2LZJA

Refined solution structure and dynamics of first catalytic cysteine half-domain from mouse e1 enzyme
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
112
Chain Sequence
EFGEEMVLTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARHGFETGDFVSFSEVQGMIQLNGCQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLPASLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-like modifier-activating enzyme 1
publication title NMR structural studies of the first catalytic half-domain of ubiquitin activating enzyme.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 22
structure length 112
sequence length 112
ec nomenclature ec 6.2.1.45: E1 ubiquitin-activating enzyme.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16190 E1_FCCH Ubiquitin-activating enzyme E1 FCCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.180 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2lzjA00
4II3A 4NNJA 5KNLA 4II2A 2LZJA 2V31A 3CMMA 4P22A
chains in the Genus database with same CATH superfamily
3DDYA 4LBYA 1XE1A 4PC2A 1JJ2B 1S0UA 1UD4A 4TMTA 2GK6A 4X05A 4Z4YA 3JU4A 4LBWA 4P26A 1GO2A 4LBZA 3CTAA 1KK0A 2D3LA 1PJ5A 4M2LA 4DQKA 2ZBUA 5F4JA 2QTLA 1WPCA 1QGZA 4R71A 1GJRA 2XGJA 4TMVA 2ZL6A 1JA1A 1Y0YA 2OYNA 3A1PA 1OB0A 2QN6A 4Q7JB 4RD3A 3I1FA 1Y0RA 3AGPA 1EXMA 1KK2A 2ZXIA 1KQSB 5TRDA 3CPXA 3BQJA 4QVJA 4XD7A 3KEWA 4TMWA 4OOVA 2VBSA 1FNMA 3G05A 1TUIA 4AC9A 2M5SA 4Y9UA 4OOXA 2XZOA 4Y9RA 4YALA 5GV8A 5BSYA 2ZXHA 1N05A 1B2RA 1DARA 2ZBVA 3Q39A 4OPVA 3HAGA 4P3YA 2JJ1A 1S4MA 3W5VA 4DNRB 1WDTA 1KZLA 3CCRB 3T56B 2C5HA 1YHQB 4WQMA 3OFNA 1VQ7B 3PENA 2F1LA 2DEUA 3V76A 3W2EA 5IK2A 4P2NA 1K8AD 2I1LA 3OP1A 3LVBA 2YWHA 1UD6A 4WZKA 3ZIAA 4UZFA 3GVKA 3CP2A 1UD5A 1QFYA 2B7CA 4YAFA 2WSSA 1QFJA 4M0LA 2X0KA 1V0FA 2P3MA 1PKVA 2BM1A 1ZM3A 3U6BA 1YLOA 2Q6IA 2YWGA 3WYAA 1KJZA 2VNJA 4Z4ZA 3MMPA 4F7DA 3CD6B 2BF4A 4LBVA 3ZPNA 1N08A 1VQ6B 2NV4A 4PC1A 3QFRA 1T6ZA 1BX0A 5F4MA 4GQNA 4DQLA 1E64A 4RD4A 5HZBA 2BGJA 4RM0A 2Q6LA 3LQ6A 4G6IA 4KKTA 4DK1A 3CW2A 4FWTA 4ZGQB 5FIUA 1N0UA 1K9MD 4B3FX 3R6JA 4HE5A 3GIRA 3U2QA 4RJLA 1YX2A 1PJ6A 1BLIA 5IYQA 4BPRA 2GQFA 4WZEA 3I55B 1G7TA 4N3NA 1GVHA 1F60A 1B23P 1Q86D 1YITB 1FX0A 