1W87A

Ferredoxin-nadp reductase (mutation: y 303 w) complexed with nadp by cocrystallization
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title C-Terminal Tyrosine of Ferredoxin-Nadp(+) Reductase in Hydride Transfer Processes with Nad(P)(+)/H.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP REDUCTASE
total genus 88
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1w87A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1w87A02
4ZCIA 3P27A 3A1FA 4G5GA 3WBKA 1QGZA 1KTVA 1JNYA 1QFYA 3E20A 4AF7A 2BM1A 3FPKA 1R5NA 1Q81D 1R5OA 4YAFA 1FNCA 1BX0A 1YJ9B 2YWEA 1A8PA 1QH0A 4B43A 3W2EA 4M53A 5EMNA 1E63A 2D74A 3CCSB 2E1RA 2B7BA 1SKQA 1OB2A 4Y9RA 3ES9A 4RD6A 1NJID 2B5OA 4HE5A 4LC0A 4ZGQB 1TLLA 2QMUA 1ELOA 4LBWA 3WY9A 1M90D 2YWHA 4B48A 4ACAA 3CD6B 2BN4A 4TMTA 1G7RA 2BMWA 3OJXA 2RC5A 3U6BA 2BF4A 1VQPB 1UMKA 1QG0A 1CQXA 1GVHA 1H42A 1B23P 3AVYA 2AHOA 3I56B 2QEXB 4AF6A 4DQLA 3OW2B 4R71A 1KD1D 1XB2A 4G1VA 1QUFA 3FJOA 3LYUA 3CCLB 3W2FA 3CCRB 3ZBUA 4PC7A 4YAOA 1GJRA 5GV8A 3CMAB 3I1FA 3CCUB 1GAWA 1QVFB 2DETA 1S72B 1KRHA 2QTZA 3VNVA 3OJWA 3WNCA 3WNBA 1JJ2B 2XEXA 1GR1A 4M2LA 4H9GA 3ZC3A 3JQRA 2PMDA 3WNDA 1K8AD 1EWYA 4NBSA 1JA1A 1XE1A 1DG1G 1OGJA 3VO1A 5H59A 3CPWB 1VQMB 1TUIA 1N0VC 4ACBA 4UAJA 1ZM9A 3QFRA 2RC6A 3QFSA 2OTLB 5FA6A 1R5BA 4Q7JB 1KK2A 1AIPA 1OGIA 3CXCB 4BPRA 3QFTA 5TR9A 1NDHA 4ZGNB 4FWTA 3AVXA 1K73D 1N8RD 3CC2B 4PC6A 3VO2A 1QFJA 3B82A 3JQQA 1U2RA 4PC1A 2BM0A 2HDNB 1VQNB 3J81k 4F7DA 3JQPA 4RCYA 1F60A 5JBQA 4NCNA 2B7CA 2HMAA 3I55B 1B2RA 4K1XA 3G71B 3W2IA 1VQ5B 4RD3A 4TMVA 3CB4A 1I7PA 4EH1A 3CC4B 1FNDA 2DCUA 3U2QA 3ZZ0A 4HE6A 4DQKA 1VQ4B 3PENA 1W87A 2VYQA 1VQ9B 3AGQA 3AVVA 2EFGA 2J7KA 4RD4A 2CRVA 4B4DA 1BQEA 3LVBA 1WDTA 4J0QA 5HXBA 3G4SB 5AN9A 1YI2B 1FDRA 3CMEB 1VQLB 3CCMB 2DEUA 2DERA 1OB5A 4RCZA 3AVWA 1Q86D 1GAQA 2X3UA 1FRNA 1Q7YD 1D1NA 1EFCA 4MYTA 3CRZA 4C43A 3ZZTA 3MCAA 1QVGB 3ZZUA 3LO8A 3LRXA 3OZVA 1ZM3A 4RD0A 4C0SA 1EFUA 1YITB 1HA3A 1VQKB 3OZWA 3B78A 1KQSB 4M4SA 3CW2A 1JB9A 4LBVA 4G1BA 1W2BB 1G7SA 1G7TA 1EP3B 1ZM4A 4LBYA 1SM4A 1Q82D 5DSZA 1CNEA 1KK0A 2PIAA 3AVTA 3CCVB 1QFZA 2XNJA 1EP2B 1FRQA 4FN5A 1YIJB 4B3XA 3CCJB 2GQFA 1EFTA 1E62A 2ZITA 1QUEA 5TY0A 1QGYA 1IB0A 2QA4B 1QGAA 1DARA 2OTJB 4TN1A 1QX4A 3WXMA 4QHYA 1JA0A 1CNFA 1VQOB 3QFCA 1G7CA 2VNIA 2OK8A 1BX1A 1KJZA 2BGJA 3WYAA 2EIXA 4P6VF 4B44A 2VNHA 3G6EB 3AVUA 3OZUA 4U9UA 4Y7CA 1YJNB 3CC7B 4IW3B 1W35A 4RD2A 1D2EA 4AC9A 1YJWB 3P26A 1KK1A 3W5HA 2BV3A 2YWGA 1YHQB 2YWFA 4PGOA 3W5UA 2BPOA 2XNCA 1AMOA 1EXMA 2R6HA 1FNMA 2VNKA 1N0UA 4MYUA 2NPFA 2QN6A 4TMWA 1TTTA 4B47A 3CCEB 2OK7A 1VQ7B 3E1YE 4M0LA 2CNDA 3VNUA 2BVNA 1J9ZA 1F20A 1EP1B 5THXA 3W2GA 2C77A 1VQ6B 4YALA 2BSAA 5H5JA 2GPJA 3W5VA 3VMFA 4PC3A 4LBZA 2BGIA 1W34A 5GV7A 4WQMA 3CCQB 5TV2A 2DY1A 4ZCMA 1TVCA 1M1KD 2VNJA 1GO2A 4P3YA 1DDIA 4TMXA 3U6KA 1FNBA 1ZM2A 1D8TA 3QE2A 4N3NA 2QTLA 1KC8D 3MHPA 4PC2A 3QSYA 3MMPA 1E64A 1S0UA 1ZUNB 4ZCLA 5KSWB 4FK8A 4M1KA 3WBJA 1VQ8B 4QFMA 2QDXA 1DDGA 1BJKA 1IJEA 1H85A 3SJZA 4YAUA 4Y9UA 2C78A 4YAWA 3B8HA 4RJLA 4TMZA 1K9MD 2VZLA 4YHBA 2FX3A 4RD1A 3ZBTA 3AGPA 3W2HA 1KK3A 2PLFA 2HCJB 3V76A 4ZV4A 4N3GA 1IJFA
chains in the Genus database with same CATH superfamily
3ZXXA 1H4VB 1NOJA 1TKCA 1NT4A 4Y2HA 1P2SA 4I4TB 5TEWA 3RVOA 4EFKA 2EFHB 4U2EA 2X9QA 2QRZA 2XZDA 2JBAA 3FLMA 5K09A 2HT1A 1Y82A 4IIJA 2FPPB 3MN1A 5LBUA 3WDSA 1X7WA 5JFTA 1QGZA 1JJ7A 1QFYA 1GKIA 2ZJ6A 4WWVA 2BHNA 4RL4A 4GYWA 4PGAA 1P3Y1 4GYYA 1BE8A 1FVXA 3OOSA 2QG4A 2OQIA 5EGNA 3ZJTA 3EHDA 2GPNA 3EIEA 2G40A 5J23A 1MIOA 3C7CB 1L5HA 2FCAA 4BB9A 4EA9A 1QP7A 1KI8A 3P2MA 5EXEA 5LBTA 3RAJA 5CCBA 4OQXA 2AR0A 3AUXA 1VZ3A 2J09A 5FBZA 4DJTA 3LRTA 3W4JA 3ASTA 3JD1A 1F7UA 1XJ0A 5H68A 2C7QA 3E7XA 1L5OA 3NM6B 5FDFA 4BCDA 2B7BA 1JHMA 1DEXA 2IDZA 4R8RA 3DB2A 3PXGA 1CETA 2QQ5A 5JDIC 2H4JA 5M5BA 1DAIA 3NT4A 2O8BB 4HGZA 2CLFB 4RD6A 1T4CB 3D7RA 3Q12A 1D1TA 4J1NA 4L7VA 3LI2A 1BRTA 4M7RA 1J5PA 3AM4A 3IV9A 4ZU6X 1TK2A 4LC9A 4XE5A 1U8FO 2G5PA 2ZJOA 3GZ4A 4KQIA 3V1NA 1QWSA 3N8IA 2P4QA 4C89A 2PZ8A 3PNKA 3P2IA 5DX1A 5TF4A 3WIBA 5JNTA 3BFKA 5KDDA 4L8GA 1W96A 3OPYB 4XDZA 5SY9A 4BIIA 1NBAA 1P7ZA 3KXDA 3L0SA 5B12A 3U1BA 4P3PA 4XOIA 4Q1BA 3DHYA 4LNAA 1XSEA 4EFNA 3IT2A 1BCRA 4ALLA 4HF7A 4IGKA 2MYUA 1RKBA 3UC5A 4BNKA 3NU1A 2CCGA 4PY2A 4O4JA 5BVGA 2CLEB 4GLBA 4DIBA 4YBZA 1OC2A 2BFOA 4ZVUA 3TTSA 5ABPA 2P1ZA 4Q6WA 3G3EA 5GP1A 5JYCA 6ADHA 4FUQA 5K99A 3ZQJA 3ROQA 2R84A 2EL9A 5AVRA 4XIJA 1ZK0A 1L7AA 1GU1A 4YRDA 4ZICA 2CMHA 1ZGHA 5CYGA 1Y0BA 3BT7A 3I05A 5FOVA 1ATIA 4PG6A 5FR1A 4DNPA 1TZBA 4HNRA 2AN4A 5C8VA 4PWYA 3EZYA 3R6GA 4X41A 4LOKA 4AZVA 1NLUA 3GJ5A 4R71A 1KE1A 2OZKA 4B0OA 2ZB7A 1VLMA 4M37A 4Z54A 5FWXB 2DU8A 5LMZA 3EZ9A 3GRAA 3LHFA 2V9CA 4F4HA 5HQTA 3L79A 4CHGA 3DLCA 1FDOA 3VYUB 2GJPA 4IZHA 4JROA 3NEYA 3OIVA 1L7RA 4D3FA 4F06A 4A1OA 4RTJA 2DQYA 3E4DA 5GV8A 4GAEA 3IP5A 4DJ5X 4DA9A 5JZOA 2M5SA 4JXZA 3KQOA 4CMHA 1UH5A 1UFRA 1J90A 1Z25A 5JXIA 1F0NA 2JLCA 5EWLA 2Z6UA 2AWOA 2RJOA 3TGWA 5CXQA 3RWBA 4M8KA 4JLVA 2FWIA 3VR5A 1A5AB 1V7QA 2IH5A 4EUHA 1ULSA 2FG6C 4LRUA 3O7WA 4I3GA 