3ZUGA

E268d mutant of fad synthetase from corynebacterium ammoniagenes
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
338
structure length
335
Chain Sequence
MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRRAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPDEQRSVDSFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title Key Residues at the Riboflavin Kinase Catalytic Site of the Bifunctional Riboflavin Kinase/Fmn Adenylyltransferase from Corynebacterium Ammoniagenes.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
total genus 103
structure length 335
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 3zugA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3zugA01
2NSYA 4JZYA 2EL7A 5KHAA 4MUJA 1Q11A 1K4KA 4YBRA 1N06A 1GLNA 1V8FA 4U7JA 3CVXA 2JAXA 1CT9A 2J5BA 1ILEA 2H2AA 1GPMA 3IOBA 3FH0A 4KKVA 1XNHA 1GTSA 2GKSA 1NZJA 1IH8A 4ZCRA 3ZIUA 5DB4A 2CV1A 1F7UA 3ILVA 4MVYA 3FDXA 3Q12A 1K4MA 1D2RA 2O5RA 4MW0A 1NURA 1O94D 4HJXA 1K92A 2OQ2A 4DNXA 3COWA 2G36A 3ZXIA 4MWBA 2QTNA 4MW4A 4K03A 2YXNA 3GUZA 3PRHA 3G5AA 4MW6A 1LI7A 4JXXA 3FOCA 2QTRA 3RBAA 5LFAA 5F23A 4ZT2A 1N05A 4NAHA 1O94C 1WXFA 1J09A 3MLAA 4G5FA 3FNRA 2AG6A 1KAMA 1EUYA 2I1LA 1O96B 3COZA 3HMQA 5EKDA 2JANA 1MAUA 3NV7A 3UMVA 1DNPA 3IMGA 4DDMA 3INNA 1O96A 3CLUD 4MQ6A 2HGZA 3IVCA 1NB0A 1EFVB 1N3LA 5KWVA 1I6LA 2DR2A 1EFVA 5J59A 4KPUB 5IJXA 1G59A 1N77A 2CSXA 2QJFA 3U1VA 4KPUA 5TRDA 3IVXA 3IVGA 3A4IA 3TQOA 1JZSA 2A88A 2EJCA 2QUHA 3PNYA 5TS2A 3N2YA 3CLUC 1R6TA 1UFVA 2QJOA 3I05A 4JXZA 1KKUA 4J75A 1G8FA 1H3EA 4NX2A 2D13A 2OYNA 1M8JA 4WSOA 2Z3VA 4EGAA 3N8HA 2V0GA 1KQNA 5FO1A 3PXUA 2GOYA 2CV0A 1J1ZA 1MJHA 2RD2A 4ZCSA 1JIKA 3QTTA 1MB2A 3QE4A 2B7LA 1QQTA 1GN8A 2A7XA 1U7XA 2X3FA 1M8FA 1J70A 2DETA 1T6XA 4MULA 1MOPA 4MVWA 4CQNA 1KH2A 1OWLA 1F9AA 2A86A 3CLTD 1I6MA 1QU2A 2P3MA 3KT8A 3ZUGA 3ZJVA 1A8HA 3IODA 3UC5A 1KQPA 2X1MA 3COYA 1N2BA 2RE8A 5A8AA 5DASA 3L92A 4UZFA 4MUFA 4S1OA 4K0RA 4JFAA 3FWKA 4QBTA 3IMCA 2VBUA 1KP3A 1VBMA 1EJ2A 1QNFA 1NUUA 1YIAA 3CLTC 3D6VA 3G6KA 3SEZA 5HG0A 4ZCPA 2IELA 4NZPA 1GZUA 1N2JA 5HUJA 2CYBA 4ARCA 1IRXA 2PG3A 2WSIA 4DDKA 1X8XA 5H7XA 4P2BA 1ZH0A 2QUKA 2IJGX 1IQUA 1KH3A 4EG7A 4EG5A 5LLTA 3AL0C 3F3MA 3TZLA 2H29A 3AG5A 1WY5A 1OWPA 1JILA 1YULA 3P52A 3TS1A 4ND7A 1ZH6A 2CUZA 3UOWA 4Q93A 2PZ8A 3PNVA 3CTAA 4MVCA 4WNYA 2D5BA 5J58A 4R0NA 1N07A 1NUTA 3SZ3A 1NYLA 1I6KA 4HK4A 3A04A 4GU5A 3RHSA 3SZGA 2BYTA 4ZT7A 3OTWA 4R2MA 1RQGA 1TQ8A 4MW2A 1TYCA 1JGTA 5IHXA 5TEWA 1XNGA 3CLRD 1N75A 2CT8A 1MRZA 1TYAE 1BS2A 3IUEA 3FHJA 1H3NA 1ZUNA 3GMIA 2DUMA 5TGTA 2VXOA 3DO8A 3AIIA 2DEUA 3E27A 1O6BA 1N2IA 2HZ7A 3DV2A 1T6ZA 3X1KA 4MUIA 3X1JA 4NDAA 3C8ZA 2BTEA 1KP2A 2AKEA 4L2IB 3BL5A 1N2HA 3MLBA 4EG4A 2PFSA 2TS1A 3IOEA 3N9IA 1PFWA 1ULHA 2DPLA 3IUBA 5KCMA 1EFPB 1NP7A 4ZT4A 3H9BA 3VRHA 1OBCA 3ND7A 1EFPA 4EG1A 1QTQA 1COZA 3DLAA 1JHDA 1U3CA 5FO0A 3UY4A 1WOYA 1QRUA 1M83A 4R2LA 3SYTA 1TEZA 4MW9A 2HMAA 2CV2A 3HFJA 1WXGA 1XJQA 4I6GA 1YIDA 4ZCTA 4YMIA 1M8PA 1O5TA 3UK2A 4DE5A 2DERA 3SP1A 1NUSA 4PBRA 2VBTA 1IFXA 1MBZA 1K97A 1PFVA 5DK4A 3DPIA 4KR7A 1T6YA 3VGJA 3D6UA 3Q10A 2O8VA 3ZJUA 3ND6A 1Y42X 2CYAA 1N08A 1WKBA 1LI5A 4MWEA 3ZGZA 3FIUA 2J07A 1EXDA 4FZJA 2WQ7A 4OJMX 4MAFA 4AS1A 3H97A 4ZT5A 2YWCA 1B6TA 1QJCA 2AZXA 1JEEA 1JIJA 2V0CA 1TYDE 4MWCA 1J21A 4ZT6A 4H3SA 1VBNA 1N78A 4I6JA 1KR2A 1QRSA 2WQ6A 1NUPA 3HZRA 2A84A 1M1ZA 3LOQA 3SDBA 4RPIA 1KAQA 1I2DA 2GM3A 3QTBA 4U8HA 1OWNA 2X1LA 2VBSA 4XSVA 1F7VA 2JA2A 3LE8A 1TYBE 1VBKA 4G5YA 1O97D 1XNJA 1NUQA 3TZEA 5AHWA 2ZP1A 3HV0A 1IVSA 1JECA 2E18A 3P0IA 3TNJA 5HUHA 4X0EA 3IDFA 1MB9A 1R6UA 1SURA 3SEQA 4ARIA 2DLCX 4KR9A 4RUKA 2NZ2A 4NATA 1Q9SA 1NSYA 2Z08A 1JMVA 2QUIA 5H16A 1WZ2A 3GLVA 3A05A 1O97C 4MUNA 1ZJWA 5FNZA 1H3FA 1M8KA 3IH5A 3RFFA 4MW5A 4G6ZA 2ZUEA 4GRIA 1J1UA 2X0KA 1YI8A 2CYCA 2J08A 4EG3A 3HL4A 3JXEA 5LM3A 3PNBA 4HJRA 5J5AA 4MW1A 4MUGA 4EF6A 3G59A 2E89A 4MLPA 2J4DA 4QRDA 3CA8A 4J76A 2XRZA 3X1MA 4BWVA 3K9WA 4Q16A 1O0CA 1WQ3A 4MUEA 3RK1A 1OD6A 3CLRC 4F4HA 3HGMA 2PXHA 4EG8A 2Z09A 1MAWA 1TFUA 3NBAA 1OWMA 2YY5A 2A1TS 1PFUA 3LCJA 3FY4A 2PIDA 3KT3A 3ZXSA 4L2IA 1Q77A 1FFYA 1PG0A 4DJAA 3AKZA 2ZUFA 1Q19A 2QTMA 1KH1A 1IQRA 4U63A 3ZJTA 1KORA 3NBKA 4CDNA 3MMXA 4UZEA 1WJGA 3COVA 3KT6A 3P0JA 1WXHA 1GTRA 1OWOA 1V47A 4HPWA 3TQIA 1Q15A 3CVWA 2C5SA 4MVXA 3N05A 4MWDA 3A2KA 1JEDA 4XFJA 1J20A 3AG6A 1R6XA 4MUKA 2A1TR 3CR8A 1IHOA 3RJZA 1P4MA 4NAUA 1HYBA 1YUNA 5A88A 3FI0A 3H05A 1VLHA 2YWBA 3S3TA 2CFOA 5JBNA 1N1DA 1N2GA 2QJTA 4DDHA 1H1TA 1G8GA 3Q4GA 1WXEA 4YP5A 3KT0A 3L93A 5BNZA 4YP6A 5TEVA 1PFYA 1JIIA 1QRTA 2WB2A 1U3DA 2R5WA 1KQOA 4JYZA 1M8GA 1LW7A 1EE1A 2OV4A 4PY2A 4OUDB 2A1UB 3P0HA 2E0IA 3KFLA 4OUDA 2A1UA 1S4MA 2J09A 3FETA 2A4MA 3AFHA 3BNWA 4YP7A 4AQ7A 4TS1A 1T9GS 4PBTA 1EUQA 1WQ4A 1NB9A 1JZQA 2E21A 3IOCA 4ND6A 4I6EA 4EFKA 4PBSA 3CVVA 2DXIA 3FG9A 2XRYA 4ZT3A 4E1AA 3CLSD 1F4LA 1VL2A 1O95D 3CVUA 4KR6A 1YUMA 2VBVA 4F3RA 3M5WA 3ISJA 1OBHA 5A89A 3ELBA 1WXIA 3K32A 4CDMA 2PZAA 1U7DA 3IMEA 3ND5A 4XFDA 2VTBB 4DLPA 3CVYA 3MUEA 2VTBA 4QREA 1G8HA 1PG2A 3H9CA 4EG6A 3H99A 1QU3A 3CLSC 1FYDA 1O95C 2PZBA 1IQ0A 1X6VA 1N2EA 4ZCQA 1MC1A 3RK0A 4CT0A 1T9GR 1O0BA 4A91A 5K0TA 4MW7A 1U0BB 3MXTA 1GAXA 3OP1A 5DEOA 1N2OA 3VU8A 5K0SA 2QUJA 4MUHA 1NI5A 1P7PA 2IP1A 2D54A
