2OK8A

Ferredoxin-nadp+ reductase from plasmodium falciparum
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
312
structure length
263
Chain Sequence
NFINLYTVKNPLKCKIVDKINLVRPNSPNEVYHLEINHNGLFKYLEGHTCGIIPYYNERCARLYSISSSNNMENLSVAIKIHKYETNYGYCSGFIKNLKINDDIYLTGAHGYFNLPNDAIQKNTNFIFIATGTGISPYISFLKKLFAYDRNSNYTGYITIYYGVYNEDSILYLNELEYFQKMYPNNINIHYVFSYKQNSDATSFYVQDEIYKRKTEFLNLFNNYKCELYICGHKSIRYKVMDILKSHDQFDEKKKKRVHVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ferredoxin--NADP reductase
publication title Ferredoxin-NADP(+) Reductase from Plasmodium falciparum Undergoes NADP(+)-dependent Dimerization and Inactivation: Functional and Crystallographic Analysis.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Oxidoreductase
total genus 85
structure length 263
sequence length 312
chains with identical sequence B, C, D
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2ok8A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2ok8A02
1CNFA 1EXMA 4FK8A 1FRNA 1W35A 4ACBA 3CCQB 1W87A 3CD6B 1E62A 2FX3A 4G1VA 2QEXB 1NDHA 4PGOA 1I7PA 1TVCA 2OK7A 3VO1A 2BPOA 4Y7CA 1VQ5B 4RD0A 1TTTA 3J81k 1EFTA 3WNCA 4H9GA 1QGZA 4G1BA 1ZM9A 1K8AD 1DARA 1BX1A 3LO8A 2XEXA 3JQQA 1FNCA 3ZZTA 5AN9A 4RCYA 5TR9A 3WYAA 1EP3B 1Q7YD 2BF4A 2RC6A 1KJZA 1KRHA 5HXBA 3ZZUA 1DG1G 4YHBA 5EMNA 1S0UA 3CCJB 1N8RD 4B48A 3VMFA 2BGIA 3AVVA 1KK2A 3QFRA 3MMPA 1IJEA 1KTVA 3OZWA 4YALA 2VNIA 3A1FA 2CNDA 1VQ9B 3U6KA 1QFJA 2C77A 1G7RA 3WNBA 4RD2A 1KK0A 4ZGNB 4WQMA 1B23P 3I56B 1JJ2B 3LYUA 1KK3A 1G7TA 5GV8A 4TMZA 1N0VC 1E64A 2BM0A 1Q86D 1M1KD 3QE2A 2QMUA 3ZC3A 1FNDA 2QTZA 1Q82D 1K73D 3G6EB 1VQ6B 3QFTA 1YJ9B 3CRZA 3WBJA 5TY0A 5DSZA 4Y9RA 1Q81D 4YAOA 2D74A 3AGQA 4MYTA 1YJWB 1FDRA 1HA3A 2PMDA 4P6VF 2R6HA 4B4DA 4B43A 2VYQA 3AGPA 1N0UA 2AHOA 4QHYA 5KSWB 1OGJA 2EIXA 1UMKA 3I55B 4RCZA 1F60A 1ELOA 1QVGB 4HE6A 1GR1A 1VQ4B 1VQ7B 3QFCA 1DDIA 2BV3A 3CCSB 1CNEA 4RJLA 1S72B 4RD6A 2HCJB 1QUFA 2OK8A 2HDNB 2BM1A 1G7SA 3OJXA 1H42A 4N3NA 4LC0A 3MHPA 3CPWB 1KD1D 4PC7A 5H5JA 2VNKA 4ZCIA 1EP1B 3VO2A 1JB9A 4PC6A 3CCEB 3U6BA 1QUEA 1OGIA 2QA4B 3W5HA 1VQOB 1KK1A 4K1XA 2EFGA 1QGAA 3CMEB 1F20A 3CB4A 4HE5A 3U2QA 4M0LA 4M1KA 3CCVB 3WNDA 1YIJB 3W2GA 3CC7B 1KQSB 3OZVA 5JBQA 4IW3B 3VNUA 1EFCA 3ZBUA 3ZBTA 4PC3A 2XNCA 1GJRA 4Q7JB 2GQFA 4LBZA 2E1RA 1QVFB 4ZCLA 3E20A 1FNBA 2BN4A 4P3YA 4PC2A 4AC9A 1E63A 1R5BA 1BX0A 1VQNB 4NBSA 4LBYA 4UAJA 1BJKA 3VNVA 3CC4B 4J0QA 4ZGQB 3CXCB 1FRQA 1IJFA 2QDXA 4DQLA 4YAWA 3QSYA 3AVWA 1OB2A 3W5UA 2YWFA 1W2BB 3MCAA 3W2FA 4ACAA 1SM4A 3CW2A 1YJNB 1JA0A 3E1YE 1KC8D 1U2RA 3WXMA 3FPKA 2YWEA 5H59A 2DETA 1QX4A 3B8HA 3LVBA 1VQLB 1SKQA 3CCMB 1VQ8B 4BPRA 2PIAA 2J7KA 4RD3A 4B3XA 2B5OA 2VNJA 1AMOA 2OTLB 1OB5A 2PLFA 3W2HA 2DCUA 1ZM3A 4C0SA 1NJID 2BVNA 4MYUA 1W34A 4M2LA 1VQPB 3OJWA 1GAWA 1R5OA 4YAUA 3CCLB 4RD4A 1ZM4A 3CCRB 3LRXA 1QGYA 2B7BA 3CMAB 1K9MD 2DEUA 1YHQB 1J9ZA 3JQRA 1EWYA 4TMWA 4RD1A 1B2RA 1FNMA 3QFSA 2BMWA 3SJZA 1D1NA 3B78A 3AVUA 4EH1A 1QFZA 3CCUB 1GVHA 3JQPA 3B82A 1M90D 2HMAA 2DERA 1R5NA 4LBVA 4U9UA 1QFYA 3AVYA 1DDGA 4F7DA 2RC5A 1VQKB 4PC1A 4R71A 3WY9A 4LBWA 1QH0A 3G71B 4TMTA 5FA6A 4AF7A 4ZCMA 4YAFA 1ZM2A 3ES9A 4B44A 2GPJA 4M53A 2OTJB 2BGJA 2BSAA 1GO2A 3AVTA 4C43A 2VNHA 3OW2B 1D8TA 1YI2B 2DY1A 2QN6A 3FJOA 3OZUA 1XE1A 4TMXA 3AVXA 4TMVA 2NPFA 1D2EA 2VZLA 2XNJA 3W2EA 4FN5A 1G7CA 4ZV4A 3ZZ0A 1EP2B 1TLLA 2ZITA 3I1FA 4DQKA 4G5GA 3CC2B 3P27A 1EFUA 1ZUNB 2QTLA 2C78A 1VQMB 1H85A 1IB0A 3W2IA 4NCNA 2CRVA 1AIPA 1WDTA 3W5VA 4N3GA 1TUIA 2B7CA 4M4SA 1YITB 2X3UA 3WBKA 4Y9UA 1GAQA 4AF6A 5TV2A 1QG0A 5THXA 4QFMA 4B47A 1A8PA 1CQXA 2YWGA 5GV7A 3PENA 4TN1A 1BQEA 1JNYA 3P26A 3V76A 1JA1A 3G4SB 2YWHA 4FWTA 1XB2A
chains in the Genus database with same CATH superfamily
1TKRA 2YFYA 3IJPA 2IOHA 1WQ3A 2IPNA 3JQBC 4DA8A 2JCBA 1P3DA 1B0AA 2BC9A 4R8SA 2P35A 1DQNA 2P7HA 1WPQA 1SVLA 3O94A 3FYCA 3NTUA 4F6LA 1H2BA 3CBQA 1YL7A 1ORHA 1VHWA 1RQGA 1V43A 4RSMA 2JLXA 2JF0A 2X2EA 2NSHA 5MN6A 4I55F 2AGVA 4Y30A 2GM9A 1MAWA 2RGNC 4Z4CA 4YRZA 3UWPA 2M6SA 1NDHA 1EFKA 2A3RA 2WFLA 3OE4A 4P82A 4B6JA 3H18A 1CJMA 2B61A 4G09A 4DV1B 4KQWA 3NH6A 3HKCA 2QX6A 1UODA 2GEKA 2BZ1A 3GUVA 3HXQA 2HWWA 4YCBA 1P9RA 5DMHA 4REMA 4Z3DA 2UVPA 2V4UA 4IXWA 4N9QA 2CF6A 2YMPA 3IP7A 3OEYA 5F21A 4YRCA 4BMSA 2JFUA 3I30X 3WK9A 5I3ZA 2WVGA 3ELDA 2B1RA 2WJJA 2GR9A 1Y3IA 3JY6A 3VRHA 4HC4A 4L8FA 1EVQA 2C04A 4M8KA 4JX8A 3WP1B 3CWCA 1IZ0A 1M1UA 1M8PA 1YZYA 2CGEA 2WIFA 3KQTA 4DCOA 4I1IA 5KJCA 1PLKA 3WNCA 4DCCA 2VAWA 3N75A 4IUCS 4B09A 5DYIA 1DPFA 3M0EA 3VR4H 1A3CA 4UJ3A 1ZM9A 3BKWA 5HCIA 4C7BA 1W2GA 4JUFA 1KOGA 4MKRA 5KC8A 4JB8A 2D2FA 4KQHA 5ALWA 2ZTMA 1NLMA 3LC0A 2XEXA 3OD1A 2CHEA 2AOWA 3QFFA 4IX9A 4KQ1A 3T3GA 1E3IA 4D9EA 2UYYA 3SIWA 1RZRA 3ZPNA 2ZGVA 1W49A 1XKXA 4AJEA 5B37A 2ODTX 4B45A 2IQ5A 1KMCA 3BWXA 5D87A 5K0GA 4RZ2A 3IUYA 2XNKA 1YHNA 4RETA 2GVDC 4U7HA 3DP9A 4P3KA 2PXAA 4MI9A 5LA6A 4PVCA 4L7QA 2OCPA 4KJZA 1V8OA 3QKSB 4HBZA 5IWCA 2J4DA 2MYPA 4IG4A 2V6GA 1E0JA 4ETNA 2HREA 2ZYAA 2YW9A 3UBMA 1HLDA 3TQFA 2YVLA 5CDTA 3GWZA 4LK2A 9ATCA 2C4NA 2JFNA 1NVWQ 5D1NA 2FSUA 3J81A 3SLRA 3SYRA 1Y6QA 1XMOB 3ESQA 1NA5A 1Z8DA 5BYJA 3B9RA 