5KW9A

Structural basis for norovirus neutralization by a hbga blocking human iga antibody
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
290
structure length
289
Chain Sequence
b'RPFTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSSITEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNASSGPQQLPINGVFVFVSWVSRFYQLKPVGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
molecule tags Antiviral protein
source organism Norwalk virus
publication title Structural basis for norovirus neutralization by an HBGA blocking human IgA antibody.
pubmed doi rcsb
total genus 64
structure length 289
sequence length 290
ec nomenclature
pdb deposition date 2016-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5kw9A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5kw9A01
3ASPA 4Z4WA 5IYQA 4Z4RA 4P2NA 4RPDA 1IHMA 4OPVA 3SEJA 3SLNA 3R6KA 5E6TA 4P12A 4Z4VA 4QV2A 5BSXA 2ZL6A 4OP7A 4X0CA 4P1VA 3ASTA 5KW9A 4OPSA 3R6JA 4QVAA 3Q39A 4X05A 3PUMA 4RDKA 3SJPA 4WZTA 4X7FA 4RPBA 3SKBA 3ONUA 3PVDA 4QUZA 5F4MA 4X06A 4RM0A 5HZAA 2OBRA 3BY2A 4X7DA 4P3IA 4OPOA 4ROXA 5BSYA 3V7AA 5J3OA 3LQ6A 4X7CA 3D26A 4X7EA 3Q3AA 3Q38A 3PUNA 3PA1A 3Q6QA 3RY8A 4RDLA 4QVJA 5F4JA 3SLDA 4Z4TA 4P25A 2OBTA 5IYNA 3ONYA 4Z4SA 5IYRA 5F4OA 4OOSA 4Z4UA 4OOVA 4RDJA 4WZEA 5J35A 4WZLA 3PA2A 2ZL7A 4X07A 3BY1A 2OBSA 3ASRA 4WZKA 4P26A 5IYWA 5IYPA 3ASSA 3ASQA 4Z4ZA 4OOXA 4Z4YA 5HZBA 3LQEA 4RLZA 2ZL5A 3Q6RA 3BQJA
chains in the Genus database with same CATH superfamily
2BM1A 3CCEB 2YWFA 2BVNA 4XONA 2PLFA 4NCNA 2V7QA 4RPDA 1KK1A 1KK0A 3KEWA 4P6VF 4KKUA 3A8IA 4II2A 2R6HA 3LNNA 2DCUA 5TY0A 4YAFA 4OPVA 1IB0A 2VBTA 3G71B 3SEJA 3BC9A 3CXCB 3GQBA 1VQKB 3JQRA 2DEUA 3WNDA 3A3BA 4B43A 4Z4VA 3SJZA 3CCQB 2YWHA 1BJKA 3OJWA 4PC7A 1R5OA 1EP2B 2BGIA 4M2LA 2C5BA 1RQRA 4P22A 2V7XA 2D9RA 2DOGA 4TMVA 2VNKA 4BPRA 3R6JA 2V7UA 1ZUNB 2JJ1A 4QVAA 3Q39A 4G5GA 4PC3A 4TMWA 3ZIAA 4X05A 3A35A 2QA4B 1Q81D 3VNUA 5CDFA 2QDXA 2X0KA 1COWA 2D3LA 3KL9A 1YHQB 1TVCA 1S72B 4E0FA 1DG1G 2QMUA 1QH0A 4RJLA 2XNCA 4RM0A 5HZAA 2VNJA 3CPXA 2BV3A 3LVBA 4YAUA 1W34A 1F20A 1EFCA 2CRVA 2D74A 1FNBA 1QFYA 3LQ6A 4HE5A 2X8KA 3D26A 4B47A 4XM3A 