2C4TA

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with an inhibitor, an analogue of s- adenosyl methionine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
publication title Substrates and Inhibitors of the Fluorinase from Streptomyces Cattleya
rcsb
source organism Streptomyces cattleya
molecule tags Transferase
total genus 74
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2005-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2c4tA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2c4tA01
1WU8A 2V7WA 5B6IA 2ZBVA 2CBXA 2V7XA 2Q6OA 2F4NA 2C2WA 1RQPA 2Q6LA 2ZBUA 2Q6KA 2WR8A 5LMZA 2V7TA 2CW5A 5FIUA 2C4UA 2V7UA 4CQJA 2C4TA 1RQRA 2CC2A 2V7VA 2Q6IA 2C5HA 2C5BA
chains in the Genus database with same CATH superfamily
2OBXA 1C4WA 1B14A 4OBBA 3NATA 2P6PA 1LSJA 1CG6A 1VQ6B 2C2MA 4A4DA 1VXRA 4ZU3A 3OPYB 5J2UB 3AP2A 3NZEA 3HZOA 3H5VA 2O14A 3RB8A 3H0KA 1UDRA 2EP8A 4UTXA 2J85A 4XLLA 4RACA 1H9AA 3ENVA 3CEJA 4HNVA 1ZAKA 2VTVA 5JFGA 1B3RA 3HKDA 1JI3A 2FPUA 4RZQA 1JHQA 1C2YA 1RQ2A 3ETEA 4XCVA 1HE3A 2J9FB 5DM70 3HXQA 1PFKA 2CVHA 3CNOA 2C4VA 1YU6A 4ZEMA 2H4ZA 1H2BA 1PVDA 1YS1X 3T5AA 4AKGA 3NUZA 5IWAB 1HRDA 1TD9A 2WSYB 5DB4A 5HF6A 3U4CA 1FCJA 1SUSA 4OTZA 3V46A 4DLXA 2GPJA 3QBDA 2GESA 2W83A 1VBMA 3R3WA 2DJIA 1RWBA 3HXKA 4MW6A 1BCSA 4D97A 1N08A 2R1UA 2HCRA 4B6EA 1F7VA 1E0JA 3LLCA 1D04A 5GOZA 3H87A 2IHUA 3P2EA 1C4OA 1WHTA 2I6TA 2Q2VA 2SKCA 3TLMA 1TGYA 2QRNA 3O8NA 3PGKA 1Y1LA 2GM3A 3GLSA 3FDIA 2H1IA 4G4GA 2I22A 3ICPA 4X93A 5H80A 2FN7A 5AD1A 2H1WA 5F3WB 4TYNA 2H2IA 4P26A 1BVUA 1K8QA 3OWOA 4U9IS 3WQQA 5CP8A 1TO1E 3CCLB 3TPFA 4FMBB 4L5YA 3I39X 3RS2A 1X1DA 4DB2A 2R9VA 1QAOA 2FR1A 1U4SA 2I71A 5FYQA 4B4VA 2C9OA 4P33A 5FBWB 3SGLA 2COKA 3W2FA 3BWVA 3AF0A 3KV3O 4PX5A 5EIOA 3TNDA 3EFOB 821PA 1TYCA 3VC1A 2AX4A 4H1UA 4HDOB 3WQZA 5BY2A 2EJUA 1E3LA 4B31A 1U3DA 2Z8YA 4HNAB 1QG0A 1TZKA 4JI8B 2GHQA 4N03A 3CB4A 1R9MA 5KMGB 3P9QA 2XITA 3HEMA 1E32A 2G5GX 3IIEA 1SCJA 1UKZA 1DX9A 4ZVNA 5JRZA 1TVEA 1Y3FE 3O31A 4H4CA 1P4JA 5JAOA 1PR3A 2AKYA 2O0JA 2JA2A 1XPOA 1A8HA 2P2GA 4Y3UA 1M2FA 2R7NA 4P3IA 3AETA 4NCIA 2RONA 4HV4A 1BA2A 3TFOA 2FSVA 3LOUA 2F64A 3ASTA 2QZ9A 1GY8A 2REBA 3KL4A 4FFLA 4Q4JB 4F2GA 2Q5EA 2F3RA 4K6HA 5U4QA 1POXA 2FP4A 2Q4RA 4ILKA 4WLFA 1GGJA 2DQYA 3UF0A 3A4LA 3UK7A 3A1NA 3RDPA 2X0DA 3V1MA 4ATNA 1PKVA 2V4DA 1KDOA 1TQ4A 4ZVKA 1T1EA 1TK9A 2L17A 3A8TA 3NIDB 4M4SA 2EJBA 3OBIA 1ISMA 5DHRA 2GXSA 2Y1GA 3CWZA 1J07A 1R9GA 4F86A 7YASA 1E1RD 2JLVA 3CCVB 3I62A 5E6TA 3IOEA 1ULBA 2QSJA 4JLMA 1HMYA 2GN9A 2P4UA 3AEQB 3H4IA 2GH1A 3MRXA 4R68A 2J8ZA 3ZDFA 1L3CA 3A11A 1RQGA 1Z45A 4X7CA 3ZWQA 1XAGA 5A3RA 4K05A 4EVQA 5K6RA 1V1RB 3WV5A 4YRTA 1L5QA 3EOZA 3V8NA 2ZYTX 2QB5A 3IAAA 4YRZA 4NYMQ 3GT4A 3GN1A 4J0CA 1V8ZA 4EHBA 3DLBA 1HH4A 1V5GA 4XVHA 1A5ZA 3L07A 4L78A 3ILHA 2HJRA 4AK9A 1AKMA 1N5LA 2ZYAA 1E2EA 1QTIA 4YWJA 3A10A 4TUYA 1C8LA 2O52A 1TJ5A 2V98A 4QQRA 3KQYA 4FHCA 1S0UA 1GCIA 1HI9A 2Z83A 2VJKA 1UP7A 3FHLA 3NTQA 4HXGA 1AG9A 5K7SA 2IUYA 3C6KA 5FD8A 3ZJUA 1JG3A 4UQLA 2RD2A 1EVYA 3OY7A 1E60A 3IRUA 4XW2A 1PYGA 5JMPA 4MS1A 2XYVA 4LC1A 5FUWA 3ES9A 4YUZA 4EO7A 2Q9UA 4QPNA 2VHJA 3BWEA 5LLSA 4DMGA 1VB5A 1YZUA 3FGZA 3M4XA 3M6VA 1QU3A 3GVKA 5K8IA 4P5EA 1GA1A 3GGOA 3R09A 4BQQA 1X1TA 2WYHA 5A3SA 2W6CX 2VCYA 4PLGA 5BSMA 3ZEAA 3AL3A 4RV5A 5B6JA 4B48A 1P6QA 1WETA 2R25B 1A76A 2QTNA 3G8YA 4K1LA 4TOIA 1A1VA 2IP4A 2NO0A 1HDXA 2UZ3A 3E2PA 4PPNA 3RJMA 2PKCA 3PFGA 4LYAA 1VSVA 2QG4A 5C3UA 5BN3A 3HL0A 4N8DA 4DCMA 5AVRA 1M2EA 5H1YA 2C2HA 4EY4A 4QUZA 3QKSB 1BU8A 3R6JA 1NNSA 3BNWA 1ZD3A 1EHYA 1KJZA 1LTQA 1E1QA 3AUSA 4M36A 5HM6A 4QJ3A 4HDRB 3T12A 3RGGA 4CGZA 3ZWXA 3ZS8A 2ANCA 3DOCA 1NLMA 2YZMA 1XN1A 2WHEA 1OU4A 2NO4A 3SLDA 4HB0A 3SCZA 3Q72A 5CFOA 4Z4RA 4H60A 5FPSA 4HAXA 1VQ4B 4EL0A 1NSYA 4DJ5X 2H9AA 4EDFA 4EM6A 4QFMA 4GNKA 4WJLA 3V4LA 1J8YF 2FW8A 3HL4A 3WGLA 2XZPA 1LDEA 1NI4A 2J3IA 4O4IA 2UU9B 5E6UA 3WIEA 2B69A 4JOBA 4CLXA 1T5EA 5J9FA 1LUAA 4DCGA 3AB7A 4XUDA 4R41A 1P9RA 3S3TA 1EZ4A 1TEVA 2UKDA 3R6LA 3DQZA 4G67A 3LW8A 4FFNA 2YICA 4GFDA 2VF5X 5FHRA 1DG1G 4YAFA 3T4EA 1VSQA 3OU2A 1VKOA 1JFSA 1PJRA 5E0OA 5L8VA 2Y8EA 4KQGA 1Z7EA 5KCMA 1EWYA 1FVXA 1H2FA 4DKJA 4DLRA 5T5QA 3ZU3A 4A6XA 5HDQA 5EPOA 3S70A 1XDSA 3KB2A 5CB4B 1EP3B 1G8GA 4P08A 3TG2A 1H1LB 3LQ4A 1JILA 2A14A 3MGCA 4JJ4A 4NECA 4UTRA 4FFDA 4Y30A 5KJCA 3AVYA 3CV3A 1JEJA 3C1OA 1ITZA 3O4GA 3WXMA 2J4CA 4ID9A 2P9JA 2CZCA 3GRRA 3CX7A 2UXCB 1B2LA 4KSCA 1ZM2A 3NRBA 4KN6A 2B4QA 1PZHA 3IELA 2VYVA 4MWDA 3WSWA 1SK9A 5GV7A 3MNFA 1PZGA 3D7LA 2QRMA 5AH0A 2FFJA 4RTMA 2I6FA 2J08A 4FXUA 2IZ1A 3A4MA 3FX2A 4GYKA 3ZZMA 4PS1A 3GLIE 1RYFA 2FN8A 2YBDA 1T1JA 1ADBA 4WZEA 4DV5B 4P98A 4ER5A 1NBME 4IICA 4PICA 4B6FA 4C2AA 5I7WA 1O6GA 4PAQA 2V4ZA 1K88A 1KZ6A 1UJ6A 4L9RA 4BVBA 3LNNA 3REGA 4RKEA 2QVLA 1ACLA 3FOFC 1NF9A 1Z5ZA 1WDKA 1N8NA 3TQTA 4QDJA 3QEMB 2AQHA 1S4MA 4TS3A 1R0YA 5JFTA 1JMVA 3LWNA 4IGEA 4L95C 4P2NA 4R16A 2AFHE 2BMWA 4FKZA 1MB0A 4IUDS 2Q29A 2VBVA 1RRPA 3CLKA 4N9QA 4LN1A 1KC3A 4RY2A 4WXPA 4EYEA 3O8RA 1JFTA 1GZHB 1Z12A 3CPSA 3KAPA 3THRA 3SC2A 2XGOA 2OL4A 2OB2A 