A 4M2LA 1KQSB 3B82A 1R5NA 1T6XA 1BJKA 1DG1G 4Y7CA 3MHPA 2ZTGA 2GJPA
chains in the Genus database with same CATH topology
4XLEA 1W0KA 3ZIAA 5IK2A 2XZLA 3BCDA 1PKVA 1H8HA 2WSSA 2Z6BD 4YXWA 1E79A 2JJ1A 1SKYB 1E43A 3OPOA 1BLIA 3DDYA 3OE7A 2WJVA 3ZPNA 1UD4A 4DNRB 1V0FA 2V4DA 4TSFA 4YEJA 3A3GA 2ZZEA 3LNNA 4FXUA 2X6WA 5CDFA 2DIEA 1FX0A 2XZPA 4DK0A 2E1BA 4XN0A 1W0JA 4XLAA 2M5SA 1OB0A 2JJ2A 3GQBA 2D3LA 1NRKA 4P22A 2XZOA 4XNFA 1UD3A 1I8DA 1KMHA 1UD6A 4G7WA 4XN3A 3CP8A 4DNTB 5DN6A 1V0EA 2HLDA 3CESA 5HKKA 1VF7A 2W6JA 3OAAA 4XOTA 2X6YA 3KEWA 4JMQA 1UD8A 2XNDA 3FPPA 2V31A 2WPDA 4ASUA 2X85A 3CMMA 3GVLA 4XM3A 1HZEA 4YELA 3BCFA 1WP6A 2WZPP 2X8KA 4XORA 3T53B 1COWA 4G6IA 4B3GA 4KKTA 1E1QA 3OOCA 2WJYA 4TKOB 2D3NA 4XLFA 2CK3A 3A35A 1EFRA 4XONA 4II2A 2V7QA 5KNLA 4KKUA 1W9XA 2JIZA 1VJSA 1WTHD 3OW7A 4XMYA 2F1MA 1K28D 2XGJA 4GQNA 3FKSA 5FL7A 1E3XA 3OEHA 2W6IA 4HIZA 3BC9A 3GVKA 1H8EA 4XKVA 1VLYA 3JU4A 1T5EA 3OFNA 3A3BA 4XL9A 1WPCA 4XR6A 3GVJA 3H94A 3G05A 1UD5A 3BH4A 2GJRA 2VJJA 2XOKA 4II3A 4E0FA 1BPLA 2X53S 2ZZQA 4XD7A 4XKWA 3CP2A 2JDIA 4UZUA 4G7XA 1MABA 1OHHA 3T51B 2ZXHA 3WQZA 1NBMA 3T56B 3OEEA 2ZTNA 4AVZA 1KZLA 4DK1A 4XLHA 2VJIA 2LZJA 2X6XA 2QE7A 3HAGA 4XOPA 4L8JA 3VR6A 1I18A 1HVXA 4XLCA 2KVOA 2ZZFA 4Z1MA 4NNJA 2ZXIA 3NE5B 4B3FX 2F43A 4KKSA 2GK7A 1UD2A 4TT3A 1BMFA 2R9VA 2ZZGA 1E3ZA 4XQFA 2GK6A 2GJKA 1E1RA 2ZTGA 2GJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LZJ A;  4P22 A;  4NNJ A;  4II2 A;  5KNL A;  2V31 A;  3CMM A;  4II3 A; 
#chains in the Genus database with same CATH topology
 4X05 A;  3CD6 B;  4RPB A;  1KK3 A;  5IK2 A;  3V76 A;  1G7S A;  3ZC3 A;  2WSS A;  2QEX B;  2Z6B D;  2C78 A;  1E43 A;  3AVX A;  1F20 A;  2VYQ A;  4RD0 A;  2PE3 A;  2CRV A;  4CQJ A;  4DNR B;  4WWV A;  3I56 B;  3VO1 A;  2CC2 A;  3ZBU A;  4ZGQ B;  4X7F A;  4RDL A;  2VBU A;  3LNN A;  1D8T A;  4RD4 A;  1FX0 A;  3SLN A;  4Z4W A;  1KTV A;  3A1P A;  3OW2 B;  4AF7 A;  2VZL A;  3LQ6 A;  3VMF A;  1OB0 A;  2E1R A;  2JJ2 A;  3GQB A;  2D3L A;  1Y0R A;  2PIA A;  2QN6 A;  2XZO A;  3G6E B;  1S72 B;  4M53 A;  3CCS B;  1KMH A;  2BF4 A;  4G7W A;  4TMX A;  4TMV A;  3U6B A;  3WYA A;  2OTJ B;  2OK8 A;  5DN6 A;  2HLD A;  1IJE A;  2Q6L A;  4G5G A;  3JQQ A;  3AVV A;  2V31 A;  1N05 A;  2X85 A;  1ZM3 A;  