1VF7A

Crystal structure of the membrane fusion protein, mexa of the multidrug transporter
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
237
structure length
237
Chain Sequence
b'TLNTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQLQEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug resistance protein mexA
publication title Crystal structure of the membrane fusion protein, MexA, of the multidrug transporter in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 67
structure length 237
sequence length 237
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1vf7A03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1vf7A01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vf7A02
4KKSA 4HR7B 3TZUA 4DNTB 2NN6H 1A6XA 5KNCA 5K36H 2CW0C 2LMCB 1Q1BA 4KHZA 4KKTA 1YNJC 3WB0A 3H94A 1ZYRC 2BE5C 1Y8NB 4LJZC 1BDOA 2JE6I 5JEAG 4PV1C 4GZYC 2D5DA 1H9SB 1Q90A 4G7HC 1DXMA 4GYCB 3WB2A 1GUGA 1OXTA 3D31A 3ND9A 4KMUC 1LABA 2A6HC 4DNRB 1H2SB 2DNEA 3OW7A 3IFTA 4DK0A 2IT1A 1IW7C 3PUWA 4XIGS 3T53B 1IYUA 1HPCA 1I6VC 4OO1H 4IFDG 3HGBA 3FMCA 5JJJB 3PUVA 1HCZA 3OOCA 2EJMA 3AB9A 1DD2A 3I4LA 2EVBA 4RCNA 3DXJC 1FR3A 2A6EC 1GJXA 1GHKA 4LK1C 2F1MA 2A69C 3A8KE 1LACA 2EDGA 1B9MA 3LWUA 4KN4C 4G7ZC 3BRCA 3KLRA 4I7ZC 5BN3A 4JK1C 2JEBI 4L8JA 1GUSA 3M7NA 1OXXK 2DNCA 2F93B 3P20A 5BN4A 3RLFA 1H9MA 3EQLC 3MXUA 1EWHA 1H9RA 3CRLC 5C0XG 1Y8OB 1H9JA 1OXVA 1ZKOA 5BN5A 2O5IC 2F95B 1T5EA 1FYCA 1Z6HA 1E2VA 3VA7A 3M85A 2EJGC 1TKWB 3GQBA 3A8JE 3QG1A 2BDOA 3QJYA 2L5TA 3WB1A 5JJEB 1CTMA 4H13C 1E2WA 3WDNA 2JEAI 3VR5A 2A68D 2PCFB 4XTCS 3VR6A 2AWOA 4G7OC 5JEAH 1OXUA 1DCZA 2K32A 2K33A 2Q8IB 4BA1I 4TKOB 2NN6I 1E2ZA 2NN6G 2YYZA 2QF7A 3I73A 4H44C 3CRKC 5K36G 1VF7A 1O7LA 1RSOA 3I72A 2EJFC 2O5JC 5D5QA 3PUXA 4JBWA 1GUTA 3BDOA 5KNBA 3U9SA 2BE5D 2V4DA 3T51B 3L7ZC 1G291 1QJOA 4KN7C 3LNNA 2AUJD 4IFDH 1VDZA 3W3AA 3T56B 1V43A 5D5PA 3OPOA 1HQMC 2DN8A 3A8IE 1CI3M 1CFMA 4KKUA 2ZT9C 1YNNC 3PV0A 3SE0A 3QIAA 1IW7D 4H0LC 2PNRC 4IQZA 3SDZA 1TU2B 2AUKA 3GD7A 4OO1G 1H9KA 1SMYC 1Y8PB 2KA7A 1IYVA 2PPBC 1H9SA 1Z7TA 2BA1A 3NE5B 1K8MA 1O78A 1Y69U 1K8OA 3MFYA 5A35A 4DK1A 3IKJA 3VR3A 2E76C 3BG3A 1Q1EA 1VF5C 2D2CC 2D62A 2K7VA 3PUZA 2A6ED 4TQUS 5C0XH 3VR4A 5KNDA 2A69D 1VCIA 1OXSC 5JJNB 1Q12A 1GUNA 3FPPA 2B8FA 2B8GA 3D4RA 2KCCA 1ONLA 3PUYA 4KI0A 4OGQC 1PMRA 1GHJA 1GUOA 2E75C 3A7LA 2BA0A 2E74C 3M4YA 3N6RA 3VR2A 4BA2I 1V8QA 2A68C 2A6HD 1B9NA 1HTPA 2JXMB 3A7AB 3ND8A 2R6GA
chains in the Genus database with same CATH superfamily
2JA6H 3TP8A 1SRUA 5DS0A 3J81k 1SKYB 1IXBA 3WBJA 1X56A 1SQPH 3E20A 4BS9A 2B63B 2B5UA 2VS1A 4LFBQ 1M93A 3GTQB 3UT5B 4A3CG 3N52A 4MW3A 3ZX6A 2Q67A 2IM9A 1BQZA 2DJFC 3R2TA 3DSQA 1PNKA 2CH4W 5JQGA 2F0DA 2XEXA 1JCHA 4H9GA 4YALA 2Q8VA 2Z9HA 5HGTA 1E64A 2ZBVA 1IJFA 5FLMH 3KUPA 3V76A 2AQ1B 1FNCA 1GAQA 1XYIA 3NBHB 4K5XA 1DLBA 2OK8A 3CCJB 3ITPA 4UCUA 4KHVA 4PDMA 1PFBA 2QWQB 4K0KL 4UHVA 4X1IA 1I5XA 3PUNA 3M4YA 1PYWD 4X7FA 1HNWO 2KCMA 4DUYO 5IE8A 4H33A 3N2GA 1J9OA 5J3OA 1KABA 1HNXO 2K05A 2BSKA 2CGNA 2X3UA 2D5DA 1M57C 5IYBG 2LGWA 2L55A 4X7DA 4LF5Q 3CD6A 4WJ4A 1PL4A 2F1MA 4XT3B 3DEOA 5I2XA 2KG7B 3CMAB 1EUJA 1MGSA 3JCZA 4C2MB 2JN9A 4P74A 5H5JA 5LXTB 1QR9A 1XREA 1NQTA 2O5IC 4RD0A 1QX4A 4BIOA 3QJYA 1I94L 2H8PC 5L3FA 3I4NB 1CKNB 1SJED 3M4PA 1MKHA 3R6KA 1MSGA 2K4KA 5CORA 1M4VA 2I1LA 5FIUA 2X85A 3HKCA 1QFYA 3I1FA 4JI7L 1PV0A 1QLNA 3W7UA 2UXBL 5KMGB 1BT8A 3ZMVA 5GQOA 1S5DD 2Z6BA 1HP8A 2O57A 4B3MO 4DNRB 3F2DA 4NXNB 4DR7Q 3CMEA 4MVQA 2ZM6O 4G4KA 3B6YA 1K73C 2YI8A 1CK1A 5IP7H 3AU7A 4FLTA 4M1KA 3E8BA 3SDLA 4I9WA 2Y0SG 5BSYA 4JI2L 1A8VA 1SDFA 3ZCCA 5EKKA 1JR9A 2F4VQ 3WB1A 3ZRXA 3A35A 2HQLA 4OPVA 4YCUA 2K1EA 4YJ3B 3S15B 5IYNA 1DONA 2IPKD 3BVZA 1IBLO 4QB4A 1RTOA 4CS3A 5L3CA 2KECA 2R7ZB 1RODA 4A3CH 4TMZA 3LGJA 2NTSA 4HIOA 3JCUZ 1N34L 2YTYA 3RN5A 3X2QB 1NI8A 3I90A 2QM4A 5HURA 4OX9O 2RCVA 5LOVB 3JASA 1YZ6A 5KHJA 2C5HA 5A9GA 4AQYB 1YCIA 1Y14B 1V55C 1E24A 2EBOA 2WKDA 3STBC 4XIGS 4GOPA 1HPCA 4RD2A 2ITDC 1QVFB 4O4HB 1P49A 4YJ2A 3E3XA 3HOVB 1KDCA 3M4QA 4O4JA 2L6LA 5LP6B 5IDJA 2ZTNA 4OOVA 4P75A 1EP2B 2HHHQ 1IL8A 1STYA 4X62O 2X6GA 2FTKA 3TP6A 3FKIB 5EJWA 5IYBH 4AF7A 3GTGB 4P3YA 2EINC 3RLOA 4C3JB 2SOBA 1I4PA 4APVA 3HKEB 1N32O 3ONYA 4EFBA 2ZZFA 4DV2O 4OO1G 5DM6V 3CRZA 2PPBC 2BCOA 3SPIA 5I6YA 2JXMB 4MN3A 1M56C 2Q9LA 4ZUJA 1DARA 4A3EB 3S1QH 3WB2A 4X64L 2A9HA 1LNQA 3H01A 3OM3B 2AHOB 3HKZB 1XX8A 4QCLA 2ZXWC 4RDLA 3Q8DA 1HA3A 2F66C 1SE4A 4GOPC 2PYKA 3CC2B 3B78A 1NBWA 2EIKB 1NUCA 5B6IA 2N05A 3HOZG 3ML0A 1KDBA 3HOWG 3P20A 5J2UB 2BOCC 2NNUA 4L5RC 4CC6A 1AI6A 1GH6A 3OR7C 3N27A 4NBSA 1R4PB 4X0CA 3KBGA 1C48A 3PUXA 3E22B 1HR0Q 1XHZA 2QM7A 2B7BA 2GPJA 4XM3A 4DUYQ 2XNAC 4K6LA 4ABNA 5B1OA 3T1YO 2YC0A 4JI1O 3MEHA 1N36O 5KEEA 5IYRA 4Y9RA 4JGSA 2D62A 4MVZA 4B7EA 3F5WC 3FAVA 3TBIB 4DV0L 3AG3C 3R6JA 1Q7YW 2XNDA 4RCOA 3R2IA 1NR7A 3KLSX 1VQHA 2BH8A 4Q6GA 