1VF7A

Crystal structure of the membrane fusion protein, mexa of the multidrug transporter
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
237
structure length
237
Chain Sequence
TLNTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQLQEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the membrane fusion protein, MexA, of the multidrug transporter in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords Multidrug resistance protein mexA
total genus 67
structure length 237
sequence length 237
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1vf7A03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1vf7A01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vf7A02
4H44C 3BG3A 1VF7A 1TKWB 1ONLA 3AB9A 3EQLC 4L8JA 4LK1C 3M7NA 3T51B 4GYCB 3MFYA 1HTPA 3PUZA 1O7LA 1Q12A 2DN8A 1K8OA 4TQUS 1Y8OB 1T5EA 1ZKOA 3I72A 1OXTA 3WB1A 1GUTA 1HCZA 5D5PA 3OOCA 3OW7A 4KN7C 1H9SA 4IQZA 3FPPA 3DXJC 1B9NA 2BDOA 2AWOA 2F1MA 2B8GA 1E2VA 1CFMA 2K32A 5BN5A 2F93B 1BDOA 3A8JE 5K36G 4KKUA 1OXSC 1OXXK 2KCCA 3CRLC 1B9MA 3W3AA 4BA2I 3KLRA 4G7ZC 1CTMA 3A7AB 1E2ZA 2E74C 1Z7TA 2A68C 3QIAA 4DNRB 1Y8PB 1GHKA 4KKTA 3T56B 1FR3A 1VDZA 3TZUA 1GUNA 1H9RA 1K8MA 1DCZA 1Q1BA 2R6GA 1H2SB 2EJFC 1HQMC 2BA0A 4OGQC 4KMUC 4I7ZC 2A6HD 3PUWA 1I6VC 2JEAI 4LJZC 3WDNA 2LMCB 1DXMA 1Y8NB 2BA1A 4XTCS 3PV0A 2V4DA 5K36H 1TU2B 2JXMB 4H0LC 1IW7C 4BA1I 1VF5C 2E75C 3CRKC 3QG1A 2QF7A 2L5TA 3N6RA 2EDGA 3SDZA 3WB2A 3WB0A 1H9SB 3ND8A 2DNEA 1Z6HA 3U9SA 5KNCA 2D5DA 2D2CC 5C0XG 3M85A 1A6XA 1OXUA 1GUGA 2A6EC 5JJNB 3D4RA 3FMCA 2AUJD 2Q8IB 4JK1C 1LABA 4DNTB 4GZYC 3D31A 1Q1EA 3PUYA 1GUSA 2NN6G 3IKJA 3GQBA 1H9KA 2K7VA 2F95B 1QJOA 1GUOA 3I73A 3L7ZC 1DD2A 4KKSA 2JEBI 5JJEB 2A69D 2BE5D 3BDOA 1H9JA 3IFTA 5KNBA 2O5IC 5JEAH 1HPCA 4G7OC 5JEAG 2A6ED 3A7LA 3T53B 2PCFB 1E2WA 2NN6H 2K33A 4RCNA 5BN3A 1LACA 1EWHA 1FYCA 2B8FA 1YNNC 3A8KE 2A6HC 4OO1G 2CW0C 3A8IE 2JE6I 1RSOA 2EJGC 2EJMA 1PMRA 4JBWA 3RLFA 4IFDG 2A69C 1GHJA 2BE5C 3HGBA 3BRCA 1SMYC 4DK0A 2PNRC 1YNJC 3GD7A 3P20A 1V8QA 1IYVA 2AUKA 3MXUA 1O78A 3I4LA 2A68D 3LWUA 3NE5B 2ZT9C 1OXVA 4KI0A 2KA7A 3VR4A 1GJXA 2EVBA 1IW7D 1VCIA 3QJYA 4H13C 4KN4C 3PUXA 3VR3A 1H9MA 3VA7A 3OPOA 2IT1A 4OO1H 2YYZA 5KNDA 3H94A 5C0XH 4DK1A 5BN4A 4IFDH 2O5JC 4PV1C 4XIGS 1V43A 1Y69U 4HR7B 1CI3M 1G291 5A35A 5D5QA 1ZYRC 4TKOB 3VR6A 2NN6I 3VR5A 3SE0A 3LNNA 3ND9A 4KHZA 4G7HC 2PPBC 2D62A 2DNCA 3PUVA 3VR2A 3M4YA 1IYUA 5JJJB 1Q90A 2E76C
chains in the Genus database with same CATH superfamily
3C2PA 1VF7A 1AB3A 1PH2A 3CS5A 2Q67A 3J81j 2E5LQ 3OJWA 4JVZA 3HOYB 2VQFL 2CGOA 3OAAA 4JC0A 1VQ6V 3R93A 1EFTA 5CV5A 4UCOA 5C4XH 3KJPA 3F2CA 1HNZB 4LFAB 1R6KA 1KB9F 3F2DA 1VQOB 1QVGA 3HB3B 1IHZA 5A8AA 1N0JA 3SR1A 4HAMA 5BZBA 1SE3A 4JTCB 1BVSA 4IQZA 4A3IB 1SA0A 2DEUA 2NVQB 3OW2U 1JQYD 3VA5A 4LWSA 4XKWA 2QWRB 4FM0A 5BN5A 1PNLA 1QUEA 5ELDA 1L0LH 4KKUA 4P73A 2B7BA 4EEQA 1JVMA 4LF4B 3HKDA 2F0JA 2DE0X 5L37A 3ZPNA 5LMNQ 3E6ZX 4QE9A 5E1AC 4OONA 3AGPA 3C3LA 4C3JG 1A2UA 5H5JA 1GKFA 1SE8A 5E79Z 1MD2D 2E74C 3RZOH 2H1EA 4DV3O 1UEBA 4JI4O 2GSMB 1EP2B 4LF6B 1OCZC 5GONB 1H9RA 1E64A 1TY2A 3QR8A 4WFBV 3SK4A 1TUIA 1KC8W 5CORA 2XAJA 5FNZA 4QCLA 3NPPA 4MYUA 1HQMC 2RBMA 2HIXA 4I7ZC 2ARHA 4WFFA 2JA7B 1RM1C 3ERSX 3G67A 3HKZE 5I9OA 2DW4A 3VO2A 3OMNB 1QFJA 1NJID 2R9AA 3IGAC 4LR3A 3CU7A 4POFA 4FXUA 4PGOA 4UAJA 2HUGA 2EY1A 2GUZA 4BA1I 3H09A 3PIP3 4A3CH 3U4ZA 4PA4A 3CRKC 2DOSA 3W7TA 1KK1A 2OCEA 3RN2A 1QNUA 2B1GA 4Z9CB 1HFNA 3WB2A 4JI3O 3P27A 3SHLA 1NB9A 1K83B 5C0XG 4DR3O 2Q0AA 4NKGB 2OK7A 1WORA 2SOBA 1YJ9A 3ASOB 4JI3Q 1UD3A 1DF5A 3ABKC 1RHPA 1A63A 4K5XA 1GUSA 1KNAA 1SYEA 4PC2A 1H9KA 2WZPP 2YU9B 1IX9A 2EXZA 4UVCA 2QKIC 1S3JA 3P3NA 3CB2A 3LSQA 4X65O 2CK3G 1HR0B 2Q6AA 1J9ZA 2YWGA 4P1VA 1EIGA 2B3GA 3N2KB 4OHJA 4CDEC 2FMLA 1IBKB 3K7UC 5DM73 4GKJB 4OWXB 4X64O 2M2LA 1RP3B 3HOWH 5JEAH 3AQQA 4M0LA 4NB3A 4Q20A 2K5QA 1Q82C 1Q81D 2UUCL 1D5AA 4UVBA 4UCRA 4II2A 2UU9O 3VQYA 2F0UA 1WYDA 3I91A 4UFZA 1PJ5A 3S1RH 1O80A 1LACA 2K03A 4XT3B 1I94Q 4IO9A 5TISZ 2XAFA 4YIJA 1YJNB 3K7AB 3OHXC 1WPXA 2XASA 2EJMA 1DONA 1PMRA 3CPWA 4X1IB 1SE2A 3U6BA 4DPGA 2ILMA 1NKDA 3PUNA 4A3FB 2ZL5A 4OELB 3JD2A 2E5LB 4FVMA 2QW7A 4RD3A 1Z2GA 2MHVA 3EA6A 1WP6A 4XLAA 2ZBVA 4NXNL 2AQ2B 5IDJA 4AF7A 3PUXA 3UT5B 3A5ZB 4RMFA 1BZKA 2Q8TA 1OJHA 1QU7A 4I0XA 1G8ZD 2GN5A 2HDMA 3I4OA 5GAEC 2MJ8A 2OTLB 1JWSD 5GROA 5BN4A 2EY2A 4X20A 4XLFA 1JX9A 4ZCKA 2VQFQ 3KLSA 5D5QA 2QKAA 1ZYRC 4BY1H 4JI7L 2F4VB 2A8VA 1TWFB 3I8ZA 3AG3C 3RZDH 1VQBA 4PHZA 4DR1O 4JF3A 4Z4WA 3PUVA 1MZEA 4HIMA 1EU4A 3EFXD 2NVTB 5JOBA 3BG3A 1N33Q 3QG5A 2C35B 3OR7C 1L1FA 1XMQB 2WLIA 1B2RA 2BOSA 5CBAE 1HNWQ 1Q43A 4ROXA 1EN5A 2Z8LA 2DN8A 1G7TA 3X2QB 4UVAA 3GVLA 1XDCA 1T5EA 2ZE5A 2J7ZA 1OGJA 1VJSA 3UO3A 1N32L 2M6YA 2Q6IA 1TWCH 2QE7A 3GTOB 4XQFA 3FPPA 1K3RA 5BR8B 2JEUA 3B8HA 2HVKC 3NENA 3S1NB 5AN9A 2IH1C 5KHGA 1J5EQ 1JA8A 2NLJC 3AVTA 3CC2A 4G1VA 5DS0A 5GQOA 2RCNA 2AZ0A 1HA3A 4FN5A 1U4RA 3RFRA 1TWHB 3P1HA 3STBC 2BMWA 3D36A 4ZUJA 4DR1L 1EP1B 4G7ZC 2PIAA 4HBNA 2C77A 3ASOC 3G05A 1C9OA 2I07B 1ZTEA 1Y8PB 3MA2B 4KKTA 2MK3A 3DM1A 3E22A 5B6IA 4HIZA 3L75H 