3OFNA 1U65A 1GGKA 3CT4A 1UFKA 4AY5A 2JDID 2WNHA 5EWMB 3KVOA 1SUAA 5H68A 4UULA 3LCUA 3PPIA 4LHWA 3RBXA 3T7IA 1K7YA 3IMKA 1X7YB 4D4GA 1IZZA 4WFKA 5I5EA 2YQZA 4DBZA 1K8ZB 3WKCA 5KVSA 1PKEA 2QZPA 3PQ8A 3F9RA 3L7YA 3S40A 4EFDA 3LTEA 1ODCA 2B8JA 4B87A 1V4NA 1QUFA 2AR9A 5JR3A 4INOA 1B2RA 1AZLA 3LPAA 3L0DA 1IHDA 5SZJA 2EATA 5COAA 4DANA 3AKYA 1QGUA 2NAFA 5BXYA 2HADA 4CR6A 3Q8KA 1P4HA 2ZP1A 1GPKA 3QGMA 2AXNA 3NHRA 4EYSA 5BMVF 4IIJB 1U8CB 4M9ZA 1T3GA 1XZPA 1W87A 2XBUA 3D54D 1O6BA 2FZ4A 3A3KA 2W8BA 4MUBA 3ZJYA 4EB8A 1KR2A 2XGGA 2BFCB 3N8DA 4UVHA 4EG4A 2UZAA 3Q1KA 4X20B 4LYHA 4TRRA 5DVZA 1V7PC 1L7RA 1EA5A 4H4EA 1GKKA 4YCNA 3FDZB 3OJEA 4OIFA 4NWIA 1UK9A 2GFHA 1DADA 3W8EA 4L8GA 3QKTA 1UADA 3NO4A 2VPYA 4AKHA 2A88A 2E0IA 2QYHA 1YJNB 3G8BA 4JT8A 4R01A 1R8YA 5L3RA 1ZWKA 1GL9B 1I13A 2CWDA 2OO5C 4WEQA 5HQ3B 1CTQA 1E5LA 2C29D 1HE5A 4GR5A 1O57A 3OQIB 1LRJA 2ZXFA 5LQUA 3AP1A 3OZ7A 1KJQA 3OOHA 1RJDA 3T94A 2QYOA 4J7UA 1VE7A 3BCUA 1C3LA 4IMIB 4NEQA 4OQDA 4XTRA 1XMQB 4MAAA 4NMMA 4MGKR 3KJEA 5HZBA 3CSSA 3IBYA 4WFQA 1CDOA 1HZJA 3DAGA 3FG9A 3D8SA 4QE3A 4CLRB 3G85A 3HCDA 3L7AA 2FHPA 4MK4A 4FW8A 5AOVA 3S68A 1COWA 3EGWA 3N9IA 3Q87B 5FLKA 2CL7X 4P12A 1QO0D 4O2BF 1PTJC 5ULLA 4F38A 4DQKA 1KJYA 2MSNA 1XAHA 2BWJA 2A78A 5IYPA 3OIFA 1KRHA 1KHTA 2LCIA 3DDSA 3OC0A 1O6ZA 1R0XA 5AKYA 1GR1A 1ZW1A 2COUA 5ANRB 2GCIA 3GLIB 4IYJA 3RT9A 2GCEA 2C2YA 4IJKA 1G8YA 1ADJA 1MA3A 3RLFA 1LQTA 1WB4A 1L4BA 3LDAA 4K3UA 5DMXA 2HJGA 4I4CA 3S6JA 4BKPA 4C29A 5CM8B 1R66A 4FT2A 1PK8A 2IGBA 4XM0A 5FB3A 4YEJA 1WMBA 3KTAB 5HJEA 3AR6A 5T7BA 2FW7A 5M34A 4TV8F 3CJRA 7MDHA 2ZSKA 3F71A 3GPIA 2H0QA 1S4QA 3EQZA 4ND6A 1UM9B 2PGDA 2CFSA 3E3NA 4PY2A 4WK4B 2PZAA 3ENKA 2ZTMA 1Z0AA 3CEPB 3KHUA 1HNNA 2GEUA 4HWPA 3BA1A 3WP1B 4ZPJA 3CC8A 3NBYC 3ZDEA 1H2XA 1VLVA 5A06A 5KNDH 1SULA 1NPTO 2AFHB 2I29A 3C16C 4R9SA 2VSYA 1MAHA 2CEKA 4UAVA 3KQKA 4BLWA 2WJIA 3WWYA 1QYRA 5HJ5A 3I92A 1E43A 4DE5A 5B55A 3M6LA 4MHTA 1F2TB 3FJYA 5JV5A 3IURA 1F38A 1DKUA 5ICEA 4AS1A 2IS1A 1DCTA 3FRHA 3NS7A 1VG9B 3B6KA 3VJRA 3OFJA 1ZD1A 2M1XA 3SEJA 3DYIA 3C2QA 3PT5A 4ALNA 1N0UA 2GZAA 1Z22A 4AL4A 2ETXA 4EJ0A 5TQ2A 5CX4A 3TR5A 4V24A 3CVUA 2VPPA 5AVVA 4L27A 2AUMA 3CUVA 5KYYB 2HWKA 5ITZA 1K86A 3EVCA 5JSQA 4Z53A 3ZJVA 2J9ZB 2W58A 3A4TA 1IN7A 4WFJA 2O7NA 4B7XA 1J0XO 4EJSA 4EPWA 5EIXA 3BD6A 3IOCA 1GNPA 5B1HA 4YPOA 5HGXA 1L2TA 2HZ7A 2ZFUA 4DLTA 2O0KA 2PPVA 2AMVA 4HRYA 4NE7A 1GGFA 1SVKA 4OK3A 4ZQIA 1KVTA 3WGMA 4YYEA 4RS4A 2HEGA 3B7WA 2XWQA 3HY3A 3I01M 3H5TA 1G20A 1X1CA 1FDVA 4PZEA 2FZWA 2WU8A 5DNVA 2V54A 2B4YA 4WUVA 1TX4B 3EZGA 5F4OA 1UFRA 3WB1A 2BRUA 3CPEA 3UJCA 3HDGA 5JATA 4ZHQF 5CJJA 4BFYA 1W46A 3DBOB 4KKTA 1BE6A 3UMGA 1EJ2A 2Z1MA 6PFKA 5IH3A 4C0SA 4JQSA 1M3SA 1K06A 2WWVD 1TMGE 4AX4A 1J0DA 4HAOA 4YP0A 5DI3B 1I2AA 4CM3A 5DN9A 1ZNZA 1HOTA 1NLYA 2ZUBA 3WJ2A 1P19A 1GFWA 4PSCA 5E1MA 2XCQA 2E85A 4ZT6A 3MHTA 1AB6A 1WV1A 3W9BA 1UXJA 1SG0A 2WLTA 2DBZA 3PQ4A 4N3BA 4L1KA 5ALTA 4RF5A 1K9MD 1G8SA 3DLCA 1RW4A 1SB8A 3AB8A 3EIXA 3RSLA 2CMKA 2IK8A 2XSZA 1U9CA 2PR7A 3R7NA 1SVMA 1SIBE 2AX3A 2O5VA 1TUEA 3VH2A 2Y99A 3LBAA 2KMLA 2ZW9A 2XUHA 3N7UA 4ROSA 4I9NA 1MAWA 3ZLTA 4ARSA 4BMVA 1QVFB 3SWWA 1N7GA 1MKYA 1GRCA 1NBEA 2CJPA 5J58A 1SU4A 2GBGA 4BNWA 2R87A 4YK7A 3VHXA 1SC3A 1PDVA 2GAJA 1DZIA 2GZ3A 4B3DA 4TKVA 1YQXA 2PZ8A 2G5TA 1XEWY 3G2NA 3DDZX 3HUEA 1V8PA 2XQKA 3E1SA 1P9WA 2ONKA 4JN6B 4QIHA 2VJDA 1NW3A 4TL7A 4JLUA 3NHBA 3ZLVA 2R48A 4ENQA 3WDLA 3COWA 1SXJD 4QC2A 2WJ3A 1OW3B 2EU8A 1M1XB 3AERA 4DARA 3GBPA 4AM8A 5CIYA 1EU1A 4RTSA 1AB5A 2I4MA 5FUVA 3TXXA 2REQA 1QZTA 4IEIA 1J1IA 5EAIA 4RDJA 2XZTA 4BZQA 1E9RA 4C7BA 5K4AA 4EI7A 5G2OA 4MCAA 2CHEA 5AK3A 1TADA 2W2KA 1XEXB 3O7WA 1RR6A 4O5AA 4DCPA 4ZCIA 1ZXBA 1CULC 1UKBA 3EBPA 3RHFA 3IP9A 3D6JA 4JBIA 1UBLS 4AZ3A 5EIFA 4BFZA 3DFIA 2YOHA 3G0BA 2WWGA 4YJDA 3RYHA 1GUFA 2C5BA 1AS0A 4GEKA 2A1UA 1WUJS 2IITA 4LC0A 1MB4A 3I2HA 5E9QA 1KWKA 3A2KA 3ZWYA 2JGDB 2JJYA 3GVIA 3IUJA 3UMYA 3MILA 3LWZA 3QXSA 2Z3VA 1W76A 1OHHA 5FUYA 1BN6A 4HE6A 1N2EA 1BHO1 4KH1A 1CSEE 4C0WA 3UPTA 2ZIVB 3CZ9A 4R8SA 4BE7B 3TOCA 1CY7A 3UMMA 1NWHA 3GXBA 5DI9A 2D1RA 3GJQA 1WPCA 1J8FA 1ZUNA 2BMJA 3L18A 3K3PA 5ARCA 3ZGVA 4B32A 4E31A 1DJQA 1HFEL 1BXRB 3G4SB 2PA0A 3I42A 4WKCA 4M6WA 5TVGA 3T1HB 1RP7A 1NULA 1P33A 3K9FC 3S5UA 3U7HB 4F1JA 1LV7A 1N57A 2QRZA 3IVRA 4BNTA 1XJCA 1Z25A 3FNQA 5BOSA 1YT5A 3C0KA 3RS4A 3GYGA 4EI2A 2JKYA 1IEXA 4RFLA 1U5BB 1G18A 1B8VA 3CO5A 4N39A 3PE4A 2OBYA 5GJBA 1V3TA 2YYZA 1F8XA 3ONNA 2JIDA 3ZQ6A 3N3AC 3PFCA 4Z4CA 1G3UA 1NX9A 3G79A 5L3VA 1G6HA 4LZZA 3WLJA 4EG5A 5B5SA 1YZLA 4NNPA 1NI5A 2RK4A 2FG7C 1JPNA 3IP8A 2XYQA 3C3XA 4CTKA 1J5XA 4RE5A 1EBBA 1BG6A 1YVEI 2CBZA 3CUKA 4PHHA 5JS6A 3PUMA 3LP8A 4DZRA 1PT6A 4ISCA 4LCBA 2BDEA 1I4OA 4DG9A 2WTXA 2I80A 4ZXPA 4C4TA 4EA9A 2VAWA 1KVSA 4NF2A 4F3CA 1N5IA 4GLFA 3D4OA 1NN5A 1H2WA 1NJ6A 3KD2A 1FTNA 3S1AB 1EK1A 1MVNA 5JC8A 1YQWA 2K2QB 2B34A 4F8JA 3WE7A 3QW2A 4UUQA 2D2EA 4E5YA 1M7GA 2ZE6A 5T3UA 3C3KA 3UWOA 2QJOA 1XDWA 3BREA 2XY4A 4MB6A 4TMXA 4TXMA 2J3KA 2VJMA 3D0KA 2ZSDA 4LTMA 4OHXA 4PANA 4R2HA 3U9SA 3SZOA 1GTJ1 4QFCA 4R3WA 4U8HA 