2LZJA

Refined solution structure and dynamics of first catalytic cysteine half-domain from mouse e1 enzyme
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
112
Chain Sequence
EFGEEMVLTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARHGFETGDFVSFSEVQGMIQLNGCQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLPASLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-like modifier-activating enzyme 1
publication title NMR structural studies of the first catalytic half-domain of ubiquitin activating enzyme.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 22
structure length 112
sequence length 112
ec nomenclature ec 6.2.1.45: E1 ubiquitin-activating enzyme.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16190 E1_FCCH Ubiquitin-activating enzyme E1 FCCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.180 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2lzjA00
4II2A 2V31A 3CMMA 4II3A 5KNLA 4NNJA 4P22A 2LZJA
chains in the Genus database with same CATH superfamily
3W5UA 1BMFA 1KK0A 3Q3AA 5FA6A 3SJPA 1YJWB 3OEHA 3JQPA 3NE5B 1R5OA 2JIZA 2WPDA 2QTLA 1XB2A 4MYUA 4AVZA 1NB0A 1E64A 3CMMA 2Q6IA 2VNKA 3V76A 3W2EA 2QMUA 3PA2A 1E3ZA 3A3BA 3AGPA 3OKXA 4P9SA 1JB9A 4B43A 4X7CA 1T6YA 2GK7A 2XZPA 4PABA 5GV7A 1QVGB 2XNDA 4DK1A 4XNFA 1N08A 4OPSA 3ES9A 3CCRB 3B78A 2CC2A 3Q38A 1KTVA 4AF7A 3GSIA 4ACAA 3MHPA 4UZEA 2D74A 4TKOB 1KK2A 1DARA 1PKVA 2VNHA 2WJVA 1E1QA 5IYQA 2HDNB 3D26A 3PENA 3BCDA 2RC6A 1UD8A 3WY9A 1Y0YA 1R5BA 1UD6A 2PLFA 1VQKB 3LNNA 4FXUA 1UD5A 4LBYA 1YI2B 2VJJA 1WSVA 1WOPA 4YAUA 3CXCB 1VQ7B 4X07A 2WR8A 5J35A 1D2EA 3B82A 3P27A 3MMPA 3ZBTA 1VQ9B 2X8KA 4AF6A 2ZBVA 1TLLA 1U2RA 2YWGA 5IYRA 1VQPB 1E62A 2F1MA 3BNWA 5JBQA 5IK2A 2WZNA 4RM0A 1N07A 2BN4A 1SKQA 2VNIA 4G6IA 4UZFA 1F60A 1YIJB 4TN1A 4ZV4A 5TRDA 1I18A 4C43A 4QV2A 1Q7YD 1SM4A 4WZTA 1V5VA 3LO8A 3Q6QA 2WZPP 2CBXA 1H8EA 3T53B 1T6XA 1VHOA 1EFCA 3RY8A 1BQEA 4DK0A 5HZAA 4BPRA 2ZL7A 3ZIAA 3QFTA 3A3GA 2X0KA 4P6YA 3GVKA 3PUNA 3CCSB 3ASPA 4RD6A 2R6HA 3Q39A 2JN9A 2JJ2A 2OK8A 1COWA 2OTJB 4NCNA 1N0VC 1TUIA 2BV3A 4G7XA 4M4SA 2XGJA 2DERA 5FO0A 1EP2B 2F4NA 5A88A 3VNVA 5HXBA 4KKSA 5J3OA 2Q6KA 1S4MA 1AMOA 3A8IA 4PGOA 