5KW9A

Structural basis for norovirus neutralization by a hbga blocking human iga antibody
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
290
structure length
289
Chain Sequence
RPFTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSSITEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNASSGPQQLPINGVFVFVSWVSRFYQLKPVGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antiviral protein
molecule keywords Capsid protein VP1
publication title Structural basis for norovirus neutralization by an HBGA blocking human IgA antibody.
pubmed doi rcsb
source organism Norwalk virus
total genus 64
structure length 289
sequence length 290
ec nomenclature
pdb deposition date 2016-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5kw9A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5kw9A01
3ASPA 4P25A 5IYPA 4Z4SA 4X7DA 5F4OA 5J3OA 5HZBA 4X7EA 3BY1A 4RPBA 3PA1A 3Q38A 4WZEA 4QVJA 4P2NA 5F4MA 3ONYA 5BSYA 5BSXA 4RM0A 3ASTA 2OBRA 3PUMA 2OBSA 4RLZA 3RY8A 3SEJA 5J35A 3Q6QA 3Q39A 4Z4UA 4RDJA 4X0CA 5HZAA 5IYNA 3LQEA 4Z4VA 4P1VA 3ASRA 2ZL7A 4RPDA 4OOVA 4OPSA 3R6KA 3R6JA 2ZL5A 3PA2A 3D26A 4P26A 3V7AA 3ASQA 5IYQA 3ASSA 4OP7A 5IYWA 3BY2A 3Q6RA 4RDKA 4QV2A 4Z4YA 3ONUA 4X7CA 4WZTA 4RDLA 3BQJA 4WZLA 5KW9A 4X06A 4QUZA 4Z4ZA 4OPVA 3PUNA 4X7FA 3SKBA 4QVAA 4P3IA 2OBTA 4OOXA 4OOSA 5IYRA 4OPOA 4Z4RA 4Z4TA 3SLDA 4P12A 3LQ6A 4Z4WA 2ZL6A 1IHMA 3Q3AA 3PVDA 3SJPA 5F4JA 4X05A 4WZKA 3SLNA 4X07A 5E6TA 4ROXA
chains in the Genus database with same CATH superfamily
2W6IA 1VQ7B 2BVNA 3A35A 4X7DA 1BX0A 4NNJA 3A1PA 1H8HA 1XFOA 3T53B 2WZNA 1YIJB 2OTJB 2VNJA 1EP2B 4GQNA 4ASUA 3CPXA 2XNCA 4DNTB 2GREA 5BSYA 1B2RA 3BNWA 3FPPA 3FKSA 1WDTA 3ASTA 2HMAA 2OBRA 3PUMA 2OBSA 2ZTNA 3RY8A 4Y9RA 1QH0A 3QSYA 3AVWA 1VHOA 3Q39A 4Z4UA 1D2EA 2B5OA 3H9NA 2OK8A 1WP6A 4NBSA 1COWA 3GIRA 3FPKA 4RD4A 3CCEB 1OB2A 4E0FA 4DQLA 1E3XA 3LNNA 3OEEA 3PENA 4X0CA 4DK1A 4PC7A 4Z1MA 1WSRA 4XN3A 4F7DA 2Q6IA 5IYNA 1Q7YD 1HA3A 1K28D 2BMWA 3VNUA 1QVGB 2V31A 2F43A 2D3LA 2BM0A 5EMNA 4HE5A 1ZM2A 2GJPA 1Y0YA 1UD6A 2ZITA 1NB9A 1I18A 2JN9A 1S4MA 4OOVA 1W0JA 5H5JA 1NDHA 1XB2A 2PE3A 4B47A 3R6KA 3WQZA 2ZL5A 5FA6A 2JIZA 