2C4TA

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with an inhibitor, an analogue of s- adenosyl methionine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
291
structure length
291
Chain Sequence
b'RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
publication title Substrates and Inhibitors of the Fluorinase from Streptomyces Cattleya
rcsb
source organism Streptomyces cattleya
molecule tags Transferase
total genus 74
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2005-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2c4tA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2c4tA01
2F4NA 2V7WA 5B6IA 2Q6IA 2V7VA 2Q6OA 2CBXA 2V7XA 2C4TA 1WU8A 2Q6KA 2WR8A 2C5BA 2C5HA 2CW5A 2ZBVA 2V7TA 1RQPA 2ZBUA 2Q6LA 2CC2A 5FIUA 1RQRA 5LMZA 2C2WA 4CQJA 2V7UA 2C4UA
chains in the Genus database with same CATH superfamily
4QDKA 1GKKA 4Q1CA 4UC0A 1M5UA 4PPYA 3L1UA 2DPGA 2NLOA 4N0MA 2FP4B 2QQ0A 3G2OA 5BO5A 3V1MA 2HFKA 2F1JA 1PNQA 1O95D 1QTIA 1YOVA 2JH8A 3G3EA 4F6RA 1YF3A 3E84A 5MDHA 5JCPA 1O6FA 5EY5B 1HNNA 5AHRA 2QJWA 3PP8A 2IOYA 4PQFA 4CMJA 1E8MA 4HB0A 4KQCA 2VDLB 1R12A 3AP1A 5AIBA 5BT8A 5LMZA 3P27A 3DEKA 3EXHA 4R7TA 4O4JF 1T3LA 3V4ZA 2QT0A 1BS9A 3GJYA 4F5WA 5K3DA 2O57A 3FUWA 3OZRA 1IPFA 3LCRA 3Q8WA 2GA8A 4RY8A 5IUKC 3JAWB 3UATA 3ULKA 4JYBA 4Y7CA 4NS4A 3IKTA 3DR5A 1WBBA 2DUUA 3S5JA 4LNAA 2H57A 3PGMA 1TM1E 1SKYB 5BMOA 1NI5A 1GTL1 2QAGA 3GVKA 3TOXA 3GLIE 1VHTA 2ZRJA 1ZVQA 1N9KA 4IGIA 1ZQ1A 1XK7A 1AA9A 4JD5A 1JF8A 1Y7LA 3SKBA 1WSRA 2V7EA 4WECA 1RXVA 1MV5A 2JFYA 4QT0A 3LTNC 4C2BA 1N2HA 5TPWB 4ND3A 4KWHA 1OB2A 1X1CA 2UYCA 2OZEA 3QV2A 4ZV7A 3HLKA 1SCKA 3H8WA 4LJKA 5AXAA 4YWHA 1NHGA 4YAWA 1BQ3A 2YXNA 4WJKB 1PZFA 3VHRA 1CZUA 9GPBA 1W47A 1ONSA 2AG6A 5DXJA 3CRMA 3TUIC 3GAFA 1GG8A 4KO1S 4HMPA 3NHWA 3LO8A 3A2MA 1PNVA 4DZZA 4OATA 3QTBA 4I55B 1IEWA 3WHIA 2P2ZA 2QXTA 3VPGA 3QLVA 2IIQA 3ROMA 4PTZA 5KB3A 4IG9A 2MSCB 3QF4A 4L3OA 3STYA 2XMCA 5K3AA 3A2KA 2ZE8A 2VXBA 3IUMA 2CNOA 1DUSA 3EVAA 1WD7A 4DIUA 1WF6A 3UHAA 3OEHA 5ESRA 3SN6A 3ZGVA 2X7HA 1R5OA 2Z9BA 2AKAB 3ASUA 4HTAA 4JV5B 3HVIA 1ODLA 3BS4A 4COOA 2FUKA 4BO0A 1JSCA 1XAGA 5E9QA 2MYPA 1C2YA 4AU1A 5AOCA 4YV7A 2ECKA 2O4UX 4OPSA 3OE7D 4M1ZA 2VAVA 4X91A 4TV9A 3WYGA 2V7UA 4B74A 4K6KA 5C1IA 3KQOA 1MD9A 2TYSB 3OAAD 4F4JA 4WZTA 1AK1A 3IE0A 4X8HA 4JL8A 2HU7A 2PYIA 3GJ6A 2DFVA 4G67A 2Q9UA 2I4NA 1YBHA 4O1IA 4JBWA 4RTSA 4DIDA 4OMDA 1XJ0A 3DCIA 1BQEA 1O9HA 1P3Y1 1X1DA 2A9FA 2QZ4A 3B9PA 4MRRA 5ED0A 2W2PA 3DAOA 4YDHB 4C6TB 1QKIA 1OFTA 3EC7A 3D26A 3OOHA 2VHXA 1ZS9A 4YJ2B 5FWDA 2BI4A 5L53A 2FVXA 2BMJA 4HZUA 2UZ4A 4D0LB 4DUZB 1KY4A 1K3UB 1Z56C 5KUTA 2W0SA 3DCNA 2J4FA 3IAFA 3K70C 3B48A 1A82A 4OLHA 5BURA 4JXKA 2IWRA 2DB3A 5PNTA 5K3BA 1UOEA 4KAXA 3AFGA 1QAQA 2KYRA 2BFPA 3IFSA 2IXEA 4RQTA 5BOVA 4TN1A 4B47A 4P5EA 4WUTA 1RYEA 1E1QA 1TYBE 3JQEA 1NMQA 2I55A 1X2BA 4BVLA 4PC3A 1PGOA 2DUMA 2DJIA 1V1RA 3FTQA 4RS3A 5JAHA 2O7SA 2V74B 1OBVA 2XYRA 4KXFB 1SCNE 3H1BA 2BEWA 2UYYA 2I1VB 1G3IA 4KO4S 3LUDA 1PVOA 1EUCA 1WZEA 1KAOA 3BCDA 4LRXA 3I9FA 3BG5A 4WBXC 5DV9A 2BH2A 4UVGA 1NBOA 5AXCA 4FMCB 2OO5A 4U0JA 1WUIS 2GZ2A 2QMEA 4MQUA 5TQ2B 3OZDA 3AF1A 3WSWA 2A14A 1T4DA 4Y9RA 5CAEB 4XTCS 1FTGA 1EWRA 5AVWA 3IKLA 3OIUA 3PDJA 4CU2A 2HQOA 5GTDA 1TEZA 3U31A 5F4MA 5JXGA 4DOMA 2V5AA 5JFGA 3O8CA 3JQ6A 2W0MA 2VOJA 4HXEB 3CWCA 4B40A 2F3UA 3D5EA 4NYIQ 2VDWB 1HA3A 4TMKA 4E33A 1I2CA 1HK7A 3LECA 4L7QA 3WIUA 3K73O 1BMQA 5EP3A 2IGBA 5MGBA 1TC2A 1WKVA 2C2XA 4XI9A 3UFBA 4HHEA 4KPGA 1T5SA 2BUBA 5JG7A 4BNJA 3GDGA 2ZVJA 3KHUA 4KNYA 1FXUA 2ONKA 3HC7A 4JUCA 3CPHA 3A10A 3G2LA 3WNCA 2PZLA 3M7IA 4LJSA 4YJ3B 4IUBS 1PJ6A 2G63A 1W8IA 3WB0A 4EHHA 5GJBA 1K4KA 2YIDA 4RF5A 3M1IA 3OA2A 4K6CA 1Y1SA 4PZCA 1JZQA 4ZAXA 3SX4A 5A5FA 1PR0A 2ZIEA 1L7EA 3DO8A 3RW9A 4JJEA 4N0DA 1TIBA 3SKYA 3QPAA 3RVJA 2C7VA 2BSAA 2HU8A 4HKTA 2O54A 3LLVA 4O2AB 3QX9A 2POQX 1MH1A 3B85A 4GE3A 4L7VA 4C21A 1HZJA 3OT5A 1N7IA 4X92A 5AXBA 5LFAA 3GU3A 4YP7A 1E2PA 2F3PA 4XAQA 3WFJA 4DDMA 1SIUA 3N59A 5KVSA 4RXUA 1GA6A 2OLEA 3Q38A 1H0KA 2RHCA 1Q3HA 1GXSB 1PQ4A 2O3SA 2Y6UA 3OO1A 1VA5A 1Y0BA 2QB5A 3OEEA 4Y0NA 3HRKA 2AH5A 2VHUA 3KETA 2FWNA 2I2CA 1NATA 3FB1A 2JAWA 5E6UB 1K63A 1H1TA 4A0HA 2C2YA 2UDPA 1G21A 1L5SA 3DMNA 1DT3A 2OBXA 4GM4A 1Z8DA 5JSZB 3WNQA 2P5TB 3ITKA 1SCUA 3BSWA 3TLZA 3RKRA 1SVLA 3UCEA 4ZOEA 2L19A 3VVCA 7REQA 5HFNA 3NVDA 3O73A 3OEHD 1E99A 2HNKA 2A7XA 1KBQA 2QDKA 2CXQA 2YASA 4NJEA 4PFKA 1G1MA 5FFFA 1HDZA 1NY5A 3WZMA 4XN0A 5CT8A 2F3TA 1JJ2B 3O4JA 4FDVA 1U9JA 5IVIA 2B7LA 4BFYA 4BNWA 2Z0MA 5G2OA 2VWQA 4CNBA 5IAAA 5LN1A 2JD1A 2AL7A 5F2KA 1O08A 3GWZA 3G2IA 3HP1A 3QW2A 5CJPA 2OWDA 5WRFA 1IUOA 4OSPA 4LSMA 5JR3A 1J8QA 1LDGA 1QBKC 4N9WA 4EKNB 1XUOA 1R5JA 1Y8CA 2DMRA 2J67A 4LOIA 3CG0A 2V9CA 3QEAZ 1KQFA 1T5HX 2AR0A 1Z7YA 2HJRA 3RIGA 3THSA 3K70B 3FNHA 4RORA 2WYRA 2RH8A 3DFFA 1NOIA 3PC2A 1UODA 2C00A 4YMWA 1L5HB 2YUTA 4KYIB 2FSHA 3Q7TA 1XRRA 1SIBE 2CYCA 1CUFA 3H11A 5AW2A 3S2SA 3ZGYA 1KP2A 1TTQB 1MXHA 1E5TA 2Y9MB 5HZBA 3PNSA 4XQ0A 3WYNA 2H2DA 4E4TA 2X14A 3TQTA 2AEMA 5TX7A 1PJRA 1SR8A 4HMQA 1VRWA 3MB5A 1DAFA 3GGDA 1KMQA 