5KW9A

Structural basis for norovirus neutralization by a hbga blocking human iga antibody
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
290
structure length
289
Chain Sequence
RPFTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSSITEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNASSGPQQLPINGVFVFVSWVSRFYQLKPVGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Structural basis for norovirus neutralization by an HBGA blocking human IgA antibody.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Antiviral protein
total genus 64
structure length 289
sequence length 290
ec nomenclature
pdb deposition date 2016-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5kw9A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5kw9A01
3PVDA 4RPBA 4X7DA 4OOXA 4X7CA 4OPOA 4Z4TA 3SEJA 3ASPA 4RDLA 3Q3AA 4X7EA 1IHMA 3Q6RA 4QVJA 3R6KA 5BSXA 4RDJA 2OBRA 4X07A 5IYPA 5IYRA 3SLDA 5F4OA 3SJPA 4X7FA 3LQ6A 5HZAA 3PUNA 4Z4SA 5F4JA 2OBSA 4P12A 4OP7A 3ASTA 5IYQA 5IYNA 4RDKA 4QUZA 3ASRA 2ZL6A 2OBTA 4X0CA 4Z4ZA 4Z4YA 2ZL7A 4OOVA 3R6JA 3RY8A 4Z4WA 4ROXA 4X06A 4Z4UA 4OPSA 3ASQA 4QV2A 4WZEA 4Z4VA 3BQJA 3ASSA 4P26A 3ONYA 3SLNA 5BSYA 2ZL5A 5HZBA 3V7AA 5F4MA 3BY1A 4WZLA 4P25A 3PUMA 4Z4RA 3LQEA 4RLZA 4P3IA 3Q38A 4WZKA 3D26A 3PA2A 5J35A 5IYWA 4RPDA 4X05A 4QVAA 3Q39A 4OPVA 5J3OA 4RM0A 3SKBA 3Q6QA 4WZTA 3ONUA 3PA1A 4P1VA 4OOSA 5KW9A 3BY2A 5E6TA 4P2NA
chains in the Genus database with same CATH superfamily
4X8IA 1UD3A 2B5OA 1QGYA 2V7VA 4DNTB 4AF6A 3CD6B 3GVLA 4UAJA 2W6IA 4TMXA 2P3MA 2NPFA 2YWGA 4X7CA 4EH1A 1WTHD 1CNEA 3WNDA 4RDLA 2D3LA 1PJ5A 2F1LA 5AN9A 4JMQA 3Q3AA 1VQMB 1BQEA 4FN5A 1OGJA 1DDGA 2V7XA 1K73D 4QVJA 3MCAA 1BX0A 1T6ZA 3LNNA 3VO2A 1W9XA 1N0UA 3OAAA 4RDJA 5DSZA 4TMTA 4FXUA 1SKQA 5THXA 4IW3B 1BJKA 2D9RA 2YWHA 1D2EA 1CNFA 2C78A 3SLDA 2ZZFA 3W2IA 4E0FA 4ZV4A 3QE2A 2BVNA 3GSIA 2XGJA 2XZLA 3SJPA 4Y9UA 2V7WA 3LQ6A 1FNCA 2RC6A 3WBKA 4PC1A 4RD2A 1N0VC 3JQPA 4PC2A 3OJWA 1VQ9B 5HZAA 2JJ1A 4YHBA 1VQNB 3I1FA 2BSAA 1YJNB 1G7TA 2WJYA 4Z4SA 3CCEB 1FNMA 1VHOA 2KVOA 5TR9A 1FX0A 1E3ZA 4M4SA 1N8RD 1KK1A 2BN4A 5IYQA 1DDIA 5A88A 4ZGQB 3AVYA 5IYNA 2J7KA 1OB0A 4RD4A 