1VF7A

Crystal structure of the membrane fusion protein, mexa of the multidrug transporter
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
237
structure length
237
Chain Sequence
TLNTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQLQEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the membrane fusion protein, MexA, of the multidrug transporter in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords Multidrug resistance protein mexA
total genus 67
structure length 237
sequence length 237
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1vf7A03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1vf7A01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vf7A02
1GUNA 2DNCA 1DCZA 2BE5C 5K36H 1TU2B 3I73A 4H13C 1Y69U 3M7NA 3T51B 1GHJA 4H44C 5JEAG 1OXVA 1H9SB 3HGBA 1OXXK 1H9JA 3P20A 1H9SA 2QF7A 3QIAA 1GHKA 1GUSA 2NN6G 2EDGA 3OPOA 3OOCA 2D62A 1Z6HA 4TQUS 2EJFC 1YNJC 4G7OC 2ZT9C 5KNDA 4KMUC 1H9KA 1Y8NB 3A8JE 3BG3A 5JJEB 1IW7C 1V8QA 4KKTA 3A7AB 2R6GA 3BDOA 5A35A 5K36G 2E75C 3IKJA 3OW7A 2NN6I 1K8MA 3AB9A 4H0LC 5JJNB 5JEAH 4JBWA 3SDZA 2AWOA 2V4DA 1CI3M 1Q90A 2BA1A 1TKWB 2D2CC 2EVBA 3WDNA 2O5JC 3WB2A 1PMRA 2A68C 2DN8A 2BE5D 2E76C 1DXMA 2K33A 2NN6H 4HR7B 1Q1BA 4OO1G 3PUXA 2JXMB 1A6XA 4OGQC 1Q1EA 1IW7D 3M85A 1LABA 3U9SA 1OXTA 1ZYRC 1VF5C 2JE6I 2F95B 5D5QA 1HTPA 3L7ZC 3LNNA 4IQZA 3VR2A 4GYCB 3H94A 2A69C 1H9RA 2A6HC 2KCCA 1IYVA 1EWHA 1VCIA 1YNNC 3QG1A 4KN7C 3I4LA 3NE5B 4DNTB 1V43A 3D31A 1E2VA 5BN4A 2PPBC 2A69D 3FPPA 2A6HD 3CRLC 3GQBA 1O78A 1OXSC 4PV1C 4BA2I 1K8OA 4G7HC 3W3AA 3VR6A 4XTCS 3RLFA 1CTMA 4KKSA 3DXJC 2BA0A 2AUJD 1GUTA 4IFDG 2IT1A 3EQLC 2Q8IB 5JJJB 5KNCA 1Y8OB 2BDOA 3ND8A 5C0XH 1CFMA 2JEBI 3I72A 2A68D 1B9NA 2A6ED 4DK1A 3VR5A 1FR3A 3KLRA 1Y8PB 5BN5A 1GUGA 5BN3A 2F93B 2YYZA 2PCFB 5D5PA 5KNBA 3A8KE 3T56B 1E2ZA 1I6VC 3A8IE 3N6RA 4LK1C 1ONLA 3GD7A 1H9MA 2O5IC 4DK0A 3T53B 4DNRB 1G291 3LWUA 1ZKOA 3FMCA 2AUKA 3ND9A 3PUYA 1GUOA 3PUWA 4IFDH 3WB1A 2CW0C 4OO1H 2B8FA 2B8GA 4TKOB 1HCZA 4I7ZC 1HPCA 2L5TA 3TZUA 3D4RA 4LJZC 1LACA 2JEAI 1T5EA 3BRCA 1O7LA 4KHZA 4RCNA 1IYUA 1VDZA 1Z7TA 3MFYA 4KI0A 4L8JA 4G7ZC 1RSOA 1B9MA 3IFTA 2D5DA 1FYCA 3PUVA 2K32A 3M4YA 2EJMA 1GJXA 1BDOA 4KKUA 2LMCB 4BA1I 3PV0A 3WB0A 3VA7A 1DD2A 1SMYC 3VR3A 3CRKC 1VF7A 3A7LA 4GZYC 1E2WA 1Q12A 3VR4A 3SE0A 1H2SB 2EJGC 2PNRC 2KA7A 2K7VA 2A6EC 1HQMC 3PUZA 3QJYA 4KN4C 2F1MA 4JK1C 2E74C 1QJOA 4XIGS 1OXUA 5C0XG 2DNEA 3MXUA
chains in the Genus database with same CATH superfamily
1VQKV 4IOCA 3I73A 2BOBC 4RCZA 1EY7A 3AQQA 1DZ1A 4BY1G 1OZ0A 2QSAA 3CMAB 1R5OA 4UPAA 3G6EB 4JI2Q 1PH1A 2QWPB 2F4VL 1PJ6A 1I50H 5EKLA 4G1VA 4A3FB 2DY1A 2BPOA 3S2DH 1JA0A 3K9SA 4TQUS 1XMOB 5C3EB 1IBLB 4OPVA 1QVGU 4PDMA 1LTLA 1M1KC 2EJFC 5CA1A 1JC7A 1ZL8A 2AZ2A 2IPKD 1OCRB 4KMUC 1IW7C 1V8QA 3R93A 2JJ1A 3JAMi 2X6AA 4U673 4DR3L 3C3LA 1LNQA 4UXNA 3IKJA 4BPRA 4LFCO 1TR5A 2KEEA 4H0LC 5CR3A 5M3MH 3IGAC 1PLFA 3HOZH 3RT3C 1XNRQ 2ZE7A 4FXGC 2O5JC 3WNBA 3PENA 2JIZA 2GK7A 1WYDA 1PV0A 4FLZA 1XDCA 1GAQA 5EKKA 2WYRA 1TS2A 5ELEA 3B77A 2ENBA 5C0XJ 3CCEB 3S17H 1YEZA 4TRDA 3BC9A 5BSYA 3OT7A 4OPAA 2NNUA 4YAWA 1IW7D 1QZGA 1G2SA 3GB7C 2VNJA 3NXWA 4JYYA 4MW3A 4LUZA 4LNQA 1J5EQ 3CF5A 3LNNA 2I07B 5I2XA 2XNCA 2M2LA 5KLVH 3WY9A 1XHZA 1UE1A 3SPJA 3CHBD 4LFCL 1M1KD 3CB4A 3U6KA 1KD1D 2DIEA 5L46A 3R2TA 5FOBB 3EROA 4XQNA 3TGUH 3D31A 5E4WC 4C1NI 1JVMA 1SF9A 2A6HD 3PO3G 2OTJB 1SN8A 4OIJA 2NB0A 4G7HC 3TP5A 1GN2A 3JASB 2EIKC 4MSWC 3SKBA 1E24A 2C5CA 3GTMH 4OONA 1WB8A 2BTQA 2JP1A 2IT1A 4JI4L 4RGNA 3S1MH 4JV5Q 4X66O 1XEQA 3MMPA 3KJOA 4LFBB 3ND8A 1YHBA 2YXLA 1HA5A 2D0PA 3MTSA 1AJPA 3HKDB 3QNEA 4MVRA 2PZWA 4DV2Q 4ASUA 2VXWA 3QR8A 2YTVA 3MA2B 1EZVH 1VQLV 1VQ4V 4EB6A 1RODA 4RUFA 4I7AA 1SNCA 4J1MA 1QR9A 1VQ8B 2QM8A 1YZ6A 4QGPA 5M3MG 4G27B 1OCOB 1L2FA 5DNFA 3K6OA 4RGTA 4AQYB 1MSHA 1LUVA 2X6XA 3NTHA 1QVFB 3FB7C 1RPOA 4QE9A 3WB1A 1G7CA 1SM4A 3HOWB 3E35A 3EN2A 4GKJO 3IFDA 5IDJA 1Y1WG 2P06A 1RFYA 3T1YB 1SFOB 2F4VQ 2JEAI 4OPHA 1BE3H 3R65A 5E3FA 1CA6A 3EFFK 1GTOA 3CXCB 5IP9G 4B3TO 3WBKA 4DV7L 4U3FH 1K92A 4XLEA 1EY6A 3I8ZA 5F4MA 4NP5A 1Q82C 2YXHA 4F7XA 2IHFA 3CCJB 3PUVA 5K36H 3NR7A 5I6WA 2AHOA 3B6YA 2YICA 1W2BB 3MEFA 1XNQL 5IYBH 2BH2A 3M7MX 3CJHB 3KDFB 1VQPB 3WB0A 1JT8A 4DR1L 4A3CG 2EFGA 5FLXL 1BT8A 3JARB 4X3UA 4B3TL 1Q3LA 1HNXB 3ZHUA 4GZYC 4NPSA 2DJVA 4A3BH 5IT9N 3OUSA 3ZEDA 2P3MA 2UXNA 1VF5B 1A32A 2FMLA 2A74C 4GKJL 2KA7A 2QWNB 1GRJA 5LOVA 2ZR2A 4X62L 3HOYB 4IOAA 4X64O 4NXNB 4LBWA 4LNUA 2E74C 4Y7NB 3B8HA 4IYHA 1N0JA 2I1LA 2Q8RE 5JVG3 1A8PA 1LLRD 1P16A 3F2DA 3ZHVA 2YIBA 2PZSA 1A15A 5FL7A 2WLIA 2B7BA 4OOXA 3G6JB 2JN4A 3HKSA 4K5WA 4RHRA 2Y69C 2RQ6A 5J2UB 1Q5OA 3AK2A 1FX0A 2ZL5A 3G05A 1EU3A 3SK4A 4NXNQ 1JQ0A 3J7A5 5BMVB 4IIJA 2DMXA 5C4XB 1DGSA 4DRXB 3CCRV 4CDEC 1VQDA 3ZHSA 4Y9RA 3GV6A 2V31A 4O4IA 4LF6L 1Y8NB 1KP3A 1RCVD 3H15A 4KHPL 3VYUA 3BS1A 3ZIAA 2AMCB 4A3EH 4RLZA 1N34Q 2AZ0A 1K8AW 1TWGH 3OW7A 2WAMA 2LFRA 4WCEV 4JI4O 1PZID 1SEBD 1I6HB 1A3VA 1AIPA 4QPKA 1E63A 4X65O 1CT1D 1JWSD 4XLCA 1VMCA 2V7QG 1X6OA 1NR1A 2R92H 4ZOLA 2OYQA 1PYWD 4X89A 3FYIB 4PZ8A 2HLDG 4DR5L 1G6ZA 