1VF7A

Crystal structure of the membrane fusion protein, mexa of the multidrug transporter
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
237
structure length
237
Chain Sequence
TLNTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQLQEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the membrane fusion protein, MexA, of the multidrug transporter in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords Multidrug resistance protein mexA
total genus 67
structure length 237
sequence length 237
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1vf7A03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1vf7A01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vf7A02
3WB1A 1ONLA 1LABA 3QIAA 1E2ZA 1Y8OB 4JBWA 2LMCB 3AB9A 3ND9A 1OXUA 1PMRA 3LNNA 2EDGA 3BRCA 4OO1G 5JJEB 3VR6A 2E75C 1K8OA 1Q1EA 3A8JE 2AUJD 4HR7B 5C0XH 1VF5C 2PCFB 3ND8A 3W3AA 3EQLC 3M4YA 4RCNA 3OW7A 4G7HC 2R6GA 2EJMA 1ZKOA 2BE5C 3I73A 3FPPA 4DK0A 3QG1A 2JEBI 3OPOA 2BA0A 1CTMA 2DNEA 3CRLC 1GHKA 2NN6G 3PV0A 2A69C 4KHZA 3T53B 1HTPA 3BDOA 5JJJB 4GYCB 2DNCA 3VR3A 1V43A 3I72A 1H2SB 5JEAG 1RSOA 2A6EC 2B8FA 1H9JA 3T51B 3MFYA 4XIGS 3WB0A 2AUKA 2QF7A 3WDNA 4H44C 4DNTB 1B9MA 4DNRB 2A68C 2BE5D 3T56B 3GD7A 2EVBA 1E2VA 4LJZC 3L7ZC 3RLFA 1H9KA 4IQZA 2F93B 1OXSC 1BDOA 3DXJC 2NN6H 5K36G 4KKUA 1GUSA 4G7ZC 3D4RA 2IT1A 3LWUA 2KCCA 1VCIA 2A69D 1EWHA 3QJYA 4KN7C 2JEAI 2O5JC 1OXVA 1HPCA 1GHJA 4DK1A 3SDZA 3PUYA 2F1MA 2ZT9C 1Z7TA 2A6HC 3PUZA 4OO1H 3MXUA 1SMYC 5JEAH 5BN4A 3WB2A 1Z6HA 3IFTA 1TU2B 1VF7A 1GUNA 1T5EA 1GUTA 1K8MA 3P20A 5JJNB 3FMCA 2BA1A 4H0LC 4PV1C 1Y8PB 5D5QA 2D2CC 2BDOA 1G291 2A68D 1H9SB 1V8QA 1GUOA 2KA7A 5BN5A 2L5TA 1Y69U 2K32A 3A7AB 5A35A 2DN8A 2EJGC 1E2WA 1VDZA 1YNNC 3M7NA 2PPBC 1FYCA 5K36H 2O5IC 4BA2I 3NE5B 3PUWA 4KKTA 3D31A 3VR4A 4IFDH 4GZYC 3M85A 2D62A 3GQBA 3SE0A 1FR3A 2V4DA 1Q90A 1YNJC 3PUXA 3VA7A 3A8KE 5C0XG 1HCZA 4I7ZC 3A8IE 1A6XA 1QJOA 1GJXA 1IYVA 4H13C 1CI3M 5BN3A 4KKSA 1DXMA 1DCZA 2A6HD 4XTCS 2E76C 4TQUS 1O78A 1Y8NB 1O7LA 2JXMB 2AWOA 2K7VA 3OOCA 4KI0A 3VR5A 2PNRC 3CRKC 1IW7D 3U9SA 2EJFC 1OXXK 1IW7C 1ZYRC 1H9MA 2A6ED 3KLRA 3VR2A 3H94A 1HQMC 3PUVA 1TKWB 2E74C 2B8GA 3IKJA 1LACA 2NN6I 2Q8IB 4TKOB 4JK1C 3TZUA 5KNCA 2K33A 4G7OC 1Q1BA 4BA1I 3I4LA 2F95B 3BG3A 1OXTA 4IFDG 3N6RA 1B9NA 2D5DA 2YYZA 5D5PA 4LK1C 1GUGA 3A7LA 1H9RA 1I6VC 1CFMA 5KNBA 5KNDA 3HGBA 2JE6I 2CW0C 4OGQC 1DD2A 4L8JA 1H9SA 1Q12A 4KMUC 1IYUA 4KN4C
chains in the Genus database with same CATH superfamily
2R72A 5CA1A 4X7CA 1H8EA 3W7SA 3W1GA 2HVKC 2B2VC 5BR8Q 2L11A 4FXUA 4LP8A 1OXUA 2EDGA 5IWAL 2DGYA 1LT6D 5IP9G 1XMQO 2ODMA 4YALA 2GA4B 4BS9A 1SZXA 3NXSA 5E4WC 1BPLA 3EQLC 3M4YA 5D65A 2VBTA 4G7HC 3A1PA 2WLNA 4JTCB 4DAYB 4IHJB 1IXRA 4R4IA 1ICFB 3OPOA 2YTXA 3S2HH 3ETEA 1RCVD 2FB5A 1NTZH 1IZ3A 4YCUA 2I0QA 4LF9L 3T1HO 4YY3O 2QEXB 1S5HC 4U9UA 2ZZEA 4LFCQ 1Q9SA 3CC7B 4IIJA 2QKSA 3AVYA 2EULA 2EFGA 4EX5A 3LNMB 1PH5A 3K3WA 5G3LF 1BMFG 4J7JA 5GV7A 2K28A 3N52A 1STGA 1VQDA 4DR5Q 1YVWA 4EB6B 1QLNA 2WAQE 1Q81C 3ZN1A 4LF8Q 5I6WA 3W5HA 2SDFA 3CCRV 5D14A 1JB9A 5KRUA 2OWOA 1FNWA 2K03A 1GO3E 1RSOB 1EN4A 3AK2A 4GS3A 1HNXQ 5IYPA 1GO3F 1F77A 4G7ZC 1HNWQ 3CE2A 4IUPA 1JQ0A 1RPOA 1KBHA 1EWHA 5A2QL 1TY2A 2MQHA 1JB3A 3T2MA 1PTOB 2ZNJA 3LSSA 2D0PA 2CW0D 3ER0A 4KK7A 4PQXA 3U0ZA 1EEFD 4FJCC 1SNOA 2IH1C 2WPDA 1Z7TA 4CQJA 2E8GA 3HG9A 3M9BA 5EBDA 4CJ2C 1XL6A 1F2LA 2VQEB 3H6MA 3ABMC 1J9OA 1T5EA 1FDRA 1THZA 1GUTA 1PFMA 2ZKOA 1KKCA 2Q2IA 4XDXA 1JCKB 3CHBD 1NUCA 4C3HH 4WFGA 1E24A 4JI6O 2F0OA 1I4PA 4X66O 5BR8B 2K32A 2EJGC 3L74H 4DV1O 1B44D 2L0CA 4DPGA 4X8AA 4GCZA 5H2FZ 5LA6A 5C4ZA 3OT7A 2YUAA 1SQXH 2ZXPA 3D31A 1ICWA 2WWWA 3OWFA 2JA7G 2X8KA 3V76A 3G6JB 4Q20A 3MD0A 1RDPD 4LF5L 1KC8D 1HXYD 1YNXA 1QVGA 1A63A 1X54A 1FAFA 3J80c 1II3A 1EP3B 1A3UA 1PYSB 3T1YB 1SNQA 1QJOA 1TVXA 2XSCA 4A3DB 2CK3G 1WTHD 4RPDA 1WTRA 1N08A 1FD9A 2CGOA 4JI5O 1V54C 1DCZA 2DEUA 4A3LH 5GTIZ 4C2MB 4PA6A 2AZ0A 1F9PA 2DJGC 3TZDA 4KXRA 4RWUA 2XTIA 1LUZA 1TWCH 2UXXA 4PA9A 5JWPA 1STAA 4K6DA 4C3IH 4A3LG 2VJJA 4TUYA 2KQXA 3H94A 2EBOA 3CCVB 3RR5A 1QZGA 1LACA 1XHXA 3AG2B 1SN8A 3PQIA 1E3PA 1YJWB 3WOEA 2ZJRA 4K0KO 2F0FA 2MPMA 4GOPA 3L73H 1HR0L 1H8HA 3AFQA 1HNWL 5J3BA 2CH7A 4IGGA 3OAAA 1QZHA 4G57A 3OGCC 5D5PA 1O7IA 1IURA 3L75H 5ITZB 1HFGA 1Y4MA 5KHHA 5F4OA 4AQYL 4DRXB 3ETQA 4EFEA 4X9QA 3HGBA 3VYUA 1NB0A 2CRVA 3U58A 4TSFA 3RYIA 3LVBA 3S17H 3L9AX 5CBFA 1H9SA 4DR7O 2FL4A 1VQIA 1FNVA 2KCTA 3ZJZA 1WJZA 2KEEA 1MRZA 3SK8A 2LQTA 4WJ3M 4HMIA 4LBWA 3D8GA 5IDJA 4C3IB 2EILB 1J95A 4YHBA 1E2ZA 1LABA 2Y0SB 2JJ1A 3G48A 3ZS8C 3I1FA 1YIJB 2K1BA 4N8FA 5TV2A 4DUYL 5JH7A 3LNNA 1IBLO 3F5TA 2Q67A 1HZBA 3AYHB 3GIRA 4CDEC 5M5WB 4PI2A 3T4DA 2GREA 1TIID 2RDGA 2JA6H 4LF9O 3JAWB 1A0IA 1GD7A 4JV5L 3WBJA 1GKHA 1QLEB 2UU9Q 1LLRD 1AR1B 3ZPNA 2XNDG 4C56C 3S1MH 2YXHA 4DV1L 2HLDA 3A0JA 1RTNA 3IFXA 4B3SB 3CRLC 3IJ4A 3QB3A 3EA6A 4HTHA 2F0NA 2B63H 1AI4A 4O0AA 4A93B 3WG7B 1Y76A 1SQVH 4B3RB 1HTPA 4KY5A 2NVTB 5JJJB 4A3KB 3ZUGA 4LR3A 1VQ9V 3G6EB 4UPAA 4U3JA 3NBHA 3B09A 1SETA 1YITB 5CN0A 4HZ3A 4DR1B 3MXPA 4JZGA 5JPMC 2CTQA 4RLZA 4DYLA 2WZPP 