5KW9A

Structural basis for norovirus neutralization by a hbga blocking human iga antibody
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
290
structure length
289
Chain Sequence
RPFTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSSITEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNASSGPQQLPINGVFVFVSWVSRFYQLKPVGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Structural basis for norovirus neutralization by an HBGA blocking human IgA antibody.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Antiviral protein
total genus 64
structure length 289
sequence length 290
ec nomenclature
pdb deposition date 2016-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5kw9A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5kw9A01
5BSXA 3PUMA 4P12A 4X7CA 3LQEA 4OOVA 4Z4WA 4Z4TA 3Q6RA 5J3OA 4X7DA 3PUNA 3ONYA 4RLZA 3ASSA 4Z4UA 3ASTA 3ASRA 4X0CA 4X7FA 1IHMA 3LQ6A 2ZL5A 4RPBA 5IYQA 3PVDA 3R6JA 4X7EA 4Z4ZA 4QV2A 5IYNA 4OOXA 4Z4YA 3RY8A 5F4OA 4Z4SA 5IYRA 3SLDA 4P26A 4P2NA 4RDKA 5HZAA 3Q38A 5HZBA 5IYPA 4OPSA 4OPVA 2ZL6A 4P1VA 3SEJA 4WZKA 5J35A 4OOSA 3ONUA 4QVAA 4QUZA 4X05A 4ROXA 4WZLA 3Q3AA 3BQJA 5F4JA 4WZTA 2OBTA 3ASPA 5BSYA 3SKBA 3ASQA 4OP7A 4WZEA 2OBRA 4OPOA 3BY2A 3Q6QA 3R6KA 3PA2A 2ZL7A 4X07A 4P3IA 3SJPA 4Z4RA 3BY1A 5E6TA 3D26A 4RDLA 4Z4VA 2OBSA 5F4MA 3V7AA 4RDJA 4QVJA 4X06A 3PA1A 4P25A 4RM0A 3SLNA 4RPDA 3Q39A 5IYWA 5KW9A
chains in the Genus database with same CATH superfamily
1V0FA 4FK8A 5H5JA 3CCQB 2QDXA 1KJZA 3CC2B 1W0KA 1EP3B 1SKQA 1KRHA 1VLYA 1YX2A 2GREA 3PUMA 3ZUGA 4YAUA 2QA4B 3ES9A 4X7CA 5DN6A 3V76A 2GK7A 2X8KA 1QGYA 1ZM2A 2J7KA 4UZUA 4OOVA 1VHEA 2F4NA 4LBWA 4Z4TA 4BPRA 1GVHA 3BCFA 1Q9SA 3B78A 2PMDA 2D3LA 5HKKA 3PUNA 1E1QA 1A8PA 3AGPA 2QTZA 3CMMA 3ASSA 1VLOA 3ASTA 3OJXA 4RLZA 2V7QA 3ASRA 4G6IA 1E63A 1KMHA 1IHMA 3LQ6A 2CBXA 2X85A 2EIXA 2QGGA 3AVYA 4K1XA 1JA0A 1ZM4A 2LZJA 3QFCA 2OTLB 1G7SA 2HCJB 2XEXA 4HIZA 4AC9A 4Z4ZA 2JIZA 1N0UA 5IYNA 2CF4A 4J0QA 4Z4YA 2BF4A 5KSWB 3FKSA 3OW7A 4G7WA 2X6WA 4M2LA 1RQRA 4KKTA 1EFCA 1GO2A 3WNDA 3BCDA 4XMYA 1E62A 1F20A 3SLDA 5FNZA 3CC7B 5DSZA 2F43A 1WOOA 1UMKA 2X53S 2ZTGA 3ZZTA 1PJ6A 4KKSA 