3ZUGA

E268d mutant of fad synthetase from corynebacterium ammoniagenes
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
338
structure length
335
Chain Sequence
MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRRAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPDEQRSVDSFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Key Residues at the Riboflavin Kinase Catalytic Site of the Bifunctional Riboflavin Kinase/Fmn Adenylyltransferase from Corynebacterium Ammoniagenes.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
total genus 103
structure length 335
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 3zugA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3zugA01
1F7UA 5LLTA 3VU8A 1F4LA 3U1VA 1KAQA 2RD2A 4MUEA 4YP6A 3ND7A 1F7VA 4DNXA 2A4MA 2HMAA 4Q16A 4U8HA 5J58A 4MUNA 3CLTC 1DNPA 2A7XA 4DE5A 1WXGA 1M8KA 1PFVA 1OWOA 2BYTA 4WNYA 1I6KA 1KQNA 2QUKA 1I2DA 3IOBA 3IMGA 4ZT3A 2EJCA 3NV7A 1K92A 3IH5A 4DDHA 4JZYA 4E1AA 2DETA 1V47A 3SZGA 4G6ZA 4NAUA 3JXEA 3CVUA 1QU2A 5KHAA 5DB4A 2IJGX 1PFWA 1JIIA 4HPWA 1G59A 1WXHA 3UOWA 3ILVA 1P7PA 4MW1A 3DO8A 5TS2A 5TEWA 3LOQA 3TQOA 3HZRA 4YBRA 1ZUNA 1O0BA 1WQ4A 1M8PA 3SEQA 5H16A 1H1TA 1WOYA 4DDKA 3GLVA 4EG1A 3ZJVA 2V0GA 1PFUA 3FIUA 1EFVB 4K0RA 1MJHA 3FETA 4UZFA 4YP7A 3RJZA 1YIDA 3SP1A 3HV0A 1HYBA 2CYCA 4BWVA 1IVSA 3OTWA 3H05A 3DV2A 4ZCPA 1N2EA 1X6VA 3AIIA 1JZSA 4ND7A 4YP5A 2A1TR 1GPMA 1NB9A 1KAMA 4MW7A 5HG0A 2PZAA 2CV2A 1TYAE 3LCJA 4MW4A 2R5WA 4ZT6A 2TS1A 3PNYA 1NYLA 4L2IA 1Q11A 1KH3A 3SDBA 2WSIA 3KT3A 1H3NA 2A86A 5KCMA 4J76A 4R2LA 2JAXA 1LW7A 4TS1A 1MAUA 4CT0A 3ND5A 1GLNA 4PY2A 4MVWA 1Q15A 3AKZA 2H29A 1VBNA 1GAXA 2WQ6A 3ND6A 2YWCA 4KPUA 1WXIA 3MUEA 3QTBA 1CT9A 2CSXA 1V8FA 1QRTA 2VTBB 3CR8A 4NZPA 2PG3A 4ZCQA 2J4DA 3HMQA 3SZ3A 4NAHA 2VTBA 3CLRD 1IH8A 5BNZA 5LM3A 2D13A 2VBSA 2QJOA 2AG6A 1O95D 1WXFA 1F9AA 2CFOA 3HGMA 3ZUGA 3Q10A 2OQ2A 2I1LA 1T9GR 2E18A 4J75A 4MAFA 3AFHA 3C8ZA 5JBNA 1S4MA 3IVGA 4AQ7A 3IVCA 3CLUC 1MB9A 1NI5A 4GRIA 3ZJUA 3G59A 4KPUB 1OD6A 4I6JA 4QRDA 1WQ3A 4MUHA 2WQ7A 4KR9A 1J20A 4G5FA 4P2BA 2B7LA 3K32A 1KP2A 2J5BA 5TRDA 1WJGA 3COWA 3KT8A 3N05A 4AS1A 3GUZA 4JXZA 1IQ0A 1N2BA 1OWLA 2VXOA 4PBTA 3ZGZA 1COZA 1J1ZA 3CLSC 3IUEA 5LFAA 3INNA 4JXXA 4ARIA 1T6YA 4JFAA 2RE8A 2CV0A 4OJMX 1N1DA 4XFJA 1YIAA 2ZP1A 2C5SA 3CA8A 1TQ8A 1ULHA 2Z08A 1VLHA 1O6BA 1PG2A 2YXNA 3IOEA 2QJFA 4ZT2A 3X1MA 1N07A 2QUJA 4U7JA 1ZH0A 3TZLA 1O96A 2J09A 2DR2A 1J70A 3H9BA 1TEZA 1T6XA 4XFDA 4NDAA 1N08A 1Y42X 3CLSD 4X0EA 4MVYA 4MQ6A 1N78A 4I6GA 1NUSA 3D6VA 3D6UA 4H3SA 2QTRA 1NP7A 2A84A 4MWBA 4ZT4A 1OWNA 1GTSA 1G8FA 1N75A 2D54A 3PNBA 5FO1A 5K0TA 2X0KA 1NUUA 4WSOA 1X8XA 2PXHA 2XRYA 3CLUD 3MMXA 4KR7A 1VBKA 2DPLA 2GM3A 4EGAA 1OWMA 1MB2A 1Q77A 3CVYA 2JANA 1XNJA 1XNGA 5HUHA 1GZUA 4DJAA 5A8AA 3QE4A 1M83A 3K9WA 3UK2A 3P0HA 2ZUEA 3HFJA 1O97D 2NZ2A 5J5AA 2ZUFA 1EFPB 1G8HA 1MBZA 4QREA 1MRZA 2OV4A 2QUHA 5FNZA 1KH2A 1O94C 1TYCA 2PZ8A 3IUBA 1EFPA 1IRXA 4ARCA 1U7XA 3FOCA 2Z3VA 4DDMA 3P0JA 3L93A 1A8HA 3KT6A 3QTTA 1QRUA 3S3TA 4MVXA 3ZXSA 4F3RA 3F3MA 3IODA 1U3CA 2DXIA 3H9CA 3CLRC 4EF6A 1R6UA 1N2GA 3N2YA 3RBAA 3TZEA 2X1MA 3RHSA 3X1JA 1OBHA 3CLTD 4DLPA 1YI8A 2E0IA 2J08A 1O96B 4EFKA 3LE8A 3FH0A 1OBCA 2A88A 4MWCA 4NX2A 4RPIA 4ZT5A 5F23A 1KQOA 1OWPA 1FYDA 1VBMA 1NUTA 4NATA 4A91A 1M8FA 3IMCA 1YUNA 3H97A 4MUJA 1NUQA 5IHXA 1P4MA 1ZH6A 3P52A 5KWVA 2P3MA 1NSYA 2IELA 5A89A 2QJTA 1GTRA 1G8GA 1JECA 1KR2A 3ISJA 1I6MA 1N2OA 3CTAA 5J59A 1QNFA 1U3DA 1KQPA 3N9IA 1LI5A 1N2JA 3DLAA 4GU5A 4HJXA 2O8VA 3PXUA 3H99A 4ZCTA 3RK1A 1EUYA 4MW2A 1M1ZA 2E21A 3FHJA 2PZBA 1YULA 2V0CA 4EG7A 1J1UA 1FFYA 4CQNA 3CVVA 3ELBA 1JHDA 4PBRA 4MW0A 3A4IA 1QQTA 3IVXA 3BL5A 1ILEA 4JYZA 3MXTA 1NURA 4MULA 1KH1A 1B6TA 1UFVA 3OP1A 1O97C 2D5BA 3E27A 1O5TA 1H3FA 5K0SA 2DLCX 2A1UA 1IHOA 4ZT7A 4MLPA 3TQIA 3ZIUA 1D2RA 4MW5A 2OYNA 3NBKA 1R6XA 3G5AA 3I05A 3CVXA 3P0IA 4KKVA 1MAWA 1VL2A 4I6EA 2IP1A 5H7XA 5TGTA 5TEVA 3SEZA 5HUJA 1KKUA 2Z09A 3FI0A 1KORA 4XSVA 2DUMA 2GKSA 5IJXA 2VBVA 3L92A 3MLAA 1M8GA 3FY4A 1Q19A 2CYBA 4PBSA 4Q93A 3N8HA 4FZJA 2YY5A 2PIDA 1T6ZA 1RQGA 3UY4A 4ZCRA 2WB2A 3COYA 1O94D 1N2IA 1TFUA 2HGZA 1QU3A 3AG5A 1QRSA 3SYTA 1QTQA 3Q4GA 1PG0A 3GMIA 1T9GS 1JILA 1NB0A 3FWKA 1JIJA 3IMEA 3IOCA 3FDXA 3PNVA 1I6LA 1N3LA 1N05A 3AG6A 4F4HA 2A1TS 1O95C 4KR6A 2VBUA 5AHWA 1XJQA 2G36A 1K4MA 4ZCSA 1J09A 3UC5A 2J07A 1JGTA 2DEUA 1XNHA 1MC1A 4R0NA 3FNRA 1TYDE 3KFLA 1JMVA 1N77A 3MLBA 4QBTA 1EXDA 3TS1A 3COZA 3RK0A 1Q9SA 5DK4A 2QTNA 3G6KA 1NZJA 4S1OA 3A2KA 1U0BB 1IQUA 4ND6A 1JEDA 4MVCA 1K4KA 4EG4A 2QTMA 4OUDA 2H2AA 1PFYA 2AZXA 3TNJA 5DASA 3FG9A 2HZ7A 1R6TA 1EFVA 3NBAA 1IQRA 4MUGA 4CDNA 1EJ2A 3A05A 2CYAA 3PRHA 4MUKA 2X3FA 4EG5A 2XRZA 2AKEA 3M5WA 4R2MA 5A88A 1U7DA 3BNWA 3X1KA 3VGJA 5DEOA 4MWDA 4U63A 1O0CA 4UZEA 1H3EA 1IFXA 2JA2A 4HJRA 1NUPA 3ZXIA 2VBTA 3A04A 3KT0A 1BS2A 2GOYA 5FO0A 1SURA 3RFFA 1GN8A 1JEEA 2CV1A 1YUMA 3DPIA 1TYBE 4MUIA 1J21A 1EE1A 2CUZA 4MUFA 4OUDB 2E89A 4L2IB 2EL7A 1M8JA 3ZJTA 1MOPA 2X1LA 4G5YA 4EG8A 3Q12A 2A1UB 4HK4A 1N06A 2O5RA 1WY5A 3IDFA 4K03A 4CDMA 4MW9A 2DERA 1QJCA 2PFSA 4EG3A 4MWEA 4EG6A 2NSYA 3VRHA 1JZQA 5EKDA 1KP3A 3AL0C 4YMIA 1LI7A 2QUIA 1WZ2A 4MW6A 1N2HA 3CVWA 3UMVA 1WKBA 1K97A 1ZJWA 1EUQA 2CT8A 2YWBA 1WXEA 2BTEA 3COVA 1JIKA 4RUKA 3HL4A
