2OK8A

Ferredoxin-nadp+ reductase from plasmodium falciparum
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
312
structure length
263
Chain Sequence
b'NFINLYTVKNPLKCKIVDKINLVRPNSPNEVYHLEINHNGLFKYLEGHTCGIIPYYNERCARLYSISSSNNMENLSVAIKIHKYETNYGYCSGFIKNLKINDDIYLTGAHGYFNLPNDAIQKNTNFIFIATGTGISPYISFLKKLFAYDRNSNYTGYITIYYGVYNEDSILYLNELEYFQKMYPNNINIHYVFSYKQNSDATSFYVQDEIYKRKTEFLNLFNNYKCELYICGHKSIRYKVMDILKSHDQFDEKKKKRVHVEVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ferredoxin--NADP reductase
molecule tags Oxidoreductase
source organism Plasmodium falciparum 3d7
publication title Ferredoxin-NADP(+) Reductase from Plasmodium falciparum Undergoes NADP(+)-dependent Dimerization and Inactivation: Functional and Crystallographic Analysis.
pubmed doi rcsb
total genus 85
structure length 263
sequence length 312
chains with identical sequence B, C, D
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2ok8A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2ok8A02
3G71B 2RC5A 1KK3A 1QFZA 1VQ8B 1R5OA 2B7CA 4LBZA 3CC2B 2VYQA 1FNBA 1EFTA 3WBKA 4B48A 3W5HA 2X3UA 1Q86D 2BGIA 1QVFB 1N0VC 3CCVB 4P6VF 1QGYA 3FJOA 4TMXA 2BGJA 1Q82D 5HXBA 5TY0A 4LBWA 2PIAA 3B78A 4H9GA 2BM0A 1JA0A 4Y9UA 4YAFA 2DETA 4NCNA 4K1XA 3MHPA 1GAWA 1W35A 3QFSA 2QEXB 1UMKA 2YWFA 4YAOA 3CRZA 3B8HA 1A8PA 1QG0A 1VQ9B 3J81k 3B82A 5AN9A 4Y9RA 1W87A 3LRXA 1KQSB 2E1RA 4M4SA 5DSZA 3CPWB 4DQKA 1KD1D 1VQMB 4BPRA 3MCAA 2J7KA 3VNUA 3LO8A 4YALA 3CC4B 4FWTA 4YAWA 1SKQA 1W34A 2HCJB 3VO2A 1IB0A 1KK1A 4WQMA 1VQOB 2BPOA 3A1FA 4HE5A 4TMZA 1BQEA 4IW3B 4N3GA 1U2RA 2HDNB 2CRVA 4FN5A 1EWYA 3I1FA 2OK7A 3CMEB 1GR1A 1ZM9A 1KTVA 2RC6A 1E64A 3CCUB 3W5VA 4DQLA 2B7BA 1OB5A 1YJWB 4C0SA 4C43A 4PGOA 3VNVA 5TV2A 2VNHA 4RD6A 2QA4B 4PC3A 4ZCIA 1R5NA 1TLLA 3CB4A 1QGAA 1GAQA 1HA3A 4ZV4A 3QSYA 3ZC3A 1G7RA 1Q81D 1VQ5B 1VQ6B 1IJFA 3W2FA 4PC7A 1DDIA 4AF7A 1OGIA 3OW2B 1QUFA 1CNEA 2VNKA 4R71A 4RD0A 1I7PA 3OZWA 3VMFA 4B43A 1YJ9B 1FRNA 3E20A 4RD4A 3LVBA 3JQPA 1K73D 3CCQB 1EFCA 2ZITA 2OK8A 2BV3A 2EIXA 4M0LA 4YAUA 2VNIA 2NPFA 3P26A 1CQXA 1N0UA 1EP2B 2YWHA 3AVUA 3CW2A 2QTLA 4HE6A 1QVGB 3WXMA 3AVWA 3WNCA 1CNFA 1IJEA 3JQQA 1H42A 1DARA 1VQPB 3OJWA 2CNDA 1YI2B 1VQNB 2YWEA 4FK8A 1W2BB 3AGPA 4ACAA 1ZM2A 4M53A 4B47A 4QFMA 3JQRA 3AVYA 1ELOA 2VZLA 1ZM4A 3AGQA 4G1BA 4F7DA 3I55B 1D8TA 1NJID 4TMWA 4Q7JB 2AHOA 2B5OA 4ACBA 1XB2A 2BF4A 1QFJA 1BJKA 1B2RA 4P3YA 3CCRB 1QH0A 3FPKA 1F60A 2BN4A 1Q7YD 4PC1A 1FNCA 1N8RD 1EFUA 3ZBTA 1YJNB 1E63A 5H5JA 3CC7B 3MMPA 1VQKB 2PLFA 1R5BA 3U6KA 2XNJA 1YIJB 1JA1A 3OJXA 1ZM3A 1QUEA 4B4DA 1FDRA 2XNCA 4J0QA 3CCEB 3ES9A 2BMWA 4ZGNB 2GPJA 1JJ2B 1GVHA 2DCUA 4ZGQB 3U6BA 2D74A 3G4SB 4ZCLA 3ZZUA 2DEUA 2YWGA 1M1KD 1VQLB 1KK0A 4YHBA 4G5GA 2FX3A 5GV8A 1G7SA 5H59A 1BX0A 4RD1A 1ZUNB 1JNYA 2BVNA 2HMAA 1XE1A 1B23P 4PC6A 1KC8D 3G6EB 3E1YE 2EFGA 1G7CA 3AVTA 3U2QA 1QFYA 2QMUA 5FA6A 2C77A 4U9UA 4B3XA 4RCZA 1WDTA 2QN6A 3WNDA 1J9ZA 4TMVA 4LC0A 3AVXA 1SM4A 3W2GA 5THXA 5TR9A 1OGJA 2BM1A 3PENA 5EMNA 2QDXA 1KRHA 1F20A 1S0UA 1TVCA 4RCYA 3CCLB 3QE2A 4TMTA 4RJLA 3AVVA 3WBJA 1OB2A 1GJRA 3SJZA 1K8AD 1BX1A 3W2EA 2PMDA 2OTLB 3P27A 1JB9A 5JBQA 2XEXA 1VQ7B 1QX4A 3I56B 1FNMA 1GO2A 1QGZA 3CCSB 1EP3B 1KJZA 3CCJB 1TTTA 2DERA 1KK2A 3ZZTA 3CD6B 3OZUA 3ZBUA 4RD3A 3V76A 1TUIA 1EXMA 4N3NA 3LYUA 3QFRA 1YHQB 3QFTA 4NBSA 1EP1B 3WY9A 4RD2A 1DDGA 1FNDA 2R6HA 3CCMB 1NDHA 1AIPA 1DG1G 2OTJB 1FRQA 1M90D 4ZCMA 4MYUA 5KSWB 4MYTA 2VNJA 4LBYA 4M1KA 4QHYA 4G1VA 1D2EA 3WYAA 1K9MD 3OZVA 4B44A 1G7TA 4M2LA 1VQ4B 2DY1A 4Y7CA 4LBVA 3CMAB 4TN1A 1YITB 2GQFA 2QTZA 2C78A 1D1NA 4PC2A 3CXCB 1E62A 3VO1A 2BSAA 4UAJA 4EH1A 3W5UA 1S72B 1H85A 4AC9A 3ZZ0A 3W2HA 4AF6A 3WNBA 3W2IA 5GV7A 3QFCA 1AMOA
chains in the Genus database with same CATH superfamily
1P31A 2GPWA 1OXXK 2P78A 3ANLA 5K0TA 1FQWA 1JFVA 1JA9A 4YA6A 2YJGA 4MQEA 1VQ8B 1OXUA 1PT9A 2PK3A 4K6MA 1YB5A 3IQEA 4M1YA 2AJBA 4MJ3A 4NLLA 4OKNA 4URVR 1FW6A 1FNBA 4R1PA 1YMVA 1DFIA 5T4BA 1UWCA 1H6CA 1DJLA 2HJGA 3W5HA 2X3UA 1KMIY 1ZSYA 1IATA 5FHQA 2AE2A 1FXWA 2Q5LA 2Y1KA 4GZMA 5DX0A 5HE9A 3NGXA 4Q1CA 3S2EA 1Q82D 2I6QA 1FZQA 3W7VA 4H9GA 1XYYA 2XD9A 4MVJI 2A84A 4YP0A 4FW9A 3IUNA 3G2NA 2DETA 2BGMA 2G83A 1N25A 1T2DA 3GPBA 4QOJA 4EUKA 4URFA 1CKEA 4DKXA 1SBZA 3W6ZA 1JKJB 3GLVA 4NCNA 3B20A 1D0IA 1NP7A 3MHPA 3IP9A 2O8FB 5DT2A 1W35A 1NXXA 2WWRA 3DYVA 4GL4A 4QDUA 4QUJA 3E3NA 1QTQA 1DJPA 3ZE1B 2IYPA 1KA9H 2ZATA 5K01A 1IU9A 4EDHA 1P2UA 2QV7A 2O0HA 4JUBA 1ID8A 1Z7BA 1A3CA 4MS4A 2IBTA 1R74A 4B7ZA 3CRZA 1M9NA 2FGJA 1EZZA 2EG9A 1QG6A 3B70A 2BMEA 4CKEB 3DZIA 4JJAA 5DYWA 4ZCTA 1W1IA 4Y9RA 4LFAB 2F8SA 4MKIA 2FMHA 2AZXA 2IU6A 1S2NA 1QDUA 2QZ4A 3AFNA 1QWSA 3AI1A 4DLZA 3PPVA 3PQ3A 1T9AA 2DX7A 5EKDA 4L73A 2V58A 4YYZA 1H1TA 3NTOA 5SYNA 1BCRB 1IEWA 2BFMA 2VATA 2XRFA 4DLXA 3TMYA 2W4MA 1CG6A 4CM9A 3ZV6A 1EQ2A 3MUEA 3Q5DA 4NSNA 1P1RA 2GUGA 4LCEA 5BVHA 2F8TA 4RYDA 1J8VA 1A4IA 1JHMA 4PLCA 2RI0A 4MWSA 4KI7A 4PYQA 1F17A 1NVKA 1NE2A 2XNSA 2EKLA 3P1JA 4FC7A 4X3PA 2QL9A 4ZOEA 4EUSA 2GRAA 2C5SA 5I45A 3TFQA 1A9RA 4FMDF 1LBSA 4BO6A 1HFKA 4NXNB 3IHKA 5JD3A 1OASA 3V9PA 1NQTA 3QX8A 4M60A 3ZWBA 2X3YA 3IAM1 4FEEA 4EGCB 