3SDSA 4F97A 1RC8A 1MP0A 3BEDA 1RXEA 1J9GA 5B1EA 4JLVA 3RC2A 3ZNNA 1M1KD 3H1GA 3O1LA 2OP1A 1N78A 5ECDA 1XBTA 4UAGA 1HT2E 1HEUA 2LKCA 1QDEA 1PLLA 1PL7A 2DT5A 2X86A 4AP9A 1BE8A 3OWXA 4MLZA 3SYKA 4BV9A 2ECQA 5ISMA 3VPDA 4WZKA 2MYPA 3ZZTA 1RNLA 4Z4YA 2G76A 1R8SA 2RDMA 3G8AA 3N2IA 4HNTA 2O2SA 1MC1A 3FF4A 4UAJA 1GPNA 2G9UA 4H15A 4P4SA 4YRKA 4AW9A 4FYIA 1UQUA 3WSVA 4BZPA 3BTUA 1V3UA 4J4HA 1FJXA 5EHIA 3WLQA 1PZMA 3AL2A 4LSWA 3DYVA 3IQHX 1Q6ZA 1U2EA 4DLWA 3GP5A 4HAWA 4DQDA 4E4YA 5AVWA 2IEZA 1BEZA 1T2CA 3PPWA 4W8GA 3EPKA 5JWHA 1ECJA 1TLTA 2VLBA 2EAUA 3CPXA 3ABOB 1YTLA 2WYOA 4N5IX 4CLEA 5JRJA 3S5JA 1HNXB 1N6RA 2JFZA 1AHIA 2VNHA 2WYUA 2B61A 3GFGA 3GJYA 1HBJA 4L8YA 5A5DA 5JMOA 3BXXA 5LU9A 2Z8XA 3ELUA 1EVQA 5F12A 1EQUA 3X2EA 2B1QA 1SQ5A 4RA9B 1FU7A 2EZ8A 2JEOA 2JB9A 3B1JA 4O1IA 1A5BB 3I30X 2C0CA 3ICCA 3JALA 1OA1A 4M49A 1E99A 2J5BA 1QHYA 2WNSA 4KCGA 2V58A 2XZLA 3A6DA 3GNSA 2G0AA 4I4TB 1U0GA 2FZLA 2WA1A 5TPWB 4RK4A 4ARZB 4DLBA 4MYDA 4F12A 3FA2A 4NQZA 4XA8A 4AY2A 1BIFA 4GM1A 4CDRA 4W5QA 2NTEA 4OI2A 1UBOS 3VHRA 1DINA 1XRQA 2YIVX 4EW1A 5CB0A 2E4UA 1SXGA 2DEUA 1B0AA 1WPRA 3WRYC 4YQFA 5JS7A 2B4RO 5D3MB 4ND4A 2ONCA 3GP8A 4B0PA 1I7LA 3WQSB 4EPXA 1LF5A 4PZZA 2DLNA 3MJTA 4UQOA 4C2TA 1KMIY 1KBQA 1J1UA 2BZ0A 4IMJB 4OQEA 5LP1A 3CR7A 1PG2A 1C3OB 3VUFA 1VSTA 3IALA 4ETNA 3Q7SA 3GCDA 1VB3A 3UUEA 3FWNA 1KQNA 4YXWD 4C1NA 3ZX4A 1QK3A 5FTLA 1GRRA 1UIMA 3NTUA 2H4XA 5CLHA 4U7TB 1E6MA 3UPUA 1J7KA 2C83A 2GZMA 5DM60 4W9NA 3I28A 1UBSB 4Z7JA 1EM6A 3NV9A 5D86A 1DL5A 1KFJB 2ZG6A 2DOKA 3H4VA 4MAMA 5ALZA 2EX0A 1OPRA 1E2JA 1Z2CA 2B3DA 4JKOA 1U0NA 1H0HA 5C8YA 3ZCTA 1EDEA 1ZCBA 2B2CA 3UK6A 1U63A 2C2OA 2QQ5A 1ZVQA 3R3JA 1E4VA 4JUDX 1SC1A 1O89A 2VNSA 1L5RA 4AJEA 3HB5X 2CV2A 2IVFA 5FI5A 3UZUA 2HSJA 4L7VA 3OF3A 5IBQA 1AMNA 2Q7OE 3H2HA 5E2AA 5DT2A 2ECOA 4YRCA 5J5VA 3TINA 1UXHA 1R0WA 4OXRA 2AFVA 2JGAA 3JQBA 3DOOA 4TL6A 5JAPA 1H94A 2ATEA 2L18A 1X0XA 4R98A 3HJTA 5ICSA 5IPFA 3VOAA 2AN1A 4MCIA 3LXUX 3IQIX 1L5LA 1RRMA 2Q3JA 2VDWB 1CFZA 1PGNA 3FWPA 1IN6A 2BJVA 3IKMB 3B6IA 3D3WA 3KZMA 4PM4A 4EECA 3T9DA 1OYVA 1GFZA 1XUOA 4RA6B 1Y4AE 2B9EA 3SN6A 4AIRA 4KAXA 1NW9B 3M1LA 4AURA 1RM4A 2ZVDA 3DBRB 1S2GA 3FY4A 4PWYA 5IC5A 1W5TA 5FIUA 2OENG 1CZNA 3AR4A 3PZBA 1JT9A 4I50F 2OBMA 3HTXA 4X1KB 2PXHA 4LRWA 4GLOA 1HDGO 3GVLA 1YB7A 4KDRA 4MP8A 4A0FA 3SVTA 1X13A 2M32A 4QVAA 3DL2A 3L84A 4QPJC 2WQZA 1SA0B 5JD6A 2VJIA 2IZZA 4JC0A 4TZKA 1ZIOA 4UTZA 4X7DA 5TY0A 1JG2A 1KFBB 2DMRA 2HA3A 3GVPA 5T64A 5LL6P 1YR3A 1FTSA 4JKYA 4QDXA 3OMLA 4MIEA 2OFXA 4BLSA 4F46A 4NG5A 3Q9LA 3CE9A 4O2AB 4UU0A 3IIKA 4D02A 5IYWA 2XTZA 2ZVJA 4UOQA 2R8YA 4HAZA 2JJ1A 3JQAD 1YR1A 3ZOKA 5CA0A 5K2MA 2DKFA 4JXJA 1Y7LA 3CISA 1Y6RA 3GCXA 5BYJA 1E9AA 3OAAA 4KX5A 2ZBVA 3D7SA 5T6MA 1IG0A 3TUJC 3C7CB 4C89A 2QSUA 5FWYA 2D2IA 4WZBE 3MOIA 5JPCA 2IUEA 1MAUA 4BJHB 1DELA 4P4LA 5K0EA 1ZINA 3TUZC 3ZGNA 1HZZA 3L8MA 4FQ7A 1T5TA 1L4NA 5LXTF 3SSMA 4TN5A 3TIXB 5TR9A 4WLNA 4BB0A 1E2MA 2ZJ5A 3HWSA 2A4KA 2C96A 4X64B 1T1IA 1G6OA 2FFBA 2QR5A 4KBGA 4N6NA 5A6SB 3Q7TA 3JU4A 1C0EA 3ST7A 3D6VA 3SF8B 3ZI4A 3X0DA 5E4FA 1MC5A 2IEGA 2VYCA 1GT91 3QVOA 4DLYA 2D1QA 1VTKA 1PJ8A 2D4AA 4J0FA 3NVDA 5AI4A 5FA8A 3SKVA 3K9LA 3MGAA 3LPLA 1ZD2P 2B5VA 3FUTA 1JX6A 3WYEA 1GPJA 5IJ0A 3U4QA 4MKFA 3K6KA 5EQTA 1UD3A 1BXGA 1BJTA 3EXFA 5IM4A 1KZ7B 4R8LA 2CMGA 3I9V6 1H8ED 1YGPA 3HFGA 3WV4A 2OQ2A 1DFGA 2NVBA 3PGXA 5JEEA 2BKLA 1C30B 1YBFA 4MMYB 4PAGA 3WLIA 3SE0A 1Q17A 4R2KA 2EKBA 2CVOA 2RGCA 3PF8A 4ZO9A 2BFPA 3UJDA 3RVOA 4MCJA 3ONFA 4KAJA 1K28D 4G0UA 1QE5A 2BM0A 2DR2A 3HB4X 1VCIA 5HW0A 4IIYA 2YVAA 4KR2A 4NYJQ 1LJLA 5KKCA 2C4TA 2G1KA 1V9CA 2YS6A 4MVJA 5ECWA 4M38A 3T35A 3U4AA 4OVKA 2ZTLA 4C4ZA 4EMTA 4RVNA 2OA0A 3TCXB 2VTBB 2QPTA 2HU7A 2YWJA 4KLNA 3F7NA 5THKA 2BFFA 2C4NA 4AVYA 2R68A 2XMCA 3PPXA 2C5LA 1BHQ1 4H3HB 5HS6A 3RUFA 3E9NA 1VDMA 2HPHA 2JCYA 3LYLA 3NT5A 3GAAA 2DERA 3O91A 3ZY5A 4FE3A 4CCWA 3IT2A 3TJZA 3PGLA 4CMHA 3KRTA 3R41A 2P2YA 1PNOA 1UJ4A 1YFZA 2GJKA 3A0RB 3C6YA 2GPAA 3DLTA 4MUXA 1BPLA 1KARA 2VK4A 1UXKA 1CZLA 1FZTA 2ZJBA 4YV0A 3ML1A 4EA8A 2CLCX 3ESDA 4HEQA 2FQYA 4YP9A 4NDZA 5CLJA 2BM1A 1I2CA 2LR0A 3S44A 2BI7A 4L4ZA 2TMGA 3OJCA 1Q7CA 2GN0A 2WT4A 1P77A 1H4TA 3VR4D 5CDFA 1EFUA 1DJMA 1ZKMA 4OHOA 2O8CB 1XJQA 2VJLA 4EENA 2AA3A 2ZPUA 4WCFB 3TLAA 2Y1EA 3OLYA 1OFTA 1Z5PA 4PNZA 1Q82D 4I5EA 3TMYA 3VRHA 2P30A 4ZCMA 1WQ3A 3UJ7A 4DDHA 3VI3B 2HV8A 4EQZA 2QMQA 1RPJA 4L3VA 1JBEA 3BEOA 3HBJA 1EFHA 4KO1S 1HDYA 3FTFA 4OHKA 3BWCA 3P2KA 3DKVA 2G80A 4LG1A 1CQJA 4YJ2F 2ONZA 3QTBA 3HC7A 4MGYR 3WOVA 1G3IA 1QXSA 3UT5A 2Q5FA 1DBIA 5EJEA 4YACA 4M0PA 2FH5B 2JF0A 3OUZA 3MWLA 1XO1A 5BQ5A 4Z54A 3LSYA 2OYRA 2BUBA 3KIPA 3R5SA 1A2OA 4KZKA 3T0FA 3HM9A 4YRJA 5ER9A 5BMVA 4RD0A 2QTAA 4BLPA 3SIPA 5L3SA 2OHJA 2XYGA 3GD5A 2V6BA 2Y1DA 4AWBA 3T15A 1ZH2A 4G0QA 1N4DA 2R7LA 1RJ9A 2RAPA 3WRVA 5FADA 4FK8A 4E09A 5C46F 4B75A 1E5XA 1QH1B 1S8AA 3EN0A 3JZIA 1JJ7A 3D4IA 3TAXA 2JBAA 4WZBB 5JLJA 5EE9A 4PRZA 3V2HA 3E3OA 3NBUA 5HHTA 4E88A 1MXFA 1YDEA 3R5KA 4Y1GA 3ZNOA 2I7VA 3QF4A 4IL5A 5M2QA 3Q38A 3SJAA 4V2IA 1WM1A 3BBLA 1GRNA 3CCCA 1NG9A 1G8JA 1MIOA 