3VRHA 3LQEA 1NF9A 3DJYA 3ANYB 2XUIA 4WXRA 1X3LA 3H2HA 3N7AA 3NTVA 5A02A 3T34A 2YIMA 3QXJA 5HJ5A 4CF6A 1QHYA 3BL5A 3MJEA 3V55A 3NCTA 3L02A 4D9FA 4BX8A 1NT2A 4J0FA 4AMBA 5JEDA 1PS9A 2N42A 3EXEB 5ESXA 1AUOA 2QG6A 1JXQA 1U1GA 4IKEA 1VBNA 5KKNB 1M66A 1P2DA 1LPSA 3GEDA 4EAQA 3FOZA 4ZI5A 1NU6A 1T2AA 3O3OB 1MKYA 3C3PA 4RHCA 2QT0A 5I9TA 5HZGA 2V7PA 2OHHA 2IWRA 4MVJG 4RLZA 3X43A 2FWJA 4HDAA 2PM8A 1G9XA 4ZOQI 5CD9A 4J3FA 3EZ2A 2H7XA 1TCAA 4NCJA 2X4LA 2JK1A 2KLHA 3K9QO 3JATB 4BCCA 3V8NA 4KQKA 1R9JA 4D0GA 3ER8A 4CEHA 4NQZA 3HL0A 5KYKA 2GEUA 4KWTA 1P5FA 2ZQ5A 1MH9A 1O9HA 2QX6A 1UD2A 2J4DA 3SX2A 4L9AA 2CL5A 1EXWA 2I8LA 3GLTA 1IM2A 1DQPA 2JD0A 3QQ5A 4N6OA 1N0IA 3UUFA 4C4SA 2V0NA 4GKKB 3QNMA 1DKQA 2C2HA 3ZWQA 3EFHA 2Q9UA 3RWMB 3VZRA 1C9NA 4OQYA 4JGBA 2DSNA 2IHTA 3KUDA 3ZIDA 4QKQA 1QHXA 1WDWB 2J5QA 1ACMA 2VOJA 3FGNA 2HK8A 2PBLA 3NC1C 3PHGA 4HMOA 4R8LA 3H42B 2HCRA 3AR4A 1G6Q1 4OXXA 2OB2A 3BAZA 4JDPA 1T5EA 4TYQA 3L8FA 2IL1A 2C1ZA 1KYWA 2F6RA 1E4EA 4GEGA 3U19A 2ZSFA 3K6KA 1TKRA 2E4YA 2RG1A 4LDZA 5IH3A 2WF5A 1EWRA 2I4TA 4QTUB 3GFRA 4GVXA 1KI6B 4LZWA 1TVKA 2ZL5A 3DMDA 1QP0A 1V5EA 2W22A 4YTEA 1SCKA 1OWOA 2XCTB 2BDTA 4LJYA 3RUAA 2Q99A 3RR2A 4BVHA 3IMKA 3KLMX 3SJ7A 1U0HC 1NI4A 4NCHA 3NKFA 4RPBA 1VBFA 4GLFA 2IOYA 4ZIRB 2OPHA 4PYQA 3JTEA 4UHKA 1QHIA 4FCCA 4ZIRA 2CF5A 3NASA 1MEEA 3IP1A 1RJWA 1P2UA 1Y81A 2CFIA 3KPJA 3ND6A 3NS7A 5HKAA 1KMNA 3CC4B 3NH9A 4JLNA 5CB4F 4HNAB 3KSBC 5B3JA 2IZOA 4ZVSA 4GH5A 3GELA 3KQLA 4P12A 2OSVA 4P7KA 1VE9A 3WLNA 4MI9A 1U31A 4N8DA 3CA8A 5AJTA 5AJZA 4K6KA 1TE2A 3PCRB 2Z9DA 4GOMD 5T6BA 3Q9NA 5DN6D 3DNFA 2WPDD 4KBYA 4F12A 5JQGA 2ZUCA 4MUJA 2EX0A 2YHIB 2GAIA 3E58A 5TSDA 3SHFA 1QG4A 5FTWA 5BN3A 2JGDA 2OGZA 3FFTA 3HH8A 4PF1A 1ZCJA 1Z74A 1EXDA 1WDTA 4BE7B 1P2FA 1OZ0A 3CESA 3PUNA 3EGCA 1XLWA 3HJGA 4CCSA 4YUAA 2GBGA 4FDVA 1BLIA 2FX2A 5BN4B 3WLEA 3GIDA 5B2ZA 3R3VA 3RD5A 1GQQA 2JANA 3I5UA 3PGLA 5JQGF 3JAKB 1UKVY 2HLNA 4Y6QA 3DL7A 1VHOA 3SVZA 2QRGA 3O8DA 5BOSA 1EBUA 4V38A 2PYIA 4YGYA 5DB4A 4P2GA 1ZCAA 3AVWA 2HFKA 2JFWA 4IOKA 5FO1A 2FEMA 3GGSA 3M4XA 5KYXA 1SUEA 1TZCA 4N5MA 4AP9A 5EJ7A 3KAQA 3O5AA 2MMGA 5AW8A 1C0KA 4LVNA 1AK1A 2F48A 4MHOA 5EMLA 4JKIA 3OW7A 1R3UA 1SC1A 3GOQA 3Q8LA 1T3LA 2IDJA 4WOBA 2C4TA 1PEDA 2EFYA 4RY0A 1U0LA 3TOCA 1VKOA 3W8DA 3KHKA 4CIDA 4A92A 1F12A 3EG9A 4GOOD 1EWQA 2YIVX 3KL9A 3G2MA 4BGEA 5FX2A 1Q57A 1TU3A 1LI4A 3ZV7A 4F6LA 4DLBA 2VPWA 3EUEA 4G07A 1JHXA 1OWPA 2RAUA 2Q5FA 2HA5A 1C1DB 1CUEA 3HA3A 3KO8A 4HC4A 1E9VA 2H51A 3NGMA 5KVSA 3T06B 5KC9A 3CE9A 4RHYA 1B1CA 1P77A 1B1AA 4BL5A 1A50B 4RTSA 3A0UA 2JHCA 2WHPA 4B7ZA 1M2EA 4UUQA 4Y2GA 1AKQA 1X6VA 1AKUA 4QG7A 2Q5EA 2OGUA 5TMBA 2OHFA 2ZL7A 1CF2O 2SKCA 1DE0A 3MA0A 3KBOA 3P9PA 1UZMA 3O4IA 4R0MA 4N5LA 4CTJA 3IXMA 3Q8MA 3JASA 1QJ4A 3CW2A 2K4MA 3PLNA 3JTMA 5CLIA 3ZXIA 4LNUA 4KN5A 2WIJA 4LYFA 1L4HA 4MGHA 5IMSA 1ZM4A 2R9VA 1G0OA 3I0ZA 2P2DA 3R5SA 2PX8A 4WI1A 3NDRA 2H63A 3IESA 4ONEA 2AC7A 2VQ3A 3C6BA 1UBOS 4F46A 2VPZA 3ZHUA 4DNOA 3O2SB 1XZEA 2F9FA 3K30A 3SHTA 1SQSA 2J3JA 5CXSA 2O3SA 3VOBA 4PAWA 1EP2B 3A1NA 1FVOA 3NWBA 1CQIB 2IHKA 4XLCA 1V9SA 2FP3A 5LQAA 3ZNQA 1EDOA 2XUJA 4A2WA 4QBGB 5FIUA 2ZM6B 2XOEA 4GRDA 1PR1A 4XH9B 4AS3A 2ZIZA 3E3AA 4DIFA 2JLUA 1G3QA 2D62A 2VF5X 5DF1A 3G9UA 3I64A 3PPYA 4AROA 2PQ6A 3E23A 3R40A 1KVRA 2MU1A 3DEAA 4Q6BA 1RFGE 2ON6A 4NRDA 1Q0ZA 2HPHA 2VWQA 3LY5A 3M5PA 4RMIA 2O5CA 4AMVA 4E5SA 2TYSB 1IEVA 1D6NA 4EWLA 5BWOA 1EK2A 1M3SA 2H92A 4FC7A 3ELDA 2DFPA 1LY1A 2DTEA 2IT1A 3CLHA 3QWHA 1IB0A 2GNPA 3JY6A 4QODA 4YIHA 1UXGA 1WOYA 3BIWA 4DYDA 1UXJA 1AHIA 1WKBA 3PE3A 4LJSA 4UXIA 2BKLA 4ALJA 1A9QA 3EFEA 2DKNA 4P3XA 1J42A 1JMYA 5P21A 4WKGA 4NCBA 3AF6A 1L3IA 1VG0B 2IW3A 3L6RA 4KKSA 4UD6A 2IU0A 4MTLA 3IT0A 1IRIA 2Y68A 4LXHA 4AWAA 3WB1A 3QELB 4JMPA 2P4HX 1KH2A 5AI5A 3O4FA 2IW1A 1F2TA 3HXPA 4LWPA 2VF4X 2V8BA 3H8SA 4MWOA 3EEOA 3NXSA 3TAXA 3CX7A 3K72B 5KJFA 4N65A 4IUBS 2Q9BA 4DLUA 4GPZA 5AW1A 4IKPA 2EEZA 1G1AA 4DNQA 2VNHA 2NU7B 5I5EA 5EVJA 2DHCA 3R0VA 4MLDA 4EVRA 5KBYA 1WO8A 4Z4FA 1VJTA 4DA6A 1KQPA 5BR1A 2ZTNA 1D2EA 4BJHB 2GCNA 1CJTC 1P4SA 4C76A 2C2ZA 4DXHA 5JRDS 4TYYA 3AEUB 3DKVA 4ISCA 4RL6A 4U5QA 1E3WB 5EWLB 2YWFA 2W00A 3LPDA 1VSVA 3PL5A 2ZI7A 2TMKA 4E5UA 1Z75A 2GD0A 3QVMA 1GV0A 3KR1A 1GPUA 1HM5A 3NDJA 3VH4A 3VDMA 3VXKA 3FZQA 3QQPA 4DEXA 4JYAB 4JEMA 2P0EA 2BC9A 1HZZC 4CTKA 4M89A 2YY5A 5CNIA 1XTIA 2OM2A 3LQQA 1TF2A 4UXHA 2NPFA 4W6QA 1GPDG 2DB3A 3BSWA 3T9CA 4JOQA 2WJZB 2PR2A 1KFEB 2LPMA 5ALGA 1W9MA 3FUTA 4CLRA 3SEZA 1TJ3A 4KCGA 1T29A 4KI7A 1TTPB 1XTPA 4BTLA 2WVAA 4R8KA 5DTQA 3MGAA 3PNBA 2VJYA 4DRXA 5B4VA 3A1SA 1OXMA 1GSHA 3OCVA 4Z3DA 5AQ1A 1YQUA 4W5HA 5KTRA 1GSOA 4XR6A 2D1TA 2Q5IA 3FDIA 3Q3HA 2W4QA 4KXFB 1OLSB 4E0FA 3T1NA 1P74A 1MNQA 2XCQA 1DAPA 1J25A 3MJSA 1U0RA 1LFDB 4IG4A 3HU3A 2EU8A 3ZKWB 4M9XA 4MUEA 4NJMA 4ZI7B 4BO0A 2PVSA 3DMPA 5DM4A 2IIPA 2HEGA 4R8SA 3I37X 2EKDA 3BRCA 2QOEA 2PUHA 4P0TA 1K66A 5F1YA 5BWNA 2OKGA 4XJVA 3IV7A 4ZYUA 1JIJA 2PYZA 1YHNA 2WWYA 1K63A 2V8OA 2PH3A 1ZRSA 2G76A 5GV7A 4PONA 1YOVA 4UU0A 3W4IA 2PUAA 2WNHA 1WTCA 2QU7A 2YWDA 3BL6A 4ZI3A 1NUQA 4C7MA 