3VO2A 3NE5B 2C4UA 3QFRA 2WYRA 1QFZA 3PUNA 3FPKA 3OW7A 3WY9A 4XQFA 4QFMA 1T5EA 1G7RA 4PABA 1VQOB 3VNVA 1TLLA 5LMZA 4YALA 3AVVA 1OGJA 2FX3A 3OW2B 2BF4A 3SLDA 1JB9A 3P26A 4AF7A 3E20A 4PC2A 4Z4TA 1N8RD 1B23P 3BCFA 2V7VA 4P25A 1VF7A 2ZTNA 2C5HA 3CCSB 3B82A 1NBMA 2GK6A 1V0FA 2GK7A 1QVFB 2NPFA 3AVTA 1VHOA 4UZFA 5F4OA 4XLHA 4ZGQB 4KKSA 2C4TA 1PJ5A 4RD1A 4B4DA 1VQ4B 4RDJA 4WZEA 3J81k 1BPLA 1WP6A 1UD4A 4XORA 1G7TA 2XOKA 1H85A 3I56B 2JN9A 3CP8A 2PIAA 1H8EA 2W6JA 4RD0A 2OK8A 4Y9UA 1B2RA 1QUFA 1IJFA 2VNIA 1FNDA 3B78A 1FX0A 1UD8A 2PMDA 3ASSA 3ASQA 3AGQA 1OB2A 4PC6A 1K28D 3CTAA 4Z4YA 3CP2A 3JU4A 4Y7CA 3W5VA 1WORA 3QSYA 3WQZA 3OJXA 3B8HA 4NNJA 4PAAA 5FO1A 2CBXA 1EP3B 2P3MA 3ASPA 1VLOA 4Z4WA 2JJ2A 3ZBTA 1E64A 2EFGA 2ZBVA 3Q6RA 3QFSA 1QUEA 3U2QA 5GV7A 4HIZA 3OE7A 1RQPA 3AVXA 3OAAA 4P3YA 1IHMA 2EIXA 2E1RA 1NRKA 3W2GA 1QFJA 2W6IA 5FA6A 3CC7B 4DK1A 1GO2A 5E6TA 1XFOA 4B48A 2XZPA 2V31A 4WQMA 4QV2A 1YI2B 4TN1A 2R9VA 2V4DA 2ZL6A 1I7PA 3WBJA 2X3UA 1EFTA 1BQEA 5GV8A 2QE7A 1BMFA 1W87A 4XOTA 1PKVA 1QVGB 2BGJA 4OPSA 4AF6A 4N3NA 1MRZA 1N0VC 4RD4A 3W2HA 4ZCIA 3OFNA 1WSVA 1NDHA 1UD2A 4RCYA 1KQSB 1M90D 3GVKA 1T6YA 3W2FA 1MABA 3LO8A 1UD3A 3QE2A 4XLAA 5F4MA 4ZGNB 4P9SA 1VQ6B 2VYQA 2QTLA 1M1KD 4LBVA 2CC2A 2X6YA 3CMAB 4G7XA 4P3IA 3VO1A 2DYIA 4ROXA 1DARA 3MMPA 3ZZUA 4PGOA 4X7CA 3QFTA 1Y0YA 3BH4A 2ZXHA 4J0QA 3Q3AA 1W9XA 3Q38A 2WJVA 2WR8A 1T6XA 2C77A 2ZTGA 3PA1A 3Q6QA 1W0KA 2PE3A 2GJKA 3AGPA 4M1KA 3PENA 4XLFA 4XLCA 2GREA 1HVXA 1WU8A 5F4JA 1VHEA 1DDIA 2F1LA 5DSZA 1XQBA 2B7CA 4LBYA 3ZZTA 3AVUA 1Q86D 2ZZFA 5FL7A 4GQNA 3QFCA 4M4SA 4G1VA 4Z4SA 5THXA 3OEHA 2HDNB 1JJ2B 4ZV4A 3ISXA 4OOSA 1YX2A 1YLOA 2BN4A 4CQJA 1GVHA 4OOVA 4PC1A 4XMYA 2WZPP 4DNRB 5J35A 1T6ZA 2VBVA 3BNWA 5A88A 2AHOA 1H8HA 3CW2A 1E79A 3ZBUA 3E1YE 5H5JA 5A8AA 2CNDA 4R71A 1WTHD 4ZCMA 2ZXIA 3V76A 1DDGA 1YJWB 1JA1A 2WZNA 4Z4ZA 2HMAA 3JQPA 2M5SA 2QTZA 4II3A 3W5HA 4RD2A 3CCRB 2DETA 3W5UA 3BCDA 3ZZ0A 4ASUA 3G05A 1E1QA 1Q9SA 1J9ZA 1EXMA 2B7BA 3BQJA 4JMQA 1FDRA 4XLEA 1D1NA 2BM0A 5IYQA 4Z4RA 2JIZA 4P2NA 5TR9A 1KJZA 3AVYA 1YJNB 4KKTA 3WNCA 3CCVB 1NJID 4B44A 4MYUA 3SLNA 1NB9A 2KVOA 2ZITA 4UAJA 4TKOB 4YELA 2X6WA 2F1MA 2VNHA 1VQMB 1N06A 