4HJ5A 2NN6H 2EINC 2KHJA 5D65A 1WTVA 1EIHA 2HDNB 3B78A 3NBHB 1GM5A 2WINB 5IGGA 3CCSB 1XFOA 2JXMB 1A3TA 2BVNA 1ZUNB 2CWPA 2PGGA 4RUEA 3G80A 1R9TH 1HNZB 5A89A 2B9ZA 5LMUL 4RDKA 2D74A 5LL6X 4DR6O 1E43A 3H94A 5H59A 1KHIA 1B3QA 2IJKA 2JDIG 2UUAB 3Q6RA 1VQNB 1IYJB 1VCIA 2KCNA 4ZAIA 3NE5B 1UUPA 3I4MB 2DW4A 2GA4B 2Y48A 1E2VA 4M1UB 5BN4A 2UXBL 1HVXA 4NNJA 1D8LA 1V1QA 1QR8A 3B2EE 2L6LA 2MW2B 4E4EA 4H13B 4Z1MG 1HR0B 4MW8A 1NCVA 2AKWB 2L1BA 5IGCA 1GM7A 2M6YA 4NMZA 1WI5A 1KK1A 2YIDA 2NPFA 2F0SA 1QFZA 2RSOA 4DA2A 5C3EH 3DXRA 2L4NA 5CV7A 3JCZA 4CH6A 1XMQO 3CPFA 3I4NB 1N0NA 4FYDA 5CC4A 1F7YA 4YWMA 2JEBI 2YSUB 1HQRD 4DXGA 4O4LA 3WYAA 2AQ1B 4DYLA 5EZYA 1LTRD 2XNAC 4HSVA 2VQFO 2WFWA 1HUMA 1Z5VA 3JSLA 4PV1B 3T1HL 2MUYA 1WSVA 2HDLA 4HJ7A 3BH4A 3E0JA 1ONLA 2CH7B 3RYCB 2VNHA 3W1BA 1S72B 1QZHA 3CMEA 2VQEB 1TWFH 1U97A 3QTCA 4PA3A 1GUOA 5ELOA 2ZJQA 2Z0AA 4IFDH 4FZ1A 4R7CA 5KAFZ 4CS4A 2ZM6Q 2X7RB 2N05A 3K08A 3ABMB 4DUYL 3D4RA 4WQMA 5JH7B 1Y67A 1R9TB 2B1GA 4RKBA 3TCUA 5IT9E 2JEUA 3OHXC 4AYBE 5IODA 1SQFA 2NN4A 1B9MA 1GUWA 1UFIA 4HIZA 5H5JA 2K1EA 1FYCA 3CCMA 1KK2A 1EUJA 3DDYA 5EKIA 2RCVA 3HKDA 1MBYA 4OWXB 4FDBA 5JQGB 2VWKA 4NTWA 5K1PA 1SERA 5HXBA 1VQMB 4EEQA 1LYLA 3CXHF 2MHVA 4MVUA 1IBLL 3ASNC 1IURA 4X06A 4F4LA 4LFCQ 3AVWA 3HG9A 1NJIC 2B63G 1BNZA 1S5DD 2G5DA 5LBQA 1TVXA 4LBEC 1B4OA 4QQBX 5DS0A 3HKCB 4YJ2A 1VJSA 2J0TD 1M4VA 2PQAA 4UHVA 2K5DA 4YCVA 2UUBL 2OTJA 4DV3B 3HKBA 2ES2A 4C3IG 4ZI7A 1CUKA 1I4RA 4KHVA 2CW5A 3A8KA 2PYJA 3KL9A 2M7WA 2F0NA 2R9VA 2NVTH 1GO2A 1TY2A 4QNHB 1YVWA 2ZE5A 2XGTA 1TWFB 4V0BA 4WZEA 4DAPA 5KX5A 1YJ9V 5KHKA 1H9SA 2NBFA 2UUCB 2LXJA 3QIAA 4APVA 5H5NA 4RDJA 3GTPB 1GUSA 4B3FX 3IFXA 3CJHA 3CPWU 5EQ0A 4JI8B 1U4LA 3PA1A 4NBSA 2QWQB 1IXRA 2C9OA 4DR7Q 4PHZA 2F0QA 4LF8Q 1VMGA 4R71A 4LF4O 4RQFA 3G7LA 3A7AB 1Y1WB 2ZIOA 3T4DA 4JV5O 1NSNS 1KRTA 4GX5A 3STLC 3HOUG 4J11A 4B3SO 4C0SA 3C3TA 1E79G 1TVCA 3FYEB 4P9PA 1IBKO 3CP1A 3CXCA 1XQ8A 4V190 3S14H 4DGZA 4HR7B 3F5WC 4Q6GA 2E76C 1ZL8B 2XAQA 5GROA 4NDXA 2UUAO 4J7JA 3I55B 3CCRA 3TDQA 4OL7A 4F6RA 4YHBA 4K8XA 3BHPA 2GJPA 1I94O 4D7TA 2JQOA 2K01A 4A3KH 2EYPA 3STBC 5L3DA 1LABA 1NBMA 5B6IA 1ZYRC 2F95B 3L7ZC 3VBBA 3E2EA 4ZHQB 3WG7C 1SQPH 2IJJA 1V0FA 2B2YA 5C4JH 1I4XA 3LDDA 4OX9L 2R93B 3HOWH 3AVYA 4G57A 4QF4A 1NMFA 1EFRG 2EIMC 3E89A 4DNTB 4BBRB 1TWAH 1QE6A 3BYTB 4DR2Q 3GQBA 2UXCO 4Z2WA 3A74A 4LF6O 1SQGA 2Q68A 2A1AA 2C5BA 3ABLB 5B5EZ 3ASTA 4B48A 1CTMA 1C0AA 3STBD 2PQEA 2XVSA 2IU0A 3B8NA 3BABA 4ZLTF 1HDJA 4X62B 2YWFA 2ZZFA 2B2TC 3AFPA 5CORA 5L3CA 2Q4PA 2E2IB 3OMAB 1R73A 5DLQE 3CC7A 3CCVA 4Z1VA 1FPOA 1E1TA 3IL8A 5C0XH 1K3BC 1NBMG 1GN4A 2ZXRA 2A6ED 3E8HA 4NB5A 4LF9B 1H8EG 1PHJA 1N07A 3OUFA 2EJRA 2QDOA 3JAWA 4PC2A 3SLDA 5F2DA 1EIYB 4A3GG 1RQRA 1X3EA 2HVJC 5D5PA 3G4SV 5CN0A 3F1ZA 4LF6Q 3SJAC 3C1FA 3B4SA 2ADQB 4XOPA 3ZN1A 3GD7A 3T2MA 2VQEL 4BXXG 4DK0A 3ULJA 5C6AA 3LWUA 1ILPA 5CBFA 4A3CH 4U3JA 3DLLA 3RVZA 5BR8Q 1XPRA 3ULLA 1Q7YC 4LH7A 2CW0C 3I2ZA 2B63H 2FJ2A 4PZ6A 1WNSA 1PTOB 1RJTA 2F3WA 4TKOB 1N33Q 5KYIA 1XE1A 3BY2A 1NI8A 4R1JA 2HFEC 2QEJC 2R7ZG 2J4XA 5L3FA 2VBUA 1WP6A 5LL6Y 5E7NA 4GNXB 2HG5C 4LF5L 3PUNA 4PC7A 2D5DA 3J80i 3GTJB 1CNFA 3CRRA 2VNUD 1Y1VB 1TWGB 3M4YA 4ROXA 4R9WA 5A8AA 2D9UA 2F3VA 4AIMA 2CQOA 2RDHA 1OTCA 4HZ3A 1AR5A 2GTSA 2KVOA 1D8TA 2WAQG 3OTFA 1C7YA 2LP7A 2F03A 2IW5A 3AG3C 2EYHA 1X3QA 3DGEA 5EK0A 1HNZO 1EP3B 1H2SB 2EJGC 5KHIA 2E1BA 3E6ZX 1L0WA 4O2BB 4XDLA 2DWEC 2DYSC 2Q6LA 1VQ7B 3M4PA 1CNEA 4ME5A 1HWYA 2B2UC 1IBMQ 3ICXA 4A3DH 3OZVA 2IU3A 2EJ7A 3ZHRA 5KUMA 5FLMG 3UDIA 2NR5A 4DV6Q 3A54A 2OWOA 3KUPA 3RUZA 4LFBQ 1FXHA 1DCZA 3H0GG 4LW1A 2R93G 2XNDA 5A2QL 4K6LA 5A2QN 4PQXA 4DQKA 4JTCB 1X3GA 3BVOA 4HSPA 3VQXA 5EPJA 2YU9B 4PJ0Z 1VP7A 4FLXA 3CMMA 5FLXE 1XHXA 1VLYA 2QILA 2LY7A 1YNJC 5M5WH 4HYOA 1BR9A 4B3RQ 1TWCB 1S72A 3T4ZA 1VQ6V 1XXGA 2Y0PA 4IGGA 1QU7A 1D5MC 4KKTA 2F0OA 2R6GA 2GJRA 1U5KA 3HKCA 2ZQMA 3GVMA 4XONA 2BM1A 1X65A 2I5LX 1B53A 3S1NB 1JA1A 2UXBQ 3I1FA 3W5UA 3HKBB 4R4IA 2EZVA 4B43A 1AI4A 2V4DA 5H2FZ 4MYUA 2K4KA 1P49A 4XORA 4AH6A 4P25A 2X6BA 1EFTA 4IW3B 1MD2D 4ZIBA 2BE5D 4IJHA 1EYAA 2F52A 5LOVB 2UU9B 4X66B 3GWKC 4HE5A 3ZCCA 1CP9A 4U68A 4IO9A 1P7BA 4HJ9A 4XDXA 2XHBA 3CD6V 1KRSA 3RW0A 4OXSA 1MNGA 2A8VA 4AILC 4IUNA 2OIEA 1AI6A 1NJIW 3SJZA 1VQGA 1OXTA 4X9QA 3ONYA 2JE6I 1Q81C 1B06A 2HEPA 1QCEA 2LW7A 3QG5A 4QL5A 5IJ9A 1HR0W 4JBMA 1NS1A 2NV4A 3JQQA 5IYBG 3UKMA 5TRDA 2R7FA 4DR7L 3C2PA 3JD0A 5HZAA 4IPDA 3CHXA 1TIID 1SNDA 1RQPA 2B2VA 4AC9A 1QNMA 4BAYA 1PTOF 2DCUA 2ZL7A 4BXXH 2DN9A 1E1RG 4DQLA 1QVFA 1GN6A 3ZC3A 1NDHA 3K9AA 3KLWA 3KLSA 4MIUA 4LF9O 4KKSA 3T16A 1G51A 1HZ9A 3W7WA 1EXMA 4YXWA 3PIP3 4JI2L 1M56B 3ZN0A 5JBQA 2ZJRA 1LUZA 1L0LH 3ABLC 2ZXOA 1EN5A 5LA6B 4M53A 2QE7A 1YHAA 2VQFQ 3OEHG 3I72A 1JE4A 3H3VI 1DOKA 1TUBB 2H3OA 5CBGA 4DR7O 4IUPA 4ZGQB 2KBNA 4JI5B 5CB4A 1QGAA 1TXYA 1IZ6A 2OQKA 2QJ1A 3T56B 1LTSD 3ZJYC 2E75B 4YY3O 1CKOA 4LF7O 2EXZA 4FF1A 1JOOA 2OBRA 1JQYD 1WA8B 1G291 2TSSA 4BY7H 4DV6L 4U7OA 5BXZA 4I9QA 1XQBA 4FK8A 1JWUD 1Q82W 4EKWA 2JK8A 2KECA 1YIJA 4H33A 1N36L 5HFMA 2NTSA 3QF7A 2PYKA 3CD6A 4LUOA 4UVCA 4YHHL 4H9GA 4UB8Z 5LP6B 1Y6XA 