3ZUGA

E268d mutant of fad synthetase from corynebacterium ammoniagenes
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
338
structure length
335
Chain Sequence
MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRRAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPDEQRSVDSFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title Key Residues at the Riboflavin Kinase Catalytic Site of the Bifunctional Riboflavin Kinase/Fmn Adenylyltransferase from Corynebacterium Ammoniagenes.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
total genus 103
structure length 335
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 3zugA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3zugA01
2PIDA 4YP5A 4EG3A 3HMQA 2Z09A 4L2IA 2RD2A 1EFPB 3IOBA 3KT0A 1MOPA 3RFFA 3IVGA 3CLUC 4XFDA 3H97A 3IMGA 2X0KA 3UC5A 4MUKA 3N8HA 1IH8A 5F23A 1VBNA 3N9IA 3IVCA 4MLPA 3AFHA 1D2RA 1XJQA 1O0BA 4MW9A 1U7DA 4OUDB 2QTMA 3IDFA 3FHJA 2JAXA 3ZXIA 4RUKA 1QU3A 1O94D 1KAMA 1ZUNA 1G8HA 1VBKA 2WQ6A 3GLVA 1EFVA 2A1TR 2CT8A 2A4MA 4U63A 4ZT2A 1ZH6A 1J1ZA 1X8XA 3IUEA 4MW0A 2RE8A 3A4IA 1N3LA 3P0JA 4NX2A 3UK2A 1IRXA 4F4HA 2JA2A 3FOCA 4KPUA 3AKZA 3CVYA 1R6UA 4ZT3A 4YBRA 4ZCPA 3SDBA 5LLTA 2VBTA 4YP7A 3VU8A 4F3RA 2BTEA 2AZXA 1N05A 1XNJA 1N1DA 3GMIA 4YP6A 4PBTA 3IMEA 2E18A 1MC1A 1KQNA 3CA8A 1PFVA 3A05A 1QRTA 4MUEA 1K4MA 1X6VA 3LCJA 4MWCA 5H16A 2ZUEA 1JZQA 1Q15A 1U3CA 3ELBA 3E27A 4GU5A 1UFVA 1V47A 5IHXA 4S1OA 4ND7A 3QTTA 4QBTA 3LE8A 2CSXA 3JXEA 4JZYA 1BS2A 1JIJA 1S4MA 1F7UA 4MW1A 4DDMA 4PY2A 4XSVA 2V0GA 3ILVA 1M8JA 4KKVA 3ND7A 2J08A 4K03A 1B6TA 3ISJA 3ZXSA 1N08A 1N2IA 1WKBA 1T6XA 4I6JA 4MUIA 4L2IB 4G5YA 4EG4A 1LI5A 2OQ2A 5KWVA 1NUQA 2X1LA 1WZ2A 1Y42X 2NZ2A 1I6LA 1T9GR 3IODA 4I6GA 1N07A 1WQ3A 4MVYA 4DJAA 1IVSA 5AHWA 3FH0A 3A2KA 1JECA 1KQPA 4CQNA 3BNWA 5EKDA 4ZCSA 1IQRA 2Z08A 3CLTC 1EFVB 5TRDA 1O96A 1O97D 5IJXA 2EL7A 3SZGA 3H99A 3G6KA 4MW6A 1ULHA 4I6EA 4MVWA 3OTWA 4KR9A 4KPUB 1JILA 4EGAA 4EG6A 3KFLA 1O6BA 3COWA 1QJCA 3A04A 4J76A 2IJGX 3MUEA 3LOQA 4JXXA 3UOWA 2GKSA 4WSOA 1N2OA 2DR2A 3MXTA 4DDKA 5DEOA 5A88A 2A7XA 1YULA 4KR6A 1QNFA 4HJRA 4HK4A 3TS1A 1M8FA 1TYDE 2DEUA 1MRZA 5KCMA 3IOEA 1TYAE 4G5FA 3SZ3A 1NI5A 4BWVA 2CYBA 3CLUD 1NZJA 5TEVA 3TQOA 3SP1A 2QTNA 2XRYA 1SURA 2Z3VA 3AG6A 2DXIA 1M8GA 2A1TS 3CLSD 3UMVA 2VTBA 3D6UA 3SEZA 4E1AA 1N77A 2QUJA 1WY5A 4NZPA 1ZJWA 1YIAA 2CFOA 1H1TA 1PFWA 3FNRA 3RBAA 3DO8A 1KORA 3ND6A 4DE5A 4ZT4A 4JFAA 1J21A 3AIIA 2WQ7A 5A8AA 1VBMA 4DNXA 4QRDA 4ZT6A 1OWNA 2ZUFA 2C5SA 1KH2A 2P3MA 1NSYA 2D13A 3I05A 3PRHA 1GLNA 2AKEA 1J09A 3COYA 1KR2A 1NP7A 1IFXA 1RQGA 1Q9SA 2YY5A 4NATA 1MBZA 4H3SA 1Q11A 3D6VA 2A1UA 1OWLA 1O96B 1GAXA 2YXNA 1R6TA 1GTRA 1JIKA 5J59A 2G36A 2GOYA 1ILEA 1XNGA 1A8HA 1OWPA 3FDXA 5KHAA 2JANA 2QUKA 1K92A 4MVCA 4PBSA 3L93A 2H29A 1JEEA 1OBHA 4K0RA 1F9AA 2X3FA 1OWMA 1WXGA 4FZJA 4WNYA 2QJOA 2WSIA 3UY4A 1M8PA 1PG0A 3NV7A 1T6YA 2WB2A 3Q12A 1MB2A 2QJFA 3X1JA 1O5TA 3CVWA 1LW7A 3TZEA 4P2BA 1QRSA 2E21A 5H7XA 4UZFA 4X0EA 2DERA 1H3FA 3OP1A 1MB9A 4AS1A 1MAWA 4MW2A 3PNYA 1NB9A 3RK0A 1J1UA 4MAFA 1JEDA 2QJTA 1EFPA 5DASA 1KP3A 2PZ8A 1PFUA 3NBAA 1N2EA 2YWCA 1EUQA 3ZJTA 3SYTA 1YUMA 4MWEA 1WQ4A 4OJMX 4MW5A 3CLTD 1XNHA 4OUDA 1F7VA 1JGTA 4UZEA 3VGJA 2VBVA 1O95C 2CV1A 1KKUA 1WJGA 1N2JA 3S3TA 1LI7A 1G59A 2EJCA 2H2AA 1Q77A 1TEZA 5HUJA 1MJHA 3KT3A 2A1UB 1J20A 2D5BA 2ZP1A 3N2YA 1I6KA 1KQOA 1K4KA 3HGMA 3DPIA 3P52A 2B7LA 3G5AA 1QRUA 2J5BA 3GUZA 3C8ZA 1OBCA 3HZRA 3BL5A 1O97C 2O8VA 3QTBA 4HJXA 1FYDA 5HUHA 1NUPA 5JBNA 4ZT7A 4PBRA 4ARIA 2CV0A 1G8FA 5TS2A 1F4LA 2HGZA 2D54A 1M1ZA 2NSYA 4NAHA 4MUJA 3TZLA 4DLPA 4KR7A 3CLRC 1EJ2A 1VLHA 4GRIA 2PZBA 3NBKA 4NDAA 4G6ZA 2HMAA 5FO0A 1U3DA 1JMVA 2PFSA 1WXHA 1J70A 2OYNA 2QTRA 3IMCA 4ZCQA 4AQ7A 4YMIA 1TYBE 1PFYA 4QREA 4JYZA 5FNZA 3COZA 4R2MA 5TEWA 3IVXA 1KP2A 1M83A 1K97A 1FFYA 4MW4A 3F3MA 2E0IA 2OV4A 1KH3A 1YIDA 1PG2A 2A86A 3M5WA 4RPIA 5K0TA 1COZA 3RJZA 3RK1A 3CLSC 1IQUA 3CVXA 3COVA 3SEQA 1EXDA 2GM3A 4Q16A 3TNJA 2IP1A 1O94C 1H3NA 3L92A 5DB4A 1N2BA 2DUMA 3ZIUA 2E89A 1NUUA 1OD6A 1TFUA 2O5RA 1T6ZA 1N75A 2PXHA 4MUHA 3N05A 4NAUA 1U0BB 1WXFA 3INNA 2J07A 2CYCA 1TQ8A 4EG1A 3CVVA 1O0CA 3DV2A 3K32A 3CTAA 4EFKA 1IHOA 2CUZA 4U8HA 3U1VA 4MUFA 1JZSA 2VXOA 3PNVA 3H9BA 1NUTA 1EUYA 2R5WA 4MUNA 2DLCX 1IQ0A 3K9WA 1TYCA 1HYBA 3CVUA 5J5AA 3FY4A 3KT8A 1QQTA 3AG5A 3FI0A 3KT6A 3G59A 3P0IA 4MWBA 4A91A 2IELA 3VRHA 4DDHA 4EF6A 1NURA 1V8FA 1QU2A 1T9GS 1NYLA 2J09A 5FO1A 4EG7A 4MWDA 1N78A 1R6XA 2VBUA 3ZJVA 5A89A 3ZGZA 3ZUGA 1EE1A 4CDNA 3FETA 1N2HA 4MUGA 2VTBB 3TQIA 2DETA 2J4DA 2VBSA 5J58A 1GPMA 1I2DA 3HL4A 1N06A 3QE4A 3DLAA 3Q10A 2A84A 1I6MA 3X1KA 1ZH0A 2PZAA 3IUBA 2DPLA 2QUIA 3FIUA 4MQ6A 4MULA 4ND6A 4TS1A 1DNPA 3CR8A 3P0HA 1O95D 4R0NA 4J75A 4MW7A 2YWBA 4ARCA 1YI8A 1WXEA 1H3EA 1KH1A 2V0CA 1GTSA 2PG3A 3AL0C 2I1LA 4ZT5A 1N2GA 3FWKA 1VL2A 3IOCA 3ND5A 4MVXA 4EG8A 3PXUA 3FG9A 1KAQA 1GN8A 5K0SA 5DK4A 5HG0A 3Q4GA 5TGTA 3PNBA 1JIIA 4ZCTA 4CT0A 1WOYA 2CYAA 4EG5A 3HV0A 5BNZA 5LM3A 1M8KA 2TS1A 3MLAA 3MLBA 1CT9A 3MMXA 4Q93A 4XFJA 2X1MA 4CDMA 1JHDA 3H05A 2A88A 3RHSA 1YUNA 3CLRD 4R2LA 1Q19A 4JXZA 1G8GA 1NB0A 2CV2A 4ZCRA 2AG6A 2QUHA 1GZUA 1P4MA 2XRZA 1MAUA 1NUSA 1P7PA 3ZJUA 3IH5A 2BYTA 3X1MA 3H9CA 1OWOA 4HPWA 5LFAA 1WXIA 1U7XA 4U7JA 3HFJA 1QTQA 2HZ7A