3BH0A 4PHHA 4AROA 5EKXA 2AV6A 1W4CA 2ZTMA 4U2FA 5TT1A 4YT4A 5IKPA 5AXAA 3EVTA 3MWFA 3EF3A 4W6ZA 5A4MS 1IB0A 2DECA 1EXWA 3S7ZA 4UUNA 3SF0A 3IUBA 3GAFA 1ZGAA 4BY9E 2YIMA 1A4XA 1W8IA 3WTBA 1IOVA 3TX2A 2ZXFA 5FNVF 2BL4A 3NXSA 4OXNA 2Y1EA 2H92A 3RKRA 1KOJA 3U7FB 3RVQA 1I7NA 5C18A 2OYNA 2QAGB 3H1FA 5AVKA 4AJIA 4TKVB 4PRLA 2WR8A 3T9EA 3T1NA 4Q7QA 4O29A 1RXSA 2N1BA 3VOBA 9LDBA 1EDEA 2IPXA 2F17A 2G1KA 4RY2A 4C05A 3CUYA 2OBMA 4Z9AA 3PDUA 1QCCA 3G13A 3UCEA 4DTCA 4AKHA 5T6MA 2O2DA 4YQZA 1RRPA 3ZWMA 2C4VA 1KBOA 2ZRBA 4FDUA 1OB5A 3F8SA 4YJ2F 1FUUA 3NHSA 4ZVVA 5BY2A 2WZPP 3K5HA 3MGBA 3LKDA 4RKQA 4OXXA 4AUMA 3JQFA 2C3UA 2QSUA 1FSPA 3P7MA 3HSSA 2E6KA 5BOSB 4UHBA 1U3CA 3IDSA 4JVNA 5H3HA 3E4DA 4WINA 2Y1LA 2G80A 4IHJA 2QVCA 2Q6OA 4GFDA 3FFXA 3ZW9A 5JAZA 3AUKA 2QN8A 2Y99A 4Q19A 3AHFA 4Q47A 1J5EB 3ZD7A 1FLNA 1KYIA 2QE7D 2ZB3A 3BIOA 3G02A 4BFUA 1G7RA 4EJ0A 1P9OA 2A67A 2SCUA 5CXXA 1IN8A 2K6GA 4D0LB 3PX2A 1ONNA 4ZHSA 1M0WA 4HWOA 5TT0A 1FTQA 2P4SA 1U3TA 1UK7A 2GR9A 3HRHA 3KHKA 4HWSA 1FYFA 1GP2A 3VGPA 2DULA 5HMLA 1QUFA 1RKUA 3RYHA 3I5YA 1YDMA 3L5OA 4FX5A 4O2LA 4MX8A 4A4DA 2GM4A 3HCEA 3RV3A 1XD8A 1NULA 5AM0A 1NVXQ 4XQEA 4JT9A 1NNUA 3INRA 4Z53A 3X43A 4K9SA 3TBHA 1UAAA 3RASA 4P54A 4NCKA 1VFPA 2ZBUA 5KHAA 1NHGA 3FGZA 3TPFA 5AJUA 4DBLC 5L6MB 1QAQA 4LECA 5A5DA 4WCFA 1EBUA 1GZ7A 4C4XA 4GC9A 1QPZA 1TEHA 3WB1A 1PG0A 4FWIB 3LPCA 4PO1A 3BXGA 2IHZA 2XY4A 3Q1KA 4FFDA 4FUTA 5A3VA 3IOBA 1B73A 1IC6A 1YB4A 2FE1A 2Q4EA 1Q50A 1H2RS 2QSJA 3LQ1A 3PX3A 2FPGB 1C81A 3RAGA 3EFHA 4IDCA 4EF6A 3VR3A 1NQXA 2MHCA 4EK9A 2ZCJA 2YN2A 4A6XA 2VJNA 5FTNA 3WFJA 5JAMA 3VC7A 1Z7GA 4RLQA 2J3EA 3F3YA 1W46A 5HPYB 1W0JA 5D2CA 4B3TB 1V6SA 4RX1A 4HNRA 4O2BB 2RBGA 3QUQA 2DTEA 2JCYA 5HR5A 4OFZA 4FNMA 2P6NA 2AKEA 4N7JA 3IBCA 4IL5A 5FEUA 1SU7A 4CEJB 3A4LA 1RHRA 3F74A 1H42A 4C7MA 4NH0A 2G8NA 2TRSB 2ZWOA 4GNRA 4M0KA 1NY6A 4XPZA 3IPCA 2JFWA 2VJKA 3QFHA 1D4ZA 3FR8A 5IKMA 2UUBB 5JDIC 2X4GA 2JFUA 4HK4A 1DQSA 1MBZA 3PWSA 1O58A 3IP5A 4M89A 2C8LA 3LUCA 3AH8A 2PH3A 1K6EA 4DIBA 2AQ8A 5K6AA 3ORHA 1DADA 1KFEB 1W96A 3FOAA 5DO9A 3VV2A 4F9GA 3A28A 1E7YA 1T8RA 2GJ9A 4M0DA 4MYRA 1QHFA 1ZQ9A 2V54A 2X76A 3OZCA 3UANA 2I76A 3SVZA 4A82A 2ZAMA 1ZCBA 4RSGA 3CVJA 2QI9C 4P4LA 4Q05A 3RB8A 3RHSA 5AK6A 1O6BA 3FGPA 1HDEA 1JN0A 2BFWA 5B6JA 5JD6A 1YCFA 3H1EA 1T5DX 3LDGA 5JASA 3Q11A 1VHQA 3A4VA 1SOVA 4FR0A 2Q5CA 3SAJA 5GP1A 4XWGA 5ILGA 2JIRA 4H1WA 3RS5A 2AHOA 4YX9A 3A1NA 2V7TA 3KQMA 3PQCA 4YUZA 1KMQA 5CBKA 2P7HA 3TLXA 4L27A 1OMOA 4JVSB 3E5NA 4MQFA 5DSTA 3DBOB 3V9AA 3HB0A 5BN1A 4X7MA 1K7YA 3KCQA 2PH7A 5AKZA 2A0KA 2IOHA 3ZDQA 1KI6A 3LDHA 3MLAA 4WK2B 2B4RO 1XLVA 3MTAA 4O4HA 2QZZA 3NH6A 5EMMA 5ED0A 4AKIA 4WERA 1V48A 4EATA 1FYDA 2WPDD 1Z7WA 3RY8A 1N07A 4PC1A 1C7IA 3D7RA 3R9IA 3LAWA 2J9FA 1OI2A 3TSWA 1R1DA 2NTVA 2RH8A 3HWWA 4DW8A 4RE6A 1CRLA 1Z5GA 4ZDWA 1CQPA 2IKQA 3JQEA 1C2YA 4R9UC 3ZHVA 2XXBA 3L0YA 8ABPA 3NUGA 2A9JA 3U1VA 4YP6A 4F4JA 4YRZA 3MS4A 6ADHA 3DWGA 3EC1A 2FF5A 3FVRA 4OM8A 5LB4A 8GPBA 4YDQA 3EVBA 3F6SA 1H4SA 5JBIA 2P0EA 1OBVA 2FF7A 3B12A 3UB2A 1NLFA 3RJ5A 4B4DA 4RULA 3CVVA 4LJ9A 4M38A 3MBOA 2HRBA 4ZI2A 7ABPA 1BEEA 4CIXA 2QX7A 2FI1A 3NBYC 3WADA 1CDZA 4FSDA 4HJXA 4N03A 2DVMA 4GYYA 4HFNA 4DB2A 1VIAA 3ES9A 1C1DB 2OHHA 3K70B 1WBDA 3RSCA 2X7JA 4W8HA 4QDXA 1K68A 5BQPA 1AKNA 2GRJA 1SIUA 3LF2A 4OL0A 2G1JA 3DTVD 2BR3A 1DWQA 4HQ0A 1EXVA 1UXOA 3LXUX 3FR7A 5HCUA 1VBKA 4JKOA 5I7EA 3FFTA 1THMA 4IXWA 4LMAA 1VE7A 3B6JA 1ESNA 1LNQA 5JY6A 5J2UA 1FL9A 2X85A 3CJTA 3MTBA 3PYLA 4URYR 3GBPA 1Z45A 3CR3C 3HI6A 2V8OA 3VHRA 3CVXA 1KK0A 5HKBA 1AD2A 4OMFG 2BFCB 4RY0A 4IY1A 5K6AC 5DYNA 2QA5A 3B3QA 3BAFA 1UJ5A 4D8YA 3VJLA 1ODLA 5ESWA 5H59A 1J1IA 3KJZA 4M6WB 1Q2XA 1OPRA 1EAYA 1S6YA 3AHDA 3QKSB 1W2GA 2CB0A 1HY3A 5COQA 5L3QB 3IV9A 1LC3A 5AJTA 1U81A 1XAJA 3JWHA 4E08A 1GPUA 1V3QE 1YR1A 2JRLA 4YLYA 2IIPA 2VUUA 2ZUTA 4ZOCA 3L1JA 3L84A 4FSHA 1N32B 5LZ9A 3SJUA 2NVOA 1TTPB 2ZSBA 3VNQA 5BNZA 3PPXA 5EJ4A 3LT4A 1OI4A 1GPDG 3OQIB 4DAOA 3M33A 5IKXA 3OO1A 2GJ4A 2REQA 1WDTA 4MVXA 5FL7A 5CLQA 2FR8C 3CVOA 5IANA 3TAUA 1SVUA 4LC0A 1NE7A 3QVGB 1GXSA 4IIBA 1T5IA 4LZOA 2ZIGA 4Q9DA 5FOXA 1WB9A 1KRWA 2NO7A 5KOJB 4HAWA 4Y9TA 3IQFA 5ES3A 3Q2KA 2PT9A 1R88A 2G5GX 3TVDA 3BCFA 1V1MA 3C98A 4TV9F 4IH4A 5CFZA 1ARZA 3TCKA 2BM1A 4G9EA 5DNDA 1F0NA 4YDRA 4HB4A 4QYIA 4EW6A 3HZRA 4ZRNA 3WQZA 2VS1A 1HR0B 3ZDYB 4EUFA 3D02A 1LY1A 1XQ6A 4KO2S 3CO5A 5EKUA 2HDOA 3D6MA 2WHQA 3A9RA 4Q3CA 3UFXB 1T5BA 4H7KA 1MRZA 1M0TA 2J9GA 5AJVB 2OCDA 1TM3E 1E2DA 3VO9A 1XTJA 3I8OA 1K7XB 3AVVA 3W78A 1MJ5A 3UW3A 1PNOA 3CCCA 4F6CA 4N54A 5HZGA 4RIFA 4MAAA 4BP9A 2QTNA 4JVMA 3M4NA 2B69A 4M1MA 5HZMA 3IJEB 4LWZA 1MTOA 2W37A 1WD5A 3L43A 2XYQA 4KRYA 4KDRA 4EW3A 4ENRA 4UCXA 2XUJA 3L05A 3NNNA 5HF9A 1E94E 4DF3A 2FRDA 3PITA 1U0HC 4IG9A 4BMOB 3U4QB 5K3AA 1M1ZA 2B9VA 3IKLA 3P9KA 2K7FA 1DCTA 4OX9B 3OP1A 1EP9A 4LY6A 1ONSA 4C2AA 3DBLA 3PDJA 3PI7A 1O9BA 3QYJA 1GQOA 4PR0A 1DRVA 3CCBA 3WV5A 3T3DA 4UREA 1GGMA 1M1NA 5BPHA 2HLHA 4HX2A 3UC5A 4V0QA 4AUEA 4RH3A 1O5TA 3SS8A 3GU3A 2QK4A 5I5EA 3D3JA 4J1SA 2ZS7A 1GG5A 3VPFA 2Q3BA 2OLJA 4UHHA 4ZOAA 4CIAA 3GGSA 2IP2A 3C7CB 2EJVA 2WQ7A 1J0EA 4RD2A 4F97A 3BGOS 