1VF7A

Crystal structure of the membrane fusion protein, mexa of the multidrug transporter
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
237
structure length
237
Chain Sequence
TLNTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQLQEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug resistance protein mexA
publication title Crystal structure of the membrane fusion protein, MexA, of the multidrug transporter in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 67
structure length 237
sequence length 237
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1vf7A03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1vf7A01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vf7A02
5K36G 1GUTA 2A6EC 2BA0A 2BDOA 2A68D 3M4YA 1GUSA 4XTCS 1EWHA 4XIGS 3LNNA 3KLRA 4DNRB 1Y8PB 1H9MA 5KNCA 3OPOA 2BE5C 4JBWA 2B8FA 2NN6H 4HR7B 2A6HD 4DK1A 1RSOA 1G291 1PMRA 1SMYC 3D31A 3VR5A 1ONLA 5C0XH 1VF7A 1H9SA 1VF5C 3ND9A 5BN3A 2QF7A 3I73A 4G7OC 1CFMA 1B9MA 3ND8A 1H9KA 1OXXK 2JE6I 2AWOA 2K32A 2L5TA 3T51B 4IQZA 4H0LC 1Q1BA 2ZT9C 3IFTA 3QIAA 3SE0A 4BA1I 4L8JA 4G7HC 3CRLC 4I7ZC 4KN7C 3GD7A 2A6HC 3TZUA 5JJJB 4DK0A 4GYCB 1OXVA 3N6RA 4H13C 3PV0A 4OO1H 3WDNA 3QJYA 3H94A 3MFYA 3VA7A 1GHKA 4KN4C 1I6VC 3T56B 3PUZA 2F95B 2EDGA 3W3AA 1OXTA 5A35A 3IKJA 2CW0C 4LJZC 2Q8IB 4IFDG 1LABA 2AUKA 3MXUA 1VDZA 3GQBA 1Z7TA 3WB1A 1TU2B 3PUXA 2F1MA 2YYZA 5KNBA 1T5EA 5D5QA 1QJOA 3M85A 1E2WA 3VR2A 1E2VA 3VR3A 3VR6A 4GZYC 4TQUS 1HCZA 3I4LA 2A68C 1ZYRC 3BRCA 3FMCA 1Y69U 3OOCA 1CI3M 2PNRC 2F93B 1IYUA 2B8GA 4JK1C 2NN6I 3DXJC 1GJXA 4KKSA 4KKTA 2DNEA 3AB9A 1K8MA 4RCNA 2D5DA 3RLFA 2A69D 2EJGC 1HPCA 2K33A 5JEAH 1GUNA 1YNNC 4LK1C 5K36H 1A6XA 1K8OA 4DNTB 3EQLC 4KMUC 3T53B 1IYVA 1FR3A 1TKWB 2E75C 2NN6G 4TKOB 3D4RA 2DN8A 5C0XG 1Q12A 2EVBA 3WB0A 2AUJD 2E74C 3WB2A 3A7LA 1IW7D 1DCZA 5BN5A 1OXUA 2A69C 1Y8OB 2K7VA 2O5IC 1ZKOA 2JXMB 4H44C 1O78A 5BN4A 4KKUA 4BA2I 1H2SB 3PUVA 5JJNB 3U9SA 1GUOA 2KCCA 1FYCA 3A8KE 3A8JE 4G7ZC 1H9SB 4OO1G 2JEAI 1V8QA 1DD2A 1IW7C 1VCIA 2IT1A 3QG1A 4KHZA 3LWUA 2BA1A 1HTPA 3PUWA 3PUYA 5KNDA 4KI0A 5D5PA 3FPPA 1Q1EA 2R6GA 3CRKC 3A8IE 1B9NA 1Z6HA 5JJEB 1BDOA 3A7AB 3L7ZC 1Q90A 1GHJA 2EJMA 2V4DA 4IFDH 1GUGA 3VR4A 1H9RA 1LACA 2EJFC 4PV1C 3BG3A 4OGQC 2DNCA 1YNJC 2PCFB 1H9JA 3SDZA 3NE5B 2D62A 2LMCB 1DXMA 2KA7A 2A6ED 3HGBA 2O5JC 1OXSC 2D2CC 3OW7A 2JEBI 2BE5D 3BDOA 1CTMA 3M7NA 2PPBC 3I72A 1HQMC 1E2ZA 2E76C 3P20A 5JEAG 1V43A 1O7LA 1Y8NB
chains in the Genus database with same CATH superfamily
4KHPL 1IL8A 4B3TB 3ZIAA 5GTHZ 2OCEA 2MHVA 5LP6A 2CQOA 4XXEA 3M3YH 2QN6A 2H94A 4OPAA 5CBAE 4FLWA 2X6XA 5H6RA 3KF6B 1UNSA 3VQXA 1J5EB 1QLEC 4ZLTF 1HWYA 4K0KL 3CCSA 4CQJA 4JAVA 1Z5VA 3K7AH 2EYMA 2DOGA 4JI8O 3CC4B 3RYCB 2V7WA 1I7PA 5HURA 4LH6A 4LF4B 4LF9L 2A19A 2X8KA 4XT3B 3J80L 4C43A 3KLWA 2R9AA 1STBA 1IBLL 4CBCA 3GTMH 2HIVA 4FMTA 4ULLA 2C5HA 4X1KA 4YWLA 4RG1A 4MTKA 2ZTNA 4ZQ3A 1QCEA 4NNJA 1R3LC 1JOKA 4BIOA 1UE5A 4YWKA 2E5LL 3ZUGA 3RYHA 1KZLA 3T1YQ 1HNZQ 1FGBD 1GJRA 4I4TB 2NPFA 1Q81C 1AI7A 1SYEA 4RCYA 3SYOA 1R9TB 1U0LA 3VYRA 2WA3A 5EK0A 4PV1B 2WLHA 5BMVB 1UMKA 3OMIB 2WLLA 3CRAA 3W3AA 3V96A 3CCRB 1NT2B 4DV6O 2V7QA 1TU2B 2F4VQ 3PUXA 2BF4A 3CCLA 1HA6A 3QE2A 1BQZA 5KHJA 4FWTA 1RCVD 2F93B 3ASOB 4IPHA 4EQ5A 3KDFB 2HDLA 1JJ2B 1YJ9A 3MCAA 2D0OA 4LF5Q 1N34B 5KSWB 3U6BA 1D5AA 5JWPA 3PIOA 4A5UB 1LNQA 5JPMC 1CT1D 4DW1A 2E75B 3PA1A 1QVGA 2EIKB 1FRQA 1SKQA 1MSGA 1HR0B 3K5LA 4P12A 1OCZB 1QNUA 2JEAI 4TV8A 4HE5A 1KAAA 1JQYD 1VQ4A 5FO7B 1CKMA 3BDOA 1EY0A 3EFFK 3I72A 1XMQQ 3HKCA 3A56A 3BEHA 3PIPA 3VBBA 4DNRB 4HAMA 2A74C 4NXNB 4OOVA 3I56A 2EPBA 1WORA 4IPDA 2RDHA 5DAUA 3G6EB 2WAQE 1VQKA 1WDTA 3RNUA 2E2HB 3AG3B 4N3NA 1Y14B 3QO7A 1U96A 1XB2A 2OK7A 4UCRA 1AJQA 4FDBA 3JSLA 5DM63 4AQYO 2KHIA 4JK1C 3K59A 5M5XB 2ZL7A 2Y4UA 1R4QB 3HP3A 3LDDA 2PW5A 2VWKA 1W9XA 2IBZH 4C3IB 1OXUA 1EY5A 3SK5A 4CKBA 2CUGA 2K7VA 2RNBA 1V1OA 3B4SA 1O7IA 1PNMA 4JI4B 4IOAA 2CTWA 3HOYH 2ZR2A 5AG2A 3FPUB 2DERA 1FJGQ 3T1HB 3NBHB 2EJFC 2XOKG 2MQHA 4APVA 1YIJB 3HGBA 3E5SA 4K5WA 2QR4A 3KOJA 2JA5B 2QGNA 2V1CC 2EXDA 1LTBD 4WFHA 5BR8Q 4P1VA 1VF7A 5EBWC 4DV3O 5FL7A 2Q73A 3JD0A 4OPSA 2A5HA 4GYCB 4HSVA 4JI1L 2DUDA 3CTAA 3BCFA 2QDBA 2K9PA 5G3LD 3ERQA 4WJ3M 1COWA 3RZDB 4JGSA 2F1MA 4LFBL 3IC7A 5IWAQ 3HKZE 3QOJA 5E4WC 4EB6B 5FLMH 4RLZA 3CPWU 2VY3A 3TZDA 2ZXWC 2DGYA 3ZN1A 1L8DA 2IPKD 2EYPA 4DUZQ 2BGJA 1WD0A 4JTCB 2IY5B 2WKDA 3HOVG 2I5MX 1NQTA 1XL6A 5J2TB 1PJ5A 1QILA 2EILB 3EVQA 3RFRA 4RDKA 2OT2A 3KCXA 3BCDA 3DUZA 1BO0A 3OHXC 3KBXA 3A3BA 3E35A 1YNJC 4P3IA 2UUBO 1HZCA 4FM0A 1TGOA 1E2ZA 1I18A 1NMFA 2NN4A 1UPGA 1R5BA 2YS8A 3OSOA 1V9PA 3EXAA 4JTDB 5F4JA 1RODA 3I4NG 4IUUA 4UY8C 3TZUA 3KKYA 1WTXA 5I4DA 5EC2C 1KJZA 1M1KC 1WSRA 3ML0A 4IYHA 5B1AC 2KCMA 1FS0G 4XDXA 3CCLV 1Q8KA 4F7DA 1HP8A 2L12A 2PZWA 2ZITA 2E2JB 1EFTA 3WG7C 2IJIA 3CRZA 3GTJH 5CB4A 3O9OA 1EQVA 1YJWB 5BZBA 2L1BA 1K9MW 2K1EA 4X62L 1QNMA 4Y7NB 2O5IC 1ZX3A 1R73A 5JJNB 1F9QA 1H9SB 2HCIA 1VQPA 3OYYA 5I2XA 5JH7B 1VQNA 2F0TA 4Z1MG 3MXPA 2CDYA 4RWSC 1PRTF 4DR4O 4DKAC 4F6EA 5KHIA 1W87A 2D2CB 1EFWA 1YITA 2A6EC 4KLKA 3I56V 4X1IA 