1F9RA 1X3PA 2CH4A 2XRQD 5M3FH 5M5YH 3L73H 4XLHA 1FXVA 3CCVB 4KHZA 4KUMA 2F43A 3V05A 4A3DG 4BY1B 1K7DA 2F1LA 1KLUD 2EQSA 4X62Q 4PZ7A 4F6RB 4BBSH 2VW9A 3H0GB 1DG1G 3HRZC 3K8AA 1E3XA 1J5EO 2EJMA 4K8JA 1NRKA 4XQQA 4PMCA 3TJTA 1BDOA 1HH2P 1ZM9A 1EWIA 4GNXC 1WN7A 1TQOA 4BY1H 4FLTA 2DERA 5G3LD 1BMFA 2R92B 2P67A 3AGQA 3I56B 1VMPA 3G71V 2WLLA 3HEJA 3DXRB 5C44G 1A8VA 1VQ5A 5CV4A 4JI6L 2FKXA 1WPCA 4A3KB 2F0PA 3A2FA 1F2YA 2R7ZH 1HZBA 5LHIA 4DV5O 2X3UA 3ISXA 3W5HA 1X4TA 4XL9A 1A2UA 2EZOA 3RMHA 4X65Q 3SEBA 4MTGA 5DECA 4XD7A 2AXTZ 1R3JC 1KUQA 1EU4A 3BZCA 1KC8D 5EC2C 2UXCB 1SSOA 3SJCC 2VBVA 1ZX3A 2DYRC 4O2AA 3K5LA 1JOYA 3W2EA 1QH0A 2BE5C 3K7AH 4GLVB 2ZNIA 3I56V 1AP0A 1NTZH 3J81L 1LTAD 1QUEA 2BM0A 1H9JA 1MI2A 1OXXK 3OWEB 4J7KA 4MYTA 4NYKA 4KY7A 3BFRA 4D6TH 5DSZA 4A3JH 1YX2A 3OOCA 1FFXB 3OE7A 1Z6HA 2XNJA 4KFMA 1FFXA 1PH7A 5IT9c 2VQEQ 1PPJH 1BO0A 2ZTCA 2B1IA 2NVXB 2GSMB 1JJ2B 1V1PA 2Z6BA 2OCHA 3NENA 1WVLA 1PV4A 1XNQQ 1V55B 1SESA 2E5LB 2WAQE 4DR4Q 2N74A 4L6TB 1QFJA 2V7QA 2L0CA 4IJLA 5IYQA 1TT2A 4ILWA 2Q0OC 4N9TA 5A35A 5LMNL 1SMYD 1FL0A 1WAZA 3CTAA 5B1AC 1K97A 3D6WA 3JQPA 2ILMA 3KZIZ 4FM0A 4L5TA 2BCOA 4WFEA 4YY3B 3E83A 3VQWA 1W2BU 4K8ZA 5IJ0B 2GJKA 2QTLA 4HE6A 2JGDA 1SNPA 2QGGA 5LP6C 1O7YA 2C77A 2K04A 4TSSA 3NTKA 4O4HA 2KVMA 4TV8A 3PUXA 3PMFA 3OFNA 2CTPA 1KBHA 2M00A 4RCYA 2E1RA 2FXQA 4I55A 4B7KA 4X1YA 3U2QA 4C3HG 4F88A 2XT9A 4DR4B 1ICWA 5TISZ 1D1KA 1IX9A 1BJKA 4ZCIA 5FPRA 4UZUA 1D6EC 4KXRA 3L9AX 1I94L 5FL7G 4LFAL 2A6HC 4PI2A 1IYVA 1HZCA 4O2BA 2Z6KC 2L35A 4HNAA 3ETDA 1M9NA 1H42A 3CMEB 4JV5L 1OXSC 1YJNB 4PC1A 2DYRB 1WJZA 3W3AA 4QY7A 3VQYA 4G7XA 3X3NA 2EX3A 1VQ8A 5C4HA 1CHQD 1JJCB 5LXTB 4PDLA 1US6A 1BX1A 1FNBA 4XMYA 1SRUA 5E79Z 3Q4HA 2HHHQ 4GOPC 4XDJA 1IB0A 1H2GA 2V1CC 1CSPA 2YV5A 1PJ7A 2VZAA 1EEFD 2CHBD 3OW2B 1P8LA 2LGWA 3FRPB 3VR5A 2CW0D 2CK3A 1Q7YD 1DYQA 4DR2B 3AVUA 1BXTA 4Q0FA 5BN5A 4AQYL 4CC5A 4B3RL 1YIJV 4A3MB 4H37A 2OEOA 2RN9A 3L72H 1N08A 2DETA 1E2ZA 2Y0SE 5LMNW 2B5UA 4EQOA 3I55A 4P3YA 2JA6G 5J2UA 1N8RW 3HKEA 2SOBA 5LL6S 4DV4Q 4Q5VA 5EPLA 4DR5O 4J9ZB 2EY2A 2RBMA 1V0EA 3BDCA 4C1NK 2LZJA 1PL4A 1WTOA 4FF3A 2AGAA 4TMVA 1EY8A 2MPMA 3V2TA 1T5EA 1X3FA 4GN3B 1VDZA 4L8JA 4ME3A 2HDMA 3K03A 3IFTA 3S1NH 4J41A 3BJUA 4QIWB 2Q6KA 4FFBB 3ML0A 2Q7EA 1FGUA 1MHWC 3GIRA 4DO2A 1AH9A 4LNUB 3OSOA 3QFRA 1I5FA 3PV0A 1DD2A 5BR8B 1A3UA 4DAVA 4WWVA 3APOA 4FVMA 3CS5A 3NQTA 3BVZA 1T6XA 1JJOA 4LF4B 3AG2B 3L75H 2K7VA 4ZCLA 2HQEA 2RQXA 3MC0B 5FK9C 2JA5G 1BKBA 1XNRO 1AZPA 1HNWB 1VQ4A 1SE3A 1O9HA 4I65A 3KKYA 4PC3A 4KD4A 2KUMA 3CMEV 1YLOA 4GKJQ 2YWEA 4A3LH 1VQAA 1PFMA 3OIQA 4GS3A 4KJNA 4ABNA 1D5ZC 2XZOA 1TU2B 3ASRA 1NR7A 4J42A 2OIGA 2VQFL 4W4LA 2CTRA 4DUYQ 2JSOA 2ETNA 1L0YB 3HGBA 5GV7A 3BZKA 5KHHA 2EULA 4A3BG 3FB6C 3W2HA 2NN6G 2F0VA 1SYDA 4CDCC 4JI1B 3PUMA 3FX7A 2K50A 3U6BA 3SVMA 2A06H 2K05A 4KY5A 1HXYD 2HCIA 2ZT9C 4YAFA 5JAVA 1K0RA 1Z9FA 2UU9L 5FO7B 2YUAA 1B2TA 5AG2A 4JI5Q 4YJ3A 2HCJB 1V1OA 1M57B 4YJ3B 3I70A 2XSCA 4PDVA 3F8TA 1NNXA 2Z3YA 2MJ8A 4RD3A 5BZBA 2PYLA 1HP8A 4YWLA 3I4NH 4K2LA 3T13A 4ZKBB 1A62A 2PF4E 5NUCA 1W2BA 1D5AA 2OTLV 4EQ5A 4ACBA 1BZKA 2ADPA 4DV3O 3OTOB 1JJ2U 3HP3A 3FKSG 2BH8A 1A6XA 4GZRB 3RR5A 1GVPA 2EINB 1SRYA 3AG4C 3SYAA 1EZ6A 5LMUO 3M85A 3PIPA 1EQQA 5KW9A 1SYFA 2HD3A 5LMNQ 3KCXA 1NTKH 4BBSG 3OR6C 1FJGO 3ZBUA 3ABUA 4GYCB 1NJID 3CEIA 1B70B 2BSAA 1F2MA 4KN7C 1YHQA 4LWSA 2HJDA 4LFCB 3STZC 1EFUA 3E1YE 3H1JH 1EIGA 1PXUA 4YIPA 1V43A 3LNMB 4M1KA 1FNWA 1O78A 4PV1C 1DONA 4GX2A 1YI2B 2Q8VA 1NUCA 3ZRWA 5HFLA 3QSYA 4CBCA 1SXTA 3I3CA 5IYZB 2OQ0A 1E1QG 2BE3A 3FFQA 3AVXA 1ET9A 5IYZA 3U50C 5JJKA 2WPDA 4QV2A 1NR4A 3T4AC 4FF2A 2R7DA 2JGDB 4ICGA 1EY0A 3SPHA 3H91A 4DV6B 3ERSX 4DAYB 1CFMA 1HR0L 1PL0A 4DK1A 2I5MX 5EBDA 4DV0L 5BN3A 4UUJC 4RA8A 2RDCA 3TK1A 2UXDQ 5B3SC 1S5BD 3ITPA 2RVLA 3KK7A 4B3XA 3N6RA 2JN9A 2LXKA 4J7ZA 4F6EA 1JR9A 1K28A 5H6RA 4DUYO 4DNRB 1BQZA 4HJ8A 1IKLA 2PMZB 4NB3A 4A3JG 2B7CA 3ND9A 4LFAQ 3M99B 1YBYA 5D3IB 3G71A 3SHLA 1QNUA 3HOUH 1KXLA 1Q90D 4LF4L 4RFBA 3GV3A 5J39A 4UCUA 4N21A 5EYPA 2E5LO 1NR2A 4K5VA 1H8HA 3V7AA 2DJFC 5DN6A 4KTAA 1CXZB 2BSKB 1Q3EA 4WFFA 2WWWA 1PRTC 1Z7TA 1EYGA 4UCOA 4G7ZC 3ES9A 1S5FD 3DC6A 1QWYA 1UWVA 4TOIA 4J80A 4QPJA 1XTCD 5ELDA 3TMEA 1EFCA 1I5YA 4C3HB 3H6MA 1S5HC 4NKGB 1EQVA 3Q24A 1AP6A 3NXSA 1JB9A 1TS4A 3HOWG 4K0KQ 3LQEA 3TP6A 1S0UA 3A8IA 5IE8A 3VNUA 3ZX6A 1P84F 2KOLA 2FHTA 3A7LA 3AMUA 1KRHA 4MVOA 2A5HA 1Q81W 3KBXA 4JW0A 4WJ3M 4FXUA 2BCCH 1FAFA 3B8MA 2ZTDA 3ZMUA 1YSCA 1N36O 5IYBO 2UXBO 2QR4A 4X88A 3BVMA 3D0FA 2DJGC 3RZDH 3UQ8A 4NXML 2OCCC 4XIGS 1G4YB 4Z4TA 4GT1A 4KLKA 3W7TA 2OBSA 4FLWA 3VO2A 3NPPA 3HOUB 4DR6L 1SROA 1XNRL 3QB3A 3TEHB 1D1NA 4XN3A 4QCLA 2JS3A 1M57C 1T6YA 2DQ0A 2GREA 3ABKB 5JEAG 2I5HA 1IDSA 3ZJZA 1XTDA 3OW2A 2QF7A 5ELCA 1PKVA 1N9WA 5H9CA 1QB5D 1GVHA 5GAGC 4HIMA 5IWAQ 5IWAO 4YWKA 4A3KG 1EL0A 3I90A 4X7EA 4I0XB 2V7WA 4JBKA 2L55A 1BBUA 1I50B 4LF6B 1B6QA 3K0DA 2XOKA 2UUCL 3VOUA 1QQCA 4HJAA 2JGUA 5B1OA 5FJ8G 4LF9Q 2EBOA 3OM3B 2TMPA 3E9IA 1YJWA 1Q90A 2BA1A 2MGSA 4WBNA 2EVBA 4MHEA 5EJWA 1S72V 4CH4A 2EZPA 2F4NA 2ZITA 5CV8A 1W9XA 2EYLA 4DR3Q 3A0RA 3BAAA 1Q1BA 