1VF7A

Crystal structure of the membrane fusion protein, mexa of the multidrug transporter
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
237
structure length
237
Chain Sequence
TLNTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQLQEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug resistance protein mexA
publication title Crystal structure of the membrane fusion protein, MexA, of the multidrug transporter in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 67
structure length 237
sequence length 237
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1vf7A03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1vf7A01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vf7A02
1YNJC 2K32A 2B8GA 2A68D 3H94A 3GD7A 4I7ZC 3OPOA 1H9RA 2DNEA 1O7LA 3A7LA 2F93B 2NN6G 3BDOA 4H0LC 1FYCA 2EJFC 1E2WA 1A6XA 2O5IC 2D5DA 2BE5C 2D2CC 2F1MA 2BA0A 2E75C 1DCZA 2B8FA 3VR2A 4OGQC 1RSOA 3I72A 1H9SB 2DN8A 4LJZC 1K8MA 2O5JC 3I4LA 3WDNA 3M85A 2EDGA 2K33A 1VF7A 2A6HC 1HQMC 2DNCA 3WB1A 4KN4C 1HTPA 4RCNA 2NN6H 4JK1C 3WB0A 2AUJD 1PMRA 5JJEB 3OW7A 3VR4A 1GHKA 4DNTB 1SMYC 3BRCA 1GUNA 3T56B 4H44C 4BA1I 4JBWA 1IYVA 2K7VA 2A6ED 2YYZA 1T5EA 1BDOA 1VCIA 5JEAG 3N6RA 5JJJB 2NN6I 4IFDG 3LWUA 5JJNB 4DK1A 3ND9A 1Q1EA 2CW0C 1K8OA 2BE5D 3CRKC 5C0XG 1B9NA 1ONLA 5KNDA 5BN3A 4KKTA 1YNNC 3KLRA 1OXXK 1LACA 1Q12A 1I6VC 5K36G 2KA7A 4KKSA 1IW7C 3VA7A 1HPCA 2A6HD 3D4RA 3P20A 1GUOA 4KN7C 5JEAH 3PUWA 2JEBI 4IFDH 1Q1BA 2IT1A 3HGBA 3PUVA 5KNCA 1B9MA 2BA1A 2R6GA 4TKOB 1TKWB 4H13C 4KHZA 4LK1C 3SDZA 5C0XH 4IQZA 3QG1A 4TQUS 4GYCB 3VR6A 5BN5A 3T51B 2E74C 3OOCA 2JEAI 4XIGS 5K36H 1GUSA 3QIAA 1GUGA 4KI0A 2AUKA 4GZYC 3IFTA 1ZKOA 4G7OC 1OXUA 1CI3M 1CTMA 2L5TA 1OXTA 1Z6HA 3D31A 2A69C 3A8KE 2F95B 4G7HC 3M7NA 4G7ZC 1DXMA 1GHJA 3DXJC 1Y8OB 3M4YA 3PUYA 4XTCS 1E2ZA 5A35A 4HR7B 4KKUA 1H9SA 1Y8PB 3LNNA 1DD2A 2ZT9C 1H9MA 4KMUC 3PUZA 2A68C 3ND8A 2AWOA 1GUTA 2JE6I 3U9SA 2PCFB 1IW7D 3A8IE 5D5QA 3GQBA 2EVBA 2BDOA 2EJGC 3FMCA 1H9KA 1Q90A 3SE0A 3T53B 1LABA 3NE5B 3A7AB 1Y69U 3IKJA 4OO1G 5KNBA 3L7ZC 5D5PA 1FR3A 1OXSC 2QF7A 3MFYA 1Z7TA 4BA2I 1EWHA 4L8JA 2V4DA 3RLFA 3TZUA 3FPPA 1Y8NB 1TU2B 2JXMB 1ZYRC 3A8JE 1CFMA 2KCCA 2E76C 3EQLC 3PUXA 3AB9A 3MXUA 1H2SB 1G291 1HCZA 3WB2A 3PV0A 1V43A 1QJOA 1E2VA 3VR3A 2A69D 3I73A 1IYUA 3W3AA 3VR5A 4OO1H 1VDZA 1O78A 1OXVA 3CRLC 1V8QA 4DK0A 2LMCB 1H9JA 3BG3A 2EJMA 1GJXA 2PNRC 5BN4A 1VF5C 4PV1C 2PPBC 2A6EC 2D62A 2Q8IB 4DNRB 3QJYA
chains in the Genus database with same CATH superfamily
3A8JA 1KLUD 1I50B 4ZV4A 1YTFD 1STYA 3I4OA 3TK1A 2C5HA 4UP9A 2ZIOA 3VR2A 3PO2G 1C0AA 4FIPC 2XRSD 3BYTB 3MD0A 1FFXB 3RVYA 1D5MC 2P5OA 3Q4HB 2X0KA 4WJ3M 2VB2X 1K83B 1N06A 3QE2A 5IYBH 3CXCB 4A3MB 4H13B 3M4OH 1ICFB 2NYZD 2B2WA 2BH8A 3ZRVA 5JEAH 3LDCA 3PO2B 1SRUA 2ZXRA 2C2AA 2HQLA 2XZPA 4GX5A 4G7XA 1DF5A 1QZGA 4XQJA 1Q82W 3CCSV 2J7KA 4RFBA 1XQ8A 5KA5A 2AHYA 4TV9B 5C4JB 1F77A 5J2TB 1GVHA 3S24A 4NXMQ 1IURA 3QTCA 3PSIA 4Z4RA 4RDJA 1HCZA 3OEHA 3T16A 2IWHA 4NVPA 3CMMA 1VQ5B 5EZYA 4CGYB 2B2WC 4WRDA 1MIUA 4P72A 3PCOB 3CPWB 1EY5A 2DW4A 1S5HC 2PZUA 2QEJC 2UXDL 2DWEC 1WCMG 5H1SE 1KKCA 4BY7H 5F4OA 1VQDA 2MP1A 1TWFB 1FNBA 4Y7NH 1V0FA 2KB1A 1V1QA 3HKDB 4X1YB 1LM0A 3KLRA 3NUCA 2WYRA 2E5LL 3PVDA 2A6HD 2WKCA 2E5LB 5F4MA 2EYPA 4QE9A 3ZMZA 1QX4A 4TQUS 3T51B 3EFXD 4ICGA 1WCMB 1K8AC 2JDIA 1Z6HA 2Z4HA 3OR7C 4NXMO 5FLMG 4WFGA 1PTOC 4FM2A 4QUFA 1FYJA 4PZ6A 2Z0AA 2BCCH 3KUPA 1CA5A 4R4OA 1HR0Q 1H8EG 5LMNQ 3HOVH 3A0BZ 1QVGB 3K03A 4FFKA 2IH1C 4GUNA 1RD9D 3CRLC 5JEAJ 3MHSC 3J80c 3FKIG 2B39A 3PIO3 2NB0A 4AYBB 5J2UA 3OMCA 3GTQH 5KX5B 4MHEA 2F4VL 2EINC 4JTDB 2AUJD 1E1QA 1WI5A 3CU7A 1VMPA 1BCPC 4FF4A 4HNAB 3P1HA 1FXKA 4UXNA 1Y74A 3FKIB 1N34B 1B2RA 1SNOA 2KA7A 1EIYB 3S16H 5KRUA 4X3TA 3OW2U 1EZVH 1IZ6A 1B9MA 4HIZA 1I50H 5L3GA 2BM0A 3J81L 2Q2HA 3ML0A 2JGDB 5A8AA 1CI3M 1JJCB 1BUVT 2B5OA 1HR0O 4BR6A 5LMNO 3GVLA 3MXGA 1CSQA 2V1DA 4X66Q 1PH7A 4IURA 4DV1L 1EFWA 1K83H 1UD3A 3WBJA 5D5PA 3DXRA 4A3MH 3Q8DA 1O7YA 4WZTA 3KCYA 3LUTB 1Y6XA 4P2ZA 2RDHA 2IX3A 5JPNC 4OX9B 2EY6A 3GTOH 3J7AV 3VR5A 1VF5C 1I4XA 1FXKC 3D0FA 4Z1MG 3OGCC 2RQ6A 2EFGA 4DXGA 4JI0Q 2Z9HA 4GX2A 5CA0B 4MTFA 4N21A 3BVMA 3NWSA 4ZCKA 1MKHA 3DHQA 4G4KA 4IL6Z 1QG0A 4FO2A 1AP0A 1FRQA 1N0VC 3H91A 3DTUB 4EEQA 4F6EA 4DNIA 2ZR2A 2RNBA 1W6KA 2HCCA 2Q67A 4GZRB 4F87A 5J35A 1DK1A 4IFDH 3A74A 1TUEB 4B3TQ 5LHGA 1NSNS 2L4NA 1T5XD 4X66O 5FLXc 1F4NA 1GHJA 3JAME 4GN4B 1QCEA 4KMUC 1RM1B 4DV3L 5K1XA 1EQTA 3H3VH 2KQ3A 4P9SA 2F0KA 5IYBO 5ISRA 1NH2D 3MFYA 3GWKC 1DDIA 3FVQA 3TBIB 4WFFA 1KK1A 2I5LX 3R2IA 2B3GA 3ABLB 3PF5A 1EY0A 4JI0O 1AI5A 2PI5A 2ZZQA 4JC0A 3UDXA 2C4TA 1K5QA 5GAHC 2BE3A 2QA4B 3RN5A 4CS4A 1E1RA 1E3XA 5JPMC 1TS2A 3CRRA 1Q5OA 3I3CA 2VS1A 2R70A 4DV4Q 2NN6H 1U9RA 3Q22A 2WLLB 1FAFA 2UUBQ 3VA5A 3S2DH 2VY3A 4O4IB 1IHMA 4AF7A 4Q7JB 1KMHA 4DV0L 3X2QB 1GOZA 1S5ED 1I94Q 1URFA 4C3JH 4FZ0A 4DV0B 1HNWQ 4LBZA 4BBRG 4B48A 2PI4A 3DWPA 5B1AC 1WA8B 5IYDH 3ASNB 1MRZA 1LT6D 3A56A 1JWSD 4APVA 5BN5A 3CC7B 4XIGS 5M9OA 1S5LZ 1OXUA 3TGUH 4RD2A 1H95A 3GTKH 5DM63 2D9RA 4BXXG 3W2DA 1M1KD 1C9OA 5LOVA 2F0TA 1U4MA 2AZ2A 4LFBQ 