2OK8A

Ferredoxin-nadp+ reductase from plasmodium falciparum
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
312
structure length
263
Chain Sequence
NFINLYTVKNPLKCKIVDKINLVRPNSPNEVYHLEINHNGLFKYLEGHTCGIIPYYNERCARLYSISSSNNMENLSVAIKIHKYETNYGYCSGFIKNLKINDDIYLTGAHGYFNLPNDAIQKNTNFIFIATGTGISPYISFLKKLFAYDRNSNYTGYITIYYGVYNEDSILYLNELEYFQKMYPNNINIHYVFSYKQNSDATSFYVQDEIYKRKTEFLNLFNNYKCELYICGHKSIRYKVMDILKSHDQFDEKKKKRVHVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ferredoxin-NADP(+) Reductase from Plasmodium falciparum Undergoes NADP(+)-dependent Dimerization and Inactivation: Functional and Crystallographic Analysis.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Oxidoreductase
molecule keywords Putative ferredoxin--NADP reductase
total genus 85
structure length 263
sequence length 312
chains with identical sequence B, C, D
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2ok8A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2ok8A02
2NPFA 1Q82D 2DY1A 2C78A 1ZM4A 1OGIA 4RCZA 3WXMA 4ZCLA 2YWHA 4TMXA 2DCUA 4TMTA 3MCAA 4C43A 4ZGQB 2PMDA 3MMPA 4ZCIA 3CB4A 3E1YE 3WNCA 2OTLB 3W2FA 1EP2B 1Q7YD 1VQOB 3I56B 3CCSB 1VQ6B 3CCRB 2OTJB 1KTVA 3FPKA 3OJXA 1QVGB 1UMKA 2HCJB 4ZCMA 3CPWB 4G1VA 4B3XA 2VNKA 1B23P 1XE1A 1VQ5B 4MYUA 2B5OA 1AMOA 3CMAB 1BJKA 1D2EA 2CNDA 4AF7A 1KRHA 2RC6A 4MYTA 4NCNA 1XB2A 1FRNA 1F60A 3AVWA 3W5HA 1QFJA 4ZGNB 3ZZUA 1BX1A 3VO2A 3U6BA 2DETA 1VQ8B 1WDTA 1FDRA 1DDIA 4LC0A 4HE6A 2J7KA 3JQQA 1YJNB 1AIPA 3OZVA 3CC4B 1N8RD 5TY0A 1DARA 3PENA 1N0UA 4B43A 4RCYA 1CNEA 1S72B 1QFYA 1FRQA 3G71B 1U2RA 4G5GA 2E1RA 1G7TA 3CC7B 1QUFA 3CXCB 4TMVA 3LRXA 2HDNB 1VQNB 5GV7A 1JB9A 3W2IA 1KQSB 4EH1A 2PIAA 2EIXA 3LO8A 3ZC3A 4PC7A 4B4DA 4YAUA 1CQXA 1QUEA 1GO2A 4LBYA 1EWYA 4NBSA 2QMUA 3ZZ0A 4Y9UA 5TV2A 4RJLA 5DSZA 1Q86D 1D1NA 1EXMA 1R5BA 3OZWA 2GPJA 5H59A 4RD6A 2QEXB 1K73D 4M1KA 1QG0A 1FNDA 3QFSA 2QDXA 3I1FA 1BQEA 3CRZA 3G4SB 3CD6B 1OGJA 1VQ4B 4PGOA 4YHBA 4TN1A 1NDHA 3WBJA 5H5JA 1A8PA 1J9ZA 2C77A 3QE2A 1QVFB 3CW2A 1QGAA 4YAWA 3W2HA 2OK8A 1IB0A 4AC9A 1E62A 3E20A 3U6KA 4M4SA 3OW2B 3VNUA 4Y7CA 4M2LA 1TLLA 1Q81D 3WNDA 1YIJB 2XNCA 4LBVA 1GR1A 1KK0A 1GJRA 1D8TA 1R5OA 3JQRA 1OB2A 3CCVB 1VQKB 3B82A 4AF6A 2BVNA 1TUIA 2VNHA 4Y9RA 1B2RA 1EFCA 4Q7JB 4H9GA 2PLFA 2D74A 5KSWB 3ZBTA 2GQFA 1H85A 5AN9A 1ZM3A 1YJ9B 1YJWB 4HE5A 3AVTA 1EFTA 4PC3A 4ACBA 5JBQA 3WYAA 2XEXA 4B47A 1OB5A 4U9UA 3VO1A 1K9MD 2BPOA 2YWEA 4IW3B 1QGYA 4ACAA 1EFUA 1EP1B 1IJFA 3W5VA 1S0UA 1ELOA 2BN4A 1BX0A 2QTLA 2BGIA 2AHOA 3J81k 2OK7A 3JQPA 2B7BA 1TVCA 2HMAA 1QGZA 2YWGA 4FWTA 3W5UA 4B44A 2ZITA 4K1XA 1VQLB 2VYQA 1GAWA 1GVHA 4FK8A 2BGJA 4YAOA 5TR9A 5EMNA 3ZBUA 4WQMA 1KC8D 3WY9A 2R6HA 4C0SA 3QSYA 1W34A 1W2BB 1JA1A 1TTTA 1DDGA 3OZUA 1IJEA 3CCJB 1KD1D 4N3NA 1G7CA 2BM0A 1I7PA 2CRVA 5THXA 3CCEB 3SJZA 2RC5A 4RD0A 4RD1A 2BV3A 5HXBA 4PC6A 4PC2A 4M53A 1KJZA 1H42A 3QFCA 3QFRA 2FX3A 1N0VC 2BMWA 4P3YA 2DEUA 4QHYA 1E64A 4R71A 3VNVA 3OJWA 4DQKA 3LYUA 3B78A 4PC1A 2DERA 2BF4A 3CMEB 2QN6A 1HA3A 4M0LA 3ZZTA 3AVYA 2BSAA 1R5NA 1M90D 3AGPA 3VMFA 1VQ7B 4B48A 2VNJA 1ZUNB 1SM4A 1F20A 3P27A 1K8AD 1E63A 2EFGA 1SKQA 1YITB 3QFTA 4TMWA 3ES9A 1YI2B 1JNYA 3G6EB 4P6VF 1QFZA 1CNFA 4G1BA 4F7DA 1M1KD 3P26A 4LBZA 1JJ2B 3W2GA 2QA4B 1QX4A 4RD4A 1VQ9B 1ZM9A 1FNMA 2YWFA 4YALA 3MHPA 2VZLA 3CCLB 4BPRA 2VNIA 4N3GA 1FNCA 1W87A 3A1FA 1QH0A 1KK2A 1DG1G 4RD3A 4FN5A 3CCQB 4QFMA 1G7RA 3CC2B 1GAQA 3LVBA 4RD2A 3AGQA 4ZV4A 3AVVA 1KK1A 2BM1A 5GV8A 2XNJA 1EP3B 5FA6A 3FJOA 3AVXA 2B7CA 1ZM2A 4TMZA 4DQLA 2X3UA 3W2EA 3I55B 3AVUA 3CCUB 1VQPB 4UAJA 3B8HA 3CCMB 1W35A 4YAFA 2QTZA 1G7SA 3V76A 3U2QA 1JA0A 4LBWA 1KK3A 1NJID 3WNBA 4J0QA 3WBKA 1FNBA 1VQMB 1YHQB
chains in the Genus database with same CATH superfamily
1IY8A 3MB8A 4F86A 4JASB 2C78A 3P0JA 2H6EA 3ZUGA 4V0RA 5K3CA 4L3VA 2CB0A 4ZCLA 3QHAA 5IPFA 3Q87B 3E7WA 4NZYA 1SUWA 2V6JA 1JPNA 2NU7A 4MVWA 1XWWA 4O4JB 5TMEA 3GIWA 4KPEC 3OG9A 5BSEA 3MMPA 1ZWKA 4BAZA 3D6JA 5ALEA 3PR1A 2WMNB 1NMYA 4XGKA 2EP5A 3L04A 1FFGA 2Y1XA 1PUJA 3NR2A 4S1NA 621PA 1FRFS 1DCFA 1Z6PA 1ZVQA 2JI8A 1G20B 4UBLA 2OTJB 3IVAA 1NXVA 1IG0A 3OJXA 1DWQA 3IX7A 3T1QA 3ZWYA 3DNMA 2VBFA 1Z22A 2MYNA 2OB1A 1UMKA 4LXXA 4PAQA 3NTRA 4O4IA 4J1TC 3DM5A 1PNQA 4XZ3A 3ZWVA 1XTVA 5U4QA 4LOKA 3AY7A 4LDQA 1KY5A 2WFAA 1U8YA 3GA0A 4Y1RA 3NCHA 4B7UA 2GXUA 1SIWA 2QMOA 4YT4A 2NSJA 1Y3AA 3GZNA 4I1VA 3WOHA 4CODB 4ZOQI 3H2GA 3M6FA 4MS4A 1ZJJA 3C74A 3U3ZA 3G85A 2BKEA 3GEEA 2R4QA 4Q4AA 4E7OA 4EUEA 1KJJA 4FGLA 1Q0TA 2FUNB 3CSUA 4PAGA 3R7DA 1ULBA 2A0XA 5FWYA 1Z3CA 2R8ZA 3AUAA 1XTPA 3RYCB 1KH1A 4MYTA 1VKNA 3ZU5A 4NCNA 4YXWD 5KSYA 1FRNA 4LZNA 5ABPA 3ABRB 3FF1A 3W5BA 1EWQA 1KEPA 5ICGA 3IAXA 1N5KA 3ITKA 4HDKB 4JENA 3CLRD 4LNUB 4PZYA 4UPVA 3NAMA 3NWPA 3ZIAD 1J8FA 4R8KA 3DA8A 3QKSA 5CX1A 1MOZA 4H7KA 1GLVA 3BBPA 3IO3A 1PLLA 2RG7A 3K1TA 5CVVA 3TX2A 4QV2A 3NUQA 3FX2A 3IRVA 1ZIOA 1CZNA 2PKQO 3RD5A 3U4AA 1D2MA 2BI7A 3RYFA 3A25A 4DDTA 3MT7A 3FVQA 4NOMA 2MSDB 3N7TA 3GF4A 3PUKA 3O4RA 1KJ8A 2NV2B 5U9CA 1ODJA 4W5OA 4FFBA 5CJ2A 2XUQA 2A78A 3GLTA 1IY9A 1DARA 4MR7A 4EFKA 5EJ6A 1XJWA 3PENA 3LGAA 5HZKA 5K6RA 3IE2A 2OBYA 5K6AA 5KTRA 1J8DA 