5KW9A

Structural basis for norovirus neutralization by a hbga blocking human iga antibody
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
290
structure length
289
Chain Sequence
RPFTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSSITEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNASSGPQQLPINGVFVFVSWVSRFYQLKPVGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for norovirus neutralization by an HBGA blocking human IgA antibody.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Antiviral protein
molecule keywords Capsid protein VP1
total genus 64
structure length 289
sequence length 290
ec nomenclature
pdb deposition date 2016-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5kw9A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5kw9A01
3Q6RA 4Z4ZA 3ONYA 3SLDA 4X07A 5HZBA 3Q39A 3ASTA 4WZKA 4X7FA 2ZL6A 5F4MA 5J3OA 4P26A 4RDLA 5E6TA 2ZL5A 4RLZA 3ASSA 3ASQA 4OPSA 4P3IA 4OPOA 5F4JA 5BSXA 4X0CA 4Z4RA 3ASPA 5IYNA 3SJPA 3BQJA 3Q6QA 4RM0A 4OOVA 3SKBA 2OBTA 3BY1A 3R6KA 4Z4UA 5BSYA 3RY8A 5HZAA 3PUNA 3PVDA 4RPDA 4Z4SA 3LQ6A 4QVJA 4Z4WA 4Z4YA 5KW9A 4Z4VA 4WZTA 4P12A 4RDKA 5IYRA 5F4OA 3V7AA 4OPVA 5IYQA 4P1VA 2OBRA 4RPBA 4RDJA 4OOXA 4WZEA 3BY2A 2ZL7A 4X7CA 3LQEA 4P25A 5IYPA 1IHMA 3SLNA 3D26A 3Q3AA 3PA1A 3R6JA 5IYWA 4QVAA 4QUZA 4WZLA 5J35A 3PA2A 3SEJA 4X05A 3ASRA 4ROXA 4X7DA 2OBSA 4QV2A 3Q38A 4Z4TA 4X06A 3PUMA 3ONUA 4X7EA 4OP7A 4P2NA 4OOSA
chains in the Genus database with same CATH superfamily
1I8DA 2B5OA 4Z4ZA 4RD2A 2BGJA 1H8HA 5FO0A 4XKWA 1S0UA 1B23P 3FPKA 2B7BA 3LVBA 1BLIA 3W2IA 1HVXA 3Q39A 3ZZTA 1W35A 3W2FA 1HA3A 4CQJA 1EFTA 1K28D 2ZZEA 1WDTA 3QFRA 3B78A 4M53A 1TVCA 4XL9A 4PC7A 4X7FA 2ZL6A 1N08A 1WU8A 4KKSA 4RD0A 2VZLA 4P26A 3CMMA 4C43A 5E6TA 4LBZA 4B4DA 4XN3A 3ES9A 2V7XA 2X8KA 4OPSA 3WXMA 1KRHA 4OPOA 1YJNB 4HE5A 4X0CA 4UZFA 1NBMA 2WZNA 3AGPA 4G5GA 2EFGA 2Z6BD 1WPCA 1UD6A 1HZEA 1N05A 2XZPA 3AGQA 5THXA 1NRKA 4XD7A 2BM1A 3WQZA 1V0EA 4II2A 1FDRA 2GK7A 4UAJA 2WPDA 2ZXHA 4II3A 1G7SA 1H8EA 5IYNA 1VQLB 5LMZA 1VLOA 1YITB 2C2WA 4G1VA 3A3BA 3SKBA 2GJPA 4YXWA 3H94A 4XKVA 1VJSA 1WSVA 3BY1A 3OEHA 2QN6A 4N3GA 3KL9A 5BSYA 3RY8A 2BVNA 