4QJ5A 5T8KC 2SCUB 5TIIA 2ODPA 3N2KA 2AR0A 3BRCA 3DC2A 4QJ3A 1MIOB 5TEVA 2YZKA 5HHTA 2C77A 5FPQA 4D56A 3DLPX 2OCIA 1JLRA 3L3BA 4TUYB 4HLCA 1QLWA 1W5AA 4AJIA 2GCOB 1TEHA 5GZ3A 1S96A 1XEXA 1X1CA 3CESA 1ZA2A 4MGIR 5AYVA 2VWPA 3QENA 1UD2A 2PAFA 3TX2A 5H4GA 3H5WA 1EDZA 4O8CA 1RM3A 1J2YA 5CFQA 1EVJA 2W6QA 3CUSA 2JDIA 2H6EA 3CZAA 2DB3A 1P7ZA 4OBXA 2HA5A 2NYUA 5GM1A 1QHYA 5EFOA 1PUXA 4YYZA 1Y5RA 4OJKA 4DWOA 1KKUA 2EQ5A 3MJSA 3N58A 4ANFA 1P2BA 3KR9A 1GG2A 2JAWA 2XDQB 1BFDA 3FNFA 3F9CA 3G6EB 3DO6A 1H6BA 1P44A 3WJAA 3UAVA 4O2AF 2OGZA 3AETB 2YWRA 2COUA 2QZPA 4RPJA 1XXLA 3RYTC 1G6Q1 2VNAA 2IRWA 1XE3A 4JEMA 2E2WA 1BG6A 4Q3KA 2ZLBA 1K3UB 1AKMA 4WLVA 1GV1A 1GRCA 1M6NA 2CN1A 3FR7A 3UWDA 3VU8A 1H93A 2I03A 3HHPA 5D1HA 3RVJA 2PMCA 1KJ9A 1M34A 1O57A 1ZD5A 2PKYX 3H19A 4XB6B 1DWPA 2I2WA 1G63A 1DCMA 2VXCA 3HYCA 3MRTA 3SAJA 1JLLB 1YE3A 4BNVA 3L40A 4UPVA 5AM3A 3QU2A 1H9BA 4FGUA 4HLDA 3CJTA 3LK7A 2AFIB 4G4GA 4XN3A 3SFZA 1YZVA 4ZQGA 4B31A 1ML4A 4I36A 4BNDA 3Q6NA 1O94A 4L5CA 4LOAA 3TR6A 4MW9A 2JLAA 1Z63A 4XKWA 1QV9A 2YIMA 2VDWB 3CO5A 3LCUA 3NBZC 4AWXA 2VP0A 1OGJA 4FYIA 2Z6VA 3N3AC 2B2NA 5KQSA 4W5RA 2F1HA 4RCZA 4RNCA 3CXRA 5CXUA 3CTMA 5FQNA 3WGZA 5HIAA 2IYQA 4L3WA 3A70A 3WWOA 1EUDB 2I8AA 2ZSUA 5TPWA 5AVUA 2HY7A 1I3KA 3CEAA 4QGSA 4P35A 4KC0A 4LISA 3U39A 3RJMA 4QOGA 2Z5FA 4TS4A 1R4AA 4RBNA 4LJRA 1TNDA 1Y3AA 1XPJA 4BNHA 2XDWA 1BGXT 3KL2A 2P0YA 2EQAA 1X6VA 4RV4A 1YUMA 1H1TA 4WEQA 3GVXA 4DLRA 1SC6A 1DRWA 2R00C 3GG2A 4L76A 3FPHA 4OJQA 4N7MA 1J49A 2V6IA 1XT6A 1YQQA 1W4CA 4K2HA 1XDUA 1YX2A 2FXVA 1M6EX 1UT8A 1NR5A 4KMRA 1E4YA 1O9HA 2P67A 4CM9D 1X77A 1XP8A 5M3BA 4BXOB 3KPWA 4H77A 3OOJA 3TRKA 1FS6A 4MW5A 3VO2A 2BGWA 5CGQB 5AXAA 4BAZA 2HOQA 1D2RA 1YB2A 4HH4A 3J80A 3WDMA 2ZUSA 3I5UA 1VG1A 3IAM1 3SR0A 2WG1A 5CT6A 4E4YA 2WAOA 2IXEA 4F4UA 3RAGA 4FE7A 2PE5A 4P38A 1JYFA 1M8GA 1PG0A 2AVNA 3PICA 1FU7A 4AJ1A 3IDSA 3AT1A 5KNDA 2HEGA 1NQ5A 3I9LA 4X93A 2Z2XA 4F7WA 4CTJA 4X7RA 3SC6A 4TWJA 2EV9A 3EGCA 2HMYB 3PE4A 5FV7A 4BE7B 1U0BB 5BV0A 3AEUA 5EP3A 4XMYA 3IAUA 3SC3A 4DWJA 3AV3A 5ISMA 3AP1A 1ZAYA 2PL3A 3WNDA 3KSZO 3Q41A 4EF6A 4L02A 1BFUA 5B58T 5BSUA 1MDBA 1BX3A 3TZHA 1C2YA 3DXFA 4IGAA 3BFJA 3W34A 2EATA 3X43A 4O4IF 3KWMA 2QX4A 1GZ6A 2DZDA 1Z2AA 2P9FA 2WC1A 3EVGA 3AB7A 3OZVA 2B78A 2ZAMA 1ZY2A 2PKEA 2WJYA 1SN7A 3VNUA 1KP3A 5FYQA 4C4AA 5IJWA 1BE8A 1Z8HA 2G0NA 5H3HA 4ZDKA 5AJYA 1Z18A 3A06A 3EK2A 4Z4ZA 3SI7A 2I76A 3D7SA 2IIVA 3SE0A 2YYAA 5AI6A 3HKCB 4GC5A 1RE1A 4GS5A 1AD2A 3BSWA 3ZWNA 1U8AA 4P3YA 3JZFA 3FUCA 3R9XB 3KKZA 4G86A 1R5BA 1SZPA 2PZJA 4EL0A 1VQNB 4OOXA 3D26A 1E59A 4MH0R 1KKMA 2ZI6A 3PJFA 3QPCA 1LDYA 2P9GA 2Y1KA 4X05A 2ZBEA 4RW0A 1DRJA 5CFMA 1J56A 1T3GA 2JGDB 1E9FA 4FFOA 2WTXA 2OBTA 3A8TA 4MLDA 2R1TA 5F7JA 1VPWA 1PK9A 2JFGA 4RJ2A 4XLCA 3DFUA 4JEIA 1HQDA 2Q5JA 4N4AA 1DIGA 4Q3DA 1VLJA 2O2CA 2I3ZA 3TE7A 1YFLA 4DR4B 5ALDA 1I6MA 4WRRA 4ROXA 3SHWA 4ZJPA 2QDXA 3BK2A 3RYFA 1DTSA 3E18A 3TMAA 2EW2A 1OXKB 4H6WA 4DIUA 3RADC 4N76A 4M6WA 3ISXA 3QSYA 3DV9A 3CVUA 1QHHA 2R751 3EQZA 1YQDA 4ZT3A 3QYPA 1UBFA 5IARA 1Y9EA 3LHSA 4XXHA 1O5OA 3WGNA 3W78A 1JAYA 1RU3A 3BHIA 1TFRA 2Y1CA 1G1AA 1WAMA 3FRIA 1PNVA 5L3SB 1A8HA 1YJAA 1IN5A 4HY3A 3SD7A 5I8ZA 4AFNA 4KPEC 3S2GA 2NV2B 3BQNB 2R66A 3DMNA 2JH8A 1ZINA 4PFSA 3OQNA 1JQDA 3HDJA 2WMDA 5G1OA 3ZVKA 1ECLA 1L9XA 2PXXA 4Y2XA 4YT4A 5EIBC 3A35A 5K05A 1U3UA 5LWHA 3FF4A 4HEA1 4HTFA 2OOSA 5DYWA 3GNLA 3UHFA 5CD1A 1Y7PA 4K81B 4N39A 3G2HA 1QIEA 4DIBA 5B55A 2BE9A 3HG7A 1Z2EA 3PVZA 1E89A 4H3HB 1EX7A 2IOFK 1G6OA 2IP2A 1YQTA 2CVQA 1M1YB 2B8NA 2J7KA 4HMPA 4KWEA 2JFFA 3L49A 1C7FA 1EH5A 3V46A 1K6XA 4Z49A 1MXHA 1XWFA 1NW4A 3PX3A 3IOEA 1EB9A 4AN4A 1WW2A 4G3XA 3C3AA 1ZM3A 3VAYA 3MWYW 4L9SA 3K2QA 3PQ8A 4UZSA 1QGDA 4F56A 4OHWA 3RVMA 1I4WA 1PR1A 3P19A 5TS2A 3IP8A 1MPXA 3MT9A 3GLHA 4YO7A 4GX1A 2D3WA 2W00A 1GADO 1EWTA 1HGXA 1NJGA 3JALA 4KV7A 3HVJA 3P9NA 2E6UX 4GYJA 4INAA 4JKOA 4KFUA 3OQOA 4FFWA 3OJWA 2XOKA 2C7RA 1OH5A 1ZC3A 2QJTA 3C3KA 3LA6A 4X6XA 4ZO4A 3NHWA 3QM1A 2MSDB 5EXEA 3DE3X 2VP5A 3PWZA 3NHUA 4UPEA 5AM2A 1DO8A 2XGJA 5CH5A 3WDKA 4B80A 1Z08A 5JEDA 1X1EA 2I6XA 4D3YA 3HJCA 1E3XA 4XVUA 2Q9AA 1KI6B 1UK9A 1ZJZA 3CIFA 5DHFA 1WUTA 2ZDGA 3OOHA 5JS7A 5CEEA 5KYYA 1XRLA 1T36A 4IXNA 3U3RA 1YI1A 2WTEA 1TJYA 2VAXA 3OI7A 1F2TA 2QVYX 4WFQA 3VR5D 4A73A 3ZGLA 1CZHA 1T4BA 4QGFA 1JU4A 3JRXA 4LV6A 5E9WA 1PJ3A 4WDRA 1RRKA 1YIDA 2MT9A 2ZJ6A 3DO8A 3OCWA 5CT4A 4PO3X 1XZLA 3C8UA 1A88A 1XROA 3A36A 1IRXA 4KRYA 5CJPA 4F2PA 2FK8A 3K6SA 3O0TA 1NI3A 1SBHA 4MVJF 5KDOA 2ZL5A 1BC5A 5ICFA 3WKBA 3E7XA 5EJGA 5IZ4A 4HD8A 3Q40A 4PWZA 5COQA 1RTKA 4GQAA 3C1TA 1U2GC 2GVNA 3EIUA 3VBEA 4BNTA 3EMBA 4UBMA 5SYMA 1HEUA 2E55A 3MYRA 4FHZA 2FSVA 5F52A 2NU8A 3GDGA 2F55A 4I1SA 2JGNA 1FDWA 1CF2O 2FOLA 5HGXA 2P9QA 5DM4A 3VOAA 4RA6A 3KYIB 2EAUA 4LBWA 1E7YA 4JL5A 3PPXA 1VGRA 1ZITA 4QHSA 3RJ5A 1I36A 2WSIA 1MP0A 3D1VA 3WC4A 1KA9H 3M4ZA 4X54A 5I6DA 4XUCA 4KU4A 5MN5A 1JG1A 2EBUA 1DQZA 3BXPA 1TX4B 3HKBA 5JH7B 1AX9A 3GFBA 2MWMA 4PO1A 1I5RA 1HFJA 3M6IA 1OLSB 1WSAA 2DHRA 4Y2GA 5DRTA 2KWIA 1RJWA 3AQIA 4Q34A 1J0CA 5EKDA 3U26A 4KUEA 4C43A 1UDWA 3STXA 2WZBA 5LNK6 5FV4A 1ICEA 3UJ7A 4OLBA 2I33A 