1JU4A 2EGHA 2GM3A 5K7SA 1SOWA 4QUIA 4R40A 1DLJA 4IOLA 3OLVA 3OTHA 4Q18A 3E48A 5JNWA 1AF7A 2PLRA 3PDWA 3F90A 3L46A 5I45A 4HDRA 2ZSJA 1E3WA 5COQA 3SC3A 5DHSA 4D0LB 4NXMB 2VZ9A 1S2LA 1UP4A 1TVKB 1YQEA 3I1IA 4GXRA 4POAA 3RRBA 2FWAA 1TM1E 2D2EA 2FVYA 4Z8XA 1MG5A 4OMFG 3FHOA 3F3YA 1GGMA 4NE9A 2YHUA 4G5FA 1B6SA 3BOSA 2YMMA 1E64A 1KO1A 3TLKA 2H5JA 4RTLA 4WZKA 5JYDA 3MSXA 2PGJA 2AN3A 3R3HA 2ZT7A 5DNDA 3PRKE 3WIVA 2XOKD 4BV3A 4NHEA 1JV2B 4TSFD 2D7DA 2QM8A 5BMVA 4GQNA 2E6UX 4O4LF 4DYHA 1FYXA 4JXKA 4ECEA 5TRTA 4W1SA 3V7YA 1UZLA 2NG1A 3OECA 4X7PA 1CYDA 1JTVA 4DL9A 3W9BA 2EOAA 3ST7A 1LPOA 3QXSA 2XJ9A 1N36B 3HP1A 1IH8A 1C9JA 2JJMA 3DR5A 3GNTA 3HB5X 4XWYA 5BN4A 3ADBA 1XZNA 2LUOA 1YTLA 3OEWA 3QG1A 4L22A 4EGCB 3SJZA 4ER7A 5A62A 2NIPA 1DIRA 4OSOA 2F1HA 3ACDA 2ZE6A 1Z06A 4RAQA 1DAMA 2VTKA 1EHIA 3VV2A 2VDWB 1FB5A 1LZLA 4G37A 1OAOA 3NAQA 1QDUA 2ZWPA 3TFOA 1CY6A 3LOUA 2M1XA 4CRWB 1DEKA 4F45A 5HM8A 2O5EA 1W47A 3K96A 2B8WA 1E60A 4TWRA 1W9XA 1OAKA 1JT2A 2W2NA 3LX6A 1ODSA 3ZW9A 4YYEA 2FUKA 2GESA 2AHRA 2P9CA 1CSEE 2NU6A 2REQB 3ENWA 4JJGA 4MWZA 5EKSA 4F11A 2PTGA 1Z4QA 1BYIA 3QFFA 3THXB 2P6RA 3WAGA 4IIFA 1SB8A 4X8LA 2Y4OA 2R5WA 5JISA 2YRWA 3UW3A 4FE4A 2A0FA 5E1OA 1XN1A 1AJEA 2EZ8A 1I0IA 3MXTA 2HMUA 3K9LA 2QROA 3ESCA 4L8FA 3WGGA 1Y5RA 1WZIA 5GOZA 4BATA 3LCRA 3B70A 2G88A 3PA6A 4YVFA 4A16A 3TMKA 3DL2A 3SS9X 4NBKA 1NB9A 2FZLA 4HXGA 4N0PA 3RU3A 2DYIA 1R8YA 2E55A 3ZE6A 3ZTYA 3JD0A 4BNUA 4GMXA 1GKKA 4TS9A 4EW1A 1UT8A 5DBFA 3GT7A 4CR7A 1UT6A 5BMVB 2XE8A 5LBIA 2Q6KA 1AF4A 1BMFD 1OXTA 2DY0A 2RHCA 3GJ7A 3ES9A 1E1YA 4MR9A 4OJQA 3VR1A 3WK8A 4CKYA 4FB4A 1GPWB 4DV5B 2P0YA 1UXOA 1V3TA 3HFJA 2ZRAA 5KYGA 1O96A 1R6DA 3L1KA 4HRYA 3RVMA 2KW5A 4XUDA 3ICCA 3RBAA 1IVNA 4BZWA 1Z2DA 1RSZA 4ZDKA 1E2FA 2PXXA 3EVGA 4XWAA 1ZJ6A 2BGTA 5EIBC 4I9HA 4FS8A 3FNEA 5J4VA 1QXSA 5IP5A 2Q2NA 2GR9A 3VSDA 1G5HA 1GRCA 2RHGB 1BE6A 4WFJA 4BBJA 1HZEA 4EHNA 1C1XB 2Y1DA 3QF4B 3MQ2A 3WNZA 2YZKA 3HP4A 1T2FA 1MQSA 2CHEA 3E3OA 3U6BA 5I5GA 3VHXA 2I80A 2CK3A 1FFDA 5J35A 1T6ZA 3G5AA 4U0JA 5SZHB 4B6JA 2Q6VA 2YWBA 5A3JA 3NPAA 2VJKA 1IC6A 2FRVA 2FH5B 3O1IC 4H60A 3I04A 3FNGA 3HI6A 3JU3A 3OF5A 4JP1A 1Z7EA 2JFZA 2R4UA 4UW9A 3RYHB 4YCCA 5BPFA 2AHOA 4J1SA 5MGBA 3PC8C 2OAEA 1PEAA 1BZYA 1X38A 3OA2A 1NDQA 4YJGB 4OHBA 4QEDA 2AD5A 4N9WA 5EPOA 4DIEA 1BJRE 3F1KA 1NVUQ 4H7JA 2H7CA 3UAVA 4EL5A 1OIWA 1VSBA 2EJUA 5DGDA 5DHRA 1U7OA 2BFPA 4H77A 4BZPA 3M6FA 1DOZA 1L1FA 5B36A 2GJSA 5HJ7A 4FHFA 3N6XA 3CCRB 1Y6GA 5LPNA 3A4TA 3EASA 2O20A 3BB1A 1JMKC 4ASUA 3CMAB 1NNLA 1VKRA 1JQAA 1XCLA 2DH5A 3WQSB 5IUNC 1JKMA 1SVLA 4JEIA 2I2XB 3TG2A 3IYLW 3UFBA 1WB5A 4EPXA 5K4GA 1Y7HA 3A9WA 1E2LA 1RS0A 1B3BA 3FDZA 1T8TA 2L18A 3G88A 3I04M 3PXCX 4PCVA 4DGQA 4BWYA 2ZANA 2FZ4A 4I55A 4Y0VA 3VM6A 1JG1A 2XWPA 1OJ7A 1KFCB 4ERXA 3D1JA 3HCPA 3GDHA 4PSUA 3WL6A 1YZKA 1DAHA 1T9HA 2G1UA 2WYVA 4US2R 1BW9A 2DPMA 1IJKA 2H0QA 3DBRB 1L4GA 3DXXA 4HWPA 2P9HA 1YQGA 3AEUA 1O9GA 2XY4A 5E6TA 5DCYA 4DBLE 2JLQA 4BVEA 3VNRA 1UZAA 1W4BA 4CUZA 4E5PA 3W5CA 1M1YE 4V1CB 2WMDA 3GGDA 4GPEA 2VPXA 1JXAA 4YGXB 3WGVA 4QQFA 3L7NA 4CCYA 4JIGA 3PJFA 1FTQA 4GQBA 4MV8A 4PCAA 1V1JA 1FYFA 2RH4A 3JALB 5F2OA 3A3BA 2PX0A 4LI0A 4Z4SA 2XD4A 1RQGA 4ZHQA 1C8KA 1Z22A 2V7XA 4B32A 5MN6A 3DDZX 5H9VA 2QD1A 2OYCA 3UUEA 4CLRB 3RC9A 4NPCA 1U9CA 1F2DA 3DOHA 1NJ8A 3OCJA 4LXIA 4O4HB 5BQFA 3AJ9A 4UPVA 3MRSA 1XVIA 1J33A 4NVRA 2D0DA 3SZMA 2VP0A 5K3EA 4ZYVA 2OTLB 3OETA 2H4YA 1DPGA 4H6VA 3TO5A 1O97C 4Q7JB 2XHEA 3R3SA 2BUCA 1Q7BA 2XUPA 3NDPA 1TXGA 5BVHB 2ZXHA 1PZNA 2F59A 3TXAA 3WJAA 2MSLA 3DDUA 5COAA 5JSFA 2GI4A 3ZNNA 4DY4A 4FWTA 2X22A 5FKJA 4Y2VA 5BYBA 1ORIA 3KT8A 5D87A 4ILEA 1W8DA 4WFIA 1F1JA 3ZR4B 1RNLA 1TJYA 3PSHA 4C1BA 3JQQA 1RXEA 5AJWA 5K0TA 4CI0B 3G2LA 2C61A 2K7ZA 1SU6A 1GLGA 2JIOA 2ZRBA 1G5RA 2AOXA 1IHMA 3B1ZA 3LDFA 3NH6A 5IJ9A 3JQ8A 4QDOA 3QE4A 3WBFA 3Q10A 1F7VA 4FKBA 2O3UA 1YIDA 2W70A 3UCXA 4BMNA 5F9HA 1P61B 4BZZA 1V3VA 4D5GA 2Z8YA 2B7CA 1K4MA 3ENKA 1I51A 3DXZA 1A5ZA 1TF5A 3QW2A 1SOMA 1DCKA 1U0NA 3G71B 5J5AA 1GG9A 3W2IA 5K0BA 1O87A 2YIJA 1FDIA 5HCUA 1OLXB 4EUNA 1OR8A 2W93A 1GUZA 1ZI8A 2Q2OA 4B6EA 1KQ3A 1TCVA 3IQFA 1CZUA 1H4QA 5CA0B 3ND7A 5KCMA 3U4IA 3UKJA 3YASA 4LXQA 2GLXA 1LA2A 1E3XA 1N5DA 1TADA 1Z4MA 4E22A 2C0PA 4Z4VA 5ALVA 3L8HA 2O0KA 5COBA 1NVBA 2BY4A 1OQAA 4MB2A 4EY6A 1PNRA 3H86A 5DJ5A 3N6RA 5GPBA 2C92A 2UUBB 4QVAA 1T5HX 4TQ9A 3PENA 1XQXA 4DMKA 3D5QA 3GXOA 2VA9A 5E1MA 2HGZA 3JQ7A 4KRGA 1DC7A 3KVVA 4M9SA 2Z58A 4GMFA 1L0BA 2A94A 2WJ3A 2BBOA 4GLOA 3K8ZA 4PFSA 4PXAA 3RV3A 4ASUD 4W5TA 4MGKR 2B98A 1UDCA 2PGNA 3SJCA 4AKIA 2VRBA 1VG9B 1ODIA 2OR3A 1E1RD 3EGXA 3L0ZA 3UG7A 4MI3A 3COZA 2PWZA 1IDOA 3QVTA 5JMPA 1NI5A 4BAUA 1PGJA 3AXTA 1W5FA 5DM60 4LV5B 3CCMB 4UDOA 1EE9A 3L05A 4EB8A 5LQKA 1FXWF 2A7XA 3ORFA 1OXBB 1V41E 1JQLB 2C03A 2C83A 3KEWA 3GNQA 3OPVA 4FYVA 4DVJA 2QBYA 2JHFA 4R9RA 4C5BA 1RC8A 1QR6A 4ZV7A 1U3CA 4KN9S 3LTNC 4LE0A 1K5HA 4LJAA 1Z4LA 2E89A 2OUKA 3CSDA 4FN4A 1GKUB 4BQRA 1SVSA 4FFRA 4JLAA 4MWSA 1I3KA 1I1OA 2XMGA 1QDLB 3CPEA 4EHDA 1J1UA 5GJBA 1QYVA 2EX1A 5DYNA 4XYBA 1X8LA 3THWB 1NI4B 3ER9A 2FUCA 