1DDGA 1COWA 2GPJA 2CBXA 2CRVA 3I56B 4UZEA 3OOCA 3AVXA 1VLOA 2ZTGA 4PGOA 2ZZFA 3OZUA 5F4OA 3CC2B 1F20A 3OAAA 2RC6A 1BQEA 3A3GA 4RPDA 3P27A 2B5OA 4YEJA 2BVNA 2V31A 4B4DA 3CMEB 4PC6A 2PLFA 1W0KA 1N06A 4QVAA 4ACBA 1BMFA 4M1KA 4RCYA 3CMMA 4XONA 4B48A 4X07A 3ZUGA 2CNDA 2OK8A 2GJKA 2OTJB 3PVDA 2XZLA 1WU8A 1M1KD 4RCZA 1I8DA 4XM3A 3OJWA 1A8PA 3AVVA 3VO1A 2V7VA 3R6KA 1OGJA 3W2GA 3H94A 4B3GA 3WY9A 2ZZEA 1W34A 1XQBA 4AF7A 4Y7CA 1IJEA 1TVCA 2VBTA 2HCJB 4YELA 3WBJA 1N8RD 3ASSA 1YI2B 4G1VA 3GSIA 1FRNA 2CW5A 5FL7A 5IYWA 3A8JA 3PA2A 4G1BA 1R5BA 3VMFA 4XOPA 1MRZA 2F1MA 1YJ9B 2AHOA 1H85A 1UD3A 2GREA 4ASUA 2WZNA 1WP6A 4TMZA 1YJNB 5LMZA 1HA3A 1OB2A 4L8JA 2BGIA 3CESA 2XNCA 3WXMA 4G7WA 1V0EA 4C43A 1JA0A 5FO1A 4B43A 4OP7A 3OZWA 2V7QA 3W5UA 3CCLB 1GAWA 2XNJA 4TSFA 3CXCB 2CC2A 4Z4WA 2JN9A 2FX3A 2QDXA 3D26A 4MYTA 1FNBA 1FRQA 2QGGA 2VYQA 2VNHA 3VO2A 2D9RA 1ZM4A 2ZITA 2NPFA 2JJ2A 2BSAA 4II3A 3ONYA 3Q6RA 3ONUA 5FO0A 3GVLA 4XL9A 1PJ7A 1W87A 3BY1A 3MCAA 1VHEA 1ZM9A 4JMQA 4X7EA 3OE7A 2FVGA 2VNKA 4P12A 5J3OA 1UD2A 3AVTA 3ASRA 2Q6OA 1WSVA 4XOTA 4IW3B 1W0JA 4ACAA 2DCUA 4FN5A 1T6XA 4WZLA 1S72B 3PUMA 4PAAA 1JB9A 5AN9A 4XLEA 1FNDA 1QUEA 2X3UA 2VBVA 2OBTA 1OHHA 5EMNA 5THXA 5KW9A 1KK1A 4B47A 4YAUA 4RDLA 4Z4UA 1XFOA 2CF4A 4PC3A 2WJVA 3G71B 5JBQA 4TT3A 4RD2A 3FPKA 4XLCA 1Q7YD 2DERA 3G4SB 1FNCA 4XLHA 2PE3A 1U2RA 1EP2B 2YWEA 3Q6QA 5GV7A 1OGIA 1D1NA 4YAOA 3SLNA 2DYIA 5DSZA 2DY1A 2WR8A 3CRZA 4P9SA 5TV2A 1KC8D 4TMXA 2HMAA 1V5VA 3QFCA 4XMYA 3OW2B 2HLDA 1VQLB 1VJSA 3WNCA 3LNNA 1WTHD 3AGQA 2DOGA 3ZC3A 3CCEB 1DG1G 3CCJB 4EH1A 4WWVA 3QFTA 2JDIA 3B8HA 4ROXA 2DETA 2C4TA 4J0QA 1TLLA 1KMHA 1K73D 3SKBA 2XEXA 1E43A 1T6YA 1QUFA 3WQZA 3CPWB 4Z4TA 3ASQA 1G7CA 1VQ8B 2J7KA 1P4MA 2V7WA 2XNDA 3OW7A 1UMKA 3W2HA 5HKKA 2ZL7A 4FXUA 3CCMB 2BN4A 1R5NA 1UD8A 3QFSA 2YWFA 1H42A 1H8HA 2E1BA 2X6WA 3OEEA 3T51B 3ZZUA 3VNUA 1WORA 3CC4B 1IB0A 1R5OA 5H5JA 1KD1D 1HVXA 2BPOA 3W5HA 2PIAA 4ZV4A 1E79A 4X7CA 3SJPA 1IJFA 3WNDA 2OTLB 1Q81D 1WOPA 2V7TA 2QMUA 2R6HA 4Z4VA 1MABA 3ASTA 1G7RA 1SKYB 2V7XA 1OB5A 5TR9A 5BSXA 1QGYA 1WOOA 4U9UA 4ZGNB 2RC5A 2XZPA 3AVYA 4XN0A 1QGAA 2ZL5A 2QE7A 4WZTA 5FA6A 3FPPA 3ES9A 3B78A 1I18A 4KKSA 3FJOA 1M90D 4NCNA 1T5EA 2QEXB 