3D26A 4LBVA 4YAWA 1QX4A 3V7AA 1UD5A 1V0FA 1XQBA 3OJWA 1H85A 5JBQA 5IYWA 3CC4B 2VBVA 1H42A 3I55B 2XNJA 2BGJA 1GO2A 3AVYA 4UAJA 3WBJA 1N08A 4XKVA 4YAFA 3CXCB 3JU4A 2VNKA 1BLIA 5CDFA 1T6YA 3OP1A 1QG0A 3BQJA 4P9SA 2W6JA 4WZLA 4C0SA 4N3GA 1K8AD 2Q6OA 5KW9A 3CCSB 2V7XA 1E1QA 1SKYB 4Z4ZA 4OPVA 4ZGQB 3PUNA 1NB0A 1E43A 2ZTGA 2EIXA 1BMFA 4KKUA 1VLOA 1VJSA 1KRHA 2QTLA 4M0LA 2OBTA 4QHYA 2F1MA 4ZV4A 1VQ4B 4XM3A 2M5SA 2BF4A 2ZZFA 4KKSA 1D8TA 4UZUA 1PKVA 3OW2B 1OB5A 4Z4TA 4RD6A 1QFZA 3KEWA 2I1LA 1KJZA 2DERA 2OTLB 1N0VC 3HAGA 2Z6BD 4Z4WA 1YLOA 2J7KA 1FRQA 4RCYA 4TMXA 2XEXA 2GK7A 5F4JA 2V4DA 1W35A 2C2WA 2C5BA 4YAOA 3I56B 2RC6A 4M1KA 3AVUA 1OGJA 4XLFA 3SLNA 3VNVA 1CNFA 2QEXB 4X07A 2F4NA 1G7CA 5GV8A 1WSVA 5TV2A 1VQLB 1JNYA 2ZBVA 4AVZA 4EH1A 5DS0A 2VNHA 1PJ7A 1E62A 4YALA 1GR1A 4II3A 4TMVA 1CQXA 1MABA 5F4OA 1J9ZA 1GAWA 2CNDA 4JMQA 3SJZA 3WNBA 4PC3A 3W2FA 5J3OA 1YJ9B 5AN9A 3LVBA 5A88A 3BCDA 5HZBA 2C78A 4X7EA 3W5UA 2DIEA 4U9UA 2KVOA 1WPCA 4XNFA 1ZM3A 1M1KD 3ZBUA 1TUIA 1YITB 4QVJA 3CRZA 3CC7B 1WTHD 5BSXA 1YJWB 4P22A 1QUFA 1V5VA 4RLZA 4YELA 3SEJA 3B8HA 3ZZUA 3CPWB 1AMOA 4MYUA 1FNDA 2V7QA 1ZUNB 1QUEA 2YWHA 2V7WA 1N0UA 1QGZA 5HXBA 3W2IA 2HDNB 4TSFA 1E64A 2QN6A 1K9MD 3CP8A 3CTAA 4G5GA 4ZCMA 2JJ2A 3OEHA 4Z4VA 1M90D 4XN0A 3JQPA 4XOTA 1MRZA 2XZOA 1QGAA 1D1NA 5IK2A 4B48A 4DNRB 1Q86D 1EWYA 4B4DA 3W2HA 2B7BA 1WU8A 2ZL7A 4PC6A 2BGIA 3FJOA 3R6JA 1F60A 3B78A 1G7TA 2X6YA 5IYQA 4M2LA 4OP7A 4TMTA 3CCRB 3CCVB 3BY2A 3Q6RA 3H94A 4RDKA 5THXA 1YHQB 4QV2A 4H9GA 2C4UA 1OB0A 3GVKA 1TLLA 2X6WA 3OKXA 4M53A 1Y0RA 2CF4A 3OE7A 3AVTA 1B23P 3LO8A 3KL9A 1IJEA 2NPFA 3CCMB 1WOPA 3P26A 1SKQA 2BPOA 1VQKB 2DY1A 1QVFB 4IW3B 1UD2A 1UD8A 4J0QA 5FIUA 4TT3A 2PMDA 4KKTA 2V7UA 1E79A 3OZUA 4XORA 1EFCA 3G05A 4LC0A 5FNZA 1T5EA 4P3IA 3ZZTA 4ZCIA 2XZPA 1R5OA 2QMUA 4WQMA 2ZZEA 2FVGA 1BX1A 4YAUA 2GK6A 4G1VA 4OOXA 1N06A 5L46A 1NBMA 4OPOA 1H8EA 1UMKA 2D9RA 2VBSA 1OHHA 2XGJA 1K73D 3QFRA 2QA4B 4LBYA 1W34A 4G6IA 2GJRA 4DQKA 2ZL6A 1IHMA 5HKKA 3SJPA 1Q82D 2DCUA 2ZXIA 4II2A 4TN1A 2C5HA 3BC9A 2VZLA 2YWGA 1XE1A 4RD0A 2FX3A 4L8JA 1G7RA 5E6TA 1AIPA 4ROXA 4RD3A 3ASPA 3WNDA 1BQEA 2V7VA 4NCNA 2CC2A 1QFYA 4Z4SA 5IYPA 2X85A 1HZEA 