4Z4ZA 3ASRA 4TKOB 2E1BA 2F1MA 2QEXB 4L8JA 1VLYA 2V7QA 4XLCA 3A8KA 3CCVB 2OTLB 4XN3A 4YAWA 1EFTA 4J0QA 3AVXA 4ROXA 1TTTA 3OZUA 1WSRA 3CCLB 2PE3A 4Y7CA 1OB5A 4QV2A 4UZUA 4XLHA 4NCNA 1VQKB 1E1QA 3ZC3A 4XN0A 2I1LA 3CC7B 3ONYA 3SLNA 1VHEA 3WY9A 2ZL5A 1VQLB 1K28D 3E1YE 4P6VF 5HKKA 3WQZA 4LBVA 3BY1A 1FRQA 4WZLA 2HDNB 3PUMA 3ES9A 2WSSA 4DK1A 3LQEA 3OP1A 4CQJA 4QHYA 1KQSB 1Y0RA 2VNJA 3T56B 3MHPA 4TSFA 3OPOA 1OGIA 1ZM3A 1QGAA 2GPJA 2F4NA 4KKSA 3G71B 3FJOA 4ZCIA 4XQFA 1ZM9A 1VLOA 4G5GA 4OPVA 3CC4B 3OZVA 1ZM2A 3CPXA 2WPDA 3BC9A 5L46A 1TVCA 1UD4A 2AHOA 2C4UA 2JN9A 4R71A 3FPPA 5IK2A 2V4DA 4B48A 2XZPA 1UD5A 1QG0A 2D74A 3W5UA 1VQ8B 4P2NA 1H8HA 3PVDA 3ZUGA 1QUFA 2DYIA 3T51B 1OHHA 3E20A 1KK2A 3U6KA 1N05A 2HCJB 1VQPB 2HLDA 1H42A 1EP3B 3Q6RA 3B78A 4YAOA 3WBJA 1T5EA 2DEUA 5EMNA 1H8EA 1UD6A 2ZZQA 4Y9RA 2BM1A 2PIAA 3JU4A 1W35A 3A8IA 1ELOA 1VQ4B 3G4SB 3ZZ0A 2DCUA 2ZBVA 4YXWA 1QX4A 2Z6BD 1SM4A 2R9VA 2CBXA 3HAGA 4LBYA 1WORA 4FK8A 5TRDA 4Q7JB 1VJSA 2BPOA 1SKYB 2X3UA 4XR6A 2GJKA 3CTAA 2OBSA 5F4JA 2ZITA 1NBMA 2GQFA 2ZTGA 1KD1D 4M53A 1BLIA 1S0UA 1EFCA 1EXMA 1Q81D 3ASTA 1E3XA 1JNYA 1G7CA 4TMWA 3CPWB 2QN6A 1D8TA 4XOTA 2JJ2A 3VNVA 2OBTA 1EFUA 2ZZGA 3VR6A 3AVVA 1EP1B 4NBSA 2ZL7A 1S72B 2DIEA 5A8AA 3MMPA 1I18A 2R6HA 4RD3A 2CNDA 1PKVA 4YAUA 4PABA 4RJLA 4X06A 4Z4UA 3CCMB 1VQOB 1B23P 3OOCA 5H59A 2EIXA 3WNBA 3ASQA 1KMHA 4WZEA 2VYQA 2VBTA 3AGQA 4RD1A 1GO2A 4Z4VA 3BQJA 2GJPA 1AMOA 3A1PA 5FIUA 1Q7YD 3AVUA 4YELA 5BSYA 5HZBA 2Q6OA 3CP2A 1TLLA 3B82A 4B3FX 4K1XA 3I55B 5B6IA 1QVFB 3CP8A 1DG1G 3OE7A 4YALA 3BNWA 3QFRA 3ZZUA 2PLFA 4Z4RA 1YITB 1H85A 2X6XA 4RLZA 1QVGB 2BF4A 2Q6IA 2C5BA 4MYUA 3Q38A 1NJID 3G05A 1GAQA 2NV4A 2BV3A 3PA2A 5IYWA 2GK7A 4UZEA 2WR8A 1JJ2B 1K9MD 3U6BA 5JBQA 2ZXHA 3A35A 2B7CA 2EFGA 3H9NA 1W0JA 5FO1A 1P4MA 2CF4A 2JDIA 2WZNA 1YJWB 2CK3A 3ONUA 1KK3A 1YHQB 1IJFA 1V5VA 1NB9A 1I8DA 1GJRA 1U2RA 3BCDA 4XONA 1GR1A 1PJ7A 4TT3A 2D3NA 1KK0A 1QFZA 5GV7A 1MRZA 3CCUB 1K8AD 4B44A 3AVTA 1KTVA 4XNFA 5DN6A 4RCYA 4X7DA 3VO1A 3A8JA 4M1KA 4OOXA 4M2LA 4Z4TA 1EWYA 1WP6A 3NE5B 4TMVA 2GJRA 5FA6A 4HE6A 3ASPA 1YIJB 1IJEA 2CW5A 4G6IA 4X7EA 1NDHA 2QMUA 1E43A 1VF7A 2C77A 4GQNA 3FKSA 3T53B 