3CPX A;  1VQM B;  4DQL A;  4UZF A;  2VNK A;  1D2E A;  2X8K A;  4XOR A;  4G6I A;  4ZGN B;  3I1F A;  4QV2 A;  1U2R A;  5J3O A;  2CK3 A;  4YAO A;  4OP7 A;  1VQ6 B;  2GRE A;  4DQK A;  2GQF A;  2V7Q A;  1ZM2 A;  1N06 A;  1W9X A;  1EFU A;  2BMW A;  1YJ9 B;  1KC8 D;  1QGY A;  3CW2 A;  4F7D A;  1E64 A;  1OGI A;  3CCL B;  1WTH D;  2ZBV A;  4YAW A;  2CND A;  5AN9 A;  4TN1 A;  4B44 A;  4HE5 A;  2XGJ A;  3ZZ0 A;  1B2R A;  3GSI A;  1MRZ A;  5FL7 A;  3W5U A;  4P12 A;  3SEJ A;  2W6I A;  2BN4 A;  4B43 A;  4OPO A;  1T5E A;  1VQ4 B;  1WPC A;  1BQE A;  4RCZ A;  2ZIT A;  3H94 A;  1K9M D;  1QUE A;  3BH4 A;  5H5J A;  2GJR A;  3CMA B;  2Q6K A;  2XOK A;  1G7R A;  2OYN A;  3CCR B;  1BPL A;  2OBT A;  2X53 S;  4UZU A;  2DEU A;  3OJX A;  1SM4 A;  1F60 A;  5HXB A;  1EP3 B;  3T56 B;  1P4M A;  4AF6 A;  1KZL A;  3CCM B;  4Z4T A;  3W2F A;  2LZJ A;  5TV2 A;  5B6I A;  3OZU A;  2QE7 A;  3AVW A;  2DCU A;  4TMZ A;  4L8J A;  4BPR A;  4G1V A;  3AVU A;  2X3U A;  3CB4 A;  3LVB A;  5DS0 A;  1Q7Y D;  3R6J A;  3B78 A;  5IYR A;  4B3F X;  4KKS A;  2GK7 A;  4RDJ A;  1UD2 A;  4B3X A;  1BMF A;  2R9V A;  4Z4U A;  1E3Z A;  2GJK A;  3ISX A;  2XEX A;  2QA4 B;  1KK1 A;  1EWY A;  2WYR A;  1W0K A;  2VNI A;  4LBV A;  1G7T A;  5KSW B;  2QGG A;  4R71 A;  4QVA A;  1OB2 A;  1H8H A;  1WOR A;  1E79 A;  3OPO A;  1QGZ A;  4RD2 A;  1VQ8 B;  4Z4S A;  4M1K A;  3PA2 A;  3OE7 A;  1TLL A;  5TY0 A;  3WNB A;  2VNH A;  2J7K A;  4ZCI A;  2EIX A;  1D1N A;  1GAW A;  4TSF A;  1VQK B;  4PC2 A;  2CF4 A;  4YEJ A;  1VQ9 B;  4Z4V A;  2DYI A;  5IYP A;  1W35 A;  2ZL6 A;  1CQX A;  2E1B A;  1BX1 A;  4IW3 B;  1W0J A;  2QTL A;  5F4M A;  1AIP A;  3KL9 A;  2OK7 A;  4X8I A;  2NV4 A;  4P22 A;  1XQB A;  4C0S A;  1W34 A;  3ASR A;  1I8D A;  4B47 A;  4B48 A;  4MYT A;  2OBR A;  4DNT B;  4Z4Z A;  1FDR A;  1JJ2 B;  3QFS A;  2W6J A;  3OAA A;  4XOT A;  2D74 A;  4P6Y A;  1QFY A;  2AHO A;  1DAR A;  4LBY A;  3JQR A;  3U2Q A;  4FN5 A;  1QH0 A;  4TMT A;  3OKX A;  4YEL A;  3BCF A;  4RPD A;  4RLZ A;  4P3I A;  1ZM4 A;  2C5H A;  4FK8 A;  1YIJ B;  1E1Q A;  1KRH A;  2D9R A;  2WJY A;  3OOC A;  2D3N A;  1CNE A;  2RC6 A;  2XNC A;  4LBW A;  4UZE A;  4XLF A;  3WY9 A;  3D26 A;  1EFR A;  1I7P A;  5HZA A;  2OBS A;  1KK2 A;  5H59 A;  4OOS A;  1WU8 A;  1M1K