4A3IH 3L74H 1SQBH 4R50A 1PJ5A 4BBRH 3E22B 1Q86C 3S2HH 1OB5A 5EBMC 4OGQC 1WB7A 5C3WA 1CSQA 3TN2A 1Z2GA 4I4TB 3VMFA 4QUCA 4JBJA 1HTPA 4J6HA 1FNCA 4PABA 1Q86W 4PMBA 5CB4B 3VA5A 1V54C 2K9PA 4TSFG 1KQSB 2CUGA 2PZUA 4LF4Q 4U7NA 1BCPF 2RCNA 3K06A 5FLMH 2ATWA 4R4QA 2ID0A 1IHZA 2N8NA 4O42A 4WJ4A 2ITCC 2OXPA 2WKDA 1SJHD 4MVMA 1PNKA 4X8AA 1YI2V 2OK8A 4Z1MA 3M4QA 1DOLA 1O9GA 4X7CA 4DV1O 2JA7B 1X55A 3KG2A 3AVTA 1DARA 1FNDA 1VQNV 1HNWL 2QA4A 1SZTA 1VQNA 2VZLA 1WTXA 3HFZB 4A3EB 2CH7A 3RYCA 3J80c 4OELB 1PH6A 4LFAO 3OTOO 1ZM4A 4TMWA 2V7TA 1TVKA 1Y8PB 5LGTA 2E2HB 1IVSA 2XZLA 1V55C 3E8BA 5CMUA 3D8GA 3KBGA 4JOIC 2IX3A 3U0ZA 4O4JA 1XMQQ 3AVVA 2N55A 1TWHH 4TV8B 2FFKB 2JA9A 4QE7A 2EYMA 1EY5A 3QOJA 1VHEA 2BF4A 3V76A 2KQ3A 1ESRA 2JJQA 2Q2TA 3PO2G 3PA2A 3SPCA 2Q9LA 4A3BB 4FLVA 1LACA 1V5VA 1K73W 3ZRWB 4NTYA 5GTHZ 4X6AH 5EIBD 1HNXO 3BA9A 5F4JA 3FEWX 5IYDO 3RZOB 3CCJA 3RZDB 4X1IA 4B3TQ 2CWAA 4A3GH 5FPOA 1VQ7A 1UE5A 2IBZH 4FM2A 2SDFA 4PA9A 2WB1G 1FGBD 1EBOA 2BGIA 5LMUQ 1D2BA 3LSQA 3MHPA 1EN6A 4JC0A 3SLNA 3G67A 1K73D 3R6JA 4Z4VA 1JR0D 3JASA 1TA8A 4RWUA 4UP7A 1KD1C 1VEWA 2KG7A 1D2DA 1XNQB 2RA4A 2OCCB 4A76A 1FFTB 1Y0YA 3T1YO 3FPKA 2O2LD 3RWRD 4C3HH 1UD8A 3GTJH 3RYIB 4NXMB 5FNZA 5C44B 1U0LA 1WSRA 2DYIA 5KUKA 1SE2A 4RCOA 1Y4MA 3G4SA 1I7FA 1GJRA 2X6WA 4RD2A 1C4QA 2DGYA 5C3EG 3BCDA 1TS5A 4JK1C 2ZINA 3AK3A 1QJOA 1F2ZA 3CWBH 2Q69A 2KQXA 4FK5C 1L0XB 2XRSD 3DM3A 1AI7A 1CK1A 3PF4A 2XAFA 4EB6B 3T1HO 5FIUA 2B2WA 2D0OA 3K5OA 2CBXA 1T5XD 4JTDB 2O57A 3QFCA 1F9PA 1NY4A 1ET6A 3ERQA 4H13C 4YHHQ 3K59A 3GTGB 1GH6A 4XKVA 5F4OA 3H1HH 4EQNA 1KYOF 2IL8A 4N8FA 2QM7A 3G6BA 1VQPV 1S3JA 2CVRA 2Z4HA 1PM9A 1SA0B 1YXBA 4NXMQ 4UCSA 1TY0A 3DWAA 3I55V 1PYSB 2HJFC 3UT5A 4G7OC 1P7GA 2GUZB 1Q7YW 4DR6Q 1N06A 2EILC 5BY1A 2GHYA 3S15B 5FO9B 2GQFA 1Y14B 2K5WA 1LT5D 5AFWA 1K8MA 3QO8A 4MTKA 2V7VA 1SBBB 4NW2A 5JJZA 5B1NA 1IXMA 1LR1A 1FDRA 5FO1A 3Q23A 4RQEA 4CJ0B 1LTTD 4TUYB 2N88A 1PTOC 1BCCH 1WA8A 4D7SA 5FA6A 1K34A 4RD4A 5T1IA 3CCLA 2WJVA 4AF7A 3FKIH 1PH9A 1YIJB 4JYCA 2RHSB 1VQLB 1H95A 3KEWA 1BUVT 1YTFB 1HZEA 4AYBB 2HUGA 2OCEA 5GADC 4LF9L 1IJFA 4UV9A 3H01A 4B08A 2UUAQ 2NVQB 4RPDA 1KABA 2Q6OA 1VF6C 1EWCA 3M3YB 1ICFB 3LDEA 4N23A 3OAAA 4ABMA 4RPBA 4A3IB 1JB7A 4UFZA 1E1OA 3J81k 2A19A 1YJNV 2Z0SA 2OTJV 3HOVH 2VQFB 1GN3A 1MSWD 3NWTA 5TV2A 2LJ2A 4OGQB 1ZM3A 5IK2A 2JA5H 4Q7JB 3ONAB 4WZTA 5HY6A 4WBNB 2B5OA 2B2UA 2FMMA 1J9OA 4NXMO 2E2DC 2K28A 3E86A 4MTNA 5KGUA 1EQTA 4POGA 3S2DB 1NBWA 1RM1B 3ZPNA 1PFNA 3MXNA 2C78A 3AEVA 3CXCU 4H44B 1JOQA 5I2YA 3IC7A 2FINB 4DUZB 4XYOA 1O80A 4GQNA 1K83B 4A3JB 3A8IE 4RDLA 2KSDA 1JPXA 3OJWA 4NVPA 2EY6A 3K3WA 4DXFA 4P72A 1TUEB 3N2GB 4DV2O 1STBA 1BQEA 2WKCA 3SYOA 3N2GA 1JOKA 1QVGA 5IWAB 4JYAO 3GWOA 1WU8A 4JYAL 3W1GA 4JI6O 2B8FA 4N8X1 4WFAV 1STNA 3SYCA 4PC6A 1RDPD 3I56A 2JJ1G 3BY6A 3SYQA 3ZIAG 4P6YA 2HVKC 3SJQC 2WR8A 4QVAA 1O7LA 1MKHA 4L63B 2R6HA 2VRZA 2KHSA 1HHVA 4YAOA 1IBLO 1K8AD 4C43A 1V1PB 1R6NA 4XQJA 1R6KA 1J8IA 3T1YQ 2X69A 2Q7GA 3KYHC 2F4VO 2E76B 2DWDC 3QO7A 2CK3G 4KKUA 4QGUA 2UUBQ 4DV3Q 4N9PA 4CKCA 5CBHA 5J1ZA 1GKHA 2Z4IA 1I8DA 4O4HB 5IJ0A 2PQAB 1A63A 1YVCA 4MT8A 4BIZA 1OXUA 3URYA 1M90W 3J81E 4FF4A 2XWJB 1N33O 3BPZA 2Q5ZA 1FD7D 4DV5B 3S1RH 1KD1W 3ASOC 4UZEA 4CH3A 3H1LH 1JA8A 2D3LA 2CE4A 3KF6A 1N34O 2UUCQ 2WACA 3KF6B 3LUTB 4A3EG 1GUNA 4A3MH 1Y1VG 4M8AA 1M90C 1HRJA 2UU9Q 3U4VA 3PCOB 3PIOA 2PLFA 4DV0B 2JYOA 1ORQC 1H9SB 2WAQB 3UDGA 3P20A 4RM0A 4QUZA 2F3IA 4IPCA 4X66L 3ABTA 4QVJA 2EILB 1AEXA 2ICEC 3RYFB 2ZXHA 3NEMA 3L70H 4I50B 5JVH3 2JA6H 2YI8A 2N49A 2CAZC 1XL6A 4LFAB 1WOPA 3ASQA 2OTLB 5ITZB 2XTIA 2NZHA 3CPWA 2FL4A 4C7UA 4JI1O 3K57A 3CCVV 4A93H 2QN6A 3Q6QA 3NHHA 5I9OA 2MQHA 1AE2A 3I5DA 1RP3B 1STEA 4JI2O 1W6KA 2E75C 1E79A 3JD4A 2PI2E 4Z4YA 4FO2A 4KP4A 2PY5A 1KJZA 1MSDA 2P7TC 5EBCA 1WOSA 3N2KA 4TV9A 2X6LA 2WZPP 2Z6KA 3J7YW 4IUVA 1KKDA 3AYHB 4DV1L 1IBKL 5GAHC 3ABMC 3T1HB 2I0QA 2FTKA 1AW7A 1KAWA 1JICA 3PO2H 1SKQA 3CP0A 1DF5A 2ZZGA 1PRTD 1LT6D 2A73B 1E3PA 1KB9F 3MD0A 3MZ5A 4DF7A 3RNUA 1OV9A 2KHIA 4PA6A 4IIJB 2J7KA 1U4MA 2XAJA 1VQPA 1YJNA 3QWNA 1R5NA 2IHEA 2RDFA 4ZHQA 1XMOL 5KHJA 4GUNA 1GO3F 4LCUC 2CGOA 2DE0X 1HA3A 3VR2A 1N33L 4ZUJA 3GVKA 4L87A 3UT5B 4P2NA 1JE5A 1RD9D 1GK9A 2GUZA 4LC1A 1FKAO 4DR3O 4P12A 2EIJC 4Z4SA 1B1ZA 4OWTB 3U11A 2A69D 4KV6A 3CRLC 3TZDA 1X56A 5BSXA 3GTLH 3LVBA 5KMGB 5JJLA 4LFBL 5E1FA 3T1YL 3DXJC 4K0KB 4Y7CA 2E2HH 1I94B 4YHHB 5M5WB 2R9AA 3A5UA 5A88A 1N0VC 2MP1A 5KAIZ 3SJPA 5KNDA 3TQYA 2UUAL 3UI2A 1L0NH 3P3PA 2VYQA 2DEUA 1B9NA 1NB9A 4NKLA 3I4MH 5IGFA 1TS3A 1H2KA 1U9RA 4A93G 1I4QA 1K9MC 3GTMB 1ZXTA 3SJBC 3UDFA 2GPJA 5I9PA 4LK1C 3MHHC 5CA1B 3M9BA 1WP8A 4FMTA 2RC5A 3L3OC 4U3JB 4AVZA 4BS9A 1PH8A 4I5SA 4AHCA 1AJQA 3R6KA 1ENAA 4C3JG 4DV7Q 4GOPB 2JA8G 4GOPA 4P2CB 1CPYA 4IURA 1MG1A 2R61A 3FB5C 1K8AC 1BF4A 2P4VA 3RN4A 1UD6A 4UP8A 3F2CA 4OHJA 3W2IA 3HOYH 3I7FA 3A0JA 3J81N 5FJ8H 5BR8L 2K1BA 2DUDA 4G4KA 3ASOB 1EY9A 2AWNA 2K5NA 2QGQA 4X07A 3RZOH 1EZ8A 2UXDO 3ZUGA 2UXCQ 1VQ4B 2ZXWC 4MVQA 4A3LG 2W6IA 2QWRB 4P1VA 2NVQH 4JI3L 5GTIZ 5LP6A 4E6IA 2Y4TA 4POFA 3CCEA 3U58A 2YIBD 3AG1B 5BR8O 4DUZO 3OEHA 1QLNA 4YALA 