2LZJA 3R6KA 5BSXA 1Q9SA 2OBRA 5IYRA 1V0FA 1E64A 1UD8A 4AF7A 2VBUA 1BMFA 4XD7A 3CMAB 4G7WA 1N06A 1HA3A 1ZUNB 1W34A 4WWVA 3CC2B 4Z1MA 1FNDA 1YX2A 4C0SA 4II2A 3PUNA 2V7UA 2CRVA 3BCFA 3QSYA 1PJ6A 2VBSA 3ZBTA 4P3YA 1RQPA 5TV2A 1GAWA 1BPLA 1JA1A 3ZIAA 4DQKA 3KL9A 4XLFA 1KJZA 1FRNA 1YI2B 3P26A 4AC9A 4RCZA 2CC2A 4PGOA 1W0KA 4Z4YA 2XOKA 1VQ7B 1WOSA 3AGPA 3CCJB 4B47A 2Q6KA 2FVGA 2GREA 1XQBA 1QUEA 2X0KA 4OOVA 2DERA 3CW2A 2X53S 3W5VA 2M5SA 4MYTA 4LC0A 4G1VA 2BM0A 2VBVA 2X85A 4Z4WA 1UMKA 1R5OA 2VNIA 4B4DA 4PAAA 1M1KD 4B43A 1E63A 2W6JA 2YWFA 3SJZA 2VZLA 4F7DA 1Q82D 3AVWA 3PENA 2XZOA 3CCQB 4HE5A 3V7AA 2VJIA 2X6WA 5F4MA 1I7PA 4B3XA 4KKUA 2V31A 1WPCA 5FL7A 3ZBUA 2C4TA 2RC5A 1ZM4A 2DY1A 2QTLA 2VJJA 2OK7A 4PC7A 4P3IA 3CB4A 1UD2A 4WZKA 4G1BA 5J35A 3U2QA 1VQ5B 4P22A 4WQMA 1AIPA 1OB2A 4PC3A 4QVAA 5KSWB 3Q39A 1QFJA 5HXBA 4FWTA 3ISXA 1IB0A 4RM0A 3JQRA 2XNJA 3SKBA 2DETA 1FNBA 2GK6A 4WZTA 4ACBA 1R5NA 2X6YA 3G6EB 3CRZA 3W2EA 1JB9A 2ZBUA 4LBWA 2ZTNA 3GQBA 4P1VA 1HZEA 3QFSA 5FNZA 4ZCLA 3OJXA 3W2FA 3WNCA 2QGGA 1F20A 4G7XA 1WSVA 3W2HA 2QE7A 3WYAA 1D1NA 1WDTA 2QDXA 3JQQA 1V0EA 4II3A 1BX1A 3GIRA 4QFMA 4RPBA 5KNLA 5DS0A 4U9UA 4PC6A 1Y0YA 3FPKA 4RD6A 1W2BB 1DARA 2F43A 4XKVA 4OPOA 3SEJA 1E62A 3VMFA 3W2GA 3GVJA 3ZPNA 1TUIA 2PMDA 3ZZTA 3OEHA 4DK0A 2B7BA 1IHMA 1YLOA 3LO8A 3CMMA 2XEXA 3QFTA 1QGZA 3OEEA 4X07A 5IYPA 4ASUA 2WZPP 3CXCB 1N08A 5H5JA 1HVXA 5F4OA 3OZWA 1JA0A 5FO0A 4DQLA 2WYRA 1NB0A 4HIZA 5TY0A 5LMZA 3OW7A 2VNHA 4X7FA 4NNJA 4P6YA 3H94A 4YAFA 1YJ9B 1XB2A 2HMAA 3A3BA 4N3NA 4C43A 4XMYA 1Q86D 1T6YA 2ZXIA 1J9ZA 4P12A 4B3GA 4OP7A 5GV8A 5A89A 1WOOA 2QA4B 4BPRA 1WOPA 1KC8D 5CDFA 4RDKA 4QUZA 4X0CA 2ZL6A 3KEWA 4XLEA 4XM3A 4YEJA 1S4MA 2XNCA 4LBZA 4ZCMA 1KRHA 1NRKA 2QTZA 1COWA 1G7RA 3CMEB 4RD0A 3R6JA 2X8KA 3RY8A 2OTJB 4XLAA 4N3GA 3WXMA 4DNRB 4ZGNB 4TMZA 2OK8A 1R5BA 1MABA 2C2WA 4OPSA 4XKWA 4P9SA 4H9GA 3OFNA 4AVZA 1RQRA 3ASSA 3QFCA 4P26A 2VNKA 1M90D 1G7SA 2C5HA 1WU8A 3J81k 2XNDA 3BH4A 4UZFA 4XL9A 4XORA 3GVKA 4P25A 4XOPA 2E1RA 1E79A 1CQXA 1GVHA 1EFRA 3A3GA 1A8PA 2OYNA 1W87A 1N07A 3CCSB 3I56B 3VNUA 3V76A 1E1RA 3DDYA 1QH0A 2JIZA 1QFYA 3D26A 3P27A 2BMWA 2ZZEA 4RPDA 2FX3A 4X05A 1VQ6B 3LVBA 3OW2B 5J3OA 1F60A 3Q6QA 2BGJA 2WJVA 1B2RA 1XE1A 3OKXA 3PA1A 2DOGA 3CESA 4TN1A 2V7TA 1XFOA 4M0LA 3CCRB 3B8HA 1FDRA 4OOSA 2Q6LA 4KKTA 1EP2B 3W5HA 2BGIA 2YWEA 5KW9A 4ACAA 1T6XA 3BY2A 1KZLA 5E6TA