3HKCB 1CQVA 4DR1Q 2EE1A 3D6WA 3H09A 4YHHO 1BBXC 4BBSB 1R3LC 5IY5B 1K3RA 2EY5A 4N8X1 3T56B 1ZSPA 4DXWA 2EY1A 4GKJQ 1ROPA 2I07B 2J4XA 3OMCA 4GKKQ 4GKKB 1K83B 5IE9A 2NN6H 5KX5B 1WI5A 1YNJD 1NH2D 4JI0B 4P30A 4LF5B 5IYWA 2KBNA 1ZAUA 4LBYA 3PJSK 2B2UC 4U68A 3S1NB 2O5JC 1JMCA 4B3ML 2CW5A 2R9AA 1JJ2B 1L0NH 3MVVA 3SDZA 4B3TQ 3CP8A 3PUYA 2NWGA 4K6LA 2HMAA 4TV9B 2CDYA 5LMUB 2UUCO 1S5ED 5C3EG 4QCLA 1VQKV 1T6YA 1R6KA 4PNYA 3X2QC 2X0KA 4YY3L 3C3TA 2IW5A 3ISXA 3OEEA 2A5HA 3RZDB 1KIXA 1MHWC 2K9PA 3MHPA 1C8CA 1BCPC 1JQYD 2PYLA 1TUBA 2R70A 4RDLA 1X55A 2HDMA 3I8ZA 4RWSC 2QWQB 1L0LH 4DUZQ 1XNRL 4JYAQ 5JAVA 4X05A 4FZ0A 4XDJA 3SPJA 3K5OA 3KJOA 4J80A 4PDMA 5DEDA 5CA0A 3EFXD 1KECA 4P2CB 1WTHA 3GSIA 3PGZA 4DV2B 4CC5A 1A2TA 1OB5A 1AMOA 3A54A 4V190 3TREA 1EZVH 1FR3A 4MW3A 1YBYA 3KK7A 3AG3C 3J7YW 5GADC 4JASA 4A3JH 4ZQ3A 2UU9L 4A3DG 1ZUQA 2ZIMA 1VQ7A 3D8CA 1RM1C 3V7AA 2C5CA 2ENBA 2I5LX 1U0LA 3PO3H 1GAXA 3CXCA 1GOZA 3T1CA 1KDCA 3AG1C 1R3KC 3KCXA 2ILMA 3RYCB 2JS3A 3AG1B 4RKBA 1N0NA 4GN3B 1XNQB 5IYRA 4AIMA 3ITPA 3H15A 1Q82D 4IN3A 2MNAA 4LFBB 2XNJA 5IGCA 4XN0A 2RJZA 3JCZA 3OZWA 1CKNB 1E1TA 4A3IG 4ZKCB 2V1DA 2A1AA 2E74C 3K0GA 2Y0IA 4CC6A 4PC1A 3I4MG 3E2EA 3CWBH 2NNUA 1VQOV 1EY5A 2JJQA 1FFXB 3QO7A 3FKSA 5FPRA 2W0FC 2ITCC 1FL0A 4KY6A 3J80i 1SR3A 3BQJA 4FF1A 2HFEC 2K52A 1TVCA 4B3SQ 4D6TH 3Q4HB 3GWOA 3QFSA 1Q6HA 4B3TB 4G1BA 4O4LB 2FFKB 3UDGA 2YYZA 2OCCB 4JAAA 2FMCA 1JE5A 4TSFG 4CKEA 4MW8A 5FLMG 1FPOA 3UKMA 1W0KA 2DYSC 3SPCA 1ZX3A 3JD2A 2Q2TA 4KMUC 4CS4A 2RVLA 3K6OA 1N34B 3OTFA 1W87A 1HW7A 5FJ8G 4QGUA 1WVLA 1JFFB 2ZR3A 4LH6A 1QFZA 3ND9A 3S1MB 4QPKA 2ZJQA 4UXNA 3CCUV 3OWEB 3A8JE 2Z8LA 1K73D 4RCOA 4DV2Q 1R3JC 2XNDA 2VB2X 1GK9A 1STNA 2NVQB 4J7KA 5J2TA 4DV0O 1HTLD 2NVTH 4QV2A 4R4QA 2ZXRA 3QO2A 4DK0A 3MAQA 1C48A 2YS8A 3RN4A 4RD2A 1GM8A 3ZBUA 1P4RA 3ZZ0A 3T1HQ 4A3FB 4LNQA 4A3GG 1PZJD 4YCWA 1CZGA 1NKDA 1RQRA 4YJ2A 1IHZA 2OXPA 5CBGA 4OL7A 3GVJA 2F3WA 2EIMB 3QE2A 3ZMTA 4HSPA 5IYCH 2B39A 4JTDB 5L37A 4B4DA 4FMTA 2JJ2G 1K5SA 1I5FA 1KLGD 4NTWA 2PZTA 1KNEA 3MFYA 4P73A 4XIGS 3K58A 3T16A 4XQQA 3GTKH 4A3JG 2JEUA 2QKCA 1E1QA 3JAME 1I6HH 2LJ2A 2LZJA 2OTLB 2LXKA 3HOUB 3ZHQA 3PMFA 1F9QA 3JQQA 3J81E 5TR9A 2R7ZB 4IJLA 3KLWA 3EROA 2QM8A 3PCOB 4ALPA 3D4RA 3HKEA 1M56C 1L0YB 5ELCA 2HDNB 1UD2A 3RZOH 4P25A 4I5SA 1BGYH 2ADPA 1VQBA 3QF7A 1X56A 3CW2A 3QTCA 4GX2A 3RNUA 4H02A 3OP1A 4TMZA 3I56A 2XIWA 4PG3A 1VQPB 1DGSA 5CA0B 3DGEA 4TMWA 1Q46A 4QNHB 1NSNS 4ZCLA 4OPHA 3F7VC 4UVAA 2UUBO 2QA4B 3D3QA 1RF2D 2OF1A 3IFTA 2BE3A 4RO2A 5EKIA 1CEZA 5FJ8H 3R8BA 4Z4TA 5TISZ 2NV4A 5IGGA 2QTSA 2K5QA 4A3CH 4DR4O 3HKDB 2K50A 1P49A 5IYCO 1Y69U 3JAKA 1QE6A 5HY6A 5JVDA 5IYDH 1G2TA 5M5WH 3JAKB 4DR1O 4II3A 4ME5A 1HUNA 5F4JA 1FYCA 3FDTA 1MBYA 2B9ZA 4MSWC 3S16B 3QOJA 2DY7A 1XNRO 3MHSC 1EQVA 4P9OA 3DWPA 2P4KA 2YWGA 3QO8A 2YWFA 1A8VA 1V55C 1XOUA 1PRTF 4DXGA 4RD6A 1FNMA 3JC66 1N33O 1E7ZA 2VW9A 1EIFA 2RSNA 2GDSA 2EXDA 3KYHC 2WAQG 2CUGA 4JI1L 2ARHA 2Q0AA 4M1KA 2IL8A 3G67A 3SYQA 4G1VA 3HRZC 3CCLV 4X1KB 4N3NA 3QWNA 1Y8NB 4GNXA 4ZI7B 5LMUO 1K9MW 4X07A 1IW7D 5IYBG 4ABNA 1XMQB 5JVG3 4WZTA 1GN4A 2DN9A 1S77D 3ES9A 3QFTA 1UNSA 4QJFB 3J7ZC 2IY5B 2HHHL 5EKKA 5KEEA 2Q2UA 1RP3B 3P3NA 4P26A 4G4KA 3APQA 2JA8H 4EKWA 1KRTA 2JIZA 1ILQA 4EQOA 3HOYH 1WOPA 3K7AH 1O9HA 1AB3A 1SQQH 4C43A 1PH1A 2G5DA 4BA1I 4PDLA 3ASQA 2EIJC 3I4LA 2Y69B 3QO5A 4DV2O 2EIJB 3I56V 2CCZA 3Q8DA 2F4VL 1G4YB 1LTSD 2KVMA 1BMFA 3K06A 4O42A 2NZ1D 4P74A 4DV6Q 1PFBA 2QSAA 4K35A 1M90C 1SFOB 2AWNA 3OKXA 5GAHC 1SYDA 3CQZH 5J2TB 2F0SA 4BY1G 1QILA 1FGBD 3S14B 1YTFD 1CA6A 1EN6A 4A3GB 4AH6A 4OXSA 4X1IA 4XONA 4JBJA 1Y74A 2L55A 4LF7B 3HKZG 3A5ZB 5EQ0A 3IFDA 2XGJA 2VNUD 1PH3A 3UQ8A 3ERSX 2E75B 2VWKA 2VNJA 4WZKA 4AI8A 1LTGD 2F1LA 1XX8A 2E75C 4OPSA 1Q1EA 3CRCA 1EFCA 1SYCA 4B9XA 1E64A 3A3GA 2SNSA 4CH3A 1YJNV 5LMNW 2CHBD 3LDEA 4HEDA 2WLLB 3M99B 4ILWA 2HIXA 2WA4A 3OZUA 4XMYA 2ZDIA 1IVSA 1P84F 1URFA 3EIVA 3TP7A 4KHZA 4O4IB 2UXCL 1N0UA 4K8ZA 1DM0B 5FLXc 1DONA 3VO1A 2UXDB 4XN3A 2A73B 1PL4A 1WA8A 3RYFB 2XOKA 1XMQL 3BVZA 5C3XA 1IBMO 5I9OA 2N88A 2Z5UA 1BQ0A 2AKWB 2O2LD 2YU9H 1E79A 2XTAA 2NTTA 2P5OA 4CH5A 3TS2A 4NR1A 3L70H 4LBVA 4F6RA 1Q90D 5BZBA 4DR3B 4DNTB 1R6TA 4AHCA 4MHEA 4QB4A 1EFTA 3FX7A 1UD6A 1UFIA 5CA3A 1HWYA 5M5YB 4KV6A 3S3XA 2DY8A 4Q5VA 3U4VA 5K36G 1AE3A 5A88A 2KCCA 3OM3B 3K80C 3JD4A 3G6BA 4N9TA 4KN7C 1SNPA 4LFAB 3TGUH 2PO4A 3CU7A 1QHTA 4KUMA 5E79Z 4M1UB 4BWAA 3T13A 3TJTA 1YTFB 2ZT9C 1TY0A 5CMDA 4BXXH 3W2FA 2ZT9B 4N3GA 3D3IA 2NZHA 4PELA 1BCPF 4XLCA 4RJLA 3GTLB 2PI2A 1E3XA 2OTJB 4YY3B 2IJJA 2QKAA 1CHPD 3BDLA 3CPWB 1MJCA 4EVOA 4XDKA 2CC2A 3IAYA 2BH8A 1GM7A 4CHTB 5IT9c 3ASNC 4K0KB 1I94Q 1HNZQ 3PF4A 3HOWB 1J8IA 2ZE5A 4DQKA 4FLWA 2C77A 2O5IC 2CFMA 1KMHA 3GTOB 2PGGA 3EHBB 5FO1A 4L63B 2WSSG 1AI6A 4FVMA 3RW0A 4H13B 4PC3A 2R61A 4ULLA 4NXML 4ZLTF 2JN9A 3OGIB 2ZBVA 1VS0A 3MEHA 3VA7A 3IC9A 4JI7O 1MA1A 2BSAA 3ASSA 3JYCA 1JOYA 3R6KA 3SK6A 5C6AA 3DLLA 4LC0A 4GKKL 2PNHA 2JN4A 3SYOA 1JA1A 2VBVA 2Q8RE 4NMZA 5LMNQ 5LMNB 3R6JA 1D5MC 5LL6X 2X69A 3AGPA 2M9VA 4IUNA 3DSQA 3BHPA 1YJNB 4W4LA 1ZM3A 1O7LA 4WRDA 5NUCA 1IBLB 3J80E 1VQ4A 3T1YL 