2NZ8A 3B9QA 1WZNA 4F4CA 4FYVA 5BVGA 1BH6A 4KV7A 1QIGA 1TPYA 5F76A 2XV1A 3T9EA 4KLAA 3ZD8A 4OBWA 4E5SA 1A9XA 3TGLA 3Q9UA 1BN7A 1W52X 3BL8A 4OQ4A 3RFXA 4JI3B 1VL5A 1UKAA 2R4TA 3P20A 4MW5A 4Z9XA 3KT8A 3FTQA 3PVDA 2Q6OA 3QMPA 4L6CA 4HZUA 4ZEXA 1P0CA 3GDFA 1EM8B 1UANA 2G9RA 2CJWA 3GVXA 4WECA 2J9XB 2VYND 3AESA 1W581 3AJ8A 3DVRX 3BIWA 1QIKA 1PQ4A 4GIBA 4B9AA 1LLFA 1H9CA 3TR0A 5IFLA 5CX1A 4DNRB 4G4JA 1RZVA 4IDNA 2M6LA 2CLIB 3D0OA 1NNI1 3R9KA 4BASA 5ICFA 2XDQA 4DY6A 4D9JA 2A5DA 3JWIA 3FOZA 2B0JA 1XJWA 2DKOA 1DJOA 1M0TA 4FN4A 2ZATA 5KC9A 2ZIGA 1WCV1 1N25A 3E1KA 4RPBA 3KOXA 4F72A 3FUUA 3JSXA 5LLDA 1YVRA 2W2VA 4GZMA 3B3AA 1Z7BA 4HJRA 1TF2A 3JXEA 2VPXA 2VO1A 3FZQA 4TMYA 5HBGA 3DCIA 3R40A 2OCYC 4J94A 4DEXA 4U39A 5JYEA 3IIJA 3AM3A 1CRZA 4UVDA 4QOEA 3VJMA 3VJKA 4MW7A 1RMYA 4RY8A 1Y8RB 3OP4A 4OP1A 2PVSA 1EESA 3HCCA 5KWJA 4GKVA 1GZSA 4RVDA 3E03A 2NTYC 2J33A 2NTJA 2DTXA 2VUUA 4XLAA 1UT8A 2EJVA 1CQIA 2RAFA 2VXBA 4FBGA 4OXQA 1K27A 3HXMA 4V02A 1KDYA 3Q8MA 1IRIA 1EYZA 3E35A 3KXLA 3HHEA 2ISQA 2ZYRA 2C9ZA 1Z0KA 1P45A 5KQSA 3RS3A 4CQNA 2HPVA 2JLYA 2P91A 3A6KA 4ZVMA 5A0FA 3D2AA 4JSYA 2XAAA 1LWOA 2XGJA 1JQAA 2EFJA 2FMHA 1GDHA 1W4BA 4Y6RA 2IT1A 3ENNA 1ZNWA 1P0FA 1ZNYA 2G3YA 1L4KA 3NHFA 4KIWA 4PBSA 5BN1A 5LCXA 1J33A 5JCJA 1JFVA 3KSZO 3ZKWB 5NLLA 4DTIA 4EQ6B 1ZP6A 5J1TB 5LDHA 3H9CA 4D0RA 2H0RA 2EG5A 3HZZA 4R4JA 3QI2A 1NAHA 5F78A 4OXYA 4QFDA 4LY0A 2YVLA 2ZSUA 4ZN6A 1GZUA 4EPVA 1JLHA 3NCTA 3MSCA 1GYQA 2ABWA 5AJUA 2O1EA 1CHDA 2VZ8A 4BNVA 1SBHA 2GLUA 1XI2A 2CUZA 4REOA 3T5PA 4TTSA 4BRWA 4JENA 2DBQA 2Q5QA 1TCUA 1CUIA 1PT9A 4HN2A 3OLQA 2BH2A 4YI3A 3S2IA 1PW7A 2C0PA 2J09A 2N75A 3L49A 4D9IA 4NBNA 4XOIA 3FB4A 4DFDA 5M04A 3TNYA 3PU6A 5CBKA 4IJ5A 4CM4A 1GTSA 1GNTA 2DH6A 2PT5A 1PV2A 2G7ZA 1EFPB 1N8RD 2OCKA 5I3ZA 4YCSA 1PJBA 1RKXA 5KYUB 3TGPA 1F4VA 1N1MA 1F14A 1HFJA 4V2UA 3PDIB 4E6EA 5BURA 2CXHA 4LJSA 2PYZA 3LF1A 4J9UE 4EPRA 4FMCB 1R4ZA 5E7MA 5KYXB 4KOAA 1QPZA 1V8FA 1WD5A 4L50A 4KSBA 3L43A 1OE0A 3WA7A 4PZUA 2ECPA 1D0IA 3PNKA 4PXAA 1XXHA 1VP3A 3VPBA 2IS2A 1GYPA 1UDCA 1J2TA 3K0FA 1GAWA 1PFVA 3EZ7A 1XN4A 2OAGA 1ZMRA 2X5XA 2ZBGA 3EDRA 3EUWA 3WIDA 3NC4A 1NPYA 1YH3A 2ZSFA 4HWRA 3WRXA 1XD9A 4D45A 1Z4OA 1ZNQO 2RGBA 1GPLA 2QEQA 1UOQA 3IT1A 4JGBA 2ETVA 3Q0TA 1U1IA 1WMFA 4Q82A 4ZZ0A 3ZGOA 1A4IA 3FKQA 4E4RA 4J6EA 4DDWA 1Q0UA 3EVZA 3BRCA 3CCFA 5GADl 1U3VA 1SZCA 4NS4A 1SHZA 1WRBA 3LRXA 4UUPA 3DB2A 4XB1A 1VJ0A 1U9YA 5FTNA 2E18A 1LI7A 2RHOA 2YN2A 1JLKA 3FZEA 4ASUA 3AVTA 5K3EA 4Z4WA 3BJRA 2QJTA 1T5DX 4LRTB 4LOJA 1HFWA 1X7HA 5D6NA 4BEJA 2QR3A 4LXGA 3O2JA 4W6ZA 3RSFA 1MUUA 1FDUA 2A9KA 3N75A 5EIBC 4CKEA 1SUFA 2C31A 4H1VA 3KU1A 5LQSA 1DO8A 5BSVA 3K0AB 3OX1A 4ZD6A 3ZWPA 2CL6X 1CD5A 1OZHA 2LDBA 3KCNA 4OOFA 4GC9A 4RV4A 4B74A 3T52A 4D56A 3UGQA 4A0HA 1FRQA 3HKEB 4IJVA 4FGLA 3L41A 1KJ9A 3DZ8A 3F3SA 4YJ3F 5KJ6A 3D8UA 2P27A 2QP3A 3JQFA 3KKMA 4GVLA 3CVXA 1EXWA 1LSSA 1Q95A 3Q98A 2RH5A 1HWYA 4PYOA 3ZIUA 4CKWB 4CV3A 3T3EA 4OLHA 5G0UA 1CZOA 2DR3A 3A1DA 3I37X 2XUPA 4S35A 1N2SA 4ZICA 1VI6A 4KEAA 4YMGA 1J4AA 1FDOA 1Y1RA 3V55A 1HE2A 3CE6A 2ZREA 3CMMA 1DNPA 1YS4A 2ZJ1A 1IY8A 1IWBB 3K1AA 1BKYA 2I65A 4QA9A 3AL0C 2ISSD 3BE8A 2VXCA 4I81A 4RKFA 2EFGA 2WSSA 1R5JA 5JS1A 3SK0A 3M6XA 2D13A 1LA2A 2I03A 2FMFA 1B6RA 3T7AA 3DNPA 2RGAA 2I2DA 2YRWA 3A4NA 3GJXC 3W5VA 1QQTA 2NO7A 4TXNA 4WOCA 2HBZA 3Q3EA 2YIMA 3GGSA 4HDNA 4Q19A 2PSDA 2Z2ZA 3EEBA 1VYHA 3L6DA 2II6A 2YHAA 2JFNA 3VGPA 3WMXA 4E70A 2CKDA 4YS6A 2R1TA 1C5KA 5A2QA 4YV1A 2DFDA 2X77A 5IXJA 4K5QA 3JAWA 1NVEA 3MCTA 3C6BA 2P6MA 2NQ2C 5K4GA 2NU7B 1S2OA 3RR2A 1TUGA 2BP7B 2O2DA 2ATXA 4RELA 3VPHA 2ARKA 1SRRA 1AC5A 4WKNA 2JBWA 4IVQA 1TTQB 2C77A 3EOAI 1KPHA 3NUQA 3IE2A 4YHHB 2BFWA 2QV7A 2EOAA 1B0PA 1VL1A 4CM8A 2WMDA 1G7RA 3ZBUA 4Y9UA 1TQDA 5JTUA 4G09A 3N8KA 4J91A 4O4HA 2AJCA 4UBLA 1OBHA 1OTYA 3Q10A 4BP8A 1BWRA 3CS3A 1J2JA 1VQOB 1TA4A 4WZLA 1QCDA 5L46A 1ATIA 4HLCA 1TJPB 1A4XA 1UDAA 4HEA1 4PSVA 4XLTA 1Z33A 4XYBA 4DREA 1QJCA 4QT4A 3AO0B 1JWAB 2PUWA 2OR3A 2DFNA 4LJ6A 1E3QA 4DZTA 5EP4A 3ADBA 3TF5A 1EWQA 2I4IA 1SNYA 4KKSA 3CLHA 1UAAA 1S8OA 1PTKA 1XTBA 5JO0A 2X0NA 2HBRA 1CPYA 1DRWA 2JFUA 4PHTA 1BOOA 4MW0A 3RS8A 3TVDA 3VOBA 3IXLA 3LQYA 4IR7A 2XH8A 3RTBA 5EIAA 4Z3DA 3WICA 4AYXA 2H5IA 5KPJA 4RF3A 4AJ9A 1NJFA 1Y4SA 4MVJG 3HLKA 5KPDA 1WDMA 4K40A 4DB4A 3G5MA 3K9NA 2ZIAA 4MR9A 1P0MA 4RL6A 4Y2PA 4DNFA 4QBIA 1L5KA 1BDHA 5BP7A 2CXOA 4OQPA 1SO8A 3NVMB 4BFLA 5EZSA 1NBMD 4RHYA 4U7JA 4ZOAA 1QHGA 2J30A 2WSBA 4WDRA 4EHKA 4GP7A 1GVNB 4G1MB 2VT2A 1UPFA 2K2WA 3OLWA 5EMHA 1I24A 2FPPA 1M83A 2JFOA 1OKKD 1YVDA 2CEAA 2SHKA 3GQVA 1Q14A 1QVWA 3LHFA 2G1PA 4CI9A 1H3EA 4P4GA 2UXDB 3QVGA 4DW8A 4LF4B 4EWLA 5IKEA 3LYUA 3PXEA 4GOMD 1LEHA 1VC2A 3THXA 4FOTA 5F9HA 2X6QA 4KMRA 3T0IA 1K1EA 2BEUA 3CGWA 3SOZA 4DDMA 5C18A 5HIAA 3VU9B 2FEKA 3A14A 3IDFA 4KO2S 5B1YA 5AHRA 2RSLA 1QIHA 2NN3C 3AONB 4XX0A 3OTGA 3LG2A 5D87A 4RZUA 3F1LA 2Z6AA 1PR1A 4FHFA 2Q45A 4K6FA 3BC1A 3V48A 4Z1MD 4HTAA 2XKAA 3ZV6A 4JA0A 5J40A 3SXJA 3PVZA 4M1QA 4MINA 5IBRA 4OK5A 3HXLA 2NU9A 2RFLA 2P9YA 1JHUA 1YHQB 3NE5B 3GLRA 4TROA 1NRWA 4CQLA 3GIWA 3KDSE 1C3EA 