5C3UA 4EEXA 1MCZA 4KRXA 4U2BA 4UPDA 2PIDA 1E1QD 1U0LA 2V0GA 1EQ2A 3HU5A 3GCGA 2MYTA 3SVTA 2QUAA 1EESA 1UD5A 3IOBA 1H2ZA 1N05A 1ULZA 4UVDA 4I19A 5JLAA 3RSFA 4X7PA 2IOHA 2II6A 2GCPA 3HY6A 3AESA 4B4WA 3ZH2A 1G17A 4L76A 1LCIA 1RJWA 1LB1B 2I7DA 4K81B 4JLOA 4TWJA 3JQ8B 4G24A 4DW8A 3FOEC 2BSQA 4EGJA 4R2IA 3WWEA 1R00A 3N5CA 3UCXA 3PIIA 4ENTA 1JLMA 4QTZA 1A9SA 4Q4CA 1TVKA 2VSNA 4UTVA 3C98A 4BPBA 4B6SA 2BKVA 5LQKA 5J63A 3DTVA 3ZU4A 3TG8A 2P9ZA 3MEQA 3WGHA 3B8EA 2G07A 1G98A 3G1UA 2JFVA 5DTEA 3FCUB 5GY7A 3NHJA 3CCFA 1VZ2A 3VISA 3SS9X 4BZPA 3ZZNA 4EY3A 7AT1A 4C6SA 4YQYA 3CW8X 3IPYA 5A3RA 5GVSA 2XCOA 1Y37A 3AERA 4IDEA 1OLUA 3KJFA 2Q1TA 1CJUC 4EEZA 4ARCA 3CX6A 3DE2X 3R5KA 1CZOA 3O9ZA 3W5UA 3E9DA 2JGRA 5ALLA 2LUOA 3SLRA 5CFRA 4XWGA 4ZO9A 1TQDA 5L4LA 2PL5A 3Q15C 4J4TA 1UZUA 4MX8A 3KT6A 4UNQA 3D4IA 2YCLA 4X65B 1V5EA 1ZO8A 1MVOA 5H70A 4MV4A 5LZ8A 3VI3B 1DC6A 4H31A 3K35A 3ZDQA 1S1MA 4YJHA 4IYRA 4W9NA 4RSRA 1WDTA 3EXFB 3RARA 3IEIA 3MELA 1YB2A 5E3JA 4KQXA 1GKYA 2R00C 3M6MD 4I4IA 4YRCA 1P31A 1WEKA 3I0ZA 3LQ2A 2IIBA 2X1MA 4I5GA 4LDZA 1SC6A 4YAJA 3RI3A 3WLKX 1BW9B 1TIPA 4M99A 1VMEA 4JHLA 2GN9A 3QE2A 4MUEA 2W93A 4MR7A 5ER6A 5T41A 3VO8A 4LMPA 4J16C 4NBLA 3ZCXA 4B6PA 2V4UA 2WE8A 3WAKA 3VTKA 3KQLA 2B8WA 1V8DA 3H5TA 3EF1A 3N58A 3PKZA 5A06A 4NE7A 1CJMA 5EJAA 2JN9A 1N25A 2BGLA 5LBIA 1GYPA 3PGVA 4RBNA 1XQXA 2F4VB 3A1FA 4V0ME 4FGZA 1PKEA 3U4QB 4QUGA 2JD0A 2YMMA 1H2EA 4W8HA 5AIAA 5SV2A 4CL2A 4BRUA 3A6DA 1LV8A 4JCOA 2HJ9A 1FUUA 5FTKA 5IH3A 2C77A 3FDZB 4NAUA 1M2KA 3JAKB 3OEED 3CN9A 4QBIA 4JLVA 2GJ4A 3U0BA 5I47A 3DTNA 3TRFA 1ZIXA 1UDBA 5D86A 2LBPA 3GRKA 2Z04A 2ARKA 3EGDA 1SUCA 4XKVA 2NSLA 4H16A 1P7CA 5D01A 3TKYA 2IZ7A 3Q7RA 4K9MA 2PWZA 4RJJA 1I7QB 2UUCB 1D1PA 3JS5A 5F12A 5KDDA 5CH8A 2ZPAA 3SXUA 1UKZA 3SEQA 4QOFA 1XLTA 1H9BA 2Q2WA 3QG1A 2OD7A 4KQ6A 3PFKA 2OO7A 3FGPA 2FP3A 1F8UA 1DO2A 4U39A 2BF7A 5INTA 2ZDQA 5T4FA 3KQPA 4MW6A 4E31A 3F1LA 3W3AH 2D7JA 3P4YA 4I1YA 4LRUA 2A1UB 3B60A 1P18A 2B4YA 5DKFA 4HNAA 3BWCA 3AKEA 1HLFA 2HHCA 3OT4A 4CM4B 4BQSA 4JX9A 2JGJA 2GBGA 3CB4A 3U3RA 1PR6A 5KNCA 4GKKB 4MRMB 1KFJB 1VDMA 1Q7TA 2OZPA 3VJMA 1FFWA 1NE2A 2QY6A 4HEA1 3GHHA 5GONF 5A4KA 4Q4AA 4P3IA 1Q16A 3AP2A 4POOA 4GBJA 1O03A 2VPQA 3G8AA 3O2NA 4HX2A 4L9SA 1MDFA 4FINA 2PGIA 5KOHA 2ODWA 3AKDA 3UVEA 2P0EA 2GVNA 3CUVA 4U2GA 1JG7A 1U8TA 5FRDA 4PO3X 4QBTA 3BK7A 4YREA 1LWNA 1U9IC 2CHEA 4M53A 3QW4B 1IM5A 4FDUA 5E9WA 3PBKA 4F3TA 1VG1A 1IJFA 1KH2A 3CT4A 1ZUNB 1CUUA 3HM2A 1S3FA 3LZ6A 4WK4B 5CGQB 5F2NA 1BFDA 3GGGA 3NNNA 1JXOA 4Y0AA 2N1MA 3V4FA 4BJ5A 5ISMA 3WRXA 2NV6A 4RKFA 4MB0A 3ASVA 3E9CA 3JQFC 4F2DA 2PRIA 2WVGA 3A6JA 1G7RA 4MAMA 5GAJA 4ZN6A 1GEGA 5AW9A 4TTPA 1TC1A 3FN4A 1LZKA 1VYUA 1XO1A 3LA8A 1E2FA 2WWFA 3QUAA 4UUMA 1ENYA 4G1BA 1VSVA 1O6GA 4DNTB 1LDBA 2PT5A 5EXXA 1KIMA 1NAIA 3F3KA 5DJ5A 2B2XA 3WGIA 4TMFA 3VTZA 2WHPB 1CZRA 2FW8A 1BFKA 1V3VA 2G5PA 3LK6A 1A9TA 1ZH8A 3HP7A 5DYTA 3C4JA 5B1HA 3DOUA 3ZV3A 3ZJ5A 2Q28A 5EEHA 1SXGA 3DTVD 5AI8A 5M7EA 5BSGA 3KSUA 4IL5A 4HYEA 2ZWIA 2ZJ1A 4WZBA 4X7RA 3VZRA 1NQUA 1GU0A 1T8PA 4EELA 2C8LA 3KL2A 1Z0KA 4ZT5A 3V8QA 2WG2A 3R7LA 4DLBA 3A1NA 1UWKA 1JG3A 1GG9A 1WMFA 2CNBA 3MINB 3ON5A 1QB7A 3GFSA 1SZJG 2H4WA 4H59A 2HV8A 2VUTA 2YHBA 4RQUA 1OV4A 4NEQA 5IZCC 1M33A 2GK3A 5JE8A 2R6DA 4XIIA 1MO2A 3OVMA 2VHVA 3A9WA 4GUDA 3WIDA 1NWHA 2NW6A 4BX8A 4D9EA 4AY4A 3QU4A 1X1SA 5J35A 3L9WA 1UXIA 1VC2A 4KR9A 2ASEA 1NBEA 1P7VA 1S2NA 2Q29A 4GI2A 3BBLA 3MLAA 4GU5A 5G53C 1KBZA 2Y1EA 1YJNB 4DJEC 2BFDA 2HO5A 5F21A 3R5TA 4X20B 1QQ5A 4LV5B 4ZXPA 1TF5A 2PDAA 5CFNA 2HDOA 4C2TA 3VPAA 4EI9A 4UM5A 3TOSA 2YL2A 2ZRDA 2QTMA 2C2MA 2ZQYA 1QZZA 2AJBA 1SBTA 2PR2A 5JSUA 4NCIA 1PSWA 1V47A 1A04A 4LTDA 4PZUA 4DA7A 1LRJA 5D00A 3OZTA 2JIMA 1ZITA 1U6JA 1KP9A 4X93A 4ZEWA 3AUTA 4F4DA 4QAQA 2CSUA 5GV8A 2HHJA 3BILA 1KDVA 1R37A 1N33B 2AFIB 3LY9A 3ZR4B 2R1TA 1X1RA 4BYGA 3TIFA 1ITZA 4BRSA 2B82A 5BSWA 3GAAA 3NM4A 1R8XA 2CKDA 4FNOA 1TO1E 2VBUA 1T0BA 2Q6TA 3S44A 3SR0A 3MAJA 3LWBA 3R0VA 1ZVVA 1U3GA 3RUAA 1U81A 2ZDGA 4UAVA 4XB2A 1N2OA 2BRUC 1JWLA 2OQVA 5CFLA 2FRVA 1CK4A 3LUAA 4KOAA 1X7YA 4WCFC 3L06A 1MJGA 2YR0A 5I5EA 1G291 5KJEA 1CF4A 4RZIA 1QCCA 4OJKA 3TLBA 1E3DA 4QPJC 3WGOA 3M4ZA 3CPWB 4NCJA 4KQFA 1PK9A 721PA 3B51X 3KEOA 2DWPA 3AVYA 2XMRA 2ZSJA 1YDGA 4WKCA 4N7MA 4TRMA 1O1YA 4LHZA 3D4OA 3D0RA 3PA8A 1ZRHA 5ECWA 1LC0A 3VGPA 2NYVA 4Q9DA 1U1DA 5I9IA 3BDVA 1L5FA 1P2TA 2AJLI 4D25A 3A4TA 1DDGA 3I6YA 3P1JA 4ZCTA 3I52A 1SK9A 1T3GA 2EZ4A 4QLOA 1LDEA 1J8DA 3RM3A 3ANMA 3MOSA 1Q83A 2PH3A 1F8FA 3DLIA 2O2GA 1RBYA 4M1QA 3C41J 1FZQA 3CW2A 1M2WA 1RM3A 1M7HA 2GK4A 3RAJA 3KTOA 5KNCD 3PEYA 1I2BA 2DAPA 2IYQA 3U7QA 1DNPA 3RJ5A 3DJYA 2AR9A 5B3AA 1Z9BA 1I0IA 1R0LA 3RSHA 1KVUA 4TS3A 4TXNA 3LPAA 1DKUA 1E7MA 2A5YB 3JALA 2Q0HA 3PUVA 5B3LA 5F76A 5EZYF 3E7DA 5ALHA 3CUUA 4MIOA 1E6MA 4QEKA 2CDBA 2Z2KA 4QGGA 4TGLA 3K0FB 4DDVA 1KAHA 1I94B 1BRMA 3COPA 3ZG6A 5C5IA 1IOZA 2ATEA 1HORA 4TXMA 1XXHE 1XZMA 3MTGA 5C81A 3GEBA 1EVZA 3G5TA 1UBLS 1A5SB 1G20B 1M6EX 1PJ4A 2DKOA 1SD2A 2GBPA 5DLPA 3RTAA 5ENDA 4ZVVA 2ZYAA 1V8OA 3VDNB 4WXRA 3OJLA 4FSHA 5HOQA 1L6RA 4TSRA 1EFVA 1L5YA 