2E8GA 5M5WB 3G4SV 3OEEA 5HFLA 3SR1A 1V1PB 3HKDA 2P7TC 3ZBTA 1KK3A 1W35A 3K6OA 2WKCA 3IRBA 1D6EC 1I4HA 1LTRD 4CJ0B 1YBYA 2XOKG 4FFKA 3T4ZA 1PH4A 1U2RA 4DR1Q 1RSOA 2ASBA 3MXNB 4A93B 4UPAA 4HE6A 4RUFA 1AI4A 3CP2A 4LW1A 3HOUB 4LWSA 3BYYB 2EYFA 4ZKIA 2UU9O 4A3KB 2GV9A 1NS1A 1COWA 5JJKA 1SYEA 4DAVA 5EK0A 1L0XB 4XOPA 4HSPA 3DHQA 2ZM6Q 3ND8A 1JICA 2ZT9B 3I56V 2L35A 1ROPA 4LFAL 4DR3L 4P12A 3S3WA 4PV1C 3QF7A 1LV9A 2RN9A 3D3QA 3CX5F 1WPBA 1SMXA 3RVZA 1M1KC 4DXWA 4PABA 4OO1H 2XZOA 3S1RH 3ASQA 3I4LA 3K08A 1EFTA 3WG7C 3I3CA 2GVAA 2ZTEA 3E1YE 5TISZ 1TUBB 2B2WA 3G6BA 1XNQO 3OEHG 4FLYA 3I5DA 1ZTEA 4I55A 3JQRA 4RHRA 3ZUGA 3VR5A 2A68D 3ISXA 1XE1A 4IUUA 2EZVA 2ZZQA 4XDJA 1N9WA 1BQ0A 4XQFA 4MVUA 1F9SA 3U4VA 1EQTA 4K0KB 3A8IE 3W7WA 4NXMO 1P7BA 4P9SA 1GM8A 4E2LA 1IYVA 4UUJC 1H9SA 2IJJA 3G48A 3HOZH 3OZUA 3VR3A 4O2DA 4AH6A 3HOWH 2H4OA 3D4DA 2DE0X 3A74A 2QSAA 1OCOC 2HG5C 2TSSA 2A7WA 5FLXN 4DUZO 4OPHA 2VB2X 5CV5A 4WWVA 1VIBA 4BY7G 3RYHB 1HZ9A 5JEAG 3PQIA 4PHZA 2G9HD 4IUPA 4DR4L 1KP2A 3RZDB 2CVRA 1VQ4V 1EBOA 3RYFB 4UB8Z 3CC7V 3OW2B 3NP8A 4X62Q 4NYKA 4JI0L 4F6RB 5HFMA 2IU0A 1D5ZC 3HZXA 1MABG 4ASUG 4RDKA 4XXEA 1I94B 2JEXA 2F93B 1SFOH 4X1IB 2B2WC 4JVZA 4X65Q 4OXSA 1N32Q 1KBHA 2MHVA 1EFUA 1TVCA 4FP5D 5IYCG 4X88A 1YIJB 1J95A 1OCCB 2JGDB 1FJGO 2AXTZ 1AB3A 2EJFC 2CH7A 2RDFA 2ATKC 2OCCC 5JVDA 5D5PA 1CKMA 2UXBB 4B3GA 2PNRC 1IBMO 4WZKA 2FMCA 3GTPH 1E7ZA 2PZWA 3A3GA 3P7JA 2AQ2B 5IJ9B 1E0BA 4B3SB 5IGEA 1M90C 4MW8A 2YWGA 2R92B 4Q0FA 1OV9A 1CQFA 5GV8A 2XIWA 3VYTA 1TWGH 2BE5C 1ZWIC 1OJHA 3HOYB 3QR8A 1K73W 3D31A 5GONB 5M3FG 1H2SB 4BAYA 1R9TB 4N9TA 4A3FB 3BJUA 4UB6Z 2H94A 3GWOA 2EXZA 1CP9A 5FLXL 4XYOA 2PMZB 3JSLA 3K58A 4AILC 3ZHRA 1HJPA 1W0KG 4JZGA 1QH0A 4O2BA 2EFGA 4Y7NB 4MVOA 2BDOA 4CH5A 4JI1Q 2B2TA 1N36Q 3CAMA 1BBUA 5HZBA 2RHQB 1SE2A 2WAQB 2DUDA 1G4YB 3W5UA 4MVSA 2RDGA 2SNMA 4YIJA 1AMOA 3AFPA 4JI4O 2D74A 2K03A 3L72H 5TR9A 1JR0D 4BY1G 4TQFA 4J1MA 3CESA 4QUCA 4RD4A 2DIEA 2Z5UA 4OONA 2DOSA 4X9QA 1GVHA 4FF4A 1EY5A 3J81N 1B04A 2AQ3B 3CCSV 4IOCA 3QTCA 5DSZA 1GHJA 2YTXA 3S2DH 1WAZA 1RL2A 2HIVA 3KG2A 3V2TA 3Q38A 1RCVD 4JPRA 5AFWA 1YNJC 1VQ8V 1KK2A 1FRQA 1NY4A 1F20A 5IOCA 5EBLC 2EPBA 2QTLA 4B3RB 1FL0A 3E0EA 1Q81C 3S1MH 5KW9A 3OIPA 4JI5L 1I4XA 3G71V 1VS0A 4Z9CB 2EZPA 2OCEA 3STZC 1IDSA 3SPCA 3JQPA 1VQ5A 5IGGA 2NUCA 3CCQA 1W3SA 3S24A 4BY7H 5JEAH 4A3IG 5LMNW 2UU9Q 1A15A 2B2TC 2KBNA 2UXCL 5E1AC 1E3XA 4XORA 4I7ZB 2X0LA 4ZGNB 5JH7B 1J6QA 1G8MA 1XB2A 2R3ZA 1SNDA 1CI3M 4GKJL 1X65A 2OEOA 3NE5B 5LGNA 2QWPB 1GN2A 4LF7O 1SAPA 3BVOA 1TWFB 5IWAL 5IYCH 3JAME 3AB9A 1EIYB 4X64B 3B77A 1S72A 1X59A 4UDUC 3MAQA 4PNYA 3J81L 1K73D 5FL7G 1QNMA 1JPXA 1ENAA 5GAHC 4IOAA 3QSYA 3KF6B 2OTLB 4ILWA 4WFAV 4XLFA 3LDDA 1W6KA 2RSNA 4KP4A 4ZIBA 1QG7A 1NTZH 4MTGA 2EZOA 2GBOA 1E62A 4OWWB 1A3TA 1KK1A 2Q5ZA 1BUVT 1Z6HA 4JCVE 1TKWB 1CTMA 2JK5C 4AC9A 2X0KA 2K5HA 5D3DA 2CCZA 5M3FH 3W7SA 2FX3A 2BGIA 3I2ZA 2C4TA 4BBRB 4X66Q 1GUWA 5B1BC 1QCEA 1GAXA 1P4MA 1E3ZA 4MVMA 4DYLA 3S14H 4R9WA 3T16A 5LGUA 1STNA 2XRSD 2HDLA 1BX0A 1G2SA 4DV0B 5J2TA 2MPMA 2WLJA 1CZGA 2F0FA 2QEXV 1L1OA 3VDYA 1YSCA 4JI8L 2XUMA 1QVCA 3KLWA 1D7QA 5M9OA 4PA3A 2CNDA 3GO5A 1HNZQ 5EIBC 3ZHVA 1LUWA 1VQLA 1AP5A 4AF6A 3ASRA 3DM3A 5BSXA 3OE7A 3B2EE 1Y1WB 4YXWG 1Q86D 5LMUB 4LNUB 2LQTA 1DZ1A 1R6TA 4BY1H 5CBEE 2EX3A 4E6IA 5C3XA 1FFTB 5FO1A 5J22A 4DV1Q 3OMGA 1RD9D 2LKVA 1H8HG 1N05A 2KOLA 4J11A 2NLJC 1FJGQ 4RD3A 5BMVA 5IT9N 2UUAB 3DGEA 4O0AA 4TQDA 3M7NA 1Y1VB 2XVSA 3UDIA 3EVQA 2ICIA 2JJ2G 4Z4WA 5BXZA 1T6YA 2F0JA 2JA8G 4X3UA 2A06H 1XMOQ 2NTTA 2R9RB 4PV1B 1R4QB 5EBMC 3L7ZC 4FF1A 1FXVA 2ZTGA 3ZPNA 2V31A 2D9UA 2R70A 2BTOA 2H5XA 1D1IA 1Q90D 2QWRB 3SDZA 5C8YB 1A62A 1A2UA 1WFQA 3GTLB 3ABTA 3J7YW 2HHHL 3U11A 1IYJB 1E1OA 2LS01 3T13A 4QGPA 1N08A 2Z0SA 1N33L 4DR3B 2MP1A 1L1OC 1D5XC 1QILA 4OPOA 2ATWA 5B5EZ 1TGOA 2NVTH 4A3IH 2K52A 1L0LH 2IW5A 1M1KW 4XOTA 1H2NA 3CP1A 1PJ6A 5J3BA 3AG4C 1K8AC 2CE4A 2KHSA 2YIAA 4RPDA 1LABA 5H59A 1ILQA 1VQKA 4F6EA 4UZUA 4IFDI 3K04A 5M5YB 2MJ8A 3AVVA 4ZCLA 2BE3A 2LFSA 1Z2GA 2ZTDA 3M7MX 2YV5A 3CRLC 4YCVA 2F0KA 1WA8A 4R8CA 3CD6V 2VQEL 4JC0A 1X32A 5IT9L 4FDBA 3SJZA 1CM9A 2XWJB 4PQXA 3TK1A 1EEID 3P30A 4KKUA 2M9VA 1QFZA 2PW5A 1YHQA 4CQJA 4ZV4A 2A74C 1XILA 5ELDA 5CV4A 4QVJA 5C4JB 3H0GG 3SYOA 3VO1A 4XKWA 2B8GA 1WOCA 1OHHG 1N0JA 1HR0L 4DV3O 3LQ6A 2VQFB 4DR4B 2QGGA 4GQNA 3PF4A 2UUCL 1VHEA 3P3NA 3TETA 4IIJA 3FPKA 2C4UA 4JI0B 1E79G 1UFIA 2RA4A 3DEPA 2GJRA 1UD5A 2XOKA 3VYUA 1KIXA 4GZRB 5B1AC 2BH2A 3DC6A 3NPPA 3CMEV 4B7KA 2EY2A 3CB4A 1IURA 4H13C 4F87A 5KLVH 1QR8A 2BOSA 5FNVA 2ZXRA 4H44C 3PIP3 1VF7A 2F0IA 3B09A 4JF3A 3U2QA 1WB8A 2YSUB 3U9SA 2A8VA 4N3NA 5ITZA 5BR8Q 4I0XA 4OHJA 2ZJRA 4H0LC 3L9AX 3SLNA 5LHIA 1M90W 3ZMSA 2YEVB 2HVJC 1XWEA 2Y0PA 1UE6A 3S16B 1WTVA 1JFFA 1SESA 1X4TA 1EIGA 1LTTD 4DR1L 2JJ1G 1IXMA 4FIPC 2JA8H 5EMNA 4D6TH 1AZQA 3CCEB 4KL1A 5A88A 3FEWX 1F9QA 1AN8A 1VF5B 4MHEA 2DY8A 