4FWTA 4PAAA 1T6ZA 4B3XA 1RQRA 4RCZA 3QFTA 1EXMA 2DOGA 3J81k 4RPBA 3PA1A 1VQPB 2Q6KA 4WZEA 4P2NA 4RM0A 1EFUA 1S72B 2ZBUA 5TRDA 4G7WA 3ZUGA 1BPLA 3CESA 2XNDA 2WZPP 4P6YA 1DDIA 2LZJA 4RD1A 2QGGA 2PLFA 4AF6A 2R9VA 1N07A 1FNMA 1KK2A 2JJ1A 3WBKA 3A8JA 1KK0A 4RDJA 4LBZA 5B6IA 5TR9A 2D74A 1N05A 3CMEB 2D3NA 1JB9A 2XOKA 3LQEA 1WOOA 3W5VA 4XLAA 1GJRA 2GPJA 4P1VA 2NV4A 3E1YE 4ZGNB 1KC8D 3OJXA 3ASRA 5A89A 2C77A 4FXUA 3MHPA 1JJ2B 2E1BA 2CRVA 1DG1G 2P3MA 4OPSA 4FN5A 1NJID 3PA2A 1ZM4A 1W0KA 3GVLA 2ZXHA 5KNLA 3MMPA 3ASSA 3WXMA 4XL9A 2OYNA 5LMZA 1ZM9A 1VQ8B 1E1RA 3A3GA 2PIAA 1N8RD 1VQ6B 3AVXA 4XQFA 2BM1A 3QFCA 5GV7A 3CCJB 3W5HA 4RDLA 1R5BA 1VQOB 3ISXA 5KSWB 2R6HA 4XLCA 2VJIA 4TMWA 3VO1A 3OOCA 1EFRA 4QUZA 1VLYA 1CNEA 4B43A 3CP2A 4Q7JB 2QDXA 3ES9A 4QFMA 3U6KA 4X7FA 2HLDA 1SM4A 4LBWA 3SKBA 4QVAA 3CMAB 2QE7A 4YHBA 3QE2A 1JA1A 1GAQA 1T6XA 4WWVA 4C43A 3CC2B 1KMHA 4OOSA 2GJKA 5IYRA 4CQJA 4Z4RA 1WORA 3W2GA 5A8AA 2RC5A 3OZVA 1KK3A 3SLDA 3CCQB 1KQSB 2VJJA 1A8PA 4RD2A 2OK7A 3GSIA 2X6XA 4G1BA 4TKOB 4Y7CA 2GQFA 2YWFA 3JQRA 2X0KA 2Q6LA 4B44A 3OZWA 3ZZ0A 1FNBA 3I1FA 3T56B 2QTZA 1HVXA 1RQPA 2VYQA 2BV3A 3W2EA 3B82A 3CD6B 4HE6A 1FRNA 3CCLB 3A3BA 2F1LA 1VQ5B 3T51B 3WYAA 4P25A 1VHEA 2WYRA 4UZFA 1VQNB 2YWEA 4X8IA 2DEUA 2JDIA 1U2RA 2V7TA 2BSAA 4AF7A 1VQMB 3BH4A 3DDYA 4Y9UA 3BY1A 4DK0A 3VR6A 2E1RA 3Q38A 1OGIA 1UD3A 1KTVA 1YJNB 2X53S 5F4MA 1EP1B 3ONYA 4XMYA 3ZIAA 3U6BA 2CBXA 1EP3B 3A8KA 1G7SA 5TY0A 4R71A 1Q81D 3NE5B 3CMMA 1E63A 5J35A 3Q6QA 4HIZA 3OAAA 1FDRA 1V0EA 3G6EB 1DARA 2WR8A 2WSSA 4B3FX 2WJVA 4XR6A 5HZAA 1PJ6A 3AVVA 1IB0A 3MCAA 1W87A 1BJKA 2ZZQA 2DETA 4ZCLA 4P3YA 4P6VF 4PC2A 4XOPA 3WY9A 3WNCA 3CCUB 5FO0A 4PC1A 3ZPNA 4XKWA 1VQ9B 1F20A 2ZZGA 1YX2A 2X8KA 1P4MA 4RPDA 2VNIA 1KK1A 3OFNA 1KZLA 1TTTA 1R5NA 4P26A 3ASQA 3VO2A 1Q9SA 1FX0A 2VBUA 4Z4YA 3AGQA 4PGOA 5FO1A 3G71B 3CB4A 5FL7A 3ONUA 3G4SB 4X7CA 2AHOA 2CW5A 1QGYA 4N3NA 4PABA 1PJ5A 2B7CA 4WZTA 1EFTA 2VBTA 3A8IA 1JA0A 4MYTA 4ACBA 2EFGA 1DDGA 1I8DA 1S0UA 3AGPA 4XONA 1ELOA 1WOSA 2CK3A 4M4SA 3JQQA 4X06A 4XLEA 5DN6A 4ACAA 4K1XA 1UD4A 3E20A 1I7PA 4XLHA 4YXWA 2XZLA 3ZC3A 1VF7A 3BCFA 4FK8A 1FNCA 3U2QA 5H59A 3ZBTA 2HCJB 2X3UA 3QFSA 4BPRA 4YEJA 3V76A 4XD7A 3VMFA 1GVHA 3OPOA 2BN4A 2DYIA 4RJLA 3GQBA 4B3GA 1TVCA 4AC9A 4G7XA 1W9XA 3P27A 2WPDA 4P12A 4UZEA 3LQ6A 1E3ZA 1IJFA 1YI2B 3Q3AA 3PVDA 2WJYA 3OW7A 4TMZA 4X05A 1W2BB 4WZKA 2C4TA 1KD1D 1NRKA 3CW2A 5DSZA 1QFJA 3GVJA