2DQZA 3FTFA 2R44A 1F38A 2VHTA 3P9KA 4WNCA 1CR1A 1X92A 2OAP1 1PG2A 3HJUA 4AN0A 3OQBA 2P9JA 1Y5RA 2QUZA 2X4LA 4WT7A 4F84A 2GEKA 3H1PA 3K1AA 4KG7A 3RVLA 1PVDA 2AOTB 5CM8B 3CN7A 1GVHA 1VHWA 3HR4A 4Q16A 3N5KA 4UM8B 3ZU3A 1W1UA 2YWRA 2C2ZA 2BTOA 4MV5A 3TXYA 1J1ZA 4CIYA 4MUAA 2PZAA 3F49S 2M2IA 2Q6LA 2WHRA 3G2QA 4V24A 5AI0A 3X1ZA 4MI3A 2H4XA 2PRKA 2RHHA 3F5SA 4KSYA 5HBRA 1S9HA 1PJSA 3NM5A 1NSFA 2VSXA 1J5PA 4LZAA 4DT1A 3AKZA 1KPGA 1HEUA 2XBUA 3QU7A 1WSVA 3ENVA 4LY3A 5KYGA 1K9VF 1U5BA 4H7EA 2F3QA 5I9LA 3H2SA 2XTNA 2P7IA 5DN6A 3VH3A 1DJPA 1RQ2A 5B7GA 4JLDA 4URXR 4G4JA 1MTOA 4QFMA 3RY8A 2GRJA 2P65A 3NYIA 4GPEA 4RGYA 1VJSA 4K6OA 1G59A 4MCHA 1VBKA 1VHJA 1HT1E 3SP1A 1YC5A 3JSXA 3MT7A 4NFYA 4XEUA 1QM5A 1MGOA 4TM8A 4IOJA 4ZQHA 4D8XA 3IO5A 1T2VA 4DEVA 2JA1A 2RGWA 1E6WA 2B8TA 3AEXA 1H0RA 1PLKA 2JRLA 3A1UA 1L4GA 2D4HA 3D3QA 3KR9A 4IXWA 3M1YA 5G1OA 3WO1A 4DF3A 4YJFB 1I1NA 4YECA 4I6GA 3DL0A 4FFRA 3ZXYA 2QMQA 3O8RA 3IMCA 4Y7DA 3G71B 3MTQA 4IIJA 4UATA 1H66A 2MSLA 5JAMA 4NECA 2ZSEA 2C4TA 3P7MA 1MB0A 2RKOA 1IZ9A 1OXKB 3AW9A 3L05A 3BY2A 1G8KA 3HFRA 1Z6QA 3PDHA 3QU2A 4IZOA 4LKRA 1FJ2A 4WCFB 1ZOPA 4C4SA 2PEYA 4BVJA 4BGUA 4N76A 1MAWA 1EK5A 1YS2X 2GRAA 3HSYA 2X0RA 2Z57A 3LY5A 4L6IA 1P2VA 4NESA 2G25A 3OZCA 3H9NA 2ZYUX 4ZZ1A 2H7XA 1H4SA 2IYUA 3G9XA 2W6ZA 1FMTA 1P3DA 4KUGA 1NNLA 3L6EA 5A4IS 4S05A 2IITA 2ZP1A 3PT9A 4CMEC 2I2AA 1R0BA 4GP7A 4M9XA 1T9CA 1M1NB 3DUFB 3KVVA 2VZLA 4EYEA 2AF4C 4K6HA 2KVOA 1PZXA 3KIPA 5DTMA 2QYSA 4B79A 2CT8A 2AA3A 1ISFA 4X1OA 5E0OA 4JKYA 1FS5A 2HBQA 2GTPA 4X00A 2QUJA 3BGSA 1VLOA 3I45A 4WFQA 1O3YA 4E70A 4BO7A 2AQHA 5KPDA 4UTXA 3ZIAA 1JAHA 2NV2B 2WYUA 4AROA 3BMCA 2YFYA 3EWSA 3KZOA 4JH0A 2O05A 1P5HA 2IXFA 2XNCA 1CE8B 3FKJA 1HDXA 1Y9DA 3MLBA 3L1JA 3Q98A 2FH5B 4JMLA 4YCAA 3EUEA 221PA 2YN4A 3K8ZA 4FHZA 2Z2JA 4OX9Y 2ZBFA 1HDCA 3THYA 2HA5A 2G7MC 3NEYA 4DA9A 8GPBA 3O2QB 4I9UA 3AY3A 1EJBA 2NTJA 1THZA 2Q5LA 2DVMA 4B82A 4GX2A 3VU9B 1QZXA 3AR2A 3UHPA 1JA1A 1F2VA 1P5FA 1RCFA 1K1EA 3GK3A 1G41A 3H1GA 4RVCA 4X61A 5TDHA 1JJIA 1ZD5A 2C4HA 4L9WA 4CG1A 4KMRA 3IUEA 4Q1AA 4C7OA 2VDMB 1MW9X 2G8NA 3UAGA 5L9AA 3KBOA 5IAKA 4FLEA 4N5NA 2NTVA 5JXJA 3JW8A 2ADFA 3TJZA 5B1EA 2DQYA 3O83A 1OFVA 2FG6C 4ZGQB 3D3NA 3P2JA 4G9GA 4X1YA 1DP4A 2DPHA 1CB7A 2FW0A 2CXSA 5FUXA 1GUYA 5DU2A 4CDMA 4ECAA 2O8CB 1E2MA 4WZZA 5LD2C 1UT6A 3E9QA 4JR1A 1XCLA 1K75A 1IXKA 1O97C 2ATVA 4ESEA 1HE4A 5ALQA 4CLHA 2FJ0A 1Y8RB 4OKIA 4TM7A 4Q7KA 4GLOA 4NOKA 4EABA 1UAAA 1JB1A 2I3ZA 1K8QA 2E4ZA 2V3CC 3MOIA 4K9DA 3E20A 2P3MA 1NKTA 1JV2B 2VZ9A 2COKA 1CRWG 3WK5A 3IEMA 4G1MB 5DNDA 5IM4A 4RE5A 3JPWA 5JZSA 1V9SA 1E3MA 1FJHA 2YJGA 4AZ0A 5E4JA 5JAOA 1X39A 2AW3A 1T5BA 2GCOA 3RYIA 3CCRB 4LNUB 5TGDA 3O91A 3H2YA 3RRNA 3DV2A 1E32A 2CNNA 2IEYA 2Y93A 1POWA 1KAGA 1JIJA 1IPHA 3K5PA 3KZNA 3VZPA 3TPZA 3WL7A 2GI4A 3PHJA 3L0BA 2L18A 2V3VA 1X2EA 2WFMA 3COVA 3LLCA 1N9ZA 1TM7E 3EFOA 5AKHA 1RP7A 3T7RA 1XJCA 1NV9A 4OPVA 1MHPA 1Z0IA 2VHEA 1Y4AE 4HDRA 2BJWA 1IY0A 4I1VA 5DN6D 2DLCX 4GKJB 4MLZA 1G6Q1 1QVRA 5AICA 3KE9A 1ZD4A 3BD7A 1CWUA 5ITSA 4JLWA 3GLHA 5HE9A 1VQ8B 5EZYB 3JRWA 3M2PA 4IH4A 5JJ5A 1MG0A 1MF7A 1ZXBA 3LLMA 3PXAA 4DLKA 5GM1A 3B7PA 5TARA 5B36A 2X4IA 3RC1A 2OILA 4F96A 4PFSA 4EA9A 2Q5OA 3IOYA 3OH8A 3RYHA 4XOIA 3I2FA 5F7OA 1K06A 3WC4A 1AS3A 1J6UA 4F86A 3PGKA 4F3NA 2P78A 3LIIA 4CDGA 5F7ZA 2QX9A 3BRWA 1P0PA 1Z28A 2XTJA 4KREA 4S1PA 4Z7JA 2ODBA 4B8ZA 1EWTA 2CJFA 5GJCA 2H0QA 3M70A 3QKWA 4BNZA 2P40A 5CXUA 3U56A 3USZA 1G16A 3ET5A 3MWEB 4RNDB 3K2EA 3TVTA 4S24A 3KVOA 4RHXA 1Q84A 4FONA 3PUWA 4OI0A 1LGYA 3AYZB 1K5DA 4UDNA 4DA0A 4A73A 1OWNA 5IULC 3PFIA 4G65A 3ZBTA 4CG2A 4UE2A 1YQDA 2IY8A 2EHDA 3NDJA 4CTMA 3PSHA 3QEKA 4L3WA 3FTPA 3CLSD 3LBNA 2OA0A 2Q3HA 1YC2A 5FBRB 3GVJA 1PZMA 1GNLA 2BJHA 2GZDA 4O4IF 1RBMA 4Y2UA 5HMLA 4D8YA 2C97A 1RLJA 2EJVA 5ILOA 1BXGB 5CURA 4UM7A 1XMXA 5BV1A 2OUKA 3ILXA 2X8AA 5FH9A 5ALPA 1YBMA 1CXZA 2G9QA 3VXKA 3RC8A 4ROXA 3UGQA 1NIJA 1N1DA 2XB2A 1IHPA 4EG0A 2BKLA 2CBXA 4RELA 2AZDA 5ECYA 4OMCA 5E6SB 3ZIAD 4CM3A 3NETA 1BCRA 1OJLA 3G2NA 5EG5A 4K3VA 2GEFA 4BBPA 1WW2A 5CJ2A 3KJZA 2WTAA 1WB9A 2F8TA 1BEZA 3L6DA 2J0UA 4U6SA 3RVKA 5I8PA 3TH5A 1YD7A 2F00A 2QZSA 3FB4A 2X23A 2ZRKA 2R87A 2G9UA 3O7MA 3QA9A 1KDRA 4ON9A 3JZIA 3MW8A 3OCVA 4E6PA 5H5JA 2WUGA 3QPBA 2UUAB 3ZY2A 4WA7A 4IMRA 3OQJA 3AJEA 1AO3A 2AV6A 3AHIA 4PLZA 1XRMA 2SBTA 4UU0A 4ZVRA 5KKAA 1NXSA 3LQ4A 4II3A 1KQOA 2PPVA 4EHFA 4W6ZA 5DCWA 3AJ8A 3AO0B 5C35A 5HPYB 5G4LA 2VL7A 1IY8A 1ID8A 1DEOA 4KIGA 4QEDA 1OFUX 3RU2A 5LD2B 3HQ4O 5A6VA 3A32A 4DC9A 2ZUCA 2FUCA 4XNFA 4BNLA 1GPJA 1HLDA 3SY8A 2X0EA 2B4KA 2KHZA 1IXSB 4HDSA 2HU2A 4RD6A 1JHPA 2ZJ0A 1J9GA 3O03A 3TZKA 1T8SA 1IJKA 4B71A 1YZVA 2EC5A 1QYDA 5H1YA 5SY6A 1ADFA 4PRKA 3WX0A 5B4UA 4PCUA 2GARA 3IKJA 4L6AA 4X24A 3T7CA 1Z63A 1ZC4A 3JX9A 3L7AA 4YHHB 1C4KA 1FDOA 3RVSA 4UAJA 2RCNA 1PL8A 3TVDA 4BGEA 3QIAA 4D8TA 1C7IA 2DKFA 4F8EA 4GSYA 3RR2A 3UMCA 4EECA 3QUBA 2FUG6 1U98A 4IO0A 4EG7A 4RD4A 3TBHA 5E38A 1U6KA 1PZEA 1UM9B 3EC1A 1R0RE 2H31A 2IPXA 1QU2A 3FPBA 5COQA 8ATCA 3T5BA 4ENSA 2IKSA 3SHWA 1B73A 2J0VA 1WDWB 1UC9A 4EO7A 2OYNA 3RQSA 4ZYYA 1JYSA 1F8YA 