5LBQA 4A3DB 1W2BA 1HNXO 2P7TC 4TQFA 1D5ZC 1V54B 1QUEA 1SBBB 1WD1A 2F0WA 4NB5A 4L8JA 4J9YB 1E3XA 2BTQB 4QJFA 4PJ0Z 3P75A 1TQOA 2ZD9A 4FZ1A 2P6JA 3PO3B 2ZM6O 3C3LA 1ZYRC 1B2TA 3BHPA 3VYUA 4TSFA 2MW2B 2ENBA 3CHBD 3RLFA 5FO8B 2PYJA 3ASPA 1K4CC 1E1RG 4GKKQ 1SN8A 4O1NA 5F4MA 3ABLC 1JA8A 3WB2A 2F0NA 4LFCB 2E8GA 5L3GA 1RM1B 1WTHD 4ILWA 3AG1B 3PENA 3QOLA 2EIJB 1HNWL 2JGUA 5IE9A 5EZYA 3T13A 1I7FA 4PG3A 3A0JA 2IX0A 3SK6A 3K9SA 3RWRD 1D5XC 4K35A 1Y8NB 2YTXA 3ZRSA 4S3SA 1QE6A 2VUMH 4A3KB 1QG7A 4UV9A 3CQZB 1MBYA 2B2VA 2UXBQ 5C0XJ 1Q82W 2AWOA 4DR6B 4PELA 4ZKIA 1PD3A 1TTTA 2E2IH 1L1OC 4H13C 1SQVH 1SZTA 3DWPA 4DR3L 1QGAA 3U2QA 3MA2B 4DR7Q 1P4MA 1PKVA 1SC5B 1TWFH 1U2RA 3OTOB 3QO2A 2EZOA 5HFLA 2F0EA 1VQ7V 4JV5Q 1SS3A 3EROA 1E43A 1VQ8A 4MHEA 1WB7A 2KUMA 3BDLA 1X59A 2Q2HA 2Q9LA 4C3JB 1J9ZA 3HFZB 4LF6L 4BS9A 5C8YB 2QM8A 5IYDO 4NB3A 2NVQB 5J9PC 1H2SB 1GVHA 4DR2O 5CBGA 4IPCA 3JARA 1H2KA 4WJ4A 3CC7V 4K6DA 1V1PA 5D3DA 3RT3C 2Q7EA 3UDFA 4MTOA 2ZTDA 2LFSA 1PH4A 3M4QA 4DAVA 3DGEA 3K7UC 1PH9A 3I4OA 2BA0A 1R3JC 4B4DA 1JWSD 2D9RA 4C3HG 4A76A 2HT1A 1P49A 4JI2L 1M4VA 4I7ZC 4NTWA 5C44H 2L6LA 3V05A 5J1ZA 1UE1A 1P7BA 2HHHQ 4Z4WA 1QCBD 3AVTA 1YVWA 1BBUA 1QBZA 1R3KC 2ZDIA 4DUYQ 3N2KA 5IT9c 4LNUB 3QFCA 4YALA 4GUNA 4A3IH 1RPOA 1N8RW 5AFWA 1JICA 4CJ1B 5B3SC 5CV6A 4LK1C 4RAIA 1O7YA 4Z4RA 1NS1A 1WI5A 4I5SA 4KXRA 4QHYA 3A2FA 4GNXC 4NXMQ 4BY1H 3NTKA 4L87A 2KCNA 2IH1C 2LSSA 1NKDA 2HLDA 5KMGA 1WJZA 5IYZA 2YXLA 2BA1A 4X3SA 3CPFA 1G8ZD 4DV7B 3VOUA 2YV5A 4IFDJ 4DO2A 1SM4A 4O4JB 2WB1B 3JD3A 1RD9D 1HA5A 4LCUC 4F7XA 5M3FG 4K8IA 4Q20A 5C4ZA 3K03A 4AF7A 1SESA 4PA7A 3T1CA 1GUTA 5LGTA 3KK7A 2GREA 3CD6V 1HFNA 3AVUA 4IIJA 2B2UC 4K8JA 1JWUD 4P6VF 4A3JG 5C93A 1US6A 4L5SA 3QJYA 1WCMB 5A9GA 3HKEB 4IJHA 4P3YA 4KY7A 3IKJA 4QQBX 4R4OA 1G91A 2QWRB 3W5HA 2JA7H 3CP2A 1Y74B 4P72A 3VR2A 3SYPA 4JI5B 1ZL8B 2R7ZH 4DV0O 3ASNC 1I4XA 3J80N 3CC2B 2LZJA 2OTLV 4YEJA 1V8QA 4A3GB 2X0KA 3BYTB 4C56C 3ZBTA 1KB9F 3R8BA 2NWGA 4GKJO 3K80C 4U3JB 5LMNL 3FB5C 1CTMA 1YJNB 4XLEA 1NJIW 2F3WA 1VQMV 1ET9A 4DW0A 1VQ6B 1I94Q 1OHHG 3KF8A 2QA4B 2L5TA 3CCVB 1XREA 2AHOB 1GVPA 4NDXA 1R3IC 5A89A 3Q4HB 3I2ZA 3QTCA 3G4SV 4RUEA 2XUMA 2GTAA 5IE8A 3GDEA 1VQ8V 1QVFB 1GK9A 2JEUA 1IBKB 4ZI7B 1OCRB 4FF3A 5DS0A 1QVGU 1P16A 1S5FD 4DNTB 1NR2A 4G1BA 3A0RA 3GV3A 5IGFA 4UP9A 3CC4A 2B3GA 2Z4IA 1ESFA 1E7ZA 2BH8A 3ITPA 1QR8A 2JS3A 3CXCU 2A7WA 4GOPA 5E3FA 1IJEA 4II3A 4RA8A 2AMCB 2KSDA 2VQFO 3A5ZB 3RYFB 4BW5A 3CW2A 1EU3A 1PFNA 3TMEA 4MTNA 1E62A 3TJTA 4X66L 1IXMA 4DV4L 2IW3A 1SMYC 1JOOA 5M5YB 5E7NA 1L2FA 5LHHA 1YEZA 1EIFA 2A6HC 3H1IH 4KN4C 4Z4YA 4ME3A 2YTVA 1LTGD 2YIBD 3U11A 3AVVA 4B08A 3ASOC 1DF4A 2UUAL 1K3RA 2JK5C 3S17B 4LUVA 1G2TA 2DQ3A 4B3SO 5TSSA 5EGTA 3LUTB 4X7CA 2E75C 5LMUB 1KC8C 4RUFA 1FPOA 2EIKC 2E74C 1K73D 1N0VC 3CKIB 1FL0A 1RJTA 3WOFA 4DV5Q 2W6JA 2OBRA 4KY6A 1S5CD 1G7CA 4LF7O 3OTFA 4AYBB 1VCIA 1WA8A 1KL9A 2WLKA 3HEJA 1IX9A 4O0AA 3VR4A 1KDCA 3SJZA 2Z6BA 4B3RB 1TWAH 4H37A 1E1QG 3ZIAG 4ZCMA 1QH0A 3J7YW 2JJ2G 4RGNA 5H9CA 4JYAL 5BN3A 2RN9A 4P71A 3AG3C 1PJ7A 3KCYA 3F7YC 5LA6B 4BBSB 1QZHA 4H0LB 3BVGA 2EX3A 2FYUH 3P26A 1NH2B 2FL4A 2P5ZX 3EVKA 3AVXA 1YSCA 4YXWG 4R7CA 4GLXA 3CAMA 4LBEC 4JI7Q 3H0GG 2R3ZA 1IBMB 3OOCA 3B2EE 1VQOV 3RLOA 3HOZH 1GRJA 2A79B 4BWAA 4KHPQ 2ZT9B 5JCOA 2R93H 5C3EH 1JJCB 2L0CA 3U9OA 2WLNA 5JJZA 1PH5A 5AN9A 1V5VA 3SJAC 3U9SA 1NR4A 2QGQA 4RD3A 1QUQB 4A3FH 1BVSA 5IYCH 3TP6A 2XAJA 3S3WA 2D0PA 2PQAA 3G48A 5DM73 1W6JA 1DTOA 4B3ML 1Q6UA 1AIPA 2QWNB 1NB9A 1B50A 1AB3A 2OTJB 1JVMA 2VQEO 1R9TH 4JZ2A 3T1YB 1HNZB 3OKXA 1KP2A 1Y1WG 3GTQB 1S5DD 3NBHA 1JMCA 4WFEA 2BDOA 1LT4D 1K8GA 3T16A 1YHBA 1N33Q 4X7FA 2R72A 3DM3A 1IBLQ 4WCEV 2Y69B 2JA6B 3HPLC 4X64L 5IT9L 1GHKA 3JSNA 3TXSA 1SRYA 3SR2C 1MSHA 2F4VB 3U4VA 1E2VA 1LTAD 2E5LQ 1LUVA 4YHHL 2HIXA 4LF5B 3UO3A 5JEAJ 4ZYSA 2B5OA 5C0XG 5DN6A 1N08A 1VQJA 3OGCC 2PTMA 2JXMB 2EOTA 3BVMA 4C2MH 3SK8A 1FFTB 4QF4A 5ITZA 4O2AA 4DV1O 1RHPA 5HFMA 1NMGA 3OEEA 3OW7A 2KG7B 3CRCA 2J7ZA 1XMQB 4RHRA 1MHWC 1WU8A 4UZUA 2KVOA 4ABMA 2E2HH 4YY3L 3E20A 2PMZB 2NN6H 3VO2A 2G5DA 1PMRA 2GJRA 2OK8A 3HB3B 2I5LX 1BE3H 3OMAB 4JI0O 4LWSB 4G28B 1MSWD 1W0KA 3I55B 3DXRA 3CCQB 1CK1A 3BJUA 3E0JA 3OW2A 1X3EA 5IYDG 3P32A 5C4JB 1YI2B 3VA5A 2O57A 3GP7A 4CC6A 1Y0YA 2WAQG 3E1YE 3FMCA 3AG4B 4B3TO 3Q8DA 4PHZA 2R9VA 1VQIA 1J8IA 3PO2B 3NSWA 4DA2A 3E0EA 3FB7C 1GD7A 3RVZA 2ZNIA 2KVMA 2F23A 3EBEA 2F1LA 4TMTA 1Y8OB 2BMWA 1WOSA 1J5EO 3AG2C 1BBXC 1FXKB 4WFAV 5CA0B 1E3ZA 1G4YB 1FJGB 2XN9C 3RMHA 5LGNA 1TWCB 3R93A 2EULA 4LF8L 5IYRA 1L0YB 4A3BB 3GTKB 1C48A 2VJJA 2D2CC 5J2UB 2WZNA 1E22A 4LF4O 4UCUA 4CJ0B 3OUSA 2B2TA 1WPXA 3Q22A 5E1AC 5BR8B 1AH9A 3FYIB 1Y76B 2ZIOA 1ONLA 5E1FA 2VJIA 4J80A 1VQGA 4LUZA 4FM2A 5L3CA 5JJJB 5KNLA 4DV6Q 4F8MA 4PDVA 4LJZC 4IFDG 2HCCA 1T5EA 4TUYB 1DARA 4D7TA 1KU9A 1OCCC 1JR9A 2CWPA 5B66Z 3E9HA 2X0LA 4JI6L 2UXCB 4DUZB 2DY7A 2CH4A 3J81c 3CCJB 3HKZG 5LXTB 1RM1C 3NR7A 4ZUIA 2AWNA 3ABMC 3BY1A 4LAAA 4KHZA 2WLIB 4JI1Q 1N32L 3RZOB 3W5OA 5KIXA 3KYHC 4LFBQ 1X3FA 1ELOA 3SPIA 1IXBA 2VZAA 5EC1C 4FO2A 1N34O 1VQ5V 2HP8A 1NBWA 2B7CA 2GVBA 1B2RA 4N8FA 5LL6S 3JQRA 2IU0A 5TY0A 