chains in the Genus database with same CATH topology
3ASPA 4P25A 5IYPA 4Z4SA 4X7DA 5F4OA 5J3OA 5HZBA 4X7EA 3BY1A 4RPBA 3PA1A 3Q38A 4WZEA 4QVJA 4P2NA 5F4MA 3ONYA 5BSYA 5BSXA 4RM0A 3ASTA 2OBRA 3PUMA 2OBSA 4RLZA 3RY8A 3SEJA 5J35A 3Q6QA 3Q39A 4Z4UA 4RDJA 4X0CA 5HZAA 5IYNA 3LQEA 4Z4VA 4P1VA 3ASRA 2ZL7A 4RPDA 4OOVA 4OPSA 3R6KA 3R6JA 2ZL5A 3PA2A 3D26A 4P26A 3V7AA 3ASQA 5IYQA 3ASSA 4OP7A 5IYWA 3BY2A 3Q6RA 4RDKA 4QV2A 4Z4YA 3ONUA 4X7CA 4WZTA 4RDLA 3BQJA 4WZLA 5KW9A 4X06A 4QUZA 4Z4ZA 4OPVA 3PUNA 4X7FA 3SKBA 4QVAA 4P3IA 2OBTA 4OOXA 4OOSA 5IYRA 4OPOA 4Z4RA 4Z4TA 3SLDA 4P12A 3LQ6A 4Z4WA 2ZL6A 1IHMA 3Q3AA 3PVDA 3SJPA 5F4JA 4X05A 4WZKA 3SLNA 4X07A 5E6TA 4ROXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASP A;  4P25 A;  5IYP A;  4Z4S A;  4X7D A;  5F4O A;  5J3O A;  5HZB A;  4X7E A;  3BY1 A;  4RPB A;  3PA1 A;  3Q38 A;  4WZE A;  4QVJ A;  4P2N A;  5F4M A;  3ONY A;  5BSY A;  5BSX A;  4RM0 A;  3AST A;  2OBR A;  3PUM A;  2OBS A;  4RLZ A;  3RY8 A;  3SEJ A;  5J35 A;  3Q6Q A;  3Q39 A;  4Z4U A;  4RDJ A;  4X0C A;  5HZA A;  5IYN A;  3LQE A;  4Z4V A;  4P1V A;  3ASR A;  2ZL7 A;  4RPD A;  4OOV A;  4OPS A;  3R6K A;  3R6J A;  2ZL5 A;  3PA2 A;  3D26 A;  4P26 A;  3V7A A;  3ASQ A;  5IYQ A;  3ASS A;  4OP7 A;  5IYW A;  3BY2 A;  3Q6R A;  4RDK A;  4QV2 A;  4Z4Y A;  3ONU A;  4X7C A;  4WZT A;  4RDL A;  3BQJ A;  4WZL A;  5KW9 A;  4X06 A;  4QUZ A;  4Z4Z A;  4OPV A;  3PUN A;  4X7F A;  3SKB A;  4QVA A;  4P3I A;  2OBT A;  4OOX A;  4OOS A;  5IYR A;  4OPO A;  4Z4R A;  4Z4T A;  3SLD A;  4P12 A;  3LQ6 A;  4Z4W A;  2ZL6 A;  1IHM A;  3Q3A A;  3PVD A;  3SJP A;  5F4J A;  4X05 A;  4WZK A;  3SLN A;  4X07 A;  5E6T A;  4ROX A; 
#chains in the Genus database with same CATH topology
