1W87A

Ferredoxin-nadp reductase (mutation: y 303 w) complexed with nadp by cocrystallization
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title C-Terminal Tyrosine of Ferredoxin-Nadp(+) Reductase in Hydride Transfer Processes with Nad(P)(+)/H.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
total genus 88
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1w87A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1w87A02
1U2RA 2QEXB 1FDRA 3CCMB 2OK8A 3FJOA 3LRXA 1BX1A 3AVXA 3OZUA 4TMWA 1VQKB 1I7PA 4EH1A 1E62A 1EP2B 1OGJA 4YALA 1W34A 3G6EB 3W2IA 2BM0A 1GAQA 3QE2A 1N0UA 1SM4A 2B7BA 1E63A 1EXMA 2RC6A 1KK0A 3CRZA 3B8HA 3JQQA 5JBQA 1CNEA 1QGAA 2BPOA 2J7KA 1G7TA 4LBVA 3VNUA 4P6VF 3OZWA 4RCYA 1QH0A 4G1VA 4RD0A 4LBWA 1H85A 1FRQA 2B5OA 1QGYA 3CCUB 4J0QA 1IJFA 1CQXA 3CB4A 2BM1A 4PGOA 4G5GA 1TTTA 1OB2A 3W2EA 3JQPA 3CC2B 1IJEA 4U9UA 1KD1D 2RC5A 1CNFA 4NCNA 2EIXA 1R5BA 1UMKA 3QFSA 3WBKA 1YIJB 4N3GA 2HCJB 3W5HA 2EFGA 3I55B 1FRNA 3ZC3A 2QTZA 4ZGQB 1VQ7B 1KK3A 1QVFB 2AHOA 2QN6A 4N3NA 2VNKA 4B44A 4Y9RA 1BX0A 2VNIA 3QFCA 1K8AD 3CCLB 3OW2B 3U2QA 2YWFA 1J9ZA 1JA1A 3B78A 4LBYA 2YWGA 1QFYA 1QG0A 2HMAA 4HE5A 3VO1A 2GPJA 3FPKA 1F20A 1TUIA 1VQOB 2VZLA 1A8PA 3MCAA 5GV8A 1DG1G 4RCZA 4RD6A 3J81k 4LBZA 4ZGNB 3B82A 1QX4A 3W5UA 1M90D 1FNBA 4RD2A 4ZV4A 4FWTA 1XE1A 4PC6A 1JNYA 3VNVA 2QTLA 5H5JA 4Q7JB 1ELOA 3ZZUA 3E20A 2CRVA 4AF6A 1G7CA 3A1FA 3QFRA 2QA4B 1K9MD 3WXMA 4M4SA 1YJWB 3SJZA 4RJLA 1QUFA 5KSWB 3LYUA 2BGJA 4YAFA 4P3YA 3AVWA 5TV2A 3W2FA 3CCJB 1IB0A 2BSAA 2OTJB 1D8TA 3V76A 1YI2B 1DARA 1W87A 4M0LA 4AF7A 1VQNB 1K73D 3I1FA 1G7RA 3OJXA 1W2BB 3JQRA 1VQ4B 4B43A 2VNHA 3CC4B 1S72B 2GQFA 1OGIA 3MMPA 4C43A 1E64A 1QGZA 1NJID 1D2EA 1ZM3A 1VQ6B 4TN1A 2R6HA 1KRHA 3G4SB 2BVNA 1BQEA 4YAWA 1B2RA 3G71B 3ES9A 1GVHA 3ZZTA 2C78A 2PMDA 4WQMA 1GJRA 1HA3A 1H42A 4B4DA 1SKQA 1QFJA 4H9GA 1DDIA 4RD3A 1KK1A 1ZM4A 4B3XA 3CD6B 1VQ8B 4RD1A 1TVCA 4MYUA 1GR1A 3AGPA 1VQPB 1VQLB 4PC3A 5EMNA 3WNBA 3LVBA 3CMAB 3CXCB 2OTLB 1ZUNB 4TMXA 3U6BA 4F7DA 2DEUA 3W2GA 4FK8A 4B48A 1N0VC 5TR9A 4AC9A 3CCQB 2BN4A 3WYAA 5GV7A 2BV3A 1KC8D 3VMFA 4BPRA 2D74A 4YAOA 4R71A 4QFMA 3CCVB 4MYTA 4B47A 3QFTA 1EP1B 5HXBA 1VQMB 2CNDA 3CCRB 2ZITA 1N8RD 3AVVA 2DY1A 4IW3B 2YWEA 1D1NA 4ZCIA 1JJ2B 3LO8A 3MHPA 4TMZA 4ACAA 2X3UA 2E1RA 1NDHA 2DETA 1B23P 2BMWA 4NBSA 2QMUA 3CCEB 1QVGB 1YITB 1Q7YD 3U6KA 1EWYA 1KTVA 1DDGA 2XEXA 1KQSB 3WNDA 1S0UA 2B7CA 2OK7A 1FNDA 4M2LA 5THXA 3PENA 4LC0A 1YHQB 3QSYA 4UAJA 4DQLA 1KJZA 4C0SA 1EFTA 3CC7B 1FNMA 1QFZA 1QUEA 1Q82D 2NPFA 1WDTA 1Q86D 1G7SA 2QDXA 1BJKA 3E1YE 2DCUA 1OB5A 4TMTA 3I56B 1EP3B 4TMVA 1VQ9B 3AVUA 1GO2A 3ZBTA 1KK2A 3AGQA 1W35A 4FN5A 1ZM2A 1Q81D 1M1KD 3OJWA 3P26A 5FA6A 1R5OA 4M1KA 3W5VA 3WBJA 4ZCMA 4Y9UA 1F60A 3CMEB 4ACBA 3ZBUA 1EFCA 2VYQA 4PC7A 4ZCLA 3CPWB 5DSZA 3W2HA 1JB9A 3VO2A 1YJNB 1GAWA 4K1XA 1FNCA 4DQKA 1EFUA 2VNJA 4PC1A 3AVTA 5H59A 4HE6A 4YAUA 3ZZ0A 4G1BA 3WY9A 3WNCA 2DERA 5TY0A 2PLFA 1XB2A 4M53A 1R5NA 1VQ5B 4Y7CA 3OZVA 2HDNB 2PIAA 4RD4A 3AVYA 1AMOA 2XNJA 1JA0A 2FX3A 3P27A 4QHYA 1YJ9B 2C77A 1ZM9A 4PC2A 5AN9A 4YHBA 1TLLA 2BGIA 2XNCA 3CCSB 3CW2A 2YWHA 1AIPA 2BF4A
chains in the Genus database with same CATH superfamily
2GHTA 1DOAA 4A9AA 3VSEA 3WWEA 3LRXA 1Y42X 4S12A 2QM8A 1EFAA 4FW8A 5AVXA 2AG0A 2GEKA 1IEWA 3AI2A 5JU6A 2NWQA 3HZZA 2PSEA 4XIIA 3LUDA 2SHKA 2Z1NA 1YACA 2BCJQ 4O6VA 4C4PA 1QWOA 2ZB4A 3DLPX 1GPNA 3SF0A 4BTLA 3FLBA 2G5CA 2HCTA 3PCTA 4R7GA 3LG2A 4AS3A 4LYEA 1IWBB 2QVGA 3ZKWB 4D9CA 4LY6A 3QTLA 1EPUA 2GVNA 4ZREA 3KU4A 4U6NA 3KFXA 2FOIA 3W3AA 1K0UA 4Z8YA 2AN4A 4TXHA 4EJSB 3EVDA 4H77A 1R6VA 4UVDA 4DA0A 1KP3A 3N8HA 1O9GA 4NXNB 2OWDA 2GA9A 3QU4A 5HFNA 1Z0IA 2WIJA 5ITVA 2VJDA 1NW4A 4OQYA 2XWSA 5TEVA 2IPNA 2OUIA 4QG3A 2DX7A 1CEXA 4QUEA 1Z4JA 3H04A 3B1WA 4L02A 4MSUA 1KMQA 2IOHA 4WOCA 1MU0A 1Z22A 3INRA 4N5HX 2A1IA 1D8AA 2XIQA 1QGAA 4LF9B 1VE6A 1UKVY 4DIUA 3VNUA 2GVDC 2OAP1 3H2JA 1O95D 5E6SA 1L3CA 3KYCB 3PUJA 1DXQA 4MZDA 2WHPA 4XD7D 4X60A 5ANRB 3K0KA 1QHIA 4KHPB 3F4BA 3T4EA 3X1XA 4BB0A 4B84A 2NXNA 4QBTA 2IU3A 3VZCA 1U9IA 4LJ4A 1HSZA 4AN4A 1K6EA 4ZYZA 3DBRB 1CE8A 1C0LA 4ZU1X 1EA5A 4DJFC 1K66A 3KKMA 1SWWA 4IDBA 5A1TA 3QV1A 5TB5A 3F2IA 1U8CB 3V1KA 4RV5A 4GI3A 4AG3A 3AXTA 2UXCB 2I2WA 1JXMA 1JX6A 2ZJ4A 3JQBA 3NBQA 4GR9A 4TSKA 4EP1A 4LXTA 4AJ9A 3ACCA 3QLVA 2PEYA 3GRFA 3OJFA 5DGHA 1CZOA 4UEOA 1G8GA 4COOA 1AO0A 1NJ5A 1NVUQ 2WIBA 1WD7A 3BRQA 4J07A 3WJ1A 2QROA 3I5YA 4JBIA 2COKA 1IFXA 1W25A 2FFHA 4WZAB 4ETMA 5MHTA 3WMWA 1USGA 1KD1D 3Q8WA 4P3NA 2XRMA 4Q1DA 1TJNA 3LOQA 4IO0A 3SWWA 4OQDA 3OD5A 3GA5A 3LKZA 4DR5B 1EK5A 2NAPA 4A15A 1QU2A 4QUZA 2AG6A 2EFGA 4Q4JB 3IOEA 1I1QB 1H05A 3LW7A 3MGCA 3PUWA 4FMPA 1JE0A 3SOPA 5B58T 4B79A 2YV1A 2GJ8A 4YCBA 5EA2A 2JEYA 4BP9A 1HMPA 1AG9A 2K2WA 1N92A 3KAKA 3Q7SA 1MV5A 5LUAA 5TQ0B 2GCEA 3F74A 3DAHA 2IY7A 3EVTA 3IVAA 4FPXA 4X54A 5IH7A 2QBYA 4U7GA 1UPFA 4X66B 5D6NA 1JHAA 3AR9A 2IDMA 4LV5B 5DULA 3DMRA 2ZBUA 1FU4A 3FYHA 1Z4MA 1U80A 3E70C 2FZGA 3G17A 4TKOB 4L7VA 4NBVA 4P3KA 3ILVA 4EHDA 5D5HA 3WLJA 1C14A 4A73A 1W5TA 2XGOA 4TKMA 2BKUA 2V74B 