chains in the Genus database with same CATH superfamily
3A28A 1QAQA 2XJ9A 3W78A 3E8XA 2KJQA 1UT6A 2VLBA 4FFBB 3OOWA 3RS8A 4L9AA 4MB0A 1VJDA 3LQRA 2OM6A 4QD3A 3S2ZA 1EAYA 2ZZMA 1PIWA 4AY4A 4M0UA 4PM4A 3AY7A 2GO7A 2Q99A 3I28A 2JS7A 3PC3A 4WUTA 4CQMA 5B4UA 1H4QA 3ER6A 1V9CA 1BFKA 4GQIA 4KXLA 3G0HA 1JSLA 1NXPA 2CMKA 2PN1A 1Q0SA 3ABIA 3N0TA 5F98A 4EL0A 4W7HA 1AG9A 5AKEA 2UZ0A 4K6GA 3ZCSA 5K8UA 2HYIC 3PFFA 3VU9B 1KJIA 4MVJD 2OBBA 4EUHA 2R7AA 1NQXA 4XQ0A 2A7QA 2BM8A 2BGIA 1AGYA 3KOXA 5EE1A 1CHNA 5G3ZA 3DDHA 4RJLA 4R5MA 2XKBA 4KQKA 4ZIRB 3L77A 3ZD7A 4V0NA 1JT2A 1KWKA 4AN4A 1IBKB 4G1CA 4X06A 1M0WA 1ZOOA 2JKZA 1VFNA 2V1XA 5G4KA 2BHRA 3L6RA 2VP4A 2GUGA 2BEUA 4ZMBA 5EI5A 2IJGX 1CZHA 3MGAA 3U40A 3B6KA 3FFAA 3QY0A 3NE5B 3AEQA 3UAGA 4E3ZA 4G5OA 3UJHA 1JL3A 4AKHA 4RM3A 3U7GA 2X6WA 3PNLA 1E7YA 3G1WA 1OB0A 5TEWA 5TS2A 2C2KA 2BEVA 1R64A 1TA4A 1Y4AE 1RI3A 3OSZA 4GLLA 4MGZR 4NESA 5D7BA 4URVR 3K1ZA 3FRJA 1A7KA 2GAAA 3D59A 3PDUA 4BQSA 1YU6A 2Y9PB 1MHTA 4IJ5A 1L5SA 4OXIA 5FTKA 1H1TA 2OA0A 1PR5A 1W5TA 1DBQA 1RAHA 3HJNA 3JS5A 3BC1A 5LJLA 1M2GA 5TLSA 3C85A 2X0NA 3BDVA 3LIPA 1ZQ9A 2BGNA 3DP7A 3R7BA 2WYWA 1HKUA 2VNHA 1BXRA 1WE2A 2ZE7A 3OY2A 4EJFA 2H85A 3SVTA 3L8ZA 2Q4RA 3IVRA 3BL6A 1E1KA 1RPZA 1AHPA 2HIMA 1I3LA 4PS0A 4WFQA 4B6JA 1IG3A 3L06A 3BJZA 3LLCA 1C81A 3V8BA 1W2HA 4BMCA 4HDNA 5TQ2A 4UZUA 3AXTA 1FQWA 1WZIA 3AEZA 4MDFA 5MHTA 1G20E 2XUQA 2BUCA 1C5KA 3KP1A 2W2NA 5E9AA 1JDUA 3RTBA 4M21A 1NT2A 2I7TA 1TUIA 2V59A 3ESBA 1UXJA 3UANA 4BJ5A 4E3WA 3NEAA 5LB4A 5F7JA 2QV7A 3HFGA 3L9XA 2XYRA 2O06A 4ID3A 4Y6PA 2WABA 4BWYA 4JC0A 3KLNA 2TS1A 2EW1A 3KOYA 1MQSA 3LCVB 2GB4A 2O5VA 1TVMA 1X80B 1T15A 2VK4A 3KB6A 3O4RA 3P9XA 3PQDA 3TKLA 4UE2A 1H3NA 1WCIB 5IUNC 1Y1RA 1H0RA 4K81B 1JP7A 1M34B 2IUSA 1H9BA 2KVOA 1HFKA 2HBYA 1BDMA 4J76A 4Q3NA 5DIZA 1O4WA 1R5JA 1IHXA 1T2CA 1XRRA 4CUZA 1PL6A 1Z83A 5IKMA 2GEFA 4REQB 3C3AA 1E6CA 4A6PA 5L40A 3M6XA 3JVDA 4IEEA 4AECA 1ZONA 2D0PB 4MS3B 4BNYA 1SXHA 3QVUA 4BFZA 4H7FA 5E1DA 5JJLA 5F4ZA 4KPUA 1QIHA 4BX9A 1W5EA 4K6HA 4PAWA 1GPUA 2NQ8A 4FJ0A 4ENTA 3GUHA 3PEYA 1XXHA 4J8PA 4XM2A 4L15A 4I5FA 2CCKA 4O1MA 3VPGA 1UDCA 5EP1A 4AF6A 3QPDA 4IWXA 2J7PA 4QZVA 4HY3A 4KREA 1J5EB 1X8LA 2H4FA 3ONVA 1AKNA 4S35A 4DEXA 2VTBA 2YVQA 3NXKA 2ZLBA 1JYEA 3EGVA 3NTLA 2DBQA 5KNCH 1IE3A 1GAQA 2XZPA 2JGKA 3DBOB 3CZCA 2J5KA 1FNMA 1MIHA 1LB1B 3JYPA 4AROA 4RETA 1Q92A 1LS1A 3DBRA 3HGMA 3AX6A 3QNMA 4FQ7A 1E9RA 1NMXA 1ZRMA 2EX0A 1HQKA 3TNDA 4D7AA 4DV2B 4GL2A 2I1LA 2BHLA 4MAFA 2YMQA 3DSRA 2HRCA 3EUEA 5AHOA 1XALA 3ORRA 1M6VB 3A32A 2VHCA 2Z3ZA 3B9QA 4K7JA 1CQJB 5T3UA 4IIXA 2X5NA 1N25A 4O4IB 2PS0A 2G5GX 1ZK4A 3R0JA 3MAGA 3PKZA 4RZSA 3USCS 4Q7JB 1NW8A 2DKNA 3GNLA 1ML4A 3OIUA 1RVDA 2QHXA 3OPQA 4MV0A 4XQCA 1WMEA 2X5OA 1ZL2A 4R1QA 1ACMA 1UJMA 4P0TA 3IB6A 3OOEA 3A70A 3VKUA 2H3EA 3SF8A 3OJLA 2Y0DA 2YICA 2X8AA 2H4YA 5BN3A 2W6ID 3B2EA 1EVKA 1YJXA 1C3OA 1TPYA 1ULAA 2JPDA 1PG5A 2G80A 1COZA 4QDKA 4WADA 3YASA 1NKTA 3KSDO 2BFEB 3QBEA 4QODA 1DAOA 3HC7A 5COQA 1N0IA 2WWHA 3SJZA 3WLSA 2FLKA 4NH4A 1XRNA 4UBJA 3ROGA 4BBAA 1T9AA 4O4JA 4B2IA 5C7IO 9MHTA 1XEWY 3JQDA 1DC5A 1Q82D 5CVTA 1KJ9A 2OORC 3FCAA 3IOEA 1TD9A 3JWJA 3W5SA 2Q5LA 3AZQA 1S2IA 4XLZA 5FTNA 4U9IS 5HZGA 2CDNA 3FPBA 4B3SB 2DCMA 2G04A 4DV7B 4FYKA 4BKUA 1NVEA 3HQ4O 3LIIA 1Y42X 3CISA 4LYFA 4XTRA 4MVYA 3FCSB 1FRQA 1KI2A 3IOYA 2C4WA 4K6KA 3DE7X 5BVGB 2V54A 4QPNA 2E4WA 1GUBA 2PANA 4P32A 1L8XA 4F93B 5FI5A 1MFPA 4QGAA 4QVKA 1Y6FA 1SCJA 2I66A 4JQYA 1ODJA 2UUCB 1JKIA 3DEIA 4MYTA 3QUTA 4AZWA 3RSCA 2FPXA 3HABA 2HA3A 4QGBA 1CQWA 4Q4CA 1WCXA 3CNBA 2PXHA 2D2XA 1JFTA 2ZIAA 4KXNA 2ARKA 5JNVA 1S72B 3B78A 3O92A 2PQ0A 4TV9B 2OECA 3O8NA 3JZMA 4PCUA 4YX9A 1Q0HA 2RKWA 1M75A 2XSZA 2W48A 5AVSA 3U61B 1JHMA 3IBFA 2CC2A 1EVQA 3OBIA 2NZ2A 5AKYA 4D99A 2C7QA 1KZ6A 3KFXA 4YAOA 4PGMA 3WS7A 2JVKA 3O74A 4RHTA 4W5OA 2IHVA 2YMPA 1ATIA 4YV7A 4MMYB 5L7YA 1IMJA 3HCNA 5FTMA 1OV4A 3ZE7A 2I76A 3QG1A 2XXAB 4ARCA 1X8KA 1F4VA 2WLTA 2N1BA 1Q95A 3AI1A 1X7WA 2IVFA 3I1YA 4GMGA 4I4CA 1V16B 3DZ8A 1DXOA 1FFWA 4PO9A 4I1VA 5TF4A 1FUEA 2DULA 3SFTA 5A3QA 1PYGA 5AQ1A 1U8UA 2ZUDA 3IULA 4A1OA 4B46A 4BNUA 4CIAA 1H0KA 1KR5A 4OQNA 4Q4HB 4C6RA 4C5AA 1B8VA 4XR4A 1W59A 1DKUA 4PC3A 2HSGA 4ZVTA 1QE5A 3IEPA 3NGLA 3ZN2A 2P5SA 5CX1A 4QXAA 1HOXA 1VYVA 2QMOA 3HVKA 3ED1A 2W2OA 3DL0A 4FGUA 4FT4A 1GJRA 1JEAA 2JFBA 5JVDB 1NMZA 1ORHA 3CT4A 1RLMA 4QYTA 4B4WA 2FR1A 2DOGA 1B8NA 5LA6B 3FPEA 3DQQA 3NHWA 4AZVA 4RSMA 1Y5IA 3D43A 5CK5A 1X42A 4RZXA 4QDUA 3HDGA 1CRWG 1VLZA 4MQEB 4P3IA 1PJSA 4AJJA 1WPCA 1DADA 2EJVA 4PXYA 4RLFA 5SY9A 3S5JA 1LJUA 1MVNA 5A1JA 4EZBA 2GCOA 3VPBA 4OFZA 2DY0A 4ICIA 1CS0A 3IJPA 5PGMA 4P0PB 2O7QA 2IOYA 4S05A 1ZW6A 4ZGGA 5KYYA 4J1NA 2BEWB 4GBJA 4HQKA 2XMQA 4B7CA 4PVCA 5EMNA 4M3NA 1GTRA 4D4HA 3EBPA 1SVUA 2PLFA 5ARDA 1HQCA 1X9GA 3W5VA 3T5CA 2C92A 3V34A 2O52A 421PA 3O1HB 1BAPA 4EDHA 4YT8A 1MPTA 5EKSA 5JQGF 3DVQX 1C3JA 1XFOA 4EY8A 1EM8B 1WU7A 4OREX 1EXVA 4FYPA 5EQTA 1S9HA 