1VF7A

Crystal structure of the membrane fusion protein, mexa of the multidrug transporter
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
237
structure length
237
Chain Sequence
TLNTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQLQEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Multidrug resistance protein mexA
publication title Crystal structure of the membrane fusion protein, MexA, of the multidrug transporter in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 67
structure length 237
sequence length 237
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1vf7A03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1vf7A01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vf7A02
4H44C 3WB2A 5JJNB 3H94A 1Q12A 3TZUA 2BA1A 1CFMA 2JEBI 4KKTA 2AUJD 3RLFA 1ONLA 1K8OA 1RSOA 1DXMA 3IKJA 1H9KA 1GUGA 3W3AA 4DK1A 3HGBA 1VCIA 3I73A 3VR2A 3M85A 2YYZA 1IYVA 2A6EC 1H9MA 1A6XA 1IW7D 5D5QA 3NE5B 1V43A 1Y8OB 4DNRB 4PV1C 4G7ZC 1DD2A 1GHKA 1K8MA 1YNNC 3VR6A 1E2VA 4OO1G 1Z7TA 5JEAG 3MXUA 3VR4A 3T56B 2E74C 1Q90A 2PPBC 2A68C 1OXSC 5K36H 3L7ZC 2EJMA 4DNTB 3EQLC 4H13C 3OOCA 1H9JA 4H0LC 2O5IC 1OXVA 4KN4C 4IFDH 2EDGA 5KNCA 1GUSA 1Q1EA 2D62A 2F93B 1OXUA 2KA7A 3PUZA 4OGQC 3U9SA 2E76C 3PUYA 2K7VA 2PCFB 5K36G 5C0XH 5D5PA 3I4LA 2EJGC 3AB9A 4HR7B 1FYCA 5JEAH 3QIAA 4OO1H 1Q1BA 1BDOA 1TKWB 4G7HC 2V4DA 1H9SB 2D2CC 1YNJC 1IW7C 5JJJB 3M4YA 3M7NA 3A8JE 4GZYC 3VR5A 4IFDG 1HQMC 1HTPA 2B8FA 2EJFC 1G291 3SDZA 3PUWA 1E2WA 1QJOA 4L8JA 3BRCA 4IQZA 4JBWA 1O78A 2R6GA 1ZKOA 3ND8A 4BA2I 2D5DA 2NN6I 1GUTA 1OXTA 1Y8NB 1GJXA 3CRKC 1H2SB 1VDZA 1ZYRC 3D31A 3PUVA 3BG3A 4RCNA 1VF5C 3IFTA 1O7LA 4KMUC 3VA7A 3GD7A 2O5JC 2ZT9C 3A7LA 4BA1I 1H9SA 2JE6I 2EVBA 4I7ZC 2F1MA 4KI0A 4TQUS 5BN5A 5KNDA 3BDOA 1LABA 4GYCB 3LNNA 2BDOA 3T51B 3DXJC 5JJEB 2NN6G 4LJZC 3FPPA 4KKSA 2BA0A 3GQBA 2DNCA 1E2ZA 3FMCA 3A7AB 4G7OC 2K32A 2F95B 1Z6HA 2PNRC 1IYUA 3QG1A 4JK1C 2L5TA 1EWHA 4KKUA 5BN4A 2A6HD 4XTCS 1Y69U 2AWOA 4KHZA 1SMYC 1GUOA 3I72A 3LWUA 2JXMB 4XIGS 1B9NA 1T5EA 3PUXA 1FR3A 3MFYA 4LK1C 1HCZA 2NN6H 1V8QA 1CI3M 2B8GA 2CW0C 1OXXK 2QF7A 1GUNA 2IT1A 3PV0A 3QJYA 3T53B 2LMCB 1DCZA 2DN8A 3WDNA 3OPOA 5C0XG 2E75C 4TKOB 1I6VC 1TU2B 1GHJA 3D4RA 5A35A 3WB0A 2A69C 2BE5C 3P20A 5BN3A 3WB1A 2A6ED 1CTMA 3ND9A 5KNBA 2A69D 2BE5D 1B9MA 4KN7C 4DK0A 1HPCA 1VF7A 2Q8IB 3A8IE 2KCCA 2K33A 3CRLC 3VR3A 3SE0A 2A68D 3OW7A 2AUKA 2A6HC 1Y8PB 3N6RA 1H9RA 2DNEA 1PMRA 3A8KE 2JEAI 1LACA 3KLRA
chains in the Genus database with same CATH superfamily
3WB2A 3NSWA 1R3IC 3AEIA 4NTXA 3CW2C 3VR2A 3OMIB 1I4RA 3OEHA 1BX1A 5KMGA 4RAUC 1OZ0A 1RF2D 1STGA 1QNUA 2QTSA 4D7TA 3P30A 3AG3B 4NTWA 4HEDA 4G4KA 1W2BU 3PSIA 1YZBA 5C3WA 1SESA 2MP1A 3J7AV 1YLOA 2YXHA 4H9GA 1A0IA 5ELNA 2I5LX 1QZGA 1FX0A 1V1QA 1I18A 5J3OA 3S9WA 1L8DA 1CKNB 2F1MA 3M3YB 1S40A 1JJOA 3I55V 4G1BA 2YTYA 4QQBX 1Y76A 4NXNO 2AWOA 4GKJQ 2WPDA 4WBNB 3S14H 3E8FA 2DOSA 4KTAA 5JJKA 1EFUA 1BUVT 1EIFA 2YEVA 4P26A 3W5VA 1E1TA 3RWRD 2KHSA 1DOMA 4CDCC 2ITDC 3FYIB 4Q6GA 2DIEA 3NWSA 1UD8A 1ZLZA 1RQPA 2W0XA 3VR6A 2OCCC 2QDOA 2IX1A 2Q6KA 2Q6LA 3BVGA 2GTAA 3G6JB 2N49A 5IIFA 3RZOH 4DR5O 1EYDA 3PIO3 4JBMA 5LXTB 1JFFA 4JYBA 3IJ4A 4E6IA 2QWQB 5C3XA 2JA7H 2IX3A 1IBKO 2F0WA 1W59A 4JI2Q 1BR9A 3LQEA 3MTSA 1O7ZA 4G2KA 3OW2U 4BW5A 4JI3B 3SJQC 1TXYA 5IYPA 4O4IB 4GYCB 3PO3H 1WP6A 4U7OA 1A2UA 2DWEC 1JMKC 5B66Z 1Z6HA 3CJHA 5IJ0B 4NKLA 4KK7A 4EB6A 2KOLA 4RD6A 1VQ4A 4DUZO 1TT2A 4GOPB 1S72V 3R66A 2NWGA 4OHJA 1D5AA 5A9GA 4WWVA 2B63G 1FXHA 1W2BA 4DV1B 3WQZA 1HZAA 5CBFA 3HOXH 4UP8A 1STHA 5L3BA 4QCLA 2UU9Q 4CBCA 1N05A 5FNVA 4UP9A 5FA6A 1Z2GA 1NJIW 1XYIA 3GTKH 1SC5B 3Q24A 2A68C 2G9DA 1X32A 2RMKB 3X3MA 3E22A 1NH2D 4M1KA 3A1PA 3W2GA 4N21A 2D2CC 1Q81W 2R9RB 3DXRB 5EC1C 5I6YA 1QFJA 4IURA 4JYAQ 3D8CA 2QWRB 2K03A 3JQQA 4DGZA 1U2RA 3BY2A 4JAAA 2XAJA 4J1MA 4GKJB 3B8HA 1AJQA 1VQOA 3OM3B 2ZZFA 1KK0A 2AXTZ 1VQ6B 1SMXA 3NELA 4IUTA 3PV0A 4JI0L 2DQ0A 1D1NA 4IPHA 3VYUA 2F03A 1P7BA 5FOBB 1PTOC 4RDLA 3L74H 4LF5L 3DWQA 1U0LA 4OPAA 1FKAO 4A3KB 3RLFA 2OXPA 4RDJA 2C4TA 1SSOA 1ZTEA 1JJGA 3IC7A 2KKWA 1STNA 1EXMA 3OW2A 4J10A 4PV1C 4B4DA 1R1BA 3B77A 3KLSA 3RW0A 4B08A 1YITB 1AIPA 2KEDA 4DN4M 5JCOA 4HJ9A 1BNZA 1FRQA 2N88A 1VJSA 4JI1B 1BT8A 3JASB 3D26A 2V4DA 4JI2B 1P7GA 3M4YA 1SERA 2PE3A 4YHBA 1JJCB 1TVCA 1ICWA 3QR8A 1SRUA 3NUCA 3CRKC 1VQ7A 4AYBE 2VXWA 4LF7L 5CMUA 1H8EG 1S77D 3KLSX 4Y9UA 1SYEA 2E5LQ 1YDXA 3ETDA 4UVCA 1YEZA 3H6MA 3P7JA 1GM9A 4P22A 1P8LA 1OCZC 5IODA 1WOOA 4PA4A 5G3LF 1FFXA 3P32A 4XLEA 3CW2A 2GUZA 4DR6L 4Q0FA 4UHVA 4NB5A 5CBAE 2KEEA 5M3FB 1R73A 4NYKA 1LR1A 3W3AA 4LBEC 2AQ3B 3APOA 2JRIA 1KMIZ 1GHKA 1FXVA 4WJ3M 5ITZA 1KIXA 5LL6X 4XN3A 4H0LC 1ZAUA 3ASOB 2C5BA 4X1IB 2KCNA 1JA8A 3K0DA 3KL9A 4JYAB 1EWYA 4A3EH 4G7HC 3CCMA 3CPWU 1YNJC 4GN5A 1VLOA 2Q2UA 4HJ7A 1V0EA 4QHYA 5M5YH 5D3DA 1H2SB 4X3TA 1QUEA 4B47A 1AROP 4B3RO 1NZ6A 4R4QA 4K8XA 3NWTA 2K28A 2X6YA 4X62L 3RYCA 4BY1B 3ZJZA 4LJZC 3T1YQ 3ETGA 2OBSA 2NV4A 1IBLQ 4MVQA 5FPOA 4KY6A 4PABA 4FLTA 2DYSB 4O1NA 2RCVA 5A2QE 4DW1A 4DV4L 4C3HG 1A62A 1TWGH 2JDIG 2E1RA 1BBXC 1LUWA 4B48A 4RQEA 3RYFA 1ILPA 