1THZA 3ZWDA 4LCBA 1G21E 1YRAA 1R64A 3PVCA 3SEQA 3G6KA 5EYPB 2X85A 5LOVA 3UWPA 1JA1A 4GOOD 4LBYA 1WSWA 4ND7A 4UM5A 3L02A 1XRRA 5IBRA 2PAAA 3PGKA 3EQ2A 4HVCA 1Z29A 2WFMA 4KFTA 4UTXA 3NVAA 1YR9A 4MB2A 2BF7A 4QNMA 1NUUA 1JQKA 1NBAA 2X86A 3W3ZB 3LXRA 4AD8A 3P0EA 5DNAA 5TVKA 3H2BA 2UV8A 3C3KA 2C7RA 1W0CA 1J00A 4I8IA 4LYHA 4MPRA 5L3QB 1BDHA 5A8AA 4ON9A 1THMA 3DE7X 2O1WA 4PZDA 1XA3A 2CMHA 2DKFA 4RZSA 5E1MA 5FADA 2A0XA 5J63A 1I5EA 4X6YA 1VQOB 2KBEA 5HIAA 1DCKA 3MJRA 1LK0A 4WDQA 4DR7B 4OK3A 2ZT5A 3KQKA 1ID1A 3D0RA 2Q2QA 3K30A 2E1PA 4RD6A 4D25A 1O5OA 4RK4A 4ZVKA 4EY3A 4EY7A 2ZI6A 3ZQJA 3PTZA 4WCDA 3TINA 3L79A 2O8FB 3RUEA 3C41J 5EGNA 3TOZA 1WOSA 2G9NA 1LZLA 1R0SA 2HSGA 1CERA 1WY5A 4MVCA 2VZ8A 5LBTA 7REQA 3OE5A 2FR1A 3ZZMA 4LMPA 3ZK9A 1ZVVA 1BH2A 2WINI 2HYIC 3EPKA 1OJ7A 16PKA 1PUXA 1PZGA 1LBEA 1XHEA 2Q3BA 3GLGA 3IT1A 1IQUA 3QVXA 3P0RA 3QP9A 4D82A 1GZVA 1ML4A 3EIOA 5CIQA 4PZEA 1Q1NA 2WJ3A 4ABTA 3ZE6A 3RWOA 3O95A 5HIJA 3GGGA 4ZDIA 1K3FA 1RHJA 1R0CA 2OO5C 2QA4B 1EU1A 3DTVD 4JSTA 1DTWB 1FS4A 1QDUA 3VDRA 1NJSA 2CF4A 1J21A 1QHYA 5H82A 5JSZB 4E88A 2E4VA 2H2AA 2DB3A 2NZXA 4EW3A 1PSWA 3EFEA 3O7WA 2IYUA 2WPDD 1W0JD 3B6IA 1OXXK 5C8XA 5K2OA 4TRNA 5FTJA 3PTAA 3AUFA 4IGKA 1SUBA 5I4BA 3GT4A 1BMFD 4HR7A 1YFZA 2OBXA 1P60A 4HADA 3DE6X 4FSHA 5BQ5A 1XTPA 4OK5A 2I5PO 3PFFA 5JVDA 4D3SA 2V7VA 3HEMA 4ASUA 3EH2A 4JMQA 1HTWA 2H1HA 3HB5X 4G0NA 4PQGA 3AY7A 2B36A 4RY8A 3TW4A 5LMCA 5AW0A 3JRXA 1IC6A 1HLFA 2ENWA 3Q10A 1JDPA 2JC3A 2Y92A 5HIKA 5K03A 4Z4FA 1YFJA 3K9BA 1BXRA 4M0LA 3K92A 3WGMA 1GSHA 4F4CA 4XGNA 1ILEA 1XRNA 1POXA 1DJPA 1G7RA 3FCAA 1ZS9A 4Z7OB 3B52X 2DU8A 4EPRA 4IHJF 4QXPA 5JSHA 1IXSB 2PT5A 1OH7A 4PY2A 4Z4HA 2BSQA 2HC9A 5AIBA 3HM9A 4QUBA 4XYGA 2JJMA 1SULA 1OHHA 4RPJA 1FP6A 5D5QA 3A10A 3COYA 3SR3A 3UC5A 5JY1A 3KX2A 1JJIA 1UMBB 3MM4A 4ZARA 2VUIB 4EJFA 5HWSA 4U9HS 1F8UA 4YMSA 4BMOB 3E48A 3QUSA 1O94D 2JGLA 1WY7A 4ZEWA 1HM5A 1T26A 3WGOA 1WLYA 5ALDA 3KUCA 4WXYB 3TB6A 4PLPA 2VUUA 4D8XA 2Y1GA 3WGUA 1BQEA 5IYZF 3IV6A 1HO3A 3SDSA 5IFKA 2BSXA 5BSXA 3UY4A 2YJ6A 4P7JA 4BVGA 4DSOA 2B3TA 3KJFA 3IAUA 3M9XA 3RABA 4C7MA 3G71B 3IQZA 5JZMA 1JU9A 5A3JA 1XNRB 3I83A 2JFGA 2VHZA 4RDIA 1PZHA 2HYDA 2EP8A 1A9XA 2E48A 5ALXA 3NM6B 1RJEA 3QI2A 4A8PA 5KU1A 2H8KA 1ACMA 1GG8A 1FFHA 2UVPA 2ZE8A 4NI5A 5EWJB 4BL5A 2C59A 3A6LA 3SZOA 1P6UA 1PRYA 1ZM4A 5ICGA 5JJCA 2VR1A 2AOUB 4URWR 4HWPA 1NBMA 1PR4A 5KTPA 2ZM6B 4Z2AA 1XZPA 1G59A 3PQ2A 4RTSA 3PDHA 3P1JA 1AKNA 2R44A 1FJHA 4WN3A 1WUTA 1Q20A 2DHRA 4G89A 1UD5A 4K1LA 1W1UA 2CZQA 2GX6A 3R6TA 3L4KA 4NOMA 1GCIA 3G2LA 3DAOA 4JJ6A 421PA 4IHQA 4GZLA 5FFFA 1CB7A 3CISA 3HCCA 1RPTA 5CVDA 3WLSA 4TMXA 4BKUA 4PV7A 3CE9A 1PJAA 1UZNA 2HQ1A 3RV4A 3IPCA 2N46A 3NAZA 1KDYA 1Y9AA 2WZPP 2BGRA 2QT1A 2WMDA 3IDZA 4HLQB 1J2EA 5WRFA 5LB2A 3QXSA 3VR2D 5DHFA 4JI2B 2HXSA 3DBHB 3IELA 3TRFA 2C5EA 3JSXA 4HNSA 4ZCQA 4HH0A 1U1CA 3BZBA 2WF6A 1F51E 1XEXA 2I7CA 4P2BA 4YGXB 4Y6LA 2POQX 3DQPA 4Q3BA 1KYYA 1ZNXA 3INYA 5LLSA 4YX9A 4V0NA 3NRJA 1LRJA 1TMKA 1V9CA 2XNKA 5KYTA 3KJXA 1XJ0A 1RW4A 3E0XA 3O3NB 4X24A 3NOVA 3PGVA 3FB1A 1FA9A 1B74A 3IKLA 2FE4A 4POOA 1N32B 3I39X 1EFLA 4YDRA 2YVAA 3R5TA 3ITNA 3R3XA 1QGED 4C88A 1E1QD 1YZVA 3ISTA 3BWBA 1AKQA 5DN6D 4UE3S 2BFBB 1G6KA 5HJEA 3WFZA 1JTFA 3MTJA 4A3SA 4CIWA 5EJFA 1U3FA 3DZCA 2WU3A 4ZAVA 2NUPA 3QX3A 4WV3A 1OAAA 3F6RA 5KDDA 2IBTA 3UJCA 4WGFA 5F4MA 3VU9A 1DELA 3KP1A 4UAGA 1H1TA 4ZCIA 2LUOA 2VT6A 3O31A 4PPFA 3R24A 5FUBA 1RYMA 3WLPA 1XRLA 3G1UA 2EARA 5H68A 3HGMA 3AINA 1Y3FE 3RS8A 5HXAA 5B7QA 2XMQA 1CQPA 1RAAA 3VXKA 3KXPA 4FZ3A 3V4OA 3T06B 1Y7PA 2UZIR 4RVFA 3ZQ4A 3WQHA 1Z16A 3AHIA 1P19A 3MF4A 4C05A 3FYUA 1Y81A 2X1MA 5FOTA 3KM0A 2IXGA 4B3IA 3KTDA 1JHVA 4NAUA 4DR1B 4LOAA 3A3YA 3DSRA 3QBJA 1J49A 1YBHA 1ZBDA 3UFBA 4QM7A 5G2OA 4YI5A 1GZUA 3KXKA 3VSDA 3IL2A 4YRGA 3P45A 2FYTA 5K1ZA 2DP4E 3I12A 2FH5B 1VJDA 4M9SA 4BWVA 1DKMA 3WNDA 3IQIX 4CLDA 1BHSA 1WAMA 3E61A 2P79A 1FW6A 4CMIA 3SZ3A 5GTDA 2G25A 2G71A 3V8MA 1BS2A 3ZV7A 5TS3A 2R96A 1LDYA 1AUVA 4W4TA 3L18A 4QSHA 3FF1A 4FYYA 3SHWA 2PL9A 1NXPA 4NCXA 1K2WA 4RKQA 2W2OA 1SBQA 4BMXA 3C3EA 4EVRA 2VP5A 3DE3X 4LDNA 2NYUA 2HJVA 3CG0A 2VHXA 4IM7A 5G1PA 3CC7B 3P9RA 4ZOBA 1FZQA 2RE8A 1DCFA 2ON6A 2CK3D 1C2YA 3QLEA 2HTEA 1J2JA 2W0MA 1PL8A 2ZL7A 5L6LB 2R0QC 3LY9A 2I29A 4DC0A 4YAKA 5AW1A 2VO1A 3D4IA 1OB5A 2ZYDA 5GWXA 2RH8A 2B99A 3IAM1 3CUUA 3W79A 2YQ5A 3NCTA 3EUFA 4JVNA 2HT1A 4AKGA 1W2WB 4X8LA 2AQIA 2V58A 3HRHA 5KX5F 3BJMA 4V0KA 7MHTA 3LT4A 2PT7A 1FU8A 3N2GB 4BNLA 1E1DA 3DTNA 1DZIA 2JFUA 1UBGA 3DO6A 1ZR2A 1QRUA 2PUBA 4F56A 1EGAA 2Q49A 5KDOA 1SVWA 2JIPA 3FBWA 2PUGA 1BW9B 4RSHA 4BZWA 1DKUA 1QXSA 1X19A 4EI7A 5KVSA 1WQ1R 4AMGA 4G67A 1WOYA 3R7LA 2I54A 5KYWB 2I87A 3I04M 1ZM2A 5B2FA 3SX0A 3EXEB 2DQ4A 1TNDA 2WNHA 4HGOA 4LW8A 3WBFA 5ALHA 4PNEA 2FPKA 3GYBA 3B7PA 1VE1A 1NLFA 2HLDA 2DYKA 4AJOA 1TEZA 3ZKWA 3WBJA 2X22A 1XJWA 4ZCMA 1XMVA 2MHCA 3C3JA 4NBWA 4C76A 1SB9A 2AR9A 2G9QA 3DZHA 4L1KA 1DAFA 2PLAA 4V0ME 4EJSA 5KQMA 2HSWA 4AMUA 2VF2A 1YAJA 1WSVA 4Y7DA 4P33A 2IS4A 3AI3A 1BCRB 4KYVA 4RQUA 1J24A 4Z4QA 3IBCA 2X9VA 4P1VA 1HL3A 3QPCA 4EFLA 