4Z4SA 2GJKA 2QMUA 3OE7A 1KK2A 3A1PA 1E79A 2JJ2A 1YHQB 4H9GA 5IK2A 4MYUA 4Z4VA 2XNCA 4TMWA 4WZTA 4ASUA 3AVUA 5IYRA 3V7AA 3CCRB 4OPVA 1J9ZA 5DS0A 1AIPA 2ZTGA 2KVOA 4M2LA 1QFZA 4RD4A 1EP1B 2OBRA 3JQQA 2JN9A 4Y9UA 4B43A 1D1NA 4TSFA 3CCVB 4PC3A 2X6WA 1WSRA 2J7KA 2JDIA 2C4TA 3OZVA 2C5BA 4TT3A 3OPOA 2WR8A 3CXCB 4NCNA 3P26A 3LQEA 1TLLA 2QTZA 3H9NA 1BPLA 4DQKA 5EMNA 2OK7A 2QTLA 1IHMA 3DDYA 1WORA 1IJEA 4RD3A 2GREA 3Q3AA 4L8JA 2HCJB 2V7UA 1FNMA 3J81k 1IB0A 3GVJA 3W2EA 1G7TA 3A35A 4XLFA 3BC9A 3KEWA 4QUZA 1QVGB 3CCUB 4RD6A 2W6IA 3B82A 3E20A 3PA2A 2DOGA 3A3GA 3MMPA 4DNTB 3ASRA 2W6JA 1VQ9B 1QGYA 2YWFA 4TMZA 3G05A 4Z1MA 1MABA 1T6ZA 2BM0A 3PENA 4NBSA 4Q7JB 4B47A 2BF4A 3QE2A 4TKOB 4ZCIA 2GJRA 4R71A 1UD3A 4ZV4A 3ONUA 1BJKA 1U2RA 2D3NA 2VBUA 1KK3A 2FVGA 3Q6RA 5FO1A 3ONYA 2X0KA 5DSZA 3AVTA 4Y7CA 4RCYA 3SLDA 2V7VA 4YALA 1KTVA 4EH1A 1DG1G 4WQMA 2VNHA 2GK6A 1B2RA 4IW3B 1CNFA 3A8IA 2CNDA 3CC2B 2V7TA 3BCDA 3VR6A 2CRVA 1OHHA 2E1RA 2VBVA 1E62A 3ASSA 1N06A 3BH4A 1M1KD 2DIEA 3WNBA 3JQRA 2ZTNA 1T6XA 2CF4A 4LBVA 1KMHA 4XLEA 2VJJA 5B6IA 3T56B 3CRZA 3I1FA 1E63A 3LNNA 3OEEA 5L46A 1QX4A 3CW2A 4HIZA 1RQRA 1FRQA 1ZM9A 3P27A 5KNLA 3U6BA 4RM0A 5FIUA 1E1RA 2QA4B 1EP2B 2XGJA 5GV7A 3CD6B 2M5SA 4JMQA 4LBYA 1H85A 1WOPA 4XN0A 1OGJA 4XLCA 3PVDA 2V4DA 1SKQA 1KK0A 4WWVA 1VQ4B 4YHBA 1VQKB 1G7RA 2DEUA 4Z4YA 1QFYA 2ZITA 4P6YA 2X3UA 1JB9A 2YWGA 1IJFA 3U2QA 4HE6A 1DARA 4ZCLA 4G1BA 2OTLB 1G7CA 4RD1A 5A88A 1EFRA 2Q6IA 2R6HA 2OYNA 2ZZQA 3CP8A 4P9SA 1CQXA 4TN1A 4RPBA 3ZBUA 2I1LA 1GAQA 1Y0YA 5A89A 4WZEA 1KK1A 1SM4A 1VF7A 3BY2A 3V76A 1UD4A 3W5UA 3W5VA 4NNJA 4X7CA 4FN5A 5IYPA 1DDIA 2RC6A 1NJID 1E3ZA 3AVXA 5HXBA 4TMTA 2QGGA 3OKXA 1F20A 4KKUA 4M0LA 1EWYA 3R6JA 5TRDA 1W0JA 3CCQB 3MCAA 4WZLA 3FJOA 1EXMA 2LZJA 3SEJA 2PLFA 3MHPA 4K1XA 1BX0A 3JQPA 2NPFA 4B3FX 2R9VA 5FA6A 4QV2A 1Q86D 3VNVA 1ZM3A 1Q82D 1VQ5B 2V7WA 2VBSA 2FX3A 3CB4A 4X06A 4ZCMA 1FNCA 1QGAA 4Y9RA 3GSIA 1M90D 4GQNA 3WNCA 3WBJA 4OP7A 3T51B 4XNFA 1JA1A 1I18A 5A8AA 1N8RD 2DY1A 4X07A 5HZBA 4AC9A 2YWHA 1EFUA 4P3YA 1QH0A 4XM3A 1XE1A 3ASTA 4WZKA 1VQPB 3CCMB 4F7DA 2WJYA 5FL7A 2BGIA 1VQOB 1V5VA 5F4MA 2OK8A 4FK8A 1S4MA 5J3OA 4J0QA 1ZM2A 1VQ7B 4U9UA 