1US8A 2FR8C 2VPPA 2H6EA 4MEAA 4P7KA 5COBA 5FPTA 4MYCA 2EBWA 4GL4A 4PLFA 4K9RA 5ES3A 2Y05A 4JJKA 1E3WA 3CKYA 1OPXA 5CMLA 3SMVA 1UD2A 3WNDA 2ZIWB 1XRNA 5AJTA 3TZBA 3U3KA 4EGQA 3HXLA 4CCYB 2JD2A 2C4WA 1DCKA 2OPBA 3DMPA 3QBDA 2PKCA 3LHIA 1XEWY 3NBKA 2SICE 3GLKA 3WNVA 5KQLA 1G2IA 1HYBA 3KTFA 5J5VA 2JZCA 2JVIA 2Z2ZA 4Q1DA 4LF5B 5G3ZA 1OAOA 3H9UA 4Q18A 2XT0A 2A5DA 1RDFA 1RLTA 1AA6A 2XDQB 4MS1A 3ROTA 2V8BA 1LWOA 3F8WA 3M5CA 4LZOA 1T9ZA 3AB3A 1KNXA 2H1HA 3I9V1 5F33A 1L5LA 1IBCA 3BRWD 5J3JA 2WA1A 3ISVA 1CUJA 2GKGA 1S3IA 3NIBA 5AYVA 4CHGA 4EI8A 1KMHB 3EEYA 4MRNA 2OYCA 2XDWA 3NNSA 4BQIA 3ZJTA 1I0ZA 4D4MA 1UZMA 3CSSA 1N2BA 1P91A 2OTLB 1ZIOA 3IE2A 3BE4A 4ZT6A 2QDXA 4OK6A 4ZXFA 1ZNXA 1GL3A 3SDBA 3TAXA 1RWOA 3LO5A 2G9ZA 3SCZA 1M1ZA 1QH9A 2HSJA 2OPHA 3UYLA 3ZX4A 2IELA 3CEJA 1VKNA 3CRQA 1TF2A 4KQMA 4LYYA 4NZMA 4Y2VA 3VZDA 4DSZA 1D2AA 1O4VA 5K5EA 3HXQA 4ZCIA 3OPNA 2ON6A 1PYOA 3I8OA 4IJKA 4WADA 1KDZA 1YR2A 3QJ5A 3WICA 1W94A 2FX5A 4GR9A 1K0UA 2HY7A 4RSGA 4A92A 2WIKA 1I2MA 5TRTA 1QF7A 3LYUA 4C4RA 4RCVA 3AV3A 1SZDA 2O0MA 5K3FB 1JP7A 2OFXA 4B2IA 3KKEA 5HRAA 1DI0A 1TK2A 1WCIA 2JHFA 1F17A 2LVBA 4PPNA 4WXYB 3T4PA 3T7EA 3VSCA 3EW7A 4Q3DA 4HX5A 1W581 2WV9A 4OGKA 3T6KA 2R4TA 4KVFA 3L4SO 2CLMB 3KPJA 2Q2VA 4LRQA 1OQAA 3PQ5A 3A6PC 4JLPA 3NGMA 4L8GA 2VPIA 1W30A 5HF6A 1J2JA 1HT3A 3OMXA 2GEJA 3R8XA 4YO8A 2CXRA 2EU8A 3UAWA 4UM9B 4E5MA 2OLKA 2HV9A 1QS0B 3BGDA 3PFNA 4OY3A 4WHMA 4GBGA 4MQFA 4TVBA 2VHWA 2ZIGA 3CC4B 1AU9A 4QXAA 1R8QA 4X7FA 1ZP6A 3KEFA 3BGIA 3E0QA 1E3QA 2PGAA 5MFPA 2ZUWA 1GAQA 2JGDA 4HXFB 1HE5A 1QRSA 3I55B 3RVMA 1S7CA 2INGX 1CNMA 2HCBA 4K9QA 4V2UA 1VSTA 4ZQIA 1UBRS 2R5WA 1HRDA 1NM5C 2RH5A 4I8IA 3TQCA 3ZTTA 4XJXA 5BUSA 2C9ZA 1KI6B 2HOQA 3A4MA 3DMYA 3PE4A 4EF5A 2BHNA 3O38A 1RWKA 2JLRA 4ZPXA 1YV9A 2XXAB 1NF2A 1JA9A 1HO3A 1XD2A 3NRBA 4L4RA 4XKJA 1EUDA 4GKVA 1D8TA 1IDN1 3Q5GA 4IRXA 4P83A 5KTYA 2ORWA 5LNK1 1MAVA 4HWPA 4HGRA 5FI0B 3QEMA 4Y6QA 5HGJA 1V41E 3GGPA 1UK9A 2C7PA 1WOMA 3PWZA 3V8PA 1GWNA 3I1FA 2WW8A 1ISSA 3NVAA 4M0CA 4ZAWA 3IIIA 2XOEA 2ZSUA 3CXUA 3EULA 1RPAA 1R0KA 1DUVG 4ND8B 3UFXA 1V0EA 4BLUA 1OLXA 1D09A 1S5PA 3JQQA 3NFYA 3L5OA 5IUJC 4JQYA 2BFFB 3FRJA 4MV7A 4R1LA 1PG0A 3RK0A 4NMXB 1WZUA 3QHAA 2J6BA 2XKJE 1L1RA 4OPMA 2GCNA 2X2EA 4B9EA 4DWVA 1JR6A 5AOAA 3MUFA 4BUZA 2Z83A 5BVGA 1OFUA 1AQNA 1UOQA 2PLWA 4Q03A 5DCYA 3I6BA 3IIKA 1QHSA 5A3VA 2QLMA 1PGQA 1VCOA 1NVBA 2G08A 2XWJI 4N5HX 5FD8A 3JR3A 1YRQA 5I7VA 4XUDA 5DE3A 4DQDA 2DECA 3Q11A 2ZL6A 1C8BA 1DAMA 2XY4A 4G0PA 4R9SA 3T7AA 3FLEA 3CBQA 3NOXA 2D0IA 3KHKA 2O59A 1ENZA 1U8EA 4ZOLB 1X7WA 4AIIA 1SG0A 2PTHA 2Z8XA 3W9UA 3RU3A 2KE5A 2JVKA 3N2EA 2NUAB 3H8VA 3AVWA 2DX7A 3NHUA 3OCWA 1COZA 2CFOA 4YUYA 2QRKA 4R7ZA 3MJDA 3JYPA 3BMQB 2QNBA 4HB4A 1QYWA 2V8OA 4NH4A 1BGWA 4DDTA 4JYCA 5A71A 3KV3O 3SJZA 3CLKA 1P74A 1J90A 1U7TA 1XN4A 1FXWA 4IPTA 4XXHA 2ZTUA 3A3KA 2P2GA 4CWAA 4YUZA 4I4TB 1KPHA 2P41A 3DFZA 5EJFA 1YI2B 1JQ5A 1Z2DA 4WERA 5HJ2A 4WH0A 5LQMA 2EKQA 4J49A 5K0LA 3UM9A 2VF4X 1UH5A 2J1LA 4NG5A 3K0HA 2V31A 4KO2S 3OHSX 3TLMA 4AW9A 4TKVB 4EKDA 1RYYA 3QKRA 1G7CA 2G28A 3Q1LA 3VH2A 4ZCRA 1NNEA 4PPFA 3A4IA 3ZOZA 5FKJA 5LQCA 2Y1WA 1ZCFA 1U0JA 3SZRA 1W36D 4WV3A 1E60A 2FW7A 3QOFA 3R8CA 1TJPB 4D1YA 2NAPA 3MD0A 1K88A 1N2SA 4IV0A 5GOZA 2OOSA 1NW5A 1RABA 2W90A 5EFOA 1V11A 2RHMA 3MTDA 2HYIC 1KIFA 2DTXA 1YJAA 3KSZO 2BHLA 4GVXA 5LLSA 2W6JA 1OA1A 1OKKA 1YUNA 3E18A 3WP1B 4KKTA 1YZNA 3VR5H 5LXTF 1U7WA 1MB9A 1RQLA 1FDVA 2VAMA 2LKDA 3QH4A 1PCXA 4K9NA 3E70C 4ENVA 3VKVA 5GINE 4CMGA 2QPAA 3N2ZB 5JCXA 1SEVA 4Y6OA 2IYSA 1S72B 4XN3A 2OHIA 3P0JA 3RK1A 2OV1A 3FBTA 3NEPX 3NRJA 4LDJA 4WE3A 1FLNA 1XF1A 1QBGA 3BXXA 3U13A 3PUJA 1RRGA 3M81A 2BFOA 1XMVA 1F5NA 3SWWA 3PGLA 1GCIA 4B3GA 4DG9A 2PMEA 4AO8A 1II8B 1BNCA 2IE0A 5DHRA 4C4XA 3ZU6A 2XRYA 2PQ2A 3B9BA 4I2NA 4IG4A 1I01A 5DT9A 3Q87B 2NTNA 4MV1A 4BMZA 3TLYA 3UO8B 2ZYRA 3LQQA 1PK8A 4L8JA 1J8MF 1UEJA 3MYRA 4FFDA 3V9AA 1RRVA 1EP3B 5F52A 4DHEA 2I71A 4YMGA 2OORA 2FXVA 1WHTA 1FOEB 3OZ7A 2XUQA 2D2VA 2OHJA 4S2UA 4BATA 4HUJA 3EY4A 3SHFA 3FF4A 3ZLUA 4BX2A 2Q6IA 3DBRB 4EKIA 4F38A 1RLIA 2B3TA 2CF4A 4R01A 3IULA 2A5LA 2FPPA 2WJ6A 4YS6A 2Q1YA 2LXNA 3PFGA 3CWQA 1YS4A 4KAAA 2W8BB 3EXIB 5BNZA 4D4JA 2WB4A 1JXMA 1F0KA 1M74A 1RZ3A 1Q3KA 5HDBB 1B26A 2JKYA 3KOWA 4K05A 4GZ3A 1L9KA 2AVDA 2J0QA 3D31A 1QXSA 3C0KA 3IAEA 2IYEA 4E22A 1VLZA 4RJIA 3ETJA 1W8DA 5IPFA 2HA0A 1OXUA 4ZYUA 2GQFA 1XLUA 4IJUA 4BGIA 4YMIA 4A0QA 4EO9A 3GCWA 5JVDA 1HFEL 2P1DA 3K3PA 5JXHA 3RASA 2PLNA 4C0BA 4DPMA 5KSWB 4DQVA 5M34A 1VQLB 3OPYA 4WCVA 1R16A 5EWJB 1EIZA 1FUIA 1NX9A 2WU8A 3BRQA 3LRTA 1EMDA 2OFPA 2R84A 3DLPX 3RQIA 5BUZA 2FPGA 4JIMA 1UPAA 4J0EA 1ZN8A 3KOMA 4ZVNA 1IJEA 3V9PA 1ZM2A 1GCUA 3ORHA 4BNGA 1BDJA 4F6RB 2O5CA 1VL8A 4CETA 3ZC3A 3I73A 4NP6A 3ISXA 4YALA 4JC8A 2P0AA 3ELBA 4M0UA 2IH5A 1G0NA 3LC7O 3ONFA 4Q37A 3TSZA 4FN5A 3CIOA 2XF2A 3PX2A 1XQ6A 2H5JA 5K05A 3C5VA 4DYDA 2Z2IA 1SIOA 4CCAA 4KQEA 4NX2A 1E9EA 4Q1EA 5FTWA 4HY3A 3S2ZA 1KHHA 3DYVA 3I8SA 2LZJA 2YIVX 4L4UA 1EGQA 5F51A 2D1YA 1W2GA 2WD7A 3O8OB 2RGNA 4CKEB 2NSYA 5E2AA 5C7OO 3QJGA 2HA6A 4PYQA 4U2FA 4ZAYA 2G3YA 1EB8A 