4F8JA 1AKEA 1T9DA 1GA1A 3ZHTA 4LFAB 2VP2A 4EG8A 1OAKA 5TQ2B 5FR2A 1XDUA 3MILA 1UKZA 4CM5A 2X4IA 5CA0B 1K98A 2NW6A 3E1GA 2RHBA 1Y6QA 5K0SA 1G5TA 1UK9A 4Z9BA 3UGTA 3KYCA 3O4RA 4IDQA 4LF6B 2PRSA 1WQ3A 4AW9A 1MW9X 1PJZA 2WILA 4KDFA 1CBUA 2RGYA 4DV3B 3K5IA 1ZNQO 1IN1A 2VXOA 4RYDA 3UK1A 2ZG6A 3PLRA 3DBRA 3SFTA 3MRXA 2FW1A 4I9HA 4HWOA 1IHXA 1BWSA 1J56A 4UBOA 1J23A 2P4SA 1KO5A 1DC7A 2VAPA 3W9BA 3UGJA 2ID9A 5J2TF 5CUQA 4F3CA 3C24A 2J3QA 4QU0A 3SXUB 2VBVA 2H7XA 4G37A 3KJHA 3SX4A 4LPKA 1IPFA 1D03A 2Q2NA 3ANXA 3H1BA 4MQMA 4XDHA 4BJ1A 4ZHSA 1SXJD 1X8KA 2WNIA 3ABRB 3U4GA 2XMDA 3PVDA 4CHGA 4AKIA 1RYHA 1G4UR 1S8FA 3JX9A 1Z0ZA 1BRTA 4RPBA 2QORA 3NUGA 4F45A 3TW8B 4EOGA 4Z53A 4H17A 3I2IA 3HYSA 3VBCA 1OI2A 1S7GA 1ECFA 3G85A 2IPMA 3W4JA 1M75A 1RTTA 1NYTA 1ZJJA 3CPHA 3VAYA 4HXEB 5ALJA 1Z0KA 2Q5HA 3H9GA 1VPEA 2GYUA 1QVAA 3JYHA 4Q4JA 3RIHA 1FSSA 1GNPA 1BS9A 3RLFA 3TTVA 5JAHA 1JFRA 3I62A 3P52A 4GMKA 2C58A 1I33A 5JS8A 1N5RA 3GLQA 3IEPA 5JMPA 1FVHA 4IRXA 1RDFA 2ZBQA 4MUNA 1GRQA 1KBQA 1NVMB 4L0DA 4ZO4A 1VDZA 4RJTA 3HKCA 1ZMTA 2NSJA 4LJAA 1BDBA 3I23A 3MJSA 5EZQA 5TQ0A 3RGWS 3UAGA 4EI8A 1XU4A 1P2BA 2PQ0A 3TUZC 2XQKA 1ORWA 3KQLA 2ZI5A 3QLTA 1MXHA 3G6EB 4ZPJA 1R74A 2QS9A 5IKPA 2VHQA 3GVXA 3P9KA 3Q5EA 1HH4A 1VE7A 5TMDA 4BS9A 2AFIB 1K7XB 4RW0A 1SM4A 2ECPA 1YCHA 1CS0A 1OQAA 3HRKA 4MCJA 1NF2A 1T24A 5AKZA 4DIFA 4JR0A 4XLCA 1IOWA 3BXPA 2GEJA 1RKVA 2NXJA 2I8AA 3G79A 5EHNA 4W6ZA 4ZA2A 4U4AA 3REQB 3ZE9A 5M3BA 3OA0A 5EWLA 1BA2A 1GPH1 4MS1A 1E5QA 4DXDA 1DC5A 3B53X 3PC8A 3ITEA 4CTNA 4ENPA 3ZVMA 1ZUNA 2BUAA 1G7TA 2CDBA 3EW9A 4NHEA 3NO4A 4ZIRB 3WR5A 4IICA 4RD0A 3ZJ4A 3SQDA 1IOVA 1KWKA 1AMUA 2YV4A 3OQ6A 4ATNA 2CXRA 4YREA 4YHHB 2Z6UA 2IXAA 1MH1A 3PPWA 4LMRA 4E3ZA 4B2IA 1K7YA 1K27A 3OKCA 4RABA 5HCUA 1F9EA 1QGYA 1PLLA 3PXUA 3ESRA 5KTKA 4MUGA 4QUAA 4MUKA 3MEQA 5EESA 3CT6A 5JCOC 2XD4A 3FDXA 5JW6A 5B3KA 5TRTA 4FGWA 4O8ZA 4EATA 2JLYA 3WLOA 4UEQA 5BT9A 4D6XA 1C0PA 3WV4A 4YMGA 4XX0B 2UZ1B 4P3IA 3CB4A 3HP7A 3T5TA 4AS2A 3HS3A 1WO8A 4ARCA 5J4YA 4WOPA 3AR7A 1CZHA 1IRIA 1BO6A 4CQLB 4LV8B 1MB9A 2M6LA 2R65A 5ILQA 2O8BB 1RMTA 1YQXA 2R48A 2RC5A 1U7OA 3HY6A 3I76A 1EGMB 2X5XA 4KQ1A 3A58B 1R6DA 4IGAA 3G2KA 5LZ5A 2J85A 4GYJA 2LKDA 3LBYA 4ZDKA 3GR6A 5CYOA 4HDNA 3SYTA 1U1IA 1VTKA 1EFKA 1DJMA 4KGZA 2OBBA 1N7GA 1GNVA 4IKEA 1WXEA 3EAQA 3L1IA 3LCUA 2R7MA 3UK2A 3TZKA 4NOLA 4M89A 1U5CA 3OZRA 1YB4A 1Q11A 3V3KA 2DUMA 1E9FA 1DTWA 4XWTA 3HXOA 2VNKA 1UCFA 2IF0A 5JSZA 2GXSA 3TEFA 4CI0B 1BX0A 2A7QA 2XCOA 5FWNA 2PUHA 4QVJA 4Y8VA 4JV5B 1M34E 1Z5UA 2HA7A 4QECA 4BASA 3EXG2 1CQIB 4H3VA 2P62A 3T7AA 1FF9A 4KVZA 4MPDA 3QG5A 3FTEA 4QPPA 2H7VA 2CYCA 1C29B 1KSFX 4GOJA 3FIUA 3TZHA 3VR0A 3RFVA 1XFOA 5JV5A 3RKRA 3M8KA 1W75A 3V1UA 2JH8A 3WLRA 2VJBA 1RVDA 1VYTA 1ISIA 1Q22A 5BMOA 5IF9A 4DB4A 3T52A 1DRUA 1F0NA 2HZBA 3RM3A 4B5LA 4LC9A 2EHDA 4MEAA 1P72A 3HLYA 5CFQA 1WCYA 1ISHA 2HXYA 2EATA 1VP3A 1X80B 2IKSA 2OBMA 5LA6F 4CTJA 5KNDD 3NRBA 4E0FA 1NHGA 4HZIA 1T9BA 2I6FA 3TLXA 3ZLBA 1LDMA 1QGUB 1LTQA 1I01A 3FPKA 3NHBA 1PI3A 3O82A 4N39A 4YMWA 3SVZA 1AS3A 5EZSA 4EHJA 6NULA 1QHHB 1IZZA 3FCUB 3SQMA 1YDHA 2ZRDA 4EUKA 4TQUS 1E1KA 1UMBA 5FUMA 5COBA 5REQB 4BLTA 1H5QA 3JARB 5T7BA 4MI6A 2YNMC 1CG6A 3OQOA 4D79A 3M0EA 3D7KA 1GADO 2HIGA 1P6QA 3LC7O 3ZI4A 8AT1A 3LFTA 4B46A 1M9NA 4EG0A 1VDMA 4DTCA 5K01A 2AQ8A 2KBFA 3I1YA 4TUYB 1GG5A 4QDUA 1I4EB 2PSSA 1QHSA 4Q6BA 1AQJA 2RHHA 2QTLA 2O2HA 1FQWA 5DBIA 2M32A 1WW8A 2F4NA 1DE0A 4L5YA 1QZUA 1UXKA 3B20A 3EEFA 2P1DA 1ZQ9A 3D1VA 3T9AA 1DQZA 2Y4OA 3OLXA 4GMDA 5MN4A 1HC7A 1YR6A 4LHZA 2RH4A 5CVVA 5T4EA 5K05A 2CVQA 4LGCA 2AOUA 1BMQA 5IHXA 5JXJA 3H5WA 2P3LA 1ML3A 2XCLA 4RK0A 4CN9A 2XUAA 5K7SA 2VXBA 4U2DA 4L7QA 4WCVA 5K9ZA 4G26A 3ADCA 3FIJA 3U4CA 2O5CA 2PXXA 3LYUA 2PVSA 3VYVA 1XTBA 3JTMA 3L7IA 3TYXA 1WORA 3O47A 4ZAGA 5IAKA 4C4ZA 3RRJA 1WABA 1IJKA 2YS7A 3IPRA 2XEDA 4NE2A 3A2NA 3Q98A 4V03A 4LUCA 2IHJA 4E2FA 1MOZA 2RIRA 2Y66A 1Z36A 1Z08A 3LT5A 2AD5A 3NFYA 3NNNA 3TNJA 2VQ3A 1NQ5A 4UNPA 4XI9A 5DM0A 4EHLA 1EP9A 1ZAYA 1W87A 3G2PA 1KPGA 3D7RA 2XTJA 3DBHA 3RSZA 5FOSA 3SZUA 4YJFB 4FDVA 3IEMA 5ALKA 2JB9A 2DJIA 2GBLA 4LWPA 4PGFA 2QR3A 4Z2YA 2Q4RA 2H9IA 1J0BA 3FB4A 3JZDA 1NUAA 3M34A 3IV7A 2EZ4A 3PDIB 3L41A 4CM8A 1M8PA 5JWRA 2UXDB 3PFCA 1PR5A 4Y6RA 5SYAA 3GLFE 4DPLA 1YKSA 2Q8QA 3R23A 3JQ9A 4UPVA 4WNYA 4II3A 1E60A 1TJYA 4D42A 4LSMA 2E89A 4G4GA 1TX4B 2VDRB 3TAHA 4AY3A 9LDTA 1ZCBA 3JCZA 5JY6A 3U60B 2XH8A 3CPEA 2X5KO 4JP1A 4R2LA 3CP8A 2LXNA 3MYYA 4GLOA 5HRUA 3WFIA 2WD7B 1D2EA 1E2PA 2IPOA 3EIUA 4LK3A 3HLTA 1ESNA 2EZ8A 3ZG6A 2VPWA 3TXXA 2ZAYA 4V2UA 1QO0A 4DC1A 2UUAB 3WXBA 2E4ZA 5JAUA 2BVNA 4JY7A 3AERA 1CYEA 1MO2A 4IQ8A 1YUNA 2PGIA 4R68A 3SJCA 1YGPA 2F8MA 3K9HA 3KQPA 4HYQA 3ER6A 4M83A 2QK4A 4EEKA 1YJQA 3IBYA 5I5EA 4L4SA 2DPMA 5ALNA 3LYAA 3FOEC 4LF4B 5CGZA 4WQMA 1ZSVA 1WZEA 1YL5A 1GJRA 1W5AA 4O4IB 4CTKA 4ZOQI 1PNOA 1E6MA 1GPMA 4KFRA 5CIYA 4EF6A 1U9JA 1KK1A 1YRYE 4X05A 4ZJPA 1Z5ZA 3V4ZA 2QGGA 3RJMA 1RZVA 1C9DB 3SGLA 2VPZA 2HLHA 1Z35A 3M82A 4QTZA 4PABA 1P8AA 1R9MA 2W6ZA 4ARZB 3QJ5A 2GUGA 1C8KA 3KZOA 2OLEA 2VPTA 4FFVA 4NJMB 