D;  1WOO A;  1WDT A;  3OJW A;  3W5H A;  1OGJ A;  3CPW B;  1VJS A;  3CCE B;  3PEN A;  2BGI A;  4P3Y A;  1JNY A;  2HMA A;  1W87 A;  1K28 D;  1Y0Y A;  1VQL B;  2V7W A;  1OB5 A;  5J35 A;  1E3X A;  3OEH A;  4HIZ A;  1EFC A;  1H8E A;  1VLY A;  4H9G A;  1WSV A;  4ROX A;  4UAJ A;  2ZL7 A;  2VJJ A;  1SKQ A;  3W5V A;  4RD3 A;  2NPF A;  1QUF A;  1PJ6 A;  1YJW B;  3VNU A;  2ZZQ A;  5EMN A;  3VNV A;  1EP2 B;  4PAB A;  5FA6 A;  1VQN B;  2C5B A;  4G7X A;  5KW9 A;  1MAB A;  1N07 A;  2WZN A;  3AGP A;  4NBS A;  3CCU B;  3OEE A;  1ZUN B;  4AVZ A;  1N8R D;  2R6H A;  2VJI A;  4ACA A;  2YWF A;  1T6Z A;  4PC6 A;  3HAG A;  4B4D A;  1QVG B;  3VR6 A;  4Z4Y A;  1K8A D;  1GR1 A;  1HVX A;  5F4O A;  2BV3 A;  1H85 A;  2VBT A;  4Z1M A;  4P26 A;  2F1L A;  2ZXI A;  3NE5 B;  1S4M A;  1WOP A;  2C4T A;  2PLF A;  2QMU A;  2DER A;  4LC0 A;  2ZZG A;  4QVJ A;  3SKB A;  1VQ7 B;  1PJ5 A;  1VLO A;  1DDG A;  4XQF A;  3Q39 A;  5IYQ A;  1IHM A;  3MMP A;  1E62 A;  3A8J A;  4N3G A;  4RJL A;  4X7D A;  5THX A;  3U6K A;  1W2B B;  3PUM A;  2VNJ A;  3ONY A;  3SLD A;  1XB2 A;  1PKV A;  4OPS A;  2BSA A;  2ZBU A;  4ZV4 A;  4YXW A;  1FNM A;  2JJ1 A;  4WZL A;  1T6Y A;  1R5O A;  3DDY A;  3ZPN A;  3OZW A;  1FRQ A;  2BM1 A;  1WOS A;  3W2I A;  3A3G A;  4MYU A;  4RDK A;  2ZZE A;  3G71 B;  1M90 D;  4P6V F;  5CDF A;  5BSY A;  2DIE A;  3MCA A;  4RD1 A;  1PJ7 A;  5FNZ A;  4XN0 A;  1EP1 B;  3PVD A;  1H42 A;  2M5S A;  3BY2 A;  3ZUG A;  3OZV A;  1Q82 D;  4OPV A;  2B7C A;  1V5V A;  4PC7 A;  4PGO A;  3QFC A;  1UD3 A;  1UD6 A;  3R6K A;  2BM0 A;  4XN3 A;  2DET A;  3CP8 A;  1V0E A;  5F4J A;  3CES A;  5LMZ A;  4JMQ A;  1YX2 A;  2FVG A;  2XND A;  3ONU A;  1QVF B;  5GV7 A;  4X0C A;  1JA0 A;  1S0U A;  2WPD A;  4YAL A;  4ASU A;  4HE6 A;  1VHO A;  1HZE A;  3T53 B;  1COW A;  1J9Z A;  3P26 A;  4ZCL A;  4KKT A;  2BPO A;  1B23 P;  3B8H A;  3A35 A;  5A8A A;  4WZE A;  4XON A;  4RCY A;  4KKU A;  1Q9S A;  3LO8 A;  2JIZ A;  2EFG A;  1NB0 A;  3CTA A;  4PAA A;  4XMY A;  3WND A;  2F1M A;  5JBQ A;  3I55 B;  4C43 A;  3Q6Q A;  1YJN B;  3JQP A;  3JU4 A;  3OFN A;  3WBJ A;  4XR6 A;  1Q81 D;  1EXM A;  5GV8 A;  4P9S A;  5BSX A;  3G05 A;  1UD5 A;  1AMO A;  2OTL B;  3OP1 A;  1YI2 B;  4II3 A;  2QTZ A;  3P27 A;  4E0F A;  2HCJ B;  1N08 A;  3QE2 