3HVUA 1E9RA 4JJ8A 3R5HA 1P0MA 1U0TA 3ZZUA 1QCDA 1V26A 2FSGA 4Y6GB 3WFIA 4BECA 5HKKD 4CG1A 5CFMA 1LRJA 1N6OA 2XYRA 2OWDA 2ZXFA 1N2JA 2QYTA 6AT1A 3ZQ6A 4BRSA 2H31A 1EK0A 3TKAA 1KXZA 1NW8A 4PX5A 1CJKC 4PTLA 2YJ4A 3PDIB 5FHQA 3ZHXA 4DTIA 3GHYA 4F93B 4HZUA 3E2IA 5LQUA 3U56A 4ZVVA 2UVPA 3DFUA 3NNNA 3SR4A 3M6AA 4MCAA 1X8KA 2DBVO 4PHTA 5G0SA 4ZFNA 4G1BA 4ZVQA 1VXRA 3RS3A 1G7SA 1U94A 4RGYA 5KNCA 4K0KB 1IQPA 1YS4A 1G3IA 1V1RB 3KB1A 2H85A 1I6LA 2UDPA 4DLNA 2B4YA 4XN3A 5FFFA 3TAHA 1A2KC 3NAMA 1FPMA 3M6MD 4CJXA 2R79A 1A69A 5K8UA 2QJRA 4EQ6B 5KHOC 3D54D 3ROFA 1KKMA 3I42A 2H59A 4Q4AB 2Q5HA 3SLKA 5C51B 1QVZA 1U8EA 1G21A 4IDNA 1YMQA 2IUFA 4IV8A 1IOZA 4JJAA 5DMXA 3HJRA 3SSAA 4L6CA 5HYVA 3HEAA 5CLJA 1U9ZA 6GPBA 2JW5A 2QAGA 3W1WA 3CEMA 3I9V6 3HXMA 1C3OA 3NBMA 3WDLA 4D8WA 4YV1A 5A0TA 3UF0A 1NVMB 2XXBA 3OPXA 2XCRB 2ZRPA 4BS9A 4P8RA 1C81A 2V7VA 4GKVA 5A06A 4ENTA 1Y4DE 4U8GA 1AN0A 4D92A 2X9NA 4RX1A 1EJ0A 3GU3A 2BJHA 3KUXA 4XM0A 3HC7A 4M9RA 4P2BA 4FPXA 5AM4A 2KBFA 3E5MA 5CBKA 1YJCA 2CMKA 2QRVB 3LXXA 3B2NA 1VDMA 3GZTB 1I14A 1PFKA 1Q3KA 4C88A 1X1TA 3VMMA 1Y89A 1ZQ9A 2CFCA 2AN5A 4U2FA 4XPIA 3E6AA 1UR5A 4QVJA 2YNMC 1V5IA 3URKA 3N1UA 4A0RA 1JWAB 5CDFE 3R7AA 1O94D 2HF9A 1HYHA 5IX8A 5JARA 3DKKA 1L7QA 3ESRA 5IJAA 4R51A 5B58C 1J0EA 3W3AA 2VSNA 1QGED 1ZSYA 2VP9A 3INYA 4W6ZA 3C3WA 2WYHA 1YJNB 2FSVA 5DS0A 4JHXA 3HM9A 2QRNA 2BOVA 3ADCA 4AC9A 2DLDA 3V7UA 2DUWA 1XTQA 4MW1A 1I1QB 4U6NA 3RUDA 3ZU3A 2ZB4A 3L6DA 4RO0A 2YWGA 4DLAA 4PGOA 2H1FA 5JOQA 5AVVA 2IEYA 4C0JA 2FPLA 1IL0A 2A6PA 2XUAA 3KD3A 2R2AA 3ZHBA 2E4UA 2FSPA 4B2IA 1NWHA 2B8NA 2R7MA 2YJGA 3DOIA 3JVDA 5DM2A 1AV6A 3SXJA 1DKRA 2DR3A 4WZAA 5CEFA 5KPDA 2OC4A 4YEDA 3G2HA 1CQPA 1WXIA 1PJTA 1PZEA 2C5AA 3Q7TA 1L8AA 5E8JA 3G05A 1UBKS 3S44A 2XGGA 3OBBA 2VSYA 3LBIA 1CY4A 2VJPA 5CVEA 4D0RA 5IJ0A 4M9UA 1EUDB 4PPGA 3MMZA 4MRMA 4ZHQB 1MABA 2BFFA 1RAFA 1W52X 2QQFA 4TXJA 5L3VA 5F4OA 3BTUA 4LMBA 3JQGB 3HJTA 3OO0A 3QEMB 1GL3A 1E6CA 3BIFA 4P3OA 1BTOA 5ENVA 3S5JA 4PRKA 1XE3A 3PI6A 3Q1LA 1IXZA 2FVGA 2C77A 3JQ9A 4UBNA 4XIFA 3LU1A 1MOQA 2NUPB 2R6JA 4LY9A 4ZQGA 3NVAA 3UN1A 2XKBA 1X1QA 2ATXA 3FHJA 3GRFA 4IZOA 4MKGA 3ABQB 2FGKA 4UZSA 4A6EA 4TTTS 1W29A 5LQNA 3ZX4A 4DMHA 5A88A 3J81A 1OH7A 2R8OA 2I71A 3ISXA 1FFAA 2OXTA 2YV1A 3KDPA 5J4KA 2ADMA 2E5LB 3JU4A 1Q3HA 1VPVA 3PGMA 2BRUA 5IJ9B 1I4WA 4P0QB 1E9EA 721PA 4LFCB 2QRUA 2OFFA 4YT2A 3KZMA 4FBMA 4GO1A 3IVXA 4G3XA 3KDAA 4PYIA 5CDTA 1SXJB 2F64A 4NF2A 2V03A 2IPMA 4MYSA 3TLEA 2WE8A 4HL6A 1H2HA 4RS3A 3HXQA 2RBGA 3E8SA 1ODJA 1V4NA 5AH0A 3IPAA 4RK0A 3C7KA 3WKDA 2UXBB 3K94A 2P3MA 3PFWO 4FMDB 4GPBA 2QTLA 2G80A 3HMKA 4B4UA 3OSUA 4RTKA 3CVYA 3RT9A 2OXRA 2I62A 1RIFA 4M86A 5B2EA 3P5BA 5IJZA 3ILXA 1QV6A 2XBMA 3THOA 1PUJA 3UT5B 4S0XA 4LYDA 1Z4PX 4NC9A 3K9WA 2FLWA 4YFVA 2AR9A 2EJWA 2VXCA 1L7MA 3DL0A 5LVAA 2ZLBA 2W4MA 2ZUBA 1VQ8B 3K3PA 3HFSA 3FVQA 1VHWA 1NMYA 1O8BA 2VTVA 1HYQA 3OHPA 4J2TA 3LKZA 4IO0A 4V0MA 4A23A 4KSCA 5LC1A 1DDGA 2FW6A 4AUMA 1B26A 4G2NA 2FMTA 1TNDA 2NSLA 4MGZR 1I30A 5BVHA 3H0KA 3T54A 3CPHA 2D9RA 2LR0A 4D4JA 1UOOA 5A5EA 4U7WA 3REOA 4MR8B 3THYA 4LQLA 1T6XA 4PZEA 5HXAA 1R88A 4DBLC 4IRUB 2GJKA 3R6DA 4B84A 2A1TR 3ZEAA 1RI5A 5CA0F 1DUVG 4OHFA 2FEPA 4H1VA 5F52A 2FMXA 3RFVA 3ORYA 1WOSA 2O4CA 2A4MA 4JB0A 3DWIA 4IY1A 4OQQA 1VRWA 5G1NA 3MEQA 4ZVPA 4RH0A 4D45A 4E09A 4KDCA 5K0LA 2O06A 3N2ZB 4R84A 3WGIA 2GB4A 3E53A 2EP7A 2B1RA 2TMDA 2PGXA 3TTVA 2MYTA 2PLFA 1NIPA 4AECA 2WG0A 4F9EA 2NMVA 1RWVA 4BUZA 4XM3A 2N47A 1XO1A 3VR3D 5FOQA 4YDQA 3I2JA 5EC8A 4DG5A 2CDRA 2OZLB 1FDTA 3M34A 3P27A 1ATZA 3OC6A 3DW3X 2XGJA 2NUAA 4UHFA 4RPDA 4RJTA 3MINA 3VHRA 3B6IA 1U0OC 3FHTA 4FZ3A 1LLQA 1EGQA 3R76A 3SHQA 1UPAA 3CWQA 4NK5A 4FJ1A 1TX4B 2PJDA 3O31A 4CQJA 5H4HA 4BNHA 3VR6D 5A05A 4PVCA 5B3JC 4ND7A 1FNCA 3FWKA 5IDXA 2I78A 4EB6B 3UK7A 1QH0A 4AXBA 3PL1A 2RHLA 4BJ6A 3H3FA 4MVJF 2HJVA 2PH7A 1X14A 1YZUA 4WKBA 1Q0TA 4E5YA 1SD1A 2MOKA 9LDTA 4CEIA 1X70A 2J3KA 3BMCA 3AG5A 2ZPAA 4JVOA 2IEZA 1U1IA 5P8WA 4N3AA 3SF8A 3ZWBA 2IYQA 4LDAA 2OCBA 4Y18A 4AJIA 3PJEA 3CBQA 4PQFA 4ARVA 4F2PA 4HDSA 1SOVA 2CNNA 1ESCA 3H97A 5CG2A 1E2IA 3C7DB 3LXUX 4JLUA 5CFRA 1X3SA 2YJTD 1WPCA 1JQJC 1NW6A 1PW7A 2FN8A 1I1NA 1MAVA 4WLEA 1VGVA 2JFNA 3C6KA 3OPOA 4U39A 5CGQB 1KAEA 1D9XA 1L5ZA 4Y9SA 3MOIA 4AKTA 4F1KA 3F7MA 4B3GA 2VJLA 1OD6A 1Y9ZA 3IURA 4REMA 1F2UA 1R3DA 2CMGA 4G8BA 1SBCA 3V4SA 1JEAA 2DFNA 3CX8A 1PJ8A 4LYJA 5MFPA 3HBJA 4HP8A 4OH1A 1YA4A 4KXXA 3CCBA 1FUIA 2IYTA 3L6OO 4B6QA 3D4LA 4X24A 5JBNA 2GF2A 5EI5A 3PKIA 4BVJA 4P4SB 4CG2A 3L8DA 121PA 2H08A 3BB4A 3IQEA 3HPRA 1K7YA 3V1YA 4E33A 2D2FA 1WSWA 1LF0A 1JGTA 3H1EA 4ARCA 1MF7A 4LHWA 3UOWA 5KYWB 2I3DA 1UZNA 1H42A 3IQGX 3L77A 3EJWA 1T1JA 4B9EA 4C7JA 1CE8A 1II8B 1NLMA 3U3RA 1LQTA 1RHUA 4N7BA 2HWUA 4PV7A 4N01A 2JVIA 3EAFA 3PNMA 3Q6MA 3ASPA 5ILQA 5LP6C 5L51A 1LWOA 4G0NA 2IUSA 5FI0B 2VJBA 2YZNA 2X14A 1WKVA 4HADA 1DC4A 1Y9JA 3DT8A 4KWEA 4OCZA 2VTBB 3R24A 5JI3E 1XV5A 3S40A 4WOJA 2PZAA 1WP4A 3U4HA 4C6SA 4MDEA 2E1PA 3W6OA 3ELWA 2D1SA 3K6RA 1DX4A 1UM9B 5KOIA 2QPLA 3D8NA 1SA0B 3E7DA 5M34A 4YAOA 1M2FA 4GUAA 5EOVA 3WZMA 4ETWA 