5AXDA 4JJFA 1EFAA 3GLVA 1TYDE 1XG5A 1EFVA 5JW6A 1GL3A 3B5IA 3AT1A 3OJFA 4IGFA 5LIRA 4CG1A 1M6VB 3O5AA 4UUMA 3UCXA 3X1MA 4GYJA 4RADA 2POQX 1JG4A 5C1IA 4ALLA 3K0HA 1CP2A 4FQ8A 1NIPA 4D98A 5I8PA 4GYYA 3LKBA 4ZVPA 1P91A 3LP6A 3H0EA 1W44A 4NBRA 4NBLA 4LBZA 1ZUHA 4H7PA 1YZQA 1PWZA 5FOWA 3WAJA 5BR4A 4MRRA 4TTJA 1OC4A 1ECPA 3CF2A 3HCRA 1VYTA 3ZD6A 1K4KA 3S29A 2VNJA 2E55A 1P2VA 4DR7B 1XROA 2X85A 1DKRA 1E9BA 4BP3A 1EUDA 4ZCSA 2HJ9A 3P97A 1KKLA 2Q2NA 2ZZFA 1RZRD 4IH1A 4D9EA 6ADHA 1U0JA 4ZAZA 4HQFA 1UEJA 4PVDA 1D1PA 1YJCA 5CM2Z 4Z86A 3ZU4A 1FX0A 4CQMD 3I6QA 5KOJB 3CYFA 3WNZA 2OFOA 5JS2A 3BCFA 3BFPA 4GEGA 1I4DD 2NV2B 2CNBA 3T4UA 3RY8A 2GRUA 3AVVA 4NBTA 3GNLA 2XUIA 4CE6A 5BW6B 4MDEA 1VCMA 2G4CA 2W6NA 4IRUB 4K9OA 3T3MB 3TOVA 2V6MA 3EJ6A 1E6KA 4D8TA 4CT5A 4F2DA 1B41A 3CLUC 2XZOA 1PVVA 2VNKA 3LFUA 4PTLA 3WB0A 3ZXUB 1YZVA 2PA3A 1XNJA 3PV0A 4KHPB 3MTQA 3FNFA 4QYWA 1FRZA 3LCRA 3AR2A 1KYWA 2P3SA 5ALVA 1Y1QA 1JHAA 1RYNA 3LF2A 1AKRA 2AD5A 3E3AA 4RC9A 5J2TF 4NAVA 3WJ7A 4CGYA 3EPLA 1IK6A 3GPCA 4NJMB 5EJ6A 4DCNA 3FI9A 3C74A 1QFMA 1XZLA 2PUJA 3ITDA 3O84A 2YDYA 3NASA 3OIGA 3R5TA 5LPNA 1Y7PA 3V7NA 1I4WA 3AYXB 3KUDA 2RHHA 3A05A 4JJZA 2RGUA 1ZUD1 2EQ5A 4BFWA 1ESEA 1MABA 2I1LA 4WD3A 3LY5A 4P8RA 1VHWA 3IVAA 2JNWA 2RMKA 1YQ9A 4G8CA 4IJ6A 4DR5B 3NEAA 4JZYA 2EBHX 3L0OA 4FI3F 4LQ4A 3OU6A 4RYLA 4XLCA 3BIOA 4PC3A 2XDWA 3FR7A 5LYJB 4JSTA 4OATA 2I78A 4Q5IA 1YQGA 2IBSA 3E18A 1DQSA 5K0NA 2YV3A 3N0XA 3RC9A 3OIWA 5COBA 2ASVA 4Q9NA 3MEQA 4HT3B 5BWOA 2VP6A 4HXEB 3RBZA 4B80A 1E1RA 2YJ5A 3DULA 3U9TA 2Z98A 2BDTA 5GOTA 3RM3A 3VNVA 3HDJA 2C2KA 3GJZA 1XMSA 3I45A 3JRXA 3WJ1A 4F85A 3GJSA 3PVCA 2G4LA 1YL6A 3ZGLA 5CW1A 1Z07A 3UT0A 1D1SA 3RSZA 1JQEA 4NCJA 1WOSA 1GIAA 3B5JA 4OU4A 3VSBA 3CRNA 1A69A 3R7FA 4OHYA 4CM9D 3NANA 1ST3A 3HWRA 4U0JA 2NSYA 4BIIA 4JUBA 1DFHA 2R5WA 3O8LA 1SCKA 1TEZA 2HJWA 1L5FA 2QTRA 2WZBA 1CR1A 1HSOA 5AMXA 4KQEA 1W2BB 1HQDA 4P4NA 1G98A 3LVFO 4ZTZB 5BW5A 4PQYA 4C08A 5C81A 1BZYA 1Z4IA 3AGQA 4FNAA 4UE3S 1U1FA 1LSUA 1USKA 2QN1A 2FF5A 4KQIA 1ONPA 2UUPA 2DWUA 4P22A 2PEYA 5C5DA 3V4ZA 4PO3X 1FFWA 2WHRA 4ZZ1A 1ZN7A 2L69A 1SCAA 5JFOA 1FQKA 1K4MA 4LC9A 4DLLA 3J80A 2OD9A 4K81B 4ND7A 2PV0A 4EKIA 5EWLB 3CF4A 3H9JA 2GILA 4M8NE 1G21E 3RV4A 2O48X 1Q3KA 3LX6A 4AKTA 3HA3A 2OV2A 2BJWA 2YWRA 2B3TA 4LOIA 5FOTA 4B3JA 3E5HA 5L3QB 1SPBS 2CLSA 4HGYA 4GE3A 3C8UA 1ZI8A 1DTWB 3VR3A 3LBYA 4FS8A 1ZD4A 3E5RA 4HGZA 1R74A 2O07A 3AFOA 3OPYI 5IZ4A 2IQIA 3EF1A 1J8MF 3HADA 4C2UA 1E1CB 2FWJA 5J3JA 3WMRA 3E23A 2H63A 4UHJA 2OZLA 1C9MA 2HRQA 4A8TA 1MOPA 2WWXA 1ZFNA 4HIZA 3C48A 4PYRA 4QULA 4QELA 5D3QA 3ILYA 3GFPA 3UPDA 5FBHA 2NX2A 5BQOA 3H4MA 4FHDA 1K3UB 4LX0A 2I76A 3CZMA 2WD8A 3CLRD 3GZ4A 3GIDA 4CEJA 2ZE8A 1V7QA 3MT9A 4GOND 1QFXA 3M34A 4TRJA 2J0VA 1YUBA 2BOVA 4BGIA 5CBPA 1XZGA 5FJIA 3BX1A 2QL9A 1X94A 4O29A 4OHBA 1VHQA 1EK0A 3KQTA 2V97A 1MGOA 2W37A 4G4IA 2I66A 2QTGA 2FSPA 3HLTA 1Y3AA 3RCBA 2P1DA 1RM5A 2ZI4A 1U8EA 5BV0A 5IUKC 2XJ9A 1MV8A 3T3GA 1R27A 3FSGD 5AR1A 4NZNA 3LDUA 1Z9BA 3LZCA 2VP2A 4Q9DA 2EHJA 5EE0A 5LDGA 1R10A 4FQ5A 3IP3A 3OQNA 1JPUA 1G0OA 1E61A 2I9KA 4A8JC 4FPXA 5T4HA 5LYYA 2JATA 2TECE 3L4BA 1R18A 5AW3A 2Y93A 3LV8A 4OYLA 3EXAA 2AHRA 3MTIA 3CGGA 3PB3A 4QPZA 1ODIA 2C4HA 3BZBA 3D6UA 3QEKA 5DFAA 1Z82A 4X05A 1I33A 2ZZMA 4YR7A 1JAYA 3EIEA 5H02A 5A5FA 2JEZA 3R3XA 5ECYA 2QTFA 2WHPB 1EH5A 1PDWA 3HGQA 3ZJ5A 1ZX1A 5IAGA 3QOYA 4ZO7A 2L2QA 4B6QA 1XZBA 4EHJA 4IKEA 1NXSA 1JB9A 5IYQA 1G60A 1QH8B 1PFQA 2A0UA 3GGJA 3L8EA 3OCYA 1JVNA 1YO6A 1NT2A 4UU7A 5E1DA 4DJAA 3PJGA 4M9UA 1I32A 2YL2A 5TDHA 4G1FA 4D6YA 1FS5A 4P3KA 1K4YA 4HLNA 1Q2UA 1S2MA 1OZAA 1U02A 3STYA 16PKA 3BJIC 2O5EA 3NPAA 5CR9A 4ON9A 3PUXA 4FGUA 4PGHA 5DWDA 3BF7A 3SXUA 1EVLA 2KE5A 4GMGA 3TZHA 4IFBA 5ITVA 5HNKA 3KDPA 1CY4A 3GRFA 3UH1A 5C8DA 5EZ5A 3F96A 5IZCC 1LPAB 4AJ4A 3N2KA 1X39A 3M6AA 1Q19A 4HN9A 2WZNA 1N6PA 2W2NA 4KQMA 3D1VA 3G68A 2BEWB 4M55A 2GPSA 2YJTD 5TQ0A 2AYXA 4XWKA 4DLNA 4TMZA 2C97A 4I1UA 5KOIA 3HH8A 3WYDA 4CJXA 2A84A 1EUZA 3H97A 2FSFA 2QTWB 3GVJA 1VBNA 7REQB 1JIJA 1FYFA 1PFWA 2BFNA 4YMVA 1F6DA 3WIBA 4ZK6A 2BR4A 3IV9A 4RTNA 4G97A 3N2LA 3DFZA 3ZY6A 2RHLA 2C3PA 1MX9A 1VHTA 1G21B 1BOFA 1I2BA 2JDIA 1HL7A 2FETA 3A3OA 3BYZA 3F3YA 4IILA 4MPTA 5HE9A 4BMCA 4D3XA 6Q21A 2JI8A 2VDLB 1YD7A 2WINI 1T8TA 2AC2A 3H6GA 2AG0A 3EXIB 5CJ2A 4DSTA 3LHIA 2NUPA 1ZK0A 3WYCA 4E2XA 4PO9A 4A82A 2IXBA 3MGGA 3ND6A 1ZQ1A 1WZIA 3RFCA 3I05A 4AG6A 2JPDA 3KHSA 1Z88A 2Q3MA 1TD1A 1V95A 3EC7A 1DBRA 3FNHA 3CEHA 3FTDA 3WHIA 3RSCA 4HK4A 1AQLA 3K9GA 3MG9A 5I4IA 2H2DA 4GO1A 1ZM9A 3TBHA 3OPVA 4UTPA 3IA7A 4HF7A 4NE2A 2PZKA 1ENYA 1G3RA 2DCMA 5AP9A 1MFZA 2PKRA 2QA4B 2XECA 3KV1A 4NJEA 1FE8A 3N05A 4EEZA 4ZHQB 3FYUC 4XM1A 2AFIE 3KWLA 1F7UA 2EQAA 5H3HA 4N40A 4HNRA 4B83A 1EFRA 2PGOA 4BDTA 2G63A 2RGGA 4Q24A 5KAPA 1UD6A 1DBWA 1QBKC 4M7PA 4V3BA 4WN9A 1NL3A 4GOXA 5B7PA 2XZDA 4XIFA 2OPBA 3WK6A 8ABPA 1V4VA 3CVJA 2YDXA 3LVQE 5ESXA 1I0IA 4YELA 2QD5A 1KMHB 1N8KA 4GYWA 4WQMA 1KWGA 5JSZB 3JQGA 2A5LA 2CT8A 2HJHA 1NUQA 2GXAA 1U0HC 3I5XA 1IC6A 4Y8VA 4QD3A 2NXJA 1Z6TA 3PXCX 1JTEA 4QPCA 5DLYA 1O5OA 5C7IO 2J67A 