3A3BA 4K1XA 4Z1MA 1NDHA 1RQRA 2BMWA 1YIJB 5IYPA 1FDRA 2DIEA 4B44A 2D74A 2LZJA 3V7AA 3CCVB 4P3IA 3E1YE 4P22A 4Z4SA 3U6KA 4ZCLA 3SEJA 3BC9A 2BM0A 2WZPP 2C2WA 2R9VA 2CK3A 1K28D 1KTVA 4YAWA 2V7UA 4CQJA 1EP1B 1EFUA 2C5BA 4XKVA 1VQOB 1JNYA 4DK0A 1E63A 1EFCA 4RD6A 2W6JA 2F43A 2JIZA 1KRHA 3Q38A 4TKOB 3CCUB 1ZM2A 4X0CA 1H8EA 3WBKA 4AVZA 3GVJA 1Q82D 4OPOA 4X8IA 1VQ5B 4PABA 4NBSA 3A35A 4XLFA 3ASPA 5KSWB 4QV2A 1XB2A 1EFRA 1G7SA 5DN6A 3OJXA 3T53B 2WPDA 1TTTA 3BCFA 2XOKA 3CMAB 3VNVA 3RY8A 3W2FA 4P6YA 5CDFA 3BNWA 1VQKB 1NJID 1ZUNB 1SM4A 5J35A 3KL9A 3Q3AA 1W35A 5HZAA 1CQXA 3BCDA 3A8KA 4X7DA 1VQPB 3OPOA 5A89A 2VJJA 1VF7A 2X6XA 3WNBA 4RDJA 3E20A 3OZVA 3OKXA 1N0VC 4QFMA 4KKUA 3J81k 2W6IA 3QE2A 4G7XA 3ISXA 1N07A 1AIPA 2ZZQA 2C77A 3A8IA 5E6TA 4ZCIA 1NRKA 1QVGB 4XKWA 4XNFA 1QH0A 5A8AA 4Z4RA 1E3XA 1GR1A 1CNEA 3BY2A 2GK7A 2GJRA 4QHYA 2ZTNA 1VQ4B 1D8TA 1EFTA 1BX1A 1GAQA 2C78A 4OPSA 4X06A 1E62A 1VQ9B 1VQMB 1YJWB 3AVWA 3JQRA 4NNJA 1NBMA 1WSRA 2OK7A 3PUNA 1WOSA 1W9XA 3W2IA 5B6IA 4RD1A 1QFZA 3B82A 2EFGA 2QTZA 4UAJA 5A88A 2F4NA 4AF6A 1EP3B 1BPLA 2OBRA 4TN1A 4MYUA 4HIZA 3ZBTA 3AVUA 4YXWA 3SLDA 5KNLA 1ELOA 2V4DA 2VJIA 1VQNB 4YHBA 3LQEA 5L46A 4P6VF 4X7FA 1HZEA 4RLZA 1Q9SA 2VNIA 5IYNA 3NE5B 2PMDA 1QVFB 2C4UA 3JQQA 3H9NA 4H9GA 4ZCMA 4XN3A 4N3GA 2ZZGA 5TY0A 4B3XA 2OBSA 3PA1A 3VR6A 3G6EB 1VLYA 1QG0A 4XLAA 2X85A 5IYRA 3ZBUA 2VZLA 5H59A 4M53A 1VHOA 1EWYA 1RQPA 2Z6BD 1IHMA 2EIXA 3OEHA 2HDNB 2X6YA 3GQBA 2WYRA 3CC7B 1NB0A 1E3ZA 2X8KA 4M4SA 2B7BA 2WJYA 4P1VA 1D2EA 2KVOA 4RDKA 4OOSA 2Q6KA 2BV3A 2VBUA 1DDIA 3MHPA 4HE6A 2D3NA 4RPBA 3ZZ0A 3ZZTA 4PC7A 1QX4A 3P26A 3CCSB 3SJZA 3QSYA 4E0FA 1E1QA 1CNFA 4C0SA 4DNTB 1E1RA 1I7PA 4XORA 4XQFA 3JQPA 2E1RA 3CB4A 4RD0A 4UZUA 3CP8A 5HXBA 4G5GA 3CCQB 3LO8A 1J9ZA 4FK8A 2GJPA 1SKQA 4P25A 2QA4B 3FKSA 4II2A 1AMOA 1BJKA 2X53S 1W2BB 1KK3A 5DS0A 1NB9A 4LC0A 4XR6A 4QUZA 3BH4A 5FNZA
chains in the Genus database with same CATH topology