5IY5C 1J5EB 1L1OB 1U4LA 5FK9C 1NTKH 3J80L 3CJHB 5IT9N 1NTMH 2XRQD 1UD3A 3W2DA 1OCOC 4K8JA 2OT2A 2FXQA 3E22A 4CKBA 2ZE7A 2E2IB 1I6HB 4JI6B 4TKOB 1VQ4B 2ID0A 2X6BA 4J9YB 1V5VA 1EFWA 5KA5A 2Z1CA 1TVKB 1HA3A 2R93H 2L15A 2HP8A 2UUAB 1VQKB 1FNCA 1ZXTA 3BG3A 1WJJA 1B9NA 4DAVA 1PHJA 2B1GA 1GUGA 2B1IA 2XHBA 3I56B 3JARA 4XQJA 2OT5A 1V1PA 5JVH3 1PTOD 1XMOO 1ZM9A 3ZZUA 3PIP3 1EN5A 2NVXB 2Y0SE 3GO5A 1PTOF 1IYUA 3E8BA 4OWWB 1MG1A 5LHIA 3A35A 3BH4A 3A56A 4GKKO 2CK3A 5GONA 1YCIA 4AQYB 4P6YA 4PZ7A 3DXRB 4ZHQB 4FO2A 5KMGB 4UY8C 1UD5A 1PMRA 1R4QB 3NEMA 1ZM4A 3VR6A 2XZLA 4NNJA 4RD3A 2QDOA 2EINC 2QEJC 4GLXA 1IL8A 1EEID 1VF5C 5EBWC 3S1NH 3BY6A 3OIQA 3JD3A 1BNZA 3MDSA 4J11A 4K8XA 1N32Q 1X4TA 2DYRC 2B2WA 1X3FA 2VB3X 3HOZB 2UUCB 1E62A 1JNYA 1B3QA 1E22A 3HS0C 1ZM2A 3OR7C 3I4OA 3PV0A 4AF7A 1K8AD 5DSZA 2KHSA 3F8TA 1H2NA 4OIJA 2X6XA 5J22A 3TQYA 5C0XJ 2YIDA 4JBKA 3H9VA 4DV7B 2YWEA 2UUBL 1PRTC 3Q0AA 1BS3A 3CMEV 1FFTB 1PH2A 1XE1A 3WNDA 3WDNA 5EJWA 2D3OW 4UCTA 1SKQA 4BIUA 4BXXG 3EFFK 1MZFA 3HR0A 1J6QA 1MABG 4XKVA 4X1YA 1VF6A 2AMCB 4JMQA 3E6ZX 2BV3A 1DJRD 4DGZA 4NP5A 2GQFA 1PL0A 4CH4A 1GRJA 2Z6BD 2IU0A 5FL7G 4HN7A 1FNBA 4I4TA 4DUZL 3I4MB 3KBGA 4O4JB 4JF3A 1IZ6A 4PABA 4LF7L 4IYHA 1JJ2A 2Z6KC 3F2BA 3NP8A 2EZPA 4NTYA 2FX3A 2E5LB 3BY2A 3DEPA 1JPXA 1IL2A 3GTQH 1K33A 4LFBO 1JA0A 4MZ9A 4A75A 3AG4B 1NRKA 2ZZQA 2RDCA 3AG4C 1NCVA 1M1KD 2D2CC 4OEMB 1EU3A 3U2QA 2CTPA 5FNZA 1WYDA 3HB3B 2ZDIC 3HKSA 2ZXWC 2PMZB 3KDFB 5A35A 4C1NK 1N36B 1K28A 4CJ0B 5IOCA 1PH4A 2X53S 4PZ8A 1L2FA 4PD4F 4QGPA 1F23A 3E89A 4WFEA 1EM1A 3NE5B 4A3BB 2UXBQ 1GO2A 1PXUA 1QVGB 2KECA 3OFNA 2P6JA 4DW0A 3HOUG 2GVAA 3PUXA 3JSNA 2HHHB 4JI5Q 1N32L 4RGMA 2YI9A 1OCCC 2D3LA 1BQQT 1PH7A 1HA6A 2VNKA 4A3CG 1BOSA 1IBLL 2L9HA 5C44G 1E63A 1B53A 1GR1A 1K83H 2A6HD 1HZEA 2WAQB 4OO1I 3E35A 5CMUA 4N9PA 2ZQMA 2BMWA 4DV5Q 1L0XB 4UB6Z 2LFRA 1UEAB 3ZIAG 3PUMA 4EB6A 3CYOA 2A6ED 4J6HA 3ZRSA 5EZYA 3B2EE 1TKWB 1EZJA 4C3JG 1EOTA 4YXWA 2NVYH 1JX9A 2NN6I 1M56B 1TWFH 4UAJA 4X3TA 2MK3A 1M8AA 1MSGA 5CB4A 2BTQA 1JOOA 2E2HH 2UUCL 3M4OB 1ML0D 4R8NA 2OBRA 2RC6A 2VUMG 4FXGC 2LW7A 4DK3C 3S1QB 1ESFA 4A3EG 4QL5A 2Q6AA 1XPOA 1BHBA 3CC2A 4RGOS 2PQAA 1KD1C 5IYBH 1TS2A 4BBRG 2CBXA 3W2GA 3ONUA 1CFMA 4JI7B 3E8HA 2XAGA 1KTKA 2VUMB 4NTXA 3ABTA 1IBKB 1HJPA 1BCPD 3F1ZA 5IYDG 4FLUA 4RQFA 1ZYRD 2VZAA 5IP7H 3BS1A 2M7WA 1JMKC 1AROP 1QVGU 1QX4A 2XUMA 1LTLA 1SRUA 5DM73 1EP2B 1ONLA 3CCRB 5EYPB 1Y8OB 1VQFA 1Q8IA 1H2GA 2EILC 4XL9A 2UU9O 1XNQO 1IHMA 1HZ9A 2WKDA 2EZOA 4IUVA 2YEVB 3BRCA 4XT1B 1IJEA 4IUQA 4H33A 3FB6C 2RCFA 3NBHB 2BH2A 3TRZA 2F0GA 1U97A 5ELFA 3NWSA 4Z4UA 2GTAA 2EYPA 3SYAA 3E0JA 4JI3Q 5EYPA 4MVOA 4A3IH 1RFYA 1Q7YD 5K5PA 1MZEA 2R9IA 5M3FG 5G3LD 3T53B 1UJWB 2ZR2A 2DJFC 4G27B 2UUAO 2JK8A 5IWAQ 1I5YA 1FFXA 4B3TO 4FFBB 1TT2A 3I91A 3OJWA 1YEZA 1TUEB 4HCEA 4G28B 3CCSA 1DTOA 1H2SB 3ML0A 1Y1VB 1PM9A 4JYYA 1EFUA 2QGGA 2A6EC 4WORA 4B9WA 1XPRA 3T51B 1V0EA 1XMOB 1KK1A 2EIFA 4HAMA 3HOVH 4AYBB 1C9OA 1SROA 1E2VA 1N36Q 4NXNL 3OEEG 1SQGA 3ZMSA 3CMMA 2LY7A 1KAWA 1W6JA 1BDOA 3Q3AA 2ZM6B 3DXJC 3I3CA 3ZZTA 2NB0A 1DARA 1D2DA 3RYCA 1N32B 2K75A 2KQ3A 5T1GA 3VQVA 1Q81D 5K1XA 2A69D 2UUCQ 1FYJA 4GKJO 2EIKC 1YI2B 1PKVA 3WFVA 4O2DA 4P1VA 1SYGA 2CQAA 2LS01 2KHJA 5KUMA 1K3EA 3KCYA 2CH7B 2KCMA 3E9IA 3F2UA 1GM9A 4DV0B 3G05A 4DV4Q 2VS0A 2MJ8A 4UB8Z 3Q22A 2A9HA 3OE7A 3CF5A 4GOPB 3AG2C 3X3MA 4GOPC 4KHPB 1EIYB 5I9PA 1SE4A 4PV1C 5JJKA 4RGNA 1JJOA 4PV1B 5D3IB 1VQLA 1G291 2C4TA 2IJ0A 3PF5A 1H2MA 1RL2A 4FZ1A 1BCPB 3CMAA 3A7AB 1TUBB 2DERA 4K8IA 4JBMA 4TWKA 2ZZFA 4LMQD 3CP0A 1QG7A 4P3YA 1PH8A 2YI8A 2GUZA 4CDDC 3BCDA 2EJRA 4L5RC 3HOWG 3P75A 3H9NA 3W7XA 1OCRC 3OFNG 1TR5A 1R1BA 4V0BA 2V4DA 4OOXA 1L1OA 1VQ9B 1NBMA 3CAMA 3DHQA 4TQDA 2E3CA 1WCMH 1G51A 2WACA 1W59A 4LNUB 4FLYA 4MTOA 1BX1A 2GK7A 1XUQA 4HE5A 4M4SA 1ENCA 1P8LA 1K92A 2DIEA 4LF7O 4XLHA 2KHIA 4I50A 2G9HD 3CQZB 2V7VA 2B2WC 1LYLA 4XTCS 3RLFA 1VJSA 4WFBV 1QLEC 2AXTZ 3BPZA 4D7TA 4K5WA 1JWUD 1EYCA 2UUBB 4ASUA 4DV7L 1IW7C 1PNLA 2EJ7A 2FMLA 4JTAB 5IJ9B 1HNWO 5LP6B 3OJXA 2F0TA 2MW2B 1BBWA 2Q8IB 3L72H 1UAPA 2ZXOA 4JZ2A 4X1YB 1BQEA 3VDYA 4F4LA 2YC0A 1EWIA 1PJ7A 4UCRA 1N36O 5KUKA 2JS5A 4ICGA 1RHPA 3H1HH 2FJ2A 2K33A 2X6LA 2DCUA 2K01A 3CPWA 4JI2L 3S15B 1U4PA 3DWQA 4DW1A 1GN3A 1XNRB 1Y74B 3SPIA 1G7RA 3CW2C 3I7FA 4X62L 5IWAB 2PZWA 1I4HA 2FVGA 2JDIA 1B8AA 5B5EZ 1AP0A 2HHHO 1AIPA 5DN6A 1WOOA 1I4RA 1PNMA 1N33B 4UZUA 3WQZA 3UDFA 4EFBA 4XXEA 3VYSA 1BX0A 4QVAA 4YIPA 1AR5A 1Y14B 2C9OA 2K4KA 2YICA 2MO0A 3LGJA 2L12A 5LMUL 1PJ6A 3DEOA 2YU9B 3CMAV 2JGUA 3OMGA 5JCOA 2G9DA 1D7QA 1T9HA 5LGNA 3VQWA 2GN5A 2QJ1A 3J81k 1TGOA 2ZM6Q 3GTQB 4LFCB 1SERA 2QMUA 1IKLA 2UUAL 1Q86W 1LTBD 2F52A 3ZC3A 1QU7A 2Q5ZA 3QG1A 4Y7NB 1I94L 5M3MB 3CPWU 2XEXA 4YWKA 3U9OA 2WLIB 1CSPA 4JOIC 4BY1B 2NN6G 3ABLC 5EMNA 1VQ6A 2WYRA 4UCOA 2C4UA 1JOQA 5LYJA 5IIFA 1EY6A 1PYBA 3GTPH 1OZ0A 1AJPA 5J39A 2K14A 2OIEA 2DNCA 1D5NA 3APOA 4TMVA 1S4MA 2EYHA 2QWRB 1ENVA 2V7QG 4UZEA 5A89A 1JA8A 3CCSV 3CCJA 2UUBQ 1F2YA 1H9JA 1ENAA 1X9NA 4NVPA 2J0TD 3I55B 3B6YA 4H44C 4DR2B 4J8QA 5E7NA 1AZQA 1FGUA 4UZFA 1K8GA 1D8TA 3GD7A 3TN2A 2ASBA 1IKMA 2KEDA 