4B3GA 5KNLA 1QX4A 4YAWA 3OP1A 1Q7YD 4RCZA 4XNFA 3WXMA 1E3XA 4LC0A 2QN6A 3JQQA 3ASTA 2BMWA 2FVGA 5KW9A 2QGGA 2WSSA 1K73D 3T51B 1KZLA 3VR6A 1QGAA 1JNYA 3GSIA 4N3GA 3P27A 2D3NA 4QHYA 2B5OA 1KK2A 3PUMA 4RDKA 1ZM3A 4XN0A 1OHHA 1TUIA 1V0EA 1NB0A 4TMXA 3ZUGA 1WDTA 3ZC3A 3SKBA 3U6BA 1A8PA 3OKXA 3ONUA 1I8DA 2VBUA 3PVDA 1XE1A 4DQKA 1VQ5B 2XNDA 4X06A 2Q6OA 4C0SA 4ZCLA 2GQFA 1VJSA 4YXWA 2OBRA 3BY2A 1UD5A 4X7DA 4XR6A 1KK3A 2X85A 3H9NA 1EWYA 1SM4A 3OZWA 2GJRA 4MYTA 1GAWA 4G1BA 1K9MD 1GAQA 2OYNA 5IK2A 1WPCA 1KTVA 3V7AA 5BSYA 3WBKA 4ACAA 1E62A 3CCJB 3U6KA 2WJYA 4XKVA 1UMKA 4HE6A 3RY8A 2C78A 4RDLA 4QVJA 1FRNA 2XEXA 4M0LA 1D8TA 2ZZGA 2XGJA 3OZVA 4P6YA 2V7WA 1R5BA 1GJRA 1EP1B 2YWGA 1JA0A 1UD6A 5IYNA 4TT3A 3ONYA 3GVJA 1Y0RA 1N08A 2ZBUA 5TRDA 1K8AD 3HAGA 4B3FX 3CCUB 1VQPB 2YWEA 3CC4B 1FNMA 4EH1A 1U2RA 3A8JA 4WZLA 3PA2A 2ZL7A 1VLYA 1OB0A 2Q6KA 3G4SB 3CCMB 2CW5A 2OBSA 3ASRA 2XZOA 1GR1A 4XD7A 2HCJB 3AVWA 3OOCA 5FO0A 4DQLA 3GIRA 1KMHA 1ELOA 2BSAA 3WYAA 4C43A 1VQ7B 3GVLA 4XKWA 1N07A 1ZM9A 5HZBA 1G7SA 1KRHA 2ZZEA 1VQNB 2RC6A 3DDYA 2ZL5A 5HKKA 1QGZA 2CF4A 5L46A 4FN5A 3OPOA 5TV2A 4XN3A 1VQLB 4YHBA 2ZZQA 2CK3A 1W0JA 1V5VA 4XL9A 1N05A 1BX1A 4TSFA 4F7DA 4AC9A 5JBQA 3CD6B 2GPJA 1S4MA 4DNTB 1I18A 3T56B 5B6IA 1OGIA 1G7CA 1XB2A 2DY1A 3FKSA 2C2WA 2V7TA 3CB4A 4UZUA 3VMFA 4AVZA 1QGYA 4G6IA 1YITB 4TMTA 4YEJA 1P4MA 3R6KA 4FWTA 1R5NA 5FIUA 4TMZA 4P12A 3WNBA 2WPDA 5KSWB 1S0UA 2OTJB 2X53S 5BSXA 1WOPA 3ZPNA 2QEXB 4Y9RA 4RD6A 4OP7A 3CMMA 2BPOA 2JDIA 4X0CA 1VQ9B 4P1VA 3I1FA 3OEEA 1Q82D 3MHPA 2LZJA 4DK0A 3CCLB 1E1RA 1QG0A 1EFUA 1ZM2A 3SJPA 3CC2B 3FJOA 3T53B 4B3XA 2VJIA 3CESA 3OZUA 4WZTA 4X7FA 4RPBA 4X8IA 5HXBA 2I1LA 4XOPA 1AIPA 4QUZA 1YJ9B 1E63A 2F4NA 3A8KA 4YAOA 4FK8A 2XNJA 2HLDA 1VQ8B 2Q6IA 3FPPA 1HA3A 1BX0A 4OPOA 3CMEB 2X6XA 4K1XA 5J3OA 4Z1MA 1KD1D 4LBZA 1BLIA 4G7WA 4X7EA 1HZEA 3I55B 2XZLA 4NBSA 2VZLA 2Q6LA 5FNZA 1WOSA 3ES9A 1CNFA 4RD3A 1PJ6A 4FXUA 1YIJB 4Q7JB 4WWVA 1H42A 1TTTA 2OTLB 1N0UA 1WOOA 1ZM4A 2DERA 3W2EA 5H59A 3G6EB 4UZEA 4H9GA 4IW3B 2OBTA 1E43A 3H94A 2VBSA 5IYRA 5EMNA 1F60A 1AMOA 1KC8D 2GJPA 1W35A 4Z4UA 1IJEA 1D2EA 5A89A 5DS0A 4ACBA 3MCAA 2RC5A 1FNCA 3A1PA 3A3GA 4X07A 1SKYB 3CRZA 3BY1A 3W2IA 1OB5A 4U9UA 2Z6BD 1EFRA 1CNEA 3CPWB 4WZKA 5AN9A 2DIEA 2OK7A 4P26A 1FRQA 5IYWA 2VJJA 5IYPA 4M53A 1WSRA 2NV4A 4OOXA 1CQXA 4L8JA 5DN6A 3LQEA 1SKQA 1E3ZA 4LBWA 4RLZA 1PJ7A 2F43A 1W2BB 2J7KA 2E1BA