4JAAA 4WRDA 2M2LA 3ER0A 2QTZA 3OHXC 2ADQB 1EU3A 1XMQO 1EP3B 4RWUA 4RJLA 1YJ9B 3OEHA 2PUSA 4PGOA 1EZ8A 4IYIA 3FD9A 3PO2G 1WP7A 4A3MG 1FS0G 2W6JG 5FO9B 4CBVA 4NR1A 3BDOA 3K7AB 3URYA 4FFBA 5LHGA 4DA2A 3NQIA 4NXNQ 5H2FZ 3JC66 4DV4L 4PC6A 2KA7A 2F3VA 3U4ZA 2DYSC 2GA4B 3P3PA 2B9ZA 3KLSA 3A56A 1V9PA 3K80C 4K14A 3G6EA 5KHHA 1Q81W 4DAMA 3OFNG 5E3FA 1B2TA 2YDEA 4WZLA 1B7YB 1W9XA 4JI5B 4A3LG 2IWHA 1MABA 5JPNC 2Q2UA 4ASUA 1WI5A 2N8NA 3HOXG 4X07A 2OCHA 2MUYA 3H0GH 3A8KE 3UKMA 5EKLA 4YIPA 1FXHA 2JEBI 1ASZA 4LFCL 1NH2B 3EN2A 4GN5A 2UXCB 2NWGA 4DV7L 4K0KO 1SBBB 4CJ1B 1XTCD 1QG0A 4JBMA 4GKJB 4AQYQ 2QA4B 3GTKB 3CXCA 3B82A 2K5NA 5FLXc 2B2VA 2EULA 2WPDG 3SK6A 5C0XJ 1VMCA 4ZHQB 4X65L 1ZXTA 5IWAB 1RP3B 3EVKA 3SEJA 2K04A 4ZI7B 3CCJV 3PENA 1OO9B 2PZTA 3A7AB 1J8IA 2D0PA 4KK7A 1K9MC 1U4PA 4OEMB 4LF9L 5J39A 1ZYRC 3CCQB 2HJDA 3OTOB 2YXHA 3A2FA 1SNMA 1W0KA 2GUZA 1I94O 2X6AA 4DKAC 3T1HL 3RBZA 3QG5A 2IHEA 1K92A 5IODA 3AG2C 2DWDC 1ICWA 2Z6KA 3ZEDA 5KSWB 2PLFA 4JI7O 2WZNA 3V05A 2HDMA 2UXBO 4NTYA 2P6JA 3PO3G 3ABKC 2L9HA 2F4NA 1ZAUA 3I72A 1WTHA 3ZBHA 4ZYSA 4RMFA 1FFXA 1SETA 1IBKL 2A0LA 1Q3EA 1XJVA 2RJZA 1I5FA 2PMDA 4M0LA 1XTDA 4G2KA 2XZPA 4R4QA 5CA0A 2B2VC 3L75H 2WJYA 3WXMA 4JI8B 4R4IA 4K35A 4K5WA 3W2FA 1WCMG 2J0TD 4LBEC 1G8ZD 4WZEA 4DQLA 2X53S 1CT1D 1XXGA 1SKVA 1AP0A 4K8ZA 3PO2H 1SZXA 1I4RA 4A3MH 1WJZA 2N78A 3LVBA 1K5QA 2X6YA 4JI2O 1VQOB 1F77A 3PF5A 2KENA 1IW7C 2WLLA 2EY6A 1JVMA 1BQQT 2I5MX 4CHTB 2CK3G 1N07A 3BY1A 5C4ZA 1YJWB 2YUAA 4LK1C 2ZITA 1GD7A 3R66A 3NWSA 2RHSB 2GHYA 3OZWA 1QVGU 1FD7D 3SXHA 2VRZA 5J2TB 3BDLA 2Z6KC 2GN5A 1BKBA 4I4TB 1AI5A 4QIWB 3CCRA 1N34O 2YWEA 1WNSA 4CDDC 4JBJA 4XTCS 3DXRA 3K0GA 3E5SA 4A3LH 5EBCA 1QE6A 2Q6AA 2AMCB 2E2IB 2B39A 5KYLA 2ZL7A 4ZAIA 1WD0A 1NH2D 3HOXH 2F0SA 4LC1A 1N33B 1Y8PB 3MFYA 3CW2A 4YHHL 2ZQMA 3A8IA 3CCMA 4OGQC 1QB5D 1DTOA 1NE3A 2C35B 5CBHA 5EQ0A 3QFTA 5JCOA 2Q8TA 5ISRA 3TJTA 2DEUA 4N23A 2UXXA 1T5XD 4G1BA 1CA6A 1YVWA 3KDFB 4FWTA 3TREA 1VQEA 1JQ0A 4YWLA 2IJIA 4PDLA 1KQSB 3VQWA 3OYYA 5M3MB 2VQEB 2PCFB 1H38A 2HFEC 4IL6Z 3HKSA 1UEBA 3MVVA 1DOKA 3KJOA 1GM5A 3ZBUA 2DN9A 1VQMA 2XGJA 3SJAC 4QJFB 1M9NA 2JA5G 2CC2A 2RCNA 5EKIA 2WLIB 2PGGA 4X64O 4EB6B 2EIXA 1I7PA 1FX0A 1QZHA 1MHWC 2EYHA 5LA6B 4LUZA 2UUCB 3UQ8A 3CW2C 4YXWA 3H3VC 2Q73A 3PO3H 4CKCA 1TVKA 3TZUA 4X66L 4JASA 1H42A 2DY1A 1JA0A 1KL9A 1H8HA 3AEVA 1I50H 5JCOC 2AKWB 4BWAA 2ZJQA 2NN4A 1W6JA 1G7RA 3ASNC 3K5MA 2C5CA 4PZ8A 2JJ2A 1HNZL 2QW7A 1Q6UA 1MSWD 3ICXA 5F4JA 4JTDB 2ZZGA 3N2KB 2EIJC 3PUMA 3CCLA 5JJEB 4JYYA 3RMHA 3ULPA 2AW9A 4DV1L 1W2BB 1YJNA 4X7EA 1Q9SA 1CSPA 4DV0O 2YWFA 3RZOB 1PRTB 1U97A 1MZFA 4MYUA 4NP5A 1PHJA 4DR1B 3K8AA 1K8MA 4J0QA 1O78A 4UXNA 3Q6SA 3PUZA 4A5UB 2V7TA 1I94Q 1XMOL 1U96A 1GK9A 4P2CB 3CPWB 4MYTA 1HA5A 2CW0C 4FLWA 2YXLA 3CPFA 3Q6QA 4IPDA 3A8TA 2VBTA 1DXMA 3EHBB 2A6HC 4A3JB 4DXGA 1BCCH 5KX5A 5IYCO 2GVBA 1NTGA 2UXBQ 3GDEA 4PMBA 3FB8C 1SERA 2B1GA 4G7WA 3KK7A 1VQPA 3K0YA 4TV9B 1JJCB 4O4LB 5ELNA 1OB5A 4QUFA 4B3SQ 2VW9A 1VHOA 1DM0B 4C3HB 3SPJA 1HZBA 3JAMN 2C78A 3ZMTA 4DV4B 3MEFA 1WJJA 2RDHA 3UDGA 3LWEA 3CC4A 1CHPD 4LFAO 4NVPA 4TSSA 4DR3O 1VQ5V 4F7XA 4U3FH 3BABA 1OHHA 2ZE6A 3CRMA 2NVYB 4TV8B 1IKMA 2BA1A 5FK9C 4QY7A 1LUVA 3CP8A 5H6QA 1VQFA 5CN0A 3D8GA 4P72A 3FFQA 4KY5A 3WOEA 1SNPA 1JB7A 4TMVA 4FF2A 4TUYB 1XPUA 3DDYA 2E1BA 1A2TA 3S1MB 1XDCA 4WBNB 1RJTA 2JA5H 4HBNA 2JJQA 3X3NA 4QPJA 4LFCB 3AVWA 1SMYD 4OXPA 4DV7B 1ZX3A 1G7TA 3CJHB 1EY6A 2PQAB 1FGUA 1R3IC 2RDCA 4Y7CA 4ZLTF 1MBYA 2VUMG 2PW7A 2LZJA 3HRZC 4A3BB 1P7GA 5CB4B 4B3RQ 1Y76A 3GTJB 2EY5A 3ZJYC 4A3GB 5C3EB 3PIPA 4DAYB 1VQ9A 1R1BA 4QE9A 2ZNIA 4MTXA 3FKSG 1K9MW 1VQBA 1EYDA 3C46A 3VYRA 4LF9B 1WVLA 3DWPA 4IYHA 4JI0O 1UE7A 3K0DA 1PRTD 1RPOA 1X3PA 4NB5A 4OOXA 1QGZA 5BR8L 1S3JA 1QBZA 4WFBV 4DR6O 3T1HB 3CP0A 2GREA 2WR8A 4KV6A 3TP5A 4B3TB 4CGYB 1UD6A 3CXCB 2Y69C 1VQLV 1EZ6A 5IY0A 1DD2A 3ABMB 1EIFA 1NDHA 4RCNA 4X1KA 4PELA 4II2A 3GTOH 1Y6XA 2W6JA 2YU9H 5DNFA 5LYJA 5FO8B 4DR2L 4PMCA 3ULJA 3W5VA 1IBKB 4GT1A 1E1RG 4X64Q 1DF4A 5EZYB 5CA1B 2CW5A 2UXDL 3D4WA 2VJJA 4HSVA 4UV9A 2ZXHA 2WSSG 2YXYA 3LNNA 4GNXB 1YIJV 4RUEA 2JVDA 2IX0A 4MIUA 3CC7A 1PJ5A 1Z47A 5EYPA 1BCPB 3CTAA 2F23A 4O1NA 1TS3A 1QLEC 4FXKC 2CDYA 4FZ1A 4JZ2A 3NUCA 3OFNA 1JJGA 2K6AA 4Z1VA 3QOJA 4KLKA 2QKSA 4KTAA 1BE3H 1K97A 3QNEA 3MXPA 3QO8A 1YF2A 2YIBD 2Z3YA 3F7YC 4TSFG 4NTWA 2B63G 2Q8RE 2NV4A 1EN5A 2DNEA 1P16A 3E89A 3FMCA 1GJRA 4GN4B 1UPGA 4RQEA 1HHVA 2BV3A 2ZR2A 1V54C 2QJ1A 4DW0A 4DV0Q 1A8PA 1RM1C 4QMGA 4ABMA 2J7KA 2P3MA 4LH6A 3BVMA 1WORA 1DDGA 2XWBB 2F43G 2WPDA 2Q8IB 1PH1A 1EY8A 5IJ0A 4RGMA 3TRZA 3ERQA 4O4IA 5LMUQ 3W7XA 1SNQA 2K1BA 4L87A 5LL6X 3HKZE 4YHHB 3ETDA 3H1LH 2WLMA 2WLLB 5GADC 4N21A 1X3GA 4J15A 2OIEA 2VY3A 4WZTA 2UUAQ 4GN3B 1VQ7A 4RHSA 1JMCA 2XNDG 4J10A 2WZPP 3L9DA 1V8QA 4JI5O 2LP7A 1YHQV 3M99B 2IX3A 2P5OA 2VUMH 4GX1A 2QMUA 3HPLC 2D2CB 1SA0A 1LTSD 2PI2E 1B6QA 2HKOA 5KAFZ 3P27A 2YICA 