 2W6I A;  1VQ7 B;  2BVN A;  3A35 A;  4X7D A;  1BX0 A;  4NNJ A;  3A1P A;  1H8H A;  1XFO A;  3T53 B;  2WZN A;  1YIJ B;  2OTJ B;  2VNJ A;  1EP2 B;  4GQN A;  4ASU A;  3CPX A;  2XNC A;  4DNT B;  2GRE A;  5BSY A;  1B2R A;  3BNW A;  3FPP A;  3FKS A;  1WDT A;  3AST A;  2HMA A;  2OBR A;  3PUM A;  2OBS A;  2ZTN A;  3RY8 A;  4Y9R A;  1QH0 A;  3QSY A;  3AVW A;  1VHO A;  3Q39 A;  4Z4U A;  1D2E A;  2B5O A;  3H9N A;  2OK8 A;  1WP6 A;  4NBS A;  1COW A;  3GIR A;  3FPK A;  4RD4 A;  3CCE B;  1OB2 A;  4E0F A;  4DQL A;  1E3X A;  3LNN A;  3OEE A;  3PEN A;  4X0C A;  4DK1 A;  4PC7 A;  4Z1M A;  1WSR A;  4XN3 A;  4F7D A;  2Q6I A;  5IYN A;  1Q7Y D;  1HA3 A;  1K28 D;  2BMW A;  3VNU A;  1QVG B;  2V31 A;  2F43 A;  2D3L A;  2BM0 A;  5EMN A;  4HE5 A;  1ZM2 A;  2GJP A;  1Y0Y A;  1UD6 A;  2ZIT A;  1NB9 A;  1I18 A;  2JN9 A;  1S4M A;  4OOV A;  1W0J A;  5H5J A;  1NDH A;  1XB2 A;  2PE3 A;  4B47 A;  3R6K A;  3WQZ A;  2ZL5 A;  5FA6 A;  2JIZ A;  3D26 A;  4LBV A;  4YAW A;  1QX4 A;  3V7A A;  1UD5 A;  1V0F A;  1XQB A;  3OJW A;  1H85 A;  5JBQ A;  5IYW A;  3CC4 B;  2VBV A;  1H42 A;  3I55 B;  2XNJ A;  2BGJ A;  1GO2 A;  3AVY A;  4UAJ A;  3WBJ A;  1N08 A;  4XKV A;  4YAF A;  3CXC B;  3JU4 A;  2VNK A;  1BLI A;  5CDF A;  1T6Y A;  3OP1 A;  1QG0 A;  3BQJ A;  4P9S A;  2W6J A;  4WZL A;  4C0S A;  4N3G A;  1K8A D;  2Q6O A;  5KW9 A;  3CCS B;  2V7X A;  1E1Q A;  1SKY B;  4Z4Z A;  4OPV A;  4ZGQ B;  3PUN A;  1NB0 A;  1E43 A;  2ZTG A;  2EIX A;  1BMF A;  4KKU A;  1VLO A;  1VJS A;  1KRH A;  2QTL A;  4M0L A;  2OBT A;  4QHY A;  2F1M A;  4ZV4 A;  1VQ4 B;  4XM3 A;  2M5S A;  2BF4 A;  2ZZF A;  4KKS A;  1D8T A;  4UZU A;  1PKV A;  3OW2 B;  1OB5 A;  4Z4T A;  4RD6 A;  1QFZ A;  3KEW A;  2I1L A;  1KJZ A;  2DER A;  2OTL B;  1N0V C;  3HAG A;  2Z6B D;  4Z4W A;  1YLO A;  2J7K A;  1FRQ A;  4RCY A;  4TMX A;  2XEX A;  2GK7 A;  5F4J A;  2V4D A;  1W35 A;  2C2W A;  2C5B A;  4YAO A;  3I56 B;  2RC6 A;  4M1K A;  3AVU A;  1OGJ A;  4XLF A;  3SLN A;  3VNV A;  1CNF A;  2QEX B;  4X07 A;  2F4N A;  1G7C A;  5GV8 A;  1WSV A;  5TV2 A;  1VQL B;  1JNY A;  2ZBV A;  4AVZ A;  4EH1 A;  5DS0 A;  2VNH A;  1PJ7 A;  1E62 A;  4YAL A;  1GR1 A;  4II3 A;  4TMV A;  1CQX A;  1MAB A;  5F4O A;  1J9Z A;  1GAW A;  2CND A;  4JMQ A;  3SJZ A;  3WNB A;  4PC3 A;  3W2F A;  5J3O A;  1YJ9 B;  5AN9 A;  3LVB A;  5A88 A;  3BCD A;  5HZB A;  2C78 A;  4X7E A;  