chains in the Genus database with same CATH superfamily
3FYUC 4JZYA 2W8ZA 1A88A 3D4NA 1SBQA 4LZOA 5EGSA 1I30A 3WLTA 1JHVA 3DD5A 5AKLA 5E4JA 4A8JC 1JSXA 1GQYA 1K5GA 3C3YA 1EB9A 4G5SA 4U4AA 3QLEA 5B1HA 3PVDA 1QTRA 4AQDA 2JAXA 2O3UA 3HNRA 2C57A 2E2WA 5KHOC 1N0VC 1N5LA 2AQ8A 4X6YA 4M0CA 1KWGA 4B4WA 1XR3A 3ID6C 4D8UA 2PN1A 4G7XA 3V76A 1KDPA 4KQMA 4FS3A 2G88A 1Y1LA 1Y9DA 3KHSA 4K46A 5K0LA 3UMSA 5IKPA 4HGQA 4CKCB 4X7FA 2X4IA 5IDVA 5JCJD 1UDRA 1XDBA 2MINB 3Q2OA 4G89A 4MEAA 4BDSA 4PZUA 4U0KA 4QU0A 4ARBA 2QRQA 3ZNPA 2JG3A 2I7VA 1D2RA 2JLAA 4WOPA 4XIFA 5ALGA 3SICE 1L5YA 1ZU5A 1TJ3A 2I6UA 2ZT6A 5JNVA 4E13A 3INTA 5DWDA 3DXZA 1DG9A 3U7GA 2VCEA 1ODSA 2B1RA 5F5XA 5F2KA 1RI4A 4OP7A 3SMQA 3H9NA 1SD5A 3W7VA 2R6R1 2GA8A 3MRXA 1KFKB 3II6X 1EQAA 5EN4A 3EULA 3O31A 5KX5F 2V31A 4PG7A 2BV3A 4FBGA 1L1EA 1IBCA 5CA1A 4HN4B 5KWJA 2XMGA 3O26A 2CXHA 4JD5A 5JXGA 2AG6A 4YQYA 5AXCA 3RBXA 2WWTA 9ABPA 1NIPA 4EHFA 1CR1A 1YE3A 4UMDA 4D46A 1WTCA 3G1WA 5MDHA 1XDGA 2ZJFA 1NY5A 2Q9BA 3NI2A 4KBYA 1DNPA 4TWIA 4BAZA 1UQRA 3VC2A 1BX3A 1GZ4A 4PYQA 4DDTA 3E6AA 2GYUA 3PJGA 2XNHA 2ZWIA 1BQ3A 3LF2A 1XROA 3HA3A 1J8VA 3Q0TA 4RSMA 4YPOA 2QYOA 4R3NA 5KWVA 1MIHA 4P9NA 1A4XA 4TRRA 3R9KA 2GZDA 1P4RA 1Q57A 1T8UA 5LU8A 4JI2B 4FHFA 3HCWA 2Z8ZA 3PR2B 1QVFB 1WBJB 2C5EA 4B45A 1P1JA 4EAQA 1G59A 1L5QA 2AZTA 3CXUA 1XMPA 1O9GA 1SVNA 1PK8A 1BHQ1 3BFKA 4K9NA 4QOJA 1K08A 5CDFA 1U4NA 4C0HA 4EGSA 2V98A 1TO2E 3MQFA 4P86A 4BUCA 4TXNA 4IGEA 4KODA 3TB6A 4EI8A 3N8KA 1KKMA 2HBZA 4LRTB 1ABBA 3DDYA 3VNRA 3TNYA 1U9IC 4HVAA 5EPEA 3T4PA 5BWBA 4PYIA 4PNEA 3N1UA 1AUOA 2V3VA 3HZHA 1Z7GA 4YRLA 1FYFA 5I5EA 1CETA 3DXYA 3IALA 4Q19A 4PGHA 2WEKA 3OJWA 3K9QO 3KJGA 4FZRA 5JS2A 2PV0A 1P2GA 1V1RA 3U26A 1I94B 4AY2A 3NHLA 2CNDA 1AXGA 3QW4B 3GFGA 1TMGE 1Q0LA 3C3AA 4QXPA 4XCXA 1HPLA 2PX6A 5AM3A 3IUNA 4G0NA 3HYRA 4ESHA 1Z08A 4GZ6A 1IQPA 3PKIA 4MARA 1WXXA 2HJ9A 4MKFA 4L9WA 2VF2A 3TSOA 1UP7A 4PPQA 1K6IA 1Z47A 2IHVA 4PFSA 1TGYA 3H0CA 5G41A 5A2QA 1WDWB 3M4ZA 4FNOA 3RREA 2FP4B 3W4IA 3WLHA 5CU7A 4YCDA 1A8HA 2G5PA 2WC1A 1J97A 1GXSB 1INLA 2R6GA 3CBQA 3DEJA 2X1MA 3ILYA 1E77A 3R5FA 1A9QA 1P7CA 3ZKWA 4FJ0A 4DILA 2FN9A 2GVZC 1CFZA 4AYTA 4XARA 4WWVA 4LCJA 3OWOA 3SBOA 4OHYA 3E20A 2AZMA 1UOQA 1JR3E 1UWVA 1GKYA 2OFXA 3LKDA 4IG4A 4K9OA 1T0JB 3GUYA 3ICVA 4KPGA 1U9CA 4MV8A 5FBWB 4W99A 1EX6A 3S8MA 4BFCA 2YQZA 3LTNC 3GRYA 4F9TA 1SN7A 5E6TA 3CKYA 2B2NA 4MO9A 4WDRA 2ZSBA 1CDZA 3U7HB 3Q7RA 3WGHA 3QKTA 3KOZA 2P1ZA 1NW5A 4CE6A 2G5TA 2CYBA 4INJA 2IUSA 1LDYA 5DN6D 5G4KA 4BB9A 4A8PA 4YJ3A 3ADBA 4G5OA 2QAGC 4X3OA 4LMAA 1NRWA 1YQXA 3TXYA 3T7EA 4Z4RA 3MJVA 4MQ5A 1XZFA 3ASPA 4XYGA 4MJLA 4RHTA 2WWGA 5CYPA 3SQMA 2J6IA 5L9AA 1OH5A 1L4HA 3I1FA 3CMAB 2CLFB 2QN7A 3THWA 2UYGA 4JI0B 1LW6E 3SKXA 1UOPA 1VI6A 4CIAA 5IABA 2CJFA 1PDVA 2G3YA 1T36B 5CHYA 5AJXA 5BT8A 5ITZB 1DWQA 5JJCA 2UYCA 2VF5X 3D7SA 3JZDA 3UAVA 2PSHA 3JQBA 1FMCA 1NW7A 2P8JA 3QXJA 2G80A 4LVUA 3G5MA 5K3CA 1A1VA 2PX8A 2PUVA 1BOOA 1BE0A 3OQHA 1OREA 3RAPR 3SZ3A 4EPRA 2QXTA 4YV2A 4ZTBA 4BQEA 5KB3A 1YAJA 2QW0X 4JA0A 3AVYA 5K01A 5L3QB 5EZYA 1HH4A 3QG1A 2HO5A 4JCCA 1T5LA 3CZQA 1RC8A 3CUWA 1PV2A 4Z99A 5LYJB 3HXMA 3UK6A 1P0CA 4N8DA 3G1TA 3UT0A 2AV6A 1H3NA 5EESA 3RUIA 4P36A 4ZZ0A 1P9RA 1SVSA 3R9XB 1RJWA 4Z4CA 3GMIA 4FYHA 1IB6A 3QXXA 4OV6B 5TGTA 3T3OA 2G9VA 4GKJB 3AIIA 3PI7A 2A5YB 2M5SA 5JJKA 2C61A 2BC9A 3E27A 3KPYA 4X66B 4LOJA 2P77A 3VU3A 3GEMA 2WJJA 2GZRA 3EHEA 2AKEA 5HKBA 4YV1A 5HA5A 3T4XA 1G2IA 4MINA 3KYBA 3IKMB 3EWNA 3ZH2A 1KS2A 4PW0A 2X5OA 1DO2A 2PL1A 1ULHA 2CL7X 4PAGA 4WN3A 3HKEA 2ONJA 3LGSA 2XDQB 3T7SA 4Q9IA 2JF0A 2H1RA 3WRVA 4BO5A 4BX3A 1CY2A 4K6KA 3X1DA 1LEHA 2C59A 3E1YE 2KQUA 3I1IA 4KLAA 4QDXA 4AKTA 3BGVA 5H80A 4JBLA 3AM4A 1GQFA 1U3CA 3E5NA 2XF2A 1BMDA 3H1EA 4X44A 1W4LA 4ETWA 5IVIA 3N2NA 1HYHA 5EP1A 6REQB 4FNAA 4CFYA 1IRIA 2ZJBA 4HLQB 4CMCA 5F12A 4TSFA 4KI7A 1V0JA 1QM5A 3R0ZA 4YWJA 3ZD7A 3GJ0A 3AOEA 3HR4A 3ZOKA 1EUCB 4B3TB 2XQJA 2QN9A 1LRKA 3QEKA 4AF7A 2GYWA 4FFMA 1PBTA 1R9JA 1PLLA 5BURA 1JU4A 1U9ZA 5EXXA 4UW9A 2R66A 3T3PB 1EIWA 2C3UA 3HC7A 5FBHA 5B2ZA 3WLNA 4ZI5A 2OAP1 1EGMB 1L3CA 3FKJA 3IV9A 1PUXA 4Y0VA 3RCBA 1TCVA 4MR7B 3WADA 1UDCA 1OZGA 3X3HA 3OKCA 4WZEA 1CEXA 4L8WB 3WSWA 4NY1A 4R1UA 3D6UA 3Q10A 2VBIA 3JAMA 4WKOA 1BWQA 1EDEA 1XO1A 3FMIA 5LQAA 5E4YA 5IS2A 4JJKA 3E8SA 3GEEA 3NIWA 4JP8A 1WTHD 1V5WA 4RVDA 5BORA 1P4HA 1WW8A 2W6JA 4X0CA 3CH4B 3HRIA 4GEKA 2GCPA 5E4FA 3DO5A 1K28D 3QUBA 4BVGA 5LIRA 3RUCA 3WZ2A 4X91A 2R8OA 4MAFA 3ANNA 2OZPA 4H18A 3A9CA 3HP4A 5AJHA 1J9GA 3WQSB 1QJCA 4ZPJA 3Q40A 2YZ7A 2ZANA 1IOLA 5JV5A 4DQKA 1A9TA 1W59A 1Z2EA 3BXHA 3EGCA 1GRNA 1ZXLA 1KDZA 1NP6A 4MUXA 4YRSA 1L1QA 3SK0A 4RF4A 5HF5A 5BR1A 2ZJ2A 3K8OE 1O4VA 2WW8A 1Z5VA 3VJMA 4ZODA 4N54A 2WZQA 1YTUA 1J9EA 1KC1A 2W00A 5F1KA 2UXBB 2WQ6A 8ABPA 5K5EA 1GGFA 2DP4E 2A84A 4Z86A 4YUAA 4Y2QA 5JZOA 1FFSA 3ABQB 4RTJA 3G88A 3N8GA 4DG8A 4AKEA 4EDHA 3GPLA 4IRMA 4FFBA 1OWNA 3AWDA 5L6LB 2NO9A 3WL5A 5B30A 1U7UA 