1E3XA 4G7WA 2WJYA 1KZLA 5BSYA 1HVXA 3OZVA 4RDLA 1K8AD 1GVHA 1WP6A 3AGQA 4XN3A 2PIAA 4P22A 3KL9A 3VO1A 4XR6A 1KC8D 1FNDA 4PC2A 3T51B 5B6IA 1ZM4A 2XOKA 2QDXA 1IJFA 2V7VA 3FKSA 2J7KA 1JA1A 3ASQA 1VQLB 1M90D 1OGJA 3BY1A 5IYWA 1YX2A 3WNBA 2C2WA 2ZTNA 4ASUA 4RD0A 3CP8A 4FK8A 1WSRA 2GPJA 4H9GA 4RDJA 4TMXA 4ZGNB 1G7SA 1K73D 1EFUA 4U9UA 4B44A 4Z4SA 3CRZA 3VMFA 4B3XA 1QGAA 1YITB 4B3GA 3BQJA 4DNTB 4B48A 4XLCA 2FX3A 4UAJA 2Z6BD 4MYTA 3A8JA 4M0LA 5DN6A 2X6WA 2PE3A 4XLHA 5IYPA 2OBRA 1WOOA 1CQXA 4QUZA 1E43A 1JA0A 2GQFA 3VNUA 3CC2B 3U6KA 2GJKA 2Q6LA 1VQNB 2WSSA 1N05A 4X7DA 4X7EA 1QG0A 4XN0A 2OTLB 1BX0A 3SEJA 5TR9A 1W9XA 1K28D 4N3NA 2CNDA 1QFYA 3W2GA 2BM1A 3P26A 4K1XA 1FRNA 4Z4VA 1JJ2B 4LBWA 3PUMA 1PJ6A 2ZBUA 3CESA 4HE5A 5DSZA 2GJPA 2ZTGA 4ACBA 5A89A 3CC7B 3CMAB 2DETA 3FPKA 4OOSA 2BF4A 1WPCA 2C5BA 4L8JA 1ZUNB 2VNJA 1FX0A 3Q6RA 4G1BA 3A1PA 3BCFA 4M53A 1A8PA 4RLZA 2X6YA 1FNCA 2CK3A 1WTHD 4OPVA 2EFGA 2V4DA 1N8RD 1VHEA 1T5EA 4KKUA 3R6KA 4NNJA 2CW5A 2V7XA 3CPXA 3ONYA 5GV8A 3OEEA 1DDGA 3ZZTA 3ZPNA 2ZXHA 1XE1A 2B7CA 3QFSA 3ZUGA 3ASRA 4R71A 4Z4ZA 2X53S 5KSWB 3OFNA 2FVGA 1TVCA 2JJ1A 3MCAA 3VO2A 4II2A 4WZEA 1B2RA 3CCQB 5IYNA 4RD4A 1QFJA 3SLDA 3W5HA 1W0KA 2ZITA 4B3FX 3CCVB 2XZLA 3QFCA 1BLIA 2QE7A 1Q82D 2V7QA 3AVWA 2QTZA 1S0UA 4XQFA 3JQQA 1D1NA 1W34A 3AVTA 1BX1A 4B47A 4RDKA 1YJNB 1QUEA 4TMVA 1CNEA 3OW7A 4J0QA 3OJXA 2ZXIA 4TSFA 2XNCA 4M1KA 3JU4A 4XLFA 1S72B 3OAAA 2EIXA 1T6ZA 2VZLA 4YAWA 1Q86D 1IB0A 3W5VA 2X85A 4GQNA 4II3A 5E6TA 4KKTA 3J81k 1DDIA 1QGZA 2W6JA 3ISXA 5TY0A 2WYRA 2QGGA 2XNJA 2ZL5A 2VJIA 4M2LA 3JQRA 3SLNA 4P26A 4XKWA 1JNYA 1KQSB 1VQ8B 1K9MD 4X05A 4LC0A 1MRZA 5FL7A 1NRKA 4XD7A 1W87A 3BC9A 3G6EB 3W2IA 1I7PA 2ZZEA 4ZCMA 4YEJA 2X3UA 1VQ6B 5HZBA 4AC9A 1NB9A 4RD1A 3WQZA 5AN9A 2P3MA 1NDHA 4G1VA 4TMWA 5H59A 3I55B 3DDYA 5H5JA 1QVFB 1EFTA 1TTTA 4Y7CA 3OW2B 3G71B 1EP1B 4F7DA 1OB0A 4XOTA 3VR6A 4ROXA 2QN6A 3AVXA 1RQRA 1VLYA 2X6XA 4P3IA 1CNFA 4PAAA 4RCYA 5THXA 3CD6B 3OOCA 4PC1A 3ZZUA 2F43A 3AVUA 1OGIA 2W6IA 3OP1A 2I1LA 1FNBA 2C4TA 2GK6A 2E1BA 3CP2A 4P12A 4XONA 4RD2A 3LQEA 1G7CA 3SJZA 1IJEA 1RQPA 2DEUA 2M5SA 1Q81D 5KW9A 1EXMA 4HE6A 4P6VF 1Y0RA 3ASTA 3AVYA 4XLAA 3SKBA 1KMHA 4E0FA 2LZJA 1B23P 4X8IA 