chains in the Genus database with same CATH topology
3ASPA 4Z4WA 5IYQA 4Z4RA 4P2NA 4RPDA 1IHMA 4OPVA 3SEJA 3SLNA 3R6KA 5E6TA 4P12A 4Z4VA 4QV2A 5BSXA 2ZL6A 4OP7A 4X0CA 4P1VA 3ASTA 5KW9A 4OPSA 3R6JA 4QVAA 3Q39A 4X05A 3PUMA 4RDKA 3SJPA 4WZTA 4X7FA 4RPBA 3SKBA 3ONUA 3PVDA 4QUZA 5F4MA 4X06A 4RM0A 5HZAA 2OBRA 3BY2A 4X7DA 4P3IA 4OPOA 4ROXA 5BSYA 3V7AA 5J3OA 3LQ6A 4X7CA 3D26A 4X7EA 3Q3AA 3Q38A 3PUNA 3PA1A 3Q6QA 3RY8A 4RDLA 4QVJA 5F4JA 3SLDA 4Z4TA 4P25A 2OBTA 5IYNA 3ONYA 4Z4SA 5IYRA 5F4OA 4OOSA 4Z4UA 4OOVA 4RDJA 4WZEA 5J35A 4WZLA 3PA2A 2ZL7A 4X07A 3BY1A 2OBSA 3ASRA 4WZKA 4P26A 5IYWA 5IYPA 3ASSA 3ASQA 4Z4ZA 4OOXA 4Z4YA 5HZBA 3LQEA 4RLZA 2ZL5A 3Q6RA 3BQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASP A;  4Z4W A;  5IYQ A;  4Z4R A;  4P2N A;  4RPD A;  1IHM A;  4OPV A;  3SEJ A;  3SLN A;  3R6K A;  5E6T A;  4P12 A;  4Z4V A;  4QV2 A;  5BSX A;  2ZL6 A;  4OP7 A;  4X0C A;  4P1V A;  3AST A;  5KW9 A;  4OPS A;  3R6J A;  4QVA A;  3Q39 A;  4X05 A;  3PUM A;  4RDK A;  3SJP A;  4WZT A;  4X7F A;  4RPB A;  3SKB A;  3ONU A;  3PVD A;  4QUZ A;  5F4M A;  4X06 A;  4RM0 A;  5HZA A;  2OBR A;  3BY2 A;  4X7D A;  4P3I A;  4OPO A;  4ROX A;  5BSY A;  3V7A A;  5J3O A;  3LQ6 A;  4X7C A;  3D26 A;  4X7E A;  3Q3A A;  3Q38 A;  3PUN A;  3PA1 A;  3Q6Q A;  3RY8 A;  4RDL A;  4QVJ A;  5F4J A;  3SLD A;  4Z4T A;  4P25 A;  2OBT A;  5IYN A;  3ONY A;  4Z4S A;  5IYR A;  5F4O A;  4OOS A;  4Z4U A;  4OOV A;  4RDJ A;  4WZE A;  5J35 A;  4WZL A;  3PA2 A;  2ZL7 A;  4X07 A;  3BY1 A;  2OBS A;  3ASR A;  4WZK A;  4P26 A;  5IYW A;  5IYP A;  3ASS A;  3ASQ A;  4Z4Z A;  4OOX A;  4Z4Y A;  5HZB A;  3LQE A;  4RLZ A;  2ZL5 A;  3Q6R A;  3BQJ A; 
#chains in the Genus database with same CATH topology