4RCVA 1NP3A 3DB1A 5CFOA 3RC8A 2XCTB 2HMSA 1OTYA 4PAMA 3KOMA 2XB6A 4MKIA 1L1FA 2I87A 2Y9MB 3P96A 3CRMA 4BXOB 3JQ9A 4B7AA 2CN1A 4WKPA 4Y7DA 2OG1A 3LDHA 4LWQA 1A9SA 2HLPA 5CURA 3UJPA 5I48A 1XXHA 1E6WA 1KJNA 2V03A 4IR7A 3E9ZA 2VZ8A 1F38A 1JV2B 3KJNA 3P0IA 3WL4A 4MKZA 4X3CA 2ISQA 4PINA 4X0EA 2OGUA 3H2BA 1SURA 2GH1A 4ROXA 4F97A 3UHPA 2DLCX 1H1DA 4KKSA 3FZQA 4X1KB 1M1YA 4Y2UA 5C8YA 4DAEA 1XCPA 2LVBA 4NATA 3DVRX 4U9HS 5DCWA 3T7DA 1NSYA 2BGTA 5AYVA 3W90A 2VUUA 4JT9A 1X7ZB 2GCOA 4Q3KA 2E6KA 5ILGA 4LVOA 1Y7IA 3CT6A 3ENWA 4AXBA 4D25A 1ZMBA 1ZMOA 4IX1A 3SKVA 3SR4A 3QFHA 4RA9B 4H7EA 3VSDA 1FVOA 3OOCA 3A7EA 3CV3A 3H86A 3JQ8B 2HCFA 5H9WA 1YR9A 3H1FA 4LJYA 2VNHA 4WXMA 2ZI9A 2P3LA 3H5VA 4XQCA 1MABA 1VQ7B 1U3FA 1Z3CA 1FLAA 2BHNA 2OOSA 4UUQA 1G3RA 2NQ2C 5EHQA 4ZMBA 2ECQA 3LZ6A 3QJYA 3H4VA 1U1EA 3VBCA 3KEGA 4L3OA 3DCJA 1ILEA 1H2YA 4RJLA 1WCYA 5CFZA 1B76A 4M0FA 1KEKA 1DCTA 1T9KA 2CGEA 5BN4A 3QVOA 1MAWA 4QUBA 5HS4A 1FQKA 1AVTA 2EATA 2LZ0A 5HVNA 1FFDA 1PFUA 1Q1ZA 2P5UA 4NMXB 1XRMA 4Z8YA 3CZMA 1IBRA 3OOSA 3EUAA 3ZXSA 4F3NA 3HZZA 4L2IA 5LN1A 3QV2A 1RRGA 2QXYA 5AKJA 2FEOA 2J5QA 4HGOA 4M9CA 2VUHB 1BRMA 1KU6A 2HQ1A 5IYRA 2LCFA 2ZBPA 3QVTA 1Q17A 1W19A 2PU5A 1GZVA 3I09A 3K0FA 4ITVA 4XQ9A 2A0KA 2WYIA 2D1YA 1B23P 1QH0A 1D1NA 1E5VA 3ZJTA 2O8FA 5FPQA 3TBHA 4BLWA 3W8NA 4MPRA 1TLLA 4U1RA 5F7XA 2DECA 4C4XA 2UKDA 3CCJB 2E49A 3JWGA 2CLOB 2OFOA 3AFIA 3AUKA 3HGQA 5BN3B 5JSZA 4FFDA 5LKAA 1VMEA 3G0GA 2CLIB 1Q15A 3U3DA 1XZPA 1YRYE 1U0EA 1OAAA 2C5SA 4HGZA 3CF0A 1YL6A 3OX3A 4ND4A 4O63O 4B46A 2Z6UA 3LBYA 1YONA 3UW1A 4BCBA 1YB2A 4YT8A 3IBFA 1C7QA 1OY1A 1R6XA 1WUYA 2XYVA 1NBIA 2NVUA 2JFHA 1IM5A 3DBVO 3R74A 1DBQA 2GCGA 3G79A 4MAAA 4RD3A 4QA9A 4Y6QA 1TVMA 1RXVA 3GJ6A 2R97A 3JRNA 5F3DA 3KHKA 5H82A 4B71A 4NBSA 1W88A 2VJDA 2MHCA 3D3NA 1E9CA 1DZIA 3G71B 5L7TA 2VSYA 1ZQ1A 2JLCA 4QZVA 2N0SA 4YASA 1SBIA 1A9OA 3M8KA 1DAKA 2YUIA 3F46A 1MZVA 1SRRA 4OYHA 1KVSA 1VYVA 4URXR 4C7OB 3BK7A 4EA8A 2BPOA 1HFWA 2QY6A 5KYKA 1TU3A 3IHTA 2LR0A 4G23A 4UAVA 1Q16A 1YRAA 1SCBA 2XE8A 3RFXA 5U4QA 4W1QA 4RA6B 3DB2A 4REQA 5B55A 3ZTWA 1LVUA 1HO3A 1YZUA 1QGUB 4KYUA 3V48A 3L04A 4BOYA 4W1RA 3KAPA 3MCVA 1X1SA 3M1IA 4RHCA 4XB1A 5HFAA 3FZGA 2FSUA 3G85A 5AJWA 3T94A 3V8PA 3VX3A 3LCCA 1S4MA 3WMFA 5BNWA 3M2PA 1IHMA 2QRGA 3GHYA 1KQSB 5CM2Z 4WHMA 1F4PA 2ZYAA 3OCVA 4WZBE 3THOA 4EMTA 4HVCA 2Z2JA 1W0JA 3KKPA 4MXDA 1QP7A 4UHKA 3HJFA 3MBIA 1G38A 1H4QA 2B20A 1W52X 1P2SA 3K3PA 3F7TA 3A1CA 2CCJA 4PN7A 2GEDA 1CTQA 1KO5A 2VJYA 4HQOA 3TTYA 2G6TA 5DT9A 2WSSA 4FOLA 4B3FX 4HNAB 2HNAA 1YDFA 3L07A 3ZY4A 3DHYA 4TV8A 1O6CA 1T6BY 3NM5A 3WQBA 5BQPA 2CXRA 1E8MA 1VSQA 2QV0A 1DIAA 3COSA 4ND3A 5LR6A 3GLIE 2C7QA 2ZIXA 3IEPA 3H99A 1KOLA 1VM6A 2XPCA 3MAAC 4AY4A 4XFKA 1CULC 1DPGA 4GIBA 1QV9A 1CE8B 1CJVC 1JXQA 4CKEB 3NDPA 3AR9A 3QFSA 3CNQS 5TF4A 3CXRA 5AJYA 4BMNA 4A91A 2ISCA 3PQ5A 3B8HA 1DP4A 2R5FA 4OKSA 2R1ZA 4EY8A 4A26A 2R1UA 5CEEA 2EBWA 4KK3A 5FFFA 2Y0DA 3KV1A 3PE3A 4JENA 4MUHA 4ZJYA 4AKGA 3PIRA 2AFIE 4HS4A 2Y68A 3N6XA 3WHLA 1I3MA 3ICWA 5AP9A 5KTYA 1O89A 3NVKI 4I50A 3V9PA 2ZJ6A 1TM1E 2QMEA 3CCCA 3PUYA 4R6XA 4TL7A 4XYMA 2V7WA 4KITB 5JXWA 2D7DA 4HKTA 4M36A 1RYMA 4P83A 1MB0A 5P21A 2X41A 1BS1A 3FD8A 1PZFA 4GXQA 3SFVA 3N86A 3UHAA 1JR3A 4DXAA 4K0KB 1Q7YD 2O57A 2VDLB 3SJBA 4ASUD 1RMYA 5EIHA 3CPSA 4ER7A 2PR2A 3U4DA 1LNQA 4ZJZA 4V39A 1OBFO 5COBA 1ZN8A 2RAVA 3RRYA 4ZCRA 2CVQA 4HTAA 1ANKA 1AQLA 1E60A 4DARA 2FPRA 1U2PA 1VLJA 3GRAA 2HJWA 3BC1A 4EYOA 2BGIA 4HXGA 1G5IA 1U7ZA 5KSZA 1KSHA 2H17A 2BEUA 2ZT7A 2HDNB 1TAQA 1RRVA 1AQUA 5AHOA 3EG9A 2D1FA 3ROGA 2C4NA 5K3FB 1DJMA 3WNQA 4Z2AA 2YXNA 1K98A 3KYCA 1M2KA 2VBCA 621PA 4WCVA 2XQIA 4CN8A 5J4KA 1M9NA 3AVUA 3MOGA 4L4UA 3WKAA 3T9AA 4JXXA 4DLVA 3L8CA 3LC0A 4UZUA 2WINI 2N1MA 2Z9BA 1DKUA 3LYUA 4IGIA 1QFYA 2BOVA 1Y48E 4QGAA 5F35A 4UEQA 3ZWQA 4CNQA 4DQDA 5HZMA 3QPCA 2BF7A 4P58A 1RWVA 4UHBA 4LC0A 3USZA 2ZWVA 3HO8A 1QPGA 4ME6A 3OCUA 3ZI7A 1CRWG 5AVUA 1ACLA 4R8KA 4U2BA 1QDLB 5KAPA 4X7PA 4CF3A 2QD4A 2K2WA 3LDAA 3IMGA 1I3CA 4HMOA 4KG7A 4MKHA 5EE3A 4Q34A 2PYZA 1XTBA 3G9TA 5TVGA 3PC3A 5AJUA 2BUCA 1PT9A 3GPDG 4Y8VA 5HK8A 3AYZB 4C03A 3SLNA 4X45A 1UFQA 2DR2A 4YP1A 5BRNA 4DRYA 4GPEA 3WIVA 4CHGA 4EW3A 4ZC8A 1VLMA 1K4YA 2FUKA 2ONCA 2V7BA 3QEOA 4US1R 4UASA 4GC5A 1GAWA 1P80A 2BN4A 1WWKA 4UTOA 2P9FA 2QUHA 5F9HA 3K4HA 1ZGAA 4PABA 3G2JA 5CH8A 1K73D 1MENA 2AJDA 2D5CA 3N5CA 3G0DA 2ZJAA 4UMVA 1F5SA 1ISPA 1GLVA 1JEQB 4H4EA 5DTRA 4CL0A 1RJ9A 2O4UX 1Z6AA 5F33A 3F7MA 5KTTA 1JEJA 5HRUA 4FDTA 2CNWA 2ZTUA 5L3ZA 1N7JA 3OPYB 3BCFA 4BLRA 2FDXA 3UFXA 5I8ZA 2WD7A 3BKXA 3KPUA 1JKMA 1SAYA 4CZ2A 1W1IA 4PSAA 3BH0A 4R8LA 1GUAA 1GTZA 4AF6A 2MMGA 3U4CA 1EFTA 2F3SA 2PMBA 3V4LA 2H06A 1U28A 3OFVA 4L4RA 5J3JA 5A0FA 1IHDA 4E1VA 5TQVA 4AYXA 3C6KA 3PICA 2OHGA 5CB4B 5EUBA 1V3QE 2M32A 2WKPA 5BSEA 5TY0A 3ZV3A 1U7OA 5CFPA 3HXOA 1X7XB 3DVAB 2RH5A 4GOND 4QXOA 3TRJA 1SMKA 3ZUGA 2AC2A 2FB9A 2CCKA 3JPWA 4E2FA 1Z33A 2IFTA 3G6EB 1ZGJA 3BHNA 3COYA 4MRPA 3IKTA 2H07A 4OK6A 3ZZMA 1BW9B 2J5KA 2QUBA 2P9EA 4FSDA 4IILA 3MMPA 5CA1F 1DO8A 2XEDA 3SQWA 2V59A 3ZXXA 5CITA 3OPYI 4KH1A 3ZCTA 2DX7A 2G71A 2VPQA 