chains in the Genus database with same CATH superfamily
3C3YA 2WU3A 2JI9A 1JJFA 4WBNF 5AQ1A 1DEAA 5KTOA 2YMMA 2YHAA 3V46A 3UJCA 3ASZA 1IDOA 1N3IA 5CDSA 5GTDA 5JYDA 4E31A 2BJWA 1NJ2A 3C4QA 3F8SA 1KDVA 2HPZA 4IIJB 4EDHA 3EPLA 1IJFA 3L7JA 1DJMA 3OLXA 4HNSA 2IS6A 5ESWA 4XLHA 2ZSFA 5F23A 4EHFA 2GPYA 4DBLC 2QXYA 1P8AA 4UEWA 4DIDA 1NAIA 2CXNA 3LC0A 5T5QA 3WWOA 2BM9A 1U7DA 5EMKA 2AWNA 3ZHSA 3K71B 3WGYA 4CXMA 3GCDA 3GCWA 2ERCA 2E4ZA 4RUKA 1RI4A 4AJKA 1EGQA 1W47A 2WKSA 1K6EA 3FWHA 1NF2A 5K0NA 1MC4A 2IOFK 2NADA 3A6KA 5IMBA 4C6TA 1C4WA 1Q3TA 4FZ5A 2Q0XA 4HDRB 4PLZA 4ZT2A 1AN9A 4CUZA 1X8XA 1LK7A 4DY6A 4LHZA 1IJEA 1EXMA 4RZXA 2ADFA 3A4IA 4QICA 1T2CA 1P9LA 5HRUA 3H9NA 5JCZA 2NAPA 2JLXA 1R8JA 5EZYA 1AJEA 1FRQA 3WOHA 2ECOA 2C4HA 3LO8A 2VDNB 1KFCB 1XRRA 1GNLA 1Z29A 4KR2A 4YV0A 3J80A 1GWNA 4OGLA 5B4VA 4CCWA 5NULA 4C01A 1KY4A 5K3DA 5IH3A 2GZDA 1TMOA 1REQB 4LX8A 2N42A 4ND8B 4EW6A 2ZWVA 1KPHA 2XJ9A 3EWSA 3KB2A 3OFSA 4IQ4A 4LHXA 4OMFG 4CF3A 3TSOA 1E62A 2BPOA 1IONA 1PO7A 1X3SA 3K0FA 3ZPXA 4MUEA 1OLXA 3IA2A 1QB7A 3SIRA 121PA 2PKEA 4IMJB 1U3GA 1QPBA 1HE1C 2H11A 4HH4A 4Q7MB 4DRYA 1B8PA 2WW8A 4RZ2A 1NWCA 3ESBA 4ER0A 3AVVA 4JELA 4IIUA 1ULSA 3KQLA 3C1UA 1RBYA 2FF7A 1Y3DE 4QA9A 5CT8A 2WY2D 1UDAA 3GPIA 3TLYA 4JBWA 4YPVA 4O25A 4S0ZA 3B36A 3A26A 4I3FA 4EVSA 4BKOA 5AUQA 3RVPA 3C85A 2H7YA 1WWKA 2JI6A 3I2FA 5KX5B 2CCJA 4C0BA 4MPRA 4AAYA 4DPKA 1DAEA 3JU3A 5EG5A 2BJHA 2P4QA 3AKDA 4QNRA 1GGFA 2A0WA 2WA1A 5GINE 4MDHA 2D1SA 1M54A 5I7OA 4QVJA 3ORRA 5K20A 2D1YA 4YP9A 3TQCA 2ZSEA 4WXPA 3BAZA 1L7DA 5HNKA 1LI5A 2X9GA 3HHPA 4CLRA 2VNHA 3RYHB 4IX1A 4XOPA 3Q3HA 3GPDG 4LVOA 4LSGA 4ZQIA 1U1IA 4DV2B 5F35A 3U4QA 4HKTA 3LQ2A 4KRGA 4O4LB 2VF8A 1HURA 5BRNA 1QVAA 2LP4Y 5A9RA 1U7OA 2Q5HA 5FI3A 4IZIA 1TA4A 3DO5A 1FTGA 1GADO 1M0TA 2M32A 3A27A 4BLQA 4FXPA 4N7RA 2BF7A 4OLAA 1OFUA 1Y7LA 2X0RA 5ARCA 5TC4A 3I5YA 1GA1A 3T35A 2RONA 3MHPA 1G3RA 1VRWA 1QVRA 3CCEB 1N5RA 2BAGA 4H1VA 4F04A 4MHTA 2AMVA 1Z35A 1Z56C 4G8JA 5IJXA 3TIFA 3U17A 4O2BA 2AR7A 1JDSA 2X19A 5DTMA 1VYUA 3SZGA 2KB0A 4B6JA 1DCMA 1GILA 1Q74A 2BFFB 4XD2A 5HJ7A 3EVDA 3K70C 1QQ6A 1SEPA 1MG0A 2GNAA 4OH1A 4ZZ0A 3N2GB 2X1HA 3SLDA 2TRSB 4LNUB 3CH5A 3CCQB 2BHRA 4ON9A 1NMSA 2CDCA 1LSUA 1SXQA 3DMNA 3SYRA 1MA3A 3QKRA 4JXXA 3DCIA 3JS5A 1J0CA 3QKUA 1U98A 5AJUA 1MP0A 3UOWA 2VNKA 1ES9A 1ZQ9A 2B3DA 3H87A 3PXGA 1EEHA 3M33A 3VXKA 1VM6A 3D0RA 4A8HA 1GG5A 3DNMA 3B20A 3A2LA 3KZCA 1ECFA 1O6CA 2NO1A 4HEJA 2H54A 1YDGA 3H7AA 4F6LA 4J0HA 3HXMA 4KTTE 3EZ6A 1XDZA 3KJZA 2A0YA 1C9DB 3RS9A 2YRXA 4UEOA 3RIMA 2Q5LA 1MRZA 4KXFB 2FEWB 3IOEA 2XUFA 1HZEA 2GA8A 3PFBA 5TQ0B 2O7RA 2M6LA 3TRKA 1NX6A 2VBGA 4IV8A 3F78A 4KQKA 3DHYA 3SZ3A 4IP0A 2CYBA 2DBZA 2XNKA 1EESA 1VJRA 3I5MA 3CCBA 3GVCA 3WYBA 1XEAA 1T1GA 2ZUSA 2EXXA 3D4BA 3DEIA 2GAAA 3K9QO 4J0JA 4UU7A 5TVKA 1YUBA 1UUFA 2ZT7A 4DZZA 1SQGA 1INLA 1ZH4A 1JQDA 3TCXB 3UYLA 5B1EA 2FWPA 2W6ID 3H65A 4YJDA 1N77A 3ZR4B 2PKXA 1EBFA 4GX5A 1SHJA 2GB4A 4O2AA 3RUAA 3WLKX 1DIHA 5I47A 2NG1A 3D02A 2IUTA 4J0CA 3D2LA 1KORA 3ND6A 2KYRA 1ULAA 3PFGA 2BY4A 5BWLA 3LG2A 3VDNB 3IBSA 1RZ3A 3UT5A 4F5ZA 5HZAA 4KWTA 4BE9A 2NAFA 5HGXA 1TJ4A 2CJWB 4GUAA 2BFCB 3I05A 4FFNA 2HDHA 3UF0A 3ZU2A 4YMHA 3C14C 5ARBA 5M3BA 4LGCA 3FMPB 1DAGA 2OECA 1TTPB 7ABPA 4UW9A 2RHWA 2V3WA 3AIMA 5DPMA 5KVCA 5L95A 1RLIA 1BE1A 1YBHA 3OIYA 4G1MB 3EZ9A 1JHVA 4CR6A 1IAVA 3A7DA 1WA5A 5AN9A 1AOXA 1UMDB 5FWNA 4BEJA 1NJ6A 1XYVA 1XTKA 2OO7A 1R6TA 2YXNA 3A1FA 3CF4G 3RSQA 2BMAA 4Y9DA 4LYEA 5FQOA 2XD9A 3KR9A 3WL6A 1AUQA 4TYNA 2JFZA 4OK3A 1ILEA 4U6QA 5AKHA 1OI2A 2XB4A 4FUTA 4JI2B 5KHAA 1JFFB 4RTJA 3MN1A 3WAKA 5ELLA 1WCYA 2R97A 2YN4A 1VG0B 3Q72A 1VJ0A 1EUDB 3RF7A 5G0VA 4U7PB 4JOBA 1EP2B 1K5PA 3W8FA 4HWRA 5IZ4A 1ORRA 1DV2A 1LY1A 2QXUA 4YONB 3RVJA 1EX6A 3AESB 3NATA 2VJYA 3QKWA 2CCGA 1R4MB 4GGMX 2AFHA 3F5DA 3HJNA 1S3GA 3CPJB 1M0EA 3NANA 1QF6A 3FCUB 2HYIC 3GEGA 2YFQA 2EX4A 2RG7A 1RWNA 3CNNA 1NN3A 4BGDA 1GCOA 1JSRA 1KMHA 5J3OA 2AX4A 1XT6A 3DFZA 2J0VA 1IRIA 4I1PA 3U0BA 1S3IA 1DAIA 3S5JA 1ZICA 2PFGA 3WLAA 1K5HA 3N53A 4CKXA 4JYAB 2X85A 2GD1O 2V5AA 2EWWA 2VLIA 3ZQ4A 1P3JA 4G86A 3OZDA 4G85A 3HK2A 4ODIA 1KJYA 1QC5B 2OCYC 1JSLA 3FLBA 1NB9A 1CZOA 4YTEA 4BWFB 2VQFB 4AM8A 2FSUA 3EX7C 1RTTA 2XHEA 1XBTA 3NBAA 5LBIA 3RBXA 4CT5A 4DNPA 1VL1A 2WD9A 2XE8A 5I45A 5DV9A 3DMDA 4O4JB 5BURA 3CURA 2HF2A 4XTCS 4LECA 1UMBB 3K05A 1NDQA 4WLVA 1OR8A 3IHWA 4D41A 5F2NA 4LYDA 4Z4TA 1PZXA 1J56A 1FC0A 5KYUA 4RMNA 4BQIA 1FDSA 1WJGA 1WRBA 4OXQA 5JS1A 3DMFA 3AKYA 1GPYA 2X5OA 1BJKA 1VPEA 2YVQA 5DWVA 3VR5H 1SGWA 2B98A 4LV8B 2IS4A 4TKLA 3KBOA 3WV5A 2NZUG 4MKFA 3PWTA 3CRVA 2BISA 3E22A 4LJSA 1CERA 4QYSA 4IW3B 1MJHA 3CX3A 4FQ5A 4INOA 4URYR 1UC5B 3D3EA 2IZ1A 2WJ4A 2IHUA 3GA5A 3N7UA 4Y1RA 5ENZA 3SX4A 3TWOA 1Q2UA 4A2WA 1IN1A 3M2TA 4K1XA 1YZFA 5C51B 1FIUA 5FX2A 2V7EA 4OCZA 4N5HX 1E61A 5L3QA 3D4PA 3NV9A 1P60A 1S89A 1VCNA 3OHMA 1L5FA 3QVOA 1LFDB 2ECKA 2PL5A 3QUTA 3RFUA 4RIHA 5JBNA 1TZCA 1PWEA 1JSCA 2AE2A 