3AEIA 4LF7B 1PZKD 2F0EA 1FS0G 5L37A 2NLJC 3K58A 5M3MB 3IC9A 3MFGA 4WRDA 2LO1A 5IYWA 3P1HA 1TTTA 4A5UB 4YXWG 2X85A 3WNDA 2UXDL 2YWGA 1HQMC 3U10A 1KDAA 1OCZC 4MTXA 3HZXA 5K5PA 5IE9A 4KN4C 4X3SA 2R93H 5GW7A 1ENVA 3H9VA 3B82A 1KC8W 1QCBD 1VQ7V 2EYJA 1KIXA 1GXDC 4JTAB 2DNCA 2H5XA 1EFID 2BOCC 3UDXA 2EIKB 4A3FH 1KL9A 4DR3B 1PDQA 4UV8A 4EQPA 3B40A 1VIBA 4WF9V 5M9OA 1XREA 5CBEE 4DPGA 4TVAB 1OGIA 3S15H 4CS2A 2F4VB 2ODMA 1P4MA 3W2GA 2ZXIA 2P5ZX 3Q8DA 3CCEV 2SNSA 3TP8A 4JZ2A 5JQGA 1YTFD 4P9SA 2QGNA 1FNMA 4RD0A 4O0AA 5IYDG 3NBIA 4LBZA 4XDKA 5E1AC 1EP2B 4S3SA 2H4OA 4CJ1B 1KQSA 5B3SB 4GNXA 4LFBO 5DN6G 2WV6D 3DWPA 3IAYA 2L11A 3K79A 4X3TA 3L2PA 3S1MB 1WCMG 1YDXA 2NN6I 2JA8B 4CH5A 1QUQA 1H2MA 4DV2B 3ETEA 3BZDB 3M8AA 3DMUA 2AWOA 2QTOA 1XPOA 1PTOD 4YELA 1QOHA 4F7DA 2EXDA 3GTPH 1JORA 4UCVA 2A68C 2HQLA 1G8ZD 3PO3H 2ALYB 1DXMA 4OO1G 4K0KL 1K0SA 3OIPA 1R3LC 4R8CA 1WD0A 4GKKQ 3S17B 5HGTA 2OT2A 3QFTA 1BCPC 3IRBA 1THZA 4CJ2C 2P5OA 1MGSA 1J95A 1TVKB 2QE7G 3CMAV 3X2QB 4JI6Q 5AN9A 1CKMA 3EVQA 3CP8A 4B3RB 3JCUZ 3ASPA 3HKZB 4YJ2B 4Z4ZA 3I4LA 4N3GA 1MRZA 2QWOB 1HFGA 3MXPA 1Q43A 1EFWA 4X1YB 1J6QA 3PO3B 3F2UA 3VR6A 4A93B 4HN7A 4LMQD 1G7TA 2XAGA 4X3KA 1Y74A 1E0BA 2NVXH 3CE2A 3E0EA 1VQJA 1F60A 3EQLC 1R3IC 5KX5B 2WA3A 3UE0A 1IKMA 2WA4A 2AHOB 3G71B 3T1HQ 3JAML 1GR1A 1BMFG 3CRQA 1UAPA 4XYQA 5TR9A 1TUBA 5KNLA 4C3JB 4LBVA 3ZBHA 1SAPA 4FNFA 1JNYA 3K80C 3NUCA 2Z5UA 2NVTB 3C90A 2N78A 4IN3A 4TQFA 1X59A 1KMHA 2K14A 3BEHA 3JAME 2OK7A 1K73C 2EOTA 3T53B 3WU2Z 4TT3G 3GP7A 3JU4A 1JFFB 1VARA 4QHYA 2UXDB 1ILQA 4Q20A 2SEBD 4OOVA 5CA0A 3O65A 4XLFA 2H94A 1MIUA 2KENA 4I7ZC 3X3MA 4X65L 3RGBA 4OX9B 1G7RA 4LF5B 1WTWA 3D36C 3BRCA 3RY8A 2CKZB 3F7VC 3OWFA 4YHHO 1DJRD 1F77A 2ZM6L 3I4MG 2CDYA 2ZIMA 1RSOA 4WFGA 5IJ9B 5IY5B 4OO1I 2F0DA 1RSOB 3E8GA 3B09A 2O4XA 3RLNA 4QMGA 4B9WA 3RLOA 3U9OA 3PIO3 4A3MG 1S40A 4YEJA 1MZEA 1SYBA 4DRXA 3SPIA 3JATB 3KF8B 4BY7G 3TREA 2ZM6O 3ONUA 5BMVA 4X65B 4M2LA 1CKNB 1SMYC 1LTBD 4MVZA 3QFSA 1MMMA 2DYSB 5IOCA 4XN0A 5C0XI 4B3SB 1YJ9B 2IX0A 4A4IA 1ZLZA 1IXBA 1E2WA 1W59A 1Q12A 3AK1A 3Q6SA 4RHSA 4HMJA 5C8YB 4X64L 1IL2A 1I7PA 4RAUC 4BBSB 1ZSPA 1SC5B 1IBLQ 1FVIA 5JOBA 4QB4A 4MZ9A 3DEOA 1DK1A 3W7UA 1STAA 4HAEA 3J80E 4JYBA 2ZNJA 3C1EA 2Y69B 5KA6A 1NVPD 2ZTGA 3OZWA 2DNEA 2QCPX 1RM1C 2VL6A 3M7GA 1M8AA 4Z9CB 4ID6A 3A0BZ 3LO8A 3GTKH 1AR1B 3W5VA 4DV5L 4I0XA 1B7YB 3CQZB 3M7NA 1B50A 4MTFA 3CCSA 1QVGB 4NTXA 1F9SA 5EBWC 1S5LZ 1K9MW 5DM63 3RBZA 1KP2A 1WCMB 1XOUA 3EA6A 3CD6B 1C48A 5C4XG 1OGJA 4DR2O 1OCZB 2BTQB 2G9HD 3ZRVA 3A55A 5IP7G 2F0KA 1KTVA 2PZTA 2JA5B 3CCQA 1YITA 1PYBA 2JA6B 2XTAA 3LDCA 1XMQB 2QA4V 1N0UA 4CKBA 3KJPA 3VYTA 1HNZQ 2VUMG 2UUBB 2Q67A 4UB6Z 4CS3A 1GD7A 2YXYA 1TWCH 2K03A 3DM1A 3KOJA 3PGZA 4ZKCB 1JJGA 1Q86D 1VQEA 3OTOQ 5JEAH 1KK0A 3WWVA 1STYA 4LC0A 4I50A 2R9RB 1W34A 5E4XA 5C4JB 1SETA 2HT1A 2NZOA 2QEXB 1VQ9A 2XASA 5LHHA 4FLYA 1VQ6B 2RDGA 1VQ9B 2QEXA 3Q0AA 2OTLA 1ELOA 3WNCA 2B3GA 5CV5A 3PVDA 3JAKB 3ZMSA 3A1PA 1D5NA 4DFAA 1ZM2A 3D3IA 1N32L 3UM7A 2EPBA 1L1FA 4K0KO 4OX9O 5EGTA 4BY7B 1SYGA 4FIPC 4JPRA 3CW2C 3U9SA 5A2QE 4B44A 4AQYQ 1VQMA 1SQQH 3N2KB 4TV9B 3N52A 2LKVA 3SK6A 4UAIA 5IY0A 4M0LA 2HP8A 3EBEA 3HKZG 2UXXA 2ZBVA 2IH1C 3A3GA 5FNVA 2YTYA 4JGSA 1C9OA 5B66Z 2HHHL 5JJIA 4LF7Q 4BA2I 3AG3B 1D1IA 4MN3A 1EN4A 1W0JA 1BQ0A 3K0YA 2WSSA 4LWCA 2F23A 3ZMZA 4TMTA 3WFVA 1D2EA 3J7ZC 2NVYH 1ASZA 2KG7B 4G5GA 2D3NA 4FFKA 1U4RA 1JB3A 1NMGA 4JV5B 2QKIC 3OMCA 3QOLA 2WLMA 4DR4O 4HIOA 4LWSB 2YU9H 3DUZA 1Y1WH 2CF4A 2K5VA 4KK7A 2NTTA 4ZCKA 1VQFA 5M5XB 1G6UA 1Q9SA 1ESFA 4PG3A 2E2JH 1FR3A 1XMOO 2W6IG 3VDYA 5AJ3L 4P3IA 1K5QA 2RNBA 3L9DA 3CCSV 2YYZA 2VUMH 4BIOA 4X8IA 3GTLB 3BY1A 2YI9A 4EH1A 1LM0A 3GVLA 1BOSA 3VQVA 1ZKOA 3FMCA 2HMAA 3OD4A 4YCUA 1Q81D 4YIOA 4CQJA 5C5MA 4BIUA 4P6VF 3FKIG 3W5OA 2XUMA 3LSUA 1IJEA 2PTMA 2MNAA 2OYNA 4RCNA 4HIKA 4A3DB 4MNOA 4AQYO 5LA6A 1OCCC 1Q8KA 3G4SB 5LGNA 1AJNA 5E6TA 5CGKA 2Q2UA 3HOZG 3CCRB 3NTIA 3FJOA 1QGZA 1I4PA 3O13A 1V54B 4JASA 4DV7O 4DR1O 1B2RA 2ASBA 3RYFA 5H6QA 1HUNA 5M3FB 2GVBA 3OJXA 1CM9A 1J5EL 2EIJB 4J10A 1Y76B 4OIKA 1SFOH 1M93A 1P4RA 1SZXA 1CQXA 3SK8A 2Q0AA 4YCWA 1UE7A 3SE0A 3TS2A 2PNRC 4HEDA 1I3QB 3PF5A 1CZWA 1YNJD 4KY6A 4ODGA 2DOSA 4Z4WA 3OEEA 3G6EA 3QJYA 1RTOA 4GCZA 1MABA 1XL4A 4I9WA 4JI5L 1BS3A 1R4PB 4NCNA 3TBIB 2Q6AA 4B47A 2BDNA 5CA3A 4K1XA 1MJCA 1K83H 3C3SA 3SK5A 1ENFA 1NKDA 4X1KB 2JDIA 4TQDA 1WCMH 1XX8A 3RFRA 1S4ZA 4JVZA 4K8IA 5GQOA 3WOEA 1WD1A 2A3QA 4JI4Q 3S1QH 4JI0O 4LF8O 4HIDA 3ZMTA 1YEWA 4UAJA 5CMDA 4G7WA 2Q73A 1WOOA 4X0CA 1S76D 1N8RD 3V96A 2ZTEA 4WORA 1EY4A 2OBTA 3OPOA 3VYSA 3Q38A 4JCVE 1G91A 2WLLB 4X7FA 4TUYA 3JAWB 1HNWO 4BWAA 1SNOA 3EXAA 1NZ6A 3K04A 5JCOA 2WLHA 3KCYA 5B1AB 1QFYA 1XB2A 2JIZG 1VQCA 2RKSA 2HLDA 3G48A 4OPOA 1Z47A 5IYNA 2WIIB 4IFDJ 3SYPA 1O7ZA 2GTAA 3BDOA 3JAMc 4X64Q 2RMKB 4JOIA 1XMOQ 1ML0D 1SKYB 4IHJB 3AB9A 5JJNB 3CC2B 1YHQV 3U4ZA 2VBSA 2KJXA 4FP5D 4JI2B 3SR2C 1FJGB 2DN8A 2CFMA 4R4OA 4DV2L 1VQ8V 3EVKA 4JPBW 3J81i 1PH5A 4DV3L 5GONB 2EIXA 3S3WA 3JATA 1I3QH 1H8EA 2Z1CA 3TSSA 2GDSA 3QO2A 5M5YB 3BQJA 1TAEA 3HR0A 1WLEA 1VF5C 2IW3A 3S14B 1COWA 2ZE6A 1CZGA 4J15A 