1DDIA 1E1RA 2WPDA 4QUZA 5FO0A 4P3YA 2ZITA 4XLCA 1KK2A 1FDRA 4RJLA 5FIUA 1VQ5B 4XKWA 2CK3A 3BQJA 1FNMA 1BPLA 2YWGA 2C77A 3W2GA 3PENA 4TMZA 3J81k 4G1VA 4IW3B 1XQBA 4YAFA 4TSFA 5A8AA 1XFOA 4AF7A 4PAAA 5TR9A 4G1BA 1T6XA 4Y7CA 1QUEA 1VQPB 3U6BA 2GJPA 1NDHA 4YAWA 3ASQA 5GV8A 2PIAA 3H9NA 1KK0A 2BGJA 3ZZUA 4ASUA 3VR6A 4ZCMA 4FWTA 1EP2B 3P26A 2X6XA 2CC2A 1OB5A 4Z1MA 1YJWB 3CCRB 1S72B 2C5BA 1D8TA 3ZBTA 3OZUA 1FNCA 2GQFA 4ZGNB 1KK1A 2V7UA 4UAJA 3G71B 3T51B 1YLOA 1B2RA 1UD8A 3CPWB 2E1BA 4UZFA 2BVNA 3LNNA 4NBSA 3A3GA 1E64A 4H9GA 3BY1A 1E43A 4L8JA 2OTJB 4XNFA 1KD1D 4Z4VA 2OBSA 5F4MA 3CCMB 1QVGB 4RDJA 4XL9A 1N05A 3PA1A 3AVVA 3AGQA 4M4SA 2P3MA 1WSVA 4B3XA 3VNUA 4XD7A 2C4TA 1VJSA 4YELA 5IYWA 2DCUA 4FXUA 2PE3A 2VJIA 1BX0A 2VBSA 5KW9A 2VNHA 4XLHA 2QTLA 1VQMB 3A3BA 1IJEA 2QMUA 4LBVA 3P27A 3CP8A 1V5VA 1JA1A 2BGIA 3CTAA 1H85A 4P12A 5EMNA 2B7CA 2HMAA 3CCVB 2Q6IA 1U2RA 1QUFA 5FO1A 2F1MA 3GSIA 4ZV4A 3W2IA 1UD4A 3HAGA 3JU4A 1N8RD 3Q6RA 2NPFA 3ISXA 5J3OA 2OYNA 2B5OA 2B7BA 2DYIA 3ONYA 3CW2A 4XONA 3CC4B 3OKXA 1B23P 1ZM9A 4C43A 1VF7A 4B4DA 4G7XA 3LO8A 1MRZA 1KK3A 4RPBA 2WR8A 4DQKA 3PVDA 3U6KA 3CMAB 3R6JA 1E3XA 1PJ7A 3WNBA 4Q7JB 3OJWA 1R5BA 4QV2A 1GAQA 1Q82D 2GPJA 3RY8A 4LBYA 5L46A 1OGIA 2YWFA 3OE7A 3QE2A 1Y0RA 3CXCB 1OGJA 1NB9A 3ZZ0A 1K8AD 1KZLA 1FRNA 2DERA 1ZM3A 1I18A 3G6EB 5GV7A 1SKYB 5IYPA 4OPSA 1QVFB 1UD5A 1M1KD 3CP2A 4WZKA 1KC8D 3OEHA 3ONUA 2BM1A 4Y9RA 1NRKA 4ROXA 4WZLA 3OP1A 1KTVA 2ZZGA 3Q3AA 5F4JA 1EFUA 2JJ1A 1G7CA 3CCUB 3OFNA 3OW2B 4TT3A 1WOSA 1Y0YA 1T5EA 4YEJA 5DS0A 1M90D 1CNFA 2NV4A 4XLEA 3SKBA 4PGOA 1K9MD 3WQZA 1UD2A 3T53B 5TRDA 1QX4A 2Q6KA 3AVTA 4B48A 4HE5A 1VQKB 1FNBA 3JQQA 2ZTNA 4OP7A 1OB0A 2VNJA 2DY1A 2OBRA 2WJVA 4M1KA 4XLFA 3ZIAA 3Q6QA 3R6KA 2RC5A 4WQMA 1SM4A 2YWEA 3W2EA 2XNJA 1PJ5A 1QG0A 2BV3A 2VZLA 1N06A 1WOPA 3SJPA 4Z4RA 2M5SA 5E6TA 2ZXHA 1QH0A 3CMEB 1EXMA 5AN9A 4RDLA 3ZC3A 1S0UA 3V7AA 4B43A 3CCLB 3I56B 4RD4A 1NJID 3B82A 1W35A 3Q39A 3W5VA 4XR6A 3W2FA 3DDYA 4XQFA 4RD2A 5JBQA 2ZZFA 3BNWA 2D9RA 4M0LA 1W2BB 2V7WA 2CNDA 4DNTB 3WXMA 1J9ZA 2QN6A 1P4MA 5HXBA 1HA3A 1QGZA 2VBVA 2V7XA 3FJOA 3MHPA 3QFRA 5FA6A 2XZPA 2XZLA 2W6IA 1BX1A 4Z4WA 2V7TA 2ZBUA 