3STZC 3ASRA 4R4CA 4DR4L 2K5HA 2NZHA 2BTQA 4DR4B 1TA8A 5IE9A 3HKZG 3H3VI 5GQOA 5JOBA 5IYWA 1KKDA 3KF6A 4ZHQB 1ZEQX 2SEBD 3M7MX 4Z4UA 5KMGA 4IFDJ 5F2VO 2KENA 5B3SC 3Q3AA 4Z4TA 2EQSA 3K0XA 2X69A 4HAMA 1E2WA 4OPOA 4AVZA 2UUBO 1V54B 3JATA 1OB5A 4LFCL 1AJQA 4J11A 1I94O 2JYOA 1MG1A 4FNFA 1HNWO 1QU7A 4WJ4A 4RG1A 1JWMD 3K5MA 4BPRA 2ZL6A 3WY9A 1WYDA 1UPGA 2NN6I 2JS3A 4MTKA 2AXTZ 5BN3A 1US6A 2O4XA 2HLDA 3F5WC 2VNHA 1PJ7A 2ZTEA 3JASB 2ICEC 3I4MG 3SK6A 1B70B 2C77A 1UFIA 3TDQA 2AZ0A 3K5LA 4LFBO 2E2IB 4L5QA 3A54A 1W87A 2EJGC 4UY8C 3KL9A 2ZKOA 1PZID 3EBEA 3CRAA 1XBLA 3M4QA 1Z7TA 1BQQT 3S1QB 1THZA 1E2VA 4OGQB 3BPZA 1HR0W 5LMNW 1CKMA 5HXBA 1L1OB 1HJPA 1NBWA 1TUIA 4I7ZC 4H0LC 2DYSC 2F0DA 1CNEA 1VQ4B 4RPBA 3KEWA 3I55A 2VZAA 1JOQA 1QWYA 1QBZA 3A8IA 3V2TA 1SNMA 4HIKA 2P90A 1B06A 2FXQA 1WPBA 1PM9A 5AG2A 4DR3Q 5KHJA 2D0OA 1M90W 1M56C 4H44C 4DR5Q 3PO3G 4ZLTF 1GTOA 2OIGA 3JU4A 3Q6SA 1D1KA 1EFCA 2PLFA 4DQKA 3G7LA 2OCHA 4JMQA 3JD1A 2C5BA 1KAWA 1J6QA 1HNZL 1XPRA 2ZE7A 4XONA 1PKXA 1QE6A 1FGUA 2JN4A 4LF8Q 1N8RW 1PH8A 3UDIA 4PA7A 1S76D 2CK3A 1KECA 1EFRA 2A68C 4PC6A 3MEFA 1LUZA 3JAMi 2RF4A 1CK1A 3TP7A 1Y69U 1E62A 1GM8A 1Z5VA 3Q6QA 1PH3A 3AVYA 4DR7B 3CPXA 2D2CB 3H1LH 3BY6A 3CCSB 3LQ6A 2BDNA 4CC6A 4H7BA 4HN7A 2RHQB 4N3GA 1KBHA 4B3FX 1QILA 2CGNA 5JVDB 4DR5O 5CC4A 1NAPA 1VQKV 4UP7A 4E0FA 1IBLL 4AF6A 4GLAC 2UXBQ 2JA8B 1IBLB 4JYCA 4G28B 1PV0A 1E79A 2EXDA 4XXEA 1OCRB 2LP7A 1JJGA 1N36L 4FYDA 3KLWA 4I0XB 2CRVA 2CAZC 2VBSA 1VQBA 4PDVA 4LF8O 1H42A 5JH7B 1KTKA 3SEBA 5EPKA 1N34Q 2OCCC 1IKMA 3WQZA 4UCOA 1DZ1A 2F95B 1G91A 2YEVB 4O2BA 4RD1A 5LYJB 4YWMA 4O4JB 3WFVA 1SQGA 5B5EZ 1VQEA 1MHWC 3A8IE 4XKVA 1WP7A 2WAQB 3CCEV 1M57C 3OMAB 4KY7A 4IPHA 5G3LF 3K7AB 2WPDG 4A3GB 3ZN0A 1K8AD 1Q8IA 2F0PA 2UU9L 5IYDO 1V8QA 2YUAA 1H9JA 4CDFC 2UU9B 1PTOD 3K08A 3I56B 3H94A 3EROA 4L87A 3SEJA 1GM5A 4OX9Q 4LF9B 2NVXB 1T6XA 2UXBO 3SKBA 3FYIB 1BXTA 4RM0A 1X65A 4LUZA 1IJEA 3ZIAA 3VYUA 4XN3A 1ZUQA 5IYQA 3TETA 1HFGA 3P30A 1RODA 3BA9A 5A2QN 4B3RQ 1Y0RA 4ZKIA 4GX0A 3CC2A 1N34O 1B2TA 1VQCA 3H01A 1QH0A 1G51A 5H5NA 3CXCU 4N3NA 2XN9C 1KRTA 3PUMA 1BCPD 1BVSA 3UM7A 4XLAA 2CH4A 3OTOQ 3FYEB 5JVH3 1FFXA 2GA4B 4P6YA 2OQ0A 3Q4HA 1SYGA 1EWHA 3OT7A 3FPPA 3CXCA 3PUXA 2IX1A 4O1NA 1IB0A 2QKAA 4OX9O 1RDPD 4ASUA 2XZOA 4OPSA 5B1BC 5BSXA 3LDEA 3E1YE 1IL2A 4P12A 4ZQ3A 4EGVA 1IBKL 1A8PA 5IT9L 2HDNB 1H8HG 1IBKB 2QKCA 1SESA 4KN4C 2R93G 3BZDB 4B3RO 3P75A 4Z1VA 2GJPA 4KY6A 4RO2A 3BFRA 4TV9A 3ZS8C 5J2TA 3G80A 2CVRA 4G7WA 3VA7A 4ZOLB 4H13C 3OTOO 2QCPX 1VQ5A 4OIKA 3CMAV 1WTWA 4GKKL 4MTNA 1D2EA 4RCOA 4GKKB 5FPOA 1Y8OB 1A8VA 3CPWA 2HQEA 3CQZH 4XQNA 5EKKA 2JA8H 1SQPH 4GQNA 3PGZA 4P71A 2Q69A 3E6ZX 3CXHF 1OO9B 2L15A 3HKDA 4X1YA 4PAAA 4BAYA 4TMWA 1NNXA 1ZM4A 4LF4Q 3HFZB 1XHXA 5FO7B 3D8CA 4IZ8A 2YC0A 2G5DA 3OHXC 5I9OA 4Z4SA 2BN4A 2DY1A 2JA6B 3CCLV 4P26A 1LTID 3M85A 2K28A 1QVGU 1LLRD 1GKHA 3LWEA 5THXA 2BSKB 3L9DA 4DR6Q 1SETA 4A3GH 3DEPA 3MAQA 4B08A 5ELCA 1QVGA 2NLJC 1YVWA 2IW3A 4M1UB 1R5NA 4ZUIA 2YIAA 3HOUB 2JIZA 2Z8LA 5CBAE 1LTGD 3WNDA 4DR2L 1KD1C 2N78A 1HDJA 5KX5A 1DD2A 3KOJA 1YBYA 5IYCG 4HYOA 1H8EA 4LF4O 3CAMA 4TMTA 1D5NA 5H2FZ 2RVLA 4HNAA 1XL6A 4MVSA 4HTHA 2O5IC 1A63A 1E64A 1HWYA 1A15A 3W2GA 3W5UA 4NXNL 2YI9A 1K73C 5CV8A 3CCJV 2JGDA 3D4WA 4NXNB 3FRPB 2LFNA 2B29A 2RC5A 3FP9A 3CWBH 5FK9C 3T4AC 4PI2A 1TVXA 3I90A 1EWIA 2VQEL 4IYHA 3W7TA 2DYRB 2VQEB 1MGSA 3CESA 1OHHG 4JZ2A 1HVXA 4KJNA 3ABMB 1SF9A 3MHHC 2F0JA 5GV8A 4GS3A 1DONA 3BDCA 3ERQA 1GUSA 2PI2A 1YVCA 2G38A 3CEIA 3O9OA 4DV2L 2A69C 1SRYA 1ZXTA 5CA0A 2P22C 4DV2B 1TGOA 2ZTNA 2P06A 3V7AA 4OO1G 1KRSA 2ALYB 2HP8A 3SR2C 1SKVA 2HDLA 2P3MA 2IX0A 1RFYA 4DUYQ 1JR0D 1AE2A 4Z1MA 1N05A 3A0RA 1AVMA 2EIMB 4C2MB 3GD7A 4DR7Q 4KD3A 1S5FD 3WNBA 2X8KA 2K1BA 1F9PA 3L9AX 4PA9A 2KCTA 5IOCA 5BR8L 3SJQC 5H9CA 1JOKA 4AYBE 5BR8B 5A2QL 1JJ2B 1UD5A 4AI8A 2A7WA 1SJED 2VW9A 3D36A 2IL8A 1HA6A 3E22B 5IY5C 4M8AA 3R65A 4K8XA 4J42A 4J7KA 5C0XG 1VP7A 3WXMA 1YNNC 4P22A 1Q12A 4RD6A 2QW7A 2PMDA 5ELNA 1SM4A 4NMZA 3ASPA 2XAQA 4J7ZA 3ETDA 3IGAC 3IFTA 2JA6H 1MSGA 5GADC 2QA4A 4U7OA 4A3CH 1KU9A 3I7FA 4A3JB 3ND8A 4YY3L 2WLLA 2IJJA 1Y1VG 3J81E 4DUYO 4YY3B 4XLEA 3L7ZC 3JQPA 3BVGA 3KLSX 1PKVA 2KUMA 4U7NA 2R9VA 1RM1C 4DR7O 2NBFA 3HG9A 3PV0A 3D36C 1TLLA 3UE1A 2Q7GA 1J95A 2DIEA 3BG3A 3RYIB 1WA8A 1L2FA 2A68D 2XSCA 1EQRA 3GTGH 3HOUH 4C56C 1L1FA 3ABLC 1X3GA 3CC7A 1K33A 2PI2E 3RZOH 2Q6AA 2YTXA 4UVBA 3MMPA 5JJJB 2C2WA 1XNQL 2XAJA 1VQ8V 4FK8A 3FEWX 4RMFA 4F6RB 1XNQB 1OB0A 2Q6IA 4X89A 3EXAA 1B1ZA 4QE7A 1VQKB 4W4KA 2ZZFA 3X2QC 1DJRD 1WN7A 4ZHQA 2A73B 4XQFA 3TRZA 2D3LA 2V7XA 1KNAA 3D6WA 1H2NA 3WWVA 1R9TB 3B78A 4FMTA 5EYPB 1F2MA 4EFEA 2LFRA 2MK3A 5IT9c 5GROA 1YLOA 3RWRD 2K04A 1BLIA 3HOYG 4KJOA 1I3QB 1SE3A 3NE5B 2KCNA 2DN9A 4B3SL 4IUNA 4B3SB 1MJCA 5CV9A 3C1FA 2FB5A 3U2QA 4QVAA 4X7CA 5KLVH 3K79A 1TUBB 3JASA 3CCEB 4LF9O 4PMWA 2ZITA 1WSVA 3HOYB 1GM7A 3WB1A 2KECA 3K0YA 5COYA 1N33Q 1EOVA 1B04A 1V54C 3DGEA 3K5NA 3NR7A 2FMLA 3O65A 2YXHA 1A3UA 2EZOA 1SQFA 4LR3A 1FL0A 1TWAB 1BMFA 1VJSA 2X0LA 3DC5A 1IX9A 4RH6A 3ERSX 5HGTA 3CCUV 4C2MH 3T1HL 2WB1B 3S15H 4O4HB 4KHPL 1F9SA 3FHWA 1L1OA 