5ETJA 5K6TA 1ZN9A 4K6MA 3EHEA 4ED9A 2OAQ1 4U2DA 3RLIA 5KS2A 3TPZA 1M1ZA 2BDTA 5MGNA 3TYXA 1UBLS 1NTOA 1ECJA 3HY4A 3SC4A 4P38A 3AEUB 4A1FA 1ADGA 3STUA 5KTPA 1RKUA 2XGMA 4HEQA 4XB2A 1M7BA 3H75A 4UTXA 1K9VF 5EIAA 1HSZA 4ITUA 4PINA 3B1WA 4BMXA 1VF7A 2EZTA 3K72B 1SXJE 3SJZA 4QGAA 2DUUA 4L15A 3VYSB 4Q24A 3DLCA 1P7VA 2OV2A 4JMQA 1GVHA 4P5DA 3UXEA 5DSZA 5GMOA 3TSAA 2B9VA 4RZUA 4PG8A 1N5IA 5FUWA 1TTTA 1CVLA 3K5IA 4HDKA 4JK3A 2ZSHA 5JRZA 5C34B 4NOMA 4CM4B 3H1FA 3O5AA 4OSOA 2GPSA 4PC1A 3FI9A 3L4JA 1UBUS 4DVGA 3IBTA 2Z5LA 4R2MA 4J7XA 4AG3A 4DIKA 3HHEA 3RHFA 4DQ0A 3NIBA 1D3AA 1SD5A 4JMPA 1BXGA 4NMLA 3QLVA 5DGCA 1M6WA 1U8YA 2P69A 1G5TA 2X86A 2E0IA 4CVNA 7AT1A 4X65B 2H2GA 4NBRA 2YYZA 3GP8A 2EX1A 5ECDA 3GDWA 3SYMA 2NVBA 4QL3A 1D6SA 3L2OB 1I2MA 1P7WA 2PGNA 3VSBA 4JLJA 5K5EA 5CUQA 3GP5A 4RLQA 1KGDA 3E20A 5J2UA 1D0SA 2HJWA 1E1QD 4YGYA 4AB1A 1U63A 3A9RA 2H8GA 3K0HA 3RYFB 2OL4A 3ZHQA 1FMJA 5F4JA 4X7CA 2IP1A 3GLFE 2CE7A 4D1YA 4WL0A 4ETMA 2FMUA 1ZIPA 4QOIA 4NVRA 1CUBA 1E2BA 3F2IA 2YJTD 4P80A 4EYSA 3N6XA 1N3YA 2RGUA 4OXKA 2FZKA 4B6FA 4MQUA 1K7FB 2Z5VA 5D5HA 3G9UA 2NUBA 3MWDB 3MYRA 4OBWA 2CUZA 1SBNE 2OXEA 1TQDA 3OFJA 5E6SB 3DP9A 3LT1A 5J23A 1DLIA 1FP1D 4LXUA 1NUTA 1XEXB 3LLUA 2GBFA 2GJKA 1BYUA 3CTMA 4QXQA 2HJ9A 4RZ3A 5TT1A 1XFOA 1SZPA 4LUCA 2A9JA 5LA6B 1E7QA 2BHTA 4RJJA 5FA8A 5J5AA 4B32A 1XRNA 1UBRS 1W94A 3SHWA 4K6KA 3BIFA 3KAQA 3IALA 5KNBH 4DV5B 3QIVA 1X7XB 1QHHB 1ORHA 5FBVB 1UZUA 2IEBA 3D6AA 3M34A 5BSUA 4EQ6A 1SZDA 4H6WA 4CTOA 4OI2A 4MVJI 1TUEA 2I3ZA 2PM8A 1VL8A 2ZOSA 3P71T 5AXCA 1FPMA 5A89A 4IRXA 3GIRA 2PS0A 3TNFA 3EHDA 4P7KA 2R44A 3TTVA 3WLMA 1P1CA 2QTGA 1EE1A 4LWPA 3RHTA 4E2YA 3OJWA 4GKAA 3IO5A 1SVKA 4ESVA 1YZVA 5KDOA 3FPGA 4ZAWA 3H5AA 4KOEC 3EWAA 2D0OB 4MUGA 3VSEA 3CRZA 1Z88A 3VJRA 4YRPA 2F3RA 2QMQA 4WE3A 1Q57A 5E1MA 3VR2D 2C94A 2XITA 3TAXA 1XC7A 1ZU4A 4DNQA 1DEXA 5JI3E 3PVDA 4PZEA 4JJZA 1ZH0A 3MNFA 4FYMA 1FUKA 2DPLA 3C7AA 3OU7A 1KJZA 1LPPA 2WF5A 3PD1A 5FOTA 3RANA 4C29A 5JE8A 1U2RA 4P7JA 2ZIUB 4R41A 5DM0A 1RU3A 3NTXA 1RPTA 5BSMA 5GM1A 2P91A 2P9EA 4KUGA 1GTVA 2FG6C 2CD9A 3EPPA 2YDYA 1U2PA 3X3HA 4D0NA 4C5AA 1XR3A 4QDTA 2Y1WA 3ZY6A 5EXEA 4LYAA 1EWTA 2JJ8A 1KEWA 3FA2A 5CIQA 4JUFA 4ZT5A 4IJVA 1IUNA 4Z9XA 5C46F 5KMGA 2D8MA 2OQRA 1JWLA 3AUXA 4YI3A 1B26A 1RE0A 1RXYA 2FZCA 3K9GA 5HG0A 3U7QA 2CL0X 2DH6A 2V9CA 1P0IA 1UDXA 3L1KA 4CLXA 2ZRFA 4GWLA 2YHIA 4MRNA 4R1NA 3C5EA 5IBRA 3U3OA 2YN2A 4EPTA 5KEIA 2P1DA 1DBPA 3LXRA 4JLOA 4F96A 4CKZA 1AKTA 2ALJA 1TEXA 1YDMA 3LGSA 2JHPA 4Q6BA 4CEHA 5JH7B 3QA9A 4G0OA 5EVJA 4JENA 4QUBA 1RQNA 3E3AA 3SHQA 3VR4H 1O08A 5CW1A 2VZ0A 2YZNA 5HA5A 3P9CA 4MJXA 2ZUTA 3FCEA 3BYZA 2XRZA 1J33A 1OBFO 1DIRA 3Q3EA 1W1UA 5CM2Z 4RDXA 3G7NA 1YFKA 4H6VA 4TYYA 1U5CA 1HQKA 2I78A 2JJ2D 1BAPA 2GHTA 2NOAA 3VH4A 2ZS8A 1NLFA 2YQ4A 4XPZA 4W5TA 1LKZA 4MV8A 4JUBA 2Y0CA 5IDQA 4C7OB 4HL6A 2VVTA 3OOYA 3PUKA 1KY5A 1AA6A 1RQPA 5EA2A 4YJFB 1RSZA 5CDHA 2XV1A 2PIDA 4DT1B 4EG3A 2BZGA 2OEPA 3IEKA 5EJ4A 2I2AA 2ISQA 4IS2A 3Q15C 1TQ4A 1EFPB 3KK0A 4U1RA 1WD5A 1ZHFA 3LDHA 1JHUA 4WIAA 4XFDA 3GFBA 1SCJA 4IGFA 3PU6A 4LWZA 4MR7A 4I2VA 3ZNOA 2V5UA 5K8JB 2O8EA 3KSZO 1GGVA 4EARA 3WYNA 3R9KA 1D7AA 3ZDZB 1H2AS 3AFHA 1W30A 3S70A 4OHCA 5KNDD 4RVNA 5JCOA 4BVAA 4IOMA 4NXMB 1FVHA 1Y0RA 3E4CA 1J8QA 3EXIB 3JZMA 5HJ5A 4FHZA 3UMRA 3AM3A 4BAUA 5CRIA 2R3SA 1BC5A 1F6WA 2YIVX 4O4HA 1OC4A 3ZXIA 4CLHA 1QU3A 4M86A 4LYHA 1DP4A 1NFRA 1VTKA 4LGVA 5CB8A 1Y4AE 4LSMA 1M2KA 4LDZA 5IULC 2WQ6A 4EZBA 3MJDA 4OHFA 4NNJA 3SBEA 1DWPA 1E5QA 3DBVO 3VYRB 5B37A 5A9SA 1EFUA 4TV9F 3EGOA 3QLJA 3MQ4A 3GA0A 4IDNA 2VPTA 2B4TO 3JASA 1T29A 3AVUA 2OMKA 3P0JA 4NX2A 4RV9A 2G0NA 1TD9A 1SXJA 5HOQA 3A10A 3AKZA 3CVYA 2W48A 1GGKA 2Y1GA 3G68A 3WVNA 4LPSA 4S3MA 2JK0A 2NSHA 4B75A 3FOZA 3T4XA 4D3YA 4UOEA 5ITWA 1J9EA 4DMFA 1EJ6A 1USGA 4K28A 4LJRA 1WPQA 4MO9A 3HVHA 3U4AA 2V6JA 4RZQA 4URFA 1WF3A 1CQPA 2HY7A 2WHYA 3B2EA 3GMIA 2D7CA 3QG5A 3KJXA 5DVZA 3SLKA 1LZKA 1TW3A 3F98A 2FW0A 1EUCA 1E96A 1WE2A 3F46A 1EQUA 3IOMA 5KOHA 4O2RA 4X06A 4FONA 1QRTA 1M0SA 3W78A 5BV2P 3LX4A 3GZNB 3HYRA 4GOMD 3E58A 3H8SA 3T61A 4MP6A 3MGGA 1EP3B 5EZQA 3R8FA 1DRJA 1VI2A 3DDYA 1KPIA 2J3IA 3TDKA 5LMCA 4HNUA 3U7IA 3GYBA 4PTYA 3LE8A 4MS3B 1AB6A 4JJ7A 1G1AA 4GM0A 4JZYA 3K6SB 4BN0A 1S4MA 1LRLA 1R27A 2VSNA 4UMFA 2RBKA 3BWMA 4DMUB 1DUSA 2REXB 2WJVA 1MAHA 4BLWA 2FGKA 5IX8A 2IU4A 5LYJB 3GLFA 2FUG1 2B8EA 1KVQA 5B4TA 2QP9X 5F4MA 2L42A 4ZRDA 1UM8A 4ZU6X 2YBEA 2QTTA 4QLBA 4GWGA 2E5LB 2WAMA 1XZMA 3B5JA 3FFXA 4KXNA 1ZA2A 2DJ5A 1WKBA 2ZT8A 5C8DA 3A1UA 3T1TA 3IIIA 2IDKA 4MHSA 3X43A 1EVJA 4KV7A 2FTKE 1RDFA 5FOUA 2FE4A 3VO1A 3I6QA 1CY2A 3M5DA 1Q0TA 2XNSA 1Y4SA 2PBZA 4QWMA 1E2HA 3S28A 1H65A 1IOWA 1CQIA 1RQXA 1Y3AA 1G4UR 1E2DA 1UZNA 2R1VA 1ZL0A 2RFLA 4OOSA 2XODA 5KWVA 2NZYA 4QM7A 4EPXA 4TXLA 1I6LA 3PQ6A 4RTKA 2JGAA 4BO4A 1GKYA 1YQ9A 3N39C 1JW9B 1A5ZA 4BZXA 5JCOC 1E5LA 2YXLA 1QIKA 5ECWA 4IS3A 4XGNA 3TLBA 2VYQA 1AGXA 5FOXA 1BWQA 1WMDA 4ND1A 4UNIA 1JBEA 2ZJFA 2BCGY 1NULA 4TWAA 1BROA 4DLLA 1M33A 3CT4A 3OQHA 4RJTA 1O96A 3ECCA 5D1NA 3SKXA 2BM8A 3TXXA 3MF4A 2JAOA 4I6EA 4EB8A 2IUFA 2HA0A 2Z8YA 2WB4A 5F33A 