2R7FA 2Q2HA 3OMAB 3AEVA 1NR7A 5IT9L 4DV2L 1N32L 5CBGA 3HKZG 2NTTA 1VQ4B 4DR5B 2RA4A 4AQYO 4LBVA 2UUAL 2EJGC 1T6YA 4ZKIA 2O57A 4OOSA 4HSVA 1IBKB 1NI8A 1W2BB 3ZRSA 4YXWA 1XPOA 2IW5A 1I4GA 1GOZA 3K81C 1ZYRC 5FNVB 3MXPA 2OTLV 2RQXA 3UCSC 5BN5A 1Q3EA 4PZ7A 2R93G 4MTXA 3S1MH 2C4UA 3CS5A 2P5OA 3A7AB 4X64Q 1QVGB 1D2DA 1OCRB 4DUZB 2UXBQ 4KHPQ 4MW8A 3J81k 1SE2A 2ZNIA 3FB7C 2WAMA 3CPWA 4RJLA 3ERQA 1THZA 1EY9A 4HCEA 4JI5Q 1PMRA 1KHIA 3K6OA 4ZI7B 3LDEA 5FLXN 1NVPB 3SK5A 2D3LA 3CSXA 4HIMA 3GVKA 3HKZE 3O9OA 1B2RA 4UCUA 4W4KA 1VQ6V 1BCPC 2ZTDA 1EN6A 1EYAA 1F2LA 4F7XA 3NTHA 3SPIA 1JJ2U 4TV8A 5JPMC 4JTDB 1FNUA 4A4IA 5FL7A 5HXBA 3AVYA 4B3SO 3CCUA 5FLMG 5IWAO 5KHJA 2A06H 2X6BA 3QO8A 1WSRA 4Z4RA 2B63B 1R3JC 3ICXA 1BLIA 4H13B 2DJFC 1EQTA 4R8NA 3N2KA 4KV6A 1ET9A 5DN6G 1MOFA 1YITV 1EM1A 1VQEA 1HNXL 2LJ2A 3A0RA 1MD2D 4CKBA 4FO2A 5IYWA 2XOKG 1XDCA 3CMAA 3C90A 3ABUA 3OTOB 3DLLA 3W2DA 5GTIZ 2UUCL 1UD4A 1QVCA 1E22A 1H8HA 4I7AA 1AP5A 4ICGA 3SPJA 1X4TA 3GIRA 4J9YB 4ZHQA 5C5MA 2JJQA 4O4HA 4EFEA 2ZITA 4E0FA 4H7BA 1Q12A 4OWXB 4AYBB 2K5HA 5IGDA 3HOWB 3H3VI 1NDHA 5LMUQ 1SZXA 5CV4A 5CMDA 3TCUA 2CHBD 1PZKD 1B50A 4BY7H 1KD1W 2E76C 1STBA 1DONA 4LF6L 2GUZB 1G291 4X9QA 1G51A 1OV9A 1I08A 4IQZA 2GPJA 3HKEA 1FXKC 1S76D 2UXDL 5IE9A 3ZHSA 3FVQA 4NP5A 3R2IA 2O5JC 2B2YC 4UVBA 1HDJA 3T51B 2QDBA 5ITZB 1IHZA 4QGUA 1J9ZA 3J80L 4V190 3JAMc 5GONB 5J2UB 1A8VA 4WRDA 4ZGQB 1K4CC 3DMUA 3CCLA 2WINB 1JJ2A 1I4HA 4JI5B 2TMPA 1CTMA 2GK7A 1VMCA 2IU0A 4B3MQ 4O2AA 3SE0A 3M99B 2KCTA 3N6RA 2R9VA 3KLRA 1U97A 5KHGA 1ICFB 2WR8A 4LFBL 3AG4C 4ME3A 1S5LZ 4YAWA 1F4NA 3CXCB 4NKGB 4E2LA 3F2CA 2CTPA 4K2KA 1N34Q 1NSNS 4CKEA 4QJFB 2VZAA 2J7ZA 2LFRA 5F2DA 4JF3A 4TMTA 4DR1Q 5JVG3 2OCCB 1PRTC 3BZCA 4O42A 5IT9c 2L15A 2NN6I 5IP7H 3L9DA 5C5LA 4RO2A 2CH7A 1BVSA 1PNLA 2LXJA 1H9SA 2QSAA 1VQ4V 2LGQA 1I3QH 2F43G 3MAQA 4GS3A 3CXHF 4JOIA 1GUWA 1L0WA 1R6KA 5DEHA 4RCZA 4N3NA 1SR3A 4MVOA 4BXXH 3QFTA 4BBSH 3GO5A 2E75C 4BBRG 2EOTA 4FXGC 1QU7A 4HIZA 3NPPA 1G8ZD 2XNCA 2ZR2A 1NAPA 2N05A 4Z4TA 4QVAA 4LNUA 1PA6A 5LMUB 4A3CG 5BSXA 2FMMA 2ZIOA 3CD6A 1ELOA 3KF6B 2Z8LA 1UEAB 4AQYB 1BL8A 2E74C 2DWDC 1QG7A 4XDLA 4K6LA 1M90D 3FP9A 3A5ZB 1MJEA 1ASYA 4RAIA 1V1OA 2F52A 4K14A 3I4NG 4PAAA 4IUVA 1JOYA 1KQSB 4CHTB 3RR5A 2HG5C 4C3HB 2A5HA 1QFZA 4DQLA 4A3MH 1KBHA 1YXBA 1YJWB 1SXTA 2FYUH 1VQOV 4Z1VA 4R4OA 2VBUA 1BXTA 2D9UA 2D2CB 4C43A 1PZID 4K5XA 2VNHA 2N04A 2KVMA 4X1KA 1E62A 2QEJC 3HKZB 3JARA 5HFMA 3TZDA 1Q43A 2ZL5A 4J42A 3HKSA 3A55A 4MZ9A 3SK4A 2EIXA 3UQ8A 4WZLA 1CZWA 1SS3A 3FYEB 5CORA 1IBMO 5E1FA 2F23A 4A93H 2K05A 4DV0O 5LHIA 2H4OA 1SROA 1WCMB 2ZXOA 5IP9H 3NE5B 3JSLA 3CMAB 4EQOA 4CDEC 3M3YH 4C3IB 2FJ2A 4DR1B 5IWAB 4KJOA 1DG1G 1X3EA 3K7UC 4HAEA 5ISRA 3M7MX 4LAAA 4DV5L 4PDVA 4MHEA 4ZHQB 1X3GA 2FHTA 2Z3YA 2QTLA 1PM9A 2K1BA 3E8HA 3S1QB 4DR7O 2GJRA 2CW0D 3OGCC 1NS1A 3R6KA 3MZ5A 3AG1C 3EA6A 1QUFA 1G2TA 3STLC 3CYOA 3MHHC 1JCKB 4BR6A 3RLOA 3PUNA 1GN3A 3SYOA 1KZLA 2CE4A 3HKCA 1HHVA 1S3OA 4QE9A 4QFMA 3ZZ0A 4DK0A 3CRMA 3GB7C 4DV6O 1KRHA 2G9HD 3J80c 3TZUA 2CK3G 2MJ8A 2GBOA 4ZQ3A 2CDYA 3KJOA 4LF7O 1LT4D 2JSOA 1PH1A 4LF9O 3G67A 2MFIA 4G1VA 1JJ2B 1ENAA 3R2TA 1FXKA 4MVUA 4O2AB 3S1RB 2B2YA 4N3GA 4RPBA 4F87A 4RHSA 3A0BZ 3J7A5 3W1BA 4QIWF 3T4DA 1I50H 2F4IA 2GQFA 2EBOA 4ZRZA 4DA2A 1I94O 3BDOA 3WG7C 1LUZA 1LABA 1WNSA 2NN6G 4R4IA 2WZNA 2YWHA 1LTAD 3ABLB 3VOUA 1MJCA 5IYBH 1YBYA 1U4MA 1K0RA 3B82A 5L3FA 2EINC 3BYTB 1VQIA 2CBXA 2ZL6A 3ASSA 4A3GB 1WD0A 2QKIC 2ZKOA 3G4SA 1H9SB 3CMEB 2B2UA 3HKDA 5IYDO 1ONLA 3MMPA 1GUGA 2AKWB 3W5HA 3FAVB 4P9OA 2H1EA 5A2QN 3I4MG 2ZR3A 2QM8A 2ZE6A 1UJWB 4G57A 1Q3LA 1EBOA 2D62A 4J9ZB 2NYZD 5E6TA 5L3DA 1WOPA 3ND8A 3PO2H 4RKBA 4JI0Q 4WCEV 1XILA 2DN9A 3VQYA 1XB2A 5LOVB 1IL2A 2CC2A 2DMXA 4LF5Q 1P84F 2C5HA 4A3KH 4IZ8A 4X66O 3Q22A 2ILMA 2JA8G 1VHEA 2JN4A 1YVCA 4L6TB 3QO5A 5EBLC 4LC0A 3ZBHA 1YJWV 2AQ2B 1UWVA 4FVMA 1SLJA 3FPUB 4ASUG 3CHBD 1TS2A 1I5XA 2UUAO 3CCQA 4OP7A 2NZ1D 5LP6B 3ISXA 4PG3A 1TWFB 2LXKA 3MEHA 4AC9A 3RN5A 2DY7A 1SKYB 1MMMA 2JK5C 3JARB 5EZYA 5L46A 1IBLO 2F4VL 4G7WA 2ATKC 1QB5D 5KA5A 2HUGA 3BU2A 1IVSA 2N8NA 1TKWB 1YHQB 1A63A 1Q90D 1KC8C 4BBRB 4IW3B 5C44G 4D6TH 3RY8A 3ZCCA 3K7AB 1Q6HA 2Q68A 1CSPA 1XQ8A 2E2JB 4DR3L 3A3BA 1RL2A 2ZT9C 3T1HO 4X7FA 3CMAV 4B3TL 1W0JG 4DR6Q 3LNNA 4LH7A 2NPFA 5M3FH 2L55A 3FPPA 3H0GH 1L0XB 1AI6A 2IM9A 2ZINA 2QWOB 4J11A 4KKUA 4O2BA 2ZTNA 5B1NA 3I3CA 2AHOA 4F7DA 3D6WA 1RFYA 4DU9A 2Y4UA 4N8FA 1A3VA 3A8KA 2HIVA 4C2MH 3CC2A 3CCRB 2BE5D 4JI7O 1QVFU 4DV0B 1WJJA 1RM1B 3AQQA 5KSWB 5A8AA 5CDFA 3HEJA 3UDGA 3ZN0A 3UO2A 5JJLA 5CBHA 1PH3A 1XMQO 4JI4L 1CFMA 1CA6A 1G7TA 1FNWA 1BMFA 1NB9A 4V0BA 4TMZA 3LDDA 4KP4A 1ET6A 5EIBD 1O7IA 4O2DA 1KU9A 2XWBB 4DV7L 4XQJA 4UY8C 3BVOA 2KENA 4KY5A 3KBXA 5CA0A 4X62Q 3HKCB 1Q1BA 3WYAA 2WWWA 1ZM4A 3OT7A 2B7CA 3I4OA 4YHHO 2LFSA 4DR7B 4DAMA 1B44D 4DV4Q 3L73H 2QGQA 3C2PA 5M3MG 1G7SA 1YJ9A 1N0UA 2CTQA 2E76B 2M00A 3SGIA 4UVAA 2BCOA 1SYFA 4N8X1 2DE0X 1A15A 1U4RA 2CGNA 2BOCC 4F4LA 4PGOA 1JICA 1F9QA 4FIPC 1FXKB 1MG1A 1WJZA 4DV2Q 3QJYA 1N32Q 4A76A 3W2IA 4DV6B 2K50A 1HFNA 1QLEC 4X20B 1DZ1A 5B1OA 5KAIZ 1XHZA 3FX7A 1MA1A 3VYTA 1XREA 