4LGYA 2Y92A 1OLSB 1BSVA 5KYYA 2HJRA 5TPWA 1X0VA 4F9FA 1EEXB 1OUMA 5DEIA 1AIPA 3WQQA 1TYBE 1F0PA 2FVYA 4US0R 1KP3A 2GKOA 2OC9A 4PRYA 3VR6A 1XT6A 2VDKB 1J2TA 4G5HA 2H16A 2QF7A 3OIUA 2CGEA 3E2PA 1GUAA 1EB8A 1I0ZA 4WJKB 1NFRA 2CYCA 4KH0A 4GP6A 4N6GA 2G9NA 3A0UA 1RWOA 1ZL2A 1EGAA 1FPQA 1TU0A 4PFKA 1PTKA 1QRDA 1E3LA 3DCIA 3VR3D 2Z2IA 2C7GA 1EFVB 3I8SA 1JZTA 4LFCB 2H65A 2FCRA 3AFOA 4R9SA 3TJZA 2AG5A 2BEJA 1WDLA 3JASB 3W6NA 5JQWA 1NVAA 3FGOA 5A04A 4I9NA 1VSUA 3GEHA 3ROXA 3FJ1A 5KKCA 3B89A 3W8EA 1F0YA 1PS9A 5EE5B 1UC8A 5GJWC 1DMRA 1U5AA 4ZO6A 4B7CA 3FFWA 5JXJA 4DEXA 1U3WA 4IFTA 1Q1BA 2X7HA 1ZJ6A 3K0AB 1NF2A 4DMLA 4JA0A 1YKFA 4OXYA 2C78A 4M0MA 3HDTA 3W4IA 2ZIXB 3AFGA 4Z4HA 2E49A 2JFVA 3W4JA 5CB8A 4CM5A 3FOWA 2IY9A 1C7ZA 1EHYA 1RKBA 2ZWIA 3A37A 1E5TA 2ORWA 4Q1VA 1SVWA 1XLWA 2AKAB 4X7CA 2WFZA 3GG9A 4KLAA 4MNTA 2Y6VA 3PRKE 3LGSA 4K9KA 4MAMA 4EI2A 1YBFA 3UJPA 2QUBA 3N7TA 2QUIA 1JDZA 3WKCA 5FBVB 4CM8A 2IKSA 3DDUA 2BJHA 4LBZA 4WLNA 3U80A 1H6AA 1U8TA 1T29A 2B8WA 1SN7A 4XYLA 2JJ2A 1PL0A 4P08A 5T57A 1B76A 3TLGA 3AZQA 3DP7A 3DAFA 2UYCA 3DMDA 4R9NA 2NV4A 3KOUA 3ND7A 2W9XA 4Q34A 5JH7B 2IBSA 1JDVA 2HA2A 3B6EA 4OP1A 4DMFA 1QCDA 3I6QA 3DEHA 3OQOA 2XRMA 3A14A 4G24A 4J94A 5HXBA 4L5BA 1LC0A 4A8HA 2HC9A 3HJTA 4X7RA 2X6QA 4S0XA 5LKRA 3RTGA 1J2UA 3U3OA 1V7PC 4KWIA 1O5IA 3ND9A 3WWYA 3A6KA 4TMFA 1L4NA 4KXXA 1CF4A 2HMVA 2EKQA 4EG0A 1E8NA 1WUJS 4D92A 3M81A 2D3TA 3I4CA 4KZKA 4YB8A 2HU7A 3CPXA 1NRXA 5HJ7A 5HVNA 2DU8A 3A9WA 1GNTA 4B31A 2BKAA 2WTXA 3A06A 3E82A 4QOEA 3TE6A 2J9ZB 3M6FA 1QG0A 2ENWA 3KDPA 4MHTA 4DG9A 4RDLA 4LOJA 4LVUA 4EKYA 5IBCA 3RYCB 5IJ0A 2V5VA 2VDUE 5G0WA 5E6TA 5EMJA 2ONYA 2ZJAA 4KQ6A 1XVLA 4B6FA 5B55A 1RYEA 5IUJC 2NPIA 4M4SA 4A6PA 3MT9A 4BKRA 3Q87B 3U1BA 3GLIA 3S2FA 4E4YA 1RKXA 1CJTC 5F98A 2XUIA 4DQKA 3P97A 5KNBD 1TMYA 1XDUA 2PQMA 2PMCA 3DMRA 2PUHA 2LGJA 3DEKA 3IC5A 3SPXA 3T3IA 1RJ9A 5AKJA 1ZI8A 3EAFA 5DWDA 3B8EA 3G68A 5BWLA 4TL8A 4R0MA 5JS8A 3S1LA 1ODFA 5HZBA 2VJMA 5EHZA 2XBMA 3BXXA 1E3IA 1N9GA 2OKGA 2I7DA 3M1AA 1XZQA 4CLRB 3D81A 4DR3B 1E43A 3QG1A 5LQCA 2BISA 2WWXA 4YALA 3U7QA 3BYZA 1YZNA 4EKGA 3ANTA 2Z3VA 2HNAA 3IUEA 5LMUB 4U8GA 3B53X 5ESDA 3ZQ4A 2MYPA 2HGSA 3EN0A 5JECA 2B78A 4WN9B 1E92A 1OR8A 4YRMA 1R9MA 1UDCA 2XWQA 1YXMA 1TJNA 1PGOA 2UDPA 4J07A 4RDXA 1YOBA 5AKXA 3V7NA 2Z4SA 4F21A 4FYMA 4A1FA 2ZI7A 4JBXA 2OG2A 2XV1A 3I72A 1SBCA 3EWAA 3A1FA 3SC4A 5FQOA 5KWSA 5F7ZA 4DLUA 3ISXA 3CTAA 4EITA 2OWEA 5B7PA 2ZWAA 3EVNA 3ORRA 3TECE 3LSTA 2JBAA 2Q3EA 4FU0A 1FTSA 1G8YA 1L8OA 2IUSA 4N65A 3K0EA 3JV7A 1WLSA 2OXTA 3WGMA 2DLCX 1DSSG 2JHPA 1G5FA 3ZHYA 3WYGA 1QHXA 3FOEC 1IBKB 3DP9A 4QO7A 4MV4A 3GLRA 4CMIA 2C5EA 3O4FA 1C14A 4FHDA 2CCGA 1JFTA 4QAJA 3ZNQA 4XCXA 4A92A 5J2TB 4ENQA 1NBMA 2OP0A 2Z98A 5IAOA 5E4FA 3BDIA 2WPNA 5GQSA 2WYWA 4Y2YA 3LQEA 4I3HA 5C8DA 1DTEA 1CUIA 1ECCA 3D8UA 1CQJA 3KJFA 4JFAA 5B7QA 4ZVUA 3H5AA 4F6LA 1YK0A 2YVQA 2O20A 2ROQA 1SZPA 4NFLA 4YP9A 4EGFA 4NARA 5K0ZA 3IIKA 2J0SA 2IX9A 5EIEA 1CB7A 1EVEA 2CXUA 4UU0A 2YV2A 3PHJA 1DKQA 3KKMA 4ZV4A 2I3DA 1TJ4A 1J0XO 3HCDA 3BBPA 2G0NA 2CE7A 2ISSD 1QB7A 2RGCA 2GCIA 3NRBA 1LPAB 5AW2A 1N36B 3K8YA 5KX5A 2IYAA 3N0TA 3DL0A 4BTEA 4HLUC 4KE9A 3VU1A 1SUAA 4B46A 3RBVA 5IWCA 4WI1A 2PN1A 3M1LA 3V3KA 4CLXA 3VKGA 1NN1A 4TL9A 4L9SA 1T25A 3WGOA 4DIDA 2WP8J 3N53A 3I45A 1UC5B 5D87A 3TTXA 1G8HA 2J3QA 2VNKA 1OBCA 2I54A 4A03A 1D2GA 2PCLA 4X1IB 4D25A 2GZ3A 2EGHA 3PUZA 4GLFA 4J1TA 5EL0A 4HOYA 5IAKA 2EW8A 1BOOA 2X9GA 1KO5A 1ST3A 1N4AA 3RG2A 4WN9A 1K8RA 3QW4B 4IQGA 4B09A 1I7DA 5B7GA 2Y0BA 2YUIA 1PKVA 2PMEA 2UXCB 3QQPA 4ZTZB 3RSHA 2VXYA 5LN1A 1KAGA 1KI2A 3JD0A 5FJIA 5JTUA 3I61A 3R7FA 1M2OA 1EP2B 5DRYA 2ZLBA 5I9MA 3IVGA 3ZWNA 4IIJA 4UNQA 4ND5A 3H8SA 1N2XA 3D8RA 4OU5A 2QTLA 2O7NA 4Y6PA 3S2ZA 3VC3A 3RC9A 4EHLA 1A88A 1RHQA 2KW5A 2ODEA 1P0IA 2IOYA 5SYMA 1XA3A 4BUCA 2J0EA 2HF9A 4ZXFA 1HM5A 5KQLA 3A2KA 4TL7A 4U63A 4UC0A 3DJYA 1R3DA 5HKLA 1UOEA 2VQ3A 2BOVA 2NUAA 1PZXA 1TF5A 2J3DA 3G59A 4LHWA 2WI8A 1JQJC 1ISMA 1KO4A 1OXKB 5EP1A 1RRCA 2Y27A 4FK8A 1UOQA 3VR6D 3VPCA 1ZM2A 4WLUA 3L1HA 2XGOA 3I2JA 3TZHA 3MUFA 3HVRA 3GQVA 2HQBA 3U37A 5LQMA 4QVJA 3JQRA 1G6HA 4B3RB 4Y30A 3KLMX 4R1UA 4KFSA 2HSDA 3KL2A 3UENA 3DVLA 2G1PA 1GFZA 2TMKA 4E0FA 1DAOA 4HQLA 2AD1A 4YH1A 1RPAA 1LF5A 3PUWA 5KBYA 1JMYA 1TA4A 4JLOA 4PX3A 1FMTA 4OHBA 3O8NA 3PQEA 4LTMA 1VCHA 2JCGA 4TQGA 4B6RA 4JS0A 2RKWA 2X2EA 5ECGC 3SHFA 1NHWA 4A0SA 1U8UA 4C20A 4AXBA 4KXLA 4P3OA 4BO1A 2FZEA 1Z5VA 5AXBA 2Y1XA 1DTWA 4N3BA 1PZMA 2R7NA 3RK4A 4D7AA 1F0KA 3BERA 4N9QA 4Z8YA 1Y3IA 4HLUA 3T7AA 1XD9A 5DIZA 3TPZA 2GFHA 1XAIA 3DZJA 1TMOA 3AR5A 4IMIB 5BP7A 3P9NA 1JI0A 4XB2A 5C8VA 3RARA 4ML3A 3H5OA 4GC5A 3OZFA 3TN7A 2XJ9A 4ZIRA 2YZNA 1AKWA 4HAOA 2ZIXA 3KJHA 1JF8A 1SULA 4ZT5A 5HWSA 1DDOA 3FWKA 4MLDA 2CC2A 3C5WP 1OFUX 4GVXA 3EK2A 2VUHB 4Z4CA 3NHYA 3BCRA 2RHWA 4TTTS 1E6UA 2JGMA 1QH8A 1L7BA 1R4MA 3U3RA 4U7JA 4RTQA 1Z2EA 3P9RA 1OX5A 2WD8A 1P2DA 2ZI5A 4N1AA 4OX9Y 1RWNA 3DW3X 2MINB 3CEMA 1ZGBA 3DMNA 2X4DA 3OZRA 4P7FA 2CLFB 3A6FA 1A9XA 3ZCPA 3N2LA 2ZIUB 4WCVA 3TZ6A 4D45A 3ICVA 4W9NC 2RAVA 2W2MA 4KQGA 5FNVA 3QXJA 1M5UA 4CF4A 2BJWA 1QCZA 1EU1A 2AYZA 1I3NA 1EJ0A 1RZRA 4AZ0B 