4F5ZA 5LOVF 3A3NA 2HMUA 2OCAA 1B93A 3EFOB 1G20E 3U61B 5DT9A 4ENUA 4J0JA 1YQUA 4G0MA 4LXIA 1XVVA 1QE3A 1RT9A 1PJ4A 2EBHX 2XGMA 4U2GA 4NS4A 4RC9A 3ZHBA 5K6AC 5M7EA 3L7KA 4GZ5A 4UU7A 3SF8A 1ZL2A 1J9GA 1N05A 1Z73A 2HHLA 4XIGS 4C3OB 4E94A 2ODTX 2YICA 4Y2RA 2Q1TA 4DIBA 1JQEA 3C7CB 1R12A 2BTOA 2FSFA 1WSBA 2XQIA 3TLZA 5CB4B 3GUVA 3CIOA 3O4FA 5FWYB 1MG5A 3ND9A 4YRCA 5DLYA 2UU9B 3F3MA 2QV0A 3O90A 4KVAA 3QU5A 1DXOA 1XMQB 2JD1A 1E9AA 2QUHA 2ZETA 1OW3B 4BCDA 4HUTA 2WUGA 1E1RA 1DIGA 3EIFA 3GNSA 3VSBA 1JA9A 4B3HA 2XBMA 1HQDA 4JYCA 3GIDA 2ANBA 5A3VA 3FAZA 4BJ3A 3M49A 3NM4A 1KSGA 3UH1A 2WTUA 1E2HA 2AWNA 2WKQA 4XTCS 1PL0A 2W9XA 3C3CA 3N2GA 5DU2A 4MWEA 3VGJA 3ZDEA 4NEGA 2D4HA 2EEPA 4G4SP 4LHXA 3NJ8A 1T5SA 3FPCA 3HXKA 3ONVA 4LSZA 3CKMA 5KYXB 3PC2A 4JYBA 4EG1A 2YOHA 5A0VA 2W6PA 1JQJC 2RFLA 1BW9A 3U49A 3COSA 5BSHA 2GXQA 5LU9A 2O8VA 4OD0A 2AEEA 2QN3A 2QD2A 3PA8A 1QFXA 1RRGA 5KYWA 4DNPA 4XGKA 3UWKA 2A67A 1IMJA 1FJ2A 2A5FA 3W5JA 3EXEA 4JEIA 4LJ9A 5AUQA 5H4GA 1RXEA 1L7VC 2J5XA 1ZH8A 3FHLA 3KTAA 2X15A 3ZDCA 3DOUA 2IPAB 3E9ZA 3HSKA 4ES6A 2GASA 2H65A 2QJOA 1N5KA 5DM4A 3QIAA 1RXSA 2ZTVA 4L8FA 1TVKA 1H3NA 3NIFB 4ZRMA 1KJ8A 1D5CA 2BEVA 3PQFA 2G67A 3IUMA 3ZH2A 2IIVA 4J0CA 4F9FA 3BILA 1XDBA 2CDCA 3WP1B 3TQRA 1BCRA 3SYLA 3WRXC 2YH2A 1UBEA 4GR5A 2X0EA 4IDAA 2IIQA 5I7EA 3K6SB 3A8JA 2NIPA 4QOSA 3UBMA 3TJZA 3QOYA 3KQMA 4YUAA 2NYAA 1N6IA 2PE3A 4RELA 1EWYA 4CMJA 5JVDF 5BW8A 2GCNA 3C3YA 5DSTA 4BVHA 3G23A 4B3MB 1JHMA 1IOZA 3RLIA 1YV9A 3GLIE 4F3NA 4HJXA 2AVDA 1S6YA 3EK2A 4EI2A 5HQTA 2JJQA 4AS1A 1JIIA 3I2GA 2HU2A 3BD7A 2GFQA 4JWTA 4EFMA 4IGFA 4LDZA 4XLEA 2W4MA 3CONA 3MMZA 5AM3A 3IKTA 4WOJA 3DLHA 1VBFA 2X42A 4KR2A 2G83A 4UM7A 3RTGA 1SUDA 1NKTA 2C2HA 1RZ3A 2C3UA 1DIRA 1RQXA 2J45A 3LUHA 5AOBA 1E66A 2ETVA 1GV0A 2O4UX 3JVUA 2CL5A 3AUUA 3AHFA 3PE6A 3QH4A 3QVUA 4HMPA 3TQFA 3SXUA 4EW2A 1HT1E 3EEBA 4F12A 4C7OB 5JO9A 1O8CA 1MR3F 4RACA 4X8IA 1F0KA 3W05A 1BJKA 4X8OA 4UZEA 2CWWA 3TNFA 5KQPA 3K5HA 2VT7A 5EHQA 4XR4A 3O8NA 3MJFA 4B3RB 5INTA 3FR8A 4RHTA 3O1HB 1WUYA 5A9RA 1NATA 2G04A 4KN9S 3GD5A 1E2EA 3QOWA 5FKJA 3RSFA 2IHBA 3AVUA 4XLZA 3IEKA 1SIBE 3PKZA 1ZX1A 4QDXA 3MBKA 4QJIA 4E5PA 1DINA 3BAZA 3IAAA 3Q72A 2LGJA 3NVKI 3FNGA 4H1HA 3W6NA 3H3XA 1QV9A 4ZT3A 4LDJA 1P2GA 2H6EA 5KNCD 1SCJA 3D6VA 5FYQA 1VLHA 2OMKA 4J1NA 4V1CB 2VH2A 3OZGA 2F1MA 5LMZA 1JDUA 1G1AA 1PGOA 1UAGA 3FKSD 2XWQA 1GUAA 3OWOA 1DEXA 3L7LA 4NDAA 5DTMA 3T9DA 4BNYA 1N2ZA 1HDOA 2OXRA 3IYLW 1PNTA 3IR5A 1YS7A 3EC2A 4L15A 2DSNA 4D81A 1FX0A 4K03A 1EFRA 1PBTA 3NTOA 3CLRD 3HKBB 4FSDA 4WCFB 4UM8B 2VYQA 1QKIA 5D01A 1MG0A 3NUZA 5GQSA 4BEJA 5LNK6 4U6QA 5LZ2A 2AFIA 2GRJA 4TTSA 3ZDDA 1ZMRA 3IUJA 1ZWKA 1LQ2A 1KS2A 2WT4A 4MQ5A 4M3NA 5KWIA 4FYJA 3K9LA 1F2UA 4GX1A 2NNWB 3CLSC 1V1MB 3NASA 4HP8A 4HAIA 1AKMA 1EFUA 1E89A 3IP6A 3IP1A 2C9ZA 2NO7A 3UV7A 2PXAA 2GYWA 2BISA 2PMFA 4PTZA 4ME6A 3H9NA 5H59A 1G16A 4HE6A 2CBZA 4FKZA 2VWHA 4K9OA 5B6JA 3STHA 4EFDA 1DI0A 5B6IA 3DTYA 5I8WA 3M83A 2OFPA 4JENA 1F3OA 5LYJA 2QUBA 1BHJA 2WFLB 3KSBC 4G1BA 3AC0A 2PL1A 4W9NC 5IW8A 3KXDA 4DUYB 1VE9A 3HNOA 1KMMA 4JB2A 3OTHA 4JT8A 1L4NA 2GAIA 1DBVO 2Z6AA 1QFSA 1RWKA 2FGJA 5A2GA 2HADA 2VHJA 1VBNA 4J4HA 5THQA 4CL8A 4JD5A 3FGZA 5KPDA 5D3QA 2PIAA 1P81A 1NW7A 3BSYA 3VVCA 1KAGA 1NQVA 1Y5MA 3S0JA 1M54A 3FNFA 4OOEA 4CNQA 3ZY6A 3CCFA 3G9QA 5IMBA 1SRRA 4XX0A 2UZ1A 3UHAA 3T5AA 4TVBA 4PC2A 3EMKA 4PYKA 4X45A 4HAVA 3IQEA 4UHBA 1COZA 4ZT2A 5T4BA 4C0QC 1A8SA 2OYCA 1MBZA 5IABA 2H3EA 5HKLA 4CQLA 4D98A 3BFXA 4J16A 3D0QA 1FFBA 1S3GA 2C4NA 2FG5A 2HUPA 3ZWWA 2W8BA 4HNQA 3VR3D 4RTQA 1U2RA 5CFLA 1O9HA 2JHFA 2V4UA 3PUNA 1HRKA 4YRSA 4B3SB 1WVMA 3PHLA 1CY8A 1T2VA 2BGUA 4JMPA 4OV6B 3QLJA 4KX5A 4BFTA 4F3TA 3ZHSA 2AFHB 2X0FA 1VQKB 1E7SA 5D86A 3FUVA 3CZMA 1A7KA 5K4AA 2FSUA 1CY0A 4YS6A 1HYEA 3RT1A 4P4GA 1RQNA 1PDOA 1CUEA 5JDIA 1IBLB 4P35A 1LBTA 2C9BA 2JRCA 4IBOA 3GPDG 4JKYA 3P94A 1CQIA 3D3NA 3I2JA 4B17A 4O2AF 1SXHA 4G2NA 4LE0A 4CMKA 2MINA 1TA9A 2DFPA 1JFLA 3GXBA 3QE2A 3OTQA 2WIDA 1BEEA 1VCNA 3EASA 3GBVA 2H7CA 3TIIA 1SRQA 1ZA2A 5A4AA 3QW4B 3A1TA 1XOIA 4MK4A 3HMQA 4MKZA 3B8HA 5CJJA 2H5EA 2Q0XA 2QN1A 5IYPA 5JBQA 1TLTA 2EU8A 4LZOA 4P1ZA 1B4DA 3NM5A 1E9VA 3WGVA 1OKKD 6ABPA 2QMOA 4XKVA 3ZJVA 3X2FA 1I3KA 3EDCA 1WZNA 5BSKA 4XLFA 3K16A 1QH0A 1OASA 1YONA 5FTNA 1QOZA 1OX5A 5EUCA 4D9FA 4IJUA 5JCJD 1DBSA 1E3JA 1W4ZA 2A0FA 5FLYA 2X9QA 3QX8A 5TF0A 4CFYA 5MDHA 4CMEA 2I3BA 4YFVA 1ZJZA 2E1BA 2F3PA 3SN6A 1QHHA 2H5LA 3DAYA 4PZPA 3B3GA 2JGMA 5KC8A 1MJNA 1U8YA 1ARZA 3M70A 3QXXA 2FUG1 1PWZA 2J9YB 1FSZA 1JJBA 2HRDA 3O8BA 3PSHA 4JDPA 4OYLA 4NV1A 5FA5A 5REQA 3PLAE 3EOBI 2CE2X 4RSMA 1GG9A 4JXXA 1N4DA 1VM6A 3C98A 3FWHA 4Z3KA 4ZYTA 5KSZA 1H3EA 4RKWA 5KOIA 1H2AS 3IC5A 4BJHB 2DPXA 3ITDA 1C4WA 2XNHA 5DNVA 1TMGE 2B34A 1P2FA 5BSFA 1U1EA 3S4YA 1Q50A 4TUYA 4YWHA 4NEQA 5DYIA 2C2MA 1REQA 1WZUA 1M2HA 2EIXA 1CUZA 1UMKA 1QO9A 1NWCA 2QTCA 1XU7A 5BWMA 2X0RA 3DMYA 3ROZA 1VJCA 4IXTA 1GYQA 3PZRA 1KIAA 3ZC3A 1A9ZA 1BCSB 3JWHA 1PT6A 2P69A 5L53A 4TKZA 4CM9D 3JVEA 4MR8B 4HLUA 4R05A 4DKJA 4PVDA 1XLTC 1SBZA 1KI3A 2W6JA 2AJBA 4UHFA 4UATA 1Y8QB 