3KXPA 3UNXA 2DOGA 3H4TA 2FPIB 2UU9B 1V1MA 3ESZA 2OORC 3QIVA 4RFLA 3ETLA 2X4DA 3AWIA 4P0QB 1YC5A 1O9GA 2X7HA 2H4XA 1Z7EA 3HHEA 2GVZC 3H6GA 4JI0B 2GYUA 4M55A 1VHOA 3IOMA 5EI5A 2Y0PA 4WXHA 1JU3A 3H99A 2FEOA 4G84A 1I2DA 4BAGA 4CEIA 2C2OA 3B5IA 1R7RA 3X1JA 5EY5B 3EY4A 4EL5A 4LRXA 1F1BA 3OESA 3NHAA 2ZITA 5CCBA 5CYOA 3HZRA 3ACBA 4D02A 5JH7F 1QZUA 2R86A 2J08A 4GI5A 4X97A 2XIJA 3LF2A 4CL3A 5I7EA 2BD0A 5C4IA 1J0DA 1KO1A 1VI2A 3JD0A 2XVAA 2V1UA 2BEVB 2ZJBA 5KZMB 2ID4A 4GPAA 5CG2A 1ECJA 1JDNA 4I1YA 1T0JB 3DZFA 1E7QA 1QR2A 2I4LA 1BE0A 3PFCA 1LX7A 4RZUA 5D7NA 4YWJA 4ZGGA 2O4UX 2PGDA 4TTQA 2ZB7A 1A97A 1BRTA 1YC2A 1XCGB 2IV3A 4RPIA 2HCRA 2FR0A 2EP5A 5LIPA 4ZREA 2XZDA 3QPBA 1CQWA 4N48A 3JYOA 3AHEA 4JZYA 4GMDA 2I3AA 4WUTA 2IEYA 4WH0A 2E9SA 4Z9YA 2PMWB 1VCIA 4YEDA 1FDSA 2YN0A 1MQAA 1Y98A 2LIVA 3FPPA 1PIWA 4G0ZA 1B42A 1N7HA 2OB2A 1R15A 4KFSA 3BBPA 1G3IA 1B8OA 2QM0A 2XCLA 1Y81A 1OWPA 4EUKA 3E2IA 4AZ3B 1SCIA 1D4ZA 4MR7A 3CNNA 5FDFA 2JK1A 4NJEB 4OHCA 5DM70 3P26A 3DM5A 2OAP1 2APJA 1FMTA 1I0ZA 2AW5A 1U0JA 1COWA 3MGKA 3PEUA 4JODA 1JYSA 3HU5A 4OMCA 1DT5A 3WIEA 1M8JA 4DLLA 5HW0A 3AEXA 2IXAA 1CB7A 2P7IA 2O48X 1CPYA 4Y9TA 1SCDA 2WSBA 4TL9A 2MINA 3A1PA 3W5SA 2G1PA 3AW8A 3EVAA 2UUBB 4YNBA 4RUKA 4FB4A 4ACBA 2EKZA 5CH3A 1RKQA 4EYKA 4L8GA 1E62A 3JQ7A 2JIPA 4MRRA 1QHHB 4L75A 4MVXA 3OSUA 1BYUA 1F5SA 2BF7A 4YDSA 1U8YA 3SMQA 3H0EA 1WXWA 3W06A 5DX8A 2WZCA 5KTNA 1P0MA 3ZDEA 2EDAA 1RWWA 2PX0A 4TV9A 3A1WA 4N5NA 1L8OA 2OK7A 1JHYA 1QS0B 2XXBA 5KYKA 1TU3A 5HRCA 5C8XA 4BWFB 1NW5A 2ID7A 4ARZA 1CQIA 4BGUA 5IUNC 3HB0A 4UVHA 4L8JA 1G18A 2II6A 2WF6A 3INNA 3PC8C 4ZKEA 4DIMA 2GPWA 3H6HA 4WERA 4ZAFA 3VZQA 2OAGA 2PS0A 2CE2X 3VZPA 1CG6A 1W52X 4H7PA 4HTFB 4K9SA 4N0DA 5EC8A 3ZLJA 4LFAB 4R7TA 3RVRA 1G66A 3N2IA 3G8AA 1OUMA 2CFCA 3B53X 1X80B 3N86A 5K3AA 1MEEA 3RS4A 1VSVA 3RAFC 3AFOA 3TTVA 3NZEA 1HC7A 1K98A 3T38A 4ZAYA 4IF4A 4KQIA 3LGXA 1NJ6A 1M74A 1BX1A 3D5TA 1KQOA 3KPUA 3CZ9A 5A5FA 4NCBA 1X92A 3PA8A 4XZ3A 4FU0A 2YJ6A 2IUUA 1H8EA 1LSUA 5A06A 1AV6A 1HMPA 1SU4A 2CF5A 3ADPA 4L57A 2YJ4A 4ENSA 1HM5A 1QORA 1SVKA 3E8XA 3MJHA 5AIAA 3WYAA 4Q16A 4BFUA 2Q4TA 4F21A 2G83A 3JQ9C 4GMFA 4Y2YA 2EWVA 4KIJA 3GLHB 3H1EA 4M0EA 1BMFD 2WVAA 1Z0ZA 4XA8A 3CBGA 1I4EB 3ZZUA 1ATIA 1E96A 2D2EA 2WU0A 3JALB 2B6HA 4QOSA 3SEQA 2E5FA 4CFYA 4O2BA 1R50A 1YRQA 3MW8A 1SKYB 2QYOA 4DDMA 1PFUA 3ADBA 4HNUA 1DAIA 4XR4A 1PVDA 5MGNA 1NW3A 1QXSA 3UANA 1VXRA 3LUJA 2Y1EA 4A3SA 5BN1A 2AEMA 1XDZA 3I37X 3DEKA 3O8NA 3KSAC 3N0TA 4HWTA 1KAOA 3B52X 3ZYCA 1ZK1A 1HLGA 1L7AA 2W6JD 4PGAA 4QYWA 2Z9DA 3PUHA 3RRBA 4RJTA 2BGGA 3ENQA 1CC1S 3M7IA 5K8LA 4MPPA 4E5MA 4C2AA 4FPXA 1R37A 2J67A 5ESDA 2JFHA 2IYYA 5KWIA 3H5IA 3NIWA 1BHQ1 1F2TB 2GARA 4KGZA 3WNBA 5F7XA 1KK0A 1SQGA 1T91A 1N0HA 1T6NA 2YS6A 1SQ6A 3S55A 3CYFA 3T3IA 5I7WA 1UD8A 1D1SA 4U7FA 3PV0A 4HDKA 5EERA 2RJNA 4M1TA 4EJSB 1L4LA 1JPUA 1IOWA 5A02A 3H04A 1R1DA 3NPMA 2GM3A 3L41A 2VDVE 2Z1DA 4XQFA 4R84A 3KDSE 2Z83A 3PF9A 1U98A 1IEVA 3UAZA 3EDQA 4ER6A 4NBUA 1LPOA 4MYDA 5EZ5A 3KZCA 4PZAA 3EBPA 1JL3A 3L43A 4YLYA 1JHOA 1L8AA 1E6EA 2PT6A 2GZ1A 1DZ3A 4JBIA 4K6HA 3KYCB 3QFTA 3I1JA 1PJRA 2ODWA 1XFOA 2J7PD 3CRZA 4JSRA 4AJPA 3NM4A 1JDVA 2QMOA 4D5GA 4MYCA 3AERB 4YR9A 5JS8A 2YZGA 1YJ5A 4V1CB 5A7GA 4Y9RA 2YN2A 3AR5A 1Z4PX 3SJCA 1HK7A 2QQ5A 3PUIA 2OLKA 2P4SA 3NWBA 2GD0A 5EZSA 2JLWA 1T2UA 1Q1QA 5A03A 3K9QO 3GFRA 1XN4A 4UVGA 4MYTA 4J1NA 4CU5A 1XNHA 1NVMB 1YULA 4TTJA 2TYSB 5FWNA 1AZTA 4KP7A 5LU9A 5E6TA 4P6VF 2SKDA 2YHIB 4R2LA 4S24A 1LNSA 5EMMA 3NCTA 4BNLA 1Z0AA 3QVWA 3BMXA 2IIBA 5E4YA 3RTDA 2FTKE 2VYQA 3NHLA 4HWOA 1GCGA 3TPZA 4F5WA 3QBEA 4Q18A 3S1AB 4A9AA 3T0GA 3HYLA 2WINI 1J7KA 2WIBA 5JCJD 5JRDS 1LA2A 3F73A 1V1MB 1LDBA 2VRCD 1S02A 3EC1A 2GM4A 2H4WA 3EJWA 3R5TA 4MYHA 2CLIB 4NOLA 1T2DA 1J8MF 2ONJA 2VBTA 1YRAA 3WJ2A 1C0IA 4NEQA 2PUJA 2Z2YA 1HXHA 5ICMA 3GGDA 3FSGA 5A5VA 2VT6A 1DIBA 1SG9A 1V47A 4Y2PA 5CLHA 2BIFA 2OBMA 4G23A 2PRZA 2WABA 3O92A 4CV2A 3LNTA 2PKQP 1E6KA 1DDIA 3LC1O 3EXHA 3IS3A 3FTDA 2GA8A 2LE0A 3EQ9A 1LEHA 3HP4A 3LC7O 4MIKA 3URKA 4AECA 4FCTA 4F93B 3ZH2A 4UBOA 1OXXK 4WBNB 3AEQA 2QN2A 1WZNA 4WECA 5REQA 3U49A 3BDIA 1VL1A 2HQOA 3U44A 2WYUA 2O8CB 1N0IA 3BWYA 3FDIA 3P9KA 4MUEA 5DLDA 3LVRE 2BKXA 2C3MA 3PUVA 1U99A 5DGXA 1UDCA 4R0NA 3MF4A 3KJIA 1YOVB 2O3SA 2Y4NA 1A2BA 1QHSA 3ZVNA 1WZIA 2VUUA 2Q4DA 2FHPA 2I22A 3A1VA 5L3QA 4BNUA 2RCYA 4ASUD 1NNI1 2QQ0A 3D6HA 3K72B 5EXPA 2AKYA 4IMRA 1H6CA 3U1BA 4GOND 5IFKA 2A5LA 3KRTA 4PEVA 3L4BC 5C8ZA 2FEXA 3X44A 1TRHA 2B82A 2VJKA 4X1YA 2PO7A 3L9XA 4HAZA 4LWQA 4AZSA 2QEQA 4TKVA 3BEOA 1O95C 4XPIA 1HYQA 4CR7A 1CUJA 1BOFA 1SD1A 3F1LA 3DBRB 1IAQA 3RT1A 1M33A 4JI6B 3BA6A 3CWZA 3WYFA 5B7NA 1NGSA 1SHJA 3KALA 2YZ2A 1TK3A 4MR7B 3S8EA 3EOBI 3QBVA 4XEHA 2X0RA 2IEDA 5B6JA 1OMOA 1MJNA 2Z9CA 1E0SA 2IU3A 3FGPA 5BN4B 1DEXA 3WB0A 4DEVA 2NXNA 5KDDA 5KX5B 3CC7B 4F9FA 4A15A 4UM9D 1T9GR 3FHTA 4Q3EA 5BNFA 1N3YA 1GA4A 1P91A 1IZ8A 4MINA 3BA1A 1ZISA 4KNVA 4LSMA 1RYEA 4Y2HA 3W1EA 2XYPA 2QUIA 3F98A 4URVR 2F8MA 3G2IA 2TMYA 2BHRA 5EHXA 1JEYA 3IUJA 2GF9A 3TG8A 3CNOA 3H2JA 4LBZA 3MYYA 2H7XA 1RYYA 3F47A 3OU2A 5FTLA 4PX3A 2CXXA 4UKDA 2Q5EA 3TCKA 1IBLB 4HFJA 4GAEA 4MGKR 