1U4RA 2DWEC 1WORA 1H9KA 4JV5B 1Y67A 4NCNA 1VQJA 2B2YA 4FYDA 2JA6B 1WB7A 4KKUA 4X3UA 1KC8C 1ZUNB 1PLFA 1R73A 4MYUA 4R4OA 4DV3Q 4N23A 4NB5A 3S3WA 1MGSA 1M4VA 3QJYA 5CGKA 1M1KC 3X2QB 5HFMA 2YWHA 3FKIH 4PI0A 4A3MG 2JA6G 4ABMA 4JW0A 2ZXHA 3B4SA 2P06A 2RQ6A 2J7KA 3FPKA 4M2LA 5I2XA 3JASA 5IT9E 5BN4A 1Y1WH 4OO1H 3A8JA 2DETA 2UXNA 2GJPA 3NUCA 5FIUA 3F5WC 2YXYA 1HDJA 1GVPA 3MXNA 4IOAA 2A68D 5KIXA 1SKVA 1XQ8A 4FM1A 5EIBD 3JATB 4EQPA 5C4XG 2VWJA 2AHOA 4P2NA 5HGQA 4Z1VA 1CM9A 1VDZA 3P27A 2EZVA 4U673 1ORQC 1RM1B 4J41A 5KHIA 1NMGA 4J0QA 1PVOA 4IPCA 2EQSA 3MWYW 2R7FA 3V2TA 5IY0A 1OHHG 3ZN0A 2A74C 1Q86D 3CC7V 1KYOF 3Q38A 4I55A 3TS0A 3M7GA 4HJ9A 1XNRQ 1COWG 1TWGH 3F2CA 4RD4A 1PYWD 3CX5F 4X64O 4NKLA 2Q68A 4L87A 4XR6A 1U4MA 5CV7A 5IJ9A 5BN3A 3C46A 1XNQL 3I70A 5FOBB 2ZJPA 2E74B 4DAMA 1M9NA 2FINB 1QG0A 2WKCA 5LMZA 3A74A 4YIJA 1PD3A 2DMXA 3OHXC 3FAVB 3W7UA 3RN5A 2UXDL 3CCVA 2EYJA 3KLRA 4E6IA 1OCZC 1V9PA 4FK5C 4FFBA 4WF9V 1OHHA 4NXNO 3I55A 2F3VA 3RN2A 1VEWA 1MD2D 1WDTA 4RGTA 1LTAD 5EGTA 1S72V 3S17B 2Q8VA 3A8IA 4DV4O 1QGYA 5EBCA 2Q69A 1Q1BA 4A93G 3G80A 5KYLA 4BY7B 2RA4A 2XASA 1WOCA 4IFDG 2D5DA 3ZRWB 3J81i 1MMMA 1LTID 2HQLA 4CH6A 4O4HB 3VMFA 3HP3A 2RHQB 1JT8A 2LP7A 3ZIAA 2VQEQ 4G2KA 1K28D 3ASOC 4FDBA 1K9MC 4JYAL 4CBCA 3R3OA 5L3DA 4NDXA 4MT8A 1VQLB 3ABKB 5LGTA 4YXWG 4JI1O 3OW2B 1QOHA 4PHZA 4LWCA 3CD6V 4P6VF 1WD0A 1E3ZA 4QIWB 4DV0L 1SF9A 5CBHA 2WLLA 1GUWA 5CA1B 5LL6Y 4FK8A 1KK0A 2KENA 5AJ3Q 5DEHA 5M3MH 4X64L 4DV3O 1B70B 3ICXA 1N9WA 2F4VB 1J5EO 4B3TL 3H1KH 3WY9A 3MXGA 2ZL7A 5CC4A 1S72A 3KFUA 4JI2B 1TS5A 3J7AU 3GTPB 3RLOA 4BY7H 1JJGA 2R6GA 3G6EA 1ZKOA 3NPPA 4GNXC 4ACBA 4DR6Q 2DQ3A 2E5LO 4D7SA 4Q7JB 2I5MX 2V7UA 2HIVA 4HNAA 3S2DH 1MNGA 2GK6A 4HYOA 1DK1A 2ZTEA 1WP8A 1FJGL 2C5HA 4OX9B 1EOVA 4F7XA 3RYHB 5C4XH 4R6ZA 3KEWA 4YJ2B 3ZRXA 1B7YB 1Q8KA 4RM0A 4Z4ZA 2WB1E 1H42A 3NXWA 4RA8A 2Q73A 1RSOA 2V7WA 4UP9A 1XBLA 1Y1WG 1Y6XA 4MVQA 1YHQV 3FYEB 1TWCB 3WXMA 1B2TA 4RDKA 2Z0AA 5AN9A 2WIIB 2XGTA 4RAIA 4UP8A 5FLXL 1EIHA 4XKWA 1Q7YC 1KD1W 1M57B 2YIAA 1M57C 4ID6A 1ZWIC 1DOKA 4YWMA 3SK4A 2YV5A 1ZL8B 1JVMA 3SJPA 4A76A 4NXNQ 1BUVT 2PI4A 4DR1L 3TXQA 1HNZL 1LUVA 3MTSA 5M5YH 1EQQA 4MTGA 3S15H 3W7TA 2E2JH 1TAEA 3WWVA 1G6ZA 1R5BA 4ZUJA 1RPRA 4O1NA 4JI4Q 1EY7A 2PUSA 2A6HC 5L3EA 3HOVB 3E22B 3WB2A 4YHHL 2XWJB 1YJ9B 5GW7A 2K5HA 3UDIA 3B78A 3L2PA 3G7LA 4LBEC 3PO3B 3QR8A 2R7ZG 1UE6A 4R50A 5CV8A 4JPRA 3CEIA 1VQ5V 4RMFA 1F4MA 1NT2B 1YJ9A 1VQLV 2P3MA 2NTSA 3JD0A 3B8MA 5COYA 1AILA 4DR2O 5IJ0B 3BYYB 4IFDH 4GZYC 5KHGA 3UE0A 4A3MB 1I94O 3HKBA 3JALB 1N8RW 4DR6B 2GBOA 5EIBC 1EYDA 1HH2P 1SXTA 2KUMA 2OQKA 4PGOA 4OIKA 4Z4RA 1SJHD 3Q6SA 5CORA 1KU9A 5T1IA 3BNWA 4DN4M 1S5JA 4J10A 4TT3G 4UUJC 1J5EL 3STLC 1CI3M 5BSXA 1DXMA 1M4UA 1SNCA 2F0WA 4DFAA 4N21A 1XFOA 4FNFA 2BOBC 3M8AA 1AR4A 3SJQC 3OOCA 3W2IA 1SC5B 5B6IA 2PNRC 1SEBD 3MC0B 4R7CA 4XLAA 4E4EA 2VQEO 4ZGNB 1I50B 2DUDA 3U9SA 1I18A 2CE4A 2RNBA 4BW5A 4GLVB 5ELBA 3VR2A 1GH6A 5IGFA 1I08A 1Y0YA 1PZKD 4XD7A 1K4DC 5LGUA 2NBFA 2M5SA 1VF6C 3UO2A 2RDHA 1VQHA 3S2HB 3RYHA 3LUTB 4DV1B 4A4IA 1YI2A 1S5DD 1E79G 4OOVA 1FNUA 2B2UA 3RZDH 3D4DA 5L3CA 4K14A 4GT1A 1NJIC 2JA8G 4K0KL 5H1SE 4LFCL 1N0JA 5LHGA 2GV9A 4XOPA 2ITDC 2F43A 2WP8J 3T4AC 3ZX6A 5C8YA 3ZEDA 4B3XA 3T1YQ 1P16A 3EVKA 1LT4D 3K79A 1GKFA 1Y1VH 5KNBA 3JAMN 2L35A 3RYIB 1BCCH 2BF4A 1QVFA 3BA9A 1NR7A 1O7ZA 2W6JG 2WLMA 1XWEA 5E3FA 3T1YO 3U11A 5IGDA 4YJ3B 1L1FA 4YHHQ 1KMIZ 1KQSU 1KNAA 2HJDA 3VR3A 3H3VH 1QUFA 2VBSA 1WCMG 3W5OA 1XJVA 1G7TA 3GB7C 4JBWA 1N32O 1SA0A 1EFRA 3PO2H 4OO1G 2A3QA 1P4MA 3HPLC 3JCUZ 4A5UB 3KLSX 4GKJB 3K0XA 1IB0A 2A7WA 3JQRA 2X6AA 1AEXA 3FKIG 3W3AA 5M5XH 3HOZH 4AF6A 3CCJB 1Z9FA 4NYKA 4FLZA 2DYRB 2N05A 4LBZA 3QNEA 3WYAA 1D5ZC 4DR3L 1VMPA 4DV4B 3B82A 1IX9A 2WLIA 1E1OA 4JOIA 1PFNA 4QF4A 1JE4A 3TMEA 1S5FD 4C3IG 5IODA 4QUCA 3SLDA 4MVRA 2WSSA 1VQ6B 2QDXA 3L9DA 4X66L 3W7WA 3SLNA 5M3FB 1MSHA 1ZL8A 1S40A 4LF8O 2WB1G 1FJGB 3Q6QA 1SQFA 3AK1A 4HIOA 1FJGQ 3ZHRA 5B1AC 4H37A 2W0XA 4PC7A 3SJBC 4YELA 2CKZB 4X62Q 3WB0A 2IJHA 3SJAC 4B3MO 4DV4L 4LF7Q 1ZLZA 3FAVA 4DR5B 3ZBTA 1SAPA 3UDXA 1B9MA 3S1QH 3SYPA 2KG7B 1PKXA 4JYBA 1M90D 1SMXA 2XNAC 4NB3A 1EU4A 2UXCQ 1OXSC 5EAYA 3QOLA 4J15A 4B3MQ 2UU9B 1YEWA 2AZ2A 1EWCA 1TS3A 2AHZA 2ZTDA 2CTWA 4DV3B 4X3SA 2YXLA 4IOCA 3C3LA 3KF8A 2WJVA 4PJ0Z 3HOVG 3A0RA 4KFMA 3AVXA 1PJ5A 3GVKA 5IK2A 1TWAB 5I2YA 5CV4A 1SYBA 1T5XD 4QIWF 3DXRA 5IYZB 3ZMVA 1GN2A 5TY0A 1TU2B 5FPOA 3P20A 4BBSG 4H0LC 4JI4L 1RJTA 3GTGB 4EH1A 4H0LB 3OTOQ 1YSCA 4DUYB 1WSRA 2BM0A 4OPOA 4KL1A 1R3IC 3W5VA 2BDOA 5M3FH 2KVOA 4A3FH 2DN8A 1GMGA 1W0KG 4GX0A 1F20A 3AK3A 1OB0A 3ZHUA 4RG1A 3AVTA 1G2SA 2JA5H 3BVGA 1NBMG 2AHYA 1YJ9V 3LO8A 3OW2A 3BABA 2KJXA 1NY4A 1A3TA 4DV1Q 2OIGA 3AGQA 1W2BB 1SYEA 2P22C 2NVQH 3D36A 1VQNV 2VY3A 2ZM6O 1F9SA 1HCZA 2GTSA 5C5LA 3U50C 2ZM6L 1SMYD 1LTTD 1BSMA 2RN9A 1WPCA 2DYIA 3BY1A 1R4PB 4LNUA 1RTOA 4Z2WA 3CC7A 1AE2A 4OX9Q 4JYAO 3SJZA 5C5MA 1VQ9A 1K97A 4X66Q 3FYIB 1FNDA 2ALYB 2F66C 1P7BA 1TUIA 3W2HA 3AQQA 4L5QA 4H44B 5ELOA 1G7CA 4F7DA 1AW7A 2Z9HA 4HJ8A 5FLMH 1ZYRC 3UT5B 1YHAA 1K0RA 1Y1VG 3BC9A 4BBRH 3ULPA 3O65A 3CC4V 2BDNA 3HOZG 