3MA2B 3J81j 3GV6A 2GTAA 5JJIA 1FD9A 2UXCO 1S5LZ 5IIFA 4JTCB 4J7ZA 2CRVA 4RCYA 3H6MA 5C4XB 1HZEA 3FX7A 4GKJO 2BSAA 4DR3Q 2KKWA 2FINB 4DF7A 3I55B 1LT5D 3ZIAG 4TKOB 3S2HB 3BH4A 1WPXA 3RUZA 3J80E 5IWAO 2HT1A 3ZHTA 4WFN3 3AGQA 2OT5A 4PD4F 1HRJA 3KF8A 2WB1E 2OYNA 5ELFA 1SKQA 4OO1I 5IYWA 5J9PC 1CQXA 2K7VA 3GTMB 1N0VC 1B06A 2KCCA 2PF4E 3JAKA 4B43A 4K6DA 4KKSA 1LT3D 5CV7A 2B2UA 3GVMA 2VYQA 2LXJA 4IZ8A 1OCRB 2CK3A 2ZTCA 1N8RC 4KY6A 1JB3A 5CBGA 2A69C 4CS2A 1QUQB 2MO1A 5B3SC 5C0XG 3CCUV 4DV1B 3ASSA 3M85A 2VQFQ 2DCUA 2B63H 1PH3A 5CMUA 4DR4Q 3PA2A 2K32A 2JA9A 4OX9L 4AVZA 4JI8O 1Y74A 2RNBA 1S5FD 4NMZA 3JAWB 1KTKA 4LF4Q 4JI0Q 3RD4A 4L6TB 2EJ7A 4Z1MG 1G6ZA 4UAIA 1Q8KA 2K28A 2N88A 3KL9A 1KDAA 1U5KA 2Y0SE 4UY8C 4LMQD 3CYOA 2VZAA 2B8FA 2R7FA 1JORA 2E75C 2JA8B 4AHCA 2C2WA 3TN2A 5KUMA 3I7FA 3WNBA 2LW1A 1SQFA 1H2LA 4XNFA 1TVXA 5I4DA 1JE4A 4IHJA 2B2UC 4A3DB 3A0RA 1OXTA 3HOVG 3F2BA 3G6EV 3QO7A 3MCAA 2Q69A 1VQNA 1J5EQ 4DK6C 1N0NA 2DWEC 2IJKA 1STAA 3IGAC 1G7SA 4R4CA 2BVNA 3UDFA 3A8KA 2HHHO 4C3JG 3VOUA 1STHA 2YYZA 4BW9A 5K36G 5IK2A 1N33O 4X1YB 2CFMA 4JBWA 1E3PA 3OMNB 1CQVA 1Q6IA 5KA6A 4PC7A 4C2MH 4UZFA 2OXPA 3MXGA 1NKDA 2NVXH 2BTQA 1E1TA 1XNRB 4IPCA 1GKFA 1KC8W 1SNOA 3ZRWB 4JI6L 2QDXA 1EYAA 1KAWA 2D0OA 3VR4A 2QGQA 3FVQA 4X20B 1YITB 4A3EG 1BXTA 1EN6A 3KYHC 1XQ8A 2VXWA 1GN6A 1AI7A 4R8NA 4I65A 5ELOA 3HKZG 1B23P 2I5HA 4ZQ3A 4P3IA 1K4CC 3IFDA 1W0JG 2VQEO 3JAMi 2EQSA 2B1IA 2QE7G 3G4SB 1K0SA 3DXJC 4KN4C 3U6BA 4ID6A 1HFGA 1E2VA 4CZZA 3RNUA 2AWOA 3NTHA 3MHBA 3TP7A 2ZL5A 3TS0A 5GW7A 1HR0O 3AK1A 5CYUA 1H2MA 2UUBB 1G291 3W5HA 3JD4A 4JI5Q 1WOPA 2UUCO 3JSNA 5IGFA 4B48A 4AYBB 3LQEA 2R93B 3S15H 1HZCA 2A6ED 5C0XH 1FXKA 1PKXA 5IP9G 5BR8B 4EGVA 1GMGA 2E74C 1LT6D 4HNAB 1MZEA 3ZRSA 2A6HD 1SYCA 2UXCQ 2V7QG 1FVIA 2QDBA 4P22A 4NKGB 3I56B 4GX5A 2WB1G 5IGCA 4PI0A 4GKJQ 1TS4A 1LM0A 4ZKCB 1YI2A 1K33A 4MNOA 4ZCIA 3H1HH 1XL4A 2I07B 3CQZB 1EIHA 4UCOA 4DR2B 3CCVA 3I4OA 1FNDA 1GJXA 3NELA 1IB0A 4ACBA 3J7ZC 5IWAQ 4Z4YA 3IJ4A 3BRCA 3VNUA 4G27B 2PNHA 1F4MA 1H9MA 1LTLA 4LF8B 2UXDB 3KJPA 4A93G 2FVGA 3T4DA 2EILB 4YELA 2PY5A 4DR1O 1G1XB 5KNBA 3R3OA 3HOVH 3OTOQ 2V4DA 1Y0RA 5KIXA 3L0OA 2QWOB 2PYJA 5AJ3L 2OTJA 1EOVA 3CCRV 2ES2A 1G6PA 4B3SL 4JYAQ 1KC8D 3I4MG 2ZXOA 4DU9A 3PIO3 1CNEA 3ASTA 4KHPL 1JMKC 3ZZ0A 2R61A 3MD0A 3A7LA 3LX0A 3GTGH 1FXKC 4C3JH 1EN4A 1TT2A 2V7VA 5K36H 1XNQL 3W2GA 3ZN0A 2L15A 3OMCA 1VQGA 3JARB 3OGIB 2E76B 4R8IA 1EY9A 3CCMV 4WF9V 1PTOC 1QQCA 3CCEV 2R6HA 4MT8A 2A1AA 3JAMc 1VQ4B 3FHWA 1U4MA 4JI8Q 3CC7B 4XDKA 4Z4VA 1O7ZA 4RD6A 2EYPA 5DN6G 3A55A 3FP9A 4A3EH 1NVPB 5A2QN 2N04A 3EQLC 1HNWB 1LO5D 2X6XA 5EC1C 2EJGC 1SQBH 4BBSG 3LSUA 1HNXB 4U9UA 3FB5C 1UE1A 4HN7A 1NRKA 1GUTA 3ZMZA 1JWSD 3CXHF 3FKSA 4X06A 3E8HA 4MTNA 3HOXB 3W2EA 1OB2A 1I3QB 3UO2A 4EQ5A 1JC7A 4DRXA 3AG1B 3JD0A 4IPHA 3OD4A 1B4OA 1NMGA 1ENFA 2OQKA 1VQMV 3ZRVA 1K0RA 1M8AA 3AYHB 4MZ9A 2MW2B 1K28A 4QHYA 2PZUA 3OE7G 3BCCH 4B3RL 3Q23A 2Q0OC 3KZIZ 1ZSPA 1V1QA 3OWFA 4EQOA 2CWPA 2ZZEA 4LFCO 5LMNL 4G7XA 4B44A 1S76D 5BZBA 4JYCA 4DV7O 1IVSA 1I6VC 3OUFA 2B5OA 4M4SA 4LF6Q 2X6BA 2GK7A 1YNND 2CWAA 2L4NA 1N33Q 1I6HH 3OP1A 1E1RA 5IP9H 4HZ3A 3G05A 4A75A 5L3BA 2X69A 3A0HZ 1Q82W 4LBWA 2V1DA 2WSSA 4JV5Q 4X65O 4CH3A 5M5WH 2EIMC 3CHBD 1ORQC 1R5BA 1JJ2A 1WP6A 1DF5A 3VO2A 3RYCB 4CH6A 5KHKA 4B3MB 4M8AA 3BC9A 5A2QL 3NEMA 1VQ6B 4I50B 5TV2A 3CCLV 4LF9O 1TU2B 4YCWA 3GD7A 1D5NA 1RDPD 1D5MC 4IUVA 1YJNV 5A35A 5EPJA 3ES9A 1S0VA 4N3GA 2C5BA 4TSFA 4V190 5M5XB 4O2AB 3UT5A 2VQEQ 4ZOLB 2B7CA 4A93H 1N8RW 2DGYA 3HOYG 3CCSB 2XZLA 4P26A 2K9PA 1SQVH 2F0UA 3GV3A 3HOUH 1NAPA 2XT9A 3ETGA 2KEEA 2KSDA 3UI2A 2V1CC 1VQ8B 3O9OA 2WWWA 2FXQA 1A0IA 1WCMB 3BVGA 2DETA 4R1JA 3OT7A 3I4MH 4J8QA 4JI4L 3EROA 3Q4HB 5IY5B 2B3GA 2WV6D 4B9WA 2F43A 1YTFB 4PA4A 4R50A 3RYIB 1OCZB 3LO8A 2UUCQ 3CCJA 4OX9B 3G71B 5FJ8G 2VBVA 2WAQG 1ZKOA 2NPFA 5J1ZA 4RQFA 1JJOA 1NB0A 1TAEA 4BW5A 4YY3L 3ASOC 4P9PA 1VQPV 4BA1I 2VNIA 2NN6G 5CA3A 2ZNJA 1NVPD 3IC9A 3E9IA 3T56B 2PYLA 2DERA 1KNAA 1FYJA 1B53A 2P06A 3CC4V 3VQXA 3WOFA 4IO9A 1YVCA 4BBSH 2VS0A 2R9IA 2YIDA 1O7IA 1FNWA 5LMUL 1D2DA 2CQOA 2KG7A 2ETNA 2ALYB 3CMAA 2DYRB 1FAFA 1SYGA 5T1GA 1HWYA 5LXTA 4TWKA 1DDIA 4MTOA 3ULLA 2RC6A 2UUAL 2J4XA 2L0CA 4DV2B 1MG1A 2F0LA 1X9NA 4G1VA 3SK4A 1CKNA 1SR3A 4E0FA 3ZIAA 2GTSA 2JQOA 5FO7B 4XDLA 3FPUB 1Q82D 4P9OA 3RGBA 4LF7L 2VBUA 3RZDH 4JAUA 5KMGA 4YHHO 4LNQA 2KUMA 3NXSA 5I6WA 3U6KA 2N3SA 2LFNA 3D6WA 4ME3A 3W3AA 4JI6B 1QU7A 4YIOA 1C4QA 2CKZB 5DM73 2IL8A 2ZCEA 5E1FA 1Q1EA 2EYOA 4J7KA 3H09A 5ELEA 2W0FC 4R7CA 1N8RD 1ZM4A 2QCPX 2XASA 2QEXB 4IJHA 3B8HA 2R6GA 1YZBA 1KAAA 2I5LX 1VQ9V 4DNTB 2MFIA 5LBQA 4J6HA 1LT4D 2RSOA 1EFRG 1BDOA 4P6YA 1TWAB 1F2YA 4DV4Q 2KHJA 2JA5B 1JA1A 1BHAA 3T1YB 3SPGA 1CA5A 4YJ3A 4NTXA 2Q6OA 3ZC3A 3E6ZX 2L1BA 1QGAA 3D8CA 1GO3E 1C7YA 2G5DA 2F0PA 5FKAC 1E1QA 4D7TA 1SE3A 5E79Z 1M57B 4E4EA 1GR1A 2AZ0A 3HOYH 3H1KH 2JYOA 3C90A 2JEAI 4A3FH 4Z1MA 