2MR6A 3BWBA 1HKUA 1KI3A 2BEJA 3D6VA 4Y6SA 1P77A 2O3SA 2O8EB 2B7CA 3W6NA 1IZ9A 3HVJA 5E7IA 3IC5A 4H3KB 4MYCA 1EGQA 3VV3A 3CX7A 2D7JA 1HNWB 2RG7A 3FPLA 2IKQA 5CFRA 4RTOA 1OKKD 3ILHA 1HEUA 4PLHA 4N12A 1DRJA 4PC7A 1EFRD 1RP1A 1SKBA 1BCSB 2Y3IA 1Q1GA 3TKAA 2FVXA 4Q82A 4PRLA 1ZDMA 4PS0A 2BE7A 1E9AA 3QGMA 1F8UA 5LL6P 5LXTA 2LZJA 1HKHA 1FYWA 1TQDA 3IEKA 2V7GA 3I72A 1DL5A 2Y1CA 1EHCA 2YZNA 2GJ4A 4BEBA 2PIAA 1OWPA 1WF6A 2Z5GA 5KTPA 4K2AA 2J4FA 2H85A 1ZH6A 4MRNA 3V8RA 1JEYA 4ZGWA 5HF8A 3HDYA 1KYIA 5BR4A 3BG5A 3DBLB 1AJEA 4HXEB 3C8HA 1S9DA 2NSJA 1QVGB 2AOWA 5AK6A 3R3UA 1X80A 4X90A 2C0PA 3DT9A 4RCYA 2XVAA 3MCZA 3CE6A 1GL7A 4YONB 3WWEA 4HZUA 1N07A 1WVMA 2GN2A 3BICA 2VT2A 3GN2A 3K92A 3PRYA 4P12A 2JFQA 4GU5A 2P40A 4JLBA 4TTAA 4XSGA 5DCYA 1NLMA 1XNQB 3MUOA 3I30X 4M8KA 2FQYA 3I9V6 1TDJA 2FW6A 4LQCA 2O6HA 1PW5A 3QI2A 3TUIC 4AJIA 1VIAA 4F5ZA 3RIHA 4S24A 1GUZA 5KO2A 2RI1A 3RSZA 4JDUA 4RAOA 3T0FA 2APJA 4RGYA 4FYMA 4OXKA 3RY8A 4NQZA 4X54A 4BO9A 1N5JA 4W9NC 1VCNA 2HU8A 4G67A 4F2DA 2VTEA 3WB2A 2WABA 2HU7A 2V7QD 3ECAA 2QTVA 2HEGA 4HWOA 2SKCA 4ZQGA 5FUQA 3ETNA 3AVPA 5E9JA 2PSJA 2QVCA 3OMLA 3GJ8A 3K1ZA 3NRJA 3REQB 5CD9A 1TTTA 2FX3A 3GZNA 1OLXB 4G7WA 1HI9A 1JJFA 2Q2OA 4O1IA 5HXAA 4DQXA 4YY3B 5L51A 1KP2A 1RRFA 2J32A 3I6BA 3HNPA 1GCOA 3O4JA 2Z5FA 2IV3A 5FB3A 3THYA 1NSTA 2FQQA 2PFSA 2LE0A 4BO3A 3HN7A 2IYNA 3KZOA 4TPKA 1USGA 1RRPA 2F90A 4J4HA 3REGA 1LJUA 2QVLA 2OBLA 4TYPA 3IUBA 4QJ3A 1I3OA 4HNGA 3KDPA 2QSZA 3NJ4A 4UVEA 3VRHA 4B3BA 1ZI6A 1EFPA 4BE7B 4EG1A 2YHAA 2GBPA 4D4LA 1IY0A 1UXHA 3TUZC 4M9UA 4X8LA 3MB8A 1QQAA 2ZYIA 8AT1A 4OD0A 2YXLA 4AJ2A 1V9LA 3DTNA 2P5YA 4V2IA 3FWZA 4UM7A 3EF1A 1A1SA 2H4ZA 4HC4A 4JDPA 2YWEA 4DZRA 1YZKA 2JEYA 4FXOA 3QJGA 1E92A 3HLKA 4G4IA 1KRHA 2J6BA 3KLOA 1KZ4A 1MG0A 3O8RA 2GETA 3OKAA 2YJ3A 3R5HA 4PG8A 1TD9A 1EMDA 2FMHA 3L46A 4NRDA 3NYRA 3PNOA 5KQSA 1Z16A 2CFCA 4PXAA 1SCQA 3Q9UA 4U9UA 2JD1A 3T1TA 4QVAA 3PFIA 1UMDA 3THSA 3C7TA 3Q8XB 2FUCA 5IH3A 1FF9A 1P1CA 3WP0A 4HT3B 2CYAA 1UDAA 2FZGA 1XKQA 2PRJA 3FHTA 3OPNA 3U3ZA 5EJ6A 1E69A 1JBEA 4YJGB 1AS3A 2OT3B 2XUZA 2OO5C 3OZGA 3PC6A 4Q4AA 1G1AA 3HN2A 4ABYA 1EXDA 1QCDA 4AS1A 5HIAA 1L7OA 2YVAA 2UV8A 1X7YB 4O0LA 4JN6B 1I2MA 1JTFA 4LDPA 4MLDA 3P8ZA 4XEUA 4U6SA 4URYR 3ER9A 3L8GA 5AUPB 1Z2NX 3AEKA 2QENA 4GW3A 1Q82D 4EHAA 5AVVA 5A3QA 1PRYA 4XX0B 2GJPA 1PWXA 1U80A 5CJ2A 4EPYA 5JW6A 3W3ZB 1U6KA 1D4ZA 2IOQA 3MJDA 3MS4A 2NP6A 121PA 2QRLA 7REQB 2O8BA 4AJNA 1WOOA 1A82A 1BCRB 1NE2A 2B34A 4PNHA 2ZIWB 2B37A 5HW0A 3E22B 2GM3A 4MQBA 3KKKA 4CEIB 1OXTA 4H1VA 4NL4H 2BFWA 2TSYB 1EGVB 2VJCA 4JC8A 3C5CA 1FYXA 1CR6A 3V6LA 3TG8A 1LLDA 1Y4ZA 1R7RA 5KSPA 4BTVA 1GO2A 1OX4A 1ORHA 4XUCA 4NCBA 2YRWA 4RDLA 3QKSB 1I2ZA 2J9ZB 4I9FA 1FRFS 1QE5A 2G4LA 5E1BA 2ZKIA 1XZNA 2VRBA 1AQNA 4E3ZA 1CXZA 3AR5A 4LA4A 1KDTA 4TM7A 2A0UA 4EHKA 1NIJA 1Z39A 4Q05A 4WZBA 1BRTA 3RWMB 3BBPA 2X42A 2HRQA 3QVJA 4KZKA 5IN4A 3ZW9A 2FCRA 2ZIGA 3PRKE 4FYJA 2JEZA 3LWBA 2RK6A 3PPIA 1PJ8A 1PGQA 3DL7A 3FBTA 4B4VA 2QTZA 2P9GA 4B82A 3G49A 2WWWA 4C0WA 2NNWB 2XOEA 4TYWA 4DNPA 5C1PA 1QFJA 1OLUB 1RLTA 1U7PA 1L7QA 2XH8A 2XW6A 1YA8A 4EI2A 2VNKA 1J22A 1XCMA 4O2LA 2GTHA 2OV8A 3C1UA 4Z9FA 3RVRA 3J81A 1P1BA 4OG2A 4W6ZA 3VYVA 3OQNA 3R3ZA 1ICEA 4G6ZA 2C4TA 4PTLA 1HX7A 3FNHA 4Q7MB 3V42A 3P9ZA 2VSNA 3FNQA 3L8ZA 4EG3A 3HL4A 4EYKA 1MQ9A 4P9SA 4B85A 1VJTA 1KFJB 4AFNA 1NXSA 1SBCA 4OSPA 1M5RA 1GUFA 4Q1AA 2B35A 2AN1A 2R25B 3VMFA 5H4HA 3OMWA 1XCJA 3RAGA 1KIAA 2Q07A 3T56B 1J0BA 4EP1A 1AGNA 2REXB 2HFJA 3CLRC 1EK2A 3MELA 1SG0A 1QP8A 1FFWA 2F48A 2ZB2A 3P94A 3ZHUA 3RVJA 2IHTA 1SKQA 5DSZA 4AMUA 2H7VA 2Z0MA 1K8ZB 1U7WA 1UK6A 3D0OA 3ELWA 3FR7A 3H1GA 3LCJA 3ZHVA 3FY4A 4M4SA 1UBEA 1AGRA 2H2FA 3B6KA 4N5NA 3T9FA 2AFIA 4Q1CA 1PL7A 5KJCA 3B6EA 4XGQA 3HB9A 5G0SA 2MT9A 1FFYA 2ZWOA 1HDXA 3B3QA 2W4MA 1REQA 1PX2A 4DMCA 3OTOB 2YVLA 3ESBA 5G1NA 1YBAA 4YYEA 1KRWA 4A8HA 5L4SA 1NFQA 6ABPA 3P4XA 4OGGA 4YDRA 3KFVA 5FKJA 1SFRA 1BN6A 1ODLA 1Q20A 2ZB3A 1ZUIA 4NK5A 3CESA 4NQRA 3TQIA 4E31A 2IYSA 3AF6A 4WERA 1YS7A 3PC2A 4X1YB 3ERCA 3O90A 4OQEA 5DCLA 1GRRA 3AF0A 3IBGA 1ZN7A 3A70A 5DV9A 1ODJA 2BKVA 5FUVA 2WJGA 4YV0A 3RI3A 4Z1MD 3DOHA 1QVWA 1KK2A 4UUOA 3RSLA 8OHMA 5LNK6 1J2JA 2ZDGA 4HG2A 2QL9A 3QSYA 4TWZA 3B3JA 3CTPA 3WLQA 1K3UB 2QLMA 3LA8A 3MTJA 4WX2B 3KVOA 1PR1A 1LS6A 1F4VA 2XE7A 2L82A 2B2XA 3PA8A 3Q2KA 5DNWA 1VHWA 2XXJA 5LA6B 4YMUA 1DWPA 1CUHA 1TJ5A 4HEA1 3ZD8A 2JZNA 4WNCA 1XWIA 2ZIAA 3ZDXB 1KI2A 1SHZA 3QVUA 5DGXA 2IXDA 3EWIA 1G66A 1N4AA 3E7PA 4OKIA 1QYRA 3EW7A 5AFSA 1A9PA 1LX6A 3A3PA 4L27A 3W5IA 1XRSB 1J33A 2Y1LA 1BO6A 2ATEA 3BFPA 3RU3A 1EWTA 3FYTA 2AR7A 2MYPA 3IO3A 3JAWB 1SVLA 4NCNA 1AV7A 1JE0A 4I5FA 2O2YA 2YVQA 3X2EA 4DIKA 4JODA 3LP5A 3UWSA 4EWLA 4RK0A 1HZJA 2OENG 2WWYA 3MWFA 4YMVA 3UK0A 5HCNA 5BN1A 2GQFA 5JDCA 1VLOA 1OTXA 4PBTA 1BXGB 1NB9A 1NRXA 2RC6A 2OTCA 3AF2A 4FOTA 4BGDA 1OFUA 1C50A 3KE8A 5KKNB 2XUHA 4PBSA 4JWTA 5FHRA 2FQXA 2AMYA 2ORWA 4JBYA 4BKRA 3NHJA 1N6HA 1Y5NA 1FUUA 4DIMA 13PKA 1K86A 1EKXA 3GZTB 5BV2P 5U4XA 5B3JC 3EFOA 3I1JA 3I6QA 5EINA 3BJZA 1B2RA 2O1EA 5LQDA 1CB0A 4AJ9A 3NOVA 3GR6A 2A78A 2VP5A 4B4DA 3DMDA 5HRAA 2P2ZA 