 2BM1 A;  3CCE B;  2YWF A;  2BVN A;  4XON A;  2PLF A;  4NCN A;  2V7Q A;  4RPD A;  1KK1 A;  1KK0 A;  3KEW A;  4P6V F;  4KKU A;  3A8I A;  4II2 A;  2R6H A;  3LNN A;  2DCU A;  5TY0 A;  4YAF A;  4OPV A;  1IB0 A;  2VBT A;  3G71 B;  3SEJ A;  3BC9 A;  3CXC B;  3GQB A;  1VQK B;  3JQR A;  2DEU A;  3WND A;  3A3B A;  4B43 A;  4Z4V A;  3SJZ A;  3CCQ B;  2YWH A;  1BJK A;  3OJW A;  4PC7 A;  1R5O A;  1EP2 B;  2BGI A;  4M2L A;  2C5B A;  1RQR A;  4P22 A;  2V7X A;  2D9R A;  2DOG A;  4TMV A;  2VNK A;  4BPR A;  3R6J A;  2V7U A;  1ZUN B;  2JJ1 A;  4QVA A;  3Q39 A;  4G5G A;  4PC3 A;  4TMW A;  3ZIA A;  4X05 A;  3A35 A;  2QA4 B;  1Q81 D;  3VNU A;  5CDF A;  2QDX A;  2X0K A;  1COW A;  2D3L A;  3KL9 A;  1YHQ B;  1TVC A;  1S72 B;  4E0F A;  1DG1 G;  2QMU A;  1QH0 A;  4RJL A;  2XNC A;  4RM0 A;  5HZA A;  2VNJ A;  3CPX A;  2BV3 A;  3LVB A;  4YAU A;  1W34 A;  1F20 A;  1EFC A;  2CRV A;  2D74 A;  1FNB A;  1QFY A;  3LQ6 A;  4HE5 A;  2X8K A;  3D26 A;  4B47 A;  4XM3 A;  3VO2 A;  3NE5 B;  2C4U A;  3QFR A;  2WYR A;  1QFZ A;  3PUN A;  3FPK A;  3OW7 A;  3WY9 A;  4XQF A;  4QFM A;  1T5E A;  1G7R A;  4PAB A;  1VQO B;  3VNV A;  1TLL A;  5LMZ A;  4YAL A;  3AVV A;  1OGJ A;  2FX3 A;  3OW2 B;  2BF4 A;  3SLD A;  1JB9 A;  3P26 A;  4AF7 A;  3E20 A;  4PC2 A;  4Z4T A;  1N8R D;  1B23 P;  3BCF A;  2V7V A;  4P25 A;  1VF7 A;  2ZTN A;  2C5H A;  3CCS B;  3B82 A;  1NBM A;  2GK6 A;  1V0F A;  2GK7 A;  1QVF B;  2NPF A;  3AVT A;  1VHO A;  4UZF A;  5F4O A;  4XLH A;  4ZGQ B;  4KKS A;  2C4T A;  1PJ5 A;  4RD1 A;  4B4D A;  1VQ4 B;  4RDJ A;  4WZE A;  3J81 k;  1BPL A;  1WP6 A;  1UD4 A;  4XOR A;  1G7T A;  2XOK A;  1H85 A;  3I56 B;  2JN9 A;  3CP8 A;  2PIA A;  1H8E A;  2W6J A;  4RD0 A;  2OK8 A;  4Y9U A;  1B2R A;  1QUF A;  1IJF A;  2VNI A;  1FND A;  3B78 A;  1FX0 A;  1UD8 A;  2PMD A;  3ASS A;  3ASQ A;  3AGQ A;  1OB2 A;  4PC6 A;  1K28 D;  3CTA A;  4Z4Y A;  3CP2 A;  3JU4 A;  4Y7C A;  3W5V A;  1WOR A;  3QSY A;  3WQZ A;  3OJX A;  3B8H A;  4NNJ A;  4PAA A;  5FO1 A;  2CBX A;  1EP3 B;  2P3M A;  3ASP A;  1VLO A;  4Z4W A;  2JJ2 A;  3ZBT A;  1E64 A;  2EFG A;  2ZBV A;  3Q6R A;  3QFS A;  1QUE A;  3U2Q A;  5GV7 A;  4HIZ A;  3OE7 A;  1RQP A;  3AVX A;  3OAA A;  4P3Y A;  1IHM A;  2EIX A;  2E1R A;  1NRK A;  3W2G A;  1QFJ A;  2W6I A;  5FA6 A;  3CC7 B;  4DK1 A;  1GO2 A;  5E6T A;  1XFO A;  4B48 A;  2XZP A;  2V31 A;  4WQM A;  4QV2 