3H9GA 3A6ZA 2PRKA 4RMNA 2ZCUA 2F8MA 2GKSA 1B6GA 4XGRA 1JNXX 4TLAA 2Y9MB 4JJ6A 4KXQA 4GICA 1Y3CE 3N70A 1M5RA 1RXUA 3C15C 4JB0A 4Q4HB 3VAZA 1MC8A 1PJ3A 1S1MA 2FJPA 2E1RA 3ZLUA 4BL5A 3L4JA 1YF3A 3TQFA 3BEDA 2AEMA 4P7GA 2WP0A 3O8QA 5ED4A 4KRYA 3SZUA 4V0LA 2IITA 2V3WA 5AHXA 3U0VA 4HNSA 4Q01A 1HE1C 5BT9A 4QZVA 5HCUA 3NXKA 5AOCA 3BTOA 2ZDQA 2R5WA 1J0DA 3KQQA 5CDGA 5JATA 3JD0A 4ND3A 2B99A 1L0BA 3U26A 3GGGA 5LWHA 2AN4A 1XMXA 2GK4A 4H15A 3X1WA 4S1VA 1NFQA 1N0HA 4GC9A 1Z74A 1L7EA 3C85A 3ANLA 3WGNA 4AM8A 4F3TA 1CUAA 2O6LA 3RDPA 2OQRA 1RQLA 1T26A 2PGLA 5EMHA 3UMFA 4C4OA 4CKBB 2XRYA 3TUZC 4TT3A 1SMKA 1L4LA 2TYSB 2GEUA 4MQ5A 1GARA 2F17A 3AYZB 1XOIA 1G19A 2VJPA 4Y9UA 5TV2A 3B5JA 4NK4A 4MHOA 1P39A 2O2EA 4OQYA 4WUVA 4MRMA 1X1BA 4BU0A 3HB9A 1S4QA 5IP5A 1K08A 3L8EA 3C3MA 1OR8A 3V3KA 3WQRA 4DVGA 3BSYA 7MHTA 3QU2A 5IT9A 4DNRB 4DHWA 2R8PA 3HCAA 2BFEA 1C3LA 2EGUA 3EXHB 4J0IA 4X7BA 1V6SA 3C3XA 1T9CA 3THWB 4UEQA 3DXXA 3FDZA 4NPCA 1A9SA 1MT0A 2XWSA 4HATA 3BRQA 1QZUA 1BXKA 1ZIDA 3JV7A 4I6EA 3ZPXA 3G4SB 5CB4A 2JH3A 3I01M 1N75A 3T52A 4DQDA 2V4MA 4YQEA 4INZA 4TN1A 2NU7B 1JEEA 1JG2A 2DMRA 2AI2A 3HDYA 1AKNA 1JQLB 1OXBB 4LQDA 3DDOA 5CT8A 4A91A 3JVDA 5CVTA 1VLYA 1J9ZA 4RKEA 1LBQA 5ADUS 3JRNA 1TT5A 1ISFA 3MBOA 4EZBA 3AZOA 3NEAA 4CLRB 1QQAA 2H17A 1R4MA 1XN1A 2Q0XA 3PNMA 3ZE7A 4F6CA 1KSHA 2PT5A 2NW6A 2QRQA 3MS2A 3OKCA 3PHJA 3QEKA 5A05A 3RFFA 1Y0RA 1EIWA 3PQ5A 4HB2A 3I9V6 4HDAA 5ENVA 2CFTA 1NG9A 4MVJA 3EG9B 4EHDA 3L0SA 4X7CA 1CS4C 2EYUA 2NO7A 2AEJA 3T0IA 3I5MA 4DK1A 1S2DA 2GAOA 1II0A 4K6MA 5EJ7A 2P5TB 1V41E 3ZD9A 1E1QA 3I64A 3ZCPA 5L4NA 3S99A 4WJZA 4LZZA 2QJWA 4C3VA 4IMPA 1CIJA 2BSXA 2FN4A 3UMSA 5L40A 4Q4CA 4QUAA 5A5EA 1Z16A 1LF5A 3EEFA 4PG5A 1M67A 3NHSA 3CESA 4LZJA 2JCGA 3GCZA 3QV2A 5ALXA 3A4VA 4BLSA 3QG5A 1KK0A 4K03A 3ZTYA 1PCXA 3VU8A 3QPBA 2DKOA 4HEHA 1QYXA 1FQKA 3JQAA 2D8AA 4KLCA 3MTEA 1LDBA 1OA0A 2EJTA 2X2PA 3QUBA 4K87A 3EY4A 4BLOA 4QGBA 2UZ1B 2AFIE 3LDUA 4L8YA 4D92A 4DSTA 2QRHA 1EFCA 1U3UA 3NUGA 4RU1A 5EEGA 3CR3C 3GZTB 3BSFA 3Q1KA 1V9SA 5K8IA 2G9QA 1DIAA 5KSZA 4NZPA 3F96A 1LEHA 3PDIA 3UHAA 4GP9A 1YC2A 4KQEA 4MMXB 4TTQA 4OQLA 2GQFA 1EMDA 1HLGA 3DT8A 1UP4A 1OX4A 2HTEA 1NIPA 5C1BA 3WGZA 2H7YA 4I55B 2CXNA 3IUQA 3GNLA 5H81A 3EXIB 4HE5A 3EIEA 3AVTA 4R0MA 4ZYWA 2FKNA 1C41A 2V8OA 2K7FA 1TM5E 2AI3A 3FBGA 1N7GA 3UV7A 4MJXA 2BE9A 4ACBA 4EHIA 4X41A 1EZ4A 2JFWA 4MUEA 3RU7A 5JCOA 5BSYA 2ENUA 2BTQA 2ZB4A 1I6LA 5BYKA 5AVUA 2YQ4A 2ZR7A 3OZGA 4YRJA 1CR6A 1X13A 2EQAA 4P82A 3N58A 1AN0A 1SOUA 3NEJA 4GZ6A 5EHNA 2FG5A 5A7HA 3ZY6A 4INJA 4OMUA 1JQEA 3VO1A 1Z2EA 4TL7A 3VGJA 2W2NA 1K7EB 1XELA 2JFPA 1E1DA 4P86A 4QJ4A 4YJFB 1ST3A 5FUYA 1KP9A 3OT1B 1E7MA 3G0GA 4M1OA 3JASB 5IYZF 5B3JA 3T99A 3O2QB 3NM4A 3WGGA 1ZRNA 3PVZA 4NYIR 3QHPA 4PIPA 2FRXA 4U3JA 2XH8A 3A27A 2BJVA 2ZBGA 3WDKA 2O8FA 2GK6A 3NOQA 3FBTA 3T7KA 2PXCA 4J07A 1YAHA 4B82A 3V7UA 3AESB 1I0IA 3WWDA 2CNNA 3HNPA 1J20A 3KC2A 4YRDA 2V3VA 1NJ1A 5IDQA 1P2GA 3HB1A 3DMRA 2YWGA 1J4AA 3EQZA 3O4JA 4B83A 2C3YA 2G9NA 1DBRA 4MMYB 1FP6A 4BFZA 5FUQA 3H6HA 2I6TA 2PL5A 3RKSA 1IZ9A 4E46A 3Q8LA 3L7AA 4J4HA 5HUQA 2VK4A 2VYQA 5AW1A 1SBTA 1GAWA 3A1PA 2EZ8A 3GLFA 2BM8A 3PUMA 1EE2A 3I34X 4J9UE 1SBNE 4MUIA 4WZBB 1KYWA 3NHWA 2BGGA 1EU1A 4DC9A 4JC0A 4N12A 2DIEA 2DQKA 3IQHX 1HEYA 4MW2A 2PG3A 3BC9A 4GSLA 3RFXA 2AD1A 1DDGA 1LQTA 2P8SA 4G8CA 4HC4A 1OX6A 4IP0A 4CF7A 3FDIA 4F72A 2GRUA 3QYPA 4X8LA 1F0PA 2BGUA 3SX0A 2OGZA 3LMKA 1JBEA 1FU7A 2FF5A 2AMJA 5GONF 2O0JA 2V7UA 1JJAA 3WQBA 1ZHFA 1JHRA 4ALNA 4LJAA 1QX3A 4Z54A 2P79A 4MRAA 1EWTA 1WPXA 4H6PA 1QRAA 3VZQA 4UPEA 1R3DA 3EDOA 5THXA 1M66A 4OJKA 2LCFA 5PGMA 4A8JA 3V4SA 4HB4A 4KR7A 3ZK8A 2XMRA 3CUVA 1NNEA 3I09A 3R23A 4RD1A 2REXB 3OFJA 1TCUA 2B6HA 2WAAA 4PYOA 3UT5B 2RGRA 3WRYA 1KOJA 4GR5A 4N6NA 4BFYA 3TW6A 4F9EA 5A8AA 2JGDB 3GFSA 3VH2A 1YRAA 3KVNA 3FNQA 4Y1RB 5KYYB 3N5KA 4B7AA 1Z4IA 2MINB 2GAAA 4DT1B 1J0CA 2EBFX 3EA5A 4FI3F 3TUJC 4C22A 4B74A 4AY2A 2QX7A 1VMDA 1R88A 1YZKA 3TIFA 4ZGBA 3BGDA 3TCNA 4FBGA 2JI6A 1U3CA 4W6QA 4KN8A 3TUIC 3DYBA 4EG6A 2BGNA 2JJ2D 2YN2A 3EZXA 2HFJA 1PJ7A 4IXTA 5TNXA 2FXVA 4U7DA 5K0TA 1HPLA 2M1XA 1H5QA 4AS2A 3MTIA 3DL7A 2GJRA 3CRW1 4C88A 4DIUA 4XEHA 5CNMA 2I34A 2CXPA 5EWLB 4E6EA 5GMOA 1M2JA 1YFJA 2X58A 1P2TA 2BFEB 4RXTA 5L53A 1ZD3A 4AD8A 3IODA 2PD4A 4HLUC 5G4KB 5FTLA 3GL9A 3URKA 2N0SA 5K3EA 1W6UA 1VPEA 5LOVF 3OM0A 1IBLB 5KJEA 1Z4JA 3TXYA 4DR2B 1UXIA 1SXHA 4KMOA 4LYHA 3VR5D 3RYCA 1PEYA 2X0EA 2NYVA 2W93A 3MLBA 4QEZA 4EPYA 1ZSVA 3QUSA 1CY2A 2EX1A 2XQVA 2GMWA 4UBJA 3BGOS 1NNSA 4M9CA 3AHGA 1AXRA 1Q50A 3F4LA 3PUNA 2XRMA 2O14A 4TMWA 3OU7A 4F1JA 1IHDA 4LGCA 3Q1LA 4TRJA 2Q6VA 3GMIA 3TJRA 4BJ5A 2DQZA 4KXVA 4XM3A 4JX9A 2YY7A 4HYEA 1GUZA 2ZU0C 4GL4A 4I99A 4KDCA 5CD1A 1P73A 1ORDA 1B76A 4GX5A 2D2FA 4K6GA 4RPJA 2H8GA 5TQVA 4CMBA 5BUQA 3KXIA 5MHTA 2OBFA 3UB3A 5KTMA 1WLSA 1HETA 3FYHA 2C57A 2F6RA 4GOXA 4KN6A 2VJOA 3O8QB 2WVHA 3LBHA 2D8MA 4ZAFA 3WLTA 2QRZA 2YHUA 2Y67A 5LD2B 2QG6A 3FB4A 4NCAA 1EBUA 1ZRSA 3EZ7A 3DO5A 1IXKA 2WIJA 1VJGA 3GUHA 2VZ8A 3IPRA 1N5MA 1PG2A 1PFGA 3TSCA 3FOEC 3U4DA 3OZAA 4MUGA 4N3GA 1QF6A 1LS1A 3N07A 4DLTA 3DW1X 2X9NA 2Z8ZA 3HVIA 3JATB 5AUOB 