3ED5A 2YHIB 4RKFA 4XOTA 3PUVA 1ESZA 4JC0A 3MJHA 3AEQA 5K3EA 4QU5A 2XVXA 1NBEA 1HEIA 3KTOA 3VH4A 3E8XA 2D06A 3DOEA 4PTZA 2AG0A 2DGDA 1EK1A 4MS1B 3LOUA 3DLHA 1SVIA 3R6WA 1XRLA 2ZUTA 3EZFA 4OOVA 2BGLA 2QTHA 3WO1A 1X6VA 2VP0A 2IU0A 4EW1A 5F2OA 4ZCQA 3JAKB 3BERA 4RTSA 1NVFA 1ISMA 1YJQA 4XB2A 1NNUA 2Z5LA 1LDGA 5DX0A 1EX9A 2YIMA 3GV0A 2NZVG 3A9UA 4L0CA 1Y3CE 1W34A 2ZL7A 3H2IA 4B7CA 1IE3A 2GBLA 2GGSA 2I4MA 4J29A 3C1AA 2DIEA 3JWJA 5K0SA 3OH8A 1W5SA 4TKUB 4BFYA 5LOVA 3P20A 3KK0A 1JDPA 3D1LA 3FMFA 3UT5B 5IT5A 1JSCA 4AZTA 2GASA 2HWWA 3T1YB 2ICAA 2REQB 2XUKA 3D5TA 1KEPA 1Y9AA 3G2NA 2HHHB 2W8BB 3LGXA 4U7JA 4LDNA 2DBYA 4A6DA 5BN5A 1XEAA 2RGBA 4NFHA 5F1OA 5IC5A 2DAPA 3NTLA 1D8AA 1S01A 3VYUB 1RKVA 3PTAA 1R8SA 5AK0A 3KKMA 3GJTA 3P9XA 4IZ6A 2RJ3A 3MERA 5ICMA 1U8AA 2CMKA 1EVIA 1E6UA 1V8ZA 2R4QA 1ZK3A 4MIEA 4QGFA 4BO6A 5JWRA 1NOIA 4RZIA 3A1DA 1UM8A 3HJTA 4OI0A 4I19A 4NZZA 5DTIA 2XUFA 2PZLA 3I58A 1NURA 4DDUA 1RJFA 1EB8A 1MO2A 1V5VA 3OZWA 4FCTA 3QX8A 3J7TA 5G02A 1F2TA 2VUIB 1YMUA 4LOAA 3AQIA 1RZRA 2V3CC 4WZAB 3F3SA 5IUJC 3NR2A 5ALRA 3VJKA 4DKJA 1TIPA 3TTWA 2V8BA 2OTJB 5IAEA 3X0DA 3KAJA 3QUSA 1OE0A 2O2HA 3BE5A 5ARBA 4OLAA 2WF5A 1WXWA 4AUMA 1QNLA 4QG7A 2DUWA 4BMCA 3V1KA 2BI7A 1TF5A 5FP0A 1QORA 1VYUA 2OLKA 2HHCA 1T2DA 3JQGA 4WA8A 5CB4F 1J09A 1DLJA 3Q3EA 5JYBA 3GP8A 1WCV1 1X2BA 4JLWA 2NAPA 4K2HA 4OPMA 3ZE1B 4B3IA 2IUFA 2RHTA 3EPLA 5JXJA 3Q8WA 4DNQA 4IAOA 4OHZA 1LLFA 2WV9A 1AE1A 2W6PA 4J9UE 3SHTA 1V16A 1O57A 3HMQA 2VAWA 4FYPA 1E3TA 1V48A 2WIJA 4KWCA 5EJ9A 4QHSA 3PXDA 3QY9A 4ZEOA 4BL5A 2V3WA 3OY7A 4YEDA 4F8EA 5IKEA 2C2WA 1S2GA 4OK5A 3Q7TA 3DMHA 4GOKA 3VPAA 5BSWA 1YDHA 1UR5A 4R9VA 5DTMA 2JAHA 4R41A 3DZKA 2EJTA 2ZDQA 4ND5A 2FETA 3DDWA 2UU9B 3F8SA 5FI5A 1E7QA 1AIPA 3B1KA 1HVXA 2R1TA 4W7IA 3GVLA 1PJQA 4C1NA 4KQXA 3UJBA 1UDWA 1R9NA 2PO5A 1RI5A 3PD0A 1TAHA 2Q6KA 1YIOA 1UPUA 3M89A 4QUEA 1PBNA 1PS8A 2EYUA 1D04A 4MVJD 5JJ5A 4D0RA 1DEOA 4L5CA 4X1IB 3W2TA 1A77A 2NV2B 2YICA 3CZRA 2IEIA 3C15C 4J49A 4IZIA 5HKLA 4LXQA 5LBUA 4GWGA 4P38A 5EMKA 4ZAGA 5KTSA 3VR6D 1B41A 3OOHA 4H27A 2H2HA 4HWGA 4QOFA 2RKOA 2EARA 3L7AA 4RYDA 1GCGA 3DBRB 3UANA 5JR3A 1W46A 1O1YA 1IXKA 1QF7A 4HLUC 3SE7A 1ZK0A 2A0WA 4RY0A 1E3XA 3TSZA 4G37A 5E1MA 4W5OA 3MHTA 1RDFA 1CQZA 4NZMA 3QF4A 2YKGA 4DYVA 4LF5B 1ISSA 3V4VB 1KAHA 1YA6A 1G7SA 4A8JA 2QRMA 3VQTA 2VYVD 5E38A 1PYGA 3K1AA 1BDMA 4U7PB 1Y8AA 1GCIA 1MOPA 4BPRA 4LRUA 3LQKA 1FL9A 4L16A 3WRWA 4CCWA 5EPUA 2EYQA 3ZVKA 3OOYA 1UOEA 5KIAA 1O0SA 1XCBA 3KT8A 4HXYA 3L0YA 2YWGA 2QTLA 2TMDA 2GZSA 1RXWA 5C46F 2HOQA 4MDHA 5JSUA 1OAKA 1SBYA 4Y6OA 1L4LA 3MCAA 2ZCJA 5IJ0B 1SCKA 2I3BA 3R4CA 1S02A 4HHEA 4CM9A 1TQ6A 2PGNA 4MUFA 5JYEA 3I8OA 3TI7A 4HX5A 4PNPA 1NF9A 1QZZA 4WGFA 4TYNA 1E63A 4IIYA 4AZ3B 4D9IA 4B3DA 3PGMA 1YSCA 2PBFA 1PL8A 4BCCA 1R5BA 5FT9A 5IRCD 4NTZA 3IAXA 3G2OA 1A5TA 1HWYA 3MD9A 1X2EA 4FYIA 4QUJA 4RLQA 4ASUA 2HMWA 3TINA 1P6QA 3AV3A 4UDOA 1OI2A 1JL3A 1PE0A 2IU6A 5EG5A 5HUJA 2OK8A 2B9VA 4MV4A 4B87A 2POCA 5DIZA 2VXCA 3U1TA 3FTQA 4E2ZA 2VSXA 1GA1A 2WYWA 4CLXA 2RG1A 3T54A 1RZVA 2DPMA 3QU7A 1E2PA 3LUGA 2GZMA 3OC0A 4IY1A 5B12A 5LMUB 2PVPA 4N6GA 1W5AA 2A5GA 3LRTA 5ESDA 5CXSA 3A10A 3KU1A 4JR2A 2ZRGA 4EG7A 2VP3A 4KGXA 4IV0A 3RROA 4YAFA 1V0FA 2C98A 3M6FA 5BXQC 1I8DA 4QO8A 2GB4A 2IX9A 3LO5A 4WBNB 1YULA 3QKWA 5JSYA 5JMOA 4KYTA 1U63A 3VOTA 4MYHA 2XWJI 2ZBRA 1TM3E 3V1YA 4RHUA 3ESRA 1DAEA 4H2DA 4G84A 5ADWA 1QRAA 4D81A 3E9DA 3ZY2A 3RHTA 5KSWB 2ZRAA 3QOWA 3D7NA 4ID3A 4GYJA 3F2VA 2FSSA 3HBMA 2WAYA 3PRJA 1LK0A 1NOKA 1X92A 2BBTA 2QIOA 3R5SA 1JHOA 1NYLA 3QE9Y 4HK4A 4WFIA 1CZNA 3BILA 3NUQA 1ZU4A 2EG5A 1ZCZA 2NOAA 3JSXA 1ZD9A 4O2BA 1D7OA 1N75A 3L8DA 1NKTA 3IESA 4HUQB 2CT8A 3PUNA 1DV2A 1DDOA 2IEAA 1XZQA 2OBYA 1XTRA 1FE8A 4IIUA 1U9IA 3H0KA 2IIBA 4GGMX 3UTDA 3FOAA 5ITVA 2XZOA 2GO7A 4K6CA 3OM9A 1E4EA 3OZXA 4QWMA 3RS3A 2AD1A 2H2IA 2O2IA 4HRVA 5DBEX 4BBJA 3QLTA 4XDGA 2PMDA 1L5KA 3PNLA 4RH1A 3LDUA 4PFJA 1PL6A 4C6TA 5I45A 3A9WA 2LDXA 1NNI1 1C1DA 2P6MA 1UH5A 4V0RA 3VOBA 1O6ZA 1OOEA 4M54A 1DS6A 1WZEA 1TECE 1WBDA 3RE1A 1Z0FA 2BTEA 1MA0A 4OQ4A 1UMKA 2ET6A 2R751 5BXYA 4F6RB 3Q3GE 3K4PA 4JP2A 1BU8A 2B2CA 2QLFA 3I1YA 3HBFA 2DQZA 1XYGA 3QWIA 3SHVA 1BE8A 1UKBA 1UDBA 1NP7A 4YI3A 1Z06A 4DWVA 4EHDA 5I51A 2D59A 2UZ3A 2VQ3A 5FI3A 1HDCA 3WHKA 4LMBA 1OBCA 3ZBTA 4YYZA 2XLBA 1QIHA 1QTQA 1VHQA 3ZV5A 5CBKA 2C77A 1HQYE 1FX1A 1Z0AA 5TF0A 1JDJA 3IUSA 5IKOA 1NM5A 4CF7A 4MR8B 1EG2A 3R3XA 3RJMA 5A7GA 1XEXB 2MOKA 5I7HA 1WOYA 2IOFK 5BV7A 3DTTA 5F98A 1VG0B 1XGKA 1J25A 1ZNQO 3F5DA 1ZHHA 4YT5A 3WWCA 4WFJA 1YX2A 1C8VB 3FYDA 1FS6A 2BKLA 2JLBA 2BCGY 5E8JA 2VSFA 3AC0A 3BD6A 4TWRA 4YMIA 4EIWA 2OCDA 3M4NA 1UAGA 3M6AA 5DKFA 4ATNA 2E87A 2BGUA 5AHKA 1KWKA 4MCAA 1LLCA 4NVRA 1IFXA 3P9IA 4BVHA 3OT4A 4E09A 1CUIA 2DSTA 3D5EA 1NGSA 3RIEA 3FX2A 3QHQA 2HY7A 1UBOS 3IP1A 3QIVA 3LHDA 3NP7A 5KVCA 1JVNA 3NCHA 1P7VA 5BR8B 4RPBA 3FYUB 1MX5A 2Q99A 4A10A 4DUGD 2UUCB 1E3WB 2QAGA 2FCAA 2PYDA 3LIIA 3UAYA 1GA4A 2ZJZA 4FYKA 4KB5A 3WIDA 5DWQA 3LFUA 3T5CA 1FTGA 1P3DA 2XCUA 3LC1O 3Q1LA 2IYQA 4G1CA 5ALWA 2IH4A 3AFNA 1AF7A 1V41E 3HRKA 4JZKA 5FRDA 5KOIA 2HEIA 1NRIA 5A9RA 