5JQGA 3E61A 2H59A 5CVEA 3VKHA 2P7IA 1PUJA 3Q8LA 3G0GA 1FDTA 4MI3A 1FMCA 2UUAB 4POOA 2BHTA 3OIUA 5DX1A 3VPSA 5I8ZA 1WXEA 3CZPA 3ER6A 4Z49A 3BXOA 1QMGA 1CJBA 2EFCB 3GHHA 1ZVMA 1HEIA 4HVTA 1CK4A 1DXOA 2FPSA 4RKYA 4RS3A 4BQFA 3BE4A 3W05A 1KIMA 1TTHA 4GX5A 4KO3S 2Q2OA 1CS0A 1P5FA 1UC9A 1QO0A 1V16A 1ZPDA 4BMDA 3CCMB 3LKVA 2Z3WA 1XX6A 5DSXA 2ZCJA 4WMLA 3NMUF 1GD1O 3AIMA 2R00C 3DR3A 1W35A 4LDAA 4XGKA 3VM6A 1VMIA 1ORHA 1AGRA 5ESDA 4ZRDA 3D3KA 1J0EA 1ZM4A 3EEQA 4PC6A 3E22A 3QXHA 4Y2JA 1RRFA 1E5QA 4EUEA 4U2DA 1GV0A 3E1GA 2AEEA 1WQ1R 5AJHA 4QBKA 1LRLA 1YRWA 3KYCB 3VPGA 4P34A 4QVGA 3NALA 2ZT7A 2CNDA 5EL0A 4M88A 1OTHA 3REQA 5CURA 1YQUA 5AKXA 1G59A 1WSWA 1ML3A 2AL7A 2JJMA 1G8AA 3ZC3A 2ZXUA 3E05A 5IEJA 1JFFA 5CMLA 4K3VA 3UJ8A 1FPQA 1FPMA 3NRCA 4D1YA 3R5JA 1K68A 1OFGA 2F43B 2C2WA 4KRXA 4IF4A 4RDCA 2PMEA 3UK0A 4AMVA 5HBRA 2QK4A 5ALQA 2QDXA 3RUDA 3IJEB 3WLFA 2Y9MB 2ZR0A 1OLSB 2I1WA 2P9ZA 4L85A 5CK5A 3VXKA 1LV8A 3PNPA 1N7HA 5J63A 1TPZA 1B8OA 2HF2A 2X9QA 3AI3A 3UC9A 2H92A 3PLNA 5DCLA 2PDAA 3X1YA 1DWUA 1ZY2A 1O0CA 2HRRA 1H6AA 1JTVA 4L9SA 4KYUA 1CZHA 1YQEA 2CVPA 3U49A 4EG8A 4HVLA 1XZMA 3LY8A 3IEPA 5F4ZA 1BDBA 1HNWB 2GCPA 3JD0A 4JZKA 1B0ZA 1Q81D 5JDCC 4Y1EA 4ZDWA 1CUDA 1EBUA 2VQ3A 2FR8C 4WY8A 1P3Y1 2AOTB 4BO5A 1BW9B 3HS3A 4F96A 2QN2A 4K1XA 2YH2A 4GPBA 3SYNA 1O0BA 1RYEA 3ZS9A 5KVQA 3X3HA 4TWJA 4X54A 1TT7A 3H86A 1MGPA 3W6OA 5E6SB 1M6HA 1SC9A 1UBCA 5LFAA 2BFAA 1Q16A 5EMNA 3PEWA 2CRVA 2IDKA 1S72B 1BJRE 4KPUA 3KOUA 4AZ0B 4DAOA 2DVMA 4XFKA 5CG1A 4IG4A 5ALMA 3JYQA 4CL0A 5F52A 3L7IA 3VKFA 3P9PA 4YRBA 3FMGA 3U81A 3QW4B 2VKTA 3QKIA 2QJRA 3Q1LA 3OP1A 2HPZA 2Y05A 4UEWA 1ORVA 1OI7A 3W3AD 1QCYA 4DJJA 3S1SA 1NFFA 4N5NA 4HUJA 1A8PA 1EEXB 3NM4A 5E1OA 2JZNA 2YTZA 4PBRA 3ND9A 721PA 4J9VA 4DWOA 3KS9A 4LXYA 1DG9A 4R2MA 5JZBA 4I99A 1SC4A 2ONYA 3GROA 3G7NA 1Z8DA 2IXDA 1NSTA 3H2KA 4OSPA 2KVOA 1XR3A 3UM9A 4BP9A 2HV9A 2EKQA 4YCJA 2XQFA 4REQB 3CRQA 3ZV7A 3VDNB 4WWVA 2M6RA 4LMAA 4NCXA 4Y6QA 4CU2A 5JAIA 1YLOA 4FDLA 2RH4A 5F98A 1N2GA 5D2CA 4TUYF 3K4PA 4TMVA 5IJZA 1ZBQA 1AGPA 2NOAA 1NRKA 3JCZA 3O8QA 4HAIA 4OXIA 4CKCA 1UQRA 1KK1A 1YJ8A 2P65A 1FLNA 1YR9A 2O8BA 4LSZA 4P7FA 3L92A 3D0RA 1R0BA 2ZTNA 5EJFA 1AKWA 3LY9A 1FW8A 4XYMA 5IF3A 3CMEB 4Y67A 1M2NA 3UGTA 4F71A 1GTL1 2R8RA 3M4NA 3BY2A 1LPPA 1OLUB 3FDJA 3OJOA 4U3JA 1KI7A 4IINA 3ACCA 2OECA 3UJAA 3OW2B 4F2HA 2LE0A 3W8NA 2EZ9A 3TR6A 1RQLA 1WCYA 3VC2A 4RULA 2EFEB 1CR0A 5A3QA 1Q91A 3TJMA 3BJMA 2OMEA 3AJ9A 3PDCA 4PINA 4YBZA 4MKXA 4O4JB 2A4MA 1DQNA 2PRIA 4QYIA 5WRFA 3V42A 4BX3A 3E0XA 5AI0A 4JOQA 4I5IA 4POAA 3ZHUA 3R0QA 4ZAVA 1KQGA 4U7GA 3C87A 1AXEA 1OSNA 1RRGA 4LZOA 2OAP1 3U3MA 5F7OA 2X23A 1FSZA 1NV8A 2RG1A 3I34X 3IOMA 3V1YA 4J43A 1QC5A 3OFVA 1XE3A 3F7TA 4PZ9A 3FIUA 2NU6A 4HZGA 4N7RA 3UTCA 2NLOA 1G2OA 1S8FA 4RHXA 3DVLA 3R5FA 1FRNA 1O54A 3G9UA 4ND2A 5AKKA 5KINB 3GOHA 1NFRA 4HLDA 1E18A 2VJAA 3K2QA 4IIEA 3CC2B 1H85A 3BXGA 2JN9A 4LI0A 3T5MA 5K1ZA 3T7RA 2D0IA 4RD3A 5H16A 3EVNA 3W5BA 4X9XA 4UM9D 4XQGA 4JGGA 4R83A 1P2TA 1HL3A 1RXSA 4ZI7A 3UA4A 1YTUA 2W6MA 2ZBEA 3UJ3X 2V6FA 3H18A 1XKQA 2BFBB 3AEUA 3IR7A 3C3AA 3BK2A 1MZVA 2HA2A 4MRSA 3OOSA 5MGBA 4AJOA 1OH7A 2V4UA 2EGHA 3H6KA 2NU8A 2D1FA 1GITA 1TNDA 1P0IA 3AR3A 1IPEA 1G7SA 4UU8A 2QIPA 3TL3A 3U56A 4JLJA 5FWXA 5KYWA 1KYVA 2YS7A 1CETA 3AV3A 3PD7A 1M2JA 3WGQA 1EQ2A 1NNUA 2FX5A 3BFJA 4IO0A 4WAUA 4JYZA 3FBWA 1RC0A 1DEOA 1A95A 1PF7E 4Y18A 5IW8A 3UW3A 4RLZA 2FFAA 3FTEA 3HO1A 2YWCA 3A9WA 1II0A 1IZ9A 1J20A 2N47A 3AV0B 4QOJA 4F5WA 4ZGWA 3FPJA 2W0SA 1ULAA 3JR3A 4FYHA 1F8FA 1HURA 2V7BA 3AY6A 2VIIA 4NONA 4TM7A 1E2BA 5JAQA 3I5UA 5E1BA 4XRRA 4V03A 3PQDA 3HJBA 3CX6A 3WKBA 2O05A 3QLTA 1RWWA 3MM4A 2OHOA 1C7RA 1YI8A 3PQ3A 2GSDA 2Z04A 3N6RA 1E2FA 3JQ8A 1XZQA 1Z17A 2XUOA 3FE2A 3HUTA 1U3TA 4HXYA 4P7KA 4G85A 4R8MA 1GV1A 4DRXA 2YVUA 2ROQA 1RXWA 5ELXA 4QQ8A 1MB9A 4RM0A 1O7JA 4A8JB 2WZQA 1KK2A 2V0CA 3MS7A 2YIDA 3I0ZA 1NE2A 4NH4A 2OAEA 2XNDD 1JXOA 1MORA 4BV8A 4J03A 3M70A 1EVJA 3AEKA 3M2PA 4AS3A 4DIUA 1E3WA 1ODLA 2VF7A 5JCXA 5IYZB 1CIJA 2PXAA 2OBFA 4MWOA 4D0SA 2Q4OA 3PX2A 4F3YA 5DYYA 3TIIA 4HS4A 1I7QB 1UH5A 4P3XA 5KNBD 4IKPA 3T1TA 3H5RA 1FP4B 1VIMA 3DUFA 1D4AA 4BO3A 2QJWA 3KOZA 1RPZA 1C3VA 1LFAA 4A2CA 3R3SA 5K3BA 2OCBA 4EHHA 5JD4A 4BLTA 3ETNA 4S0XA 3OE7D 4F0JA 2UYOA 3LX5A 2VYFA 3BWMA 1Z36A 4MGHA 1X7XB 3TBKA 3BK1A 3T95A 1XL0A 1Y8QA 2QG6A 1V96A 1IIRA 3AG6A 1YFLA 4GW3A 4UM8B 4Q3OA 5AK6A 1QVRA 5K6AA 1AQNA 2WILA 3ZHXA 3E5MA 4FBLA 5JSHA 1VGVA 3SMVA 3OZGA 1QYVA 2LIVA 5AQEA 4ZOQI 4DTCA 1C0LA 4WOPA 3OM8A 1AGXA 4XIYA 4JHLA 4PZLA 2WHQA 5LXTB 4IW3B 1BEUB 4DM7A 4US0R 1RT9A 2QD3A 1KMMA 4W4TA 4NXMB 5EQJB 4GS5A 4M9SA 1CUWA 4C88A 3OQHA 4FONA 5EE1A 4DWWA 2PQMA 3D1JA 4WXRA 4FEAA 2GK6A 3MS4A 1PBNA 4D9NA 3R6GA 1Y3CE 2JLRA 1GQQA 4HTFA 3RK0A 3PHGA 4NVRA 4LXIA 2ES4A 3U9LA 3PNMA 4MNTA 2G9NA 2R66A 2PX3A 1DEHA 1SIOA 4KP7A 2Q7DA 2TRSB 1W88A 1HTTA 2M5SA 1GDDA 1O77A 1Z2EA 2QMOA 2YNMC 4FYWA 4QUAA 3C97A 3SZ3A 4UD6A 4C0QC 5BORA 5GINE 3ZN2A 4NICA 2CJXA 4GQNA 1K98A 1XELA 5KTMA 3FKJA 5CAEA 4XIIA 2IYPA 3AOGA 4K28A 1UM8A 3PRKE 1VECA 4I66A 3UAVA 2HZBA 4EY3A 3TEMA 