5HKKA 3T1HB 3MWYW 1HZ9A 4KHPB 2QDXA 3CC4V 4I5SA 1YJWA 1KB9F 3W2HA 3HOWG 1LTLA 1VQ4A 4R4TA 4DYLA 1GVPA 4X05A 4EVOA 1H9KA 4FLYA 2H5XA 4M4SA 3RLFA 4DGZA 1LTTD 1B8AA 2B2YA 4O0AA 4JI4Q 2HMAA 4DFAA 2N88A 3N52A 2Q7EA 5LL6Y 1JA1A 1Q8KA 3HOWB 3EJIA 4LMQD 2LJ2A 1N33O 4OGQC 4LNQA 1Q43A 1L1OC 4JOIA 3NBHB 4A3JH 1S5BD 1SQQH 4GT1A 4G1VA 1JQYD 1BCCH 3JAWB 4TN1A 3PA1A 1VQPV 3PMFA 2ENBA 1MZFA 4RCYA 1PXUA 2MJ8A 4K5XA 3HOZH 4UVAA 5DNFA 2JEBI 3RT3C 2WJYA 2YV5A 2Q6OA 2B2YC 5H6RA 4JBJA 4GKKO 3HKCB 5C3EG 1LV9A 5JVDA 2ATKC 2XUMA 2V7VA 3I1FA 5IWAL 1WTRA 5LL6X 1TVKA 4JI4O 4JOIC 4AQYB 1LT3D 3DM3A 1RQPA 3QO8A 2HVKC 3CMAB 2QJ1A 3TZUA 1JFFB 3J81i 1N0NA 1JB7A 4K2LA 1JVMA 4RUFA 3AVXA 4I0XA 2LZJA 1EIHA 2R7ZH 1BJKA 3APQA 1XX8A 2DNEA 3BDOA 1HZCA 4C3HB 5JH7A 3AQQA 2D2CC 1YXBA 1PTOF 1R9TH 3WNCA 2OT5A 4P25A 1NMGA 2YEVA 4TVAB 5LYJA 4O4JA 1YIJB 3AG2B 4OP7A 4WZKA 1I6VC 4LFAQ 1BHAA 1ZL8B 1Y1WH 5IGGA 1PH5A 1OCRC 4K0KB 1Z5WA 3OOCA 4QCLA 3I56A 4UZEA 3GTMH 4XDJA 1PL4A 3I4NG 3S2HH 2E76B 1BCPF 2J0TD 2ZE6A 3R93A 2RN9A 5JCOA 1EY9A 1MNGA 2MFIA 1U0LA 1XMQL 2EJRA 1XMQB 4J10A 4CH5A 3ZZUA 2UXDQ 1E43A 4MTOA 1KD1D 1N32L 1STBA 1G6PA 4A93H 5KAIZ 1X56A 1SJHD 4I7AA 3I4NB 3S14B 1AW7A 3JQRA 1PH4A 2VS0A 1WSRA 2LW1A 1PFMA 4NXNO 4DK3C 2PYKA 4IGGA 2RDGA 2ZL5A 1FXHA 4LFAO 1ZTEA 1FRNA 4IPDA 2Y69B 5JCOC 1K73D 2F0FA 4F8MA 3CCJB 3P27A 3AFQA 4JI5B 2R9AA 3SYAA 4YALA 3GVMA 4KTAA 1IBML 3QB3A 2PIAA 1NTGA 1IBMB 1KC8W 3LDDA 4TRDA 4G57A 1HFNA 1JICA 1O7IA 2W0XA 1D5XC 1LABA 1ROPA 2W0FC 3E89A 1ASYA 2K01A 2KCCA 3AG1B 2QM4A 2WAQE 2A69D 1LR1A 5KHHA 1FNCA 4KK7A 1UD8A 3OJWA 1S3OA 3BVOA 4ZOLA 4YHHL 1QGAA 1H8HA 3G6EV 2LSSA 4YHHB 2OQKA 1H9SB 5T1IA 3T1YL 1X3FA 4ME3A 3T1YB 4LBVA 2IU0A 2CWAA 1ZLZA 3G6JB 1K5SA 3MEHA 1I18A 1ZUNB 4YHBA 3H09A 4U3JB 2DWDC 1GH6A 4BWAA 4B3ML 2GHYA 1X32A 3AG3B 3OZUA 4B3MB 1VQLA 4DUZL 4C3HH 2P6JA 3GB7C 4DUZB 4GZYC 3V05A 4G7OC 4HSPA 4FLUA 5A35A 1Q7YC 1YNND 1CZWA 2K50A 2XAGA 2N04A 1RF2D 2BVNA 4YY3O 1EYCA 2ZTDA 1N0UA 2IJKA 5EBWC 3ICXA 4YAUA 2KOLA 4RPDA 3H9NA 2BSKA 4B47A 1BBWA 2HG5C 3B2EE 1SE2A 1WOOA 1TS4A 1FGBD 1BQ0A 4JTCB 1TR5A 1AZPA 1R5BA 4IJLA 4YAOA 1HZAA 5JJEB 4UDUC 1H38A 1YJ9V 2ZBUA 3TP6A 1G2SA 4DO2A 4X3UA 1XXGA 2IY5B 3H1KH 2JN9A 2YXYA 3MCAA 5FL7A 1YHQV 4RDKA 1J5EB 1XNQO 5KNDA 3DWQA 1JE5A 1NS1A 4WZEA 1TWCB 3TJTA 1NZ6A 5M5YH 4C3IG 2VBVA 1JJOA 3OWFA 3B82A 3CCRV 3TXSA 3S17H 1M8AA 4OXSA 4JI7L 4XL9A 2RDFA 4NDXA 2YU9B 1I6HH 4WFHA 3QOLA 3TS2A 4GKJL 2K05A 3FDTA 1JMCA 4GKJB 4P1VA 4I9WA 4LF7L 2BOCC 3ASTA 2Y4TA 1XILA 1O78A 4LF7B 4C3IB 2EOTA 1VQNA 2ZTCA 1AR1B 1H85A 2FHTA 3H1JH 1ZM3A 2Q2UA 1AB3A 4XOTA 2JA5H 1UD4A 2H4OA 3C90A 3AU7A 1JC7A 5IGDA 1X9NA 5IK2A 1PLFA 3W2FA 3CCVV 3KF8B 4UCVA 4ACAA 1OHHA 4KL1A 1BE3H 4EQOA 2ZXHA 2IHFA 2N49A 2UXCQ 1Q86C 2GUZB 1OXXK 4ULLA 3D3RA 3JD3A 4MW8A 3PUWA 2YWEA 3ZPNA 1KABA 1EXMA 1SN8A 3ABMC 1KZLA 4JI3L 4EX5A 1YITV 2WJVA 1LT4D 4DA2A 1KQSU 4XTCS 2WR8A 4M53A 4PA4A 2GV9A 5DM6V 1T6YA 2C5CA 1JJ2A 1JE4A 4P9OA 3CCUB 1ILQA 3ZHQA 2A9HA 3L71H 4CS3A 3E22A 3CC4B 4D6TH 4AQYQ 2ATWA 2H8PC 4MT8A 3CD6V 4CC5A 1XB2A 5EIBC 4J80A 3W7SA 1JORA 3MZ5A 2F03A 2VUMH 3ZX6A 2K33A 2R9IA 2EYMA 4UPAA 4C43A 2UXNA 1SYFA 2E75B 3HOXG 2UXCO 1GM9A 1V0EA 1ZWIC 1CA6A 3TCUA 4LUVA 4ZUJA 1YZ6A 5HZAA 1SC5B 1DOKA 4I65A 3LVBA 2L1BA 2JQOA 1B23P 4IJHA 3RYIA 1SKYB 1VQ6B 4R4QA 4KFMA 3HOXB 2ARHA 3GIRA 3S1MB 3G6BA 3I91A 1VQPB 3M3YB 4K0KQ 4A3DH 4A3FH 1KYOF 4LNUB 4AQYO 3U50C 2CWPA 1YTFB 4P6VF 2QDBA 4BIOA 1E1RG 2D74A 2NUCA 4QPKA 2F0SA 2BM1A 4F6RA 2SNMA 1NTMH 1R6KA 4M0LA 5HGQA 5K1PA 3QJYA 4L5SA 2EULA 1JMKC 1VQKA 3VBBA 1PP9H 1YHAA 4DXFA 2EDGA 2JA9A 3W7XA 3U11A 1I7PA 5EYPA 3LSUA 3NPPA 1XEQA 1U2RA 5TV2A 1BNZA 1R1BA 4N9PA 4NXML 3ND9A 3CRKC 2PYLA 4NXMB 3FB5C 1KK3A 4F7XA 4DV7Q 5A2QE 3CJHB 3AGPA 4TMVA 5IYNA 4O4LB 2MW2B 4K0KO 1CP9A 2FTKA 2Z0SA 3EVQA 1TUBA 3CCEA 1LTBD 1Q81C 4JI5Q 3M4YA 1GKFA 4RGTA 2F3IA 3G4SB 3VO2A 1JR9A 3NTKA 3U9SA 3J81k 4JV5Q 5KHIA 1EBOA 4JF3A 3W2IA 3STLC 1S0UA 2CGOA 4RDLA 4A3BG 1K97A 3JAKB 1PH9A 4ME5A 5LMUB 5C3XA 1IL8A 2B63G 4DNRB 1MD2D 5JJKA 4P2NA 2EJFC 3D26A 4KXRA 4O4HA 1QUQB 1ML0D 3H9VA 4PC2A 2K5NA 2ITCC 3WOEA 1FXVA 5CBGA 3VR4A 2HLDG 4DV7O 4YIOA 2X6CA 5A88A 2VJIA 1HR0L 5LMNL 1NJIW 2B63B 5FO1A 1YNXA 4MNOA 5J22A 2GVAA 4U673 1HR0B 5LMNB 1A62A 2RCFA 4JI5O 2B7BA 1X6OA 1TKWB 1WTOA 3LO8A 4BBSH 3ONAB 4JV5O 1PZKD 1IBMO 1ILPA 1G2TA 5E1FA 1CT1D 4BY1G 3ZJYC 1ZAUA 2F43G 4X88A 2VL6A 3NSWA 4JI2Q 1OXSC 1QGZA 1QNMA 3JAWA 1CNFA 1JA8A 1EP3B 1ICWA 1CKNB 1M4UA 4JYYA 1SLJA 1CQFA 1YF2A 2GTSA 3R8BA 2ZIMA 4QGUA 4BY1B 4LJZC 2Y0SG 5IYBG 4Y9RA 3M3YH 3HKCA 3WB0A 3CCQV 3HKEB 2Q5ZA 4X66L 1WU8A 4X66B 5JEAG 1PFSA 2FYUH 4XDLA 3F5TA 3R6KA 3IAYA 1HZBA 1XWEA 1AILA 3CMAA 1JFFA 1XNRQ 3IL8A 4C0SA 2XIWA 3SK8A 1EFRG 2VXWA 4FXUA 2Y0SB 3RD4A 1J5EQ 1K0RA 1TTTA 2KJXA 4JI0L 1CTMA 1QNUA 4CQJA 4MYTA 4JI2O 3PJSK 2WB1E 4A3EH 1PV4A 4PGOA 4RGOS 4R4IA 1VQAA 4K5WA 1ZM2A 3JAMc 1YIJA 1SDFA 3B09A 1D5ZC 4FDBA 4NP5A 1IKLA 1I4PA 3AB9A 3IC9A 1QNKA 2MPMA 1K34A 4HJAA 1Q7YD 1ZL8A 3JD0A 4B3TL 1FNDA 3I2ZA 3A8TA 4LBYA 4QIWB 4B3TB 4BY7G 1CHQD 5AN9A 3I72A 1WTXA 1NTZH 5CR3A 2C78A 3GV6A 2HCJB 5I2XA 4NBSA 4P30A 