A;  4EH1 A;  3ES9 A;  4QFM A;  3CRZ A;  2GPJ A;  2XNJ A;  3WXM A;  4Z4R A;  3Q3A A;  4ZCM A;  2JDI A;  4FWT A;  4OOX A;  2I1L A;  3T51 B;  3WNC A;  2WR8 A;  2F4N A;  1GO2 A;  2ZXH A;  1NBM A;  1FRN A;  4X7C A;  3CC2 B;  2JN9 A;  1ZM9 A;  4AC9 A;  4K1X A;  4XLH A;  2X6X A;  3BNW A;  4XOP A;  1I18 A;  1DDI A;  1FNB A;  3E20 A;  4XLC A;  4X06 A;  2X0K A;  4QHY A;  5A88 A;  1IJF A;  3WBK A;  3V7A A;  4N3N A;  1NDH A;  1BX0 A;  4RD6 A;  2CW5 A;  1E63 A;  3AVY A;  2P3M A;  4TT3 A;  1KD1 D;  2QDX A;  3QFR A;  2GK6 A;  4P2N A;  5TR9 A;  3ZZT A;  3A8K A;  5TRD A;  1RQP A;  1E1R A;  3CCV B;  1Q86 D;  1XE1 A;  4XLE A;  1VQO B;  3ZIA A;  1QGA A;  1UMK A;  2V7V A;  1ELO A;  3BCD A;  1XFO A;  2XZL A;  1HA3 A;  4P1V A;  1YHQ B;  1SKY B;  1BLI A;  3ASS A;  3ASQ A;  2WJV A;  3QSY A;  1UD4 A;  1IB0 A;  3SJZ A;  1VQP B;  1QFJ A;  1V0F A;  2V4D A;  5DSZ A;  3Q6R A;  4FXU A;  2X6W A;  4M4S A;  5FIU A;  3AVT A;  3PUN A;  3CXC B;  2XZP A;  4G1B A;  2C77 A;  4DK0 A;  3CCQ B;  2RC5 A;  1WSR A;  4Y9U A;  4WZT A;  4X7E A;  4XLA A;  2FX3 A;  3BY1 A;  4P25 A;  4WQM A;  1NRK A;  4Q7J B;  3H9N A;  4XNF A;  3E1Y E;  2BGJ A;  5IYW A;  2Q6I A;  1KJZ A;  4PC3 A;  3CC7 B;  5HKK A;  5HZB A;  1VF7 A;  2B5O A;  2C2W A;  2X6Y A;  3KEW A;  4YHB A;  2YWG A;  1UD8 A;  3FPP A;  1VQ5 B;  3CMM A;  4OOV A;  3G4S B;  1G7C A;  3ASP A;  3GVL A;  4XM3 A;  1K73 D;  3FJO A;  1RQR A;  1N0V C;  2WZP P;  1WP6 A;  3AST A;  4M0L A;  3LQE A;  2C4U A;  1GJR A;  3W2G A;  4B3G A;  3QFT A;  3ZBT A;  2B7B A;  4TKO B;  4TMW A;  1EFT A;  4X07 A;  1YIT B;  2YWE A;  3CCJ B;  1JB9 A;  1R5B A;  3W2H A;  4II2 A;  4ACB A;  5KNL A;  4LBZ A;  4YAF A;  4Y9R A;  1TVC A;  3OW7 A;  4QUZ A;  2VBV A;  2V7T A;  4PC1 A;  4U9U A;  4GQN A;  3VO2 A;  3FKS A;  3J81 k;  5FO1 A;  3W2E A;  4J0Q A;  1GVH A;  1NB9 A;  1FND A;  3GIR A;  3BC9 A;  3GVK A;  4XKV A;  4XL9 A;  3A3B A;  1TTT A;  2DOG A;  3GVJ A;  1N0U A;  1NJI D;  3SJP A;  1YLO A;  1CNF A;  4XKW A;  2ZL5 A;  4RM0 A;  1FNC A;  1GAQ A;  3CP2 A;  4XD7 A;  2CBX A;  2DY1 A;  5L46 A;  1TUI A;  2YWH A;  3CME B;  3PA1 A;  1OHH A;  2V7X A;  3WQZ A;  4YAU A;  3BQJ A;  1KK0 A;  2HDN B;  2ZTN A;  1QG0 A;  3A8I A;  3RY8 A;  1QFZ A;  4DK1 A;  1JA1 A;  5E6T A;  3ZZU A;  3AGQ A;  2BVN A;  2PMD A;  4WZK A;  1QX4 A;  3FPK A;  2KVO A;  3CC4 B;  2ZZF A;  4NNJ A;  1VHE A;  5A89 A;  2V7U A;  2VBS A;  5FO0 A;  4NCN A;  2F43 A;  2Q6O A;  5IYN A;  1A8P A;  3Q38 A;  4M2L A;  1KQS B;  3B82 A;  1R5N A;  1T6X A;  1BJK A;  1DG1 G;  4Y7C A;  3MHP A;  2ZTG A;  2GJP A; 