3MCAA 4XN3A 5H59A 4N3GA 1UD6A 1YI2B 2BM0A 4DK1A 2HLDA 3LVBA 4X0CA 4R71A 4TMVA 4Y9UA 1N0VC 3A8KA 4RD6A 5A89A 1VQ8B 3H94A 5IYQA 2XZOA 3AVXA 1E3ZA 1XB2A 1XE1A 2VNKA 3AVUA 2GJRA 2KVOA 2I1LA 2QE7A 3WBJA 3VNVA 1VQNB 3FPPA 4C0SA 1QFZA 2XNDA 2C2WA 4KKUA 2BMWA 2OK7A 1EP1B 1QFJA 1T6ZA 5B6IA 1OHHA 2EFGA 3BC9A 3A35A 4RD1A 2BSAA 4JMQA 5IYRA 1VQOB 1H8HA 1ELOA 1G7TA 4NNJA 4RDKA 5HZAA 3KL9A 4PC1A 4OPVA 1QFYA 1W34A 1JJ2B 2C78A 4ZGQB 2CW5A 1NBMA 4ACAA 1CQXA 1VQ7B 1WSRA 2V31A 1W87A 4XOPA 3VMFA 1TLLA 3OZWA 4RCZA 4YHBA 2RC6A 4PABA 4LBZA 1DG1G 1R5OA 2E1RA 1ZUNB 1I8DA 3OZVA 2DEUA 4TMTA 5LMZA 4XORA 2WYRA 1COWA 3ASPA 1TVCA 3CD6B 3OPOA 4RD3A 4ZCIA 5BSYA 2C5HA 1WTHD 4M53A 3E20A 3A1PA 1E79A 2XGJA 2AHOA 2FX3A 2VYQA 1PKVA 2JN9A 4DNRB 1EWYA 5KNLA 4ACBA 3T56B 1YJNB 3CCJB 1WP6A 4OPOA 1YIJB 1JB9A 1IJFA 4N3NA 1Q81D 3CB4A 4X8IA 2V7VA 1KQSB 2WZPP 1QGAA 3QFSA 2GJKA 4B3GA 4P3IA 5TY0A 3NE5B 4XN0A 3GIRA 4GQNA 3W2HA 4ZCLA 4B47A 4XM3A 1AIPA 3MMPA 1RQPA 4P25A 2FVGA 4RM0A 3SLNA 3WBKA 3ZBUA 1Q7YD 3W5HA 3CCSB 4TN1A 4MYUA 4MYTA 1BLIA 1K28D 5A88A 2QEXB 3OAAA 1W0JA 2Z6BD 5BSXA 3SJZA 2ZZEA 1DARA 3G4SB 4QHYA 1AMOA 3CESA 4CQJA 1W9XA 1G7RA 1EFTA 2XNCA 4TKOB 4PC3A 1VQ9B 3B8HA 4P6VF 3U2QA 2BPOA 1YJ9B 3QSYA 1FX0A 1D2EA 3LQEA 2PLFA 1YHQB 3CPXA 4X7DA 3CCEB 2F1LA 4Z4UA 2WZNA 4DQLA 5CDFA 1TTTA 4G5GA 4X7FA 1GAWA 1V0EA 2ZL5A 1BMFA 4B44A 3GVKA 4AF6A 4FN5A 1EFRA 1CNEA 2WJYA 2WSSA 4X7EA 2HDNB 2VNIA 3GQBA 3GVJA 1UD3A 1S4MA 4OOXA 2VBUA 4B3FX 4UZEA 2DIEA 4P22A 2W6JA 2X0KA 2C4UA 2ZBVA 1WU8A 1VQLB 1GJRA 4II3A 2R9VA 2X3UA 3FPKA 4YALA 4AVZA 4QFMA 5F4OA 4Z4SA 4PC2A 4WWVA 3A8IA 3KEWA 3CRZA 4U9UA 4P26A 4E0FA 4P2NA 1H42A 3Q38A 5HZBA 2DOGA 3WY9A 4II2A 2ZL6A 4P1VA 3SEJA 2VJJA 3I55B 1Q86D 1VQ6B 5FL7A 5J35A 4P9SA 2XOKA 4LC0A 4OOSA 1MABA 2Q6LA 4QVAA 2X6YA 4XOTA 1HVXA 2V4DA 4NCNA 1T6YA 4X05A 1D1NA 1OB2A 3ZPNA 3OOCA 4YAOA 2CRVA 3A8JA 1TUIA 4WZTA 3AVWA 4TMWA 2OBTA 3WYAA 2D74A 4EH1A 2JDIA 2VBTA 3E1YE 1VHOA 2R6HA 1H8EA 4PC6A 3VO2A 3OEEA 1YITB 2D3NA 1JNYA 4TMXA 5TV2A 4RD0A 3JQPA 1GR1A 4WZEA 1K73D 3I1FA 2BN4A 2OK8A 1FNDA 3BY2A 2YWHA 1BQEA 5IK2A 3PA2A 4XKVA 1VQ4B 1HZEA 1WORA 4YXWA 2ZL7A 4DK0A 1WDTA 4X07A 3GVLA 3WNCA 1BJKA 4RCYA 3G05A 1N07A 2ZXIA 1IB0A 4PC7A 2GK6A 1NB0A 3D26A 3QFTA 3JQRA 2JJ2A 1WPCA 4X06A 1N08A 4QVJA 1F60A 1R5NA 1DDGA 3BH4A 1I7PA 2Q6OA 4RPDA 1FRQA 3W5UA 4HE6A 2ZZQA 4P6YA 5THXA 4F7DA 2DETA 4XLAA 3VO1A