4RLZA 1R5OA 3GQBA 2HLDA 2X6YA 3I55B 1XFOA 2XNJA 4XLAA 4P3IA 1VLYA 1WOOA 3HAGA 3U6KA 2YWEA 3CMAB 1YX2A 4PAAA 5F4JA 1QG0A 4E0FA 5BSXA 4Z4RA 1E3XA 4XMYA 1W34A 1OB5A 2C4UA 4XORA 4PABA 2BN4A 2X85A 4FXUA 3VO2A 4PGOA 2XZLA 3WYAA 4MYTA 4BPRA 4ZGQB 1YJWB 3CCSB 2EIXA 1NB9A 1QVFB 2XEXA 2HMAA 4PC2A 3ZIAA 1KZLA 5AN9A 1PJ6A 3WNDA 4UZEA 2JJ1A 1CNEA 4N3NA 3W5HA 1TTTA 2VNKA 1I7PA 1OGIA 3B8HA 1UMKA 3R6KA 4Z4UA 1JA0A 1WP6A 1COWA 2PE3A 3OP1A 1JNYA 4LBWA 3ZUGA 2VJIA 3PUNA 4P6VF 5HZAA 4RPDA 3G4SB 2V7QA 2XOKA 3GVKA 3LQ6A 4QVJA 3E1YE 3W2HA 1K9MD 3T53B 2D9RA 4Z4WA 2RC5A 1MRZA 3LO8A 1XQBA 1K8AD 4B3GA 1UD2A 4P12A 4QFMA 5CDFA 5F4OA 1E64A 5IYQA 1QFJA 3QSYA 1BMFA 3FPPA 2V31A 2WJVA 2ZZFA 3QFSA 4AF6A 3CC7B 1SKYB 1GR1A 5JBQA 1VHEA 1GO2A 2XNDA 4XR6A 2ZL7A 2XZOA 3GVLA 2ZBVA 1S72B 2QDXA 1WOSA 2BV3A 2HDNB 3D26A 2Q6KA 4YAFA 4TMVA 1XB2A 2VNJA 1TUIA 4ACBA 1P4MA 2E1BA 2Q6OA 1VQNB 3OZWA 4QVAA 3VMFA 1R5BA 5J35A 1PKVA 1T6YA 2WZPP 1YLOA 2B7CA 4M4SA 2VYQA 1QGZA 4ROXA 4X7DA 1AMOA 3VNUA 4B48A 5HKKA 5TV2A 4DNRB 1W9XA 2PIAA 3Q38A 4Z4TA 1N0UA 4G6IA 4YELA 2VNIA 4X7EA 3OW2B 4RCZA 4B3XA 1D2EA 1ELOA 1KC8D 4ACAA 3CPWB 1EP3B 1NDHA 2X6XA 3SJZA 3ZPNA 3QFCA 2C5HA 1KJZA 4G7XA 2BMWA 3AVVA 4X8IA 4M1KA 5KSWB 1GJRA 3WY9A 1WTHD 3ZZUA 3OAAA 4RDLA 2ZL5A 2P3MA 3ASQA 2WSSA 2DYIA 2NV4A 3CESA 3OW7A 2DETA 1EFCA 4XONA 3CP2A 1Q81D 3NE5B 4YAOA 1W2BB 2F1MA 1Q9SA 3OOCA 2GQFA 1W87A 4P22A 4AVZA 4DK1A 1OB0A 1KQSB 1YJ9B 2ZZGA 5TR9A 1K73D 2C77A 3A8JA 2X53S 3ASPA 1BX1A 1FNDA 3SJPA 1DDGA 1NB0A 3BQJA 3Q6QA 2QEXB 3AVWA 1OB2A 4FWTA 1VQ6B 4YAUA 1VQ8B 3ISXA 2ZBUA 3GIRA 4OOVA 1E1QA 3CC4B 2OBTA 3JU4A 2BPOA 1BQEA 3CPXA 1ZM4A 1N07A 1YI2B 2F4NA 2OTJB 3QFTA 5DN6A 1PJ5A 2D3LA 1GVHA 4G7WA 3OFNA 4XOPA 3G6EB 1E43A 2ZXIA 2GPJA 3G71B 1V0FA 1VHOA 2C78A 5KW9A 3AVYA 4TMXA 4RDKA 5H5JA 1F60A 4UZUA 3OZUA 4P1VA 3BCFA 4RJLA 4YAWA 2BSAA 5TY0A 1FX0A 3FKSA 1Q7YD 4RDJA 1RQPA 4XLHA 4OOXA 1QUFA 2DCUA 4KKTA 3W2GA 4PC6A 3CCJB 1FRNA 3ZC3A 4DQLA 1UD8A 4YEJA 5H59A 4ZGNB 2D74A 2QE7A 1QUEA 4P25A 2AHOA 2CBXA 1JJ2B 1H42A 4XQFA 2WYRA 3SLNA 4LC0A 3ZZ0A 2CW5A 2F43A 4B44A 4C0SA 1D8TA 2JIZA 2CC2A 3PA1A 4QHYA 2Q6LA 3VO1A 5IYWA 3OJWA 1KD1D 3CMEB 2F1LA 3WBKA 3CTAA 1Y0RA 3OJXA 2VBTA 3CCEB 4X05A 2DERA 3CCLB 3BNWA 1R5NA 3I56B 1A8PA 1T5EA 2OBSA 4XOTA 1PJ7A 5GV8A 2CK3A 4AF7A 4DK0A 1GAWA 1FNBA 4PC1A 1VQMB 1UD5A 1N0VC 5FNZA 3PUMA 3ZBTA 3A8KA 1YIJB 1ZUNB 2PMDA 4P2NA 1W0KA 4OOSA