1KLGD 1MZFA 4II2A 2XN9C 4RGMA 1TKWB 3KFUA 5THXA 1NE3A 4TWKA 2WLNA 1SJED 2CC2A 4EGVA 3MWYW 2QDLA 1RIPA 3WBJA 3FKIB 4EX5A 4CDFC 3J81j 3S3XA 3ZHTA 1N05A 4Y9UA 2CH4W 3J80N 2CTQA 2E2IH 2GK6A 1Q6HA 2QDBA 1LT3D 4DR5Q 3D3QA 3ABKC 1QBZA 2G38A 1Q46A 2YTXA 2ZDIA 1VQ5V 4IZ8A 3I4OA 5FKAC 3EIVA 4P75A 5JJJB 4UP9A 4IPHA 3CW2A 4C3IH 3S16B 5LGUA 4HAMA 1E3ZA 2HIVA 3FP9A 1AB3A 5DM73 4RAIA 4B3MO 4CKEA 1VQMV 2A68D 2F0UA 5CV6A 2QTZA 2QKCA 4J9YB 2BGJA 1OO9B 5I4DA 3A5ZB 1JCHA 1GUGA 3CP2A 3IJ4A 1JCKB 3E8FA 1NTGA 2PCFB 5KNBA 1CA5A 1LT4D 2YDEA 2CGNA 3OMGA 1R1BA 5HKKA 3CCQV 1H9MA 2VNKA 4JI0B 1PZJD 1ASYA 4JI0Q 2IJ0A 1ZWIC 4XBFA 4JI3B 3FHWA 5I6YA 3PUYA 4O2DA 1QG0A 5FNVB 2Y0SG 3S1QB 3K7UC 3SDLA 2CNDA 4DV6O 4FJCC 4G2KA 4IL6Z 2JS5A 2Z8LA 4BBRG 3SR1A 1SYEA 1ZEQX 4PD4F 1F4NA 4PNYA 1YF2A 4DK3C 2B2VC 1BCPB 1C8CA 4B3SL 1U2RA 4II3A 3MFYA 1NVPB 3CC7V 4R8IA 1WORA 5JVDA 5J2TB 4GLAC 2D2CB 1T9HA 4DXWA 3VYRA 5IGBA 3F2BA 4X20B 2K32A 3ETGA 2PMDA 1G1XB 4PAAA 5GV8A 5IIFA 1RL2A 1GJXA 1PFBA 2ZZEA 1NH2D 2ZKOA 4LP8A 2Y0IA 4LR3A 4K5XA 3VR3A 2W6JA 4DR6B 4PA4A 3CB2A 1Q6UA 2WPDG 1TLLA 2E5LL 2DY7A 2Z9HA 4QJFB 4DR7B 1VQKB 4R6ZA 1URFA 3ASSA 3S2HB 2DQ3A 2WSSG 1U4PA 2CTWA 5KSWB 2F1MA 5FO8B 2JA7G 3KF8A 1PNLA 4DV1B 1UEBA 4B3MQ 3MXUA 2JEXA 3WQZA 3E3XA 4GN5A 1PH4A 2JJ2G 4X66Q 3ICEA 1Y69U 2KB1A 1JX9A 3N27A 4RD1A 4DV0O 1JFFA 1K3EA 1COWG 4JF3A 3THOA 1GMGA 1OXVA 3RN5A 4UVAA 3R66A 1L1OC 3MEHA 5CA0B 5AJ3Q 1H2NA 2XAHA 3M4OH 2LW1A 4LUVA 1RKNA 4DR4L 3WXMA 1KKCA 2PO4A 1QVFU 4ZQ3A 5LHY1 3DSQA 4ZOLB 4N3NA 2WLIB 1H9KA 1D5XC 4XT3B 2C4UA 2IY5B 4MTOA 4CC6A 2F0FA 2UUCO 3TS0A 3JD3A 3T1CA 3APQA 2IJIA 1KNEA 1N8RC 1MSGA 1S5CD 4LF7L 3K7AB 2VY3A 3QE2A 4JBWA 5K36G 1MA1A 3SDZA 5IY5C 1HR0O 1OCCB 3SPGA 2ZTNA 3H09A 2UXCL 1DLBA 3WB2A 3BCCH 2K33A 1O7IA 3CCQB 3CRCA 1UNSA 4OX9Q 3JALB 3OMIB 5H1SE 2ZXPA 3ZRSA 3CU7A 1I94Q 2Z6BD 4Y52H 2VB3X 4OEMB 5KMGA 2WLJA 1DF4A 4B4DA 5FLXc 3O9OA 1VF6A 2M9VA 4Y7NH 5EPKA 5D5QA 4WZKA 1KECA 4RD6A 2NUCA 3HOZB 1FYJA 4JI7Q 2C2AA 2BTOA 4ZCMA 1BHAA 2A69C 2F0TA 2KCCA 4F8MA 2B63B 4DR1B 1XMQL 3J7AU 2K6AA 3ASNB 1UE6A 1STHA 2VBTA 4IUQA 1BQQT 4B3SQ 1J5EB 3I4NG 4HCEA 4QIWF 1N4CA 3OKXA 3JYCA 1I0HA 1LTID 1W3SA 2H8PC 3BDLA 4HTHA 4XTCS 4RG1A 3RLFA 1XBLA 4K35A 4C3IB 2Y0SB 5KYLA 3K81C 2AUJD 1S0VA 5IYPA 3JAMN 1SKVA 1VLOA 1KC8C 4YIJA 4O2AB 4DR2L 1I4HA 2Y4UA 1FD9A 2RC6A 3W7SA 2BDOA 3HS0C 2WZNA 5KNCA 1G6PA 2PUSA 1K3RA 4WJWA 1XILA 1M1KW 1EOVA 1OCOC 5FO0A 3EJIA 4EFBA 1J9ZA 1IBMO 4JI8O 3FKSA 1D7QA 2ZM6B 2C5HA 2F0HA 4ZV4A 2F0MA 1R6TA 4DUZL 3CCJV 1F9QA 5JH7A 2F0IA 2I46A 3M4OB 2F0JA 1YZBA 4WFHA 1S5JA 3W2DA 2YWHA 1JJ2A 1R3KC 3Q39A 1I08A 4J0QA 1Q6IA 4LH6A 3GVJA 1GKFA 1KAAA 3CC2V 3NQIA 3PUWA 4OOSA 1SE8A 4G28B 4OO1H 5C4ZA 1NAPA 2R72A 1HCZA 3CC2A 2VNIA 3Q3AA 1XI1A 2LQTA 3TZUA 2JVDA 5C93A 4DW0A 4GKKB 2B39A 4B3TB 3JQRA 3CC4V 4JZGA 3FB8C 3LWEA 5IYCG 4HBNA 2P22C 1XUQA 2R9IA 4QFMA 2F0WA 4B9XA 4DAYA 4PA7A 5J35A 2YIAA 1YCIA 3ETQA 4JI7O 4R8NA 4EVOA 1PH3A 4JI0L 5T1GA 4ALPA 1F2LA 5CDFA 1M90D 4K6DA 2MO0A 4DNIA 1VQOA 1CEZA 1HR0Q 2A9HA 4TMXA 1NU1H 2VJIA 4DV5Q 3H1KH 3I91A 1HNWQ 3NP8A 3LQ6A 1R4QB 4RGOS 1WTQA 1QLEC 3CYOA 1YITV 4LF8L 2AHZA 2BV3A 1EWYA 1B3AA 4K2KA 1UEAB 2PNHA 2JJ2A 2Q2IA 1HA6A 3OGCC 4JI6B 1HW7A 5IYRA 2LFNA 1YI2A 3DTUB 4HNAB 3FDTA 3OYYA 1HNXL 4P2ZA 3GSIA 4GLXA 5HZBA 2MFIA 2PI5A 2L9HA 3P27A 3C46A 3DHQA 1RPRA 4X62O 1FJGL 2A79B 4P73A 1I5XA 4DV4O 1IBKB 2AW9A 3FD9A 2MK3A 4PDRA 2D3OW 2WJYA 1QNKA 1BHBA 5D3DA 2IM9A 1PP9H 2P90A 1W87A 2W6JG 2FX3A 3PN1A 4B3GA 2KCMA 3J80L 1GM8A 1SQVH 4I55B 1GOZA 3RD4A 4E0FA 3JC66 2F66C 1Z5WA 1G8MA 1Y74B 4B3RO 1I4GA 4QUFA 4H02A 3GTOB 1IL8A 4XOTA 5JJEB 1BPLA 2GVAA 3BG3A 4J8QA 2ZZQA 4X7DA 1KNAA 3NK9A 3D36A 1SNMA 3PSIA 1H8HG 1E22A 1DTOA 1K5SA 1II3A 3CX5F 1Y66A 2W0XA 3D4DA 1KQSU 4JI8Q 4CBVA 5C3XA 1AN8A 1NB0A 2K5HA 4PGOA 5KRUA 2ZJPA 4FM1A 2B29A 2BSKA 2QKSA 3ZBTA 5ITZA 1CI3M 4ZRZA 2V1DA 4PELA 4RO2A 1PRTF 5LXTA 4GN4B 1BBXC 2HKOA 2HHHB 3CCLB 1Q82D 4UDUC 2IX1A 4LF5Q 4JAAA 3FAVA 1F20A 1LV9A 2OF1A 2K52A 3CPXA 3FAVB 4NR1A 2UXBB 3CRAA 3HOYG 3SXHA 4GKKO 1DM0B 1TWHB 3MAQA 4G6IA 5J9PC 4C56C 3G6EV 3AG2C 5ELNA 3L71H 4IQZA 4DR1Q 4P22A 5B1BC 2X6YA 1QLEB 5G3LF 1Y1VH 2ZR3A 2PI4A 3P75A 1K8OA 5GONA 4JYAQ 1FRQA 1AI5A 3PQIA 4JI4B 2ATKC 2R70A 1FRNA 1UD2A 4JMQA 1SLJA 3OMNB 4IFDG 2P4KA 2HCCA 2M5SA 5C4XH 2JA7H 1E62A 2ITDC 4KHPO 1BLIA 2FMCA 1E64A 3MXNB 3GTKB 3E9HA 5L3GA 4UVBA 1XNRB 4JYAB 2LFSA 1TGOA 1GAWA 5IWAL 2Q7HA 5IYCH 2ZT9B 3A56A 4I4TA 1PH2A 1X9NA 1EEID 2F93B 4DV7B 5DEHA 4L5SA 3ZRXA 1OHHG 1W35A 4M4SA 4DV4B 1HJPA 2ICIA 4NXNL 1DDGA 4K14A 5EC1C 3CC7B 1BVSA 3ZZ0A 1Y76A 2QEXV 2QKAA 2X6GA 1VS0A 4P30A 4JI7L 1EM1A 1QX4A 1KDCA 1JWMD 4ACAA 2LSSA 3SEJA 1YJWB 4KHPQ 4FN5A 2KCTA 1AZQA 1FNUA 2DOGA 3AGPA 1HPCA 2L5TA 2V7UA 2R3ZA 4H7BA 5J22A 1YJ9A 1AR4A 1PA6A 2N3SA 1HFNA 3CCMV 5EAYA 3AU7A 3OP1A 2AQ3B 2EYOA 3LGJA 4X1KA 2UU9O 4IYIA 1GO3E 1X32A 4B7EA 2ZCEA 1VQOV 2D9RA 2GN5A 1K28D 2X0KA 5HGQA 3UO3A 2PW7A 4BA1I 3VA7A 2X53S 2AQ2B 5C5LA 4W4KA 2ARHA 1N34B 1LO5D 1IBMB 2WB1B 3CRKC 3WOFA 4BW5A 5HURA 1VF7A 3H1IH 1VQ6A 2FB5A 3GDEA 1SYCA 4C2MH 2FYUH 3D4WA 2XNDG 1VQ5B 2WP8J 4BWGB 