3VR6A 2F0HA 2MGSA 2Z4IA 1C8CA 5FLXE 3I91A 4HTHA 1YTFD 4X66O 1V0FA 4H02A 5LOVA 2F0QA 1Q7YD 5C44B 5JQGB 4Y7NH 4ICGA 3OSOA 4LFCQ 3ONUA 2VQFL 5FJ8H 4GKKQ 4DV7Q 2QILA 3U10A 3AVYA 4IUTA 5CBAE 1QVFA 1R3JC 4O4HA 1D2EA 4UVCA 1HNZO 1Y1WG 1ZUQA 4LF4L 5JOBA 2NN6H 2IU3A 2ZJPA 5LP6A 3KEWA 2E2HB 4BIZA 3DWQA 3OUSA 3R93A 3HG9A 4DV1O 2E1RA 1X3FA 1Y1VG 5JBQA 3N2GB 4HJ9A 2BSKB 1PZID 1WTOA 3M3YB 4LF9Q 3OJXA 4C1NK 3BYTB 2HCIA 2L5TA 4FVMA 1XMOO 1X54A 3T1HQ 3X2QC 3CD6B 5F2DA 4B3TQ 2QKAA 4UCVA 1D1NA 4KHPB 2O2LD 1J5EL 2NZ1D 1YXBA 5TY0A 2XAFA 3A0JA 2JEUA 2AHOA 4PDVA 1XNQB 1GUOA 2PTMA 2BA0A 1Y0YA 3VYSA 1PZKD 3M8AA 3BA9A 1IBKQ 1W0JA 2LMCB 4LBVA 3HKCB 3H94A 5J2UA 2QE7A 3ONAB 1WSRA 1VQ7V 5LP6C 3OR6C 2H1EA 1GRJA 4R6ZA 4NXMB 4L5TA 5IYQA 1HCZA 4LC0A 2IY5B 2F03A 3E22A 2FMLA 2PI2A 4FM0A 3D0FA 3KLRA 4JK1C 1TUEB 1V55B 1HTLD 5F4MA 3B8MA 5JVH3 1DGSA 2PZSA 3TXQA 5THXA 2WP8J 4RKBA 3BCFA 3J81E 5CR3A 3RR5A 2WA3A 3CMEB 4ZBMA 1STGA 4IPGA 2JA7G 1C9OA 2V7XA 3UE1A 3C2PA 4Y9UA 1Z5VA 2KQ3A 3CB2A 5JPMC 4KJOA 2L11A 4WJWA 3PJSK 2Z4HA 2HD3A 3KOJA 2SEBD 1DOMA 2V7QA 1GXDC 2DW4A 4QL5A 3VNVA 3QO2A 1VCIA 3HAGA 1WSVA 2EINB 1D1KA 1BHBA 4CDCC 1R3LC 1QOHA 1V1PA 4BBRH 2A68C 4C3IB 5LMNB 1SE8A 3ZHSA 4X8AA 3VQVA 4EQPA 4C7UA 4AIMA 4QV2A 2WACA 2Y48A 2GDSA 3K3WA 2EIKC 4A4IA 1S40A 3K9AA 3SLDA 5FA6A 4DK0A 3M4OB 1M56B 4YHHQ 1AROP 1K83B 3MXNA 1TWHH 4EQNA 4YAFA 2E2JB 2KCTA 1AR4A 3JASB 1MOFA 1Y1WH 5L3GA 5DAUA 3CRQA 2ZXWB 3KCYA 4GOPB 2HVKC 4G7OC 2NZOA 3CWBH 2SNSA 3E9HA 1KNEA 1KYOF 4QF4A 5HGQA 4YJ2B 4FF3A 4KN7C 1CZWA 1Y1VH 4O4JB 3THOA 5BR8O 1VLOA 1U4LA 2YS8A 2VWJA 1EOTA 4POFA 2KVOA 1Z7TA 3P32A 1CXZB 4LH7A 1SJHD 1MD2D 3T4AC 1FNMA 5HY6A 4NNJA 1RQPA 3OTOL 1VP7A 3PIOA 4K8IA 3DWAA 1TUBA 1BF4A 4DR2O 3K5LA 2NVQH 3GTLH 4JI4B 5HZAA 4JYAL 3OW7A 2O4XA 5DN6A 3AG3B 1JJ2U 5EPLA 2F0WA 3GVKA 2UXDO 5IGBA 3NHHA 3S1NB 1F9RA 3P1HA 4YY3B 3MWYW 4DV5Q 1FYCA 1IXRA 2K14A 1QVGA 1P8LA 3M7GA 4U673 1VQNV 1JOOA 5M5YH 2CTPA 4IUNA 3CRKC 1AJPA 1H85A 5GTIZ 4S3SA 3AQQA 1T6XA 2Z6BD 1SSOA 2RCFA 4CDEC 2EY1A 4HJ5A 1V43A 5L46A 1PLFA 5EC2C 4NXNO 2ZT9C 4XLCA 1SXTA 3STBD 3D6CA 4F4LA 3RYHA 1MNGA 3FDTA 2OYQA 2P67A 3RVYA 1VQCA 3RYFA 1KZLA 4DFAA 2BGJA 1PKVA 3KBXA 3OW2A 4BA2I 5IT9E 2ADPA 4F6RA 4HR7B 4TN1A 2OT2A 1BX1A 1EFCA 4PA9A 2JA7H 2ZINA 3F2CA 1WN7A 5EAYA 3ZJZA 1I5YA 2CF4A 1QWYA 3WBKA 3NWTA 1VMPA 1HH2P 5H1SE 5C4JH 1ZM9A 1YIJA 2LSSA 1YX2A 1F9PA 1JNYA 2JGDA 3FAVB 3VQYA 2LXKA 4HIMA 4LF7B 4PJ0Z 1NZ6A 3E8GA 1PH8A 1PDQA 1SN8A 3U9OA 1JCKB 3CMMA 1I0HA 1QNKA 1BBWA 1PVOA 4GX2A 1HQRD 1XPOA 4GLXA 3JYCA 5JVG3 3Q0AA 3WG7B 1UEAB 5IJ9A 3HKDB 4LF6L 1NR2A 3ZYYX 4AQYO 2F0OA 4LBYA 4UP7A 2K01A 3RN4A 1UAPA 2JA6B 3OPOA 1MSHA 2NVXB 1R3KC 3QOLA 4JV5L 5GONA 1K28D 2PI4A 1JB9A 1RSOB 3PUYA 2ZE8A 1V0EA 3TS2A 2E5LL 2W6IG 1BJKA 1B8AA 2IJ0A 5LHY1 1CKOA 4LWSB 4LR3A 4DV6L 4DR5L 1OCOB 3S16H 1IYUA 4XQJA 1DG1G 1BZKA 2QEJC 1RHPA 3H3VH 1OCCC 2P22C 1XNRQ 2ARHA 4DPGA 1OXXK 4TOIA 1YI2V 3RLFA 1PNMA 2OK7A 3JD2A 3CCVV 3G7LA 2RC5A 1HDJA 1TWCH 3DTUB 4OIKA 1H8EG 2FB5A 4UAJA 3I55V 2CGOA 4ZKBB 3B4SA 1AVMA 2RBMA 3IFXA 4K2LA 5KNLA 5JAVA 4I55B 2QDOA 5J35A 4LF4B 4FN5A 3OZVA 1NR4A 2OCCB 2OTJV 1SQXH 3K7AH 5D65A 1B1ZA 4P1VA 2IHFA 2WFWA 2DQ3A 3SYQA 2Z1CA 1EFID 1O80A 5KGUA 3G6JB 3OMIB 4TT3G 3F7VC 5K5PA 1P84F 4U7NA 1H9SB 1Q90A 4BXXG 5CBFA 1KMHA 2UUBQ 3S9WA 3BZDB 3NTKA 3J7AF 3PUVA 3OOCA 1BR9A 2WYRA 1I7FA 2B2YA 1F2MA 3FYIB 2PI5A 5JH7A 1LACA 3SJCC 5FO0A 3NENA 2XNJA 4U3JA 3S17H 1KKDA 3VA7A 4PDRA 4Q5VA 1N06A 3QB3A 1MIUA 5B66Z 1R6NA 1L0NH 1QVFU 1Q86C 2WAMA 1J5EB 4OPSA 1O9HA 5CV6A 1TR5A 3QVNA 2KCNA 1BVSA 4UZEA 1M1KD 4DR2Q 1EZJA 4XKVA 3W7TA 2GJPA 3IKJA 1SS3A 3KF6A 2OTLA 4F8MA 2VBSA 1EFRA 2CUGA 3GTKH 2CH7B 4PA7A 2EYJA 3CCUA 1JQYD 4LF8Q 2UXDQ 3PMFA 5JVDB 1CEZA 4WFGA 1WOSA 3MHSC 1AIPA 1KTVA 2A79B 5BY1A 1S5HC 3HKBA 5M3MG 3NTIA 1K4DC 1R73A 1FR3A 2JS5A 3DUZA 2B2YC 4P30A 1AFPA 3KKYA 4I7ZC 3J7AU 2G9DA 3SEBA 2F0VA 5C6AA 4DV3B 1H9JA 3OKXA 4I9QA 1PFNA 3BY6A 4JI6O 4LWCA 1WLEA 3VA5A 5T1IA 4WFHA 2AZ2A 4HAMA 4EEQA 3K79A 4O2BB 2FKXA 2NBFA 2BPOA 3SPHA 1B2RA 1G6UA 1OTCA 1WPCA 1GKHA 4LNUA 1PH2A 4WCEV 1E63A 3J80i 1S5JA 1STBA 4HMIA 1GTOA 2J7ZA 3TDQA 1HFNA 1PMRA 3ABUA 1HNWQ 3E86A 4JYBA 1X3QA 3MC0B 4UCSA 3UE0A 1HNXQ 1Q1BA 1PZJD 1EQRA 4OPAA 1YITV 4R71A 4CS4A 2ZR3A 1AILA 2BOBC 3IFTA 1TS2A 4C1NI 4GKKL 4DGZA 1I6HB 1W87A 1BO0A 1B9MA 1GVPA 4XN3A 4XONA 1Y8OB 1PH5A 1BGYH 5C8YA 4K3AA 3QG1A 1M90D 2WB1B 1Q3LA 5H9CA 3MMPA 4OELB 1S5BD 4BXXH 4CH4A 3C1EA 4Z4TA 2BE5D 3WYAA 4XLEA 1L2FA 1NCVA 1JOKA 1XMQB 3SYAA 1NB9A 4JI3L 5LGTA 3SHLA 2JS3A 3S1QB 4OIJA 1VQ5B 4JW0A 1K34A 1PYSB 3CS5A 5B1BB 2TMPA 1PD3A 4PC2A 3QFRA 2E2IH 1KXLA 4NB3A 1F51A 4B3TL 3SVMA 4JYAB 3QWNA 3R65A 4A3JG 4HIZA 3KFUA 4KKTA 1V1OA 1TLLA 1GM9A 1PA6A 2PO4A 4B3MQ 1PM9A 1SF9A 1K8GA 2I46A 1VEWA 1EY4A 3I4MB 2N55A 3CPXA 1WDTA 3CMAV 4G5GA 2ZD9A 3UO3A 1HUNA 3L74H 1PXUA 1S72B 3EFFK 5F2VO 5JJZA 1B70B 4C3HG 1JX9A 3E0JA 4B3SO 