2QTHA 4YXWA 1Z7GA 3TKAA 4LYFA 3ZDRA 1XQXA 1Y89A 4Y6PA 1TK3A 4ALMA 3ECCA 4KXUA 2OGWA 1XVLA 4CDMA 2WUGA 4N54A 3GQBA 1QBGA 1NUHA 4R7TA 2G9QA 3FYUB 4E94A 1R16A 3OJ0A 3HA7A 3TIFA 1E62A 2HC9A 4N1AA 1U7UA 3DE3X 3ZBQA 1XNQB 2J45A 3IPLA 5FBQB 4H59A 1USWA 1JZSA 3PQCA 1HF3A 4OPVA 3EXG1 3UMRA 4U7DA 1KEVA 2JRCA 3P52A 4KSYA 5E3JA 4MIOA 4MDFA 4QHYA 2VK1A 1G2IA 4R7ZA 3C1AA 2X13A 3JASA 2P4EA 5EHNA 4DG5A 3CD6B 1O08A 3UAOA 1X2EA 2WI8A 1FYWA 3KQOA 2DUNA 1A0OA 5F23A 2HYDA 4NV1A 4YH1A 1NYLA 3MXOA 3H05A 3N59A 2X0FA 3I2IA 2FOXA 4D8YA 1EFLA 2FWRA 2OHXA 3DUWA 2AV6A 5A7HA 4LFBB 1Z4MA 5A02A 4IXDA 3B3JA 5D1NA 5EGNA 1HT1E 4QBTA 3QXXA 1SCDA 2QP9X 3H8VA 4Q93A 4GPEA 4R3UC 3KSAC 1NG1A 3KJZA 3PP8A 3ZQUA 1J2UA 1JMYA 1YOVA 3PS9A 3ZDQA 3S2UA 1CXZA 1U8YA 3DHVA 2CUNA 1LZLA 2ESRA 4M0KA 2RGNA 3GCWA 4PTYA 1DBQA 3UV6A 1ZVKA 3C6ZA 1XFAA 2CXXA 2H17A 2YIJA 2BCJQ 4J3FA 2C98A 3IUEA 3CJTA 4L5BA 4OBXA 4YO8A 1U2GC 1IQUA 4OM8A 1US8A 1YS7A 2C3YA 4NNJA 3JVIA 5CB6A 1FSSA 1N2HA 1ZL0A 2Q1XA 4LNHA 5AIBA 2WJPA 3NTOA 5BSGA 1Z37A 4AUMA 2OY0A 4I8XA 2GEJA 4J16C 5FTKA 3QUTA 1NQXA 2I2WA 3CKLA 4HBGA 1JLLA 5D7NA 5F2KA 4E5KA 2Z9DA 2NIPA 1SOVA 1A5AB 1HFKA 2VFAA 3B7GA 3PNVA 3QA9A 1H2AS 1QIIA 1OV6A 4G24A 4HSGA 4M60A 5A3VA 3TO5A 2WKPA 4HRAA 4MV8A 3E0QA 1UQTA 1C8BA 4ESOA 1WDLA 2WVGA 4DC1A 2DF8A 2VTEA 5ALPA 5GZ3A 4CEHB 2L82A 4FT4A 2HL6A 4F6RA 2GCNA 2C2XA 3KYDA 3JQAA 3EY4A 2WTNA 5M29A 1WVIA 5GGYA 4RWEA 1ULTA 1IVNA 1MRNA 3QWAA 5L45A 4WPGA 1BDIA 5B4UA 4P25A 4JYCA 3H11A 4FEYA 3NCHA 3AVQA 2W93A 2C5GA 4OLJA 3QUSA 3RTDA 5HRAA 2DC1A 3LPMA 2YFKA 1Q0RA 2ZJ3A 3PWTA 2DHRA 1V39A 2WV7A 3B20A 2I5PO 3KVYA 3CA8A 2ZYUX 3VKVA 1L9KA 4RTPA 4M1ZA 5LMCA 2PCLA 2ZITA 1NSFA 1SQSA 1U7DA 3DLPX 5LBIA 3KELA 2UYQA 4MYUA 2QE7D 1FQJA 5K51A 4OO3A 1Y5LA 4FI3C 4AT1A 1JEOA 3PHCA 4RENA 3UQYS 3VAYA 5CXQA 4OD0A 1E6WA 1VRWA 4RIIA 1P1KA 2REXB 2AB0A 4UXJA 2RHTA 4FBMA 3GA5A 8ADHA 3NC0C 4F4DA 1M2OB 1AT1A 1QM5A 1X7GA 1UXIA 2ANBA 2Q5OA 3NIFB 3PC4A 1Q1AA 2A8YA 4WLVA 1LS6A 4WXMA 1PL6A 4CHTA 2VRWA 1K75A 3PNOA 3WS7A 1ZGJA 3MUFA 3SQWA 3AINA 3M9WA 4XQ0A 1GPMA 2V1UA 2AOUB 3MYYA 3WLEA 4YAEA 3L7JA 1G38A 4KZPA 5HG0A 1H8EA 4E08A 2JAXA 1C0IA 5BWLA 4C6TB 5I7UA 2F4NA 1AHNA 3T1QA 1EBFA 3OG9A 1FFXB 2AMYA 1SBIA 1SELA 5EQFA 4JK3A 1SUWA 3JQQA 3QHAA 1PJ2A 3TRDA 4YCAA 1R0LA 1W1IA 2XDYA 4JQYA 1LXCA 3NKVA 4Z4SA 3LDFA 2ZAYA 3CU5A 4IS2A 2X6XA 5LU8A 4D57A 3G9ZA 4OQXA 1Q86D 2IIVA 1YZGA 4ZVOA 3AOEC 4EG1A 3EJWA 2V4MA 3PA6A 3W1EA 1VLQA 5AVYA 1YR8A 1NOKA 2XUAA 1OFUX 3EF0A 4WZAA 1UFOA 2JLCA 3NBZC 4Z9AA 4BNGA 4C76A 2FZ5A 4MRMB 2DP4E 2PH5A 3WIVA 3G13A 1I1QB 3BHNA 4DRYA 3C43A 2XE8A 4NBVA 5I9TA 3IAS1 1UFVA 1W2HA 3MC1A 2DLDA 5AM5A 3EGXB 1L5SA 1YE5A 3IO3A 4X6XA 4ZTBA 4D99A 1WV0A 3KKKA 4IAOA 5LLTA 1D0VA 2APJA 3ESAA 2Q2WA 5CA1F 1E2DA 1GGNA 3EC2A 4QT0A 1GO2A 1JE1A 2X15A 3TW8B 1VPVA 2ZWVA 3F7MA 3WLAA 4CXMA 2Q5JA 4DSNA 2JIBA 3WIOA 5HMLA 3H2ZA 1J90A 3U3DA 5KREA 2VHXA 3QF7A 1EHIA 4WEOA 3RIHA 4DHEA 4G81A 3EW9A 2XWSA 1WX1A 4AXBA 4BO1A 5AW7A 1SXPA 5M7EA 3B9BA 3U7GA 1GYRA 2R79A 1OREA 1YRQA 1ZI9A 5JH7B 3AJEA 3ETLA 1P6UA 2A33A 1KYIA 3DLAA 1KYTA 5MF6A 4MVXA 3MRSA 4RLQA 4BVJA 3RAJA 3EPJA 2BUAA 1J8QA 5CVDA 1VYVA 3BHMA 4YR9A 4FLEA 4V0LA 2AW3A 1EEHA 1DEAA 2PYIA 4FDTA 1RXIA 2F3SA 3OZCA 2BGKA 3EODA 3R0XA 3BDVA 4R05A 3TYXA 3ZXXA 3G49A 1RWPA 1M34A 3GL9A 4R5HA 2ZBQA 4WESA 1IY1A 1TECE 4H7DA 4YBRA 3LUBA 4C4XA 3FWHA 4KE6A 1V3QE 4FUQA 1R15A 4YGXB 4CF5A 4E2WA 1PZNA 1JSRA 4KWIA 4BNUA 2VHYA 2WM2A 3P8ZA 1V8OA 5IP5A 4BB6A 3RK4A 1TYEB 2EBWA 5BOVA 3S2ZA 2ZRGA 1TYZA 3EA5A 3GDGA 3T56B 2F7SA 2JAHA 3K05A 3D7RA 3VSDA 5REQB 2UVPA 3V8VA 1GTZA 5BN5A 5CEJA 1MW8X 4HUQA 1FTYA 5KNLA 1HE1C 3TSAA 3OZVA 3QOFA 2OVBA 5DNDA 2JK1A 3CX4A 1Q20A 3M1YA 2FLWA 3RRMA 3TDMA 3ZGZA 1ZO8A 3A6FA 3RG8A 3HYRA 3CG4A 2QX9A 2JGFA 3DZFA 1IUOA 1YXMA 2XTAA 4GF5A 1S96A 3HVJA 4X60A 5AM4A 1XFOA 3V9AA 4ARAA 5TV2A 3OEEA 5CCXA 4HGQA 3C6XA 1GSHA 1LY1A 2WPNA 3H3XA 1XT6A 4MQ4A 4CDGA 1GJRA 2PEZA 2PVPA 1UBMS 2QTMA 3I9LA 4XAQA 5ENVA 1Y33E 4O2BA 3F90A 1DXHA 4ZVTA 1IK4A 4Q3LA 3FMFA 3K4HA 2VYNA 4RH0A 4BU0A 2OBLA 3MLEA 4DJEC 4LWOA 3D31A 3OURA 2A1TR 1E8MA 1O96A 2F67A 1XA4A 1QWOA 2V0NA 3IUPA 4GI1A 4GICA 4RH1A 3KXIA 1W96A 4CFSA 4MQ6A 3W79A 3E3MA 2QMYA 3KEQA 2YRXA 4X45A 3RF6A 1IWPB 3L93A 4UBIA 4ESHA 1GZ6A 1SKYE 3WBFA 1Z2NX 2H1FA 4IHKA 1Y1PA 3VR6A 3EXEA 2VF8A 4KV9A 1WUHS 3O3CA 5FULA 2ONJA 1TYBE 4TV8A 1IZ8A 1WXWA 4BO2A 3K6SA 4KODA 4Q37A 1EGAA 3KYIB 3CXCB 3S2SA 3NVKI 4ZGNB 3PSAA 1C0PA 1CJTC 4D4HA 5G41A 1UCFA 2PM8A 3ODGA 5DGIA 3WHPA 5HEKA 3PVSA 3UK2A 4K9QA 2ZUTA 5C7LO 1RLIA 4OQNA 3A4VA 3M5CA 3RRZA 2FQ1A 4RQTA 4IIUA 5JSYA 4AYWA 3CVYA 1L4HA 1CIPA 1XU4A 4ZVSA 3Q85A 3LNCA 2JHPA 4ZQFA 3OPOA 2QN8A 2G9VA 4RK6A 5EUMA 2CB0A 5ALYA 2MSWA 5I7OA 5DM2A 5HIMA 7REQA 1JA9A 2O2GA 5IKPA 3BGOS 4FYKA 3WGIA 2OTLB 5LOVB 2QZ4A 3T3PB 5L7TA 1NVDA 5LQCA 5CFRA 1VQ5B 2FPGA 4BMSA 2I4TA 2KBFA 4EUKA 3IOBA 3KFVA 3O6VA 3RABA 1C4XA 4CR8A 4M0LA 4J0JA 2QM3A 1AV7A 2B82A 2WIBA 1IUNA 4LX8A 4ZOCA 2BSQA 4KQ6A 1FC0A 1Z0IA 3QU5A 4IS3A 4J0DA 1ABFA 5DBHX 3RRFA 4DCOA 3OLZA 2CDAA 2ADOA 3BORA 2WU3A 4LZWA 4CODB 2VEDA 2OILA 