3DDYA 2V31A 1UD4A 4XMYA 2GK6A 2HLDA 1VJSA 1W0KA 3JU4A 1WTHD 3LNNA 3BCDA 3OPOA 2VJJA 1VF7A 1BMFA 2JDIA 2D3LA 2X6XA 3CMMA 4XONA 1KMHA 4KKUA 1WPCA 2GJKA 2W6IA 2XGJA 2XZLA 4G7XA 1I8DA 4XM3A 1E43A 5CDFA 1OB0A 3WQZA 2ZZQA 3H94A 4B3GA 1NRKA 2ZZEA 2ZXIA 4XKWA 4XNFA 4XD7A 2XNDA 1E3XA 4YELA 3KEWA 3OW7A 2GK7A 2GJRA 5HKKA 2ZTNA 4FXUA 5FL7A 3G05A 2M5SA 2XZOA 1UD8A 3T51B 1H8HA 2E1BA 2X6WA 2ZXHA 3OEEA 4XOPA 2F1MA 3HAGA 4NNJA 1NBMA 1HVXA 2JJ1A 1UD3A 4DNRB 1W9XA 1KZLA 4ASUA 3T56B 3OFNA 1WP6A 1E79A 5IK2A 4L8JA 3CESA 1UD6A 1MABA 1BPLA 4G7WA 1V0EA 3ZIAA 4HIZA 3GVKA 1SKYB 3CP2A 1UD5A 4YXWA 2WSSA 2V7QA 5KNLA 1V0FA 2V4DA 2XZPA 4XN0A 2VJIA 2QE7A 1PKVA 4TSFA 3FPPA 1HZEA 1I18A 4KKSA 3NE5B 3ZPNA 1T5EA 3A3BA 4XN3A 4Z1MA 2ZZGA 2JJ2A 3VR6A 4II3A 1VLYA 4XLAA 2X85A 2DIEA 4GQNA 2LZJA 2Z6BD 3GVLA 4P22A 4XL9A 3OEHA 4JMQA 3BC9A 2WZPP 2X6YA 3GQBA 3OE7A 4G6IA 4KKTA 2R9VA 4DK1A 2CK3A 1K28D 1E3ZA 1UD2A 2X8KA 2WJYA 2KVOA 4XOTA 1W0JA 4B3FX 4XKVA 2D3NA 4DK0A 1BLIA 2W6JA 4XLEA 2F43A 2JIZA 4TKOB 1OHHA 4E0FA 1E1QA 4DNTB 1H8EA 1E1RA 4XORA 4XQFA 4AVZA 3GVJA 1FX0A 3CP8A 4UZUA 1COWA 2WJVA 4TT3A 3A35A 4XLFA 4XLCA 3OOCA 2ZTGA 1EFRA 2ZZFA 4XLHA 5DN6A 2GJPA 3OAAA 2WPDA 3T53B 3FKSA 4II2A 3BCFA 2XOKA 3A3GA 2X53S 4XR6A 4YEJA 3BH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4II3 A;  4NNJ A;  5KNL A;  4II2 A;  2LZJ A;  2V31 A;  3CMM A;  4P22 A; 
#chains in the Genus database with same CATH topology
 3DDY A;  4LBY A;  1XE1 A;  4PC2 A;  1JJ2 B;  1S0U A;  1UD4 A;  4TMT A;  2GK6 A;  4X05 A;  4Z4Y A;  3JU4 A;  4LBW A;  4P26 A;  1GO2 A;  4LBZ A;  3CTA A;  1KK0 A;  2D3L A;  1PJ5 A;  4M2L A;  4DQK A;  2ZBU A;  5F4J A;  2QTL A;  1WPC A;  1QGZ A;  4R71 A;  1GJR A;  2XGJ A;  4TMV A;  2ZL6 A;  1JA1 A;  1Y0Y A;  2OYN A;  3A1P A;  1OB0 A;  2QN6 A;  4Q7J B;  4RD3 A;  3I1F A;  1Y0R A;  3AGP A;  1EXM A;  1KK2 A;  2ZXI A;  1KQS B;  5TRD A;  3CPX A;  3BQJ A;  4QVJ A;  4XD7 A;  3KEW A;  4TMW A;  4OOV A;  2VBS A;  1FNM A;  3G05 A;  1TUI A;  4AC9 A;  2M5S A;  4Y9U A;  4OOX A;  2XZO A;  4Y9R A;  4YAL A;  5GV8 A;  5BSY A;  2ZXH A;  1N05 A;  1B2R A;  1DAR A;  2ZBV A;  3Q39 A;  4OPV A;  3HAG A;  4P3Y A;  2JJ1 A;  1S4M A;  3W5V A;  4DNR B;  1WDT A;  1KZL A;  3CCR B;  3T56 B;  2C5H A;  1YHQ B;  4WQM A;  3OFN A;  1VQ7 B;  3PEN A;  2F1L A;  2DEU A;  3V76 A;  3W2E A;  5IK2 A;  4P2N A;  1K8A D;  2I1L A;  3OP1 A;  3LVB A;  2YWH A;  1UD6 A;  4WZK A;  3ZIA A;  4UZF A;  3GVK A;  3CP2 A;  1UD5 A;  