2MIIA 4CN8A 1B8VA 4IMIB 5JNUA 1N4DA 2QYOA 1FVFA 3HYCA 5KYUA 5JRDS 4X8MA 1UJ2A 1FFDA 1M7BA 4LZJA 1W4RA 5KSYA 4R6WA 1VHEA 1NXXA 4XWWA 2NSJA 1MRSA 1B0PA 1JEYB 5T4BA 1J23A 1RM4A 1B8UA 4R2WA 4GW3A 3ZDRA 1KP3A 1LSUA 4BV9A 3G1WA 4KQKA 4FEAA 4INAA 1AQYA 1UEIA 3N3AC 5KBYA 2GYYA 3IE1A 2FMHA 2YWFA 1A69A 1WXHA 4OJTA 4ZQGA 5FO0A 3HYNA 3QWBA 1YJQA 3MAGA 3BH6A 1BX1A 1XVLA 4XIJA 3NR2A 5F7JA 1QIIA 4EUNA 1PR5A 1YO6A 4JEHA 3DKVA 5TJHA 2ZYDA 1DRVA 3SS7X 4ARZB 2FHPA 4JT9A 3GJ7A 3D8NA 1NQAO 1TJYA 4JBIA 4BZZA 1Q0TA 3TQSA 5KW9A 2C95A 3BOSA 4JOCA 2JLBA 3GMDA 3IAHA 4OBWA 5ALUA 4XFJA 5GPBA 3ZHOA 1VLHA 2W6JD 1OKKD 3WLTA 4IIYA 4LPKA 3HKBB 4KYVA 3WOHA 4C87A 4YYZA 2I2DA 4OQZA 5G1PA 4YP5A 3QNUA 1S2DA 4JN6B 1IVNA 2QEXB 1C4XA 2I6GA 3CRW1 4KN8A 3Q9LA 5IBRA 2BZGA 3G13A 3SZLA 3U1TA 4TN5A 4HE6A 3HZOA 3ROZA 4DLZA 2QF7A 1Y8QB 1S1CA 1Q57A 2EQAA 3FG9A 2XF8A 1K7FB 4YRFA 4BQPA 2YS6A 4GG1A 4F2GA 2DJ5A 2XYHA 4DDUA 2WJ4A 1YR1A 3DONA 5J58A 2YTZA 5T5QA 2COEA 3SIXA 3FJ1A 3OJ0A 3VOTA 2FZVA 5KX5F 2WJIA 3ZLVA 1LA2A 1S8NA 4BCBA 4WZAA 1PP4A 4C0HA 1GCGA 4ALIA 3PVCA 3TKAA 3A8JA 1DAGA 5HM6A 4NG4A 4Y9SA 3NORA 1RQPA 3IV9A 4YJKA 4B6JA 2DG2A 5IHXA 3NH6A 2COUA 3ZDEA 2AZMA 2OYSA 2V7GA 4UVHA 4J0IA 3ORRA 3ZGOA 2HUNA 4OB8A 3U4HA 1GPAA 4FEYA 4OP7A 3FCCA 4H15A 4LTMA 4YROA 3VAAA 4Z49A 1YZUA 4RDLA 3FRIA 4G9BA 4QAJA 1L8QA 3U4AA 5L8VA 1OUMA 1NU8A 1NLZA 4KUHA 4R8LA 3C45A 1DDIA 1IONA 2ZPUA 2ZR0A 5F98A 2O8DB 1G3UA 4EMUA 1K6MA 2ZWOA 2MMGA 4ZHQB 3Q5EA 1FTQA 3FJYA 4MROA 3KJQA 3W7VA 1V71A 3TL2A 4P0PB 1JEYA 5BVHA 1J0BA 5FYDA 4K03A 3UK2A 3BMNA 4W5JA 4X05A 1C7ZA 5LMCA 3W5AA 4NENA 3P9YA 3DOEA 2HPHA 1WF3A 1YQGA 3F4LA 4MR9A 1BC5A 2BLLA 1Z4NA 2QW1A 1NQVA 2Y1GA 3LRXA 4TTJA 5E7IA 3J81A 3X0DA 2BR3A 5FADA 4MIYA 3GCXA 2IX9A 4FFBB 3VH4A 4HZGA 4BMDA 5L7TA 5EIBC 2ET6A 5EIOA 3TX2A 5KJ1A 4CEIA 2HCTA 1LK7A 2MINB 4J9VA 2GXQA 4LQ4A 1G3MA 5BPFA 3CZ9A 4QGBA 3DFMA 8OHMA 5ITVA 1QVGB 3S1AA 1EGVB 1I4DD 3KELA 1B41A 3BJMA 4IIEA 1FMLA 2IU3A 2R8YA 1DKPA 1WXXA 2O0LA 2PGNA 5CM2Z 1K3FA 5ALTA 4AD8A 2CF6A 2VP3A 3FZEA 2QJFA 4Q00A 3UPDA 1VQ4B 4EY5A 2Z4RA 4YDQA 4JYAB 1UFOA 3JTMA 3RUCA 4MS4A 3TVYA 1GN9A 1XQWA 4EI2A 4FNMA 3GB9A 1CUAA 4RK5A 4YP9A 2D1FA 4B3BA 1UMCB 4BZWA 1ISIA 3EHEA 2GPBA 2X8LA 3CV3A 3JV7A 4IV8A 4PGHA 1J8YF 3OZAA 4K87A 2QAIA 1ZICA 2YKGA 1ZUHA 2X0NA 1SD5A 4R98A 2DIEA 5GJWC 2NMVA 4BAZA 4UCWA 4OV6B 4DG8A 5KSOA 4YH1A 1PR9A 4UOZA 2JFPA 1V0JA 3QRWA 4KQWA 4Y2GA 2GNOA 5JDCC 2VDJA 5CB4B 1SA0A 5IC5A 2QNRA 3IBFA 3KQTA 3KZXA 4KH1A 3RSGA 3LNTA 1MRZA 4CM6A 4KFCA 1Q21A 4NTZA 2OCLA 4JGIA 1EE2A 1GCAA 1UWVA 1BPLA 1Z4PX 1QQ7A 1K6JA 3GJ0A 4GICA 2DEUA 2DOGA 1EWVA 3RFUA 4BLRA 2J3EA 5HYVA 2IS4A 5CFQA 2I87A 4JB0A 2VTBB 4GDFA 4EHJA 3ND6A 1PE0A 4U8HA 3H9QA 2ZUSA 1QFSA 1VKRA 3OZXA 3PKJA 4RPHA 1E2IA 3EFBA 1DQRA 3D5QA 2WWRA 2ECOA 4O33A 5EXTA 2R4UA 3Q8XB 2FWMX 3BF7A 4GP9A 4OXXA 5JMTA 2A35A 2PBRA 1KH1A 2G67A 3GJXC 3VA7A 3BJRA 4YPOA 4LF9B 1N0WA 1CY2A 1GZDA 1JR3A 3EG9B 3FFTA 3HHEA 4FOTA 4KUEA 5B6PA 3KFVA 1NYRA 2XRMA 3L8FA 4KMOA 3MJVA 4IDFA 2V58A 5EOVA 1BDIA 5DTQA 4Q3OA 1N36B 2I8AA 5KIAA 1DOZA 5KYWA 1DKNA 2GZSA 2OCIA 1T13A 4QTYA 1TTPB 4MWCA 2QPOA 3MUOA 4AK9A 3ZCUA 3DA8A 1YB7A 3NZEA 1EK6A 121PA 3KLPX 4XLLA 2BHSA 3KYIB 4L0MA 2C04A 5JARA 1UMBB 3A3OA 5D1HA 2O23A 3CPXA 1PJ8A 4GOKA 4KMSA 4Z4SA 3EE6A 2O4CA 2WWIA 3WKAA 1GNPA 1GITA 4PPGA 4I5IA 5A0FA 1KZHA 3ND5A 3OE4A 4BO4A 4ME6A 4XR4A 1O5TA 5KVVA 3JYQA 3PNQA 2ERXA 2WB2A 1OIXA 1PJ3A 5BQFA 4PYMA 1XE3A 4YJDA 1MJGM 3G2MA 1FEZA 1MQ8B 4ZVQA 1E4OA 4F7WA 5JW6A 1NYLA 3RU9A 1L1QA 3Q9SA 1JX6A 2GBLA 2YJ3A 1HV8A 1RAEA 2GXSA 5TNXA 1RXIA 2PD3A 3F71A 5B6JA 3HVRA 3PTAA 2VHCA 3L4KA 2QTVA 4B4OA 4B3SB 1NUSA 2HJWA 1QVVA 2BKEA 3D6AA 3JQCA 3ICQB 3DBHB 3AHGA 3SZMA 5TY0A 4JLAA 2NU9A 4CKWB 2E6KA 2I76A 1YK1A 1NLMA 4LWQA 4EGSA 1ZN9A 5CXSA 2QN6A 4NBWA 1RPZA 3EX7C 3GLGE 4TMZA 4DSAA 1ZLYA 3TOZA 4S0ZA 1V37A 5HKLA 4A7PA 1EEHA 3PJDA 3I2GA 1E3ZA 1HRKA 4RVNA 5FTMA 4NXMB 3SVLA 4NS1A 2YRFA 2BL4A 3LOPA 1M54A 1SUEA 2WUFA 5ILQA 5BUCA 4C4AA 1QCYA 4JOBA 3CNQS 2VAXA 2W4IA 2H29A 4TTRA 3U9LA 5FTLA 2RHRA 3JD1A 3SHOA 3EPKA 4Q15A 4U00A 1EJ6A 1TVMA 3O84A 1QE5A 4G0QA 4H1TA 4RZXA 4B4UA 6ABPA 1TU0A 3CXRA 3GSIA 1NJ1A 4TLDA 1L1FA 1R4NB 3E22A 3GZTB 5IAEA 4CMBA 1PYGA 2VP0A 4WUVA 1TA4A 1XHFA 3K9QO 2DHRA 3AUKA 4Q3CA 5EUQB 4M76B 1V3TA 4UHKA 1W2WB 2QZZA 2R751 3GMIA 3GLQA 3DR3A 3NV9A 3A8IA 4MW1A 1ZC3A 4DNRB 3WOVA 1RTKA 3BXGA 4NNJA 1I10A 5DYGA 1HZZA 4OGLA 4P98A 1W93A 1NW6A 2XDAA 4HPXB 1CNFA 3MQ2A 1WXFA 4LHSA 2WK1A 2CV2A 2MU1A 3SKVA 1J0AA 1VM6A 2O8DA 1NBMA 1EFUA 2FOXA 3L4JA 1A9RA 3D8HA 4GYKA 3QY0A 2GT1A 2BFEB 2PBFA 2G4LA 3IUBA 2H2FA 4MW7A 4OH7A 1YCDA 4R54A 1P5JA 3THWB 1IH8A 4XARA 4XWAA 4GBED 1LW7A 2JI8A 3G79A 4TL8A 2CMGA 4UARA 2REXB 4DWJA 4NF2A 2OFWA 4G89A 2GH1A 1M6NA 3PEEA 1EAMA 2JJ1A 1VMIA 1CP3A 4OI2A 3RV3A 4G37A 4PG8A 1X80B 3QV1A 4R3WA 5CX1B 1QFXA 2B7BA 3LFUA 1ULAA 3BAZA 1T9DA 1K6EA 4G36A 4G8JA 4N82A 3BXHA 3DBLB 1K4MA 1KGSA 1GPNA 4XQCA 3STUA 2HSDA 3CVWA 1KSJA 4HAXA 2R6JA 3CKLA 1UDAA 3IS3A 2BMFA 1KSGA 5HZHA 5DHPA 4GNKA 1W6RA 1QGAA 2HWWA 4O8CA 3HZZA 2NU7B 3NNDA 1JT9A 4UVIA 3STHA 4MV9A 5TLSA 