1YVEI 3ZTWA 2ERYA 1UXGA 2WTNA 3ACDA 3MJSA 3OO1A 4EJ6A 2P4HX 4G1VA 3SJBA 1NUHA 4XVQA 1FP4B 1F17A 5IAAA 3IP9A 1VTKA 2RHRA 4RHYA 5E38A 1IYZA 4GKKB 2PEYA 1T4GA 1L6RA 2Y05A 5JHGB 5LQJA 1Q86D 1PJRA 3TFQA 3WNDA 3PVDA 3I6IA 3KR9A 3QPCA 1R18A 3BQMB 3EVEA 3LXUX 3UMGA 5J1SB 3BWYA 4FKMA 1SC6A 3WK5A 4CI9A 3E4CA 5TPWB 2TMKA 2FQXA 2NG1A 1YBAA 2C31A 2WTBA 2ZBQA 4JYBA 4JUAA 2QZZA 1J06A 1KAHA 4BVJA 1EIZA 3CPJB 3GROA 3H6HA 5FOVA 5IMSA 4J0EA 1I33A 3PT5A 1B0ZA 3CC4B 1OPRA 2QYTA 1O87A 1P80A 2BFCA 2HPAA 3D2AA 4GRDA 4V3BA 1JAYA 3OZEA 4ZV9A 4ECEA 1BNCA 3RIHA 1UL1X 1BXKA 1Z0IA 2V45A 3A1FA 4GUAA 2GZ1A 1A76A 4MW5A 5E2BA 5EHNA 4BUZA 4PCAA 1YZVA 1W2BB 1L5OA 4Q1BA 5ELXA 3JAKB 1VQMB 3LUCA 3G5AA 3I05A 5KAPA 3BY1A 4H7JA 4RTJA 1COWA 1GVHA 1PJCA 3D2BA 3AF5A 1U9CA 1UJ4A 1CIVA 2F1HA 2FW8A 3ZQJA 4DUPA 1VSQA 3LWZA 1W29A 1NR1A 2JIBA 4QEKA 4A9AA 3ZEAA 4H1WA 3M6WA 2QF7A 2YWHA 4KEAA 5L3SB 3B1WA 3ORFA 1XDWA 4XVUA 3Q3HA 4JI8B 3EXEB 1VXOA 2HDHA 2YY6A 4PYJA 1P7WA 4JB3A 3TIGA 3FUWA 4G8DA 5D86A 4YRDA 4Z2YA 2C5BA 1WOMA 4ER7A 3H86A 4Q47A 1CV2A 1RAIA 2I8AA 3KE9A 3RDPA 4E0FA 4ZI7A 1T6ZA 1J90A 5AVWA 2ZGVA 1UD3A 1AKYA 4YTEA 5IMBA 2X8JB 4K3VA 3TDMA 4UOZA 9ATCA 1CP3A 3ITDA 3QSYA 1HEUA 3HZOA 4AYWA 4H6VA 3GMIA 2E87A 1JKFA 4A8PA 1JIJA 3QEMB 1CJMA 3AHHA 4DSNA 4DDTA 4AYXA 5BYKA 3CUVA 4JP5A 1N3LA 1UBNA 4BMVA 5JZMA 1OX4A 5IJ0A 4Q7QA 1CZNA 4EPYA 2RJ3A 1AH2A 2AQIA 2CHQA 3PWZA 4NOJA 2VDVE 4XB6B 3TVDA 5T57A 1NRIA 2WIAA 5K99A 5GGYA 4M4SA 1E3EA 1SXGA 4Q82A 3GLHB 4MPPA 5FBRB 1WP9A 3QWHA 4N39A 1A2BA 3DUWA 2IP4A 1OXVA 3ZZ0A 2QMEA 1R8JA 2YW9A 4JSYA 2RIRA 1YRQA 1Y9AA 2PYDA 3MEQA 4YONB 3GLUA 4E2WA 3FUVA 3H0KA 1TU3A 1XAGA 3I6BA 1KDVA 3FOZA 1Z0JA 2R8XA 4U2BA 1PZEA 2GK7A 3JYOA 2GYUA 3PQ8A 5AI4A 4CGYA 1VG1A 3QVGA 4QU5A 3INTA 3LPAA 1YS1X 1CQPA 5M2QA 2A1IA 4HAUA 4HLCA 3V4PB 5EIAA 4R2IA 4UEJA 4Z9XA 2QSZA 2JAHA 4ALLA 1VDMA 2IEYA 1TEXA 5B57C 2WJPA 3SQNA 2IS6A 3DAYA 3REFA 4RPDA 3FYTA 1VMDA 3EVDA 1NW4A 2D06A 3NDPA 1Z6YA 3TSAA 5F7XA 1X7ZB 2FK7A 2XGOA 4HFMA 4UMVA 4LKRA 4N3CA 3H5IA 4AO7A 2JI7A 3EIQA 2P2GA 5BV2P 2YNMC 4DMGA 3A35A 4TXMA 1KVRA 2FUNB 1OXXK 1QLHA 1ORWA 4LXYA 1WTHD 1BVYF 3PQ3A 2XKJE 3AB8A 1PFGA 2J6HA 1ZJZA 1OUMA 2GH1A 2XUZA 3I45A 3DA8A 3H4VA 4MKGA 3O8CA 2O8BB 1PJAA 4AS1A 4V24A 4X91A 1RCFA 1FL9A 2PHZA 3OWOA 3UJDA 3ZY6A 4XI9A 5JAUA 4R2WA 4WFJA 4ZZ0A 2XADA 1BCRA 1HPLA 4BDSA 2AEJA 1CR6A 1X80A 3V8EA 3TCNA 4NZZA 3K9QO 4HGZA 4K2AA 5L95A 2XWQA 2VOEA 3HO8A 2IPOA 3VU3A 2ID4A 1W8IA 2XMCA 3V00A 3N6RA 5DLPA 1RI2A 4HK4A 1SIBE 3BYZA 2IFTA 1JBKA 1W93A 2C98A 4KVAA 5AM0A 5B2FA 4LJAA 3KDAA 5IX8A 2QPOA 1PQUA 4OL0A 1J23A 5FL3A 1QJCA 2DPXA 3GT4A 1LJ8A 2PFSA 3O82A 5CDUA 2ZXIA 4MS3A 4HYYA 3SHOA 4DDUA 1E9CA 2C4TA 1G7TA 5EKDA 3FYUB 4RM0A 3WBJA 1RKBA 1H69A 3IAFA 3TOCA 3GEGA 3QLTA 4KKSA 1DCMA 1Y7HA 3AKDA 3RU2A 1G7SA 3QE3A 4TV9F 2LPMA 4DBLC 5TE9A 4OFXA 2VHTA 4MDEA 1G21E 2VAPA 3PUXA 4OM8A 2I6UA 3CSSA 3HNOA 4ZO9A 5HMLA 2H1WA 2BP7B 2WIKA 4F71A 2Q1SA 2E1RA 2WBLC 5HE9A 4KACA 3WLHA 3C8DA 3GMDA 1D1SA 2W8BB 5MN4A 3K2BA 3PEWA 5BW6B 3LYLA 5ESXA 1H2FA 2ZYUX 1MGOA 5CFQA 4OQMA 1Y3AA 2FSUA 2VS1A 4RZ3A 3NWEA 1KPIA 2YRWA 3MWEA 3ELYA 4EB0A 4FM9A 1FW6A 3W1EA 2FN3A 4K9PA 1OHHA 1XWIA 2O2ZA 1Z2EA 4I8XA 5F5LA 4MV4A 1M1YA 4YJ2F 1UPBA 1BXGA 3SI7A 3VR5A 4D6XA 4PX2A 2D2IA 2EC5A 1E5QA 3A7EA 5JYEA 4B47A 5FTJA 3NC0C 5KO2A 3H42B 5F52A 1LRKA 4FGJA 3KEMA 4GM1A 2ODBA 4II7A 4D9CA 3P9QA 3CUKA 1B4DA 1CUYA 1FX0B 1KJWA 1BEEA 4U7PB 2XI4A 4J03A 4JLJA 3T3PB 1DCFA 3HA3A 3DDSA 1DU4A 1K6MA 4L6IA 4CR7A 5LSAA 1ZMOA 2DETA 4QJ3A 1O9GA 3A8KA 3HB7A 4QARA 2IH5A 5H80A 3GLKA 2V6FA 3CVUA 1YJCA 3N8KA 4E1BA 3U6BA 3AHCA 4KE9A 1I2MA 5K0ZA 4JR1A 1HDXA 2JH8A 4P4UA 5J2TF 2P4EA 3KZNA 1YVPA 3E9ZA 2QL6A 4FXUA 4GX5A 1BGWA 1AN0A 3T0GA 3DEJA 4CG2A 5KVQA 4LRTB 1ZUNA 4TL9A 2VJDA 4GI2A 2H2HA 4DR7B 4Q3DA 3SEQA 2Z9CA 3IKJA 4I8IA 5ECDA 3AMVA 1MNAA 2Z5VA 3GUYA 5FTWA 1PW5A 2FSVC 3H5VA 4IDOA 2INGX 5HCUA 1WR8A 2AOXA 5F4JA 4P1VA 3AR5A 2VWPA 4EAQA 1KTVA 1O4VA 3M5PA 4YFVA 3HKBA 3ROQA 2OBFA 2EKBA 2J3HA 1BHSA 3QU4A 4Y9DA 3WZLA 2AJ8A 3R44A 4BB0A 1U0NA 1RAEA 2P62A 4N49A 2JIDA 3DD5A 4BO0A 3EIUA 1CQXA 4XQGA 4EPXA 1DRJA 4JC4A 1YIJB 3RIGA 1V2HE 5C4IA 1FFBA 1RI1A 1QQ6A 4V0QA 1DRUA 2OZPA 5ALLA 2B8NA 4LE1A 4M55A 3A1TA 1VMAA 5KX5A 4MW7A 5HG0A 1GZVA 5CBPA 3AVVA 1YS4A 3T5DA 1BH2A 1EP2B 2AF4C 1KK2A 3HACA 4H17A 4EB6B 1ZR4A 4YT2A 3E2IA 2YFKA 1YBMA 4MW4A 4RV9A 1QOZA 2R5WA 5G53C 3JQ7A 1PQWA 4GR9A 1NVVQ 2B8WA 2PE5A 5DCYA 3N2KA 5IYZA 4KDFA 1F3LA 5JT1A 1YZUA 3VR2D 1PR3A 3HN7A 3G2PA 4L2IA 4F7DA 2RGBA 1ULSA 3GGCA 3ISVA 4L8FA 4TKUB 3VI3B 1SPBS 3KT3A 3ICQB 1I4TD 4D3YA 2WA2A 2NT3A 3WA6A 2B1GA 3U4QA 1W4LA 1SVLA 2Q28A 4YRNA 4G1BA 3ZGYA 1T3SA 3Q2OA 1ISPA 4N03A 1QH9A 4FXPA 2IOFA 3S27A 2PUEA 4NXNB 3A1WA 2F1LA 1MLDA 3B1KA 1TJNA 4WZKA 2J6CA 1C7EA 2DZDA 2CLMB 2FHSA 1VPDA 1VL1A 4JQZA 2OUKA 4JXJA 3D54D 3T38A 4X64B 4N01A 2Q3HA 1IXRC 3HM2A 4JI4B 1DBVO 4QYSA 3F47A 1PGOA 2AOTB 4I19A 8ADHA 1I1HA 4HWRA 4QPZA 3TX6A 1H1DA 5EPUA 3VNQA 5I7WA 1DINA 4GDMA 4XXHA 4ZCQA 4ARZA 4ZVNA 4CIYA 4BZPA 3HEMA 3FMFA 3VHLB 4D80A 3STVA 4YRLA 1JJVA 2VDNB 3A9VA 3NBYC 2IGTA 4ZOLF 4DADA 2MYTA 