1BR9A 1ORQC 3DTUB 5H59A 1Y1VB 1VQ9B 1LTID 1BXTA 4G4KA 1YXBA 3CEIA 1OXVA 3K9AA 2E2JH 3FKSG 3PA2A 4X89A 3LGJA 2ADPA 4CKCA 2KENA 4ZBMA 3ASRA 3S1QB 4PC6A 2LKVA 4AC9A 2NBFA 1IYUA 1K28D 1KK2A 4NXNO 1TVKA 3K57A 5C4XH 2AUJD 4GLAC 4JC0A 1FD7D 1F9PA 3STZC 4LR3A 4MTGA 3PUYA 5CR3A 1AVMA 1A32A 1PRTD 3I4MH 2XNAC 1PVOA 4QY7A 3T4AC 3KFUA 3SPCA 1RPRA 3CSXA 1SJHD 3KF8B 3E89A 1M4UA 1UFIA 4M8AA 4Q5VA 5LMZA 2FKXA 4ABNA 2C5BA 2XEXA 4X62Q 2F0KA 4WZLA 1LT3D 2WYRA 4JI4O 5EAYA 1SSOA 2OCHA 3CRLC 5M5WH 3F1ZA 2G38A 1RQPA 1VQFA 5DM6V 4IPGA 5GQOA 4HE6A 1Q6IA 4LBZA 5IYBH 4TSFG 4G5GA 2ZR3A 1CI3M 5C44G 1KD1C 3S14B 4DV3B 2Q6OA 3E6ZX 4KKTA 1HR0L 4IUPA 1DM0B 1SETA 5H5JA 4PMBA 2EVBA 3ZCCA 4OO1I 3Q3AA 4X20B 1SROA 1RL2A 2QWQB 4WZEA 1TWHB 1X9NA 1ZUQA 2ZTGA 1V1QA 2EIFA 2CVRA 5IT9E 1FYJA 2V4DA 3K58A 3W2EA 2HD3A 1H9JA 4NKGB 4RKLA 1WAZA 4L63B 2K52A 5JJLA 1E1OA 2EFGA 2BN4A 1XYIA 1NI8A 4GS3A 2I07B 3BABA 2F0MA 5CA3A 2UXBB 1BCPB 1II3A 3M4OB 4FFBB 3H94A 4DR7B 3ZJZA 2UUBB 2CTPA 1HNWQ 5JVG3 2QEJC 2R92B 2LO1A 1R5NA 2PW7A 2XZPA 4C3JH 3HKEA 3LQ6A 1VQBA 1A0IA 2G9DA 1JOYA 2QTLA 1OGIA 4HBNA 4JTAB 4U7OA 4B3XA 5JJIA 4P2NA 3T1HL 4DAMA 1JORA 1MABA 5CMDA 4H9GA 1HZBA 3S1MH 5LP6B 1G7RA 2BOBC 1G6PA 3F8TA 4X65L 2JA8G 3S2HB 1QUFA 2KB1A 2JIZA 1A8PA 1D7QA 2FINB 4X06A 1XNRO 4X07A 3TDQA 4TMXA 3NQIA 3DLLA 2Z8LA 2PF4E 3GWKC 3CCSB 3G80A 5M3MB 1KYOF 4LF6Q 2ZBUA 3ZRWA 2RBMA 3ND8A 4BA1I 3JQPA 1A8VA 3TP5A 4GLVB 1EN4A 2HHHB 4NKLA 1S5ED 1RDPD 1I6VC 2RCVA 4RKBA 4DUYB 1ZWIC 1PFBA 2Z6KA 4GNXA 4X1KB 4Y9RA 1NZ6A 1OCRC 3TK1A 1K92A 1JJ2U 1HNXB 3K81C 3BNWA 4ZGNB 3OFNG 3DXJC 1YNJD 3F5TA 2WA4A 2WACA 1XMOQ 3RYHB 4FLXA 1TUIA 3JAWB 1QNKA 2UXDL 4NXMB 2HLDG 5IWAL 3CCUV 4JI2Q 3SR1A 3LX0A 3FD9A 3BZKA 5B1BB 5JOBA 1JPXA 3SEBA 4H44B 1TVCA 5I9PA 2R6GA 3C90A 2IM9A 3B8MA 2DYRB 1VLYA 2QDXA 2WLLB 3ER0A 1D2BA 1ZLZA 2CHBD 3CCLB 4BY7B 3P20A 5JEAG 2Q7GA 2ZE5A 3WNBA 4B48A 1KMHA 4EQOA 1QFZA 4YAUA 1F2MA 3HOWB 4P2CB 4CH5A 1IKLA 1YJ9B 4LFCO 2M2LA 1H95A 3MFGA 1VF5B 2XWBB 4BBRB 3CB4A 2F95B 3DWQA 1QVGB 1VP7A 1N9WA 1ESRA 4TV8B 1VQ4B 1PYWD 1STYA 1B8AA 2SOBA 4IZ8A 2BDNA 2MJ8A 3ASTA 3J81L 3T4ZA 3KEWA 5K1XA 2IH3C 4KTAA 1S5JA 1SDFA 1M90D 4P26A 4DR6O 1SRUA 3HKCB 1SE4A 1Z47A 2ZXPA 2EBOA 2ZIMA 3SLDA 1LTRD 2NZOA 3I56B 2KQXA 5EPLA 3OTOO 1VQKB 4XKVA 1OB5A 2NV4A 2X6AA 1Q81W 3H01A 2N3SA 2WJYA 1BF4A 4RO2A 5KW9A 4XN0A 2BOSA 1D5MC 2WAQB 3JASA 1GO3E 1GMGA 5CN0A 3BQJA 4JBKA 4H0LC 3WFVA 4RHSA 4N3GA 2NNUA 2PZTA 5IT9N 4FVMA 2IJ0A 4J7ZA 2QGGA 2ZL6A 4X9QA 1STNA 1XNQL 4DAYA 3S2DB 4X7EA 1AE3A 4DR1O 5LA6A 2WSSA 5LMNQ 1KECA 4LH7A 4NVPA 5EKIA 4TVAB 2LFNA 3R66A 5F2VO 4OONA 1WTPA 1STAA 1O7ZA 3CMEA 2XAQA 1KP3A 3TREA 4JASA 1EY9A 3SYAA 2E3CA 3ZHSA 1TWGH 1VQLA 1GO2A 3CCEA 1S4ZA 4K8ZA 2BE3A 3FJOA 3WQZA 1CQFA 3LWUA 3ABTA 4RQEA 3HKBA 1BDOA 3QNEA 1WTWA 1NCVA 1R5OA 3G6JB 3LDEA 1LO5D 2JEBI 1GH6A 3MHBA 2PPBC 2L4NA 1TA8A 5IYCG 1ENCA 3STBD 3WBJA 1EWHA 4ZRZA 4KJOA 5GW7A 2QM7A 1RSOA 3DDYA 1NDHA 2Y69C 1EFCA 3HOVH 1W34A 1S3OA 3QIAA 2FX3A 1PA6A 1JCHA 4DV7O 3E83A 3CE2A 2CE4A 2AZ2A 1ZM2A 1CZGA 3OGIB 3BY2A 3NXSA 2CBXA 3U50C 2XRQD 4HJ7A 2LGQA 2KBNA 2RC5A 3LSUA 4B3GA 5L3FA 4PQXA 2KCTA 4DV4Q 2XHBA 1SQGA 3Q6RA 1SZXA 4JCVE 4X88A 4EFBA 5EBMC 3I4NH 1I50B 3BVZA 4NR1A 1FNVA 4PZ6A 3S1RB 2CNDA 4RPBA 3O13A 5D5PA 5IJ0A 1B9NA 5FK9C 2RQ6A 4DV0B 4JI5O 5LMNW 3H9VA 2M5SA 4O2DA 1AJPA 3K04A 1GM9A 1Y0RA 1CKNA 2OF1A 2GDSA 3TN2A 1TAEA 4R8IA 3X2QB 4P2ZA 2FHTA 4XD7A 3FB6C 4BBSH 1QR9A 4UUJC 3SJQC 5CB4B 1N06A 1S72A 4JG2A 5CBEE 4HEDA 3UT5A 3I73A 1JB3A 1PKXA 4YY3O 4V190 2BSAA 1IZ6A 4GKJB 1UAPA 3J7ZC 4FLVA 2I46A 4PMCA 1M8AA 3ETQA 1VQPB 3GQBA 4P25A 3SK4A 4JI7B 4DYLA 3CCQA 4JYBA 1VQNB 4J7KA 2VNKA 2I5HA 1KBHA 3S1NB 3ABKB 1T6YA 4KHPB 4RCNA 5FO9B 2K33A 3DMUA 2RDFA 1QU7A 4JYAQ 1SA0A 1YITB 1FXKC 1CPYA 4C3IG 3AMUA 1W2BB 3D4WA 3PQIA 4ZV4A 1EWCA 2VQFQ 2GN5A 1K73C 2NVYH 3K0GA 1EXMA 4QIWB 3JAME 1DOMA 1TS4A 1KHIA 3H9NA 5CC4A 3JCUZ 4EKWA 3K5NA 2BM0A 4RGMA 4K0KB 1V55B 4QJFB 5EJWA 2C4TA 4UZEA 3NUCA 4I50A 1VQEA 1EYDA 1PTOB 3ZBHA 2F0VA 3OMNB 1J6QA 1M1KW 2Y48A 2EYFA 4LF9B 2F52A 4A3MB 5FPOA 4JMQA 1XILA 4MS2A 2D9UA 5CGKA 5LGUA 4Z4TA 2JA5G 2B63B 3PVDA 2X6BA 3D26A 1VHEA 3OAAG 1IBLB 1JQ0A 4DRXA 3FDTA 4N21A 2HQEA 3MFYA 1N0UA 3PUZA 2OIGA 5IGDA 2JJ1G 2N55A 4B3MQ 1VQDA 5LL6Y 2YU9B 2VS0A 4DK6C 5D5QA 1QJOA 1UJWB 3NENA 2UUCL 3IC9A 5EZYB 2J4XA 2JDIA 4A3EB 3OE7A 3LDCA 2CH7A 4E0FA 1MRZA 4H02A 2ES2A 4PC1A 5EYPB 1NUCA 3BYYB 4KKUA 2XNDA 1RKNA 1A15A 4UPAA 4X64Q 4G7ZC 3Q0AA 1F2YA 5A2QL 3FPKA 2K5DA 4HIOA 1GO3F 4B3SB 3ICXA 1ILQA 3CCRV 2BE5D 4YHHQ 5LMUO 2KKWA 1DJRD 3J81E 2WLMA 4NCNA 1EZJA 4AIMA 3ETDA 1PPJH 1DONA 1Q46A 3ND9A 1MG1A 1VQ8B 2C35B 1OXXK 3GTPB 2Y0PA 5IGBA 1ZTEA 4UVBA 4JPBW 3ZHRA 1SFOB 3F2UA 1IBKL 4B3RO 2EY2A 4B44A 3JARB 1D6EC 1N36L 1I94L 4MVRA 1EQTA 1V1PB 1CSQA 2A68C 1MJEA 4XN3A 3JAMi 3Q6SA 4QNHB 2OEOA 1V0EA 3I91A 2JA8B 2GTSA 3I1FA 1X56A 4HIZA 1IW7D 2X6GA 1Q82C 4C3HH 1TWCH 4PC7A 1Y6XA 4FF4A 5KHGA 2K05A 3GTKH 1PH8A 4XQQA 4YIPA 1HTPA 3APOA 4I7AA 4M1KA 4DF7A 3ABUA 4BXXG 3ZHUA 5HKKA 4DV2L 4ZCKA 3SDZA 3H1KH 3CMMA 5T1GA 4MIUA 3MXGA 3N2KB 3E3XA 2HDMA 4H33A 4YHBA 3OWEB 3QVNA 1S72V 