1P45A 4MYSA 4JLKA 3T7SA 4X7PA 4X20B 3S29A 3PA1A 4DWJA 2D5IA 5CW2A 1JR3D 4TVKA 1Y4SA 2DQKA 5IKMA 4CIYA 5ED0A 2C88A 3FXAA 4E1AA 1IZ9A 4HC4A 4B1FA 1CUCA 2JBWA 3ZTTA 2RAVA 1G8YA 1OFUA 4NEHB 5F5LA 2JJ1A 2ZTSA 3IP9A 1DAPA 1ZGZA 2PV0A 1G5RA 3AFNA 5U4QA 1XXHB 4BV9A 1C9JA 4GP6A 5JJ5A 1ESMA 2CJWB 3P9CA 4OQQA 2B8WA 2CD9A 1MX3A 5H9VA 2Z5GA 1WP6A 1FCJA 4KKSA 3DDCA 1P9WA 2Y1FA 4FILA 2VRCA 1RBZA 2FGKA 3NWJA 4HWKA 4GE3A 5KHOC 4AK9A 1HI9A 2LIVA 2P3OA 3SFVA 3HG7A 3V6MA 1F0PA 2J3HA 4GYYA 2OB2A 1RM0A 2YFQA 4XRRA 5CIWA 1N3IA 1MNAA 2QE7D 4ZJUA 3KT0A 3C97A 4JS0A 1X0VA 2JGKA 3H5RA 2B82A 4EF5A 4YY3B 4KPGA 3CF4A 4ZI2A 2JAUA 4LBZA 3PUXA 3KKQA 3U7IA 1FFXB 2JIZD 4ZVQA 5CFRA 4YAGA 4PHGA 3EWIA 2FQWA 1EB9A 4BLPA 3JQ8B 5L4NA 4OBEA 4MRSA 5KO2A 1Y9EA 3MWEB 2F64A 2FDRA 4G8DA 2ZRAA 4Q7LA 4E32A 4M46A 1H2FA 1GL6A 2IU0A 3FMGA 4AZVA 4CT4B 3TNYA 4US0R 3C8DA 2QVCA 4NU6A 3WMRA 4B6PA 2AE1A 3AM3A 4OX9B 4QU5A 3RRBA 3TBKA 1KDRA 2QX7A 3E20A 3H5LA 3A04A 3FCSB 4I5IA 4NBTA 3DBIA 4TZTA 4YASA 2F9FA 4TS1A 4M8IA 7AT1A 4L8GA 2BD0A 1YRBA 2O2JA 3GARA 3CX7A 3UATA 4ZFNA 5JPDA 2ZRFA 4Y2HA 2AEFA 1KPHA 2LWIA 3FCOA 1ZN2A 3KL4A 5T57A 4AZSA 4AY4A 1OV6A 2D1YA 3JD4A 4ARZA 1TYEB 1MV8A 1ZD4A 1TQHA 1YJWB 4NJMA 3DE2X 1JZTA 4K6OA 3RIXA 3RYFB 3R74A 1NUTA 1Z5GA 5DNUA 1XAIA 3EFOA 1JLRA 2FE1A 4GAEA 2ID7A 2D3TA 5AVOA 1GFSA 2A2ZA 4WPGA 4HGZA 1PF7E 2C4WA 1K8QA 2AJCA 2ECFA 2XV1A 2ZU6A 3Q0IA 1Z0UA 5K8TA 3KSDO 4ZU6X 5HZAA 1DC6A 4QO8A 5DH9A 3SE7A 4EJ2A 3UC9A 2BSAA 3TZ6A 4FFRA 4B76A 3WYNA 1ZC3A 4O0LA 3F46A 3FUTA 1O0CA 4MV1A 5GPBA 1KFEB 4MWZA 1NQOA 2QMYA 1V5EA 3FETA 4Z1MD 5FWYA 2MYPA 5EFZA 1EFVB 1A50B 1NDUA 3DV0B 2NV6A 2ZM5A 5H3LA 1C7FA 1Q84A 4AZWA 4JK3A 4F5YA 3JQRA 4OJTA 1CUHA 1GZSA 5G41A 4XSVA 1LXCA 4JB8A 5CAEB 3E9CA 3JY6A 3CCBA 3P2KA 4INOA 4QDJA 3T3PB 4BECA 1UQRA 3WO0A 3EHDA 2GK3A 3OQVA 4KTVE 2RIPA 3WG9A 4UTPA 1CUSA 3AR4A 1KFCB 3QPAA 1X7ZB 4C78A 1WB5A 1MJGA 3EMDA 2WWWA 3OY7A 5DNYB 1OC2A 3KZVA 3UB2A 2ISSD 3B3AA 5H4HA 4BMYA 2LBPA 1LLUA 3HN7A 4F2PA 2CV2A 2A6PA 1U1GA 1CVLA 2A1UB 1GSIA 2HTFA 4P3OA 3T4PA 1SC6A 1AMNA 3AEZA 5EZYB 5F4ZA 2I91A 1D3AA 4BP3A 3E9MA 1SKYE 5BNTA 1Z82A 1JH9A 1QJ4A 2OXFA 5CFMA 3ZVKA 1HXHA 1I2AA 1MQAA 1UEIA 1CLEA 3AUKA 4FLEA 5EKTA 3HCWA 4FNAA 4MW4A 5M34A 2FFAA 2PZLA 2PMDA 1VG1A 4C22A 3USCS 2GWRA 1JLKA 4QDOA 1LK7A 4RADA 3X1WA 2VWGA 3G0OA 4OLFA 4Q3KA 3EGXB 1TQ8A 5DHAA 1QP7A 3PFWO 2HXGA 4Y6GB 4E4YA 2YRXA 2JIMA 4RD3A 1UK7A 2EEZA 1DKNA 1TGVA 4B3XA 1IY2A 1TEVA 3BBLA 3UW3A 5FPKA 4H7DA 1KZ7B 1DPGA 3ETLA 5F21A 3LHFA 1F4PA 5DGIA 2H57A 4HL6A 1FRFS 4GXRA 2UXBB 4M0UA 1RQRA 3UKDA 1TRKA 4ZZ0A 2PVPA 2AJTA 1KAMA 1ORHA 4BEWA 4TYYA 4HNTA 2PJZA 5KTYA 1GNSA 4NJOA 4YUZA 4BJ5A 4QQNA 3U6BA 3LS2A 2DEUA 3CJRA 3L7BA 3PNLA 1P4JA 4DREA 3ZGOA 4K6MA 1H9BA 1AHHA 1VHWA 2JLAA 2WU0A 1O5TA 4LNUB 1E43A 2R7LA 2GVZC 2VOJA 1C7RA 1DJOA 2VCHA 3H2KA 2YN2A 1VI2A 4AC9A 3DPSA 3LVFO 3QYPA 4X7MA 1KOJA 2ZTNA 1X94A 1KQOA 3K0FA 3L0YA 3C14C 3WV5A 1YOVA 4MVJA 4X61A 3VMFA 3U4AA 1CUXA 4KQXA 2EAUA 2V7QD 3F98A 4ZPXA 5ITZB 2GSWA 2K5UA 3NHMA 3ANMA 2K6GA 3R5JA 3V32A 2QW0X 4C7OA 3MBOA 1RFLA 2F7SA 3KEQA 3OJCA 2OXCA 3OX4A 4TRMA 4BNWA 3E58A 1NJ6A 2Z09A 4A5OA 3FNEA 1LRKA 5IHPA 3RFUA 1KBOA 1H2WA 1IBMB 4N82A 1MABB 2F9MA 2POCA 2IUFA 4CV2A 2HY7A 2I1QA 3H87A 4OGWA 4ZQFA 5CBPB 2ODAA 1YQWA 5ITSA 2AJLI 2IHKA 2BGGA 3V4SA 3QE3A 4UUNA 2EJUA 2YUTA 5CEEA 3I2FA 4YAIA 1W85B 2ORED 2OVFA 2P4QA 3JZMA 2FR8C 5HGJA 3VVLA 1DQPA 2G7MC 3C6KA 3Q9NA 2V6MA 3FHJA 4LYJA 5FEMA 3U80A 1KY4A 2ZOSA 4Q3EA 1RU3A 4I9GA 1BVUA 3DEKA 4V1CA 1QE0A 3GUHA 3ET4A 4AICA 5KNDH 3EUAA 1IHUA 2ACWA 2J9GA 1II8B 2C2ZA 3U13A 2FMTA 1T9ZA 2HJRA 3ZWCA 1BVRA 2VJPA 2ZIEA 5KUTA 3ZLVA 3GLTA 4AROA 1ZH6A 3HKDA 3JQBC 1KZLA 2VF4X 3PT5A 1T0BA 1YFKA 1UJMA 2V7GA 2KI5A 3DE1X 3MG9A 3SXJA 4FQ7A 4DZTA 2AJDA 3QTBA 1C8LA 1VLOA 1PJ6A 1VIDA 3HKBA 3OFVA 2QLLA 2Y1WA 4I46A 4WCFA 3I64A 4AZTA 1TK2A 3DOJA 4EITA 3T0GA 5F7XA 1KO8A 3BB3A 5I7FA 4DR3B 5DMXA 3QYFA 2OBYA 4ZYYA 4HX2A 2PUVA 2QAJA 3ECAA 4W5RA 4W5TA 1IU9A 1J0XO 3RJ5A 3IOYA 5KKNB 2RK3A 4RIEA 3HVHA 2FPUA 3J80A 5F3WB 1WNTA 1MD9A 3NH6A 3NWOA 3PB3A 1V1MA 2G63A 2WF8A 3QMVA 1NUPA 2QTMA 4LTDA 1ULTA 4HYYA 4LJ8A 3D0OA 1P7VA 5GZ6A 1V5IA 2XEXA 2VLBA 4IEEA 4IFIA 1GNRA 2MSEB 5IC5A 3GDOA 2O2DA 3DMTC 3LPAA 4B09A 5KYUB 1M83A 1T3HA 2QIPA 1YB2A 3KJIA 4PHTA 2ZUTA 1ODCA 2HMVA 2VK8A 5B1SA 5I7SA 2C3YA 3WGZA 3P9PA 2JDIA 5KTNA 1BX3A 4ZCTA 4DV1B 5JHGB 2P2NA 2OKCA 3KQYA 5LWHA 4XVHA 2JK0A 2P75A 3NEPX 1GDDA 2VK2A 4A0FA 1OWMA 2IYRA 3G2JA 4PIPA 4TRJA 5F5XA 4C0SA 5HJ2A 3DKRA 1Y5RA 5CR9A 5AICA 1N25A 2VI5A 2FSPA 2GESA 3DAPA 2IUYA 3M6UA 1RC1A 5SV2A 3NNSA 4S04A 3MWYW 2PJDA 1CJBA 1FP4B 1N5OX 3TXAA 3GJ8A 3CUKA 1G6OA 4FIZA 4LDAA 1NPYA 2B2NA 2HF8A 3LE8A 4HXFB 3A9RA 5EIHA 3ZTYA 1RM3A 2PG3A 3U7RA 3WB0A 5HKBA 4DK1A 2C8LA 5AI0A 3HCBA 5A4FS 1XCOA 3DE0X 1HF3A 4HY3A 4M1WA 2BJHA 4W99A 4KPEC 2YY7A 1Y7IA 4L4XA 1DAIA 2GB4A 1Y1RA 4QHSA 3LYLA 4II7A 3FY4A 1ACLA 4IIVA 3ROKA 4H27A 5B57C 3EAFA 4V0QA 4AMVA 2WVHA 2CXXA 1RADA 2GTPA 2HNBA 5G0SA 3EOZA 3RFCA 3ZCPA 4BRZA 2P9TA 3JWGA 1PBNA 1TTQB 4M38A 2J5RA 2QPTA 1SMKA 1X38A 1GG2A 