2ZIXB 4Y67A 1KFCB 3GPIA 3IOEA 3EIFA 2EX0A 4JT2A 6PFKA 2PGXA 3JQDA 4F93B 1M2VB 5ICCA 4JJAA 4H27A 3IP6A 3EJ6A 3K1JA 2QD4A 4GUAA 1P0FA 4EA6A 1SUIA 3F78A 4EA8A 2YDXA 1RXWA 3L9XA 2JI4A 4UUQA 3PNBA 5DHTA 4JBHA 4ZKEA 1NBHA 1NP6A 1V6AA 3CMAB 2BBSA 1IZZA 3LGAA 4OMFG 4FBMA 4E30A 1JR3D 3L7DA 1VQPB 5B4VA 1GGFA 1ZA1A 2NZWA 5G0TA 4IINA 2AXQA 4KPUB 3MFQA 3X1DA 1Z8HA 4LC1A 2HRCA 2QD3A 4GI1A 1QIFA 2QM3A 4IHJF 2VPTA 1TM5E 2JGMA 2OE2A 4A2WA 3RREA 5EIEA 2NNWB 4UXJA 3NE5B 2PE3A 2XVAA 3WMRA 5G3YA 2EW1A 4YQFA 3D2BA 1CUXA 5FBZA 4KR6A 4UW9A 3ZK7A 4BV3A 5CITA 1XCMA 3HYTA 1SXJC 2P3QA 3M33A 3OU6A 1Z16A 4CV2A 1WSWA 3LDFA 3M2TA 5LCXA 3P19A 1MIOB 3OQIA 4J76A 3WYDA 5AVYA 5CPFA 5LVAA 4LF8B 1XTVA 4MUKA 5ALJA 4DEYA 4L51A 4BHTA 2ZWVA 1O4WA 3GNTA 2FJUA 4GZ6A 4QGSA 5IC4A 1Y3FE 2GOYA 3LUHA 4EHNA 1A8HA 1UEXC 3QLJA 4MS3A 3SYTA 2R2GA 3ZJUA 1PR1A 1YASA 2O3TA 1W0CA 2PUAA 4G1FA 2AQIA 4WL0A 3TRHA 2EDCA 1QWSA 4BMCA 1OBCA 1DE0A 4GZ5A 4GX0A 3ONYA 3QPDA 1A7JA 2PSEA 3R9IA 2FZLA 5EWLA 1NNI1 3N0XA 4G07A 4ZI7B 3ZWNA 3HWWA 4OGWA 1A27A 1GP2A 3M9XA 2PY6A 3IPRA 2WJVA 3I28A 5H7XA 4X60A 3T9CA 2PS3A 3I4LA 3MGGA 2C7OA 1U31A 1H6BA 4JHXA 1SOWA 1FU4A 5AQ1A 2BC9A 2EXXA 4DBZA 1XVVA 1KZ4A 1UJCA 1Q7GA 2K5UA 3ED1A 1VOTA 1BCSA 4FT4A 4CR7A 3H04A 3SYLA 1RHMA 1RLUA 2GERA 4WLUA 1VLYA 4U7TB 4JASB 4JJ8A 5CDSA 5JYDA 1U2RA 3C3DA 4XM1A 1RIFA 521PA 3DE3X 4QIHA 2WAMA 3I62A 2VP9A 5SICE 3DKPA 1QCDA 2C59A 1W6UA 4MYDA 3EQ2A 2XBMA 4D4IA 3OIFA 1IZ0A 2Q5IA 3ZUPA 2ZIZA 2HPZA 2GZAA 2MHCA 1ZU5A 2JLQA 2XQFA 3RHSA 5JSQA 1XU9A 4M7PA 1GPLA 3BIJA 3PX3A 1L5VA 1PJTA 2QQGA 2VJNA 2WZCA 4UUPA 3SZUA 4MPPA 3WL4A 1VGQA 2XE4A 4G63A 2E1BA 3GRAA 5J2UF 1XDGA 1E8DA 4DQ0A 4E2FA 2YWEA 1XYVA 1Z4MA 1T4CB 1FX0A 1XKTA 5D7BA 3KXLA 1R6AA 1JLSA 1RYDA 3C8UA 3VYWA 2ENUA 2YYSA 4Q48A 4E3ZA 4IH1A 2H5EA 4R84A 5IT0A 3HNPA 3EA5A 1L5KA 1CDZA 4NPHA 3RUHA 1NBMD 1OI4A 4FKBA 1OA0A 1W5SA 2ZR9A 3DZHA 3F5FA 4CF4A 5J5AA 2FN9A 4PZLA 1J22A 2ZE5A 4MV6A 2D1RA 3A1DA 1A96A 1T43A 4XWKA 4GGPA 4REMA 1DS6A 3T15A 2O14A 4PO9A 5TS2A 4XZ3A 4IIVA 4U3JB 3TLGB 4M1WA 3GP8A 2QRGA 2ZUVA 3O2JA 1Q44A 3LM8A 4DSNA 1QQBA 3L41A 4M1TA 3O8QB 3NG1A 4Z8XA 1ISGA 2JJ1D 4JI5B 3OHPA 4FDTA 5ILGA 3E2PA 1RLOA 4HWSA 5E1DA 3R6JA 4M55A 5CIWA 2K7FA 1RZRA 3N6VA 2MSWA 3W9SA 5E2IA 4WDQA 4Z4ZA 3CFYA 5ERGB 3MWDA 4YVFA 4A5SA 2JHPA 2HCFA 1T2AA 1YI8A 3GZNB 5FULA 2B8EA 5M29A 1ZGBA 3UJ7A 5EZ6B 1IJBA 2R79A 3DFIA 1EK1A 1RP1A 4RDIA 3ODGA 2Q0XA 2ZBQA 1TO6A 1U2DC 4N3BA 2O5EA 4QDXA 5AM1A 5HKAA 3DDZX 1NNSA 1TGYA 1TPZA 4IX1A 2ZM6B 3REQB 3HB5X 5KOYA 3RT1A 2F55A 2W11A 2E1RA 3D7NA 3LVRE 5K1ZA 5LB2A 4PLWA 2Y1KA 2IU0A 4ZJPA 3B9QA 4PC7A 3OTGA 3R3ZA 4B84A 2RH9B 4CLOB 1NW4A 3AUXA 1UBGA 1EWKA 1DX9A 2E1PA 3A04A 4V0SA 3B3QA 2ZL5A 1VGRA 2HPVA 4ZTUB 1ZONA 4TRNA 1XG5A 2FA9A 3V3TA 1RZVA 1G18A 1XRPA 2OCBA 2ZCUA 3IXQA 4LDRA 2OENG 1ND6A 4CL8A 4XUCA 4EG6A 1XAJA 3CCEB 1DOHA 3DYIA 1YZQA 1XJWA 2PGLA 4QDTA 2EEZA 5DLDA 4Z4GA 5BOSA 3AC0A 4MVCA 3CC2B 3IMKA 2ZQ5A 4BFVA 4EW2A 5FA8A 2K2QB 1XHEA 6REQB 4G0UA 4K0KB 1NC3A 4KR3A 1XRLA 1MO6A 4HPJB 4Y2HA 3VX4A 3ZGLA 4A2CA 3Q88A 4Q7JB 1R50A 4NHOA 1ISHA 3QVWA 4IAOA 3OEWA 4Z8YA 2J5XA 2X3YA 3A58B 3NOVA 4I08A 5C53B 4PHTA 3PQ7A 1UBNA 4O4HA 4WGFA 1Q17A 3KWFA 1K27A 1W2BB 1TW3A 1VIAA 2H4HA 3Q41A 4RO0A 4YFYA 1JXQA 3PJEA 2JLVA 2YJ5A 4M1OA 4NJMA 3TSCA 5C52B 3RSSA 5H4GA 2V97A 4B44A 3OZUA 4QYXA 2QX7A 1WCXA 4KMMA 5TS3A 1D7AA 4QHTA 2LR0A 3HPRA 2ZZQA 3KDAA 1E7YA 5CDUA 2VZ0A 3ANLA 2R66A 3ET4A 3QQ5A 1NI4A 1XYGA 3QENA 3A11A 2D1SA 3UG6A 3D8BA 3BHJA 3HU3A 1VA4A 5IJZA 4HFNA 1E0AA 5HHTA 1M2GA 1N9GB 4S1TA 1MQ9A 3ITEA 4UMFA 4DLSA 1VPDA 2FE1A 1W85A 4KIFA 2JKZA 4O6VA 4OEHA 4KAFA 4OPOA 3V4OA 5I7SA 3LXRA 4HLCA 5FUMA 2NT4A 3G4SB 1KVQA 1A9XA 2PJZA 2GNPA 1EX6A 1M0WA 4XGNA 4BEWA 3SC4A 4ER7A 2PVSA 2Q2OA 1FB5A 2IYNA 3CMCO 4HDNB 3SM9A 3GBPA 4URUR 2BEVA 4I8XA 1YVUA 1UADA 4NZYA 3PFBA 4FDMA 3HN7A 4JLUA 5I45A 1B93A 2W2QA 2ORYA 2VK2A 3UC5A 1QP0A 2CMFA 2M6SA 4QOHA 3G2PA 2HRRA 1JS1X 5B64A 1GQQA 4X7EA 4GMXA 2P9BA 4QTTB 1L5NA 3ZE0B 1PT9A 5B7QA 1BWSA 5E9AA 3UJ8A 3HLTA 3GFTA 4HDKB 1GPBA 1XALA 1WHSB 2AFHA 2QTCA 4M21A 4MWEA 3D4LA 4V03A 4PLCA 3HL0A 1PWHA 4HJXA 2QQFA 4BN0A 3EMKA 5E1MA 1GPDG 3SEJA 1LJ8A 1ZK1A 4BQNA 5LOVB 1M34B 4CG0A 1PJLA 1N3YA 2ZB2A 3D7LA 1Z4KA 3RTDA 4F45A 2CCKA 1CJBA 2GEDA 3BVPA 1P72A 4Q9NA 3OQHA 3RBZA 1CEEA 4M98A 2ZZFA 5A0TA 1XEXA 1E1RA 1WUYA 2OZVA 2DHQA 3OW7A 4US2R 1YHYA 1HDRA 4D3YA 5JH7F 2XKBA 1WP4A 3GN1A 4KXQA 1WOSA 4L6CA 4OA8A 3ZJ4A 1NXTA 1T3HA 2VRNA 3X2FA 3AOEA 4CMKA 3D6HA 2ZYWX 4P54A 1RZRD 2ID8A 1WUHS 5A89A 4OUDB 4AMYA 1HNWB 4DNFA 1U0GA 1D4OA 4DUGA 2Q9AA 1AUPA 1YB1A 2J0EA 3AP3A 4BFSA 4CV0A 2YJ4A 4O0MA 2IPMA 5LYYA 2C3OA 3SSNA 3C15C 3QLUC 2YWBA 4D0GA 5B57C 2CV0A 3HCWA 3ZU5A 2VTEA 1R6TA 4K9KA 2FRDC 2DRIA 2KI5A 1IWPB 3LNNA 4FGSA 2VNSA 1OU0A 1P33A 5I7AA 2VT7A 3ICVA 4MLCA 4XDHA 2NU8A 1VJDA 2PPLA 4NSNA 3KWLA 4U2CA 3EXG2 1YAJA 1JE1A 3U39A 4D92A 4DM7A 4R2JA 5BQ3A 2GN0A 3PFFA 1YTLA 3QWAA 3S3TA 1KTVA 2CLCX 1P1JA 3EASA 1DGQA 4WKPA 1NVWQ 5EA2A 1OAAA 3G9QA 1KJ8A 1QJCA 4P5PA 3J7AC 3EZLA 2OOKA 3FWPA 4ZRDA 2D2FA 5K8LA 3OQ6A 3O3OB 1RIIA 4I50F 1E9BA 4HQ6A 