chains in the Genus database with same CATH topology
3PVDA 4RPBA 4X7DA 4OOXA 4X7CA 4OPOA 4Z4TA 3SEJA 3ASPA 4RDLA 3Q3AA 4X7EA 1IHMA 3Q6RA 4QVJA 3R6KA 5BSXA 4RDJA 2OBRA 4X07A 5IYPA 5IYRA 3SLDA 5F4OA 3SJPA 4X7FA 3LQ6A 5HZAA 3PUNA 4Z4SA 5F4JA 2OBSA 4P12A 4OP7A 3ASTA 5IYQA 5IYNA 4RDKA 4QUZA 3ASRA 2ZL6A 2OBTA 4X0CA 4Z4ZA 4Z4YA 2ZL7A 4OOVA 3R6JA 3RY8A 4Z4WA 4ROXA 4X06A 4Z4UA 4OPSA 3ASQA 4QV2A 4WZEA 4Z4VA 3BQJA 3ASSA 4P26A 3ONYA 3SLNA 5BSYA 2ZL5A 5HZBA 3V7AA 5F4MA 3BY1A 4WZLA 4P25A 3PUMA 4Z4RA 3LQEA 4RLZA 4P3IA 3Q38A 4WZKA 3D26A 3PA2A 5J35A 5IYWA 4RPDA 4X05A 4QVAA 3Q39A 4OPVA 5J3OA 4RM0A 3SKBA 3Q6QA 4WZTA 3ONUA 3PA1A 4P1VA 4OOSA 5KW9A 3BY2A 5E6TA 4P2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVD A;  4RPB A;  4X7D A;  4OOX A;  4X7C A;  4OPO A;  4Z4T A;  3SEJ A;  3ASP A;  4RDL A;  3Q3A A;  4X7E A;  1IHM A;  3Q6R A;  4QVJ A;  3R6K A;  5BSX A;  4RDJ A;  2OBR A;  4X07 A;  5IYP A;  5IYR A;  3SLD A;  5F4O A;  3SJP A;  4X7F A;  3LQ6 A;  5HZA A;  3PUN A;  4Z4S A;  5F4J A;  2OBS A;  4P12 A;  4OP7 A;  3AST A;  5IYQ A;  5IYN A;  4RDK A;  4QUZ A;  3ASR A;  2ZL6 A;  2OBT A;  4X0C A;  4Z4Z A;  4Z4Y A;  2ZL7 A;  4OOV A;  3R6J A;  3RY8 A;  4Z4W A;  4ROX A;  4X06 A;  4Z4U A;  4OPS A;  3ASQ A;  4QV2 A;  4WZE A;  4Z4V A;  3BQJ A;  3ASS A;  4P26 A;  3ONY A;  3SLN A;  5BSY A;  2ZL5 A;  5HZB A;  3V7A A;  5F4M A;  3BY1 A;  4WZL A;  4P25 A;  3PUM A;  4Z4R A;  3LQE A;  4RLZ A;  4P3I A;  3Q38 A;  4WZK A;  3D26 A;  3PA2 A;  5J35 A;  5IYW A;  4RPD A;  4X05 A;  4QVA A;  3Q39 A;  4OPV A;  5J3O A;  4RM0 A;  3SKB A;  3Q6Q A;  4WZT A;  3ONU A;  3PA1 A;  4P1V A;  4OOS A;  5KW9 A;  3BY2 A;  5E6T A;  4P2N A; 
#chains in the Genus database with same CATH topology