A;  1YI2 B;  4TN1 A;  2R9V A;  2V4D A;  2ZL6 A;  1I7P A;  3WBJ A;  2X3U A;  1EFT A;  1BQE A;  5GV8 A;  2QE7 A;  1BMF A;  1W87 A;  4XOT A;  1PKV A;  1QVG B;  2BGJ A;  4OPS A;  4AF6 A;  4N3N A;  1MRZ A;  1N0V C;  4RD4 A;  3W2H A;  4ZCI A;  3OFN A;  1WSV A;  1NDH A;  1UD2 A;  4RCY A;  1KQS B;  1M90 D;  3GVK A;  1T6Y A;  3W2F A;  1MAB A;  3LO8 A;  1UD3 A;  3QE2 A;  4XLA A;  5F4M A;  4ZGN B;  4P9S A;  1VQ6 B;  2VYQ A;  2QTL A;  1M1K D;  4LBV A;  2CC2 A;  2X6Y A;  3CMA B;  4G7X A;  4P3I A;  3VO1 A;  2DYI A;  4ROX A;  1DAR A;  3MMP A;  3ZZU A;  4PGO A;  4X7C A;  3QFT A;  1Y0Y A;  3BH4 A;  2ZXH A;  4J0Q A;  3Q3A A;  1W9X A;  3Q38 A;  2WJV A;  2WR8 A;  1T6X A;  2C77 A;  2ZTG A;  3PA1 A;  3Q6Q A;  1W0K A;  2PE3 A;  2GJK A;  3AGP A;  4M1K A;  3PEN A;  4XLF A;  4XLC A;  2GRE A;  1HVX A;  1WU8 A;  5F4J A;  1VHE A;  1DDI A;  2F1L A;  5DSZ A;  1XQB A;  2B7C A;  4LBY A;  3ZZT A;  3AVU A;  1Q86 D;  2ZZF A;  5FL7 A;  4GQN A;  3QFC A;  4M4S A;  4G1V A;  4Z4S A;  5THX A;  3OEH A;  2HDN B;  1JJ2 B;  4ZV4 A;  3ISX A;  4OOS A;  1YX2 A;  1YLO A;  2BN4 A;  4CQJ A;  1GVH A;  4OOV A;  4PC1 A;  4XMY A;  2WZP P;  4DNR B;  5J35 A;  1T6Z A;  2VBV A;  3BNW A;  5A88 A;  2AHO A;  1H8H A;  3CW2 A;  1E79 A;  3ZBU A;  3E1Y E;  5H5J A;  5A8A A;  2CND A;  4R71 A;  1WTH D;  4ZCM A;  2ZXI A;  3V76 A;  1DDG A;  1YJW B;  1JA1 A;  2WZN A;  4Z4Z A;  2HMA A;  3JQP A;  2M5S A;  2QTZ A;  4II3 A;  3W5H A;  4RD2 A;  3CCR B;  2DET A;  3W5U A;  3BCD A;  3ZZ0 A;  4ASU A;  3G05 A;  1E1Q A;  1Q9S A;  1J9Z A;  1EXM A;  2B7B A;  3BQJ A;  4JMQ A;  1FDR A;  4XLE A;  1D1N A;  2BM0 A;  5IYQ A;  4Z4R A;  2JIZ A;  4P2N A;  5TR9 A;  1KJZ A;  3AVY A;  1YJN B;  4KKT A;  3WNC A;  3CCV B;  1NJI D;  4B44 A;  4MYU A;  3SLN A;  1NB9 A;  2KVO A;  2ZIT A;  4UAJ A;  4TKO B;  4YEL A;  2X6W A;  2F1M A;  2VNH A;  1VQM B;  1N06 A;  4B3G A;  5KNL A;  1QX4 A;  4YAW A;  3OP1 A;  1Q7Y D;  4RCZ A;  4XNF A;  3WXM A;  1E3X A;  4LC0 A;  2QN6 A;  3JQQ A;  3AST A;  2BMW A;  2FVG A;  5KW9 A;  2QGG A;  2WSS A;  1K73 D;  3T51 B;  1KZL A;  3VR6 A;  1QGA A;  1JNY A;  3GSI A;  4N3G A;  3P27 A;  2D3N A;  4QHY A;  2B5O A;  1KK2 A;  