3IKVA 4R1TA 1MB9A 3F9CA 2BIFA 1KKMA 3V34A 3PICA 4GBMA 2N9UA 4MCIA 4KUGA 1BE6A 3HV2A 3RT7A 3LT0A 4RMGA 5G41A 3SEFA 1OW3B 2JCBA 2UUCB 4MQMA 3WZLA 2V5UA 3BWDD 3Q8XB 4I3FA 1SHZA 3QQ5A 4OHMA 3L9WA 2FP4A 3KELA 3NWJA 1LBHA 1L4YA 1HFEL 5ESDA 3ZH9B 3N2KA 3K4HA 1T5BA 3PQ3A 2X13A 4MUMA 4JDUA 4LHWA 3I9KA 3NONA 2Q5HA 4L3WA 2XXAA 2QLMA 2QLTA 4DBLC 5DISB 1KDPA 4FCVA 2OG1A 4AKSA 1EINA 3K0BA 4ZYZA 1B0UA 3M82A 5DPMA 4BZXA 2JJQA 3PEUA 3LBFA 1PDWA 2DULA 1PJAA 3MXOA 3ZY4A 5CXQA 3DQQA 2ZXUA 4RA9A 1RJDA 1Q0UA 4KQ2A 4ZQFA 3WL7A 3TECE 4DMKA 3BE8A 1RHMA 4G0PA 4Q21A 5K1ZA 3T7EA 3DHYA 4BNWA 1PS0A 1U9ZA 2C8JA 3HCWA 3B9BA 3H4VA 4NY1A 3K94A 3VSDA 4RFVA 1H6CA 1M9NA 3CWZA 4UQPA 3QF4A 2O8BB 3T5DA 3VUEA 1J99A 3ZCXA 3Q2KA 4TYYA 2OBMA 4N7JA 4OFWA 3GEPA 1L7VC 4KW7A 1CTQA 1AUQA 2OCDA 5EJ5A 2O1SA 2FPPA 4ZICA 2X41A 3WBKA 4M1WA 3IQGX 3R6KA 4IGFA 3NCTA 4H3VA 4Q1VA 1OTHA 1RJ9B 4FMPA 3VSEA 1II9A 3GJRA 4G0UA 4QVGA 4IBOA 4DZTA 3TBHA 5DE3A 2DT8A 3ZWBA 2IS6A 2W6MA 3H5OA 4O4IB 1WV1A 1OD6A 3Q2IA 1QDLB 4HNTA 1G59A 2EX4A 3SS8A 5JW6A 4GMXA 1RCUA 3FLAA 4HWRA 4C43A 1TCBA 2C7BA 1I10A 2CDRA 4PPFA 4C1NA 4EI8A 3SU8A 4BKUA 2IFTA 1HURA 5EWLA 2BFMA 4K81B 3DCYA 2Z09A 1RE1A 4P2GA 1NF2A 2XTJA 3IMEA 3L9XA 1ESZA 1N2BA 1SHUX 1T2EA 4ICIA 4BMCA 1OI7A 5I4IA 3S8EA 3R5KA 1FUIA 1GRQA 3FPKA 1AU9A 4PHHA 1OI4A 4FLMA 1JQDA 1P1HA 1IVYA 4NS1A 5IJAA 1XE3A 5ALNA 1K88A 1HXHA 1XEWX 4BAGA 3CPWB 4W6ZA 3IB6A 1RZ3A 1DWOA 4WCFA 3NBMA 1KI8A 1MR3F 2G9ZA 1ZMOA 3PL1A 1Z4LA 2A33A 2WG2A 2O5EA 1W30A 3N59A 1CC1S 2AQ8A 3O2JA 5L3ZA 2ZCVA 4HQ6A 3BL6A 3LKDA 4B3FX 3IT1A 3MG9A 2Y1EA 4ROTA 2BCEA 1USWA 1Z8HA 2JS7A 2YRWA 4QTUB 3UKOA 4XVHA 4BNFA 2CFOA 5BNIA 5HM8A 5KB3A 1RE0A 4CUZA 4LMRA 4KJZA 2DBQA 5DULA 1Q21A 5NLLA 2WIDA 1V5FA 5HM6A 1Z5NA 1K6EA 1XUOA 1IN6A 1Z6AA 1E1LA 2A1TS 3L7LA 4RPCA 3BCRA 1I13A 5ALWA 5YASA 4AJKA 4TS3A 4I1PA 1QBGA 1XKQA 4G36A 4XEUA 2Z04A 3AFMA 3BHMA 4LDJA 4A1FA 4IDEA 4Q47A 1MG5A 4BFXA 4TKVA 4BGEA 3OJOA 3DAHA 2UXDB 1P4HA 1KXJA 1KSFX 2C99A 2NAPA 3ETJA 5DW0A 2R8RA 3I2FA 3R76A 1DXHA 1L4GA 1NQWA 2GB4A 4AO8A 4C7OA 1ZJ4A 1QKKA 4OB8A 4RV5A 3ROGA 4BZQA 3NGLA 1Z0IA 3CLUD 3PD0A 1WXHA 3G9TA 3G6KA 3WL5A 3PX2A 2FN8A 2V9CA 3N86A 3EZGA 3NKFA 4QAJA 4TT3D 2FLWA 2V0NA 2E49A 4FMCB 2WZNA 3TVYA 2EGGA 1CUSA 1G60A 3MOGA 4AXXA 2I1WA 4CRWB 1DI0A 1EK0A 2JIOA 3RS7A 2XYHA 4E94A 3NKLA 3B1XA 1AT1A 4IIBA 3SZLA 3FLEA 5BWMA 1U4OA 5IJ9A 1XCPA 4JMPA 2ZQ5A 2Y4NA 2ZXHA 5EIBC 4ZHSA 4ZRNA 4NENB 3AR3A 2WF7A 3ADDA 3X1YA 4YT2A 3TJZA 1Y9DA 3OHSX 1ZH4A 3D43A 3FFWA 4Q24A 3B6ZA 4EMBA 4X65B 1GUDA 2VOEA 4YGYA 1CHNA 3FHJA 3Q6IA 5IC5A 3DNFA 3Q7RA 4UDNA 5GINE 3UJ9A 4ZI3A 4GMHA 3W3AA 5D3KA 2C0QA 3MFYA 2A9FA 4ZAGA 4OMCA 2HDNB 5EMMA 1LSUA 4N82A 5IH7A 1E18A 3IRUA 4FE4A 4JYAB 2QU7A 1CUEA 3EEBA 5KOIA 4D57A 2QJFA 3NOXA 2D2IA 1MX5A 5BMVB 3OJ0A 4LN1A 2QL7A 4J1NA 1IMJA 3NJRA 5IYRA 3U31A 1NQOA 2D00A 2G8NA 4AIIA 2WM9B 1QHIA 5JJLA 4QYMA 3QX7A 1KZ9A 2IPOA 3HO6A 4GYKA 5ARBA 3PLAE 4MVJD 1QUEA 1ACJA 2MR5A 1YONA 4MQFA 1E6KA 2Q99A 4MNTA 5AM0A 4MVJH 2AOWA 3FCAA 3TTXA 5BW6B 1EKXA 1F0YA 5C46F 3E3AA 1X7DA 1HO3A 4DQVA 4DDKA 4NF2A 5JI3E 1ICIA 4EZIA 5DSZA 2PX5A 4MIKA 1SVOA 4UM5A 5K3OA 4X90A 2R65A 4DUGA 1Z7EA 4XYEA 3W9UA 5EE0A 2AKYA 2GPJA 1XLTA 2O4CA 3MWDA 2GJ8A 3OTIA 4FNMA 2F1IA 2W7TA 2OCXA 2XQKA 4I7EA 2IV7A 1O08A 2Z6QA 1DC5A 2I6QA 2ZYUX 2IYWA 4QXAA 1KOGA 1U3VA 4LK3A 3SLKA 1AE1A 3VU1A 3WL6A 2X8JA 4CL3A 1AMUA 3IO5A 2NADA 3Q5DA 1EK1A 4HXYA 3SEQA 1IC6A 1G63A 3CNBA 1R66A 1IEWA 1QIEA 2AUNA 3VX3A 2WJYA 2JANA 1XL1A 4RZHA 5G0WA 3CSSA 1TZJA 4FNOA 3DEHA 2EKBA 2XB8A 3IR7A 1TNDA 5I5GA 4U7TB 1TE2A 2YXLA 3ZJTA 4PBSA 2H4JA 5FBQB 4ZCSA 5IJXA 1P0FA 4I4IA 4L0DA 1CY0A 3CZMA 2QL5A 5F9HA 3S2IA 1C30B 2WSBA 3LK6A 1Z39A 5FPQA 1NVWQ 3PNBA 3HY3A 2D6FA 2IPLA 3CZ5A 1EZZA 2QOEA 1L5YA 1ZMBA 3BH4A 4A6DA 4CV1A 1R6BX 3AETA 4TL8A 4LF7B 2ZKIA 3FTEA 1U0JA 3PGJA 5HK8A 4HAUA 3LQRA 3AI7A 3THRA 3DL4A 3MNFA 3K6RA 1KI6A 5EINA 4DR7B 1UMCB 2XKKA 2IYAA 3CXRA 2O7QA 2OZLA 3G7NA 4IQFA 4IDOA 3SJCA 1JE0A 1IOZA 2P75A 4TQUS 4DSUA 3FPPA 4QSMA 1OZGA 3CZCA 1GTG1 1O0CA 2VDLB 3HKEB 4ROSA 4Y2VA 4EF4A 1D8TA 1KYYA 3JQRA 1ZW6A 2C1EA 2VPIA 2ZYHA 2UV8A 4DHEA 4XVCA 1QCYA 3HZHA 1U2DA 5A4KA 4NBLA 5KWJA 1QO0A 2GVZC 3KQPA 4DWVA 1WDKA 4GNRA 5AVRA 1CEYA 2YJZA 3NBYC 2DOKA 4CDGA 4Z51A 4B7XA 4C0XA 4Q7JB 2WMYA 1L5ZA 2AUTA 2DFNA 2QTGA 2QRLA 4LWOA 3T7SA 1CJMA 4H9GA 1CHDA 1Z75A 3MCZA 4ZD6A 4B6QA 1VG0B 4P35A 1SU8A 1G20A 3HLKA 3JQ9A 4PO3X 4GWLA 3W90A 4JUBA 2PJRA 5KDDA 4WLVA 3NV7A 1R4NB 4LPSA 1YQQA 1LLDA 2ZR9A 1WHTA 2Q2NA 4P83A 3KR2A 3NVAA 3GG2A 4FQ7A 3LX5A 2ODTX 4J2OA 2FW8A 4UJ3A 4D80A 1WDWB 4XQEA 2NUAB 1Y8ZA 3VYUB 1LUAA 3HCNA 3IBSA 2AW5A 3IEUA 1YDFA 1P6UA 3DMYA 3LLCA 3P0IA 1H2YA 2I4OA 4PGGA 5KHOC 5LM3A 1UDCA 3O4GA 3VTAA 1LS6A 4Q9IA 3B5IA 3BL5A 1A2BA 3LE8A 1TF5A 5IF9A 3RUHA 4GEKA 1XQVA 3ZEIA 2AL7A 4FSHA 5KDOA 2BKXA 1QIHA 1ZCBA 3GEHA 4M55A 4PIVA 2FWIA 4NE7A 5DTMA 2FQQA 1WU7A 3T5CA 2V5AA 2PU7A 1C7JA 4M37A 1GFWA 4UXIA 7YASA 3TNLA 2J85A 5UKDA 2OXCA 1S0UA 1JYEA 3H83A 1EBFA 3AJ8A 3LQKA 4WVLA 4YMIA 5FR1A 4C5CA 2XZPA 1PSZA 1VRCA 1ELOA 2RJ3A 5EIEA 1J5EB 4HMPA 2IBTA 4AN0A 1ZJ6A 1Z0FA 4QYIA 4HUTA 4MKZA 1MW8X 4JI1B 4K26A 5CXXA 