chains in the Genus database with same CATH topology
3Q6RA 4Z4ZA 3ONYA 3SLDA 4X07A 5HZBA 3Q39A 3ASTA 4WZKA 4X7FA 2ZL6A 5F4MA 5J3OA 4P26A 4RDLA 5E6TA 2ZL5A 4RLZA 3ASSA 3ASQA 4OPSA 4P3IA 4OPOA 5F4JA 5BSXA 4X0CA 4Z4RA 3ASPA 5IYNA 3SJPA 3BQJA 3Q6QA 4RM0A 4OOVA 3SKBA 2OBTA 3BY1A 3R6KA 4Z4UA 5BSYA 3RY8A 5HZAA 3PUNA 3PVDA 4RPDA 4Z4SA 3LQ6A 4QVJA 4Z4WA 4Z4YA 5KW9A 4Z4VA 4WZTA 4P12A 4RDKA 5IYRA 5F4OA 3V7AA 4OPVA 5IYQA 4P1VA 2OBRA 4RPBA 4RDJA 4OOXA 4WZEA 3BY2A 2ZL7A 4X7CA 3LQEA 4P25A 5IYPA 1IHMA 3SLNA 3D26A 3Q3AA 3PA1A 3R6JA 5IYWA 4QVAA 4QUZA 4WZLA 5J35A 3PA2A 3SEJA 4X05A 3ASRA 4ROXA 4X7DA 2OBSA 4QV2A 3Q38A 4Z4TA 4X06A 3PUMA 3ONUA 4X7EA 4OP7A 4P2NA 4OOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6R A;  4Z4Z A;  3ONY A;  3SLD A;  4X07 A;  5HZB A;  3Q39 A;  3AST A;  4WZK A;  4X7F A;  2ZL6 A;  5F4M A;  5J3O A;  4P26 A;  4RDL A;  5E6T A;  2ZL5 A;  4RLZ A;  3ASS A;  3ASQ A;  4OPS A;  4P3I A;  4OPO A;  5F4J A;  5BSX A;  4X0C A;  4Z4R A;  3ASP A;  5IYN A;  3SJP A;  3BQJ A;  3Q6Q A;  4RM0 A;  4OOV A;  3SKB A;  2OBT A;  3BY1 A;  3R6K A;  4Z4U A;  5BSY A;  3RY8 A;  5HZA A;  3PUN A;  3PVD A;  4RPD A;  4Z4S A;  3LQ6 A;  4QVJ A;  4Z4W A;  4Z4Y A;  5KW9 A;  4Z4V A;  4WZT A;  4P12 A;  4RDK A;  5IYR A;  5F4O A;  3V7A A;  4OPV A;  5IYQ A;  4P1V A;  2OBR A;  4RPB A;  4RDJ A;  4OOX A;  4WZE A;  3BY2 A;  2ZL7 A;  4X7C A;  3LQE A;  4P25 A;  5IYP A;  1IHM A;  3SLN A;  3D26 A;  3Q3A A;  3PA1 A;  3R6J A;  5IYW A;  4QVA A;  4QUZ A;  4WZL A;  5J35 A;  3PA2 A;  3SEJ A;  4X05 A;  3ASR A;  4ROX A;  4X7D A;  2OBS A;  4QV2 A;  3Q38 A;  4Z4T A;  4X06 A;  3PUM A;  3ONU A;  4X7E A;  4OP7 A;  4P2N A;  4OOS A; 
#chains in the Genus database with same CATH topology