4LYEA 2H4WA 3ZU4A 4QG3A 1M7HA 4ZEVA 5JNUA 4K87A 1P5RA 4ESEA 3ZV6A 3R20A 4DIOA 1G9TA 1TA0A 4UOZA 1HURA 1UFQA 4RABA 4N03A 1WUTA 1SK8A 2E48A 2FWRA 1KRHA 4KQMA 4MUIA 2X0DA 1JE1A 3T94A 4URVR 5I9LA 1J56A 3JQ6A 2QT9A 4GG1A 2JGAA 2X6YA 2NO0A 2F1KA 3X2SA 4OYRA 1ZMBA 2X19A 2Q07A 1E1RA 3TZQA 4BV9A 1K0FA 7GPBA 2WF7A 2JEOA 4UCXA 4YV7A 2IZ7A 3OE4A 5IYPA 3PITA 1Z63A 4MYRA 5HE8A 3X44A 4CQMD 1MW8X 5JH7A 1T2UA 3VV3A 4C03A 2D2XA 1HYBA 1MPXA 1WMFA 3R23A 2ZRCA 3U0VA 3VJLA 3WADA 4TUYA 3E1GA 3RYIA 4D4HA 1Z17A 3CRW1 2BFWA 1VHJA 2PGDA 1K92A 1HG1A 3FFBA 5IAOA 5FJIA 1KJNA 2QJTA 2PKQP 4GR9A 4OU5A 4RDLA 1R37A 1WDLA 3B20A 3O21A 4KN6A 4YLEA 5LYJA 3HA2A 2D1RA 5EPEA 5E1BA 3RU9A 1L6RA 1V47A 1E3SA 2PMWB 5D3QA 5BORA 2F43A 2QVLA 3AINA 4TYWA 2WR8A 1Z6PA 2PQMA 1RWMA 2QRMA 1N57A 1R5BA 2YXDA 2FPSA 3AJEA 4Y9DA 1CRQA 5BO5A 4BNJA 3GH1A 4F91B 2YOGA 1J24A 4KEAA 4YP7A 1OGIA 4Z7NB 5JC8A 4BPBA 4XR9A 5KQMA 3KR9A 1M8KA 1IAQA 4HFRA 1OX6A 3M3DA 2BCGY 2CHUA 3O8RA 3NXKA 2G4VA 4FJ0A 4GW3A 4QDJA 1B15A 1K73D 1XZPA 3OHMA 4JZYA 1PT6A 4PU0A 2O0HA 4U8HA 2A9FA 3HYNA 2VO1A 3FNRA 2OV3A 4WADA 3PWTA 2J1LA 3PV0A 1QNLA 1Y3BE 2REQA 4ZEMA 3B82A 2AG8A 2H2AA 2NUTB 3QY0A 4WL0A 3IIEA 3K2BA 3X1XA 3NDBB 2QYSA 2CT8A 2X1VA 4WZEA 4B2YA 4YN3A 2B5VA 2ZCUA 4AI6A 1XHEA 4F7DA 2PUWA 1ADCA 2QLNA 3BDAA 3IVAA 1JDSA 3PICA 5AM2A 1VG8A 5B6PA 4BNMA 4LMPA 2HCFA 4P3NA 2Q0QA 1Z26A 4XEHA 2H1HA 5AKYA 5CFZA 1DRWA 5I8PA 1R0SA 2LVBA 1J0XO 3QPAA 4XNFA 1THTA 3GGJA 3MNFA 2ZSAA 2J0UA 4RD3A 2Z5FA 3RWOA 2FSHA 4EJ0A 1M1YA 4PYMA 4YJ2F 5EWMA 1S3FA 3BS4A 2VBFA 3ZUPA 4D4LA 3JPYA 1WZUA 1GZUA 1M6EX 1Q2UA 1H0HA 4IQGA 1UBMS 4DMRA 4GI3A 1N1DA 1Q0RA 1S89A 5J43A 2BW0A 4ZZ2A 5T57A 1V6AA 4BE4A 3EZGA 4XOUA 1GARA 3ZZ0A 1YS7A 2J6HA 3KELA 2DH6A 4E4TA 4DQKA 1KXJA 3JVVA 4WACA 1E94E 1DG9A 1I4LD 2NGRA 2A59A 4YBRA 1JWLA 1VQ9B 5CBPA 2DJ5A 2EFEB 3FSEA 3TSYA 4B6GA 4YONB 4FE3A 3UVEA 2VHTA 2GF0A 4RLFA 3OT4A 1CIVA 2QM3A 5JPDA 1G19A 2JI9A 2CRVA 2I03A 4V24A 1Y9EA 3PD7A 3TR5A 2NP7A 1EVJA 1GZDA 2AFHA 3S4YA 1Y1SA 3TDMA 3FFWA 3HDTA 4Z3KA 3L7BA 1A88A 2ZUUA 3F1LA 1YJBA 2J30A 4HQ6A 4LK3A 4Z0HO 5DHUA 4K9OA 1J8DA 3LP5A 4CKWA 3AIIA 4G8DA 4RDXA 3VU3A 2HQ1A 3OQ1A 3F5DA 4QFBA 1D2GA 1MH1A 1O57A 3A06A 2ZIEA 3LJKA 4WECA 4X3CA 3VDQA 4LVCA 4EYEA 4P22A 2H52A 3OWHA 1E6KA 2JIMA 1C30A 3MINB 1ZN2A 2CW5A 4B4VA 1PTKA 1YKFA 1XXHA 1Z5NA 3T7RA 2ZBRA 1KJQA 4QECA 4ABYA 3S7ZA 4MHTA 5HF8A 1NF8A 1DG3A 4BJ1A 1E43A 3LECA 4D9IA 2IXDA 4BC1A 1Q9SA 1Z34A 4D3ZA 4EKGA 1ZYUA 1FFSA 2Z3ZA 5DISB 5J2TB 3UENA 2PGIA 2NZJA 4JU9A 4J07A 4NOJA 3UBMA 4LOJA 2HA7A 3ABRB 3IIMA 4RADA 3TEMA 4Z7JA 1WW3A 1JI0A 3V7NA 2ONZA 1WUKS 2OM6A 1JTEA 1M8PA 3AEYA 3P9NA 2H4HA 4URZR 5LQRA 2HM7A 1Z7BA 1R0WA 3RIHA 1HKHA 6REQA 2HZ7A 3CLUD 3NX4A 4QOJA 3T38A 4BDTA 1XZQA 1NVFA 2GN8A 1UJ6A 4PGMA 1GCAA 4ZA2A 5EJEA 2Z98A 4PEVA 3K1AA 4B17A 1H05A 3TTTA 1Y8QA 2WWTA 1T0BA 5BSMA 3CUWA 3TCNA 3OZWA 2GAJA 3A8KA 4CMIA 4MQEB 5DT9A 4LOHA 1BMTA 3Q2KA 5BPHA 3OTGA 1HV8A 4LIPD 3ZH9B 4IEIA 5C7LO 3EQ6A 3DE6X 4BKPA 1JLHA 2XDQB 4DR6B 3F5FA 4RIGA 3VHQA 2IHNA 3C8MA 3K8YA 3V9AA 1A4IA 3GQBB 3OFVA 3C16C 4IQ8A 5EQTA 3K9CA 2XITA 4RKWA 2WWRA 3P0EA 2AOVA 5HG0A 5TGZA 2ATCA 3ZDQA 4DCCA 3NYRA 4IJKA 3DNPA 3GEPA 4D80A 5SY6A 1LPBB 4L85A 1LNSA 5ISMA 1IM5A 2H6EA 4JQYA 1MO5A 1RI3A 3HPQA 4RF2A 4E07A 4ALNA 2WUGA 5T67A 3PFIA 4X1YA 3VGPA 3UXYA 2HSZA 2VJNA 4O2AA 3LHDA 1RTKA 3NUQA 3UB2A 1X1BA 1XK7A 3MJDA 1KVSA 4L27A 1CNMA 1K2VN 3DV0B 3WXBA 1TVMA 2FPIB 1YUBA 3ZJVA 5BSXA 1FTYA 3HV2A 2QJFA 3LY8A 1T3ZA 2PL5A 3CNBA 3NJRA 3EDRA 1FYVA 3FKSD 5GMOA 4V39A 4JKOA 5JAQA 1T2CA 521PA 2M1ZA 2H3EA 1CIJA 1Q19A 2C5LA 2YHAA 4H08A 4XSGA 4AJ9A 5CPFA 1QGAA 2LBPA 421PA 3TG8A 4AQ7A 1IWPB 1ILWA 2ONKA 1CNFA 2XVAA 4I4IA 5H3CA 2V4UA 1AB6A 1GZHB 2O48X 2WIGA 3GEGA 2DKFA 3OE5A 1NVKA 2R66A 2X2OA 3DTVA 3A7DA 2Z08A 2WG2A 2OESA 2C0CA 3IFSA 5BSVA 4BTEA 5JSUA 3A1CA 2GJAA 1J39A 1TMYA 1GT91 2WMYA 1PAUA 2EIXA 5J58A 3PFCA 7MHTA 5ADUS 5J4LA 4WT7A 4O4IB 3QZUA 4P6VF 3KRTA 2BHRA 3O94A 1OX4B 4CCWA 4X00A 3GFQA 5B7NA 5D8DA 3ZGNA 2BTQA 2D6FA 4IW3B 3IIIA 4QQKA 3KZKA 3GWZA 3TLGA 1QAOA 2ZRGA 3KL2A 1YJWB 3R9KA 4Z4GA 1XIVA 4CKEA 1N9KA 4F2WA 2DUNA 2Q50A 1JDNA 1KKLA 2Y1LA 3A9RA 1UWVA 1ZXLA 3ECCA 3RS4A 1E2JA 1PUXA 5CNKA 3GUYA 3UKOA 1G38A 4PG4A 4L7QA 3AUTA 3U7QB 2J08A 3MM4A 2GX6A 1G21B 5IT5A 3GV0A 1RWPA 2E1BA 1N2XA 3E9YA 2A35A 3PU6A 2PA0A 4K28A 4YRJA 3OOJA 5TPZD 4A6XA 4EEZA 2UYHA 1B7GO 4ETIA 4ZDJA 5B6JA 3JQFA 4JZKA 2GCIA 5IWAB 1YCDA 4HWKA 1L3CA 4UTVA 5IBCA 3HXKA 3Q8KA 4OL9A 4LSZA 5CBPB 1Q44A 1QZ3A 4CL2A 1SJ9A 3OEHA 5EQDA 3R7LA 1W0KD 3OQBA 4AVYA 4E2YA 1AA9A 2A1IA 3H4IA 4H6WA 2JDID 1R4AA 1ZW1A 1GG5A 4Z8YA 1IWBB 5K8JB 2RGCA 1SXPA 3BRWA 4YEJA 1F20A 2IIQA 2XIQA 4QNMA 3L1VA 3D26A 1G64A 4GKBA 5IHPA 3VR5H 1FU4A 5A4AA 5C52B 2AFHE 3UNXA 1P19A 1A4RA 1XX6A 4BFTA 1VJ5A 2NACA 1QVVA 1ULUA 3A7EA 3HSKA 3G79A 4ZAGA 3PC7A 2PGOA 4CQNA 2ZAYA 2RI0A 5FPPA 2WTMA 1JHVA 4P1VA 2ZJ5A 3AU8A 5JO9A 1RW4A 1UBUS 3OE7A 5C1BA 4I55B 1XLUA 3OX4A 2WF9A 4CIWA 4OX9B 4HX9A 3GLFB 4M1MA 4V3BA 2QXUA 4GI2A 2XOKA 1I36A 2VNSA 3RKUA 4L73A 4MKHA 1BCSB 2PXAA 4FSDA 1RI2A 5DMHA 