5C3WA 4X05A 1E22A 4HCEA 4KHPO 2Y0SB 1EL0A 4HIKA 1IBLQ 1ZLZA 1RKNA 4OP7A 1VQJA 4M1UB 1K3RA 1YNJD 3F5TA 2EOTA 5M3MH 3PA1A 2YI9A 3SYPA 1Q81D 1SYDA 5C93A 2JDIG 1M4UA 2WINB 5LL6Y 2A5HA 4BBSB 1Y67A 3J80c 3L3OC 4UP8A 4YAWA 4OX9Q 3G67A 1KECA 3ZHQA 4J9ZB 3LDCA 1QVGB 1DJRD 1XEQA 5GAGC 4C56C 2P4KA 1UE5A 3F8TA 1L1OB 2DMXA 4G6IA 2BN4A 4W4LA 5CDFA 3A3BA 2RKSA 4JAVA 4B3XA 1VQLB 2JIZG 4ZRZA 1ZM3A 3AG4B 2WLKA 1H9RA 2HDNB 2F95B 3MZ5A 4LF6B 1K7DA 2YEVA 4A3BG 1MJCA 1I8DA 2K33A 4FK8A 1KP3A 2UXNA 3OW2U 3H91A 3JD1A 1KB9F 4R4TA 4A3GG 5C3EG 2QKCA 5BMVB 1VLYA 4YAUA 4DR6L 4B3RO 4JV5B 1K8AW 3RT3C 4NPSA 3CCEA 1PPJH 3SE0A 4DV2Q 5LMNO 4EX5A 2E5LB 1QHTA 4FXGC 2RMKB 3MDSA 4X3SA 1STEA 5CGKA 2KB1A 2QTOA 4JI7B 3QO5A 1YJ9A 3S1RB 1E43A 3RZOH 4RM0A 2HCJB 2D3LA 4DV6B 4DR5B 5IYDG 3BCDA 3TGUH 4PA6A 3KCXA 2MNAA 1LUZA 4J80A 3MTSA 1F2LA 4JI6Q 1RTNA 2Q7HA 1G2TA 2HEPA 5DLQE 3H15A 1SQGA 4XLAA 5A89A 2XAHA 1L1FA 4KUMA 1AZPA 4L5QA 4A3JH 1VQKB 3HOZB 5NUCA 5EIBD 1FNVA 3HOWB 4IFDJ 2ILMA 3K9SA 4JI2B 2ZL6A 3RW0A 4RCZA 5B1AB 3NBIA 3G80A 3X3MA 1MRZA 4IT5A 4UP9A 3T1YQ 1GO2A 1M5IA 1SROA 4H13B 4DV5L 3DMUA 4J7JA 3SYCA 1H9KA 2JRIA 1WA8B 1NNXA 4H44B 3CRCA 1VQ6V 4LFBL 1B50A 1VF5C 4C3HH 4LCUC 3HS0C 4GUNA 4Z4ZA 1N34B 3J7AV 1B9NA 4YWMA 3NK9A 1XHXA 4H0LB 3OMAB 2ENBA 4P73A 3GWKC 2VL6A 2G38A 1YHQB 2NVYH 1SFOB 1UWVA 3V96A 2ZIOA 4YY3O 3BEHA 4II3A 3CC2V 1S5CD 4RO2A 3K5NA 3FB7C 4PC3A 2QA4A 1L8DA 1Q6HA 2BF4A 3C3LA 5KHGA 4N8X1 5C0XI 4IIJB 1A3VA 1Q86W 1BBXC 2WA4A 1T5EA 1QUEA 4ZHQA 1II3A 3GTPB 1H95A 4RAUC 2L12A 1RPRA 4ZI7A 3GSIA 2XTIA 2CTWA 1VJSA 3BQJA 1QJOA 1K8AD 5LMUO 1VDZA 2DN8A 2WIIB 4IALA 1TWGB 2W6IA 2MK3A 1O7YA 2M5SA 1KHIA 1RF2D 3LDEA 3IL8A 5FNVB 2UUAO 4LF5L 4A3BH 3QFSA 4G57A 2F4IA 4CKEA 4OWTB 3GTJH 5JJLA 1VARA 4JTAB 5ITZB 2XAQA 1GAWA 4I0XB 4U3JB 2F0MA 5AJ3Q 4A3GH 5C3EH 2DYSB 1FNBA 1XBLA 4G7HC 3VMFA 4JPBW 1JFFB 1UD4A 4KHPQ 1SEBD 1YNXA 3BU2A 5G3LF 5C4XG 2F52A 3RLNA 4AYBE 1OB0A 4Z4SA 1XNQQ 3DC5A 1H8EA 1N0UA 3K81C 1WTXA 5IYDH 3CCUB 1AE3A 1SNCA 2OQ0A 4WORA 3S2DB 3TXSA 4JBKA 1XNRL 1NTKH 2AUJD 1A63A 1GN3A 4NXMQ 2KVMA 5JWPA 2A73B 1KRHA 4DR7L 2HUGA 1VQOA 3HKBB 4ZCKA 4B47A 2FMMA 2HMAA 4TT3A 1ONLA 3A8JA 3SR2C 2K5WA 2BDNA 1AR5A 2C2AA 1UD3A 5LL6S 4FFBB 3JATA 2ZKOA 1YJWA 4DUZQ 5ELCA 1XQBA 3BFRA 1PFMA 3RWRD 4GKKB 1IKLA 2F4VL 5L3DA 5E4WC 1LTBD 4I4TA 4NCNA 1Q46A 1D2BA 1IX9A 3E8FA 3AFQA 4BY7B 3HGBA 4RG1A 2PE3A 4ROXA 1TWHB 4K1XA 2K5QA 3HP3A 1SZTA 4XDXA 3G6EB 3FB6C 4G7ZC 5DM63 3JD3A 3O65A 2HLDG 1EWHA 4DXFA 1FPOA 1AH9A 5LMNQ 1CNFA 4U7OA 2VQFO 1QGYA 2UUBL 3U50C 4HAEA 4DR4O 3AG2B 4FXDA 2RQ6A 4JI3B 3JAML 1LLRD 2CQAA 4LF4O 5HXBA 3LSSA 1IBMQ 1OGIA 3ABKB 1LYLA 5HKKA 2GJKA 2HIXA 1U9RA 3D3RA 3BG3A 2Z0AA 1HUMA 5AN9A 5KNDA 2FL4A 4U68A 1D8LA 4Z4UA 4KD3A 4HJAA 1U0LA 5KUKA 1HTPA 3KDFA 4A3DG 1S5ED 1UD2A 1SLJA 4KHZA 3C3SA 4V0BA 3AMUA 1YHAA 1KQSA 2NVQB 5EBDA 2IH1C 1B44D 4LFAB 2P4VA 1BPLA 1BOSA 4DN4M 2NZHA 5M3FB 3PSIA 2Q6KA 4LF8L 2AHYA 1UD8A 4J9YB 3U0ZA 1EXMA 1J5EO 1WB7A 3S14B 4QJFA 2PQEA 3K7UC 4QUZA 2HQEA 2WLIA 1PTOH 1QCBD 4EB6A 2GUZB 2YTVA 2AHZA 1U4RA 1L0YB 1YEZA 5LA6A 4P2NA 1UUPA 4JI4Q 5C4XH 4JOIA 3UM7A 1IHZA 4YWKA 3QIAA 1PH9A 2OWOA 4AI8A 4BY1B 3S2HH 3FPPA 1XPRA 4YY3Q 2VZLA 2XN9C 1FFXB 1DYQA 1GO3F 2JA7B 3VBBA 2HP8A 5CA0B 1VF6A 2BMWA 3W1BA 1WU8A 2QWNB 1Y8NB 4QPKA 3N2KA 3OAAG 4OGQB 3GTMH 5FPRA 2DYIA 1NT2B 5C5LA 1W2BA 5I9OA 4XQNA 2EVBA 1HNWL 4X8IA 4DUYL 1NJIC 3H1JH 1HNXL 3CEIA 3AGPA 3E2EA 4Q20A 1OXVA 3L71H 4JG2A 1O9GA 1ET9A 3PN1A 1MSDA 4LUVA 5COYA 4DR6B 3C1FA 3A54A 1KRSA 2KHIA 3P75A 1K9MD 3PVDA 2WLNA 2OIGA 4CDFC 1ZYRD 5G3LD 4UCTA 4WFEA 2NVTB 4AYBG 3CPWA 4A3IB 2R93G 4JOIC 1SMYC 3CCRB 2IX1A 1EQVA 4LF7Q 4G28B 3DXRB 2Q7GA 4DK3C 1AR1B 1JE5A 2K5DA 2RF4A 3UDXA 5GTHZ 4IURA 4X6AH 5IE9A 4TV9A 1SYFA 4O4LA 1VMGA 5D14A 3ZN1A 1EYCA 1JWMD 3K57A 2Y4UA 5IYBO 1VF6C 4QFMA 3I4NG 4RWSC 3RY8A 5LMZA 2Q7EA 3CCMB 2QKIC 2GSMB 3TSSA 3ERSX 1K3EA 4DAPA 3W1GA 1F7YA 2YIBA 1PRTC 5EPKA 4A3DH 3I70A 2C9OA 3T1CA 3ASNB 1FDRA 4B3ML 4TV8A 1EEFD 3EBEA 5FOBB 3NXWA 1TWCB 3K59A 4FLUA 1R5OA 2ZM6L 2HCCA 2M6YA 2ZIMA 5D5QA 2F1LA 2O5JC 1CPYA 2JDIA 4DV5B 2XAGA 4UV8A 3OTOO 1ZUNB 3Q6RA 2OBSA 4LFBB 4XLHA 5FNZA 1YEWA 2EIJB 4P2ZA 4TUYA 1IW7D 2HR3A 1ZM2A 4IJLA 4FLVA 4JYAO 5GV7A 4WBNA 4KJNA 5JJNB 4H37A 1IBLL 2WJVA 3ZHUA 2QTSA 3EA6A 5A8AA 1AJNA 1PH6A 2XTAA 1VQMB 1XUQA 5KNCA 1KK0A 2H3OA 3W2DA 3CJHA 3HR0A 2OTLV 3EXAA 2PQAA 2JIZA 3A0BZ 2NB0A 2F3WA 3SK8A 1ENVA 1WTHD 1E1QG 3F1ZA 2R7ZG 3GTQH 3ZZUA 5CV9A 2QR4A 1LTAD 4N8FA 1TVKB 5CB4A 3SGIA 1H2KA 3S17B 3AK3A 1ML0D 1VQIA 1D8TA 4HCSA 1VQDA 3M9BA 4DAYA 2ODMA 5KAIZ 3AVUA 3ZMUA 1DCZA 4ZUIA 3GVJA 2NN6I 3CHXA 3ABLC 4C43A 3SJBC 2MO0A 4FM2A 1JA8A 1KD1C 4W4KA 1PV4A 1IL2A 3J81i 3I8ZA 4LF5B 3F2UA 4ME5A 1ZL8A 1MJEA 3CCLB 3B40A 4X62L 3ICEA 1T6ZA 1GUNA 1YJNB 4BWGB 3JALA 5B1NA 1B3QA 3CF5A 4QVAA 1ENCA 2Q6IA 4P71A 1N32L 2IW3A 4DV2L 3DM1A 3WU2Z 4PZ7A 2R93H 3FKIG 1KU9A 5EZYA 5CA1A 1Q43A 