2KVOA 4QVAA 1A3VA 1CKMA 3T1HL 2CKZB 3ICXA 1AI7A 1NB0A 3T1YL 3W7XA 1ZM9A 1VLOA 4TMVA 2IU3A 4HIKA 4JI6B 4DU9A 4JI5O 3RYFA 4LJZC 5I4DA 2YXYA 1SYCA 3PCOB 1DLBA 3CCVV 4KV6A 3S3WA 4DR5O 3KUPA 2QE7G 3AG1C 3CMMA 1SNCA 2JXMB 3ZJZA 4ZRZA 1SNPA 4IUQA 2V7QG 3SK5A 1IXBA 1EQQA 1BF4A 1RL2A 1FXVA 1CA6A 3OFNG 4RD2A 4DR6B 2QSAA 3W2EA 1VQMB 1AN8A 3G6BA 4IURA 1YBYA 3U9SA 5FOBB 4LF8Q 5FIUA 2D2CC 3G48A 5C4HA 1SNMA 3CCJV 1GN6A 3CC4V 3S2DB 1OGIA 4L63B 2Z4IA 4AF6A 2UU9L 2VNUD 1SXTA 3ONAB 4HSVA 5LHGA 2JK8A 4JI1L 2IX3A 1VQ6A 2VUMG 4K0KL 4HTHA 1OCRC 2Q2HA 2K7VA 1RSOB 2EIKB 1VQHA 3L7ZC 1R6TA 4UP8A 1CUKA 1S72A 4KKSA 1QGAA 3LNMB 4PELA 2YI8A 3AG2B 4UHVA 1WTQA 3S17B 2NPFA 1RPOA 2XNDG 1GO3E 1X6OA 4PMBA 1NH2B 4JI6Q 4H33A 1GM5A 4YY3O 1RF2D 4BY1B 2E75B 3K79A 3Q24A 2JDIA 1SNQA 3A0HZ 3FYIB 4X3SA 1EWHA 3MDSA 1STYA 1BHBA 2N55A 3W2DA 1FRNA 1J95A 4MT8A 1E1RA 2X8KA 3CCSB 2OTJB 4LF7O 1Z5WA 1OHHG 1HZAA 4BBRG 3B40A 2JA5G 4BBSG 1GAWA 1ICWA 3K0GA 5ELFA 2Z6BA 1EZ6A 1KK3A 2DERA 3UI2A 3JCZA 1LTRD 1MKHA 3IJ4A 1YVCA 1KQSA 1K73D 1IBLL 2HCCA 3K5OA 3ZEDA 3RYCB 3QFTA 3CWBH 4YAWA 3CQZB 1VCIA 1H9MA 4S3SA 4LH6A 5LHY1 4TV8B 4JI6O 1W2BB 3QTCA 4TQDA 4DRXA 1X4TA 3R6JA 1PPJH 1IKLA 3ZRVA 1JICA 2K5HA 2WAQG 4UV9A 2RJZA 2XVSA 4FO2A 2Q73A 4IUNA 1AI4A 4X64Q 4DR1Q 3UKMA 1CI3M 3D6CA 3SR2C 2VS0A 1GJRA 2L55A 4LUZA 4DV3B 2NTTA 2KQ3A 4X65Q 4RLZA 2UU9Q 5L3FA 5DN6A 1DM0B 3CD6B 1HRJA 4MHEA 3OUSA 4TMWA 1K4CC 4MVQA 3PA2A 4MVRA 2AQ1B 3CCEA 3HOWB 1EQVA 4U3FH 1YJ9V 5JJJB 4NPSA 5EC2C 3GQBA 2YS8A 4X7DA 2HQEA 5M9OA 2QTOA 1VQNV 3L9AX 2ZITA 4K8IA 1VQCA 3OW2B 2A9HA 1ZUNB 3MFYA 2QWQB 2VNJA 4DNIA 2EYOA 2EZOA 2PZUA 3K7AH 4DV5Q 1K5SA 3OTOL 3ZRWA 4MTNA 5LXTA 2WSSA 2OYQA 1JR9A 2QM8A 1G2SA 2RF4A 5CBEE 2GJPA 1XUQA 4R8IA 2JGUA 3HKZB 5JJZA 3S3XA 4B44A 2B8GA 3OIQA 4JI1O 4YHHL 1VP7A 1JOYA 3OMGA 1TIID 3JALB 4LMQD 2E2IH 2LP7A 4QIWE 2BTOA 3CRRA 2NVXB 4PA3A 1DK1A 4YAOA 2KENA 1EY8A 2LXKA 1SJED 5A2QN 1YIJB 4XQJA 4XDLA 1OO9B 1K5QA 1OB0A 2QDBA 1STBA 2C4TA 1ZXTA 3E8HA 2WACA 1OCRB 4GX5A 4A5UB 5JEAJ 3BCCH 3ZZTA 4P3IA 2GTAA 2ZJPA 1ZUQA 1IJEA 5F4MA 4DV2L 1XPUA 4IN3A 5JPMC 3G6EA 1ILQA 1UD2A 1VIBA 3M3YB 4FK5C 3JSNA 4OOXA 2JDIG 1SJHD 2B9ZA 2BA1A 4A3IH 2Y48A 5ITZA 3CXCU 3SDLA 3T1YB 4DR7O 4CH4A 4G57A 2Y4TA 3JU4A 1ZAUA 3DXRA 3C46A 3N6RA 3EVKA 1CXZB 1XE1A 5M5YB 3BNWA 2X53S 3NWSA 4B3SO 3U10A 3PO2B 3KF8A 1US6A 5DEDA 5GV7A 2E74B 1OXUA 3OTOB 1X54A 2EY5A 3HP3A 3KG2A 3V96A 2R7ZB 3PUMA 4GZYC 1WFQA 3OMAB 1YCIA 1KNEA 1DZ1A 1V0EA 5C6AA 1WJZA 2ENBA 2AZ2A 3MZ5A 1AP0A 2JS3A 4DV6O 1NNXA 1VQIA 3ICEA 1WTHD 2F0QA 1L0XB 4DUYB 1WSVA 5BMVB 2WZNA 3IAYA 4K0KB 2UUAL 1UUPA 3CCQV 1N05A 1QR8A 1RTNA 4DV7L 1NR2A 1Y67A 2RKSA 3CMAA 1MRZA 1PTOC 1PM9A 3ZHSA 2HJDA 2J0TD 2VQEL 3QFRA 1W0KG 1V5VA 4RD4A 4DV0O 2HG5C 1KECA 3K9AA 3ABTA 4XDKA 3OEHA 3ONUA 1HH2P 1G51A 1WJJA 3LGJA 3KZIZ 2V7XA 2ZTEA 1WP7A 4I7AA 1XNRQ 1YNJC 5B1BC 3A0BZ 2IU0A 2R61A 1WSRA 3LWUA 2UXBQ 1QB5D 3B8NA 4L6TB 2GVAA 1B04A 2HR3A 4JMQA 1QVCA 4B3TB 3SPCA 1P84F 3JATA 1Q8IA 1AI5A 1KL9A 1S5FD 4IPHA 5D3DA 1XOUA 2QDOA 4HE6A 4C0SA 3T16A 4TMZA 1EY9A 3ERQA 3M4QA 2ADQB 2N3SA 1HWYA 5ELBA 3ZHVA 4JYBA 2NZ1D 5I9PA 2F3IA 2OTJA 3WG7C 2RDGA 4AQYL 3W5OA 2DYSC 1NMGA 4GX0A 1XTCD 4X66L 2UXDL 3VQVA 2IJ0A 5FO7B 4ZBMA 4YCVA 2GTSA 2WLKA 5L3GA 2DYIA 2B29A 3OTOQ 4KHPQ 3CF5A 1QCBD 2BSKB 2IL8A 3ND9A 4R4TA 4TSFG 1PH4A 3ZN1A 1SEBD 4W4KA 3MHBA 4LFCL 1Y74A 1EYGA 1ZLZA 5IWAO 1WDTA 1AR5A 4LC1A 3HRZC 2NVQH 4WZLA 1UEAB 1RD9D 2WLNA 4M1UB 1XJVA 4FF1A 2E2IB 1A62A 2HLDG 1HP8A 2XAGA 2YUAA 1VQKV 3CMEA 1JCKB 1B6QA 3EVQA 4W4LA 4H37A 1ZKOA 4E4EA 3ZZUA 3AVYA 1WU8A 1KAAA 2HIVA 2ATWA 1FJGB 4EVOA 3CPWB 5JCOA 1MBYA 4JCVE 4YIOA 1W6JA 1YXBA 3CCSV 4YWKA 4Y7CA 3JD0A 5ITZB 1XHXA 3BY1A 3UQ8A 1PH7A 2EULA 3K0DA 3R3OA 1OXSC 2QA4B 1GOZA 4WZTA 1XNQB 1WVLA 1TS5A 5JJLA 4C3HH 4LBVA 2DYRC 1PH1A 4UAIA 3T4ZA 4HYOA 4CDFC 1L1OB 3H0GG 4XOTA 1EFUA 1KABA 1TVCA 1IBMQ 3FPUB 1K8MA 3WQZA 5IT9N 3R2IA 3RR5A 4GOPA 4Z4YA 2GV9A 2GPJA 4PD4F 3X2QC 5FLMH 1DOKA 1S5ED 4P2CB 1I18A 4JV5Q 2BGIA 2R72A 1SC5B 1EXMA 5LMUO 2LMCB 2ZL6A 4GT1A 1HNWO 5EBWC 1VQMV 1UE1A 1A15A 2DJVA 2E2HB 5CV4A 2MQHA 1TGOA 4YHBA 4WWVA 2GUZB 4A3CG 2RVLA 1I5YA 3BDCA 2HLDA 5C4XG 2LJ2A 4CKEA 3D26A 1BX1A 3ASRA 1GAXA 2DNEA 1XPOA 2H4OA 1A6XA 3VMFA 4BPRA 1UD8A 1WOCA 1W35A 4DR3Q 5HKKA 1LABA 1Y14B 1WP8A 1AE2A 2CWAA 3PUYA 2JK5C 4EB6B 4AIMA 1AJPA 2ZE7A 3A0RA 3A3BA 1EYCA 1IBKL 1DOLA 3QO7A 1JOOA 5GV8A 1F23A 2XEXA 4LF7Q 4GX1A 1SNDA 4IPDA 4DV1Q 2F4VQ 4A3BG 2K5NA 3RD4A 2BH8A 2E2HH 1XNRL 1MABA 5IYBH 3ABMB 5CV9A 5IT9E 1Q3LA 2PCFB 3UE1A 1O7ZA 3HOVG 2VBSA 4BY1G 2P5ZX 4K6DA 2UUAB 4P2NA 4UZUA 1F2ZA 2CW0C 1MSWD 2ZZEA 4Z4ZA 3MHSC 1AMOA 1EY0A 1VQ9V 4O4JA 3JQQA 4K2KA 5EGTA 4OPSA 1B06A 2WSSG 3J81N 3CHXA 1PDQA 1V1OA 1W0KA 1E79G 4IOCA 4WJ3M 3OGCC 4LF5Q 1VQLB 1CT1D 5KRUA 5H6QA 3F2UA 4MSWC 4OPHA 1VQAA 3H1KH 1I50B 2LFNA 3AG2C 3A54A 3VA7A 1WN7A 5LHHA 2ZZGA 4FZ1A 1PFBA 4O42A 5KNDA 2BH2A 3HG9A 2XOKG 1JB3A 3B77A 2DY1A 4RAUC 1TLLA 4WZEA 1G7RA 3RT3C 2WAMA 1Y6XA 3D3IA 1PH8A 3MVVA 3OMIB 5BR8L 3JSLA 1F9SA 2NBFA 3CXHF 3OTOO 3U0ZA 2CDYA 4FLVA 4PG3A 3U50C 3LNNA 2DYRB 4O4LB 4B3MO 1GAQA 1EIFA 2DNCA 4XDXA 