4BLSA 4JFAA 2HLDD 4RV5A 1NSYA 1RAGA 2J9FB 5JCZA 3OQMA 1GZ6A 1Z18A 4GX1A 1U2QA 1GO2A 4O2LA 3AEQB 2JLBA 1ODCA 2Z8YM 3BXOA 3PJDA 3CONA 4JQOA 4IIBA 4M1QA 4MEAA 1GGJA 2E49A 2OG1A 4UCQA 3QU5A 4O29A 2DPHA 5CDSA 3JYOA 1IZ8A 3W90A 2ZROA 1EVYA 3CXUA 2VN8A 3ICOA 3EMVA 4RV4A 3MMPA 1YIAA 5L9AA 3IRUA 1PF7E 1HE5A 1P81A 2FNAA 3LCJA 5HZBA 3OFKA 5DRYA 1KE2A 2NVUB 3UANA 2ERXA 3T1YB 2YH2A 3O4GA 3OCUA 3UC9A 3JX9A 3KALA 4P53A 4MPJA 4AZ3A 1RYMA 3G1TA 5CLQA 3T61A 1ZR4A 1Z4IA 2QN8A 2FN3A 4BMYA 3KQNA 1R4MB 4BP3A 1O08A 3BXZA 3SEAA 1WE2A 2E4ZA 3HMQA 4NLLA 4HX5A 4BEJA 3MZ0A 4HZGA 1T1GA 3F78A 2WNIA 1BVRA 5A1TA 2AJLI 4WHMA 3AH8A 1ST2A 4PLVA 4RGVA 1NW9B 3N28A 4FYYA 2ZJ3A 3I09A 5EZQA 3WZLA 4HVCA 1MO6A 2LGJA 3F0TA 1FVHA 2B8TA 1M1NB 2CZQA 2IZ5A 2PT5A 3EEBA 4CR8A 2GPBA 3OOYA 1O54A 3GLGA 2H8KA 2JI7A 4IGFA 2C78A 2PX6A 3KVYA 4RSGA 5EIFA 1IN6A 3C4JA 2C8VA 2XMSA 5IBPA 2X53S 4WNYA 4JODA 1KMCA 2CBZA 1XVLA 2ODAA 2O2CA 3ZBTA 2A9QA 4D6PA 2OGWA 4Z9YA 2VUSA 3MQFA 1KK3A 4WRRA 2C20A 2C88A 4B8WA 4BYMA 1L4EA 4P31A 3CT4A 3MLEA 5AJUA 4BQEA 2B99A 1FZTA 4UBLA 1SZPA 1W0JA 4EKYA 2OMKA 3ADKA 2CDAA 3H2IA 4KI0A 4L5BA 5CW2A 1NGSA 1VA4A 5K0EA 4QAQA 5KAMA 4XX1A 3A1FA 3WQZA 2WSBA 2C4KA 4PIVA 3FH0A 2JGNA 4CMGA 1H0SA 2ZSEA 3I9OA 2PCLA 1JG2A 1ZMRA 3FUVA 3IBTA 4QYIA 4HNUA 4GOKA 3MJVA 1X7XB 1A8HA 3NQ41 2NXJA 1QVRA 3URMA 1A7JA 4TKVA 1DU4A 2CHVA 1E6LA 4MWEA 1GU0A 3U17A 1CC1S 1VSUA 2WFLB 2XGMA 1DELA 1K6MA 3K7EA 4BKMA 1FSFA 2CN1A 2YWEA 4QUGA 5K51A 4CN8A 3OFNA 4NARA 1F9EA 3GVCA 3JCZA 3UV7A 1B6RA 1G8FA 1XYGA 2PRZA 4OHYA 2XF2A 2A2ZA 1TK9A 1VPTA 2QLTA 4C4ZA 2VBUA 4XYLA 2IF2A 5EN4A 3LY7A 1A2QA 1NXPA 2EQ5A 4WN9A 5A3QA 3TZ6A 3DHWC 4I14A 4H27A 1TIBA 4BFSA 1H6CA 4RY2A 4AD8A 2GOYA 1FEZA 4X6XA 4OJTA 5TVKA 1DINA 4X07A 1WUHS 3GB9A 5JAHA 3G9ZA 3K0KA 4HTFB 4LBWA 1DZIA 2OBNA 1N8NA 1XVUA 5IXJA 5EFOA 1X1AA 2GUGA 1XRJA 3RRZA 2GDZA 4EL0A 5ALMA 5F5NA 4DR4B 4A8JA 5HP4A 4MW4A 1NXTA 4XB6B 2NAFA 2WBLC 1JHDA 3SOZA 4KFTA 1Q7CA 3U7QA 4AP6A 1HOXA 2YCLA 5DM0A 1G7RA 1NJFA 3SYNA 1ULHA 3VZDA 1KS9A 3W9YA 4C06A 5LMCA 4PGHA 4HH4A 2CLSA 4M8SA 3ZDYB 3I1JA 1T9ZA 1BH2A 4TMYA 3DVAB 5SICE 2CEAA 2IBSA 4FFBA 3OFND 3I6BA 3N2NA 3RC3A 4Y6LA 4LZAA 5KWJA 4Q9NA 3L43A 3ZQKA 2O3RA 3OFSA 4M36A 4DABA 3T7CA 1FJ2A 1NFRA 3E1KA 4IICA 2X2EA 2W9XA 5CPBA 4N1AA 2QE7D 4MW2A 4RZ3A 3UOAB 4RKEA 3PNQA 1KO8A 3LMKA 4BZQA 4EO7A 3P0FA 3SJAA 2DFKB 4AF6A 3TUZC 2CZCA 3WKEA 3RF7A 2I4MA 2FJPA 2IDMA 4I4CA 2Z4RA 2LE0A 3PNVA 4NATA 2Z95A 2DFTA 3T4XA 1GA1A 3CLKA 1NF3A 2PRYA 3LCMA 4XUEA 3CISA 1NUUA 3GP5A 4C0XA 2WDZA 3CSUA 3VU0A 1X7HA 5BNZA 2JG3A 1Z3CA 1ECGA 4XXHA 2XMPA 4REQA 4PLPA 2HK7A 3JXEA 2CDBA 4G5HA 5GONF 3LQ2A 4FSHA 3LYUA 4ZWNA 4PG7A 1Z15A 3GUVA 1JFFA 1XRRA 4JEUA 3BGVA 4YRFA 1VYUA 3ISVA 4POOA 2ORED 1KSGA 1TEZA 1WSRA 3I1FA 1SOUA 1TZMA 2FSFA 2VDJA 2ZSIA 2IRWA 4Q1AA 1V9CA 3GJYA 5HUQA 5JASA 1EGVB 3MBIA 1M6YA 3DBLB 3H65A 1I6KA 2NU9B 3GVHA 4B83A 4BQQA 4MARA 4IQ4A 4AJNA 1UBHS 4IGAA 1DBQA 3LLUA 4AKEA 2HAEA 5A5GA 1JHRA 1M10A 4KQCA 3K9FC 3O2NA 5F4JA 3VNBA 1Z62A 2CXQA 2ZJ0A 2A1TS 2EKLA 4ZYYA 3OPYA 4BU0A 4GWLA 3SBOA 5IT4A 3CR7A 4Y6OA 4BAZA 5KSZA 2B69A 1HE1C 2IFTA 3C14C 4B6FA 2OQ2A 2C57A 2QVYX 4G25A 5DLYA 3KS9A 3VTAA 4E12A 1CR0A 2PD3A 2VZ8A 3RADC 4FNMA 3FF4A 3PR1A 2P2SA 3WGNA 5JCOC 2X5KO 3VPGA 1WPRA 4A27A 4G5QA 3EA5A 4EG5A 3OEYA 3NYWA 3HBLA 3O83A 5B7PA 4WZTA 2UZAA 5EXDA 4GP6A 1RBZA 3L8MA 2I4OA 1P1KA 1ZM9A 3UAXA 1OXXK 1LPAB 3CUUA 1RC1A 1V0FA 4QDUA 3ANXA 3BSSA 3WL5A 2NVBA 3KE9A 1Z0KA 1IUPA 1JDZA 2EZUA 4GP9A 4QTZA 5KSPA 1TUBA 2ZUVA 5E95A 2XMCA 3DF7A 1PK7A 4UUAA 1ICIA 1WXHA 3W4KA 1DC6A 3IE1A 1G6HA 2QU8A 1HZZA 2XCLA 1MB2A 3O3MB 4R2KA 2RGWA 3C3XA 1NDHA 3EN0A 3VOAA 1FUEA 4P54A 3E9CA 2NVOA 4FKZA 1NJ1A 4N82A 1YJXA 2XVMA 3CHYA 3I8XA 5DLPA 4RSHA 3K1YA 3U3MA 3TGLA 1E59A 3RK1A 1J8QA 4EJFA 3NJ4A 5HQ3B 2O57A 4K3VA 3D4IA 1YU6A 4E32A 4N4AA 2BBSA 4TWIA 3TLAA 3PLAE 4P98A 3FYUC 4IH9A 1AUVA 2J9YB 4QO7A 4XPZA 4CBVA 1EM6A 3CRMA 2VRNA 4K9SA 4TLBA 5G2OA 5GIPE 4IS3A 1XHLA 5CTJA 3U4DA 5CU7A 2PKCA 4NWIA 3NUGA 1EMDA 2NYUA 3A4VA 3D9QX 4FT4A 1A0OA 1OE0A 1VKNA 4JCCA 2B1JA 4MO9A 3WJ2A 1OZHA 3HK2A 5EWMB 4OQPA 1DTSA 5AM3A 1K6JA 4PAQA 5A6SA 2F1IA 3CS3A 3GAMA 4Y2UA 5ALIA 5K3FA 4EA6A 3E15A 2P65A 5G4KB 2IS2A 4GICA 3GBVA 5AVQA 4R1NA 5IYRA 3BQ9A 5LYJB 5TVGA 3Q39A 5CCEA 3KPWA 4IILA 3OJOA 2OCGA 4YXWA 2B4KA 4OK6A 5CLHA 2AEJA 1I5OA 2EF1A 1TJ4A 4UNSA 2REXB 2A0YA 4ZT6A 1W87A 4PRYA 1L7DA 2VYQA 4HNTA 2J85A 4XI9A 5C8YF 3EXHC 1YXMA 1TU0A 2KJQA 1ZONA 1DQNA 4ME6A 6CHYA 3FCCA 3HBAA 4JUCA 3L2OB 4B4DA 2C4NA 5B1DA 4Q9KA 4Y2PA 3LUHA 1G6KA 1L5YA 1HO3A 4JVNA 5GY7A 1NTOA 1J20A 4MDYA 1XL0A 2WUDA 1B8PA 5B57C 3NHBA 5C8YA 2CKDA 5T64A 4CV1A 3W5IA 3RGWS 3CEJA 4U2KA 4ZI7F 3DMNA 1T91A 1BFKA 3W34A 3O1LA 1OB5A 3H9JA 1BXGB 1GILA 2VSOA 4R8VA 2IX9A 3DE0X 4G4IA 4FR0A 3JVEA 1T1RA 4Z4YA 3GA7A 5ALDA 1PI3A 2QX9A 3BCSA 4UHCA 3E7PA 3C97A 2HPAA 5EP3A 2RK3A 3QKIA 4H3SA 5FOTA 4CQMA 4IIJF 2P0AA 3I45A 4L6IA 4QYIB 1R0BA 3HAGA 3K9GA 5IU6A 4WCFA 1EE1A 5EMJA 3WRVA 4PWZA 1BGXT 5EJMA 2VAWA 4H2DA 1SZCA 3ZK8A 4C43A 1VHDA 1Y4AE 5G53C 4D3SA 3A6HA 3KTAB 3H0EA 1LW7A 