4B08A 1TXYA 4LF6O 1FKAO 2KEDA 4GNXA 2DY7A 2FFKB 5DEDA 3MXUA 1AP6A 4FMTA 4IGGA 1Z9FA 2EE1A 4JV5O 2AGAA 2LGQA 5KX5B 3BS1A 1WYDA 4HE5A 1DOLA 5I9PA 3CQZH 2E5LO 1LR1A 3I4NH 1VQPB 4QIWF 1KKCA 5IYZA 4DR7B 5KRUA 1YDXA 3ASPA 2M00A 2OBTA 1Q5OA 1XL6A 4DQKA 3A5UA 2DJVA 2I0QA 1LTID 1S4ZA 4YEJA 4DV6O 4DR5O 1JWUD 1YHBA 5LHHA 3D26A 2JN4A 3L2PA 1WTRA 1TUIA 4F88A 4NDXA 4DV3Q 1ELOA 3WWVA 2F4VB 3CC4B 2K50A 3Q39A 4GCZA 3H0GB 3ABMC 5L3EA 1TY2A 3T1YL 4M2LA 4JI1L 1CHQD 1GUGA 1N36L 4LP8A 2LW7A 3AG7A 4WJ3M 4XYQA 1FNUA 2VNUD 5C5MA 5GROA 5FPOA 5DECA 2B29A 5K1XA 3GP7A 3ZZTA 1F23A 4RDJA 3L73H 1GUSA 4Y52H 5C4HA 4PC1A 3BA8A 4GNXC 1R5NA 2VWKA 2ZXPA 2Y69B 3GQBA 3P26A 1BCPC 4MSWC 3TQYA 3A5ZB 3JATB 3BPZA 2PMZE 1BMFG 2CW0D 3QE2A 1EY0A 1Z5WA 3IAYA 4EH1A 4WQMA 2R7ZH 3SJQC 4YAOA 4IQZA 3J81c 4JMQA 1IHMA 1F4NA 1NSNS 2WAQE 3TMEA 2Q4PA 3LNMB 1OXSC 1FGBD 3APQA 3ETEA 2HHHB 1Y76B 1PFSA 1I3QH 4QQBX 4HIDA 3CKIB 1EP1B 1VQ9B 1QLEB 3JU4A 3RFRA 1JT8A 1K5SA 4B4DA 2Q2TA 2UU9L 3I55A 5FL7A 4WFFA 1XMQQ 4IFDG 4HYOA 2EJMA 4ULLA 3ETQA 3HOUG 3FRPB 5E4XA 2DNCA 4A3KG 1ZEQX 1MA1A 1EFWA 1PYBA 1AJQA 1V54B 1OXUA 4A76A 1NBMG 1QFJA 2A19A 2ZE7A 1RM1B 3PO2B 4X1KB 1ASYA 1S0UA 3FKIH 4A3MB 1A3UA 2Q68A 1HQMC 3STLC 3OWEB 1KQSU 5LYJB 4FZ0A 1KUQA 1IJEA 3BNWA 1MMMA 1C0AA 1Y69U 1EQQA 1PRTF 1BSMA 2D2CC 4HMJA 1R6KA 4TQUS 3BZCA 4BR6A 4FLXA 4L63B 4QNHB 2LJ2A 3K03A 1BLIA 1ICFB 1QUQA 5A2QE 2IJHA 2Q6LA 2D9RA 4NXML 5EYPB 4LJZC 1HR0B 4P6VF 3CU7A 3H9VA 1NJIW 4DV4O 1AE2A 1YJ9V 4DUYB 5M5XH 3PUWA 4K8JA 3T53B 2HLDA 4MTKA 3D36A 4H7BA 2P5ZX 1HXYD 3JAWA 2R7DA 2ID0A 4DUZL 1TIID 5BN4A 1HR0W 5F4OA 1HW7A 1EYGA 1BQEA 3R8BA 4K0KQ 1WCMH 5E6TA 2D3OW 2EJRA 4POGA 1SRYA 2VJIA 5C44G 1TA8A 4UVBA 5GAEC 2QDLA 2X7RB 2ZDIA 1LTGD 1N4CA 3Q3AA 3EFXD 5CC4A 3WNCA 3TEHB 1F60A 1OCRC 4ALPA 4FM1A 2JSOA 1FJGL 2NR5A 5IJ0B 4KFMA 4GKKO 3D4RA 1W2BU 4TRDA 1EZVH 3W5OA 1WTPA 4O4IB 4PAAA 5KHIA 3NQTA 1F2ZA 4I7AA 3WY9A 2VNJA 1IBML 3C3TA 1VQAA 1ESRA 4XMYA 3WQZA 4GYCB 4Z4RA 3WFVA 2R9VA 1VQ7B 5IT9c 1I08A 4X1YA 2AWNA 2A6EC 1MI2A 3D36C 2E2DC 2E5LQ 3CPWU 2M7WA 4JI3O 2IH3C 4GLVB 2GQFA 4MTFA 4JI7Q 4F7DA 1SA0B 2ZM6B 3TCUA 1W59A 1AW7A 1WTWA 4XBFA 1W34A 2CH4A 4GLAC 1E2WA 2QA4V 3ZRWA 2R92G 3MHHC 4DO2A 4DV6Q 4DR5Q 2QF7A 1TQOA 1Y4MA 4X20A 1YITA 3T1HO 3D3IA 1G7CA 3T51B 5B3SB 4B3TO 3PO3B 4IFDH 2ZDIC 1BNZA 2HJFC 1CFMA 4HJ8A 5IYDO 2XAJA 1IBLB 4A3FG 1I50B 3H3VI 1NR1A 1GN4A 5TSSA 4TVAB 3APOA 2F0GA 4A3KH 3S3XA 2P90A 4RA8A 2XHBA 5IYPA 4B9XA 1CUKA 4BPRA 3SKBA 2DOGA 3G4SA 4MVRA 3OAAA 3CCQV 4FNFA 5AG2A 2R9AA 1IBKO 5CV8A 3KF8B 1PJ7A 3ABLB 5KA5A 4RH6A 4JI2Q 4GZYC 2Z8LA 1NJID 3NBHA 2Q2HA 4ACAA 3ND9A 2D3NA 2VB3X 2E75B 1EY7A 4PMWA 4DW1A 2VNKA 1NU1H 1YLOA 1IZ6A 1E79A 4ZK9B 3JAKB 1KC8C 4FLZA 1PP9H 2ICEC 2LO1A 1JOQA 5CMDA 4Q7JB 3PGZA 5D3IB 4IUQA 5BN3A 4L5SA 1H2GA 2F0EA 1TWAH 1N34Q 1KD1W 4BIUA 5I2YA 4EFEA 3BHPA 1S72V 1E2ZA 3CRRA 3SK5A 1EWYA 1RIPA 4CKBA 4HNAA 3BY2A 4D7SA 3CE2A 1XOUA 2W0XA 4XT1B 2XSCA 4X62B 3I56A 4IW3B 1QNUA 4C3IG 4DK1A 2GK6A 4RKLA 1RQRA 3K5OA 1Y74B 5ELBA 4X65B 2BM1A 1N32B 1BCPF 3VR2A 1B3AA 4DNIA 1THZA 1FRNA 2X8KA 5C44H 2KJXA 2JJ1A 3HFZB 4CJ2C 1VQOV 1PNLA 3U58A 2CBXA 4LAAA 2XRQD 4HJ7A 3GVLA 4PG3A 3BDCA 1YJWV 3V7AA 1T9HA 4GX0A 3LWUA 4XN0A 4YHBA 1ZL8B 4IHJB 2JGUA 3SJPA 2E2HH 4FJCC 1S4MA 4XL9A 3JALB 3WDNA 4OWXB 3CXCU 3EIVA 1PH7A 1G91A 3W2HA 2F3IA 1VQNB 3NSWA 3MFGA 1YNNC 3M3YH 4LUOA 3JARA 4X3TA 3ZS8C 2Q2IA 1A32A 1L0WA 2CTQA 2A69D 1QZGA 4ODGA 4TMWA 2F0TA 4KI0A 4PZ6A 4ZCMA 1S3OA 2X6LA 3J7A5 1VQ4A 3OTFA 2EYMA 3Q24A 4CBCA 4JI1B 2R92H 4PI2A 1N36B 1A6XA 3DLLA 3CSXA 3O13A 1I4QA 1DK1A 3H1IH 1G51A 2XGTA 2Y4TA 3WB0A 4NKLA 1HVXA 4X3KA 2BTQB 3H9NA 1BL8A 5IGDA 1RFYA 3B8NA 3OIQA 5E7NA 2E74B 2IT1A 2C77A 1UJWB 1ET6A 1EWIA 1R9TH 4BBRG 2LFRA 5IYZB 3AVTA 1X3EA 4RGNA 4RPBA 4NXNL 2EILC 1PTOF 4NW2A 4K5VA 1GM7A 4OL7A 1PL0A 2FJ2A 2VNHA 1KJZA 2EXDA 3E83A 4DV5O 5H6RA 1XI1A 2A3QA 2MQHA 1KD1D 5DEHA 2BCCH 4LFBO 2PIAA 3OJWA 2N49A 3I73A 2K75A 3BAAA 1KRTA 2ZBUA 1VQKV 2CAZC 1TY0A 1J9ZA 3OGCC 4FXUA 5H5NA 4I5SA 1OGJA 2RQXA 1K8OA 2E76C 4TMTA 3AK2A 1Q12A 2QGNA 4UFZA 4RD1A 4RGTA 1EM1A 2KQXA 2FYUH 2QN6A 3NR7A 3GTOB 2UU9B 3K06A 2YU9B 4JI3Q 3HKEA 2JP1A 4P25A 1SC5B 4X7CA 1FXKB 3LUTB 4AQYL 4RLZA 1US6A 4C3IH 1WTQA 3RYCA 3PCOB 5EGTA 1VQ6A 4I50A 3BZKA 1EU4A 3WNDA 3AEIA 2X6CA 1PTOB 3OEEG 4FO2A 1P4RA 5JEAJ 4IN3A 3UCSC 4XR6A 4Z2WA 3HB3B 1BS3A 2CTRA 1YI2B 3AG1C 4GS3A 4KD4A 2JA6G 2RVLA 4LF5O 3M4OH 2YWHA 1K83H 4O2AA 2Y0IA 3CCVB 4ZOLA 2DJGC 2E2JH 4OOSA 1OZ0A 3CCSA 1I18A 4LFAQ 1CSQA 3CC2A 1K3BC 2DQ0A 2OBRA 2AUKA 1SM4A 2ZXIA 2V7UA 3AVXA 3Q22A 1VQ8A 1Q82C 1IZ3A 1QUFA 4CC5A 2XNCA 4XD7A 3Q4HA 2K5VA 3J80N 1TWFH 2CHBD 2OTJB 1WOOA 3MHPA 1D5AA 2LY7A 3RYIA 1COWG 3G71A 2Q0AA 5FLMG 4X66B 4C0SA 1JOYA 1X6OA 1GOZA 3RN2A 2R72A 1ESFA 2X6WA 5JJJB 4DUZB 1TTTA 1UNSA 3EJIA 4DV3L 1X55A 4XQQA 1GHKA 1BCPD 1XNRO 4RAIA 2OF1A 2V7WA 4KY7A 1BMFA 1HNZB 4DR7O 3HEJA 2NYZD 1I4GA 4ZGQB 2N74A 1O7LA 3TZDA 5K1PA 3S1NH 4X89A 3QFCA 1SYBA 1HA6A 2BM0A 1NTMH 2EIFA 2VUMB 3PV0A 4FPPA 1FJGB 2EIMB 4TMXA 2F4VO 3FYEB 1KLUD 4O42A 3A1PA 4UCRA 2WLHA 2EYLA 4EVOA 2E3CA 5L37A 4R4OA 1IBMB 4K2KA 4QE7A 4M53A 2FHTA 1XMOB 4DR6Q 5IY5C 1AEXA 5EBWC 4DRXB 3JQQA 2JE6I 3LSQA 1TS5A 4KMUC 1WD1A 1Q7YC 5KYIA 1OCZC 4EKWA 2ITCC 2UUBO 1V5VA 3W2IA 1Q8IA 4LBZA 1KLGD 4QGUA 2IBZH 3J80L 4RGOS 2F0NA 2SDFA 2QM8A 1EWCA 1UMKA 4J41A 2EDGA 4KXRA 4FK5C 1NBMA 4L8JA 1SQQH 1XFOA 1WP8A 3GB7C 5BN5A 3A8JE 4FYDA 4RFBA 3L70H 3T2MA 3GIRA 1KMIZ 1XMQL 1HZAA 2QEXA 2JK8A 4HEDA 2ZE5A 4N9PA 3IC7A 1PTOD 4QIWE 1S77D 3K0XA 1NMFA 3ASOB 2DYRC 3FJOA 1Y66A 3CRAA 4J42A 1JJ2B 5IP7G 4MS2A 4UVAA 5TRDA 3N6RA 1URFA 1ILPA 3E35A 4K8XA 4B3FX 4LF8O