1QFY A;  2B7C A;  4YAF A;  2WSS A;  1QFJ A;  4M0L A;  2X0K A;  1V0F A;  2P3M A;  1PKV A;  2BM1 A;  1ZM3 A;  3U6B A;  1YLO A;  2Q6I A;  2YWG A;  3WYA A;  1KJZ A;  2VNJ A;  4Z4Z A;  3MMP A;  4F7D A;  3CD6 B;  2BF4 A;  4LBV A;  3ZPN A;  1N08 A;  1VQ6 B;  2NV4 A;  4PC1 A;  3QFR A;  1T6Z A;  1BX0 A;  5F4M A;  4GQN A;  4DQL A;  1E64 A;  4RD4 A;  5HZB A;  2BGJ A;  4RM0 A;  2Q6L A;  3LQ6 A;  4G6I A;  4KKT A;  4DK1 A;  3CW2 A;  4FWT A;  4ZGQ B;  5FIU A;  1N0U A;  1K9M D;  4B3F X;  3R6J A;  4HE5 A;  3GIR A;  3U2Q A;  4RJL A;  1YX2 A;  1PJ6 A;  1BLI A;  5IYQ A;  4BPR A;  2GQF A;  4WZE A;  3I55 B;  1G7T A;  4N3N A;  1GVH A;  1F60 A;  1B23 P;  1Q86 D;  1YIT B;  1FX0 A;  1DDG A;  1COW A;  2GPJ A;  2CBX A;  2CRV A;  3I56 B;  4UZE A;  3OOC A;  3AVX A;  1VLO A;  2ZTG A;  4PGO A;  2ZZF A;  3OZU A;  5F4O A;  3CC2 B;  1F20 A;  3OAA A;  2RC6 A;  1BQE A;  3A3G A;  4RPD A;  3P27 A;  2B5O A;  4YEJ A;  2BVN A;  2V31 A;  4B4D A;  3CME B;  4PC6 A;  2PLF A;  1W0K A;  1N06 A;  4QVA A;  4ACB A;  1BMF A;  4M1K A;  4RCY A;  3CMM A;  4XON A;  4B48 A;  4X07 A;  3ZUG A;  2CND A;  2OK8 A;  2GJK A;  2OTJ B;  3PVD A;  2XZL A;  1WU8 A;  1M1K D;  4RCZ A;  1I8D A;  4XM3 A;  3OJW A;  1A8P A;  3AVV A;  3VO1 A;  2V7V A;  3R6K A;  1OGJ A;  3W2G A;  3H94 A;  4B3G A;  3WY9 A;  2ZZE A;  1W34 A;  1XQB A;  4AF7 A;  4Y7C A;  1IJE A;  1TVC A;  2VBT A;  2HCJ B;  4YEL A;  3WBJ A;  1N8R D;  3ASS A;  1YI2 B;  4G1V A;  3GSI A;  1FRN A;  2CW5 A;  5FL7 A;  5IYW A;  3A8J A;  3PA2 A;  4G1B A;  1R5B A;  3VMF A;  4XOP A;  1MRZ A;  2F1M A;  1YJ9 B;  2AHO A;  1H85 A;  1UD3 A;  2GRE A;  4ASU A;  2WZN A;  1WP6 A;  4TMZ A;  1YJN B;  5LMZ A;  1HA3 A;  1OB2 A;  4L8J A;  2BGI A;  3CES A;  2XNC A;  3WXM A;  4G7W A;  1V0E A;  4C43 A;  1JA0 A;  5FO1 A;  4B43 A;  4OP7 A;  3OZW A;  2V7Q A;  3W5U A;  3CCL B;  1GAW A;  2XNJ A;  4TSF A;  3CXC B;  2CC2 A;  4Z4W A;  2JN9 A;  2FX3 A;  2QDX A;  3D26 A;  4MYT A;  1FNB A;  1FRQ A;  2QGG A;  2VYQ A;  2VNH A;  3VO2 A;  2D9R A;  1ZM4 A;  2ZIT A;  2NPF A;  2JJ2 A;  2BSA A;  4II3 A;  3ONY A;  3Q6R A;  3ONU A;  5FO0 A;  3GVL A;  4XL9 A;  1PJ7 A;  1W87 A;  3BY1 A;  3MCA A;  1VHE A;  1ZM9 A;  4JMQ A;  4X7E