4G0YA 1WTAA 4PQEA 2PZFA 4XWKA 3I9KA 5IH7A 4UU8A 2W2PA 4MX8A 4LNHA 4OHPA 4YEJA 2J46A 3BM5A 1JEEA 3RASA 3HSYA 1T1GA 1ZM7A 5HP4A 1WP6A 3P5BA 3NH6A 4V3CA 4D4HA 1M76A 1QFXA 3FYSA 3JALB 4HQFA 4ZT6A 3N07A 3OUUA 2WWVD 3M6UA 3GCWA 2WK1A 2G6BA 3PZBA 4KDRA 4LV8B 4M0DA 4ZANA 2VJAA 4IVPA 1ATZA 3EB9A 3RK4A 4LDZA 1C2TA 3AM5A 4LYFA 1KMMA 4QODA 1P1KA 3SDBA 5HKKA 3EZNA 4K6HA 4X71A 3JVVA 5EIBC 1LFDB 2CXQA 4CCYB 4ENTA 2NPFA 2JJ2A 2A9JA 3EJ6A 1WPRA 2GD1O 1QDUA 3B53X 3OCCA 5C5CA 1UPXA 4P34A 1P5HA 2I6XA 2J3IA 3GEBA 2CLDX 1NX6A 3H5IA 3NWJA 3SXPA 1C7FA 3WKDA 1OX5A 3PGA1 3WG9A 4AJEA 2YZ2A 3BE6A 1JFLA 1D1SA 1OI4A 2GTIA 2EF0A 4RD6A 1DRVA 3LE8A 1LX7A 5ALTA 2BZSA 5F2EA 3BX1A 3BCUA 3S28A 4KWTA 3UHFA 5A62A 5C53B 4I4LA 3HJBA 3IJ5A 2IRWA 2RHOA 3BQ9A 4H60A 1Z5NA 4KXXA 4LRQA 1NXXA 5BQXA 3WGIA 1IVSA 1JECA 2JH9A 3DOJA 1H8EA 2FRVA 2W43A 3NTRA 4OHKA 2RB5A 3AP2A 2DJ5A 1FX0B 2UVPA 4J91A 2V7QA 3VZDA 4G4SO 2I55A 1ORIA 3GNQA 5SYMA 1D2EA 3E23A 3ZHYA 3MILA 2OBTA 1JMVA 1NQXA 3U5ZB 1ULUA 1H0RA 4ZYYA 3DUWA 3TLKA 3WJ7A 1RQPA 2P9QA 2ZYDA 3AYXB 1LQUA 5LA6F 3R7AA 4LQ4A 4IDPA 4EPWA 3Q38A 4DIFA 3CBGA 5JO9A 4NCHA 3IEIA 4MUGA 2Q3EA 2OO7A 1TLFA 2HSWA 2ZUSA 5C18A 4DBLC 3GLFE 3U4QB 1N2CB 3AI2A 1IJFA 4XJXA 1EP9A 4BX9A 4D79A 4P5EA 5TJHA 4E15A 5KQRA 3X1MA 4LEIA 2WLTA 1A04A 1AK2A 4ER3A 1IDOA 4R68A 4JIGA 4M3NA 2ECOA 4QEDA 4DV4B 1ORDA 5ALYA 2G17A 2HK6A 3HCOA 1C0KA 2B1QA 3DONA 4MV1A 4X94A 3ELYA 5ELMA 4LKOA 4QQ8A 4XE5A 3CF4A 2FPPB 1GEEA 1JIVA 3HV2A 3MCWA 4YR7A 1FFCA 5ED0A 3ZE7A 2I4NA 3WZMA 4PRZA 1ZC3A 3D8NA 5EE5B 4JXJA 4ZRMA 5IAGA 2JJ8A 4GP7A 3SXUA 2JGEA 1ZVKA 1AF4A 3D3WB 1H6DA 4ZU1X 3AIMA 4Q7QA 1DRWA 1CQJA 2XDQA 3RQSA 1SD2A 5JI2E 4JUIA 1V5IA 3HK2A 3C1TA 3MA0A 5CNJA 3RNOA 3GBSA 5FPPA 1GNTA 5I4CA 2IH2A 2IBMA 3KS9A 3QXHA 1AMNA 1Q7EA 2X7XA 1GKLA 2ZZFA 1PV1A 2CJWB 3L79A 2RHDA 4NYMQ 1UBTS 4F3CA 4QAQA 1DG3A 5HQ3A 4P4NA 5H5JA 1GTG1 1KO8A 2V6IA 3HB1A 3IQWA 4I1RA 5T64A 4NZYA 1AKWA 4TZ0A 3M9LA 5CFLA 1JDBB 4ZQEA 5C8VA 4L22A 2V9CA 3EARA 2X6RA 4S1PA 4Q00A 5EPOA 4PX2A 5LC1A 4M7WA 1Y7PA 4X7MA 4IZHA 4ENRA 3ZWDA 2M9MA 1P8JA 3IQEA 3NAZA 1E7WA 1T13A 2V7TA 1JIUA 4JSYA 3LPMA 3PUJA 5DOZA 3VYRB 3BWXA 3AL2A 3UUWA 1TX4B 1B8UA 1BYUA 1L8XA 2VA9A 3FPKA 3C6XA 4IYJA 2IYYA 4XQ0A 1L7EA 3ZZUA 4MMZB 3PDWA 4HSGA 3V2IA 2AZ4A 3KM0A 3KT0A 2DT5A 4U7GA 5ICSA 3O1LA 1WA5A 4JFRA 2XXAB 3BMNB 4TSRA 5FBLB 4F2PA 5BW5A 1B8NA 2R5WA 3LHKA 4P53A 5K7SA 4QHYA 2VJOA 4TN1A 2W6OA 1DCKA 4PY2A 5DRTA 5K0JA 2HYIC 3O03A 3GRZA 1YT5A 2QLBA 2Z2IA 3GLUA 2C2HA 4FCWA 4FMCF 4JP3A 4OXYA 5EWJA 5A5EA 2A1UA 3ZBUA 4RDIA 4UBOA 3ZWBA 3JQDA 1T26A 5HWSA 4U3JB 1HGXA 4OPSA 1OZHA 1EYZA 2G06A 1AA6A 1EWVA 4JLOA 4D92A 1WQ4A 2C97A 1F0PA 5AVRA 2O8NA 2JGRA 4LHEA 5AOBA 3ES9A 3QVGB 4X95A 2P0AA 3W7BA 4E1AA 3HNOA 2ONKA 1ZINA 1PL0A 1WV1A 5CT9A 4ZYVA 1C0LA 3EZGA 1NF8A 3T95A 1JJ2B 1T5DX 4CMGA 3O75A 3HI4A 4IKPA 4NU6A 5DYNA 2YZMA 1P17A 1RC1A 2YJ5A 4L50A 2ZROA 4TRNA 4RM2A 1R8XA 4ZAVA 2J59A 2OV6A 3W77A 1DADA 1TGVA 4Q9KA 5F1PA 3H5WA 2DPXA 3UPTA 4PZZA 2A9PA 4PV7A 3I9MA 3RS2A 4MIKA 4HB2A 2QP3A 1M6WA 1ZOPA 1RRMA 5DLDA 3P1JA 3WOHA 4CMJA 4HQ6A 1V6CA 1E32A 2I80A 4L85A 1NHWA 1P9OA 4YMSA 1WETA 4DCVA 521PA 1DQRA 1UJ5A 1DSSG 1D2NA 2GQ0A 1JDZA 1RAGA 1UDXA 3AJEA 3OZCA 5AKXA 4EJFA 1CERA 2GLUA 2C99A 3RRJA 2B6HA 2X8KA 5TJ9A 3IAM6 3KQPA 1ZKDA 3QITA 5DS0A 1VE6A 4X1KA 3TCKA 1VYHA 3TTTA 1P7PA 2JI8A 4ZYUA 1B0ZA 1D4FA 2H0QA 1E5LA 1O4WA 3A9TA 1AXEA 2O0LA 3BK2A 4NOKA 2EL7A 1XMIA 4IHJB 3RABA 2ACKA 3TIGA 2X0IA 3JVIA 4OX9B 3IAS1 4Q01A 3CRZA 4A3SA 3AJRA 4D44A 1W4ZA 3OIDA 3PFFA 3EMVA 4P3XA 4UUNA 3ZZ1A 1SBTA 4LOIA 2I1QA 2JIOA 3JQ8A 3IQIX 1PI3A 3OOWA 2YW9A 2QY9A 4IUDS 1AN9A 3CKKA 3EG5A 5HUQA 3QLUC 3VPSA 2KMLA 3G2IA 4CMBA 1UIRA 2FR1A 2FFRA 3FR8A 1C4KA 1QFMA 1YXMA 3MK31 4J0CA 5HBRA 5HIJA 1GTSA 4B48A 1E61A 3G9XA 3B1WA 5J2UB 4I2VA 4C2TA 2CL6X 2QNRA 3DT6A 2L42A 1I32A 3CZPA 3FDXA 3N7TA 2OCAA 4C6RA 1K4MA 5L3SB 3DL4A 4JITA 2MSDB 2PWZA 5A4MS 3AR2A 3KC2A 5EWMB 1K9MD 3RS5A 3ZKAA 1P1IA 5EE0A 3JCZA 1RXCA 4JMQA 4GOMD 3IQGX 3O38A 2GEKA 4KQGA 5CA0B 2YWRA 4Z1MA 2CWWA 4K87A 4B35A 3H87A 1ST3A 4UCWA 5CIYA 4FWTA 5CLJA 3G5AA 1G3QA 2A5DA 1LI7A 4MW6A 2BSAA 5B7NA 3BF7A 1QIIA 3L0BA 3KKLA 2B8WA 3ZE9A 3ZTTA 1JDSA 1X87A 3KELA 1C3EA 3C45A 1ZOIA 2PM8A 2XXAA 1NW6A 3DXXA 3IIKA 1RKUA 2GSWA 2GK4A 3NIDB 4RKEA 4B5LA 1FXSA 2AVNA 1EFHA 1NQTA 3I9OA 5HZAA 3BXFA 1SXJC 1MORA 5D1NA 3UW3A 3B48A 4AO7A 4D1YA 1ZAKA 4MEBA 4AVYA 3IE0A 3A6GA 3P4YA 3M4XA 5LQCA 1G8JA 5IHPA 3QLJA 4GGOA 1TYZA 3I6IA 4XIJA 4MRVA 3DCNA 2FXIA 3PG5A 2EZ4A 4XB6B 2CLKB 5BSFA 3N3BC 3PWZA 3QFRA 1K7YA 1O96A 1W0KD 1NXWA 2AJTA 4MQ6A 4EH1A 2VYND 1A4UA 4JR0A 3E15A 4R2WA 4UAJA 3OZEA 3NTQA 3H3JA 2C4KA 3ZW7A 5ITWA 1JP7A 4HMQA 2CLLB 3ANTA 5BSRA 2LGJA 3GHHA 3OTHA 2BM8A 4ZDKA 4PIVA 3IVGA 3UXEA 3R0QA 1Y8QB 3GF4A 5I7AA 1JZSA 4P1VA 3HEMA 2JFBA 3QOYA 1Q2XA 2QWXA 3EVFA 1RW4A 1EK5A 3OD5A 4KR0A 4ZO6A 3URMA 1XTVA 3Q7PA 5LOVF 1R6TA 1UFVA 1U4SA 1QYDA 2QJOA 1XJ5A 3FPSA 5JG7A 1W87A 3S29A 4BNWA 1NF3A 4KLZA 4LJ5A 4C7OA 1Z45A 2OPBA 2XBUA 5KNLA 1T0PA 2ZJOA 5KQGA 4KPEC 3BEDA 2D13A 5JY6A 4TTJA 4KRGA 1H2WA 2AYXA 2P3QA 2DUJA 2W6MA 1XZKA 3HUTA 