3FPUB 4A3EH 4JK1C 1XL4A 1IXBA 4CS3A 1COWA 4HE6A 1VMCA 2MO1A 1A15A 1SE3A 3PO2G 1MJEA 3OE7G 5H9CA 2ZITA 1HNXL 2F43G 1LM0A 3BYTB 2H4OA 2ZCEA 2A79B 1OXTA 4O2AA 4GN4B 4BWGB 2LFSA 4Y9UA 1F51A 3C3SA 4X7DA 3U4ZA 4DAPA 4LWSB 3OUFA 3SR2C 3RFRA 1CKMA 1EUJA 5E6TA 1H9RA 1BF4A 2V31A 3K7UC 1HFNA 4OP7A 5DS0A 3K8AA 2IPKD 4DU9A 3J81N 1LV9A 3OTOB 3TXSA 1WFQA 5LHY1 2NN4A 2WV6D 3EBEA 1NJID 1BHAA 3UE1A 4KHVA 4MYTA 4G6IA 4DO2A 5EK0A 3I2ZA 3TP6A 1UUPA 4DR2Q 4EQ5A 2VUMH 1AVMA 3ASRA 3H3VI 4LFAL 1IBML 1QNMA 5CR3A 3CD6B 5DECA 1SKYB 4RUFA 1XHZA 2AUJD 3CD6A 5J1ZA 1SYFA 4HJAA 2DOGA 1HNWB 1JICA 3T1HL 1YHBA 2CTRA 2WAMA 1HNXB 4A3EB 3SJCC 3K08A 1CKOA 4DR7L 2WLJA 4DA2A 3KKYA 2A69C 4IUUA 3CRRA 2HKOA 5AFWA 5CV5A 3D0FA 1OV9A 4L5TA 1TA8A 2K1EA 5KMGA 4IO9A 2PQEA 1EY9A 4B3FX 2QDBA 1ASZA 1YLOA 4ZAIA 4UVBA 1HHVA 4F6EA 4OX9L 5E4XA 1KRHA 4IL6Z 1S72B 4NPSA 2DOSA 1HR0O 4DUYQ 4DAYA 1S5LZ 1GTOA 2K05A 3RBZA 1WPXA 4P9SA 1VARA 1EQRA 1X65A 4L6TB 1YJWA 2CWPA 3OMAB 4LH7A 5AG2A 3WNCA 2A19A 2KSDA 4NBSA 2K6AA 1PTOC 4Q0FA 1PA6A 1XTDA 3PA2A 1ET9A 4MVMA 2Y69C 1G1XB 5E1FA 4WZEA 2YTYA 1OTCA 4FF4A 3UT5A 4LF5Q 4X64B 3ABMB 4PA3A 4X64Q 4LFCO 1OXVA 4O4HA 1TQOA 2CF4A 5KAIZ 3BCCH 5J9PC 3ASOB 4OWTB 3FB7C 1QVFB 1B04A 2NR5A 3CC2B 5A9GA 1JB7A 2QE7A 1R5NA 5IYDO 2LXJA 1K5QA 1S76D 1QUQB 4QPJA 4RKLA 3ZHSA 5JOBA 1BO0A 1I4GA 3FMCA 3NTKA 3NWTA 4Y7CA 5D5QA 4A3KH 1OJHA 1YZ6A 2IJKA 2RMKB 4IYIA 1VQMV 2XAQA 5IP7G 1EFID 1PPJH 2VQEL 3A8TA 1X6OA 3CRAA 1VLYA 3M3YH 3NQIA 4LF8B 2V7TA 2B63B 5JCOC 1FJGO 1O9GA 2VQFQ 4POGA 3STBD 1JWSD 2V7QA 2F0JA 5LA6B 1ILPA 3PUWA 4DR5O 4P22A 3FRPB 1FXKA 3CRMA 3M85A 3GQBA 1VQ7B 2JRIA 4WJWA 4MTNA 4YAFA 3A8KE 3N2KB 4BPRA 2QE7G 1KAAA 4P2ZA 3CCMB 1U5KA 2HCCA 4K5XA 4LF4L 1IYVA 4P75A 1D2EA 1U9RA 4RUEA 1BT8A 1N8RD 1Q3LA 1KB9F 3EJIA 2N8NA 2E76C 4E2LA 3E0EA 2K5VA 2JGDA 2K7VA 2IBZH 2EY6A 5BMVA 1VMGA 2QKIC 3JALA 5DN6G 4R71A 2J7ZA 5GAEC 3HZXA 1H9MA 4DR4L 2D9RA 4WBNB 4F88A 2JIZG 3CKIB 4Z1MG 1VLOA 3PUVA 2P5ZX 4DUYO 3SHLA 4BY7G 1SRYA 5FNVB 1HUMA 3BVMA 3CCSB 2QM4A 2NVXH 4FF2A 4RQEA 1ZEQX 5H6QA 2DWDC 2R92H 4GX1A 4GZRB 1KK3A 1Y0RA 3NENA 4B3RO 1LTRD 4DKAC 2AQ2B 3NTHA 3MHBA 4O2BB 3RWRD 1CSQA 3SPHA 4XT3B 3H0GG 3JAMi 3HOXG 2JA7B 3M3YB 3HOUH 3OR6C 1BQZA 1S3JA 1KP3A 4JI8L 4B3RQ 3K59A 4RDJA 4MVZA 4S3SA 3GTLH 2WFWA 1WU8A 2KKWA 2JE6I 3P7JA 5KGUA 2IX0A 1K9MD 2E1RA 5TSSA 1WTPA 2SEBD 3TDQA 4OXPA 3G4SA 1KD1D 1AN8A 1KQSA 2Q4PA 4FWTA 4JYAB 4KD3A 3K9AA 1YX2A 5C3WA 3OW2U 4DV5O 2HJFC 2O57A 1QVFU 1EZ8A 4JI0O 2M2LA 3CMAB 2XAFA 3MFGA 1I5XA 3CCEB 1FD7D 2ZE8A 2OEOA 2RCNA 4LUZA 4ZOLA 5LL6S 3WBKA 2HLDG 2R92G 4R1JA 3URYA 4X20B 3S1RH 1FXKC 1DF5A 4DQLA 4F87A 2P4VA 2EJMA 3FPPA 3CHXA 3P3PA 2PIAA 1DG1G 3G71B 3CC4A 1CTMA 2R92B 3NQTA 1DZ1A 2CQOA 4ZUIA 2FYUH 2Q0OC 2WPDG 2RQXA 3SDLA 2F0KA 5JJIA 2F0LA 4DV6B 4H7BA 3AVUA 2OCHA 1CA5A 5CB4B 3R2IA 4JAUA 3E1YE 5KHJA 1QBZA 2HUGA 3F7YC 2OCEA 3I72A 4RHSA 4R8CA 1YF2A 3CESA 1OCOB 5I6YA 1C4QA 2B3GA 3E5SA 4M8AA 1BVSA 2Q7EA 2IH3C 1LO5D 1SE2A 2A68C 3NR7A 2FHTA 1EQTA 1WSVA 1I94B 5EZYB 1D1NA 2XVSA 4FXKC 4A3MH 1XILA 5LXTB 1VQOA 4QQBX 4LWSA 4ZI7A 3CP1A 4NKGB 1GUSA 4X3KA 2TSSA 1AZPA 4EEQA 4ZYSA 3AU7A 2AHOB 3KOJA 3VNUA 2DQ0A 5BSYA 2MHVA 3D3RA 2H94A 4KP4A 3JARB 2ZIOA 4YEJA 3ZBHA 5IT9L 2HT1A 5LP6C 4XYOA 1QNKA 4TRDA 5IGEA 3B8NA 1K73C 3HKZE 1V1QA 2E5LQ 5KA6A 1IYJB 3JASB 1GUNA 1I50H 2LFNA 3MEFA 2R9RB 2R6HA 2Q9LA 4X89A 3JU4A 3KL9A 3KF6A 3NTIA 4GUNA 4F8MA 3SVMA 4X65O 3MMPA 1J5EQ 3AEVA 1PNKA 4BIOA 2BM1A 3S16H 2UXBO 3Q6RA 3M7NA 1HR0B 3HKZB 2PPBC 3KDFA 1X3PA 2EX3A 4TV9A 2F23A 3KF6B 4I0XA 5C4XB 3LSQA 4X06A 2L4NA 2D62A 2X0LA 3H0GH 3R2TA 3J81c 3HOXH 4MTKA 1Q90A 3IRBA 4A93H 2Q6LA 1FVIA 1XQBA 3D36C 3AEIA 5M9OA 1R5OA 4O4IA 1W2BA 2GVBA 4ME3A 5IP9H 4LFBL 4P71A 2HQEA 5FNVA 1GJXA 1YI2V 1S5CD 4H13C 4KKSA 4RAUC 1N34O 4LFAO 4WBNA 3LDDA 2F0DA 2VBUA 1Y66A 2X3UA 1R9TB 1SE8A 1I4XA 3UCSC 5B1AB 1PH6A 1VQ4V 5BMVB 2Y0SG 4BAYA 4IZ8A 4XDLA 2PE3A 3VQYA 3CXHF 3ETGA 4QFMA 3QG5A 2ZZGA 1KDBA 2CGNA 2EXZA 2KCNA 4J9ZB 4ZIBA 3GTMH 2G38A 1UEBA 3CCQV 2ZBUA 1VQEA 1XYIA 1UPGA 2LW1A 4X88A 3ZRVA 4X62O 1QFJA 3K57A 3F2DA 1N8RC 2OCCC 4IPGA 4TVAB 4DV2L 4PAAA 5A8AA 3GV6A 5KNCA 3QVNA 3M4PA 1D2BA 1M5IA 2ZNIA 1MABA 5B1BC 3FEWX 2PYJA 5JBQA 5B1BB 1I4QA 3MXNB 4U3FH 1LT3D 3N6RA 5BR8L 5B3SC 3PVDA 2ZD9A 3A7LA 4MVUA 1N0VC 1ESRA 1FRQA 2KOLA 5I4DA 3H1LH 4PMBA 5B1OA 3CXCU 1MKHA 3SEBA 5JH7B 2WJYA 4LUOA 1SZTA 1A62A 2B2TA 3AG7A 4JI7Q 4U7OA 3L0OA 4P9PA 4BR6A 2E5LL 3CCLA 1C0AA 2DW4A 2WZNA 3W5UA 1NB9A 3GVMA 5LMNO 4I7ZB 5LHHA 3QIAA 2RC5A 4X7EA 3FKIB 2D0OA 2ZXIA 3ABUA 1SS3A 4DUZB 1HZCA 3ULLA 1JFFA 3ETDA 1F2ZA 4LF9Q 2LSSA 4ZHQA 1JR0D 3ZMUA 2OTJV 3OIPA 4NXMO 4JI3L 3A5UA 2JSOA 1NJIW 3CCQA 3HOYG 4JI6Q 1SSOA 3CCUA 4A3JB 1VP7A 1BE3H 3VQXA 1VQ8B 1MOFA 4GX5A 1BBUA 3HOWH 4WZLA 3QFCA 2F0UA 2OBSA 3HOYB 3PIOA 3AG3B 3EXAA 4KTAA 4LCUC 1KL9A 4TV8B 4XBFA 1MI2A 3PA1A 3G71V 5F2DA 2VJIA 4LW1A 1GM5A 1VQ8A 1AI7A 3HKCA 3LWUA 1YITA 4P12A 3R66A 1I3QH 2AUKA 4AQYQ 1DLBA 4C7UA 3CCEV 1YDXA 1EP1B 1AJNA 1XMOQ 4DNRB 1DOMA 1D8LA 4CZZA 3KG2A 4HSVA 1IXMA 3L7ZC 4LJZC 2BTQB 2L1BA 4IQZA 3ICEA 2CNDA 2F0VA 4L5SA 1LUWA 2QM7A 4AQYO 1WB8A 1JOKA 