1SY7A 1FC0A 2BH2A 3R3HA 3W8EA 4DTCA 1AV7A 1C14A 1M6VA 1SVIA 3I5AA 4GL4A 4PC2A 3FKQA 3QJGA 4I1VA 4PLTA 1I7DA 9GPBA 2A5DA 5P8WA 4M7RA 1SBQA 5FOUA 2PJUA 3QF4B 2XF2A 2QTMA 3ZWWA 4JYAB 4LBYA 3FBTA 3THXA 1XMIA 2XR1A 1WQ4A 3EVEA 4WAUA 4Z0TA 3UY4A 4DMHA 3RT9A 5GONB 1I8TA 3OP1A 1XZBA 1KO5A 1AVTA 1JEJA 4WGGA 3SBXA 4XR6A 1D1PA 5CA0B 1QZTA 3T5AA 1KGSA 1EFVA 1PGJA 3MLBA 5JWHA 5KQLA 4DQLA 3UWKA 2XKJE 4B32A 1J1IA 1HDOA 2CE7A 1H4VB 4REQA 3DPUA 3FI0A 1Z5GA 3K1ZA 3QMWA 4B17A 1KWKA 2NPOA 4DC1A 1LZLA 4MZDA 2X6YA 4W5WA 1T1EA 1ONSA 1WB6A 5ENVA 3VV3A 3GVKA 5DI9A 5F7OA 3EZ7A 3QA3E 2B7LA 1DIAA 2DYKA 3CW2A 2XYGA 1YJNB 4ITRC 2G1AA 3CW8X 4YV2A 1CUIA 5CIYA 4DM3A 1DFHA 2HQBA 1NVFA 1NVVQ 2OD9A 1J2EA 1LCIA 3L7JA 3WXMA 5EHIA 3TEJA 5GY7A 2QQGA 1FDVA 4NS4A 3FI9A 3U3OA 5LB4A 3W1WA 1E6LA 3DE2X 1U1EA 1QMPA 4O2BF 1YQEA 2OL4A 1NF9A 3OZEA 2PSJA 4MR9A 4R4JA 4BIMA 4DZRA 4OUDA 4ZOEA 1FJ2A 4OYYA 3BEDA 3M3PA 2ZZMA 5PGMA 1N05A 2PL5A 1C41A 4BVFA 1XRQA 5IJ0B 1FY2A 4XLHA 2RE8A 1EDEA 4GZLA 1GITA 1GKIA 5FBHA 4CIWA 3CWQA 3UMSA 5E7QA 1U31A 4JENA 2Y27A 1VCHA 2PY6A 4XVRA 1P80A 3GMTA 2ZYUX 3SXUB 2W2OA 4PG8A 2WF8A 1VL2A 4MW1A 3TL6A 3PQ2A 4IIYA 2GILA 1U3VA 3B1WA 1PBTA 3JYPA 1NXVA 3T5DA 1DRKA 3H1TA 3NO4A 4BO4A 2NM0A 4FW8A 1T9GS 4G6ZA 4TRNA 4L2IA 2NYRA 4BMXA 4RTLA 1NN0A 3ML1A 4M2LA 1NM5C 5IYQA 3KXDA 4D97A 1J23A 1CHNA 2GXUA 2SECE 4NI5A 2IHYA 5EKTA 1Z6GA 1HOXA 4V0QA 1WKVA 4PLYA 1HORA 4NHOA 4GGOA 4NENA 2AEEA 1YMVA 3CINA 2I4OA 4QYMA 2BDTA 2FZWA 3UUFA 3B1JA 4BECA 1C3XA 3ZZNA 1NMYA 1ZM4A 1ZCFA 3FPJA 2PNJA 1PR5A 4W8OA 2DBQA 2G17A 2F4NA 3L6RA 3MINA 5I7OA 2EFDB 2IDJA 4OB7A 2WZNA 1C9EA 2IZZA 4BQNA 1K9MD 3PGVA 1IBCA 1SHKA 2JIOA 4FIZA 3IE0A 5CT8A 2OUIA 2P9YA 4GDMA 4KVFA 1JZTA 4QPJC 2QTFA 2PMKA 1ZSYA 3H13A 3DE0X 3KOOA 2JGAA 1RI4A 4EY4A 5JJCA 3KYJB 1T3ZA 2G7ZA 3SZUA 1E5XA 1SHLA 2UVDA 1P6UA 1YS6A 1UKYA 1URPA 3IUMA 3O1IC 4X8HA 3WYBA 5L46A 4C0JA 4I6EA 3SC2B 2Q3HA 1QCYA 3LWBA 2BSXA 1FXSA 4MWOA 4LYDA 4M54A 4LYJA 3UXEA 3IAM6 1QFZA 4C1NA 1LQ2A 2FOXA 5TPZA 2WJVA 3ESCA 5C0OE 4B33A 1ZUD1 2WE8A 1GVHA 2Q7DA 1K8RA 4YCMA 4UMEA 4OD0A 4GRDA 4G0QA 4G01B 4H3SA 3RSGA 4HRXA 1YR7A 1YDMA 4H27A 4QUEA 1XK7A 4FGZA 3ZI7A 4I8XA 4CDNA 5BXQC 4LJ4A 2NTYC 4O0LA 4C4RA 5FWXB 4M0FA 4DWWA 1ADCA 5FFFA 2EGHA 2B4RO 3P96A 1GG9A 3R7AA 2RC5A 3BXOA 3GT4A 4EYQA 3BT7A 5SYAA 1KEPA 1CUZA 2VRBA 5K3OA 2PANA 2XIQA 1Z4QA 7MDHA 1Z2NX 3OIWA 1FTYA 4FZ5A 3SP1A 4A1FA 2PL1A 3AF3A 1KOJA 1Q84A 4EM6A 4K6GA 1XPUA 3EULA 4WTOA 1UJCA 3I3OA 1XZEA 1JVBA 3ZHZA 2WPNA 4X85A 3JD3A 4RLSA 3EGVA 1R6VA 2CHQA 2FZKA 1KDZA 3TXAA 4WZTA 1A7UA 2QTAA 1C9NA 3OZBA 4JP1A 1B0ZA 4Q03A 2F90A 3EEBA 1CE8A 4DZTA 3PUZA 4BCBA 3OCXA 3KQHA 2AG6A 5JXGA 4ND1A 4II7A 2CKMA 2QN6A 1IHYA 2FUCA 1RCFA 3A4TA 2QRZA 2KVOA 3KK0A 4G37A 4LTDA 4OI2A 3MTEA 5J5CA 4F72A 4DUGA 3TNLA 1T8RA 1MV8A 1YCDA 1P1CA 2B8EA 3LXXA 2CSXA 3PGA1 1MUUA 1UL1X 2C99A 4R1UA 5JYDA 4HF7A 1KZ6A 2NPFA 2WUFA 4WHMA 4G8BA 2VA8A 3PEYA 2CFRA 4EF4A 3PA2A 5FBVB 4NK5A 1W36B 2CVPA 4RVNA 3DDHA 3DMTA 3ZD9A 2Y9MB 2GESA 1ZOOA 4FEEA 5DT2A 4A03A 3RTCA 1YTUA 2N46A 1LDNA 2AA3A 2X0DA 1UZLA 4TTTS 3U61B 1A27A 1VBNA 3KUXA 4DQKA 4F9TA 2VYVD 4G1CA 1TW2A 5DBFA 4EHJA 2MU1A 3CEPB 3BJEA 3LXUX 2Y1XA 4NMXB 4TQUS 3DOOA 4Y3UA 1N2OA 5IYZA 3VR6A 1BU8A 2VJAA 4Y2VA 4WE3A 2OV3A 2C2MA 4DMLA 4CFZA 4Q1EA 1JPVA 2R1ZA 2ZBGA 3OMLA 5UKDA 3EODA 3RDPA 2C3UA 4GP7A 4CU2A 1HZEA 3L0ZA 1V7QA 5HIIA 2ANCA 3JWIA 2FZCA 1R00A 4Q66C 1AKVA 4OHZA 1EWVA 2A9VA 4ND2A 3LUPA 3A3NA 3PRHA 1M2JA 1RRVA 2GHTA 1DRVA 1OI7A 1UXIA 3I04M 1VRCA 4O4JB 3IT3A 5KYNA 2BKLA 3U9SA 3BSYA 4EYEA 1YH3A 1TT5B 2JJ1D 4YECA 2ISSD 1F48A 2QE7D 1GKKA 3G49A 4OXIA 5THXA 1L4YA 2H7VA 1AUOA 1QX3A 4TQGA 3VVBA 4AMGA 4LVNA 4LX8A 3TAXA 4EHKA 4PYJA 1SOUA 2HIAA 1GNVA 1B26A 4ZQIA 5C32A 2O14A 3QWHA 1MFPA 4JJEA 3ZDQA 2XQIA 4FW9A 5DE3A 3RRNA 1U7TA 2IH2A 4PINA 2ZZGA 4YUVA 4G2TA 1EA7A 3F7OA 3RU9A 4X63A 1YB6A 2HSWA 3KOMA 4E14A 2IIQA 3QMMA 3ST7A 2AR9A 4QXPA 5CLFA 3EPKA 3K96A 1A5BB 4Z5XA 1N1DA 1XDDA 5GOZA 1NW9B 2HTEA 4OL9A 5HBGA 5KYGA 3MMXA 1MRSA 1W35A 4Q1CA 1Y7HA 1W4BA 4Y2QA 3IV9A 1EK2A 1KRWA 4XD7A 1VE6A 2YYYA 4REQB 2L0XA 3JQ8B 2C83A 1U9ZA 2BHSA 4FFLA 5EKXA 5DEOA 1ZR4A 5DPMA 4BNIA 4GYYA 2UYQA 4YUYA 3HVKA 3SZRA 2C3PA 3D8BA 4NKRA 4TRMA 4GLFA 4I2VA 3LW8A 3GI1A 4HDAA 3CZPA 1O8BA 1RRPA 1QB7A 3DSRA 4RGVA 1K7XB 1G4AE 1NYQA 4FS3A 3BH7A 1UJ2A 4X90A 1SCNE 1GRRA 5SZIA 3IKJA 1UJ6A 3V6MA 2Y05A 3LBIA 3OCVA 1QHXA 1QOQB 1GCIA 2Q6OA 1YS2X 3HNRA 5HKKA 1T5LA 4OH1A 4H4CA 2ZG6A 2I7VA 4HPWA 1TM5E 4XUDA 3ZDYB 4DRYA 1XZIA 4PVDA 2C2XA 2R7LA 4MR9B 1WXQA 4NCIA 4MS4A 4OUDB 1GQSA 2WD7A 4XGQA 2IBMA 5JYEA 2ADMA 1SHTX 2RI1A 4TXNA 4AKIA 3AV0B 1ULHA 5HRAA 2AI3A 2G0TA 5K3FA 2GDJA 1JSRA 3EXFB 2ZZQA 1B3BA 1WSVA 3KAQA 1G4HA 1Z5OA 4CUJA 2XMSA 1P81A 4EYGA 3PQ6A 4MB2A 1T5BA 4U2GA 3FKJA 2R5NA 5DX1A 5DXJA 2KLBA 3MBOA 3I3SR 1LBTA 3VXKA 1ZR2A 4CXMA 2A0UA 1AXRA 1AZLA 2CLOB 3GMSA 4TYMA 1JS1X 4WZ6A 5DN6D 1SUWA 3T1YB 4K9QA 4RCYA 5A05A 4PX9A 5DN9A 2PUBA 2Z4TA 3W7BA 1W5SA 4BNYA 3VO9A 2RC6A 1CJUC 2YWXA 3DYBA 3GY0A 3IJRA 4YV0A 4WZKA 5HXBA 3LDAA 3TDMA 3V7FA 3CSSA 2OT3B 2PU5A 3QEJA 2N3ZA 4Y18A 1SZJG 3KZVA 4LZJA 5KB3A 4G81A 5AK6A 3GLGE 2WFZA 4NDNE 