 1I8D A;  2B5O A;  4Z4Z A;  4RD2 A;  2BGJ A;  1H8H A;  5FO0 A;  4XKW A;  1S0U A;  1B23 P;  3FPK A;  2B7B A;  3LVB A;  1BLI A;  3W2I A;  1HVX A;  3Q39 A;  3ZZT A;  1W35 A;  3W2F A;  1HA3 A;  4CQJ A;  1EFT A;  1K28 D;  2ZZE A;  1WDT A;  3QFR A;  3B78 A;  4M53 A;  1TVC A;  4XL9 A;  4PC7 A;  4X7F A;  2ZL6 A;  1N08 A;  1WU8 A;  4KKS A;  4RD0 A;  2VZL A;  4P26 A;  3CMM A;  4C43 A;  5E6T A;  4LBZ A;  4B4D A;  4XN3 A;  3ES9 A;  2V7X A;  2X8K A;  4OPS A;  3WXM A;  1KRH A;  4OPO A;  1YJN B;  4HE5 A;  4X0C A;  4UZF A;  1NBM A;  2WZN A;  3AGP A;  4G5G A;  2EFG A;  2Z6B D;  1WPC A;  1UD6 A;  1HZE A;  1N05 A;  2XZP A;  3AGQ A;  5THX A;  1NRK A;  4XD7 A;  2BM1 A;  3WQZ A;  1V0E A;  4II2 A;  1FDR A;  2GK7 A;  4UAJ A;  2WPD A;  2ZXH A;  4II3 A;  1G7S A;  1H8E A;  5IYN A;  1VQL B;  5LMZ A;  1VLO A;  1YIT B;  2C2W A;  4G1V A;  3A3B A;  3SKB A;  2GJP A;  4YXW A;  3H94 A;  4XKV A;  1VJS A;  1WSV A;  3BY1 A;  3OEH A;  2QN6 A;  4N3G A;  3KL9 A;  5BSY A;  3RY8 A;  2BVN A;  4Z4S A;  2GJK A;  2QMU A;  3OE7 A;  1KK2 A;  3A1P A;  1E79 A;  2JJ2 A;  1YHQ B;  4H9G A;  5IK2 A;  4MYU A;  4Z4V A;  2XNC A;  4TMW A;  4WZT A;  4ASU A;  3AVU A;  5IYR A;  3V7A A;  3CCR B;  4OPV A;  1J9Z A;  5DS0 A;  1AIP A;  2ZTG A;  2KVO A;  4M2L A;  1QFZ A;  4RD4 A;  1EP1 B;  2OBR A;  3JQQ A;  2JN9 A;  4Y9U A;  4B43 A;  1D1N A;  4TSF A;  3CCV B;  4PC3 A;  2X6W A;  1WSR A;  2J7K A;  2JDI A;  2C4T A;  3OZV A;  2C5B A;  4TT3 A;  3OPO A;  2WR8 A;  3CXC B;  4NCN A;  3P26 A;  3LQE A;  1TLL A;  2QTZ A;  3H9N A;  1BPL A;  4DQK A;  5EMN A;  2OK7 A;  2QTL A;  1IHM A;  3DDY A;  1WOR A;  1IJE A;  4RD3 A;  2GRE A;  3Q3A A;  4L8J A;  2HCJ B;  2V7U A;  1FNM A;  3J81 k;  1IB0 A;  3GVJ A;  3W2E A;  1G7T A;  3A35 A;  4XLF A;  3BC9 A;  3KEW A;  4QUZ A;  1QVG B;  3CCU B;  4RD6 A;  2W6I A;  3B82 A;  3E20 A;  3PA2 A;  2DOG A;  3A3G A;  3MMP A;  4DNT B;  3ASR A;  2W6J A;  1VQ9 B;  1QGY A;  2YWF A;  4TMZ A;  3G05 A;  4Z1M A;  1MAB A;  1T6Z A;  2BM0 A;  3PEN A;  4NBS A;  4Q7J B;  4B47 A;  2BF4 A;  3QE2 A;  4TKO B;  4ZCI A;  2GJR A;  4R71 A;  1UD3 A;  4ZV4 A;  3ONU A;  1BJK A;  1U2R A;  2D3N A;  2VBU A;  1KK3 A;  2FVG A;  3Q6R A;  5FO1 A;  3ONY A;  2X0K A;  5DSZ A;  3AVT A;  4Y7C A;  4RCY A;  3SLD A;  2V7V A;  4YAL A;  1KTV A;  4EH1 A;  1DG1 G;  4WQM A;  2VNH A;  2GK6 A;  1B2R A;  4IW3 B;  1CNF A;  3A8I A;  2CND A;  