3LQ1A 2XWPA 5KJEA 1WXXA 3F6BX 8OHMA 4YFVA 3TIVA 4L4SA 1U28C 2FJ0A 2MSKA 2RJOA 2V74B 4YJGB 1K6XA 2C9CA 1Q1ZA 3OM1A 2NO9A 2O59A 1ISIA 1VJ5A 4AC9A 3EVBA 2V7UA 4P3OA 4YDRA 4BL5A 3F5MA 3LBHA 2IU4A 2WE7A 4FKMA 2WMOB 4J2TA 5JD3A 4U7FA 2C9BA 3MLBA 4IUBS 4CMCA 2TSYB 5H82A 1GUZA 1OFVA 3TTVA 3EDMA 3K9BA 1DMSA 1MDFA 3KP1A 4OL9A 5H9VA 1GKIA 1ZK1A 4WKPA 2AW5A 4ZYXA 2IS4A 4NR0A 4YRAA 5IH7A 1YB4A 1VE9A 1T9GS 1MX3A 1JDBC 4Q3EA 4BBPA 2HREA 4EKDA 1JR6A 5KX5F 4Q4HA 4JMQA 3VFDA 1DC7A 3LH5A 2RI6A 3SF0A 4A6DA 5TMPA 2X76A 3FYTA 1H66A 1E9VA 2PSFA 4TSFD 3COYA 3RVSA 2GZHA 1WXIA 2IF2A 4G1BA 3QX8A 4RHEA 3MJRA 2GHIA 2WJWA 2VLIA 3DFMA 4PR3A 2ODAA 1J56A 1C7ZA 4R1OA 4AQYB 1JEYB 4I8DA 4ENUA 2W6OA 5DU2A 5FWNA 1KO5A 4U02A 3NHYA 4W1QA 3RT1A 4N82A 1A3CA 2FNAA 4H08A 3V7YA 3CRW1 5EIBD 4EMSA 1PZXA 2IOQA 3BFXA 3G17A 1F6BA 3I9JA 5CA1A 2BEVB 2DWQA 4H3KB 4OFZA 1I0LA 2GPNA 3RVJA 5JALA 3JYPA 4JT9A 3KOMA 2NZ2A 3URKA 1PWYE 3D4LA 1GPUA 3V97A 1TUIA 2GM5A 3VR4H 1T29A 4W5HA 3KWMA 1KP9A 1QIFA 2IQ5A 5K2OA 1E96A 2BLNA 1OAKA 3TSZA 1IUKA 5KWSA 2BD0A 1ISRA 4BV3A 2E1PA 1IM5A 2ZS9A 2FPOA 2NGRA 2F9LA 4NPCA 1SKYB 2CLHB 3C7KA 3II6X 5G1PA 2XBMA 4GKJB 4YRDA 3WWDA 1CU1A 3ANTA 3L1UA 1FK8A 4GECA 3VYTB 3R7LA 4CMIB 5KTOA 4IDFA 3AGPA 2CE7A 5AM3A 1SMKA 2IYEA 2ZSIA 1IXZA 1P29A 3EBOA 1KMCA 4XWGA 4RD6A 3S99A 2B5OA 1T8PA 2ZUUA 3MJCA 3IEMA 4ARIA 2UAGA 1ORRA 4JASB 1FVHA 2NUTB 2F1LA 3NP9A 1SRQA 4JXKA 4YUAA 5ERYA 4Q00A 1A77A 1WUTA 2XUKA 4HYQA 4B8ZA 4FHGA 4F45A 5HXAA 2YN0A 3JD3A 4K6GA 4NNOA 4LOKA 5DS0A 4PXSA 4UNSA 1JQKA 3JAKA 4M8LA 4MYRA 2PNJA 3SG0A 4D6PA 4EK9A 1X70A 2EBUA 2ZDQA 3VV3A 2J0EA 4GOKA 1ZA2A 1NW6A 5CA0F 2BC9A 5KNDD 4I8IA 2D2VA 4IOLA 2HH9A 3WLRA 2J4DA 2BM8A 1BAPA 4RTQA 2G6TA 3QTTA 4EGCB 2ZIXB 4YT2A 4CCAA 1Y8AA 2OXTA 1GILA 5KCZA 1I3MA 2FSVC 4JBHA 5H83A 2HW8A 1TZBA 5L3ZA 1XZJA 1R00A 2ZI3A 4TKLA 2QL5A 1SVNA 2X0JA 2ODWA 4KH0A 4LY3A 4F4IA 5KYVA 5AVZA 5LQAA 3RJ9A 2ZRIA 4KG7A 2PKWA 3GSIA 1TVKA 1WXGA 2HRCA 3K0KA 3AEYA 2IX9A 3OKCA 1WJGA 5F2NA 3HJFA 1P1IA 3I3SR 2MYNA 3QXCA 5EXPA 1Z2AA 1PNVA 2OC9A 3UXHA 1WB9A 4PPGA 3GLFE 5DYNA 3LIPA 4KFSA 2ECKA 2PU5A 3N2GB 4PPFA 1ZC3A 2YXBA 1E6CA 5CTJA 1K5DA 5KB3A 1SKMA 5J2TB 4XN0A 5K8LA 1NKTA 3EK2A 4EDHA 1XKTA 2CSUA 3CRMA 3KT3A 3INTA 2YWHA 3DZGA 1QDUA 1K7XB 1YIDA 4QDZA 5F33A 1IHMA 1CZKA 3NHUA 1TOAA 4EJMA 2ZJFA 5HX7A 3VNAA 3K96A 3N8HA 4ISBA 2JFWA 1MTZA 1M75A 1FP2A 2XB2A 2O3RA 3HVKA 3ANLA 4W8HA 1ISFA 1ZZGA 5LUBA 4EBFA 2VUIB 1SOUA 1GVHA 2CZGA 2H48A 4QGAA 3VAAA 1SURA 5JECA 4Y2YA 4IRXA 2HX1A 2PGNA 3PDWA 4MVJF 2DGDA 4OQFA 4YCDA 4UPEA 3H6HA 3RG2A 4E0FA 3LDGA 3IJRA 4MI1A 5FLXA 4MR7B 2QV0A 5IJ9A 1WP6A 1RJEA 2PWBA 2VBTA 2B35A 3FTCA 4HNGA 1KZLA 3OPXA 4D74A 4M99A 4WN3A 1RTTA 1VLYA 1RIFA 3BWYA 4FP9A 3X2SA 1JYSA 2Q50A 2W90A 3PQ2A 3K30A 4H16A 1YHNA 3OKAA 3VHQA 3LC7O 1KH3A 3NR2A 3VSAA 1CNFA 2XVAA 1CLUA 3PT9A 3DF9A 2J6HA 3SQDA 1J0BA 1QSGA 1BQ3A 2Z8ZA 2ZYIA 5DZSA 4NI5A 2J7KA 3IUQA 3AF2A 2E5FA 4GVPA 4AQDA 2EFHB 3H1FA 3BHIA 3GLHA 1Z34A 2YWEA 3IAXA 4TKUA 3KJGA 3KKZA 4DQXA 3T5TA 1QG4A 1OCEA 4BBAA 1YZFA 4GM0A 3STTA 1JHPA 3TLXA 3BXFA 5LKAA 1PS0A 2CMDA 1W0KD 3PIIA 1W0JD 4NU6A 1T6ZA 1P9LA 1JI0A 2R1VB 1G8KA 3IAHA 5A71A 1JWLA 1M8GA 4KR7A 1G2QA 3F1KA 1IEVA 3UVEA 3E8XA 2WOJA 1NN3A 2WUFA 4IDCA 4JI5B 2EW8A 1Z18A 3QVWA 3R24A 3IS3A 1F20A 4PVCA 3WWCA 5ES3A 3GFBA 1O95D 1WW2A 2YWFA 3EGVA 3NU1A 1QQ5A 4P6VF 5H8WA 2QUIA 3R44A 3SNHA 3NYQA 3E20A 3BIFA 1N9GA 2Z08A 4JLWA 4R84A 3PRJA 4S1WA 5EEGA 3H42B 1OJLA 5JARA 5JT1A 1LK5A 2QI9C 2OCIA 5DGDA 1XLTA 1T91A 4XGRA 3JTEA 5HKAA 5KC8A 2X1LA 4BPBA 2F4VB 2Q3BA 1JDZA 4QLAA 2NZXA 3USES 1X7WB 1W6RA 3KDAA 5T57A 6REQA 3WQRA 1PE0A 5AUNB 4G07A 2XMDA 2X40A 4JI0B 3VR5H 3GEBA 3ZLBA 3V4FA 2K4MA 2M6SA 4FFBA 3R75A 3G2QA 4FGJA 1VFNA 1T6XA 1WCIB 4JA2A 1NYTA 5LB4A 3RVDA 2RHBA 1ZMTA 3LHKA 5EZYB 1LJUA 4JJ6A 1TRKA 2KX7A 1N2CE 3CLUD 1KQ3A 3MJEA 2EF0A 1V11B 4F5DA 4QQNA 1S9HA 2C20A 3EG9A 1KVRA 2VBIA 2N9UA 3TLEA 3S7TA 3F3MA 1QKKA 4UUNA 3WO1A 1J09A 5FBKA 1J6UA 3GLFB 3QI7A 4YXFA 4GQBA 1T5SA 4CQMA 3IQEA 5F73A 5K0ZA 3AF4A 1YB2A 3ON5A 5DHUA 5GONF 4Q4AA 2NVUB 1T6BY 3FKSD 1OQAA 2RGXA 2BAGA 2ZIEA 1CLEA 1TM4E 1JJAA 3DEIA 1SD1A 1OH8A 2GAFA 1T13A 3H1PA 5E95A 1JR2A 1FMTA 2QXYA 3DKIA 4JYPA 4NYIR 3UG6A 4AF8A 4KLZA 2CF5A 1BX3A 3DDHA 2OLJA 3ESXA 1FXSA 3I2KA 3NYIA 4KNVA 1O97D 5DKFA 5IN5A 5DM1A 3UMFA 2BCEA 4LRQA 2PRZA 3K20A 1GZVA 3G2OA 2PSSA 3B9PA 1XTJA 2BFMA 3H17A 4M0FA 1E0SA 5AKGA 2WD9A 5E6RB 4AICA 2AKEA 1XA0A 2JCXA 3AJAA 2N1MA 4NPAA 3BERA 3CCJB 1JG6A 1USUA 3KJQA 4JI4B 4OHPA 3KL9A 5I01A 4L51A 3GMSA 1V45E 3IBCA 1PR0A 4TMWA 3EG5A 2BEKA 5K0FA 4CCYA 4ND1A 3DVSX 4MW1A 3VBEA 3NORA 3TXAA 1Y3DE 4C7KA 5KOHA 1GLGA 2CXPA 2HFJA 2QGNA 3RIEA 2G7MC 3PG5A 4MUNA 3R76A 3ISXA 4I50A 4HS9A 4L6AA 4URVR 5I6DA 4GXTA 3CESA 1KR5A 1N3IA 3HXPA 3NI2A 4YP7A 3GT0A 1OLXB 3OZWA 1U2DA 1W5EA 3JARA 4X1IA 3HABA 4UTOA 3ETHA 4P58A 3HEAA 3GGDA 4G0ZA 2HNKA 2QAIA 2XRFA 4TL8A 2GT1A 1NMXA 1VM6A 1WZCA 1YU9A 1E2QA 1LU9A 2I54A 1L4UA 1UD4A 3LUHA 4LWZA 1INLA 2W6IA 4DCUA 2Q9AA 4HHEA 3WGYA 3LVRE 4FZVA 4RXTA 4X1YB 4DBLC 3Q6QA 1LVGA 3L2OB 4AMZA 2YHIB 1AU9A 4JLNA