4PYNA 4JBWA 2HXYA 1X7WA 2AIRA 4X9XA 3THWA 2VATA 3OETA 4ADSG 2Q6LA 2IPAB 4Z1MA 1PW5A 3D3WB 1R88A 4IUYA 5DBIA 4MJ7A 3ROXA 2GLXA 1KJNA 1RHMA 3MJVA 3CN9A 1CUXA 4GM1A 4ILEA 4ZHQB 1X9GA 3KTAB 2ZCVA 5ECGC 3ZBPA 4MWTA 4PF1A 4ZI7B 2VCEA 3ICQB 3MINB 5T64A 1G17A 5HFJA 4M1OA 1VQ9B 3TFWA 5KHLB 1KZHA 3EEOA 3W5IA 2GTPA 3LRTA 3VC3A 3ZOZA 4BWVA 2UYCA 1TMKA 3F5FA 1XHFA 1WV0A 2CFIA 3ZWMA 4UHEA 4UHBA 3V3TA 4HO1X 4D57A 2BMFA 4P5PA 1WABA 3QITA 3AKCA 3U40A 4JJ6A 1QM5A 3QKRB 2BLLA 2BGTA 1PWZA 3HN2A 3LYUA 4RELA 3CZ4A 5GV8A 2QDKA 1P4SA 2HJSA 4WVLA 3RKRA 2PQMA 3UMCA 5IYWA 4QUHA 1CKEA 3Q5GA 5C7OO 1H6DA 1H2RS 1P39A 2R65A 3B2QA 4HRYA 3V4LA 5FPKA 4A8PA 3UJNA 3N53A 1Q3TA 3EWAA 1D2GA 3L4EA 3B8EA 1IMOA 3PNYA 4G7XA 1JHDA 3WRYA 4L7VA 1PW7A 3RKUA 3MWKA 1B43A 4HX9A 4P22A 3EASA 5BR4A 5LQDA 5AUOB 1Q81D 1ODTC 2OV8A 2QD5A 3WB2A 1CUVA 4MUXA 3AEKB 1F8XA 1L0BA 4OGFA 4DE5A 3UPTA 2JRCA 5EUQB 4IHJA 4BNNA 2BGNA 1JDTA 3ICCA 3ORSA 4FSXA 1YJWB 2R7KA 4XX0B 1E60A 3KXIA 3V1NA 1ZO8A 3OKFA 1F8UA 2VBIA 4KDCA 2AV6A 2COEA 4AURA 5EE1A 5FI1B 1CE8B 3D81A 2BMAA 3CB2A 3VNRA 1JSXA 4RENA 4U0KA 3A1UA 1KGDA 3D6JA 2ON6A 2B1GA 3L0OA 3L9WA 4D1YA 3SJPA 3B38A 3LY9A 4KUGA 4JB0A 1XLVA 4F0JA 1UK6A 3R9IA 2LCIA 4FFBB 3HKEA 2NAPA 4Q9NA 4KPUA 4X1KB 2DPYA 4IXMA 2HMUA 1GQ2A 2J85A 4C6SA 3U9TA 4G5YA 3AESA 4XIGS 3DZIA 3Q6RA 1JJBA 4RK6A 1U81A 4MYSA 1PJ8A 1NQOA 4B4UA 4C4OA 1MO4A 1Z34A 4O4HA 3VSAA 5IYZB 4ZCPA 1MH1A 3IA7A 5JI3E 4Q48A 3GLIA 1N6OA 3QIAA 4UZFA 2OMEA 2V96A 4P5DA 5H70A 3QZUA 3B2EA 4TVBA 4N3NA 4MRSA 3UH0A 5JY1A 3Q8KA 3KFVA 3B3GA 4C7XA 1UDBA 2PUVA 4AG6A 5KU7A 3L4KA 2V7UA 4BU1A 2HF2A 1P4RA 2CLHB 4C2BA 5BUZA 1JB9A 1T5EA 2WMYA 3ZHUA 3U7QB 4IJQA 5LB2A 1WXHA 3OTHA 2I1LA 3DBVO 4HUJA 1I1HA 4JL6A 4XCQA 2Y1LA 1ZMOA 3IBSA 4WW0A 4DQUA 4EDFA 4HNVA 2J0VA 1OGIA 2XGSA 1EGQA 2CHGA 5BRAA 4DSOA 4NZYA 4JFAA 3RVDA 1VQOB 1K6EA 5AJUA 2EIHA 3ZTTA 1B0UA 1IY2A 2E85A 1W25A 2FK7A 4YQZA 3UFXB 1DJMA 4K1XA 2KW5A 4JR0A 2HX1A 1WL8A 3M1IA 4J75A 1MX1A 5KNDH 5BP7A 3A3PA 1NBME 3P20A 3IRVA 1ZK2A 1ZMRA 5D7BA 4ZAXA 1MPTA 2JPDA 3EUWA 2M6KA 1HZZC 3ETCA 3NYRA 5L4NA 1ZNZA 4UMDA 1PNRA 4N65A 3ZJYA 3GUUA 1ECCA 2N0SA 3MGGA 3ONYA 1K3FA 5A0TA 2BTOA 2ZULA 4NTZA 1KDYA 4RORA 4KHPB 3T4UA 1SKAA 3NDRA 2ZRKA 4UXJA 3U3MA 4PRYA 1NU6A 3MM4A 3T4EA 2QRLA 3BMOB 3OFND 5A6SB 2YZMA 2BDEA 1DEHA 1RWNA 4PC3A 2QLNA 4W1QA 5HTOA 3HYTA 2FEPA 4YDHB 3R23A 2YC2C 3L8GA 4Q7JB 1E9SA 1OT3A 2OZKA 2VWQA 5BY2A 1PEAA 2G1JA 3LE8A 2PSDA 2XMGA 3LQKA 1I7NA 3K4PA 4M88A 3U19A 4P81A 4X24A 5AKEA 1VHLA 2XD9A 3CS3A 4PPYA 1AZSC 1IM5A 1H8HD 1TZBA 2RFLA 2V7QD 3C85A 4QU9A 3ETGA 3T7JA 4UUNA 5JLJA 2HGZA 4ZV7A 3RU7A 3B6MA 2B98A 5M34A 2GS9A 1D0IA 1MAVA 1RPAA 3SM9A 5JAIA 2I1VB 1Z4KA 1Y6RA 3LCJA 3OOEA 4WOCA 4ALJA 2VL7A 4G1FA 3JAWB 3DC7A 4BQSA 4F3RA 1E2GA 3GRKA 5COBA 1BJKA 3SPXA 3TGWA 1I6LA 2P41A 1TIPA 1E2LA 4IYRA 4GLJA 3H1GA 3DFIA 3NR2A 3SLKA 2F9LA 1IBRA 2AEFA 5LKRA 4EUEA 2H0RA 4FX5A 4K2AA 5DRYA 1UANA 2DCMA 3FPGA 4YRFA 2CHVA 4FBGA 1QQTA 5LWQA 4EHNA 3SZOA 1Q15A 4DMRA 1BH6A 1KMHA 1OU4A 2GMWA 3H97A 3I1IA 4FMDB 2IYFA 4IH1A 3ZHXA 1YI8A 2WY2D 3ZVLA 4A8HA 1PJ7A 4DQXA 4M89A 3SXPA 2ZIVB 1YKFA 3ILVA 2A1UB 1H5QA 2I6UA 3HXPA 5AHXA 4NOKA 4X44A 4BE9A 1FFGA 2DFPA 5IAAA 3SQXA 1YIAA 1BCSA 1WY5A 3R77A 1XZKA 3R41A 1KEKA 1E2QA 5D3QA 4YEJA 1PTJA 1OAOC 3HXOA 4JI4B 1Q5PA 2PK3A 2IE8A 2R48A 2GBLC 2D54A 3TKAA 4BFTA 1Z0UA 3L6DA 2H85A 4DRZA 5AQEA 2AL7A 3KL9A 2NU7B 2G9ZA 1JAZA 1K7YA 3DOHA 3OFKA 4CDRA 4EVQA 3DEYX 3KE8A 4J0HA 4KQ9A 3A10A 1JQJC 4UDNA 2H4FA 5KVCA 2C2WA 1R8JA 5KOHB 1FLAA 1TCCA 2Q21A 3U7IA 5FO1A 2GK3A 4D8UA 2D5CA 5BN3A 2HLNA 4KMOA 3RJZA 1XCOA 4LQDA 4XL9A 3E9YA 1XHEA 4KWHA 3X1MA 4I6JA 3NW9A 3WLJA 1TI7A 3CUUA 4JGGA 3EWSA 3SNHA 1QK5A 2CLCX 4E5VA 2PZEA 4EFKA 3EDMA 2XA9A 2VNJA 3OC6A 2JARA 2VR1A 4J2OA 2HH9A 2O2DA 2EL7A 2YX1A 1L7RA 2PBRA 3I8XA 1LJLA 5KWSA 2OQIA 2JIDA 3AFNA 4J7AA 3OLYA 1SXJC 1CY4A 1FS4A 4K6CA 3RC2A 4BQOA 5ITSA 1Z12A 5JCZA 1T8UA 3W3ZB 2P2CA 1W7AA 2V6JA 2CL0X 4QTZA 2QSJA 5C1BA 1O6CA 3AVPA 1DAMA 2ID8A 1FSFA 4KPFC 5AW9A 3VZBA 4DARA 5B3LA 4QBHA 1DIRA 3IAXA 3K31A 3UHPA 1WQ1R 1R5OA 3E4CA 3OIGA 1T13A 3GJQA 3OA2A 4LGYA 1E2MA 1YHYA 3RS3A 3WDLA 2AF3C 2OZLB 3PFHA 2OYCA 2X5NA 4MAFA 5IJAA 1OGYA 1VP9A 1ZX1A 3SS7X 3LX5A 4UTRA 2JD0A 3DZKA 3JYHA 1VMIA 3INRA 2VEDA 3D4IA 2HBYA 3CKYA 1XEWX 3N8HA 3CZCA 1P61B 2Y71A 3IODA 3PRKE 4KLAA 4O08A 4YGYA 5GJWC 1T6BY 1V71A 3A58B 3HCAA 3TKYA 3WLSA 2XT0A 2BISA 3L02A 3UK7A 1BXKA 4WCVA 5BQPA 3LY8A 5TGTA 3P4UA 4IHJF 4L5AA 3PXBA 3MJFA 1CY8A 1U3CA 5EHZA 1SXQA 1E1DA 1DQPA 4MV8A 1WCWA 3O3OB 4LXGA 4XGNA 5BV2P 1AXGA 3B48A 2I34A 5H3LA 2BMWA 2F67A 2PX2A 5AIBA 2JAHA 2O06A 2PM8A 2BFMA 2OHOA 1C7ZA 3E48A 3GAAA 5SY4A 4YP5A 2CJWA 2ZPTX 1M90D 3WADA 3ZGYA 5A1TA 1VJRA 3WXBA 1W4RA 4G97A 5J4KA 1ZRHA 3C6XA 4J7XA 2JI6A 4L07A 2IEIA 2WUWE 4NBNA 3NOXA 2HIMA 1GTVA 1B16A 4Y6RA 4X3PA 4WN9A 3OM1A 3N0XA 4OQQA 3DXZA 3HKEB 4GNKA 4GOLD 1CJVC 4Y6OA 3RYHA 1X86B 5HZMA 3EXIB 1FFSA 5ILQA 3TG2A 4HGPA 4AP5A 2PUEA 4YJGA 3WX0A 2IF0A 1SCBA 4WKCA 5LJLA 3QLTA 1QANA 1KJYA 3S27A 3LQQA 3NHFA 2KM1A 1JTFA 2DFKB 2AMVA 3HXLA 1KORA 1XRNA 3CE9A 4V02A 3ANYB 3EJ6A 4ZCMA 3QEMB 1LK0A 1T1IA 3QU7A 4KN5A 