2P2YA 1ZH8A 2IP1A 4RWZA 3MVEA 4QT4A 2HA3A 2VSFA 4HJRA 4JLUA 3FPCA 3I58A 3IEXA 4QD3A 1E7YA 1DUIA 2F9FA 2YXNA 4ND2A 4DNXA 3DD1A 2EFJA 4W9RA 4G0VA 2WHEA 2JFUA 3THXB 5ALKA 1NSFA 1HY3A 1T8UA 1OH7A 3EW9A 3VPSA 1FPMA 2WTAA 3LHIA 1NVXQ 1G4HA 4HB3A 4XJTA 1O96A 2VG8A 4ZQBA 5H0IA 2P1ZA 3F74A 4GWKA 4M8SA 1QIGA 5FTNA 1Z0SA 3G02A 4K1XA 1KC1A 4OAOA 3F6EX 3TCXB 3PC8A 2J8ZA 3T41A 2XWBF 4CU5A 1XCLA 2F43B 1AK1A 1TQ6A 3L7OA 4M0PA 1H6DA 5DGXA 1E8MA 3MWYW 5F98A 3ZBUA 2HSWA 3CUWA 3AUTA 3L1UA 1X1CA 1RXYA 1KDVA 4RM3A 3AVPA 3SYRA 1VJTA 3PQEA 3TOVA 2I1VB 5JPIA 4GE0A 2ZCJA 1KZYC 1T0BA 2GASA 2O2YA 4XKWA 1XLVA 3OCWA 4HBZA 4J1QA 1BXGA 1A9RA 4L0CA 1G4AE 5ER6A 1R0RE 3PQ7A 2IL1A 1VM6A 4RQTA 5HTOA 3SLNA 1OU0A 1T6NA 1DDOA 4IF4A 1LDGA 4R05A 2JFHA 4RHEA 5DOZA 3GLIB 1J0EA 3TO5A 3PI6A 2BM0A 1LLCA 4DR4B 2H4ZA 1N77A 2WB2A 1B6SA 4OQEA 1CUUA 1EGQA 1FUEA 1K6XA 4RMHA 4D1YA 1M76A 1ZR4A 3KXPA 1X92A 2FPIA 3QWBA 5C5DA 1K8RA 4WDQA 1KRXA 3MILA 3QTLA 1MP0A 3QWIA 1SG0A 1N08A 3AJEA 4JSTA 1FLNA 1NVDA 1H5NA 2AF3C 3L05A 5DJ5A 5FWYB 1MN6A 2GQ0A 4C0WA 4CKWA 4X5OA 1NY6A 2W6NA 1BH6A 5EQJB 2CLDX 4XVUA 2XODA 1PI3A 1ISJA 1ONOA 3IBTA 4CV3A 2ZE5A 3QF7A 2FWPA 3IXLA 3KQWA 4UOEA 4WLUA 3GYGA 2ACVA 4BCDA 1N6PA 2QTTA 1CY7A 1GIAA 3EIWA 1BC5A 4BO5A 2FU5C 1N07A 3WOVA 1J7JA 4KR2A 2WZQA 5TC4A 4WIAA 1I6KA 3WAGA 4X66B 4CM8B 1A7AA 1OWNA 1RQXA 1EVZA 2B2XA 2QLNA 1CIPA 2VAVA 2WIGA 2X3YA 2ZUWA 4ODIA 5IZCA 2C7PA 5IXSA 5CEEA 4PC1A 3DO8A 2GBCA 1P2UA 3H8VA 5DXJA 1YL7A 2IA5A 2IYXA 3CBGA 2NSDA 3H1PA 3CMEB 2G83A 4DREA 4QLBA 1J25A 4ZT4A 3HM9A 4A16A 2I4IA 1FUUA 2D2EA 3ONVA 4ISCA 4B79A 2QXTA 4XUEA 5BOVA 1ND5A 2IHZA 4DKXA 4E14A 2XNSA 1ISRA 1Z5GA 5HMMA 1GFIA 1SUCA 3IUBA 4HDRA 1I24A 4ITRC 1DAPA 4C7BA 3EDMA 4J2HA 2PRYA 1SM4A 4X93A 3GDFA 2IIQA 1GTL1 2HIMA 3KKOA 4RC9A 2PCJA 3PKIA 4EG8A 1E63A 2IIBA 2J9FB 2XQFA 3QVWA 1T2FA 4RSMA 4Y1GA 4YUWA 3IOEA 2HCBA 2BJWA 3NYWA 1B16A 3ES9A 3G6EB 1PF7E 3T4UA 1B0PA 3VPAA 1P2VA 2QGZA 1QFZA 1YZNA 2QT0A 3QVTA 2GHQA 2WZBA 2BFBA 5AKKA 1L3IA 1JKXA 5I7SA 4FZ5A 4XOUA 1XU7A 1U7UA 3KTAA 1VCHA 2R6CA 3S2YA 2JHCA 3DHEA 1JHZA 1MG0A 3N5CA 4INAA 1W5SA 1VA4A 4S1TA 2Y1KA 3K73O 1NJFA 4RENA 1WOMA 1E2GA 3AY3A 4FIZA 4C6RA 3N2LA 2EJVA 4CR6A 1C29B 1J2TA 2D2VA 3RVLA 5DNUA 3ZDYB 4D9HA 3GPDG 4LCJA 2P90A 1V11A 4GMDA 5TQJA 2JDIA 1Q0PA 1JDNA 1TK3A 1KBOA 1WDLA 3HZZA 1Z0JA 4N0EA 4X8IA 4MS3A 4PFQA 4RIGA 4ARUA 4PNEA 4K9PA 2BEWB 4WI1A 5G0VA 3ZY5A 1D6JA 1HG1A 4DMUB 1JIXA 1UBMS 1DKPA 2W5UA 2CGEA 3A0RB 5H3LA 5ALHA 1AX9A 4CG2A 2RHOA 2VDQB 3P2JA 4U8GA 5DOVA 5I51A 1BTOA 2QJOA 3LZCA 4WGGA 4CMIA 1AKRA 4XUDA 5CVCA 3D1JA 4IIJB 2XX3A 3AY6A 3EIOA 1GNPA 2VWQA 4QJ5A 1I9CA 4X0CA 1PIWA 2LW7A 5LQSA 3THOA 1GYRA 2IYRA 1ZL0A 3R3JA 3LCMA 1A8HA 4NJMA 4R2XA 3AFHA 4DCTA 3RVPA 2H5EA 5TQ2B 5JSKA 3ZQ4A 1ULTA 1JHDA 1IEVA 1CR0A 1K5GA 1LI7A 2QAGC 2ES4A 2UAGA 4NJEA 1SCDA 2QVCA 5JCXA 4XE5A 4AKGA 3DHVA 2VAXA 2B4QA 1KP3A 3GRPA 3D26A 1C50A 4OKSA 2AFIA 1Z28A 3OO1A 1Z0KA 1O5TA 4M1ZA 1M3SA 4MJ7A 4BV9A 5A9RA 5B4UA 3VOBA 2X14A 2GJ9A 1MVNA 2WC1A 3LUPA 3PUZA 3DE4X 4HQLA 1L7XA 2GWHA 3AVXA 1CS0B 2H57A 3AV3A 4IYJA 1IQ0A 4L27A 1SVIA 3RNLA 1TL7C 3S2ZA 5EQTA 4U7GA 4F11A 1SVLA 1ZSNA 5A0TA 2A5GA 1QR2A 1Y8QA 2XKAA 4A2CA 2DX7A 1VG8A 3BAZA 3CF4G 4RXMA 5H4HA 4ERXA 5B4VA 2I6XA 2UUBB 3F9IA 1RHUA 3BFVA 3GI1A 4YBRA 2P9EA 3P0EA 4PFJA 4ZZ1A 1W35A 1ZRMA 4MJ3A 5HZGA 3M2PA 1GKUB 3P94A 3RADC 1RBQA 3W8FA 1KAHA 4KACA 5SY9A 1SXJB 4WLFA 1Q1GA 1I8DA 2OBXA 4CEHB 5C8YF 2QP3A 1OBVA 1T4BA 3D54D 1NKTA 4H08A 5T57A 2WYIA 2E1BA 1GGKA 1RI5A 4BB5A 4U4AA 4CKWB 4CM4A 2EP8A 2VHYA 3SHFA 4R1OA 1ANKA 2ZBEA 2QM7A 1Y1LA 4IGEA 3ZI7A 5BSTA 3E3OA 3GLGA 4FWIB 4YMGA 1ZA2A 1HYHA 3DV0A 4DLUA 4N54A 3W6NA 5BQPA 2OZKA 2VTKA 3BHNA 1UBKS 2FN7A 2IVZA 5J23A 1OC2A 4HDMB 1TZBA 1BZYA 3IS3A 4LV6A 3D6HA 1VCMA 3W1EA 2LGJA 1UP6A 3LWBA 4GZLA 2A5JA 4DLPA 2Z6VA 1LKZA 4ZVRA 4KODA 2G7MC 2X9QA 2ZKLA 2ZUDA 5AI4A 3RLIA 3U39A 1DBSA 4KGDA 2R8YA 5J5VA 3SKYA 4BX9A 2DCUA 1ZGZA 4KN9S 2J0UB 4AJEA 4DQ0A 3TX6A 2G9VA 3E22B 4BV2A 4NCIA 4NJEB 1JV2B 2J0EA 2R62A 3VTKA 4AY4A 3EPHA 3IT3A 3LW8A 2Q50A 5KTTA 3F7NA 3AFIA 5IKPA 5F4JA 5IT5A 3RY8A 4KTTE 4U7PB 1E79D 4BDTA 1QPZA 3Q0IA 1SZDA 4IO0A 5KTKA 5KYUA 4B33A 3ZVMA 2J32A 3KHKA 2XCIA 5BV0A 1V5VA 4YDRA 1HYEA 4QUGA 1FTWA 2GVNA 1G3IA 2BEKA 2BM9A 2JIRA 3ST7A 3VHXB 3IKTA 1YVEI 5CRIA 3PQ8A 1QZTA 4DMFA 5JARA 2C0PA 2WA1A 3KT8A 1AKWA 5AHKA 3Q11A 4YWHA 5HF8A 5LQRA 2LCIA 1QFMA 5BY2A 1U1DA 3O8RA 3CNNA 3L93A 2GJKA 3ZVRA 1DG9A 3JWHA 3I8OA 5CFOA 5IN4A 3C7CB 3K7EA 1UF9A 2XDYA 3N7AA 1Z62A 4DQXA 1QLJA 2EBHX 3ERCA 4C7OB 1GDHA 1NBHA 4MUBA 1RPZA 2O57A 2PR7A 1IQPA 5J9FA 1IYZA 5JUWA 3O3OB 1KY3A 2EKQA 4L0MA 2NPIA 1P0CA 2DH6A 1X2EA 1ULZA 2PVPA 4F4FA 2MSCB 1F1JA 3HG7A 2RC6A 4E5NA 2ORIA 4JJZA 2AZXA 4F4HA 2GCIA 2I7TA 2CHUA 3R1IA 3O1HB 3NWOA 4YLGA 5P8WA 5J47A 3K0EA 3AINA 2J9RA 1O97C 4F4UA 3LF1A 3ITEA 3MB5A 5FI3A 3VR2A 2RB5A 1QHEA 2QRNA 1CZUA 4WINA 1JHQA 2GEFA 3ZZUA 2QI9F 3TE6A 3UN1A 4M76B 3CVXA 2JN9A 3LT5A 2QGNA 2RHBA 1I36A 4K86A 2PRIA 4ZHQA 1C2YA 1F3LA 3AF5A 1DOZA 2Y05A 5K3FB 5JSQA 3DWGA 2FEWB 1FRVA 1X74A 4XGIA 4CYMA 1IHUA 1NQ5A 3G2OA 3GJQA 3JQQA 4KKUA 1PS9A 5DW3A 5LJLA 4HNVA 4XIFA 2EHDA 