3CC2 B;  2V7T A;  3BCD A;  3VR6 A;  2CRV A;  1OHH A;  2E1R A;  2VBV A;  1E62 A;  3ASS A;  1N06 A;  3BH4 A;  1M1K D;  2DIE A;  3WNB A;  3JQR A;  2ZTN A;  1T6X A;  2CF4 A;  4LBV A;  1KMH A;  4XLE A;  2VJJ A;  5B6I A;  3T56 B;  3CRZ A;  3I1F A;  1E63 A;  3LNN A;  3OEE A;  5L46 A;  1QX4 A;  3CW2 A;  4HIZ A;  1RQR A;  1FRQ A;  1ZM9 A;  3P27 A;  5KNL A;  3U6B A;  4RM0 A;  5FIU A;  1E1R A;  2QA4 B;  1EP2 B;  2XGJ A;  5GV7 A;  3CD6 B;  2M5S A;  4JMQ A;  4LBY A;  1H85 A;  1WOP A;  4XN0 A;  1OGJ A;  4XLC A;  3PVD A;  2V4D A;  1SKQ A;  1KK0 A;  4WWV A;  1VQ4 B;  4YHB A;  1VQK B;  1G7R A;  2DEU A;  4Z4Y A;  1QFY A;  2ZIT A;  4P6Y A;  2X3U A;  1JB9 A;  2YWG A;  1IJF A;  3U2Q A;  4HE6 A;  1DAR A;  4ZCL A;  4G1B A;  2OTL B;  1G7C A;  4RD1 A;  5A88 A;  1EFR A;  2Q6I A;  2R6H A;  2OYN A;  2ZZQ A;  3CP8 A;  4P9S A;  1CQX A;  4TN1 A;  4RPB A;  3ZBU A;  2I1L A;  1GAQ A;  1Y0Y A;  5A89 A;  4WZE A;  1KK1 A;  1SM4 A;  1VF7 A;  3BY2 A;  3V76 A;  1UD4 A;  3W5U A;  3W5V A;  4NNJ A;  4X7C A;  4FN5 A;  5IYP A;  1DDI A;  2RC6 A;  1NJI D;  1E3Z A;  3AVX A;  5HXB A;  4TMT A;  2QGG A;  3OKX A;  1F20 A;  4KKU A;  4M0L A;  1EWY A;  3R6J A;  5TRD A;  1W0J A;  3CCQ B;  3MCA A;  4WZL A;  3FJO A;  1EXM A;  2LZJ A;  3SEJ A;  2PLF A;  3MHP A;  4K1X A;  1BX0 A;  3JQP A;  2NPF A;  4B3F X;  2R9V A;  5FA6 A;  4QV2 A;  1Q86 D;  3VNV A;  1ZM3 A;  1Q82 D;  1VQ5 B;  2V7W A;  2VBS A;  2FX3 A;  3CB4 A;  4X06 A;  4ZCM A;  1FNC A;  1QGA A;  4Y9R A;  3GSI A;  1M90 D;  4GQN A;  3WNC A;  3WBJ A;  4OP7 A;  3T51 B;  4XNF A;  1JA1 A;  1I18 A;  5A8A A;  1N8R D;  2DY1 A;  4X07 A;  5HZB A;  4AC9 A;  2YWH A;  1EFU A;  4P3Y A;  1QH0 A;  4XM3 A;  1XE1 A;  3AST A;  4WZK A;  1VQP B;  3CCM B;  4F7D A;  2WJY A;  5FL7 A;  2BGI A;  1VQO B;  1V5V A;  5F4M A;  2OK8 A;  4FK8 A;  1S4M A;  5J3O A;  4J0Q A;  1ZM2 A;  1VQ7 B;  4U9U A;  4RLZ A;  1R5O A;  3GQB A;  2HLD A;  2X6Y A;  3I55 B;  1XFO A;  2XNJ A;  4XLA A;  4P3I A;  1VLY A;  1WOO A;  3HAG A;  3U6K A;  2YWE A;  3CMA B;  1YX2 A;  4PAA A;  5F4J A;  1QG0 A;  4E0F A;  5BSX A;  4Z4R A;  1E3X A;  4XMY A;  1W34 A;  1OB5 A;  2C4U A;  4XOR A;  4PAB A;  2BN4 A;  2X85 