2HJSA 1J39A 3COYA 4U02A 3OOCA 1KMMA 1U63A 3JQGB 3GV0A 1ESNA 4PZEA 5H68A 1PZNA 3CSDA 4GS5A 4IKPA 1J9EA 3AK4A 4NV3A 1EDBA 4JC0A 2VT6A 1A8SA 3A9CA 1ZAYA 1IQRA 1HETA 1QQTA 1RD4A 3DOFA 4FFPA 3GOHA 3F7TA 1ORWA 3C3XA 4QXMA 3UENA 1DIAA 3GLRA 5EHQA 2CLDX 3NIFB 2J9FA 1GTMA 3UMVA 3GRVA 3NWOA 4ENRA 1OB0A 5AW4A 4Z7NB 1E2BA 3DMTA 3A9VA 5KNCH 1WQ3A 4R6XA 3IPAA 3TBKA 3U44A 7ABPA 2JGKA 3G17A 1SUSA 3H6GA 2J5BA 2CBGA 2MTBA 2Y4OA 3JWPA 4DCNA 1EBUA 1GGHA 5B53A 1VG9B 1FNSA 3E03A 3N2YA 1N34B 4B0PA 3KLMX 4DCSA 3KD3A 3WB9A 2VC2B 4EJSA 2XMSA 3OIWA 3IHKA 1CQPA 2GYWA 4NL4H 4RZHA 5DM0A 4BAUA 3I23A 4U7JA 1KYZA 1X3LA 1DRWA 3EY9A 3FCSB 3CVJA 4ADSG 1ZGHA 5FPQA 1VQ7B 2NU6A 2QYHA 5D84A 5FYQA 2WD9A 3FSRA 2JKVA 5C8YA 3ADCA 3R9XA 2EP7A 1PWZA 1DVRA 5EKTA 3E81A 3QVLA 4F8YA 1QIDA 1VJCA 1DWUA 2OHFA 4R0VA 2DYIA 3TL6A 1V95A 4C3VA 3MRVA 2X7XA 5GZ6A 2HJHA 4D96A 4O4LA 5T8KA 5DMXA 5LP6A 1T9HA 1W46A 4LX0A 1D2RA 1RM0A 5F9HA 1IN7A 4N03A 4HFMA 3VO1A 3DE6X 4DQLA 1X1AA 4M8KA 4EYKA 4PSVA 1H6CA 1I2AA 1NVFA 1NW9B 3DB1A 4BQFA 3UOWA 4DS3A 3ONDA 4KXLA 3KKLA 3ND8A 1TAHA 1BGVA 1CBUA 2PYDA 1MT3A 1I7LA 1IQ0A 1YQXA 2BBTA 2C5GA 2YJTD 4GWLA 4IMJB 5CDFE 3A37A 1ZHOA 1IUPA 1UK6A 3N2NA 2CEKA 2C5SA 2FZEA 1SQGA 2VYFA 1SOVA 4EBFA 5EKSA 1FP4A 3HCDA 4YAIA 1LLFA 1W48A 3IDFA 4DM3A 4ZOBA 1PUIA 1KETA 2FZGA 4NPCA 2ZXHA 2V4MA 2GN8A 1PNTA 2WIAA 5BW6B 3UMFA 3P5BA 3QOXA 5LYJF 2J5RA 1VE3A 2AG8A 4QYSA 2BWJA 3THOA 2IT1A 5CTJA 4LXYA 4BAGA 4M0EA 1H65A 4CM8A 4AKHA 1EM6A 2AUTA 2KQUA 1JFLA 4H0NA 4IXNA 2JBWA 2RG7A 3LW8A 3NYRA 5EJMA 2F1HA 3VDMA 3ZU2A 2QUKA 3ZW9A 1EUQA 3HY4A 1K3TA 3MJSA 1T35A 4OQLA 4OAQA 3WV4A 1THTA 4IJ6A 2BGNA 2QENA 2VKTA 3MGBA 5JQGA 3IMFA 1E1RD 3M4JA 1F9EA 3BQMB 3HKDA 2CLIB 5G4KA 3ZKWB 2ZUEA 3I01A 1FYFA 1PZGA 4A4DA 3NXKA 4WNAA 4MA0A 1CUSA 2IPAB 1YTUA 1R0CA 3G7SA 1UFVA 3GJSA 2HZ7A 1JQJC 3BWYA 5DGIA 4FS3A 2G1JA 2F90A 2BR4A 5AKKA 4K9SA 1H2XA 2AUMA 4NFLA 1UXJA 4RVGA 3OKFA 3KDPA 5K6TA 2FG5A 4DUGD 3GGSA 5AW8A 5JC8A 4Q19A 3Q6RA 3GAZA 4RGVA 2OCAA 3BE5A 2VEDA 2Y0PA 4KRFA 3D64A 2AMJA 1F2UA 1O96B 1Q19A 2GBCA 4P2NA 1N2CA 2VDVE 1MFZA 3NT2A 3DZIA 4H4CA 3FFXA 2NVUA 4XX1A 3AEUA 3SOZA 1P0CA 5K2MA 3PEWA 5K9ZA 5JZOA 4ITRC 1QVZA 4LJ6A 1QYRA 4F3CA 1O6CA 3LHFA 1XQVA 1GUDA 3LA6A 2REBA 5KQRA 5KYXB 1VP3A 1XN1A 1Z34A 4K28A 2E4UA 3D9QX 2R97A 1EX9A 2QSYA 3KEWA 4H2DA 4I1OA 5DK4A 3QLTA 2F8MA 4RLFA 3TW8B 1B8OA 5EJIA 1EPUA 2JDIA 3EXHC 3EZ6A 3IMEA 3PCXA 4BLVA 3N0VA 2FN3A 4Y6LA 3QVMA 2IEAA 1R6UA 4JP3A 4XR9A 1MB4A 3SX0A 3C48A 2ZROA 4XM3A 3LBFA 1NW7A 4ZYWA 1O0SA 1Y1RA 2YC4C 1D0IA 1I4WA 1QF9A 3EBPA 4DMLA 5C51B 4DV7B 3JZDA 2QAGC 3I4FA 2I34A 2GYVA 4MLPA 1P4GA 1PTJA 3GVLA 1XHLA 1XZNA 3UYKA 1G38A 1T36A 1X7DA 2YXBA 2OZLA 2PZMA 2YFKA 2ZB7A 4J1TA 4KLAA 3BE6A 1F9AA 4PS0A 1FBTA 4H1WA 5IXYA 1JQ3A 1WULS 1X9IA 2ZRQA 3BCUA 3OZBA 3FBWA 3PYLA 2R6CA 4J2OA 2Y68A 4Z6KA 3QEBZ 3NLLA 4MUGA 3OPVA 4B3DA 3RUFA 1C4OA 2CHFA 3FETA 3GRFA 2ZYHA 3NTRA 3QP9A 3HL4A 4L85A 4YCDA 5IYZA 1E2NA 1JQAA 3DUWA 1NLFA 4JP1A 4Y2TA 1SUDA 2Z9DA 1AJEA 3D6TB 4LI3X 1TF7A 4LTNA 2X6QA 4G01B 3NHBA 3LKBA 2DUNA 1UJ4A 3QLVC 3FPPA 1KC1A 2HHAA 3LQRA 3K9LA 3NIWA 4XVCA 1HDYA 2EHJA 2XUZA 2P1ZA 4RIIA 1MGPA 1RJDA 4BNKA 3ZS8A 4GF5A 3G9ZA 4CF3A 4F1JA 1X1BA 2WFLB 1Y48E 5EUBA 1RZUA 5HNKA 3HRHA 3O90A 1DJLA 3Q39A 2A78A 2QGZA 4XL9A 4CLEA 1NJID 5DW0A 4JOSA 3TNFA 4CIXA 3CX8A 1JNXX 3PZBA 4JC5A 1WZIA 1B74A 3FJOA 1L8AA 3L8ZA 3GUYA 5GM2A 1JLLA 3KAJA 2QG9A 2YBEA 2J08A 4EW6A 2P67A 2VXOA 5BN3A 2CFCA 2ZRBA 4IS2A 4QRDA 5I8WA 4JLNA 1LBSA 2ATIA 3AM4A 2PBLA 3C1TA 2QTZA 3V6LA 2CEAA 5AD1A 4D46A 3IVMA 4P6YA 2IZ1A 3DNMA 4FP9A 1TRHA 3R6WA 4OXYA 3ZPNA 1KVSA 5BSTA 2IV3A 2QSJA 1U0SY 4WPGA 3WDLA 2Y1LA 5K6RA 2WJPA 1JAYA 3DAFA 4WOPA 1N8KA 4YB8A 4J0FA 5AHOA 4DUYB 2O2EA 4TMXA 1KFEB 1MZVA 1P7WA 2Q9CA 2QVCA 3H5NA 5DRTA 1NT2A 3WVNA 5I7EA 3R7WB 3S2UA 3FTCA 3HI4A 2OHXA 1OX6A 4QNNA 2IBSA 2OVFA 3PK0A 4JDUA 3RTCA 2Z8ZA 3H6HA 1UC5B 4Q02A 4WGGA 4CYMA 3LX8A 2EWWA 3K71B 1E4EB 1Z37A 3ASYA 3DXZA 4POAA 1YL5A 4X1IB 1N0HA 3R3UA 3ENZA 5JBQA 1F12A 4Z99A 5DYIA 2V1XA 3WLPA 4WBNF 5KHOC 4O59O 2YHAA 3BMOB 4XGQA 3I1JA 5FWXB 3MJHA 4OYYA 2CE2X 2AVNA 4H7JA 5JYEA 2IIPA 3ILYA 3CCCA 2G72A 2O7QA 2W2OA 4BN5A 3HDJA 2I67A 3HKEB 5FOTA 3ZWPA 3H1TA 1G6KA 1RHRA 4Z1MA 1Z2AA 2ATCA 1GD1O 3C87A 4CUZA 3TDKA 1AK2A 1K7YA 3RD5A 2YY7A 3IESA 4Y2SA 3IELA 3HB7A 4F3KA 1QHGA 1Z0AA 2H1IA 3ETCA 2XA2A 3LQYA 4X97A 4R8RA 2XD9A 5BR4A 1GSHA 3UW1A 3W3ZB 4XWOA 3LD9A 3ZDFA 3SC2A 5JPDA 1DWOA 1Q14A 5I4KA 1RU3A 1XZLA 3COSA 1H2RS 1SVIA 2GZ1A 3A1VA 3B6EA 3EDQA 1SWWA 3IAS6 4HXGA 2WMYA 4FB5A 2OO5C 3A9RA 3C3YA 3U2QA 2XR1A 5JI2E 2UVQA 1A7KA 3KCNA 5FPKA 1EXNA 2BM1A 4Z4VA 4TMWA 1EGAA 1M72A 1R3UA 1TQHA 4NMLA 4R8VA 3RABA 1FFSA 3T06B 2X0JA 1E4VA 3EXHB 5LU9A 5CEFA 1GYRA 3BSFA 4ZP1A 3IBCA 4HX9A 1KD1D 4ERNA 3ZWCA 4N39A 4TXLA 4AM8A 2C8VA 2ZJ4A 3CVVA 1NAHA 1CR2A 1FLAA 1SVKA 2ES4A 2FKNA 4ZO7A 2ZEJA 3GLSA 5NULA 3VYRB 3CX3A 1M76A 4AN1A 1K6XA 1X1QA 2QAGB 3W2FA 1RXCA 2JDID 2NT3A 4JENA 4O2BA 5FOVA 3CMEB 4KWCA 1YZTA 3BWVA 4KOEC 2N42A 3MC1A 4F46A 1Q0RA 3N2KA 4ZEMA 1ZR2A 3HCNA 3U16A 1ZMOA 3UGTA 3EB9A 3IKMB 3KYJB 4J91A 2ORED 4DDHA 