4XLEA 1PJ5A 2NV4A 2C4UA 3FJOA 4B4DA 1W0JA 2JDIA 2ZZFA 4Z4RA 4OPOA 4YXWA 3GVLA 1V0FA 3CPWB 4TT3A 3WNDA 1GAQA 1N06A 2VBVA 3E20A 5EMNA 4RJLA 1EP3B 4XMYA 3W2FA 3CCJB 2DCUA 1BJKA 1ZM9A 2VBUA 2PMDA 4PC3A 4QFMA 1J9ZA 3LQ6A 4TMZA 3FPPA 1G7TA 2QA4B 1W2BB 2GREA 2YWHA 1QFZA 3CB4A 1VQOB 4C0SA 1GR1A 1EWYA 2OBSA 2D3LA 2KVOA 3OZUA 3HAGA 4FWTA 1OB5A 4Y9UA 2DY1A 5CDFA 4WWVA 5A8AA 1NBMA 2BSAA 2ZL6A 1M1KD 1WOSA 1V0EA 1BPLA 2BPOA 2VBTA 4YHBA 2V7WA 5HKKA 2V7UA 5KNLA 1HA3A 2C5HA 1D8TA 4Y9RA 3OE7A 4RPBA 1ZM2A 1UD4A 1IHMA 4YAOA 4DQLA 2XZOA 4G5GA 3I56B 2E1RA 4OOVA 3A35A 1DG1G 3CTAA 4P25A 4RD3A 3PVDA 3WBKA 2DIEA 4ZCIA 4QVAA 1OB2A 1FRQA 2NPFA 3AVVA 1Q9SA 2C78A 4RPDA 5F4OA 2OBTA 2F1LA 3WNCA 1QUFA 3E1YE 4P3YA 3CCEB 1XQBA 1YHQB 1YJ9B 1EFRA 1KJZA 2BGIA 5FIUA 4WZKA 4YALA 5DS0A 3WBJA 4EH1A 4IW3B 4OOXA 1VQ4B 2D3NA 3W2HA 1KD1D 4XM3A 1UD2A 1QH0A 3U2QA 3KEWA 4LBZA 1AIPA 2RC5A 1G7RA 2CRVA 3H9NA 1KRHA 4LBVA 4Z1MA 2HMAA 2XEXA 1PJ7A 3ONUA 3B8HA 1WDTA 3GVJA 4FN5A 1VF7A 3GQBA 1W35A 2C77A 2OYNA 1GO2A 3T56B 2R9VA 4P1VA 1OHHA 2CF4A 3QE2A 2VBSA 1H85A 2B5OA 1WORA 3PA1A 1YLOA 3ZC3A 1QGYA 4X7FA 2B7BA 2BMWA 2V7TA 1VJSA 2ZZQA 3ZZ0A 3CCUB 3LVBA 4TMTA 5BSXA 3BH4A 2YWEA 4NBSA 1E1RA 4Z4TA 5L46A 1NJID 4ZCLA 1N0UA 4UZUA 1I8DA 1VQ5B 2V31A 5FO1A 4PC7A 1QX4A 4PC6A 1KK1A 3A8KA 3G4SB 5LMZA 3G05A 3U6BA 3R6JA 1H42A 2DYIA 2ZZGA 4YELA 1GJRA 2D9RA 2VYQA 1VLOA 2DOGA 4DNRB 4DQKA 2Q6OA 3I1FA 1WU8A 1VQMB 1GAWA 5TV2A 3OZWA 5FNZA 2BM0A 1F20A 2BGJA 1UD3A 3CCMB 4P2NA 2GJRA 3CW2A 4WZLA 3GIRA 4Z4WA 1FDRA 1KK3A 2AHOA 1E63A 4HIZA 5F4JA 3OJWA 3OPOA 4ZGQB 4Q7JB 3ZBUA 1FNMA 1P4MA 1UMKA 3QFRA 4OP7A 2QEXB 4QVJA 2BVNA 3H94A 3V7AA 2YWFA 2HCJB 3BY2A 4XOPA 4XORA 3QSYA 1H8HA 4YAFA 4X06A 1ELOA 3ASSA 4WQMA 4XL9A 4Z4YA 4Z4UA 2HLDA 1HZEA 1XFOA 1R5NA 2OK7A 4CQJA 3WYAA 1MABA 4N3GA 3WXMA 1ZM3A 4RCZA 3CCLB 1SKYB 4XKVA 4QHYA 4X0CA 3CC4B 1E79A 3CMEB 4JMQA 5F4MA
chains in the Genus database with same CATH topology