3UDFA 1FRQA 1NBMG 1EIHA 2JIZA 4JI3L 3HOWG 3G71V 4CDCC 1R73A 2JGDB 2Y69C 2YIBA 2ZNIA 5LHIA 4PA9A 2AW9A 4JBJA 1V1PB 4TV9A 4UXNA 5M5WB 5IYZA 1PTOF 3CRMA 3LDDA 1G7CA 2K04A 3EHBB 2YWHA 2F0HA 3I56B 3CXCB 2F0LA 3KDFA 4DFAA 5C3WA 1GN3A 1CNFA 4JI8O 3GWKC 1G4YB 2WFWA 1R5BA 4K5VA 1CFMA 3FB7C 1QX4A 1KDAA 3S15H 5F4OA 1BDOA 1NS1A 4FLUA 1Y1WG 1H95A 2VW9A 5EYPA 2Z3YA 4DR1B 1XMOO 3K80C 3VYRA 2N49A 4J8QA 3HOVB 4XMYA 1E2ZA 1I4XA 1VQFA 4NW2A 2JA9A 3ABLC 1IYJB 3I4MB 1LT4D 1VEWA 1XHZA 1JR0D 1FNWA 5FLXN 2OYNA 1QZGA 4WRDA 3ULJA 2PLFA 1SQGA 2RQ6A 3MHPA 3HOUB 1SRYA 1P7GA 1YSCA 5BR8Q 4RHSA 4QL5A 1I94O 1SNOA 1VF6A 1VQNB 1BKBA 4II3A 2YC0A 4PC6A 4HJ5A 5H1SE 1S5LZ 3CYOA 4Y7NB 2EX3A 2JN4A 1B2TA 4BAYA 3QO5A 1NAPA 3GVMA 1YHQV 2K01A 1GTOA 3WYAA 5CDFA 2PW5A 3RUZA 2VNHA 4DV5O 2ZXWB 4DV7O 1F9QA 2Q6LA 1TUBB 2QGNA 4DQKA 2K4KA 5ELOA 4UCUA 1VMGA 4X89A 4PDVA 4C2MH 3ZHTA 4D7SA 5BMVA 1NDHA 5D3IB 4RUEA 3VQWA 2V7VA 5KNCA 2XNCA 1CP9A 2YEVB 4LFCQ 3ASNC 2RMKB 4FIPC 5KSWB 1X3GA 4A93G 3D31A 1AJNA 2UXCQ 2VQFB 2MNAA 4KHPL 4PC3A 1N8RC 1SSOA 3HKBB 3CMEV 1S40A 4GKJQ 4GQNA 1SESA 3I55A 2VUMH 4C3HB 2BPOA 5T1IA 3L72H 4Q6GA 4CH5A 2KKWA 2DOGA 1F2YA 4BS9A 1AW7A 2Q7EA 1H9JA 1M1KW 1V9PA 2XT9A 1PZJD 3ZMUA 4PDRA 2BN4A 1CQXA 2KG7A 1TS4A 1F20A 3IL8A 4N9TA 4UDUC 5C5MA 2PQAA 4RPDA 2OTLA 2F0DA 4K14A 4YXWG 2LZJA 2GVBA 5D14A 1XNQQ 3MC0B 1D7QA 1JT8A 4UY8C 2KJXA 3G7LA 2I1LA 4FP5D 2K28A 4KY7A 5FJ8H 2A6HC 1RDPD 1QGZA 3D4WA 3OYYA 2EIFA 3AK2A 1RSOA 1XMOB 1JPXA 4N3GA 5DSZA 2YI9A 4JASA 1D2EA 2K14A 3KF6A 5L46A 1XQBA 2Y69B 3K03A 3P20A 1Q5OA 4HSPA 2K5DA 4R6ZA 4KI0A 1NZ6A 2ZT9C 3OEEG 5C44H 3W2FA 4X1YB 5HY6A 3JD3A 2I0QA 2EZPA 2FTKA 5THXA 1HR0L 2F03A 1B23P 4PMCA 1BE3H 1B3QA 5FO9B 4JTDB 4CQJA 2UXDQ 3CB4A 3H3VI 1DDIA 3D3QA 3ABUA 4GN3B 4Z2WA 3RYHA 1ZEQX 3GTLH 1AIPA 3W5HA 1BBUA 2BE3A 4R1JA 1R9TH 1VQ7A 1PTOB 4IALA 2A74C 2NTSA 2YDEA 3ZRWB 4G6IA 3ZBUA 1DGSA 3H6MA 1BQQT 1NJIC 1SKYB 2IW5A 3G4SB 4B3MB 1F2LA 3RBZA 2AXTZ 1YX2A 1STEA 2B7CA 1H2LA 2FJ2A 4LF4O 3U2QA 3K0XA 1U4LA 5GAGC 4X88A 1U4PA 4XYQA 5LMUQ 1WTWA 5B1BB 5C8YA 4GN4B 3M7NA 1Z47A 4DKAC 2DY7A 1Y1WH 3SPJA 2AHOB 2ES2A 1S76D 5ISRA 3T13A 2JIZG 1FXKC 5LA6B 5LYJB 1WTHA 5ELNA 1EZJA 3TP5A 1RODA 2HT1A 1FJGO 5IK2A 1EFRG 1SZTA 4E0FA 4F6RA 3HOYH 3CESA 4X62L 1X32A 4P9PA 4KN7C 2KCTA 1EL0A 2X7RB 4H02A 1Y76B 2BDOA 3D36C 4JOIA 4LF9B 3IC9A 3K9SA 3WG7B 2X0KA 2OT2A 1EEID 1TWGB 3VDYA 2DYSB 2VNIA 3H1JH 4KFMA 1XMQO 1VQGA 1PL0A 4PI0A 3K81C 3WU2Z 1W2BA 3DC5A 2ZXWC 4WBNA 3Q4HB 1N08A 3CRZA 2B39A 2KCCA 3CRLC 1V55C 1CQFA 4AI8A 4IOAA 1UFIA 4DRXB 3KLRA 4RQEA 1KTVA 5JQGB 2C78A 1HZBA 1N34B 3ASNB 1Z7TA 3C1FA 3OMCA 4DNRB 3DWPA 3UE0A 4A75A 2IHFA 4RGOS 3HOXB 4L5RC 1SQPH 1FXKA 3CJHA 3FFQA 3E83A 3C1EA 1MJEA 2CK3A 3WNDA 4A3JB 1BHAA 3ETGA 2CFMA 1KMIZ 3JAKB 3RYIA 3D3RA 5LL6X 3S2HH 4I55B 1OB2A 1HW7A 2BOCC 5EYPB 2PMZB 4DV2O 1A8VA 3KEWA 4UCSA 3CCSA 2VYQA 1XXGA 3J81L 3GB7C 3OZWA 3EN2A 2V4DA 1N9WA 4FPPA 2WAQB 5K36H 4CHTB 1SERA 3QG1A 3CKIB 3M99B 2M7WA 4BIUA 4GKKO 3K04A 3V76A 1KD1D 1UMKA 1I4HA 1ESRA 4CKCA 4TV9B 3AG7A 2XRSD 3D6WA 3JD4A 3FKIH 5HGTA 1L1OC 2WB1E 4A3MB 4DN4M 4WFAV 3M7GA 1IURA 4I65A 5IOCA 3HOUH 2UXBO 2YIDA 3GV3A 5K5PA 2NN6G 4XLCA 3OR6C 2JJ1A 2DGYA 2N8NA 4M1KA 1ZM4A 1PJ7A 4FF4A 1YZBA 4XR6A 2BOBC 1SFOH 1XTDA 1QVFU 2A69D 4DUZL 1I6HB 1IBKO 4ZIBA 2VZLA 2SDFA 1SMXA 4LBYA 2Y4UA 4WCEV 1YJNV 1QNMA 3I4NB 4A3BB 1G8MA 1ELOA 3AG4B 2E1BA 4X7FA 2LFRA 2A6ED 3CCRB 3G6EV 3DEOA 3ITPA 3MXGA 2RDCA 5L3CA 2K5VA 3E5SA 3QO2A 3GTLB 3CCUV 2JEXA 4JI4B 3ISXA 3JAWA 3LVBA 1DTOA 3FAVA 1NE3A 1WD0A 1D8LA 3E1YE 1AI6A 2DCUA 2F0GA 4O2BA 1FNCA 1V0FA 4QFMA 1D1IA 1LT6D 1M1KC 3GP7A 4FLTA 1GHJA 3Q8DA 3WNBA 4UB6Z 2PNRC 1LO5D 4HMIA 2OIEA 2HQLA 3T1HO 3U4VA 3EROA 3G6JB 4K8JA 3BPZA 3S16H 1W9XA 3LWEA 4B3RB 4KN4C 4H9GA 3VR3A 3SEJA 4IHJA 4LF8B 1GD7A 4ME5A 3Q0AA 1PNKA 2OQKA 1IBMB 4R4OA 1GVHA 1TUBA 3CPXA 3NBIA 2YICA 3ABMC 4HR7B 1H38A 5A35A 3CCEV 2PY5A 4LF6O 2QR4A 4EKWA 1IZ6A 5KUKA 4DR3B 4TKOB 1TWCB 1MGSA 5IWAB 3CCQA 3GWOA 2N78A 1F51A 2BGJA 4TRDA 4G2KA 1UJWB 1VHEA 4H7BA 4P12A 4RCYA 4ASUG 5C93A 2HHHO 4M8AA 4IW3B 5C3EG 3PO2G 3AB9A 2ZM6B 2Q7HA 3RY8A 4JI1B 2XWBB 4G5GA 5LP6A 4DV5L 4LC0A 4MVMA 1B3AA 5LL6Y 3I55V 5C0XI 2EIXA 1DF4A 5J2TB 4ZKCB 1DDGA 3KCYA 3GTPB 1RIPA 2Z5UA 1FFXB 3SPHA 1NCVA 4JGSA 1NUCA 3OOCA 2UXCL 2R9RB 1HVXA 2CWPA 1NVPB 5ELCA 2B63H 1MJCA 4X20B 1N33O 1U96A 2F1MA 1W2BU 4PMWA 1Y4MA 1ET6A 1COWA 1J5EB 3FDTA 2E3CA 5I2YA 4DR2Q 2CW5A 1TS2A 2JYOA 4LF9Q 4R7CA 5KHHA 1JOKA 2HD3A 3VYUA 4LWSB 1ORQC 3KLWA 4TQFA 1B9MA 1BXTA 1MABG 3FHWA 3W3AA 1Q8KA 1SQBH 4YJ2B 1IXRA 3V05A 4UV8A 3P7JA 4JI4Q 4EH1A 2ZXPA 3OIPA 1DOMA 1JA1A 4X1YA 2JGDA 2L1BA 5IWAQ 2J4XA 4BXXH 4RD0A 1XBLA 3A8TA 3NR7A 2X3UA 3SYAA 3FX7A 1VQ6B 1CQVA 4X64L 1EIYB 2R7ZH 4FDBA 2KUMA 4ZI7A 1H2SB 1SFOB 1X65A 1KC8D 2NYZD 4KMUC 1QUQA 5C3XA 3PO3B 4JG2A 2UUBB 3A56A 1HNZO 4LFAO 4XQQA 3FEWX 3CC7A 3DXRB 3RWRD 4DR4B 2LGWA 4LFCO 2Z9HA 4B4DA 2LKVA 4U7NA 4QHYA 1XNRB 3A8IA 3GTKB 3J7A5 1FD7D 2WWWA 2KEDA 5KA5A 1VARA 1U5KA 5NUCA 1VMPA 2PZTA 5J39A 2IWHA 3OAAG 2H5XA 2N05A 5ELEA 2R7FA 3ND8A 2GBOA 1ZL8A 1T6XA 3DDYA 2MO1A 3F7YC 2AKWB 3ABLB 5LXTB 3SLDA 