1K8OA 3QB3A 4XLHA 2KG7A 4TOIA 4LF7B 1V5VA 3SJAC 3TN2A 4G7ZC 2WFWA 3K58A 4LF9B 3K06A 1EUJA 2Z9HA 4LFAO 4JYCA 4CQJA 1CNFA 1EP2B 2V1CC 5J2TA 4RPDA 4ROXA 3R93A 1PH6A 1WORA 1PFNA 2ZJPA 5DM63 4ACAA 2ZTGA 1R5BA 2PZSA 3G7LA 1DDIA 4GZYC 4ZIBA 3AG4B 4XDXA 1Y74A 3N2GB 4XR6A 3THOA 3QO2A 1WA8B 1PH2A 1V1PB 4FLUA 1M90C 1QVFA 4LF8Q 1I94B 1LT5D 4QPKA 2PMZE 2WA3A 5HURA 3ONYA 2B1GA 2JIZG 4QUFA 2RKSA 3AK1A 3UDIA 1H2GA 2CCZA 3OE7G 3GTQB 4UZFA 4FLXA 1GK9A 2A1AA 2HR3A 2OF1A 3VDYA 2PTMA 1NH2B 1STAA 3KDFB 4A3BB 1BKBA 5FK9C 1VQPA 1W34A 3ZBTA 2JJ1G 4OX9Q 3OW7A 1KL9A 5BXZA 1A3TA 2C78A 1O9GA 2B63H 4OXSA 2E75B 4X62B 1PH9A 3M4QA 1VQHA 4LBWA 1GKFA 1RTOA 2Q9LA 2KCMA 1HNWO 2C5CA 1HNXQ 5CR3A 4X3KA 3CCQB 4DV4B 5TV2A 5JWPA 5TRDA 5LMNL 1QJOA 5DM73 2YV5A 3E89A 4ABNA 2EILC 2E74B 5HFLA 1GUTA 2PO4A 4HN7A 2R92G 3I56A 2UUCQ 4TT3G 1E24A 4NPSA 3W2HA 1YIJA 2LFNA 2GVBA 4X66B 3CCVB 1OHHG 4XLCA 3RN2A 5KA6A 4DV2B 1N32B 4LW1A 1YI2A 5J3BA 4OPHA 4JI3L 4XIGS 3A8IA 3GTMB 2R9AA 2CW0C 4G6IA 3NP8A 2UUAB 2E2IB 5LA6A 4PHZA 4A3DG 2F0HA 1Y66A 1KDAA 3QO7A 3HOYG 3LVBA 3JQPA 4ODGA 4LF6Q 1RSOA 1XUQA 4FXUA 5DLQE 3LNMB 4J41A 3HGBA 4I7ZB 2JJ2A 2Y69B 2EIJC 4DV1L 1XE1A 3CX5F 2AHOB 2UXDQ 1SQXH 5IYZB 2F1LA 5TR9A 1LTLA 3GWKC 3VA5A 4TUYB 2EJFC 3E9IA 1HVXA 2IX0A 5FLXL 3ZEDA 1H85A 4Q5VA 2XZLA 4X0CA 3V7AA 3PUVA 3T1HB 1SMYD 2VBVA 2QA4A 1QHTA 4C1NI 2QKAA 2BDOA 1PFSA 1JOKA 3E5SA 1HP8A 4YY3O 2IL8A 2F95B 5FO1A 5DAUA 1K28D 5AJ3L 4LFBQ 2IJJA 2YWFA 2X6GA 5JJZA 4OPVA 1SE3A 2XAFA 3T16A 3FHWA 4JI7B 1SF9A 3WOFA 1V54C 3AG1B 1HPCA 4DPGA 1XMQB 2R7ZG 5I2XA 2A7WA 4DR2O 3F7VC 2PQEA 1NTKH 5B3SC 4LCUC 1S0UA 1S5CD 3VO2A 1SQBH 2OBRA 5JVDA 4X88A 1HNXB 4YAUA 3G71A 1TVKA 2QTZA 4JASA 1QH0A 4MTFA 2O5IC 3DEPA 3CKIB 1VQAA 4QUCA 2D0PA 4YHHB 3Q6RA 4ZBMA 2UUCB 4IUQA 4BA2I 1FGBD 4JI1L 2I1LA 3KK7A 2H94A 5TISZ 3BY6A 1LTRD 1ML0D 4C56C 3MDSA 2W6JA 5M9OA 1AI7A 2VQFL 3FD9A 1O9HA 3KLWA 4RCOA 3QG1A 1I8DA 1B6QA 1V0FA 3J7AU 5LYJA 1Q7YD 3QFCA 2QF7A 3G4SV 3U9OA 1PH4A 2CAZC 3WG7B 5BZBA 1E1QA 4QNHB 3WB1A 3AK2A 1EFWA 3KBGA 2K33A 4GX0A 4RD0A 4C3HH 4MTNA 3L75H 4MYUA 2BSKA 4LWSB 5M3MB 2JN9A 2UXDB 3LDCA 4XN0A 4LFAB 2PMZB 3F8TA 3Q8DA 4ZCKA 5GQOA 4FLZA 4GX2A 2DETA 2QM4A 5CA1A 2X0LA 4XDJA 1IJFA 1SZTA 2VJIA 2GREA 1X3FA 3GTKB 1YNXA 1J5EO 1WB8A 5KEEA 1AEXA 2VQEO 1E2WA 2ZBVA 3OEEA 4XDKA 3JAMi 2WLKA 4C3JG 5GAEC 3TETA 3CCJB 3ERSX 2Q73A 1JA0A 1B53A 4LFBB 3DM1A 3K9AA 1D7QA 2VZLA 5IYRA 2PNRC 1KLGD 1WCMH 1WVLA 4CBVA 1UEBA 1AI5A 1XL4A 3CCQV 3EN2A 3ER0A 3TGUH 4K5VA 4NXNL 4C3IH 2P4VA 5T1GA 1N07A 1GN4A 2KQXA 4YWLA 3MEFA 1YIJB 1K3BC 3CCVV 4DV5Q 1IJEA 4X7DA 1M1KC 3L72H 4DF7A 4PMWA 3S1QH 1GD7A 1EWIA 5ELOA 5GROA 2QKSA 1VQGA 1ZM3A 3A8JA 1EOVA 3ZMUA 3B6YA 5IGCA 4YJ3B 3VR5A 1KABA 2H5XA 1XTDA 1H95A 3BJUA 4JPBW 4DR5L 1GO2A 3G48A 4Y9RA 4XORA 5L3EA 4XBFA 2NR5A 2VYQA 3AG2B 4WZKA 1DOKA 5FLMH 4EKWA 4FM1A 5LGUA 1R6TA 3I55A 2YTVA 2KSDA 1Q86D 2HKOA 3GTPB 3ULPA 4AILC 3PF4A 4FJCC 3CMMA 1FL0A 1XQBA 5LL6Y 5JEAJ 4MYTA 2ZBUA 5EC2C 5IYCG 3CC2V 1BOSA 1BCPF 1IYJB 1T5EA 2EY2A 4RD3A 2HVJC 2HEPA 1CI3M 3J81j 2ZT9B 1GUNA 4JPRA 1BPLA 2F0JA 3H9NA 5A35A 2EIMC 2A69D 5H6RA 2EJ7A 4IFDI 4DUZL 3BY1A 2XAGA 1G7RA 3KF8A 5K1PA 1TA8A 5CB4A 3S1RH 5T1IA 2R92B 4JV5L 1UMKA 4M8AA 1H9KA 3ASNC 2YIAA 1K8MA 2P06A 1Q82D 1EN5A 2MPMA 5BR8O 4B3TO 4PZ6A 3GTGH 2EYLA 3PUYA 2QE7A 3ABMC 5IYCO 4GOPC 4HCSA 3G05A 5DM6V 5KHIA 1FAFA 4ZUJA 1UD5A 2CVRA 2RF4A 3HOYB 2ZTCA 3PIP3 3BG3A 2DY8A 5JBQA 3EIVA 1TVKB 2XAQA 5HZAA 2YUAA 1VQCA 3CRRA 3PA2A 1K73D 2DJGC 1S72A 3T13A 4II3A 4LUOA 1HTLD 1YNND 3J81c 3S15B 4R4CA 1GVPA 2Q8RE 3H1JH 4OPSA 3H9VA 4Q7JB 1SBBB 3W1GA 1CPYA 4JI8O 5JH7A 1QZHA 5F2VO 5EBMC 2WLLB 4DV3O 4IPDA 3MC0B 2YDEA 2NVYB 2YIBD 4JBKA 3FB5C 1PKXA 1K5SA 4X65O 4QL5A 1FYCA 2R72A 3N52A 4I9QA 1AJNA 3DSQA 4MS2A 1ZKOA 1J95A 2BSKB 4X6AH 1XNQO 2QMUA 3LO8A 2CFMA 1AZQA 2XUMA 3E83A 3CB4A 4FFBA 4RMFA 4FLYA 1TWFH 5J35A 1Q8KA 1QNKA 1ZX3A 3N27A 1FR3A 5C8YB 1WTQA 4U68A 3HOZG 3ASPA 4ZCLA 2BPOA 2RSOA 4K2LA 2F0DA 3JAME 1JR0D 4DXFA 1PRTF 3OZUA 4LF4O 2J0TD 1R6NA 4BBRH 4RD1A 1SNCA 4I55B 2E2JH 2CUGA 1XNRO 2X7RB 2YXLA 3TQYA 1V55B 2KQ3A 2WA4A 1J5EB 4DR3Q 4CC6A 1MSWD 3Q23A 4A3CH 2KECA 2EXZA 1NE3A 3JD2A 1MZFA 1CNEA 2Q7GA 4GQNA 3SHLA 1EFRA 1PVOA 1YIJV 4HBNA 4WZTA 5IGEA 4IIJB 4PC7A 3TRZA 3MD0A 1EY0A 3E8GA 3TK1A 4YCWA 5A2QL 5JVH3 4GZRB 1DYQA 5C4XG 4JZGA 1XPUA 1SYCA 4B3RL 2N74A 4MVRA 2DNCA 1ZUQA 2EILB 4JI4Q 1SNPA 3I8ZA 4EFBA 3ASOC 4K3AA 1SMYC 2WJYA 4LWCA 1SAPA 3CQZH 4ZLTF 1F77A 4PNYA 2QDLA 2XNDG 4DV7Q 4YIJA 4A3JG 4P25A 1CKNA 1AFPA 1GN6A 4L87A 1VF7A 4II2A 3A35A 3FKSG 3RYHB 4LF8O 4JI6O 3ZHQA 4C3JB 5LMNO 2AMCB 1D5ZC 3H1LH 4WBNA 4HIOA 1QGYA 1M90W 3OJWA 2Z6BA 4JVZA 1NUCA 3L7ZC 4CJ2C 2OK7A 3FKIG 2CTWA 1SETA 2DYSC 3QTCA 2EZPA 2IWHA 1VHOA 3RT3C 4AQYL 3P3NA 1YSCA 2QA4V 1JMCA 4BY7B 3CRAA 2M6YA 3KF8B 5E1AC 3H3VH 5CB4B 4OX9O 4GKKQ 1GRJA 2IBZH 2ALYB 2EULA 2HLDA 1EU3A 1NJID 1L2FA 2UXXA 3JALB 1JORA 4P30A 4TV9B 3RUZA 1NCVA 5LXTA 5IY0A 4ACBA 4KKSA 2F4VB 1FFTB 4IGGA 3LWUA 4FYDA 2ZQMA 3X2QC 1A8PA 3HOVB 2B3GA 2Z5UA 2X6CA 1OO9B 3F5WC 5D3IB 1IZ3A 4O4IA 3HAGA 2Q7HA 4G27B 2FX3A 4CH3A 1MBYA 2BM1A 5IJ0A 1BCCH 1PLFA 