3A6JA 3OQMA 4HFMA 4U7HA 5AM3A 3F67A 4Q3LA 3ITEA 3AEKB 2N1MA 3FMGA 5JDCA 4YRLA 4Y1RA 3LQRA 3PWZA 5GONB 2JVIA 4PE5B 3IRUA 3A9UA 4CF3A 4EX6A 5FA5A 2EJWA 1ADCA 1GKUB 5IVPA 1UPFA 3HBLA 2MYNA 2QPLA 4W5NA 5EFZA 2WHRA 1HDOA 4IOLA 1JAZA 2O8DA 1GQRA 3IKMB 4AD8A 3MINB 1FP2A 3DOUA 1YR8A 4RVUA 5BN4B 2VLIA 3SR3A 1BN6A 2RAPA 5F33A 4C5CA 2QHXA 3FX2A 2Y9MB 3QTLA 4RPGA 4URUR 4NDZA 3W6PA 3DOHA 5L4SA 3RREA 3G82C 3VU9A 2BMDA 4U7FA 5EIFA 4HL6A 3GRKA 1PJLA 3AJEA 3MOGA 1I1HA 3SJ7A 2BVNA 4TSFD 5AOVA 1DC7A 1L7EA 3A0RB 3DXZA 3GMIA 1E9BA 2AQKA 3ONWA 4KLNA 3RYFA 4WJLA 2WM3A 3W3AD 1IVNA 3L0SA 5GJVC 2R44A 3HKEA 1LW7A 4WK4B 1LV7A 3QVUA 4D2IA 2C2MA 1R0SA 1XE3A 1J8MF 4Z0HO 3T5PA 2W2KB 5C3MA 5ALWA 3C1AA 1YQWA 4D3YA 3QUBA 3CXUA 3EXEB 2FN9A 2FLVA 3WIOA 3OU6A 2CEKA 4G1UC 1S4QA 2HF2A 4BMZA 5H1YA 4ZI7F 1NWHA 4X06A 3NHKA 2PX2A 4FYPA 1HPLA 3VR2D 3MCTA 4B3XA 1G8GA 5DLEA 4CMJA 1N6KA 1OHHA 2QN6A 3VKWA 1Z2AA 3WNDA 5FV4A 1JBKA 3BH6A 1B0PA 4TMKA 2VJPA 3CNOA 4NK4A 2ZL5A 1ORHA 3KPJA 3HCBA 1AN0A 2FQWA 1QHHB 2WQZA 2ZI6A 2ZS9A 3GPCA 4UU8A 3Q7EA 1Z4OA 3R5SA 3U4MA 1N5KA 1RBZA 5C31A 1I8TA 3CEPB 3I39X 3N0WA 2IWRA 5AUPB 2X0FA 2WWGA 3LL7A 2IXFA 2B25A 1R8QA 1UQTA 3BWMA 3GLSA 3H2BA 3M83A 4P86A 2XCLA 2PUVA 2XA9A 4WXEA 3SYKA 3TSAA 2ORYA 1QPBA 2Q50A 2W2KA 2XA2A 4MKXA 1KARA 4MRMB 4F5ZA 2PUCA 1BVHA 1XP8A 4UM7A 3MCVA 1P4GA 4BZQA 1NW3A 3PD1A 5GM2A 4A27A 3LX4A 1T5HX 2RBEA 1SCNE 1ZC4A 1GZUA 2VJOA 4KR0A 4KOEC 4DRYA 2FPIB 2I67A 1NZJA 4Q4CA 4RJLA 2B3TA 3ED1A 2Q4TA 2J3MA 4H77A 2WB2A 1L5VA 2WSMA 3KPYA 1FQOA 4B73A 4Y67A 1JJVA 5JCOA 2VCYA 2WC1A 3ZNNA 3DDYA 1BJTA 1OZGA 1RWWA 3G9UA 4KGVA 3RAPR 4NZZA 4NBLA 1R0YA 3BQJA 1G5QA 1L8AA 2NVWA 2YRFA 3I9V6 3KOOA 3LUKA 5D84A 5K7SA 2HGZA 1VQ7B 1RCTE 2NYRA 3OLZA 4BMCA 4BCCA 3BREA 3OEED 4WY2A 4GZ3A 3ZDZB 4MRMA 4UW9A 1E18A 1MC4A 2PZGA 4RPJA 5KSZA 1E2BA 3A4MA 1I51A 3PUJA 2WHPB 4OYLA 2PS0A 3I83A 3N6XA 1SXJD 1F5NA 1VCNA 3DTVB 3OJOA 3H3FA 3F97A 2W6JA 4D4IA 1JLHA 4JODA 1MENA 4EAAA 4NWIA 5L3QA 3H5NA 2V7QA 1YVPA 3R0QA 3WGZA 5A0TA 4FNAA 4Z54A 2MU1A 1FUYB 2ZJOA 3LW7A 5CB0A 4DGSA 2BI7A 1VKJA 1WE2A 3GLHE 2OWDA 3NHWA 3Q10A 1O8BA 2ZUFA 2CHGA 3G5AA 3PI6A 4C14A 4RQBA 1VG1A 2D1FA 2EWWA 2D13A 4XM1A 4WOBA 1OTYA 4MXDA 1CY2A 3QFTA 4WRRA 3WY9A 1JR3D 3I5UA 1RTKA 1MAAA 2O1EA 5BSWA 4MVJH 1X1DA 2HNKA 1AKTA 1WXGA 3F90A 5DASA 2R6HA 1TYAE 2JJYA 3PCRB 1NDHA 4IXNA 4HVAA 2QI9F 4BS9A 5D5HA 4V1CI 5K05A 4DK1A 1XU7A 5LOVF 1WZEA 4UU7A 3ISVA 5CJJA 4LDQA 3KVRA 2QGZA 3PG5A 1T2NA 2SBTA 2DHQA 2P2ZA 1YU6A 5FTJA 4CL0A 4Z3KA 2OBSA 4OHOA 4M0FA 1ZOSA 3QY9A 4CL2A 3HGTA 3ML1A 5CH3A 3WLJA 4KMSA 2OBXA 3B60A 5IF3A 1I94B 1JFLA 3LYHA 1DC5A 1Z33A 3OLVA 3RABA 1PZNA 2GGSA 4B44A 1MB0A 2QLMA 3L46A 1KDZA 3ZDEA 5KVAA 1YTUA 1KAEA 3NM5A 5DHRA 2DY1A 4JEIA 5KQRA 1JHZA 1PWZA 2ZYAA 2AUTA 1QOPB 4I1IA 3HZOA 4EGSA 1O4WA 3E27A 3HC7A 4YFVA 2D7JA 1RC8A 2JG3A 1ZW6A 2X1LA 3FOBA 4ZTUB 2IYLD 2D1YA 2PZBA 4Y6QA 3SNHA 1NMZA 4BNJA 1GGKA 2H7YA 1MAUA 2OHVA 3V34A 1Z63A 2GQFA 3HA3A 1P6XA 2I1VB 4Z4GA 4PLWA 1Z6ZA 2QRHA 4ZAWA 1MO2A 1VYHA 1C1XA 1VHJA 1MJGM 4IIFA 4Z0NA 5BQ5A 2ONJA 3WLPA 5LMCA 2PGNA 1XKTA 2X9LA 1UUFA 1U4NA 3HVIA 1X6VA 1Z17A 2LIVA 4II2A 4EEZA 4DADA 5IT5A 1D3AA 1VDMA 2BHSA 1U7OA 1Y8QB 2IYUA 5EIHA 3ASUA 3CZAA 3TDNA 3QFCA 3R74A 3T12A 2FJUA 4MW2A 5E2AA 3I9MA 3BRQA 3RLIA 2EKPA 3ZQJA 2ZK7A 121PA 3AI2A 4PZDA 4BUJA 2NV2B 5EC8A 4K28A 1U3VA 4UUMA 1A82A 3BIFA 3D2AA 4RZUA 3MWEA 3RHZA 3C3BA 3KEWA 3BE5A 1RXIA 1EK6A 1FNNA 3KT0A 4IO0A 2BGNA 3QEJA 4Y2PA 2QTBA 5DBFA 1A9TA 2X4LA 1NBIA 1PP4A 1RQ2A 4B48A 2WAOA 3HNRA 2DPHA 2Q7DA 1F06A 4ZQHA 1QP7A 3WRWA 1F7UA 3ZY4A 2IHVA 3IJPA 2NQ2C 1PL6A 2NX2A 2ZRPA 2ZU6A 2IE8A 2Z4TA 2RARA 5BQXA 4L5CA 2BM0A 2H59A 4EUHA 1GWNA 1B93A 4EQ6B 4BLUA 1UPAA 2QE7A 4DMKA 3EVFA 1Y1QA 1OILA 1Z8FA 2WYVA 3Q3EA 4FGUA 4X00A 3WOHA 1GAWA 2XSZD 4F2PA 3AONB 3L0PA 4WZAE 5FUVA 3OT1B 3EIUA 4D80A 1UWVA 3OZIA 4XI9A 2ZZMA 2WUFA 4R2JA 4PABA 1KORA 3IVCA 2H00A 2R7AA 1G42A 2QTTA 3PUYA 2WNHA 3FDJA 4I5DA 4F9TA 3IL2A 2BUBA 4RJIA 1YL7A 4HDOB 4X9XA 1A2BA 4V0SA 1YB6A 3NO4A 1II9A 2JFFA 3LFTA 3DF9A 3TFWA 3E7FA 2RB4A 5D5QA 1HDZA 4OB8A 2F7SA 1W4BA 3AUAA 3U39A 3T1HB 2QD5A 2HBZA 4HPXB 5GWXA 4BFTA 5ADUS 1BE6A 4MWEA 2ZZQA 2EGUA 4HGRA 4X91A 5CAEB 2H7VA 3BMQB 3QX9A 4PVDA 2JHGA 1RXEA 5K8IA 3UYKA 2GZHA 4KJXA 2H06A 5JRDS 4PTZA 5AIBA 4CV1A 4NNJA 1GL7A 1TB4A 1G8AA 2D1RA 1BRMA 2WIDA 2WNSA 3B1VA 1P4JA 1QP8A 4M83A 3ZQ6A 4WHMA 2YBEA 3T9AA 3FA2A 1CP2A 3QYAA 4MB6A 3DHEA 3ZD9A 2JLXA 4WCFB 4RDKA 3ULKA 3CXRA 5CR9A 5DHFA 3TLCA 2RHJA 4L5IA 2P6RA 3OPVA 2HREA 5KTNA 3BH4A 3A1WA 3DT9A 4AU1A 3M1YA 4O4JA 4Z1MD 2GAJA 1W0JD 2BUCA 1JSXA 4FYYA 2P5SA 5DCYA 3Q2OA 5ALEA 4YMIA 2RIRA 3OEHA 1HXHA 3AM4A 2C61A 3EC2A 4RIHA 1PFVA 5IC4A 1SOMA 5LU9A 2A0FA 2BAGA 3PHIA 1NVFA 2GTHA 4HMPA 4HVTA 1VQOB 2B1GA 9ATCA 1JAXA 2PJRA 1K3FA 4DA6A 2ENUA 1CUGA 3WIUA 1S2GA 2C1ZA 4MV1A 3IHWA 3A9VA 2DR0A 3AF4A 1NASA 4LC9A 3WYBA 5AVTA 4TSFA 4WV3A 3KEQA 4PZYA 3J7AC 2UZAA 5JE8A 4WFQA 5FLYA 2UZ0A 1UFVA 2B34A 2PJDA 1IQ0A 1IG3A 3T7SA 5LD2C 4KVFA 3OESA 1CUEA 4JN6B 3D59A 1XKLA 1C3JA 1PR5A 2CLKB 1MKYA 3TAXA 4BB0A 4QJ3A 2IHTA 8ATCA 4DQLA 4D8UA 5KYXA 2QUKA 3COJA 1IK4A 4HDKB 3F4KA 1U90A 1NW7A 