1POXA 1U0GA 5KUTA 3D8SA 2P41A 3I9KA 4AJKA 4YS6A 5BP7A 4TMVA 4V0SA 2JGLA 3IR7A 5AJXA 2OCAA 1OI4A 2AQ8A 3C87A 3OT4A 4JCCA 2BTQA 3Q10A 1DC8A 3CMAB 2ZRMA 4TZTA 3RG8A 2G1PA 2AG5A 4CMKA 1FU4A 3EMKA 4IFTA 1Z6XA 3MUOA 1UUFA 3C8ZA 4NZYA 3WQQA 1NW7A 5K45A 2BZ1A 3CLUC 2X0IA 4L5BA 4MRMB 1PD0A 1NI5A 2PMFA 4DSTA 3ZJYA 3QXGA 3GLGA 4Q9IA 2P2LA 3F90A 1K6XA 4FSXA 5AVZA 5KYYB 2J6IA 4FMCB 4U7HA 2GNOA 4Z3DA 5HOQA 3PL5A 4YV1A 1R5NA 4CEJA 3FBTA 4Y7DA 3WIVA 5IKEA 3HBNA 2HWKA 1HL7A 1C3EA 1B8OA 3EVAA 1GPYA 1AKEA 1YXMA 3OQIA 1JDSA 3ZLBA 3HJTA 4NEGA 4DV1B 2UXDB 1RJ9A 2QGFA 5BWNA 1PJ5A 5CT4A 3V9PA 2QRJA 3VJKA 5LXTA 3E9QA 2PZFA 4NS1A 1P6XA 1UKBA 4EQ6B 4FI3F 1L5VA 1WUTA 1SOMA 4M1OA 1TIKA 1TZKA 4L0DA 4X1IA 3ZDYB 2AOUB 3W8RA 3EGWA 1ULZA 3BH0A 4OATA 4R83A 4JU9A 5J1TB 2A9OA 5K6AA 1F2TA 3EPRA 1N07A 1U7OA 3AFNA 2I1WA 2NV4A 4XR9A 3IV9A 2NXWA 2MSWA 4HDMA 4YO7A 5JEDA 3VUFA 1J70A 1DHTA 4BVEA 1D0IA 1P5FA 4NK5A 4R1TA 4ZVQA 3SE7A 5LP6F 2F17A 2XE7A 4XGRA 1K86A 2YIMA 2DMRA 3IRUA 4QRIA 2GSWA 1QOQB 1XCLA 4WZEA 5IFLA 4UHBA 3SZOA 3X3HA 1P0MA 5ALSA 3DPSA 4U2EA 3LDHA 4LY3A 2PKYX 4FNMA 4D02A 3BXPA 821PA 2PTGA 3HCOA 4EO9A 3WLKX 3KOZA 2CK3A 1QBKC 4BU0A 3WKCA 4OX9Y 4UUPA 2HHCA 2ZZNA 1OROA 4JYAB 2FE4A 2ONYA 3ZTTA 4F6LA 3JV7A 3SPXA 1FDWA 2XD9A 4OP2A 4HZIA 3W5DA 4FZ3A 1GNRA 2V96A 3GLIB 2J7KA 1YI0A 2P30A 3C97A 3VQTA 3V5NA 1FZTA 1Q7BA 1DL5A 3ENKA 2IYNA 4F9FA 3CVYA 2VJQA 3CONA 3Q41A 1DEXA 1Z2CA 1Z6GA 1QFSA 1OB2A 3MK31 3PEUA 2L69A 3PPIA 4IIEA 2PVSA 4PGOA 2PL3A 1D9ZA 1PJ2A 3P0HA 4O8ZA 2Q6IA 5ECWA 5DISB 3K0EA 1P2VA 1IBMB 3ICEA 1AQUA 1X38A 2X2EA 1HQDA 4X7RA 1G8HA 3N8NA 2D2EA 2OCPA 4ZQBA 1FZQA 5EE9A 4ENUA 4ZICA 4OHCA 2EOAA 3PCTA 2Z4RA 3PDIA 5JH7B 3K70B 1VQOB 3ZW7A 3C5EA 1JS1X 2HO5A 1P3DA 2V7WA 1ZNZA 2XQGA 2AN9A 3GU3A 1YZNA 1X94A 3IXMA 3MPOA 1NW3A 4I9UA 4WKPA 3VDRA 5FUMA 4B7UA 4Y7CA 4R5HA 2XB2A 3T9FA 3ZIAD 2ZJZA 3ANNA 5GAJA 4HT3B 2WSMA 5FNVF 1I0LA 3AQIA 1C29B 2FFJA 3UKJA 4ZMRA 3V2UA 4JUCA 1SBCA 1T24A 1A82A 3CURA 1NR5A 5DGTA 1BGVA 1GUZA 4HHEA 2DXIA 2WHPA 3H9CA 3EWNA 4Q0MA 4JJGA 2FPGA 1BWRA 4ESHA 5K8JB 1N2GA 2GO1A 2YJTD 1H0SA 2WEKA 3BZUA 4V0OA 1TCCA 2CFSA 1G18A 4YAUA 1V7CA 4DY4A 4TTVA 3X1JA 4GS5A 1D4ZA 1XVAA 1ZD2P 1Q7CA 4EFKA 5U9CA 2H4JA 1DLIA 1E2PA 3SJUA 2RB4A 3HWSA 2GARA 1AZWA 1S3FA 4TL7A 4E2YA 3THWB 4HTFA 3T51B 1YRBA 2ZQZA 1GUFA 3Q3IA 4BNMA 5TMPA 4B84A 2VSFA 5K0GA 1ISHA 4KMOA 1TZCA 4YELA 2FWJA 1YOVB 1Y3CE 4PHGA 4RFLA 2J59A 1Z37A 4EI7A 1FFXA 5AOVA 2WMOB 3F7TA 2F90A 4KO1S 4TV8B 3F5QA 1N2CB 2NU6A 2H7XA 2I7XA 5EWLB 5GQSA 3RTDA 3L0PA 3U3XA 3VPDA 5JZOA 3IP1A 1MJGM 3L1JA 4DIDA 4N3AA 2Y9MB 1LI5A 3A6HA 2HTFA 3FE2A 2QQ0A 3H99A 4C2AA 2QVCA 1M2VA 1YV9A 4K86A 3GEPA 4TMYA 4BMDA 4ODIA 4GOND 1DWUA 1W0KD 3LQ4A 1QQBA 4XCVA 5I7OA 4MYUA 3FPJA 4J9VA 1L5GB 1RPNA 4HAZA 1QFYA 4M37A 5A2GA 3FTNA 3LNCA 1Z0SA 2JRLA 1Z3IX 1G2QA 1W30A 3I55B 1YK1A 4M7PA 3F5SA 4JLKA 1NPYA 3HUEA 3RHTA 1ZWKA 3RSSA 3AIKA 3VSAA 1ADCA 2BPOA 3ELBA 3K9LA 4PBRA 3E1YE 4H2DA 3TLXA 5LOVA 5F2NA 2ZDHA 2N0SA 3N7UA 4BN4A 2F6RA 3NZEA 1ILEA 1QO9A 3TGLA 3FTDA 1L7QA 3IQEA 3WIOA 1NHGA 4MULA 2FA9A 3T8YA 1RWQA 4BRUA 3OP1A 1XZ8A 3EARA 3GCGA 2C88A 3UFXA 3WYBA 4HNTA 4G4JA 5CA0A 5JQWA 5BSEA 2PUHA 2QLMA 4I3FA 2BCGY 2DSTA 4HYQA 2R6FA 2C00A 4WLOA 1VQNB 3BCSA 3B48A 1B0UA 3TQIA 3UAXA 1BW9A 1UC8A 3EZLA 2R1VB 4JUFA 3VKWA 2XOKA 3P2MA 1RXCA 4HDKB 5MGNA 3ADCA 2R6AA 1Q7RA 3K16A 4M1ZA 2HREA 4BLPA 1CC1S 4CV3A 2UYGA 3RVRA 4Q4JA 4CI0B 3KYJB 5KVSA 1R8XA 1S2LA 4C20A 2WKWA 2Z6BD 5MDHA 1QVWA 1KBQA 2HA7A 1J25A 3KLMX 3DMDA 5IEJA 5K6RA 2W6JA 1JE0A 1DOZA 1HDZA 3AONB 4B40A 5AW6A 3KQUA 4XLHA 1FJHA 1NSTA 1QSGA 1XC7A 2A0XA 2EFEB 2FZ4A 2QLTA 3FI0A 4K40A 3EN0A 4FHZA 1H2YA 2GKSA 4GO1A 4HEQA 1Q16A 4ZCIA 4TM7A 1I9CA 4B80A 3MLAA 3W2GA 1NVBA 2DH5A 4GAEA 3PDWA 2J67A 4HVAA 2W8BA 4MS4A 4G1MB 4WY2A 1CUXA 3SG0A 5LR6A 2CKDA 1AT1A 3B6EA 4M1KA 3QYPA 1GT6A 1V41E 1TE2A 2GLXA 1UXKA 3FKQA 4A8HA 1R0ZA 2WAOA 1DMSA 5CA1A 4OPMA 2W43A 3TG2A 1LV7A 5F3WB 4HB2A 3NNNA 1N2IA 1VLMA 1ZN2A 2FZCA 2VPWA 1KZHA 1F0KA 4EMUA 5CTAA 1QRSA 2XCUA 4P6VF 4C4SA 3NWJA 2JK1A 2AFHE 1ZGHA 2DPYA 1DSSG 3IOCA 3T3HA 1X9IA 1IAQA 4U8GA 4XZ3A 4X00A 2JG3A 4BNTA 4NZNA 3TRJA 2O7RA 1BEUB 3I34X 3JVIA 4DA4A 3RVJA 3LQ6A 4KV7A 3T7IA 3OJXA 3IIMA 4MIOA 2C1XA 4IMIB 2HDNB 1U1DA 4TL6A 2QL9A 4FOPA 1A3CA 2JZNA 2EAUA 2AOWA 3BBLA 2JIRA 3HV2A 4NDNE 5JMWA 1W5AA 3QKTA 1OGIA 1HEIA 2DFVA 2YOHA 5KC9A 3H65A 3FYDA 2PK3A 4JJEA 3ZD9A 4CQMD 1QVAA 1YS6A 3DVSX 4MS1A 2NUTA 1VJ0A 3MLBA 2VHYA 4NQZA 4RKQA 3RRYA 3RK0A 1U1GA 1Y9JA 2VJBA 5ELMA 3EEBA 4S1OA 1RYDA 4JEUA 4Z4ZA 4TS4A 5KU1A 2VHVA 5EUQB 3HK2A 3T3OA 4MVCA 2OXRA 4HDCA 1L7NA 2WYOA 1Q81D 4X7DA 2LP4Y 3B85A 3S70A 3ZDXB 5FA6A 2AX4A 3TPZA 3AEKB 4D4MA 2FWNA 2X0RA 3FG9A 1URPA 4NECA 2ECOA 5REQA 4JBGA 3MOGA 3PA6A 3EZXA 2G25A 1EKXA 2QJRA 3ILSA 3KC2A 3OIVA 4MUKA 3TK1A 4RVFA 4PTZA 2XRZA 2FV8A 4B09A 1WU8A 4G67A 1ZAKA 3SVZA 2JH3A 3ETJA 3IAS1 5F51A 4RHXA 3RYFB 5JCJA 2QNIA 3G9XA 2VC2B 4RYLA 3UWOA 1PR9A 4G5GA 1E60A 2AB0A 2VHQA 2ZYAA 4X9XA 2HXGA 4JKIA 3DLHA 3ZHBA 4NKRA 3MCZA 1P1CA 4IWYA 4W9NA 3DFIA 1PE0A 3RRNA 5AI9A 1W4AA 1E2EA 1MO4A 2XQVA 5FRDA 1FBTA 3TSCA 