4XIGS 1AMOA 5KNCA 2K75A 3KJPA 3VR5A 1DLBA 2N74A 4A3DG 2LS01 1JOQA 3D8CA 1FAFA 2D3NA 2F0FA 5TV2A 4ZKBB 2B2WC 4PI0A 1OXTA 2OYNA 3HKDA 5KMGB 5IYZB 2RHSB 3T1YO 1HNZO 1XDCA 3PO3G 3U0ZA 2Y0SE 2PUSA 5M3FH 1GJXA 5EBCA 4FF1A 1KLUD 2PGGA 4HNAA 4UAJA 4X3UA 4UFZA 3FKIB 4JBJA 3MXNA 2DN8A 5IYBG 4HSPA 1VF6C 1FXHA 4JI3Q 2F0OA 1UE6A 3ETGA 2W6IG 1PNKA 4A3JH 4ASUA 1KIXA 2F4VO 4JI1B 4IIJB 2DYSB 4X20A 1Z6HA 4LFBB 1EWYA 2IW5A 1JE4A 4UDUC 2EYHA 4LF5O 3QF7A 1P84F 1Y1VH 3GO5A 1BCPC 2ICEC 2RSOA 5L3EA 4TQDA 4A3KG 3ES9A 4HYOA 1FX0A 3IFTA 3GVKA 1HUNA 2NYZD 2R70A 3S1QH 2PO4A 4RGTA 2UU9L 2AQ1B 1HQRD 1N32Q 4UCOA 4FYDA 2BH2A 4GX1A 1XMQO 4XR6A 3IAYA 2EINB 1K0SA 4KL1A 3BFRA 5D14A 4JAUA 4RCOA 1QVFU 4AF6A 1GM7A 5KAIZ 2Q6AA 3SGIA 2F0LA 4KJNA 3MZ5A 3FP9A 4PI2A 2J7KA 1PM9A 1SNQA 1TKWB 1DYQA 1Q12A 3M3YB 1XJVA 1NU1H 4C3JG 3T4DA 1ZKOA 5KHKA 1AJNA 3M9BA 2XT9A 4ME5A 3PUWA 5LOVA 4O2BB 4UHVA 3SHLA 1MMMA 3ZHVA 3K08A 1BL8A 2BCOA 1UD2A 4IFDI 2IU3A 1QX4A 5K36G 5IYNA 3NTHA 2P5OA 4YJ2A 4X62B 5H5NA 1EEID 1KDBA 5CORA 1YJWV 1BHBA 4U7NA 2K32A 3GTLB 4R8NA 1NSNS 3GTMB 1FJGO 4OIKA 4LWCA 1E1TA 1CUKA 2HG5C 4X1YB 2P3MA 1X3PA 2QWPB 1H2NA 1FFXA 3MXUA 1N33L 5C6AA 5CYUA 4GOPB 2QM4A 4LFAL 3J81N 2DE0X 1UD8A 4G27B 5BR8O 1SAPA 4HTHA 4P22A 1AILA 5BSYA 2ZE6A 3KG2A 3A35A 1E63A 3B6YA 2XASA 1RP3B 2E2DC 2D3LA 1R6KA 4H44C 4FK5C 5EKLA 1U4MA 4DR5L 3JAWA 1G7SA 1MKHA 2DYRC 2A73B 2FMLA 2C5CA 4ZCLA 2ID0A 1N34Q 4B9XA 3ASQA 4NMZA 3K5OA 2LMCB 3LVBA 1K34A 2DN9A 2UXCO 2WB1G 3PIO3 4A4IA 4DUZO 1PRTC 2FJ2A 1HR0Q 3F2DA 4OX9L 2BPOA 2AQ3B 2XGTA 4RPDA 3N2GA 3EJIA 3C3SA 1VF5C 1VMCA 2XGJA 2QTOA 2KOLA 4MTFA 1HNWB 1WCMG 1L1FA 1H42A 2K04A 2K5NA 3PIP3 2SEBD 1WA8B 3C1EA 2OYQA 2K01A 3F2BA 1A3UA 3VR6A 1LYLA 1EBOA 4NXNQ 3OJWA 2GV9A 2BM1A 4Z4ZA 1U9RA 3W7WA 2HQLA 2Q4PA 2QE7G 3D6WA 3STLC 1KRSA 1IYVA 1MABG 3NWTA 4MVUA 1ASZA 2ZZFA 3HZXA 4JI8L 2ILMA 4DR3B 1Q86D 4OL7A 1Y4MA 4A3GG 3H3VI 1IB0A 2YEVB 1EUJA 2RHQB 4OELB 1BGYH 3TXQA 5M3MH 3H0GH 1OXSC 2RDCA 2ZE8A 3PJSK 2B1GA 1XBLA 1O7LA 2JS5A 4FLZA 1K5SA 4LF6B 3DSQA 1ZM3A 1KRHA 3T1HQ 1MA1A 3UDXA 1FDRA 1PV4A 3F2CA 1NAPA 2G9HD 3HOYB 1JJGA 2XOKA 3A5UA 1FD9A 4XNFA 3AK1A 4X65Q 3OP1A 3WB1A 3MEHA 4IURA 1EP1B 1KC8W 1XTCD 2PQAB 2PZUA 1HR0W 1FNBA 4UXNA 1R6NA 1NVPB 2B7BA 4DV6L 1Y1WH 1XHXA 3OEHG 4CHTB 4K1XA 2YWEA 1VQAA 2F4NA 1X65A 2QKAA 4ZUJA 4JI2B 1SQQH 1GUOA 1BCPF 2XNJA 2ZJRA 4RAUC 4FF2A 2BSKA 1FVIA 1K33A 4G6IA 4CZZA 1EQQA 3LSSA 1SJED 4ZCIA 2MPMA 4GKKO 2YWHA 2CFMA 2Q0OC 3KUPA 1GUSA 4BBRH 1C0AA 2MK3A 2UXDQ 1PHJA 5C0XH 1QWYA 3MEFA 3SJCC 3T51B 1KQSB 1UEAB 3TRZA 3R65A 2EQSA 4YCWA 2MP1A 1VQ7A 4Y9UA 4P9OA 4TV9B 3OM3B 3QWNA 5ITZB 2QWOB 2OWOA 1DK1A 4O2AB 1NTKH 2V7UA 2Q8TA 1AROP 5L3BA 1SQPH 2QEXA 1PH1A 4K2KA 4WZTA 2UXBO 3ZX6A 2QDOA 5JVDA 4AQYL 3CC7A 1PV0A 5J3BA 3SPJA 4DR7O 3K6OA 3K79A 4OO1G 1TUBB 1DD2A 1Q8IA 4JV5O 2JP1A 1WN7A 4AYBG 3GTOH 3NTIA 4XYOA 2ZL5A 5ELFA 5IYDH 4G7WA 1JC7A 3DXRB 3HOXB 3OW2B 1VMGA 2WPDG 3MMPA 1P8LA 3X2QC 1AFPA 3GTJB 4P9SA 2EYOA 2ZBVA 2ZINA 3TQYA 3Q38A 4XQFA 1K8AD 3OIPA 2ASBA 3F5WC 4ACBA 1KD1D 2CTRA 1CFMA 3CC2V 2RKSA 1YCIA 4A3CG 3ZMUA 4Z1MA 3UKMA 1A63A 3N6RA 3CCMV 4ODGA 2I0QA 4BBSG 2EXZA 1XNRB 4DV3L 4RFBA 1X55A 4I0XA 2GK7A 3L9AX 3ABKC 1HA3A 5LMNB 4Z1VA 4JOIA 4GZYC 4O4LA 4UV8A 5E6TA 4JBMA 2RCNA 4CS3A 3J81k 4N23A 1YJNV 5BXZA 4QIWE 2HHHO 1EIYB 4HJ8A 1M90C 1U4LA 1VQ6V 4DUYO 3P7JA 2QA4V 3CCVV 3B78A 4C1NK 3H3VC 5B5EZ 4TMZA 1XNQQ 1I5YA 4CDFC 4IFDH 1GUGA 3J80E 3MDSA 4Z4UA 4A93B 4XDKA 5THXA 3CD6A 1E1RA 1I4GA 1K4DC 3UI2A 4NXMO 1JMKC 3BS1A 4DK1A 3DC6A 3HOUG 3NBIA 1T9HA 5KUKA 3RR5A 2RCFA 2DWEC 4RJLA 1AP0A 4PZ7A 1WTVA 2HVJC 2JA6G 3JQQA 2B5UA 1EY8A 2Z9HA 4RM0A 4IO9A 1QHTA 4L5RC 4CS4A 3TP8A 2YSUB 2NTSA 1CXZB 2VUMB 2CK3G 3KJOA 4X66B 2OTLA 1D5NA 4DV4B 5FA6A 2FMMA 1SQXH 3S1RH 3D36C 1THZA 2Q2IA 2OBSA 3OTOQ 2B2VC 4XBFA 2E2IB 3PUVA 5EYPA 2AHYA 4FXGC 2ICIA 1ENVA 3ZRXA 4HMIA 1TWFB 1I3QB 4OEMB 4IN3A 2UUAB 1NNXA 2PCFB 1VQMA 2KA7A 4V0BA 3CPWA 4UB6Z 3OD4A 1K3BC 1SYFA 1U4RA 3DWAA 4DR4L 1D1KA 3K8AA 2VNIA 5D65A 1TVKB 4G7OC 2QF7A 3STBC 3G4SA 1H9KA 4CDCC 1SXTA 2K6AA 2YIBA 1TXYA 2ZZQA 3UE0A 1PH7A 1HHVA 1OCOB 3CCUB 3C2PA 1B04A 1PH2A 2BVNA 2IJJA 2QEXV 3I4LA 4RD1A 4J9ZB 4B3FX 1MJCA 4HIMA 3S24A 1F7YA 1I94O 4X05A 3PO2G 3ETEA 2ZM6L 3B8HA 4JYAB 3J80i 3SLNA 2EZVA 2EJ7A 2DWDC 2AKWB 4DR1B 4EFEA 2ZNJA 1ZM9A 1FNDA 1EZ8A 1XMOL 2ZDIC 2KHSA 3P3NA 4A3IB 5IIFA 4I9WA 4DN4M 4YJ3B 4A3BG 4GX5A 3ABLB 3KLSX 3FAVA 1RF2D 4OPHA 3MWYW 1YLOA 2JEXA 1SNPA 1K3EA 4BY1B 1WNSA 2IX3A 3R6KA 2EE1A 1MSDA 1I5XA 2YU9H 1NTGA 4WBNB 2N05A 1CNEA 1UD5A 1SEBD 4HZ3A 4YCVA 2Z0AA 3TEHB 4A3EH 4ID6A 4XM3A 2AGAA 4CS2A 4HJ5A 5KNBA 4YAWA 2LXJA 1E2WA 2XNCA 1OZ0A 2N78A 1S0UA 2OTJV 3B09A 4GN5A 2BGIA 1WLEA 4O4IA 2WINB 1URFA 4JYCA 2HEPA 2JGDA 3QR8A 3ZHQA 1PYBA 4MVQA 1B6QA 1YX2A 2DYSC 4X64B 4JI5Q 5HZAA 1B7YB 3R3OA 5GV7A 4PA4A 1CEZA 3OZVA 1I8DA 2JA7B 4XYQA 4OP7A 1I6HH 3ZZ0A 4DR2L 5KGUA 3PMFA 1NH2D 3DEPA 5C3XA 4QL5A 1HZEA 2R7ZB 2UUCQ 4YHHB 4ZHQA 3OWFA 4EQPA 3WWVA 4DV5O 2DYIA 2O4XA 1H9MA 1PYSB 3ONAB 3A8TA 4RQFA 2CKZB 1Y1VG 3QB3A 1DOLA 3G6BA 4PNYA 3VMFA 1F77A 2YUAA 1VQOA 1LUWA 4CGYB 4QIWF 2JA8H 3NWSA 3TETA 