4DUYO 1JT8A 5K1XA 3HOXG 1VCIA 1BHAA 3U6BA 1F2ZA 5BR8B 1I4XA 4B3TB 2HFEC 4GOPA 4YJ2A 3AMUA 5H9CA 2VBSA 1WD1A 1ZSPA 4DR4O 5KHKA 1GM5A 1OB5A 5B3SB 3GTQH 1V9PA 3OZWA 4L8JA 4B3SL 5IWAL 5JH7B 2WSSA 5B1AC 5IYDH 4OOXA 3ZMZA 1JOQA 3I5DA 3WBJA 5C0XI 2C2AA 1NNXA 3DXRA 2V31A 3K03A 3CF5A 4K0KO 4XTCS 1I3QB 1QCBD 1M9NA 2NN6H 2V1DA 4TKOB 2ZZQA 2OYQA 1LTGD 1PL4A 1B9MA 1G91A 1KJZA 5I4DA 4APVA 4RLZA 4JI8B 4EGVA 3OTFA 4UCTA 5JJNB 3K59A 2D74A 1AVMA 2QM7A 2K6AA 2YI9A 4DV3B 4LUVA 1IYVA 1N06A 4ME5A 4BPRA 3SYQA 1A32A 3LSQA 5H5NA 1PJ6A 3CRCA 4LBYA 4TMXA 1Q1EA 1OXUA 2JGUA 1KECA 3I4MH 1EQRA 1NR1A 3UE0A 4K5WA 4TWKA 4J6HA 4JI3Q 2HHHL 4FFKA 4A3MB 2E2IH 2NTSA 3QF7A 2BCCH 3GD7A 1ILQA 4TQUS 2JVDA 3URYA 3CCSB 3G6EA 1COWA 1EFID 1KK1A 5FKAC 4JK1C 4B9WA 2XT9A 3BABA 4FK8A 2V7QG 2K5NA 5EBCA 4DV1Q 1Q86C 4NXMO 1AH9A 4X89A 4DRXB 1Y67A 4JG2A 1PH8A 2JA8H 4MVSA 4LF4B 1RQRA 4UAIA 1D1IA 1MABG 3JAKA 1NBMG 1EIHA 2B2WC 3KYHC 4FLVA 1XNRB 4A93B 1F9SA 1NMFA 4R8CA 4K1XA 3D6CA 2NBFA 4DNRB 3HRZC 1G6PA 4B7KA 5CV6A 2X3UA 4RFBA 2C77A 3PIOA 1L1FA 1WU8A 1XOUA 2XNAC 1XHXA 1JWMD 4PDLA 1PJ5A 3ETQA 5DECA 3UE1A 2PI2E 3EXAA 3CESA 3HOZB 5AJ3Q 1Q82C 3U2QA 4CS4A 1QVGU 2JA5G 3WY9A 4UV9A 4HJ8A 2OBTA 4X1IA 3CPXA 5C44H 3CC4A 1W3SA 1LT6D 1FPOA 4XYOA 4TSFA 5FO9B 3ABKC 3SJCC 4ZCMA 4KHZA 2IH1C 2WKDA 3PGZA 2LMCB 1DCZA 5LGTA 1TU2B 4CGYB 1OJHA 2F0OA 5KIXA 1R5OA 5LMNB 1DF5A 3BA8A 3QSYA 2QR4A 1XMOO 2JEBI 2AUJD 3VMFA 4AI8A 4RGTA 3HOUB 1BF4A 4JI1Q 1YNNC 2EIMB 1NMGA 5D14A 2WB1G 1GM8A 2A9HA 1CKMA 1L0NH 4WFAV 1SM4A 2BTOA 4Z2WA 3W7XA 4KN4C 3U58A 2VS0A 1A3UA 2VQFQ 5M5XH 2NUCA 3ASNB 2VWKA 1SFOB 3NBHB 4A3JB 4CKCA 2EJRA 2OCHA 3JCUZ 1FD9A 3DTUB 4HSPA 2GK6A 2WACA 3R65A 3AVUA 3ABMB 1MZEA 3NXWA 4YJ2B 2DEUA 2TSSA 3SR1A 1R3KC 4OELB 3ZIAG 3MVVA 1I50B 1RODA 1ROPA 4JV5O 4B44A 2WIIB 5M3MH 1YVWA 1M1KW 1TWHB 2L5TA 4RDKA 2R9IA 4EEQA 3FKIB 2L12A 1VQ8B 1GKHA 1MSHA 5C0XG 2I46A 4EQ5A 1EFCA 2ZE5A 1PL0A 1B8AA 2HVKC 5KNBA 3MXGA 2LGWA 1GN2A 4DUYB 4FF3A 1G6ZA 1QVGA 1IBML 4IYIA 5LHGA 5C0XJ 4DV0L 2PQAB 2YWGA 3JD0A 4DR4B 1SNQA 3CRQA 2WB1E 4XT3B 2ZM6O 4LFCO 5IY5B 2D0OA 5C4HA 3B4SA 1SKVA 3H1KH 1RPRA 2CWAA 1MSGA 2QTOA 2OT2A 1C4QA 1PV4A 5LMNW 4ZI7A 2HCJB 4P71A 4U673 4O0AA 3U11A 5EMNA 1PPJH 4JBJA 3MA2B 4I50B 4J7JA 2WAQG 1K9MD 4X8IA 5E7NA 3D4WA 3PO2B 2JE6I 3JAWA 2EY5A 3M4OB 4DR7L 1TUBB 1X6OA 3JD4A 4K0KB 2ZXWC 4LR3A 1YJNA 3LSUA 3BPZA 4LH6A 3V2TA 2PW7A 1SJHD 3ZS8C 3OSOA 4HYOA 2RJZA 3CXCU 1PXUA 1I5FA 2VNJA 2ZIMA 2B39A 1EY4A 3CCSV 3CP1A 3T1CA 3KG2A 4DV6L 4O4LB 4DR5Q 3E6ZX 3G6EB 4UAJA 2YYZA 3TSSA 4DK3C 4UB6Z 3UKMA 4XOPA 5B5EZ 2VQFB 3GV6A 4XXEA 1IBKQ 1PJ7A 3GTPH 3BAAA 3JAMN 3WWVA 3FB8C 4LF9L 2BM0A 2QEXB 3OP1A 3JAKB 3BRCA 3IAYA 4IL6Z 5AG2A 2EIKB 5BY1A 2WAQE 3W7TA 1L0YB 3RGBA 2ETNA 2MNAA 1K34A 1VQBA 4DUZQ 2F0UA 1C7YA 2R92H 2BGIA 1TS5A 1I94L 4B3FX 4A3FG 3VBBA 1B70B 1YCIA 5CA3A 1VQMA 4NXMB 3H0GB 2A79B 3E0JA 1W0KG 5IGBA 3T53B 4FF1A 1MRZA 3CTAA 2B2WA 2BN4A 4KN7C 4D7SA 1VP7A 1SQFA 2Q6OA 4J8QA 1VF6C 4C2MB 1F23A 1XTCD 5GONA 3CC4B 1KQSU 3J7AF 5J2UA 4JCVE 3EVKA 1L1OC 2AZ0A 1HUNA 1BQQT 3HOYH 3ABLC 2K5WA 3T56B 2E5LL 1Z5WA 1NBWA 3B09A 2X85A 1CK1A 1BZKA 3I4LA 3QIAA 5IJ9B 1UE6A 1WSVA 4NXNB 3H15A 1SRYA 1VMGA 1IURA 1H8EA 1GO3E 3UT5B 5F4JA 2VWJA 2AW9A 1B23P 4GN3B 3CXCA 5LBQA 5FPRA 3K08A 3OJXA 2BGJA 3RYIB 2NB0A 4WFFA 3S15H 4QJFA 3OFNG 4I0XB 1FJGO 1LLRD 2GV9A 3S17B 3OTOQ 2L35A 1X3QA 3GQBA 1HA6A 4TVAB 1EWHA 1GO3F 2V7VA 1N33O 2W6IG 3F2BA 4X66L 3GVJA 2IT1A 1H2MA 4PELA 2WJVA 2NVYH 4M1UB 4ZAIA 4B7EA 1Y1VG 4GLAC 1XMOB 4WJWA 1H9RA 2C2WA 4GN4B 4EQNA 4P75A 5HGTA 2ZZEA 2JA5B 3X2QB 1XBLA 1KTVA 3CC7B 3S1NH 3PVDA 1X56A 1UFIA 2EYJA 3CAMA 4IJLA 1P49A 4I4TB 1VQ8V 3P1HA 4Z9CB 1ZM2A 5EKLA 2UUBO 3GTOB 1IBLL 2YIBA 2HDLA 1PDQA 2HMAA 3AVWA 5EBDA 2ZTEA 3KF6A 2NVQB 5LP6C 1Y8NB 1LTID 3Q3AA 1F2YA 3HKBB 2VUMG 2EFGA 4JV5B 1KQSA 1E3PA 1LNQA 3T1HL 2JDIA 2D9RA 1HNZO 5C3EG 1YJWA 1SQVH 4GLXA 5B1AB 5LHY1 2QILA 3BHPA 1K92A 2F0KA 2Q6AA 2IJHA 2B1IA 2PYLA 5BMVB 2FXQA 1BBUA 2I07B 3TEHB 3FB6C 3I7FA 4HMJA 2KHIA 3K80C 1JOOA 3BDLA 4JI7L 4OIJA 2YTXA 5IYQA 4Y52H 2DYRC 1J8IA 1AILA 3JAWB 4LP8A 2UXCO 2K9PA 1XMQL 4LFCB 1YJNB 4KFMA 2SNSA 3L70H 3L9AX 5GW7A 1KRSA 2V7XA 5LMZA 3HG9A 2JA6G 2XN9C 5M5WB 3MWYW 4B3RQ 1YHAA 2OYNA 1E1RG 4OL7A 1PYSB 4Z4WA 1RM1C 4ZKBB 1QLNA 2WLMA 1O78A 1VQNA 3CE2A 3ZJYC 1GM7A 3G6EV 4YHHL 2PIAA 1VF5C 4R7CA 2OIGA 1CT1D 1Y0RA 1NR2A 3EJIA 4C3JH 3H1HH 1CSQA 1Q7YW 1UE7A 3J81i 3RVYA 2L6LA 1K8GA 3IC9A 3SXHA 4G5GA 4CDDC 2QEXV 2EX3A 1N36O 1MKHA 1OCCB 2ZE7A 3SPGA 1HH2P 1W9XA 3D3RA 3BDCA 3D8GA 2HLDG 1PTOD 3HZXA 3LSSA 3I1FA 2XRSD 4AQYQ 3SYPA 2HHHO 2WAQB 4BIOA 2VW9A 5J22A 1KLUD 4XT1B 3F2UA 1VQMB 3E0EA 2YC0A 4DAYB 2FTKA 3Q39A 1SDFA 2JS3A 3H3VC 1B06A 3QE2A 1VQLB 4LFAL 2VRZA 3AU7A 4PI0A 3OYYA 4ZK9B 1HR0O 4MVZA 3R3OA 1WTHA 1K0SA 3WNCA 3A56A 2VS1A 5DN6A 1XEQA 2KB1A 2X6AA 3SEBA 3HOVH 3CC4V 3ASQA 2R6GA 2KHJA 4IOAA 5EQ0A 2M9VA 2A0LA 1AE2A 3E9HA 4FNFA 3E2EA 4DNIA 3OR6C 2Z1CA 2IHFA 1AZPA 3ZHRA 1ZL8B 1CEZA 2HP8A 1QFYA 5GAHC 3SLNA 1TWCH 3AGQA 2AQ1B 1VF6A 5IYBG 4HIKA 3UO3A 5L3CA 1B1ZA 5IYCH 1PFBA 4FZ0A 2WZPP 2A74C 4JZ2A 1L1OA 3ABKB 1S3JA 3KZIZ 1URFA 