chains in the Genus database with same CATH topology
5BSXA 3PUMA 4P12A 4X7CA 3LQEA 4OOVA 4Z4WA 4Z4TA 3Q6RA 5J3OA 4X7DA 3PUNA 3ONYA 4RLZA 3ASSA 4Z4UA 3ASTA 3ASRA 4X0CA 4X7FA 1IHMA 3LQ6A 2ZL5A 4RPBA 5IYQA 3PVDA 3R6JA 4X7EA 4Z4ZA 4QV2A 5IYNA 4OOXA 4Z4YA 3RY8A 5F4OA 4Z4SA 5IYRA 3SLDA 4P26A 4P2NA 4RDKA 5HZAA 3Q38A 5HZBA 5IYPA 4OPSA 4OPVA 2ZL6A 4P1VA 3SEJA 4WZKA 5J35A 4OOSA 3ONUA 4QVAA 4QUZA 4X05A 4ROXA 4WZLA 3Q3AA 3BQJA 5F4JA 4WZTA 2OBTA 3ASPA 5BSYA 3SKBA 3ASQA 4OP7A 4WZEA 2OBRA 4OPOA 3BY2A 3Q6QA 3R6KA 3PA2A 2ZL7A 4X07A 4P3IA 3SJPA 4Z4RA 3BY1A 5E6TA 3D26A 4RDLA 4Z4VA 2OBSA 5F4MA 3V7AA 4RDJA 4QVJA 4X06A 3PA1A 4P25A 4RM0A 3SLNA 4RPDA 3Q39A 5IYWA 5KW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BSX A;  3PUM A;  4P12 A;  4X7C A;  3LQE A;  4OOV A;  4Z4W A;  4Z4T A;  3Q6R A;  5J3O A;  4X7D A;  3PUN A;  3ONY A;  4RLZ A;  3ASS A;  4Z4U A;  3AST A;  3ASR A;  4X0C A;  4X7F A;  1IHM A;  3LQ6 A;  2ZL5 A;  4RPB A;  5IYQ A;  3PVD A;  3R6J A;  4X7E A;  4Z4Z A;  4QV2 A;  5IYN A;  4OOX A;  4Z4Y A;  3RY8 A;  5F4O A;  4Z4S A;  5IYR A;  3SLD A;  4P26 A;  4P2N A;  4RDK A;  5HZA A;  3Q38 A;  5HZB A;  5IYP A;  4OPS A;  4OPV A;  2ZL6 A;  4P1V A;  3SEJ A;  4WZK A;  5J35 A;  4OOS A;  3ONU A;  4QVA A;  4QUZ A;  4X05 A;  4ROX A;  4WZL A;  3Q3A A;  3BQJ A;  5F4J A;  4WZT A;  2OBT A;  3ASP A;  5BSY A;  3SKB A;  3ASQ A;  4OP7 A;  4WZE A;  2OBR A;  4OPO A;  3BY2 A;  3Q6Q A;  3R6K A;  3PA2 A;  2ZL7 A;  4X07 A;  4P3I A;  3SJP A;  4Z4R A;  3BY1 A;  5E6T A;  3D26 A;  4RDL A;  4Z4V A;  2OBS A;  5F4M A;  3V7A A;  4RDJ A;  4QVJ A;  4X06 A;  3PA1 A;  4P25 A;  4RM0 A;  3SLN A;  4RPD A;  3Q39 A;  5IYW A;  5KW9 A; 
#chains in the Genus database with same CATH topology