4ASUA 2W6JA 1BMFA 2DIEA 3CP8A 4KKTA 3OEHA 2VJIA 3NE5B 4XKWA 2JIZA 2WPDA 4AVZA 5FL7A 3CMMA 1NRKA 4XD7A 3BC9A 1E3ZA 3A3BA 4B3GA 1EFRA 2ZZEA 4DNTB 4YEJA 2GK7A 2XZPA 4XLCA 3WQZA 2XNDA 2Z6BD 2D3NA 3DDYA 4DK1A 4XNFA 4XM3A 1UD2A 5DN6A 2X6WA 3KEWA 1OB0A 4XLHA 4XOTA 3VR6A 1E43A 1VLYA 2X6XA 4Z1MA 4TKOB 2GJKA 2WJVA 1PKVA 2WSSA 1E1QA 3OOCA 3GVJA 2F43A 4XN0A 2W6IA 3BCDA 1UD8A 1VF7A 3GQBA 1W9XA 1UD6A 1K28D 2E1BA 2GK6A 3CP2A 4XONA 3LNNA 4FXUA 1UD5A 2R9VA 3T56B 2VJJA 1OHHA 3CESA 2GJPA 2ZTGA 2M5SA 2X8KA 1WPCA 4L8JA 1FX0A 2F1MA 3BCFA 1VJSA 2ZZQA 4XLAA 2X6YA 5IK2A 2CK3A 1WTHD 1KMHA 3BH4A 4E0FA 2LZJA 1E1RA 4G6IA 4XLEA 4UZUA 1I8DA 1I18A 2V4DA 2V31A 1W0JA 1T5EA 2JDIA 2ZZFA 4KKUA 4NNJA 2WZPP 3T53B 1H8EA 3OEEA 3G05A 4DK0A 4YXWA 3ZPNA 2ZXHA 3GVLA 1V0FA 2ZZGA 4TT3A 4YELA 2X53S 3ZIAA 3OFNA 4DNRB 2JJ1A 3A3GA 3GVKA 4XMYA 4II2A 1UD3A 2JJ2A 1COWA 3FPPA 4G7XA 2XGJA 2GJRA 1W0KA 4KKSA 4B3FX 4HIZA 2XZLA 1BLIA 2D3LA 1E3XA 2KVOA 2QE7A 3HAGA 3OPOA 2WJYA 1KZLA 4G7WA 1HVXA 2V7QA 3H94A 5CDFA 4XQFA 1NBMA 1WP6A 4XN3A 4XOPA 4XORA 1H8HA 1V0EA 1BPLA 3OW7A 4XL9A 4P22A 2HLDA 2ZXIA 1HZEA 4TSFA 4XR6A 3JU4A 4XLFA 1MABA 3OAAA 5HKKA 3T51B 5KNLA 2XOKA 3OE7A 1SKYB 1UD4A 3FKSA 2XZOA 4XKVA 2X85A 4GQNA 4II3A 1E79A 2ZTNA 3A35A 4JMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4II2 A;  2V31 A;  3CMM A;  4II3 A;  5KNL A;  4NNJ A;  4P22 A;  2LZJ A; 
#chains in the Genus database with same CATH topology
 3W5U A;  1BMF A;  1KK0 A;  3Q3A A;  5FA6 A;  3SJP A;  1YJW B;  3OEH A;  3JQP A;  3NE5 B;  1R5O A;  2JIZ A;  2WPD A;  2QTL A;  1XB2 A;  4MYU A;  4AVZ A;  1NB0 A;  1E64 A;  3CMM A;  2Q6I A;  2VNK A;  3V76 A;  3W2E A;  2QMU A;  3PA2 A;  1E3Z A;  3A3B A;  3AGP A;  3OKX A;  4P9S A;  1JB9 A;  4B43 A;  4X7C A;  1T6Y A;  2GK7 A;  2XZP A;  4PAB A;  5GV7 A;  1QVG B;  2XND A;  4DK1 A;  4XNF A;  1N08 A;  4OPS A;  3ES9 A;  3CCR B;  3B78 A;  2CC2 A;  3Q38 A;  1KTV A;  4AF7 A;  3GSI A;  4ACA A;  3MHP A;  4UZE A;  2D74 A;  4TKO B;  1KK2 A;  1DAR A;  1PKV A;  2VNH A;  2WJV A;  1E1Q A;  5IYQ A;  2HDN B;  3D26 A;  3PEN A;  3BCD A;  2RC6 A;  1UD8 A;  3WY9 A;  1Y0Y A;  1R5B A;  1UD6 A;  2PLF A;  1VQK B;  3LNN A;  4FXU A;  1UD5 A;  4LBY A;  1YI2 B;  2VJJ A;  1WSV A;  1WOP A;  4YAU A;  3CXC B;  1VQ7 B;  4X07 A;  2WR8 A;  5J35 A;  1D2E A;  3B82 A;  3P27 A;  3MMP A;  3ZBT A;  1VQ9 B;  2X8K A;  4AF6 A;  2ZBV A;  1TLL A;  1U2R A;  2YWG A;  5IYR A;  1VQP B;  1E62 A;  2F1M A;  3BNW A;  5JBQ A;  