2QWNB 4AIMA 5COYA 3VNVA 4B3SQ 5IWAQ 2B29A 2HCIA 3K8AA 2X8KA 4B3RB 1F60A 4RGOS 4A3FB 1JE5A 2KJXA 1X9NA 3CMEA 2K7VA 2GTSA 1HNWL 4G7XA 3E8BA 3WNDA 2WP8J 1D5MC 1YNJD 5ELCA 1WLEA 3FAVA 3NHHA 1SNMA 4JBWA 1Q86W 2D5DA 1QUQB 1FVIA 3Q6QA 2OWOA 3CC7V 4PDMA 3RBZA 1FJGB 2X69A 4QB4A 1WTWA 1WN7A 2JGDB 1EIGA 2ICEC 1JB3A 5FJ8G 4K8ZA 1E2ZA 3OMNB 1BJKA 2A6HD 4GX1A 2I5HA 2ZJRA 1VQ5B 1K9MC 4LK1C 1BQ0A 2LW1A 2J4XA 2A73B 3K0XA 3ZC3A 5LOVA 1ZWIC 1Q6IA 3W2FA 4GKJO 1H2LA 1XFOA 3QFSA 1PNKA 1Q82W 4CZZA 3PA1A 3OIPA 2LY7A 4ALPA 3Q0AA 5E4XA 2HDNB 1TS3A 1PHJA 4UCRA 2YXYA 1K8AD 5H59A 1EYCA 2EDGA 3OEHG 5LP6A 2ZXHA 3RFRA 1NRKA 4F6RA 2B8FA 2Q2TA 1BS3A 3K5NA 3MXNB 3UI2A 2K01A 1Y1VB 1AB3A 2OCEA 5CN0A 1S5HC 2F43A 1YJNV 5IOCA 1EZVH 4I9WA 4I7ZC 3Q4HA 2Y69C 4X8AA 1K73W 1HNZB 5KUMA 1B3QA 3M9BA 1YHQA 4UZEA 4JI2O 1NB0A 3OUSA 5A89A 4YY3L 3BA9A 4P73A 2R93B 1VQNB 4L5SA 3OMGA 2WPDG 1HZBA 3CPFA 2ZXWB 4NDXA 2ZD9A 2GSMB 4OO1I 4B3SB 3SDLA 2UXCB 3HOZH 3JATB 2O4XA 4DR2L 1BQEA 3U4VA 4WZEA 1IW7D 1RJTA 2QWPB 3J81E 1KAAA 4IHJB 1XX8A 3CCRA 1BCPD 2L1BA 3C1FA 1NKDA 3S2DB 2X53S 1F51A 2UU9O 5CC4A 4BW9A 2DGYA 3OZVA 2RCFA 4BY1G 3KCYA 4XOTA 2BDNA 5IK2A 1TQOA 5CV8A 3B8MA 1AJPA 2Q67A 2E1BA 2K5VA 2M5SA 4IUNA 1VQMV 4P2CB 2NNUA 3OIQA 1FDRA 2F0EA 4JYAO 4JW0A 2O2LD 1VQLV 1CKOA 3HOUH 3ABTA 2VNKA 2WLIA 1STEA 5C4XH 1N36B 4Z4SA 3H01A 4K8IA 2JA6B 4GX5A 3ASRA 3S24A 3Q6SA 1JR9A 4RCYA 1Z5VA 5IGFA 1JQYD 2WLNA 4QIWE 4Q20A 3KFUA 2HHHB 3BVMA 1SFOH 4A3JH 2IW3A 5JPNC 4R71A 2Q4PA 2XGTA 4P74A 3MCAA 4KUMA 4X20A 1AR1B 4RG1A 5E3FA 3ZUGA 1HR0B 4CS2A 2VB3X 1OXVA 5KRUA 2NVXH 4IFDH 4WF9V 3SJBC 4FDBA 5ELDA 1L1OB 2YI8A 1TWHH 1J5EL 1IKLA 2YICA 1PD3A 1EY8A 3FKIH 3C46A 3GTGB 1RHPA 1B4OA 3A2FA 1TS4A 1KAWA 3L0OA 2VQEL 1Y6XA 2PMDA 4RCNA 3GVLA 4Z4UA 1QR8A 4AF6A 3VYRA 4H33A 2MW2B 3ONUA 4TSSA 2Q8TA 4KD4A 5GV8A 1M5IA 4G7OC 3N2GA 1WA8A 2GDSA 4CH4A 1V1PA 1IBMQ 2F0QA 1CHPD 4DFAA 3JYCA 2MO0A 1SEBD 4DV0Q 2RCNA 2SEBD 2E5LO 2HQLA 1I0HA 4N23A 2CK3A 4HNAB 3BCFA 4Y7NB 5EYPB 1AI4A 4IPCA 3ZHTA 3AG7A 3CP2A 4CS3A 1WI5A 2ADPA 4TMWA 1J9OA 3KDFA 5CV7A 1VQ5V 2DYIA 3CWBH 5K36H 3B40A 1O80A 3M4OH 2PZWA 4DR7Q 1BO0A 2OTLB 3KJPA 2L4NA 1IDSA 1PRTD 1JE4A 1DK1A 2K5DA 1VQKB 3OR7C 4H44B 2F0VA 1MNGA 1U96A 3A3GA 3J7ZC 3HS0C 1HR0W 2BH2A 1TVXA 3BNWA 2ARHA 2XGJA 2HCCA 5C4JH 4DV6Q 4NTYA 4MVMA 2ZL7A 4AYBG 4F6RB 3HOWG 3I2ZA 1K4DC 3T1YO 5FO8B 1D8TA 2Y0SG 3AG2C 3CCVA 4YCVA 4LF7Q 3TP7A 5F4MA 1JNYA 4LF9Q 3Q4HB 2L9HA 5KLVH 3EHBB 3I73A 1PV0A 1CHQD 3OTOO 1SYDA 4OO1G 3U50C 3MXUA 1KB9F 2EE1A 2VL6A 1OXSC 4U9UA 2NZOA 3S3WA 2CH4W 3JC66 1GAWA 5KNCA 1EU4A 1VQNV 4OGQC 2DYRB 2RC5A 3DWPA 5BR8L 1BDOA 3OAAA 3FPKA 1I94Q 1EEFD 3BS1A 3BCDA 2F3WA 1BSMA 3B2EE 2EYHA 5I6WA 3VO1A 5IYZA 3I4NB 1VMPA 2F0PA 3X3NA 3NTKA 4L63B 3KCXA 1IBMB 2PYJA 4IN3A 4XLFA 1OGJA 4TUYA 4ASUA 2R70A 5B1BB 2C9OA 1QNMA 1N08A 1I4QA 1VF5B 3E35A 3AYHB 2EPBA 2Y0SE 2IH3C 3CQZB 5KMGB 1QQCA 1IXMA 4X64O 4PC2A 2UXBO 4KHPO 4HZ3A 1H38A 4KKTA 2PYKA 1ENCA 3M85A 4JI8L 2WLIB 1HZEA 2ZNJA 4MTGA 5K5PA 2UU9B 4JI5O 4QE7A 3ZYYX 4I5SA 1RKNA 2OTJA 3EQLC 2RQ6A 3U10A 3IRBA 3CRZA 3CB2A 5ELBA 4DV3L 3S17H 4Z1MA 2PCFB 4PD4F 4C7UA 3GTLB 4X65L 4HJ5A 1Y76B 2K14A 2RNBA 4ZGNB 1STYA 3I91A 5IYNA 3PQIA 1W0JA 1Q8IA 1R3LC 4X66Q 1ORQC 4QIWB 4P2ZA 2PNHA 3OD4A 2YEVB 4LNQA 4YXWG 2M2LA 1CUKA 1XNQL 2RDCA 4IOCA 4A3IG 2JA5H 1QE6A 2UUAQ 3JAML 3OMCA 3ZN1A 3ZHUA 2IPKD 1OGIA 2OQ0A 5FIUA 1WTVA 3GTOH 2EQSA 4RUFA 3LWEA 4B43A 1WTXA 2A6HC 2X6WA 2XVSA 5DS0A 2RHSB 1Q5OA 3KEWA 2ZE8A 3GVMA 3EVQA 1JFFB 4GUNA 3S3XA 3ASTA 2B2VC 2NVQH 1WP8A 4LF4L 3CMEV 4J0QA 4JOIC 1IXBA 1FNMA 4UB8Z 1IB0A 5ELEA 1EL0A 4E4EA 2ID0A 3U4ZA 1XNRL 1F9RA 1WTPA 1Q46A 2KA7A 1NR4A 3T1HQ 2ZJQA 4LWSA 1FGUA 4CC5A 1FNDA 1KDBA 5LMUO 3CJHB 4P2NA 1K8AC 4EB6B 2FMLA 3PCOB 3BC9A 4UCSA 5FL7G 4JTAB 4OXPA 3A7LA 1CQVA 2OQKA 2EYOA 4OIKA 3WOEA 3UM7A 5KX5A 4CJ0B 1V55C 5DEDA 2AHZA 2ZXPA 2D3NA 1X65A 3FMCA 4JI7Q 3CHXA 1NY4A 1G8MA 2YS8A 2E5LB 3I72A 3PN1A 1XMQQ 1DJRD 1OCOB 1WCMG 1EP1B 3CCJA 4PMCA 4FMTA 3F7YC 5M5WH 1CP9A 1VQKV 1IZ6A 2ASBA 4RWSC 1FNCA 3GV3A 4C3IG 2CQOA 4EH1A 3E22B 2G5DA 1I7FA 5C0XH 4QGPA 1BHBA 1H8HG 2CRVA 2B2TC 5I9OA 4LF8L 4JI6L 3Q38A 4B3MO 4YHHQ 4RA8A 1H9JA 2Z0AA 3ZMVA 1A2TA 4BAYA 4OPOA 2OT5A 1IW7C 1G6UA 4WFGA 2JYOA 4NBSA 1VQOB 3I4MB 3HFZB 4UPAA 2ITCC 3V96A 1N34O 1HA3A 2JIZA 1SYGA 1YHQV 1ZXTA 4FP5D 3OE7A 3IFTA 1WOCA 4OX9L 4YEJA 4DR1O 5KNDA 2CTRA 1HFGA 3TP6A 1QGAA 1XJVA 4YJ3A 2E8GA 5EAYA 3DHQA 3I90A 4IUPA 4WJ4A 3TREA 4UV8A 2JJ1A 4ULLA 3T1YB 4GLVB 4ZCIA 1KP2A 2YIDA 3OW2B 1IBLB 2UXNA 2LO1A 3WB0A 1S5JA 1EQVA 3MHBA 3NTIA 4LFAQ 2LP7A 2JA8B 4DXWA 4GNXC 3CCRV 4B9XA 4UUJC 1T6ZA 3ZMSA 3ZZUA 2NVTH 1V43A 4POFA 1DGSA 1TGOA 4I65A 5EPKA 2N78A 4DUYL 1VQ7B 2K5QA 1PTOF 4TN1A 2Y48A 1NT2B 1GR1A 2CNDA 2JQOA 1WP7A 4HR7B 1HRJA 4DR4L 3AVVA 4OONA 3P3PA 2KUMA 4TT3A 3SDZA 1K9MW 1K83B 1YTFD 2Y0SB 1KC8D 3P26A 1WTOA 4ZKCB 4QY7A 1K97A 2ODMA 1OHHA 3D3IA 3J81N 4NNJA 3BZDB 1DARA 1FFXB 1N8RD 3DC6A 1E0BA 4A3GG 2F0MA 5TSSA 2OTJB 4P1VA 5C44B 1S5BD 1CQXA 4LC1A 1B9NA 3ML0A 1NQTA 5EPJA 4S3SA 3STBD 3S16B 4K0KL 4X07A 1NTZH 4A3FH 2CQAA 4X64B 2HIXA 2AWNA 2UXBB 4KHPB 2KVOA 1Z47A 3DWAA 