 1V0F A;  4FK8 A;  5H5J A;  3CCQ B;  2QDX A;  1KJZ A;  3CC2 B;  1W0K A;  1EP3 B;  1SKQ A;  1KRH A;  1VLY A;  1YX2 A;  2GRE A;  3PUM A;  3ZUG A;  4YAU A;  2QA4 B;  3ES9 A;  4X7C A;  5DN6 A;  3V76 A;  2GK7 A;  2X8K A;  1QGY A;  1ZM2 A;  2J7K A;  4UZU A;  4OOV A;  1VHE A;  2F4N A;  4LBW A;  4Z4T A;  4BPR A;  1GVH A;  3BCF A;  1Q9S A;  3B78 A;  2PMD A;  2D3L A;  5HKK A;  3PUN A;  1E1Q A;  1A8P A;  3AGP A;  2QTZ A;  3CMM A;  3ASS A;  1VLO A;  3AST A;  3OJX A;  4RLZ A;  2V7Q A;  3ASR A;  4G6I A;  1E63 A;  1KMH A;  1IHM A;  3LQ6 A;  2CBX A;  2X85 A;  2EIX A;  2QGG A;  3AVY A;  4K1X A;  1JA0 A;  1ZM4 A;  2LZJ A;  3QFC A;  2OTL B;  1G7S A;  2HCJ B;  2XEX A;  4HIZ A;  4AC9 A;  4Z4Z A;  2JIZ A;  1N0U A;  5IYN A;  2CF4 A;  4J0Q A;  4Z4Y A;  2BF4 A;  5KSW B;  3FKS A;  3OW7 A;  4G7W A;  2X6W A;  4M2L A;  1RQR A;  4KKT A;  1EFC A;  1GO2 A;  3WND A;  3BCD A;  4XMY A;  1E62 A;  1F20 A;  3SLD A;  5FNZ A;  3CC7 B;  5DSZ A;  2F43 A;  1WOO A;  1UMK A;  2X53 S;  2ZTG A;  3ZZT A;  1PJ6 A;  4KKS A;  1DDI A;  1E1R A;  2WPD A;  4QUZ A;  5FO0 A;  4P3Y A;  2ZIT A;  4XLC A;  1KK2 A;  1FDR A;  4RJL A;  5FIU A;  1VQ5 B;  4XKW A;  2CK3 A;  3BQJ A;  1FNM A;  1BPL A;  2YWG A;  2C77 A;  3W2G A;  3PEN A;  4TMZ A;  3J81 k;  4G1V A;  4IW3 B;  1XQB A;  4YAF A;  4TSF A;  5A8A A;  1XFO A;  4AF7 A;  4PAA A;  5TR9 A;  4G1B A;  1T6X A;  4Y7C A;  1QUE A;  1VQP B;  3U6B A;  2GJP A;  1NDH A;  4YAW A;  3ASQ A;  5GV8 A;  2PIA A;  3H9N A;  1KK0 A;  2BGJ A;  3ZZU A;  4ASU A;  3VR6 A;  4ZCM A;  4FWT A;  1EP2 B;  3P26 A;  2X6X A;  2CC2 A;  1OB5 A;  4Z1M A;  1YJW B;  3CCR B;  1S72 B;  2C5B A;  1D8T A;  3ZBT A;  3OZU A;  1FNC A;  2GQF A;  4ZGN B;  1KK1 A;  2V7U A;  4UAJ A;  3G71 B;  3T51 B;  1YLO A;  1B2R A;  1UD8 A;  3CPW B;  2E1B A;  4UZF A;  2BVN A;  3LNN A;  4NBS A;  3A3G A;  1E64 A;  4H9G A;  3BY1 A;  1E43 A;  4L8J A;  2OTJ B;  4XNF A;  1KD1 D;  4Z4V A;  2OBS A;  5F4M A;  3CCM B;  1QVG B;  4RDJ A;  4XL9 A;  1N05 A;  3PA1 A;  3AVV A;  3AGQ A;  4M4S A;  2P3M A;  1WSV A;  4B3X A;  3VNU A;  4XD7 A;  2C4T A;  1VJS A;  4YEL A;  5IYW A;  2DCU A;  4FXU A;  2PE3 A;  2VJI A;  1BX0 A;  2VBS A;  5KW9 A;  2VNH A;  4XLH A;  2QTL A;  1VQM B;  3A3B A;  1IJE A;  2QMU A;  4LBV A;  3P27 A;  3CP8 A;  1V5V A;  1JA1 A;  2BGI A;  3CTA A;  1H85 A;  4P12 A;  5EMN A;  2B7C A;  2HMA A;  3CCV B;  2Q6I A;  1U2R A;  1QUF A;  