1HK7A 1YJWB 1Y7LA 2DOKA 2WUWE 1DWUA 4HWPA 1BKDR 4QECA 3RD5A 4CTOA 1AS0A 2X2PA 5BYAA 1M7BA 1AUVA 3A6HA 4OH7A 3B6IA 1BYIA 1CY1A 4NG4A 1LRLA 3LUDA 4ESOA 1MO6A 1PFQA 3O0TA 3AX6A 3GD7A 3VDXA 4LGMA 4CKZA 2I91A 2PZMA 2JHFA 3KOYA 4UTOA 1GAQA 1AGPA 1Q0LA 2WA2A 1QGED 1HFEL 2YIJA 4FZJA 1GRQA 4DNXA 2RHMA 1XOIA 1A7KA 1RJGA 2O5RA 1IWPB 4GW3A 5FL3A 3CWZA 4Y8VA 1BXKA 1TC2A 5DF1A 2PO7A 5FI3A 5IC6A 4YPFA 3EW9A 4PHGA 3V1YA 2CYBA 3GMSA 4JBNA 2Y67A 1N1EA 5EPEA 3G7NA 4YAKA 4ZV7A 1W29A 2HYIC 4JMPA 4UXIA 4YI3A 4G89A 4O02B 2QL7A 5ITZA 5JVDA 1EA5A 3PCTA 1CY4A 3LLUA 5HF5A 4F5EA 1QF6A 4GYWA 2CVHA 4JYZA 4TYNA 4W7IA 2A30A 1E6EA 3OM9A 4ARBA 4D3DA 5KTOA 4TZKA 1Q1GA 1YJ9B 3PNMA 1ZISA 4R1SA 3WLEA 4DKJA 4JB0A 1FRNA 5FR2A 1OREA 4J49A 4R1LA 3I2YX 3LVBA 2FPPA 3DLPX 4RV5A 4K9OA 4X8OA 3HDQA 4FI3C 5CK4A 3ER6A 5FUXA 5TPZD 3K73O 1P1BA 3T54A 3V1NA 2C7PA 3EWIA 3QBEA 2P2CA 1V25A 4Z9YA 3KZCA 2FR0A 3L1IA 3LT2A 5TEWA 3SU8A 2D06A 3AYZB 3MXTA 3N3AC 5IYZF 1FVXA 3UMSA 3X2SA 3UKDA 2QYSA 4P7KA 4KSBA 4WX2B 3ZUPA 4Q03A 1JDBC 1F1JA 1N1GA 1EFVA 1UBKS 2DHEA 3L49A 4PFJA 4RK4A 2PRZA 4GQBA 3TTSA 4L1KA 4RK1A 5CVVA 5AOCA 1D4OA 2V7QD 2CDRA 2Q0HA 1FDSA 1LS1A 3EJ6A 4D6PA 4YC7A 1SU6A 5TMPA 1NKTA 5HXAA 2XRZA 2XA1A 3N0VA 5T6BA 2X22A 2YIDA 1P73A 3QW2A 3GK3A 3C45A 3EVDA 2XXAB 2CKMA 3CGGA 2XMCA 3WISA 3WV4A 5B64A 4KCGA 1QQ6A 2J4DA 3GOQA 1L5LA 1J99A 3EXAA 1OXSC 3ZE7A 4WZLA 1VQPB 2OV1A 5L53A 1RC0A 2A35A 2E4UA 2I6GA 4R8MA 4E7PA 4R2HA 1RPTA 1P6QA 3F5SA 1AU9A 1SKUA 1Y7IA 2D5AA 1Z37A 1KZ6A 2A9OA 2PYIA 3CSUA 3U9TA 4AN0A 1LCIA 2W0SA 2FX5A 4K9MA 4AMGA 5GOTA 3SK0A 3S8EA 2ZXUA 1PSWA 1XLTA 1U94A 1J2RA 1G9SA 1LLUA 2XQJA 2IEDA 4B47A 2CXPA 1RYMA 2R00A 3HHEA 5T3UA 2E85A 2XF2A 1NYLA 3TIFA 3TW8A 1S1MA 3U31A 1S4MA 3BUSA 1IBRA 1Q7TA 4I4TA 1FP4B 3BZWA 1J22A 4BLQA 2VJCA 4N01A 2A86A 3B48A 4B6QA 2B4YA 1A69A 4FFBA 3KLPX 4LXTA 3BSSA 2QW1A 2YCLA 3CNNA 2NADA 3TH5A 2NUTA 1WTHD 2R25B 1AJEA 1QMGA 3F6RA 2ZSUA 3JAMA 3TTWA 1FVHA 3GY0A 3TKAA 5DBEX 4NE2A 4P25A 4XOUA 2IH2A 3DV9A 4C0KA 1RAIA 4IVNA 1CUCA 1O94D 1FRFS 4ONEA 4AURA 2X53S 3CCRB 3JRWA 5A6VA 1GFSA 1Q1EA 3CRW1 3LS2A 3AW9A 3GJYA 5EKSA 3OEEA 1Q1NA 1QQTA 2XUHA 3F8WA 4X7DA 3GJ4A 3QTTA 4I5GA 4JOQA 1HT0A 2UZIR 4UNSA 4CCWA 4D43A 4POOA 5B4VA 3MW8A 3IEKA 2ODTX 1QRTA 4Z4SA 1SD1A 4KNWA 5MF6A 3VH3A 4EBFA 2AF4C 4UMDA 2CW5A 4ZCQA 1HO3A 2OR3A 3CY6A 3EASA 4NG5A 4OMCA 4TKZA 1BNCA 1Z2OX 4ZEWA 1IOWA 2VPXA 2YJ4A 2RK4A 3NASA 8OHMA 1KO7A 3LCRA 3G89A 3M7IA 1NONA 4GKJB 2H63A 4ILEA 2ARKA 1GEGA 3QSGA 2A1TR 2P0YA 2P9CA 4MCHA 1ZLYA 3FDZA 5H5JA 4LRXA 4N6NA 4QGGA 4D9NA 5FPKA 3HA5A 1TGYA 3N2IA 2GNAA 1Y9AA 2NXNA 4B81A 5I7WA 4F4UA 4BNXA 1J97A 3VBCA 4ZZ0A 2J5RA 3G85A 3I1IA 4FCVA 2IZOA 3L18A 4YROA 4LDZA 1KIFA 4ZO4A 4CM8B 2P6UA 2IEBA 4BNVA 1CYDA 2D8MA 4IIDA 4AX4A 2X0KA 2BEVA 3AJ9A 2OA0A 1EK2A 4BV2A 1K6IA 3FVWA 5DBGA 5JTTA 3WQRA 3R5HA 3NP9A 2ZUEA 1JPJA 3W8RA 1QJCA 5CFOA 1DJMA 1YZYA 3GJQA 3ACCA 3BXHA 4EG5A 3R09A 5FA8A 2BBSA 1AHHA 2HMUA 3GVIA 5L3ZA 1WAMA 2EFDB 1KETA 2W93A 3X1ZA 1S2LA 1Z2DA 3TLGB 1E0DA 5EIXA 3N8HA 3GPDG 2GPJA 4JJ7A 3AEQA 1JJ2B 1KMCA 4NYIQ 4A7PA 3OKXA 4L95C 5KPDA 1SVOA 4COOA 4JAVC 3WMXA 2QLFA 2KI5A 2I62A 2Q3DA 3DNFA 3KKLA 4MI6A 2I2XB 2IV3A 2O7QA 4QBKA 4XVQA 5ANRB 4Q1EA 4Q9AA 4D5EA 1K8ZB 3G4SB 2IUYA 5EFOA 3SE7A 1YJBA 3ZZ1A 3ZZUA 3NBMA 4K05A 3K70C 4LY3A 1I0LA 4XZ3A 1ZS9A 5ENDA 4GP7A 3MRVA 4M7OA 4A0GA 4K0KB 4GT1A 1WCXA 5A0VA 2DH6A 3VC1A 1ORVA 4G4IA 3M4JA 1RCFA 4ADSG 2OUIA 4YAGA 1U2EA 2WABA 3DXYA 4BWGA 1NX9A 5JCPA 1QHGA 5K8VA 4LF7B 1E9FA 1BX0A 1LVHA 4MUJA 5GZ6A 3A7EA 1THGA 4A5OA 3S2IA 2QN2A 1DC8A 1I2ZA 1K9VF 4QXAA 4Q4LA 1XWIA 4R1NA 3TSCA 3OZDA 3QF7A 1E3DA 2BBTA 1P91A 2VUSA 2CLMB 1XC7A 5KVSA 3RWMB 3E3OA 5AKHA 1ZL0A 2H4YA 1V3TA 2YUTA 2GTIA 1L1QA 4UBNA 1LBIA 1FS5A 4YONB 3NU1A 2R97A 2X4IA 3QLJA 1MMFB 4M8IA 4TKLA 3TNFA 1WDWB 4IINA 4II7A 5JO9A 1KGSA 1ZH2A 1Y33E 3RKUA 2XH8A 3V8MA 1OI3A 1THZA 4H1UA 1JZQA 4F7WA 3RF6A 4G6ZA 2F1MA 1TADA 1V47A 3KHSA 3LZDA 4EJ6A 3T4UA 5AVJA 1KWKA 4FFMA 4MJXA 4YRPA 4D56A 1A8IA 4NCHA 1QP0A 1R27A 2G6BA 3UF0A 2PVSA 3A9TA 2AZ4A 2JS7A 3MIIA 3QITA 4I08A 2W6MA 3UAYA 1GQSA 3HYCA 3A32A 2GWRA 2F1IA 3B3GA 1UJ4A 4HNSA 5F52A 3UWDA 6NULA 4IKOA 4LVOA 1MJFA 4AQ7A 2O8EA 2QLTA 1XRRA 2UYYA 2BJVA 1JALA 2XSZA 3ILHA 4KU4A 3NNSA 3NYQA 3K0BA 3PEWA 2OV4A 1BE1A 4B4VA 4XKWA 1IN4A 3QUTA 3FSGA 2VT6A 3HB4X 4EB6A 4EZEA 5MN6A 3PFHA 2VJIA 5BUCA 2ZTGA 1XD2A 1RLIA 1U11A 4C01A 4Q1DA 4UBMA 3FN4A 4RY8A 4FMCB 4J0CA 2EHJA 4P84A 4R4JA 5FI0B 2C82A 3EZ6A 2GYYA 3VMMA 4ZYLA 1ORIA 2IPLA 2KM1A 4L9AA 3ZXSA 4AJ4A 2PPLA 3G2LA 3PJFA 5E9JA 1AZSC 5JJIA 3SSNA 4EW1A 1YKGA 4HH4A 4RHYA 1ORRA 5CT8A 2DLNA 2R8PA 1ML4A 1CJVC 1AOXA 1DCFA 3HAGA 1DBSA 2OCGA 2V59A 1GYPA 1HTTA 1AY0A 3KXIA 5DTIA 3RNLA 3L07A 4DCTA 1FFWA 2G72A 2HIAA 2EARA 2QT0A 3T3HA 1C1DA 3BOSA 3LQ6A 1ESEA 4FZ3A 1MVLA 1HLGA 5JHGB 1ZGHA 1C29B 1NR5A 1T9ZA 2CHEA 1QGZA 3O47A 4GUDA 2IF0A 1UBNA 4Q4HA 5K0CA 4E0BA 4TYQA 4JYCA 3U81A 1E99A 2GBGA 3E8XA 1C3OB 5B4TA 2AMFA 4WVFA 1F6WA 1JP7A 3H3XA 3ZWYA 3R5JA 5NULA 2Q1TA 3TQCA 1QBKC 3YASA 2VHJA 3R8CA 2ERCA 1QS0B 3OMXA 4AF8A 4Z4IA 1DU4A 4MZXA 2BTEA 2O5CA 4NMLA 2A92A 1ZWLA 2Q6TA 4JJ4A 4UPEA 5B36A 3PZRA 1GKYA 