2JJ1D 5ALUA 2DP4E 2W4MA 3GZ4A 4L2IB 3K71B 1FMLA 3CX6A 1E9EA 4JT2A 5ALXA 4FCCA 4FZRA 1QZZA 1QMGA 2YRFA 4DFDA 2TYSB 3P9KA 1JAXA 1U1IA 3OKCA 1SVMA 4OU4A 1GZHB 3R8CA 1GYRA 3L7OA 3VNSA 3IDFA 3WP0A 2PUBA 3K72B 3T0IA 3Q40A 4F3CA 1YDMA 2PGNA 1UADA 3AF1A 3DLTA 4JT4A 3HEBA 2BJWA 3EDMA 1PSWA 1WMFA 4OJQA 5CJPA 2P78A 4LA4A 1TQ2A 4E70A 1KAOA 3EOBI 2PMDA 3EW9A 1P8AA 4GPIB 1ZM2A 3MTEA 4J1SA 4KQWA 4R3NA 1QHXA 1E7RA 4X6YA 4DQDA 3IKTA 2B78A 2LUOA 2X1HA 1UJ2A 5HZKA 5LBUA 1PLLA 4IDBA 5EXTA 4D3XA 4GXRA 1N9GB 1XJ0A 2JHAA 1G8AA 1G17A 3GJQA 4AWXA 3DKRA 4JU8A 4P82A 5AN9A 5JPDA 1UQUA 4EKDA 4ZOLA 1LDBA 2XUDA 2Z04A 2I22A 3VU8A 2KLBA 4XN0A 1Z74A 5I4BA 2EZUA 4P7BA 2L18A 4DAEA 2HMAA 3M6MD 5I01A 4Q1AA 2OILA 4O4IF 4PRZA 4XH9B 5EL0A 3EULA 2W6PA 2J6BA 2AZMA 4A2CA 4YXFA 5KNCA 4BTVA 4HNAB 3R3UA 1C0LA 3L7CA 4RJ2A 2R6HA 3D6NB 5B2EA 4XGNA 1IXYA 4ZEXA 1OJ7A 2QSUA 3SFZA 4LVCA 1ESNA 1G98A 2I1QA 3DWEX 3PGJA 3RS0A 2DC1A 2GASA 3BRCA 1GCGA 3K1AB 5A0FA 1UEJA 3HI4A 1LC0A 2LCIA 3WG9A 3UIEA 4BV9A 1RMYA 5CB4A 4MV8A 3EF0A 2XEXA 4G9EA 2B0CA 4WJZA 3E5RA 3G8CA 2BJVA 2RB5A 1PFWA 3A06A 3FHTA 5J3OA 1XVVA 4DNRB 3GARA 3WGYA 2YJ5A 4UFOA 1TYZA 4NE7A 5BRAA 5H3CA 3UJ7A 2BEUB 2Q4OA 1PSDA 3LYUA 4FQ8A 1ZH2A 3S7TA 2AE1A 2HMTA 4HP8A 4G7WA 4UVDA 3TN7A 2ZTNA 2B1JA 1GPAA 2WSLA 4B4UA 2AN3A 1OXMA 1KDOA 3HP7A 4Y1GA 1D0SA 5DSZA 3WKAA 4F8JA 4ZANA 1WHTB 2MYPA 2O1SA 3K6SA 4OB8A 1BKYA 1NYQA 2IKQA 3KTOA 4OJKA 5D51S 4DDKA 2R11A 3DB2A 3LNTA 3BTVA 4GWLA 4HFJA 3WYEA 4DQ0A 2DM6A 1ONNA 5ISMA 4MIYA 2BFOA 4FEAA 1AE1A 3RVKA 3H9EO 5GP1A 2WAXA 1Y3BE 3AP2A 1PFQA 2R4UA 3KEGA 1N57A 1SCUB 2IYAA 2C07A 4I55A 3CCMB 3GJXC 4X3CA 3RJZA 2ZAOA 2D1YA 4OJNA 4BWVA 2REBA 1D09A 1KFJB 2RHMA 4XWTA 2FFAA 1XP8A 4IICA 4D4KA 1D8TA 4ND7A 4GF5A 3PGMA 4WECA 3H8JA 1ZK3A 3R0QA 2MCFA 1NRXA 1NXVA 4BZXA 1POWA 1E3LA 3UMFA 5BN3B 3HYRA 1IZ9A 1T5EA 1VIVA 2REOA 2IYRA 5CHEA 2CV2A 3BGWA 1DUSA 2FEAA 2ZYWX 5IULC 3VVMA 2DJIA 1TVKB 2WPDD 4GYWA 3ZBQA 3AM4A 1BS1A 1YR9A 1Q11A 2X4IA 3LQQA 1ZUD1 2Z3WA 3PR2B 3AVXA 4MPDA 5HF6A 3W8EA 1B2RA 1CUHA 2LIVA 3MT7A 3Q85A 4YRSA 2QJWA 2R44A 4M46A 1R9GA 2X0DA 2BTOA 1D1TA 3PGVA 3ZLVA 2GJ9A 1D1PA 2OEPA 4DCNA 2G6TA 4URXR 3AESA 3X2FA 4QG3A 1EHYA 2H3HA 2R00A 3I2IA 2DTDA 1OAOA 1WKVA 4AT1A 3I5AA 1E94E 4RVSA 4LZNA 2XDAA 5BSFA 4V1CB 2Q3FA 2XAAA 4MMXB 1YJ8A 2FVXA 3C6ZA 2F9MA 4LNHA 4QOHA 5DSTA 1A9SA 4RV5A 5GZ3A 4FR0A 2BN4A 3IJEB 4X7EA 2Q21A 1JQAA 1Z6AA 3ED5A 3ZCVA 2CRVA 3E7XA 4DLWA 2OY0A 1NPDA 2COUA 1EU1A 2BR4A 3CR8A 4RVGA 2HCTA 4QVAA 3LQKA 4FZVA 5GM1A 4KMSA 2NAFA 4CF5A 4FGLA 4DIMA 4EJ0A 4AP5A 2F8SA 3Q3GE 4FONA 4MJLA 5KNDD 1JSCA 3B3AA 3L6OO 4D0GA 1E0DA 5LU9A 1RHMA 1A5TA 2EERA 1CKEA 3IS3A 5A4AA 3UWKA 1ESEA 1JQEA 2JD0A 2YZ7A 3UYLA 2YRXA 3QFRA 1J5PA 2FF5A 3Q38A 2PD4A 4ITUA 1F9AA 3DW1X 1GGMA 5A9SA 3ZUGA 3BMQA 1IPEA 2RCYA 3PFCA 1DBWA 1M6EX 2L82A 1I4OA 2GCPA 1KY3A 3IQGX 4H7EA 4J75A 2IPNA 5F1YA 2IYWA 3VO8A 3P2OA 4BQEA 1DELA 2QPLA 1ENYA 4OI4A 1TF7A 1E4EB 2Y77A 3SKXA 3NVDA 1Z4LA 1DIBA 3QMVA 1RQ2A 4GP7A 4OMCA 4PYRA 5LYJF 1CRLA 2W6MA 3NEPX 1G6HA 2FKNA 3HB5X 2FFRA 4PNHA 2WQ7A 4OSPA 3GZNB 4P2BA 5KINB 1PVDA 1UC5B 4IJVA 1Z5VA 1SKQA 4QM6A 1KC8D 4PIMA 3KT8A 4WK0B 4UMDA 4Q4LA 2XA1A 1VL5A 2KWIA 2ODQA 3CKMA 4EA9A 2EKPA 5DX8A 3LO5A 5T67A 2HRBA 5CDYA 4XLFA 1I7QB 3DAPA 1IDOA 3I53A 4HEJA 3JVUA 4LW8A 3TQHA 3WGGA 4L4XA 3RGGA 3KAQA 5LQAA 3GVCA 3JD1A 2ET6A 3VH2A 4AICA 2I4IA 1PEAA 2PBLA 3KDPA 4K88A 1ULHA 2CLDX 3A8JA 3Q2IA 4F85A 5IC5A 2JFPA 4F9GA 2I6SA 1NVAA 1ZH0A 2VO1A 3ETLA 1TLFA 4O4JB 2JD1A 2XZDA 5B1HA 1R0YA 1ZCAA 1WUHS 3QPAA 1Z0ZA 2UYHA 4LF8B 3G7NA 2BFWA 2HBZA 3W7VA 1RRMA 1X7YA 3UH1A 4G0QA 4PSKA 1V39A 5KYVA 3MUNA 5EMMA 4DR5B 4ADSG 3VOBA 1L8OA 1PYOA 4LTDA 4KO2S 3ZHCA 1W36D 1VLJA 1E32A 2QD1A 2QEQA 3RC7A 3ENWA 4RVHA 5A4KA 2QTRA 2RH5A 4HSEA 4NP6A 5IASA 3OQNA 3WLOA 4DNFA 3NORA 2VPQA 4FD2A 5G0TA 1UD8A 4UTRA 4BFYA 3SJAA 3H5TA 4IIDA 3UJCA 1IY0A 3GRCA 4N0EA 2OBRA 3EXFA 1I94B 4MLCA 3T5GA 3PGXA 1EM8A 1TUBA 1D6SA 4MWTA 4O0MA 2ALJA 4TXNA 1CUVA 2YYSA 2O3UA 3SR4A 1NBME 4RACA 2G07A 2DQSA 4RPGA 3TSZA 4RZIA 2Z83A 4JROA 4BV2A 2ZANA 4JC5A 3ZHRA 5LIRA 1M2OB 1QK3A 2VDLB 3HDYA 3TL2A 3QKWA 5A8AA 2OLKA 3HSSA 5D1NA 4P6YA 2XYGA 1E18A 2G8NA 4KN5A 4HDAA 4BAGA 1JR2A 1XZDA 1V8BA 2H0QA 2Q6OA 1PZXA 2QXUA 3A1DA 1IVNA 2B2CA 5DYIA 3M3HA 1Y3FE 2D3WA 4YJFA 2OV4A 2QE6A 2XOEA 2GN4A 4TWIA 4AXXA 5FAKA 4RCYA 1PNQA 4KB5A 1VKNA 2E37A 4ENQA 3LUKA 4Z4RA 1OV6A 2W6CX 3FN4A 5TXGA 1DAFA 2AD1A 2XXAA 3T52A 2VT2A 2ZBDA 4AFNA 4RJJA 4ZOAA 3NT4A 2WJ4A 4XNFA 4RL4A 4BJ6A 5JPCA 2RHOA 3G23A 2HHHB 1PUXA 2EWMA 2GBLA 2PRYA 2ZSAA 1ECJA 3R5HA 4TKZA 1M90D 4KQ1A 5ER6A 4O08A 3VA7A 5THXA 4I81A 1ISFA 2DFPA 3O2NA 2VZ9A 1GDDA 5JLAA 1GZ4A 1XE3A 5C3UA 2QN7A 2NV0A 2Q3BA 2V7TA 4O1IA 2JHFA 3EDOA 4KXVA 4A23A 5JZSA 1OBHA 3GDHA 4JAVC 3P96A 1ODFA 2JZOA 2CLIB 3K0AA 4D5GA 4D0SA 1KY4A 1Y4ZA 1Y81A 1TKBA 1JFFA 4FFPA 1NUTA 3OZSA 3H94A 2Z5GA 4M53A 4NATA 4TRJA 3GJTA 1QGZA 3H9NA 3LLUA 2X6XA 2Q2WA 3R3XA 1U94A 1I7NA 2IYFA 4KO8A 1ZMTA 5ALFA 2EP8A 1E63A 1NJFA 1Z6QA 2XMRA 1FPQA 3EEOA 1NBEA 4US0R 2A5DA 4J0JA 3AL2A 4I1IA 3TLMA 1RZVA 3C98A 2VDQB 5IP5A 1EDOA 2EHJA 3JVVA 1AO0A 