4RAUC 5IP9H 2WLJA 2NVTB 1SMYC 1TY2A 2OEOA 3FJOA 4F88A 3BH4A 1J5EO 4KKTA 1LACA 1WAZA 1OCOB 4ALPA 4FZ1A 2DY8A 4BY7B 3AG2C 3ZEDA 5E4WC 1SROA 5I9PA 2LS01 3QG1A 3CRZA 1YJ9B 3QIAA 1EWCA 2NVQB 1NH2B 2ZDIA 2CH7B 3HOVG 3OAAG 3ZBTA 4PJ0Z 1VQ7B 4S3SA 4OIJA 2UUBL 4DV4B 4MTGA 2BMWA 1SERA 4UAIA 1I94L 3NXWA 2E76C 2RSNA 5I2YA 1HNWL 1QR9A 3Q0AA 1UWVA 2W6JG 3T4ZA 2F4IA 4QQBX 3CCRB 4B7KA 1HNWB 2ZE5A 4ZCLA 2PYJA 3CCJA 4JGSA 3A7LA 3NP8A 4JW0A 3H15A 2M9VA 4EH1A 1U5KA 3S1NH 1RL2A 4XKWA 4JAUA 4POFA 2ZDIC 5IODA 4GLVB 4LFBL 4B43A 3W5HA 2EBOA 4JBMA 3ZRWB 4LFBB 4DR2Q 2E74B 4TT3G 1P16A 1XDCA 4JPRA 4YWKA 2Q8VA 4RGMA 3BQJA 3F7VC 2WKDA 2Y69C 5DS0A 4XLFA 1O7ZA 1A3TA 4G6IA 4A3MG 1H9SA 5LXTB 3FAVB 1Q86D 1E24A 3S16B 1K28A 5KYLA 4OWXB 5LP6A 5L3CA 2Q6KA 3ICEA 1JCHA 1YITB 4U3JA 3ZCCA 5GW7A 1WORA 2PNRC 2SDFA 1NR2A 2QF7A 5FJ8H 1YJNV 3M99B 3AG1C 1NKDA 3U9OA 4IUTA 4IT5A 4P3IA 1J9ZA 4CKCA 3GTOB 4XQQA 3SYPA 2CBXA 4DV6Q 5GONB 5I6WA 4I4TB 1Q82C 3MHBA 1VCIA 3N6RA 3CF5A 2OF1A 1X59A 4IFDG 3URYA 3LWUA 5EIBD 5FNVB 1VHEA 5EC1C 1XTCD 4FFBB 5LP6C 3VNVA 3ABUA 1EY4A 4QV2A 2WLMA 3JSLA 2WACA 2HHHQ 4IQZA 3VR6A 1UAPA 2ZZGA 5BSYA 2VYQA 3SYQA 3C46A 3BEHA 4R71A 3F7YC 5C5LA 4MIUA 5EQ0A 2Q0OC 1FS0G 4R7CA 2NVTH 4I9QA 3QFSA 1B50A 1J9OA 4PHZA 4DR5L 4M2LA 4DR3B 4DAMA 4DR5B 1PNLA 1K9MW 1AH9A 2RC6A 1R3JC 3PIPA 3ES9A 2LMCB 2HCIA 4K3AA 1XUQA 2NN6G 1ESFA 2NVQH 1X3PA 4FK5C 5LMUQ 4A75A 4EB6B 2NTSA 3SGIA 4LF8L 1L8DA 1P7BA 2XAFA 5KHGA 3DM1A 4LF8B 4C3JG 1PH1A 1G6ZA 2R7FA 2VZLA 5KUMA 2JEXA 2Q2IA 5IYDG 4FF2A 3AK1A 3LQEA 2E2HH 2JIZG 5JJZA 1XQBA 4AYBG 1EOTA 2ETNA 1Y76B 1VS0A 1OB2A 3S2DB 4ZK9B 2ZT9B 4QY7A 4XDKA 2XHBA 1I0HA 3SYCA 4RD4A 4C3JB 1OV9A 2OT2A 1SSOA 2LQTA 3RLOA 4X3SA 4QJFB 1NT2B 2E3CA 3QO5A 3RZDH 1PH6A 3ULLA 5CMUA 3GQBA 1JQ0A 2UXBL 3KF8A 5EPLA 2QKIC 5EBCA 1UMKA 2UXBB 4LCUC 3GTKB 3IC7A 2R3ZA 5I4DA 5H6QA 1Q81D 3W3AA 5LMUO 3OFNG 2F3VA 2GUZA 1KXLA 3CMEV 5ELBA 1CEZA 1XYIA 1O7LA 2CQOA 2F93B 4X64Q 1A6XA 1X3QA 1N34L 1SR3A 4UCUA 2B8FA 3ONYA 1K8MA 4WF9V 4N8X1 2RQXA 1OCZC 1W3SA 3L0OA 3CHBD 1QLNA 2PE3A 4Z2WA 2JEUA 3IFDA 2KVMA 4PDMA 1NB9A 4IALA 5DN6A 3CCUA 2NV4A 3M8AA 4KUMA 1C48A 3D4RA 3CC4A 4HJ8A 2BGIA 2QM7A 2E2JB 5GTIZ 3CCMB 4OX9L 3STBC 3EN2A 5HURA 2NPFA 1KTVA 2BSAA 5JJLA 4JI8Q 3HS0C 4YCVA 1PTOB 2AWNA 4B3RL 4CJ0B 3NXSA 2Q8RE 5BY1A 4B3RB 3AK3A 2EE1A 2K75A 3U6BA 1ENFA 1V1PB 1ELOA 2OTLB 3E8BA 3JALB 4JG2A 1PYWD 3CSXA 1VQ6A 5TSSA 3G71B 2Z4IA 3ZHVA 3OTOL 1FD9A 1VQPA 3A1PA 3OTOB 3KLSA 2KCMA 1BQEA 4LNUA 2RDCA 2PW5A 1K8OA 2WLKA 3BHPA 1MOFA 3OYYA 4FPPA 2EPBA 3CCQB 4UCSA 1RSOB 4YEJA 2L0CA 4QPJA 3SJBC 4BW9A 1EY7A 2AQ2B 2GJKA 1S0VA 5HFLA 2UUCQ 3ZJZA 5I6YA 2N74A 2EXZA 4D7SA 4DK6C 1E1OA 1VQGA 5L3BA 2PNHA 3HRZC 3WOFA 5B1NA 3K57A 1PFBA 2KHSA 3E83A 5EK0A 2NZ1D 3IKJA 3J80N 5J2UB 5E4XA 3SHLA 1OTCA 5LGUA 4X06A 4OWWB 1O9GA 5CV4A 3MXUA 3IJ4A 3MC0B 1IYUA 1TT2A 1F20A 1QR8A 3W5VA 3CJHA 4MVOA 2B8GA 1RQRA 1H2KA 1TWHH 4O4LA 5KGUA 4B3TO 1Y74B 3P26A 2GBOA 4UCTA 2X6XA 1G4YB 1YEWA 5J3BA 3UO2A 3KDFB 3G4SA 2I5HA 4XM3A 1T5EA 1Q3LA 3NQTA 2I07B 1UUPA 2X3UA 5CN0A 4IFDI 3Q24A 1IZ3A 3BY1A 2QTSA 4X65B 3JAKA 4LF4L 3OW2B 2E2DC 4NTXA 2LXJA 4LF4B 1E0BA 1SMYD 3R2TA 1WJZA 1BX0A 2JA7H 4DXWA 3L74H 4X9QA 3F2DA 1QUQA 3OZVA 4HR7B 1QOHA 2D0PA 3GVKA 1NI8A 2XWBB 3FMCA 1X4TA 1HH2P 4DV4O 2R92H 3KJOA 4JTAB 2R6HA 3MFGA 4JI1Q 3K7UC 3RW0A 2PZSA 2M00A 4DR6L 1D7QA 4TV8B 4RJLA 4YCWA 4UCRA 2HIVA 1VQ5V 3CP0A 4DR6B 1W2BB 4QFMA 2E2JH 1H9RA 4X8AA 2BE5C 2A3QA 3OKXA 3CS5A 1A32A 5CORA 4A3IG 3ZN1A 4I50B 1BF4A 2EIJB 1L0WA 3T56B 4XYQA 1BMFG 1GAXA 1B6QA 5EBLC 4PI0A 1PTOH 4AH6A 2DERA 3HR0A 3W1BA 1UEBA 1MA1A 2K5WA 3UQ8A 1UNSA 1TAEA 1S3JA 1E7ZA 1HRJA 3B40A 1YZBA 4YIJA 4LF6Q 4FLVA 5CV7A 1AEXA 5A89A 1CKNA 4A3IB 3BNWA 2MGSA 5DM73 2OWOA 2L5TA 4IUVA 4PA6A 4X1KB 1OGJA 3ABKB 5C8YB 1FX0A 2F43A 1QHTA 1PH2A 3O13A 2BDOA 1E3PA 4PD4F 3HKEA 2B2VA 1TS5A 4L8JA 1M90C 1Y8NB 4XT3B 4JI6B 1FDRA 3B77A 2ZXWB 1NCVA 3PIOA 1CM9A 2EYHA 1JT8A 4AILC 1QB5D 5TR9A 4DW1A 4QHYA 4X07A 1UJWB 4LF5Q 4DAPA 2D3OW 3I4LA 4DW0A 4IHJB 1BZKA 4JK1C 1N8RC 3RFRA 2A1AA 2ZCEA 3RVZA 1YDXA 1LTRD 3MDSA 4GNXB 4OL7A 1YJNB 1RTNA 2GTAA 2B2VC 2RKSA 2YSUB 3HAGA 5CYUA 2RMKB 3QFCA 2L35A 4DUYL 4CH3A 2VQFQ 4DUYB 4GOPB 3E35A 1Q82D 4DR7L 1GN2A 1ORQC 2K5QA 2QWNB 2JA8G 4MS2A 1K28D 2QDOA 3DLLA 2X6LA 1EYGA 4ZGQB 4B9WA 5KSWB 1DGSA 3S1RB 1HNXQ 1M9NA 4DR3O 1ZYRC 1STHA 3K0DA 3J81c 2HT1A 4JYAQ 1Q9SA 3CQZB 3TP5A 1GUWA 2D62A 1EU3A 2XNCA 4AHCA 2JRIA 4BW5A 4E6IA 1YJ9A 2WAQG 4HSVA 1FKAO 1JCKB 1UE1A 4Y7CA 2CH7A 4A3GG 2FMCA 3OZWA 4BA1I 4FJCC 5T1GA 1QFJA 2QGQA 3PIP3 1WP8A 2UUAQ 1EZ6A 1VQ7A 4X3KA 1VQMV 2VQFO 3OIPA 4OPHA 1IXBA 3UO3A 5C4ZA 1AI6A 4CS2A 3DC6A 4HMIA 2M6YA 4IUPA 2P4VA 5M5XH 3CCRA 1SFOB 4LW1A 4II2A 1E1TA 1OCOC 1QUFA 4G7HC 1HNXO 2GK7A 3J80L 3OAAA 2SOBA 2Y0SE 2OBTA 4QNHB 2Y0PA 3RUZA 3EHBB 4LF9L 4JYAO 1Y67A 2KHIA 4BS9A 1PNMA 2V7TA 2AHZA 2W6JA 3EQLC 1G291 2F0QA 2GVBA 3ZRWA 3GSIA 4WWVA 3TN2A 1GJXA 3ISXA 4X62Q 1R5OA 1WP6A 2JVDA 4A3IH 1HUMA 2OYNA 5IGBA 3EIVA 4HBNA 4TUYB 3BYYB 3Q23A 3AVWA 4FLZA 4X7FA 2UUAO 1I4RA 4ZKCB 2ZTGA 4YWLA 1F2LA 4QIWE 4WFN3 4DR1Q 5LXTA 3FAVA 1XHZA 1FNUA 3CMEB 2R61A 