4YUVA 2OQVA 5JUWA 3EGXB 1P1RA 3LUKA 1B3BA 1JHRA 5FLEX 4BB5A 3RJ5A 4O1HA 3CN7A 3RVSA 1SXJC 1ZIXA 4Q34A 3P9SA 3IDZA 3K1JA 5KYVA 1ST3A 3ZXYA 4E51A 1P31A 1A9QA 5HHTA 1NE7A 4KTVE 3O4IA 2GCGA 4IUCS 1OH8A 5CDGA 3NJ4A 1W88A 2FETA 4D0SA 3QNUA 2I3AA 3GUVA 3KYCA 4CDRA 3LXXA 1CRWG 1TTHA 1Z8FA 2IYXA 2ORWA 4J6EA 4OF4A 5FBLB 4F60A 1HNZB 3V4VB 1C7FA 1DIOB 4ASUA 3I6YA 3PITA 4AJOA 4U02A 4QQRA 3T8YA 2R6R1 4TXHA 4LHEA 2OD7A 3TW0A 2XMRA 1A4RA 5IJWA 2PJDA 3ZVRA 2AMYA 3KZNA 1EP9A 1D4AA 3LKDA 1SRQA 2DOGA 1XMJA 3PNPA 4NWIA 2CHVA 1J25A 1UBNA 4LY9A 5HWSA 1WULS 3LS2A 3UUFA 3BF8A 2FFAA 4F85A 2GPWA 3ZCVA 1T4CB 1EWQA 1M8GA 2OCDA 1YB4A 3Q5DA 3QY9A 1T2VA 4FN4A 2VHVA 3CLSD 1C1DA 5CAEB 4WBNB 2IOYA 3BKXA 4QE3A 2O7SA 3M70A 1WY5A 3L41A 1XYGA 5IFKA 1S01A 2GFIA 2GGSA 4E5YA 2WT8A 4RY0A 5B1HA 2PCLA 4MINA 4EFLA 5DNYB 1T26A 1Y6QA 3CNBA 4TLMB 4ZT4A 1CW2B 2P0AA 1NXPA 1KAHA 1U8EA 2MYPA 5A62A 4BAGA 1COWD 1X80B 2C5SA 4EHAA 3DAPA 1OBOA 4N03A 5CK5A 4WLOA 4MQ4A 1JEYB 2AKEA 5BN5A 3DVLA 3COYA 3LTNC 5D7NA 3ACDA 1UR5A 2QPOA 4DA7A 1RZRD 3BFKA 2ZLBA 3QOFA 3FNBA 1WBDA 3ETCA 3SHFA 3KU1A 4CKYA 4E15A 3L9XA 5DNVA 1JG4A 3S2YA 2QAJA 2P2CA 5FBZA 2JCXA 1PTJA 1UT8A 4CHTA 3RKRA 3DA8A 1KERA 4F2DA 3K2QA 1VE1A 4R0MA 3JQCA 1Z37A 1OV4A 2FPLA 2GN9A 3OZEA 4IR7A 1KZYC 1XQVA 4A92A 4CLOA 3CJTA 4DR1B 2YTZA 3OPQA 2V4DA 3M1IA 1TJNA 4EP1A 2H7VA 1I94B 9MHTA 2JLAA 3KP1A 2ODQA 5JMTA 1E4VA 2FP3A 1QGAA 1RAGA 1X38A 4ZTZB 5L45A 1N5KA 3OCVA 3ADKA 3DLPX 1OTYA 1QUEA 4LXIA 3MT8A 3H8VA 2WJYA 1OU0A 1DE0A 4CODB 3U3DA 4IUYA 4BNLA 4E6EA 3OIFA 2QW0X 1S9HA 2ZI3A 4DK1A 4HZUB 1RJFA 2JIBA 3USES 4JI0B 2D8AA 2GJ4A 4ZYTA 4DNFA 1CJTC 2Q0QA 3RS4A 3WRXA 3W7AA 1HUQA 1KI6B 2ZRJA 5KAMA 4EG0A 2UUCB 1DKQA 4EMBA 3H5NA 3QEOA 3CKMA 1Z0SA 1T3ZA 1PV2A 3H7IA 3M4XA 3NHFA 3NVDA 4A2QA 2JKYA 1UZLA 2WPNA 5HVNA 3PQ5A 2WFLB 3GRCA 2JLRA 5EPEA 2OTCA 2XUAA 1XL0A 4GEGA 2ZAGA 1NJ8A 4N5DA 2EDCA 5G0WA 4U7FA 3ZU4A 5AW0A 5E6UB 2DWUA 1MCZA 5ESDA 1TIKA 1PW7A 5B58T 2MT9A 1EUQA 2J6BA 1KC3A 2BFWA 3AWDA 4HS9A 1NVGA 4N3NA 3WLHA 5DX0A 3ZC3A 1IB6A 4PQGA 2XT6A 1U28A 3CY6A 5LL6P 1JGTA 2R1TA 3VGJA 3DXYA 3QVGA 4X7FA 1YHQB 1LBEA 4P36A 5EWLB 5AXAA 1XPOA 2HTEA 3U4IA 4I9UA 5EL0A 3VSAA 1E2NA 1D7OA 3RUIA 3I2YX 4GOOD 3U7FB 1HLPA 2MR5A 2V6GA 1NZDA 4AP9A 13PKA 1Z3IX 2RH5A 1OGJA 1JQ3A 2ATEA 2B1JA 3BE6A 4WXYB 3R9XB 4G65A 2JI7A 1JEQB 4H60A 3WGNA 4CQMD 1K4KA 1PTJC 1K8QA 2CMDA 2BT4A 3QKSA 3IMFA 2II6A 3EQ9A 5CA0A 4MIOA 4PG5A 3RSOA 3EXEB 2OZLB 4CEIA 2ENWA 1E6MA 1GT6A 3QTBA 5HUHA 3ICQB 5CR9A 2V4ZA 3EIFA 1OI7A 4YWHA 1WORA 5IXYA 3BZWA 1KOLA 4WKPA 5AW6A 3M6LA 1D04A 1LWNA 2AXPA 2J5RA 3E9DA 3RAJA 4G0ZA 4F11A 1FRFS 2AEMA 3KTFA 4BLOA 3QFCA 3CRW1 1B15A 1C8VB 3JZFA 5DXAA 5EUQB 2IYYA 5CT4A 1N6PA 4M0LA 1NU6A 1OH7A 5FR2A 3OLCX 5T64A 1A5SB 1I4OA 5I8WA 1V16A 2XRMA 3L1HA 4MAAA 4Q3KA 1KIMA 2OB1A 3EEIA 3STTA 3MA0A 5IVDA 4B3BA 1Z68A 4F4UA 4WLEA 3R8XA 3F71A 4ARBA 4BKPA 3WRXC 5FB3A 2YY6A 4Z99A 5LQRA 3T1HB 4G0WA 4Z1MD 2N46A 3PNSA 4E88A 5DBOA 3BD6A 4H7DA 4Q9LA 3LK7A 3PDIB 2FUEA 2YJZA 4HEA1 4L5JA 5FNZA 2QW1A 3DVSX 3SCZA 5IDXA 1TAUA 1M1UA 2IS2A 3PKZA 5IF3A 2IDZA 3OJLA 4L7VA 5FPQA 4EB6B 2QI9F 4A36A 3B7GA 2P4HX 3UFXB 3N75A 1EXWA 3OTIA 2QVGA 4AWBA 2O48X 3R2JA 2IDJA 1TKAA 3CUYA 4M8IA 1IQUA 1WCIB 2XVXA 3ZE0B 3ZXUB 1ZGBA 1I6WA 3IJEB 2P7HA 2CUNA 4PIPA 2ZRHA 4ZPXA 1U28C 2RJNA 4Q16A 4N5LA 1Q0HA 4OKNA 4QYIA 1M1NB 3DEAA 3TNJA 1E0KA 3UCFA 5IG2A 2C4KA 3RTEA 4WKBA 2SNIE 1J2RA 2DUMA 1CZUA 1FNNA 1SVUA 1Z5OA 3DBOB 3GRPA 3ONEA 4RLSA 2VNJA 4UHJA 1UBKS 2RGCA 4Y2UA 1OPRA 2OSVA 1JJ2B 4HVTA 4QLOA 4WN3A 4XOTA 4COOA 4ZGQB 5ITZA 4H9GA 4DOMA 3CVVA 5C1IA 3I55B 1Q1NA 1IHOA 1QDLB 2GPBA 4KL8S 4UMEA 5CPFA 4EFKA 4PLYA 4MUFA 4R1LA 5U4QA 4YIHA 1BHJA 3DE0X 3PNVA 2UV8A 3OPMA 3SM3A 4H27A 3SJPA 3T1NA 5FWYA 2ZI6A 4Y2XA 5J4LA 1H2RS 1QK5A 3L1VA 4QKQA 4L85A 5B36A 2R62A 2CUKA 3FTPA 3PIRA 5EWMA 4JL6A 3Q41A 4Q3DA 5CM9C 4LF5B 2W5UA 2DY1A 1QP8A 4KN5A 4MEBA 1M2JA 3C8DA 5K3AA 1RJ9A 3DZIA 3AEQB 3CVJA 2P1RA 2NP6A 1NG9A 1OOEA 4IKOA 3FVQA 4OY3A 1U0HC 3RBZA 5AOCA 5T3UA 1K3FA 1XZHA 4FBLA 1G2IA 2FQ1A 3RC3A 1ECGA 1F2UA 3DFIA 1F06A 2IHJA 2Q3CA 3NYQA 3PC4A 4OTZA 4PCAA 4G7XA 3PG5A 1JPUA 1OFVA 2KW5A 3DMYA 4Q3CA 4WZEA 1MABB 4WK0B 5KNLA 4BV2A 3ABSB 4Q4AB 2HIHA 4LEIA 4X85A 4UQLA 5LP1A 2DETA 3CE9A 2G8LA 2LVBA 5TDHA 4JT4A 1I7SB 5HIJA 1MNAA 2XOEA 2IHKA 3RPEA 4B83A 4YT8A 4ZIRB 1XE1A 3DTTA 4IDHA 1PGQA 1UK6A 1Z8HA 1PNTA 2WUFA 2O8DB 4D57A 7YASA 1Y9EA 2HQSA 3K7EA 1XPUA 2VHJA 3PQEA 1UDRA 2HLHA 2WIDA 1EVYA 4MCHA 4I50F 5JNSA 4TUYF 1XV5A 4PAMA 2J0UB 2NUTA 1N5JA 3KZXA 3JD1A 1F4PA 2G5GX 3O31A 1O95D 1XJ5A 5D6OA 1BH2A 3K5PA 3WMWA 3T53B 3GHHA 3ZI4A 4H1WA 5J2TA 3DG9A 5SY9A 3KXIA 4JKIA 1C3LA 4N7JA 2UU9B 3ND9A 2VAPA 4TRNA 4EEKA 4RM2A 3TLMA 1ILWA 1V8ZA 3L8EA 3V33A 1UKCA 3OKFA 1DT3A 3BXZA 3DQPA 3F9CA 5C9ZA 1VJ1A 3I2GA 3OZSA 3PXUA 3FG9A 5J4VA 1X1DA 5AW8A 3EIQA 4EDFA 5TT0A 4EI7A 1BOOA 3NEAA 2Q3FA 4HAXA 3QKIA 3MWYW 4CZ2A 1ACLA 1AXRA 1E1MA 1E4EA 3KUXA 4JBXA 4B9EA 2VPQA 1EWRA 2ACWA 3MJTA 3LXUX 4HQ6A 5K4AA 2YOFA 3BD8A 4P34A 1OXSC 4EA8A 3EIWA 4L0MA 4FZRA 5B57C 4A4DA 1SCUB 2RJ3A 5EFZA 2ACEA 4RSRA 4UE3S 2OE2A 3F7OA 3JYPA 