4K6FA 4OHXA 5REQB 3ZJ4A 1I3NA 1XDGA 5BT8A 3B1FA 1A04A 3PP8A 4MYDA 2QI9C 1PK7A 1W75A 2GCIA 6LDHA 1JBEA 2R2AA 5FD8A 3C4VA 1B1CA 4RTNA 2MSKA 4PRKA 1U28C 1JF8A 3H5LA 4IMJB 3RYFA 3UBTA 4DXHA 1G5PA 4YI3A 3JY6A 2RH4A 5E6SA 4OOFA 5JSKA 3V1NA 3EGCA 4TGLA 4BC1A 1O6CA 3EUFA 2PJZA 4OHPA 1F8GA 3KWMA 3EJWA 3KB2A 3NOVA 2W58A 1T5OA 1YBHA 5EHIA 3CCEB 1CVRA 4F4FA 1P62B 4Y1RB 1WTCA 5EXSA 1P60A 4RDCA 1KOJA 1X77A 4JB8A 4H4CA 2PNFA 2JEOA 4JYZA 1BYIA 1OT5A 2EG9A 4HAOA 2E55A 4I8DA 3PPYA 1RWOA 3BXZA 1I24A 1GAWA 1Y4SA 3DPUA 4M88A 1E3JA 2D5BA 1OFVA 4PF1A 2X41A 3ECCA 5TPWA 3CRW1 4B6GA 3QOXA 3PV0A 5A5GA 5C1DA 2RGWA 2EXXA 2UZ4A 3KYIB 3CCUB 1IHOA 1YC2A 1U7PA 3ZIUA 1GLGA 2FI1A 3F8SA 4ZVPA 3TNFA 1VQ8B 4AZ0A 3SZMA 2C59A 2P5UA 1Z62A 3NBKA 4LDRA 3R9KA 1T0PA 4DV4B 4IOKA 1JHVA 1MF7A 4Y1EA 5ALDA 5IVHA 3PT9A 4L50A 4WX2B 3QF4B 4H7DA 1VHWA 1W85B 4TWAA 1SVWA 5F1KA 2ZAYA 3M2PA 5BVHA 5H7XA 2IHUA 3HA5A 4BL5A 1XTBA 4DHWA 4U7DA 5H8WA 3U4MA 2HUPA 3HFSA 3TR6A 1ILWA 1G4UR 5IN5A 2PMEA 3E7FA 2J3IA 5K1ZA 5LZ5A 1FPMA 1AS0A 3RODA 1G16A 3R3ZA 3N70A 4J0FA 4O3MA 4KPGA 2VBVA 1CQIB 1P4RA 1Z16A 2LXNA 1BE8A 3O1LA 4GR4A 4DZZA 3QA9A 3H13A 3JVEA 2ZBEA 3SHVA 4POOA 2ZIUB 4QGHA 3WDSA 1NC3A 2FR8A 1I2ZA 4C0BA 2RC6A 4ZCRA 4ITVA 5M5BA 2H0AA 3K1TA 3NAQA 2H31A 4L5CA 3V8PA 2JK0A 2O1EA 4JI3B 3O26A 3FOEC 2XDWA 2HA6A 4MICA 2R79A 1R5BA 3GDOA 3LBFA 4NHEA 3HXPA 3ZE2B 1RWWA 2WHXA 3N0WA 5JIBA 1R0XA 3MBOA 721PA 3EAQA 1S7CA 2GN2A 3R3HA 3WZMA 4XKJA 2AI3A 3GNSA 1I14A 3GBPA 1M6YA 4BP9A 1T29A 2VR1A 4DPLA 1A4IA 4YQFA 2VBUA 1U7UA 1XJQA 3FNHA 4P3NA 5AHWA 1U6JA 4UTNA 2YJGA 1KZ4A 2ZBUA 4UPEA 1RQRA 1QH8B 1A88A 1DPGA 1E5TA 1RHJA 2FJ0A 4Z4YA 1ISJA 4M9SA 2Y1GA 4ISCA 3R3SA 2P4UA 3NIFB 1KYVA 1BDIA 3RANA 3A1VA 3MBKA 4I9GA 5AOCA 3VHXB 2EFCB 4BIIA 3AHIA 2WZPP 4KH0A 3D7MA 1SO8A 5CM2Z 4ERNA 1VQ6B 1OXSC 3ASVA 2DE0X 2IXEA 4FGWA 3A2KA 1L4HA 1L8QA 3LWBA 4PVDA 2K6GA 3SS9X 4BFTA 2XNJA 2N9UA 4EA7A 5I51A 4YVFA 3A6PC 4MWGA 2QQGA 2CNLA 2IIQA 2C29D 1UOPA 3HKDB 2HM7A 3CUEF 3WRYA 4CFSA 1FMJA 2BHSA 4WKOA 2B4TO 3T1VA 4UE3S 4PG8A 5IVKA 4L85A 3THRA 4TWJA 3I58A 4AZ3B 4QM7A 1YLOA 1G21A 4QUJA 1JEYA 1CUSA 1SCUA 1XDZA 4TKVB 4CDNA 1WSVA 5LDDC 2A14A 1XZNA 2YHUA 2DBVO 3HP1A 4EG5A 5KB3A 1UINA 3L8DA 1DJLA 2Z6VA 4DV0B 2RHDA 5EINA 4FHGA 2I87A 3LWNA 1U7DA 2IDJA 2HRQA 2J41A 1CK4A 2EWWA 2I7VA 2P9CA 4UBKA 3OEWA 5I7HA 3MJVA 3MRXA 3VOAA 3MTIA 4L75A 2CXOA 2F43B 2ZULA 3BF7A 1BN6A 5A3JA 3O2JA 3H9GA 3CE9A 4NWIA 5ALKA 1R50A 1GEEA 4EGCB 5EZSA 1HSOA 4ARVA 1LRJA 5CVUA 1K75A 2GOYA 1CY4A 2XIQA 4OYLA 5JE8A 5KTSA 4DKJA 3R20A 1FRVA 3Q1KA 5BN4B 2OCYC 4XSHA 5K4AA 3ZDDA 3IPLA 3D0OA 4AKSA 3L07A 1PQYA 1KZ7B 2OESA 4P35A 4DUZB 3HCEA 3OI7A 2VF8A 3N8GA 1SU6A 4MITA 4DF3A 3HY4A 4RY9A 1AC5A 3V3KA 4KBGA 5B7PA 3DDCA 2G4VA 3S55A 4XIGS 4BCDA 4G56A 4ZDIA 4G9GA 3G0CA 3OURA 3B1ZA 1U81A 5C3MA 2DKOA 1G8JA 2DBYA 1AD2A 3VC2A 3FWNA 3OF5A 3HCBA 3TPCA 4LZPA 3AP3A 2GK3A 2IV2X 4EG3A 2VCEA 2PSDA 2V8BA 4X1OA 1QS0B 2HAEA 4ZYWA 3ZDBA 4TQ9A 4GL4A 1HDOA 2HC9A 3JD4A 1V7QA 4EY4A 1BSVA 1LDYA 1M5UA 1N2HA 1UZMA 4NDZA 5ITWA 2R8EA 1UODA 2GZDA 3UZUA 5DHRA 3CPEA 2CT8A 7AT1A 4L76A 3KCNA 4EGAA 2IH4A 3IIKA 2FN8A 2JNWA 3HYLA 4N5NA 3W6ZA 4ESOA 1GYQA 4F96A 1VQ4B 1FP2A 4XUGB 1SU4A 2BFDA 2JAPA 1LA2A 3EBOA 5AUPB 4MIKA 2O8DA 4DMMA 2D4HA 2B92A 1QIJA 3C7AA 3Q8MA 2RD2A 2GD2A 3WQSB 3NHSA 2XHEA 4V0ME 4Y18A 1QANA 4HXYA 2EEZA 4PINA 4Y2RA 1RDFA 3GVKA 1EHCA 4IJ6A 4IIJF 4EVRA 3KOOA 4B6SA 3QKIA 3GJYA 1C1XB 3PA1A 4GM0A 1SG0A 3AKYA 1A9PA 2EF1A 3BXGA 4BV3A 4G2TA 4DNPA 4QRHA 4U3JA 3QSGA 1BWPA 2V7PA 4QQNA 1E4EA 3RTGA 5K8TA 4TZ6A 1BA3A 2BYTA 1Q50A 3LLSA 1U5BB 2HLDA 4UE6A 2R00C 2E82A 3OE5A 3N2ZB 2GEBA 3VXKA 4CCWA 4E4TA 1MOZA 1YR6A 4WCFB 4CTOA 4A6XA 3WK4A 4W5RA 3HB4X 2DTXA 4JK3A 2ZZGA 3G2QA 2VOJA 3NUZA 4YJHA 3TIIA 5LP1A 1WVGA 3SKBA 2R85A 1E98A 5HZBA 2AOTA 1FRNA 2FH5B 5CCBA 1GD1O 3QE2A 2WNHA 3CF6R 3NKFA 1U04A 3ESDA 3WAKA 1G55A 4FB5A 5J4VA 2IYXA 5GIOE 2F4NA 3KQVA 4OQPA 2V7UA 1JIIA 3N07A 4NBUA 5FR1A 4F2WA 1JG2A 4RXMA 3ZBPA 4HQLA 4OU5A 1K7YA 4B79A 2ZIZA 4H18A 2FE1A 4CM7A 5BQOA 4BZQA 1S8AA 2V55B 4D9BA 2HPHA 1CY6A 2B6NA 3BREA 5LMZA 1OXUA 4LK3A 5H16A 3L02A 3PIIA 1OYWA 4PLTA 3CEMA 2C9ZA 4XGKA 4KYUA 2V0GA 1FP7A 1ST3A 3AY0A 3BFJA 3FIUA 3U1TA 3PUNA 3R2JA 3IAM6 2UUAB 3VI4B 3GEDA 3D5TA 4HEA1 3L1HA 4K0RA 2C94A 2FLWA 3AVOA 3SOZA 4ND1A 3EGXA 3L0YA 3M4JA 2H54A 3R7WA 1M74A 1Q74A 3FETA 5DWQA 1OH5A 4RMIA 2MSDB 3VJMA 4AKGA 1E9DA 1LPMA 2A57A 1RE1A 4JIGA 1E3IA 3BSSA 3HKBB 3QVTA 1BKDR 3AIIA 2V1UA 3K6RA 1SD5A 3P5BA 1I10A 1O6FA 4ACBA 1AHIA 4KXUA 4CMBA 3OQIB 2OHFA 3IAUA 3QKSA 4R98A 1KI8A 1W1IA 3V55A 4TRRA 4XQEA 3ZWXA 2BFFA 2YWFA 3T1YB 2Y0CA 3PUMA 4DLAA 1YS2X 2VDRB 5H9WA 1KO8A 5JFTA 1U02A 2JBHA 3LX8A 1C8LA 1XCGB 2YV3A 1DCTA 4FIDA 2GCGA 1JTVA 3H2BA 4KX5A 3PJDA 2GQ0A 1RXUA 1TK3A 3SQWA 3CX8A 4MUXA 4DAOA 5EUBA 3ZUPA 2LV8A 1MAAA 5A7HA 3R7AA 2GGSA 1U2QA 4BLWA 3ILHA 4QICA 2O4CA 5HQ3B 2WZNA 3EYWA 5I9TA 2ZZEA 4R3WA 4NFYA 4GEKA 2H11A 1P44A 1BLIA 4FFLA 4QBIA 3PQEA 1MN6A 4E12A 3OT1B 2WICA 4KRYA 1V95A 2P67A 2FPKA 2VKQA 3BWBA 5TQ2B 2WQ6A 3IEUA 1EK2A 2CLSA 4LSGA 4C03A 2OTCA 2VP3A 4UOQA 3UAZA 2ZJ1A 3KUCA 