4PMCA 4HAEA 4TT3A 1GO3F 1YITA 5IP7H 4ZAIA 1ENVA 4HIDA 3ZMTA 1XE1A 2RCVA 1P8LA 3A3GA 3JC66 2E74C 3CTAA 3K81C 5IGCA 2F0VA 2GQFA 1E2ZA 4CDEC 2LXKA 5GONA 1N33L 4JAAA 5CDFA 1M1KW 4I4TA 1LT5D 1N33B 4X62O 2WFWA 1OCCB 1PRTB 3MVVA 3STBD 1BSMA 5FNVA 4MYUA 3C1EA 3ZRXA 2VJJA 1DYQA 1DF4A 4X20B 5FOBB 1BKBA 2C35B 3ZC3A 2L9HA 1SBBB 3JYCA 1NTKH 4DR1O 3ONUA 4WFEA 2XTAA 4Q5VA 4CBVA 3CPWU 4OHJA 2WA4A 4RGNA 1GRJA 2XT9A 5CBFA 1PPJH 2HD3A 5D3IB 3PUNA 2L6LA 3S1RH 4DF7A 3NK9A 2KSDA 4FXKC 4J15A 2ZD9A 1Q1EA 4O2BB 3KCXA 4UB8Z 2PO4A 5GV7A 3H0GH 2JA6G 4JI4L 2F0HA 4A3CG 4JI4B 1VQ9V 5K36H 3F2CA 4X65Q 2KEDA 3A55A 5EKLA 1CXZB 2E1BA 4EB6A 4OOXA 1MBYA 3OE7A 2RCNA 1YEZA 4POGA 2DYIA 1ZX3A 2XVSA 5C44B 2WZPP 3GTJB 2ASBA 1MABG 3A5ZB 4ZI7B 3PN1A 3IRBA 1SAPA 5EC2C 3HOUG 3ASOB 2LFSA 1PYSB 2JGUA 1O80A 3LSSA 2ZQMA 1L0XB 4KP4A 2M2LA 1Y76A 1SFOH 4DU9A 1YJWV 4DRXB 1WD1A 2CDYA 2F0UA 3GTPH 1STGA 1D1IA 1I4HA 5FL7G 3H3VC 4QJFA 5KAFZ 1NE3A 4ZGNB 4L5RC 1DOLA 2F0OA 4UFZA 5M3MH 3GTGB 2CW5A 1F51A 1BDOA 4XN0A 3DEOA 1OGIA 1KK2A 3RZOB 1S5DD 4X65O 4HEDA 5GAEC 3SYOA 1I8DA 4YAFA 1LTAD 3ETQA 4DV5Q 4LAAA 3V96A 3QWNA 5CBHA 1KHIA 1S40A 1JWUD 1E22A 3W7UA 4X6AH 2KEEA 2V7WA 2ZT9C 1NBMG 1EZ8A 5FO9B 3Q39A 1H2GA 4K6LA 1FR3A 3FPKA 3OFNA 4U68A 5F4JA 4LFAL 4DR6O 3DMUA 4LFAB 1FNWA 4JI6Q 1DARA 2BA0A 3CCMA 3P32A 3CB4A 3AYHB 2DE0X 3VQXA 2IJHA 1GN4A 4A3LH 5EMNA 4XT1B 2GK6A 1X55A 1T9HA 3OEEG 2PZTA 5JVG3 4FLWA 2BE5D 5IIFA 2QEXV 1MZEA 2B2TA 4DV5O 1Q6IA 4GN5A 2HUGA 3LNMB 1ENCA 1QVCA 2UXDB 2C9OA 5C6AA 3EFFK 4A3KH 1AMOA 1V1PA 2EZVA 1BPLA 5IJ0B 2OTLA 1OXTA 4XR6A 3JALA 1D5AA 4B3GA 3J81j 1EN6A 5M3FH 5FA6A 5CB4B 4LWSB 5DLQE 1VQOV 3E0EA 3G71A 4J6HA 2CCZA 1D6EC 3S15B 3T53B 2EIXA 2R9RB 3I70A 1JX9A 1UE5A 3A8JE 1WJJA 1S5CD 3Q38A 4JI6O 1EEID 1R4QB 4IIJB 3FKSG 3D8GA 1XOUA 2AQ3B 2ZINA 3I56V 1K8AW 2B2TC 4UV9A 4A3JG 3CCQA 4B4DA 4F7DA 2Y4UA 1RSOA 1PFNA 1M90D 4KHVA 3H1IH 2LY7A 2CHBD 5C44H 2OK7A 5L3DA 3HOZG 1RHPA 1XREA 1S5JA 3HZXA 3GTJH 3FB7C 1LTSD 4DK1A 2EX3A 1WLEA 2DMXA 3UT5B 1KMIZ 4PELA 4I55B 3DWAA 3LSQA 1WOPA 2F4VB 1S77D 2F0LA 1N8RD 1WB7A 4R8CA 4O4IA 4R9WA 4XMYA 4II3A 2YICA 4P73A 5C4XH 4FVMA 3NTHA 2WIIB 3HOZB 4J1MA 1H9MA 3CKIB 5TY0A 3TQYA 3S9WA 5EJWA 4UAJA 1R6TA 3SJAC 4CH4A 1R6NA 2YDEA 2FMMA 3KDFA 1EWYA 1XTDA 2PQAB 2R7ZG 1QG7A 2DJFC 2V4DA 2A8VA 1E63A 5H59A 1S4MA 1QLEB 5LL6S 1OXVA 2D9UA 4NR1A 1NVPB 3EVKA 2M5SA 1UD6A 3OW2A 4DV1B 1STAA 4IO9A 1AZQA 1ZYRD 3SPIA 1CQXA 1U97A 2IJIA 2YS8A 2R7ZB 1W2BU 3BRCA 3PO2H 1LUVA 4JBWA 4FXDA 1Y1WG 4KY5A 3VYRA 3ASNC 1Z2GA 2V1CC 5E79Z 5IY5B 1IW7C 4TV8A 3NTIA 3HP3A 5C4JH 1W2BA 3SDZA 4LK1C 1FJGQ 2FL4A 2IU3A 3K3WA 3CRQA 2AHOB 1F60A 1GAQA 1VQMB 3F2BA 3D31A 2DETA 2QILA 1DXMA 5JWPA 2ZM6Q 2FKXA 1B3QA 1Y1WB 4I50A 1ET6A 1NR4A 1XMOQ 3GTMB 4A93G 3N2GB 5EPJA 2WB1G 1JPXA 1VQLV 3S2HB 4TQFA 1S72V 4DV3B 1TWFH 4PZ8A 1BO0A 4YCUA 2D5DA 1CQVA 2I46A 5H5JA 4TSFG 1AP5A 3E20A 2A19A 2DN8A 5C4HA 1HTPA 3VDYA 4LUOA 5GAGC 2HR3A 3AMUA 4A93B 4X1KA 5C8YA 2VB3X 3K6OA 1GK9A 1WCMH 2CW0C 1FJGO 1ONLA 4LP8A 2EIJC 1SYBA 4RD0A 2LO1A 1EQQA 1E3ZA 4KN7C 1EFUA 4B44A 2VBTA 3RYHB 1VMGA 3SPCA 1B7YB 3KBXA 1D2DA 2ZM6O 2PY5A 4R8IA 1M93A 4NKLA 2F52A 5K5PA 3A0HZ 3QR8A 3NWTA 5B6IA 1XMOO 1P84F 3PQIA 1EYAA 1RP3B 4IHJA 4XYOA 4WFAV 5DAUA 3KG2A 4YJ2B 3U0ZA 2AMCB 5ELFA 5FLMH 3K8AA 2Q4PA 5EAYA 3ABKC 4GNXA 2JJ1A 3OMGA 2UXCL 1YJNA 5JBQA 2D3NA 2UXCB 3A3BA 1OZ0A 3ZBHA 3E3XA 5EGTA 4NB5A 4JPBW 2HEPA 3BCDA 4BBRB 3FB8C 3UCSC 4B9XA 4GOPA 2ZXWC 1PA6A 3BJUA 1XPOA 4ABNA 5IYZB 3FKIH 3ZHSA 5TISZ 1H2LA 3SJCC 2DEUA 2PTMA 2ZJQA 3HKBB 3KK7A 4QF4A 3CCSA 1STEA 2DY7A 3G05A 3NQIA 3VOUA 1QVFB 5AJ3Q 1VARA 1TQOA 4C3HG 2FX3A 1NR7A 1VQNV 4LH6A 4PMBA 4LFCB 3P20A 2AKWB 4AQYL 4EKWA 5IT9N 4Y9UA 4GNXC 5DSZA 3HKZB 2AUKA 2P5ZX 1I5FA 1EQVA 3LGJA 3AVVA 3TEHB 1O9HA 1KK0A 1R73A 4GOPC 2JE6I 4K2KA 4RWUA 1GMGA 1VQ9B 2JS5A 1DOMA 1EN4A 2G9HD 1JNYA 1L0NH 2XGJA 2WLIB 1SYCA 3CCLB 5LA6B 3KBGA 2V31A 1R3KC 4HJ5A 3K04A 4UUJC 4HZ3A 3I4MB 5CA1B 4CJ1B 1BR9A 4NNJA 4K0KL 2N3SA 4Y52H 1SNDA 2JJ2G 4PC7A 1YJWB 4K8IA 2Y48A 3J7ZC 3N2KB 1BS3A 2P7TC 3C2PA 4UZUA 1CUKA 4P2CB 1A3VA 4PC1A 3OUSA 4G1BA 3UDGA 4A76A 4UP8A 3E8HA 4E2LA 3L70H 4C7UA 2C4UA 1II3A 2VNKA 2DCUA 2NWGA 4D7TA 1YI2V 3Q6RA 1BX1A 4FF3A 4RHSA 1A2TA 3M4PA 4TUYA 4MVRA 4P75A 2Q0AA 2AWOA 1FFTB 5M5YB 1STNA 2AGAA 3WU2Z 3CMEA 1RPRA 2QWOB 4IOAA 1HNZB 1V55B 4J8QA 2E5LQ 1B53A 4TOIA 3PO3B 1QJOA 3S17B 4W4LA 2OBRA 3K5OA 5L46A 4DV7L 4CHTB 4H37A 2JA5G 2CE4A 4UHVA 4UB6Z 1I6HB 4DV7B 4YAWA 2O57A 4J41A 4QB4A 4JASA 4CZZA 2BV3A 2B9ZA 2BF4A 2XOKG 2OTJV 2O5JC 2NN4A 4JI5L 4WQMA 3PENA 3J7A5 3J7AU 4K6DA 1GHKA 3BY2A 2ZNIA 2WSSG 2R72A 1KC8C 4JV5L 2GSMB 1KUQA 2PMZE 1KDAA 4JV5B 2JA5B 4MVQA 2IJ0A 4L5TA 1TVKB 1OJHA 2UXDO 3PF4A 4TKOB 4K5VA 4BBRH 1RCVD 3L3OC 4LWCA 4X20A 2ADPA 2Z3YA 2GREA 5E1AC 2XWJB 3E8FA 2F4VQ 1WTPA 3GVJA 4JCVE 2QEXB 1N36B 4OXPA 2E5LO 1TIID 2DQ0A 4YJ3B 3RLNA 2UXXA 4H9GA 4BXXH 1JB9A 3AK2A 2WAMA 1FD7D 1N0JA 3J80E 2E1RA 1CFMA 4HIMA 3FX7A 3TREA 3FPUB 4N9TA 3ZHUA 3P3NA 2VUMG 2ES2A 1VQOB 4B3XA 3X3MA 1OCCC 3BABA 4FM1A 1PRTC 5IYPA 2IW5A 3SR1A 5FNZA 3OTFA 1VLYA 2KQXA 4DV1Q 4RUEA 4JI2L 1BBXC 2P67A 5GTHZ 