3DFFA 2GHIA 3LDAA 3SD7A 5BMVF 3VPXA 3VSEA 1PSDA 4EPTA 1NXSA 1MPTA 2W58A 5JV5A 1TQ6A 2G09A 4DK1A 1TTHA 4UEJA 1PR5A 1W30A 1U0SY 2GBPA 2OC9A 1GN9A 1YMUA 2R4QA 4I6EA 4N3CA 3MOSA 3H1AA 1CR2A 5K3FB 1IXRC 2Q46A 2WLTA 3O8CA 2AB0A 3DE5X 3WMGA 3MHTA 1L6IA 4IAOA 3RSSA 3FZNA 4NZMA 2VDKB 4E5NA 4V1CI 3SXUB 2WJIA 3QY9A 3B78A 4B45A 3TLCA 1WXDA 4IUDS 1G2QA 2JH8A 2YJNA 3TLJA 4MW6A 1DGQA 2UVQA 4EGSA 5SYMA 2YICA 1W2BB 1MIHA 2X8KA 2O2EA 3ONNA 4NENB 2WE7A 5AI9A 2ZTGA 1Y5IA 2ZB2A 3NATA 1EP3B 3BE6A 3W7BA 2NZYA 4LE1A 4CF7A 1U9IC 2PIAA 4A0HA 1ECPA 1QAQA 2JIQA 4QUAA 4OGLA 3GPBA 3AVTA 2VDWA 3CNNA 1IPHA 1ID1A 2XNJA 1VE6A 4KZPA 1SGWA 4H3HB 3F71A 3AIKA 5FPYA 1ZICA 2GWRA 2G28A 1BVUA 4IV0A 4OLJA 2VIIA 4H7HA 2WKWA 4OXKA 4QUDA 2P79A 4QU0A 1C7JA 2RGNC 3SNHA 2ZXIA 2HMSA 1H66A 1J8FA 1NVXQ 3BWVA 4ITUA 6LDHA 4AYXA 4DA8A 1PBTA 1A97A 3K9HA 2A86A 4LJLA 5EPUA 1O94A 4HRXA 4EENA 2ZITA 2DR2A 1ZLYA 1WV0A 1D7AA 3IBFA 4D99A 4A2CA 4TKOB 3I5AA 3C15C 3G5LA 3HEBA 5KNCD 3UKDA 1MHTA 2NUAB 2PUCA 3H9UA 1N5LA 2ILVA 1GSIA 3QYJA 4J16A 4D8YA 4MCIA 1P6UA 4O3FA 1R16A 2VCYA 3G6WA 2IYZA 3GROA 5B3LA 3F6SA 4B2PA 4LOAA 4KO8A 4EK9A 3FSGA 5BSHA 1V7ZA 1YRYE 2FKAA 4OFWA 5A4FS 4LISA 2EERA 4KHPB 2P1RA 3SC2A 4LHZA 1PZXA 4CL3A 1GL6A 3SDZA 3KLPX 4K6CA 4UBJA 5GVSA 5AKKA 4ZGBA 1QVWA 1RKXA 2OB1A 3OZIA 1FY2A 2DP4E 2HJ9A 4QNNA 1W36C 1DXOA 4HQNA 2C8LA 6Q21A 1KZ7B 4GXNA 4M76B 1WLYA 5TT1A 5DK4A 3D8RA 4LMRA 3CWZA 5CFOA 4CMEA 2XD9A 3ZIUA 4BMOB 1BQ4A 2F3PA 3OT1A 4TV9F 4UAVA 3ZKAA 1KI1A 5JXJA 2IEBA 4L4XA 5CG1A 2C2MA 4QGFA 4U9UA 3CC7B 4MV1A 4YROA 3IEVA 5BY2A 3L7DA 2BTEA 4A8JB 4ZPJA 2D3NA 1WBBA 1VCMA 3F5QA 4D9MA 2QTTA 3TMAA 1MAWA 5JNRA 2VJJA 4IJ6A 1FLAA 3KKPA 3ZE1B 3TIXB 1YHQB 4EIWA 1S5PA 2Y0PA 3PX7A 1C1YA 3VKHA 4EG4A 4N48A 1QRAA 4L3OA 2WMNB 1ZGCA 2PDAA 2BPOA 1IUOA 4P4GA 4M22A 2XNCA 1CBUA 3DAHA 2B6HA 3BIJA 2NXNA 4X1YB 3PXDA 4QUBA 1MW9X 4V1CA 3DDNA 4D8XA 3RJ9A 1UIRA 2YW2A 3K0AA 2QLBA 3S99A 5IEJA 2ZKIA 4HG2A 1DIHA 1VPEA 1VL1A 3QUQA 3TI7A 4U6SA 2IZ0A 5DYGA 1VQ7B 4NCKA 1Z6QA 3BCHA 5FUVA 2QYOA 2GHRA 3FTEA 2FUG6 3V8EA 4BO7A 2ECKA 3AEKA 3SLRA 2MMCA 1EDEA 4UFNA 2BGKA 1RPTA 2B20A 3V7FA 3VU9A 4BP1A 5HIMA 3COJA 1JX6A 1N92A 5ERXA 4Z9FA 2MWMA 3MTGA 3UK2A 1V5WA 2FP4A 4OOEA 4I9NA 2FETA 1N2IA 4MSUA 4XKWA 2GSWA 1U98A 2IPLA 3OZRA 2XCUA 4KTTE 3RIYA 1NRJB 4PZCA 1AQNA 5EJIA 3RSGA 3L40A 1PS0A 2OV2A 2QX7A 4V0ME 1W85B 1M5TA 1WDKA 5L6LB 4IMPA 5HZAA 3B9PA 3VMFA 4R05A 3C5CA 1PT7A 2G0AA 1DX6A 4KMOA 1B6GA 3I5YA 3FX2A 1ILEA 1E1MA 1HNNA 3PX2A 5EZ6B 2JNWA 1GR0A 2OBYA 1MRSA 3MWDA 4R1SA 1MLDA 2IWHA 1KOJA 4E5DA 1G8PA 5JNSA 3AM5A 1CV2A 4HNGA 4L76A 3Q87B 3ZWXA 1NX9A 1OX5A 1U5BA 4Y1RA 1ZD4A 2H29A 4RH3A 3RT1A 4MAMA 3TDNA 4ZCMA 5KVCA 5KYUB 5BSRA 3PHHA 2PCJA 4M7PA 1HLPA 3S8EA 1DDIA 3N39C 1XP5A 4G1EB 4UQOA 4ZP1A 3SQLA 2JLSA 2R8EA 1RRMA 1E6UA 1DRUA 1RQ2A 1OY1A 2J3IA 5HCIA 1E9DA 3AK4A 3HXLA 1NNUA 4JI2B 1JDVA 3AUJB 3FPGA 4ZOLF 4DCTA 3VNSA 4AZ3B 3D0OA 3GAZA 5BW8A 4F84A 3KNZA 1PQYA 1PJRA 2DBZA 2R751 4FGJA 4EARA 4ZGGA 1TYAE 1K5GA 4LJ4A 4OAPA 4FGWA 1YR1A 3BQMB 1GLVA 5KSWB 1N2ZA 1MABB 2BFFB 2OXEA 3H2YA 4IYJA 5FADA 1M9NA 1S2OA 1PJAA 2CY0A 2VRCD 2W2KA 2W2OA 1NKSA 4NZ9A 4P38A 3DTVD 5ALKA 1JIIA 5E9WA 3RS0A 4JBXA 2C9OA 1P1IA 4WGFA 3SBEA 4JWTA 1PJ4A 1BKDR 1BH6A 4KDEA 1IN4A 1MZPA 1H2FA 3BAFA 3ZDBA 4P25A 2GAAA 2Q3EA 3D7MA 1BD3A 4NENA 1UWCA 5IVDA 5LZ7A 5IT9A 4JUBA 3JVUA 3QXGA 1SUWA 3T5TA 1AKEA 1SBTA 4MV6A 5C18A 4LJRA 3HBFA 1FK8A 4H35A 4BGVA 2Q5OA 5CITA 3JZAA 2I7DA 1RHMA 3U60B 1XNJA 2PMBA 3AWDA 2AXNA 2VCEA 2P75A 5EZSA 1SC6A 3RVBA 3DYBA 1AVTA 3T1QA 1ISSA 1OXKB 5LKAA 4WY5A 1XC7A 3RSOA 3ZE7A 2J3EA 2FZCA 2JCYA 2PX4A 3CZCA 2G9ZA 3G1UA 4HXFB 4MWCA 3B85A 4BVGA 5BWCA 1S9DA 1ZHHA 1FU7A 1CX9B 1T9KA 3NTQA 2E4WA 5K05A 4QT4A 1XU4A 1A98A 4BV8A 3GRRA 3I9KA 3EY9A 4N3GA 1I8TA 3CNQS 1NW7A 3LQ4A 2P4UA 1T6YA 2VAMA 5DGCA 2D59A 1WA5A 3Q9LA 4I1YA 4AS1A 5FO0A 4XUCA 3DM9B 1O6ZA 1RVDA 3VPCA 2VEDA 4C0HA 4MVCA 4GE3A 3CO5A 5GM2A 4MNTA 4EHHA 2C9YA 2XDWA 1NA5A 4RPHA 5JG7A 3V80A 4G41A 1JG6A 1V71A 4BFWA 2EFCB 4OBXA 1O2DA 3M81A 3LF2A 1OBCA 1O58A 4K9PA 1KAOA 1DKPA 1MAAA 2G07A 3S81A 3Q3EA 3AW8A 3H8WA 1FE8A 1PQWA 1WQ4A 1D4AA 3ADDA 2PZEA 2J9GA 3W2EA 1LDYA 4LTNA 4EKEA 1X94A 1KYYA 1P0QA 3VVBA 4XQCA 3EDYA 4ES6A 1DB3A 1N2EA 1X39A 4FGSA 5C0OE 3FYCA 4QV2A 4KPFC 2WT9A 1ZAYA 3AFGA 4ETNA 2GZAA 1XJCA 3ZN2A 3BRQA 3EZLA 4DSOA 4LC0A 1R0XA 3N86A 3WKCA 2HV9A 2HLHA 1L7BA 1U02A 3GFOA 4O4HF 4F85A 1KAMA 4FFOA 5SZKB 5T3YA 1KHTA 1NUSA 2K5UA 2Z2JA 1EA5A 3B53X 3KKZA 5LNK6 2FSIA 5EKUA 1HXHA 4ZOLB 5CH8A 4DV2B 3CZ9A 3P4XA 4J6EA 3GT4A 2WILA 4ACAA 5E2IA 1SC3A 3A4LA 4AY6A 1ZBDA 2GN9A 3GI1A 1JSLA 2BN4A 1HORA 1V1MA 1XD2A 1V5GA 3OLWA 2D8AA 4GBED 4HWRA 4N8SA 3AY6A 1DS6A 4MP6A 1DHTA 4QVKA 1FYEA 3QU7A 1EA7A 1X15A 3SMQA 5AW3A 3EXFB 4B6RA 3FSJX 1ZESA 4EB3A 2FUNB 4E11A 2ETXA 3HQ4O 1VQPB 4BQSA 1ZOOA 3LDHA 1D2MA 3IOEA 1QG0A 4EI9A 2D3LA 3R7FA 3HZHA 1G63A 1IBRA 2W0MA 5LL6P 4JL8A 5LZ5A 4KNWA 3CTPA 2RG7A 1V48A 2NX2A 3BXXA 3CKLA 4KAJA 3HUDA 1M2HA 4LHXA 2E18A 2J48A 3QEKA 1E0JA 2QRPA 2EKQA 4OB6A 1QRTA 1I2CA 1KDTA 1QQ7A 1NYTA 1KOLA 4DG8A 2ZAIA 4PLTA 