5C4JB 4X1IB 2NUCA 3ONYA 2PYKA 4GKJL 5C4HA 4M0LA 1YJNA 4LFAQ 2JEAI 1C7YA 5B66Z 1FRNA 4TN1A 2IHEA 1KXLA 1QR9A 2C2WA 3O9OA 4FFKA 4DK1A 1STHA 4HMJA 5FL7A 5LMUQ 3PO2B 4BBSH 2Z0SA 1XREA 2BGIA 4Z4VA 4HR7B 3P32A 2QW7A 1IBKL 2F0IA 4JI7L 2B2TC 2BTOA 4FXDA 2UXCO 3OAAG 4YAWA 2DYSB 1H9SB 5L3BA 4YY3Q 5DAUA 4DV7O 4OOSA 4IPDA 1I7FA 3K0DA 2Q6KA 2VQFB 3R65A 4IFDJ 5GONB 3NELA 3MZ5A 3JSLA 3E9HA 3BZCA 3K81C 1LNQA 1PV0A 4JI5L 1B6QA 4FIPC 5THXA 5JPNC 1EL0A 2PW5A 4HJ7A 4A3IB 3SE0A 4JI6L 2R93B 2W6IA 1X3QA 1YNJC 2ZL5A 2EPBA 1GN6A 4ZCKA 4JI4O 3W1BA 4JCVE 5JJZA 3FJOA 4B47A 1F60A 2HCIA 2PZUA 3VA5A 2DY1A 2R9VA 3BZDB 3OTOO 4YAOA 4MS2A 2VNIA 2CVRA 4CGYB 5ISRA 4DV5L 4K5VA 1V0FA 1VQ8V 4XLFA 5FA6A 3CPFA 1VQCA 1TVKA 5EPLA 4DV7Q 3BFRA 1CT1D 1TWHB 4X7FA 1YVCA 2O4XA 5HZAA 1TXYA 1W2BU 4B08A 3LQEA 4F6RB 1M90W 2OK8A 5KNLA 2Z6BA 4GLAC 3IC7A 4R4CA 4X65L 2F0EA 1F9RA 1HNXO 4QMGA 1SNDA 3GV3A 5A2QE 1X3EA 3K7AB 4KJNA 2WA3A 4OPVA 3CMEB 3TZUA 1QWYA 2A8VA 4PA7A 4TQFA 1Q6UA 3SPGA 2UXBB 2PMZE 1WTOA 3K04A 1CQXA 4CJ1B 4Y52H 3Q24A 1MSWD 1MIUA 1XI1A 2VQFL 5E1AC 2Z3YA 4WFHA 1JORA 1OGJA 4PMCA 4HCSA 1E1RG 4TSSA 4IPHA 4C3JH 4O4LA 1IBMQ 5A2QN 1IBMB 4O4JA 2C35B 3K5MA 1X3GA 4DNIA 1SM4A 2M00A 2JJ2A 1DD2A 2HG5C 1Q81W 1SLJA 2JA5B 4L8JA 1N34L 4DR3O 3A0HZ 1A3VA 4QVJA 1G8ZD 3HKEB 1Q6IA 2QGNA 1F7YA 2PI2E 1K0SA 2RBMA 2BN4A 1OCCB 1HNZB 1PH9A 4K0KQ 3CCQB 4R4TA 3X3NA 3AMUA 3P1HA 3FKSG 5H5NA 3PO3G 4A3DH 1K8OA 3KBXA 2QTOA 4WFFA 1V54B 4FPPA 3CB2A 3ND8A 1SBBB 4JI0Q 1BLIA 3BAAA 1KZLA 3OW7A 4GQNA 2H1EA 3WOFA 3I73A 3J81j 2BE5C 4WCEV 3K5NA 4DR5L 2BOCC 1T6XA 5DM63 4K2LA 5AJ3L 3BDOA 1Z2GA 2ZINA 1E1RA 3DC5A 3MCAA 3BVOA 3TSSA 2Z4HA 5C44H 3AVWA 2HDLA 1IBKQ 1W0JG 5EPKA 5JEAG 4UHVA 3UM7A 1OGIA 2WR8A 2X85A 1RIPA 3H3VC 4X20A 5C3EH 1K8AC 1H2LA 4IURA 2OTLV 1QGAA 5FO9B 1XMQQ 2QF7A 1DYQA 5FO8B 1Z5VA 2QEXA 4Q6GA 3GP7A 2EVBA 5HKKA 1EY4A 4JPBW 4DF7A 2ETNA 1QGZA 1ET6A 1STEA 4KLKA 1N4CA 1K7DA 5BXZA 2WLHA 3RY8A 1HA5A 4PA4A 1UMKA 1WA8B 2IU3A 4JI3B 2IT1A 2MUYA 1NAPA 5ELNA 4PC2A 1CNEA 3GDEA 3RGBA 1Q82C 4TMXA 1WOSA 1HPCA 1PDQA 3Q4HA 2R3ZA 4FM2A 4HBNA 1D6EC 4RHRA 4RH6A 5D3DA 4UCUA 4XQNA 1SFOH 4WWVA 1EYAA 2XZPA 2WLKA 3CRQA 4HIZA 4K3AA 1SA0B 3PIPA 4LF8L 3THOA 2UXDQ 3AB9A 4IALA 2EIKB 2KB1A 2XZOA 5DM6V 3D26A 1K8MA 1AP5A 5JJNB 3N2GB 3TP8A 1G7SA 3LQ6A 3CCUB 5FO7B 1W35A 4YJ3A 4JI8Q 1TWGB 4CS2A 5JVDB 4ZRZA 3DDYA 2BGJA 1YNNC 4QY7A 3V96A 1Q43A 1EWYA 3M4OH 2E2JB 2MGSA 1M93A 1UWVA 3UO3A 1KKDA 1PRTD 4RCYA 1ASYA 2ZL6A 4LF6L 4BA2I 1H8EG 3VR4A 2PI5A 2BVNA 3A0BZ 1FXVA 3FB8C 4UV8A 1LR1A 2XAJA 3OMIB 3OZVA 2C2AA 3U10A 4RCZA 4JI0L 5IYQA 3BA8A 5CBAE 4PMWA 1Y76B 3N2KA 4ACAA 2ZTGA 4DV0Q 2N49A 1NDHA 2B7CA 1UD8A 3VYRA 3CCMA 4G5GA 1NNXA 2E2DC 3JAML 1BL8A 1VF5B 3RVYA 3HEJA 5JEAJ 5LXTA 5JQGB 4M53A 3CS5A 4DV5B 1VQOB 4ASUG 1O78A 4IW3B 2JXMB 3VR5A 1N34Q 2JK5C 4Y9RA 1B3AA 3IGAC 1ZTEA 1GXDC 4KHPO 2CH4A 4W4KA 3SK5A 1HR0W 1HQMC 4QJFA 2ATWA 2N74A 1O7YA 5LOVB 3QFRA 3HFZB 4DR6L 4FLTA 1CNFA 2VNHA 3IKJA 3GTOH 2RHSB 4RPBA 1Y1WB 2CWAA 1Q3EA 2JVDA 3ONAB 1WPBA 1ELOA 1W3SA 1SDFA 2B5UA 3FB5C 3AVVA 3T1HB 3RUZA 3S24A 3C1EA 2FMMA 2RF4A 4LK1C 3VNVA 3A55A 2RKSA 1AJQA 2DE0X 2EIXA 4C0SA 1I6VC 4MNOA 2PMDA 2FKXA 2CW0C 4TMTA 3C1FA 1CUKA 4WFN3 5HFLA 2IHFA 2ICIA 2JQOA 1TS4A 3M4QA 2PY5A 1N05A 1W34A 1VQKA 3STBC 1KQSB 1FX0A 3CCEA 4I9QA 2R93G 2NLJC 2VL6A 5JJEB 2TMPA 1AP6A 3ASNB 5LYJB 2Q7HA 2YEVA 3LDCA 1CP9A 1NVPB 1E43A 2Y0PA 2E2HB 4RCNA 1KLUD 3O13A 1F2MA 4IHJA 3ERQA 2NVYB 4RFBA 4JI2Q 4CDCC 4CKCA 2OQ0A 2HHHQ 2UXBL 5ELEA 3CJHA 4XORA 1A2UA 2F4NA 1VQ6V 4X0CA 5C44B 3TETA 2B5OA 5FKAC 2R7ZH 1S5BD 3CCMV 4UV9A 3E8GA 4U7NA 4X65B 4JI8O 5CDFA 1EXMA 1WTXA 2H8PC 3RVZA 3E83A 2A0LA 4I9WA 2QGQA 1YHQA 1VQ7V 1XTCD 5B1NA 1UE7A 5C3EB 3CCJV 1XXGA 5HURA 5IYBO 2HVJC 2FTKA 3ZCCA 1NU1H 1S0VA 4G7WA 4P3IA 1CQFA 3FD9A 3VOUA 2B8FA 1CKNA 2HD3A 2ES2A 3GTGH 2D9UA 4Z4YA 4DR3Q 3I4NH 1VQAA 1S3OA 4UCVA 1CK1A 2QILA 3PUNA 3B40A 4B43A 3CTAA 5L46A 1KDAA 4GN5A 1VQMB 5LOVA 2NZOA 2N04A 2SOBA 1HP8A 3CCLB 3DM1A 4BW9A 3G6EV 4K2KA 1QNUA 2WINB 2P67A 4JI5B 3CC2V 4LF6B 2JP1A 4C3HG 4WJ4A 4Z4SA 1Q86C 2D2CB 3ASTA 3K0YA 3NHHA 4JVZA 1V1PB 5HZBA 3AFPA 5EBLC 1BKBA 1K8AW 3H91A 3WU2Z 3MXUA 3RLNA 5M3MG 2ZXWB 4QHYA 4IFDI 1VF7A 2VXWA 3OUSA 2PTMA 3JATA 1VHOA 4DV6O 4OELB 1QQCA 4RD0A 2QWPB 4X62B 1YIJV 3ABLB 2PF4E 1L8DA 5BY1A 1PTOH 5K36H 2OBTA 4I0XB 2EIMC 4JAVA 2LGQA 2C78A 2ADQB 2F3IA 4MN3A 5EBMC 4GNXB 3H1JH 3H1IH 2EINB 2QA4V 4DV3L 1PZID 3QSYA 2K5NA 1LT5D 1SQBH 4JV5O 2VS1A 1VQPV 4LFBQ 1UE5A 4NXMQ 4Z9CB 3ASPA 1IBKO 4KD4A 1CHQD 2GJKA 3ZYYX 1WAZA 1TTTA 1AFPA 2HR3A 5IYNA 4LC1A 3HAGA 3SKBA 3RYFA 4IT5A 2VRZA 1TWAH 2IW3A 2BOSA 5HGTA 4TQUS 2SNMA 3A8KA 4DUZO 4BY1H 3J81L 1CPYA 2AWOA 3EN2A 1IBLQ 4A3GH 2ZTNA 4K1XA 3CRKC 1NR1A 1J9ZA 2LGWA 3CCVV 1UD4A 2A06H 1VQ5B 4LUVA 1KRSA 2Q7GA 4LF9B 2WB1B 1NE3A 1JCHA 3E20A 2F4IA 2IJIA 1HQRD 3KJPA 3JAMc 4FLXA 2AGAA 2H3OA 2X6WA 3EVQA 1PV4A 3D6CA 4QE9A 1X32A 1EFRG 5IYZA 4EQNA 4UP7A 3DTUB 1STYA 1WN7A 3ZMZA 2RDFA 4II2A 1TWHH 3U6BA 1YZBA 5CV9A 1RD9D 2BSKB 2IX3A 2Z4IA 5F2VO 1VQPA 2JA7H 1VQGA 1NH2B 1S0UA 2Z6KA 2Y4UA 1H8HG 2YDEA 3I5DA 3FP9A 3B77A 5FLXN 3J7A5 