3FMCA 2Q8IB 4A3EG 2QKSA 5CBFA 1XILA 2PMDA 1SN8A 3T1YO 4Z1MA 2F4NA 4GKKQ 5HFMA 1FNMA 1Y0YA 2Z6BD 5C0XJ 1R4QB 1A2TA 1XMOQ 1Y1VH 1AZPA 2NZOA 2W6JG 1YLOA 4GKJL 4FLZA 1VQ9B 3ZCCA 4PQXA 5B1AB 1S4MA 3CCEB 4P2ZA 4MTOA 1SDFA 2E2JH 3GTKH 5JEAG 4YHHB 3S17H 4N8FA 3L2PA 3ZBTA 4QY7A 5J3BA 3ZC3A 5FLXL 2Q8VA 1N34O 1LV9A 4B3SL 5AG2A 4YJ3B 1Y76A 4K8XA 5KNLA 2QEXV 3HKEA 5IP9G 2UXBL 4A3FH 4I50B 1L0WA 3RW0A 3E86A 1KKDA 3E0EA 1YDXA 3H9VA 4IYHA 4QIWB 2OBRA 2KB1A 4JI7O 4ZCLA 2D0OA 2YSUB 2EPBA 2SEBD 5CC4A 3KOJA 1PXUA 2A68D 2I5LX 3MHHC 3I70A 4NKLA 3FVQA 5B66Z 2XUMA 3H9NA 3BCFA 1TY0A 4LFCB 4LF9O 3MFGA 4HIDA 4DW0A 4C3IB 5M5XB 2QEJC 3QJYA 1Q7YC 1STHA 4DAMA 2UUBO 3CCUB 2IT1A 4UCVA 1Q81W 2X6GA 2YTVA 1QLEC 1AR4A 2YYZA 5CB4A 4JZ2A 4NTXA 1XEQA 4O2BB 3CCRV 4JI0B 4MW8A 2YTXA 2DJFC 4IFDH 4MVUA 2EFGA 3CD6V 1VQ5V 1V43A 2OF1A 4KY5A 2DQ0A 1E43A 2F0KA 1FJGL 2PI2A 5DNFA 3FD9A 1YITA 2F66C 3QFCA 4P25A 4LNQA 3QWNA 5IP9H 1JB7A 2EILB 3SE0A 2BM0A 4YAUA 3I4NH 3VR2A 3K59A 2Q8RE 3BH4A 2WLLB 5BY1A 2ICEC 1I5XA 2ZTCA 5M3FG 4LF4L 3A8KA 4J6HA 4DR3L 3P75A 3ASQA 4YY3Q 2B2YA 4LK1C 4HJ7A 4A3LG 1HHVA 3EJIA 4NXNO 2CQOA 4LF9L 2ZT9B 2B2WA 1JNYA 5EPJA 4OPAA 2PF4E 1CSQA 3MAQA 2QWOB 3S15B 3TDQA 4BW5A 3JAWB 2EYLA 3H0GH 4X06A 1LTLA 4DV1L 4LWCA 3LQEA 4RH6A 1SQXH 1S77D 3JQRA 3B8MA 1PKXA 2QA4V 1EZ8A 5IJ9A 1N34L 3H91A 2ZM6O 3ONYA 1SYGA 5EK0A 3Q6QA 2PQAB 1K92A 4F87A 1Y66A 1TTTA 3LDEA 3ES9A 3BU2A 1P16A 4BA2I 2IJIA 1XWEA 2UUCO 4IUVA 4TUYA 1K8AC 5C3EH 1S0VA 1UE7A 3CCJA 1PZKD 2CAZC 4ALPA 5EKLA 1FVIA 3T56B 1VQLA 4A3LH 4I9QA 2W6JA 1NTKH 5TSSA 2XN9C 3QOLA 1Q1BA 4JW0A 3E22B 1C7YA 3PO3G 1FXKB 4P26A 4JPRA 4X62O 1CNEA 1YVWA 1S72V 4UZFA 1SBBB 2DY8A 5COYA 5DEHA 4DAVA 2R92G 1HNZL 4LFAL 1HA6A 3CC4B 1EY7A 3E89A 3RN5A 4C3IG 1XL4A 3CP8A 3L70H 4HMJA 4BWGB 2KEEA 1DXMA 5AFWA 3CRCA 3JCUZ 5IYCH 1IBLO 1N0UA 1N4CA 2P4VA 4AYBB 1B50A 1WTRA 2UXDB 3MTSA 5A89A 1K9MD 1TWGH 4B08A 2QF7A 2JVDA 5CV6A 3QF7A 1JMKC 1V55B 3WB0A 4XONA 1UWVA 3G4SA 1SAPA 5J2TA 1Z6HA 2HCJB 4FXGC 3KJOA 1CM9A 5JVDB 4EB6A 1QVFB 1R3IC 4X9QA 2B2TC 5KAFZ 5JJNB 2XHBA 1D5ZC 3CRQA 2UU9B 2AUJD 3O65A 3D4RA 3PGZA 3WWVA 4A3MG 3LQ6A 2UXDO 1V54C 4O4IB 3QE2A 1KBHA 3GTGB 1G1XB 3SYOA 1IBLB 2F95B 4X64B 4G28B 2ZZFA 1E0BA 2BDNA 2EYPA 4PABA 2WLMA 4XXEA 2JEBI 3DHQA 4FWTA 1WAZA 1ILPA 3KKYA 4Q5VA 1QLEB 5CA0A 1EY4A 5KEEA 4OX9B 4PZ6A 2E5LL 1MHWC 5KYIA 2HHHQ 4YALA 4FZ0A 4PV1B 4CH3A 1Q86D 2K6AA 1J5EL 4JYAL 5HXBA 1CKNA 4RCNA 4RDJA 3ZIAG 4IHJB 3STZC 3AU7A 3IRBA 1K9MC 1D1KA 1WCMB 1YHQA 2JA8H 1IL2A 2KHJA 4IFDG 4ZHQB 2BE5C 2E76B 1M56B 2JS5A 2GA4B 3THOA 3NQIA 3BDLA 3GSIA 4KK7A 4RGTA 1IBML 4KD3A 2IW3A 5M5YH 3NE5B 1OXVA 2KA7A 2W0FC 4RPBA 4J41A 1M5IA 1EWCA 3H01A 1XB2A 3QVNA 3IC7A 3GTQB 1NTGA 2HKOA 4X62B 2B5OA 1CKOA 3T4DA 5C0XH 1N32O 2QGGA 1YJNA 5IYRA 2R9IA 4B43A 1TVXA 5CV8A 2NVTH 3AG4C 4ZCMA 4DAYB 1H2NA 1FD9A 1KYOF 1QFYA 4X7EA 1JE4A 1Q46A 5IJ9B 4P72A 5JBQA 4RG1A 3RLNA 3RZDB 1KZLA 3B09A 1PFNA 3D4DA 3E9IA 4HE5A 3MMPA 4Z4SA 2EYFA 2P67A 4BY7H 3AGQA 1UD6A 3NTHA 3E3XA 5GADC 3UO2A 1A32A 1M4UA 2Q6OA 4B7KA 2C5CA 2I5MX 2NVYB 3CMEB 1CPYA 3PQIA 4TSSA 1LR1A 4HJ8A 1Q90A 2ZIOA 3FKSA 4JBKA 4O2DA 4WJ4A 1ZM2A 3CEIA 2WPDA 3SJBC 5B3SB 3ZBHA 2ZXIA 3AVWA 4QMGA 4RCOA 4JI1Q 2IX0A 1KDCA 1VMCA 4DR2O 1YTFB 2K1BA 4YJ2A 1I4GA 3TXQA 1YNXA 4TQUS 1VQMA 3WB1A 1GUTA 3MEHA 3NP8A 4RWUA 1QZHA 2D9UA 4EQOA 5LMNW 3HKCB 2R6HA 2ZIMA 4ACBA 1VQ5B 2LW7A 1WPCA 2AWOA 2MGSA 1E24A 1N33L 2JA6B 4A3GB 1FFTB 3WBKA 2RHQB 2L6LA 2XWJB 4Y9RA 3GTOH 3TS2A 2XOKA 1N07A 1W59A 1YJWB 1HUMA 1GRJA 3J80c 3BA8A 1F9RA 3I2ZA 4RM0A 1EYDA 2PI4A 2GK6A 4QPKA 3WY9A 4X7CA 1ESFA 3NWTA 1BBWA 1WD1A 2R93H 2PTMA 1RPRA 3ETDA 5F2VO 4G4KA 2M5SA 3KFUA 1HTLD 2OBSA 1BO0A 1WOOA 1CZGA 1FR3A 2K75A 3MWYW 3A5UA 4A76A 2B2TA 4AILC 3O9OA 4JI0O 5LP6C 2AHZA 4WF9V 4YHHO 1BMFG 4JI8B 4B3XA 1Q7YD 4FMTA 1IVSA 2JJ1G 1EWIA 2NUCA 3R66A 5FKAC 4OWWB 1E63A 1YJWV 5A2QE 3S1QH 2GQFA 1WTOA 4WBNB 2ZINA 5KHKA 4F7XA 1F60A 4RKLA 3HS0C 2LS01 3Q3AA 2B2UC 3KLSX 4XT1B 2NV4A 4WJWA 4JAAA 4Q7JB 2WV6D 1Q86C 3W7WA 3RN4A 4Z1VA 1BCPD 1WPBA 3NTIA 4UPAA 4NXNQ 1VF5C 3I56V 1L2FA 2JJQA 1STGA 1LTTD 2ZXRA 1K73C 4BBRB 4BBSB 2JA5B 1EWYA 3H15A 3TXSA 1SF9A 1I0HA 3GTJB 3A8JA 1I4QA 1TWAB 3M85A 3A3GA 2A7WA 1Q9SA 2F4VO 2P22C 2AHOA 1PH5A 2KQXA 5JH7A 1OCOC 2ZCEA 4Z4UA 3J81k 3M7MX 4JK1C 4O0AA 2IY5B 4Y52H 4A3EB 3A1PA 4OIJA 2P90A 1KK0A 2V1CC 3KF8B 3K3WA 4PA6A 5FJ8G 1XREA 2JA7G 4LUVA 2NVXH 1B4OA 1FGBD 5H6RA 1CK1A 3J7AU 2Q6KA 4B3RL 3KL9A 1GO2A 4JAUA 2OCHA 3W7SA 3K5LA 4DV1B 1DARA 4O4LA 3F8TA 4APVA 1HNWL 4DR6L 2OTJV 1HPCA 2CRVA 3RZOB 1AILA 3H1IH 2G5DA 5IYBG 4RKBA 5IYPA 1H2KA 1K97A 2JJ2A 3S9WA 3PIOA 1IZ3A 1ICFB 1MZFA 2K33A 3TEHB 1KRTA 4K0KQ 2VQEB 2BF4A 1XMQL 1E7ZA 5DM63 1JQ0A 4OX9L 4PNYA 5M3MG 2WLJA 1WB7A 4KY6A 4LF7L 3K5MA 3CW2C 4A93H 2ZL7A 4GZRB 4R4CA 1O9HA 3H1LH 5B3SC 3JYCA 1JE5A 2AUKA 2K50A 5CYUA 3W1GA 2X6LA 4NXMQ 3VOUA 3M4OB 2VJIA 1VQKA 5FPRA 2GDSA 1IW7D 1AFPA 4NNJA 3HKZG 2WLLA 4P75A 4C3JH 1XFOA 2LFSA 5B1AC 1X55A 2F0VA 2Q5ZA 2D3OW 4XDJA 3FKIB 3HFZB 3NUCA 4G1BA 1PV4A 1HR0Q 1FYJA 1BR9A 4MVSA 4DW1A 3B82A 3T1YQ 1Y1VB 3CCMV 3PMFA 4FJCC 2CBXA 2W6IA 2Z6KC 1EOVA 3FB5C 