1DM0B 1HNWQ 3CCMB 2RN9A 3H09A 4FXKC 5KGUA 3E3XA 3BYYB 4KXRA 4F8MA 4J7KA 4UZUA 3PENA 1II3A 2A19A 1HJPA 4L5TA 2WLJA 1JA1A 2EXDA 2VB2X 3RYCB 3IFXA 2VBTA 4FF2A 2IY5B 4B3XA 1JPXA 1XWEA 5M5XB 3D4DA 2B2UC 5JJIA 2WLLA 3WXMA 3G6BA 3QNEA 1WYDA 3TP5A 3E20A 4MTOA 4IO9A 1XXGA 4OWWB 1E3XA 3BH4A 3ZRWA 3RYFB 1LUVA 4M0LA 2M7WA 2K32A 4UCVA 1I5YA 4P9SA 1TTTA 3AFQA 2GA4B 4H37A 4B3GA 2B2VA 2KCCA 4NXML 1R5NA 3K57A 1JQ0A 2JEAI 4BWGB 1MHWC 3ZHVA 1YHBA 1C9OA 5KX5B 2FVGA 4O4JA 1Y1VH 5C8YA 3W7WA 1KMHA 4JGSA 1FNVA 4P6YA 2PY5A 3T4ZA 3ZZTA 2KBNA 4POGA 4A3IB 1TY2A 3CEIA 3F5TA 3TS0A 3TP8A 2AGAA 4RH6A 3J7YW 3K0YA 4ZYSA 5I2YA 3C1EA 2PI4A 3FRPB 4I55A 1MIUA 2V7TA 1R9TH 4YY3Q 1VQDA 2R93H 1QG0A 1CXZB 4ABMA 4BA1I 2X0KA 1KNEA 2YSUB 1M8AA 3CPWB 2A8VA 1Y14B 2CWPA 1TR5A 4L5QA 2VUMH 3QFRA 4IIJA 4UFZA 2D3OW 4DR2Q 3EFXD 1V8QA 2IHEA 5L37A 2W0FC 2BE5C 5C3EH 3S2DH 3ND9A 2B2TA 4RD2A 1HNWB 3MHPA 4HAMA 3HP3A 3HPLC 4P6VF 4TV8B 3CCUB 1YX2A 1AE3A 1GVHA 4M53A 4NVPA 4B3MB 2VNIA 5EIBC 1XMOL 1GJRA 5JEAG 3K5OA 1ZUNB 2EYFA 3WFVA 3N2KB 2XTAA 3H1IH 5FO7B 1RIPA 4C1NK 3RYHA 3RZDB 3U9SA 1LM0A 1AP6A 1UUPA 2JEXA 2P4KA 1N34B 1R4QB 2JA6H 2EYPA 1EY6A 4FN5A 1PTOB 3PIPA 4L5RC 1JX9A 5GTHZ 5FLXc 1B7YB 3C3SA 1BGYH 1CM9A 4OGQB 4TRDA 3S2HB 1VQ7V 1C48A 4PV1B 3TBIB 4A3LG 3DGEA 4O4HB 4JI0O 2QDXA 2BVNA 3QWNA 2B5UA 2Q0OC 4QUZA 3DC5A 3CU7A 2ADQB 4DAPA 4F88A 3CCEA 4F6EA 3WDNA 3JALA 4LF5O 4GNXA 5BN3A 4IYHA 3SK6A 4PA9A 4TV9A 3CP0A 5B6IA 2Q8IB 4YIPA 3RLNA 5AFWA 2DNEA 4HE5A 1J5EQ 2OTJV 5L3GA 1P4RA 1T9HA 3AGPA 1K3EA 2F66C 4QMGA 3ZX6A 4A3DB 1SA0A 2VQEQ 1E7ZA 3HKEB 2Z6KC 2ZM6L 2ZXIA 4LFCL 4P3IA 1TIID 4YY3B 4WORA 2SNMA 1ZM9A 1OCZB 1PYBA 2ZXRA 1PNMA 3D36C 1K5QA 3CCMV 2MQHA 2PLFA 1LTSD 1OXTA 1P16A 1EZJA 3AFPA 2DCUA 3CCLB 4Y7NH 4G28B 1SJED 2FL4A 4P3YA 4A3BG 1HA5A 1HZCA 1UE5A 1BQZA 5KAFZ 1B3AA 4DR2B 4RM0A 5IY5C 2ZZGA 2QW7A 5IYDG 2PZTA 4KHVA 1XL6A 2HD3A 1Y69U 1GUOA 2EZVA 1QR9A 4H0LB 4WFEA 5HY6A 1Y1WG 3K04A 2PW5A 4DR6O 1X3PA 5FO0A 3L2PA 4DKAC 3O65A 4FXDA 4P72A 4PMBA 1N0VC 1H2NA 2QKCA 3ZRWB 2R3ZA 2P3MA 1Y8OB 4R50A 4YAFA 1MGSA 1X59A 3S1NB 2K1EA 2CH7B 3A0HZ 4FK5C 1G2SA 2R7ZB 3DM3A 5CYUA 2CF4A 1UPGA 1LO5D 1RP3B 1KKDA 2BV3A 2L11A 2NZHA 3M7NA 3W5UA 1FRNA 1ESRA 3J80i 1M93A 4X62O 4O4JB 2K04A 1M4UA 2E2HB 1NU1H 5H2FZ 2ZDIC 2F4VQ 4DW0A 3T4AC 3CCJV 3C3LA 2P67A 2XEXA 1EY5A 4DV4O 1G4YB 4LNUB 3OAAG 1EFTA 5FJ8H 4UCOA 3CD6B 1E79A 3CCSA 2EIKC 3CP8A 3EFFK 5BR8Q 4B3TQ 3M8AA 1N4CA 4DV2O 1N32O 2VQEB 1C8CA 3BEHA 1X55A 4DRXA 5KYIA 3I4NH 1Q90A 1D5NA 3QOLA 1BMFG 1S4ZA 3P75A 3K5LA 2F93B 3SYAA 4YIOA 2Q6IA 5JOBA 1I6HB 1JWUD 4X1KB 3LGJA 3UDXA 5IT9E 3CCUV 2RDFA 4XQQA 3ITPA 1KYOF 1YEWA 3M4PA 1S5FD 2BOBC 1SQQH 4JAVA 1N0JA 2B7BA 3PJSK 1FJGL 1BCPB 1MSDA 4Z1MG 4J15A 4JI8Q 3TXSA 1N8RC 3OPOA 3TJTA 3RNUA 1N33L 3MHSC 3OWFA 3CRLC 2F0NA 4DV3Q 1WAZA 3W2EA 3A8KE 3GTLH 1B04A 4CJ1B 1WB7A 4X65Q 4WFHA 2E2DC 3E86A 3STBC 2XZOA 2R6HA 1K8AW 4JC0A 1M1KD 1HZ9A 3FJOA 1FNBA 3CCEB 5KNLA 2JA7G 4GNXB 4Z4YA 1NTMH 1AN8A 3A5UA 1XNQQ 2UUBL 2Z6BD 4P12A 1IX9A 3VQVA 5EGTA 2MO1A 5LHHA 3PO3G 1Q81D 1HNXO 4CH5A 4BY1H 4X7EA 1AR5A 4XQNA 1O7LA 1BX0A 1SA0B 5CGKA 1M4VA 1SNOA 4EX5A 4JI0B 2ES2A 1AR4A 2XNDA 3GP7A 3NBHA 2F0TA 5GADC 2UUCO 4AHCA 1Q7YC 4NMZA 2CGOA 4LF5B 3FKSA 4LF4Q 4LUZA 1HNZL 1GXDC 1TWCB 4U3FH 4H02A 3CCLV 4YWKA 1XNRQ 2LQTA 4X3UA 4IUUA 2VJJA 4PC3A 4TQDA 4C0SA 2BA1A 2QCPX 5EBWC 4GKKL 1EYGA 3IKJA 4RQFA 2Z6KA 1KUQA 1VQ8A 2ICIA 1VS0A 3ULLA 1S5DD 1Z7TA 3VQXA 2UXCL 1SNDA 4UDUC 3D36A 1FS0G 4LF6O 5E79Z 1BBWA 3GTJB 3APQA 2K52A 4R8IA 2I0QA 4X06A 4MT8A 1K33A 2UXDO 5NUCA 1R4PB 2PQAA 1VQ9A 4JAUA 3K0GA 2XSCA 1X54A 1U4PA 5KYLA 4UXNA 2EY1A 2JK8A 2PF4E 1MI2A 2EZOA 3G4SB 1YZ6A 4U7NA 4JMQA 2GJPA 3HKDB 1D8LA 1HUMA 5JQGA 1TWAB 4DR6B 4JI6Q 1ASZA 4RGMA 5LMNQ 4I50A 3D4RA 1PH7A 2GHYA 1N36L 4X65B 1LTBD 3VR3A 1TUBA 1PRTB 4LFBO 1Y8PB 3J80E 1TY0A 1KNAA 1US6A 4TMVA 1TAEA 3VR4A 1JB9A 3A54A 5KW9A 2XASA 3CD6V 3ZRXA 1XNQB 2H3OA 1GUSA 4HMIA 2JJ2G 3BCCH 1SKQA 1Y1WB 1OCCC 2Q2IA 4O4LA 4XM3A 2ZDIA 4OWTB 2YU9B 1HR0L 4KY7A 1JVMA 3TXQA 3PF5A 4AH6A 4MTKA 4KI0A 1NTGA 1KTKA 1W35A 1QX4A 1M56C 2V7WA 4A5UB 4MNOA 2QEXA 2V7UA 1IXRA 1B2TA 1S0VA 2C35B 1J6QA 4KJNA 1OXXK 5EZYB 4DUYQ 1I6VC 2A69C 3L71H 2A6ED 2RBMA 5J39A 2Q69A 3A8IE 3HOWH 3OUFA 4DR4Q 3SPCA 1IKMA 2PUSA 2LZJA 1K83H 1E63A 3SLDA 4KD3A 1M57C 3PUMA 1E2VA 4A3EG 1D1KA 3FDTA 5AN9A 2PI2A 3LQ6A 3A8TA 1GH6A 4N9PA 5I9PA 2Z4IA 4OO1H 3JU4A 4TQFA 1TLLA 2LW7A 2PZUA 3OHXC 3SPHA 3NR7A 2GJKA 5IDJA 1D5XC 4O2BB 5EK0A 1ENVA 3S16H 3NK9A 1RDPD 4K0KQ 1K28A 2F3VA 1HW7A 4YELA 2EVBA 3ZPNA 3CC2B 3KKYA 3VYSA 3QG5A 3K79A 4LF8B 2V7QA 3CCEV 4JI6B 5IJ9A 2BA0A 2P5ZX 1IYUA 1K73C 3UT5A 2BF4A 4UP7A 2W6JG 1MABA 1OB0A 2E3CA 3RYIA 1S5ED 5C4XB 1SYBA 1NBMA 3L3OC 4FF4A 4I0XA 1LV9A 2CW5A 1QGZA 2Q8VA 2WYRA 4MIUA 5CA0B 3JCZA 4YWMA 3H94A 2FMCA 1E1QG 4XONA 2P90A 3NXSA 4J80A 4GKJL 4OX9B 1XPRA 1GMGA 2Q7EA 2FFKB 3S14B 1RCVD 1YJ9B 2K75A 1K3RA 1GAQA 4X7CA 4DV5O 1F2MA 5D5PA 2WLHA 4WFBV 4MN3A 2NVXB 5EJWA 1WFQA 1OTCA 5H1SE 1SE8A 3CC7A 4XLAA 2EY6A 1KDCA 4PQXA 1VDZA 4PA3A 4I4TA 4YCUA 1AMOA 1Y4MA 3OEEG 1RPOA 1EZ6A 4NXMQ 3P27A 2WKCA 3RZOB 1WDTA 5D65A 2JP1A 