4Q3AA 4XAQA 3VV2A 4DA9A 4CIAA 4B3GA 3DDOA 1ZOIA 5LMNB 1GARA 2GAOA 5AKLA 4DWOA 2AG6A 2CXRA 4EJMA 1L4UA 2GCNA 1P2GA 4KK4A 3O38A 5DEIA 4E5VA 1H42A 4PR0A 3HJUA 1XPRA 3KAKA 2ZR8A 4H08A 4YRZA 4L4UA 4JSYA 4TX1A 2WUEA 1SBYA 4H2DA 3SQXA 3N8DA 2FU5C 3P9RA 1RLOA 1ZC4A 3BRWD 2PZKA 4RPKA 4HPWA 2JAHA 1U9ZA 2KLBA 4W9MC 1THTA 4G9EA 2F17A 4IO0A 3SICE 2PX3A 4BNIA 3EH1A 2PBRA 1VHEA 2R6GA 1C9NA 3FYUB 4IUDS 5JLJA 5H3HA 3VR3D 4A6DA 4IF6A 1CHDA 4FFSA 5ALLA 3WIOA 2OCKA 1Z0JA 5AKYA 4BQNA 5FTMA 2A5LA 2C42A 2NV2B 3NUGA 2WVAA 2B82A 4GMGA 3WWYA 2X0KA 4HNGA 3PRKE 2PMDA 1FFBA 2PUHA 5CGZA 2R6CA 1ODFA 4AJ4A 3ESRA 4BJ3A 4C7BA 4YR9A 1QZ3A 4JJGA 1Z4IA 3ZY2A 2VTEA 4YP0A 5L6LB 2C2GA 1EXVA 3E9ZA 2OFFA 1QYIA 3EWNA 4QOEA 6PFKA 2FWBA 1X3LA 3TEFA 4MIYA 3GJ8A 3GWZA 3IDFA 3M0EA 1TM2A 5IVPA 2R60A 2VYCA 4XWAA 4N82A 4YFYA 3U37A 1O94D 3M6IA 1KS9A 1DQNA 3OLWA 2JBAA 1RC8A 1MTZA 5H8WA 3LA6A 5REQB 1KU0A 3AR3A 4Q82A 5E8JA 1I2AA 1IBLB 1IYZA 2HT6A 1D8TA 1QQ7A 4OPMA 1ZH6A 2J3DA 1UD3A 2C2BA 2WWGA 2G6TA 4PPNA 3YASA 5AI8A 3UK2A 4BYMA 1Q5PA 2Z5GA 4HWTA 1TXGA 1R6UA 3KHTA 3PPXA 4D02A 2WF9A 5IYPA 3B48A 2K7ZA 2PX4A 1SWWA 1YCDA 2NU8A 3VZCA 1C5KA 1I0IA 1IHPA 1WLYA 4D8TA 4TMFA 3PA2A 3E81A 3EPHA 1JYEA 1GCGA 1U65A 4F4IA 1IEVA 3K5HA 3OE5A 2HA4A 4ZZIA 3TTTA 3GT3A 5AW9A 2C31A 2FAXA 3L6EA 4HR7A 1PSWA 3GEIA 4IDFA 4II7A 4MWGA 4WFJA 5BOSB 4MQBA 2O07A 5BSYA 1K4MA 1E79A 5CJ2A 1EK1A 2FPPA 5H16A 5KVQA 1PT7A 2V6FA 1PR4A 4NSNA 1JIVA 1H9CA 2Q2OA 1KZ4A 2J9GA 4BEBA 4RF5A 1EDBA 1H1DA 5BN4A 4JQSA 4C2BA 1UBGA 2WE8A 3JXEA 3OPYA 3R41A 4GBED 3PFHA 4RHUA 1QGUB 5EHIA 3TE7A 3TVDA 4P3PA 5E95A 3KZ1E 4A27A 2WPDD 2XEXA 5K03A 4PYKA 3PGJA 4JEHA 3LQKA 1MT3A 3TLGA 3DD5A 1EKXA 1XTIA 4FKBA 5LQSA 1AGPA 2OHFA 2P9TA 1VKNA 4GXQA 3KRTA 3PUYA 3FPHA 2KS6A 1TUGA 2O1WA 5JCPA 1BXRA 3B9RA 3OLYA 1H69A 4LI0A 2MSCB 4L2IB 4F93B 4Z4IA 2IT1A 3HBLA 1U9JA 4M55A 4UAGA 1QTIA 2Q0SA 1HRKA 2H3EA 3V8NA 3OF2A 1P4AA 3K1YA 1QGOA 3TW6A 2O8FA 4EMTA 1Q0LA 5F98A 2FQYA 3KOUA 5B6IA 3GMTA 1FPQA 2YQZA 3AFIA 4GXTA 5JBIA 3T5PA 3VOTA 4ZFNA 4HNVA 1HY3A 5H80A 5EOVA 3N2ZB 5JMOA 1YI0A 1TRHA 1Z28A 1VIYA 1MPTA 1P61B 1DX4A 3V48A 1TFRA 4BKUA 5HQ3A 4D79A 4N0MA 4JT2A 4KAAA 2FA9A 1KC1A 5FOVA 1IQRA 3BTSA 4FU0A 3T7EA 1LV8A 1YMQA 2ZQZA 1XVLA 1R74A 4RWZA 4PR3A 1UF9A 2OGUA 1UXKA 2ZR9A 3MSCA 3T56B 1C30A 2X9NA 5HIKA 2EZUA 3TR6A 1KJQA 4P0TA 3W5UA 3MIZA 4R81A 5TMPA 2XQVA 3O8RA 2ABWA 1S3SA 4KPUB 3ST7A 1G18A 2W4IA 4EJ6A 3O9MA 5DLPA 1TLFA 3JQQA 4BZQA 3LVQE 3D4IA 5JJCA 3AVWA 3LHSA 3ASRA 5FIUA 1KF0A 4PFJA 4U6SA 3WOVA 2QQEA 1MPXA 3R0JA 2KHZA 2GKSA 1HFEL 1X1BA 2QAGA 1Z5NA 1YJ5A 3NOVA 1B8UA 1L5RA 4J91A 1YTLA 2PT9A 3DBIA 2JDIA 3SMQA 3M4ZA 4C0HA 3DEJA 4ND5A 2JRLA 1YR2A 4CM8A 3OW7A 1G6OA 2X2EA 3FHTA 1W96A 3DH0A 1Z5UA 3A1DA 2VR1A 3HZHA 2W6JD 3D31A 4HAVA 2AC4A 4Y0NA 4CI9A 5AM3A 4RTLA 1NSTA 4XD7D 1A1SA 4ZA2A 2FZLA 3ZGYA 3CN9A 3QYFA 3F6PA 3R5JA 3WDLA 2FVGA 1NI5A 2VQSA 1ZVKA 4TTSA 3F8WA 3VTZA 4MA4A 3WFJA 1OLSA 1TA9A 4F1WA 5ILGA 5D3ZA 4MGEA 3DD1A 2C9YA 1V1MB 1JXMA 2FSHA 3GVLA 1YKGA 1U7TA 2REQB 2A1TS 5AK5A 2FPXA 3WRVA 3UMVA 3ZHXA 1A9ZA 3B38A 1SCBA 2XIJA 3Q2IA 3WAGA 1JR2A 2NTVA 1KEEB 4CMAA 1QQBA 1DBQA 1AGYA 3D8BA 3KYBA 2JVKA 2QV7A 3QEMA 3MMZA 3DTVA 4LXXA 5DCYA 3OPOA 4PG6A 3R3XA 4C20A 1PFWA 1TO1E 2QZ9A 2R6ZA 4BYGA 2BSQA 1FQKA 4JB8A 5E2BA 2LD4A 5A6SA 1VL0A 1Y5IA 4HUQB 4NIMA 3ZLTA 2I87A 3G5UA 2ZUFA 3FZGA 1G17A 1R2QA 3QFTA 2CKMA 4N76A 2BFDA 2F1IA 2X15A 3IAS6 1ISFA 3NGXA 4FPXA 1R0SA 3BIXA 4U5XA 3PCRB 3ILYA 4IUBS 3DBRB 5EAIA 1JALA 4FE3A 2QSYA 3G8AA 2ZYSA 4QSHA 1H8HA 3VZBA 3CZRA 4ER5A 3USCS 1N7GA 3UJPA 1XO1A 2RIRA 5AVYA 2A1UA 3QVKA 1RPNA 4D9EA 3K0AB 1LLUA 4TV9B 1DTWB 1FFXA 1N4AA 4YQFA 3QX8A 2ZYUX 3LFHA 3GFTA 4BBAA 1T3GA 2YIDA 3R8CA 4UHCA 4DR4B 4YXWA 3JQAA 3ZKWA 1L8OA 3RYCA 3WFZA 5EHGA 3GAAA 1IDN1 2NO0A 1ORVA 3M4JA 1KIFA 3D7SA 3LK6A 3VC1A 3GNSA 4GFDA 1RWBA 2H29A 3DB2A 3FLAA 3PDUA 4WESB 4HN2A 5LBUA 1SOUA 3OOHA 2PEYA 3NGLA 3W2IA 2QQ5A 1BX0A 2QNBA 2QAGC 3UW3A 3TX2A 3T38A 3BS4A 3JYHA 4DRXB 1TO6A 3OUUA 4FE7A 3PT5A 2H3HA 5HSGA 2G76A 2WB2A 1XG5A 3TL3A 2IXTA 1E4OA 4L6AA 4IDPA 1QGED 2C4NA 3A2NA 4XQFA 2ST1A 2W71A 3D6FA 4BVBA 5J3JA 5CD1A 4MB2A 3LY7A 1EP1B 4UHKA 2W4QA 3KTAA 4OAOA 3LFUA 5B1DA 4RACA 1GO2A 4EGQA 4XONA 5JWRA 3ZWQA 1PTKA 1YJ8A 4FSXA 3G9QA 4EUHA 3C5CA 3DT8A 2UXCB 1WP9A 2J1LA 1H3FA 2Z57A 3A3PA 3P4UA 2X0FA 3V55A 5FHRA 1FLVA 3KU4A 4R31A 1K28D 4LDRA 2O2YA 2H07A 4MMYB 4PNEA 4ZODA 3VNQA 3PFWO 3CMMA 2Z1DA 1VLVA 1BGWA 1L7EA 3G17A 1HYHA 1MAVA 2Z9BA 4LHSA 2K6GA 2PWBA 4IIJA 2UVPB 2XSZA 2XOXA 3MWGA 4C76A 1FDOA 1GGJA 2DWOA 1E94E 4MITA 5E8RA 2RHTA 3UOGA 1VSVA 3JWEA 1QG4A 4O6VA 4LRQA 2D1RA 4ZVSA 2ZWPA 1HPLA 2PLNA 2ZWMA 5J2UF 1DEHA 3G2HA 4A8TA 2C07A 1CUHA 5JLAA 2OBXA 3R4VA 3GLGE 2AEJA 1QGDA 3UMJA 4EBBA 1DL5A 3QQPA 2WBLC 2IEZA 5LQCA 2NUPA 5H3CA 1OVMA 1PFKA 3PQ8A 1MOSA 2ZVPX 2ZBEA 4N7BA 4RCVA 4CKEB 4S1PA 4I66A 3U16A 4M1WA 2ZSJA 4PAAA 1XKTA 4AS3A 1E2UA 1J5PA 3NT4A 4W1SA 2RGRA 3L8HA 1RJGA 4L3VA 3AVYA 3BPSA 4UCQA 5G1NA 3WDMA 4AD8A 4DGQA 2B7BA 3FOWA 1OBCA 3GRRA 2BFBB 1O9HA 3FCSB 1Y82A 4MMZB 1IZ0A 4QO8A 3E1SA 3VZPA 4K9PA 3URMA 4DKXA 4KREA 3UOAB 3BL8A 