 4X8I A;  1UD3 A;  2B5O A;  1QGY A;  2V7V A;  4DNT B;  4AF6 A;  3CD6 B;  3GVL A;  4UAJ A;  2W6I A;  4TMX A;  2P3M A;  2NPF A;  2YWG A;  4X7C A;  4EH1 A;  1WTH D;  1CNE A;  3WND A;  4RDL A;  2D3L A;  1PJ5 A;  2F1L A;  5AN9 A;  4JMQ A;  3Q3A A;  1VQM B;  1BQE A;  4FN5 A;  1OGJ A;  1DDG A;  2V7X A;  1K73 D;  4QVJ A;  3MCA A;  1BX0 A;  1T6Z A;  3LNN A;  3VO2 A;  1W9X A;  1N0U A;  3OAA A;  4RDJ A;  5DSZ A;  4TMT A;  4FXU A;  1SKQ A;  5THX A;  4IW3 B;  1BJK A;  2D9R A;  2YWH A;  1D2E A;  1CNF A;  2C78 A;  3SLD A;  2ZZF A;  3W2I A;  4E0F A;  4ZV4 A;  3QE2 A;  2BVN A;  3GSI A;  2XGJ A;  2XZL A;  3SJP A;  4Y9U A;  2V7W A;  3LQ6 A;  1FNC A;  2RC6 A;  3WBK A;  4PC1 A;  4RD2 A;  1N0V C;  3JQP A;  4PC2 A;  3OJW A;  1VQ9 B;  5HZA A;  2JJ1 A;  4YHB A;  1VQN B;  3I1F A;  2BSA A;  1YJN B;  1G7T A;  2WJY A;  4Z4S A;  3CCE B;  1FNM A;  1VHO A;  2KVO A;  5TR9 A;  1FX0 A;  1E3Z A;  4M4S A;  1N8R D;  1KK1 A;  2BN4 A;  5IYQ A;  1DDI A;  5A88 A;  4ZGQ B;  3AVY A;  5IYN A;  2J7K A;  1OB0 A;  4RD4 A;  4Z4Z A;  3ASR A;  4TKO B;  2E1B A;  2F1M A;  2QEX B;  4L8J A;  1VLY A;  2V7Q A;  4XLC A;  3A8K A;  3CCV B;  2OTL B;  4XN3 A;  4YAW A;  1EFT A;  4J0Q A;  3AVX A;  4ROX A;  1TTT A;  3OZU A;  1WSR A;  3CCL B;  2PE3 A;  4Y7C A;  1OB5 A;  4QV2 A;  4UZU A;  4XLH A;  4NCN A;  1VQK B;  1E1Q A;  3ZC3 A;  4XN0 A;  2I1L A;  3CC7 B;  3ONY A;  3SLN A;  1VHE A;  3WY9 A;  2ZL5 A;  1VQL B;  1K28 D;  3E1Y E;  4P6V F;  5HKK A;  3WQZ A;  4LBV A;  3BY1 A;  1FRQ A;  4WZL A;  2HDN B;  3PUM A;  3ES9 A;  2WSS A;  4DK1 A;  3LQE A;  3OP1 A;  4CQJ A;  4QHY A;  1KQS B;  1Y0R A;  2VNJ A;  3T56 B;  3MHP A;  4TSF A;  3OPO A;  1OGI A;  1ZM3 A;  1QGA A;  2GPJ A;  2F4N A;  4KKS A;  3G71 B;  3FJO A;  4ZCI A;  4XQF A;  1ZM9 A;  1VLO A;  4G5G A;  4OPV A;  3CC4 B;  3OZV A;  1ZM2 A;  3CPX A;  2WPD A;  3BC9 A;  5L46 A;  1TVC A;  1UD4 A;  2AHO A;  2C4U A;  2JN9 A;  4R71 A;  3FPP A;  5IK2 A;  2V4D A;  4B48 A;  2XZP A;  1UD5 A;  1QG0 A;  2D74 A;  3W5U A;  1VQ8 B;  4P2N A;  1H8H A;  3PVD A;  3ZUG A;  1QUF A;  2DYI A;  3T51 B;  1OHH A;  3E20 A;  1KK2 A;  3U6K A;  1N05 A;  2HCJ B;  1VQP B;  2HLD A;  1H42 A;  1EP3 B;  3Q6R A;  3B78 A;  4YAO A;  3WBJ A;  1T5E A;  2DEU A;  5EMN A;  1H8E A;  1UD6 A;  2ZZQ A;  4Y9R A;  2BM1 A;  2PIA A;  3JU4 A;  1W35 A;  3A8I A;  1ELO A;  1VQ4 B;  3G4S B;  3ZZ0 A;  2DCU A;  2ZBV A;  4YXW A;  