4QCLA 3JD2A 2PY5A 3W5VA 3CPXA 3S15B 1MGSA 4YY3B 1HPCA 1PTOF 2ZE7A 1EOTA 4ZKCB 1LTSD 1FNMA 4WFBV 5JJKA 4QB4A 5LL6X 3JAKB 1XFOA 4L5TA 1GTOA 1R4PB 5ELOA 2KCCA 4C7UA 4DFAA 3ZRWB 3MTSA 4JI7O 1IBKQ 3I55V 1N36Q 4KHPO 1FNWA 3E22A 3ICEA 4O2BA 2YC0A 3W2GA 1OB2A 5CDFA 3ZMSA 2PIAA 4GNXB 4IYIA 2B2WA 3TS2A 4K14A 3AG7A 4LC0A 1I4QA 2BE5C 2VBTA 3QFTA 2ZTCA 5C3WA 2Z3YA 1PL0A 2XTAA 1OB0A 1K83H 1GOZA 1N07A 4LUOA 2P06A 1FXVA 1S77D 2WJVA 3TGUH 4LBWA 1IYJB 4K0KO 2ZXRA 4GOPC 4J7JA 4LF8B 1BKBA 1Q9SA 3JC66 4DV2Q 1Q43A 4LF9O 4BPRA 4X1YA 3ZZUA 3CW2C 1N33O 4IHJA 3ONYA 5JEAH 1KRTA 3WY9A 1IBLO 1WPCA 1X54A 2PZSA 1QLNA 3A54A 3CYOA 1GN4A 5JAVA 1TY2A 5IY5B 1IW7C 1BBWA 3M4PA 2E5LO 3ASNB 2Q5ZA 3H1HH 1EM1A 3B8NA 4PV1C 3TCUA 3NE5B 2XVSA 5KRUA 2E1BA 4JI6B 5IYWA 2IJHA 5CBHA 2K5QA 3SYQA 4MN3A 3L0OA 3CCJV 2H3OA 4CH3A 1QGYA 3GTGB 1EFUA 1N32B 3M99B 2ZZGA 1F2ZA 2IL8A 1ZSPA 3ULLA 4R4IA 2ZXOA 1E1QA 5K5PA 1KKCA 5IJ9A 2HVKC 1BOSA 1TWAB 2DJFC 4Y52H 2O2LD 1OCZC 2R92G 4IT5A 1HCZA 1PDQA 2VWJA 2JJ2A 4GN4B 4QE9A 4TN1A 1F51A 3FX7A 3EQLC 1PZJD 4BIZA 4ALPA 1UUPA 4HN7A 1K9MD 1YTFB 4H7BA 3JASB 1BHAA 2UU9Q 2D3OW 4YXWA 1VQ9V 1IBMQ 2R6HA 2IT1A 3TS0A 2DOSA 2F3IA 1YVCA 2OT5A 2XAGA 4HMJA 3RUZA 4Q0FA 1UEBA 1H9RA 2Q0AA 5COYA 3RN2A 4QVAA 3HOZB 4DAYB 5FJ8G 2YEVA 4B9WA 3GTLH 2VQFL 2R93B 5C3EB 3EFXD 5JCOC 3WBKA 3IGAC 3PF4A 2ATWA 1A3VA 5M3MG 3CMEB 4A3FB 1B1ZA 5JQGB 5IDJA 3QFSA 3CMAA 1LTTD 4DK0A 4POGA 1VQLB 3CCEB 3MHSC 1K28A 2M7WA 5KA6A 2VNHA 3HKBB 4LBVA 4KV6A 1SNCA 4QUCA 5DEDA 4JW0A 1XI1A 2WR8A 4KKSA 4RDLA 4X3TA 1OO9B 1JX9A 1JNYA 2C2WA 3ZMVA 1PLFA 2PI2E 3K06A 4TOIA 4B3SL 1ILPA 2OCCB 1RSOB 3W7UA 1E64A 5FO0A 3FRPB 4MZ9A 3SXHA 1UD4A 5JJEB 1VQ5A 4Q7JB 3E8HA 3HOUB 4LF7L 2PI2A 4LFAQ 1HXYD 1ICFB 1XEQA 2E74B 4XLAA 1I08A 1CKOA 2V7QG 3AU7A 1IZ3A 4BY7G 2ZXHA 2F4IA 2A68D 3BA9A 3HOWG 3CRRA 2JJQA 1WYDA 3M7GA 4C2MB 4JI1O 4FXDA 1LV9A 2FB5A 2WWWA 3CXCA 4K8XA 4DR5Q 3RN5A 3PUMA 4LFBO 2RDGA 1A2TA 3IFXA 5CV8A 1Q82D 1QGZA 3CXHF 2V7VA 4UZFA 1PP9H 3GV6A 4BBRG 1W59A 1KQSA 1BNZA 3SKBA 1YNXA 4ZAIA 5IK2A 1CA6A 5IJ0B 5KAFZ 2P90A 5E79Z 2EILC 4TV9A 4CKEA 1ZAUA 4OX9Q 4PAAA 3O65A 1A6XA 1D8TA 1CKNB 4I55B 1NTMH 1CNFA 2Q6IA 5J35A 1W2BU 3SVMA 1QOHA 2BV3A 1S72B 4M1UB 3UT5B 5KA5A 2Z5UA 5M9OA 2RC6A 4NP5A 1N05A 3G71A 1TUBA 4EEQA 4P9PA 1WB8A 4FLYA 1NBMA 1EYGA 3OR7C 1MZFA 2OIEA 2VQEL 5M5XH 3U6KA 4AILC 2Z1CA 3EN2A 4JI8Q 1XXGA 4P75A 2NUCA 3SPHA 4C3IH 2NVTB 1SA0B 3L3OC 3WYAA 3JCZA 4X65B 2SNSA 1UD6A 4PA6A 2VNJA 2A9HA 5C5LA 2XTIA 1Y69U 3K3WA 4FJCC 5J39A 4X62O 2BCCH 1KNAA 4I50B 2B2TC 1N8RD 1XQBA 2GJPA 1M57B 2JA5H 1PFSA 3CCSV 4OWXB 2ITDC 1BCPD 1E3PA 3OUFA 1KK0A 1ZUNB 5FO1A 4II2A 3OR6C 4HCEA 4D7SA 2GK6A 4DRXB 1MI2A 5KNDA 5FL7G 1V54C 1EZVH 1VIBA 2UXCQ 4FPPA 1Q86C 3VNUA 3A74A 2AHZA 4JI3L 5EIBD 5A8AA 4DV1L 3RZDH 3AGPA 4DGZA 1GAWA 1COWG 2Y0IA 2PE3A 1GKFA 2UXDB 4JBWA 3LO8A 5IWAB 4AI8A 2CH7B 3CMAV 1S5BD 5GROA 1SE3A 1CP9A 1EY4A 2IWHA 3AFPA 5B1OA 2C4UA 2GQFA 1A3TA 2P22C 4JI0L 3OJXA 1I4RA 4QVJA 1L0NH 1JT8A 1BQEA 1JFFA 3AG1C 3V76A 5CA1A 4DQLA 2EIJC 4MSWC 3RYIA 1K73W 1NRKA 3BU2A 1QB5D 4PDMA 1GN2A 5IP9G 4B3TL 4K5VA 3FKSA 1XQ8A 3HOXH 1S76D 1WVLA 2M9VA 1YJ9V 4KY5A 1HNWO 1DOKA 3ZRVA 3PUNA 3GSIA 2NR5A 5CV4A 1J5EL 4W4LA 1W0JA 1EP3B 2LXKA 1Z9FA 1LACA 1SYBA 4R8CA 2PLFA 4F6RB 1VQ4V 2KECA 5C4XB 1STHA 1AR1B 4MNOA 1YZ6A 4DNIA 4AQYQ 3AG2B 3M8AA 4EVOA 1F20A 4N8X1 4LF4L 1NJID 4DR3O 5J3OA 1Q3EA 4K5XA 4Y7NH 1FNCA 1EY7A 1YF2A 1OCOC 3ZC3A 5A88A 1RIPA 5BSXA 1SQFA 3Q6QA 4BW9A 1AI6A 1QG0A 5A35A 3I4MB 3UM7A 1XX8A 2QKIC 3RY8A 3JALA 4PDLA 1VQKV 1H2MA 4BXXH 4Z4SA 2GUZA 4TQUS 2PYLA 2ATKC 4FNFA 2NZ1D 1HRJA 3CCUA 2TMPA 4LF6O 1CQVA 2GJKA 5KEEA 2A3QA 1UD3A 4WRDA 2Q67A 2VNUD 4O4HA 2H5XA 1F9SA 2F0PA 4A3DH 3RN4A 3DC5A 5M5WB 4RCZA 1GM5A 4A93H 2C2AA 3SPGA 2F03A 1KK1A 3G71V 3JATA 2CF4A 4DV3Q 1XNQB 3FPPA 3OZWA 3L71H 3AVWA 1H85A 1OCCB 3BG3A 2LW1A 1OJHA 4KUMA 2O5JC 1XMOO 3BZCA 3HKDB 3PO3H 4PC2A 1DDIA 1TS5A 4FXKC 3J81j 3ABMB 4JI2O 4IGGA 4A3MG 4YJ3A 1N34L 4RD2A 3N52A 5HY6A 3GWOA 1K8AC 2B63G 4HNAB 3MXNB 3CJHA 4FM1A 3FHWA 5EBLC 3PV0A 2X3UA 3CRQA 2X85A 4BWGB 1OTCA 4WBNA 4UVCA 3I90A 3ERSX 4FFKA 4GKKB 3D36A 1VDZA 2R7DA 2VYQA 2Y0SB 3VR3A 2B2YC 4R4TA 4R1JA 2L15A 1SYCA 4A3EG 3ZJYC 1Q7YC 3W7TA 3S3XA 2PI5A 3WNDA 1I3QH 2UUBQ 3DM1A 2JN9A 4A3KH 2C9OA 4C1NI 4NXNL 4IL6Z 3CQZH 1BSMA 1L1OA 4QUZA 5CV7A 3RLNA 1U5KA 4KI0A 3CRKC 5LYJB 4GCZA 5FOBB 3IFDA 2Q2TA 2YXHA 1K7DA 2TSSA 2Q8RE 5IP7G 2DNCA 2NB0A 4FP5D 1W6KA 1SNMA 2CC2A 4G2KA 5H2FZ 1EEFD 2HFEC 2WFWA 2WZPP 1SMXA 4PD4F 2F43A 1XL4A 5NUCA 1X3GA 2K1BA 4E4EA 3L73H 4JV5B 4XOTA 3PF5A 1LLRD 2CW5A 2RVLA 3I70A 4XOPA 4P74A 3S1MB 3H1JH 2NVQH 4IUTA 4CH6A 4IUVA 5KYIA 3OZUA 4CC5A 3R6JA 4JI4L 1EN5A 4J42A 5LOVB 4X8AA 1IHZA 1XWEA 1BMFA 4Z9CB 4TT3A 2V31A 5IODA 2EIXA 5K36H 3UE1A 4DR4Q 3B77A 1FNUA 2K4KA 3FVQA 4FIPC 2WV6D 4YJ2B 3CB2A 4GQNA 4ZIBA 5EPJA 1HNXQ 3JAKA 4MVOA 5LMNO 3A7AB 4I65A 1VARA 3OFNA 3J7AF 1G8MA 2Z6KC 1VQPV 2JVDA 1FFXB 2N49A 4X0CA 4UB8Z 1VQNV 1GAQA 2MO1A 1AN8A 2ZM6Q 2CTQA 3KLRA 2X6CA 5FNVA 1MNGA 4J15A 2JE6I 1YITV 5ELCA 2AW9A 4LC1A 1WTRA 4DPGA 2Q8IB 2WLJA 4L6TB 3HAGA 3A0HZ 3M85A 1F60A 3GIRA 4Y7CA 