3KBXA 3LX0A 5E4XA 3VR6A 2YU9H 1A8PA 1D5NA 4DF7A 3UCSC 3I55B 2XTIA 5EJWA 4DXWA 4QQBX 1VQ8B 3UM7A 3HKBA 4FFKA 1IYUA 3KBGA 2IJKA 4V0BA 2VBVA 1BMFA 4J10A 2RQXA 4L8JA 5CN0A 2WLHA 2YIBD 1I08A 1HNWB 4GN5A 4BIOA 4A4IA 1D1NA 2Y0PA 3PUZA 2VNKA 5JVG3 5LP6B 4DR2L 5LMUB 1O7LA 1JORA 5FO1A 1S5HC 3TS0A 3LSUA 4X66O 4LAAA 1W87A 3DLLA 4HCSA 5IT9c 3E2EA 5DECA 4JI4L 3ZMZA 1H9SA 4A3GG 2EINC 3JASA 3CC2B 2W0XA 2WB1G 4J7ZA 4FM2A 1E1RG 1F2MA 3U58A 2QJ1A 4OXSA 5KAIZ 4RQFA 3Q6RA 5GTIZ 1OXXK 4WFN3 4A3DG 1FXHA 2WA4A 2EJ7A 4XLEA 2ZBUA 4NXML 3I3CA 2EILC 2ICIA 3NEMA 1X3FA 1HXYD 5LOVA 2LXJA 3HOZB 1XNQO 4JYAQ 2EY6A 4F6RB 4MNOA 2A68C 2WLIB 2QTLA 4JYAO 4DA2A 4DXFA 3L71H 3ASSA 3BC9A 1EY5A 1D2BA 1SMYD 4AQYO 1VQ8A 1QVGB 2Q2UA 1VQ5A 1OCCB 4JYYA 4I4TA 2PI5A 5J35A 2EQSA 2G9DA 4IUTA 4OGQC 4ME3A 5KIXA 1OTCA 1H2GA 3R6KA 3NTKA 4RA8A 4ULLA 2B63G 1ZL8B 4JV5O 2F0SA 3HOZH 3M9BA 4P9SA 4LFAQ 1HNZQ 2O57A 2X6WA 3OUFA 3E8BA 4K3AA 1R6NA 1PTOH 4O2AA 3H3VH 1XPRA 4Q0FA 4I0XB 1FGUA 4Y7NH 2UXBB 1NBWA 1XL6A 2CVRA 3CQZH 5EBDA 3BQJA 3GTMH 3HOYG 3A0JA 2WA3A 3BZDB 1CSPA 4KD4A 1LUWA 1XI1A 3G80A 4R9WA 4LF6L 1KP2A 4DV2Q 4B3SB 1UNSA 1F4MA 2VQEO 3CC7B 2D5DA 2A6EC 1QUQB 1N32Q 3CSXA 4KP4A 5EAYA 4WQMA 3I90A 5IIFA 1M90D 5M5WH 5IP7H 4LF5O 1QLNA 2UXCB 2E8GA 3S14H 3JD1A 4FK8A 3QNEA 4OEMB 4LBWA 1I94L 1MNGA 4DR4Q 1FS0G 1K83H 1GUOA 1HA5A 4B9WA 1DD2A 5EMNA 3ER0A 3J81c 1CEZA 1EFID 5JPNC 4O4HA 1Q82D 3BDOA 4TWKA 4CZZA 3MXPA 4ZAIA 1PH6A 2BSKA 3FYEB 1LTBD 2ZE6A 2PI2E 4DUZQ 1PVOA 5CA1B 1H8EA 3ZRSA 2R7DA 3T1HB 4GLAC 4KLKA 3L9DA 3TJTA 2V7UA 3S1MH 1W3SA 4PZ7A 5BN3A 1WTPA 1AP6A 1P49A 4ODGA 3S1QB 2P4KA 3N27A 1Q90D 3NXSA 3TN2A 3S2HB 2O4XA 1LYLA 4HN7A 4X0CA 4BW9A 1QHTA 4NP5A 4DAPA 1FFXA 1TR5A 4NMZA 3BZCA 1KIXA 4R71A 2RCVA 2VJJA 4CJ2C 4EQ5A 2IHEA 3G71A 1NR1A 3JAKA 2VS1A 4ZQ3A 5IWAL 1IYVA 1V54B 2ZDIC 1CHPD 2JA7H 3RMHA 2CC2A 5C44G 4DV4Q 2Z1CA 2V1DA 4EFBA 4LCUC 4DV6B 3JQPA 3NSWA 3R8BA 4XM3A 2Y0SB 4IJLA 4JV5L 1KTKA 4BR6A 4I50A 1PRTC 4J15A 5JJKA 5DLQE 4FF2A 4YJ3A 5LMNB 1QGYA 5FLXE 4C2MB 4LF4Q 3CCQB 2XRQD 4PV1C 1YF2A 2PE3A 2ZZQA 4U9UA 2L9HA 3TBIB 3SJCC 4CGYB 4TOIA 4V190 2ODMA 1QUFA 1AH9A 1MIUA 2N88A 1VS0A 3B6YA 5EIBC 2IJJA 2Z0AA 3KCXA 5KX5A 2WJYA 4GKKB 3BYYB 3JARB 4RHRA 2PZSA 1I6HH 2QWNB 2E76C 3V2TA 1VF6C 1M56C 4WFEA 4DR7B 1ONLA 1TKWB 4J9YB 5CMUA 3AVUA 1J5EO 4F7DA 2X0LA 3G4SV 2Q0OC 1OCCC 1RFYA 5HGQA 4OGQB 3HAGA 1K8AD 3EXAA 3VBBA 1UPGA 1MOFA 2XAHA 1QCEA 2RDFA 2F4VL 4ABNA 2FB5A 1YZ6A 4J0QA 3D0FA 3RYHB 3SPIA 5IP7G 5LMUL 1UAPA 3FAVB 4C1NK 4OXPA 1WOPA 3HKCA 4X3UA 3TQYA 1K0SA 2KCNA 4JTAB 1R5NA 4GLXA 1G2TA 2F0NA 1ZM3A 2ZM6Q 2JJ2G 4LUOA 1VQOA 5E7NA 4XN0A 1S5CD 1ZYRD 5FA6A 1XQ8A 2RSOA 1V1PA 2FFKB 3ASPA 1OZ0A 4AC9A 2OWOA 5F2DA 3QIAA 4JI2Q 1DG1G 4QIWF 3CCLV 3ZHRA 1VQPV 4LBZA 2ALYB 4A3EH 1GHKA 1JJOA 1XMQQ 4RJLA 3ULLA 2JN9A 5LBQA 4MZ9A 1WOSA 1DCZA 2A06H 4GOPC 2R7ZG 2B63B 1H85A 4XBFA 1M90W 3JAMc 1YIJA 2K1EA 2Q7GA 1WA8A 3BA9A 3OE7G 5FLMG 4LF8L 4IT5A 4X65L 3TP6A 3A35A 4M53A 3S14B 1SYBA 2M9VA 3MD0A 4B3RO 2L11A 4XTCS 4OX9Q 2I46A 1Q82W 2FKXA 4MTGA 1E3XA 3SGIA 3JALA 1IXMA 2EOTA 1N06A 1JCHA 2MPMA 4QB4A 1LTID 2Z6KA 2A3QA 5IYCO 5IYDG 1Y1WB 3ULPA 1XNQL 3QO8A 2A73B 3E9HA 4A3FG 1L8DA 4DR6O 1HDJA 4IPGA 3ML0A 4TN1A 4J80A 1BSMA 5M3FB 2D74A 4J1MA 3GVJA 3IKJA 1X9NA 4B47A 3J7AV 2K9PA 4P30A 5E4WC 1HFGA 1STAA 3TP8A 1C4QA 2ZD9A 3A2FA 5IYQA 5HFLA 1GN4A 2RNBA 3W7UA 1KD1C 4UCTA 5BXZA 4FXKC 1C0AA 5JQGA 3BZKA 2G9HD 1ROPA 3QSYA 5BSXA 1RKNA 2BCOA 2F52A 1SETA 4KJOA 4ZGNB 4LFBB 1I94B 4L87A 2WYRA 2JA8G 4LH7A 3PO2H 4OP7A 3DC6A 3DTUB 3B78A 4DV3L 4ABMA 5A2QL 1WNSA 1VF5B 5M5XH 2QEXA 1PHJA 2XZPA 1N34Q 5K1XA 2LSSA 1FYCA 1HZCA 3CTAA 1NR7A 1WLEA 2PZWA 1IBKQ 3BY6A 1SRUA 2EJGC 3RLFA 2E2DC 2AGAA 4XYOA 2FXQA 1SMYC 4P74A 1YI2A 1TWAH 1OCOB 2TSSA 3NBHA 4R8NA 1KMHA 3JAMi 1B44D 2A1AA 5J3OA 3HKSA 2D3LA 2HDNB 5IYCG 5C44B 2QWPB 4FLWA 1K0RA 4U7OA 4DR5L 5JVDA 3K57A 2P6JA 3CP1A 4QE7A 4OIKA 5CGKA 2YXLA 1G91A 1VQEA 3J7ZC 1MMMA 1N36Q 3I5DA 3U11A 5FLXc 4YXWA 1QVFA 2FX3A 2HFEC 4X8AA 1EM1A 1A0IA 1LTSD 1QILA 3PVDA 2WIIB 3FKIG 3I7FA 4YCUA 4OL7A 4N8X1 4X05A 3U6KA 2F1LA 2ZTNA 1BCPB 1MSHA 2C5HA 2L15A 1SKVA 3T1HQ 4JOIC 3U9OA 1GVPA 4B9XA 4UUJC 1IJFA 5IE8A 1QWYA 4LF5L 4JAVA 1EFCA 1NR4A 3PIO3 1Y1VG 1VQ4A 2N74A 4MN3A 4A3KH 4MTFA 4RD1A 4DV0L 1FJGQ 4BWAA 3J80E 4NVPA 4XLHA 4CC5A 2VY3A 3ZN0A 4DV7B 3CC4A 4NCNA 2IBZH 1BS3A 5IYZB 4DV4B 1M93A 3G71B 3EQLC 3S24A 4LF6Q 4GOPB 1TS3A 2D9RA 3EIVA 4GYCB 1L0NH 5A88A 3E0JA 3ZHQA 1QR9A 1L0YB 2MUYA 2RCFA 3KF6B 4JI5Q 3M4OH 4IFDI 2F43A 4U68A 2B5UA 1I4PA 2QA4A 2R93B 4GX2A 3DXJC 1JWUD 1SZXA 2MW2B 4YWMA 2LGQA 1K28D 2E5LO 3WNCA 1E3PA 1LTAD 2OXPA 2F93B 4DXGA 3A8JE 2JA8B 1JMCA 4R8CA 1QG0A 4NTYA 4DV4O 1IL8A 2F0MA 5I6WA 3CX5F 4J11A 3ZMTA 2CGNA 5IYDH 4M2LA 1SE4A 4C3IH 1VQLV 3CE2A 4PAAA 1H2MA 4CH6A 4UZEA 1EFRA 2UUAO 4B3TQ 3W5VA 2FMCA 1VQDA 1F9PA 1A3TA 4DK6C 3QB3A 2MFIA 1FPOA 2ASBA 3OTFA 3OZVA 1BUVT 1GUNA 1LLRD 5H2FZ 2EE1A 3PN1A 1NQTA 1G6UA 1MG1A 2Y0SE 4Z4RA 1RJTA 1IHMA 4DV6Q 1OHHA 1N32B 2GREA 1LNQA 1BOSA 1KJZA 4Z4VA 3PUWA 1I6VC 3AFQA 3MCAA 5I2XA 5EIBD 5EPKA 5M3FH 2HDLA 1MI2A 1GM8A 2EINB 2XNJA 3WDNA 3AEVA 4R50A 