3ZMUA 2VUMB 2V7UA 3F2UA 4JI2B 4AC9A 3BCCH 3BDLA 4ZI7A 2E2IH 3MXPA 2F4VO 5D14A 2Q8TA 1C8CA 4A3DG 2BOBC 4A3FG 2JEAI 1EIFA 4DRXA 2WP8J 5J1ZA 2V7QG 3S1QH 2YTVA 3K06A 2L11A 3I4MH 3PUZA 1K0SA 4H33A 1MABA 2AW9A 4PV1B 1F2YA 4G27B 3FB6C 4A3DB 4A3FB 1XNRL 2HJFC 1CPYA 1XNRB 2H3OA 1FYCA 1J5EL 4DV1O 3ASOC 5TRDA 4YXWA 3ZHTA 2DNCA 2VNUD 3OD4A 5IGFA 4DV3Q 1COWG 1R4PB 1SYEA 2XRQD 3ZHRA 3UKMA 2MO0A 4TSSA 4O42A 4PG3A 1AJPA 1VQ8B 2SNSA 3BU2A 3LX0A 4N23A 3RYFB 3SVMA 3PO3H 1HA5A 2B1GA 5FLXE 1NUCA 4P3YA 4UVCA 4Z4VA 1WNSA 3KKYA 1DTOA 1GN3A 3ASSA 4G7ZC 1NBMA 1KDBA 3DXJC 4IYIA 1R3LC 2CH4W 4CDCC 4L63B 3VQVA 1IW7D 4MSWC 1G8MA 2ZJPA 2Q9LA 4MTXA 4DV0Q 2R93B 3K0GA 4PABA 2JXMB 3AFPA 1QFZA 4YELA 2QE7G 4AIMA 3FD9A 1SA0B 3I73A 2BH2A 1W59A 2A6EC 4NW2A 3EA6A 4DV3O 4FF1A 2CC2A 2OK8A 5LHHA 1K3BC 3RR5A 1HP8A 3OUFA 5DN6G 5IJ0A 4J0QA 1HQRD 1VQLB 1YIJV 2DYRC 1I5XA 1JJ2U 5CB4A 4LWSA 1CSPA 3OEEA 4DR4Q 2QM8A 4TMXA 1S72B 2WLHA 1X54A 3AG4B 3DUZA 5JJNB 2LKVA 3ER0A 4BBSG 1U4RA 1K8GA 3H6MA 1GUOA 4IOCA 4IIJA 1BHBA 4KHZA 2MNAA 2K5VA 1DM0B 4K14A 5NUCA 3K7AH 1GUGA 4R8NA 4LFCQ 4LC0A 4DV0O 2CW0D 4WZLA 3PA2A 3W5OA 2JJQA 3SJPA 3A7AB 4BBSB 3WG7B 3D3QA 2NVXH 4X1IB 4RKBA 5J39A 5D65A 3FKSA 2EIMC 5M5WB 3UT5A 4DR2B 4I55A 3J80i 2ZNJA 1KLGD 4ZCMA 2ID0A 1KD1W 1F9QA 1DCZA 4DR4O 2X53S 2F0MA 2EZPA 2EILB 3JD2A 5HY6A 4NB3A 2H94A 3SJZA 4HJ7A 1U4LA 3F1ZA 1QCBD 3C3TA 3U58A 1SKQA 4DKAC 2PQAA 1VMCA 4LFCO 1HPCA 1NQTA 2QN6A 4RA8A 3K80C 4XBFA 2ZXPA 1Q1BA 4EQNA 1K73W 5EBMC 2PGGA 4UZFA 4A3EG 2K14A 1ZKOA 1GAWA 1VF6A 4QIWF 3ZBUA 2ZXIA 2Y0IA 4ZYSA 1VQNB 4DV6L 5BXZA 3QF7A 4DV6B 3U10A 3AEVA 1C7YA 2I5MX 3ETGA 1Y4MA 1W6JA 2BGJA 4A3EB 4J7JA 4K8JA 5FO8B 5ELOA 1WD0A 3HGBA 4RHRA 1HNZQ 2IM9A 4IW3B 2HHHL 3K59A 1YSCA 5IP9G 2F1MA 4IUQA 2HHHB 1QLEC 1GD7A 2XNJA 2IHEA 2AHOA 4K8ZA 3WDNA 1VQMA 1AFPA 4RCNA 4K1XA 3D6CA 3UE0A 1XI1A 2ZXOA 3QG5A 1VF6C 4WCEV 1BGYH 3ULPA 2R93H 1SE4A 2YIBA 1DLBA 3K58A 4MVZA 5HFMA 1EFTA 2NVYB 2QWQB 3N2GA 1L0YB 2YIDA 1RJTA 4V190 5E6TA 1IHZA 4X0CA 1EN5A 5EBDA 3ZRSA 2P4KA 1TY0A 1R3IC 5LMUL 3M7NA 2CTQA 1IJFA 1KQSB 4Q0FA 2B7CA 1IBLQ 3FFQA 5BZBA 4OOVA 2YXLA 1WOSA 3E9IA 1PHJA 4H02A 3B8MA 4BA2I 1N36Q 1HNZO 3C3LA 2AQ1B 1EYDA 1YI2B 1ZSPA 2XNAC 2DJVA 1EM1A 1EL0A 2ITDC 1NJIC 3WYAA 2PPBC 2K32A 3TS0A 3E2EA 4RAIA 3RYHA 1SXTA 4TSFA 5KEEA 4OPVA 5EKIA 1TS3A 1AIPA 1XL4A 4LH7A 4YJ2A 4HJ9A 4EQPA 2Z5UA 2RA4A 1G1XB 2GDSA 1SQXH 4M1KA 2EY2A 3S1NB 2UU9Q 1Y1VB 2OTJB 5M5WH 4OOSA 3NBHA 2HIXA 2IT1A 4LF9Q 1IXMA 1IBLO 4Q6GA 4PQXA 4X64L 1KC8D 4PA3A 1F23A 1QVFU 4X64B 3QVNA 2JK5C 5FIUA 2K9PA 5FKAC 2Q6LA 3T13A 3BCFA 4ZCIA 2CNDA 1N36O 3JD4A 5IYZA 2F0NA 2Z6BA 2O2LD 3R66A 1LUWA 3HKBA 3G48A 2OXPA 4FM0A 1KP3A 1MJEA 5IYCH 4R50A 2XTIA 1K92A 1W0KG 3CHXA 3VQWA 5FJ8G 1QVFA 2FVGA 4V0BA 5KHKA 2EIKB 2VWKA 3SPHA 4NTWA 2A0LA 4F4LA 2XAHA 3HKSA 1WTHA 3TSSA 3TZDA 3G6EB 1D8TA 1M5IA 1VF7A 1H2MA 1ENAA 3VYSA 4FLXA 2ZL7A 2W6IG 3H1HH 3DDYA 1KDCA 4JI8L 2UU9O 3T2MA 4JI8B 3M9BA 4TWKA 1PRTD 2GN5A 4IN3A 4CKBA 2HFEC 1MI2A 1VQ9A 5E7NA 3MA2B 2BTOA 4XDXA 2CUGA 3RBZA 2WINB 5KNCA 2BA1A 2KHJA 4GYCB 3V76A 1FPOA 1IBKQ 4G5GA 2VNJA 2KVOA 1W9XA 2QTLA 2WLIA 2X85A 1P4RA 1AI7A 4KKUA 2F1LA 3CCLA 5LA6A 4ABMA 3ASQA 3IFXA 4R6ZA 5CA1A 2EVBA 3VMFA 4CJ2C 4DQLA 4J9ZB 5KIXA 2JK8A 3JARB 2NVYH 3HEJA 4TMZA 3QSYA 3N2KA 4XD7A 4OO1H 1BL8A 2EJMA 2F0GA 2F0IA 1XFOA 1XNRO 2Q7HA 4GKKQ 3E9HA 4A5UB 3BS1A 1RTOA 1KL9A 2UUCL 3P7JA 3A0JA 4QUZA 5FO0A 4LBWA 2UUCB 2JJ2A 1SNCA 1HA3A 3RNUA 1AROP 3ZYYX 3MTSA 1DDGA 4FN5A 4R1JA 4DAYB 2WA3A 1I4QA 1KNEA 1YHQB 2HDMA 3OIQA 1IBKO 2OCEA 2GJRA 2EY5A 4DV4L 3U6KA 1VQ6V 2R6GA 5C0XH 2A74C 2Q73A 2E2HB 1XJVA 1HXYD 3ZMVA 3RY8A 4ID6A 1LNQA 4RKLA 3BA8A 3HKZE 1EY6A 5CV6A 2CFMA 2X6AA 1MMMA 5DEDA 5IDJA 1LYLA 2RJZA 3MXNB 1Y1VH 5B1OA 3RZDB 1SMXA 2F23A 5KNLA 4KLKA 2CQAA 4HCEA 5IWAB 1V55C 2XOKA 4B7EA 3QFRA 2F0EA 4OO1I 4MN3A 2N55A 2Z1CA 5ELEA 2LGWA 1AE3A 2X6BA 2WSSA 2EYLA 3TXQA 3OM3B 2QEXA 4HIOA 3CCVB 1IYVA 3CX5F 5C3EB 2A6ED 5JAVA 4YJ3A 5L3FA 1EY8A 3L2PA 4JI1L 1FNMA 1I5YA 1I4GA 4JI1B 1CZGA 2BPOA 1I3QH 1VLOA 4QUCA 1QQCA 1VQOA 3JAMN 4NXNQ 2RHSB 2OBSA 2XNDG 3G4SV 4A4IA 5C0XI 3P3PA 3J7YW 4TQDA 1TXYA 4PZ7A 1W0JG 2VQEQ 5ITZB 4EFBA 1Q90A 1A2UA 1BBUA 1NY4A 3GDEA 1TU2B 3ETEA 5JQGB 3HOYH 2WV6D 5KYIA 1MSWD 4BIUA 1IDSA 4PDRA 4DR2O 3K9AA 2KBNA 2PUSA 4LF6L 1YNJC 5C0XJ 5IJ9B 1B4OA 4LF6B 3CD6B 1I08A 2WPDA 3AGQA 1EP1B 4DV2Q 3SLNA 5KUKA 4WBNB 2ZBVA 2QTZA 4X7DA 3L72H 1GR1A 1TWAH 1RKNA 2KG7B 1XPUA 4GX1A 4JZGA 1GO2A 1NB0A 2XEXA 1K7DA 3RN4A 3JSNA 1N32B 4RCZA 2A06H 4O2AB 3T1CA 1SZTA 3AG3C 5IYCO 1SE8A 1B9NA 1SYDA 2OYQA 2X6GA 1K9MC 4DR3L 3OE7G 5BMVB 1HW7A 3GWOA 4LC1A 2VQEO 4DPGA 2V7QA 4LF5L 5BR8Q 4LF5B 5LBQA 1VHOA 1D8LA 2IH3C 3CP8A 5D5QA 2WLNA 4DV6O 3HOWH 1WPCA 4J9YB 3B8HA 1W35A 4MW3A 2WWWA 2XASA 3JCUZ 3SXHA 1VQ8A 4PDLA 3CW2A 3CYOA 4DV2O 4CH6A 3RYFA 3HPLC 3B4SA 4PV1C 1NU1H 2VQFL 1WB8A 2VQFB 2HHHO 2VRZA 1COWA 1Y66A 5CBEE 1YCIA 3GTLB 1EZJA 3SPJA 2MQHA 1PMRA 4YY3Q 3RYCB 3OW7A 2RBMA 4KV6A 1G7CA 3I55V 3RMHA 2MHVA 3AEIA 2H1EA 3VQYA 2X7RB 1TWHB 1HNXL 1L0LH 1P4MA 4NYKA 1HNXB 3R3OA 1EIGA 2JSOA 2JA7G 4JYAL 2PQEA 1NVPD 2HKOA 1SA0A 5BR8O 4JYAB 