1QX4 A;  2Z6B D;  1SM4 A;  2R9V A;  2CBX A;  3HAG A;  4LBY A;  1WOR A;  4FK8 A;  5TRD A;  4Q7J B;  1VJS A;  2BPO A;  1SKY B;  2X3U A;  4XR6 A;  2GJK A;  3CTA A;  2OBS A;  5F4J A;  2ZIT A;  1NBM A;  2GQF A;  2ZTG A;  1KD1 D;  4M53 A;  1BLI A;  1S0U A;  1EFC A;  1EXM A;  1Q81 D;  3AST A;  1E3X A;  1JNY A;  1G7C A;  4TMW A;  3CPW B;  2QN6 A;  1D8T A;  4XOT A;  2JJ2 A;  3VNV A;  2OBT A;  1EFU A;  2ZZG A;  3VR6 A;  3AVV A;  1EP1 B;  4NBS A;  2ZL7 A;  1S72 B;  2DIE A;  5A8A A;  3MMP A;  1I18 A;  2R6H A;  4RD3 A;  2CND A;  1PKV A;  4YAU A;  4PAB A;  4RJL A;  4X06 A;  4Z4U A;  3CCM B;  1VQO B;  1B23 P;  3OOC A;  5H59 A;  2EIX A;  3WNB A;  3ASQ A;  1KMH A;  4WZE A;  2VYQ A;  2VBT A;  3AGQ A;  4RD1 A;  1GO2 A;  4Z4V A;  3BQJ A;  2GJP A;  1AMO A;  3A1P A;  5FIU A;  1Q7Y D;  3AVU A;  4YEL A;  5BSY A;  5HZB A;  2Q6O A;  3CP2 A;  1TLL A;  3B82 A;  4B3F X;  4K1X A;  3I55 B;  5B6I A;  1QVF B;  3CP8 A;  1DG1 G;  3OE7 A;  4YAL A;  3BNW A;  3QFR A;  3ZZU A;  2PLF A;  4Z4R A;  1YIT B;  1H85 A;  2X6X A;  4RLZ A;  1QVG B;  2BF4 A;  2Q6I A;  2C5B A;  4MYU A;  3Q38 A;  1NJI D;  3G05 A;  1GAQ A;  2NV4 A;  2BV3 A;  3PA2 A;  5IYW A;  2GK7 A;  4UZE A;  2WR8 A;  1JJ2 B;  1K9M D;  3U6B A;  5JBQ A;  2ZXH A;  3A35 A;  2B7C A;  2EFG A;  3H9N A;  1W0J A;  5FO1 A;  1P4M A;  2CF4 A;  2JDI A;  2WZN A;  1YJW B;  2CK3 A;  3ONU A;  1KK3 A;  1YHQ B;  1IJF A;  1V5V A;  1NB9 A;  1I8D A;  1GJR A;  1U2R A;  3BCD A;  4XON A;  1GR1 A;  1PJ7 A;  4TT3 A;  2D3N A;  1KK0 A;  1QFZ A;  5GV7 A;  1MRZ A;  3CCU B;  1K8A D;  4B44 A;  3AVT A;  1KTV A;  4XNF A;  5DN6 A;  4RCY A;  4X7D A;  3VO1 A;  3A8J A;  4M1K A;  4OOX A;  4M2L A;  4Z4T A;  1EWY A;  1WP6 A;  3NE5 B;  4TMV A;  2GJR A;  5FA6 A;  4HE6 A;  3ASP A;  1YIJ B;  1IJE A;  2CW5 A;  4G6I A;  4X7E A;  1NDH A;  2QMU A;  1E43 A;  1VF7 A;  2C77 A;  4GQN A;  3FKS A;  3T53 B;  2LZJ A;  3R6K A;  5BSX A;  1Q9S A;  2OBR A;  5IYR A;  1V0F A;  1E64 A;  1UD8 A;  4AF7 A;  2VBU A;  1BMF A;  4XD7 A;  3CMA B;  4G7W A;  1N06 A;  1HA3 A;  1ZUN B;  1W34 A;  4WWV A;  3CC2 B;  4Z1M A;  1FND A;  1YX2 A;  4C0S A;  4II2 A;  3PUN A;  2V7U A;  2CRV A;  3BCF A;  