3WLTA 3PUVA 2FW9A 3NCHA 2OBSA 1KOFA 3QK7A 5K4HA 3THXB 1A95A 2IY7A 3KSAC 3ETEA 4FKZA 3SZ3A 5I6DA 4FPXA 2LGJA 1OCEA 2WWYA 1EBFA 1NFRA 1TIPA 3CLRD 5L3RA 1DXYA 5ALOA 1T3LA 3L0DA 3RSGA 5LDHA 4GWGA 4BASA 2VBSA 3WK6A 1JU9A 1MABB 2P9JA 1I8TA 3FFTA 1CUJA 1HBJA 3FBGA 4D79A 5K4GA 2CF4A 2WAYA 4JBNA 4Z4IA 1TW3A 4IIJA 1KL7A 4B71A 3ZIDA 4P31A 4HH4A 5EXXA 2H5JA 2G9QA 1BOOA 5LBTA 4CIVA 4F45A 2P1ZA 4ZVVA 5HHTA 5JC8A 5JAZA 4A15A 2PH5A 4NZ9A 2VPYA 5JISA 4N4AA 2PE3A 4REQA 3LD9A 4RCZA 2C1EA 4F21A 3IEVA 1SEPA 2ZSHA 3HYTA 4P53A 3A9SA 4C2BA 2J9GA 4LMBA 3OQMA 1VGVA 3L8FA 4KPUB 3VO9A 3BB4A 7YASA 2VP5A 1IN8A 2HPVA 4KR9A 3REQA 1IQPA 4G4SO 1C3XA 2B7LA 3RTEA 3WSWA 2GXUA 4EJSA 2J5BA 3TH5A 5TRDA 3PVCA 5A5VA 1JHXA 1N7HA 2C9DA 2JFUA 5EWMB 1JVNA 4LS3A 3VAZA 4BUCA 5FDFA 2AN4A 5KQLA 3R3YA 2FZKA 3I1FA 2WJZB 4FNGA 5C1IA 2MU1A 3NETA 2CFTA 4DLUA 3FA2A 3H5WA 1PJQA 3CLSC 4H4EA 2WSBA 2E6KA 5LQKA 1F1JA 1G19A 3EGIA 2Q6KA 2NACA 4X3PA 4XWOA 2EW8A 1EZ1A 1ZIYA 1S89A 3LPLA 5IW8A 3T7RA 3H2GA 5T4FA 1IRIA 4EQ6A 1M6VA 1D07A 2HLPA 4RTRA 5HE8A 3UMBA 1T6XA 1HWYA 3H2ZA 2ACWA 5KTNA 4UHFA 3EZ9A 1G1MA 2GZRA 3E03A 3W06A 2HR1A 2OV2A 1SM4A 4GVXA 1K6JA 1N3BA 3PI6A 4YJ3B 1J9EA 1W581 3D6VA 4ND3A 1GTMA 3AR3A 3X1XA 3ZY3A 3C7CB 3UCEA 2H1OA 1Y6ZA 2I67A 1RLTA 3DM9B 3DEKA 4ACAA 1XZEA 3EQ2A 4NULA 5EQJB 1NU8A 4PCVA 1JH8A 3Q7TA 3DTTA 4KE7A 4D9MA 1WXQA 1CR2A 1T8UA 3AI3A 5B6PA 1YHNA 2GUWA 2O2CA 2QV0A 3FJOA 1DKOA 1NQUA 1RCTE 3QUSA 1GPDG 4LFBB 4B44A 4TN5A 4TUYA 2D1RA 2XKAA 5BSKA 4YHHB 1VBKA 4JVLA 4ZAYA 1N6IA 3IDSA 5L8VA 5FUXA 1OWMA 1KKMA 1P9LA 1ESZA 2HRDA 3ANTA 3D3EA 3HR7A 3PFBA 2X58A 3GRPA 4BN0A 3KQWA 3QEOA 2VA9A 2WKPA 2JA1A 2PIAA 5F33A 3A1NA 1W36B 1HDIA 2CVOA 2GSDA 2YQ4A 3HFJA 4BFLA 4JR0A 1YMVA 1HE3A 5KPJA 4LUCA 1UBKS 2HIGA 3D26A 2COKA 2XOKD 2W2QA 3NMUF 1ZVQA 4TKOB 4PQGA 5CT9A 2ZIVB 4R81A 1K89A 1KH2A 2ZR7A 4MYHA 3RFVA 3NGMA 3T06B 3GD7A 1T2UA 5CA1F 2BFNA 1Z2PX 2GFHA 3K0BA 1R74A 4PN3A 4F11A 2UUBB 4LTMA 3NHZA 5DMXA 5FOTA 4QSMA 1JIQA 3BE8A 3HNRA 4WESA 5E9WA 1BDHA 3P0JA 3NIGB 2QDKA 5D6NA 3QTTA 2W0MA 2R1VA 4OGKA 5MGBA 1B16A 2RHGB 2Q29A 1XQYA 2J3QA 3OX1A 4HWSA 1GARA 1X1CA 3UMCA 2IHBA 4ESEA 3UQZA 3JD2A 2QXTA 4MJXA 5AKLA 2V9ZA 1D03A 5AVTA 4LFAB 1ID8A 4KVGA 3KHTA 2WZCA 3N2YA 3HJHA 3GZJA 3JASA 3M6FA 5SYMA 5CBKA 2PUDA 4B74A 1QQAA 1IM8A 1JDTA 5CG2A 4HGRA 5FI1B 2VP2A 1V71A 3O8OB 2JCXA 4PC1A 3UOGA 4WK2B 3HVJA 5DO9A 1EVJA 2D1SA 3IMCA 4RH3A 3WAJA 1IZZA 3RE1A 4N6GA 5K3BA 3K0HA 2VAVA 1Q2XA 1N5OX 3PZBA 2YJZA 1V16A 4YN3A 3RC1A 3WIEA 4Z4WA 1V1RB 1SZJG 1WF6A 2GJPA 5MFPA 2CUNA 2Z98A 3G2JA 1WW8A 4K9QA 2CL5A 2QN2A 1HTBA 3ISJA 1YACA 5ARCA 3T5TA 3GFSA 1RXYA 4AY3A 1IN5A 1A9QA 1YOVA 2Q0SA 4PLWA 4C7MA 1FNBA 3AJEA 1OZGA 2VHZA 4W1PA 4EUEA 1G21B 1K2WA 4WOCA 4ZQGA 1X19A 1Z63A 3OPYA 1K8ZB 1YQQA 1C80A 5BXQC 2QNRA 5GIPE 2ZSUA 3GVHA 2BV3A 5AOBA 3IE1A 4P22A 3GUVA 1G8PA 3DLIA 4DPMA 1Y80A 1EB9A 4FI3C 2BWJA 3HJAA 4Y2YA 1H2WA 4KQHA 5BW5A 1LFAA 4RKFA 4C3VA 4UXJA 2GREA 1U9YA 4YCCA 3V1UA 2Y6UA 4K9MA 5FV7A 1V4VA 2QY6A 3GCWA 1CRQA 2VYVD 1PQPA 4X24A 2NUBA 1NURA 4PLVA 2ZTHA 2PD6A 2VKTA 5E4JA 3O9VA 2O0MA 1SOUA 1XU4A 4Y9TA 5DHPA 3CHYA 3GUCA 4XQFA 4E5UA 1P7ZA 2NVWA 6ABPA 4DSZA 2JARA 2WHQA 1B1AA 2XNDA 1NTRA 1P0QA 4YECA 1VCHA 3AEKA 4XVHA 1XELA 2FPSA 5EKXA 1MOQA 2GEVA 2ACKA 4KXQA 4YQYA 1FS4A 2FSGA 1MXFA 2DKFA 4UU7A 1ISRA 1VJTA 2ESRA 4HB3A 4JY7A 1NOIA 2W5UA 4WZAE 5J47A 4DQXA 2NZUG 1P1KA 4HRXA 3U5ZB 3RYIA 1NJ2A 3D4PA 4JVSB 1SUCA 3LM8A 4DMCA 4YB8A 5K3CA 3FNBA 3WGUA 2VPTA 1AB6A 2FEKA 3QVXA 1J7KA 2HGSA 2XDQB 2DUMA 3R23A 3IQFA 2BT4A 4FC7A 1IPHA 4R84A 1J0DA 5EJGA 1FNNA 4JEIA 1PLKA 2AJLI 1EJBA 2W6ZA 1ODCA 2FR8C 4G85A 4Z0NA 4MJ7A 3KSBC 1K5GA 3W79A 1RC0A 4DWWA 5BQ5A 3A3GA 2C7BA 1TF2A 2NUPB 4OOVA 2RAUA 2QN9A 2R751 3F78A 1DBPA 2H1VA 5K2MA 2Y76A 4AN0A 4RPBA 2AK2A 4MV3A 4D4IA 1KE1A 4Y9UA 2GYWA 4GLBA 5FT9A 3OKAA 1IZ0A 1I5EA 2UZAA 3UMYA 4DUGD 4EGFA 4UVIA 3LNNA 1E9FA 1GQQA 2Y1EA 4KE6A 2CCJA 1NA5A 2PUVA 3I3SR 4IGEA 4Z1MA 2GN0A 2C8KA 2RSLA 4KWEA 3VHRA 1EUZA 1UZNA 5CW1A 1YQGA 4WXYB 5KKNB 3WJAA 3TINA 1CLUA 3KZOA 1LUAA 3PNOA 4YJHB 4MV1A 4KNWA 5KJEA 3UV7A 5K3EA 1KSJA 3LDGA 1STOA 4BNJA 1JAIA 4UUBA 1NQAO 5BW4A 4W5QA 5AJHA 5GGXA 3G1UA 4XWGA 1XCPA 4MV5A 4NPHA 3MT9A 4BKMA 2ORYA 4EVSA 3A4LA 1RXWA 3BHJA 4BO5A 3T15A 1IEWA 5CDGA 3OKPA 4JBXA 1FVXA 2XE8A 3TF5A 1O6GA 3F7OA 2K7FA 3EVZA 3JSAA 4ETMA 1TIBA 1U0OC 2NUTB 3FM9A 3OE7D 4R7GA 5AUQA 4ZFNA 3RUHA 4LJYA 2RHHA 1OYYA 5B4TA 1YC5A 2NO4A 4QFBA 5DWDA 1TXGA 3ND8A 3BH6A 1CUCA 1NX6A 3QEMA 1TNDA 1JHUA 2X6QA 1SHZA 4POAA 2ODNA 1SCNE 4Q01A 1AZSC 3PNSA 3NP7A 1J24A 5JC1A 3DHVA 2JLWA 1TU0A 2HZ7A 4IUDS 4EGJA 1JHYA 4O2BB 4URZR 1EFVA 4EW3A 3G6WA 3ROMA 3QBTA 1UBMS 4NSNA 5DBOA 3RUAA 2CYAA 4JP3A 5KVAA 3OTOB 3WMWA 3GGSA 5EY5B 4I7EA 3LJKA 2BHNA 3FVRA 1I30A 4RELA 3PB3A 2HJWA 3OC6A 2ES4A 1EK0A 3NWOA 3OEHA 3MMZA 1UK9A 4F5YA 1VQKB 1XZMA 4LF4B 5FWXB 4NMHA 1JMYA 2JA2A 5TMEA 1PHRA 4TYWA 4UNNA 4KQFA 1PN3A 3CZPA 3CUTA 4O63O 3I4FA 4QASA 4QPPA 2NPFA 2ZWIA 3T99A 3G3EA 5DGIA 4ZAZA 3BMCB 1N2XA 3GRZA 3Q6IA 2QTHA 4ZEVA 4DUYB 5A6SA 4OUDB 3OIYA 2VK1A 1ONBA 1UDBA 4IUCS 1L7DA 2E4ZA 2PVCA 4EHLA 3HM9A 1PF7E 