5IK2 A;  2WZN A;  4RM0 A;  1N07 A;  2BN4 A;  1SKQ A;  2VNI A;  4G6I A;  4UZF A;  1F60 A;  1YIJ B;  4TN1 A;  4ZV4 A;  5TRD A;  1I18 A;  4C43 A;  4QV2 A;  1Q7Y D;  1SM4 A;  4WZT A;  1V5V A;  3LO8 A;  3Q6Q A;  2WZP P;  2CBX A;  1H8E A;  3T53 B;  1T6X A;  1VHO A;  1EFC A;  3RY8 A;  1BQE A;  4DK0 A;  5HZA A;  4BPR A;  2ZL7 A;  3ZIA A;  3QFT A;  3A3G A;  2X0K A;  4P6Y A;  3GVK A;  3PUN A;  3CCS B;  3ASP A;  4RD6 A;  2R6H A;  3Q39 A;  2JN9 A;  2JJ2 A;  2OK8 A;  1COW A;  2OTJ B;  4NCN A;  1N0V C;  1TUI A;  2BV3 A;  4G7X A;  4M4S A;  2XGJ A;  2DER A;  5FO0 A;  1EP2 B;  2F4N A;  5A88 A;  3VNV A;  5HXB A;  4KKS A;  5J3O A;  2Q6K A;  1S4M A;  1AMO A;  3A8I A;  4PGO A;  1E3X A;  4G7W A;  2WJY A;  1KZL A;  5BSY A;  1HVX A;  3OZV A;  4RDL A;  1K8A D;  1GVH A;  1WP6 A;  3AGQ A;  4XN3 A;  2PIA A;  4P22 A;  3KL9 A;  3VO1 A;  4XR6 A;  1KC8 D;  1FND A;  4PC2 A;  3T51 B;  5B6I A;  1ZM4 A;  2XOK A;  2QDX A;  1IJF A;  2V7V A;  3FKS A;  2J7K A;  1JA1 A;  3ASQ A;  1VQL B;  1M90 D;  1OGJ A;  3BY1 A;  5IYW A;  1YX2 A;  3WNB A;  2C2W A;  2ZTN A;  4ASU A;  4RD0 A;  3CP8 A;  4FK8 A;  1WSR A;  2GPJ A;  4H9G A;  4RDJ A;  4TMX A;  4ZGN B;  1G7S A;  1K73 D;  1EFU A;  4U9U A;  4B44 A;  4Z4S A;  3CRZ A;  3VMF A;  4B3X A;  1QGA A;  1YIT B;  4B3G A;  3BQJ A;  4DNT B;  4B48 A;  4XLC A;  2FX3 A;  4UAJ A;  2Z6B D;  4MYT A;  3A8J A;  4M0L A;  5DN6 A;  2X6W A;  2PE3 A;  4XLH A;  5IYP A;  2OBR A;  1WOO A;  1CQX A;  4QUZ A;  1E43 A;  1JA0 A;  2GQF A;  3VNU A;  3CC2 B;  3U6K A;  2GJK A;  2Q6L A;  1VQN B;  2WSS A;  1N05 A;  4X7D A;  4X7E A;  1QG0 A;  4XN0 A;  2OTL B;  1BX0 A;  3SEJ A;  5TR9 A;  1W9X A;  1K28 D;  4N3N A;  2CND A;  1QFY A;  3W2G A;  2BM1 A;  3P26 A;  4K1X A;  1FRN A;  4Z4V A;  1JJ2 B;  4LBW A;  3PUM A;  1PJ6 A;  2ZBU A;  3CES A;  4HE5 A;  5DSZ A;  2GJP A;  2ZTG A;  4ACB A;  5A89 A;  3CC7 B;  3CMA B;  2DET A;  3FPK A;  4OOS A;  2BF4 A;  1WPC A;  2C5B A;  4L8J A;  1ZUN B;  2VNJ A;  1FX0 A;  3Q6R A;  4G1B A;  3A1P A;  3BCF A;  4M53 A;  1A8P A;  4RLZ A;  2X6Y A;  1FNC A;  2CK3 A;  1WTH D;  4OPV A;  2EFG A;  2V4D A;  1N8R D;  1VHE A;  1T5E A;  4KKU A;  3R6K A;  4NNJ A;  2CW5 A;  2V7X A;  3CPX A;  3ONY