3QSY A;  1PJ6 A;  2VBS A;  3ZBT A;  4P3Y A;  1RQP A;  5TV2 A;  1GAW A;  1BPL A;  1JA1 A;  3ZIA A;  4DQK A;  3KL9 A;  4XLF A;  1KJZ A;  1FRN A;  1YI2 B;  3P26 A;  4AC9 A;  4RCZ A;  2CC2 A;  4PGO A;  1W0K A;  4Z4Y A;  2XOK A;  1VQ7 B;  1WOS A;  3AGP A;  3CCJ B;  4B47 A;  2Q6K A;  2FVG A;  2GRE A;  1XQB A;  1QUE A;  2X0K A;  4OOV A;  2DER A;  3CW2 A;  2X53 S;  3W5V A;  2M5S A;  4MYT A;  4LC0 A;  4G1V A;  2BM0 A;  2VBV A;  2X85 A;  4Z4W A;  1UMK A;  1R5O A;  2VNI A;  4B4D A;  4PAA A;  1M1K D;  4B43 A;  1E63 A;  2W6J A;  2YWF A;  3SJZ A;  2VZL A;  4F7D A;  1Q82 D;  3AVW A;  3PEN A;  2XZO A;  3CCQ B;  4HE5 A;  3V7A A;  2VJI A;  2X6W A;  5F4M A;  1I7P A;  4B3X A;  4KKU A;  2V31 A;  1WPC A;  5FL7 A;  3ZBU A;  2C4T A;  2RC5 A;  1ZM4 A;  2DY1 A;  2QTL A;  2VJJ A;  2OK7 A;  4PC7 A;  4P3I A;  3CB4 A;  1UD2 A;  4WZK A;  4G1B A;  5J35 A;  3U2Q A;  1VQ5 B;  4P22 A;  4WQM A;  1AIP A;  1OB2 A;  4PC3 A;  4QVA A;  5KSW B;  3Q39 A;  1QFJ A;  5HXB A;  4FWT A;  3ISX A;  1IB0 A;  4RM0 A;  3JQR A;  2XNJ A;  3SKB A;  2DET A;  1FNB A;  2GK6 A;  4WZT A;  4ACB A;  1R5N A;  2X6Y A;  3G6E B;  3CRZ A;  3W2E A;  1JB9 A;  2ZBU A;  4LBW A;  2ZTN A;  3GQB A;  4P1V A;  1HZE A;  3QFS A;  5FNZ A;  4ZCL A;  3OJX A;  3W2F A;  3WNC A;  2QGG A;  1F20 A;  4G7X A;  1WSV A;  3W2H A;  2QE7 A;  3WYA A;  1D1N A;  1WDT A;  2QDX A;  3JQQ A;  1V0E A;  4II3 A;  1BX1 A;  3GIR A;  4QFM A;  4RPB A;  5KNL A;  5DS0 A;  4U9U A;  4PC6 A;  1Y0Y A;  3FPK A;  4RD6 A;  1W2B B;  1DAR A;  2F43 A;  4XKV A;  4OPO A;  3SEJ A;  1E62 A;  3VMF A;  3W2G A;  3GVJ A;  3ZPN A;  1TUI A;  2PMD A;  3ZZT A;  3OEH A;  4DK0 A;  2B7B A;  1IHM A;  1YLO A;  3LO8 A;  3CMM A;  2XEX A;  3QFT A;  1QGZ A;  3OEE A;  4X07 A;  5IYP A;  4ASU A;  2WZP P;  3CXC B;  1N08 A;  5H5J A;  1HVX A;  5F4O A;  3OZW A;  1JA0 A;  5FO0 A;  4DQL A;  2WYR A;  1NB0 A;  4HIZ A;  5TY0 A;  5LMZ A;  3OW7 A;  2VNH A;  4X7F A;  4NNJ A;  4P6Y A;  3H94 A;  4YAF A;  1YJ9 B;  1XB2 A;  2HMA A;  3A3B A;  4N3N A;  4C43 A;  4XMY A;  1Q86 D;  1T6Y A;  2ZXI A;  1J9Z A;  4P12 A;  4B3G A;  4OP7 A;  5GV8 A;  5A89 A;  1WOO A;  2QA4 B;  4BPR A;  1WOP A;  1KC8 