3OZVA 1YS2X 3BB4A 2UYHA 3FYTA 1Y7HA 1ZKDA 3HKCA 3DKKA 3FWNA 2XQGA 3DO6A 3M6UA 2G76A 1KP2A 3EAGA 4PF1A 4B17A 5B2ZA 4C3UA 2R6DA 4J0CA 4KVGA 3UHOA 1BWSA 1GPLA 3MSCA 5DM60 4TLLB 3CM0A 3OE4A 4NTZA 2CV2A 3WJ1A 3FCXA 3V1MA 1EUCA 1YB6A 2E3JA 2GD2A 1VOTA 2CCGA 4HFRA 4OXNA 4D6XA 2PRJA 4V3CA 1A96A 1F2UA 4ALJA 1PT6A 5KNCA 1ZMXA 2P4EA 3KX2A 1U2TA 3LVFO 1A2QA 1NBEA 5LYJA 2PNJA 2VPZA 2WJPA 4QO8A 4DLLA 2VSXA 1RWBA 4Q0MA 5F2NA 4OQXA 4RAQA 3R5XA 4MKFA 1HMPA 1NYTA 2AMVA 4HAYA 1LBSA 5J40A 4WFJA 3RIYA 3UBTA 2Q8PA 3LO5A 1NPDA 3AHCA 2NPOA 4A6XA 4MRPA 3QEMA 3OZ7A 5JO9A 1KZHA 4G4IA 3H19A 4BECA 1BD4A 4P22A 3ER6A 3LY9A 1C5KA 3K9LA 2PXAA 4QUZA 1S8AA 2RHMA 2ZRQA 4B84A 3LX4A 4Z4ZA 4ZCTA 1HNXB 3G0HA 2O48X 1EWYA 3WIEA 3I72A 4OUDB 4NBSA 2ZPTX 5HDBB 2MYUA 2IPXA 3IA7A 3EEQA 4WL0A 3HSSA 2O05A 3BXPA 5KX5F 5GZ6A 1IZZA 3JVUA 3VPXA 5EUMA 2HTFA 3KBBA 1V5EA 3KL2A 4KNWA 1SCUA 2ZAGA 3SZMA 5BVGB 3ZKWB 3M3DA 3DR3A 4AVZA 2C3UA 1X7WB 4LRUA 4CIBA 2BMVA 5BSMA 3NVDA 4OYLA 5EHZA 3QFSA 2QDXA 1CPYA 3PDIB 2R60A 2QX6A 3CRZA 4TXJA 1WG8A 4HVTA 4X7PA 5JAMA 1W8IA 5B3KA 1QO0D 5I5EA 1EWKA 5LLSA 3ASSA 1T1EA 2VUIB 1ZN7A 2XUIA 3V2HA 4PGOA 1M72A 2HNKA 4L4YA 4UNQA 5DBGA 3URMA 2WT8A 1GNTA 3IE0A 3WBJA 1L5SA 3DG9A 2W6ZA 3KEMA 4JOBA 2VPYA 3ADCA 3X1ZA 5HQJA 3SYMA 3ZUPA 4Z4QA 2OM6A 3DS8A 4QDOA 2VT2A 3W2HA 2X53S 4XOPA 1S3IA 1XHFA 2FVXA 5EPEA 4WOCA 4WY2A 3BD7A 3JX9A 1QGED 4I5IA 4NAVA 4BU1A 5M29A 3IL2A 2YNMA 3L6CA 1DAMA 5GY7A 1B3BA 1H3FA 4QARA 3B85A 3NG1A 5L6LB 5CXSA 3WZMA 4ZODA 2RHGB 1M8GA 1DRUA 3GEDA 1A9ZA 2F4NA 4X07A 3DOJA 3KUKA 1V7ZA 1Z36A 2FCAA 4UFNA 5ANRB 5F76A 5MGBA 1V9LA 1NQVA 4P0PB 3GG9A 3C98A 3GROA 3EF3A 2MINA 3L1HA 3PPIA 2P9YA 3SE0A 4AZ0A 5BPHA 1GTRA 5U1PA 3F7TA 4TVSA 1FDUA 4D4JA 1LVHA 1JHXA 4Z8XA 3ZK7A 2IOQA 4ALIA 3A6LA 5I4BA 1USIA 4X6LA 4OATA 1O94D 1HVXA 2D0OB 4DLSA 1Z34A 1C9DB 4U0KA 1OLUB 4I5FA 2DM6A 3GWGA 4TS1A 2AD5A 4NAHA 4NR0A 3W79A 4DSZA 3CCVB 3MUNA 2X0DA 2ZUVA 3FKSD 3MTQA 3WISA 4MARA 1Y63A 2WWGA 1DLJA 5AKXA 4F92B 2VXYA 4AF6A 1QB7A 1U02A 1XCMA 3DH0A 2OGSA 3IJ5A 4OSPA 2G0TA 1MVOA 3EAFA 1J5XA 4HBGA 4Y9RA 3ICCA 1BA2A 5CFMA 1M10A 4CTOA 5K05A 5HW0A 3CS3A 1P0MA 1UEXC 4GDMA 3UPDA 4R8LA 4RY9A 2XRFA 1P1KA 4ZA2A 1A9XA 1UWLA 3P9YA 1XFOA 1XTTA 1F2VA 2PL1A 3QOXA 4YMVA 5EJFA 4G0YA 1E2KA 5CM8B 1VBMA 5FTKA 2G63A 5H7XA 4D4GA 1EUQA 3BHJA 1NR7A 2Z98A 4ZVVA 5JS2A 1OA1A 4PV7A 4DFDA 4YXFA 4BLQA 2WD7B 3MELA 4KGZA 4CM6A 4ZMBA 1LVUA 3PWKA 1MB0A 4IWXA 4X92A 4BWFB 5KNCD 5DNYB 4WZEA 3CWCA 1FXWA 4XLFA 2Q6KA 3JR3A 3MWEB 2IUYA 1SKUA 5EXTA 5J4YA 1B93A 5GIPE 1IN1A 4CIXA 3Q12A 4FYVA 3VZCA 1CQJB 4AY5A 2OBSA 1CU1A 5H83A 4AXBA 2DF8A 3MT0A 1JFFA 1QIJA 3W6ZA 3WLKX 5BN4A 4JB3A 4U9UA 4KFRA 1NVVQ 3PX7A 4RV4A 1L8QA 5FJJA 1YD7A 3JAMA 5HEKA 5T67A 1JYFA 1NJ8A 1EVYA 4YAEA 3K6JA 4ZQHA 1GG2A 1PQ4A 4GECA 3Q3VA 4HN9A 2RI6A 4P81A 3HDGA 3WJ7A 2ZXIA 2WKQA 4HAVA 1KO7A 4RULA 5JZSA 3F5FA 1IATA 4D9KA 4RXUA 1K7CA 1NW9B 4XPZA 2LVBA 3A06A 3COVA 5LFAA 1EK2A 3H9NA 2JIZA 2C5HA 2HRRA 2QPLA 2QVLA 2DYIA 1N3BA 4EVQA 3J81k 2J33A 4J3FA 2X5KO 2EQ5A 4L5JA 3KEOA 3R8CA 3Q0EA 5EZSA 2ISSD 1H65A 4TRRA 4W1QA 2PU5A 4NQZA 4UTZA 1UXKA 2H7VA 3GAMA 5FI5A 1QGZA 4ZT6A 1U0FA 1KZ7B 2NUBA 1CY6A 3KEQA 1R8YA 1P8JA 1XEAA 3EXG2 4ZU3A 3EEIA 5DFAA 1QMGA 3JCZA 1S3SA 2DFLA 3H5WA 4C0HA 3NI2A 1UC9A 2I6SA 1HUQA 2H1CA 3ADPA 3AOGA 3HVHA 1W25A 2G1AA 2R6ZA 1BHJA 1ZCZA 2C4KA 2VJDA 2Y0EA 2DOGA 2PPLA 4UCQA 3L01A 2AXNA 1UWCA 4UEWA 3TQRA 3WWPA 4F45A 1UBRS 1GPDG 2G8LA 2OV4A 2HD4A 4IG9A 2IVFA 1GTZA 3GD5A 5CCXA 1YE8A 1B4DA 4BLUA 3R3YA 2R6HA 1OKKD 2PZLA 5BSUA 3Q7PA 1DFIA 1PR6A 4PN7A 3PEFA 1SCBA 1EFVB 1WORA 5IYQA 1LFDB 2IZ6A 2ZBPA 3NB0A 1G21A 4I14A 2GESA 4JU8A 721PA 1IIRA 3BNWA 4YUYA 1KZ6A 1VHDA 2GF0A 3QBTA 2Z9CA 4XIYA 3HADA 3UVEA 5CIYA 2ZSFA 1SIOA 4IDCA 4Z2YA 4V24A 2CRVA 2PL3A 5K4HA 4LRQA 1PR3A 3CLKA 3P4XA 3G05A 1AQIA 1KORA 1WF6A 2R96A 4LWQA 3KFVA 3M4XA 1S02A 1EJ6A 2GZ2A 1OXMA 2R87A 1UMDB 3WGLA 4YMHA 2JVKA 4HSGA 1XRNA 3JZFA 3PFWO 3S2GA 4F56A 3AEZA 3IB3A 3RBAA 1KAMA 3A1SA 3PYXA 2BV3A 4CCYB 2BP7A 5F12A 1HMYA 3EPRA 2DHRA 5BO5A 1TK2A 2DHDA 4RTQA 2QPOA 2X0NA 3ED5A 1BS1A 5DMXA 4ARBA 3DXZA 1HE3A 2RCYA 4UULA 2IV2X 1X9HA 1YA4A 4H59A 3HZOA 4D0LB 2BTQB 4BFLA 4FJ0A 1P9NA 2O0MA 4QGFA 2Z57A 5IK2D 3KPVA 2CXHA 4Y1EA 4M22A 4WBNA 1PZFA 2C4UA 1RZVA 4KZKA 3QFCA 2IHUA 2JZOA 3ZXYA 3T1NA 5EAIA 1Q1EA 3EFHA 1W88B 5JTUA 2PWAA 4P54A 4UCFA 2FWBA 2CT8A 4KHPB 4N41A 1WMDA 1P1IA 2QX8A 4PHFA 1YU9A 2QP9X 4MCHA 5AI9A 4RTLA 1X7YA 1IMOA 1EX6A 2VQDA 4MWGA 4RY0A 1RW4A 5AHWA 1OXXK 5DBHX 1U7DA 5CA1B 2E55A 4YRAA 4HDNB 2DQYA 1SA0A 2CLMB 4H35A 3GCWA 3HYCA 3G5AA 2NXJA 4WK0B 4XYMA 1O9BA 3LUHA 4HNUA 1OHHA 2JLAA 3AUFA 4BYGA 4YY3B 1WPCA 1GV0A 4IINA 4JSRA 4WRRA 3ABZA 5A9TA 2DZDA 1VIVA 1KSGA 1HC7A 3C6QA 2XYVA 3IAUA 4FFOA 1QAMA 2C3OA 5E4YA 5CEFA 1G9SA 2CUZA 2Q29A 3CR7A 1M1UA 4CTKA 4DDUA 4ZZIA 5F7XA 4K9DA 4OXYA 4MB0A 4NS4A 3KVYA 3MYYA 4KQ1A 3G2KA 1M2FA 2VATA 1R4ZA 2Y2VA 4TZTA 3ZY3A 1KZ1A 2OCGA 3LI2A 4PTYA 2VTEA 2J9XB 3PFGA 1TMYA 1ZD5A 3AHDA 2HPZA 4OA8A 4QGHA 4UCXA 5EXPA 5TGTA 3VQTA 4EM6A 1XKXA 1XRRA 4IH9A 1J2RA 4GM4A 4RESA 3G89A 3P26A 2BEJA 1TECE 4DIMA 3WIOA 3IUNA 4XD2A 3V4LA 1TYEB 4CGYA 2CF4A 