5C93A 4MTXA 4UVCA 1N06A 4H9GA 3LWEA 1G6UA 3PSIA 3S9WA 4HJ5A 1A32A 2E2IH 1N33Q 2PLFA 3BEHA 1L0WA 5H5JA 1X59A 4LF4O 4YCVA 2CAZC 2Y48A 4B7EA 4KN4C 1WP6A 4QIWE 4A3KG 1YIJA 1WTQA 1MSDA 2X6CA 3WB1A 4ZV4A 1I3QB 3NSWA 3V05A 4HAEA 3CC4B 3G71A 3B8HA 2LMCB 2BCCH 4LF5O 3Q39A 1YHQB 1SJED 1KJZA 1PFSA 1SNMA 4IIJB 2QN6A 2I46A 2JJ1G 5C0XH 3GTJB 2P7TC 3L71H 3OMNB 4ZOLB 2AQ3B 2R7DA 4NXNB 1F4NA 4FN5A 1HZAA 3S1RB 2JEBI 3J7AF 5HXBA 1BJKA 1XMOL 2ATKC 3DWAA 3P30A 4ZBMA 4LAAA 3J7AV 4GYCB 2X7RB 2X6GA 4X1KA 1XPUA 4KHPQ 4TV8A 5J2UA 5F4MA 1VQNB 3PN1A 1OCRB 1H2KA 3GWKC 1GAWA 3GVLA 2VQFO 4R8IA 4POFA 2W6JA 3SGIA 2F03A 3GTKB 2LKVA 3BJUA 5IGBA 1NS1A 5LMNL 4J42A 2W6IG 3H01A 4DR7Q 1QH0A 4DR7B 2D74A 1EBOA 4JI1B 1H85A 3P26A 2BE5D 3CMEA 4FLVA 2B29A 1BXTA 1FS0G 2F93B 2Q6OA 2AQ1B 1YXBA 1US6A 3OD4A 1TWFB 2JYOA 1JC7A 1CXZB 3ABKC 4UFZA 4C3HB 1KHIA 3L3OC 2F4VO 4NXMB 2C5BA 4J7ZA 5C8YB 4AVZA 1KK2A 1QCEA 1S4ZA 1V1OA 1G91A 4QUZA 4OHJA 5H6RA 4JI2O 1B1ZA 2I1LA 4NW2A 4Y7NH 3E8FA 1YNND 4HIKA 3LX0A 3R93A 5FO0A 4R9WA 3OTOL 1T6ZA 3STZC 4E0FA 4MVSA 1Z6HA 2K04A 5JEAH 1EYGA 2EYOA 1EY0A 1ENFA 2BA1A 5LBQA 1I8DA 2QWOB 2Q6IA 1Y8PB 4JI8B 2KA7A 3Q23A 4HIDA 5BN5A 1SESA 1SQPH 2K5WA 4JG2A 5CYUA 2BCOA 3JD1A 4MIUA 3BCFA 3RD4A 1E2WA 1KC8W 1DDGA 4DXFA 4A3BG 3PENA 4CBVA 1K34A 3OSOA 1QCBD 3H0GB 3HOXB 1P7GA 2OYNA 4UAIA 4XLEA 2JGDB 1STBA 2QCPX 3OEHG 1D5AA 3RT3C 1I7PA 4QUFA 5J3OA 1NQTA 1V55B 5IWAO 2UUAQ 5M5XB 1Q7YW 3CB4A 1FKAO 4TT3A 4BBRB 4Z4WA 2E76B 4HIMA 1WTVA 3CXCB 1WD1A 3I4NG 2OTJA 5K1PA 1B06A 2L6LA 2DJVA 1GVHA 1R9TH 1QUEA 2LO1A 2F0QA 4DR2L 1XEQA 3WG7C 3TP5A 4LF6O 1QR8A 1Z47A 2H5XA 1WLEA 3BU2A 4JYCA 1OB2A 5H59A 2PW7A 3KF8B 1FXKB 5FLXE 3TBIB 3KLSA 4PDRA 2QDLA 1NMFA 2JEXA 3I4NB 4YWLA 1QFYA 4XNFA 4C3JB 3S2DB 1OXXK 4JGSA 4ZKBB 1WP7A 1EY8A 4OPAA 4DV6L 1N07A 5JJLA 5EKLA 1U2RA 2UXCB 3OEHA 3W2EA 1IDSA 1QB5D 4LF4Q 2EY2A 2QR4A 2Y4TA 4WQMA 1YITV 1EZ6A 2MFIA 1TLLA 4PC6A 2HCJB 2E1BA 3M7MX 4G7OC 5L3GA 2B7BA 4I4TB 4IUTA 3HKDA 4KI0A 4YAUA 4X6AH 3TEHB 1NI8A 5DNFA 2Q2HA 2N55A 4CDFC 4LF6Q 2N3SA 3RMHA 3KZIZ 1Q5OA 1I0HA 4DR6O 3CP2A 1JR9A 1XDCA 2XRSD 5J35A 4JI4B 3ULJA 2QA4A 4OGQC 4UCSA 4KHPL 4A3FG 2YTVA 1FXHA 4OGQB 1JJ2U 4C1NI 5KX5A 2VYQA 3CCRA 1D1IA 4AYBG 3S14H 1O80A 1N33L 4O2BA 2EYMA 2GJRA 3FVQA 1B23P 3VYTA 3VBBA 4ROXA 2B2VA 2F4VQ 4XYQA 4JI3O 3PIO3 4JV5Q 3I55V 3JAWA 3I90A 3FFQA 2HEPA 3I4MH 1NVPD 2PCFB 1NBWA 1B2RA 1RODA 4I65A 1U96A 3MHHC 2M6YA 5CV6A 2F0PA 3E3XA 2BA0A 1L1OC 1W6KA 2DNEA 2P90A 5ELDA 2IWHA 2JA5G 4FF3A 1GHKA 2QWNB 3G4SV 1W9XA 1NR4A 5KSWB 2ZE6A 2F0HA 1PP9H 4HNAB 3DC6A 4B3GA 4C2MH 1VIBA 4DR4Q 1H38A 4DR4B 3A2FA 5EC2C 2YIBD 4JC0A 1V43A 4X66B 5BR8O 3FHWA 1YJWV 3CRZA 3C2PA 4EGVA 1K73W 2RCVA 4PZ6A 2YSUB 2KG7A 4B48A 4I7AA 5IYCG 1H95A 2EOTA 1VQ5A 4LF4B 3J80N 3DM3A 5CBEE 3UI2A 5IE8A 5GAGC 1B50A 1E1QG 3C90A 1HNZO 2OK7A 5KW9A 1BZKA 1KABA 4ZCIA 3DUZA 5EPJA 3WNBA 2JDIG 4I50B 2XAHA 2V7XA 1NTGA 2F0MA 2AW9A 4BIZA 1E0BA 1UE1A 2YIBA 1VCIA 2VZLA 4TUYB 2JA9A 3ZRWA 5C4JH 1D1KA 3G4SB 3SXHA 5ITZA 4FM0A 1D5XC 1B4OA 1GHJA 5KHKA 2F1MA 1OCZB 4ZKIA 5KAFZ 3LSUA 4O2AB 5KLVH 4DK6C 2JA8B 5LP6A 3PUZA 5KYIA 1SMYC 5GV8A 5IJ0A 4FP5D 2QTLA 2NYZD 2GHYA 3CSXA 4QE7A 3A3BA 4ZGQB 1RKNA 5L3FA 2QTZA 2V1CC 3HKBB 3JQPA 4AC9A 1DOLA 3K5LA 3BZKA 4YIOA 2BPOA 2OYQA 1GUOA 1V8QA 2XWBB 5DLQE 2L5TA 2XN9C 3MA2B 2D3NA 4RD1A 1AH9A 3TK1A 3K9SA 2PQAB 4OWXB 2GPJA 4XM3A 3SEJA 1W0JA 1M1KW 4B3MB 3SR1A 1DDIA 2CH4W 5C0XI 1PRTB 4KKTA 4B7KA 2B63G 4Z1MA 2XNCA 1HVXA 4ZCMA 3RZOB 5J2UB 1VQNA 5GQOA 1AI5A 1G6PA 2ZTCA 1NZ6A 1GJRA 1R6NA 2K5DA 4I7ZC 5C0XG 1VHEA 1A8PA 1KUQA 3A8IE 3SYCA 2GUZB 2EYFA 2PZSA 4XOTA 3ZHVA 4WFAV 1G8MA 1XB2A 1A6XA 1OO9B 1KP2A 1K3BC 4U3JB 5GTHZ 4OONA 3GTJH 1BR9A 4AYBE 1EIGA 4PDVA 4MTFA 4I55B 4KJOA 2N78A 1JWMD 3NBIA 4UDUC 1JJCB 1RQPA 1VQMA 1XNQQ 3NK9A 2Q8TA 4TOIA 5JQGA 2EJFC 4KY7A 3VO2A 3U6KA 2IM9A 1KTVA 2RSOA 3CPXA 1DF4A 1WTWA 1Z5WA 1GAQA 3IL8A 4P72A 2B2YC 4JI1Q 1HRJA 1WCMB 2B8GA 1HR0Q 4APVA 5B3SB 4B3SO 2OTLA 4B3SL 2I5HA 4ODGA 3KUPA 4B3RL 2GSMB 3T4ZA 1Q82W 4X8IA 3K03A 2QEXV 2XOKG 2XT9A 3BDCA 1N36L 3E86A 1WNSA 1CZWA 2F95B 4OX9O 2UXDO 5TRDA 4IJHA 2ICEC 4J1MA 1K4CC 2BSKA 4XQFA 3TCUA 3ZHTA 1QUQA 1IJFA 4ZK9B 2NPFA 4X65Q 2X6YA 2MP1A 2EYLA 5KNDA 3GTMB 3N27A 5EC1C 1NR2A 4A3BH 4AILC 3OYYA 4YHHB 4DRXA 1QVCA 5GROA 1Q12A 3ZJYC 4B44A 3D4WA 4G7XA 2IX1A 3N2GA 3DMUA
chains in the Genus database with same CATH topology