1KDRA 1M8JA 3BQNB 3GBSA 5DH9A 4ZO8A 5CVCA 5AKHA 3WYNA 5AW2A 1WHTA 5K7SA 2ZDQA 2H2IA 2AI1A 2ZXEA 1QV9A 1X86B 2ETXA 3GO4A 3HADA 4I1OA 3T7CA 1RQ7A 1SHUX 2Q0HA 2AMLA 4IEFB 4I1SA 4FJ1A 4FEGA 3ZNOA 3BK2A 4KQGA 4LC1A 4LQ4A 4MW9A 3GHYA 1GU1A 4QPJC 1RIIA 4D9FA 4EJ2A 2CEKA 4YMIA 2VHWA 3PFGA 1IBSA 1PT8A 4FMDB 3M82A 2ZBVA 3QBVA 5C18A 3C7DB 4FYHA 4KWHA 3W5HA 3H5NA 4PNPA 1HYEA 1CY1A 1U0RA 1ZM7A 2Q0QA 1A2KC 1W6UA 4ENPA 4CLXA 2EFJA 3TLJA 1AUXA 3S29A 4CWAA 5K01A 1EUQA 3JYNA 2OORA 5HKBA 1HLFA 2IDMA 3RUPA 3LXRA 1MO3A 1RYHA 1JIKA 2O0JA 2Y0EA 4MVJA 4ZGBA 3OQ1A 5AM1A 4BFVA 4D81A 1UZUA 1H9CA 3HCWA 2H1CA 1TVKA 2I5PO 4O1HA 3VBEA 5IC6A 3UW3A 1AUVA 3OMWA 2DPGA 1OA0A 5ES3A 4YRBA 3QELB 5AM2A 3NIWA 3OU7A 1C3LA 3LUAA 2PX4A 2A7XA 2PUWA 4Z8YA 3ZWVA 4EHNA 1A1SA 1NLYA 4TLLB 3DXXA 1LDEA 3QFCA 5DXJA 4Q48A 1S1CA 3R7FA 3UK6A 4P9SA 2JCYA 1I1OA 1JU4A 1QRAA 4AULA 2DUWA 2X5JO 1SUBA 1NT4A 3HU2A 2C3YA 4OBEA 1XF1A 1KQNA 5JOQA 3DNMA 1P74A 2P8SA 1U4OA 2EJCA 3CTMA 1XLTA 1USWA 2IEZA 2A5FA 3ZHYA 3FZNA 1QHIA 4CM9A 4RA6A 2PD3A 3T53B 3SZGA 4PGAA 1DC4A 1FNDA 2L2QA 1EWYA 1LU9A 1UWKA 4TLBA 1PR2A 3HAGA 4ARUA 1EGVB 3AUFA 3HUDA 1QZTA 5FYQA 1WEKA 3K8OE 1NVVR 1Z34A 4L5AA 2UZ3A 3DOIA 4QIHA 3I3OA 4QOFA 3FLMA 1L5HA 4EM6A 3AXSA 1ZIXA 4OXKA 4YCMA 4ZTZB 3NW9A 1VKZA 2HBRA 1XTKA 1MB4A 3QY9A 4JITA 2HHJA 2F67A 1UFRA 4KSBA 2WUFA 2C5GA 4R69A 3QE9Y 3TX2A 1Z6ZA 3D0KA 2XE6A 1W9XA 3INGA 4J4HA 4S3MA 1NXWA 1VZ2A 2ZAGA 3FGZA 4JVNA 2GF0A 4L07A 2ZBFA 4WFKA 3S2SA 3SNHA 3VNVA 4IKPA 3SYNA 1J99A 1NUAA 3AT1A 3KG2A 5IFKA 3RC3A 1JWAB 3EIOA 4TKLA 4Q4AA 2VL7A 4Q3AA 2QG6A 5BR8B 4CGZA 2FWMX 1KIFA 2AG8A 2EZ8A 1I5RA 4HQRA 1W2GA 5EXDA 4CZ2A 1XTPA 2PU7A 3CZ4A 3KVRA 3LTNC 1F4PA 3KJQA 2ZK7A 2YWJA 4ZC1A 4CJXA 3IBGA 2ZJ7A 3DKVA 5TPZA 3SF0A 1EZ4A 3QE0A 1Q1GA 2YWXA 4LXXA 3FR8A 4DYVA 3RJMA 5CD1A 4MKHA 4RK5A 3WL4A 3DMHA 4BTEA 3RS3A 4B1FA 1NB9A 4DQUA 4P7KA 3SC2B 1ZZEA 3NOXA 2BMJA 3MNFA 1NLMA 2WJHA 5IJ9A 5EJEA 1G4AE 1OFUX 4YXWA 1KEWA 1ODIA 3RYHB 1OGYA 2ADOA 1Z4JA 2P68A 1J42A 3H7AA 4OIFA 4YT5A 3V33A 3WGMA 4IXNA 2PLAA 1ZU4A 1NVMB 4DBLE 2RI0A 3F5DA 3VTFA 5IM4F 1OKKD 4UUQA 1MJGA 3DVAB 4CKCB 1H93A 4RHUA 2QR2A 4G0PA 4ZYXA 1GGFA 4JBHA 3Q9SA 1J8YF 4ZU1X 3VAYA 2AMFA 3WRXC 1G2OA 2J7PD 4PN7A 5H5JA 5CH5A 3CCLB 1OH8A 3CD6B 3VTZA 3GHHA 4ZQFA 2C61A 1KDZA 3GIRA 3PA2A 1QR2A 4ISBA 3VSBA 3NG1A 1HLDA 1J2RA 2WFLB 1FTGA 1CJUC 2P75A 4JUBA 2OFFA 1INLA 4M98A 5JJIA 1VBNA 2YUIA 2ZYRA 5IEBA 1XU7A 2AXEA 3ND6A 4LV5B 3L4SO 3UK1A 2A5JA 5K3FA 3QUBA 5FWAA 3UT5B 4DLKA 4XIYA 2O4UX 1E9BA 2Z1MA 1L3CA 3AR2A 1BIFA 4I5GA 4XYBA 1QRTA 4EB6A 1J2EA 1N6HA 1UJBA 2JGDB 2HRZA 1ODKA 4GXQA 4RIEA 4B82A 4CQLA 3CU5A 1KEUA 2XTJA 2D8MA 1VG9B 3JQ7B 2CHEA 3HO1A 3TZQA 3ZHXA 2I4MA 4NOKA 1XN4A 1GUAA 2PKQP 2WVJA 2XCLA 2RJNA 2ZRCA 5K3SA 4XQ9A 5AW5A 3T54A 3HJFA 2WLSA 1QVZA 2AG6A 2O2JA 3IKLA 4B3DA 3G02A 2WTEA 4M6WA 3M2TA 3AVPA 2J1LA 4P3YA 1NLZA 2NZYA 3E1SA 2I6XA 4IX9A 4ME6A 1B3BA 1LPOA 1M2OA 4DLLA 3GAFA 3TMAA 3ELDA 1E2HA 1JXAA 1P1FA 4PO1A 4RY2A 2WD8A 1H23A 2I2FA 1PV4A 3BMQB 3IVCA 4B73A 1VSTA 4ZPXA 5LVAA 1MB9A 4DRYA 2V7EA 1RI5A 4Q00A 5FBWB 1TL7C 1UK8A 2PMBA 4D41A 4RTQA 4LJLA 4JQSA 1UBUS 4C2UA 2O8CB 1L4EA 4HNUA 3FHOA 1F0NA 3ACBA 4X1YB 5SZHB 1R4NA 4BFXA 1OLSA 4LBZA 4EZIA 3RKRA 1NULA 4HAXA 5JZ9A 1JU3A 2OLEA 3GZNA 1T2FA 3LT0A 1Y3HA 4RVUA 4ZDWA 3TE7A 3ZDQA 4QOEA 1DKMA 1J0EA 3B9PA 3D3KA 2F62A 2IVZA 1IZ8A 4LGCA 2XBLA 1ORRA 1BMDA 4R9UC 5JAQA 2V97A 5BV8A 2FETA 1IZYA 3T3MB 3CA8A 4FCWA 4OM7A 2PGIA 2XGGA 1ZM4A 1A77A 1PG2A 4PX9A 3L7JA 4ZT2A 1PJTA 2HD4A 3K0AB 2XOXA 3TZLA 1M34A 3QUQA 4XM3A 2WPNA 3OOJA 1HH4A 2J09A 4XOIA 3FPCA 2X8WA 4CEHB 1R16A 3OFSA 4MRMA 3N53A 3D5EA 3EEYA 5D1HA 2XCOA 2AFHA 3DTVA 4LOHA 4OUKX 4QFCA 5C46F 3UJ3X 1Z9BA 5CK4A 2VWHA 4HLUC 4RLZA 2OBXA 3D7KA 3E3OA 4D4JA 5I47A 1EE2A 1E1RA 2POCA 3KB8A 3TTYA 1VSUA 1EDBA 1F9EA 1QHFA 2Z2XA 3OFJA 1NJ1A 1YZQA 1FC0A 1ANKA 3IC5A 4P4SB 1ONPA 2FSFA 3E70C 2FTKE 2W2XA 1VCNA 3BMOA 3E48A 5J5CA 2X9LA 4NV1A 2HA5A 1RJ9B 4BMXA 2NU9B 4AZ3A 1KETA 2PT7A 3ZD6A 1WRBA 2A9KA 2H7VA 2B5OA 2QQEA 2Y93A 4RD6A 1ZM3A 3DR3A 3GW8A 1U7ZA 3UMSA 4B3HA 1UD5A 3CP2A 1S3GA 3JZIA 2PRJA 2BCJQ 3NH9A 5FOXA 4PLFA 1UPFA 4RO0A 4J0KA 2J3MA 4BO9A 3C3XA 5JSZB 2OHJA 1BQEA 2FNAA 4XCXA 1XNJA 2BRUC 4Q9HA 1JVSA 2G67A 4S2UA 4A73A 1ZNXA 3U7HB 1GLVA 3INYA 4W5WA 1XK6A 2WU4A 5AI8A 5BNIA 5HRUA 5KMGA 4UDXX 4GI1A 3H1FA 5J5AA 5BURA 4N3NA 1NBOA 3CG4A 5G40A 3VR6D 2GKGA 3ZU3A 4YV2A 3A4YA 5HS4A 4HX2A 2M2IA 3TEJA 4GP6A 4W5NA 2O0LA 1PWEA 4R2HA 3ONEA 1EYZA 1MBZA 1L5YA 4Q3EA 3ROTA 2I34A 2QUHA 3DQPA 1TYCA 1IHUA 3B6JA 1L5KA 1E7WA 1WF3A 2RI6A 2LTAA 2Z0MA 3BB1A 3W6UA 1Q12A 3FMVA 2BFBA 1GXSA 3FOCA 3MTBA 2Z3VA 5TJHA 4NBTA 3JQBC 3ZZMA 1YCGA 2XVXA 1NNLA 4AQDA 3KUKA 4I4TF 4EO7A 1MQAA 4BHTA 3MTJA 4MV9A 3OLWA 2QXYA 2D3LA 4AWAA 3GGOA 3A14A 2H2FA 4RY0A 1FFSA 1ZD1A 3O7MA 3IODA 4U39A 4U2DA 1ESCA 5DLYA 4PZPA 2AE2A 1OB5A 2P5YA 4EF6A 5FV4A 2CVFA 3OE1A 5FOSA 4KODA 3RBAA 4UM9B 1T0BA 4IFIA 2P3LA 4L8VA 3C16C 2O6LA 2VZLA 2X1MA 1RJEA 1DTSA 2IPXA 5EUMA 3VNRA 3ASPA 1YR2A 1ZUIA 2PGDA 2NVOA 2J08A 1N2SA 2OAQ1 4YAWA 1E61A 3EZGA 4PZ0A 3RARA 5IPFA 2Q8QA 2DGDA 1DFHA 1GPBA