3I8XA 1POWA 1L5SA 2J0VA 1PL7A 3HUFA 3BWCA 3L4BA 3E9RA 3MFQA 3Q7IA 3E22B 1JYSA 3DEAA 2XB9A 4EYEA 1R4NB 2QEQA 1XEFA 3PHCA 4W5HA 4XWGA 5G1NA 4ZJZA 1J22A 3LRPA 3TLKA 4UULA 1L5RA 3ERCA 2G8LA 4ID9A 4IDNA 2XYPA 3Q1KA 4D1YA 3NATA 3S2SA 4KWEA 4ZCLA 5ECDA 1UC4B 3JR3A 2OA0A 3SJAA 3B6ZA 2DUNA 4BNFA 3ZVLA 1YJNB 4UDXX 3KKPA 2OBSA 2C57A 2P6NA 3CBGA 3PHIA 4WTOA 2WYWA 4EA8A 2J67A 3OM0A 2GT1A 1DWOA 4IIBA 2A14A 2Y1DA 1AQUA 5AHXA 1C7JA 3VPFA 4UHEA 3GG9A 2FWMX 1IEQA 5HKOA 3NZEA 3P5SA 4ZANA 4LECA 2O14A 3CX6A 3GJQA 1IWOA 2XZDA 4TV9B 2AE2A 3KO8A 5KKAA 2NZWA 2ZTHA 2QNRA 2Q9AA 5HFJA 4DJEC 3IIEA 4EZBA 4LGYA 2ZSBA 3G49A 1UINA 1UIMA 4F84A 4ZTUB 3TGWA 2C7BA 4DF3A 1JUDA 2W6CX 3LXXA 4XASA 4B8ZA 2QMQA 4H0FA 3WB9A 4GQBA 4H31A 3AOGA 2L18A 4TT8A 3ECSA 1G9SA 4B3CA 3L0IB 3ROMA 2GN8A 1PK7A 3PT9A 3SIWA 1B1CA 1NOJA 4QYXA 4N65A 3DB1A 2C77A 4KEAA 4QVKA 3GP5A 3N0RA 4YUXA 4DHWA 1RQGA 3KALA 4A0HA 1E32A 2C84A 2YV5A 4OJMX 1N78A 1BYUA 1AE1A 2XW6A 4KI7A 5BXYA 4ZQHA 4TYMA 4D41A 4JJ8A 4P0TA 3LGAA 2XLCA 3FPJA 3RW9A 3K2BA 3KEFA 3LVQE 4R1PA 4CM1A 1EESA 1E7WA 3K73O 4PHFA 4MCHA 3U40A 3FLAA 1XKTA 4V39A 3RFFA 1FDRA 1QYIA 1NVDA 1UANA 3FMVA 3O1JC 4ENWA 2BEWB 3AIMA 1BCSA 1JLMA 1Z28A 3B1YA 1LU9A 3HDVA 3LVRE 3ASYA 4WKCA 1EIZA 4YJHA 3STVA 3O93A 2Q4TA 2XJ4A 4MR8A 5IT4A 1TU3A 4P0PB 2JLQA 4UQLA 4ZVMA 2R751 3KTOA 1T5EA 3TFWA 4HGRA 4X20A 4MWOA 5ELLA 3ACDA 4WY5A 3P20A 3RK4A 3FCEA 3U4DA 1NF8A 2FJ0A 1LVHA 2Z9CA 3I5AA 4QOJA 2PYDA 3TOSA 3JV7A 3EDQA 5E9AA 3L0BA 1PD0A 4UE2A 4UBKA 2E49A 3DT9A 4IVRA 1U3VA 4ZDWA 1ODFA 2CFCA 2Y8EA 3TL6A 1ZC4A 5L4LA 1N1DA 2JGFA 3GJYA 5ENVA 5IYNA 3K0CC 1D2HA 1XXHA 4DXHA 4M99A 3W4KA 4KE6A 3AKCA 2H2IA 1MOSA 3AVOA 3G9UA 1Z33A 2CB0A 2CJWA 3OKPA 1G42A 2PRKA 4NULA 3J7AC 1KI6B 2YZ2A 3OSUA 1A9PA 5KYVA 3S8EA 4CQMD 2A0KA 1NYQA 3FUWA 1MIOB 2JFVA 5JE8A 1KPIA 3SZLA 3V2IA 3C15C 4IG4A 4G6ZA 1LJ8A 1AF4A 3ONUA 4LBWA 4BBAA 1OI7A 3DKVA 1KKLA 5EQDA 3LXMA 3HZOA 1P4AA 1FZTA 5CD9A 5CDYA 4PAGA 5LQDA 3DZDA 1CHDA 3FNBA 3X1YA 1O6CA 1Z13A 2XLBA 3F5DA 3LCVB 4DCNA 1UDXA 2VG8A 3OT1B 4G41A 2O06A 3HB7A 2E18A 2RKOA 2Y3IA 3L84A 3QOXA 3QQPA 4YT4A 1DEAA 5D6OA 5JSQA 1FFXA 4HD8A 1CV2A 2VYVA 1M72A 2Y68A 4MR9B 4UC0A 5IWCA 3NRCA 1AUOA 1LDNA 4UZFA 4X1IA 1K8ZB 4UCWA 2C98A 4UVEA 3TN7A 3MWEA 1TM5E 2ZB7A 2ZYHA 4NK5A 5DLDA 5C52B 1JXAA 4L22A 4ED9A 4D9EA 2GOYA 3ZCVA 1B8PA 4CT5A 1BWRA 3OE7A 2C42A 5YASA 4Z4EA 3G2IA 3AF3A 3GCXA 1R37A 4C21A 3B6MA 4F92B 5KVCA 2BHTA 3WBKA 3M4YA 2AMVA 1Z4PX 5HKKA 3A11A 3TBHA 3OO1A 4A2PA 3HB0A 4C5BA 4FS8A 4AYTA 1LLFA 3H9EO 4V2IA 5F35A 2O48X 2GTHA 1VQ7B 4KDEA 3WZLA 2CEKA 1DB3A 2X6TA 3JQ6A 3M1YA 4ZI7F 1KJWA 1F5NA 1J7KA 1NQAO 1WULS 2YINC 3CU5A 4FJ2A 4KX3A 1C4OA 1CVIA 2NU6B 1YE5A 3E2PA 3DXXA 3IAS1 3PPXA 4RE5A 4B44A 1WU7A 1ZNWA 3K6JA 4HRXA 5D8DA 4B6SA 1JEJA 1EWKA 4BWFB 3HSSA 4KWHA 4BKMA 1K8AD 2NLOA 2G0NA 3RODA 5T8KC 2OYRA 4G5FA 5FB3A 3RYFA 2QGZA 1C3OA 1DT3A 3KUDA 4P3PA 4YLYA 3HCAA 1QAOA 1N8NA 4KCGA 3RIYA 2VCEA 1NR5A 2XA9A 3WLEA 4A2CA 1WP9A 4XARA 4CF6A 2J3LA 2JHGA 1A8HA 1ZK3A 2RG1A 2WUDA 4ZVRA 5KNCH 1RE1A 3RQSA 3DQZA 2AMYA 4JUIA 1W9MA 5C1BA 1WUJS 2A8YA 4AI6A 5LYJF 5M04A 3PUZA 2A84A 3QSGA 3UJ9A 2FEMA 2XUPA 3KKOA 1SR8A 2WJHA 1GTL1 2X9LA 2XA2A 2BGTA 4MQFB 1EFVA 4NPCA 4QUKA 4R5MA 3E27A 4YIKA 4GZ3A 4M9ZA 2EOAA 1NQUA 5K0JA 2VDOB 3NKFA 1Q1BA 2JHPA 5ER9A 2ESRA 1PN3A 3FYUC 1H2HA 3OTIA 5CAEA 4DS3A 1LUAA 1T4GA 3EDRA 1DQYA 1N75A 2GZ1A 3I6IA 4WY2A 4BX3A 1UBHS 3OEYA 3ZWYA 4E1BA 3ASUA 3KR9A 2GFIA 1GYRA 4YUYA 5FL7D 4HPWA 4ENSA 1I3MA 1CZUA 1Z4OA 2AG1A 2X58A 4U8GA 5D3ZA 1LDGA 1T3TA 2AH5A 1Z4NA 2A1UA 2B1QA 2F59A 2YW9A 3HFSA 4H3HB 2VJQA 3EZLA 5CEFA 3DWGA 3F96A 3CP2A 4N6GA 1H4SA 3ZGVA 3L07A 2X8LA 4AULA 2VA9A 4B40A 5GAJA 3H6GA 1AD2A 4Z9AA 3WO1A 1U99A 4RD2A 4ZV4A 2OSBA 4J6FA 1P3Y1 1NJ8A 4ILKA 4QNNA 1Z6GA 1PKVA 2NSLA 2VNAA 2EDCA 3JQDA 3CPXA 3HWX1 4KMSA 3WL6A 1YZFA 2XOEA 4I50F 1LJUA 1P91A 1T35A 2PXHA 4FUQA 4KAFA 1TXGA 3U4MA 4E21A 3EGXA 3L7CA 4JI7B 5EFOA 4E07A 3CFYA 5A4DA 3LHKA 1FE8A 2EL7A 3FVWA 1SELA 5E38A 1DMSA 3T1OA 2IYFA 2BMAA 5IFLA 5JRDS 2J9XB 4KR3A 1F1BA 3W8DA 3CBQA 1NTRA 3L9XA 1T1RA 4OHBA 2YCLA 4PZ0A 4BFCA 1QF6A 3WXMA 1JEYB 1AKWA 2VWPA 3NI2A 3QUBA 2WIKA 1U02A 4AUNA 1Y63A 3PF8A 4CIDA 3V4RA 2UAGA 3B1KA 5ABPA 1J8MF 4D3FA 2F2TA 5ERXA 1GP2A 3MTGA 5FLXA 1JG3A 3A3GA 1H4VB 5M5BA 3E5MA 3TJRA 3DDSA 1CRWG 2P8SA 2GD6A 1KU6A 1MDFA 3CCJB 1T1JA 2OHVA 2YJNA 3DZKA 3A8KA 4LNUA 4PO9A 2ODEA 4A27A 1IZ8A 1OWNA 3BWYA 4GX5A 2VJLA 2YUIA 4J1TA 5FEUA 2C54A 3JQGB 5T4HA 5IKEA 3C4VA 1YGYA 3OMLA 4CL0A 4AP9A 4EJSC 3H11A 3WZ2A 4GXQA 1CXZA 1T9CA 5ITZA 1FRVA 1GTMA 3TTYA 4ZK2A 3WHIA 5H81A 3LOUA 1RPNA 3RSQA 2P2LA 3K5WA 3UNXA 4BWGA 5JOQA 1UK6A 1SXIA 3OLQA 1A9QA 1NJ1A 4WASA 4B43A 4BGDA 4MLCA 5K3AA 1XWWA 2E87A 1ISPA 2OR3A 4OGGA 4TM8A 3RG8A 4FNOA 1C7IA 2JVIA 1MABA 3KAPA 1XZCA 5GY7A 4ARBA 4ZVSA 2YFYA 3DXFA 5EIEA 1ECCA 1OPXA 5GZ3A 4QVGA 5BUCA 1WS6A 1JAIA 2PK3A 3IMKA 1E64A 1VIYA 5GJBA 2FG7C 3UEOA 2BR3A 1OXVA 3DDHA 1ZM3A 3EW7A 4TUYF 4KOEC 2H17A 3IVCA 1ODLA 4F4FA 2OGUA 3F9CA 2EJBA 3VAZA 2BKLA 5BQFA 2ZXUA 3B70A 5M2QA 4K86A 4JNKA 4UHHA 4A0QA 2M5SA 2R6HA 