4IIDA 4N65A 2VJBA 3SM3A 3K6JA 4P4GA 2V0GA 1U04A 5IM4F 3B2NA 1RM0A 4QOIA 3P0EA 5EHZA 3A3BA 5ARCA 3CISA 5EIFA 1XFAA 4Q37A 5D6NA 5IEBA 3JD1A 4QG3A 4YDQA 2VZLA 5AVKA 3W0LB 2FPSA 1XQ6A 3GFRA 4XAQA 3LUFA 5YASA 1JKJA 1QQTA 3ESXA 4ITUA 3DE3X 5CB0A 2X3FA 3C8UA 3U4GA 3W3AD 1EP1B 1VCOA 1XDDA 2HJVA 1M1KD 1G16A 4RY2A 4XLZA 4DSUA 1PT5A 1H1LA 1KH2A 2J41A 5BNIA 2VP6A 3DZ8A 3VSEA 1GU1A 3UMRA 1NBWB 4PLPA 1QDEA 2JBWA 5KYVA 4EB0A 4PR0A 3EQ6A 3SWWA 1QQ7A 1KQPA 2NV0A 3W2EA 2WJWA 1NW3A 3OX4A 4HNAA 3CR7A 3JPYA 2WTMA 1SUSA 4DZTA 4BFLA 3K7EA 2V9ZA 4K0RA 1VL6A 3DBOB 4TWJA 3V8NA 4Z53A 3LZDA 1DG1G 2JJ1D 1W6UA 1IL0A 4YGYA 1NUUA 4BMSA 5AVTA 1U3WA 5JS7A 3GGCA 4B34A 3OY2A 2H6EA 3H16A 3ROPA 1UD6A 4OQNA 5EXPA 3MJRA 1V7QA 5GADl 5L6MB 5CT4A 1YJNB 1UBJS 4DJEC 2XRFA 1QHHB 4BWYA 1PGPA 1SM4A 1L7NA 5H7XA 3C3MA 1XYVA 2JGJA 4U2DA 2HDHA 1EZZA 4MICA 4ZRNA 3MFQA 3FE2A 1C1YA 3W6ZA 4CLDA 4EG5A 4X9XA 5EC8A 5TQ0B 3MW8A 3PGJA 5JMPA 1P74A 4CLEA 3FB1A 5JI3E 1LPPA 3JX9A 4XDZA 3ZDQA 2CDNA 1J4AA 5KYWA 4UEKA 3ZV7A 3O74A 3P9SA 1G19A 4LZZA 4PSDA 2YIDA 1B7GO 1M74A 2MIIA 4UQPA 4XWAA 4DM3A 2O1SA 3U3OA 1CUJA 4Z7QB 4IOMA 3QMWA 5LKRA 2PZ8A 5KNBH 3I5UA 1MRSA 3IKLA 4K9SA 2IY8A 1N3IA 2WU8A 1ZW6A 1ZVJA 3AJ8A 3HG7A 1XVTA 4HDMB 4Q9DA 5HF6A 1I18A 4DEXA 4GDFA 1UQUA 1W5EA 2N75A 2Y76A 4RFLA 1QP0A 3N8DA 2BLNA 4O29A 3RHSA 1VDMA 2BCJQ 4OQPA 1M2OA 1MXHA 3KOUA 5KYGA 1DDGA 5AXAA 4J4TA 4CQJA 2IPAB 3QH4A 4IBOA 4NCIA 4FKMA 1Y5MA 2GHRA 3DZJA 4RENA 5IDWA 4GX1A 3FTFA 3OIGA 5JH7A 2ZPUA 3A6DA 1QUFA 5BW8A 3Q6QA 1K5HA 1URPA 4PYMA 3WA7A 4EGFA 2W2LD 1NVBA 1XRJA 2L18A 4ER5A 3EIXA 1Y9EA 3GG2A 4F71A 2ZAIA 4DIOA 3BTVA 3W5HA 1LDEA 1QQ5A 1V3VA 2H1CA 5DM60 4Z4HA 4H3HB 4DB4A 3GJQA 4AWBA 2VOJA 5HSGA 4KO8A 4DCCA 1F1JA 1U5BA 4P54A 1M67A 3DFZA 4N8EA 2C2GA 1YKGA 3LQYA 1BU5A 3F78A 4HGPA 2NO6A 5HYVA 4GRDA 2WF9A 3BL5A 5KHLB 3VV2A 3NFYA 2PKQO 3GARA 3EGDA 3MLBA 4JNKA 2ZTNA 3T51B 3VR6A 3CJRA 1SB8A 2HXSA 1MAVA 5LQSA 2UXDB 4E2XA 1YCDA 4B2LA 3HA2A 5CFNA 3TLAA 2ECPA 1A8QA 3QOFA 3Q0EA 4LS3A 4NCAA 3CF6R 3BGSA 3QE2A 5IYPA 1E3DA 3G9ZA 3N7AA 3PKJA 4NYMR 1I0LA 1OGYA 2ZVPX 3EQ9A 3RARA 3GLFA 3Q3AA 4BNDA 1CR4A 3V8QA 5KUTA 1A9RA 3GFOA 2VYVA 4MWTA 2XBLA 1XWWA 4WADA 1X1AA 1N5RA 3AMVA 5HGJA 1KTVA 5BP7A 4CCAA 5THQA 4HWRA 4IHAA 2BJVA 2NZXA 1J42A 1N1GA 1GITA 1L7VC 3EUFA 4WXRA 3F9IA 1USUA 3QA9A 5JOQA 2DERA 4R7GA 1VSBA 4Y0AA 5JD3A 1NUSA 1FDRA 1FA9A 2VNSA 1MBZA 4MV5A 1AM4D 1FRQA 1K97A 1W1WA 3A4LA 1IK4A 1GZ7A 2NUPA 3C85A 2OQRA 3MJTA 1XT6A 5FWXA 3STVA 2IEDA 5DHUA 2BM0A 3IBYA 1R12A 3UKJA 5SY6A 1RADA 5K8TA 1K7FB 3NC4A 4A16A 3I5YA 2ZRHA 2GVNA 1K8AD 2ZE8A 1LPNA 2WE8A 1B26A 1PKEA 3D2LA 3ND6A 3ORFA 3ORQA 4E08A 2R7NA 4F96A 5CDTA 5KYYB 2OV3A 1J8MF 2OLEA 2VEOA 1JXOA 2NXNA 1FW8A 3JU4A 1NDUA 1W47A 4HEQA 1S3IA 2ZBGA 5KINB 4FZJA 5AR1A 1DDIA 2D3TA 1BROA 5KQLA 2ST1A 1U3GA 1E9EA 2B3DA 3LM8A 5B36A 2EU8A 2Z8YA 5LQUA 4JKYA 1LQTA 4RFSB 4LPKA 4UREA 4BRSA 1XL1A 4JXKA 3G2LA 1K8RA 3GA0A 3JTEA 4GI2A 2J7PD 4NDZA 5EIBD 4D74A 1NATA 4MRMB 3OPXA 1Y4AE 1M0EA 1U7HA 4YQFA 4C4RA 2Y0EA 1ODTC 4YRQA 2PH3A 5HZKA 4LY0A 3FF1A 4M88A 2RGEA 4LJ7A 1R37A 5SICE 3CW2A 2G1PA 1PQYA 3CMEB 3EXHC 4TTPA 4GQBA 4XR9A 2A3RA 3UMFA 2J0SA 2JI6A 3ZDBA 4KQKA 4POAA 1NUPA 1Y0BA 1EUZA 3CEJA 2B0JA 2ZI7A 3B12A 2VAXA 3OCXA 2OORC 3MVEA 3DCYA 1BKDR 1PWHA 3A6FA 1ZRNA 4PHHA 4ZVKA 5JAPA 5EFOA 1XA0A 3BSSA 3IDSA 4D0NA 4W9NA 3D7MA 3EA0A 4IH9A 5A71A 5ALEA 4E07A 4IIJB 2HA7A 1M0TA 1KIMA 2PS0A 5DO9A 1XRPA 5KAMA 2C96A 3TLYA 3EZ9A 2Z8YM 4JJIA 2IYZA 2JBAB 4FXUA 1FUKA 3FYHA 4EFNA 2GPAA 4FQ5A 3A31A 4DR4B 1Z6GA 2WJYA 3TZEA 1PW7A 5AHWA 2HRZA 1Z22A 3C3CA 4NYJQ 4RH3A 2UUBB 1GTVA 4FYVA 1IZZA 5H3HA 2Q7XA 2Q3MA 4LYEA 3HVRA 4ZVOA 1EFAA 3K0HA 4RUKA 1RIFA 2NZ2A 1O54A 4IO1A 1KYTA 1BZYA 1XF1A 2FPKA 2PH1A 3QWFA 5DSTA 4KJZA 5H16A 1RZ3A 5L7WA 2GXQA 1GG5A 3OG9A 1VPDA 4G0XA 4GNKA 4MUNA 2C9BA 3ETCA 4ZU6X 1U2ZA 3R6KA 1H3FA 1PFQA 4C08A 5IMSA 3U9SA 3ASYA 4HLCA 2HMUA 3PF8A 1JVBA 1XK7A 2ERCA 4UC0A 4ZVMA 3OLVA 2FWPA 4TKOB 1XDZA 1KMQA 5JANA 3JXEA 1GPKA 3P19A 4YMWA 3C8MA 3KWFA 2XTJA 1R66A 5CX1A 1E64A 4FB5A 4CM7A 3EXEB 1CYDA 3EZ2A 3PYMA 4R7ZA 4RSGA 3MG9A 4D4MA 3X1ZA 5FNVF 3H83A 2FZCA 1XD2A 1WQ3A 2Z6VA 4LX0A 4OP2A 1T4DA 4MQFB 5FH9A 4G81A 4LDJA 2QN1A 2XNDD 3REQA 3H1AA 4QVIA 4D6YA 1DGQA 1OLXA 1ZN9A 2HYDA 4AP9A 4DOMA 3DMPA 1O87A 4HDNB 4WOBA 3GFPA 2OO5A 3RW9A 1D1PA 3EXFA 2C7GA 4NU8X 1CNFA 4OP1A 1E1RA 4QDZA 5CNKA 2OA0A 3FZEA 1G18A 1C8BA 3I2YX 4GBGA 2H5IA 4JCOA 4F3YA 1Z4QA 3AKCA 3AF4A 4BQIA 4IQ8A 1KH1A 3DE4X 3E84A 1FSPA 5BWMA 3P97A 3NBKA 1ENOA 1OFIA 1G7RA 3STTA 4A5OA 3M5DA 4E5SA 5KEIA 4BIIA 3AB8A 1DFGA 2B0CA 1BVUA 4IFIA 4LW8A 3TW0A 3WS7A 3HACA 4CV1A 5IXSA 3K70C 2WQZA 4RULA 3ZG6A 2JHCA 1NVEA 2I62A 3TD2A 5D51S 2OZKA 1SC3A 4GSKA 2J9YB 4MWDA 3OJOA 3BCHA 1DQPA 1OZ0A 4YMLA 1BAPA 1KZYC 2ZRKA 3GA7A 1YRHA 3MEQA 2QZPA 4MVJI 1HFEL 5AW0A 5JCOA 4YALA 3OETA 4L28A 4Z0NA 1T91A 4NAVA 3BBLA 4BB5A 1XMVA 2E4YA 3CE9A 4KCGA 4JB8A 1VE7A 2X8JB 2J48A 2YWBA 2ZWPA 3EVZA 3LP6A 1ZOOA 1MEEA 4G5QA 4Q3LA 2B30A 3VGPA 1QP4A 2ZJ4A 4GPAA 1TYEB 4Y18A 5E2AA 3W4JA 4LJAA 4O2RA 2VK8A 3DHVA 1K06A 4ZCLA 3DUFA 5JC1A 2H00A 4GMGA 2GN1A 2PSEA 