5A3RA 3DFZA 4JLNA 2OAP1 4ZC8A 1NUTA 2BSXA 1CIJA 3AM5A 1HWYA 2VHTA 4J6FA 2FW8A 3IAAA 5ILOA 1C1YA 1L8QA 4KTTE 3FYUC 1GNRA 5G1NA 3JW8A 3BGDA 1Y34E 3AR6A 1AV6A 1UDXA 3OSUA 4DWWA 1L5FA 3V2UA 3OOEA 4IUCS 3K09C 3ZWQA 3IPYA 5A2QA 5LLDA 3QEBZ 3TQFA 5FI5A 1P9NA 3I6MA 1KJ8A 2F55A 3KR2A 2WWWA 2ATEA 2EFJA 2X5KO 5G0SA 1EDBA 4BZZA 3ZDAA 1JSZA 2YDXA 1NNSA 3UJ3X 2ZDQA 4URWR 4X84A 1C9NA 4Z99A 4A23A 4BEBA 1IVYA 4DHEA 3GT4A 4MW0A 2J32A 1RI3A 4IIXA 3U9SA 1KJQA 4YBRA 3DLTA 3WGNA 1KXJA 5GIPE 1M34A 3HA7A 3ZU2A 2PA3A 4IHJF 4BBPA 4NNPA 3VVMA 4WKGA 4EGAA 2R751 1W4RA 2C4TA 4GXNA 3ASSA 1GA6A 3KQWA 4I1UA 4NFYA 4G8CA 1NN5A 5TQ0A 2NSHA 4AS3A 2JC3A 4JBYA 1FVOA 5JCJD 4M8KA 5E6RB 5K20A 1CQIB 1W5AA 2D5IA 1TYZA 3GRYA 4EYSA 2SECE 4RGQA 4EHFA 3TD2A 4PTLA 2HEIA 1F2DA 4QBGB 2C94A 3TRJA 3CKKA 4XLLA 1DKNA 4QARA 4MGHA 1R66A 2R65A 1NUQA 4AX8A 4EY4A 3WNBA 1JJ7A 2EF1A 2JFNA 1SQ6A 1C8LA 4YCSA 3NHUA 3SD7A 1DEKA 1X9IA 2V4MA 2B3DA 5K4HA 1WG8A 4MW4A 2E48A 4IZ6A 2LPMA 1DQNA 1AKRA 2WYOA 3A25A 1DRUA 2HY7A 1DPFA 2R8RA 1OW3B 3CH6A 3CT6A 3H5IA 4DPKA 2BIFA 1PNQA 2VYQA 3E84A 1N6OA 1O2DA 1G8MA 1GLGA 4L4YA 1MLDA 1RI1A 1XPRA 4UE6A 4EI9A 3GO4A 3LUGA 1GNPA 3JD2A 3Q3GE 3R44A 1QVFB 4NP6A 2ZUWA 4E5SA 2Z57A 2ZB8A 4B6JA 1ZCZA 4Q4HB 1SRQA 4WZBB 2H3EA 1DUVG 4K87A 2GXSA 4N0PA 3FAZA 4MVYA 4MS1A 1CQIA 2IJGX 2VRBA 4C07A 2PNJA 4MQFB 2DCMA 3CLVA 1JG1A 1YB7A 3GVCA 1U7UA 3I9JA 1RKQA 2F1JA 1WUYA 2OECA 2GESA 3VU3A 2SKEA 1C9DB 4AZVA 1X1TA 3RTAA 1XXHE 4L2IA 2FU5C 2WWTA 3JCZA 4QGSA 5M04A 2R84A 1ECLA 3F6PA 1XFDA 2XIQA 1LRJA 3KUKA 1CEEA 3FYUA 4QKQA 3FHLA 1NL3A 3DOCA 2HA3A 3BWVA 2WZDA 5EAIA 3UWKA 1EVQA 1NI3A 3L8CA 1XRPA 5T67A 1HEUA 2D00A 1OH6A 3WGTA 1OAOC 2PGDA 1QK3A 2YOFA 2DH5A 1H3EA 1SBYA 2ZYGA 3PIDA 2EKZA 4LJ6A 3Q5EA 4LE1A 4MQ5A 5LUBA 5IH7A 3A4IA 4UD6A 4C2UA 1WQ1R 13PKA 1CF2O 1GAXA 3MWLA 2D3WA 4MVJA 3V1LA 3EQ6A 2FOXA 3MCAA 2GN4A 5BWNA 4QPCA 2J7KA 1VIYA 2XMBA 3LO8A 3ZKWB 1IMOA 1T9KA 3PS9A 3U40A 2VDJA 2VTEA 4UAGA 3Q7IA 5LVAA 4JLBA 3A3KA 1X9GA 2IYRA 2J0VA 3SVLA 5FOTA 4BDSA 4XQ9A 3GFOA 5JCOC 2VHZA 4G5YA 1EGVB 1MCZA 1KYWA 2LKCA 3MYRA 1AB5A 3IYLW 2X23A 2RKBA 4JQCA 1BGVA 1SO8A 2WU8A 4FFVA 2YZ2A 1G8JA 2NZUG 1B7GO 1A2QA 1USUA 1WW2A 3QKTA 1PLKA 1E1CB 1OGYA 4L3OA 4RFSB 5F35A 4ECEA 2OVBA 2Q9AA 1BDBA 4FJ1A 2HK8A 4BNMA 4DBVO 3KU4A 4QPZA 3V4OA 1I30A 4X7EA 1D6JA 3IS3A 4MW1A 4DARA 4MYHA 4UQLA 2C2GA 1DT5A 1GAJA 1O77A 2P4HX 1VDZA 4FQ7A 1UBTS 2JGEA 2YW9A 2HA0A 5D3ZA 4ZICA 4IEIA 1CERA 3IODA 2XBLA 4OHUA 4MI9A 4ZAFA 4DCVA 5HF8A 4GRIA 3JTEA 2HOQA 3WGGA 2WOJA 1ETUA 1NTRA 2EV9A 2G5PA 2GN2A 4BVJA 1UF9A 4INZA 3UXMA 3OH8A 3CCUB 2XOEA 3PDHA 1X80B 3ENKA 1XQBA 4O0LA 1R4NA 5A05A 3RC7A 2FPOA 1WPXA 2PFKA 3JQGA 1ULBA 4JLUA 4L3VA 5C37A 3KJNA 4WACA 1PFUA 4DLAA 3EXEA 3ZD8A 4JLAA 4YJ2B 1IHOA 2CUNA 1IZZA 3QLVC 2NTNA 3VNVA 2YTZA 3VR5H 5MFZA 2GPBA 1GV1A 3VYVA 2I55A 2IC5A 5ELLA 1XCJA 3JWPA 2PSSA 4D4MA 4KE7A 1C80A 3PGXA 1PBNA 1EWVA 2QX9A 1DBQA 4OHMA 2VO1A 2VKQA 2DTXA 2XCQA 3Q3AA 3I53A 4YWHA 3LF1A 3RIGA 3Q0EA 4DJTA 4DPLA 4YHHB 2YV4A 1S2DA 2QYTA 1EB9A 1EA7A 4MQEB 3K70D 1IJFA 4TLEA 3MNFA 4YLGA 1RACA 2NG1A 4WH0A 1L7OA 4HEJA 2VRCD 1CZUA 1DDIA 1AGXA 4AQDA 5I5GA 1ZHFA 3EZ9A 1ECJA 2IZ5A 1CNEA 2MYTA 3BIXA 3F47A 1M0SA 3QOWA 1VKHA 4RMGA 1GUBA 1I7PA 3TR0A 1AKMA 2FPIA 4ESVA 1E5VA 1UBGA 1I8DA 4G63A 3RFTA 4Q7KA 3PHCA 3E20A 1V7CA 3LWNA 1TKCA 3L7IA 2PSEA 3EEIA 3LWDA 4MVWA 5IUKC 3JQPA 2CF4A 3RFXA 1GZ6A 1U0NA 3LW8A 3ESAA 4EA6A 1XZIA 1L6RA 2J1LA 3A6PC 1GN9A 2EIXA 1XKQA 1TW3A 4XJVA 3VHXA 3PC8A 1LEHA 4KR7A 3DO5A 2GH1A 3QWAA 2IU4A 4M55A 4Q3BA 3HXOA 3PGJA 2A1UA 2PZ8A 1SKMA 5L9AA 4B2PA 2C5FA 2QZ9A 4Q6BA 5DRTA 4KOAA 1SC3A 1ZJZA 4U4AA 2C58A 2E5LB 3KZNA 1Z88A 1KZ7B 5TARA 2VDPB 2WSSA 3OLYA 4HIZA 2PMBA 3QVSA 3KFXA 4FI3F 4M0UA 1OROA 4O63O 4W5JA 1ZN8A 3EHDA 3H2YA 2P91A 4KN8A 5H81A 3RJZA 4DDHA 5JOQA 1A77A 1WUHS 4FFBB 1YR7A 2L17A 4EY7A 1VE3A 2SNIE 2HJSA 2VJAA 4IRMA 4AWXA 5C8XA 1IN6A 1WXFA 1VI5A 1C3EA 1XN1A 3R4VA 3SZOA 2MCFA 1IHYA 1P75A 4A1OA 4DUZB 1NW4A 1N5OX 3N6VA 4KQFA 3K5WA 4AG3A 5EWJB 4EG8A 3VYWA 4G65A 2ZUSA 1AVTA 3IO5A 3LQQA 4WKOA 4BVLA 3W4KA 4DLVA 4OQYA 5MGBA 4NENA 2J31A 4QGBA 5DCLA 2JGKA 4EI8A 3U13A 2C4KA 5COAA 2YYAA 2CZQA 5K5EA 3NDBB 4PSAA 2DHDA 1BCRA 1ZNYA 3OPNA 4RADA 4W1QA 1NYTA 5BYBA 3ETEA 3RJMA 2BGRA 4EFMA 3JZFA 4URXR 4K81B 1ZM4A 3S2GA 3K9QO 4CTNA 4R8KA 3K1TA 4TS3A 4CR7A 5HGXA 3H16A 4GVLA 4YVFA 3IDAA 5H70A 5IM4A 3CX4A 1JU9A 4EJFA 2FMFA 4RTSA 1R6DA 4QSHA 5KNDA 4ZI7B 1MV5A 2CV0A 1NZDA 4AKTA 2BP7A 1SNYA 4W5OA 3D1JA 1JHYA 1KJWA 3WL4A 5ESRA 3RIXA 2YFKA 3C3AA 3PYMA 1Z0IA 3EWNA 4H2DA 1JV2B 2K2WA 1MC5A 4EF4A 5A4DA 3BXFA 5KREA 3QTBA 4EX7A 1TA9A 2AXPA 3HBAA 1LDMA 4IBOA 3AT1A 4RAQA 5E6SB 5E3IA 1NJ1A 3H4MA 4BN5A 1JEDA 3RF7A 1LDBA 3MB5A 5DI9A 1MTZA 4TV8F 5DTEA 1EFKA 2IYYA 1MIOB 3P9IA 5GIOE 1Q11A 2QLLA 2FK7A 3GJ5A 4HO1X 3P8ZA 1L1RA 2DBZA 2CXQA 5H8WA 1H65A 5FWYA 5L6LB 1II0A 1XLUA 1MB4A 1MXFA 2FR1A 3LPLA 4RA6B 2BYTA 5KYUA 2DC1A 1GCAA 4OMDA 3RBZA 3A9CA 3DQPA 1F14A 1ULTA 5FADA 3HV2A 4A9AA 1O9GA 1QQ5A 3HCCA 1J2EA 1CK4A 5BNTA 1YE3A 3ONEA 2FW6A 3FSRA 3T15A 3OJXA 1N2GA 3VVLA 4RPBA 2F1KA 1Y48E 1L4UA 1OZHA 5LQRA 5LXTB 1TAUA 3HY4A 1N8KA 4J0QA 1ZMRA 