D;  5CDF A;  4RDK A;  4QUZ A;  4X0C A;  2ZL6 A;  3KEW A;  4XLE A;  4XM3 A;  4YEJ A;  1S4M A;  2XNC A;  4LBZ A;  4ZCM A;  1KRH A;  1NRK A;  2QTZ A;  1COW A;  1G7R A;  3CME B;  4RD0 A;  3R6J A;  2X8K A;  3RY8 A;  2OTJ B;  4XLA A;  4N3G A;  3WXM A;  4DNR B;  4ZGN B;  4TMZ A;  2OK8 A;  1R5B A;  1MAB A;  2C2W A;  4OPS A;  4XKW A;  4P9S A;  4H9G A;  3OFN A;  4AVZ A;  1RQR A;  3ASS A;  3QFC A;  4P26 A;  2VNK A;  1M90 D;  1G7S A;  2C5H A;  1WU8 A;  3J81 k;  2XND A;  3BH4 A;  4UZF A;  4XL9 A;  4XOR A;  3GVK A;  4P25 A;  4XOP A;  2E1R A;  1E79 A;  1CQX A;  1GVH A;  1EFR A;  3A3G A;  1A8P A;  2OYN A;  1W87 A;  1N07 A;  3CCS B;  3I56 B;  3VNU A;  3V76 A;  1E1R A;  3DDY A;  1QH0 A;  2JIZ A;  1QFY A;  3D26 A;  3P27 A;  2BMW A;  2ZZE A;  4RPD A;  2FX3 A;  4X05 A;  1VQ6 B;  3LVB A;  3OW2 B;  5J3O A;  1F60 A;  3Q6Q A;  2BGJ A;  2WJV A;  1B2R A;  1XE1 A;  3OKX A;  3PA1 A;  2DOG A;  3CES A;  4TN1 A;  2V7T A;  1XFO A;  4M0L A;  3CCR B;  3B8H A;  1FDR A;  4OOS A;  2Q6L A;  4KKT A;  1EP2 B;  3W5H A;  2BGI A;  2YWE A;  5KW9 A;  4ACA A;  1T6X A;  3BY2 A;  1KZL A;  5E6T A; 
#chains in the Genus database with same CATH homology
 3PVD A;  4RPB A;  4X7D A;  4OOX A;  4X7C A;  4OPO A;  4Z4T A;  3SEJ A;  3ASP A;  4RDL A;  3Q3A A;  4X7E A;  1IHM A;  3Q6R A;  4QVJ A;  3R6K A;  5BSX A;  4RDJ A;  2OBR A;  4X07 A;  5IYP A;  5IYR A;  3SLD A;  5F4O A;  3SJP A;  4X7F A;  3LQ6 A;  5HZA A;  3PUN A;  4Z4S A;  5F4J A;  2OBS A;  4P12 A;  4OP7 A;  3AST A;  5IYQ A;  5IYN A;  4RDK A;  4QUZ A;  3ASR A;  2ZL6 A;  2OBT A;  4X0C A;  4Z4Z A;  4Z4Y A;  2ZL7 A;  4OOV A;  3R6J A;  3RY8 A;  4Z4W A;  4ROX A;  4X06 A;  4Z4U A;  4OPS A;  3ASQ A;  4QV2 A;  4WZE A;  4Z4V A;  3BQJ A;  3ASS A;  4P26 A;  3ONY A;  3SLN A;  5BSY A;  2ZL5 A;  5HZB A;  3V7A A;  5F4M A;  3BY1 A;  4WZL A;  4P25 A;  3PUM A;  4Z4R A;  3LQE A;  4RLZ A;  4P3I A;  3Q38 A;  4WZK A;  3D26 A;  3PA2 A;  5J35 A;  5IYW A;  4RPD A;  4X05 A;  4QVA A;  3Q39 A;  4OPV A;  5J3O A;  4RM0 A;  3SKB A;  3Q6Q A;  4WZT A;  3ONU A;  3PA1 A;  4P1V A;  4OOS A;  5KW9 A;  3BY2 A;  5E6T A;  4P2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...