A;  5GV8 A;  3OEE A;  1DDG A;  3ZZT A;  3ZPN A;  2ZXH A;  1XE1 A;  2B7C A;  3QFS A;  3ZUG A;  3ASR A;  4R71 A;  4Z4Z A;  2X53 S;  5KSW B;  3OFN A;  2FVG A;  1TVC A;  2JJ1 A;  3MCA A;  3VO2 A;  4II2 A;  4WZE A;  1B2R A;  3CCQ B;  5IYN A;  4RD4 A;  1QFJ A;  3SLD A;  3W5H A;  1W0K A;  2ZIT A;  4B3F X;  3CCV B;  2XZL A;  3QFC A;  1BLI A;  2QE7 A;  1Q82 D;  2V7Q A;  3AVW A;  2QTZ A;  1S0U A;  4XQF A;  3JQQ A;  1D1N A;  1W34 A;  3AVT A;  1BX1 A;  4B47 A;  4RDK A;  1YJN B;  1QUE A;  4TMV A;  1CNE A;  3OW7 A;  4J0Q A;  3OJX A;  2ZXI A;  4TSF A;  2XNC A;  4M1K A;  3JU4 A;  4XLF A;  1S72 B;  3OAA A;  2EIX A;  1T6Z A;  2VZL A;  4YAW A;  1Q86 D;  1IB0 A;  3W5V A;  2X85 A;  4GQN A;  4II3 A;  5E6T A;  4KKT A;  3J81 k;  1DDI A;  1QGZ A;  2W6J A;  3ISX A;  5TY0 A;  2WYR A;  2QGG A;  2XNJ A;  2ZL5 A;  2VJI A;  4M2L A;  3JQR A;  3SLN A;  4P26 A;  4XKW A;  1JNY A;  1KQS B;  1VQ8 B;  1K9M D;  4X05 A;  4LC0 A;  1MRZ A;  5FL7 A;  1NRK A;  4XD7 A;  1W87 A;  3BC9 A;  3G6E B;  3W2I A;  1I7P A;  2ZZE A;  4ZCM A;  4YEJ A;  2X3U A;  1VQ6 B;  5HZB A;  4AC9 A;  1NB9 A;  4RD1 A;  3WQZ A;  5AN9 A;  2P3M A;  1NDH A;  4G1V A;  4TMW A;  5H59 A;  3I55 B;  3DDY A;  5H5J A;  1QVF B;  1EFT A;  1TTT A;  4Y7C A;  3OW2 B;  3G71 B;  1EP1 B;  4F7D A;  1OB0 A;  4XOT A;  3VR6 A;  4ROX A;  2QN6 A;  3AVX A;  1RQR A;  1VLY A;  2X6X A;  4P3I A;  1CNF A;  4PAA A;  4RCY A;  5THX A;  3CD6 B;  3OOC A;  4PC1 A;  3ZZU A;  2F43 A;  3AVU A;  1OGI A;  2W6I A;  3OP1 A;  2I1L A;  1FNB A;  2C4T A;  2GK6 A;  2E1B A;  3CP2 A;  4P12 A;  4XON A;  4RD2 A;  3LQE A;  1G7C A;  3SJZ A;  1IJE A;  1RQP A;  2DEU A;  2M5S A;  1Q81 D;  5KW9 A;  1EXM A;  4HE6 A;  4P6V F;  1Y0R A;  3AST A;  3AVY A;  4XLA A;  3SKB A;  1KMH A;  4E0F A;  2LZJ A;  1B23 P;  4X8I A;  4XLE A;  1PJ5 A;  2NV4 A;  2C4U A;  3FJO A;  4B4D A;  1W0J A;  2JDI A;  2ZZF A;  4Z4R A;  4OPO A;  4YXW A;  3GVL A;  1V0F A;  3CPW B;  4TT3 A;  3WND A;  1GAQ A;  1N06 A;  2VBV A;  3E20 A;  5EMN A;  4RJL A;  1EP3 B;  4XMY A;  3W2F A;  3CCJ B;  2DCU A;  1BJK A;  1ZM9 A;  2VBU A;  2PMD A;  4PC3 A;  4QFM A;  1J9Z A;  3LQ6 A;  4TMZ A;  3FPP A;  1G7T A;  2QA4 B;  1W2B B;  2GRE A;  2YWH A;  