3I9V1 4O4HF 4OYRA 5HZAA 3EZ2A 4L15A 1Y6GA 1KQGA 4RVUA 1N25A 1J2RA 2DPMA 2VK8A 4MUGA 5FT9A 4CKEB 2VNHA 3MJCA 1G9XA 2VP2A 2VWGA 1N92A 2OHFA 3W2TA 4UUQA 5IAJA 4FZVA 3COSA 1FTNA 1RI5A 1XZCA 2O7RA 4JLNA 4X20A 5BRNA 4H0FA 2RAPA 3T41A 3ZEAA 4D0SA 3RABA 2H2FA 4IMIB 1ABEA 1CX9B 2O7NA 2LP4Y 5EMJA 3SDBA 2H29A 1G21E 4O2AB 3C3BA 2I6TA 1X9IA 1XL1A 4RK4A 2AZ4A 2W2QA 4M99A 3MMSA 4UE2A 3QEOA 1UQUA 3RIEA 3SHVA 5GJBA 1RIIA 2HT1A 3B1KA 2DQZA 1MC5A 1PKEA 2F2TA 4L0QA 4AROA 1CDZA 1TLLA 2HNKA 4BQRA 2GUGA 4JLAA 4JWTA 5AKHA 3AG6A 3K4HA 1HFWA 1N2BA 2ZR8A 1L4MA 1L7QA 1V5WA 3IPRA 3KQSA 3NGLA 4WZAB 2J5KA 1BEUB 3HI4A 2BCJQ 4NH4A 3M9XA 4HGOA 3L82B 1HYEA 2VUHB 4B7UA 1ZUNB 2P40A 3RC9A 2ACVA 4BMZA 3HC7A 4CGYA 3PDCA 2R4UA 3K94A 4ZVTA 4DCSA 5AP9A 1M0TA 3G0IA 4FZRA 3FJ1A 3BIWA 4KQMA 1AM4D 4MS1A 3RLFA 1JRLA 5FOQA 3C6BA 1SXJE 4LRUA 4QUKA 1MRNA 1W93A 3HA3A 3AKZA 1NHWA 1DAFA 3STHA 2XT6A 5TMPA 3TZLA 3HCNA 2G9UA 3DTYA 4D0RA 1EPUA 3KHKA 5LZ7A 4DM4A 4GLLA 4IIGA 4CKZA 2J3IA 2EBHX 1R12A 4L95C 3WE7A 1MKYA 3LS2A 3KVRA 2Z6BD 5F7ZA 3SSOA 4NFSA 3K1TA 1ODCA 1XEWY 4Y9UA 3TM4A 1KFJB 2WF5A 1FPMA 3TW8A 3BXGA 5A3SA 5J2UA 1QK3A 1SC3A 1A8PA 2G7MC 1V4VA 2X13A 3CRRA 3D3JA 1E9AA 3HB4X 4NBLA 3WNQA 3IPCA 1X1QA 3CNHA 4WINA 4MRAA 4EI2A 5AJZA 4EG6A 4JC4A 2HUNA 4ER5A 2BUBA 3O21A 2FX5A 1QH1B 5KNBD 2PUWA 5HVNA 4NNOA 2EL9A 1P3Y1 2YJGA 3N2GA 3L0CA 4ENUA 1GT6A 1UEIA 4JP3A 4KYTA 5FL7A 4DGQA 4Q4AA 1VHEA 1LFDB 1MHPA 2DFVA 3BVPA 2V9CA 3AUFA 1N75A 3KJEA 4OHPA 5FORA 5C46F 4F6RB 4MK4A 5ANRB 3C3XA 2PUCA 1TFUA 3GUHA 4KMMA 1ZOSA 3CLSC 1Y9AA 4XJXA 2NLOA 1DLIA 2A57A 2IGTA 3A8IA 2PBLA 5KAPA 1CIJA 1FRNA 3U5ZB 2GCNA 2YRWA 2QL6A 4DZZA 1QF9A 3OKPA 2XZPA 4C6HA 1S1CA 3HACA 4PSAA 3S2UA 1NWCA 2FX3A 2BLNA 2BFOA 3CTPA 1J7JA 5CURA 2MSEB 3KBBA 4ICIA 4U2DA 3ID6C 4B6FA 1W85A 1YL6A 4KFRA 1YRLA 3L1KA 4YUAA 4QRIA 5G41A 2FGKA 4R1QA 1BCSB 3E9RA 3HJRA 3UG6A 5LJIA 1TVKA 1P5FA 3Q0TA 1R64A 2C5AA 2LPMA 1QO0D 2EKPA 2QNBA 2W2LD 5JMTA 2D3TA 2XYRA 1L7VC 3UH1A 3Q4GA 4FBMA 4ZYLA 2ZXFA 2ZCUA 1N2CA 3KFXA 4IIXA 1UFVA 4IZOA 3SVZA 1WHTB 3K1YA 5K6AA 1TJNA 1IG3A 1QSGA 3F3SA 4JVLA 5TC4A 4KITB 4O4IB 1II8B 5G1NA 4NECA 1VIMA 4G9EA 1RZVA 2WJPA 5FLYA 5H82A 1JEDA 1JKXA 4ES6A 3E22A 2NUPA 3I2JA 3JQ6A 1VB5A 2GFHA 4H16A 3LX6A 1CP3A 2WG0A 3P0HA 4XTRA 4FYXA 1YFJA 2VJCA 3BAFA 4KLRA 1IHPA 1TLFA 4US2R 2WE7A 1EFPA 1K08A 3OP4A 5JQGA 1RADA 3OKAA 4IP0A 3BZWA 2OXIA 3W6OA 3IEMA 3F3YA 4DR3B 1O7JA 1CRLA 4DSZA 1PSZA 3VPDA 3HK2A 2ZSBA 2MMGA 3C39A 3HFSA 1J1UA 3FETA 1JIQA 2OC4A 2LW7A 2QM8A 3GFOA 3I39X 4R05A 5EUBA 5CPBA 5EQDA 1HH4A 2NUAA 3L79A 4LMBA 2VH1A 4K5QA 4NNPA 2D0PB 4Q47A 4YMVA 1ZI6A 3EVBA 3JPYA 3KQMA 3PIIA 3FPCA 5CFZA 3UWSA 4ZAWA 4TSKA 3AVVA 2YHBA 3MFYA 1X1AA 4BEJA 3ZWPA 2QPAA 3GZ4A 3QFRA 1PD1A 3CC8A 3WHPA 2NO5A 2HPAA 3OEEA 3OM0A 3CN7A 5C9ZA 1QAOA 3OZWA 2PTHA 2C84A 3EZXA 5TQ0B 4BMPB 5FWYA 1Z38A 4G0UA 2VNIA 2HYDA 3ORQA 4KXLA 3MWJA 2GCPA 4HADA 1W1WA 3OY7A 1V5VA 4UREA 4W7IA 1QZZA 3T3OA 1D7OA 3MB5A 4U63A 3T5CA 2JFVA 2Q8PA 4R1LA 1WDWB 1SMKA 3ED1A 2VBCA 2XLBA 4Q9HA 5FADA 5I7HA 1V96A 2AFIE 2EDCA 2RMKA 4WT7A 4Y2UA 4YJKA 4LMRA 1P4MA 1KK3A 1ZUHA 2B4KA 2Q9BA 2I4NA 3UJ8A 5HILA 3IUPA 1ENPA 4G36A 5JD5A 4J16A 4A0SA 1DWOA 4N7JA 3LD9A 3RODA 3BXXA 3SX0A 1P2VA 3DQPA 5C80A 2YWCA 1C3EA 4RHTA 1M1KD 1KEWA 5HXAA 4XN0A 4ZEOA 3ZC3A 1GTJ1 4V0LA 2QTZA 6ADHA 3CIOA 4KCGA 1ZDMA 1T0HB 4CM7A 1I33A 2XH8A 4YCAA 1MIHA 2OV2A 3I52A 1QE0A 2PFGA 1SBZA 1N2GA 4JI2B 4W5NA 2EZ9A 4CMIA 4FHDA 4RM2A 4CM6A 4HIZA 1A8QA 3OIDA 3RG2A 1PLLA 2QUAA 4MAAA 2N9UA 5K3CA 4LG1A 3IMEA 4BKPA 5JXHA 2Q2QA 4NFLA 2HJGA 3BB4A 1D5WA 1WXXA 3CKMA 1SUDA 3HVRA 1MC1A 5FEUA 2VTBA 1U0RA 2V1XA 3ZJUA 1OILA 3INYA 3L8HA 3TQSA 4MIEA 1FUKA 3WNVA 3MTQA 3DP7A 2QRPA 3AFGA 2PMDA 3E5RA 3O74A 3V97A 3BE5A 5ER6A 2P1DA 5B1IA 4EKYA 2GK7A 2FRDC 3ETEA 4I50A 2Q6TA 1BSVA 4FYYA 4AJ2A 3EEFA 2BR3A 4QNRA 4N6GA 5KOIA 3KOYA 4G41A 5D5PA 1I80A 4AJKA 1VCNA 5KSWB 5LXTB 2WJ6A 2G40A 1AY0A 1HWYA 2ZFUA 1FSSA 4OM7A 4I3FA 2RI0A 4WXPA 3VGPA 1FXUA 1YASA 1PAUA 2P62A 4R68A 3LO5A 4P32A 4PIVA 4HVCA 5J43A 3DDYA 1JN0A 2QD4A 3OZIA 1ZICA 3V55A 4QGBA 3OE1A 3S2IA 4DNQA 2PJRA 3BX1A 5B4TA 4JK3A 4F91B 4BX8A 4QDOA 2M6LA 5D6NA 3QFCA 1AHIA 4LCJA 1H2FA 2ZRIA 4A82A 3TH5A 4PPQA 1NRIA 1UBOS 3CCSB 4MUAA 2OG2A 1IFXA 3CJQA 1NMSA 4N54A 5CTJA 4EKIA 2R8PA 4POOA 2R9VA 3I73A 3TGLA 4Z4GA 4TKMA 5CLIA 4GYWA 1XUOA 2HTFA 4EX7A 4P4UA 4J90A 1F51E 2CXPA 4KKSA 4NOJA 1T1JA 1CUEA 1P7YA 2EZTA 4W5HA 4Y6GB 1EUZA 4H08A 5IEBA 3DQQA 1C30A 2PH5A 1BXRA 3C15C 3MHPA 2FPSA 3CPWB 1TA0A 4MS1B 2QTGA 4TS1A 5E3JA 1ESDA 1FUEA 3D54D 3COWA 4IV8A 5LQCA 1CUAA 1EP1B 3UAOA 2JW5A 2V6FA 4HH1A 2C5SA 2CDRA 1C8VB 2REQA 4PXYA 5A8AA 3VYVA 3OPOA 3HBMA 2VHTA 2VHXA 3L1JA 3ZLTA 4C4YA 3ROQA 2VZ8A 1DL5A 2HMVA 2YVKA 5IK2A 3HP1A 5KYUB 5F5XA 3LGAA 3PWKA 1KI1A 1NY6A 4IJ5A 4JWKA 5H83A 5CYPA 1RYNA 5IHXA 1KFBB 2VYND 1H94A 1OZGA 4UNIA 4OQYA 5C8VA 3CMEB 3WK8A 2OPHA 2AX3A 2VJMA 4BX9A 5J2UB 1FUYB 3LPCA 3BTSA 2KS6A 4YXWD 4GZ3A 3ZQUA 5HCNA 4L74A 3C8HA 5FHRA 4MV9A 4A2QA 4CT4B 3DCNA 5EXXA 4DQ0A 1E2PA 1E8DA 3AHHA 3LLMA 3N2GB 1MO2A 1E18A 1UC5B 3BMCB 5IF3A 2CJFA 3DVAA 3PGKA 5L8VA 1T3TA 4ZICA 3TLKA 2ILVA 4N0MA 3NAMA 4YUWA 