A;  3OE7 A;  2FVG A;  2VNK A;  4P12 A;  5J3O A;  1UD2 A;  3AVT A;  3ASR A;  2Q6O A;  1WSV A;  4XOT A;  4IW3 B;  1W0J A;  4ACA A;  2DCU A;  4FN5 A;  1T6X A;  4WZL A;  1S72 B;  3PUM A;  4PAA A;  1JB9 A;  5AN9 A;  4XLE A;  1FND A;  1QUE A;  2X3U A;  2VBV A;  2OBT A;  1OHH A;  5EMN A;  5THX A;  5KW9 A;  1KK1 A;  4B47 A;  4YAU A;  4RDL A;  4Z4U A;  1XFO A;  2CF4 A;  4PC3 A;  2WJV A;  3G71 B;  5JBQ A;  4TT3 A;  4RD2 A;  3FPK A;  4XLC A;  1Q7Y D;  2DER A;  3G4S B;  1FNC A;  4XLH A;  2PE3 A;  1U2R A;  1EP2 B;  2YWE A;  3Q6Q A;  5GV7 A;  1OGI A;  1D1N A;  4YAO A;  3SLN A;  2DYI A;  5DSZ A;  2DY1 A;  2WR8 A;  3CRZ A;  4P9S A;  5TV2 A;  1KC8 D;  4TMX A;  2HMA A;  1V5V A;  3QFC A;  4XMY A;  3OW2 B;  2HLD A;  1VQL B;  1VJS A;  3WNC A;  3LNN A;  1WTH D;  3AGQ A;  2DOG A;  3ZC3 A;  3CCE B;  1DG1 G;  3CCJ B;  4EH1 A;  4WWV A;  3QFT A;  2JDI A;  3B8H A;  4ROX A;  2DET A;  2C4T A;  4J0Q A;  1TLL A;  1KMH A;  1K73 D;  3SKB A;  2XEX A;  1E43 A;  1T6Y A;  1QUF A;  3WQZ A;  3CPW B;  4Z4T A;  3ASQ A;  1G7C A;  1VQ8 B;  2J7K A;  1P4M A;  2V7W A;  2XND A;  3OW7 A;  1UMK A;  3W2H A;  5HKK A;  2ZL7 A;  4FXU A;  3CCM B;  2BN4 A;  1R5N A;  1UD8 A;  3QFS A;  2YWF A;  1H42 A;  1H8H A;  2E1B A;  2X6W A;  3OEE A;  3T51 B;  3ZZU A;  3VNU A;  1WOR A;  3CC4 B;  1IB0 A;  1R5O A;  5H5J A;  1KD1 D;  1HVX A;  2BPO A;  3W5H A;  2PIA A;  4ZV4 A;  1E79 A;  4X7C A;  3SJP A;  1IJF A;  3WND A;  2OTL B;  1Q81 D;  1WOP A;  2V7T A;  2QMU A;  2R6H A;  4Z4V A;  1MAB A;  3AST A;  1G7R A;  1SKY B;  2V7X A;  1OB5 A;  5TR9 A;  5BSX A;  1QGY A;  1WOO A;  4U9U A;  4ZGN B;  2RC5 A;  2XZP A;  3AVY A;  4XN0 A;  1QGA A;  2ZL5 A;  2QE7 A;  4WZT A;  5FA6 A;  3FPP A;  3ES9 A;  3B78 A;  1I18 A;  4KKS A;  3FJO A;  1M90 D;  4NCN A;  1T5E A;  2QEX B;  3A3B A;  4K1X A;  4Z1M A;  1NDH A;  1RQR A;  2BMW A;  1YIJ B;  5IYP A;  1FDR A;  2DIE A;  4B44 A;  2D74 A;  2LZJ A;  3V7A A;  3CCV B;  4P3I A;  3E1Y E;  4P22 A;  4Z4S A;  3U6K A;  4ZCL A;  3SEJ A;  3BC9 A;  2BM0 A;  2WZP P;  2C2W A;  2R9V A;  2CK3 A;  1K28 D;  1KTV A;  4YAW A;  2V7U A;  4CQJ A;  1EP1 B;  1EFU A;  2C5B A;  4XKV A;  1VQO B;  1JNY A;  4DK0 A;  1E63 A;  1EFC A;  4RD6 A;  