4F85A 2DPXA 2J4DA 4LXQA 1JMKC 2C2KA 3DEZA 3V7YA 1AHHA 1K8YB 2D2IA 2JBAA 2VRCA 2XGJA 4YCBA 4Z9YA 1MKYA 3WK8A 4R69A 2O19A 2QNIA 3S1LA 4IF6A 3IILA 1K9MD 5T4HA 1CZLA 1WXEA 2ZZMA 3IVCA 4XA8A 1CIPA 2V5UA 3B1VA 4Z4WA 3E1KA 5BYAA 1L4LA 2NO1A 3IEPA 2Y92A 3BDAA 1VG0B 3OZWA 3UV6A 1KSFX 5KNDA 4KXXA 3LVFO 1FU7A 4RVSA 4C29A 4PWYA 3ZQ6A 1XNRB 3DKIA 2O2SA 4KIJA 1UD6A 1P77A 3IA7A 4OH1A 2AHOA 3JASA 4BO6A 4JAVC 2P6MA 1SHLA 2PUHA 1QHFA 3QF4B 4IHAA 1B6GA 2VWGA 3C97A 5F77A 5KKCA 1Z07A 1EYZA 4CIVA 4C30A 4HAIA 2WHQA 4W5QA 3WNBA 3Q6NA 2VQEB 3WWPA 2G77B 4QTUB 1PG5A 5J59A 1YFLA 3PT5A 4CLRA 3CPJB 5EJ6A 2XH8A 1N8RD 2IYTA 3WJ1A 4BUJA 4N49A 3NBQA 3QX3A 3H2KA 3GR6A 4PXYA 1DBRA 2X5NA 3TAUA 2PZFA 4RHUA 3CX7A 3VV3A 3ZD9A 3HP4A 5DNCA 3IPLA 4TV9B 2AZ4A 3BQJA 3ZNPA 9ATCA 3UMYA 1U0BB 3RRFA 4CKZA 3QU9A 1IN5A 1QHHA 1RYHA 1PQUA 4XFDA 2Q3CA 1XNJA 3E9EA 3GUHA 4QC2A 4Z0HO 1FVXA 1ORIA 1HNZB 3EPHA 1Q5PA 1TZBA 3OW2B 5HS6A 3ETEA 1S2OA 2QN9A 4KC0A 2X4DA 3COJA 5IEJA 2C0CA 2VXCA 2XWQA 4X7MA 3UEOA 3A9SA 3D6FA 3IEUA 5EP1A 1Z6PA 1GA1A 5KCZA 1ONPA 3QHPA 4MH0R 5C37A 2FK7A 5JC1A 1XDSA 5KYYA 1A1SA 1YDFA 3AU9A 3H4MA 1EVLA 2X2OA 3ESZA 2PMCA 4R1NA 2MSKA 2Q3FA 4ND7A 4JI3B 1AIPA 1SXPA 1GL6A 1LQ2A 1GZ7A 2FTKE 1GPMA 2PUWA 1QMPA 2ADMA 2QUBA 4HFRA 1GZUA 2A4KA 2ZJ6A 1BMDA 4HZUB 1GKLA 4R05A 3CRNA 4NONA 2IUUA 3STTA 1DBIA 3IEKA 4QUDA 2KLBA 4CL0A 2JLXA 4Q9LA 1VYVA 1FS6A 3M0EA 2W6IA 2IUTA 4P8RA 4AXBA 1K8RA 1C1DA 1U0HC 4Z3OA 1ZVKA 4HN4B 4GYJA 2Z1MA 1PU2A 5B2FA 2D3NA 1V9LA 1F51E 2IW1A 1IN6A 1ZCAA 3ND7A 2CMDA 4LIPD 1P80A 3PUIA 2DY1A 5CJJA 3WGLA 5DLEA 1V1RB 3PXUA 5CA0F 3VHXA 4Z3DA 3QX8A 4LG1A 3TINA 4D4HA 2BEWB 1P7ZA 2A0WA 2FFRA 3LOQA 5ADVA 2CCGA 1SCJA 4JP2A 3WHPA 3ENNA 1WU7A 1EUCB 1XZCA 3L4BA 5BP7A 4C14A 2XHZA 4NULA 2XUPA 3RSOA 1KO5A 4EB6A 1KERA 4Z1MD 4DG5A 5JZ9A 1SULA 3OKXA 3JARA 3M83A 4QE3A 1TAQA 4DB4A 4M0FA 4BE9A 1LK0A 4A82A 2C4KA 4KR2A 3BH4A 1L5QA 1DQNA 1OC2A 2HLPA 1G6HA 3IR7A 3OD1A 4HUQA 2MSEB 3WGZA 1PR4A 1SCQA 4B3JA 4TMVA 1N3LA 3I6MA 1ZH6A 2G6TA 5CP8A 3VNSA 5C7LO 1ECBA 5T7BA 4JX8A 1GAXA 1OZFA 5IARA 3A2NA 4ZGBA 2G5TA 1BVYF 4M6WA 4MW0A 2IYWA 5A7FA 3T3IA 2WTUA 5FNVA 4NAHA 4L16A 3IAM1 1A7AA 2G40A 1AVTA 4QODA 3UTCA 3RRZA 3NTUA 2UXDB 1YS7A 3TRKA 3HJHA 4ALLA 1QP4A 2X9LA 5DHFA 3AUJB 1ARZA 1JHXA 1TYAE 2VJMA 2P9CA 5ARDA 4AVYA 4MTLA 3KFLA 2QMZA 3G85A 2PL3A 3BHNA 3GBVA 4FDLA 2HHLA 1JZSA 4WXHA 3FHOA 1AS2A 3VYVA 1VB5A 3A28A 2BGUA 2E21A 2Q5FA 4IIBA 2HRBA 1GPWB 4PYLA 4URWR 1CJSA 1HKHA 1C1YA 1OTHA 2QHXA 1P1FA 2WYIA 3GO4A 4QQRA 1N5IA 4W9NC 3ZE7A 4EYQA 1Z3CA 1J21A 3SYNA 5LQSA 4CQMA 4DMGA 1AKEA 3CYFA 2IY9A 3UKDA 3BZUA 4S0XA 3KQYA 1KWGA 1N6IA 4ZGNB 1SHTX 1NF3A 1YQEA 2GAIA 2PZKA 1QG4A 2QLBA 1E20A 4NLLA 2IK8A 5HKKA 4U63A 3UAOA 4HNQA 4Q7QA 4M83A 5CCXA 2WAXA 3CINA 1VIYA 1MVLA 1M2JA 1NVDA 4BU0A 4QULA 5DYWA 3UA4A 3MWLA 2PSHA 2OHVA 4YRTA 2I2FA 1HURA 3L77A 5KNDD 2PD6A 3K8YA 1M5RA 2A9KA 4PQEA 1G21B 3EIXA 1T34A 2CHGA 4ZCLA 5FOQA 5ELXA 4RFVA 4R1QA 2W48A 5L3SA 1BD3A 4L5AA 4AICA 4QGFA 1VYTA 4NBRA 7REQB 3HCFA 3NGXA 2CFRA 4C7XA 2DU8A 1DJNA 3LHKA 5EQFA 5CW2A 4NJEB 4D99A 2Z8YA 4GO1A 4EB8A 1YU9A 3O3CA 1SQFA 3IHLA 3UHOA 2IH2A 2AXNA 1SC1A 2FWAA 3B6MA 3BSSA 3CHYA 1YULA 5KAMA 1X86B 3G0GA 3D7SA 1BE8A 5HQ3A 1E64A 3STWA 1GQRA 5ADWA 3B8HA 3WB2A 1XLTC 1ZVMA 4PO8A 3K8OE 3OBBA 4I66A 2EKZA 3TW0A 2XMGA 3C6KA 3WGVA 4X7CA 3Q6QA 1EH5A 1UZLA 3QLEA 4P33A 3KSBC 3L18A 4FYMA 1C9JA 4R4JA 2ZBUA 1HDIA 3NRCA 3BC9A 4LUCA 2A9QA 4MK4A 3F7NA 4YJGA 4RF3A 5FQNA 5IVDA 4EOGA 2A5GA 5I6DA 4NYMR 1R4MA 3ZLTA 4I5FA 4LCJA 4YC7A 2IUEA 1RXYA 4CMIA 5EMNA 2Y1OA 1SD1A 3AETB 1OT5A 1QIKA 2CJWA 5K8IA 5JECA 2RK4A 4MQ5A 3RWBA 3DD1A 2VLBA 3LL7A 4G5RA 5CH5A 2P2NA 3H11B 3UMGA 1KS2A 2AFRA 3NHRA 2IXTA 3QBTA 4NDZA 2ZXIA 5JHHB 3E3OA 5FBLB 1QDEA 1UPTA 3M6FA 2JGFA 4MVXA 3WK4A 4D5GA 5HWSA 2XB9A 2GQ0A 3K30A 3KPYA 1Z36A 2W6ID 2DSTA 3C70A 5CIQA 1CUHA 1M73E 1L4YA 1DIOB 3MS7A 3PF8A 1OGIA 2EERA 4UQOA 5IW8A 3TD6A 4YRGA 2FWRA 4G85A 4UULA 2JCYA 1SUBA 1H3EA 2CCJA 2Q5CA 1PJZA 4QG7A 2PKWA 1IZ7A 3EDRA 1U2SA 1M1YE 5JWRA 5HR5A 4BX0A 3GLFE 5C1PA 3AF4A 1TZCA 3HB4X 2ZZKA 3OI7A 4GMFA 4TV8F 5LUAA 3WADA 1D1TA 1IG3A 1WB6A 3WYFA 3PENA 2QRVA 3JZMA 3ACBA 3AESB 1UBUS 3R40A 3C4VA 2HLDA 3IVRA 3CXCB 1DINA 3L7NA 3FE2A 2XW6A 7MDHA 1FFBA 5BMVB 2TMYA 2FB9A 1TVKB 1M2OA 3HA2A 2O0KA 3N0TA 2AXEA 1K4YA 4K9PA 3DTVB 2KPOA 2D54A 4URHA 1OILA 2DC1A 4PFQA 3PD7A 2E49A 3EVDA 4LVUA 1QFYA 2PX2A 1E7QA 3M5PA 5DBFA 3AERB 4IOLA 3QMPA 4Q6WA 2DETA 2HA7A 2R68A 2CY0A 5A9SA 3W5CA 2XAAA 4RD0A 3PIDA 3SJBA 4QLAA 1KJJA 2E9SA 1WQ4A 5E4TA 4C78A 4PSCA 1OU4A 1E0DA 3GROA 4PINA 1NN5A 3R7AA 5BNFA 1YITB 4LYJA 5IZ4A 1Q0ZA 1CZKA 1UUFA 1SOMA 1OWPA 2B6NA 2RI1A 4X8OA 4YJHB 4BFUA 4DLAA 1E61A 1JVBA 2Q7XA 1MNAA 3VC2A 1ZMBA 3AF3A 3DAHA 3HCEA 2CMKA 1X77A 3IR6A 1O0BA 4X45A 2YFHA 5AN9A 1EJ0A 3E3LA 3P0HA 3BQNB 3EA4A 1NMSA 3FD8A 3VU1A 2XIJA 4EPXA 1ZSYA 2ID9A 3KT3A 4UMVA 1YKSA 4G1UC 4UHFA 4EDFA 4NCAA 3PXXA 4QX6A 3A36A 2CL5A 4HAZA 2WY2D 2HLHA 4WK0B 4ZEVA 1QH8A 1I9GA 2OAEA 3D2LA 4CQMD 5ADHA 3BYZA 4PFJA 1WLSA 2B5OA 4IGEA 1YR7A 4KGVA 3BWEA 2Q4BA 3WL8A 2PUDA 4CKBA 1GZSA 2ZDHA 2ZU6A 3JQ7