3PUM A;  4RDK A;  1ZM3 A;  4XN0 A;  1OHH A;  1TUI A;  1V0E A;  1NB0 A;  4TMX A;  3ZUG A;  1WDT A;  3ZC3 A;  3SKB A;  3U6B A;  1A8P A;  3OKX A;  3ONU A;  1I8D A;  2VBU A;  3PVD A;  1XE1 A;  4DQK A;  1VQ5 B;  2XND A;  4X06 A;  2Q6O A;  4C0S A;  4ZCL A;  2GQF A;  1VJS A;  4YXW A;  2OBR A;  3BY2 A;  1UD5 A;  4X7D A;  4XR6 A;  1KK3 A;  2X85 A;  3H9N A;  1EWY A;  1SM4 A;  3OZW A;  2GJR A;  4MYT A;  1GAW A;  4G1B A;  1K9M D;  1GAQ A;  2OYN A;  5IK2 A;  1WPC A;  1KTV A;  3V7A A;  5BSY A;  3WBK A;  4ACA A;  1E62 A;  3CCJ B;  3U6K A;  2WJY A;  4XKV A;  1UMK A;  4HE6 A;  3RY8 A;  2C78 A;  4RDL A;  4QVJ A;  1FRN A;  2XEX A;  4M0L A;  1D8T A;  2ZZG A;  2XGJ A;  3OZV A;  4P6Y A;  2V7W A;  1R5B A;  1GJR A;  1EP1 B;  2YWG A;  1JA0 A;  1UD6 A;  5IYN A;  4TT3 A;  3ONY A;  3GVJ A;  1Y0R A;  1N08 A;  2ZBU A;  5TRD A;  1K8A D;  3HAG A;  4B3F X;  3CCU B;  1VQP B;  2YWE A;  3CC4 B;  1FNM A;  4EH1 A;  1U2R A;  3A8J A;  4WZL A;  3PA2 A;  2ZL7 A;  1VLY A;  1OB0 A;  2Q6K A;  3G4S B;  3CCM B;  2CW5 A;  2OBS A;  3ASR A;  2XZO A;  1GR1 A;  4XD7 A;  2HCJ B;  3AVW A;  3OOC A;  5FO0 A;  4DQL A;  3GIR A;  1KMH A;  1ELO A;  2BSA A;  3WYA A;  4C43 A;  1VQ7 B;  3GVL A;  4XKW A;  1N07 A;  1ZM9 A;  5HZB A;  1G7S A;  1KRH A;  2ZZE A;  1VQN B;  2RC6 A;  3DDY A;  2ZL5 A;  5HKK A;  1QGZ A;  2CF4 A;  5L46 A;  4FN5 A;  3OPO A;  5TV2 A;  4XN3 A;  1VQL B;  4YHB A;  2ZZQ A;  2CK3 A;  1W0J A;  1V5V A;  4XL9 A;  1N05 A;  1BX1 A;  4TSF A;  4F7D A;  4AC9 A;  5JBQ A;  3CD6 B;  2GPJ A;  1S4M A;  4DNT B;  1I18 A;  3T56 B;  5B6I A;  1OGI A;  1G7C A;  1XB2 A;  2DY1 A;  3FKS A;  2C2W A;  2V7T A;  3CB4 A;  4UZU A;  3VMF A;  4AVZ A;  1QGY A;  4G6I A;  1YIT B;  4TMT A;  4YEJ A;  1P4M A;  3R6K A;  4FWT A;  1R5N A;  5FIU A;  4TMZ A;  4P12 A;  3WNB A;  2WPD A;  5KSW B;  1S0U A;  2OTJ B;  2X53 S;  5BSX A;  1WOP A;  3ZPN A;  2QEX B;  4Y9R A;  4RD6 A;  4OP7 A;  3CMM A;  2BPO A;  2JDI A;  4X0C A;  1VQ9 B;  4P1V A;  3I1F A;  3OEE A;  1Q82 D;  3MHP A;  2LZJ A;  4DK0 A;  3CCL B;  1E1R A;  1QG0 A;  1EFU A;  1ZM2 A;  3SJP A;  3CC2 B;  3FJO A;  3T53 B;  4B3X A;  2VJI A;  3CES A;  3OZU A;  4WZT A;  4X7F A;  4RPB