A;  4FXU A;  3VO2 A;  4PGO A;  2XZL A;  3WYA A;  4MYT A;  4BPR A;  4ZGQ B;  1YJW B;  3CCS B;  2EIX A;  1NB9 A;  1QVF B;  2XEX A;  2HMA A;  4PC2 A;  3ZIA A;  1KZL A;  5AN9 A;  1PJ6 A;  3WND A;  4UZE A;  2JJ1 A;  1CNE A;  4N3N A;  3W5H A;  1TTT A;  2VNK A;  1I7P A;  1OGI A;  3B8H A;  1UMK A;  3R6K A;  4Z4U A;  1JA0 A;  1WP6 A;  1COW A;  2PE3 A;  3OP1 A;  1JNY A;  4LBW A;  3ZUG A;  2VJI A;  3PUN A;  4P6V F;  5HZA A;  4RPD A;  3G4S B;  2V7Q A;  2XOK A;  3GVK A;  3LQ6 A;  4QVJ A;  3E1Y E;  3W2H A;  1K9M D;  3T53 B;  2D9R A;  4Z4W A;  2RC5 A;  1MRZ A;  3LO8 A;  1XQB A;  1K8A D;  4B3G A;  1UD2 A;  4P12 A;  4QFM A;  5CDF A;  5F4O A;  1E64 A;  5IYQ A;  1QFJ A;  3QSY A;  1BMF A;  3FPP A;  2V31 A;  2WJV A;  2ZZF A;  3QFS A;  4AF6 A;  3CC7 B;  1SKY B;  1GR1 A;  5JBQ A;  1VHE A;  1GO2 A;  2XND A;  4XR6 A;  2ZL7 A;  2XZO A;  3GVL A;  2ZBV A;  1S72 B;  2QDX A;  1WOS A;  2BV3 A;  2HDN B;  3D26 A;  2Q6K A;  4YAF A;  4TMV A;  1XB2 A;  2VNJ A;  1TUI A;  4ACB A;  1P4M A;  2E1B A;  2Q6O A;  1VQN B;  3OZW A;  4QVA A;  3VMF A;  1R5B A;  5J35 A;  1PKV A;  1T6Y A;  2WZP P;  1YLO A;  2B7C A;  4M4S A;  2VYQ A;  1QGZ A;  4ROX A;  4X7D A;  1AMO A;  3VNU A;  4B48 A;  5HKK A;  5TV2 A;  4DNR B;  1W9X A;  2PIA A;  3Q38 A;  4Z4T A;  1N0U A;  4G6I A;  4YEL A;  2VNI A;  4X7E A;  3OW2 B;  4RCZ A;  4B3X A;  1D2E A;  1ELO A;  1KC8 D;  4ACA A;  3CPW B;  1EP3 B;  1NDH A;  2X6X A;  3SJZ A;  3ZPN A;  3QFC A;  2C5H A;  1KJZ A;  4G7X A;  2BMW A;  3AVV A;  4X8I A;  4M1K A;  5KSW B;  1GJR A;  3WY9 A;  1WTH D;  3ZZU A;  3OAA A;  4RDL A;  2ZL5 A;  2P3M A;  3ASQ A;  2WSS A;  2DYI A;  2NV4 A;  3CES A;  3OW7 A;  2DET A;  1EFC A;  4XON A;  3CP2 A;  1Q81 D;  3NE5 B;  4YAO A;  1W2B B;  2F1M A;  1Q9S A;  3OOC A;  2GQF A;  1W87 A;  4P22 A;  4AVZ A;  4DK1 A;  1OB0 A;  1KQS B;  1YJ9 B;  2ZZG A;  5TR9 A;  1K73 D;  2C77 A;  3A8J A;  2X53 S;  3ASP A;  1BX1 A;  1FND A;  3SJP A;  1DDG A;  1NB0 A;  3BQJ A;  3Q6Q A;  2QEX B;  3AVW A;  1OB2 A;  4FWT A;  1VQ6 B;  4YAU A;  1VQ8 B;  3ISX A;  2ZBU A;  3GIR A;  4OOV A;  1E1Q A;  3CC4 B;  2OBT A;  3JU4 A;  2BPO A;  1BQE A;  3CPX A;  1ZM4 A;  1N07 A;  1YI2 