3W5U A;  2DIE A;  4U9U A;  2KVO A;  1WPC A;  4XNF A;  1ZM3 A;  1M1K D;  3ZBU A;  1TUI A;  1YIT B;  4QVJ A;  3CRZ A;  3CC7 B;  1WTH D;  5BSX A;  1YJW B;  4P22 A;  1QUF A;  1V5V A;  4RLZ A;  4YEL A;  3SEJ A;  3B8H A;  3ZZU A;  3CPW B;  1AMO A;  4MYU A;  1FND A;  2V7Q A;  1ZUN B;  1QUE A;  2YWH A;  2V7W A;  1N0U A;  1QGZ A;  5HXB A;  3W2I A;  2HDN B;  4TSF A;  1E64 A;  2QN6 A;  1K9M D;  3CP8 A;  3CTA A;  4G5G A;  4ZCM A;  2JJ2 A;  3OEH A;  4Z4V A;  1M90 D;  4XN0 A;  3JQP A;  4XOT A;  1MRZ A;  2XZO A;  1QGA A;  1D1N A;  5IK2 A;  4B48 A;  4DNR B;  1Q86 D;  1EWY A;  4B4D A;  3W2H A;  2B7B A;  1WU8 A;  2ZL7 A;  4PC6 A;  2BGI A;  3FJO A;  3R6J A;  1F60 A;  3B78 A;  1G7T A;  2X6Y A;  5IYQ A;  4M2L A;  4OP7 A;  4TMT A;  3CCR B;  3CCV B;  3BY2 A;  3Q6R A;  3H94 A;  4RDK A;  5THX A;  1YHQ B;  4QV2 A;  4H9G A;  2C4U A;  1OB0 A;  3GVK A;  1TLL A;  2X6W A;  3OKX A;  4M53 A;  1Y0R A;  2CF4 A;  3OE7 A;  3AVT A;  1B23 P;  3LO8 A;  3KL9 A;  1IJE A;  2NPF A;  3CCM B;  1WOP A;  3P26 A;  1SKQ A;  2BPO A;  1VQK B;  2DY1 A;  1QVF B;  4IW3 B;  1UD2 A;  1UD8 A;  4J0Q A;  5FIU A;  4TT3 A;  2PMD A;  4KKT A;  2V7U A;  1E79 A;  3OZU A;  4XOR A;  1EFC A;  3G05 A;  4LC0 A;  5FNZ A;  1T5E A;  4P3I A;  3ZZT A;  4ZCI A;  2XZP A;  1R5O A;  2QMU A;  4WQM A;  2ZZE A;  2FVG A;  1BX1 A;  4YAU A;  2GK6 A;  4G1V A;  4OOX A;  1N06 A;  5L46 A;  1NBM A;  4OPO A;  1H8E A;  1UMK A;  2D9R A;  2VBS A;  1OHH A;  2XGJ A;  1K73 D;  3QFR A;  2QA4 B;  4LBY A;  1W34 A;  4G6I A;  2GJR A;  4DQK A;  2ZL6 A;  1IHM A;  5HKK A;  3SJP A;  1Q82 D;  2DCU A;  2ZXI A;  4II2 A;  4TN1 A;  2C5H A;  3BC9 A;  2VZL A;  2YWG A;  1XE1 A;  4RD0 A;  2FX3 A;  4L8J A;  1G7R A;  5E6T A;  1AIP A;  4ROX A;  4RD3 A;  3ASP A;  3WND A;  1BQE A;  2V7V A;  4NCN A;  2CC2 A;  1QFY A;  4Z4S A;  5IYP A;  2X85 A;  1HZE A;  4FWT A;  4PAA A;  1T6Z A;  4B3X A;  1RQR A;  4RCZ A;  3QFT A;  1EXM A;  2DOG A;  3J81 k;  4RPB A;  3PA1 A;  1VQP B;  2Q6K A;  4WZE A;  4P2N A;  4RM0 A;  1EFU A;  1S72 B;  2ZBU A;  5TRD A;  4G7W A;  3ZUG A;  1BPL A;  3CES A;  2XND A;  2WZP P;  4P6Y A;  1DDI A;  2LZJ A;  4RD1 A;  2QGG A;  2PLF A;  4AF6 A;  2R9V