1I18A 3F5TA 4AF6A 1WTRA 4JI1Q 2A6EC 2A7WA 4WFBV 1U96A 4K3AA 4CZZA 5B1BB 2QMUA 4CDDC 4DN4M 3CCUA 2VQEO 4IPGA 4O4LB 3CCUB 4IHJA 1BCPD 2SNMA 5EZYB 5C0XG 4DUYB 3HB3B 4P74A 3UCSC 3MVVA 2VUMB 3ZZTA 4IFDI 1IBKQ 1B8AA 4X1IB 5D14A 4PMWA 1GHJA 1YNXA 1MJEA 1BL8A 2YC0A 5JWPA 4KL1A 4YY3Q 3EHBB 2BOSA 2X0LA 5J3BA 3W2FA 1OB0A 5EIBC 3JARA 2EDGA 2MO1A 4Z4RA 3R8BA 1KU9A 1QHTA 1SMXA 1VQOB 4ZK9B 2IH3C 4O4JB 4JI3Q 2E2JB 5DM6V 5ISRA 1UD5A 1SE4A 1FXKC 1ZYRD 2YEVA 3CCMB 2EY5A 1ZAUA 3S9WA 3OTOL 2IWHA 4AI8A 2H1EA 2HHHO 3S16H 3AG4B 1F51A 1YHQB 2VS1A 4IUTA 5TY0A 1KK3A 4IUUA 1M4UA 2KKWA 1B44D 2XOKG 1L1OB 3AFQA 2XZPA 2DY8A 1N32Q 2AHYA 2VS0A 3GTQB 3RYHA 4I7ZB 1PKXA 3HKEB 1MOFA 5LMNO 1N32O 4JAUA 3RYHB 1UD3A 2LS01 3HOVG 3KLSX 3E5SA 1KZLA 3J7AV 4B3MB 1K4CC 1H85A 1QUFA 3P30A 1QUQB 1QVCA 4DV1Q 1WTPA 4UCTA 3GTQH 4ULLA 1NTMH 4JI8L 2WB1E 3ZZUA 5IT9L 3K5NA 1EIFA 4XT1B 1H9RA 4LF8B 4XQFA 5K1XA 1EWHA 1UPGA 5GAEC 1W0KA 4FFBA 1RF2D 3Q22A 3RN2A 4RJLA 1HNXQ 5FLXN 3D8CA 1T6ZA 2PPBC 3TETA 3MCAA 3H0GH 3FPPA 1XPUA 2X6CA 5EMNA 1X54A 4FZ0A 5EYPB 1E1RA 1KMIZ 2ZD9A 1DOMA 3ZYYX 3OEEG 4HCSA 2BA0A 2XEXA 1WTHD 1V9PA 1W0KG 4OP7A 1GUTA 5A9GA 1G7SA 2Q6IA 2VJJA 4TSFA 3HOXH 1EOTA 1F4MA 2RCFA 4OWWB 2PMZE 2L12A 4G1BA 3ULPA 1XNQO 3CMAA 2B2WC 4X20A 3P26A 3PJSK 2ZDIC 1FXKA 2W0FC 3GO5A 4WZLA 4KD3A 4DV4L 1BBWA 3OR7C 1FXKB 3L0OA 4EFEA 2QDXA 3OFNG 2GBOA 2VWJA 1A0IA 2NVYB 1RHPA 2XWBB 3SGIA 2E8GA 3MDSA 1I6VC 3A8KE 4KJOA 3BVGA 3CCLV 2HR3A 2CRVA 1YNND 4JI7B 4ZUIA 3H3VH 2F43G 3JALA 1BX0A 5DEDA 4ZBMA 2R92G 4DW1A 2PIAA 1K9MD 2AUKA 5IP7H 4QJFA 1VQKA 1GAXA 4LAAA 5F2VO 4DKAC 2B8GA 4R4CA 3DWQA 3CRZA 1EYDA 3K5MA 5DAUA 3BCFA 4LJZC 2L15A 3S24A 4CGYB 3H9NA 5L3EA 1EYCA 4RKLA 4JAVA 5ELBA 1FJGQ 1AP5A 3J81c 2G9DA 2ZE8A 3A3BA 5IGEA 4XXEA 1VQLA 3K0GA 1ZUQA 2QM4A 1OHHA 1EQRA 3OE7G 3E22A 4DR5B 1G2TA 2EE1A 1PFSA 1PRTB 4C2MB 5CYUA 2OT5A 1PNMA 2PE3A 1DDIA 1K8GA 4ZGNB 3QVNA 3D3RA 4HMIA 2C2WA 3CESA 5L3BA 2F0GA 4PI0A 1XJVA 1FNVA 4FXKC 2ZL6A 2PI2A 2RSNA 2HIXA 3VR4A 1WP7A 4E2LA 1WDTA 1E1QA 4R4TA 3NBHA 1OB2A 3OZUA 4L5QA 4XNFA 2B2YC 3PUZA 1F23A 5EBLC 1CKNA 4LF5O 3P32A 2BMWA 2QW7A 3HOXG 1ENCA 1UJWB 3CAMA 1A2TA 2XIWA 1CQFA 1SQXH 3OAAG 4U9UA 1KTKA 1EFRA 2FVGA 2RJZA 1S77D 5CV9A 4O4IB 1WPBA 1IBML 3LX0A 2JK5C 4RWSC 4JI3O 4P71A 1WJJA 5JEAJ 3T51B 4H44C 1JMKC 4BW9A 1YITB 1I6HH 1WPXA 2E3CA 1SS3A 5LHGA 4MVSA 3J7AF 1GHKA 1CQVA 4UCRA 3D6CA 1N33B 2BN4A 4KHPB 4ZYSA 1L8DA 1EP1B 2D62A 1BSMA 4X64B 4NXNO 2C4TA 3NWSA 1NH2B 4F87A 1BGYH 1XWEA 1VQ9V 1ZTEA 4H0LB 1VQIA 4OXPA 5JPNC 5KIXA 3A8JE 3CC4B 4GKJB 3QO5A 3FVQA 1HZAA 1OJHA 5LMNB 4FWTA 3CRMA 3CC4A 5TSSA 2XGJA 5IP9H 4UY8C 1E7ZA 4A3FG 3VO1A 3X2QC 4JG2A 3JSNA 1AILA 2JRIA 2PW5A 2K75A 3BU2A 4JI1L 5JPMC 4YY3L 4AYBG 4WFN3 1WTHA 2D2CC 4DU9A 4L5RC 4TMZA 4TT3A 2QA4B 2RF4A 1STGA 3WDNA 5J3OA 4P9OA 1PMRA 3CKIB 5CBAE 3P3NA 4XKWA 1VHOA 1CHPD 1KDBA 1W6JA 2F4IA 1Q8IA 4B3ML 3M3YH 1PVOA 5ELFA 5IYDH 3LSSA 5IYCO 1HTLD 3JD2A 5KHGA 5C44H 3TP7A 5JCOC 4ASUG 1Q1EA 3ZHQA 3A8TA 3KDFA 2EYFA 2E5LQ 4YAUA 3ER0A 3CSXA 3S1RB 4GKKL 4IT5A 1UMKA 1SDFA 2F0LA 1YNNC 3QG1A 3CPWB 3JAKA 4XR6A 1S5ED 4QIWE 1N34L 1NT2B 5JVDB 5J2TA 4LBYA 1R5BA 3HPLC 1VQBA 3R2IA 3CCUV 5M5XH 3UE1A 1NQTA 4RH6A 1W0JG 4A3GB 1SR3A 2P6JA 5LYJA 3HOXB 5LMUB 1HNZL 3GTOH 4UZFA 3BNWA 5LYJB 1AMOA 1L1OA 4DV0Q 1WOCA 2KEDA 2JA8H 3F7YC 1K4DC 4GX1A 2NYZD 2Q8IB 4C3JH 3A0HZ 1B04A 1XYIA 1VQHA 1Y8OB 3H3VC 3DC5A 2WLKA 4FPPA 1N32B 1QGYA 3BA8A 2C35B 4BR6A 2NWGA 3K0XA 3NELA 1S4MA 1B23P 4DK6C 5M3FG 1LUWA 3DEPA 3KLRA 1K33A 3OGIB 2J7ZA 2QTSA 4ZKIA 3FPUB 1RTNA 3R3OA 4MS2A 2LGQA 3Q4HB 3E20A 4Z4UA 3P7JA 2YEVB 4IALA 2O5IC 3HAGA 2N04A 1S3OA 1ROPA 3TRZA 4X05A 3MXGA 5KEEA 1JMCA 3AG1C 3RYIA 1H38A 3CQZH 1OCRC 1Y0RA 2UUBO 3GTGH 4GX0A 1WFQA 5IGDA 1YJWV 3HKZE 4FXDA 3PO2B 4XLAA 3TXQA 1EZJA 3A35A 5KA5A 3BYYB 2A0LA 2GV9A 1IYUA 1M5IA 1N36B 1UD4A 2IJHA 1LTGD 3VNVA 3D26A 2Q2HA 4KI0A 5COYA 4XM3A 1N36Q 2R7ZB 3ZS8C 1H2LA 2CQAA 2Q8TA 1TWAB 3MHSC 2V7XA 4CHTB 5LMZA 4ZI7B 3A8JA 1QG7A 2B2TA 2EY1A 2K5QA 2LMCB 2RHQB 3MHBA 4A3IG 1SNQA 3JD1A 1SA0A 3EFXD 3HOVB 2EIMB 3RVYA 4DAMA 4TN1A 3W7XA 4O1NA 3TXSA 3AG7A 1AVMA 1AROP 5C8YA 2YS8A 2E74B 2ZBUA 4JI5O 4OPSA 1QILA 3UO2A 1PTOH 2EIFA 4P26A 2NZ1D 3NSWA 3WG7B 2CCZA 1AE3A 2VB2X 4FLUA 1TUIA 4DUZQ 2X8KA 4A75A 1MABG 1AFPA 1IZ3A 4RMFA 1IHMA 2ZXWB 3ZMVA 1GM9A 1PD3A 1M56C 3OW2U
chains in the Genus database with same CATH topology