4JYBA 5LP6B 2EY1A 1DG1G 3B8NA 3HB3B 3CW2C 3ZUGA 2DQ3A 4OPAA 3AVTA 4ACBA 2R92G 1K3EA 5LGTA 5HZBA 4IPCA 2CKZB 4ROXA 1VQHA 2EIFA 2PCFB 4ILWA 3U4VA 5C3EH 1XNQQ 2UUAL 2JA7B 2QE7A 4RWSC 2UUAB 1S72A 3CRMA 1V43A 2QKSA 1G6UA 2DJGC 1N07A 5LHY1 5CGKA 4GLXA 3OEHG 3MHPA 5JJIA 3VO1A 3L75H 2R92B 3OPOA 1Q7YW 1G7SA 2IBZH 3RGBA 3E5SA 4RLZA 4CBCA 1VEWA 2EYJA 4RD3A 3CRCA 4XLHA 2YIBD 4WORA 1NJID 1M4VA 4B3SQ 2TMPA 1UE7A 5C5MA 4Z4ZA 4X1IA 5L3EA 5EZYB 4MVUA 3PUVA 4X62L 3BVZA 3AG4C 4N8FA 5IGEA 4X62B 1ESRA 5IT9E 3SK4A 3W7WA 4RQEA 4OELB 4X64O 1SNQA 2ZJRA 1KP2A 4FLTA 2JDIG 1WPXA 1VQ7V 2I0QA 2QWPB 4DR1L 3I4NH 3S14H 4DR1B 2FJ2A 2B1IA 2QDLA 3U4ZA 2X6YA 4X8IA 3A2FA 1JA0A 4LBEC 1KJZA 3OMNB 1VDZA 1Q6HA 1K4CC 3WG7C 2EINB 1Y14B 3T1HQ 1Q46A 4KHPQ 3B6YA 3CB2A 2BOSA 5D3DA 4JI7B 3KJPA 3BC9A 5CA3A 2M7WA 2E75C 4B3SO 1BCPB 4WJWA 2RSOA 4HCSA 1J8IA 1HQMC 2Z6KA 1EU4A 3CPFA 2F66C 4ZIBA 1P7GA 1RIPA 1OCZB 4E4EA 1E1QG 1K4DC 5A9GA 2QGGA 1S4ZA 2QMUA 4JI8O 4OEMB 4XLCA 4YIPA 2EILC 2ODMA 5KA6A 1KIXA 2BCOA 1HTLD 3QOJA 3JAML 4OONA 2NR5A 3CC2V 2XGTA 4Z9CB 5J9PC 1NDHA 2K1EA 3GTLH 2Z6BD 3C3SA 1U96A 2Q68A 3BZCA 3OSOA 1AN8A 3SE0A 1Q86W 4QL5A 2Z6KC 2PZWA 1VF5B 1FXKB 4JVZA 3T1HO 3OP1A 4KHPO 2K03A 1F4MA 4JI3B 2F0WA 1N9WA 2QTOA 4XOPA 1P49A 3OWEB 1VQFA 1SZXA 5BN4A 3X3NA 1VIBA 1WTHD 1SQVH 2DGYA 5C3WA 2IPKD 4P9PA 4X65L 3DSQA 4XNFA 5IWAQ 1KQSA 2UUCO 2YWFA 4DNTB 1FNVA 1GUNA 1UEAB 1WDTA 4UV8A 4JAVA 3DXRB 2K7VA 2JP1A 3A35A 3ZZ0A 1PVOA 3GP7A 5ELDA 2DOGA 1Z9FA 4NCNA 1YI2A 4P74A 1PZJD 1TVCA 4KD4A 2TSSA 1PD3A 4KI0A 1FVIA 1PDQA 3PUYA 2B5UA 1VQIA 3N27A 4O2DA 1Y8PB 4WFBV 4QGPA 5M5XB 5AFWA 1EP2B 1UE6A 4K35A 4NKGB 1AJNA 2F4NA 2PW7A 3E0JA 3ZMSA 4GN3B 1HHVA 5CMDA 1QGYA 2OTJA 4RQFA 1WFQA 2EYFA 1QZHA 2NZOA 1Q6UA 5IWAO 1Y0YA 3NENA 2LGQA 1GXDC 4DV5L 5FLXN 1VQJA 4OWTB 4QMGA 2F3WA 5J3OA 4NTYA 4DV5B 2A6HC 1SNPA 4G2KA 1GN6A 1SQBH 1GO3E 1RPOA 1TWCH 5B1AB 5IP7G 2YYZA 3OJXA 3QO7A 1XMQQ 1AR5A 3NELA 2VBUA 5F2DA 1B3AA 2DOSA 2B2UA 2K4KA 1N32Q 1PRTF 4JI1O 3OR6C 2J7ZA 3E8GA 3D4DA 2I1LA 3OMIB 2YU9H 2ADQB 3J7AF 5C93A 4JI6L 1F9RA 3AVUA 4Z4WA 1ZM9A 4CDDC 3G6EA 2JJ1G 4C3IH 4GCZA 1PYBA 1SEBD 3TMEA 1W0KA 5B3SB 4X7EA 4PNYA 1PNKA 3GV3A 1EFID 3WB2A 5DECA 2QWRB 1A0IA 4DK0A 5KW9A 1NR1A 1GJRA 1Q81W 5LHIA 2B2UC 3A8KA 4C1NI 1BT8A 1WVLA 1IBMQ 1G7RA 4LF6O 1TWGB 4MZ9A 2A5HA 1G8ZD 2EIKC 2W6IA 4MVMA 1XMQO 1IYJB 5LOVB 3CP2A 4IPGA 2BTQB 2QGNA 3H0GG 1N32O 1YNJD 2KKWA 1X3EA 1BQZA 1V5VA 3KF6B 2EYOA 5KMGB 2EJ7A 5K36G 3JARA 1B44D 3RN2A 1LO5D 5IYRA 3CCMV 4YHHQ 3JATB 1WTVA 4A3BB 1JOYA 3AG7A 3T1YQ 1Q3EA 2R7DA 4ODGA 4LF5O 3H0GB 1Q90D 1EEFD 4HMJA 3D3IA 2A79B 2HJDA 1K9MD 4C1NK 4FP5D 4Z4YA 4Q20A 4I7ZB 2ZE8A 4H0LB 1AI4A 3QNEA 4DAYA 4B3MQ 1CKOA 2DYSB 2G9DA 1V9PA 2PMZB 4HE5A 3QO2A 1YHQA 3CP1A 3CE2A 3L73H 4DUZQ 3THOA 2PF4E 2FINB 2OTLV 5B66Z 3I5DA 3JCZA 1M56B 1CHPD 4H44B 3W2EA 2CTWA 3ZZTA 4NPSA 3G71V 5M3MG 1N4CA 2ICIA 1PJ6A 3UI2A 1D2BA 2Q2TA 1W34A 4DAVA 5LGNA 4FWTA 4ZKBB 3NHHA 3I8ZA 1HZEA 3HOXH 3GTPB 2WZNA 4YHHO 3JQQA 3BAAA 3APOA 3S1MH 3ITPA 3T1YO 3MXNA 2ZZEA 2N05A 5M3MB 2ZR3A 2VWJA 2K6AA 3I55B 1WOCA 1C4QA 4HE6A 3A8KE 4FXGC 2X6WA 2CF4A 4XORA 3TP8A 4B3MO 1JB3A 3BZKA 2CK3G 2QA4V 5IY0A 2VNIA 3CCVA 4DUZO 3M7GA 2XZLA 3M4OB 5LMZA 2MO1A 3VR3A 4JI0B 1G7TA 1ET9A 4QVJA 2DUDA 3SPGA 1U4PA 4CKEA 3QFTA 1KRHA 1FJGL 1AR4A 2N8NA 5CV5A 1SS3A 1FJGB 4A3LG 3W1GA 4PC3A 3GO5A 2E8GA 2OIEA 4JI7Q 1F2ZA 2YTYA 2ZM6L 5IE8A 1NMFA 3CC7V 1Z47A 3T4DA 2ZM6B 4DN4M 4GKJQ 5ITZA 4BIZA 1XMOL 2GPJA 1KAAA 3G67A 2OCCB 4LF7Q 2HVJC 1YHBA 1QFYA 4A3KG 1M1KC 1XMOB 1E79G 4ZRZA 4KKSA 2K52A 5JQGA 3NEMA 2FFKB 3VYTA 4L6TB 5M3FG 5E3FA 1TWGH 2XNDA 2QR4A 3SDLA 1M57B 1N08A 5IJ9A 1MSDA 3CD6A 5FPRA 1W0JA 3LNNA 1NRKA 4FFBA 3A5UA 4WBNA 3J81N 1GUTA 2CTPA 1V1OA 2KG7A 2YWHA 4A3KB 1F7YA 3KYHC 2QSAA 4ZBMA 4Y7NB 3K9SA 4IUUA 3ABTA 2CTRA 3F8TA 1HUNA 4O2AA 5M3FB 1I7FA 5FLXL 2Q8IB 3KFUA 4A3BH 4JI3Q 3S3XA 4JI7O 1IVSA 5BMVA 2UUBB 1PJ5A 1T6ZA 5C44G 3S3WA 4GKJO 3KZIZ 2B63H 2MUYA 1I94B 3E86A 2NNUA 4LF7O 1WTQA 4U9UA 2ILMA 3VNUA 2L55A 3ZIAG 4BWGB 3OGIB 3R6JA 4JBKA 3HOVB 3SK5A 3UDFA 3WBKA 1K3RA 5C4XG 3NBIA 1ASZA 2LW7A 2K5DA 2J4XA 4EQ5A 1JOOA 1YX2A 5DEHA 2YI8A 3GTQB 1UD2A 1MSHA 5G3LD 1D1NA 1IXRA 1EUJA 3RYCA 1QUEA 5KNBA 5B1BB 1VQ4V 1BOSA 1AP6A 3CC2B 2NTTA 3SLDA 4U3FH 2L12A 4BY1H 4JI3O 5C4XB 1PL0A 1H2SB 5AJ3L 3ULJA 2YWGA 5L37A 4YXWG 4ASUG
chains in the Genus database with same CATH topology