3ZYYX 1KABA 3HG9A 3CESA 2EY6A 2NN6I 3CP0A 2Y4TA 2DJVA 4PA3A 4DXWA 3EA6A 3FFQA 1X6OA 3FKIG 3WB0A 4BR6A 5IY5C 2B2UA 2F3VA 1CZWA 1WFQA 1EYAA 2L55A 3N2GB 3D6CA 4QE7A 3W5UA 1WCMH 4AH6A 3EIVA 1D1NA 5GONA 2UUCB 1X4TA 1Q5OA 2LW7A 1VS0A 3ZEDA 4X66O 3CCMB 4DV4O 2EY5A 2XWJB 2OBTA 3B82A 1WTQA 4HIDA 2KJXA 2K5VA 1Z5WA 1XNRL 2DIEA 1WOPA 1TS2A 1DZ1A 2UXNA 2R7FA 2F0JA 2CW0D 1YHQA 3ZHTA 1JE5A 2UUAO 3W2DA 2EDGA 3K0YA 4A3GH 4HAEA 4DR2Q 3S15H 4W4KA 2EYJA 4A3LG 1IURA 2OQ0A 2QCPX 1E24A 1PTOD 3AB9A 2MGSA 1SNDA 2NVXB 3OMGA 3SYCA 2QMUA 1FR3A 3D4RA 3QG5A 4X8IA 3KF6A 4NYKA 3MHHC 1IHMA 2A8VA 4U673 3BZDB 5JVH3 2Q6LA 1N36B 2BOCC 1I94B 2QKCA 3ZMTA 3BH4A 4KFMA 3RYCA 2PI4A 1S4MA 3UDGA 2MO0A 1PJ6A 4OWTB 4HJAA 4JYAO 5AJ3L 2JA9A 2OXPA 5ELBA 1WOOA 2F0SA 3H6MA 1TWGB 1CA5A 4PA9A 1G291 3D31A 1KK3A 1KQSU 4JF3A 2ZT9C 5DECA 1BX0A 1S0VA 5FLXc 3D3QA 1EN6A 4LFCL 4UCVA 5JQGA 3THOA 3I7FA 4DV2B 3L75H 5HGQA 1DGSA 2K5WA 4JYYA 2BSKB 4FLUA 1YNND 5EQ0A 3BRCA 1BQQT 4I4TA 2VRZA 1FGUA 1TY0A 3H09A 2XRSD 1PH6A 3E8FA 4KMUC 3HOVB 2OCCC 3I5DA 4X6AH 1STGA 2NZHA 1BPLA 3CU7A 5BMVA 4B3MO 5M5YH 3CCRA 1XUQA 4LBYA 4DR6L 2P4VA 2PQEA 2A0LA 4B47A 2PYKA 1BCCH 1VQ7B 3OW2U 3AK2A 5I9OA 2Q2UA 1RTNA 1TLLA 3AFQA 3KDFA 3C1FA 2Z4HA 1JJ2A 3OTOL 2DETA 5EMNA 3K5MA 5B6IA 2QDLA 3M7NA 3S17H 1H2LA 3GTGH 5ELNA 4YIJA 3S16B 2WP8J 3NP8A 1J9OA 4RH6A 4X64O 2QEXB 4DV0Q 3W2IA 2WKCA 4Z2WA 3I4NB 4U3FH 5JVDB 3FYEB 4DXFA 3CC7B 4OO1H 3VA7A 2X7RB 3L72H 4JZGA 4TRDA 2W6JG 4LW1A 4YHHO 1SNOA 4DV5B 3JD1A 1AP5A 1H38A 4M4SA 4GKJQ 4DR1L 3CX5F 1SKYB 2X6YA 1O80A 3G6EA 4MYUA 4Q6GA 4CDDC 2EJRA 2UU9B 1FRNA 4A3CH 4I55A 3Q39A 1CHQD 4D6TH 2RQXA 3MVVA 1B3QA 2GSMB 1Q90A 2EJMA 1IL2A 1GN6A 4J11A 2YIDA 4QMGA 3H1LH 4I0XB 3RVYA 2ARHA 1HJPA 1M9NA 4OGQB 4YAFA 2H4OA 4QV2A 5IGCA 3WXMA 4O4LB 4P73A 3UDIA 4X7DA 3AEVA 3AG4C 4NTXA 1YHQV 1G2SA 1S40A 5L3DA 4K0KQ 3SE0A 4PGOA 2NVYB 3IRBA 3N27A 4XDJA 3J7AU 3HOYG 5CMUA 1Z2GA 1YIJA 4LF9Q 1EQRA 2F0HA 4K2LA 1NTZH 3A3GA 1Z7TA 4N9TA 5I2YA 4DV7L 5TISZ 3V2TA 1LT5D 4GZRB 1EFRA 4L5QA 5B1NA 1WJJA 4F87A 4LNQA 3OAAA 1M57C 4GX2A 1KTVA 3CD6B 3GTQH 4M2LA 1IXRA 1WP6A 2EIMB 5IY0A 1SYGA 3CHXA 2ZXIA 3HOUH 2JJ1A 2ZTEA 4OPOA 2F0DA 3ZS8C 4LF8O 4K3AA 2JA6H 1K9MC 4YELA 1N33B 3CC4V 4POFA 4EB6A 1QVCA 3AVYA 1G7TA 4LFAB 5CBFA 4IUNA 5FLMG 3A55A 4AHCA 4JI5L 4UCSA 4JAAA 1V43A 4JI3O 3L2PA 2CGNA 1H8EA 4MTXA 5J2TA 3NELA 3F7VC 2X53S 3NK9A 2W0FC 4C0SA 2OTLB 4B3SQ 4OWWB 1G51A 2E5LB 4IQZA 1F23A 4DR5B 1B06A 5DN6G 2YICA 1B23P 5IYPA 2XAHA 2JK8A 1R1BA 3OMCA 4LF7Q 1Q6HA 4JI6O 2A1AA 3A1PA 1M90W 1IKMA 2FFKB 4OX9B 1VQMB 2DNEA 5T1IA 3CPWB 2RJZA 2H1EA 3OEEG 1SE8A 3JAMc 5GADC 1AZQA 2XAFA 1N32O 1EY6A 2N88A 4ZOLB 4U68A 1L0XB 1NR1A 4OOXA 1O78A 1HTLD 2V1DA 3ZN0A 3KZIZ 4B7KA 1O9HA 3G4SB 4B7EA 1MD2D 4XT1B 1E79A 4LP8A 2GHYA 1W0KG 1TUEB 3LQEA 1NBMG 5C4JH 3HOXG 4OOSA 2FXQA 2K03A 1YJWA 2NVTH 3JYCA 5HXBA 2KQ3A 4JPRA 1H8HA 3BAAA 2SNMA 3PO2H 3M4YA 3T2MA 4F6RA 3AYHB 3OPOA 2B8FA 4JI8B 4C3HB 1G1XB 1H9SA 3R2TA 5C5MA 1N0NA 3OT7A 2HDNB 5JH7A 5ELEA 2K50A 1EIGA 3PGZA 1C8CA 3ZMZA 4XONA 3R2IA 1ZM4A 2F0UA 5D3IB 1QFJA 5HZBA 2CCZA 2DCUA 4A3BH 3G6EV 2P67A 1KMIZ 2VQEQ 2A69D 2L9HA 2YTYA 3FAVB 1WP7A 2QKSA 2BTQA 5IYCO 2YXYA 2HR3A 5KLVH 2FVGA 1G6ZA 4WQMA 1GAXA 3A8JE 2WAMA 3QG1A 4HCSA 2ODMA 2YIAA 4RMFA 4N9PA 1SERA 3LSQA 3X3NA 2V7TA 3ULPA 3ZPNA 4A93G 5M3FB 4DV6B 1PZKD 2Q68A 3A8JA 2Z6BD 2VW9A 2W6IA 1VJSA 1Y8PB 4HR7B 5FLXL 2GVAA 3W7XA 4O4IB 1LTLA 5LMUL 5TRDA 3UCSC 3QO8A 4A3JB 2Q6KA 2JGDB 1YIJV 1GXDC 3NXWA 4BIUA 1F4MA 1K0RA 3PCOB 3RZOH 1SKVA 1NR7A 1HR0O 2VL6A 4DK3C 4DV1Q 4B3RL 3J81i 3LWEA 5KX5B 1OV9A 3CF5A 1TT2A 2VUMG 4ZHQB 3ZBUA 4WJWA 1T6XA 5EBDA 3GVLA 1N8RC 4M53A 1BT8A 2FTKA 1W0JG 4JI0Q 2DQ0A 3L7ZC 4R9WA 1HVXA 1VQOB 2K5HA 1U97A 1AI4A 1Q81D 5LYJA 4R71A 5CV5A 1IBML 3DHQA 1BLIA 3K0XA 4QUFA 1NVPD 3VNVA 2H8PC 5EIBC 4AQYB 5C8YA 4XTCS 1TS3A 1JB9A 4B3TQ 3AQQA 4EX5A 3P30A 1SYDA 4ICGA 3T56B 4MW3A 1J5EQ 1YZBA 2AQ2B 2OQKA 3ASSA 1WP8A 5LP6C 1PNLA 2CGOA 1ZEQX 1CQXA 3T1YL 1AEXA 1HNZL 3T1HO 3E22B 4PABA 3OIQA 1KXLA 4WFFA 4LF4Q 1AI5A 3IL8A 1YDXA 2KEEA 3A7LA 1GN3A 3CRMA 3VDYA 3K7AB 5BN4A 1D2EA 4X65O 4LNUA 3JU4A 1B44D 1VEWA 2F4VL 1DXMA 3I8ZA 4A3IG 3QO5A 1KDAA 5GV8A 2IJKA 4FN5A 3P3PA 4BAYA 3S14H 2WB1E 3KL9A 2LQTA 3M7MX 2JYOA 3MD0A 4LF5L 2Z0SA 4IHJB 1M56B 1W3SA 3D3IA 4BY1G 4GT1A 2W0XA 5L46A 1GR1A 2B2YA 1B53A 4CJ2C 1NJIC 3D4DA 1UE7A 4R4CA 4O4JA 1TWHH 1IJFA 2YI9A 3GVJA 3UQ8A 3ISXA 2YWGA 2K14A 2JQOA 1S3JA 2DY1A 2ALYB 4YAOA 5B1BC 3VQYA 3EHBB 5GAGC 3Q23A 2UXDO 5IWAO 1XMQL 3NHHA 5BN5A 5IOCA 3MC0B 4O42A 3CS5A 4ZK9B 4RD4A 2XZLA 3M4OH 5CV9A 3KBGA 4J6HA 4E2LA 4Z4VA 1Y74A 2AZ0A 5L37A 1ZL8A 1V0FA 2JA7G 3MHPA 3J7AV 1SE2A 2R92H 2QE7A 4J41A 2F43G 5IJ9B 2R7ZG 3CC2A 2Q7HA 2ZCEA 5DSZA 5TR9A 4DR3Q 2VBUA 2F0IA 2VBVA 1ENFA 3CCMA 5A2QE 1A2UA 4YIOA 2E76B 1GUWA 2B29A 2F0QA 1PFMA 1I4PA 1WTOA 4G7HC 1RFYA 4KN7C 5LHGA 2Q8VA 4XLCA 1JB7A 2HJDA 3I3CA 2ADQB 4XQJA 5LHY1 4U3JA 1FJGL 1LUZA 1WTHA 1BMFG 3PN1A 3H0GB 1IVSA 4TT3G 3S2HH 1C4QA 1YJNA 1QLEB 3U4ZA 3RBZA 3QFRA 2XSCA 5FJ8H 4GN3B 3JAML 3H15A 2JIZG 1VLOA 4RDJA 1VQ6A 4DR4B 2QILA 2QA4A 3CCVA 3HR0A 2AHOA 1X32A 2N8NA 5IYQA 