2R72A 5CA1A 1H8EA 2B2VC 2L11A 4FXUA 1OXUA 2EDGA 1LT6D 2GA4B 4BS9A 5E4WC 1BPLA 3EQLC 3M4YA 5D65A 4G7HC 4IHJB 3OPOA 1RCVD 2ZZEA 4IIJA 5G3LF 2K28A 3N52A 1STGA 4EB6B 5I6WA 2SDFA 5D14A 5KRUA 2OWOA 1FNWA 2K03A 4G7ZC 1F77A 4IUPA 1EWHA 5A2QL 1TY2A 1JB3A 4PQXA 1PTOB 2ZNJA 4KK7A 2CW0D 3U0ZA 1EEFD 1SNOA 1Z7TA 2WPDA 3HG9A 4CJ2C 5EBDA 1F2LA 2VQEB 3H6MA 1J9OA 1T5EA 1GUTA 4XDXA 1PFMA 1JCKB 3CHBD 1NUCA 2F0OA 1I4PA 5BR8B 2K32A 2EJGC 1B44D 2L0CA 5LA6A 5C4ZA 2ZXPA 3D31A 1ICWA 3OWFA 2X8KA 3G6JB 1RDPD 1HXYD 1II3A 1A3UA 2XSCA 1TVXA 3T1YB 1SNQA 1QJOA 4A3DB 1WTHD 1DCZA 4C2MB 1F9PA 3TZDA 1STAA 2VJJA 4TUYA 3H94A 1LACA 1XHXA 3WOEA 2MPMA 2F0FA 1H8HA 3OAAA 4G57A 5D5PA 5ITZB 1HFGA 5KHHA 4DRXB 3ETQA 4EFEA 3VYUA 3HGBA 4TSFA 3RYIA 3L9AX 1H9SA 1FNVA 2KEEA 3SK8A 4HMIA 3D8GA 4C3IB 1LABA 2Y0SB 1E2ZA 2JJ1A 3ZS8C 2K1BA 5JH7A 3LNNA 5M5WB 4PI2A 1TIID 2RDGA 3JAWB 1LLRD 3ZPNA 4C56C 2HLDA 1RTNA 3CRLC 4B3SB 4HTHA 3QB3A 3EA6A 2F0NA 4A93B 4B3RB 1HTPA 4KY5A 2NVTB 5JJJB 4A3KB 4LR3A 4U3JA 3NBHA 4DR1B 3MXPA 5JPMC 2WZPP 1CQVA 3HKCB 2EE1A 3D6WA 3H09A 1BBXC 4BBSB 2EY5A 3T56B 2EY1A 2J4XA 3OMCA 4GKKB 1K83B 2NN6H 5KX5B 1YNJD 4JI0B 4LF5B 1ZAUA 2B2UC 4U68A 3S1NB 2O5JC 2R9AA 3MVVA 3SDZA 3CP8A 3PUYA 2NWGA 4K6LA 4TV9B 5LMUB 1S5ED 4QCLA 4PNYA 2A5HA 3OEEA 3RZDB 1BCPC 1JQYD 2PYLA 1TUBA 2R70A 3I8ZA 2HDMA 4RWSC 5JAVA 3K5OA 5CA0A 3EFXD 4P2CB 4DV2B 4CC5A 1A2TA 3A54A 4V190 1FR3A 3J7YW 3KK7A 4ZQ3A 2ZIMA 2C5CA 2ENBA 1GOZA 1KDCA 3RYCB 4RKBA 1XNQB 3ITPA 4IN3A 4LFBB 5IGCA 4XN0A 2RJZA 4ZKCB 2E74C 4CC6A 1EY5A 1FFXB 3FKSA 5FPRA 4KY6A 4FF1A 2FFKB 4B3TB 4O4LB 2YYZA 2FMCA 4CKEA 1W0KA 4KMUC 4CS4A 2RVLA 3K6OA 1N34B 3OTFA 1HW7A 1WVLA 1JFFB 4LH6A 3ND9A 3S1MB 3OWEB 4RCOA 3A8JE 2Z8LA 2XNDA 2VB2X 1STNA 2NVQB 5J2TA 1HTLD 2ZXRA 3QO2A 4DK0A 3MAQA 1C48A 4A3FB 1PZJD 1CZGA 4YJ2A 1IHZA 2OXPA 4OL7A 3GVJA 2F3WA 4HSPA 2B39A 1KLGD 2PZTA 1KNEA 3MFYA 4XIGS 3K58A 3T16A 4XQQA 1E1QA 3JAME 2LZJA 3HOUB 3J81E 3PMFA 1F9QA 2R7ZB 3EROA 3D4RA 3HKEA 1L0YB 5ELCA 1UD2A 3QF7A 3QTCA 2XIWA 1DGSA 5CA0B 1NSNS 3IFTA 1RF2D 2OF1A 5EKIA 3R8BA 5IGGA 2K5QA 3HKDB 1P49A 1Y69U 3JAKA 1QE6A 5JVDA 1G2TA 3JAKB 4ME5A 4II3A 1HUNA 1FYCA 3FDTA 1MBYA 3QOJA 2DY7A 1EQVA 3DWPA 1PRTF 4DXGA 2RSNA 2Q0AA 2IL8A 3HRZC 4X1KB 3QWNA 1Y8NB 4ZI7B 1IW7D 5JVG3 4ABNA 1XMQB 1UNSA 5EKKA 5KEEA 4G4KA 2JIZA 1ILQA 4EQOA 1O9HA 4BA1I 3I4LA 1LTSD 2KVMA 1BMFA 4O42A 2NZ1D 1PFBA 1SFOB 2AWNA 1SYDA 5J2TB 2F0SA 1QILA 1FGBD 3S14B 1CA6A 4A3GB 4X1IA 4XONA 2L55A 4LF7B 5EQ0A 3IFDA 2XGJA 2VNUD 3UQ8A 2VWKA 2I07B 1XX8A 1LTGD 2E75C 1Q1EA 4B9XA 1SYCA 3A3GA 2SNSA 4CH3A 2CHBD 4HEDA 4ILWA 4XMYA 3TP7A 4KHZA 4O4IB 4K8ZA 1DM0B 1DONA 2UXDB 4XN3A 2A73B 3RYFB 2XOKA 3BVZA 5C3XA 5I9OA 2N88A 2O2LD 1E79A 2NTTA 2P5OA 4CH5A 4F6RA 4DNTB 4DR3B 3GTGB 4AHCA 4MHEA 4QB4A 1UD6A 5M5YB 4KV6A 2DY8A 4Q5VA 5K36G 2KCCA 4N9TA 4KN7C 1SNPA 4LFAB 2PO4A 3CU7A 1QHTA 4M1UB 4BWAA 3T13A 2ZT9C 5CMDA 1TY0A 1BCPF 4XLCA 3GTLB 1E3XA 4YY3B 1CHPD 4EVOA 3BDLA 3IAYA 3HOWB 4CHTB 4K0KB 1J8IA 3GTOB 4FLWA 2O5IC 1KMHA 2PGGA 4L63B 4FVMA 2R61A 4ULLA 4ZLTF 3MEHA 3VA7A 3SK6A 5C6AA 2Q8RE 4NMZA 5LMNB 1D5MC 5LL6X 2X69A 4IUNA 2M9VA 4WRDA 3DSQA 3BHPA 1O7LA 5NUCA 4C3IG 3J80E 1IBLB 1J5EB 1U4LA 5FK9C 3J80L 2XRQD 1UD3A 3W2DA 4K8JA 2OT2A 3E22A 4CKBA 2E2IB 1I6HB 4JI6B 4TKOB 2ID0A 2Z1CA 1TVKB 2UUAB 1ZXTA 3BG3A 1B9NA 4DAVA 1GUGA 2XHBA 3JARA 4XQJA 1V1PA 5JVH3 1PTOD 3PIP3 2NVXB 3GO5A 1PTOF 1IYUA 3BH4A 3A35A 3A56A 2CK3A 5GONA 4AQYB 4ZHQB 4FO2A 5KMGB 1UD5A 1PMRA 1R4QB 3VR6A 2XZLA 4NNJA 2QEJC 4GLXA 1IL8A 1EEID 1VF5C 3OIQA 1BNZA 4K8XA 1X4TA 2B2WA 2VB3X 3HOZB 2UUCB 3HS0C 3PV0A 2KHSA 4OIJA 5C0XJ 5J22A 2X6XA 4DV7B 1PRTC 3Q0AA 3WDNA 5EJWA 4UCTA 4XKVA 4X1YA 4JMQA 3E6ZX 1DJRD 4DGZA 4NP5A 4CH4A 2Z6BD 4HN7A 4I4TA 3I4MB 3KBGA 4O4JB 3NP8A 2E5LB 3DEPA 1NRKA 2ZZQA 1NCVA 2D2CC 1EU3A 5A35A 2PMZB 4C1NK 1N36B 1HRJA 4CJ0B 5IOCA 2X53S 4A3BB 3NE5B 1PXUA 2KECA 3OFNA 3PUXA 3JSNA 2HHHB 4RGMA 2YI9A 2D3LA 1BQQT 1HA6A 1BOSA 2L9HA 1B53A 2A6HD 2WAQB 1HZEA 4OO1I 4N9PA 1L0XB 1UEAB 4EB6A 2A6ED 4J6HA 5EZYA 3B2EE 1TKWB 4C3JG 1EOTA 4YXWA 2NN6I 4X3TA 1MSGA 1M8AA 5CB4A 2BTQA 1JOOA 3M4OB 1ML0D 4R8NA 4FXGC 3S1QB 1ESFA 4RGOS 1TS2A 1CFMA 4JI7B 2VUMB 1KTKA 1IBKB 1BCPD 4FLUA 1ZYRD 3BS1A 5DM73 1JMKC 1ONLA 5EYPB 1Y8OB 1Q8IA 4XL9A 4K6DA 2WKDA 4IUVA 3BRCA 4XT1B 4IUQA 2F0GA 5ELFA 3NWSA 2EYPA 3E0JA 5EYPA 5K5PA 5G3LD 3T53B 1FFXA 1TT2A 4FFBB 3I91A 1H2SB 1Y1VB 2A6EC 4WORA 4B9WA 3T51B 1V0EA 1XMOB 4AYBB 1E2VA 3CMMA 1SQGA 2LY7A 1WTRA 3I3CA 1W6JA 4HCEA 1BDOA 3DXJC 2ZM6B 1AZQA 2NB0A 2KQ3A 3RYCA 1N32B 5T1GA 3VQVA 5K1XA 2A69D 1PKVA 1SYGA 2CQAA 2LS01 3F2UA 4DV0B 3G05A 2MJ8A 3Q22A 3OE7A 3X3MA 4KHPB 5I9PA 1SE4A 4PV1C 4RGNA 1JJOA 5D3IB 1G291 2IJ0A 1BCPB 3A7AB 1TUBB 4K8IA 2ZZFA 4LMQD 1QG7A 2YI8A 3BCDA 3P75A 1TR5A 4V0BA 2V4DA 1NBMA 3DHQA 4TQDA 2E3CA 2WACA 4LNUB 2GK7A 4FLYA 1ENCA 2DIEA 4XLHA 4I50A 2G9HD 3CQZB 4XTCS 2B2WC 1VJSA 3BPZA 4D7TA 4K5WA 1JWUD 1EYCA 2UUBB 4ASUA 1IW7C 5IJ9B 5LP6B 2F0TA 2Q8IB 1UAPA 2ZXOA 4X1YB 4UCRA 2X6LA 2JS5A 2K33A 1RHPA 2FJ2A 2K01A 3S15B 1U4PA 3DWQA 1XNRB 5IWAB 2PZWA 1I4HA 2JDIA 1AP0A 5DN6A 1I4RA 1N33B 4UZUA 3WQZA 3VYSA 4EFBA 4XXEA 2C9OA 2L12A 3DEOA 2YU9B 2JGUA 3OMGA 5JCOA 2G9DA 3VQWA 2QJ1A 1TGOA 3GTQB 4LFCB 1IKLA 1LTBD 3QG1A 4Y7NB 5M3MB 3U9OA 4BY1B 2NN6G 4UCOA 1JOQA 5LYJA 5IIFA 1EY6A 5J39A 2DNCA 2EYHA 1F2YA 1H9JA 1ENAA 4NVPA 2J0TD 4H44C 4DR2B 4J8QA 3GD7A 3TN2A 1IKMA 2KEDA 1U4RA 1H9KA 3RLFA 2B2YA 4JV5B 4FYDA 2JA6B 4KKUA 4X3UA 1PLFA 1C8CA 1MGSA 1M4VA 3QJYA 5CGKA 4PI0A 2ZXHA 2RQ6A 5I2XA 5IT9E 4OO1H 3JASA 5BN4A 2GJPA 3NUCA 3MXNA 2A68D 5KIXA 1XQ8A 1SKVA 4FM1A 5EIBD 3JATB 4EQPA 2VWJA 1CM9A 1VDZA 2EZVA 4U673 5KHIA 3MWYW 3V2TA 2A74C 4I55A 3M7GA 1PYWD 4NKLA 3C46A 4XR6A 1U4MA 5CV7A 5IJ9A 3I70A 5FOBB 2FINB 2WKCA 4YIJA 3OHXC 2EYJA 3KLRA 4E6IA 1V9PA 1OHHA 4FFBA 2F3VA 4RGTA 1MD2D 3S17B 1LTAD 5EGTA 5EBCA 1Q1BA 4BY7B 5KYLA </