4HMOA 3O26A 5A3QA 1P4RA 1J6UA 2XB6A 2QAGB 3KZOA 3ZIUA 3CO5A 4BNTA 3CVVA 1PNTA 1YDGA 4M87A 4OXQA 2HF8A 2XHZA 1ES9A 2B21A 3OE7D 1EXNA 2WM8A 2ZI5A 5F77A 3TINA 4CTJA 1JDUA 1KAOA 2O2SA 1WSWA 2Y9PB 4V0KA 1QX4A 2IW3A 2ZRMA 5EE5B 2I7DA 2C54A 3OE5A 5ENDA 2QIOA 2WWXA 1QVRA 1WS6A 3CY6A 4HH3C 1BHQ1 4MKHA 1TD9A 4X94A 5F2EA 1SBHA 2AN3A 2HU8A 2YJTD 1L7PA 1DEKA 2JA1A 4BKQA 1X9GA 2FCRA 2YZ7A 3GQBB 3PVSA 4B4OA 4YCJA 2DQ4A 5HF9A 2ZZNA 1W87A 5A6SA 3K1ZA 3T9DA 2ZTVA 4MROA 2H54A 1YBAA 5G40A 3G13A 1ZJZA 2BP7B 4XUGB 1RI2A 2X4LA 4CFSA 3GUCA 3CSDA 1WP4A 2IKSA 3HY6A 3ZN2A 4LTDA 3MC1A 3DE1X 4KZPA 5JNRA 2J41A 1KFJB 2QM3A 3LXUX 1NPTO 3IP1A 1ZXBA 3A4LA 1YS9A 4YMUA 2DVMA 3FBWA 3ASPA 3CMMA 2ZJ8A 5HIJA 4ADSG 3PX3A 2Q2WA 1GY8A 2YV5A 5CJPA 1WX1A 1N8TA 2EOAA 3JQ8A 2ZXEA 3I9MA 4CTMA 2FZ5A 3OLQA 3R44A 3LF2A 2QTWB 2L19A 2G3YA 4I55A 1E3XA 1DRVA 5CVEA 4L5AA 3ORQA 4B0PA 3JWIA 3R9IA 2XF8A 3BD6A 3RVJA 3V8MA 3IQEA 4YO8A 1V1JA 5C9ZA 1AZLA 2HU2A 1V6AA 2JGKA 1VQPB 5TB5A 5DT9A 4JSYA 1Z37A 2VF7A 1ILEA 2WVJA 1IVSA 3ZKWA 1GCUA 2AJLI 3L1KA 4IXDA 4N4AA 4M0EA 1AN9A 2VJCA 1OT3A 1XVTA 3CMCO 1KO4A 4RM0A 4F3CA 1TB4A 1IHYA 4NZOA 2O7NA 2H2HA 2RGGA 3EDRA 5LCXA 1NYQA 3TFWA 3RM3A 1JPJA 1ZNQO 1YJBA 3CUKA 2C2MA 1R7RA 3NS7A 4RVSA 4DY4A 1PT9A 1KHHA 3O31A 3ZWQA 5HRUA 1CVIA 1P5HA 3CLTC 1R27A 1N36B 4JJIA 5H9WA 4C6HA 5EE9A 2DE0X 1DXOA 2E21A 2E89A 2XLCA 3RQIA 1KK3A 2YZMA 4RYDA 4PABA 4F6RA 3LQ1A 4BMPB 4TYNA 2ECQA 1A7KA 2D5IA 4NFLA 4X3OA 2XVXA 3EZFA 4L8GA 4CIAA 1K97A 5BNFA 1APBA 2XJ4A 3LQQA 3M5WA 2QZ9A 2OLJA 3TZ6A 1SVMA 4E0FA 3WNVA 4ITUA 4TKZA 1OHHD 4PSAA 3NMUF 3PUIA 3G5UA 2VK2A 2G04A 3AOEA 3OMWA 4U2GA 2H0RA 4R7ZA 4LF5B 3P0FA 4MPTA 3GT4A 4X71A 5ULLA 5TMBA 5KMGB 1YRQA 2MSNA 4BNIA 4D2IA 4B7ZA 4JGGA 4NMWA 1QDEA 3CF4A 4PZLA 4RNDB 3I2JA 2Z58A 4J3JA 1UFVA 2QG4A 3ZXXA 5BN3B 2B92A 2PMEA 3GMTA 1E2EA 4CKYA 1E1CB 4JQOA 2A2ZA 1YMQA 4QJIA 2F4VB 2XLBA 4R31A 5DX1A 5M5BA 3EIXA 3ESYA 1NL3A 1ZK0A 3P4YA 5DO9A 1NVKA 1U8CB 3ORYA 3R3ZA 1O94C 1QS0B 4ZT3A 4C2AA 4ETMA 2JRCA 1MPTA 3EBLA 5FR2A 3R0ZA 2HQSA 4YP5A 3PXDA 5CITA 4IWYA 4MRSA 3Q38A 1Z4MA 3JYQA 1PGOA 3H87A 5WRFA 5E6UB 4ZTBA 1GADO 5DDIP 2PBRA 1BD3A 2B0JA 4QGAA 4M9QA 5SY4A 1XJ0A 2H11A 2O2IA 3AUUA 3B51X 2W43A 2X7HA 3K35A 3OF3A 4HS9A 3SSNA 3Q7QA 3A70A 5KAPA 5TE9A 2OKGA 1JVSA 3G2PA 4CPDA 1RYYA 1D7AA 2GN8A 2P2NA 1GYQA 2IEZA 2QMZA 2GCGA 3ZCSA 2A88A 2RHHA 2BH9A 1UMBA 1Z8DA 4EW1A 2YRFA 1BKYA 2O9JA 2WAXA 2DJIA 3HV0A 4KO1S 1ZH6A 1IY2A 3HR7A 3NFRA 4HG2A 1KHTA 3TN7A 3L82B 4ZGNB 4XD7D 5BN5A 3I1YA 1UXOA 1R9JA 1ZOOA 3PEVA 1PE0A 2X6QA 4RYLA 1TVKA 4EG0A 2YKGA 1E4EA 1T9ZA 2IW1A 1XNJA 1DQRA 4JQZA 5BRNA 3UMCA 3LHDA 5HNKA 1UJNA 4CBVA 1UK7A 1W96A 4XWAA 4RF2A 2ZRPA 2EP7A 4Q3DA 3PPYA 1L5HB 3VZBA 1T1RA 2V7QD 1GA1A 4N6GA 4TTJA 1YJNB 1U2EA 3ASYA 2YN0A 4RZIA 2V4ZA 2PO5A 4HAZA 1EDOA 4EA9A 1TEHA 1GR0A 2WFMA 1GCIA 1PQWA 1S8FA 4OYRA 2RHRA 4JBLA 5A5FA 5BWNA 2IYYA 3JRXA 1J8YF 3NZEA 4MVCA 1DAFA 3CU5A 3KXLA 1N0UA 3G8YA 2G6BA 4FZVA 3PQDA 2IBSA 1HSOA 2AXEA 1ZDMA 1CNEA 3PJDA 4ENVA 2GNPA 1CUDA 3ANTA 1ICEA 1NV8A 1KMMA 1JZQA 3D2LA 4MW7A 3WBBA 1XG5A 5JBIA 1HQDA 1D09A 1M34A 3RRMA 4DCSA 2D5AA 1EFDN 1A95A 2AG8A 4N7RA 4AMBA 1IBCA 1OBFO 1PKEA 3DLTA 3PYMA 3RUPA 2XQIA 5JWOA 3CKYA 4YONB 4UOZA 3ZJVA 1CBUA 3M9XA 2PZFA 4OUDA 4A0HA 3X2SA 1BN6A 4XW2A 1ECFA 4BQIA 4E5KA 3GRVA 3WL3A 4BWVA 4W8OA 3GRKA 3OA2A 3NTUA 5GV7A 1IPEA 4DLZA 3LFTA 2REQB 3BXOA 3H9CA 5AM5A 2LKCA 4COOA 4Z6KA 5CLJA 3AR4A 5JMTA 4KPGA 2EJCA 1DBQA 2WUDA 3NRJA 1IM8A 2IYUA 2YNMD 1RDFA 3CZAA 4JLPA 5DYNA 4EOGA 1F5SA 4Q9KA 2ZIFA 1O03A 3KKEA 1TC2A 2W2QA 2QAGA 4R8VA 5EHQA 3O74A 1DEAA 5DN6D 1E6LA 3GBPA 1GO2A 3ILHA 4MPDA 4AROA 3HU1A 2ZUTA 3B1WA 1N5DA 4KMSA 4QVKA 4L8VA 4ZJPA 4N03A 1HZZC 4RO0A 3FIJA 2RBKA 3F6SA 2FP3A 5IS2A 1E3ZA 2FDCA 4HNAA 4B6FA 5IU6A 1EXMA 1R5BA 4BNJA 4CMEC 5BN1A 3FE2A 3DPSA 3FFTA 4GYYA 3U40A 3ZZNA 2YQ5A 4BBAA 3A1NA 4CMKA 3N76A 3L4BA 2W6CX 5TRTA 4PGMA 4TKOB 4KKTA 1VLVA 5CH3A 5CH8A 5D5HA 3TZBA 4DPLA 2PFKA 4BQEA 3U81A 1PQUA 2JATA 2NUAA 2GCEA 4FYWA 1R6UA 3TE7A 2GT1A 2GJPA 1U6IA 3HU5A 3V4OA 2HJWA 3U7HB 5IBRA 1NASA 1KFKB 4BLWA 4IOJA 5ECWA 4EGCB 2Z5GA 1JKJB 3P9QA 1FFYA 1X7XB 2IYFA 3G2IA 3QLJA 3GVJA 4R4JA 4TTIA 5KKCA 1F9AA 3PJGA 1P33A 3SDSA 2IZZA 1CB0A 4AQDA 4PSKA 3V00A 2A1UA 3PDHA 3HBAA 1GD1O 3LGXA 3H5AA 2JVIA 1WAMA 2GRAA 1BW9B 3G2LA 3TDKA 4YUAA 4G07A 1O8CA 1Y3IA 4ZT7A 1I9GA 2DSNA 2RARA 5TGZA 5JVDF 3S1LA 2JA2A 2W6JA 1P9LA 2ZATA 3LH5A 3O0DA 1K9VF 4KSBA 3EBPA 5CDTA 4GPBA 1T8PA 1N2EA 3MA0A 4M4SA 1SCJA 2HLDD 5IEJA 1ZUIA 3KZKA 5HS6A 3T95A 5AXCA 3N2EA 2INGX 4G63A 1WCYA 4RIIA 5CK5A 1H8HD 4FGSA 5HOEA 3JWGA 1JIQA 2ZAOA 2C9OA 1PBNA 3NAZA 3OU2A 4IQGA 2HRDA 4JYMA 4WASA 1QRUA 5DHRA 5FWXB 1GJRA 4PWYA 3PTZA 1G17A 3CO0S 2P4SA 3GLKA 1D1SA 3JWEA 5JMWA 1U94A 1XTJA 4ZYYA 5T7BA 4Y2XA 4OLBA 2G82A 4YH1A 3GPIA 4II7A 5KOHB 1TKRA 1ZISA 2VNHA 1BDBA 3EEYA 1GYPA 2V6IA 1YQTA 2B4AA 3GIRA 1EM6A 1G21E 1R9NA 3FOBA 5JALA 3BE5A 2PUGA 3L2OB 5GONB 1CVRA 2KW5A 2YL2A 3DKVA 4DXHA 3R5HA 2L18A 3Q85A 1V37A 1BXRB 1ECLA 2NQTA 4G26A 1KAEA 3GDGA 4YV0A 2B8WA 4WJKB 3W04A 3JATA 1Y1SA 3KZCA 1DSSG 5HBRA 2ZEJA 4I1RA 2WU0A 5F7ZA 2ZWOA 5TEWA 3U3KA 2GNOA 1EFTA 4GDFA 