4ND8A 5HZHA 1JQEA 3GVXA 5T4EA 5JEDA 3LNNA 5I9LA 5KWIA 2PU7A 1BN6A 1C7IA 4N41A 3CV3A 5AQEA 4MI3A 4W63A 3LH5A 3M89A 4KIGA 1HOTA 1YL5A 1U1CA 2CF5A 2ORVA 3HYTA 2YV1A 5A03A 1DT5A 4Q7QA 1OLOA 3K6JA 4HNQA 1GRCA 2XUZA 3ZGXA 1TI7A 4KB5A 1SA0A 4NDAA 4F1JA 1RYHA 4KO4S 2YXPX 1T43A 4WFIA 4XCXA 2Q0HA 1T1JA 3D0OA 1Y4DE 4NZMA 2MMCA 2WE7A 3M6XA 5DN9A 4HT3B 5CEEA 4MUAA 3B13B 4WZBB 4AJ2A 1J49A 1U2GA 3IMKA 4ZKEA 2PFSA 1WETA 5BSEA 2Q1XA 5DI3B 5EPUA 2VTKA 3U9SA 1OREA 2R1UA 1PRYA 4FXUA 3QX9A 4RGYA 2EP7A 3NH6A 3REOA 4RHCA 5HE8A 4BNDB 3CKKA 3C1TA 5EMHA 1VGVA 3DOOA 3GG9A 1AF7A 4NF2A 1K1EA 4RD2A 1KMNA 1Q3HA 3ABIA 3EIHA 5G4KA 1YAHA 5TEWA 1R4AA 1H85A 1G0NA 3PX2A 1RYDA 2EFHB 1POWA 1SVNA 1ZXLA 3IEIA 1WDWB 1Z17A 3K1TA 4P9NA 4RVSA 4YRGA 2FOXA 3HKEA 4EFNA 2A86A 1XQWA 2D3TA 3B8EA 4IRUB 4XB6B 5DYYA 3X1DA 5EUCA 4D9FA 5JZVA 1ZEJA 3MCVA 3L0DA 2AYYA 3DDCA 4O4LA 1YQQA 1B43A 1H2BA 2B34A 3QX7A 4LXGA 5DYWA 5DNEA 3AVXA 3RUDA 4BO2A 5B6PA 5HCNA 3EXG2 4ZK6A 3BQNB 3RC9A 1YONA 4X93A 4C0XA 2WSSA 1M74A 3EZ7A 3O4HA 2OPHA 3G5MA 4N40A 2X5KO 1M2GA 3IBFA 4AZVA 2E89A 2CMKA 2L17A 2JLBA 4PPQA 4V3BA 1GD1O 5FLYA 5TSDA 3N05A 3E3MA 4ROSA 2HUNA 2OV6A 1U0BB 3WXBA 4GO1A 4QEZA 1I2CA 3T5CA 1J8MF 2BFFA 3U9LA 4BZPA 1ZZEA 5LNK6 2ZVQX 4RMJA 2IX3A 1DI0A 2XQKA 3QPWA 4KO3S 4X1YA 2IGTA 4XASA 2R5WA 3KCQA 5LVAA 4KK3A 4OUKX 2D0PB 2I5PO 3K9WA 1OUMA 3LY5A 3VJLA 2VZ8A 1TYCA 5MF6A 4G5XA 3O4FA 2C1EA 4E22A 4LF7B 1UDCA 1ZVMA 4R6XA 1US8B 1W36B 1QQTA 1Z25A 2DFTA 2XT0A 4PZUA 1QXSA 1YRHA 2YVLA 3FI0A 3C5VA 4GE3A 4N0EA 1QU2A 1XVTA 1YS6A 2IELA 2Z83A 1NYLA 5EZ6B 2GAFA 5SYNA 1R0BA 2JRCA 1S2IA 4ADSG 4P31A 5LQAA 1DUVG 1KVTA 4E3WA 5AVKA 3PTAA 2XCSB 1NT4A 2XNDD 3EYAA 1OZGA 3FSJX 1U6JA 4QDZA 5EIEA 2Z98A 2IWHA 4R54A 2G9UA 3PS9A 3BN3A 1XX6A 1P1JA 2VDPB 3L46A 3EB9A 1T5LA 2YMQA 2HXYA 1CJKC 3DAGA 3EIUA 5AVJA 2IH2A 5JEEA 1JT2A 2WQZA 2VBSA 3GX1A 3WR5A 2Q4TA 2LXNA 2ETXA 2XJ4A 1U2GC 4U7WA 1E5DA 3Q2OA 1OC2A 4COKA 2BFNA 4OM8A 5JR3A 1BX1A 3REQA 2PS1A 4DV7B 1LJUA 3Q10A 5M29A 3KWJA 3ROMA 4TWIA 3GFPA 2AN5A 5AT1A 2ZCJA 5GADl 2D00A 1LLFA 2FPMA 5ALYA 2QUIA 4E03A 2IU3A 2JJ1D 1KZ1A 2FQWA 2NQTA 3UHAA 5JECA 2KQUA 3PL5A 2KBEA 4AZSA 2I8LA 2G4LA 4Y2GA 4N18A 3DC7A 3KLMX 2Q62A 4FR5A 1EJ0A 4KLZA 5DNCA 1RAHA 4PS0A 1NW6A 3OCCA 3A36A 3CO5A 4JX8A 3K6RA 4QQ8A 4Y2QA 1XTUA 5AKZA 1BEUB 3HZZA 4CF6A 4E5SA 2AI2A 1H93A 4IDDA 2HM7A 4HIZA 5HZMA 2J3QA 5COBA 5INTA 1BD3A 2G9NA 5EZYF 1KAQA 3LT5A 2H65A 3D3NA 3HUDA 3S27A 1RC1A 4JWTA 1UMDA 1U6KA 3HMKA 1XQ9A 2XWSA 3C3PA 4ZVQA 4ZEXA 2OT3B 4Q03A 2V55B 4FLEA 2OO5C 3PHLA 2IYVA 2L19A 3RWOA 1V6AA 5A4KA 4XJXA 4MKHA 3QUCA 5L6MB 2C3MA 1C8BA 2WJ6A 4KOAA 4GYKA 4GVXA 2AB0A 1Z2CA 3TUIC 1EVLA 2F3PA 3LKVA 4JNKA 5DMHA 1R0ZA 3N28A 2HB6A 2VDWA 2WWWA 3N2LA 4YP1A 3O3NB 3ZLVA 5I4CA 3CCFA 5FQNA 5FFMA 5F3DA 5KYXA 1G8GA 4FKZA 2FX3A 1XQ6A 3RK4A 2AZTA 3ETEA 1RWQA 3ROXA 5K8LA 4OQEA 1R6BX 2OZPA 2XEDA 2VP4A 3GVIA 3QSGA 4X7MA 2I03A 1FB5A 1YS4A 2PUDA 1DO0A 4QUDA 2AQKA 1P2VA 4ZV9A 5JJKA 3JRXA 3FTEA 1R4MA 3GF4A 3I2IA 3GRYA 1DXQA 4OQPA 4HDNA 4JU9A 2W2PA 1RS0A 4EKGA 3GLGA 2A0UA 4X1IB 5I9BA 3UAOA 1DBIA 1JZTA 2JIRA 4XL9A 3FWPA 5TGZA 1JXOA 2OHJA 5F4ZA 1U0SY 3VPGA 2P75A 5HZKA 2IVFA 4GMKA 4QEKA 1FQOA 1P1KA 1P6QA 3PXEA 4LXHA 4PN7A 1C9MA 4DCCA 3SU8A 4IILA 2C7RA 4X66B 1SG6A 5EI5A 2JFXA 1CLEA 1QC5A 4DCTA 1MTOA 3DKVA 1UJ4A 1B16A 4II2A 1QIEA 3BHNA 3RRXA 4P26A 3ZQ6A 2CXHA 1MOQA 3HBNA 1FFAA 1U2SA 3I6MA 1I7PA 1II8B 1OY1A 4GX2A 4XIFA 1N34B 3L49A 4EM6A 4IPTA 3DUFB 1M2VB 1OYVA 3PENA 2GK7A 1E1CA 3FROA 3IS3A 1IHXA 3ROZA 5AIBA 4O2LA 1BWSA 2EP8A 2LGJA 3C3KA 3VO9A 4QVAA 2BD0A 2FMXA 3OLVA 1ZUNA 4KQMA 3Q88A 2JS7A 1CLUA 5DF1A 3VVLA 1IE3A 2XH8A 1EFVA 2EFGA 1EEXB 2CHUA 3GPCA 2FZWA 3NHLA 2CT8A 1OXXK 2PS9A 5B3KA 1S2GA 3LQYA 1UPAA 3AR2A 1H1LB 3IUEA 4J0GA 4UHHA 4XYBA 2HHLA 1WPCA 1JN0A 4AJNA 4JODA 4BO8A 2QRNA 3VSCA 1GPUA 3QWAA 5LQJA 3VKGA 2HSJA 2ZE7A 3FOCA 2CVZA 5T3YA 4Y9UA 1T8UA 2HSGA 1USVA 3IP3A 3G2JA 2DLNA 2W6OA 2AZXA 3BRCA 2QM0A 4IXNA 4AZ0B 1FUUA 1YRAA 1N33B 1L7NA 4QRIA 3AP3A 3LI2A 2DFVA 5ECGC 4LVUA 1J0DA 4YAWA 1YF3A 2CLLB 4LZOA 2QY9A 2QPAA 4IM7A 4FDUA 5EJ5A 1I1HA 3CA8A 3A35A 2B1IA 1Z73A 3PE4A 4MLZA 4XPIB 5HF8A 2ZYGA 1QP7A 3B8HA 2PA3A 2NTEA 3ACCA 3ESYA 5DN6D 5CVEA 4FEGA 3RBVA 1QG2A 1L1RA 3MWEB 1V47A 4X90A 1YMUA 3IFSA 4CRWB 1ND6A 1NQWA 5C35A 1RRCA 2KSQA 4YASA 3ET5A 1Z2DA 3R6DA 4BEWA 2FSPA 3CGGA 2YY7A 1WIWA 3AEUA 1GPJA 4C4ZA 1Y63A 1ZNYA 3G5TA 3OKPA 4UTOA 4YRSA 5B1YA 4W8GA 3FBTA 3LNTA 4HQ0A 1FMTA 2JFOA 3B85A 4QSMA 4TQAA 4TMZA 2A67A 2VDVE 4J03A 2XUKA 1M8JA 1T8SA 3DQZA 4MB0A 2AG0A 2NZ8A 3IESA 5AOBA 2DBQA 4UD6A 3AFMA 3W1WA 1QIGA 5JSZA 3HCNA 3TOCA 5DSXA 2JA1A 1RRVA 2PV7A 3FF1A 3OPVA 4C4XA 2BGGA 3H6KA 2GLXA 4GL2A 3HR8A 4O2AF 3A58B 3EF0A 1AS0A 4QYWA 1LEHA 5EZSA 2A59A 4KNYA 1EVEA 4NK4A 5EUBA 4C2AA 3A0RB 3WG9A 3KBBA 4I50B 2J5KA 4TUYB 1TX4B 3EC7A 4KXUA 1G8KA 1Y3BE 1YR1A 1FFWA 4OXNA 3VKUA 1VQ1A 1HR0B 4LZJA 1SKBA 1I32A 1DQPA 2IXGA 4RDJA 3BE8A 4JJ6A 1QH8B 4NJMB 3AI3A 5ALWA 4ZCSA 1E69A 1ZNQO 2ZWOA 3O74A 4KZKA 1SD2A 4A23A 3CLTC 1WDLA 1C14A 3D6MA 3NRJA 3RYFA 5LIPA 2Q6OA 3ZWCA 5TV2A 3SZLA 2EL7A 1QKJA 1MO6A 5YASA 3VTFA 