3V34A 2C82A 1KDPA 3ET4A 3EWIA 3KP1A 1WUJS 1V39A 1PJSA 3TL3A 1TAUA 4WX2B 4H7EA 3G7UA 2VF7A 4JBIA 4XIGS 2ODQA 3V2HA 3B6ZA 2XQIA 1DXYA 5TS3A 4YAIA 4HLNA 1VGRA 4QDKA 4A8HA 3PXXA 5H80A 1AGYA 3IBYA 2OOSA 4UPEA 2GBLA 3N76A 3CTMA 2G77B 2ANBA 4MUBA 3RIXA 1QVFB 4RF4A 4HH3C 4G67A 1Z8HA 2GZHA 3LPNA 3KX2A 1P5HA 2LD4A 1B2LA 3GJSA 4G97A 4INOA 4N40A 2QTZA 3DLPX 3M1AA 3ND8A 4S2UA 1PVDA 5B1HA 4OY3A 3AUAA 1FMFA 3LCVB 3ZJYA 2PY6A 3A05A 4C78A 4LWZA 3QI2A 4Q3AA 1RWXA 4QYMA 2OYRA 2W2XA 2YUTA 1IRXA 3ZI7A 3EQ7A 3WLMA 2WKPA 3KM0A 5FXMA 1RADA 5K0CA 5AK0A 2O54A 2ZUSA 3MUFA 1ADYA 3BE4A 1H3NA 4EHKA 1NMSA 2ES4A 3QIVA 5IKEA 1T0HB 3ANSA 3I9V1 2PMDA 1WZCA 1KQNA 2RCYA 4D3XA 1NHWA 3QKSB 4EJMA 3IQHX 2TMGA 4YWHA 2IS6A 3GUHA 1CF4A 1Q0PA 1JA1A 4F97A 1SXIA 1I10A 3FRJA 9ABPA 1BMFA 2AC4A 2WTBA 3MMXA 1K7CA 3ROMA 3V8QA 4B73A 1H2ZA 3K0CC 3B2QA 3DQQA 5ALPA 1HE8B 2WVJA 2WUWE 3F9RA 2D2IA 1A71A 2OV4A 3GW8A 2QS9A 3SE0A 4FNOA 2HADA 3FCXA 2H18A 3IEXA 2WPNA 2YVLA 3L84A 3BWMA 4D1YA 5JNVA 3G2QA 5BN5A 3CGGA 1OREA 2GA9A 2E37A 4KXWA 5CHYA 3V97A 5CB8A 1BQ3A 1XTVA 3RSZA 3FPFA 1JBEA 1Q1EA 2P6NA 4F2GA 4YHHB 1QGUB 1UKBA 4MEJA 1T5LA 2I91A 4DNTB 1X0XA 3PHLA 4NZZA 3RBZA 1YS1X 4ZXPA 5C5CA 3OBIA 1QWOA 4HLQB 2LIVA 2H2HA 2FWBA 4ZKEA 4QBTA 3TBKA 2C7PA 3BULA 4N49A 4EA7A 3KVNA 3M4ZA 4AYTA 1JDJA 3FPLA 1INLA 1SUIA 3IVCA 3JZIA 1SBNE 3R09A 2Q45A 3MTEA 2BMEA 4E94A 4IPTA 1DTEA 1I8DA 1KY3A 1MV8A 3GP8A 1MEOA 4JSYA 3ZWMA 2YUIA 1YB7A 3NVDA 3NKLA 2JLZA 1WZ2A 3UAZA 2ZWVA 2Z8XA 4O4JB 5DEOA 2W0SA 4RPGA 2AZMA 5HFAA 4P32A 1XMIA 1KPIA 2CVPA 2ZBVA 4HIZA 1AXGA 1UJNA 4OP3A 5ECWA 3HRHA 3SCZA 1UEJA 5JJ5A 1Q91A 2FQXA 2FE4A 1M6NA 3R3ZA 4IHJF 1C3VA 4KFSA 5JCPA 1IY9A 2QM7A 1NN1A 1SRRA 3QWIA 1X77A 4RNCA 5AVUA 2C4HA 1G66A 1FMJA 3KLBA 1VL6A 3QA9A 1T26A 1WRBA 1ZUIA 2VYVA 3FD8A 4J90A 3O1JC 2V7WA 3UUWA 1SXJD 4FC6A 3KYDB 1BG6A 4OTZA 1OFGA 4R69A 4CXMA 1UFKA 5A7FA 4WKCA 2OGTA 4CUKA 2GN1A 2WZDA 3K15A 1IN5A 3HUEA 3WNQA 3KJHA 1AZLA 2GXSA 1P3DA 1WHSA 1XF1A 2OV6A 1KU6A 4MDHA 5DNCA 4M83A 4MS1A 1OXVA 3DR3A 2A9RA 4JI8B 2XXJA 4U7DA 4MICA 4GOXA 2WDPA 2EFGA 1J7KA 2YBEA 3G23A 1CF9A 4GEKA 4AL4A 5HZHA 3U1VA 3ITNA 2HSJA 4YMLA 2Q3JA 4UTZA 5A5VA 2Z8ZA 1Q0QA 1NBOA 3PD0A 1PR3A 4TTQA 5A9RA 5GZ3A 1VKZA 2FVXA 1SZDA 3WC4A 5JIBA 3UAGA 2W11A 1FP1D 4UUPA 1U7ZA 2AJTA 3LP8A 1Y1TA 4L1KA 5L3SB 5I7UA 3EMKA 4GHWA 1QOPB 2XZTA 1YBHA 3EE6A 3I30X 5GONB 4RHTA 1I7SB 1H2EA 1GFZA 2DPXA 2R00C 2RFLA 3BA1A 1TT7A 1UPCA 3ORRA 4G9EA 3N0WA 4W7SA 4HATA 4DGSA 5BQ3A 1Z2PX 1LGYA 2X0RA 4DBVO 3QLTA 1HE3A 2EP8A 4RS4A 1SXJA 1A72A 1YB5A 2F3TA 3M2PA 1D6JA 1GRQA 2ZRNA 1R2QA 3F46A 3SFTA 3AB8A 4OJYA 4U1RA 3FOEC 1I01A 5IULC 4DHWA 4HWTA 2JAWA 3RG2A 2NLOA 3OICA 3JALA 1TGVA 4PAOA 4RM0A 1UQUA 1DZ3A 2FEWB 4QYTA 3ITEA 4XD2A 1OWLA 3IV6A 2H4ZA 3RH0A 3TUIC 5D1HA 3ZYZA 4RTRA 3RO7A 3PA8A 1ZM3A 1CZRA 2Q2VA 3AR2A 4YPOA 4UXJA 2B7LA 1GITA 1JDBC 4J7XA 4OFBA 5I4BA 1FIUA 4EJ2A 3USES 1L8QA 2IU4A 1YITB 3HRKA 4RCVA 1C7EA 4LC1A 4K26A 3WGUA 3WHIA 1VB5A 4D9KA 1UMCA 1V8FA 2IE8A 4YRMA 3L0IB 4I1SA 1DXHA 3WG9A 4BB5A 1NAHA 3O4VA 4GKAA 2ZRFA 4AO6A 4LBVA 4EW3A 2ZZGA 4CLDA 1TMGE 1PN3A 2B2CA 1IQUA 3R9XB 1ZVMA 5EE5B 5EJGA 5EFZA 2PMEA 3KXIA 3CZRA 4I36A 3VNQA 2X13A 2XYQA 1JRLA 5JZSA 1OKKA 4L0QA 4JX8A 5JFOA 1ORRA 1E7SA 3SZLA 1GPYA 1UADA 1OU4A 3A3OA 1K88A 4QXOA 5HUHA 1EVLA 1N5IA 4CMBA 3P4UA 2A92A 4UQLA 2ONJA 3IL2A 2DG2A 4OLBA 1JR4A 5D2CA 4QPPA 2PL9A 3CPSA 4B3XA 2PG3A 3FCUB 3I01M 3JRNA 5E3JA 1H9CA 1UD6A 4DSNA 2JAXA 1BDBA 2XRMA 1ZHFA 3AL3A 4JKYA 3TTUA 3V1TC 2GYUA 2IPNA 5BXYA 5LP1A 4TKVB 1ISFA 2ID4A 3CM0A 4TXMA 1GNPA 3V9PA 3KKOA 4ZDWA 4XVRA 2EW2A 3DTTA 3GJTA 3QMWA 3HE3A 3RK0A 1K8ZB 5BUQA 1GG2A 1KC1A 3SKVA 2OBBA 1TLFA 1VYTA 3F3MA 1DJOA 2QM0A 4DMFA 4II3A 2DTDA 1SBQA 5ARBA 2Y1XA 2FWMX 1GL9B 1MENA 5DN6A 2YN4A 4PLHA 1OKKD 3FN4A 4UVIA 4WN3A 4WY8A 4ZAZA 2O8EA 5JHGB 1CULC 3Q11A 3I92A 1OZFA 1KC3A 1E3ZA 1WKCA 2HDWA 3O47A 3KEOA 3S8MA 4YRNA 2R6R1 3CVUA 2QLLA 1CEQA 2BEVB 4W5WA 2VL7A 3FMIA 4WKOA 4UZEA 2AJ8A 4GBGA 4U7HA 3JVIA 1T25A 4L16A 1UD5A 3WGYA 1XZCA 1QVAA 2EBUA 3C1AA 1HUQA 3C98A 3HP7A 4M3NA 2NQTA 3MB5A 4TWBA 1K75A 4YRCA 3VHLB 5E6RA 3IUQA 3DHVA 2F00A 3VJKA 3MAAC 4QJ4A 4RVOA 5JWHA 3IQWA 2BV3A 4Q3EA 5HA5A 2B61A 1ZOLA 2Y2UA 3WL3A 1HMPA 3WSTA 4FD2A 3WSWA 1CQIA 2QAGB 3JSXA 1VE5A 2XMBA 5DNAA 4KYVA 3ZE9A 5FLXA 4D2IA 1P0CA 4MIYA 3V46A 2HSWA 2ZXUA 3N8HA 2EATA 2O19A 1GPLA 3QHAA 2FRDC 1NQUA 3DFZA 1RXCA 4HBGA 3W1VA 1OZAA 4MYHA 1MD9A 2HRZA 1ECCA 2ZSUA 3FHLA 3LPAA 2A3NA 4QSMA 4XWWA 1VHEA 4B47A 4H15A 1F8FA 4O5AA 2P9BA 3E35A 2ZJ2A 4OB8A 4E08A 5KW9A 1FFXA 1RKQA 1XMXA 1L5GB 5FYDA 2FWNA 1QORA 2QMOA 1ZOSA 3WHLA 2IV2X 2BVNA 4OIFA 5JNLA 2C98A 1XL1A 3W3AD 4DDTA 2IY8A 4BNDB 4CCAA 4M1ZA 2Q4EA 1YZLA 1N7GA 2F2TA 3FPEA 4Q3CA 1DFHA 1SBZA 3GR6A 1GZVA 2B25A 2JGEA 4BGIA 4YT8A 3W2GA 4NAUA 5KTMA 2NU7A 4O2AF 1PGOA 1ETUA 5ADVA 2ISQA 5GJCA 4FUTA 2PL1A 4ZQHA 4EKDA 8ABPA 3W5VA 1A8QA 1FSGA 1UJBA 4YJ2A 1IEWA 1BHO1 1QHGA 3L8ZA 1I7QB 4AN4A 4L8YA 1JJVA 1RM4A 1G8KA 2VHEA 5EZ5A 4KUEA 2XOXA 3RQSA 3BK1A 3MMNA 4QXMA 3TMYA 3A10A 4AY5A 1P7WA 4CU5A 4L4SA 3UHPA 3CB2A 3Q3AA 2FW8A