3L84A 1PVVA 1FU8A 4QQNA 2O52A 3B8EA 3TOCA 5K99A 3HJHA 4I2NA 4JZYA 4N8DA 5JPDA 3HWWA 1V2GA 4B71A 5ESRA 3L0YA 3FLMA 4UHCA 2BH2A 3TZEA 1E3LA 1WZIA 3GLRA 1NU8A 3L6UA 3DUWA 1IPFA 3WVNA 3BL8A 4CQLA 4MLZA 3R6DA 2EYQA 2HHJA 5IKXA 2PX4A 2B20A 2EIHA 3QPVA 2IF2A 4I1SA 2ZRIA 2R48A 1MB3A 3DOFA 2G08A 4DANA 3FHLA 4II2A 1UBFA 4LTMA 4FHGA 4LXTA 1FDWA 5K2MA 2O5RA 5JNTA 2BTOA 3C3CA 4KQCA 2ZE8A 1FFXA 3D3KA 2C4HA 2MDTA 4XB6B 4RV9A 1YB5A 5JTTA 4DCPA 1OREA 2JEOA 3E7XA 2JG3A 2L82A 2VRCD 4RHTA 3V8BA 4DSAA 3H8JA 4CW7A 5KJCA 1WCV1 3PR2B 1UOEA 1SVWA 4FD2A 2HRQA 4RVHA 2ZM5A 1DKUA 3CP8A 4HGRA 1XZLA 1K8YB 1I51A 3CT4A 3OPVA 1LK0A 3W5CA 5B12A 1VSTA 2PX6A 5KVQA 2BGKA 4WH0A 4CIYA 3DC2A 2ZDGA 5KREA 1X6VA 1N6LA 2QN9A 1YGYA 5ESWA 1YB7A 2O23A 1Q17A 4NYMR 3SG0A 3TBKA 2WFZA 7REQA 4IZHA 4FR5A 2NSHA 2J7PD 2AFIB 1GVHA 3LPNA 4FYMA 1BEEA 4LJSA 4R41A 3UWOA 3A9VA 3A28A 5TR9A 1NP6A 1R2QA 3O82A 1C8KA 2R1VA 4C0SA 1GZSA 1OFIA 5KAMA 3WKAA 3T7TA 3BF8A 4RFSB 2FZ4A 1SQGA 2BKAA 4D0NA 5KMGA 2Q49A 4RE6A 3K5HA 2O2ZA 4ME6A 4N3NA 4AMUA 4F1WA 5GWXA 2FHSA 1JDSA 2QQGA 1SCKA 1ZK3A 2YS6A 4GXNA 4CV2A 3PQ6A 3QA9A 1BHSA 1NOKA 2E6KA 4MV0A 3EPLA 5J1SB 1D2NA 4MV7A 2ZRJA 5IARA 1V39A 3R5TA 4MPPA 1C0LA 5G4KA 5L3RA 2YYSA 5DCWA 1G6OA 1XZEA 3GMSA 4PONA 4WFIA 4AULA 2ID8A 3OF2A 2BFFB 4EY5A 1XWFA 1KO1A 1IU9A 1G3RA 2RC5A 1KQPA 3UFXB 2EKLA 2EKZA 1X7YB 2JJYA 4TKUA 1CDDA 5GJWC 3MXTA 1PR5A 3VOTA 5KO2A 5CLFA 4LXUA 4Z0NA 3AVQA 3LOPA 5EL0A 1UQUA 2ZSBA 5TLSA 5SYMA 4D9FA 4PC6A 5HOQA 2BFWA 3SIXA 2ZRHA 3Q0TA 1S2GA 4BWGA 4NZ9A 4L9WA 4N5HX 2IWHA 1ENYA 1BQ3A 3DGFC 3A8TA 3K09A 3P9ZA 4PE5B 2WNSA 2YXPX 4KYUA 1EBBA 3S28A 4ENUA 4K9MA 3IXQA 1XZNA 2XMPA 4F93B 2DEUA 1A7JA 2YJGA 3I2YX 2HU7A 3OPXA 4IFTA 1Q3TA 3DOEA 3F7OA 4TMYA 5DRTA 5GPBA 2J5QA 5KTYA 3ROMA 4WXMA 2PVSA 3GDWA 1GZ5A 2F9MA 2NZ2A 4LY6A 1URPA 2ODEA 4IZOA 4X3PA 3O0TA 3OTGA 5FBLB 4BRUA 2NV6A 4GX1A 1G5TA 3PC7A 3RK4A 4ENQA 3K8ZA 5KNDD 4KIJA 3X2EA 4BX8A 2B1GA 4CLXA 2WAYA 4RPHA 2OCIA 5LQAA 3B70A 3UWMA 2NYAA 3UPUA 4JKOA 3ZV6A 4KO2S 1WPGA 2B36A 3H42B 4LXQA 3BXXA 2G1PA 4L1KA 4HXGA 4BEWA 1QOQB 4DADA 3FETA 3S2EA 1YTLA 4E5PA 1H3EA 1P45A 1BXRA 1P17A 5L7TA 1L6RA 1UODA 1QZ3A 3ZHCA 1F7UA 4TUYB 2GWRA 3RS0A 2G1UA 2O8FB 4EHBA 5LVAA 4EX6A 4ZQCB 1NVFA 1PEDA 1LX6A 5NULA 1J0AA 4TV8A 3P5SA 2D7JA 2PM8A 3QUCA 3VO8A 5H70A 3WFZA 1QJ4A 4R5MA 3GP8A 3KWLA 1CV2A 1OZ0A 1RCTE 3HCPA 5KU1A 5LMUB 3BZBA 1MXFA 3K0KA 2GLXA 3MOSA 4FEAA 3UK2A 4B45A 4HFMA 1N6NA 2QUKA 1S5PA 3UWPA 1Z9BA 1YIOA 2JFBA 4MVYA 3UJCA 2H9YA 1T1IA 4QICA 4R1SA 4Z9FA 1XHEA 4TQGA 4YRZA 3FAZA 3AKCA 4J90A 2NU8B 3OCZA 5FO1A 4HEA6 4UD2A 3RKRA 1KI6B 2QHXA 4DLRA 3AHJA 2YWFA 3HBMA 4FMCF 3TQOA 2R86A 3CEAA 4JXZA 4GPZA 1HBJA 2ZZMA 1ARZA 1U0OC 1U3GA 4FXUA 1DHTA 1L9KA 1Z3IX 2J7PA 1EVEA 3NHZA 2OB2A 4E0BA 4YV7A 4GE3A 2PQ0A 1F1BA 1QVZA 1A5ZA 1X1RA 1X1DA 1Y3BE 2CJXA 3A05A 4FNGA 3GFPA 4D8WA 1MABB 4CIWA 3UT6A 3D0RA 3FUTA 2CCKA 1Y1TA 2YWCA 4MYCA 4NCXA 3SIRA 1C81A 4XL9A 4HL6A 1DGQA 3C4JA 3MWGA 4BZPA 1M1NB 1CB7A 3VNSA 1E96A 3D1LA 4DA0A 5KOJB 5JQWA 4KKSA 4CV0A 2WYHA 2IHJA 4I4NA 3REQA 5LJIA 5HMLA 3K6SB 3FWHA 3DBLA 2OKCA 2ZS8A 4YJ3B 3I1JA 3B7WA 2WWRA 1EFHA 2BM1A 4U2FA 1XLWA 5AVXA 1MO3A 1WCWA 2FWNA 3DZGA 1CEEA 5L46A 3RRBA 3A6KA 2R3SA 2I54A 3AL3A 4PFKA 3WO1A 3IHTA 4QEKA 2X8JB 4TMZA 4IJ5A 1LQ2A 5LP6C 2OHJA 4LHVA 5C8DA 4A2WA 2J4CA 2X3UA 2XADA 4EUSA 2Q5JA 3GGCA 3MTDA 3SOPA 4W7IA 1ILWA 1XZAA 3AVUA 2HYDA 3CN9A 4OO3A 2FX5A 1NUUA 3O4HA 3EQ9A 3NM6B 3RVNA 2J3IA 2O3QA 1FMTA 3ITNA 4FZRA 5JHGB 5KTNA 4HXEB 2GM9A 4OUKX 5ALJA 2J3EA 1Q91A 1TYAE 1LXCA 4CLOB 1KEUA 4F0JA 1E5LA 2H5LA 1SJ9A 1U0LA 2ZS7A 3H16A 3JD4A 4I8DA 5JQGF 1LRLA 2E0IA 1VB5A 2RH8A 3UMBA 4E5YA 2DB3A 2Y0PA 3ON5A 4RH0A 5E2BA 1U2SA 2QRJA 1FFHA 4R69A 3IURA 4YJHB 1ZX1A 4ARZB 2XUHA 2NOAA 1IUOA 1MH9A 3NO4A 1JL3A 1JIVA 3UOWA 2P9QA 1MA3A 3ECAA 3IC5A 4XDYA 2WNIA 2X6YA 1N57A 2ZBVA 4M89A 2HY7A 2Q1WA 3ZHUA 3RC9A 2X4IA 1I7QB 2DY1A 2CWWA 1RQPA 1MJHA 4K6CA 5AM2A 1OGIA 2GBLC 4XVRA 2FMHA 3QXGA 5IAJA 3SLRA 1WDMA 4BTEA 1YVRA 1SWVA 4P4GA 3GOQA 5FAXA 4C14A 2XYRA 3BILA 3PKZA 3F3SA 3LV8A 3DPUA 3MBKA 3MCAA 4CCYA 5INTA 5B6IA 1T8YA 4IH1A 4Q7QA 1GAEO 3FSJX 4TKLA 1AZTA 2OV8A 3ECCA 4MP3A 3SK0A 2OTLB 1LTQA 1B8PA 1DKLA 1W52X 3MRVA 3ZK9A 4CLDA 1BCSB 3B2EA 1VQOB 1UT5A 2CDAA 2BY4A 2Q7XA 3L0BA 2I9PA 1O89A 3O90A 4FGZA 1VQ6B 2ZRLA 3IYLW 4MIYA 2FR8A 3FZYA 4EX7A 4LJRA 421PA 3DFKA 4BB9A 1TA9A 4YCAA 3CT6A 4U63A 4N7BA 3K0SA 2PZKA 4E21A 2ZTGA 1MV5A 3U61B 2MOKA 2GYYA 1T0PA 2FZVA 3FYSA 1YFLA 1KY2A 3WK7A 3KOWA 1C8BA 1V95A 3CGWA 4NX2A 3UJ7A 4LYYA 3A2NA 4ZU6X 2ID4A 2JBHA 3UJ8A 4AUEA 2Y27A 4BEBA 1GXSB 2FKAA 1UPAA 1F48A 1D1TA 1E4EB 1VDMA 4J49A 4X1KA 2GZHA 2FEMA 1NF9A 1SD2A 3QYAA 2OD9A 2PY6A 4LDPA 3QLUA 5I4CA 4KKXB 5EY5B 4MMZB 4YGXB 1XQ1A 3PGMA 3UK7A 4GOND 3CCFA 4WZBE 2RG1A 1EUDA 4Y30A 2FPUA 3P2KA 1MF7A 1SIUA 3CRMA 1OWPA 3ELUA 1O2DA 2X5OA 2RHLA 5E4JA 1XB2A 1O9GA 1THZA 4FX2A 3RSOA 1JIUA 1XVVA 1Z6TA 3ZGOA 2YNMC 3G68A 4ZQIA 3D8TA 5JJ5A 1XDUA 5BMVA 1GPAA 1LSOA 1NDQA 3RF7A 3KZNA 2FR8C 4BMVA 1J56A 3A04A 1OWLA 4BBPA 3EGVA 1N9GB 3PXXA 4ML3A 3RT1A 2VN8A 2ICAA 3BMOB 3VJLA 5K9ZA 1V1MB 1AHNA 3PDJA 1CWUA 2A9QA 1CUBA 1M8PA 4HFJA 1ONNA 