2J46A 1QHNA 2ZWIA 4G07A 4QELA 4D5EA 1G21B 2O2DA 3AHFA 3RUPA 4KXXA 5CP8A 5HS4A 1KAEA 10MHA 4EG6A 1G20B 4J0KA 4TWJA 1E2FA 3VISA 4EA9A 3T41A 4V0KA 2PYIA 2UUOA 3LWNA 3EE6A 2IJGX 3GZ4A 3MCUA 4D4JA 3EC2A 5BVHB 1RLUA 3LOQA 4K40A 1DKLA 5E6SA 2GJSA 5DP1A 1X86B 1X7GA 3RYIB 2R96A 5HZBA 1GHTA 3U3RA 1NATA 2P1ZA 2PU5A 4MCJA 1TJPB 2VZEA 1OPXA 4U8GA 3FWYA 1KDYA 1WMEA 5MN4A 3IE1A 4XNFA 4Y9RA 3GGJA 4RDLA 4L50A 4KDCA 4V39A 3ZOKA 1UK8A 4NONA 2LPMA 3FFAA 4AZ3B 4J7CA 2MSEB 1X7XA 1QHHA 1OKKD 3L5OA 1VECA 4FFRA 2Y66A 4IICA 4F0JA 4ZV4A 1B0PA 1IN7A 1NG1A 1TYAE 3LDGA 2NV0A 4O4IB 5K0ZA 1E2GA 4AMUA 4G0NA 1WX1A 3CZ5A 4BO5A 4DEYA 4AQDA 5SZJA 2IZ6A 3BCHA 1DQZA 4MS1B 1SQ0A 4ES6A 4Z2YA 5JALA 2BZ0A 3HCCA 2OFWA 2OXCA 1JQAA 4N3BA 2PK3A 1FDVA 2XUHA 5I4IA 1P4GA 2ODWA 2WF7A 3OT5A 4PFQA 4G5SA 4D9JA 3HB1A 2VUIB 3FCYA 3ED5A 5GIOE 2VBFA 1T5HX 3GD5A 3LCMA 3D6UA 1QO9A 1GL9B 1CCWA 3BGWA 1JI0A 4D8WA 3VNVA 2BKUA 2A5DA 2WKWA 4D9KA 1I9CA 2OK7A 4KDFA 4MA0A 2I9KA 1TVKA 2OV8A 5AVQA 5KBYA 4MS4A 3ZTWA 4IJWA 2O2ZA 4QJ3A 2Q8PA 2H2HA 4W7IA 2CL5A 1KP9A 4N3GA 3FSGD 3OIVA 4HVAA 1KZ9A 3BERA 2WWVD 1XCPA 3LBIA 4DA4A 2POCA 2B4AA 1HYQA 5KOJA 1UBJS 1USKA 1GTL1 1VPVA 3HRIA 5E6RA 5L40A 2EATA 4PQEA 4KGXA 1K0FA 5TMBA 2O0KA 3NGMA 4H15A 3A6EA 4KSBA 4P6VF 2G5CA 4H3SA 2N9UA 5KSWB 1AB5A 2P2YA 2R84A 4IQ8A 3PK0A 5ALIA 5IWCA 3BWXA 4L57A 5BT8A 2NO9A 4RADA 5GQSA 5HK9A 3VZRA 1KRXA 1JDNA 2QUZA 2JLUA 4Y1GA 4Y1EA 1YCGA 4E4RA 2ZJ3A 3K0KA 5FP0A 5CDFE 2BKAA 4KKSA 1DX9A 2A0XA 3R3SA 4NFLA 1T4DA 4CGYA 2ADMA 3HVKA 4B4OA 3KE8A 3LLCA 4V02A 1LNQA 4Z51A 1UP6A 2Q5CA 1A7KA 3A32A 3I45A 3I58A 4ZGNB 1K92A 5EMMA 4AKGA 3HJCA 3ZV6A 4BDTA 1BXKA 1JJIA 3CPEA 5L4NA 1L5QA 4AUMA 2KX7A 3OO1A 1I01A 3NKFA 4RORA 2VG8A 2C4VA 3W6ZA 1A8IA 3HU2A 3QVSA 3G3EA 4HN4B 1V2GA 1KRWA 1NQ5A 1CR2A 1M8PA 4PZPA 4PO3X 3R7LA 4CR8A 1RWVA 4CUKA 2NVUA 5K01A 2ZSAA 1DC7A 3QVXA 1B8OA 1ZD4A 2XYGA 1T0IA 1B76A 2PYDA 3TQRA 1FEZA 2ACKA 1QO7A 3R5HA 4C7OA 3PUJA 1JUDA 1Y5MA 4M1QA 5FL7D 4JXJA 1NIPA 4P1ZA 4GKKB 2WD7B 3E18A 4X0EA 5HK8A 2GESA 2JIZA 3RS5A 1XCJA 3FPSA 1GG8A 4M0FA 4GYYA 5ALXA 3HKCB 2QGZA 1P4JA 3UQZA 1KK2A 4LBZA 2BP7B 5JNLA 1SKYB 3W4KA 4WT7A 1PF7E 2XOKD 4XWTA 1IXSB 3ROGA 4EA7A 1AURA 1EFPA 1KVUA 3GUCA 3CWCA 2VWQA 3OM0A 3WK4A 4J94A 1HFKA 1MX9A 3C15C 4JUDX 3HDYA 4TVOA 2PR7A 3M3HA 1IPFA 3BDIA 1WU7A 4X6LA 5IF9A 2ZZQA 3TQSA 1FRZA 1UOPA 2GF9A 2OHIA 1XD8A 1E2KA 1THMA 1W2BB 3U44B 1C0LA 1EGMB 3M2PA 4FFMA 1JG2A 3EXIA 3C1AA 5JJIA 1PNRA 1JPVA 3HCBA 4U00A 4GI1A 4PTLA 1J90A 4KHZA 2W2KA 2W8ZA 1OBVA 4RGQA 5H9VA 1CUFA 2ZXEA 5JBQA 2HRCA 2LWIA 2JKZA 2WV7A 2O50A 4QV2A 3BCFA 3PE3A 4MV7A 3LV8A 3AOEA 4Q1CA 3H8JA 1YJNB 1YRWA 3DE6X 3Q1KA 2DJIA 2IZ0A 2G9QA 3ZH9B 5F7ZA 3I2KA 2VJIA 3JQGA 3GGSA 4WMLA 1ZRHA 2NVOA 5A02A 2ZSIA 3IP5A 4XOUA 1N32B 3HLKA 5L7TA 4DV3B 1ZD1A 3TMAA 1P39A 4HGYA 1P2BA 4YBZA 2ZJ5A 4YN3A 1A71A 3HXLA 3S2SA 3DULA 6REQA 1MO2A 1NHWA 5A3JA 4LG1A 3NP7A 4D25A 4LC1A 5KSOA 1TD1A 5JNRA 1PI3A 3T54A 2BTEA 3P5SA 1GCUA 3WJ7A 3ZI7A 5L3RA 3WMGA 5C8YF 2VZLA 4HJXA 4I3HA 5KHOC 1DC4A 3KUDA 2DKOA 3R1IA 5E9AA 3AXTA 3RC8A 2MIIA 5TS2A 5FLXA 1KO4A 3O4GA 4WY8A 2F55A 4IHJA 1U5BB 3GJZA 2O2SA 2VH1A 2EGHA 3W3AA 1SG0A 1NVTA 5EIBC 1JU4A 4B17A 4GRIA 5MN6A 4KR7A 2VJOA 2Y9MB 3I2HA 5EJIA 3SYLA 2LDBA 2XB9A 3H1BA 4X8MA 2GHQA 1ZRSA 4ZEMA 3K6SA 3L7KA 1BJTA 2CFIA 3ICEA 3RKSA 1N7JA 2DIEA 1EA5A 2OYSA 2VHEA 2Z2JA 3HSSA 4WOJA 4ZQFA 5E3HA 2AUTA 4BUJA 3I9JA 2AMFA 3Q8XB 2ZRDA 4HQNA 4UHFA 3S68A 5AK0A 1EM8B 1ZN2A 3JYOA 3TRHA 4A0RA 4E46A 1UBOS 5IAGA 3CIOA 1BA2A 4WINA 1D4FA 3DR3A 4JEUA 4NZOA 4F4JA 3COZA 3T5BA 5KNCH 4B3XA 4DLBA 1PJ2A 2QX7A 1M7HA 1CU1A 2VQ3A 2SBTA 1ECCA 4X05A 4RPCA 2ETVA 2Q99A 4KKXB 4RQAA 1VC2A 1W581 1YIDA 2Q5FA 3DXZA 4MIEA 4RF2A 5KSPA 3IAAA 5ALNA 1GJRA 2Y9PB 3EYWA 3MQ2A 2R66A 4BFWA 1BVYF 1XJ0A 2GILA 1W85B 2JASA 2OA0A 3ULKA 1F20A 4L27A 3W6UA 3T0FA 1E9BA 3BTVA 1MEEA 1VDZA 3HNRA 3C6BA 4MEJA 4NU0A 5IUNC 4EJ0A 3JARA 4B4KA 1YB7A 5LYYA 1N6RA 1O4VA 4CM9D 1C29B 2ZVDA 1EFKA 4EWLA 4DV0B 2QV0A 4MDYA 2O52A 4C07A 3HM9A 4LE0A 3ET4A 3V1TC 4RELA 4X97A 2P6MA 5LPNA 1ZJZA 3AOEC 4DQUA 4YRJA 1N5MA 2VRWA 4IL5A 5GWXA 5LB2A 5UKDA 1B1AA 3KOOA 3ROTA 2X3YA 1T6NA 4CF7A 4BV9A 1EBBA 1UEXC 2JIPA 3EGXA 4U8HA 1X15A 1DIAA 2IXFA 2PT6A 4BE7B 5ANRB 1JZSA 5I3CA 3ZWYA 4XEUA 1ZO8A 2N1BA 4CTMA 2VDKB 3BZUA 4IIEA 4MUNA 4YRFA 5IHPA 1IQ0A 2XHZA 4G5HA 4C4SA 1VYHA 5B4UA 1I2BA 5DISB 1T9HA 5KTRA 3FYSA 1C2YA 2XMPA 3CXUA 4Z2AA 3AUAA 1JAXA 3UPTA 4QC2A 5IFLA 2V74B 3W8DA 4ZAXA 3KXKA 1V8FA 3LP5A 4LTMA 4MUXA 4Q05A 1Y6RA 3P1JA 4UKDA 3AFGA 4ZYLA 2JFQA 3EFOB 1B23P 5FO1A 2IEGA 1QHEA 2XKJE 3B3GA 3V8EA 1P4HA 3S2IA 1ZGHA 3KQPA 5F2KA 1EDOA 2F1MA 3CC7B 3HCEA 3MPUA 3ZUGA 1SIOA 4L8JA 2GJ8A 1CUGA 2P3LA 1LBTA 2Q07A 3LHKA 3KOXA 5EIHA 1GCAA 1U0TA 2ORED 5FWYB 1C2TA 2FPIB 3KPVA 4QJ5A 4PHGA 4NICA 4Z8XA 3TPCA 5IASA 2FJ0A 4ER6A 2H4JA 1CEQA 4KFTA 3OVMA 4HEHA 4Z3OA 5CDFA 5DXFA 4H1TA 1M34E 3V34A 1E9EA 4QDUA 3JAKB 4WBNA 1GVNB 3HWSA 3EZYA 4IOJA 3X1KA 1ESCA 3GB9A 5FORA 2HBYA 4LC9A 3MJHA 4BTVA 4BX0A 3PDHA 3AVQA 1EPUA 3KELA 1H5UA 4IQGA 3RG8A 3KZVA 3VNSA 1KKLA 3PX3A 3N3BC 4ALNA 1SUEA 3RE1A 4O4HF 4W7SA 3T9FA 4IMIB 