4QGPA 4K8ZA 1H8HG 1SS3A 2ZR2A 1KRHA 1EUJA 1STNA 1QVGU 1RCVD 4NB5A 1J9OA 1LT5D 2D0PA 4C56C 1I7FA 2Y0IA 2OCCB 4IGGA 1X3EA 1VQ7V 5KMGA 3ZX6A 1SYDA 4P71A 3CCUA 1B8AA 1E1TA 3SDZA 4QJFB 3DM3A 1ENFA 4F6EA 4RD6A 2X6AA 1ENCA 4EFEA 3ZYYX 4GNXB 1PP9H 1D2DA 2WKDA 3J81i 3OEEA 3AMUA 5EKIA 2Q9LA 1JC7A 5B5EZ 1SYFA 5LYJA 1Q7YW 1Q1EA 5KYLA 4ZLTF 1DJRD 1D8TA 1QJOA 3BS1A 5KX5B 4MVOA 3X3NA 4A3JG 3P32A 4H13B 2DUDA 4K1XA 3WXMA 4QJFA 1HNXQ 3CD6A 1KXLA 1M1KD 3OJXA 1I7PA 5BSYA 1FL0A 4A3DB 1D5XC 3W1BA 4HJAA 3CRAA 1BCPC 1YJWA 4N21A 3J80L 4MIUA 1F4NA 3D8CA 2QM7A 3JASB 4DR5Q 4OO1H 1H8EG 1K34A 1E3ZA 1O7YA 5CV7A 3B2EE 2E1RA 2B8FA 2EXDA 4POGA 4Y9UA 1CHQD 1SA0B 2KCMA 4O1NA 5C4JB 3VO1A 2JE6I 4P3YA 2XZOA 1BQEA 1W6KA 3VQXA 4EQNA 3CCLA 2BVNA 2F0FA 3ETQA 2R70A 5C8YB 2RC5A 1FNUA 3MXUA 4EX5A 2ZM6L 3BHPA 2L0CA 1E22A 1GN2A 4CDDC 2LO1A 1M90C 4RDLA 4ZOLA 4A3KG 2LW1A 2VB3X 1AEXA 2BCCH 4GKJO 4F88A 2G38A 4N23A 5B1OA 3L0OA 2PO4A 4IIJB 1U4MA 5C4JH 2CCZA 3LDCA 1S4ZA 4IL6Z 1WI5A 1QH0A 2SNMA 3NHHA 3FPKA 2RC6A 1Y69U 5FK9C 2L35A 4RDKA 5LGTA 4DK3C 4JYAB 2IM9A 2X6XA 5IY5C 2F0IA 3SLNA 2C2AA 4Z1MG 3DMUA 2E2JB 1PD3A 4KHZA 2RSNA 1VQKB 4IIJA 2BV3A 4P6YA 2NWGA 3N2KA 4YWLA 4H44C 2ZJRA 3ZMVA 4JI6L 3D8GA 3T51B 1S5DD 1NU1H 3LUTB 1K8GA 1TT2A 3T1CA 2DN9A 1Y8OB 2QKCA 2R93G 4P22A 1VQPB 1IKMA 2QTSA 1D6EC 3S1NH 1M4VA 1TWFH 5D5PA 1PRTB 2QDXA 1YHQB 2WR8A 4X8IA 4RFBA 3T4AC 4OO1I 2K32A 3UDGA 4H0LB 1YITB 3TZDA 1KLGD 4G7XA 3OE7A 2OCCC 1F77A 5IGGA 1WTVA 2P5OA 1I8DA 1BBXC 2Z4HA 3RLOA 3E35A 1PH9A 4PC7A 1EY6A 5IGFA 2UUAQ 1GM9A 1TQOA 4GNXC 4JI8Q 1Q6UA 4B3GA 1JFFB 2F0OA 1VQNA 4MYTA 3TZUA 2N04A 2F3WA 1SM4A 2FHTA 5I6YA 1SR3A 4BXXG 4OOSA 2XZLA 1KRSA 3TGUH 5J9PC 2DETA 4HIOA 4XOPA 4K0KO 2BA0A 3O13A 1URFA 3GO5A 2DWEC 3Q4HA 1COWG 1K7DA 2JEAI 3GTMB 3CMAB 2FINB 5H5NA 3SJAC 1PRTD 5KLVH 3IFDA 4UB8Z 1E62A 3FJOA 2B2UA 1K9MW 2B2VA 5D65A 5J1ZA 3OT7A 4LF5B 4QUFA 5AJ3L 1W0JG 4JI7B 1VQ4V 1FNDA 3ZZ0A 4DV0B 1VQOV 3OZUA 1PTOD 2F23A 2Q4PA 2C9OA 2KHIA 3Q38A 3I56A 1KAWA 2ZXOA 1K33A 4MVZA 1GUGA 5KA6A 1NRKA 4PC1A 3ASTA 1H42A 4YEJA 2CH7A 4TSFA 3VNVA 4OPVA 2OT5A 1FKAO 2CF4A 2HJFC 2DIEA 1KQSB 4HNAA 1PL4A 1QNKA 1EZVH 3VNUA 1U0LA 3QOJA 1R3KC 5JJEB 3T2MA 4K35A 3CW2A 2A79B 4JV5B 3FB8C 4GS3A 1AZQA 1JJ2B 4DUZO 4KJNA 2FVGA 2UUCQ 4P9OA 3MXNA 4JI2O 1W0JA 2PQEA 4RGMA 2O5IC 4CS4A 3ZIAA 2WINB 3WOFA 3CCRA 3I4MH 1G6ZA 2P06A 1CA5A 1PKVA 1NI8A 3N2GA 3A7LA 5IJ0A 5CA1A 3HEJA 2EZVA 4ZGQB 3AVXA 4UP9A 3F5TA 3DGEA 5FNVB 3HOVH 4X62Q 2CTQA 3IFXA 3OWFA 1YITV 3UT5A 1P7BA 2OIGA 1YNNC 3HR0A 1S0UA 4U3JA 2OBTA 3TMEA 4F4LA 1OV9A 2B2WC 3AEIA 1K3EA 3HOZG 1NY4A 2VQEQ 4NDXA 1EQTA 3OEHG 4HEDA 2HHHL 1ASZA 4ZOLB 3S16B 1JJGA 1N8RD 3UDIA 4X1IA 1G6PA 1NTZH 1GJXA 3L73H 1X3PA 4O4JB 5AJ3Q 2ZNJA 4B3TL 1YHAA 1O7IA 2XGTA 4IZ8A 4FYDA 3OPOA 4CS2A 1TVKB 4PI2A 3L3OC 3CC7V 3JAME 3CCMA 1G7SA 4AVZA 2KOLA 2WAQE 3HOXH 2CTPA 1XYIA 2IJHA 2JP1A 3J80i 4DYLA 4ACAA 5A9GA 4XIGS 5B1NA 1TUEB 2BTQB 1PRTF 3S1RB 2VZAA 2R3ZA 3BVMA 2B2VC 4MS2A 4B48A 4OPOA 1H8HA 5LMZA 3SK8A 4AQYQ 3GTPH 3RYFB 1BGYH 1M57C 3PSIA 1QBZA 4A3DH 4LNUB 3GTGH 5KHIA 2KECA 4GKKL 2JA6H 1YI2V 4DV0Q 3OW2A 5IGDA 5C4ZA 1EN6A 3CJHB 4N3NA 1R3JC 2FL4A 2ID0A 1ZSPA 5L3BA 1W34A 1YJ9B 3JARA 3KK7A 5HURA 1T9HA 1EP3B 2EJRA 2CNDA 2Z0SA 1ZX3A 3SJQC 4CBCA 4L5SA 1U97A 2X85A 4XORA 1U9RA 3EBEA 4XD7A 1HCZA 5CBGA 1AJQA 4CS3A 1KDBA 1RQPA 4AQYB 2OK8A 4WORA 4XQNA 3PF4A 5F4JA 5EZYB 1E2VA 4X3TA 3SYQA 1GR1A 5G3LD 1EN4A 1I3QH 2JSOA 2VXWA 1AR1B 5DAUA 4HJ9A 3F2BA 5C4XB 1J6QA 3SXHA 3SEBA 4WFHA 3J7YW 1WTXA 2HHHB 2QMUA 2CQAA 4K2LA 1N36O 4A3JH 5LGNA 3CC2V 2WKCA 4PA7A 5DM6V 4RO2A 2UXNA 4LF7B 1CTMA 4FLXA 3AK1A 3CP0A 3N52A 3K0YA 3NK9A 1Y0RA 1KKCA 4IPCA 4L5QA 1VQ9A 1P4RA 5GONA 5J2UB 2V7WA 1ENAA 4KHPB 2SNSA 2HEPA 3GV6A 5LA6A 3GTQH 1YNJD 2HP8A 3VYSA 4GUNA 2R92H 4CC6A 2XTAA 3H3VC 3GTJH 2DQ3A 3FKSG 3CHBD 4RWSC 4C1NI 1R9TB 1NBMA 4ZV4A 4DV1O 1TAEA 3HKDB 4LF8O 1VQ8V 3K8AA 1RTOA 3OGIB 2JA6G 1EOTA 4BY7B 3BVOA 3CPWU 1NJIW 4JYCA 1E1QA 1FNVA 4LFBL 2F0EA 2F0TA 1IW7C 3P30A 1YTFD 3KDFB 3TREA 3CXCA 1R1BA 4J7KA 4E6IA 5KHJA 1KU9A 5CA3A 4FFBA 1NVPD 2F4IA 1BQZA 2XGJA 4ZKBB 5TV2A 2NR5A 3HOXG 2C5BA 4JPBW 2ZE8A 3PA1A 5IYBO 3E20A 4YELA 1WA8B 1ENVA 1PNMA 2QCPX 1MA1A 1NMFA 3L74H 4YY3B 2GJRA 3BFRA 1YNND 1PV0A 4DV6L 1PJ6A 1N0NA 3WBJA 4TUYB 5JAVA 4OX9O 4TVAB 2D3NA 4MTXA 3DWQA 1B70B 3RVZA 4FFBB 4DUYO 1K73W 2EBOA 1GK9A 1YEWA 2BE5D 5M3MH 4FNFA 5J22A 4DUYQ 1BJKA 2CW0D 2CTWA 1A3UA 2TMPA 5KNBA 2UUBL 3CPFA 3K06A 2ZJQA 2ZTGA 4MTKA 2VQFO 4KTAA 4D6TH 3V7AA 1OB5A 2KG7B 2PYJA 1MSGA 4LP8A 3T53B 1VQJA 2AWNA 4QF4A 3S2DH 2EIJC 1E2WA 2NN6H 4CJ1B 1JOQA 5JCOC 1HUNA 1M57B 3A8KE 4HAEA 2Q2TA 4JI0L 4OO1G 2LY7A 1C8CA 4HNAB 4YIPA 3ZUGA 3W5UA 3SPGA 2YWEA 1AE3A 5FO0A 3A55A 4JBWA 1KC8C 3JAMN 3BRCA 1LTGD 2NZHA 2VWKA 4I4TB 4ZYSA 1BX0A 4DV4L 4DR5B 1LUVA 4B3FX 3I4LA 4IJHA 3URYA 3C3TA 5C3EB 4U673 4ZHQA 5IYNA 2NN4A 5LOVB 3PENA 3DSQA 3NBHB 4H13C 3BABA 5FO8B 4A3KB 1JJCB 2YEVA 4B3SQ 4DV2B 2PGGA 3KYHC 4C3HG 4J7JA 2DJGC 3BAAA 1QQCA 1XX8A 4WZKA 2PMZE 2VL6A 2H3OA 4ID6A 2KBNA 1NSNS 2PYKA 3M3YH 2ZKOA 4C7UA 1CZWA 2HCIA 4KUMA 3ZMSA 2QILA 3BVZA 5CA0B 3SKBA 5LL6S 