5FO1 A;  2F1M A;  3GSI A;  4ZV4 A;  3W2I A;  1UD4 A;  3HAG A;  3JU4 A;  1N8R D;  3Q6R A;  2NPF A;  3ISX A;  5J3O A;  2OYN A;  2B5O A;  2B7B A;  2DYI A;  3ONY A;  3CW2 A;  4XON A;  3CC4 B;  3OKX A;  1B23 P;  1ZM9 A;  4C43 A;  1VF7 A;  4B4D A;  4G7X A;  3LO8 A;  1MRZ A;  1KK3 A;  4RPB A;  2WR8 A;  4DQK A;  3PVD A;  3U6K A;  3CMA B;  3R6J A;  1E3X A;  1PJ7 A;  3WNB A;  4Q7J B;  3OJW A;  1R5B A;  4QV2 A;  1GAQ A;  1Q82 D;  2GPJ A;  3RY8 A;  4LBY A;  5L46 A;  1OGI A;  2YWF A;  3OE7 A;  3QE2 A;  1Y0R A;  3CXC B;  1OGJ A;  1NB9 A;  3ZZ0 A;  1K8A D;  1KZL A;  1FRN A;  2DER A;  1ZM3 A;  1I18 A;  3G6E B;  5GV7 A;  1SKY B;  5IYP A;  4OPS A;  1QVF B;  1UD5 A;  1M1K D;  3CP2 A;  4WZK A;  1KC8 D;  3OEH A;  3ONU A;  2BM1 A;  4Y9R A;  1NRK A;  4ROX A;  4WZL A;  3OP1 A;  1KTV A;  2ZZG A;  3Q3A A;  5F4J A;  1EFU A;  2JJ1 A;  1G7C A;  3CCU B;  3OFN A;  3OW2 B;  4TT3 A;  1WOS A;  1Y0Y A;  1T5E A;  4YEJ A;  5DS0 A;  1M90 D;  1CNF A;  2NV4 A;  4XLE A;  3SKB A;  4PGO A;  1K9M D;  3WQZ A;  1UD2 A;  3T53 B;  5TRD A;  1QX4 A;  2Q6K A;  3AVT A;  4B48 A;  4HE5 A;  1VQK B;  1FNB A;  3JQQ A;  2ZTN A;  4OP7 A;  1OB0 A;  2VNJ A;  2DY1 A;  2OBR A;  2WJV A;  4M1K A;  4XLF A;  3ZIA A;  3Q6Q A;  3R6K A;  2RC5 A;  4WQM A;  1SM4 A;  2YWE A;  3W2E A;  2XNJ A;  1PJ5 A;  1QG0 A;  2BV3 A;  2VZL A;  1N06 A;  1WOP A;  3SJP A;  4Z4R A;  2M5S A;  5E6T A;  2ZXH A;  1QH0 A;  3CME B;  1EXM A;  5AN9 A;  4RDL A;  3ZC3 A;  1S0U A;  3V7A A;  4B43 A;  3CCL B;  3I56 B;  4RD4 A;  1NJI D;  3B82 A;  1W35 A;  3Q39 A;  3W5V A;  4XR6 A;  3W2F A;  3DDY A;  4XQF A;  4RD2 A;  5JBQ A;  2ZZF A;  3BNW A;  2D9R A;  4M0L A;  1W2B B;  2V7W A;  2CND A;  4DNT B;  3WXM A;  1J9Z A;  2QN6 A;  1P4M A;  5HXB A;  1HA3 A;  1QGZ A;  2VBV A;  2V7X A;  3FJO A;  3MHP A;  3QFR A;  5FA6 A;  2XZP A;  2XZL A;  2W6I A;  1BX1 A;  4Z4W A;  2V7T A;  2ZBU A;  3MCA A;  4XN3 A;  5H59 A;  4N3G A;  1UD6 A;  1YI2 B;  2BM0 A;  4DK1 A;  2HLD A;  3LVB A;  4X0C A;  4R71 A;  4TMV A;  4Y9U A;  1N0V C;  3A8K A;  4RD6 A;  5A89 A;  1VQ8 B;  3H94 A;  5IYQ A;  2XZO A;  3AVX A;  1E3Z A;  1XB2 A;  1XE1 A;  2VNK A;  3AVU A;  2GJR A;  2KVO A;  