2ZNJA 1KLGD 1KLUD 1H9RA 1XX8A 2DNEA 2ID0A 1I50B 3BDOA 4C3HB 1STYA 5JH7A 1F9QA 2BE5C 2D2CC 2ZIOA 1DCZA 2X53S 3VR2A 1PTOF 5CORA 2XRSD 2F0MA 3BYTB 1FFXB 4I50B 1D5MC 1BF4A 5LYJA 4O4JA 2P5OA 3T56B 4XYQA 2VB2X 1K83B 4PI0A 1PTOH 4A3MB 1U4LA 1QCBD 2K5WA 3UQ8A 1UNSA 1TAEA 2NYZD 2B2WA 1I6VC 1VMCA 1HRJA 1HPCA 5JEAH 4YIJA 4RA8A 4FLVA 2ZXPA 5CV7A 1AEXA 1Q1BA 4EQNA 5IGGA 3PO2B 4A3IB 2ZXRA 4K0KB 2PGGA 1Z5WA 2MGSA 3OOCA 4QCLA 5DM73 2XZPA 1ZKOA 4G7XA 2OWOA 2L5TA 4XQJA 4IUVA 4X1KB 2ZXIA 4RFBA 4ZYSA 1XQ8A 1BCPF 5C8YB 1FX0A 2F43A 1QHTA 2J0TD 4TV9B 5C4JB 3O13A 3QF7A 2BDOA 1F77A 5J2TB 3R93A 4DV6B 3HKEA 5JCOA 2B2VA 3U10A 1EY9A 1TS5A 4L8JA 1W6JA 1Y8NB 3QTCA 4XT3B 1XMQB 4JI6B 1HCZA 3OEHA 4CH5A 2IWHA 3T16A 4A3EB 4NVPA 1E43A 1NCVA 1CM9A 4K8JA 5FO8B 3CMMA 5EZYA 1STBA 2EYHA 4CGYB 1WD0A 3HGBA 4AILC 1QB5D 4RHRA 1SJHD 3I4NB 2IM9A 3S14B 2B2WC 4WRDA 1AW7A 3K59A 2F1MA 4IUQA 2HHHB 4DAPA 1PFMA 4K8ZA 3I4LA 3WDNA 1EY5A 1AFPA 2PZUA 2QEJC 4IHJB 4JK1C 4RCNA 2PYKA 3D6CA 2RDGA 1XI1A 2ZXOA 2MP1A 3QG5A 3RFRA 1TWFB 2ZCEA 1V0FA 1SE4A 1LTRD 2YIBA 4OL7A 3HKDB 4X1YB 3K58A 1RTNA 2NVYB 3KLRA 2B2VC 5JCOC 2RKSA 3N2GA 3HAGA 3NUCA 5CYUA 1L0YB 2F0FA 4F8MA 2A6HD 1RJTA 2WKCA 4CH3A 2E5LB 4JI5B 4V190 2EYPA 1IHZA 5EBDA 2R9AA 4DUYB 4TQUS 3T51B 3EFXD 1TY0A 4KTAA 1WCMB 3QB3A 2K5QA 2JDIA 1K28D 1Z6HA 3M7NA 1IBMB 2Z4HA 4Q0FA 2X6LA 4TRDA 3FFQA 4G57A 1HFNA 1PTOC 4FM2A 1JICA 4QUFA 4B9WA 2YXLA 1DGSA 3S1RB 1D5XC 1LABA 3KUPA 1CA5A 4BA2I 2K01A 3C3LA 1ZYRC 1STHA 2KCCA 2AQ1B 1EYDA 2QM4A 2A69D 5KHHA 2XNAC 1RD9D 3CQZB 3CRLC 5JEAJ 1EL0A 3TP5A 4KK7A 2PPBC 1GUWA 2D62A 1UD8A 1EU3A 2K32A 2B39A 3PIO3 2NB0A 3RYHA 4ZOLA 1SXTA 4TSFA 4AHCA 4AYBB 5KEEA 1H8HA 4E6IA 5J2UA 4YHHB 1H9SB 3OMCA 4HSVA 5T1IA 5KX5B 5EKIA 4MHEA 1JCKB 1TS3A 3T1YB 2AUJD 1E1QA 2FMCA 3G6JB 4BA1I 3CU7A 1VMPA 3MEHA 1I18A 5T1GA 4LH7A 3PIP3 1EZ6A 3H09A 4X3KA 4U3JB 4YJ2A 1BCPC 4EQPA 3OIPA 4FF4A 2RA4A 4HNAB 3P1HA 2EY2A 3FKIB 1N34B 3S1NB 5C4ZA 4BWAA 4CS2A 1SNOA 1Y1VB 2KA7A 1X32A 4HMIA 3NBHA 4B3MB 5KRUA 4X3TA 4IUPA 2IT1A 1B9MA 1SFOB 4HIZA 4Q6GA 4PQXA 4DUZB 3J81L 4GZYC 4II2A 3V05A 4G7OC 4HSPA 4FLUA 1CI3M 4X64B 4G7HC 1BUVT 2GK7A 3J80L 3OAAA 5A35A 5FKAC 2SOBA 3T13A 1YNND 3BCFA 3GVLA 1CZWA 5IYZA 3MXGA 3RUZA 2F0NA 4IURA 2O2LD 1RF2D 3HKBA 1UD3A 1EYCA 4BS9A 5D5PA 2OXPA 3ICXA 4FM0A 1O7YA 2KOLA 2W6JA 3EQLC 3VQWA 3CHXA 1G291 2RDHA 5JPNC 2IX3A 4OX9B 2F0QA 2EY6A 4V0BA 3J7AV 3VR5A 5KHKA 3TN2A 3B2EE 1SE2A 1GJXA 2VWKA 1VF5C 1I4XA 1WP6A 2JVDA 1HUMA 1TS4A 2RQ6A 1FGBD 5IGBA 4DXGA 4HBNA 1TR5A 4TUYB 3BYYB 3Q23A 1AZPA 4FLZA 5CA0B 3TSSA 1I4RA 3TZDA 3BVMA 3NWSA 1M5IA 1VF7A 4ZKCB 2ZTGA 1ENAA 3VYSA 3DHQA 4FLXA 1F2LA 4G4KA 5JJEB 4UDUC 4WFN3 3DDYA 1KDCA 5LXTA 1XHZA 3TP6A 1G2SA 1FNUA 4FO2A 1AP0A 4X3UA 1XXGA 2R61A 4JI8B 4PMCA 3H91A 1PRTD 4TT3A 4HAEA 4EEQA 4IN3A 5FL7A 4CKBA 1J5EB 5KNDA 3DWQA 1W6KA 1MI2A 2HCCA 4ZAIA 3MA2B 2BTOA 4F87A 4XDXA 1TWCB 4IFDH 2WINB 5KNCA 2BA1A 2L4NA 1NSNS 1T5XD 4GYCB 3A3GA 2E74C 4C3IG 1JJOA 3OWFA 2KVOA 1W9XA 1GHJA 3JAME 2X85A 2F0VA 1E2ZA 5IGCA 4KKUA 5LA6A 1M8AA 4KMUC 5K1XA 5CA1A 1EQTA 4XL9A 2EVBA 2RDFA 4NDXA 2YU9B 5GONA 4CJ2C 2KQ3A 5CDFA 2F0KA 3QOLA 5KIXA 4I4TA 1LT5D 5ISRA 2K05A 3MFYA 1N33B 3FDTA 3FVQA 3TBIB 4GKJB 1PRTB 3MVVA 3JARB 3R2IA 3HEJA 3N2KA 5FNVA 1EY0A 4XD7A 4OO1H 1O78A 4LF7B 3C1EA 2ZZQA 2EJMA 2VJJA 4C3IB 2F0GA 1DYQA 2EOTA 2F0IA 4X20B 5FOBB 2Q7HA 2L9HA 1SBBB 2FHTA 4CS4A 1E1RA 1E3XA 5JPMC 4XOTA 3BS1A 1RTOA 4Q5VA 4CBVA 1TS2A 1UD4A 2H4OA 1Q5OA 4OHJA 3AU7A 3I3CA 3P7JA 2R70A 2NN6H 4RGNA 1U9RA 3Q22A 1JC7A 5IGDA 5IK2A 1PLFA 2UUCB 3VA5A 2JJ2A 1SNCA 5D3IB 4UCVA 1OHHA 4O4IB 3NK9A 4KL1A 4FXKC 3ZYYX 4DF7A 3MTSA 1KMHA 1GOZA 1S5ED 4EQOA 2ZXHA 1Q1EA 4O2BB 4DV0B 1I4QA 1KNEA 2PO4A 2HDMA 3OIQA 1OXXK 3DWPA 4ULLA 2GJRA 2EY5A 3D3RA 2F0HA 3PUWA 1LT6D 3A56A 3ZPNA 1KABA 2R6GA 1JWSD 4JI4B 5C0XH 5BN5A 2A74C 1KZLA 4XIGS 5K36H 2WJVA 2E2HB 1HXYD 5M9OA 1OXUA 2KEDA 3A55A 4ID6A 5EKLA 1LT4D 2E1BA 5DM63 4DA2A 4XTCS 4EB6A 4RKLA 3BA8A 1MBYA 3W2DA 2GV9A 3OE7A 1EY6A 5LOVA 2C5CA 5CV6A 2F0TA 1U4MA 2XVSA 5C44B 2WZPP 1JE4A 2BTQA 3GTJB 1ILQA 4DR4B 1TA8A 3PN1A 4ZI7B 4CS3A 3E22A 1SAPA 2RJZA 5JOBA 3RZDB 2JGUA 1O80A 4ZHQB 5KNLA 1ZEQX 2SEBD 3M7MX 1L0XB 2CQAA 5KMGA 4IFDJ 2M2LA 4DU9A 4HCEA 4CC5A 2X69A 1E2WA 4DRXB 5IWAB 2XOKA 5EIBC 1WD1A 4AVZA 2F0EA 3JATA 2F0UA 4OO1I 1JORA 3MZ5A 2F03A 1STGA 4MN3A 1D1IA 1I4HA 2N55A 2Z1CA 2K33A 5ELEA 2EYMA 3H3VC 1SYFA 2JYOA 2WSSA 4FNFA 2EYLA 1V0EA 1DOLA 2F0OA 1IYVA 4UFZA 3GTGB 5C3EB 1JWMD 2A6ED 3K5MA 5JAVA 1BDOA 1CA6A 4YJ3A 2NN6I 4XN0A 4ZUJA 1EY8A 3DEOA 5BN3A 2O4XA 1I4GA 3RZOB 2HLDA 4JI1B 1S5DD 1CZGA 1DOKA 4I65A 4HEDA 2L1BA 3JASB 1I8DA 3RYIA 1SKYB 2ICEC 1LTAD 3ETQA 4QUCA 1QQCA 3SK6A 3HOXB 4LAAA 3TDQA 3V96A 3QWNA 3K5LA 1JWUD 3S1MB 3I91A 2E2IB 3M3YB 2KEEA 5C0XI 3A54A 2ZT9C 3J7YW 4TQDA 1EZ8A 5FO9B 2EJGC 5ITZB 4EFBA 1Q90A 1PZID 1A2UA 4LNUB 4K6LA 1FR3A 1Z7TA 2QDBA 1TU2B 1BQQT 3OFNA 5JQGB 2NUCA 2F0SA 3S1QB 2WV6D 5KYIA 1E2VA 4F6RA 4U68A 2SNMA 3BPZA 3DMUA 2PUSA 5K1PA 4LFAB 3QJYA 1YNJC 4I7ZC 5C0XJ 1JMKC 1FNWA 4H0LC 5IJ9B 1B4OA 4LF6B 2WPDA 2F0DA 2BA0A 3KEWA 1JOQA 1QWYA 4DXFA 2EDGA 3VQXA 4WBNB 3V2TA 3U11A 1SNMA 1WPBA 5EYPA 1RKNA 3NPPA 5KHJA 4H44C 3JSNA 1N32B 4XT1B 1BNZA 4ZLTF 4N9PA 2GK6A 4O2AB 3JU4A 2PZTA 3Q6SA 5JVG3 4FLWA 3ND9A 1D1KA 2BE5D 3CRKC 5IIFA 1B9NA 2PYLA 4NXMB 2B2TA 1SYDA 2OYQA 2X6GA 2HUGA 3G7LA 4F7XA 5A2QE 4JMQA 1ENCA 2UXDB 2C9OA 4O4LB 5BMVB 5C6AA 1HW7A 4XONA 1QE6A 2V7QA 1V1PA 2EZVA 3EVQA 1BPLA 1TUBA 5IJ0B 1OXTA 1LTBD 4XR6A 3JALA 1D5AA 4LF5B 4B3GA 3M4YA 4RGTA 5CB4B 2CK3A 1EFRA 3NTKA 2A68C 4J6HA 3CP8A 3U9SA 5D5QA 1D6EC 3S15B 3T53B 5KHIA 1CK1A 3TP7A 1Y69U 1WPCA 3I70A 1Z5VA 3A8JE 4DR7B 1S5CD 1EEID 3JAKB 1R4QB 3SXHA 4IIJB 4ME5A 5LMUB 4CH6A 5C3XA 3D8GA 3RYFA 2AQ3B 2ZINA 1IL8A 4PV1C 4DNRB 2BDNA 1MD2D 2B2TC 4CC6A 2EJFC 4H7BA 4HN7A 2VQFB 4O4HA 4B3FX 1QILA 1ML0D 5JVDB 1RSO