4WF9V 5BR8L 4RD6A 1ML0D 5FPRA 4XKWA 2C77A 4OPVA 3Q4HA 4BA2I 3DEOA 4E6IA 1QZGA 3URYA 2B1IA 3W1GA 4JI4Q 1UWVA 3B40A 4XMYA 3CMAB 2HUGA 3TSSA 1QVFA 3OEHA 2ETNA 4ZI7A 3RW0A 4LMQD 2HKOA 2L11A 5I6YA 5LHIA 1Y1WB 1VQHA 2GPJA 3U58A 3K0DA 2ZM6B 1S5HC 3W2HA 1WSVA 2UXCL 2J0TD 4DUZL 2FMCA 1D2DA 1M1KD 2R9RB 3BCCH 2VXWA 1ASYA 3AEIA 1F9RA 1EYCA 1R6TA 1XNQO 1EL0A 5IYBO 3VO1A 3GB7C 1XMOB 4KD3A 3RYFA 4P30A 2VZLA 1PRTB 2X69A 2GA4B 5G3LF 4UP8A 1VQ5B 4X3KA 2Q69A 2D5DA 5DLQE 1T6ZA 2EY1A 4BY7H 1JA0A 4XLFA 5FIUA 3APQA 3HOWH 3JD4A 3WNCA 3KLSA 5FLXE 2CAZC 4EH1A 2QTZA 1C9OA 3A8KE 4XLHA 1AW7A 4MVZA 3LNMB 3CXCB 5H1SE 1YBYA 4AYBE 4CDEC 1JJOA 2A6ED 4AVZA 2IHEA 1YEWA 5HGTA 5KHHA 1L0LH 4QFMA 3A8KA 1KAWA 2XZOA 2UXXA 1RTOA 3SDLA 4YWMA 1TIID 1HUMA 2M00A 4MVMA 1BZKA 3D0FA 1MZEA 1KTKA 2DY8A 3H91A 1M5IA 1FKAO 2WPDA 3GTOB 5FKAC 3D3RA 2VB2X 2L35A 4DR2B 5EPKA 1ZYRD 3WU2Z 2NVXH 4ZGQB 2XIWA 5F2DA 2IHFA 1VHOA 1S5LZ 1O9GA 2PNRC 5JBQA 3G71B 4F4LA 4B43A 4R4QA 4UCTA 1ET6A 1B3AA 4OXSA 1XNRQ 4TSSA 4XL9A 1DCZA 1NY4A 1YHAA 1VQCA 2VS1A 1CHPD 4NBSA 1HZ9A 3ULJA 3CP1A 1CM9A 1X3QA 2R9IA 4OXPA 4IOCA 3S2DH 4OGQC 1EP2B 1XTDA 3V7AA 4JOIC 3HRZC 2BTOA 3HOZG 1XHZA 1M93A 4J10A 1PXUA 2ZKOA 2WSSG 4YCUA 2R93G 5C3EG 5DEHA 1QFYA 5BY1A 4UP7A 4PDRA 3AK3A 2MFIA 1QUQA 4GKKL 3BA8A 4RWUA 1B9MA 1Q7YD 1CSPA 3P1HA 4A3FG 4EGVA 4IALA 1OGJA 2OTJA 4RD0A 3UO2A 1AP6A 2CW0C 2HMAA 5FNZA 2CRVA 3CP8A 1Y67A 4CH4A 1D8LA 2JRIA 2RA4A 3G7LA 5AJ3Q 2NLJC 1JCKB 5A2QN 2EIMC 2EJGC 1V55C 2ZZEA 3HKZB 3T53B 1ENAA 4TKOB 3C46A 1H2GA 2ZXWB 1PTOC 2UXBL 1STEA 1FYCA 1SR3A 1DDGA 1HH2P 1KNEA 3PSIA 2QSAA 4LFCQ 4PC3A 1DF5A 2E1RA 4X66Q 4DR7L 2UUBL 1N4CA 3S16H 1I4HA 2CK3A 4J0QA 5GAEC 2D62A 4JV5L 5GTIZ 5ELDA 1J95A 2LP7A 1ZXTA 1JFFB 1ICWA 5CA1B 1MOFA 3E8GA 4XORA 1XPOA 4NTYA 3RYIB 5IP9H 1JR0D 2UUAQ 2B39A 1Q1BA 2PMZE 1B4OA 1PH3A 4DR6Q 4IW3B 4TWKA 1NB0A 1I50H 2F0GA 2UUCO 1HZAA 4IJLA 1LABA 1U4PA 4RGOS 2A06H 5B1AB 2KG7A 2DW4A 2LY7A 3VQVA 1KKDA 1DG1G 1YNNC 1N0JA 3WG7B 2NN6G 4LWSA 4JVZA 4I9QA 4M0LA 2QTSA 3NPPA 4PZ8A 3I55A 1Q86W 1K5QA 4WZKA 1AZPA 4EQNA 5K1PA 1EZ6A 3J80c 3HKSA 1YI2A 2HHHL 3SJBC 1F2LA 4ZOLA 3HS0C 3A8IE 3Q24A 1SQBH 1GHJA 4XDLA 4DUYL 2CH4W 1EOVA 2X6LA 3ONUA 3P27A 5C4HA 1BS3A 2QW7A 2LGWA 2IX1A 3JALB 4X1IB 1Y66A 2HCJB 4DR1Q 1HNXL 2GUZB 3S1NH 1BUVT 1LR1A 2JN4A 5FLXN 2KHJA 4DXGA 3A8IA 5KYLA 2X6WA 1FXKA 3SEJA 1IBKO 4NXML 5CA0A 4WWVA 4O4HB 4QGPA 4F88A 1N36O 3FB8C 2EZPA 3WDNA 2RMKB 1EFRG 1F4NA 2KEDA 5I6WA 1JWMD 5J2UA 2ZJQA 3JATB 5C44B 1LT6D 3H3VH 3TP7A 3FEWX 4WFGA 2VQFB 5ISRA 2CQAA 2M6YA 2B8GA 1Y76A 1PTOH 4K6LA 1TVXA 3J7A5 2MNAA 2B9ZA 4A3MH 3C3TA 2B63H 4G1VA 1L0WA 2HJFC 1HDJA 3E8BA 3CMEV 5GAHC 1G6UA 5EKKA 4DV2O 3SJPA 3L70H 4TUYA 3CJHB 3E86A 4IUQA 2PMDA 4ACAA 1VQLV 3NEMA 4DV7Q 3CCEV 4FLTA 1H8EG 1NE3A 4KHVA 3CCJA 4QGUA 5LXTA 4PMWA 1E0BA 4B3MB 1GM8A 2K28A 3LNNA 2JDIG 1EIHA 3OE7G 3E2EA 2WLIA 1YTFD 4DQKA 1I6HB 4MVSA 2RSNA 4H13B 1L1OB 2XNDG 4LF7B 3TBIB 2F66C 2R61A 5IP7H 1Q3LA 5J22A 1LM0A 4R6ZA 3MAQA 4J8QA 4MW8A 3G05A 4U9UA 1K8MA 1GUNA 1VQ9A 1K8OA 3RD4A 1AE2A 1I0HA 5KX5A 5H6QA 4FK8A 1WOCA 1E79G 1T5XD 3GTPH 1BQ0A 4QPJA 1SFOH 3NQTA 5F4OA 4YY3Q 2D74A 2PNHA 2MUYA 2ZQMA 2N04A 1K8AW 2DEUA 1H8HG 1K97A 3L9DA 1P7GA 4OIJA 3W1BA 1KD1W 1SMYD 1B70B 2DJGC 2GBOA 2EINC 5C4XG 2UU9O 3IJ4A 1IBMO 2A6HD 4HJ9A 5IGEA 4TMVA 2C78A 3GD7A 3AGQA 1PZID 1OHHA 4GX0A 3CWBH 1JA1A 4I7ZB 2RF4A 1Q7YW 4HIKA 2ZJPA 2ITCC 1EFID 3U10A 2AUKA 4MYTA 3I4MG 3BY6A 1SLJA 1QQCA 3VYTA 2NTTA 1KC8D 4CBVA 2WIIB 2VQEB 5C0XI 3S9WA 4UAIA 1HFGA 4TMWA 3CCQV 1PL4A 4R50A 3RGBA 3VYSA 3GVMA 3BDCA 1XOUA 1W35A 5B3SB 4LF8Q 1K83B 1YI2V 4MT8A 2DMXA 3BC9A 5KUMA 1P4RA 5FNVB 2CWAA 1WPBA 4FXUA 1Q1EA 3W2FA 3W7SA 2QJ1A 3ZZTA 3VQWA 1HW7A 5E4XA 1SF9A 2P4KA 1HQMC 1AR5A 3WOEA 1M56C 1A62A 4NW2A 1XPRA 2V7XA 1VF6A 4KK7A 5DNFA 4NPSA 3FKIH 2I1LA 2SDFA 1VMPA 1BJKA 3L74H 1EU4A 3BVOA 4DV5L 1Q90D 1IDSA 4FZ0A 1BX1A 4KD4A 4JI6Q 4LFAO 2AXTZ 1ROPA 5JPNC 1RQRA 2VB3X 3E9IA 1AR4A 4DV0L 4JI3B 3X3MA 4G57A 4ASUG 4DV1B 2YYZA 4UVAA 2VBSA 2Y0SG 3A0BZ 1KLGD 3D8GA 3JAMN 2EYLA 5GONB 1EWIA 4ROXA 4A75A 4QPKA 1D1IA 3QSYA 2LFRA 4DR5O 4FFBA 4P6YA 2LJ2A 4WORA 4DAPA 1GKHA 5LMUQ 2YWFA 2A69C 1TR5A 4KP4A 3BPZA 1C7YA 4J1MA 1XE1A 4GKJL 2YDEA 1I5FA 4JI0B 4G7XA 1YHQB 3G67A 1XPUA 2JSOA 5IGGA 1KUQA 4OHJA 4DU9A 2YI8A 4OX9O 1MIUA 4A3LH 4JI7L 4B3RQ 4XQNA 4WFN3 2E76C
chains in the Genus database with same CATH topology