3DAFA 3EG5A 1CTQA 4AZVA 4MDHA 2PLAA 3H2BA 3KJNA 4Z4EA 2IUSA 1R9GA 1R4ZA 1G3UA 4IINA 3AINA 2ZYDA 1T15A 3RFFA 3TS1A 4C5AA 2VG8A 2P5YA 4PQYA 4ER3A 3R7BA 2G77B 3LPDA 3EOZA 2QR2A 4WLEA 5G0SA 1E2DA 3SGLA 3F2IA 3QOXA 1K86A 1XD2B 1EFDN 1V2GA 4XCXA 5DHPA 1C81A 5HSGA 3JAMA 1NBMD 2EHDA 5IMBA 4B3BA 3GOQA 4MPJA 2VHWA 4QXOA 4Z9BA 4B2YA 3P0IA 3U4IA 3TINA 1VF7A 4ZCLA 2RGXA 1I30A 2A0XA 4D9JA 2OWDA 3K9HA 4MMZB 7REQA 3EDRA 1ZRNA 1F2UB 4CUKA 1BMDA 4IJ6A 5JSKA 3HBLA 3R5KA 1ST2A 3GP3A 2I1WA 3QXHA 3DLAA 4P08A 4RMIA 4Y67A 2B3DA 2DU8A 1UBHS 3H4VA 3K5PA 2X5JO 2W4MA 4QXRA 3PU6A 1MX5A 2D00A 2HK8A 1PJTA 2G4CA 2XV1A 2NU6A 3MTGA 4URXR 1VYUA 1X42A 4DV5B 1KDRA 2I9KA 1ZS9A 1M1YE 1TADA 3THSA 1TYDE 4CEHB 3WHIA 4CCSA 1RXWA 4RIIA 1R0YA 4RY8A 3RG8A 3WO1A 3EHEA 4FEAA 3C7KA 4F4HA 3PRJA 4A6XA 3E22B 1CBUA 2JL1A 2NUPB 2OLEA 1QOZA 2ZL6A 2C1XA 3COYA 3HVHA 3LAWA 4QPPA 5JCJA 3ZIAA 4YAWA 2Y0EA 3T9DA 1D1QA 5F4ZA 3I2YX 4AU1A 4YGXB 3QP9A 3A28A 3W5UA 3K71B 3I64A 3PVCA 4DT1A 3RFXA 4CQMD 3ZWOA 1MGOA 2O8DB 4Q6BA 4L8LA 5DNWA 1NURA 5E3HA 4PFKA 3H87A 4JYPA 3RLIA 3BSSA 1KC8D 2B4AA 4AXBA 1YVEI 3UHAA 4FXOA 1N7GA 1OKKA 1PI3A 3KYBA 3MT8A 4I4IA 4S2EA 3BTUA 5LP6B 3HKDB 4X45A 4BZPA 1AKTA 2RGNA 2YINC 3B85A 2YFKA 3MOSA 2YNMC 4NL4H 3K9FC 4EFDA 2OC9A 2P2DA 3ZU6A 4B84A 3B8HA 4TWRA 1EQUA 4UBKA 1HPLA 1JG6A 1KNQA 1NMZA 2AF4C 2CSUA 1FYVA 2QZ4A 4L4ZA 4WZBB 3R4VA 3C97A 1P7CA 2N42A 3IX7A 1AUQA 3F67A 4CQLA 3Q7TA 2WK1A 1RRMA 3U3ZA 4QELA 4JIGA 3HR8A 5JTUA 1WZEA 1AMOA 2OTLB 1LV7A 1MG0A 5FOVA 3G5LA 4UOZA 2O6HA 1OZFA 2GBFA 1AUVA 2V45A 4GZ6A 4Q4CA 4IICA 2WKRA 4RF4A 5LQAA 1QKJA 3VHXA 4C0SA 1YZGA 2JHPA 2Q3JA 2NO0A 4DVJA 2WB2A 4ZA2A 4B85A 3DAGA 4JVOA 3V7UA 1KEEB 2ZYWX 3KUCA 3UOGA 2PUFA 3RIXA 2R8XA 3ROFA 5JPIA 3IHTA 4MQLA 3KKNA 3S2SA 2GEDA 2ZRHA 3B6IA 5FQOA 5KWEA 5IVDA 2VQDA 1BDMA 5K0SA 2HHHB 4HNHA 3TMKA 3EWNA 2WJ3A 4MWEA 3ASQA 1BWRA 1XQ9A 1V7PC 1P74A 2QSYA 3SF8A 4Q4JB 4INPA 5E7IA 4QTYA 5JCXA 4Q1BA 3OZXA 3AYXB 4E11A 4M9QA 4P0PB 1R0LA 2VQEB 4RKRA 5IPFA 3C6MA 3NTLA 3DQZA 1UM9B 2Z2JA 3AR2A 4OXNA 3TD2A 1ZI8A 1AO0A 4NZNA 1QGUA 2CCKA 5ESXA 3F5MA 2EGGA 1L5VA 2CXOA 1TM3E 3IBGA 3OPQA 1Q7TA 4PSUA 3RUFA 1PF7E 3KKQA 4GKKB 4Q9DA 4Q7EA 4TMWA 2RHGB 4NF2A 1IH8A 4BJ6A 3A1DA 2P6PA 3U1TA 3LK6A 1N5IA 4GFDA 1XLTA 1NBEA 4MKXA 4F2GA 5B1EA 5TRTA 1HE3A 2XOEA 3A6KA 3R3XA 4I50B 4QICA 3DNMA 3OE7D 1IXYA 2C5GA 4PZUA 3ICEA 2VYCA 3AVUA 2K87A 5EWJA 3RRFA 3QVJA 4RLHA 5T67A 1JDBB 4I14A 5A9TA 5B7GA 4GUAA 4H59A 2OCDA 1KI7A 2DERA 2WJIA 1IU9A 3V1KA 2I4TA 2ACWA 3G2MA 4KO1S 3CLKA 1BHSA 2PX6A 2PS9A 3LWDA 1SVNA 4BN4A 5ERXA 1L5LA 2A9OA 4C4XA 4FB5A 3EIWA 4HGQA 3T5GA 4YPOA 3DKVA 4QM6A 3RRJA 2I2CA 2QJFA 4MICA 3RS2A 3VVMA 3KIPA 2FPGA 2LKCA 4NVRA 4LWPA 4N12A 1CEQA 4K8OA 3NPAA 4NESA 1SUFA 3GMIA 3DB2A 2IYTA 3D6TB 3ILHA 3PC4A 2X3YA 2RH9B 4OXKA 1VDMA 4TXJA 4ZGWA 1L1FA 4O4LA 2ZSKA 1Z6PA 2OBXA 1DG3A 5F1YA 1BXRB 4MB6A 4MQFA 3GZJA 3L0BA 4BRZA 3WIOA 3ZJ5A 3CXUA 3HP7A 4Q4HA 5EZYA 3WSWA 1NY5A 3KL4A 3M6WA 4GR5A 3OT4A 3T95A 1T29A 1MO5A 1XRPA 5AESA 4PIMA 3ZY5A 1N3IA 3AVXA 2FZVA 2VC2B 2ZJYA 1T9HA 1FSGA 3C45A 1GPDG 1U5BB 1HEYA 5A3VA 4RJJA 2ZUVA 3G5AA 1XVAA 3C3YA 4BO5A 1UJ5A 2QF7A 4RGBA 4AJ4A 1SIOA 4EG5A 1SQ0A 2ZRBA 1CUHA 1G7CA 1RJEA 2ECOA 2GNPA 2VJMB 2WOOA 4TV8B 4B9AA 3ZZ0A 1JMYA 1FDTA 2C82A 4BVJA 1DAEA 4HXFB 1YU9A 2EJBA 2HJRA 3NYIA 4US1R 4W1PA 1U90A 4ECEA 4RZXA 1VMAA 5BYBA 3TNFA 3OZRA 4F4JA 1WULS 5CEFA 1TB4A 3VR6H 1W1IA 1GFIA 2HSEA 2JGFA 2ZTHA 2XKKA 1NR7A 2MSCB 4TTSA 1YVPA 2I7XA 2FKAA 4FP9A 4EW3A 2J9YB 5JSZA 1Q1BA 1RHUA 1YBAA 2BUCA 4Z4WA 2D3LA 4G67A 4IHKA 3DAHA 1HR0B 2ZZFA 4R1PA 5IN4A 2CV2A 1WDKA 3A9TA 4WFKA 1CF4A 2XWQA 2YH2A 4CTMA 1NP3A 3BJRA 4XLZA 5DBEX 5MF6A 4ZIRB 3B3JA 4NEGA 2Z6AA 4F3TA 2A0KA 4UTVA 1MOSA 3M83A 1ZN7A 1JBQA 3AF2A 4YREA 1SD2A 4D3ZA 5BURA 3DT6A 1KI8A 1Y0YA 2W5UA 3KSRA 4TZ6A 1IHXA 4PTYA 1MMFB 4U7WA 4AAYA 4F5YA 3WLFA 4I5GA 5JRJA 1EZZA 2H2DA 5ALEA 2IODA 4FI3C 3E6AA 4MUFA 2FNAA 3F4LA 3QNUA 1K7FB 3TTXA 3O8QA 4P4LA 2XMRA 2BKUA 4IIJB 4YJHA 3WLPA 3ZWCA 1XC7A 2YOGA 4NZOA 3A05A 1DHTA 2H4ZA 3UK6A 4BUZA 1GZHB 2ZI9A 1SXJD 3Q7IA 3HB5X 1F6BA 4E46A 4BC0A 2OV1A 4XM3A 1G98A 2ZYVX 3LVQE 3AEZA 4XDHA 1HVXA 2H4JA 4HGYA 4DIKA 4YJFA 3OM9A 2MYTA 4X7DA 3HEAA 5DGDA 3RAPR 1MC4A 4G5XA 4XEUA 2HWUA 3UJ3X 3FAZA 1W87A 4HZUA 4ZCRA 3EIHA 3FXAA 2G07A 2FZ4A 2ORIA 1T2NA 3PKJA 5JECA 1X7XA 1PSDA 1VLQA 4JJFA 1SK8A 3KVOA 4L9RA 3SBOA 1NP7A 5BUSA 3R3YA 5AUPB 5KS2A 2FSGA 4IMPA 1O97C 3KAJA 4OQXA 1PR3A 1TCAA 4Y1RB 1RVDA 4FINA 2X0EA 3V3KA 1U4OA 3LDHA 1YB7A 3EEIA 2F48A 3IR6A 2Y0DA 1CUUA 2JA1A 1SKYE 3O47A 1ESEA 1LQUA 3S1LA 5JY6A 3H9NA 1Y8QA 2WSSA 3IP6A 1JE1A 1QJCA 4KLCA 3LPNA 1UWCA 5F2NA 4R3UC 1R0RE 3RV3A 2XNSA 3LCRA 1TTTA 4HDSB 2PV0A 3RK1A 3A8JA 3LI2A 1TEXA 1XMSA 2AUMA 2A84A 2X9NA 4CLOB 4Z53A 3ABQB 3W5BA 1B4DA 4JOSA 3PLNA 1NBIA 2DWCA 4JD5A 4Q39A 1WBBA 3OA0A 4KFTA 1XALA 4XFKA 3DBIA 1JF8A 1Q0TA 3AUUA 4UEWA 4MB0A 4Y1EA 5G53C 3VJRA 3PFBA 5A88A 2V7TA 4EB0A 1CVLA 1P31A 4JLOA 5EFZA 1ZOPA 3K53A 1UC4B 2FRVA 3D3EA 2QRKA 3HNOA 5ADUS 3KM0A 5A9RA 3D7KA 3L8MA 1AB5A 1IRIA 4IH9A 3GRPA 3AUTA 1SQ5A 3N39C 4K9OA 2A5JA 4W1RA 5CTAA 1KWGA 1MA3A 2O07A 1KRHA 1YFKA 1X1TA 2YQ4A 4E5UA 