1QFZ A;  3CB4 A;  1VQO B;  4C0S A;  1GR1 A;  1EWY A;  2OBS A;  2D3L A;  2KVO A;  3OZU A;  3HAG A;  4FWT A;  1OB5 A;  4Y9U A;  2DY1 A;  5CDF A;  4WWV A;  5A8A A;  1NBM A;  2BSA A;  2ZL6 A;  1M1K D;  1WOS A;  1V0E A;  1BPL A;  2BPO A;  2VBT A;  4YHB A;  2V7W A;  5HKK A;  2V7U A;  5KNL A;  1HA3 A;  2C5H A;  1D8T A;  4Y9R A;  3OE7 A;  4RPB A;  1ZM2 A;  1UD4 A;  1IHM A;  4YAO A;  4DQL A;  2XZO A;  4G5G A;  3I56 B;  2E1R A;  4OOV A;  3A35 A;  1DG1 G;  3CTA A;  4P25 A;  4RD3 A;  3PVD A;  3WBK A;  2DIE A;  4ZCI A;  4QVA A;  1OB2 A;  1FRQ A;  2NPF A;  3AVV A;  1Q9S A;  2C78 A;  4RPD A;  5F4O A;  2OBT A;  2F1L A;  3WNC A;  1QUF A;  3E1Y E;  4P3Y A;  3CCE B;  1XQB A;  1YHQ B;  1YJ9 B;  1EFR A;  1KJZ A;  2BGI A;  5FIU A;  4WZK A;  4YAL A;  5DS0 A;  3WBJ A;  4EH1 A;  4IW3 B;  4OOX A;  1VQ4 B;  2D3N A;  3W2H A;  1KD1 D;  4XM3 A;  1UD2 A;  1QH0 A;  3U2Q A;  3KEW A;  4LBZ A;  1AIP A;  2RC5 A;  1G7R A;  2CRV A;  3H9N A;  1KRH A;  4LBV A;  4Z1M A;  2HMA A;  2XEX A;  1PJ7 A;  3ONU A;  3B8H A;  1WDT A;  3GVJ A;  4FN5 A;  1VF7 A;  3GQB A;  1W35 A;  2C77 A;  2OYN A;  1GO2 A;  3T56 B;  2R9V A;  4P1V A;  1OHH A;  2CF4 A;  3QE2 A;  2VBS A;  1H85 A;  2B5O A;  1WOR A;  3PA1 A;  1YLO A;  3ZC3 A;  1QGY A;  4X7F A;  2B7B A;  2BMW A;  2V7T A;  1VJS A;  2ZZQ A;  3ZZ0 A;  3CCU B;  3LVB A;  4TMT A;  5BSX A;  3BH4 A;  2YWE A;  4NBS A;  1E1R A;  4Z4T A;  5L46 A;  1NJI D;  4ZCL A;  1N0U A;  4UZU A;  1I8D A;  1VQ5 B;  2V31 A;  5FO1 A;  4PC7 A;  1QX4 A;  4PC6 A;  1KK1 A;  3A8K A;  3G4S B;  5LMZ A;  3G05 A;  3U6B A;  3R6J A;  1H42 A;  2DYI A;  2ZZG A;  4YEL A;  1GJR A;  2D9R A;  2VYQ A;  1VLO A;  2DOG A;  4DNR B;  4DQK A;  2Q6O A;  3I1F A;  1WU8 A;  1VQM B;  1GAW A;  5TV2 A;  3OZW A;  5FNZ A;  2BM0 A;  1F20 A;  2BGJ A;  1UD3 A;  3CCM B;  4P2N A;  2GJR A;  3CW2 A;  4WZL A;  3GIR A;  4Z4W A;  1FDR A;  1KK3 A;  2AHO A;  1E63 A;  4HIZ A;  5F4J A;  3OJW A;  3OPO A;  4ZGQ B;  4Q7J B;  3ZBU A;  1FNM A;  1P4M A;  1UMK A;  3QFR A;  4OP7 A;  2QEX B;  4QVJ A;  2BVN A;  3H94 A;  3V7A A;  2YWF A;  2HCJ B;  3BY2 A;  4XOP A;  4XOR A;  3QSY A;  1H8H A;  4YAF A;  4X06 A;  1ELO A;  3ASS A;  4WQM A;  4XL9 A;  4Z4Y A;  4Z4U A;  2HLD A;  1HZE A;  1XFO A;  1R5N A;  2OK7 A;  4CQJ A;  3WYA A;  1MAB A;  4N3G A;  3WXM A;  1ZM3 A;  4RCZ A;  3CCL B;  1SKY B;  4XKV A;  4QHY A;  4X0C A;  3CC4 B;  1E79 A;  3CME B;  4JMQ A;  5F4M A; 