4X71A 1YZUA 2P6NA 4DJFC 1AKRA 1E89A 4IXWA 3OOJA 2O2EA 3TW4A 5EXTA 1X80A 2HK7A 2DFLA 5J2UB 2ZRQA 5IK2A 2VBIA 3L7NA 3MCWA 4IJ5A 4RTOA 3AL0C 4TV8B 3MGCA 3ZHTA 1GPAA 2I1LA 1FA9A 1TIBA 4GR9A 1PZMA 1KEVA 5AESA 2EJTA 4EGSA 4PONA 2O1XA 2MHCA 3EEYA 2A30A 1CP3A 2EKDA 3LM8A 2UZ3A 1J07A 3GJQA 4C0QC 1DHTA 1BHQ1 1OXUA 2CW5A 2EFYA 1Q1BA 3D7LA 2VF5X 5D00A 3P26A 1FF9A 3RO7A 4AUEA 1ZM2A 4FCCA 3CH6A 1Z6AA 2BRUA 2UVDA 1OT5A 3PVSA 4DR6B 2FPKA 4OPOA 1T2UA 1J8YF 3QUQA 1IJKA 4DR5B 1F2TB 1B42A 3MBOA 1K6MA 1TZKA 4WA7A 2FFQA 3O90A 4NJEB 5ALVA 4IFBA 4OHVA 5CX1A 4B40A 4E94A 3GC6A 4RVFA 4ZCRA 1FSSA 2RK4A 3IBGA 1XWFA 3H4TA 3IC5A 4UM8B 4XGKA 5JC8A 2B1RA 4NYMR 4M89A 1M2NA 2ISCA 2HBQA 3F5FA 4TZKA 2OD9A 4KQ6A 1YR6A 1Z6GA 1G98A 1NVXQ 2QGNA 1VPLA 2E82A 3AQIA 3IH5A 3OOSA 4RXTA 4DQDA 3CW2A 1OWOA 4Q9JA 4QU8A 3WQZA 3HVRA 1U7PA 1Q16A 1WP4A 2ZIEA 3HV2A 4G5OA 4UU1A 2ZT6A 1WXQA 4DCGA 2WYRA 1VPTA 4QJIA 2AXQA 3ZV3A 4A8PA 1SVWA 1KI6A 3KOWA 2PZLA 1YX2A 2VDJA 2ZUDA 5FOSA 3UFBA 4URXR 4W1PA 2D59A 2VHUA 4GR5A 3LBYA 5BRJA 2CXQA 2DQZA 4HWKA 3BF7A 4R2HA 3G9TA 4D81A 5KPDA 5K7SA 3IPAA 3LDAA 1T2NA 3MD0A 4DMMA 4X6YA 1DAKA 2TMYA 1GY8A 2EZ4A 1JQJC 3IVCA 1Z36A 5ESXA 3WMRA 1Y1PA 2ZQ5A 4DCNA 3U5ZB 1D2RA 5IVHA 4L0QA 1K8YB 3NWPA 5I7RA 2EG5A 2AKYA 4YNBA 1WEKA 3CXRA 3LOPA 3M3PA 4NYMQ 3UHFA 1JA9A 3X1YA 4LRUA 4RNCA 2X9LA 3UT6A 4AJEA 5KZMB 2Z2XA 2Q9CA 3AF0A 5EKTA 4B3FX 1LCIA 2CXTA 1Y98A 3KWLA 4F8YA 1CEYA 2BMWA 3A11A 1GQYA 4C4RA 3TXYA 2XX3A 4F9GA 3EPKA 2FOIA 4XCVA 4RL4A 4RQUA 4CM1A 5LQKA 3LF2A 1G4AE 1Q91A 4MW0A 4QPDA 4R8KA 2BGRA 5ALZA 4I1SA 3QU9A 5L46A 3UM9A 4ETNA 3EDQA 3K30A 1EZ4A 1NJSA 5IRCD 3B3JA 4W5QA 4AI6A 3M83A 4OU4A 1DJNA 2JCBA 2B25A 2CRVA 4NDNE 3L84A 4ZCPA 5JC1A 2AOUB 2VBTA 2ATVA 2P77A 3EN0A 2HLDA 2IHTA 4D46A 1N05A 3ED1A 3OZIA 3I34X 4RA6B 1G9TA 1U4SA 2Q41A 2GO7A 5EJEA 4ZOCA 5JASA 3R9XA 1XLVA 3FUVA 3O47A 1DCKA 1X0VA 5C5IA 1EFRA 4GQAA 3MTAA 2OSBA 1RABA 1P73A 1NI4A 5ICCA 1O9GA 2OZLA 2ZTSA 5IP5A 4KO2S 4M46A 1ZJ5A 1V0FA 2IHYA 3BSWA 4M1TA 2C96A 3MG9A 3QIAA 1KNXA 4F71A 5HIAA 3V00A 4GRAA 5T67A 2OV3A 3RUCA 2VHWA 5EJ6A 1S2MA 4TVSA 5B5SA 5CFOA 4W5JA 3ZD8A 1QZUA 4LWOA 4B3HA 3P32A 3MJVA 1XOIA 2VYVA 4EECA 1RD4A 1YVRA 2JHGA 2X2OA 2ZIZA 2W2TA 3KYJB 3FKJA 4G25A 4XSVA 4TLCA 1HA3A 2WJAA 2CZQA 1M6EX 2VRCD 3WIVA 1QIJA 2GEVA 2HSZA 3BWEA 4AMBA 3F6BX 5E38A 4ZMSA 3EXG1 3U13A 1OA1A 1YS7A 1FOEB 2YH2A 3OE7D 3ASQA 3ILXA 2HOQA 2OTJB 2H2IA 4K9NA 1Z9BA 2YASA 3ZCPA 1YOVA 4I1VA 1NY6A 4I0WB 4ABYA 2GXSA 1I8TA 3ZHUA 4UHBA 1RBQA 2YOHA 3PDIA 1HZZA 1E3ZA 4M54A 3IAXA 2V7UA 3WB0A 3QM1A 1RZVA 5D6NA 4B2PA 1ZXBA 2OCAA 2XBLA 1Y42X 3GLHB 3BGIA 3D2BA 2D1FA 1UKAA 4FX2A 3RNOA 4D3SA 3BMXA 3KKNA 1UC4B 3ECSA 1BMQA 1NOKA 2NPIA 2F3SA 1ZK4A 4BQFA 4W8OA 2XKBA 3PQ3A 4HDOB 3TEJA 5HM8A 2A35A 5GV8A 3KKQA 4UOZA 4MPTA 1Q7TA 2ZZGA 1JR6A 1J8FA 2MOKA 4LVNA 1FTNA 3HDJA 4C6TB 2PMBA 3T4EA 5TRDA 2OCPA 1DC5A 3E6AA 2QL7A 3CCLB 2P4EA 4H7FA 4A2CA 4DXDA 2O7VA 3S8EA 3MVEA 4WK4B 1K08A 1M1NA 1ODTC 2ORYA 1QE0A 2QN7A 3K70B 2VN8A 4PG4A 4BVFA 1ESNA 3OEWA 1Y0BA 4QVGA 5EVCA 4ICIA 5EZYB 3GJ7A 2C2HA 3CZQA 3A1SA 1J5XA 4D42A 2NT4A 3KFLA 4BOYA 1FQJA 4Z53A 1N3BA 3CLVA 3KE9A 4AKIA 3JWPA 1N0IA 3IQXA 2HF9A 1M34A 1G3UA 1XEWY 2GERA 3K8OE 2P68A 1L4GA 4X54A 1R15A 1HE8B 2VRBA 3DWFA 4HH3C 3D81A 2YC4C 3SEAA 1Y5NA 2P2SA 1HDYA 1ECBA 4LV6A 4PZ0A 3MXTA 1HLFA 2BGNA 2OILA 1SBTA 1OLXB 2GPTA 3L6OO 1MHPA 1O6GA 1Q82D 2RC5A 4KEAA 5HE9A 2WEKA 4IGEA 1JHXA 1SMKA 3S1AA 4V38A 3TS1A 3NETA 3TD9A 4NMHA 4JDPA 5DHUA 1AQNA 2IYSA 3KVVA 3P7MA 3UGTA 1DKPA 3A28A 2AD1A 3N86A 4TT8A 2AOWA 2BUCA 3H16A 4TQUS 4ZC8A 3V4LA 1I9GA 1XP5A 3HXOA 3GFGA 3DAHA 3F47A 3QNMA 4Z9FA 1I24A 1EFLA 3BVPA 4NHOA 4R98A 2MSWA 3F67A 3ANMA 4WZTA 1MABA 2DXIA 3IP7A 4PW0A 4Q4AA 2WG1A 5C4IA 1YC2A 2WYUA 2XBMA 3V1KA 4C43A 1A77A 1QV9A 3D5EA 4GXRA 4ZIRA 3WY9A 2DX7A 3CS3A 3KV1A 2O8DA 4Q21A 2O4CA 5EIOA 2NZVG 2EBFX 2WG0A 1WOPA 2FXIA 1AGRA 2OFOA 4MX8A 1Y89A 2UUBB 4NBWA 1H2ZA 1NNUA 1LC0A 4ZDWA 3ZZ0A 1HZZC 3OP4A 4NAVA 2FW6A 2PH3A 4ZOLA 3I53A 1GL6A 3KKLA 3UO8B 5LLDA 4PC6A 2FZ4A 4RIIA 1D8AA 2B0CA 3VH1A 1SU4A 3G0GA 1CULC 4JEIA 1X9HA 4RMIA 2J9ZB 3CVOA 2AUNA 2C9DA 2K2WA 3LTEA 4I1OA 4MGZR 4URHA 4WACA 3EIEA 3S8MA 4OU5A 3EC1A 4OL0A 5F21A 3RTBA 4P3OA 2XWQA 1ETUA 1C0PA 4B3RB 3L7AA 3SBOA 1FYXA 5G4LA 1DPGA 4US1R 1GAXA 3JQEA 3OEYA 1X8LA 3BOSA 3OT1B 4C6SA 1JNYA 3F6SA 4XYMA 3FZQA 2QU7A 3LA8A 2AC7A 4ERXA 1R3UA 5CA0F 4FI3C 4DSUA 1A96A 1CZNA 2FGJA 2AJDA 2HCBA 1BE0A 2FLWA 4RXUA 2BLLA 3EODA 5T41A 4D97A 2LR0A 3VI3B 2RHRA 3PPWA 3O2QB 3CRQA 3LKZA 1JEEA 1OBHA 1PJCA 3QKRB 3C48A 1PQWA 3R7FA 4CQJA 3N7TA 3TZHA 3BSFA 1NJGA 3R7WB 3V2UA 4JJ4A 2FR8A 2K2QB 4DC1A 5KWJA 2H52A 3LBFA 4L9AA 2EJBA 3TIIA 7MHTA 2O19A 2XCQA 1XNRB 3AYZB 1IMJA 3HRHA 3O8BA 4PE5B 3UUGA 3WLTA 4F3TA 3PXDA 1Z8NA 3FOEC 4PQYA 4KH1A 4BX8A 3OQJA 1SOMA 2X2PA 1WD7A 5JV5A 4F06A 3P0EA 3EVBA 1SKUA 1DWUA 4DUGA 1SBZA 3IV6A 1M75A 2R65A 2JCVA 3BTOA 3N70A 1C1XA 3PWKA 5D5PA 1S2OA 3A8TA 5FYQA 1ZMOA 2C9OA 5JMPA 1VMDA 3QVVA 3WBKA 3EH2A 5F9HA 2W2QA 4QAJA 4LNHA 3CH7A 1RXEA 3FYUA 4W5WA 1Q7CA 4DWWA 4DQKA 1CUYA 1UAGA 2X5NA 4IFIA 2D4HA 1MEOA 4KFUA 1JEDA 3R3WA