2YHSA 2Z3ZA 1KJIA 3D8BA 3L8HA 3SJBA 4FHZA 1K27A 4OFWA 3ZV5A 5ICCA 1A27A 1IPHA 3NOVA 1AQNA 3ZJUA 1XHEA 2HJVA 4MDHA 2VDWB 1XKXA 4RMNA 2E0IA 1NYQA 1X42A 5ADHA 1QYVA 3QZUA 4LNHA 4KFCA 1Q1AA 2Q2OA 3DEFA 3EDYA 5HDQA 4B76A 2FPMA 1NVEA 1BWSA 1F12A 2PWZA 4A15A 4POAA 3ROEA 3TOZA 2I8AA 1AHIA 3ELDA 3KE9A 2AS0A 4MKFA 1BA2A 4OUDA 3OHSX 2V97A 4LYFA 3NE5B 4OH1A 4PBTA 1JQ5A 5MN4A 2AUNA 4F4HA 1R18A 4PXAA 3DFUA 4YAJA 5CG1A 1M2JA 3LHFA 4G8JA 4QQFA 2AW3A 3VDRA 4LOLA 4DUGA 1VQLB 1IZ9A 4LVCA 3WMWA 1G2IA 2BCGY 2IOFA 4TTAA 5JWOA 3FI9A 4LJRA 5C7OO 5HMMA 4AJPA 4Z4FA 4C76A 4XVHA 3GJ7A 3QOXA 2GDZA 3ECCA 5LLSA 3SMQA 3V7UA 4GKBA 4OHYA 3Q38A 2C4WA 3MWDB 2AUMA 3DGEC 3T4PA 2OGTA 3CF2A 1T0HB 1F51E 3B9QA 3O3NB 3QKWA 2XZLA 1FJHA 1UODA 1KI3A 2MSDB 3NBKA 1FEZA 1GZSA 4HDQB 4IMJB 2QD3A 3M49A 3F8TA 1R0BA 1AURA 4I1OA 1AH2A 1TT5A 1WUTA 2ZPAA 4TTJA 4LZPA 3IH5A 1G7CA 1HC7A 4P5DA 4C0LA 3AVOA 1ZOIA 1M76A 2IRWA 1FDUA 3GT3A 5ECWA 3CH7A 5DZSA 2ZWPA 3F5FA 5B58C 1UINA 3CUSA 4BEVA 2JH9A 2EP5A 3PP8A 1CEQA 3ZPNA 3IPAA 4ZP1A 1UZLA 2A0UA 2QAIA 7ADHA 5L95A 4XN3A 1RCUA 3O8DA 1KDTA 3P2IA 2H9YA 1JR6A 2B4KA 4OFBA 5AVUA 2AOWA 3A8KA 4BFWA 2OO5C 5BT9A 2EKBA 2AQHA 1NRKA 2JRCA 3LQ2A 4DBZA 2J4CA 3ICPA 1E0KA 2DF8A 1KU6A 1TVEA 1XEXA 5HCNA 4C7BA 1VMIA 1Q0TA 4EYKA 2C1XA 1SVSA 3PENA 4MB0A 4FIZA 1JJIA 1VA4A 1N77A 1A4UA 3THYA 4P36A 2D3NA 4NC9A 5BRNA 2CMFA 2EWMA 3HKDB 4UTNA 3O1JC 2P1DA 2YBDA 3CR7A 1A7UA 2GCOA 2Q3CA 1DLIA 2VQDA 3PNYA 4TQ9A 5DWVA 4DMCA 3QE2A 5K3BA 2B8EA 3E1SA 1Z0KA 4TMTA 4HNQA 5DBIA 3F2VA 5BURA 1MUUA 5SZIA 1JJFA 5JATA 4GYKA 1LTQA 4K9PA 4FPXA 4UEOA 1OIXA 2QMZA 1H5QA 1Q15A 1UAGA 2ADOA 2QVLA 4YFYA 3OC0A 4Y6SA 4BO3A 3CX6A 4ENUA 3V4RA 4JITA 4Z4EA 4RL4A 4OQQA 5AFSA 2YXNA 2YHIB 1PJ7A 1JIVA 1KH2A 4XJSA 5PGMA 4AMYA 3K9HA 1S8OA 4C4OA 2Q4BA 4DHWA 5KWEA 2B0CA 3V7AA 2YC2C 1WSWA 3V8BA 1DO2A 4ZI7A 2AWOA 2LDBA 2ZB4A 2AFHB 4PO9A 4Q3KA 3WWCA 1VHLA 2BFEA 2Q28A 2AFIA 2FRVA 2FZVA 1TQHA 2JVKA 3GARA 3JYPA 3KWJA 4IOMA 4NOLA 2ECOA 1ESDA 4WIAA 3CPHA 1DBVO 4TRNA 1E8MA 3NYWA 3FKJA 3MSCA 3AQIA 4PM4A 3OFKA 2JGIA 1ZUHA 3INNA 2XYRA 2AA3A 4DL9A 4XOIA 4RD3A 3ZD6A 4BOYA 1UFOA 2Z56A 4X45A 5D6NA 2ZXEA 4CM3A 3A3PA 3RIYA 1ZAKA 3ZE9A 1Y3DE 1TT5B 3TVTA 1I7LA 4F8EA 3ISJA 2ZRFA 1EP1B 4MW5A 5A71A 1L5HA 1A71A 2OZPA 1CVRA 3M6VA 3PR1A 4FGWA 4HAVA 3LFUA 2NTYC 2FH5B 1ES9A 3ROPA 4HYTA 4LYDA 4JDUA 2JAWA 5LMNB 4NPCA 2AWNA 2F4VB 4XCQA 3IAFA 2PX8A 1BDMA 3FCXA 3STUA 1O96A 5ALIA 4DA8A 3ND5A 1Z0UA 1TJPB 4UOZA 2OY0A 1SCBA 5HNKA 3NHAA 3N2NA 3UHFA 1K5DA 1JFFB 1RWXA 2JIBA 1J56A 3IRVA 4IRUB 5AVXA 3GLIE 4MUEA 4JFRA 3SX0A 3CT4A 2HD4A 5LOVB 1LSOA 1SK9A 1N6IA 4CCAA 1RRKA 2VC2B 1ZCFA 2D5CA 1IMJA 1P39A 4QBFA 1L7NA 3SEZA 4YMVA 1DBPA 2QL6A 4G0XA 3SC2B 3ZDBA 1ENZA 4NH4A 4S2EA 4DGQA 4I1PA 1PIWA 1YUMA 2NGRA 2XT0A 2OO5A 3C3KA 1UMBB 5ALZA 4DYHA 4PIMA 3SXUB 4UTRA 3O83A 4ZQIA 1JXOA 1DRWA 3IMEA 3CZCA 3K9GA 4EQ6A 2DHRA 2DG2A 1NG9A 4A6EA 2EZUA 1N7IA 4AQYB 5BSUA 4INOA 2OHFA 4HMQA 2H5JA 3HBJA 4GRAA 3MPOA 1QU3A 3KPWA 4N6OA 3Q4GA 2PY6A 3A3GA 1YKSA 1G5HA 5HTKA 5LYJA 1M66A 1YNOA 2PD3A 4G84A 4J1NA 4LRYA 4IZOA 3H1GA 3WKEA 3V42A 4G4SP 4YJFA 2LCIA 2C5BA 2DTDA 3EIHA 3BULA 3JALB 3MQ2A 3OZEA 4HGOA 2Q1XA 1YC5A 2CXOA 2IX3A 1A9SA 1KJYA 1XZBA 5KS2A 1R15A 4IXDA 1KZ9A 1VC2A 2JHAA 1C3XA 1RT9A 1T0PA 2V7GA 2YFQA 3JS5A 3LIPA 4FEYA 2C20A 3Q8KA 3L7JA 4ZEXA 1E2EA 2BGTA 4NBUA 4TLAA 4XUGB 3BL6A 4E2YA 3OCWA 2QVZX 1BD4A 3PPIA 1TL7C 1UC4B 1SUCA 4F3CA 4OM7A 3OURA 5EWMA 3B1XA 2N47A 1JEAA 2WHPA 4HTFA 3ZDCA 2GK3A 3DHNA 2GD1O 4B6GA 2DFKB 1TCBA 5C8YA 4LMBA 3NIWA 1JYFA 3BQ9A 4KXFB 1K1EA 2WT8A 1TW2A 2PTHA 1K08A 1SVKA 1LQ2A 2AR7A 2OZKA 3L9XA 4EGQA 1W49A 4GUAA 3CC8A 4B8ZA 2IIBA 2IT1A 3PD7A 4V0LA 5JS1A 1KYQA 1FU4A 1HNXB 3NAQA 2FSVC 4AVZA 2BRUA 3RFVA 1J07A 2ATCA 3ZDRA 4YI5A 5I4IA 1YMQA 2YHUA 4M22A 2W6ID 3NC1C 3PEEA 3TOCA 4PEVA 5IN4A 4G85A 1QGUB 1UOPA 2QRVA 4FOPA 3MCWA 1P81A 3WGHA 5JI3E 3DE3X 3B82A 1C7QA 2UYOA 1KC1A 1JXAA 2VFAA 2XWBF 1IPEA 3DPSA 1FMCA 1NP6A 4HRXA 3IP7A 3MAGA 1P1CA 4OHWA 3QVWA 4Y1EA 3ROFA 1GGFA 4CTJA 3ANYB 4FW8A 2ZZKA 5I7FA 5KYWA 2PMWB 1CUSA 5EIWA 2HLNA 4DR5B 1HMYA 1Y6FA 2KJQA 5SV2A 4GGPA 7MDHA 1MOPA 3O4IA 4B4WA 3QNWA 4RFSA 4NENB 4H0CA 4X71A 5ULLA 3SBXA 3E3MA 1C9MA 1T2FA 5AW4A 3JR3A 1NQWA 3HV0A 1WULS 3AZPA 1AS2A 1UPTA 2JKZA 1N5JA 1TIKA 1TMGE 3L93A 2Q3LA 4NV3A 4XEHA 2OQRA 5AVSA 3E9EA 4AJ9A 3FGNA 3BMCB 3LLCA 3NGMA 5ABPA 4ZOQI 3GCWA 9LDTA 5HW0A 4YPOA 4XN0A 2PLWA 3DBRB 3DG9A 3KTFA 3OJFA 1CS0A 3T4XA 2D0DA 3CC4B 4TM8A 1EUYA 2D9RA 2JANA 3KOWA 5EVJA 2PT6A 3FSEA 4K88A 4FWTA 3UXYA 4EPRA 1RHMA 1YB1A 1YAHA 5FB3A 4DRZA 3AFIA 1J20A 2GJKA 1CY7A 2HCJB 4LRUA 4OQXA 1Z75A 3UJBA 5TQ2B 5KU1A 2AXNA 4QJIA 2YZ7A 1JQBA 2C5AA 2OCKA 3HB5X 1QZXA 3M2PA 2Q5OA 4WQMA 2WYHA 3OFJA 4YR7A 3T61A 4MV3A 4EA7A 3W1EA 3AL0C 5FTWA 4RDIA 4MHSA 4YJ2A 1FFSA 4MV0A 2ZGVA 3PQ4A 2F48A 3MJHA 1ENOA 3P4YA 1RM5A 3K32A 4BKPA 4C4SA 2V4DA 1Q95A 1AQ6A 1E3WB 1N2SA 3OOJA 1G20A 3WHIA 1PDWA 2JLCA 5F4JA 4R40A 5EZYB 3U48A 3IX7A 4BVKA 1PJZA 4P9NA 3D4IA 2FDXA 3WAJA 4XKVA 1BMDA 3IA2A 2F2TA 1X8XA 3SBDA 4B3SB 1CUBA 2FMKA 4E5YA 4X20B 4DR7B 4FCTA 1MDFA 2HN9A 3CGWA 1M3SA 1I4OA 2X19A 3TQRA 4NBVA 3BVPA 3SZRA 3UTCA 