1IK6A 3IQHX 4BO4A 3MNFA 3DWIA 1II8A 2I55A 5ENZA 4D3YA 3S8YA 1PFYA 4E5NA 2XPCA 4FMCF 4TYQA 1T8PA 4MW7A 3T38A 2Q3EA 1E8MA 1D6NA 1MQ9A 5MF6A 4I1VA 2WWTA 3RUAA 1Q0TA 1I4TD 1ZJWA 3VH4A 1D4AA 1ONSA 3H17A 4ZRNA 3O5AA 3MUEA 4L3WA 2GCIA 4COKA 1H42A 1B6RA 1XEAA 4PFQA 3DTVB 5AI4A 5BSUA 2H2DA 2ZQYA 4S24A 1DDIA 1M2JA 2GAAA 1TUGA 1I7SB 5DRTA 1ZGJA 2GBCA 3D5QA 4BIMA 1JVBA 4K46A 3AVPA 3OPYB 1TKAA 5TXGA 3WIVA 3BOSA 3AGPA 5B4TA 1C30B 5HHTA 1KVUA 3ENKA 3EIQA 1L8QA 1C2TA 4PEVA 4XJSA 1QPBA 3DO5A 4QICA 2O8DA 2Z30A 2E21A 3UJAA 4TZKA 3F5FA 3IKJA 5ICMA 2OCKA 2V6BA 1E9SA 1XCGB 1HQKA 1YRHA 5KYUA 8ADHA 4QNRA 4PPNA 5TF4A 4NMMA 3GFGA 5CXUA 4H15A 2LRHA 3NHAA 3QZUA 5A02A 2JFFA 4CLOB 1Z47A 1A1SA 1UBOS 1DTSA 2FETA 1M5UA 4W1QA 1A5BB 1B8OA 1NRJB 2ASEA 3GFOA 1NKVA 1UKCA 2ZIAA 3NTUA 4TWRA 3VBEA 5I7OA 3G05A 1KERA 1M1YE 2GTIA 3LNCA 4P4SB 2FK8A 4WA7A 1UL1X 4MGHA 5LD2C 2VSNA 2R6ZA 4WMLA 1Y6GA 1XR3A 2QYTA 4NS1A 4O08A 1ESDA 3ZXSA 3DE4X 1JU3A 3N3AC 4HB0A 2ZI3A 1T6XA 2BFDB 2XAUA 3EXAA 4UDYX 3SCZA 1DIAA 4EAAA 4ZVNA 4PG8A 3HU2A 3X2EA 2FEXA 3VJKA 1OA1A 1W4AA 4ZTBA 2FEOA 3PC8C 3QU9A 3TL3A 1JKFA 4PM4A 7MDHA 2XSZD 3RANA 5FWDA 2ZRQA 3ZUPA 5J58A 1PNRA 4FX5A 3GJ4A 3HO1A 3M5WA 2I6TA 1T15A 1QCDA 1VIAA 3IE2A 4BQPA 2GK6A 1IY0A 3B9BA 4HS9A 3QVGB 3IOBA 2B5VA 2J3DA 2XUIA 4YGYA 4IF6A 4YAJA 1U63A 2YL2A 4ZVUA 1SQ5A 1XTIA 1YR3A 3NC0C 4FX2A 4KQ6A 3ZZNA 621PA 4LHEA 4C6TB 2HCBA 2QRQA 2REBA 1KVQA 4RTPA 3NIBA 3FDFA 3K2EA 1GAEO 1ISMA 1R4NA 2R66A 2P4HX 1H5NA 2R6FA 2Q29A 5CXQA 1C7EA 1WXQA 4QLBA 5LDDC 3T51B 2NU9B 3OPMA 1CNMA 2J07A 1JKXA 3K8OE 3K6RA 2ZRNA 4L08A 3C5WP 4B3TB 4FJ0A 4F38A 4BGVA 4EDFA 2ZUDA 3F6BX 5IUKC 2AFRA 3GGSA 1G64A 1FFWA 2Q5JA 3D6NB 2OBNA 4QLAA 5DCYA 1WBDA 1H8HD 4BB6A 4MHOA 1K63A 1UWLA 2BZ1A 2P5YA 3PXEA 4CFZA 2NVUB 1QZTA 3GNLA 3PHJA 2B9EA 4C06A 1W36D 3PXXA 4NBUA 1QV7A 1LKZA 2O57A 4KB5A 4TV9A 4N0EA 3T3IA 4LOKA 4LJ7A 3VZDA 3FR7A 4RA9A 3PENA 4CIAA 1I7QB 2C2KA 2Y05A 3N75A 2D0PB 4K0RA 4Y6SA 4EYKA 4ZZ1A 4QX6A 3GQBB 3EGVA 4X0EA 3IUQA 1VMEA 4OP7A 3ICWA 4FZJA 2D54A 3QSYA 2OFXA 4B4OA 2W6NA 4HNRA 3OH8A 1KJZA 4OMUA 5C5EA 3KVYA 3KQNA 3ONYA 1AKRA 1ULBA 2J4DA 4FHDA 5CPBA 2WTEA 1PTKA 2KYRA 2VF5X 1W6UA 1QIKA 2RHLA 2CDNA 3LL4A 4JEMA 3SYNA 3Q3GE 4M1OA 1A69A 3QQ5A 4WLFA 2ZIWB 4KR6A 1QF9A 2OVBA 4F3RA 1WDTA 1UUFA 3FHTA 3DDYA 1C50A 1WCV1 4N7JA 4LOLA 3TEMA 5EZ5A 2AZDA 3G2QA 4CCYB 1N6HA 1RYNA 3K15A 5GIPE 1NONA 2XF8A 2ZSHA 5CLIA 3CYFA 1M2KA 4QKQA 3JATA 3RS2A 2ZR0A 3N0WA 1H6AA 3LPDA 1L5LA 3V00A 5D85A 2XUFA 2ZTMA 3TKLA 4FOLA 2ORVA 2TSYB 3QEJA 4NQZA 4ZVPA 2BOVA 1ZXBA 1QGDA 1FVXA 4W5WA 1O54A 1JHQA 1OXMA 3AP1A 1OH8A 5IP5A 2VJOA 1MAWA 3MS4A 4I9NA 3EMBA 4TGLA 3CZQA 4AIRA 1KEZA 3CRW1 3OLWA 1CRQA 1J1IA 1YKGA 1YHNA 3IP7A 1NXTA 1R16A 2HEIA 3FRIA 3BFVA 5KHAA 5TPZA 1PJBA 1RSZA 1XZHA 1I80A 2FP3A 2G72A 2JAWA 1A2QA 4EHNA 3FLMA 5BNIA 2XCIA 3EVBA 2OHFA 1K8XB 2QGFA 5DP1A 4TXLA 2W6ID 2WKSA 2PUTA 3W2HA 4A26A 5JXHA 1A82A 1MJGM 2BDUA 2LVBA 2HPHA 1SHZA 1ZW6A 4YV7A 1F6BA 1X87A 4B3DA 3U1VA 1EX6A 2XTZA 4WBXC 1V95A 2HK6A 3KR1A 2KQUA 1RI5A 3P32A 4PIVA 3WIDA 3CGGA 1CP3A 4ZVTA 4H2DA 1AJEA 1ITZA 5G3YA 4A36A 3USES 3FRHA 3W77A 4DBLE 3NP9A 3M81A 121PA 2V4DA 3WLIA 3LQKA 3I5MA 2FEKA 1VLMA 4QRHA 3IFSA 2IYOA 3O0DA 4GBJA 4MVJF 3WY9A 4ZCSA 4XWAA 1YHZA 1S8OA 4P32A 3HL4A 2VBUA 3HP4A 4GSYA 5TY0A 4NMLA 1EBBA 5A5GA 4YECA 3LM8A 1RLOA 4INAA 4DCPA 1QYCA 4Q6WA 1FJXA 1R5NA 4S1VA 3OT1A 4Q9NA 2H11A 4XUDA 5EE0A 3SKXA 2XUQA 5IKXA 3AH8A 3A9WA 3GU3A 4I9UA 1V5VA 4NWIA 1YD7A 2WV7A 4RD4A 4RHFA 2PX3A 4HWTA 1SHUX 2JIRA 3K31A 1KSJA 2AHRA 2PGNA 4MR9A 3EF3A 3PR2B 3FSJX 3ZQ6A 1ZCAA 3VVBA 3K0AB 3CUWA 2ZT8A 3R09A 4I19A 1TZ2A 3EZ7A 2Q3JA 1KYVA 1FFGA 2Q1UA 3GLSA 2DH5A 2E7ZA 4Q66C 2V54A 4OHWA 3S2IA 3BXOA 3DC7A 5AI8A 1NUSA 4FEEA 2C9CA 3WYFA 2GERA 1PJRA 4ZEXA 1H85A 3GF4A 4LRSB 4WN9B 4NV0A 4P34A 3V46A 1CJKC 3A25A 1DDOA 1SHKA 3HI6A 5JCXA 4LQDA 2G82A 3ECCA 2VDLB 4PNPA 1GTSA 1WRBA 2H4HA 3FVQA 3MT7A 4B7ZA 1FDUA 1VL5A 4EH1A 1FSGA 4BVLA 3DLAA 4MVJM 1NZDA 3TRKA 3RC1A 2IRWA 1TZBA 4UMEA 4FE7A 4L78A 2NU6A 1KVSA 1N5MA 4BLWA 3N53A 5DK4A 1JR2A 1BDIA 2GSDA 2LPMA 2PA0A 2FPRA 3BCUA 1LI5A 2N1MA 4A5SA 2GD0A 3NHFA 1SCQA 2BRUA 4DLLA 2RDMA 3CHYA 2BKVA 4P92A 5KYKA 1A5AB 2AC7A 5EE9A 2FZ4A 2PBFA 3BWEA 4B6RA 3REGA 4G4JA 4J1SA 3UMBA 2OECA 4HDCA 2B7BA 3SR4A 2D13A 3REOA 3GFVA 4FE4A 4U7FA 2GZ3A 1C3VA 2HRBA 5FOXA 3TMYA 3VPXA 3AILA 2Y93A 1KK0A 2DWQA 5ALEA 4OA8A 1HL7A 4BP8A 2UYQA 1G6Q1 2PX6A 4TYPA 5AVJA 4B6JA 2BPOA 1WZCA 2CXOA 2IELA 3TG8A 3GA7A 2CV0A 2VF7A 2B69A 4OA5A 3AXSA 5DGXA 2GETA 2JLBA 1PJCA 3VX4A 3ZGLA 2IPXA 1BN7A 1X7YA 4O2LA 4HGQA 4NTZA 1V3QE 3A05A 1YLOA 4NJEB 3I9OA 4QUDA 2FSVA 2J87A 2PXCA 5FPTA 4BV8A 1KYWA 4XKWA 1Q0LA 2RJOA 3CW9A 3VZBA 4AIIA 5LQAA 4AXBA 5BVGB 3CCUB 1FTQA 2JASA 1HDRA 3CCCA 3G5MA 3MRTA 4X44A 4EFNA 5JRJA 5HW0A 3KDAA 4JC8A 4MUMA 3R1IA 3RU7A 4J0QA 1GAJA 3N76A 5K3FB 1RHQA 5BWLA 1WZ2A 1H8ED 3ESQA 4ZAYA 5C35A 4PO1A 2Z1DA 3PNSA 3AMVA 1U6IA 4RZXA 1HEUA 1GQRA 5BO5A 2G40A 1I2MA 1GQQA 1TIKA 2XE7A 3D3QA 3AP3A 1D0VA 1G0OA 2WSMA 3LLMA 3QNWA 4IGEA 5B4VA 4IL5A 5FOVA 3OEEA 4N5IX 4KQHA 4P9NA 