5EMNA 2JLZA 2GJKA 2R96A 3WISA 4EPWA 3S70A 2IZ7A 3P9CA 3DYIA 3PC7A 3TOXA 2C3YA 3W9SA 4AG5A 5LP1A 1UOOA 3P9RA 1V3UA 5I47A 2IBTA 5C31A 2QP4A 4PHFA 4FCVA 1WP9A 2MOKA 2J41A 3SLNA 4OSOA 3NNNA 3TW4A 4EB6B 2Q4OA 5EJ8A 1O2DA 4CG3A 1UKVY 3GFTA 1PEYA 4CG2A 4P5EA 3ZJVA 1YVRA 2BFPA 1X7YA 4UM9B 3NC1C 4YCLA 2QD3A 3E9QA 3DV0B 2ZI5A 1OI4A 1BJTA 1CWUA 1GU0A 2G8LA 3OQBA 4I6GA 3ZHYA 4B71A 4UTOA 4DLUA 3BN3A 3CM0A 3D4NA 1BA2A 1Q22A 5DZSA 1U7OA 1PT8A 3DUFA 4B9EA 1QVRA 1ZKDA 3O9MA 3M1LA 4PICA 3LX4A 4UE6A 4R8RA 2WUDA 5AI8A 3LYHA 3P9ZA 5JI2E 1HDEA 5ES3A 5A71A 2P2GA 1W9XA 1SEPA 2W0SA 1VBKA 1BXGA 3WMGA 5HZGA 4BFVA 3AHGA 3CEHA 3BK7A 4Z8YA 3SIRA 4NX2A 1EGAA 2VZEA 2X7XA 2XUGA 4ER0A 3AQ4A 1UF9A 2IP1A 3PL5A 1NJFA 1UMCA 1TF2A 2OCLA 3R3WA 4Q1VA 3N0WA 4AKEA 1ZMBA 5DM1A 4RDKA 4W5OA 2CUZA 5DX0A 1U2DA 2Y1GA 1AN0A 1WMFA 4XM0A 3ASZA 4DW8A 1QO9A 2FPOA 1N9ZA 4MQEB 3H5TA 1XPOA 3DT8A 4L73A 1EMDA 3IAEA 4MA0A 5K3DA 2ZATA 1GEEA 2NZ2A 2JD2A 4HFRA 2KBFA 3EIQA 3L7LA 3QA9A 5YASA 5FIUA 2GERA 5A4FS 1L5YA 2DQYA 1F6WA 3UGJA 3ZCXA 2X4LA 4QQNA 1AN9A 1DX4A 3DZCA 1TQHA 2EF0A 3VDQA 3MS4A 4E2WA 3IVGA 3QELA 4GW3A 2HXSA 4P4SA 3WK7A 2JZCA 3D6AA 2QAJA 4UNSA 1C8LA 5FI0B 3OF5A 3P2OA 4MX8A 3LNNA 1GWNA 2CDCA 4J6FA 4NYMR 3UCXA 2RBEA 3CH6A 2CB0A 4CHGA 1F8YA 4BRWA 2O2EA 3S2ZA 4Q4HB 4LNAA 1NFFA 4N0EA 2GQ0A 3UJDA 5D5HA 1VZ2A 4K0RA 3V7WA 1UADA 5AQ1A 4OLJA 3LUKA 1OXVA 3Q7RA 1ELOA 5EZYF 1KAGA 3ETNA 5IAEA 2Z43A 1KDTA 3HV0A 1Q2XA 1VLVA 3KUKA 2YJ3A 3AFHA 4AY4A 4BNXA 5ABPA 4HE6A 5ER9A 1J2TA 1GU1A 4RIGA 4BYGA 2ZR0A 1IY1A 1ORVA 3GFFA 1GSIA 1DNPA 2GZ2A 5DLQC 1L8QA 1U2GA 2VP9A 1CNEA 4HWSA 3JX9A 3V2IA 1LLCA 4E31A 3H2HA 4U7DA 2BP7B 3GEMA 1HE5A 4ER7A 1JKMA 2H52A 2PRIA 2R2GA 3UUGA 1F4VA 1AK1A 1M66A 2HU2A 4K28A 4NIMA 3KTDA 2X0FA 5HDQA 1PGOA 2JBAB 1OQAA 1IUNA 5IBPA 4HZGA 3OJXA 1XRMA 5CT9A 2ZTNA 3GHHA 5K51A 4W6QA 1P6QA 3K8QA 3C3DA 4PYRA 4PC7A 4DLVA 1NJ8A 5JSZB 2J9ZB 1CZNA 3MTIA 1OHHA 1C9MA 3I8OA 3ZHTA 4PZEA 1C8BA 1CFZA 3C2QA 4UHKA 4BWYA 5KUTA 4AQ7A 3GNQA 4UQOA 3NDJA 4PC6A 2D4AA 4GQNA 1D9XA 3IAHA 3ZU5A 1ESZA 3U6BA 5FPPA 1J2UA 2VAMA 2XWBF 2WM9B 1KOFA 2VF8A 3L18A 4OHKA 3O95A 2G9QA 5DIZA 1OZHA 1JEAA 1I2ZA 2BEJA 1XPRA 3SS9X 3CLTC 3C70A 3AKEA 4AIRA 5HG0A 1US8B 2IV7A 4DJ5X 5MGBA 2HGSA 2Q0HA 2QRMA 1DINA 3E70C 1GNQA 4EX6A 2HA4A 4FQ8A 1E92A 2OORA 3ZI4A 4CKWB 5ARCA 4YJHB 1QWSA 3NI2A 1GUYA 2FFHA 1ES9A 2FR8C 2OE2A 1A8SA 4WWHA 2C4MA 2OFPA 4X60A 2DKOA 3QG5A 2I2DA 4MS3A 4C7OA 5EYPA 1U0SY 2QAIA 1UPFA 5LZ5A 4RXUA 2DVMA 1N1MA 1JFRA 1PLJA 2NSJA 3PIRA 1E1CB 2WVHA 3G2OA 4PNHA 4F12A 2PX8A 1PKXA 3UJCA 1TM7E 3OEWA 3VUEA 2LD4A 4OK5A 3E82A 4HQKA 3DAOA 4IW3B 1BVRA 2NAFA 2QRVA 1M1NA 2R8BA 5H3CA 4F11A 3VPCA 2K7FA 4YLEA 3FTFA 3DOEA 1DWQA 3DDWA 2XF8A 2R2AA 2XRFA 4HZUB 1UXJA 2GBGA 4OI4A 3BJMA 1QHEA 2VJYA 1T26A 1UZNA 5AHKA 5ARDA 5FL3A 5DO9A 1QVFB 1YRYE 4TLCA 3CEMA 4NK4A 2FEAA 2O8BB 1U11A 2YY5A 2NTEA 3DHVA 2D1SA 5JAOA 3G2LA 3O1JC 4QPZA 3WB1A 2IEGA 5CLJA 5FUQA 1A4XA 3EQ8A 3FKSD 1QB8A 2VK1A 4RWEA 3AOEC 4XOIA 2YXNA 2Q4EA 3ZV4A 2QTVA 4XKVA 1HDZA 1ZK4A 4L5IA 1HLFA 3TDKA 5CNKA 3RB8A 1FZQA 5HJ2A 4R9SA 3TEMA 1XTPA 3HSKA 4J0QA 4PFJA 1FFEA 4RKEA 2NV6A 5CRIA 5DP2A 5ALJA 1IXSB 2O2GA 2XUJA 3HDHA 4LF8B 2QU8A 5J3JA 1F9EA 1P4AA 1NVXQ 1Q77A 2PG3A 3HGQA 3UCEA 4A0QA 1KSHA 3P4YA 1OXBB 3QUSA 5LZ2A 1TTPB 2V7XA 1YS4A 4IXTA 4JYCA 3FVWA 4LJSA 5JHHB 1E5QA 1GLNA 3H2IA 3EIEA 3MCAA 2B37A 2EKDA 4D82A 5HUHA 3TAUA 4C76A 4Z7OB 5IT5A 3ZY2A 3B3AA 1XG5A 4E5DA 2GAJA 2H1CA 2DBVO 2B2XA 2E87A 4JBNA 4XOUA 2NSYA 3DJYA 3GH3A 3RBZA 4Z4HA 4LE1A 1TMOA 1A96A 1F6DA 3H4MA 3JSAA 2BGUA 1EUYA 1ISGA 5DNAA 5F51A 3TYXA 1Q0ZA 4QJIA 4P9NA 4UASA 5ECWA 1UEXC 3RARA 4YQFA 2DP4E 4IDHA 1D2CA 2A9RA 1FFDA 4S2UA 4HGNA 1QV6A 2QZJA 5JDCC 4DLAA 3B20A 4M9XA 4DRXA 3L4JA 1PN3A 2EP7A 4L8VA 4RADA 4WESB 1NKTA 3GBSA 3H1BA 1DP4A 1KVTA 4AD8A 2XJ9A 1QP4A 4W9MC 1BVYF 1X87A 1FFXA 1RLMA 3JD2A 3GGJA 3PC8A 1GGJA 1V11B 4M8LA 3VR2D 4UEKA 4TYPA 3U4DA 3M5WA 4C0LA 4EGQA 1CHDA 4IFTA 4XLEA 2BR5A 4ALLA 2JH9A 4F97A 5AW8A 1WOSA 3L1VA 3NHMA 2RAUA 5JD3A 1D03A 1Z35A 2XOXA 2QI9F 2ZETA 4FOPA 3U56A 2F8TA 3EMVA 2JHCA 3D7LA 1JSCA 3UATA 1W34A 4NU8X 5I9BA 3TTWA 2EU8A 2M1XA 2JJ8A 4QGHA 3CLUD 1CXZA 3T7EA 3I9KA 4FOTA 2C9ZA 3JVDA 1UWKA 1QJ4A 5CDHA 1A5ZA 1D0SA 1NIJA 1CERA 3A7EA 3Q3IA 4JB2A 3JQ9A 1DBQA 3IIJA 2QE6A 4G1EB 1K63A 4O0MA 3ZGZA 3PD7A 1HL7A 1GYRA 1WSWA 3MGCA 1QIDA 3HEBA 3PHBE 3U0VA 3ZJ4A 2XNDA 4KKVA 1JX6A 1MV5A 1CQJA 1M6HA 2O8VA 4BE4A 5AKLA 5FNVF 5LQRA 3FYDA 1Y7IA 3NKFA 2OP0A 4B73A 3JQRA 2PFKA 1HY3A 4MMXB 3ESBA 4P53A 2HFKA 4M36A 4RQBA 1XXHA 5BVGA 4XJSA 1L1QA 2DPLA 5HE9A 3QELB 3KELA 2X5KO 1HDYA 4RVOA 3MHTA 1FTSA 3UB3A 1U80A 2NTNA 2V7QA 4RK5A 4OHVA 1XL0A 4UUMA 1ZNXA 1LDEA 4JLJA 5IKPA 4EH1A 4UHHA 3RC3A 3VR4A 5T6MA 1CY1A 3ULKA 2J5XA 5ALLA 5BMVB 4LRSB 4C2TA 1CEYA 1CUGA 3ZCTA 3IC5A 3VPAA 1RM4A 1WPXA 3RRZA 1I9GA 3BWDD 1YRBA 3K32A 1G59A 3CG4A 3N5KA 5F5NA 2R8YA 3O2NA 3WGGA 4RQUA 4U9UA 5AK3A 5KYWA 2YKGA 1T24A 3SG0A 2OBBA 4FBLA 2QP9X 2R1UA 1ESCA 4L16A 2YJTD 2ZJAA 2YXLA 1H2AS 3I8SA 5I48A 3K8OE 2NZUG 3IMGA 5C5EA 2WHQA 3Q9SA 2O1XA 4XVQA 4PLWA 5TX7A 4XORA 2P6RA 3VQTA 1GARA 2PNFA 3ZDRA 3DCJA 3RI3A 3VV2A 3BRWA </