3I73A 1EY7A 1DZ1A 5EKLA 4A3FB 4TQUS 1XMOB 5C3EB 1IBLB 2EJFC 5CA1A 1JC7A 2IPKD 4KMUC 1IW7C 1V8QA 3R93A 2JJ1A 3C3LA 4U673 3IKJA 1TR5A 2KEEA 4H0LC 5CR3A 1PLFA 4FXGC 2O5JC 2JIZA 2GK7A 4FLZA 5EKKA 1TS2A 5ELEA 2ENBA 5C0XJ 4TRDA 3BC9A 1IW7D 1G2SA 3NXWA 3LNNA 2I07B 5I2XA 2M2LA 1XHZA 3CHBD 5FOBB 2DIEA 3R2TA 3EROA 4XQNA 3D31A 5E4WC 4C1NI 2A6HD 4OIJA 2NB0A 4G7HC 3TP5A 3JASB 2C5CA 2BTQA 2JP1A 2IT1A 4RGNA 4LFBB 3ND8A 2YXLA 1HA5A 3MTSA 3HKDB 2PZWA 4ASUA 2VXWA 3MA2B 4EB6A 1RODA 1SNCA 4J1MA 5DNFA 3K6OA 4RGTA 4AQYB 1MSHA 2X6XA 3NTHA 3WB1A 3HOWB 3IFDA 1SFOB 2JEAI 3T1YB 1CA6A 5E3FA 4XLEA 1EY6A 3I8ZA 4NP5A 4F7XA 3PUVA 5I6WA 3M7MX 3WB0A 5FLXL 3JARB 4X3UA 1Q3LA 1HNXB 4GZYC 3ZEDA 2A74C 2KA7A 5LOVA 3HOYB 4NXNB 2E74C 4LNUA 4Y7NB 2Q8RE 5JVG3 1LLRD 2YIBA 2PZSA 1A15A 5FL7A 4K5WA 3G6JB 2RQ6A 1Q5OA 5J2UB 1FX0A 3G05A 1EU3A 3SK4A 5BMVB 4IIJA 5C4XB 4DRXB 1DGSA 3GV6A 2V31A 4O4IA 1Y8NB 1RCVD 3VYUA 3BS1A 3ZIAA 3OW7A 1SEBD 1I6HB 1PZID 1A3VA 1CT1D 1JWSD 1VMCA 4XLCA 4ZOLA 2OYQA 1PYWD 1G6ZA 2NN6H 5D65A 1WTVA 1EIHA 2WINB 5IGGA 2JXMB 1A3TA 2PGGA 1HNZB 5LL6X 1E43A 3H94A 2UUAB 2KCNA 1VCIA 4ZAIA 3I4MB 3NE5B 1UUPA 4M1UB 2GA4B 1E2VA 5BN4A 1HVXA 4NNJA 5IGBA 3PIO3 3B2EE 1NCVA 1HR0B 2L1BA 5IGCA 4NMZA 2F0SA 2RSOA 4DA2A 2L4NA 5CV7A 4CH6A 4FYDA 5CC4A 2JEBI 1HQRD 4DXGA 4O4LA 2AQ1B 5EZYA 1LTRD 2XNAC 4HSVA 1HUMA 1Z5VA 3JSLA 2MUYA 2HDLA 3BH4A 3E0JA 1ONLA 3RYCB 2VQEB 3QTCA 1GUOA 4IFDH 4CS4A 3D4RA 5JH7B 1R9TB 4RKBA 5IT9E 3OHXC 5IODA 1SQFA 1B9MA 1GUWA 1FYCA 4HIZA 3DDYA 5EKIA 1MBYA 3HKDA 5JQGB 2VWKA 4DF7A 5K1PA 2MHVA 4EEQA 3HG9A 1BNZA 1S5DD 1TVXA 1B4OA 3HKCB 4YJ2A 1VJSA 2J0TD 1M4VA 2K5DA 4DV3B 3HKBA 4C3IG 4ZI7A 4KHVA 1I4RA 2PYJA 2F0NA 2R9VA 1TY2A 4V0BA 1TWFB 4DAPA 5KX5A 5KHKA 1H9SA 2NBFA 2UUCB 3QIAA 3GTPB 1GUSA 4B3FX 5EQ0A 4JI8B 1U4LA 2C9OA 4PHZA 2F0QA 3G7LA 3A7AB 1Y1WB 2ZIOA 1NSNS 1XQ8A 4V190 4DGZA 4HR7B 4Q6GA 2E76C 4NDXA 3TDQA 4OL7A 4F6RA 4K8XA 3BHPA 2GJPA 4D7TA 2K01A 2EYPA 1LABA 1NBMA 1ZYRC 3L7ZC 2F95B 4ZHQB 2B2YA 1V0FA 2R93B 1I4XA 4G57A 4QF4A 4DNTB 4BBRB 3BYTB 1QE6A 3GQBA 1SQGA 1CTMA 2PQEA 2XVSA 3BABA 4ZLTF 2ZZFA 4X62B 2B2TC 5CORA 2E2IB 3IL8A 5C0XH 2ZXRA 2A6ED 4LF9B 5F2DA 3JAWA 5D5PA 3SJAC 3C1FA 4XOPA 3GD7A 4DK0A 5C6AA 1ILPA 3LWUA 4U3JA 4LH7A 2CW0C 2FJ2A 1WNSA 1PTOB 1RJTA 2F3WA 4TKOB 5KYIA 2QEJC 2J4XA 1WP6A 2D5DA 3GTJB 2VNUD 1Y1VB 1TWGB 3M4YA 4R9WA 2D9UA 2F3VA 2RDHA 2KVOA 3OTFA 2F03A 2EYHA 1X3QA 2EJGC 1H2SB 5KHIA 2E1BA 3E6ZX 4O2BB 4ME5A 2B2UC 3ICXA 3A54A 2OWOA 3KUPA 3RUZA 1DCZA 2XNDA 5A2QL 4K6LA 4HSPA 3VQXA 5EPJA 2YU9B 4FLXA 3CMMA 5FLXE 1XHXA 1VLYA 2QILA 2LY7A 1YNJC 1BR9A 1TWCB 1XXGA 1D5MC 4KKTA 2F0OA 2R6GA 2GJRA 3HKCA 4XONA 3S1NB 1B53A 3HKBB 2EZVA 2V4DA 1P49A 4XORA 1MD2D 2BE5D 4ZIBA 1EYAA 5LOVB 2UU9B 4X66B 4U68A 4XDXA 2XHBA 4AILC 4IUNA 1OXTA 2JE6I 2HEPA 3QG5A 5IJ9A 3C2PA 3CHXA 1TIID 1SNDA 2B2VA 1PTOF 3KLSA 4MIUA 4KKSA 3T16A 3PIP3 4YXWA 2ZXOA 5LA6B 2QE7A 3I72A 1JE4A 1DOKA 1TUBB 4IUPA 4JI5B 5CB4A 2QJ1A 3T56B 1LTSD 2EXZA 4FF1A 1JOOA 2TSSA 1JQYD 1G291 4I9QA 1JWUD 2KECA 2NTSA 3QF7A 2PYKA 5LP6B 2XRQD 1F9RA 1X3PA 4XLHA 4KHZA 3V05A 2F43A 4BY1B 1KLUD 4F6RB 3H0GB 3HRZC 1E3XA 2EJMA 4K8JA 4XQQA 1NRKA 4PMCA 1BDOA 1WN7A 1TQOA 4FLTA 5G3LD 1BMFA 2R92B 3HEJA 1VMPA 5CV4A 1WPCA 4A3KB 2F0PA 3A2FA 1F2YA 1X4TA 4XL9A 1A2UA 3RMHA 3SEBA 4XD7A 1EU4A 2UXCB 1SSOA 3SJCC 2BE5C 4O2AA 3K5LA 2ZNIA 1AP0A 3J81L 1LTAD 1OXXK 1H9JA 1MI2A 3OWEB 4KY7A 3OOCA 1FFXB 3OE7A 1Z6HA 1FFXA 2NVXB 1BO0A 1V1PA 2E5LB 4L6TB 2V7QA 2L0CA 4ILWA 1TT2A 4N9TA 5A35A 1SMYD 3D6WA 4FM0A 2BCOA 4YY3B 3VQWA 4K8ZA 2GJKA 1SNPA 5IJ0B 1TKWB 2K04A 2VB2X 5LP6C 1O7YA 4TSSA 3NTKA 4O4HA 2KVMA 4TV8A 3PUXA 3PMFA 3OFNA 2M00A 4I55A 4X1YA 4C3HG 4F88A 4DR4B 1ICWA 1D1KA 3L9AX 5FPRA 4UZUA 1D6EC 2A6HC 4PI2A 1IYVA 4O2BA 4HNAA 1OXSC 3W3AA 3VQYA 4G7XA 3X3NA 2EX3A 5C4HA 1CHQD 5LXTB 4XMYA 1EEFD 2CHBD 3FRPB 3VR5A 2CW0D 2CK3A 1DYQA 4Q0FA 4DR2B 1BXTA 5BN5A 4CC5A 4A3MB 2OEOA 1E2ZA 4EQOA 5J2UA 2SOBA 3HKEA 5LL6S 4Q5VA 5EPLA 2EY2A 2RBMA 1V0EA 3BDCA 4C1NK 2LZJA 1WTOA 4FF3A 1EY8A 2MPMA 3V2TA 1T5EA 1VDZA 4L8JA 2HDMA 3IFTA 4QIWB 4FFBB 2Q7EA 4LNUB 3PV0A 1DD2A 5BR8B 1A3UA 4DAVA 4FVMA 3NQTA 3BVZA 1JJOA 4LF4B 1C8CA 3RZOB 2K7VA 2HQEA 2RQXA 3MC0B 5FK9C 1AZPA 1HNWB 1SE3A 1O9HA 4I65A 4KD4A 2KUMA 4KJNA 1PFMA 3OIQA 4ABNA 1D5ZC 2XZOA 1TU2B 2JSOA 1L0YB 3HGBA 5KHHA 2NN6G 2F0VA 1SYDA 4JI1B 3SVMA 2K05A 4KY5A 1HXYD 2HCIA 2ZT9C 5JAVA 5FO7B 1B2TA 4YJ3A 1V1OA 4YJ3B 3I70A 2XSCA 2MJ8A 2PYLA 4K2LA 3T13A 4ZKBB 5NUCA 1D5AA 3OTOB 3HP3A 1A6XA 1EZ6A 3M85A 1SYFA 4GYCB 1F2MA 4KN7C 1PXUA 1V43A 4LFCB 1EIGA 3OSOA 4PV1C 1FNWA 1DONA 1O78A 1NUCA 3I3CA 1SXTA 5IYZB 3FFQA 1ET9A 5IYZA 2WPDA 1NR4A 3T4AC 4FF2A 1EY0A 3H91A 4DV6B 1CFMA 4DK1A 5EBDA 5BN3A 4RA8A 3ITPA 1S5BD 2RVLA 3KK7A 3N6RA 4DNRB 1IKLA 2PMZB 3ND9A 5D3IB 3SHLA 1QNUA 4RFBA 3GV3A 5J39A 4UCUA 5EYPA 1NR2A 4K5VA 1H8HA 5DN6A 4KTAA 1Q3EA 1PRTC 1Z7TA 4UCOA 4G7ZC 1S5FD 1QWYA 1XTCD 5ELDA 4TOIA 3TMEA 4C3HB 3H6MA 1EQVA 3Q24A 1TS4A 3TP6A 2KOLA 2FHTA 3A7LA 3AMUA 2A5HA 3KBXA 4FXUA 3BVMA 3UQ8A 4XIGS 3HOUB 4FLWA 3NPPA 3QB3A 4XN3A 4QCLA 5JEAG 2QF7A 5ELCA 1PKVA 1QB5D 1EL0A 3I90A 2L55A 1I50B 4LF6B 2XOKA 1QQCA 2JGUA 2TMPA 1Q90A 2BA1A 2MGSA 4WBNA 2EVBA 4MHEA 5EJWA 5CV8A 4CH4A 1W9XA 2EYLA 3BAAA 1Q1BA 3E22B 4OGQC 5C3WA 3TN2A 4I4TB 4QUCA 3I4NB 1HTPA 4J6HA 3VA5A 4PMBA 5CB4B 2PZUA 1BCPF 2ID0A 1IHZA 4O42A 2OXPA 2WKDA 1SJHD 4Z1MA 1DOLA 1O9GA 2JA7B 1WTXA 4A3EB 3RYCA 1TVKA 1Y8PB 2E2HB 2XZLA 3D8GA 3KBGA 2IX3A 3U0ZA 4O4JA 2N55A 4TV8B 2FFKB 2EYMA 1EY5A 3QOJA 2KQ3A 1ESRA 4A3BB 4FLVA 1LACA 5EIBD 3FEWX 3BA9A 3RZDB 4X1IA 5FPOA 4FM2A 2SDFA 1FGBD 1D2BA 1JR0D 3JASA 1TA8A 1XNQB 2RA4A 2O2LD 3RWRD 1UD8A 3RYIB 4NXMB 5C44B 1SE2A 4RCOA 1I7FA 2X6WA 1C4QA 3BCDA 1TS5A 4JK1C 2ZINA 1QJOA 2XRSD 1F2ZA 3V96A 1L0XB 1CK1A 2B2WA 4EB6B 1T5XD 3K5OA 4H13C 5CGKA 3S17B 3ERQA 1F9PA 5K36H 1ET6A 3GTGB 3K59A 4XKVA 4EQNA </