1JMKC 3BS1A 4YIJA 3S16B 2WP8J 3NP8A 1J9OA 1IL8A 4B3TB 4RH6A 4ABNA 3ZIAA 4DK1A 2F0KA 2WKCA 2MHVA 3I4NB 5LP6A 1LT3D 3NBIA 4XXEA 5JVDB 1SSOA 5CBAE 4FLWA 2X6XA 3CRLC 4DXFA 1AP0A 1UNSA 1WTVA 4OO1H 3VA7A 3VQXA 1J5EB 1EY8A 4TRDA 4ZLTF 1SNOA 4DV5B 1QHTA 1CI3M 3S14B 4CS4A 3TP8A 1Z5VA 2EYMA 4DV3B 2NTSA 3E6ZX 1SKYB 3RYCB 4KKTA 2VUMB 2X6YA 1O80A 4X66B 4IUPA 4LH6A 1DM0B 5HURA 4DV4B 2FMMA 4LF4B 2X8KA 4XT3B 3J80L 4PMBA 2EVBA 4Q6GA 4OO1I 2R9AA 2B2VC 4X20B 2E2IB 2UU9B 1STBA 3PUVA 5EYPA 4I55A 4FXGC 1CHQD 2ICIA 1TWHB 2RQXA 2ZTGA 3MVVA 4HMIA 1TWFB 4ULLA 1I3QB 4X1KA 4IN3A 2CVRA 5IT9E 1Q90A 2EJMA 2V4DA 2ZTNA 2UUAB 3K58A 4QMGA 4ZQ3A 2PCFB 1H9JA 4NNJA 2KA7A 4V0BA 4RKLA 1JOKA 4L63B 3RYHA 1KZLA 1SYFA 2H4OA 5IGCA 1XYIA 1U4RA 4O4LB 1FGBD 2I07B 4I4TB 3DWAA 1D1KA 3BABA 1SYEA 1R9TB 2F0MA 2UXBB 5D65A 1TVKB 3VYRA 1BCPB 2QF7A 1G2SA 4G7OC 1II3A 1H9KA 3SE0A 3M4OB 4FFBB 2NVYB 1SXTA 2K6AA 2YIBA 2ZZQA 3H94A 5BMVB 4DR7B 1HHVA 3W3AA 3V96A 2UUBB 2F0HA 1NT2B 5JVG3 4K2LA 3C2PA 2QEJC 3A3GA 1Z7TA 1B04A 2V7QA 4N9TA 2R92B 1TU2B 3PUXA 5I2YA 2PW7A 1HA6A 2XZPA 3V2TA 3HKEA 5KHJA 1LT5D 1EFRA 3I4LA 1RCVD 2F93B 2G9DA 4B3FX 4F87A 2HDLA 4HBNA 3OAAA 1N34B 1D5AA 4JYAB 1WP6A 2EZVA 1SYGA 3CHXA 5JPMC 1CT1D 2ZXIA 2JJ1A 1JORA 1MABA 4DR1B 4EFEA 5CMDA 2ZNJA 2F0DA 1MSGA 3ZS8C 1HR0B 3K5LA 5LP6B 1QNUA 4TV8A 2JEAI 1EZ8A 1KAAA 1JQYD 4YELA 1N33B 5FO7B 4EB6A 2KHSA 3S2HB 2JIZA 4LFAB 4A3IB 5IIFA 4IUNA 4DN4M 4YJ3B 2FINB 3A55A 4AHCA 3BDOA 4UCSA 1EY0A 3KLSX 3TDQA 3I72A 1RF2D 3HKCA 1V43A 3NQIA 3A56A 3MWYW 2Z8LA 1H8EA 5J2TA 4DNRB 2A74C 1SNPA 5M3MB 2X53S 4BY1B 3NK9A 4NXNB 1WNSA 2IX3A 2EE1A 2EPBA 3ND8A 2RBMA 4WBNB 2E5LB 2RDHA 5DAUA 4IQZA 4BA1I 4DR5B 3TP5A 1UD5A 1SEBD 2HHHB 4NKLA 2E2HB 1S5ED 1RDPD 1I6VC 4RKBA 4DUYB 4ID6A 4XM3A 1PFBA 4CS2A 3OMCA 5KNBA 1E2WA 4X1KB 4UCRA 3JSLA 5DM63 1HNXB 4JK1C 1IKMA 2FFKB 4OX9B 3DXJC 3K59A 5M5XB 2DNEA 1YNJD 1R4QB 4O4IA 2WINB 5T1IA 2RJZA 3HP3A 2H1EA 2WACA 2HEPA 2PW5A 2VWKA 3RYHB 1W9XA 4FLXA 3JAWB 1QNKA 4NXMB 4C3IB 1AZQA 1EY6A 1OXUA 1EY5A 3SK5A 4CKBA 2N88A 4ZOLB 4U68A 2K7VA 1L0XB 1V1OA 1O78A 1HTLD 3SR1A 3LX0A 4X64B 5JOBA 1O9HA 3SEBA 4JI4B 1MD2D 3R3OA 4XT1B 1E79A 5I9PA 2R6GA 1I8DA 2JA7B 4XYQA 3FPUB 2IM9A 5KGUA 3PMFA 3T1HB 3DEPA 1VLYA 5C3XA 2EJFC 1HZEA 2R7ZB 2K03A 1D2BA 3HGBA 2CHBD 4YHHB 4ZHQA 3OWFA 3E5SA 4BY7B 3P20A 5JEAG 2Q7GA 2KQ3A 4EQPA 4K5WA 1H8HA 3BAAA 1KMHA 2SNMA 3M4YA 4EQOA 2JA5B 4F6RA 1F2MA 3HOWB 2O4XA 1H9MA 1LTBD 3OPOA 4P2CB 4CH5A 2B8FA 4JI8B 3ONAB 1IKLA 4C3HB 1VF7A 1H9SA 2M2LA 3R2TA 5FL7A 3QB3A 5C5MA 1DOLA 5JH7A 3MFGA 5ELEA 4PNYA 1EIGA 2A5HA 1C8CA 4GYCB 1F77A 2XWBB 4BBRB 4HSVA 2F95B 3DWQA 4XONA 1ESRA 3R2IA 3BCFA 2QDBA 4TV8B 5G3LD 3ERQA 4CGYB 2F0UA 1COWA 3RZDB 2F1MA 3QOJA 5D3IB 1PYWD 1STYA 3NWSA 2SOBA 4IZ8A 5E4WC 2BDNA 4EB6B 4QCLA 2MJ8A 3J81L 3KEWA 5K1XA 2PY5A 1KMIZ 3S15B 1MGSA 4YY3B 3TZDA 2A69D 1HPCA 1PTOF 4KTAA 1S5JA 1EOTA 4ZKCB 1LTSD 2L9HA 1SDFA 1L8DA 2IPKD 2EYPA 4QB4A 5LL6X 1WD0A 2WKDA 3HKCB 1SE4A 2BTQA 3JAKB 5J2TB 1G6ZA 1R4PB 1Z47A 1QILA 2ZXPA 2KCCA 2ZIMA 1LTRD 3A8JE 4DFAA 5EPLA 3MTSA 3QG1A 3EVQA 4HCSA 4XKVA 3RFRA 2YIAA 2OT2A 3DUZA 3BCDA 4N9PA 1BO0A 3OHXC 3KBXA 3A3BA 1YNJC 1FNWA 3X3NA 2WJYA 3E22A 3ZPNA 4O2BA 1BF4A 5M3FB 4DV6B 5CDFA 1PZKD 4FM0A 1TGOA 1E2ZA 2B2WA 1I18A 2BOSA 4XN0A 2Z6BD 4K14A 2W6IA 1D5MC 1VJSA 1I4QA 2WAQB 1Y8PB 3JASA 2BE5C 4HR7B 3OSOA 1V9PA 5FLXL 4O4IB 5C3WA 1RODA 1OB0A 4H0LC 1GOZA 4A3JB 4RHSA 4IUUA 2PZTA 3TZUA 1WTXA 1GXDC 5I4DA 4FVMA 2WJVA 2IJ0A 3NXWA 2ZXRA 4XDXA 1STNA 4LF8B 4DAYA 3S2DB 1SKVA 2L12A 1Q43A 5LA6A 2WSSA 2PZWA 4LH7A 4X1YA 3LWEA 2E2JB 5KX5B 4NVPA 5EKIA 2LFNA 4IHJA 5CB4A 1WTPA 5JEAH 1STAA 1O7ZA 1TT2A 1EQVA 2L1BA 4ZHQB 4WJWA 1EY9A 2E3CA 1WPCA 2PZSA 4Y7NB 5EBDA 3GVLA 2O5IC 3A54A 5JJNB 1F9QA 1S4ZA 5JAVA 1TY2A 1H9SB 2HCIA 4K8ZA 1IW7C 3WQZA 1CQFA 3LWUA 5I2XA 3HKBA 5JH7B 2F0TA 1BDOA 3L7ZC 3MXPA 1WTWA 4R9WA 1HVXA 1NCVA 4PV1C 4RWSC 3G6JB 1PRTF 3NE5B 1LO5D 5LYJA 2XVSA 5CV5A 2JEBI 3MHBA 5KRUA 2PPBC 2E1BA 2L4NA 4JI6B 1TA8A 5KHIA 3DHQA 1BLIA 1ENCA 4QUFA 5EIBC 4AQYB 2A6EC 5C8YA 4XTCS 1EWHA 1TS3A 4ZRZA 4KJOA 4X1IA 4A3DB 1RSOA 3DDYA 2K5QA 4MN3A 4TQFA 1D5ZC 4CH3A 1SBBB 1WD1A 3QIAA 2F0WA 4L8JA 3GTGB 1SYDA 1E3XA 2BTQB 1N32B 2ZZGA 1F2ZA 2IL8A 3T56B 2ZXOA 1E1QA 5K5PA 2AQ2B 5IJ9A 3P75A 1BOSA 1TWAB 1TQOA 1CZGA 2O2LD 3PO3B 5LP6C 3C3LA 1HCZA 1PDQA 1ZYRC 2VWJA 2XRQD 1B2TA 3BHPA 2JJ2A 1ZEQX 3VYUA 4TSFA 3CHBD 2ENBA 1AEXA 3RLFA 3E22B 3OIQA 4B3GA 3EQLC 5FO8B 2PYJA 4PQXA 2XHBA 4O1NA 1SQGA 3IL8A 1PZJD 2KEEA 3WB2A 3A7LA 1UUPA 4HN7A 4EFBA 2F0NA 3K7AB 4H7BA 5BN4A 3JASB 1I50B 3BVZA 4LFCB 4YXWA 1FNVA 1WTHD 3S1RB 2IT1A 4LNUA 3O13A 4ILWA 5D5PA 5IJ0A 1B9NA 5FK9C 2RQ6A 4DV0B 4HMJA 3QOLA 3RUZA 2JGUA 4Q0FA 3JU4A 2M5SA 5EZYA 1B44D 1H9RA 3T13A 2Q0AA 5COYA 1I7FA 1DXMA 2IX0A 3SK6A 3I8ZA 3HOZB 1KDAA 4B9WA 3RWRD 2OF1A 3TN2A 1D5XC 2R93B 1TAEA 4R8IA 5C3EB 3M7MX 1Y8NB 2JYOA 2FHTA 4XD7A 3EFXD 4S3SA 5JCOC 1QE6A 4IHJB 4A3KB 5CB4B 1A3VA 1QG7A 5CBEE 4HEDA 3UT5A 3CQZB 1MBYA 3I73A 1JB3A 2B2VA 5C0XJ 2AWOA 4A3FB 1B1ZA 5JQGB 2B2YA 4DR6B 4V190 1UAPA 4GKJB 1B53A 1LTTD 4FLVA 4DK0A 2I46A 4CJ2C 4H13C 4PMCA 3D4DA 3DWPA 1M8AA 4O4JA 3ETQA 3MA2B 2YI9A 1PKVA 3GVJA 3UQ8A 3GQBA 3OTOB 3QO2A 3SK4A 4JI7B 2F0EA 3HKBB 4KV6A 1SNCA 4QUCA 3EROA 3VQYA 3Q23A 3S1NB 1E43A 1XI1A 4KHPB 4KKSA 4RCNA 5FO9B 4X3TA 1OO9B 2K33A 3DMUA 2RDFA 4MHEA 2KUMA 3BDLA 3NHHA 4C3JB 1PLFA 1SA0A 4TOIA 5BN5A 4BS9A 5IOCA 5C8YB 3MC0B 4C3IG 3AMUA 2NVQB 1ILPA 1H2SB 4O42A 4ZK9B 3D4WA 2XZLA 1EWCA 3JARA 5CV9A 3KBGA 4J6HA 4QIWB 3FRPB 3JAME 3SXHA 1UD4A 1DOMA 1TS4A 5JJEB 4K6DA 1V1PA 5CC4A 5D3DA 1V0FA 2Q7EA 3K5NA 3HOUB 3J7AV 4RGMA 4K0KB 1SE2A 5EJWA 3NUCA 1HXYD 2QE7A 4I50A 5IJ9B 1EYDA 1PTOB 4XLAA 2Q7HA 2ZCEA 2F0VA 3AU7A 2EYFA 4LF9B 4DAVA 2F0IA 4A3MB 2ZXHA 2F4IA 2BA0A 2A68D 5FPOA 4JMQA 1ENFA 3BA9A 2D9UA 5CGKA 1JWSD 5A2QE 1A2UA 1GUWA 2B63B 2F0QA 3M7GA 1PFM