A;  1N07 A;  1FNM A;  1KK2 A;  2JJ1 A;  3WBK A;  3A8J A;  1KK0 A;  4RDJ A;  4LBZ A;  5B6I A;  5TR9 A;  2D74 A;  1N05 A;  3CME B;  2D3N A;  1JB9 A;  2XOK A;  3LQE A;  1WOO A;  3W5V A;  4XLA A;  1GJR A;  2GPJ A;  4P1V A;  2NV4 A;  3E1Y E;  4ZGN B;  1KC8 D;  3OJX A;  3ASR A;  5A89 A;  2C77 A;  4FXU A;  3MHP A;  1JJ2 B;  2E1B A;  2CRV A;  1DG1 G;  2P3M A;  4OPS A;  4FN5 A;  1NJI D;  3PA2 A;  1ZM4 A;  1W0K A;  3GVL A;  2ZXH A;  5KNL A;  3MMP A;  3ASS A;  3WXM A;  4XL9 A;  2OYN A;  5LMZ A;  1ZM9 A;  1VQ8 B;  1E1R A;  3A3G A;  2PIA A;  1N8R D;  1VQ6 B;  3AVX A;  4XQF A;  2BM1 A;  3QFC A;  5GV7 A;  3CCJ B;  3W5H A;  4RDL A;  1R5B A;  1VQO B;  3ISX A;  5KSW B;  2R6H A;  4XLC A;  2VJI A;  4TMW A;  3VO1 A;  3OOC A;  1EFR A;  4QUZ A;  1VLY A;  1CNE A;  4B43 A;  3CP2 A;  4Q7J B;  2QDX A;  3ES9 A;  4QFM A;  3U6K A;  4X7F A;  2HLD A;  1SM4 A;  4LBW A;  3SKB A;  4QVA A;  3CMA B;  2QE7 A;  4YHB A;  3QE2 A;  1JA1 A;  1GAQ A;  1T6X A;  4WWV A;  4C43 A;  3CC2 B;  1KMH A;  4OOS A;  2GJK A;  5IYR A;  4CQJ A;  4Z4R A;  1WOR A;  3W2G A;  5A8A A;  2RC5 A;  3OZV A;  1KK3 A;  3SLD A;  3CCQ B;  1KQS B;  2VJJ A;  1A8P A;  4RD2 A;  2OK7 A;  3GSI A;  2X6X A;  4G1B A;  4TKO B;  4Y7C A;  2GQF A;  2YWF A;  3JQR A;  2X0K A;  2Q6L A;  4B44 A;  3OZW A;  3ZZ0 A;  1FNB A;  3I1F A;  3T56 B;  2QTZ A;  1HVX A;  1RQP A;  2VYQ A;  2BV3 A;  3W2E A;  3B82 A;  3CD6 B;  4HE6 A;  1FRN A;  3CCL B;  3A3B A;  2F1L A;  1VQ5 B;  3T51 B;  3WYA A;  4P25 A;  1VHE A;  2WYR A;  4UZF A;  1VQN B;  2YWE A;  4X8I A;  2DEU A;  2JDI A;  1U2R A;  2V7T A;  2BSA A;  4AF7 A;  1VQM B;  3BH4 A;  3DDY A;  4Y9U A;  3BY1 A;  4DK0 A;  3VR6 A;  2E1R A;  3Q38 A;  1OGI A;  1UD3 A;  1KTV A;  1YJN B;  2X53 S;  5F4M A;  1EP1 B;  3ONY A;  4XMY A;  3ZIA A;  3U6B A;  2CBX A;  1EP3 B;  3A8K A;  1G7S A;  5TY0 A;  4R71 A;  1Q81 D;  3NE5 B;  3CMM A;  1E63 A;  5J35 A;  3Q6Q A;  4HIZ A;  3OAA A;  1FDR A;  1V0E A;  3G6E B;  1DAR A;  2WR8 A;  2WSS A;  4B3F X;  2WJV A;  4XR6 A;  5HZA A;  1PJ6 A;  3AVV A;  1IB0 A;  3MCA A;  1W87 A;  1BJK A;  2ZZQ A;  2DET A;  4ZCL A;  4P3Y A;  4P6V F;  4PC2 A;  4XOP A;  3WY9 A;  3WNC A;  3CCU B;  