2P7TC 2KG7B 4HJAA 1HCZA 1AP0A 4JI2L 2QGNA 2JA7B 4A3IH 3VQWA 1GHJA 1VQ9B 3HKBA 5FNZA 3J81L 1D2BA 5J2TB 2DJVA 2Q5ZA 3NENA 1O7YA 1ENFA 3PO3B 2IJIA 2X6XA 3ZRVA 1VIBA 2OIEA 1Y74B 3RMHA 3TMEA 1WOSA 2RDGA 2L0CA 5EKKA 1SE4A 4LF6B 5JQGB 4IT5A 1QVFB 3V76A 1T5XD 3W7UA 3RD4A 5BMVA 4NXNQ 3NBIA 3PUZA 4K35A 2EINB 3HOXB 4DO2A 2UU9L 1WPXA 3UDFA 2PI5A 1HQRD 4A75A 1KD1D 2Y4TA 3ZIAA 3A0JA 4R6ZA 3WBKA 3D31A 3SR2C 4KMUC 3K5MA 1JWSD 2BSAA 1NVPD 1VQPB 2Q0AA 1WPBA 4XKVA 3VNUA 3M7GA 3MFGA 5BN4A 1UE1A 1U4LA 4JYAL 2F0LA 3MFYA 2QJ1A 1IL8A 1XMOQ 2F4NA 4CH6A 5C4JB 3BZKA 2RSNA 4LBZA 3RZDH 1N9WA 1PZJD 4PDRA 4MW3A 4BIZA 3JQRA 4FM2A 3AG3C 2PGGA 1PTOH 4DK1A 3JD3A 4BY7G 3AVXA 1DD2A 4NW2A 2DOGA 3S2HH 3I56B 3FEWX 1QBZA 1BE3H 3STZC 1UD3A 1S4MA 3NEMA 1C0AA 3DEOA 3JSNA 2JEUA 4RHRA 5JJJB 3A8JE 4BIUA 3RN4A 1HWYA 1YI2B 2RHQB 1WTRA 1FD7D 4JV5Q 2QE7G 3ULJA 2P22C 1FYJA 2RC6A 4DAYA 1NJIC 2IJ0A 1U5KA 3HOVG 3VA7A 5LA6B 2J7KA 3SYCA 1VQLA 3BQJA 2IJKA 2P6JA 3DXJC 3B78A 5G3LD 4XNFA 1RTNA 3F2DA 1K7DA 1Q81C 1IHMA 5IT9N 1RSOB 3KUPA 4A3DH 4PJ0Z 4MSWC 1IBKL 4QVJA 4Y7CA 2CKZB 4WFN3 1YTFB 5BSYA 1ZL8A 2ZM6Q 4LFCQ 1EWCA 1JC7A 3O13A 3C3TA 1KK3A 1F9PA 4HE6A 2F4VO 3NQTA 1U9RA 1DTOA 3E1YE 2DW4A 4IALA 1LTTD 1Z9FA 1F20A 2DERA 4JTCB 4AF7A 3SK8A 3OOCA 2QA4B 2X6LA 1EOTA 5TY0A 3LUTB 5IP7G 2QGGA 3AB9A 3A74A 1JCHA 3GDEA 4DR3O 1TUEB 2JS5A 4PZ8A 2Z0SA 2LKVA 4HIDA 4LMQD 2HJDA 1VLYA 4RD4A 4GT1A 4BXXG 1YJ9V 1W0KA 4BBSG 4A3EB 4M2LA 3W7SA 2R7DA 1EP3B 1W87A 1QUQA 2H8PC 5C4ZA 4A3GH 3ES9A 1EN4A 1KP3A 5KUKA 2B8GA 5M5YB 5JVDB 2JGDA 3G71B 2R7ZH 4W4LA 2XRQD 2SDFA 4JI4O 1YF2A 1LT3D 4DK6C 2Z4HA 3T1YL 3SJZA 4H44C 1LYLA 3SJPA 2XIWA 1DXMA 2OEOA 1VQJA 1VQ5A 4DV7O 4EQPA 2MUYA 3V05A 4EVOA 4U3JA 1A6XA 2ZCEA 1SN8A 1WPCA 2E2HH 2EIFA 3D0FA 4P9PA 4PA7A 2Y0PA 4ZV4A 4DV5B 2DQ3A 2F0GA 1TWGB 4A3MG 1JB7A 5KHHA 3OTOL 2BOSA 1VQ9V 3SEJA 1KC8W 3WU2Z 2XHBA 1E79G 4RGNA 2NN4A 5A88A 3TS2A 1HTPA 3T2MA 1F7YA 3OFNA 1QLEB 2ATWA 1N8RW 5LYJB 2WB1B 2IU3A 4ZOLA 1EFRG 3ICEA 1E64A 1W6KA 2WV6D 5EPLA 2W6IA 2F0IA 1UD2A 4GKKO 3QOJA 3MXNA 4WQMA 1Y0YA 2FINB 4A93G 3LX0A 2BMWA 4X1YA 2ZM6B 2I5MX 5CA1B 5IE8A 2MK3A 3IFDA 4OEMB 1KK2A 2AHYA 5IP9G 4R9WA 4RWUA 4J7ZA 2A68D 1VQPV 3S1MB 1I6HH 1I4PA 5CV9A 4X64L 2BTQA 1F4MA 1E1OA 3TDQA 2F3IA 2UXBL 4KHPL 2A6EC 5D5QA 3DDYA 2FB5A 4R1JA 4X05A 2PPBC 5B1BC 2VNUD 2RDHA 3AVTA 4JI5L 3IL8A 3J80N 3K7AH 1CA5A 1E3ZA 2XWJB 4FWTA 1D6EC 1FJGQ 3JATA 1KKCA 1EZ8A 3PUWA 1GTOA 1EQQA 4K6DA 1G1XB 4GCZA 5DSZA 4IHJA 1GJXA 1TUIA 5J9PC 3WNBA 1N33Q 3ONAB 4DQKA 2F0FA 2SOBA 1PYWD 1PFMA 3I56V 3U6KA 5JJEB 3HR0A 1UD6A 4IPGA 3KOJA 5LGNA 2B9ZA 4DYLA 3PUXA 2XTIA 3HOUG 2YWEA 5HGQA 1YI2V 3SKBA 4BWAA 1M56B 1DDGA 2XAHA 2B5OA 1LACA 5DNFA 2UUBQ 3ZBUA 1KXLA 4YALA 4DXGA 4XKWA 4X3SA 3R8BA 1H9MA 1PKVA 2AZ2A 1E1RA 4CDFC 2BE3A 4PC1A 2EJMA 3BVZA 4FLWA 4DNTB 2NVTB 4PI2A 3R6JA 3I55B 2NLJC 4DAVA 2ENBA 3IGAC 2XOKA 4PA6A 5JEAH 1UNSA 4IFDG 1M57B 1DF4A 5HZBA 5IGGA 3HB3B 5GV7A 3H91A 1QILA 2HDMA 1HNZQ 5LMUL 1WTHD 3PMFA 1OB2A 4IFDJ 4JI3O 5HKKA 2WSSG 2EIJB 4OOVA 3F1ZA 4NR1A 2MGSA 2HQEA 5THXA 2F0SA 2G38A 4ILWA 2XZPA 4ID6A 4A3LH 3BFRA 4KLKA 4HTHA 1VARA 4XL9A 2HJFC 2UXCQ 3GSIA 1P4MA 4FPPA 4NCNA 3GTJH 2EYMA 1N0NA 1KRTA 1E43A 1SQGA 4DV1O 3EROA 4ZUIA 1DOLA 1I7PA 4QPJA 4R4TA 1RD9D 3K9SA 4PC6A 5JAVA 5IYBO 3OKXA 2FKXA 2CH4A 3D3QA 5H6QA 4HNAA 5EYPA 1T6XA 2BH8A 3G71V 2K4KA 4B3ML 1OCOC 5J1ZA 3PO2G 5K36G 3ETEA 4DR3B 5EKIA 3EBEA 1TWAH 5ELFA 1CZGA 1V54B 1N33B 1AW7A 2HT1A 1EIYB 3G80A 3K3WA 4QV2A 2VY3A 1OCRC 1S72B 4A3KG 2OK8A 4U3JB 1UAPA 1N34L 2RVLA 1N36Q 3GWOA 1ESFA 2N55A 1KD1C 4DR1L 5FLXE 2DY1A 2OTLA 1EEID 4K8JA 3SVMA 3RVZA 4A3BH 3FFQA 4QF4A 4BS9A 1VQKA 5GAGC 2DN8A 2HHHQ 1COWG 4JI4B 1EY7A 3P20A 5CV5A 4KL1A 1Q9SA 2UUBB 2Y0IA 1Y1WH 2GVAA 4ZOLB 4JYYA 1HXYD 4NB3A 2QN6A 3OGIB 4DV7B 1W6JA 5H5JA 4N9TA 2YU9H 4FM0A 1SQPH 3B8NA 4AVZA 1HR0Q 1GAXA 2R61A 2JA9A 1ZEQX 2LS01 3U0ZA 1CQFA 4XYQA 4BBSB 3NQIA 4RUEA 4H13C 3QVNA 4M4SA 1D2EA 1ZYRD 1VEWA 4YAOA 1Q6UA 4X1YB 4XQFA 1L0LH 3ZMTA 1H42A 4FFBB 1VQ6A 5C93A 4JI1O 1HQMC 3I70A 4Z4VA 5JCOC 4IJHA 2A3QA 5M3FG 2LSSA 2BTQB 3H0GG 5LL6S 4RKLA 2VQFO 1R9TB 2MHVA 3OWEB 2N3SA 4XMYA 4GKKB 2GN5A 3W5OA 4Z4ZA 4XD7A 3GTMH 1QCEA 1PH5A 5E4WC 1YITA 4FZ1A 2XNJA 2JXMB 1G7CA 1PP9H 3DUZA 2DUDA 1QWYA 3AK3A 1QOHA 2VUMB 5CBEE 4TSFG 3JASA 5C6AA 3JD1A 1H2KA 1DLBA 1XI1A 1VQFA 2AUKA 5C3EB 5F4OA
chains in the Genus database with same CATH topology