#chains in the Genus database with same CATH homology
 4XLE A;  1W0K A;  3ZIA A;  5IK2 A;  2XZL A;  3BCD A;  1PKV A;  1H8H A;  2WSS A;  2Z6B D;  4YXW A;  1E79 A;  2JJ1 A;  1SKY B;  1E43 A;  3OPO A;  1BLI A;  3DDY A;  3OE7 A;  2WJV A;  3ZPN A;  1UD4 A;  4DNR B;  1V0F A;  2V4D A;  4TSF A;  4YEJ A;  3A3G A;  2ZZE A;  3LNN A;  4FXU A;  2X6W A;  5CDF A;  2DIE A;  1FX0 A;  2XZP A;  4DK0 A;  2E1B A;  4XN0 A;  1W0J A;  4XLA A;  2M5S A;  1OB0 A;  2JJ2 A;  3GQB A;  2D3L A;  1NRK A;  4P22 A;  2XZO A;  4XNF A;  1UD3 A;  1I8D A;  1KMH A;  1UD6 A;  4G7W A;  4XN3 A;  3CP8 A;  4DNT B;  5DN6 A;  1V0E A;  2HLD A;  3CES A;  5HKK A;  1VF7 A;  2W6J A;  3OAA A;  4XOT A;  2X6Y A;  3KEW A;  4JMQ A;  1UD8 A;  2XND A;  3FPP A;  2V31 A;  2WPD A;  4ASU A;  2X85 A;  3CMM A;  3GVL A;  4XM3 A;  1HZE A;  4YEL A;  3BCF A;  1WP6 A;  2WZP P;  2X8K A;  4XOR A;  3T53 B;  1COW A;  4G6I A;  4B3G A;  4KKT A;  1E1Q A;  3OOC A;  2WJY A;  4TKO B;  2D3N A;  4XLF A;  2CK3 A;  3A35 A;  1EFR A;  4XON A;  4II2 A;  2V7Q A;  5KNL A;  4KKU A;  1W9X A;  2JIZ A;  1VJS A;  1WTH D;  3OW7 A;  4XMY A;  2F1M A;  1K28 D;  2XGJ A;  4GQN A;  3FKS A;  5FL7 A;  1E3X A;  3OEH A;  2W6I A;  4HIZ A;  3BC9 A;  3GVK A;  1H8E A;  4XKV A;  1VLY A;  3JU4 A;  1T5E A;  3OFN A;  3A3B A;  4XL9 A;  1WPC A;  4XR6 A;  3GVJ A;  3H94 A;  3G05 A;  1UD5 A;  3BH4 A;  2GJR A;  2VJJ A;  2XOK A;  4II3 A;  4E0F A;  1BPL A;  2X53 S;  2ZZQ A;  4XD7 A;  4XKW A;  3CP2 A;  2JDI A;  4UZU A;  4G7X A;  1MAB A;  1OHH A;  3T51 B;  2ZXH A;  3WQZ A;  1NBM A;  3T56 B;  3OEE A;  2ZTN A;  4AVZ A;  1KZL A;  4DK1 A;  4XLH A;  2VJI A;  2LZJ A;  2X6X A;  2QE7 A;  3HAG A;  4XOP A;  4L8J A;  3VR6 A;  1I18 A;  1HVX A;  4XLC A;  2KVO A;  2ZZF A;  4Z1M A;  4NNJ A;  2ZXI A;  3NE5 B;  4B3F X;  2F43 A;  4KKS A;  2GK7 A;  1UD2 A;  4TT3 A;  1BMF A;  2R9V A;  2ZZG A;  1E3Z A;  4XQF A;  2GK6 A;  2GJK A;  1E1R A;  2ZTG A;  2GJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...