2PZAA 4PHHA 5H9WA 2HWWA 3ZY4A 3R5KA 3U3MA 2HMWA 1RIIA 1S2DA 1JYEA 4OF4A 4B81A 1SKBA 3RTDA 4HQNA 4JI4B 4QXOA 2ZIZA 4AQ7A 4R0VA 4JYAB 3MLEA 5MFZA 3T3MB 1IULA 3WDLA 4RMIA 2CNLA 1GLNA 2DT8A 2HPZA 3A35A 2HT6A 3P4XA 5JWOA 1QVFB 3K70D 2J3EA 3I1JA 4F11A 2PU5A 4YXWA 4ZK6A 2V5UA 1RXIA 4KFSA 1AVTA 4LQ4A 3WYDA 1H9AA 2HIMA 1BZYA 4F4DA 1JEYA 3DEIA 4BLSA 1TM3E 3HDQA 2RCNA 3NEJA 3R0JA 1HETA 3NC1C 2AQHA 2IF2A 2YMPA 5E2BA 3RYCB 3OZEA 2A9VA 1VHOA 3QVOA 3F5QA 1ZCZA 4KQWA 3T35A 1ZQ1A 1MJ5A 1F2VA 3OG9A 3WWOA 4BV3A 2ECOA 1K92A 5D2CA 2V97A 4CKCA 2I9KA 3N2KA 3CLTD 2WF9A 2HU5A 4JR1A 1NY6A 3C6ZA 3EG9B 2J32A 3HFRA 2R4QA 4BV2A 4LZNA 4QC2A 3ER9A 4QRIA 1OOEA 2BM9A 2Q7XA 2JFPA 3NHJA 4ZOLB 4RF5A 4IJVA 1WX1A 2OKGA 3JQGA 2HBZA 4EPXA 5J59A 4IIJB 3EH1A 1SQGA 1E4VA 2WHXA 3E2MA 3EGWA 1IPHA 1GTJ1 4IJMA 4LVUA 2MYUA 3FHOA 4H1WA 5K45A 4JMLA 4MKHA 2RGCA 5BW5A 3DDUA 1EQ2A 1QVVA 2GJSA 1GA6A 1YQ9A 2D5CA 4MRPA 4FOTA 3BPSA 2QUZA 3FA2A 1E3QA 3WLLA 3C3WA 4JI1B 5A03A 2PS3A 5HJ5A 5FUVA 3Q2IA 2I03A 1QP0A 3C5HA 4RTKA 2GPJA 3V4VB 3D3EA 1JDSA 1F20A 3L3BA 1B15A 1JEOA 3H5AA 3V1NA 1NBHA 4GWLA 1TI7A 5GIOE 1JS1X 1KI4A 1YDWA 1DG1G 3ZQKA 3N05A 4LYGA 3CSDA 1C1DB 1US8B 2IPLA 1J0AA 2IEIA 4R3WA 3BERA 2CLLB 1CIVA 3HZHA 2AS0A 1EAYA 3G2MA 2E4UA 4GBGA 3EZYA 4LVNA 4QOGA 3UHPA 5JEEA 3ELWA 3T3NA 4E5UA 2ZUUA 4HRVA 5FTMA 3UYLA 1W4BA 4GPD1 3AY0A 5J9FA 4YVFA 3T7RA 2ZR9A 2WFZA 2O1EA 4Y2PA 2C82A 2OMEA 3VO8A 4LJLA 3KK0A 2A5JA 1RWMA 2ALJA 4V24A 3KJZA 4C2TA 1E4OA 1QVZA 2V7PA 4PU0A 3AF5A 1A9OA 1SAYA 3FWPA 4P83A 2ZL5A 1ELOA 5EIWA 4J6EA 1A7AA 1CZNA 2I8LA 2P67A 3BN3A 3UTCA 4CKXA 1I32A 1ADFA 1XTVA 1WPGA 2WJZB 3ZNQA 2GZ2A 4KZKA 1ORIA 3A1CA 3LSTA 1ULZA 1NKSA 5KREA 1GGEA 1WHTA 4DT1B 2ZBRA 3TVTA 1N0HA 1ABBA 4JLBA 1QK3A 3WOHA 1JXOA 1NMEA 1RZRD 3EVAA 1M2GA 5TS2A 4S1NA 4FHZA 3EPPA 1IN5A 4A8HA 1WUIS 2MWMA 4OM8A 3W1VA 1T9GS 3SLNA 3RASA 1Z5NA 4EUEA 1PT9A 1SVNA 2PRYA 5EE3A 1NYRA 2NP6A 1GFIA 2D1RA 2J9FB 1TMYA 3AUXA 3Q88A 4CEHB 3M9LA 1QVWA 1VG9B 2RGEA 3D54D 1WHSA 4CLOA 5BMVB 2IYSA 2AR0A 3AX6A 2OTJB 2CXUA 2BTEA 4QPJC 3MJEA 3ZZ1A 4NYJR 3HZRA 4BY9E 4XJVA 4P4SA 1OU0A 3F6YA 2WTNA 3W06A 3MQ2A 1YVRA 1DJLA 2Q41A 4X07A 1IIBA 4I8DA 4YELA 2SCUA 4LNHA 1PJ2A 4F4HA 4MO2A 1SURA 2V31A 4OHFA 4Q3NA 2JATA 4WOKA 4BNJA 4PINA 4UPEA 1MHTA 2HK7A 1GPWB 9ATCA 2CNOA 1O87A 3EUWA 4KJXA 2CBXA 1S72B 1UOPA 4B6EA 2Q7OE 3FTDA 3OJEA 3HA3A 3BM5A 4KMOA 2C5SA 3FNQA 3RCBA 4UUOA 1KMHA 1EJ2A 1CDEA 1QAQA 2PMBA 3DGEC 3O26A 5BN3A 5IK2A 4A7PA 2PQ2A 3D8TA 1CUGA 2Y0CA 1TUBB 3IVXA 2FN9A 4UVIA 4I14A 5F1KA 4XVQA 2ZYSA 5FI1B 4JLVA 2I4NA 2D7JA 4FCCA 3I0MA 5K5EA 3QVGA 2OO5A 4O4HA 2P9ZA 1HE5A 4NARA 4TTJA 5KAMA 5A3RA 2AVNA 5EAIA 4C6TA 3ANNA 1WKVA 3GJ5A 2FEPA 1OXSC 5B36A 2R6DA 2UUPA 1DJNA 4NQRA 4DANA 4HDSB 2NAFA 5IAGA 5FJJA 4C87A 4HZUA 9GPBA 2RGNA 1TW2A 3QNUA 4B3GA 3CW8X 3ICVA 4RY2A 4GI7A 4B32A 2NU9A 3GQVA 4G65A 4RM0A 4QODA 5CNJA 4OQXA 5I9LA 2DQZA 3TCXB 1NT2A 1EDZA 1UQTA 1FUYB 4J8PA 2KVOA 2AJ8A 3LY7A 3W5IA 3VVMA 2HWUA 2V59A 1SD1A 3GXOA 3SC3A 4DEVA 4MTLA 5DXFA 3FPGA 4GMHA 2NVUA 3EWAA 3M6FA 3O4HA 4PAOA 4OQ4A 4TXNA 5BYBA 2AYXA 1CTQA 3IB3A 5EMNA 5EP2A 1RQ2A 1MPXA 3PF9A 2GJPA 2PBZA 1LW7A 4YCAA 3TBFA 1WSAA 4JBHA 3RNOA 3DMNA 4PICA 3DOEA 1N8TA 3C70A 4J0FA 4XFDA 1FTWA 2A5GA 1QX3A 2XKJE 1A96A 2G9ZA 3FX2A 3H8JA 5FWAA 2Z2IA 3GQBA 1QH8B 3VR2A 1E99A 3VU0A 1L4MA 5I4CA 5F4JA 1SXGA 3HJCA 4R81A 1BQ4A 4XYBA 2BN4A 1EM6A 4AECA 3BWVA 2CD7A 3MMSA 2Y1EA 1Y7LA 3WGJA 4DCUA 2HJHA 3IOMA 2BV3A 4MWDA 3C6BA 1I3NA 3PJRA 1TECE 4J94A 2V4ZA 5IUNC 4BPRA 1FDIA 1VL2A 3HEBA 4N5NA 4U2BA 2QAIA 2NSDA 3RC2A 3TSOA 5KQSA 3OEHD 3WIOA 3MD9A 1R1DA 4KIFA 2AN3A 3P2OA 3LWDA 1SQ0A 4PNZA 3SIRA 1P0FA 2ZSFA 4O5AA 4QTYA 2ZB2A 4B47A 3AQ4A 3FFTA 4HDQB 5FBZA 4CCYA 2XT6A 2C9MA 4HEJA 4R1QA 2GN1A 1O9BA 4EEXA 2NZJA 4I3GA 1VI6A 3FVVA 5FOQA 3T56B 5FXMA 4FD3A 2ATCA 1W0KD 1E8DA 3DFMA 4AKHA 5EJMA 4E5SA 1UFOA 3RVLA 4CV0A 1E7RA 1VLQA 2J41A 2GHIA 4V0OA 1NI3A 4BWYA 4DZZA 5ALGA 4UBNA 3MPUA 5B7GA 1GKIA 2VQDA 4HVTA 3SP1A 4GKBA 4AO8A 4BMPB 4EY4A 2DTDA 3BXHA 3OAAA 2B35A 2EERA 5DNWA 4QAQA 1RJGA 3BQJA 3UHFA 4LXXA 4XGQA 3UWOA 4L3VA 2VUSA 4ZGWA 1JJ2B 2CMDA 4URUR 1IY8A 1N2CE 3W2TA 1YB1A 2OHIA 3GMTA 4H3KB 1FBTA 3EDMA 3VFDA 2A9FA 1QPZA 1DUVG 1WB6A 1NUHA 2A9RA 1X8JA 1XRPA 4W63A 3VJLA 4K9SA 5FUYA 2DAPA 3UAYA 3RJTA 2X4GA 5DX1A 2BMWA 1WXFA 4NBSA 4MKXA 4PWZA 5L3SB 3BYZA 4RL6A 4E70A 1SCDA 2W2LD 1K06A 2ZJ1A 3T95A 2IGTA 3HDTA 5LUBA 3PX2A 1EDOA 3HYLA 1V8ZA 2RGXA 3L49A 4JX8A 3VOSA 4G0QA 1TU4A 1EFHA 1UJCA 3HBJA 5CT4A 4BMSA 2XNDD 2ZR8A 3GDFA 5FBKA 4JXZA 1JN0A 1Y48E 5TX7A 4P4TA 4BYGA 4DCGA 2QGNA 2NUBA 2X7JA 5LN1A 1E6KA 2C4UA 1S0UA 1IN7A 1M0WA 2QN7A 1BKSB 2PQMA 3IBGA 3K05A 1FNDA 3PK0A 5SZJA 1SQ6A 2AD1A 4RMJA 4D43A 3K1ZA 1UXIA 3PG5A 3ENZA 5KVAA 3NTVA 4HLUC 5EIBD 4NYJQ 3JQAB 3TZQA 1CR6A 1H69A 1DRJA 4F91B 3LLSA 1Q2UA 1YZHA 4IH1A 4DDWA 3ZJTA 1EFTA 1CHNA 2IITA 3RRNA 4BQSA 3JYQA 4Q12A 1QFZA 3I42A 1OCEA 3EWSA 1RAHA 3CVUA 4KBFA 4MYDA 3GSIA 4LJSA 5DGCA 3N5CA 4FFWA 2PA3A 3K0AA 2A0YA 1VQ1A 2GD1O 2RJNA 5HILA 2QMEA 4TTRA 3N8KA 3U17A 2EP7A 4K9PA 4LSGA 2B92A 2RHCA 3R9XB 1YA4A</