3EXFA 2FHPA 3B2EA 2ESRA 3OTIA 3N7UA 1V8ZA 1J8YF 3V1UA 5JAQA 3EDCA 4IDQA 4RHFA 1A96A 2B92A 1TF2A 1P8AA 2BH9A 2XBUA 3HCWA 2QM8A 2IW1A 5HSGA 2EAUA 2PWYA 1Q2UA 1X70A 1VHDA 4L9RA 1C2TA 3EUFA 4EYQA 2P2SA 4C43A 4YP7A 1LJLA 2BDUA 2CBZA 3QXCA 4UUQA 4MPDA 3UMYA 3QVTA 2PGOA 4IDAA 1ZVJA 3M5WA 1WR8A 5F1YA 3DOOA 5LR6A 2OM6A 3ANXA 2QU7A 1XQ1A 3UICA 4GOJA 1Z62A 1ULHA 1XZMA 2P35A 1R5NA 4M1ZA 4IHKA 1R6XA 1W76A 1QGAA 1ZD3A 3WDKA 2GEUA 4I46A 1WZ2A 4MOWA 5AKYA 5F5NA 1LJ8A 1XTVA 2D2EA 4OHVA 4EYGA 4IIYA 4LC1A 5DM2A 5CX1A 3PVSA 2C7VA 3LXRA 1UAYA 3H86A 4YK7A 4CTKA 1ZICA 5CDYA 3RS0A 4LFBB 4DM4A 5AW8A 3JVEA 2BD0A 4JD5A 5C80A 3TQSA 1GSIA 2GM9A 2XVYA 1UD5A 2A5GA 3WIEA 3CH5A 4K9NA 4RPLA 3WLSA 2ZJYA 3Q9NA 1IBLB 4W4TA 3H0CA 1HYBA 1F2VA 4Q02A 1J25A 4UVGA 3U56A 3PTAA 1X1EA 2RH9B 1QE3A 3BH7A 4R84A 4Z4QA 1CXZA 3JQDA 1SBHA 1MAHA 2PYZA 3N8DA 3OZXA 5GY7A 3U62A 3W3ZB 1EX1A 4A8TA 3HSYA 4DCMA 3T51B 2VNIA 3IJ5A 4EMBA 3FCYA 1JEOA 3ZHSA 1AC5A 1GFIA 3GROA 2ZIFA 3F78A 2ATXA 2PZAA 3QOYA 1N0UA 1G2QA 3LX5A 4ER0A 2R8BA 1Q92A 1XZNA 4ZV9A 2QN7A 1L4YA 2Z6VA 3PU6A 1W4ZA 1KY5A 1ZESA 2F8MA 5D01A 5ALTA 4D57A 5CU7A 3HR4A 2H4JA 2R11A 2VSFA 4LOKA 4OL9A 4NBKA 4UM9D 1TI7A 3QF4B 1VJGA 1Z4KA 1VLZA 3T5AA 1JJAA 2FZLA 5TX7A 1DJOA 4KXUA 2YOHA 3NJ8A 2TYSB 4P33A 2CJFA 3KSAC 3HI4A 2IVFA 2ZS8A 4MLCA 1PR2A 3CJQA 3JQQA 3BWCA 3IUPA 4IIUA 1FDTA 1UD6A 3QEMB 3CPSA 4UULA 4AZ0A 3GOHA 4KE6A 1ZNWA 4RY9A 4XB1A 1U8XX 3EZ2A 1O97D 4E94A 4KVAA 1Z73A 4HH3C 1KVSA 4YRSA 3N1UA 2QG4A 3ETHA 2OFOA 1Q16A 2R86A 2YWEA 2C2ZA 3GUYA 3R7BA 2D0IA 1PFWA 4A36A 3U0VA 2JZNA 3HQ4O 3O2NA 3GLTA 2W2TA 1GGJA 3I04M 2QXYA 1XTQA 2WB4A 1M67A 2ZJ5A 3LQYA 2VPWA 1SELA 3PTZA 1XG5A 4GM0A 3T1TA 4GI2A 1WIWA 3C70A 4XWOA 3BRCA 3VI4B 5B3AA 4BTLA 9MHTA 1ISGA 1PR9A 1RLJA 3AKYA 5C7IO 2JLUA 1GIAA 3BWXA 3M5PA 2N75A 4LIPD 4B45A 4KQMA 4PZLA 1PQUA 3F4BA 3CZQA 4CF6A 1LDNA 4I50A 3RUPA 3UK2A 4US2R 1JEJA 2FSHA 4J4BA 1QFJA 4P3YA 4KACA 3RFFA 3AJAA 5JZVA 4Z7OB 4GMKA 3DNMA 5CVUA 4UDYX 4QUGA 3ROGA 2HJWA 4GI3A 3EX7C 1Z74A 5CG2A 1MP0A 2PUJA 2PYDA 4XDHA 3TNYA 4BFVA 2CSXA 2XITA 4PHTA 2ZTVA 1SKYB 3KZXA 2EQ5A 3A3YA 3CG0A 1L5NA 1KL7A 1L4MA 3SXUA 3ZBPA 5UKDA 4DS3A 5J2TA 5E8JA 2SICE 2DFNA 4L8LA 1NC1A 1W73A 4C4TA 1M6EX 2DKOA 3CX8A 3OE7D 4GYJA 3RYHB 1R5JA 3G23A 5IAJA 4DDMA 5J1SB 4UKDA 3MWYW 3F3SA 5EHQA 3ZVLA 1M2OB 4C0HA 3O26A 3TLEA 2WINI 3QYFA 4KC0A 3KYDB 1XZPA 3EHEA 3NAMA 2ZTUA 1RP7A 3LGXA 4JVOA 2FEPA 2X5XA 3RT1A 2FNAA 2GCNA 4RVGA 3UAVA 1RWPA 4E11A 4EABA 3ZOKA 3LHSA 3WKBA 3ELUA 2IHYA 3EPJA 4E2ZA 4M1TA 4LY0A 3U5TA 3LY8A 4X1YB 5KAMA 4YELA 4R2WA 1UIRA 3Q3CA 3OBBA 2J48A 4N0QA 1QUEA 2PGXA 2QMOA 4TYPA 3AUXA 2IV7A 4JMLA 4WADA 3TIXB 2WBLC 1C0PA 4XX0B 2GCOB 4JQYA 1WB5A 1C1HA 3VYRB 3AERA 4PSVA 2Q0QA 5I6DA 4IS3A 2XEDA 1TUEA 3WGYA 4BC0A 4ZN6A 1X7XB 3ASQA 3EPHA 1HV8A 1ND6A 4LA4A 2Z95A 5KSYA 1ISRA 3K4HA 1WDKA 4MWGA 1K0FA 1X94A 2QMYA 4XUDA 5DX8A 4RETA 2K7ZA 1KVRA 4EHJA 2IGTA 2JA2A 4EJSB 3OKCA 3FYHA 4HN9A 4HATA 4BVFA 4BEWA 5JQGF 1BMFA 3K0KA 5SZKB 5CJPA 1L5SA 4U02A 5AHXA 4UVHA 1P33A 2L69A 4XIGS 3U6BA 4LV5B 5KKNB 1H22A 3F5DA 5EJFA 3G0GA 5CX4A 3S8YA 1L7PA 4RV9A 2RD2A 1A1VA 5KOYA 3N5KA 4RM2A 2O1WA 2GS9A 4OLAA 4FOLA 1BG6A 3FPCA 1OOEA 2XOXA 1QLHA 3VNAA 3ZLTA 4B5KA 4C88A 5CA1B 3T7EA 1SOAA 4OI1A 5BUSA 3RYCA 1AUQA 4PCLA 4QPJC 2JZOA 4WFIA 3EF1A 1ULUA 5JQGA 3FHJA 4RKWA 3SSAA 1L5YA 1YIDA 2DAPA 3W3AA 4DLWA 5JNUA 1GADO 3KKPA 4OGLA 4ZWNA 4Y0AA 2X6RA 5F23A 3PC7A 1XTZA 2PU7A 1BH6A 1QE5A 3EFOB 4KBGA 3CP8A 4LXYA 2BLNA 4MGKR 4WLFA 3UGKA 1V9CA 4EHAA 1PEAA 1TUGA 3A7DA 2J08A 2RGBA 1FE8A 4XSHA 3O3CA 3HR7A 1TJYA 3MB8A 2O3UA 1C8BA 3ZQKA 1V11A 4YUYA 1F2TB 2JD2A 1QIFA 2OBRA 1IZ7A 1YONA 1QX3A 3A05A 5EUMA 4BC1A 7YASA 1Y8ZA 1IBMB 2I22A 4MTCA 3ILSA 2BR4A 4ZU3A 1ZIYA 3AUYA 3U7QB 3ENQA 3RTEA 3GNQA 5KOIA 4WZAA 1IHPA 4W5QA 3MLBA 3PC8C 1B00A 2F1RA 2IODA 2GAIA 2WOOA 4UUBA 1YIAA 3UMVA 2DUMA 2FWNA 3KYBA 5AVRA 3DW1X 3BF7A 1JAYA 4O5OA 2OAEA 1HZJA 4TVOA 4F56A 4UEKA 1F1BA 4WPGA 4X1OA 3U4DA 1V16B 1V9LA 1KR2A 5E0KB 5JS6A 4MARA 4GPZA 2A9KA 5EWLB 2QG9A 4QUZA 1O3YA 4MIOA 4CKEA 3FDZB 3ZLVA 4RA9A 1S0UA 2NSLA 1DKPA 4ZQBA 2HQRA 4OJKA 2WRZA 4WXHA 2YXLA 2WF6A 3NDPA 3DV0A 5F9MA 1GNQA 1NLUA 2IS4A 3KSZO 2QAGA 4ZAYA 3T0GA 2R7MA 5IVIA 3INGA 3GNLA 4D0NA 2QJRA 4F8YA 2NYAA 1P72A 2O05A 2RHLA 3HDHA 1XZEA 3VVCA 4B0PA 1H9BA 1XP5A 2X9NA 3SQDA 1QO9A 2QN9A 3DLCA 3KQYA 4DSZA 3OT4A 1PZGA 4FHCA 5CYFA 1OLUB 2HLPA 1WKBA 1G66A 1T24A 2XEXA 4AB1A 4MWTA 4TYYA 5HP4A 1GZ4A 3EXG2 5EPUA 3UCFA 4LX8A 1OU4A 4LRSB 4C4YA 1SXJA 1HURA 1N2CB 2HXSA 5AKGA 1WNFA 3VV3A 1CYEA 1L1FA 5KU7A 3BN3A 5A4JA 2UV8A 3HU5A 3R76A 2PL1A 1SKYE 4BATA 3MUNA 3I01A 4FR2A 4EB8A 3RFCA 1RLTA 2PKCA 1E6MA 1KK2A 3CD6B 2IUFA 4G0PA 3LJKA 3K71B 5ESXA 1T8TA 2FZGA 1LPBB 3F3MA 5BWMA 1NN0A 1UJ2A 1X3SA 3OOHA 4D9GA 2O3SA 2Y1CA 4MR9B 4X41A 2GPNA 1PNVA 2FZWA 3IUQA 3L7BA 2QG6A 1E7SA 4FX2A 4OHCA 1YHQB 4FYVA 2PUFA 2X0NA 5G40A 7AT1A 1YS6A 1VLMA 2ZSIA 5DLPA 3OCYA 2R4UA 3BK2A 3RVSA 3T5MA 1JJBA 1K66A 4KREA 1CR2A 1OT3A 1X2EA 3EDQA 5DN6D 2W6CX 4R3WA 4P3IA 1O6ZA 4EUNA 1WXEA 4EY8A 2YHBA 2H3HA 4BV9A 4MYUA 5LIPA 3FM9A 1UKBA 1H2XA 2P3QA 2PS9A 1CP3A 3TW6A 4ZO7A 4D8VA 4QTUB 5B2ZA 2XTMA