#chains in the Genus database with same CATH homology
 4ASU A;  2W6J A;  1BMF A;  2DIE A;  3CP8 A;  4KKT A;  3OEH A;  2VJI A;  3NE5 B;  4XKW A;  2JIZ A;  2WPD A;  4AVZ A;  5FL7 A;  3CMM A;  1NRK A;  4XD7 A;  3BC9 A;  1E3Z A;  3A3B A;  4B3G A;  1EFR A;  2ZZE A;  4DNT B;  4YEJ A;  2GK7 A;  2XZP A;  4XLC A;  3WQZ A;  2XND A;  2Z6B D;  2D3N A;  3DDY A;  4DK1 A;  4XNF A;  4XM3 A;  1UD2 A;  5DN6 A;  2X6W A;  3KEW A;  1OB0 A;  4XLH A;  4XOT A;  3VR6 A;  1E43 A;  1VLY A;  2X6X A;  4Z1M A;  4TKO B;  2GJK A;  2WJV A;  1PKV A;  2WSS A;  1E1Q A;  3OOC A;  3GVJ A;  2F43 A;  4XN0 A;  2W6I A;  3BCD A;  1UD8 A;  1VF7 A;  3GQB A;  1W9X A;  1UD6 A;  1K28 D;  2E1B A;  2GK6 A;  3CP2 A;  4XON A;  3LNN A;  4FXU A;  1UD5 A;  2R9V A;  3T56 B;  2VJJ A;  1OHH A;  3CES A;  2GJP A;  2ZTG A;  2M5S A;  2X8K A;  1WPC A;  4L8J A;  1FX0 A;  2F1M A;  3BCF A;  1VJS A;  2ZZQ A;  4XLA A;  2X6Y A;  5IK2 A;  2CK3 A;  1WTH D;  1KMH A;  3BH4 A;  4E0F A;  2LZJ A;  1E1R A;  4G6I A;  4XLE A;  4UZU A;  1I8D A;  1I18 A;  2V4D A;  2V31 A;  1W0J A;  1T5E A;  2JDI A;  2ZZF A;  4KKU A;  4NNJ A;  2WZP P;  3T53 B;  1H8E A;  3OEE A;  3G05 A;  4DK0 A;  4YXW A;  3ZPN A;  2ZXH A;  3GVL A;  1V0F A;  2ZZG A;  4TT3 A;  4YEL A;  2X53 S;  3ZIA A;  3OFN A;  4DNR B;  2JJ1 A;  3A3G A;  3GVK A;  4XMY A;  4II2 A;  1UD3 A;  2JJ2 A;  1COW A;  3FPP A;  4G7X A;  2XGJ A;  2GJR A;  1W0K A;  4KKS A;  4B3F X;  4HIZ A;  2XZL A;  1BLI A;  2D3L A;  1E3X A;  2KVO A;  2QE7 A;  3HAG A;  3OPO A;  2WJY A;  1KZL A;  4G7W A;  1HVX A;  2V7Q A;  3H94 A;  5CDF A;  4XQF A;  1NBM A;  1WP6 A;  4XN3 A;  4XOP A;  4XOR A;  1H8H A;  1V0E A;  1BPL A;  3OW7 A;  4XL9 A;  4P22 A;  2HLD A;  2ZXI A;  1HZE A;  4TSF A;  4XR6 A;  3JU4 A;  4XLF A;  1MAB A;  3OAA A;  5HKK A;  3T51 B;  5KNL A;  2XOK A;  3OE7 A;  1SKY B;  1UD4 A;  3FKS A;  2XZO A;  4XKV A;  2X85 A;  4GQN A;  4II3 A;  1E79 A;  2ZTN A;  3A35 A;  4JMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...