4P6VF 1EFWA 3STBD 4IFDJ 2EYMA 3NXWA 2WJVA 1HNXO 1VHOA 5IGBA 4ZUIA 2AMCB 3CMAV 2D62A 3K58A 1Y8NB 3X3MA 4O4IA 3Q22A 2NNUA 2VUMB 2F3VA 1BPLA 1PH3A 3H0GB 1JFFA 1UE5A 3F5WC 2R92B 3BY2A 4DR4L 1VLYA 4XNFA 1EEFD 1Q12A 5L3EA 1K3BC 2Q69A 1HZEA 1S5BD 5EKKA 3PIPA 1K8OA 1E79A 4JI5B 3I72A 4I7ZB 2K5WA 4QPJA 2PNHA 2X6BA 3OW7A 2R9VA 3STLC 2QEXB 1BCPF 1SQQH 2OTLV 5LMNL 3GDEA 3JAML 2L12A 2M00A 1GM7A 1NT2B 4TT3G 5FL7G 4DV7Q 3RGBA 5IY5B 4R4QA 2CE4A 4C3JB 4YHHQ 3HPLC 5E6TA 1PZID 4A3GH 2Q2IA 2A19A 3A7AB 3NQTA 3E8GA 3OKXA 3H1HH 4H44B 5L3DA 4DO2A 4X07A 1SLJA 1GMGA 3ABKB 2J7KA 1YIJV 4ZI7B 1GH6A 3R65A 2CH4A 2IPKD 4I9WA 4PJ0Z 4OOVA 5BR8O 1JA0A 4JI8L 3SVMA 3Q23A 1UE6A 2B2YC 4U3JB 1PFSA 3OSOA 1FDRA 2JRIA 2EIMB 1X3QA 4FXDA 4BY7G 1EYAA 2WB1B 4ICGA 3K08A 3AVVA 4DR2B 2YTYA 2QTZA 5JJIA 2V31A 5EQ0A 3M4PA 3PV0A 1PYWD 1B7YB 4MW3A 1TU2B 4H0LC 1I50H 5FNVA 1TA8A 2AQ3B 1SKQA 3ZS8C 5IJ0B 4O2AB 2L5TA 2EDGA 2GJKA 1ASYA 2V7TA 2CTRA 1X56A 2YIAA 1HNXB 1II3A 5GTHZ 2WPDG 2CHBD 2UUBQ 4CJ0B 1Q81C 1PLFA 2F0PA 4XN3A 1UD4A 3BJUA 4DNTB 4KL1A 2GHYA 2YXHA 4GCZA 2MP1A 4NXMB 4NTWA 5JH7B 1BLIA 1M9NA 3APQA 5H59A 1HZ9A 2OQ0A 1Y74B 3BYTB 4LW1A 4RUFA 2CH7B 2PYLA 5HZBA 1YEZA 3A74A 4IUPA 4JI0Q 1F7YA 3DUZA 5G3LF 3CCLB 2KHSA 4X1KB 1FNBA 2ZXHA 1VQ4B 2PW7A 4K6LA 4Z4TA 3UDXA 3GIRA 4X65B 2IH3C 1CKNB 4DV3Q 1JWMD 2I5HA 1SQFA 4G7OC 1QFZA 2V7QA 4GLVB 5C5LA 3J7AF 1KQSU 2B1IA 5CR3A 3SYPA 1LT3D 2F0WA 4QGUA 3PF5A 3PJSK 4NXMO 2K52A 5CMDA 5EBLC 5IGEA 3SJPA 5EZYA 1JJ2U 3AG3B 2XNDA 2NB0A 4X3KA 5IT9L 4HZ3A 2UUCB 5TR9A 3F1ZA 1K4DC 4LBEC 5EBMC 1C48A 4TV8A 2JQOA 4IUUA 4FF3A 2OEOA 4YAFA 3W2GA 4KHVA 5JVH3 4DK0A 1IDSA 1Q6IA 3BEHA 2BSAA 4DV5B 2HMAA 1E1OA 3GD7A 1V8QA 4DR6Q 1NTMH 1XNRO 1FX0A 4DGZA 3GVKA 4LFBO 4ZK9B 4GNXA 1N36L 3M8AA 1LM0A 3VR4A 1SROA 3BCDA 4CKBA 3RNUA 2DWDC 5CBHA 4QNHB 4YCWA 4X6AH 2UXXA 1KLUD 2RN9A 1HR0O 1M8AA 2CUGA 3H94A 4DK1A 1GUWA 2L4NA 1K8AW 1JB9A 4JI7Q 1BQ0A 1K28A 3Q39A 5KMGB 1D5MC 5HZAA 4NXNB 1VQ7B 1G291 2ETNA 3J81E 5KUMA 1Z5VA 1SQVH 2BTQA 3TP7A 1Q6HA 1PA6A 3EFFK 1VQPA 5TRDA 3VR5A 1FAFA 1KK2A 4B7EA 4OWTB 3WOEA 1Z9FA 3ZJYC 4X66Q 4G7HC 5LGUA 2K05A 3M4YA 4R4IA 1XMOL 4B3ML 4QUZA 4XKVA 5M3MB 1I5FA 4ILWA 4B3RQ 2PUSA 1S72B 3SYCA 1V1QA 4AH6A 3I4MG 2YWFA 3CCJB 5IODA 4RCZA 3TSSA 3TCUA 1GXDC 1HTPA 2Y0SG 4JZGA 1S3OA 4M4SA 4DQLA 1LUZA 2CH4W 3RVYA 2ZTDA 2EYJA 5GAHC 4JBMA 3E8FA 1OXTA 2P3MA 2WP8J 2EIMC 1L1OA 4X66B 3SK6A 1BL8A 2XIWA 3S1MB 2W6IG 1B9NA 1EQRA 2P7TC 2DMXA 2VBUA 4RGNA 4A3IG 4DR7Q 3CCVB 4C43A 3K6OA 3AG1B 1JJ2A 3OP1A 1NH2D 2ZQMA 4FLYA 1BNZA 4J9ZB 3FP9A 3QFSA 1B1ZA 3CAMA 3G6EB 3N2GB 2ITCC 2HVJC 4AYBG 5T1GA 2QGQA 4DUYL 2IX1A 2ADPA 3OWEB 2X6CA 1U2RA 1N36B 2EYHA 4N9PA 3CP2A 2D2CB 1KP3A 2QN6A 1DYQA 1AROP 4EGVA 3J80N 3W2IA 1QG7A 2A0LA 3RYIB 1TWHH 1RQRA 4F8MA 1HJPA 1VDZA 3HZXA 4A93B 2BM1A 2R6GA 5IGCA 2O2LD 2EIKC 3ZRXA 1IBMO 2EJFC 5E1FA 2MO0A 1WCMH 4ASUA 5J2UA 4QUCA 5EPLA 3I4NG 2A6HD 3C90A 3WFVA 1KUQA 4BBRH 2JA5H 5E3FA 4BBSH 4B3TO 3JC66 4K5WA 1PFMA 5DN6G 4JI2L 4G7WA 5GW7A 2LQTA 3F7VC 2X6YA 4TMTA 3AFPA 1T6ZA 5TY0A 4QVJA 2E75C 3B4SA 5CB4B 4NBSA 1I3QB 3APOA 1HR0W 5IY0A 3LSSA 1YHBA 4YY3L 4LFBQ 3PO3H 4AYBE 4I55A 4ZKIA 1QE6A 4AHCA 1R5OA 2KSDA 3JATB 1H9SB 2XNAC 3DEPA 2XSCA 3ZHUA 5IE9A 1UD5A 5IYDO 3FRPB 3HOUG 2XAQA 2VBTA 4QV2A 2GK7A 2NVYH 1OCZB 3NELA 2H94A 4NR1A 5FPOA 1YI2B 5JWPA 4A3MH 5LMNO 1HNXL 3I73A 1N0VC 1BCCH 2AHYA 1X59A 3HKEB 4JI5L 1GKHA 4CBVA 2ZR3A 5K1PA 1J8IA 1RM1B 3TRZA 3ETEA 4NYKA 4A3BH 1QOHA 2ITDC 5KW9A 2RDHA 3IFTA 3BVGA 4WFGA 2KVMA 5H9CA 1Q86W 1P8LA 3MEFA 4KXRA 2Q68A 4PZ8A 1EU3A 1KD1W 1AVMA 2VRZA 3P3PA 4TMXA 5EBCA 4HCEA 3LO8A 5EC1C 4UP7A 1R3LC 1THZA 4TT3A 5FL7A 1BT8A 1HQRD 1PYSB 3A8IE 5IYWA 4G27B 1TVKA 4JI3B 4I5SA 3RYCA 2C4UA 1ET9A 2A69C 4PDLA 4X1KA 2VB2X 4J42A 3HGBA 3TETA 2RHSB 1IBLQ 1Q3EA 2A5HA 2F43G 1I4RA 2VWJA 3K5NA 1AP5A 1O78A 2ZDIA 4EQPA 1N8RW 4JI2B 2RA4A 4PDMA 3R2TA 1N33B 4DUZB 1PYBA 4DR4O 2EVBA 3P26A 4LNUA 4XL9A 4L5TA 3DWAA 1B53A 2X69A 3AK3A 1ML0D 4BIZA 3OM3B 3AYHB 4B3MQ 1IB0A 3I1FA 3OFNA 1TXYA 1S5JA 1GO3F 5KGUA 2O5JC 3TK1A 2FYUH 1WB8A 3FB6C 1EBOA 2UXCO 3W2HA 4ZCIA 3VYTA 3CCVA 3OD4A 4FM1A 2EIJB 1E1QG 2ATKC 4KHPO 3CCMB 1T5XD 1WCMG 2FMMA 3Q6SA 1MSDA 4DAYA 2QM4A 4IYIA 4O4HB 1R4PB 3C3SA 1ZWIC 4RAIA 4D7TA 4E2LA 2NN6I 2QDLA 2C2WA 3MXNB 2PPBC 2H8PC 1T6YA 3SJZA 5K36G 1P4MA 1KHIA 2YV5A 1O9GA 4DR7L
chains in the Genus database with same CATH topology