4NE2A 5A4IS 2HXGA 1XMOB 3HEBA 1YQDA 4HGYA 2CC2A 5HKLA 2HYIC 3LPCA 4FILA 3HUDA 1DADA 3O7MA 3ZWAA 4XWKA 3LDHA 4X00A 3M6VA 4OOEA 4RHFA 2FXIA 3V1LA 3VNRA 2XE7A 3EVCA 3G71B 4XR6A 3A37A 5BN4B 3SS9X 1W85B 4DLYA 4YK7A 5BV2P 4G7WA 5DI9A 4PZ0A 3OLCX 1U2QA 1Z38A 2KLBA 3VR6H 4PQYA 1US8A 1CQPA 3BUSA 5EZYF 1MD9A 2C9DA 2GHIA 3BSWA 3LUDA 5D6NA 2YR0A 4QUKA 3DCIA 3C3EA 1WUYA 2WWIA 2CK3D 1ISPA 4EJSC 1QHHB 2J67A 1B00A 1ENZA 2A92A 4ZOLA 4GZMA 1EFAA 3EH2A 3H4IA 3HHPA 3IULA 2Q3BA 2RGNC 2FFAA 3ILSA 3BMQB 2EIXA 2Z08A 4HWTA 4IV5A 1P7ZA 4UBMA 4WECA 1E2NA 3LRTA 1XRJA 3PPWA 4RQBA 1ABBA 1NXWA 4E31A 2I6FA 4FSXA 4JOSA 1ZXXA 3IBGA 5ILGA 2DBRA 3FGOA 2WTUA 4XIJA 3CG4A 3KSDO 1U0NA 3B1VA 4E6PA 1EFKA 2R7NA 4YJ3F 4EHKA 4KWHA 3WIVA 1K7XB 1TK9A 2VDJA 3ENNA 3SBOA 4IOKA 3QU7A 3TOZA 2HH9A 4B6JA 4ZV7A 1D0IA 1Y80A 2IHBA 3ORFA 1VSBA 4E08A 4RJLA 1YCDA 4Z2AA 1XQXA 1SBCA 1W19A 1PK7A 1M5UA 3JAKA 4I3GA 2GEDA 3ISTA 1Q15A 4Z4YA 1R0ZA 1TJ5A 1G2QA 2WKRA 3BKWA 4JR0A 5ARCA 2HUNA 4Q4AB 3OQBA 5FFMA 5KS2A 2XYGA 4WBXC 1U8EA 1PR4A 1JXMA 3VYTB 4CR7A 2OBLA 3I1FA 4Z4UA 4FGKA 4EKGA 2WNHA 2NTNA 2ZQZA 4DB4A 3FOFC 1UFQA 1KRWA 1F4LA 3CD6B 2BOVA 2C5BA 4CFZA 1MJNA 1QLHA 2M98A 4IFBA 5AXBA 3W7BA 5BW4A 3DDSA 3TQQA 1HSZA 2IP4A 4MR7B 3DJYA 2FEOA 1S89A 4LWZA 3ELBA 3O8DA 2W6PA 3CKMA 3AEQA 3OSZA 2UUPA 5I7VA 1A72A 5DP2A 4MAFA 5BSRA 1ZGGA 3TLMA 1W85A 1R0YA 3CVYA 3OPYI 1JEQB 1WCIB 2HZ7A 4P3XA 4MO9A 4JLOA 4E7PA 3BKXA 1E1KA 1W581 1RRKA 4KGXA 4CM8A 5EQFA 3TNJA 3USZA 2X40A 3OSUA 4CG1A 3P9KA 3G8AA 3KLPX 3E20A 3U6KA 2V65A 5EJEA 1P31A 2HEGA 5H8WA 4ARSA 4UEJA 1O1YA 3ENWA 1P7PA 4W5JA 1HNNA 3CIOA 5KVVA 2DHEA 4E32A 2R00A 4KTVE 2P9FA 3VNUA 3H1BA 1LF0A 1SNYA 1Z6QA 5KQPA 1V96A 3LBIA 1N2CE 4QUJA 3T51B 4OHYA 2A9VA 1OFUA 2O5VA 4M0DA 2RMKA 3LP5A 3EXHC 2CL6X 3O75A 2IGTA 3DVQX 1KETA 2R8BA 4RNCA 1TO2E 5HRAA 1TW2A 4Y2PA 1O54A 3QYFA 4ZEVA 2EFCB 4Q3LA 4X60A 5ES3A 5IWCA 1GR1A 3C2QA 3OURA 3BQJA 1OPXA 2ACEA 3L0ZA 4OHCA 1Y33E 3EZNA 2WPDD 2VRBA 3V1UA 4DS3A 3NORA 1E3MA 4I4CA 2AEFA 4N0DA 1G8JA 3HUUA 4HO1X 4IY1A 2JIPA 1BPLA 4ZRDA 3BWVA 2DY0A 4LI3X 3CKKA 1FX0A 3R2JA 2O54A 1VE7A 2IQ5A 2IC5A 3GA7A 5IZ4A 1TF2A 1PNVA 2HA0A 3GLQA 2VWHA 2VF5X 5KDLA 5B5SA 5HZHA 4ZVNA 3VBEA 5AN9A 2DPYA 4REQB 2RGXA 1RLTA 4K40A 3LWZA 2C4TA 1GSAA 1UBJS 2Z4SA 3KLBA 4TS9A 2YZKA 3BS4A 1LK7A 2B94A 3VVMA 1LD3A 2H8KA 1CEQA 2OVBA 2V54A 3GPLA 1XDZA 4AS1A 2ORVA 5K8JB 2C2GA 1YFKA 2XOEA 3FCCA 1DIBA 4LOAA 1JTEA 1I7LA 1Y5RA 4QOSA 1XYGA 4QU8A 4WXYB 4WW0A 2O07A 4BO4A 1A27A 1SC9A 3ZWDA 1VIDA 2F90A 3RUAA 3H3FA 5FLXA 4QLAA 4JU9A 1MRNA 3OE1A 1L7BA 1P7VA 1PJBA 2DGDA 3F6PA 1O5OA 3RS4A 4ACAA 1QYRA 1J9GA 1RBMA 2CLKB 2MSKA 2VKQA 3FPSA 3RKUA 3U7EB 1O57A 4XWGA 4WCVA 4ABTA 2C9CA 3KQVA 5IBCA 5KOJA 1NLMA 5CGZA 2XOXA 3DEJA 5IVPA 3R7BA 5KTOA 1BX0A 2R8OA 2ZTLA 3H1GA 1CUCA 1Z26A 5FL3A 2BGIA 2ZE7A 5DGTA 3B48A 3FF4A 3DMFA 5FCDA 4EQ6B 2L2QA 5JEEA 1CX9B 2WW8A 2VAPA 3IIEA 5KYVA 4F4JA 1EFLA 1ZK2A 5HA5A 1PGNA 1MB2A 3KAQA 2IZ1A 1K3TA 2Q4EA 2XCRB 4RKYA 3OCCA 3C5HA 4H18A 3WAKA 1SXQA 4I6GA 5I9NA 4WE3A 3JQBC 5LA6B 4EA6A 2HJ9A 4DA4A 1QRSA 1M7HA 1P3DA 2C9YA 1MX1A 1V0JA 3RGWS 1WB9A 1DJNA 2FPIB 2Y93A 5B1HA 3T34A 4BAUA 1ZW1A 2GF2A 4F1KA 2DFKB 2C20A 4P7FA 5AK4A 2VJNA 3FTCA 5KJ6A 4CQLB 2V6MA 1W4RA 2L42A 2VBIA 2YWJA 1KI9A 1X87A 3N2NA 4LHZA 4WADA 4IXNA 5JNVA 2R25B 3GGPA 3SD7A 1KEKA 5BPFA 2ZRKA 4C2BA 3FMIA 1GZVA 3FMGA 4NZNA 1YE3A 4C1BA 4D8TA 3OQHA 1P1BA 1H0KA 4DEXA 5JYBA 2IH5A 3EVFA 3VR0A 3AOEC 2IZ5A 2XYPA 3RSHA 4AAYA 4EB6A 1X7ZB 4MWEA 1MUUA 3R6WA 3OX2A 1CERA 1ISGA 1Z2DA 1KYTA 4E13A 4H6XA 3CCEB 3OESA 2PUBA 1TMKA 4DCVA 2BMJA 3IBCA 1D6NA 3QVXA 3EGXA 5DU2A 1BFUA 4MKRA 4PSCA 1P5ZB 1XZFA 5AI5A 1CY4A 4YCCA 1SXIA 3RYIA 4GWGA 1FYDA 1O7JA 1W9HA 1JWLA 1PJRA 2XITA 3RS2A 2F3TA 3AJRA 3AR9A 2KS6A 3V8QA 3E35A 4D4IA 4GOMD 6ABPA 1PV2A 3BZWA 1VE1A 1JSRA 2ZYTX 3M1AA 3PLNA 3A3YA 1I3NA 1BX3A 3ZV4A 1MQ8B 1G5RA 1CDZA 2PWPA 4H16A 3NLLA 3OTOB 4U2BA 3HO8A 1U1IA 2OFFA 2IU4A 3N0TA 4GX0A 4IQ0A 5KYXB 2G28A 3I42A 2JCYA 4ZVMA 1UKZA 3BTVA 2NZYA 3VNVA 1MV8A 4RIHA 2G4VA 1R37A 5LU9A 1KQFA 2O0LA 3I76A 4JHXA 4OH1A 2D0IA 3K16A 3K9HA 3L7YA 3B78A 1I4DD 1JZTA 1Z18A 3DZIA 3IP3A 4PYKA 2I4MA 1RRCA 3PUYA 4HD8A 5E3IA 4IIJF 1E3QA 2BF4A 4R2IA 2YFKA 1OYVA 3GLHE 1V3QE 3M3HA 1OXTA 3OIGA 4RA6B 5T3UA 4J4BA 4JUFA 5EZ6B 4Z0PA 4M0LA 3U4MA 4FYHA 5CTAA 1U65A 1P91A 4DRXA 1O3YA 1BAPA 4H6VA 1E58A 3PT9A 2XE8A 5DM4A 3QUTA 3B3QA 3RVMA 3RYFB 2ZIVB 2ROQA 4D0GA 3UWDA 2LXNA 3B6EA 4DF3A 3AF4A 1XDGA 1K8QA 4U7FA 4V02A 3HYRA 3N8HA 4OGGA 4XUCA 5AKIA 3RJMA 3AEQB 5P21A 4D6YA 1KJWA 3QKSB 5CX1B 4IIGA 2X7XA 4N8SA 1VIMA 1QH1B 4XPIA 3KAKA 1GPWB 5IDYA 2BTEA 2LIPA 3FUVA 2X0KA 3DFUA 1CJVC 3RUEA 1E60A 1TRKA 2UVQA 4JP5A 2WU8A 3SMQA 1H9AA 5JANA 1JYSA 1A4UA 4P58A 4L4SA 1ZN9A 4CNBA 4M88A 1M75A 5JZBA 3DTYA 3W2GA 3C6BA 4PXYA 3HA5A 2G25A 5JD4A 1KWGA 2P11A 3HU3A 3BT7A 2AYYA 2Q4RA 3T6KA 3NBFA 1YACA 1ID1A 2N46A 4KBYA 2NZ8A 4OHVA 3RPEA 5ADVA 4I55F 3SVZA 2UU9B 2H4XA 2DFPA 4J1SA 1Y8RB 3P9XA 4OX9Y 3NANA 1K4KA 1LPMA 3DEFA 3RI3A 2WHPA 4YCNA 4UVEA 3N3BC 5C3MA 2IS4A 4PZDA 3D4PA 1FNCA 2RAFA 4HV4A 5HSGA 2JARA 1V8PA 3MMZA 1RC1A 3RYIB 3VR2D 1HNWB 2QR2A 4OKNA 2ZSEA 3A4MA 4R9RA