3WB2A 4EQNA 3NSWA 5HGTA 1A3TA 2ZZEA 2JA5B 1O9GA 3VR2A 1I4RA 3OEHA 2F66C 4QMGA 2EYJA 4A3DB 1SA0A 4X62B 1P49A 5KMGA 3HKEB 4RAUC 4I4TB 3P1HA 4Z9CB 1RTOA 5EKLA 1RF2D 3GTOB 1STGA 1QNUA 2C5CA 2YIBA 2HDLA 2ZXIA 1PDQA 4D7TA 5CR3A 1TIID 4HEDA 4YY3B 4X3KA 4WORA 2SNMA 4G4KA 4DV4B 2ZXRA 1QJOA 5EBDA 5DM73 5C3WA 2MP1A 4ABNA 3J7AV 1GUTA 2NVQB 2PO4A 5LP6C 1LTSD 1OXTA 1Y8NB 4HN7A 1LTID 1FX0A 1SJED 1I18A 1F2YA 3S9WA 3HKBB 1L8DA 2F1MA 3M3YB 2LFNA 1HA5A 4JV5B 4X66B 1JJOA 1B3AA 4DR2B 4XLCA 2ZZGA 2JDIA 4DV2B 2PZTA 1N32B 4KHVA 1Y69U 2AWOA 1GUOA 2WPDA 4WBNB 2EZVA 4XIGS 4GLXA 3GTMB 2R9AA 2CW0C 4G6IA 3NP8A 5LHY1 2UUAB 2PW5A 2QILA 3BHPA 1X3PA 2E2IB 4KTAA 5LA6A 4PHZA 2F0KA 1BUVT 4FXDA 2F0HA 4PMBA 2PYLA 3RWRD 5BMVB 1KDAA 2I07B 2KHSA 1DOMA 4HMJA 4Q6GA 1JOOA 3BDLA 4OIJA 4ODGA 1J8IA 3JAWB 1RSOA 2DIEA 4FXUA 3NWSA 2R3ZA 1UD8A 3HGBA 4LFCB 2JJ2A 1Y8OB 3VR6A 2SNSA 3L9AX 2IX1A 1MGSA 3S1NB 3HG9A 5IYZB 2XN9C 1G2SA 2R7ZB 5M5WB 3BVGA 3G6JB 5CYUA 5IIFA 3MWYW 1EYDA 3PIO3 1LO5D 2L11A 5LXTB 3M7NA 4OL7A 3VA5A 1JFFA 4TUYB 2EJFC 1HVXA 2IX0A 4E6IA 5C3XA 5FLXL 4ZKBB 2IX3A 2F0WA 1O78A 3ZEDA 4Q5VA 1BR9A 1ESRA 2XZLA 1M93A 3PUVA 3T1HB 1SMYD 4O4JB 3MTSA 2K04A 1M4UA 2E2HB 1VF5C 1O7ZA 4JI3B 1QHTA 4C1NI 1CT1D 4O4IB 4GYCB 1NR2A 2BDOA 1WP6A 3EJIA 1A2UA 3T4AC 1JOKA 3E5SA 1JMKC 3C3LA 2IL8A 2F95B 1Z6HA 5DAUA 1EY5A 1K28D 3SXHA 5IJ0B 4LNUB 4NKLA 4KK7A 4EB6A 2KOLA 2X6GA 5JJZA 1SE3A 4UCOA 3T16A 2EX3A 4JI7B 1TT2A 3WOFA 1E79A 1W9XA 3D3RA 2NWGA 1HPCA 4OHJA 1D5AA 3BDCA 1XMQB 3D8GA 1PTOD 3HZXA 4DV1B 3CP8A 3WQZA 5I2XA 1STHA 2PQEA 2XRSD 4QCLA 2VQEB 1C8CA 2WAQB 1S5CD 5FNVA 5J22A 1KLUD 4XT1B 1XYIA 5JVDA 4DRXA 1HNXB 3F2UA 3Q24A 5KYIA 1TVKA 1Q90A 2A68C 2G9DA 1SDFA 3QOLA 1S4ZA 3P75A 1X32A 2O5IC 3DEPA 3K5LA 3CKIB 3H3VC 3X3MA 3E22A 2F93B 3AU7A 4PI0A 4QUCA 4ZK9B 4YHHB 3R3OA 5JOBA 2D2CC 1I6HB 1JWUD 4X1KB 3A56A 5IT9E 5I6YA 5DN6A 2UUCB 4IURA 3SEBA 2K03A 2RDFA 4XQQA 2R6GA 3ITPA 4IUQA 4BA2I 1FGBD 1YEWA 1S5FD 3KK7A 5EQ0A 2M9VA 4DGZA 4FNFA 1LTRD 1ML0D 4C56C 2Z1CA 2W6JA 5M9OA 4J1MA 4GKJB 1AZPA 1O9HA 4RCOA 1BCPB 3QG1A 1I8DA 2ZZFA 1V0FA 5LYJA 4IUTA 2QF7A 3PV0A 3U9OA 2AQ1B 2CAZC 3OPOA 1E1QA 1B1ZA 3VYUA 3WB1A 1PFBA 2F03A 2WZPP 5FOBB 1PTOC 2A74C 3KBGA 3OWFA 2K33A 2F0NA 3CRLC 3DWQA 3A8KE 1B04A 4CJ1B 4A3KB 3RLFA 2OXPA 5COYA 2E2DC 5M3MB 1SSOA 2UXDB 2XZOA 2KKWA 4XN0A 1STNA 4LFAB 2PMZB 4PV1C 2HCIA 4FLZA 2X8KA 3KLSA 2QM4A 5CA1A 4B3RB 4B08A 2KEDA 4DN4M 4RGOS 5JCOA 4A3FB 2VJIA 3GTKB 1BNZA 5KNLA 2KJXA 2N88A 1VJSA 4JI1B 2K7VA 1AN8A 5KEEA 3JASB 1AEXA 2Z6BD 2V4DA 4JI2B 3M4YA 4G7XA 3VQVA 2WP8J 1D5MC 5EGTA 1YNJD 1E2WA 5ELCA 3OEEA 3NHHA 1SNMA 4JBWA 2D5DA 1ICWA 3NUCA 4C3JG 3CRKC 2OWOA 4CH5A 1FJGB 2VXWA 2X69A 4QB4A 4XQNA 1WN7A 1O7LA 1WTWA 1EIGA 1SA0B 5CGKA 2ICEC 3KLSX 1SYEA 1JB3A 1M4VA 1B53A 4K8ZA 1SNOA 4LFBB 4JI0B 3DM1A 1E2ZA 2XNDA 3GP7A 3NBHA 2PNRC 1KLGD 3H6MA 1WVLA 4CBVA 2F0TA 2A6HD 4AHCA 3P7JA 4NMZA 4LF5B 3FKSA 4LK1C 4P22A 4K5VA 2J4XA 5IODA 1GXDC 2A73B 1TWCB 5LOVA 5G3LF 1FFXA 4XLEA 5T1GA 4X3UA 4Q0FA 5CBAE 4IUUA 2KEEA 2VJJA 5M3FB 4TQDA 2BA1A 2QCPX 3IKJA 3W3AA 2ICIA 2AQ3B 3OIPA 4DF7A 4PMWA 1KMIZ 2LY7A 1GHKA 1S5DD 1Z7TA 3VQXA 3Q0AA 5E4XA 1TS3A 4UCRA 5ITZA 1SNDA 5LL6X 4XN3A 4H0LC 4UDUC 1ZAUA 1EYCA 4X1IB 2EDGA 2KCNA 5LP6A 4JYAB 2ZXHA 3GTJB 3RFRA 4G7HC 1YNJC 5IGCA 4YJ3B 1NRKA 3VR5A 4F6RA 4R8IA 2B8FA 1KABA 3K5NA 1V0EA 1R4PB 5NUCA 4XORA 3UI2A 2K01A 1Y1VB 5D3DA 2F43A 1H2SB 4X3TA 1DOKA 4FM1A 2XSCA 5IOCA 4I7ZC 4K8XA 3NWTA 1U4PA 2K28A 2X6YA 5KYLA 2EY1A 3RYCA 3GTPB 4BY1B 1HNZB 4AILC 1MI2A 4LJZC 3CMMA 4JMQA 5JEAJ 2GJPA 3HKDB 5FPOA 1BOSA 4KY6A 1BCPF 1HUMA 5JQGA 1TWAB 4FLTA 4DR6B 1T5EA 2EY2A 3BA9A 4O1NA 4RGMA 2HEPA 1CI3M 5A2QE 1GUNA 4C3HG 4I50A 1BPLA 2F0JA 3D4RA 5A35A 1BBXC 2R93B 2A69D 3OMGA 4X65B 1LTBD 4IFDI 3VR3A 1TUBA 3RYFA 1PRTB 4NDXA 1Y8PB 3KF8A 3J80E 5K1PA 1TA8A 4OO1I 1TY0A 4B3SB 1ILPA 5CB4A 2UXCB 5T1IA 2R92B 4M8AA 1H9KA 3JATB 1KNAA 2O4XA 1TAEA 1IW7D 1RJTA 2YIAA 5IT9L 1K8MA 3J81E 1KAAA 4IHJB 3VR4A 3A54A 1XX8A 2NTTA 2MPMA 1BCPD 1XNQB 2L1BA 4DR5B 3C1FA 2RA4A 3S2DB 2X53S 5CC4A 1GUSA 4HMIA 4BW9A 2EYLA 3PUYA 2QE7A 1Y1WB 2EJGC 4HCSA 3G05A 4HSVA 1IBKB 4O4LA 5KHIA 4XM3A 4ZUJA 2YU9B 4XOTA 2BDNA 1UD5A 5IK2A 1TQOA 5CV8A 4KY7A 4YXWA 2CVRA 1I4GA 1GOZA 3HOYB 2E1BA 1ZYRC 3PIP3 5FNVB 3BG3A 2DY8A 2M5SA 3MXPA 4IUNA 2RQXA 4P2CB 4KI0A 3OIQA 5BN5A 1Q3EA 1KTKA 1TVKB 2F0EA 2P5OA 2O2LD 3A7AB 1B2TA 1STEA 1N36B 2JA6B 4DUZB 4K8IA 3Q6SA 4KJNA 1OXXK 3T13A 1Z5VA 5EZYB 5IGFA 1I6VC 2A69C 1SE2A 2ZNIA 2A6ED 4II3A 1JQYD 2RBMA 1HTLD 1YNND 5J39A 3S15B 3A8IE 3ERQA 2Q8RE 1EY9A 4HCEA 2HHHB 1PMRA 1SBBB 3K6OA 1IKMA 4ZI7B 3BVMA 2PUSA 5JH7A 2IW3A 5JPNC 2LZJA 3SK5A 4KD3A 2D3LA 3CSXA 3GVKA 1E2VA 4UCUA 1D1KA 3MC0B 1BCPC 1EYAA 2NVYB 3FDTA 1F2LA 4X20A 5E3FA 4F7XA 2YIBD 3NTHA 1HR0B 4CS2A 2VB3X 1OXVA 5KRUA 4IFDH 4TV8A 5JPMC 4N9PA 5I9PA 1FNUA 3SJBC 2Z4IA 4OO1H 3JU4A 4TQFA 5FL7A 2R72A 1FYCA 3N52A 5ELDA 2PZUA 3OHXC 5KHJA 4I9QA 2YI8A 1IKLA 1EY8A 3GTGB 2GJKA 3C46A 1RHPA 1B4OA 1D5XC 4O2BB 3DSQA 3A2FA 1TS4A 1ZKOA 2B63B 3ICXA 3NK9A 1RDPD 1BLIA 4RCNA 1EQTA 2F3VA 3N2KA 4R8NA 1HW7A 4YELA 3GVLA 3VYRA 2EVBA 4KV6A 1ET9A 3ZPNA 3VYSA 1AZQA 3QG5A 4FFBA 4LF8B 4TSSA 4FLYA 2V7QA 4JI6B 2Q8TA 5IJ9A 2BA0A 4KD4A 1MD2D 1M5IA 4G7OC 3N2GA 4CKBA 1IYUA 4FO2A 4CH4A 1QNKA 1V1PA 3UT5A 2F0QA 1CHPD 4DFAA 1FR3A 1SEBD 5C8YB 3OTOB 1WTQA 1MABA 2SEBD 4U68A 1OB0A 2E3CA 3RYIA 1S5ED 5C4XB 1SYBA 1NBMA 3W2DA 3L3OC 1UD4A 4FF4A 2CK3A 1LV9A 1H8HA 4HNAB 3BCFA 4Y7NB 5EYPB 2RSOA 4K2LA 2F0DA 1X4TA 3JAME 1JR0D 4MIUA 5CA0B 4DXFA 4ZHQA 1PRTF 5C5MA 3CP2A 4O4HA 4EFEA 4E0FA 3H94A 1Q12A 2FMCA 2J0TD 4H7BA 4XONA 4CS3A 1SNCA 4AYBB 5IGDA 1J9OA 4I55B 3HOWB 4OX9B 5CV7A 2YXLA 2Q7EA 2FFKB 3S14B 2KQ3A 1J5EB 5K36H 5CV4A 1RCVD 5CMDA 1O80A 4CC6A 3Q23A 2KECA 2EXZA 2CHBD 1PZKD 1B50A 1F2MA 1STBA 2E76C 1BO0A 2PZWA 2Q7GA 5D5PA 1DONA 4GQNA 3SHLA 4MN3A 1EFRA