2I1L A;  2QE7 A;  3WBJ A;  3VNV A;  1VQN B;  3FPP A;  4C0S A;  1QFZ A;  2XND A;  2C2W A;  4KKU A;  2BMW A;  2OK7 A;  1EP1 B;  1QFJ A;  1T6Z A;  5B6I A;  1OHH A;  2EFG A;  3BC9 A;  3A35 A;  4RD1 A;  2BSA A;  4JMQ A;  5IYR A;  1VQO B;  1H8H A;  1ELO A;  1G7T A;  4NNJ A;  4RDK A;  5HZA A;  3KL9 A;  4PC1 A;  4OPV A;  1QFY A;  1W34 A;  1JJ2 B;  2C78 A;  4ZGQ B;  2CW5 A;  1NBM A;  4ACA A;  1CQX A;  1VQ7 B;  1WSR A;  2V31 A;  1W87 A;  4XOP A;  3VMF A;  1TLL A;  3OZW A;  4RCZ A;  4YHB A;  2RC6 A;  4PAB A;  4LBZ A;  1DG1 G;  1R5O A;  2E1R A;  1ZUN B;  1I8D A;  3OZV A;  2DEU A;  4TMT A;  5LMZ A;  4XOR A;  2WYR A;  1COW A;  3ASP A;  1TVC A;  3CD6 B;  3OPO A;  4RD3 A;  4ZCI A;  5BSY A;  2C5H A;  1WTH D;  4M53 A;  3E20 A;  3A1P A;  1E79 A;  2XGJ A;  2AHO A;  2FX3 A;  2VYQ A;  1PKV A;  2JN9 A;  4DNR B;  1EWY A;  5KNL A;  4ACB A;  3T56 B;  1YJN B;  3CCJ B;  1WP6 A;  4OPO A;  1YIJ B;  1JB9 A;  1IJF A;  4N3N A;  1Q81 D;  3CB4 A;  4X8I A;  2V7V A;  1KQS B;  2WZP P;  1QGA A;  3QFS A;  2GJK A;  4B3G A;  4P3I A;  5TY0 A;  3NE5 B;  4XN0 A;  3GIR A;  4GQN A;  3W2H A;  4ZCL A;  4B47 A;  4XM3 A;  1AIP A;  3MMP A;  1RQP A;  4P25 A;  2FVG A;  4RM0 A;  3SLN A;  3WBK A;  3ZBU A;  1Q7Y D;  3W5H A;  3CCS B;  4TN1 A;  4MYU A;  4MYT A;  1BLI A;  1K28 D;  5A88 A;  2QEX B;  3OAA A;  1W0J A;  2Z6B D;  5BSX A;  3SJZ A;  2ZZE A;  1DAR A;  3G4S B;  4QHY A;  1AMO A;  3CES A;  4CQJ A;  1W9X A;  1G7R A;  1EFT A;  2XNC A;  4TKO B;  4PC3 A;  1VQ9 B;  3B8H A;  4P6V F;  3U2Q A;  2BPO A;  1YJ9 B;  3QSY A;  1FX0 A;  1D2E A;  3LQE A;  2PLF A;  1YHQ B;  3CPX A;  4X7D A;  3CCE B;  2F1L A;  4Z4U A;  2WZN A;  4DQL A;  5CDF A;  1TTT A;  4G5G A;  4X7F A;  1GAW A;  1V0E A;  2ZL5 A;  1BMF A;  4B44 A;  3GVK A;  4AF6 A;  4FN5 A;  1EFR A;  1CNE A;  2WJY A;  2WSS A;  4X7E A;  2HDN B;  2VNI A;  3GQB A;  3GVJ A;  1UD3 A;  1S4M A;  4OOX A;  2VBU A;  4B3F X;  4UZE A;  2DIE A;  4P22 A;  2W6J A;  2X0K A;  2C4U A;  2ZBV A;  1WU8 A;  1VQL B;  1GJR A;  4II3 A;  2R9V A;  2X3U A;  3FPK A;  4YAL A;  4AVZ A;  4QFM A;  5F4O A;  4Z4S A;  4PC2 A;  4WWV A;  3A8I A;  3KEW A;  3CRZ A;  4U9U A;  4P26 A;  4E0F