5FO0 A;  4PC1 A;  3ZPN A;  4XKW A;  1VQ9 B;  1F20 A;  2ZZG A;  1YX2 A;  2X8K A;  1P4M A;  4RPD A;  2VNI A;  1KK1 A;  3OFN A;  1KZL A;  1TTT A;  1R5N A;  4P26 A;  3ASQ A;  3VO2 A;  1Q9S A;  1FX0 A;  2VBU A;  4Z4Y A;  3AGQ A;  4PGO A;  5FO1 A;  3G71 B;  3CB4 A;  5FL7 A;  3ONU A;  3G4S B;  4X7C A;  2AHO A;  2CW5 A;  1QGY A;  4N3N A;  4PAB A;  1PJ5 A;  2B7C A;  4WZT A;  1EFT A;  2VBT A;  3A8I A;  1JA0 A;  4MYT A;  4ACB A;  2EFG A;  1DDG A;  1I8D A;  1S0U A;  3AGP A;  4XON A;  1ELO A;  1WOS A;  2CK3 A;  4M4S A;  3JQQ A;  4X06 A;  4XLE A;  5DN6 A;  4ACA A;  4K1X A;  1UD4 A;  3E20 A;  1I7P A;  4XLH A;  4YXW A;  2XZL A;  3ZC3 A;  1VF7 A;  3BCF A;  4FK8 A;  1FNC A;  3U2Q A;  5H59 A;  3ZBT A;  2HCJ B;  2X3U A;  3QFS A;  4BPR A;  4YEJ A;  3V76 A;  4XD7 A;  3VMF A;  1GVH A;  3OPO A;  2BN4 A;  2DYI A;  4RJL A;  3GQB A;  4B3G A;  1TVC A;  4AC9 A;  4G7X A;  1W9X A;  3P27 A;  2WPD A;  4P12 A;  4UZE A;  3LQ6 A;  1E3Z A;  1IJF A;  1YI2 B;  3Q3A A;  3PVD A;  2WJY A;  3OW7 A;  4TMZ A;  4X05 A;  1W2B B;  4WZK A;  2C4T A;  1KD1 D;  1NRK A;  3CW2 A;  5DSZ A;  1QFJ A;  3GVJ A; 
#chains in the Genus database with same CATH homology
 3ASP A;  4P25 A;  5IYP A;  4Z4S A;  4X7D A;  5F4O A;  5J3O A;  5HZB A;  4X7E A;  3BY1 A;  4RPB A;  3PA1 A;  3Q38 A;  4WZE A;  4QVJ A;  4P2N A;  5F4M A;  3ONY A;  5BSY A;  5BSX A;  4RM0 A;  3AST A;  2OBR A;  3PUM A;  2OBS A;  4RLZ A;  3RY8 A;  3SEJ A;  5J35 A;  3Q6Q A;  3Q39 A;  4Z4U A;  4RDJ A;  4X0C A;  5HZA A;  5IYN A;  3LQE A;  4Z4V A;  4P1V A;  3ASR A;  2ZL7 A;  4RPD A;  4OOV A;  4OPS A;  3R6K A;  3R6J A;  2ZL5 A;  3PA2 A;  3D26 A;  4P26 A;  3V7A A;  3ASQ A;  5IYQ A;  3ASS A;  4OP7 A;  5IYW A;  3BY2 A;  3Q6R A;  4RDK A;  4QV2 A;  4Z4Y A;  3ONU A;  4X7C A;  4WZT A;  4RDL A;  3BQJ A;  4WZL A;  5KW9 A;  4X06 A;  4QUZ A;  4Z4Z A;  4OPV A;  3PUN A;  4X7F A;  3SKB A;  4QVA A;  4P3I A;  2OBT A;  4OOX A;  4OOS A;  5IYR A;  4OPO A;  4Z4R A;  4Z4T A;  3SLD A;  4P12 A;  3LQ6 A;  4Z4W A;  2ZL6 A;  1IHM A;  3Q3A A;  3PVD A;  3SJP A;  5F4J A;  4X05 A;  4WZK A;  3SLN A;  4X07 A;  5E6T A;  4ROX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...