B;  2F4N A;  2OTJ B;  3QFT A;  5DN6 A;  1PJ5 A;  2D3L A;  1GVH A;  4G7W A;  3OFN A;  4XOP A;  3G6E B;  1E43 A;  2ZXI A;  2GPJ A;  3G71 B;  1V0F A;  1VHO A;  2C78 A;  5KW9 A;  3AVY A;  4TMX A;  4RDK A;  5H5J A;  1F60 A;  4UZU A;  3OZU A;  4P1V A;  3BCF A;  4RJL A;  4YAW A;  2BSA A;  5TY0 A;  1FX0 A;  3FKS A;  1Q7Y D;  4RDJ A;  1RQP A;  4XLH A;  4OOX A;  1QUF A;  2DCU A;  4KKT A;  3W2G A;  4PC6 A;  3CCJ B;  1FRN A;  3ZC3 A;  4DQL A;  1UD8 A;  4YEJ A;  5H59 A;  4ZGN B;  2D74 A;  2QE7 A;  1QUE A;  4P25 A;  2AHO A;  2CBX A;  1JJ2 B;  1H42 A;  4XQF A;  2WYR A;  3SLN A;  4LC0 A;  3ZZ0 A;  2CW5 A;  2F43 A;  4B44 A;  4C0S A;  1D8T A;  2JIZ A;  2CC2 A;  3PA1 A;  4QHY A;  2Q6L A;  3VO1 A;  5IYW A;  3OJW A;  1KD1 D;  3CME B;  2F1L A;  3WBK A;  3CTA A;  1Y0R A;  3OJX A;  2VBT A;  3CCE B;  4X05 A;  2DER A;  3CCL B;  3BNW A;  1R5N A;  3I56 B;  1A8P A;  1T5E A;  2OBS A;  4XOT A;  1PJ7 A;  5GV8 A;  2CK3 A;  4AF7 A;  4DK0 A;  1GAW A;  1FNB A;  4PC1 A;  1VQM B;  1UD5 A;  1N0V C;  5FNZ A;  3PUM A;  3ZBT A;  3A8K A;  1YIJ B;  1ZUN B;  2PMD A;  4P2N A;  1W0K A;  4OOS A; 
#chains in the Genus database with same CATH homology
 3Q6R A;  4Z4Z A;  3ONY A;  3SLD A;  4X07 A;  5HZB A;  3Q39 A;  3AST A;  4WZK A;  4X7F A;  2ZL6 A;  5F4M A;  5J3O A;  4P26 A;  4RDL A;  5E6T A;  2ZL5 A;  4RLZ A;  3ASS A;  3ASQ A;  4OPS A;  4P3I A;  4OPO A;  5F4J A;  5BSX A;  4X0C A;  4Z4R A;  3ASP A;  5IYN A;  3SJP A;  3BQJ A;  3Q6Q A;  4RM0 A;  4OOV A;  3SKB A;  2OBT A;  3BY1 A;  3R6K A;  4Z4U A;  5BSY A;  3RY8 A;  5HZA A;  3PUN A;  3PVD A;  4RPD A;  4Z4S A;  3LQ6 A;  4QVJ A;  4Z4W A;  4Z4Y A;  5KW9 A;  4Z4V A;  4WZT A;  4P12 A;  4RDK A;  5IYR A;  5F4O A;  3V7A A;  4OPV A;  5IYQ A;  4P1V A;  2OBR A;  4RPB A;  4RDJ A;  4OOX A;  4WZE A;  3BY2 A;  2ZL7 A;  4X7C A;  3LQE A;  4P25 A;  5IYP A;  1IHM A;  3SLN A;  3D26 A;  3Q3A A;  3PA1 A;  3R6J A;  5IYW A;  4QVA A;  4QUZ A;  4WZL A;  5J35 A;  3PA2 A;  3SEJ A;  4X05 A;  3ASR A;  4ROX A;  4X7D A;  2OBS A;  4QV2 A;  3Q38 A;  4Z4T A;  4X06 A;  3PUM A;  3ONU A;  4X7E A;  4OP7 A;  4P2N A;  4OOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...