A;  4X8I A;  5HXB A;  2I1L A;  4XOP A;  1AIP A;  4QUZ A;  1YJ9 B;  1E63 A;  2F4N A;  3A8K A;  4YAO A;  4FK8 A;  2XNJ A;  2HLD A;  1VQ8 B;  2Q6I A;  3FPP A;  1HA3 A;  1BX0 A;  4OPO A;  3CME B;  2X6X A;  4K1X A;  5J3O A;  4Z1M A;  1KD1 D;  4LBZ A;  1BLI A;  4G7W A;  4X7E A;  1HZE A;  3I55 B;  2XZL A;  4NBS A;  2VZL A;  2Q6L A;  5FNZ A;  1WOS A;  3ES9 A;  1CNF A;  4RD3 A;  1PJ6 A;  4FXU A;  1YIJ B;  4Q7J B;  4WWV A;  1H42 A;  1TTT A;  2OTL B;  1N0U A;  1WOO A;  1ZM4 A;  2DER A;  3W2E A;  5H59 A;  3G6E B;  4UZE A;  4H9G A;  4IW3 B;  2OBT A;  1E43 A;  3H94 A;  2VBS A;  5IYR A;  5EMN A;  1F60 A;  1AMO A;  1KC8 D;  2GJP A;  1W35 A;  4Z4U A;  1IJE A;  1D2E A;  5A89 A;  5DS0 A;  4ACB A;  3MCA A;  2RC5 A;  1FNC A;  3A1P A;  3A3G A;  4X07 A;  1SKY B;  3CRZ A;  3BY1 A;  3W2I A;  1OB5 A;  4U9U A;  2Z6B D;  1EFR A;  1CNE A;  3CPW B;  4WZK A;  5AN9 A;  2DIE A;  2OK7 A;  4P26 A;  1FRQ A;  5IYW A;  2VJJ A;  5IYP A;  4M53 A;  1WSR A;  2NV4 A;  4OOX A;  1CQX A;  4L8J A;  5DN6 A;  3LQE A;  1SKQ A;  1E3Z A;  4LBW A;  4RLZ A;  1PJ7 A;  2F43 A;  1W2B B;  2J7K A;  2E1B A; 
#chains in the Genus database with same CATH homology
 3ASP A;  4Z4W A;  5IYQ A;  4Z4R A;  4P2N A;  4RPD A;  1IHM A;  4OPV A;  3SEJ A;  3SLN A;  3R6K A;  5E6T A;  4P12 A;  4Z4V A;  4QV2 A;  5BSX A;  2ZL6 A;  4OP7 A;  4X0C A;  4P1V A;  3AST A;  5KW9 A;  4OPS A;  3R6J A;  4QVA A;  3Q39 A;  4X05 A;  3PUM A;  4RDK A;  3SJP A;  4WZT A;  4X7F A;  4RPB A;  3SKB A;  3ONU A;  3PVD A;  4QUZ A;  5F4M A;  4X06 A;  4RM0 A;  5HZA A;  2OBR A;  3BY2 A;  4X7D A;  4P3I A;  4OPO A;  4ROX A;  5BSY A;  3V7A A;  5J3O A;  3LQ6 A;  4X7C A;  3D26 A;  4X7E A;  3Q3A A;  3Q38 A;  3PUN A;  3PA1 A;  3Q6Q A;  3RY8 A;  4RDL A;  4QVJ A;  5F4J A;  3SLD A;  4Z4T A;  4P25 A;  2OBT A;  5IYN A;  3ONY A;  4Z4S A;  5IYR A;  5F4O A;  4OOS A;  4Z4U A;  4OOV A;  4RDJ A;  4WZE A;  5J35 A;  4WZL A;  3PA2 A;  2ZL7 A;  4X07 A;  3BY1 A;  2OBS A;  3ASR A;  4WZK A;  4P26 A;  5IYW A;  5IYP A;  3ASS A;  3ASQ A;  4Z4Z A;  4OOX A;  4Z4Y A;  5HZB A;  3LQE A;  4RLZ A;  2ZL5 A;  3Q6R A;  3BQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...