A;  4P2N A;  1H42 A;  3Q38 A;  5HZB A;  2DOG A;  3WY9 A;  4II2 A;  2ZL6 A;  4P1V A;  3SEJ A;  2VJJ A;  3I55 B;  1Q86 D;  1VQ6 B;  5FL7 A;  5J35 A;  4P9S A;  2XOK A;  4LC0 A;  4OOS A;  1MAB A;  2Q6L A;  4QVA A;  2X6Y A;  4XOT A;  1HVX A;  2V4D A;  4NCN A;  1T6Y A;  4X05 A;  1D1N A;  1OB2 A;  3ZPN A;  3OOC A;  4YAO A;  2CRV A;  3A8J A;  1TUI A;  4WZT A;  3AVW A;  4TMW A;  2OBT A;  3WYA A;  2D74 A;  4EH1 A;  2JDI A;  2VBT A;  3E1Y E;  1VHO A;  2R6H A;  1H8E A;  4PC6 A;  3VO2 A;  3OEE A;  1YIT B;  2D3N A;  1JNY A;  4TMX A;  5TV2 A;  4RD0 A;  3JQP A;  1GR1 A;  4WZE A;  1K73 D;  3I1F A;  2BN4 A;  2OK8 A;  1FND A;  3BY2 A;  2YWH A;  1BQE A;  5IK2 A;  3PA2 A;  4XKV A;  1VQ4 B;  1HZE A;  1WOR A;  4YXW A;  2ZL7 A;  4DK0 A;  1WDT A;  4X07 A;  3GVL A;  3WNC A;  1BJK A;  4RCY A;  3G05 A;  1N07 A;  2ZXI A;  1IB0 A;  4PC7 A;  2GK6 A;  1NB0 A;  3D26 A;  3QFT A;  3JQR A;  2JJ2 A;  1WPC A;  4X06 A;  1N08 A;  4QVJ A;  1F60 A;  1R5N A;  1DDG A;  3BH4 A;  1I7P A;  2Q6O A;  4RPD A;  1FRQ A;  3W5U A;  4HE6 A;  2ZZQ A;  4P6Y A;  5THX A;  4F7D A;  2DET A;  4XLA A;  3VO1 A; 
#chains in the Genus database with same CATH homology
 5BSX A;  3PUM A;  4P12 A;  4X7C A;  3LQE A;  4OOV A;  4Z4W A;  4Z4T A;  3Q6R A;  5J3O A;  4X7D A;  3PUN A;  3ONY A;  4RLZ A;  3ASS A;  4Z4U A;  3AST A;  3ASR A;  4X0C A;  4X7F A;  1IHM A;  3LQ6 A;  2ZL5 A;  4RPB A;  5IYQ A;  3PVD A;  3R6J A;  4X7E A;  4Z4Z A;  4QV2 A;  5IYN A;  4OOX A;  4Z4Y A;  3RY8 A;  5F4O A;  4Z4S A;  5IYR A;  3SLD A;  4P26 A;  4P2N A;  4RDK A;  5HZA A;  3Q38 A;  5HZB A;  5IYP A;  4OPS A;  4OPV A;  2ZL6 A;  4P1V A;  3SEJ A;  4WZK A;  5J35 A;  4OOS A;  3ONU A;  4QVA A;  4QUZ A;  4X05 A;  4ROX A;  4WZL A;  3Q3A A;  3BQJ A;  5F4J A;  4WZT A;  2OBT A;  3ASP A;  5BSY A;  3SKB A;  3ASQ A;  4OP7 A;  4WZE A;  2OBR A;  4OPO A;  3BY2 A;  3Q6Q A;  3R6K A;  3PA2 A;  2ZL7 A;  4X07 A;  4P3I A;  3SJP A;  4Z4R A;  3BY1 A;  5E6T A;  3D26 A;  4RDL A;  4Z4V A;  2OBS A;  5F4M A;  3V7A A;  4RDJ A;  4QVJ A;  4X06 A;  3PA1 A;  4P25 A;  4RM0 A;  3SLN A;  4RPD A;  3Q39 A;  5IYW A;  5KW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...