3C2PA 1VF7A 3HOYB 3OAAA 3R93A 5CV5A 4UCOA 1HNZB 4LFAB 1IHZA 3SR1A 4A3IB 1SE3A 4IQZA 1SA0A 2NVQB 1JQYD 3VA5A 4XKWA 4FM0A 5BN5A 5ELDA 4KKUA 4EEQA 4LF4B 3HKDA 2F0JA 3ZPNA 3E6ZX 3C3LA 4C3JG 1A2UA 1MD2D 2E74C 2H1EA 4LF6B 5GONB 1TY2A 1H9RA 3SK4A 5CORA 4QCLA 3NPPA 2RBMA 1HQMC 4I7ZC 2JA7B 5I9OA 2R9AA 4LR3A 3CU7A 4FXUA 2HUGA 2EY1A 4BA1I 3H09A 3PIP3 3CRKC 1QNUA 4Z9CB 1HFNA 3WB2A 3SHLA 1K83B 5C0XG 2Q0AA 2SOBA 1UD3A 1RHPA 4K5XA 1GUSA 1KNAA 1SYEA 1H9KA 2WZPP 2YU9B 2EXZA 2QKIC 3CB2A 1HR0B 4OHJA 5I4DA 1EIGA 3N2KB 5DM73 1IBKB 4GKJB 2M2LA 5JEAH 2K5QA 1D5AA 4II2A 4UCRA 3VQYA 2F0UA 3I91A 4UFZA 1O80A 1LACA 2K03A 4XT3B 4YIJA 3K7AB 3OHXC 2EJMA 1DONA 1PMRA 4X1IB 1SE2A 4A3FB 2E5LB 4FVMA 3EA6A 2MHVA 1WP6A 4XLAA 2AQ2B 3PUXA 3UT5B 2Q8TA 1G8ZD 2HDMA 2MJ8A 1JWSD 2EY2A 4X20A 4XLFA 3KLSA 5D5QA 1ZYRC 2F4VB 1TWFB 3I8ZA 4PHZA 3PUVA 1EU4A 3EFXD 2NVTB 3BG3A 3QG5A 1XMQB 2BOSA 5CBAE 1Q43A 2Z8LA 2DN8A 2J7ZA 3GVLA 1T5EA 1VJSA 2QE7A 3GTOB 4XQFA 3FPPA 5BR8B 3S1NB 5KHGA 1U4RA 3RFRA 3P1HA 4ZUJA 4G7ZC 4HBNA 3G05A 3MA2B 2I07B 1Y8PB 4KKTA 3DM1A 3E22A 4HIZA 2KVOA 1A3VA 3ICXA 4JI6B 4DU9A 3RYFA 4LJZC 1SYCA 4KV6A 3KUPA 1SNCA 3CMMA 2JXMB 3SK5A 4ZRZA 4A3DB 1BF4A 1SNPA 4IUQA 1CA6A 4DR6B 1AN8A 4IURA 5FOBB 3U9SA 2D2CC 5C4HA 1SNMA 4L63B 2Z4IA 2VNUD 1SXTA 3ONAB 4HSVA 2IX3A 4HTHA 5I6YA 2K7VA 3L7ZC 4KKSA 2YI8A 1WTQA 3S17B 4PMBA 1RF2D 4BY1B 3Q24A 2JDIA 1SNQA 4X3SA 1EWHA 1STYA 3W2DA 2N55A 1E1RA 2X8KA 1Z5WA 1ICWA 5ELFA 1EZ6A 3UI2A 1LTRD 3K5OA 3ZEDA 3RYCB 3CQZB 1VCIA 1H9MA 4S3SA 4LH6A 5LHY1 4TV8B 3QTCA 4TQDA 4DRXA 1X4TA 1JICA 1IKLA 4FO2A 4XT1B 5BN4A 4IUNA 2RJZA 2XVSA 3D6CA 1CI3M 3SR2C 2L55A 4DV3B 2NTTA 2KQ3A 5DN6A 1DM0B 4MHEA 3HOWB 2AQ1B 1EQVA 5JJJB 3GQBA 2HQEA 5M9OA 3L9AX 4K8IA 3MFYA 2EYOA 2PZUA 5LXTA 2WSSA 2OYQA 1G2SA 5CBEE 2GJPA 4R8IA 2JGUA 3HKZB 5JJZA 2B8GA 3OIQA 3OMGA 1TIID 3JALB 4LMQD 2BTOA 2NVXB 1EY8A 1SJED 4XQJA 1OO9B 1OB0A 2QDBA 1STBA 1ZXTA 2WACA 5JEAJ 4IN3A 5JPMC 3M3YB 1ILQA 1UD2A 3JSNA 1SJHD 2BA1A 5ITZA 3T1YB 4CH4A 4G57A 3JU4A 1ZAUA 3C46A 3N6RA 5M5YB 2X53S 3NWSA 3U10A 3PO2B 3KF8A 3HP3A 1OXUA 2EY5A 3OTOB 3V96A 2R7ZB 4GZYC 1KNEA 1DZ1A 1V0EA 5C6AA 2ENBA 3MZ5A 1AP0A 1WTHD 2F0QA 1L0XB 4DUYB 5BMVB 3IAYA 4K0KB 1UUPA 1RTNA 1NR2A 2RKSA 1PTOC 2J0TD 4N9PA 3OEHA 1YNJC 2R61A 3LWUA 1QB5D 4L6TB 1B04A 4JMQA 4B3TB 3JATA 1Q8IA 1S5FD 5D3DA 3T16A 1EY9A 3ERQA 5ELBA 5I9PA 2NZ1D 2RDGA 1XTCD 3VQVA 2IJ0A 5FO7B 1QCBD 2IL8A 3ND9A 1SEBD 3MHBA 3HRZC 1UEAB 1RD9D 4M1UB 4FF1A 2E2IB 1JCKB 3EVQA 1ZKOA 1KAAA 1FJGB 4EVOA 5JCOA 1MBYA 1W6JA 5ITZB 1XHXA 3UQ8A 3R3OA 1OXSC 1GOZA 1XNQB 1WVLA 1TS5A 4UAIA 4XOTA 1KABA 3FPUB 1K8MA 3WQZA 3R2IA 2GV9A 1DOKA 1S5ED 4P2CB 1I18A 2R72A 2LMCB 1A15A 2E2HB 5CV4A 1TGOA 2RVLA 3BDCA 2HLDA 4CKEA 2DNEA 2H4OA 1A6XA 1UD8A 5HKKA 1LABA 3PUYA 4EB6B 3A3BA 1EYCA 1DOLA 1JOOA 1SNDA 3RD4A 1MABA 5CV9A 1Q3LA 2PCFB 1O7ZA 4K6DA 2UUAB 4UZUA 1F2ZA 2CW0C 2ZZEA 1EY0A 4O4JA 4K2KA 5EGTA 1V1OA 3CHXA 1PDQA 1W0KA 1CT1D 5KRUA 3F2UA 2LFNA 1I50B 3VA7A 3A54A 1WN7A 2ZZGA 1PFBA 4O42A 5KNDA 3HG9A 1JB3A 4RAUC 3MVVA 3JSLA 1F9SA 2NBFA 3U0ZA 4FLVA 3LNNA 4O4LB 4XDXA 2DNCA 1EIHA 2JIZA 2YIBA 2ZNIA 1V1PB 4TV9A 5M5WB 5IYZA 1PTOF 2K04A 4DFAA 2F0HA 2F0LA 5C3WA 4K5VA 1CFMA 1KDAA 1BDOA 4FLUA 5EYPA 4DR1B 3HOVB 3VYRA 4J8QA 4XMYA 1E2ZA 1I4XA 3I4MB 1LT4D 1JR0D 1XHZA 1FNWA 4WRDA 1SQGA 2RQ6A 4RHSA 1SNOA 4II3A 4Y7NB 2EX3A 1B2TA 1NAPA 2K01A 5CDFA 2PW5A 3RUZA 1F9QA 1TUBB 4UCUA 4D7SA 5BMVA 5D3IB 3VQWA 5KNCA 3D31A 2VQFB 1SSOA 3HKBB 4GQNA 4C3HB 5T1IA 4Q6GA 4CH5A 2KKWA 1F2YA 4BS9A 1AW7A 2Q7EA 1H9JA 1PZJD 1V9PA 1TS4A 1TWHB 4UDUC 4N9TA 3IL8A 5C5MA 2F0DA 4K14A 2LZJA 5D14A 3MC0B 2KJXA 3G7LA 4FP5D 2K28A 4KY7A 2A6HC 1RDPD 3D4WA 1RSOA 1XMOB 2YI9A 3P20A 4HSPA 1Q5OA 2K5DA 4KI0A 2ZT9C 4X1YB 2F03A 4PMCA 5FO9B 3RYHA 1ZEQX 1PTOB 4IALA 2A74C 2NTSA 4G6IA 1DGSA 3H6MA 1BQQT 1SKYB 1F2LA 2A73B 4B3MB 1STEA 2C5CA 2FJ2A 2XNAC 1WTWA 1U4LA 1U4PA 4XYQA 5C8YA 3M7NA 1Z47A 2DY7A 5ISRA 3T13A 5LA6B 3TP5A 5LYJB 1RODA 5IK2A 4E0FA 4F6RA 3CESA 1X32A 4KN7C 1EL0A 2BDOA 4LF9B 2OT2A 1EEID 1TWGB 5K36G 4PI0A 4WBNA 2B39A 2KCCA 3CRLC 1CQFA 4DRXB 3KLRA 5JQGB 1N34B 1Z7TA 3C1FA 3OMCA 4DNRB 3DWPA 3HOXB 4RGOS 3FFQA 3C1EA 2CK3A 4A3JB 1KMIZ 3JAKB 3RYIA 3D3RA 5LL6X 4I55B 1HW7A 5EYPB 2PMZB 3KEWA 4UCSA 1XXGA 3J81L 2V4DA 5K36H 2WAQB 4CHTB 3QG1A 3CKIB 4CKCA 1I4HA 1ESRA 4TV9B 3D6WA 2XRSD 5HGTA 4A3MB 4DN4M 3M7GA 4I65A 5IOCA 3GV3A 5K5PA 2NN6G 4XLCA 2JJ1A 4FF4A 4XR6A 2A69D 1I6HB 4ZIBA 3I4NB 2SDFA 4A3BB 2A6ED 3FKIB 2E1BA 3MXGA 3DEOA 3ITPA 3E5SA 3QO2A 3GTLB 4JI4B 3JAWA 1WD0A 2F0GA 4O2BA 1V0FA 1D1IA 1LT6D 3GP7A 4FLTA 1GHJA 2PNRC 1LO5D 4HMIA 3EROA 3G6JB 4K8JA 3BPZA 1W9XA 3LWEA 4B3RB 4KN4C 3VR3A 4ME5A 4IHJA 4LF8B 3Q0AA 1IBMB 1TUBA 3NBIA 4HR7B 5A35A 2PY5A 4DR3B 4TKOB 1TWCB 1MGSA 5IWAB 4TRDA 4H7BA 4M8AA 3AB9A 2ZM6B 2Q7HA 4JI1B 2XWBB 5LP6A 1B3AA 5C0XI 5J2TB 4ZKCB 1FFXB 1NUCA 1NCVA 3OOCA 1HVXA 5ELCA 4X20B 2F1MA 4PMWA 1ET6A 1COWA 1J5EB 3FDTA 2E3CA 5I2YA 1TS2A 2JYOA 3VYUA 5KHHA 1JOKA 4TQFA 1B9MA 1BXTA 3W3AA 4YJ2B 3V05A 2ZXPA 3OIPA 1DOMA 4X1YA 2L1BA 2J4XA 1CQVA 2KUMA 4ZI7A 1H2SB 1SFOB 2NYZD 4KMUC 5C3XA 3PO3B 2UUBB 3A56A 4XQQA 3FEWX 3RWRD 4DR4B 2LKVA 1XNRB 3GTKB 1FD7D 5NUCA 2KEDA 5J39A 1B50A 1VMPA 2PZTA 2IWHA 5ELEA 3ND8A 3DDYA 5LXTB 3FMCA 2Q8IB 4Z1MA 2Z6BD 5C0XJ 1R4QB 1A2TA 1AZPA 4FLZA 4PQXA 1SDFA 5JEAG 4YHHB 5FLXL 1LV9A 4YJ3B 4K8XA 5KNLA 3HKEA 4I50B 5IT9E 4QIWB 1HRJA 2SEBD 5CC4A 2EPBA 1PXUA 2A68D 3I70A 4NKLA 3FVQA 1TY0A 3BCFA 4LFCB 3MFGA 5M5XB 4C3IB 2QEJC 3QJYA 1STHA 2IT1A 4UCVA 2X6GA 2YYZA 5CB4A 4O2BB 4JI0B 4IFDH 1V43A 2OF1A 4KY5A 1E43A 2F0KA 5DNFA 2F66C 3QWNA 3SE0A 3VR2A 3K59A 2Q8RE 3BH4A 2ICEC 4J6HA 3P75A 2B2YA 4LK1C 1HHVA 3EJIA 2B2WA 5EPJA 3MAQA 3S15B 3TDQA 3JAWB 2EYLA 4RH6A 1EZ8A 5IJ9A 3H91A 1SYGA 4BA2I 1XWEA 4IUVA 4TUYA 1PZKD 2CAZC 5EKLA 3T56B 4I9QA 2W6JA 5TSSA 2XN9C 3QOLA 1Q1BA 3E22B 5DEHA 1SBBB 2DY8A </