2W6J A;  2F43 A;  2JIZ A;  1KRH A;  3Q38 A;  4TKO B;  3CCU B;  1ZM2 A;  4X0C A;  1H8E A;  3WBK A;  4AVZ A;  3GVJ A;  1Q82 D;  4OPO A;  4X8I A;  1VQ5 B;  4PAB A;  4NBS A;  3A35 A;  4XLF A;  3ASP A;  5KSW B;  4QV2 A;  1XB2 A;  1EFR A;  1G7S A;  5DN6 A;  3OJX A;  3T53 B;  2WPD A;  1TTT A;  3BCF A;  2XOK A;  3CMA B;  3VNV A;  3RY8 A;  3W2F A;  4P6Y A;  5CDF A;  3BNW A;  1VQK B;  1NJI D;  1ZUN B;  1SM4 A;  5J35 A;  3KL9 A;  3Q3A A;  1W35 A;  5HZA A;  1CQX A;  3BCD A;  3A8K A;  4X7D A;  1VQP B;  3OPO A;  5A89 A;  2VJJ A;  1VF7 A;  2X6X A;  3WNB A;  4RDJ A;  3E20 A;  3OZV A;  3OKX A;  1N0V C;  4QFM A;  4KKU A;  3J81 k;  2W6I A;  3QE2 A;  4G7X A;  3ISX A;  1N07 A;  1AIP A;  2ZZQ A;  2C77 A;  3A8I A;  5E6T A;  4ZCI A;  1NRK A;  1QVG B;  4XKW A;  4XNF A;  1QH0 A;  5A8A A;  4Z4R A;  1E3X A;  1GR1 A;  1CNE A;  3BY2 A;  2GK7 A;  2GJR A;  4QHY A;  2ZTN A;  1VQ4 B;  1D8T A;  1EFT A;  1BX1 A;  1GAQ A;  2C78 A;  4OPS A;  4X06 A;  1E62 A;  1VQ9 B;  1VQM B;  1YJW B;  3AVW A;  3JQR A;  4NNJ A;  1NBM A;  1WSR A;  2OK7 A;  3PUN A;  1WOS A;  1W9X A;  3W2I A;  5B6I A;  4RD1 A;  1QFZ A;  3B82 A;  2EFG A;  2QTZ A;  4UAJ A;  5A88 A;  2F4N A;  4AF6 A;  1EP3 B;  1BPL A;  2OBR A;  4TN1 A;  4MYU A;  4HIZ A;  3ZBT A;  3AVU A;  4YXW A;  3SLD A;  5KNL A;  1ELO A;  2V4D A;  2VJI A;  1VQN B;  4YHB A;  3LQE A;  5L46 A;  4P6V F;  4X7F A;  1HZE A;  4RLZ A;  1Q9S A;  2VNI A;  5IYN A;  3NE5 B;  2PMD A;  1QVF B;  2C4U A;  3JQQ A;  3H9N A;  4H9G A;  4ZCM A;  4XN3 A;  4N3G A;  2ZZG A;  5TY0 A;  4B3X A;  2OBS A;  3PA1 A;  3VR6 A;  3G6E B;  1VLY A;  1QG0 A;  4XLA A;  2X85 A;  5IYR A;  3ZBU A;  2VZL A;  5H59 A;  4M53 A;  1VHO A;  1EWY A;  1RQP A;  2Z6B D;  1IHM A;  2EIX A;  3OEH A;  2HDN B;  2X6Y A;  3GQB A;  2WYR A;  3CC7 B;  1NB0 A;  1E3Z A;  2X8K A;  4M4S A;  2B7B A;  2WJY A;  4P1V A;  1D2E A;  2KVO A;  4RDK A;  4OOS A;  2Q6K A;  2BV3 A;  2VBU A;  1DDI A;  3MHP A;  4HE6 A;  2D3N A;  4RPB A;  3ZZ0 A;  3ZZT A;  4PC7 A;  1QX4 A;  3P26 A;  3CCS B;  3SJZ A;  3QSY A;  4E0F A;  1E1Q A;  1CNF A;  4C0S A;  4DNT B;  1E1R A;  1I7P A;  4XOR A;  4XQF A;  3JQP A;  2E1R A;  3CB4 A;  4RD0 A;  4UZU A;  3CP8 A;  5HXB A;  4G5G A;  3CCQ B;  3LO8 A;  1J9Z A;  4FK8 A;  2GJP A;  1SKQ A;  4P25 A;  2QA4 B;  3FKS A;  4II2 A;  1AMO A;  1BJK A;  2X53 S;  1W2B B;  1KK3 A;  5DS0 A;  1NB9 A;  4LC0 A;  4XR6 A;  4QUZ A;  3BH4 A;  5FNZ A; 