5AI6A 1FFGA 2QD5A 3SHOA 3TFWA 3JD4A 1PJ4A 4RQUA 4YJGA 5E6UA 3C97A 4IHJF 5TEVA 3DH0A 1RTTA 3K2QA 2PS3A 2Q41A 1Z4NA 2UVDA 2PE3A 5KSOA 2XODA 1RFGE 2F3PA 2P2DA 2OVFA 5AK3A 4GGPA 1CLEA 1RM3A 2Y1DA 3FW1A 4BFWA 1GQRA 5F4OA 1QYIA 2PT9A 2IZ7A 1AG9A 3VPFA 2OV2A 1MA3A 1WHSB 4OQXA 4Q4HB 1MT0A 4EUFA 2ZIVB 1FP1D 1DOAA 1E8NA 4GMDA 4UKDA 2J9GA 2OP1A 1WMAA 4DREA 4AQ7A 3PZRA 1OB5A 1EDDA 3CP2A 2PJUA 1N6OA 3NDBB 2HA2A 2GM9A 2ZBVA 2GZ1A 5J2UF 4OQMA 3CVVA 4Z4ZA 2CFIA 3CT4A 2NU9A 4ZK6A 4YRRA 2BKEA 5I7RA 2IS1A 1IMJA 4PWZA 2VBVA 4KAAA 2B8TA 1DXOA 2OVBA 1E9FA 5CA0F 1OBHA 5FWAA 4IOJA 4WT7A 4ENUA 3A0UA 4DKXA 1BXRB 1UKZA 3W5CA 3ND5A 2VTBB 2Y1GA 3TSYA 4X05A 2VXBA 1O9BA 3C7AA 4ZI3A 3P9CA 4R4JA 3HMKA 5EIOA 4AG5A 2XB2A 2PZBA 3DZCA 4LNUB 3PDIB 1VKZA 1I7NA 1VMIA 1P6UA 3CCBA 3EA4A 3R5XA 5K4GA 5KYTA 1YHYA 2XCIA 3BE4A 3GELA 2V4MA 2FXVA 3DEIA 4GP6A 5T67A 5LNK1 4W9MC 3K71B 2PUAA 2CXUA 2FPIA 2ZTLA 4L5IA 5ELXA 5ALMA 4EYQA 3DMTC 3T1NA 5MN4A 5KW9A 4GX0A 4V0KA 8ADHA 5BT9A 2FMTA 1F6WA 1HZZC 3SJZA 3P9KA 2V7EA 4BLOA 5B58T 1MFPA 3B70A 4A9AA 4RIHA 1TK2A 4ROSA 2DWUA 1MN6A 2B8JA 2C7PA 3N2KB 4MIYA 4RNCA 4BNLA 4KLRA 3ZGNA 4X20A 1X9GA 1U0GA 1YJCA 2FOLA 4P3KA 4UOZA 4FS8A 1WHTA 2IF2A 2PR7A 1W35A 4FQ7A 1GQQA 1WNTA 2V5AA 4HB4A 4N4AA 1YZQA 2I8AA 3MINA 4B3HA 4WACA 2OBNA 4MKRA 4RBNA 1XXLA 4EF5A 5LJLA 4HTFA 1H42A 5TMBA 1GRCA 5FYDA 5JS8A 1FMTA 1US8A 4TROA 3QEMA 1NJFA 2JVIA 3TVDA 1RLOA 2HBYA 2HMVA 4JNCA 3HU1A 1E0KA 1OPRA 4B43A 3H1BA 4GQAA 2WOOA 1SNYA 3Q6NA 1NJ8A 4C7KA 1G64A 1R6AA 3D6NB 5AD1A 2GF2A 4ZO8A 2VRWA 4PZ0A 4HV4A 2A5JA 4DNXA 5IVDA 5JNUA 3EFEA 3MS2A 3UJ7A 4F6LA 3FXAA 2CVOA 2ZRDA 4N3GA 4EHLA 2O54A 1CNEA 4E0BA 5KWSA 3BJRA 4MW4A 3D0QA 2Z2ZA 2DFPA 1G7CA 1K8YB 2CL0X 4Z9AA 3PEWA 5JSFA 4WA7A 4EELA 2IYVA 2OV1A 4EGCB 2H1VA 2OCPA 3CVJA 3ITEA 3OE7D 2QQ5A 4FR2A 4QFDA 1RLMA 4Y6PA 3TFQA 3QVVA 4ZQCB 3IPYA 2IPNA 1O94C 2HPZA 3GUUA 2LKDA 2L2QA 2O48X 4BNXA 1P33A 5F5NA 3B6ZA 1EI9A 3TLEA 2KSQA 2WM3A 2DUNA 1BHJA 3TOZA 4O4HB 3BDIA 5JZBA 1J8QA 3LW7A 1JALA 1MAUA 3KL9A 3PT5A 3BIOA 4OREX 2B5OA 5CVDA 2QRHA 1XU9A 5IYNA 1PIWA 2VLBA 2ONYA 5AW9A 4COOA 1ZY2A 5K6RA 2JJYA 3BN3A 5IWAB 1QS0B 2VK4A 2O8CA 1T9ZA 5FX2A 1A27A 2BI8A 3AR3A 1LPBB 1Z4IA 4TXMA 3BB1A 1G6KA 5FLXA 2CSXA 5I7EA 3WYNA 1VA5A 2GN0A 1JQ3A 3L40A 4NLLA 5GWXA 4DNFA 2FMFA 1XVAA 2Y77A 3HKDA 4BX8A 3W5AA 1SQFA 2NPOA 1D2AA 3E2IA 3CVUA 4BQFA 2GUGA 4AURA 4XN3A 3DE2X 3EXG1 5GP1A 5CB8A 4Y98A 4EJSA 2FWBA 4DBLE 1WS6A 2PX4A 3AJDA 3DOIA 4TMFA 4Q6BA 2IHUA 2R8RA 1ZEJA 3TD6A 1HT0A 3KQKA 4YB8A 2QAJA 1R5OA 1MHPA 5JTUA 3VR0A 2FZKA 4FFLA 4WSOA 1KE1A 3BMCB 2PRYA 1VECA 2ZE6A 3HJGA 3QVMA 4J0FA 5HKAA 3RWBA 3IDZA 3F6BX 1E20A 3NRCA 3PXUA 4HNRA 8ATCA 3DBHA 4GRAA 3DQPA 1N5OX 4LF4B 3DSRA 1GOTA 2GPNA 5JASA 2XMDA 1Y6JA 4FONA 5EQDA 4U6QA 3SZMA 1CZLA 1Q1QA 3WGQA 4XRGA 4X6UA 1WPGA 3DF7A 1D4OA 1BXGA 2Z04A 1YMVA 5IK2A 1R50A 1Y5LA 2ZK7A 4AJJA 1X0XA 4Q4LA 4EPTA 3GD5A 3C39A 1PWEA 1TXGA 4YRDA 3KSUA 2H1LA 4DCUA 4DB2A 1LXCA 4N0QA 2AN9A 1TVCA 2EFHB 4YT2A 2HIHA 4R1MA 2P9ZA 3IODA 3PC4A 8GPBA 3W5UA 2O0HA 3W78A 2Q2WA 2A5LA 3CSUA 3F1KA 3E35A 3GG9A 4ZGNB 1G5FA 1VE5A 1KJ9A 2EBUA 4JVOA 5E3JA 4GPIB 3D31A 2YHSA 3JWPA 3CC8A 3DHNA 5A4KA 3B6MA 1I1QB 2FDRA 1SWWA 1P0IA 3KQQA 3PGXA 2O2ZA 2VCYA 3WNBA 4LCBA 3A1PA 3MGCA 3EGXB 3MJCA 3DT8A 1N2CE 3N2ZB 5HG0A 3SEZA 2WJ3A 2Z58A 2I3GA 5CK4A 4ZHQB 3A4NA 3JAKA 1ZRSA 5E4TA 1YI1A 1KKLA 2I67A 3E7XA 1TZ2A 2ZYGA 5FORA 1PGOA 1WE2A 5KOHA 1OFGA 3R6TA 1MMFB 3UJAA 4Y1EA 3TZQA 2YYYA 3CW9A 1E58A 2PQMA 2X8WA 5DPMA 3RRMA 1AURA 4NYJR 1N9KA 1H2XA 3KTAB 3N3AC 5LB2A 4J1TC 4FR5A 4BB6A 5CNMA 2EKLA 1FUYB 3OLQA 4U02A 5LZ7A 3TZLA 3GJ4A 5LP6C 2QB5A 3FB4A 2REQA 3HUFA 4LHZA 1H8HD 1FTSA 2W8BA 4N6OA 5CCEA 3URKA 4KJXA 2CUTA 3CKLA 4WFKA 2AKAB 2R44A 5A9SB 1FZTA 2YFKA 3CTAA 2Y4NA 5E7MA 7ABPA 3SLDA 2PTGA 4IIVA 5CCXA 2NG1A 3F98A 1MV8A 2GPBA 4EABA 3RYCA 1MO5A 5BMOA 5HJ2A 1HE1C 1BMFD 2HKIA 2P2SA 3TRKA 4FD3A 5B3AA 4JV5B 1XALA 2PWPA 4ISBA 2AT1A 4D4JA 1NW8A 1UMBA 3TJZA 1YQDA 3QJ5A 2FW0A 2VYNA 3OU2A 2FK7A 4DZZA 4DYHA 3WQZA 3WLPA 3GFQA 1P7WA 1QWOA 3K0AB 3NHKA 5BYAA 1FDTA 1U0FA 2AK3A 5C1IA 3BWDD 1RWOA 5EXEA 3GAFA 2DUMA 3K31A 1SG9A 1Q2UA 1ZGZA 4NBUA 2OZEA 3ED1A 1L7BA 1F2UA 2GJRA 5CEJA 1O6BA 5A4FS 5GTDA 3K72B 4DG9A 4CKZA 3S2FA 1NN1A 3FRHA 4F9FA 1H5NA 1O6FA 2Y66A 5EVJA 1FVFA 4BQQA 4P81A 2R7MA 4B47A 1N2HA 2MDTA 3FKSA 1GL6A 5AUQA 4Y9SA 3VO1A 2DHQA 4JQZA 3TVYA 3CCEB 4DGSA 3BF8A 2X19A 3Q7SA 4H4CA 5HDBB 4BEVA 4CKBB 4EEZA 7GPBA 5M29A 3EPJA 4PGAA 1CS0B 1JJAA 4GMHA 4D80A 2AFHB 1JW9B 3FPPA 4ND8B 3TSCA 3DYVA 1GP2A 2NZUG 1PZMA 3G2QA 1IN4A 1BDJA 1YQQA 3VR3D 1QRUA 3RGGA 1KMNA 1ACMA 1L5HB 2RONA 4MW9A 2EG9A 1ZXXA 2H4HA 4NPHA 4XGRA 4AMVA 4BP1A 5AESA 1L4GA 1H5QA 1ZMRA 4TSKA 1A8UA 1N2SA 1DAPA 1Q1BA 1W73A 1O95A 3OBIA 4QYIB 2WICA 5A3RA 2JFZA 2SNIE 3LBFA 5DLEA 4BECA 1U99A 3BGOS 4RLFA 4X1IA 1A4RA 1UBFA 1ZHFA 3GLSA 3CS3A 1QZ3A 3PDUA 4KXNA 2B98A 3S0JA 3UCFA 1YCGA 1GTMA 2ZI5A 3GRRA 3UKOA 8MHTA 3IP3A 3QSGA 3J7AC 1E79D 1SOVA 4PEVA 3BL6A 2VAMA 1QB8A 1VJ1A 4IDCA 1TAUA 4BP9A 1XAIA 2JJ1A 1NRJB 2ZRLA 4I5GA 4D45A 1ZOLA 1GPAA 2B8EA 3U7QA 4Q6WA 1SK9A 2IYRA 2DUUA 4X92A