#chains in the Genus database with same CATH homology
 3DDY A;  2V31 A;  1UD4 A;  4XMY A;  2GK6 A;  2HLD A;  1VJS A;  1W0K A;  3JU4 A;  1WTH D;  3LNN A;  3BCD A;  3OPO A;  2VJJ A;  1VF7 A;  1BMF A;  2JDI A;  2D3L A;  2X6X A;  3CMM A;  4XON A;  1KMH A;  4KKU A;  1WPC A;  2GJK A;  2W6I A;  2XGJ A;  2XZL A;  4G7X A;  1I8D A;  4XM3 A;  1E43 A;  5CDF A;  1OB0 A;  3WQZ A;  2ZZQ A;  3H94 A;  4B3G A;  1NRK A;  2ZZE A;  2ZXI A;  4XKW A;  4XNF A;  4XD7 A;  2XND A;  1E3X A;  4YEL A;  3KEW A;  3OW7 A;  2GK7 A;  2GJR A;  5HKK A;  2ZTN A;  4FXU A;  5FL7 A;  3G05 A;  2M5S A;  2XZO A;  1UD8 A;  3T51 B;  1H8H A;  2E1B A;  2X6W A;  2ZXH A;  3OEE A;  4XOP A;  2F1M A;  3HAG A;  4NNJ A;  1NBM A;  1HVX A;  2JJ1 A;  1UD3 A;  4DNR B;  1W9X A;  1KZL A;  4ASU A;  3T56 B;  3OFN A;  1WP6 A;  1E79 A;  5IK2 A;  4L8J A;  3CES A;  1UD6 A;  1MAB A;  1BPL A;  4G7W A;  1V0E A;  3ZIA A;  4HIZ A;  3GVK A;  1SKY B;  3CP2 A;  1UD5 A;  4YXW A;  2WSS A;  2V7Q A;  5KNL A;  1V0F A;  2V4D A;  2XZP A;  4XN0 A;  2VJI A;  2QE7 A;  1PKV A;  4TSF A;  3FPP A;  1HZE A;  1I18 A;  4KKS A;  3NE5 B;  3ZPN A;  1T5E A;  3A3B A;  4XN3 A;  4Z1M A;  2ZZG A;  2JJ2 A;  3VR6 A;  4II3 A;  1VLY A;  4XLA A;  2X85 A;  2DIE A;  4GQN A;  2LZJ A;  2Z6B D;  3GVL A;  4P22 A;  4XL9 A;  3OEH A;  4JMQ A;  3BC9 A;  2WZP P;  2X6Y A;  3GQB A;  3OE7 A;  4G6I A;  4KKT A;  2R9V A;  4DK1 A;  2CK3 A;  1K28 D;  1E3Z A;  1UD2 A;  2X8K A;  2WJY A;  2KVO A;  4XOT A;  1W0J A;  4B3F X;  4XKV A;  2D3N A;  4DK0 A;  1BLI A;  2W6J A;  4XLE A;  2F43 A;  2JIZ A;  4TKO B;  1OHH A;  4E0F A;  1E1Q A;  4DNT B;  1H8E A;  1E1R A;  4XOR A;  4XQF A;  4AVZ A;  3GVJ A;  1FX0 A;  3CP8 A;  4UZU A;  1COW A;  2WJV A;  4TT3 A;  3A35 A;  4XLF A;  4XLC A;  3OOC A;  2ZTG A;  1EFR A;  2ZZF A;  4XLH A;  5DN6 A;  2GJP A;  3OAA A;  2WPD A;  3T53 B;  3FKS A;  4II2 A;  3BCF A;  2XOK A;  3A3G A;  2X53 S;  4XR6 A;  4YEJ A;  3BH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...