chains in the Genus database with same CATH topology
4KK7A 3TP8A 1FNWA 5ELCA 1U4PA 5J39A 1SKYB 1ZYRC 1PFMA 1SYGA 3RWRD 4GKKB 1IKLA 5E4WC 5T1GA 3OTOB 5LXTA 4BS9A 1LTBD 4I4TA 1D2BA 3A2FA 1SNMA 1W0KA 2B63B 2J4XA 2L0CA 4BY7B 4DV2B 3HGBA 1M93A 2F0LA 3GTQB 3UT5B 3QG5A 1TWHB 3N52A 3SK4A 5IODA 2K5QA 3HP3A 2IM9A 4XDXA 3R2TA 3DSQA 4G7ZC 5DM63 4E0FA 1ICWA 3ZIAA 3ZEDA 5FO7B 3FPUB 5JQGA 2F0DA 3RGBA 1EWHA 4DXFA 3V05A 2HDMA 5HGTA 5KMGA 4HAEA 2L9HA 4FXDA 1ZAUA 2KUMA 2RQ6A 4JI3B 3I72A 3JAML 4ZYSA 1FFXA 5I6WA 3KUPA 2AQ1B 2LFNA 1Q3EA 3D6WA 1LLRD 2RJZA 2CQAA 3W3AA 1XYIA 4JI6B 4K5XA 2XZPA 5CA0A 1C4QA 2B2VC 2WJYA 4UCUA 4JI8B 3ITPA 4KHVA 5DM73 4K5WA 2IL8A 1PFBA 2ZCEA 2GJKA 5HKKA 2J0TD 1U9RA 5E1FA 3D3RA 1G8ZD 3BG3A 1Q1EA 4X1IA 2X53S 1HUMA 1CT1D 5KNDA 1XXGA 2EYOA 4U68A 3H09A 5ELEA 1SKVA 1AP0A 4K8ZA 3M4YA 4KD3A 1I4RA 1PYWD 2QCPX 1HTPA 2R6GA 3N2GA 1KAAA 1J9OA 1S5ED 4DNTB 1UD2A 1KABA 4KHZA 4J6HA 4V0BA 3AMUA 2K05A 1LT4D 2RSOA 2NVQB 2X6YA 1BDOA 5EBDA 2D5DA 1TWAB 1F2YA 1F77A 1B44D 2JA5B 4LFAB 1IW7C 2EY6A 3T1YB 1BPLA 1CA5A 4YJ3A 1BOSA 1BQQT 2L55A 4DN4M 4CHTB 3E6ZX 2L1BA 5M3FB 5C4ZA 2F0PA 4LK1C 2F1MA 5FKAC 4XT3B 1E1QA 3DEOA 4D7TA 5I2XA 1UD8A 1SE3A 3NWSA 3U0ZA 1MGSA 1FD7D 3SXHA 5J2TB 4C2MB 3BDLA 3S14B 2PQEA 5LXTB 2O5IC 2HQEA 1PTOH 1QCBD 4I4TB 4QIWB 3QJYA 2JYOA 4EB6A 2JEAI 1WNSA 4Z1MA 3VR6A 4XTCS 1U4RA 2F0HA 1L0YB 3E5SA 2MGSA 5LA6A 3I4NB 1SJED 5EBCA 1UUPA 2Z4IA 1MSGA 1QE6A 1C8CA 5FLXE 5CORA 3I91A 2E2IB 4HTHA 1M4VA 2B39A 5KYLA 4ZAIA 1V0FA 5LOVA 2F0QA 5C44B 1WD0A 2X85A 1IHZA 3HKCA 5JQGB 3QIAA 2F0SA 1N33B 1Y8PB 3OSOA 2OWOA 3MFYA 5KMGB 4BY1B 2QILA 3U10A 3FPPA 4IUTA 4OGQC 1QB5D 5CBAE 2XN9C 1FFXB 4O4HA 1DYQA 2JA7B 5JOBA 1S5DD 2NN6H 5EQ0A 5CA0B 5JCOA 1Y8NB 2Q8TA 5ISRA 5LP6A 3KEWA 2E2HB 3DWQA 3N2KA 4DNRB 3R93A 4NXNB 5FPRA 3HG9A 1NT2B 1T5XD 1CA6A 5C5LA 4G4KA 5I9OA 4XQNA 2EVBA 2YI8A 1CK1A 3N2GB 3AU7A 4FLTA 3VQWA 1PZID 5M3MB 2VQEB 1WTOA 3M3YB 1OXVA 1O9GA 4C1NK 1ET9A 1SDFA 3PN1A 5EKKA 3BYTB 2HCIA 2L5TA 3WB1A 3A35A 5COYA 2PCFB 4FVMA 4DR6B 3C1FA 3A54A 4YJ3B 3S15B 1DONA 3MVVA 3P75A 2IPKD 3BVZA 1DOKA 4QB4A 1ZYRD 1RTOA 5G3LD 4UCTA 5F2DA 4CS3A 2KECA 4UCVA 2R7ZB 2NVTB 1RODA 4A3IB 4KHPB 2O2LD 2XGJA 3SJAC 2NZ1D 2NTSA 5EKIA 1SMYC 2IX1A 1EQVA 2PGGA 4EB6B 1FX0A 3I90A 2QM4A 2EYHA 2Q7GA 5LA6B 1XNQB 2K5DA 2UUCB 3UQ8A 5HURA 1GUOA 2PTMA 2BA0A 4YXWA 3VYSA 3H3VC 1PZKD 3BA9A 4CKCA 1TVKA 3TZUA 5LOVB 4IURA 1W0JA 2LMCB 4TV9A 1SYFA 3HKCB 4O4LA 3JASA 1H8HA 3H94A 5KHJA 5D14A 1EYCA 1JWMD 4AQYB 5J2UA 2QE7A 3K57A 3ONAB 5JCOC 5LP6C 4BWAA 2H1EA 1W6JA 2WKDA 4RWSC 4XIGS 4NXMB 2Q7EA 1HPCA 2QKIC 1HCZA 3K5MA 2C5CA 4O4HB 2F03A 3TSSA 1P49A 2JJ2A 3E22A 4DAPA 4YJ2A 3HOVB 4FM0A 1KDCA 3ICXA 3KLRA 2YIBA 4JK1C 4O4JA 1HTLD 1PRTC 5LP6B 5EPKA 2ZTNA 5JVH3 1DGSA 2PZSA 2WP8J 4RKBA 3I70A 2C9OA 2ZZGA 3N2KB 3BCFA 3J81E 4TV8A 1IL8A 1EEFD 5JJEB 5CR3A 5FOBB 3NXWA 1STYA 3RMHA 1TWCB 1STGA 3K59A 2X6GA 4FLUA 2HCCA 2O5JC 2ZIMA 5D5QA 3TP6A 3FKIB 3C2PA 5EJWA 2JDIA 4DV5B 3GTGB 1Z5VA 3RZOB 1PRTB 4C3JB 2KQ3A 2SOBA 3CB2A 4LFBB 4XLHA 1I4PA 1YEWA 3HKEB 4NP5A 5JPMC 4TUYA 4KJOA 1IW7D 4EFBA 2ZZFA 2L11A 4WJWA 4OO1G 2Z4HA 4FLVA 2PPBC 4DR1B 2BCOA 1DOMA 2SEBD 1K8MA 1O78A 2V7QA 1GXDC 3Q6SA 3PUZA 4WBNA 3QO2A 4KJNA 5I6YA 1VCIA 3HAGA 5JJNB 2WJVA 1D1KA 3EA6A 1QOHA 1V1PA 2A68C 2JXMB 4C3IB 5LMNB 4MN3A 4P2CB 3VQVA 4EQPA 1HA5A 5KNCA 2CW0C 2WACA 4FLWA 4ZUJA 3W2DA 4A3EB 2YXLA 1DXMA 3WB2A 2A6HC 2JIZA 4A3JB 4DXGA 2NB0A 5KX5A 4DK0A 2F3WA 3HKZB 3SK8A 1XX8A 4QCLA 1WTHD 4PMBA 3M4OB 1K83B 1SE4A 2F66C 4G7WA 2PYKA 3KK7A 3MXNA 4EQNA 5CV9A 1LTAD 1TVKB 5CB4A 3K0YA 1NUCA 3SGIA 4TV9B 2E2JB 4O4LB 3JASB 1KDBA 3P20A 3S17B 5J2UB 1ML0D 5DAUA 4QUFA 4HCSA 4DAYA 4CC6A 4G7OC 1DCZA 1DM0B 4ZUIA 3GVJA 2NN6I 1R4PB 3CHXA 2SNSA 3KBGA 4C3HB 1KNEA 3SJBC 1C48A 3PUXA 3E22B 4DV4B 4QF4A 4FM2A 4YJ2B 4FF3A 1XHZA 2RDHA 3LWEA 4KN7C 1CHPD 1CZWA 4XM3A 4O4JB 3THOA 4NVPA 4TSSA 2XNAC 4F7XA 4K6LA 4ABNA 3BABA 1OHHA 1U4LA 3I8ZA 4LF5B 2VWJA 3F2UA 4ME5A 1EOTA 2NVYB 2KVOA 3MEHA 4TV8B 1Z7TA 1IKMA 2BA1A 5FK9C 5KEEA 2D62A 3CP8A 1GUNA 4LH7A 1SJHD 1MD2D 3JALA 4BWGB 3T4AC 3D8GA 3TBIB 3FFQA 4NNJA 4KY5A 3WOEA 2XNDA 4RCOA 1SNPA 4K8IA 1ENCA 3DWAA 3R2IA 4FF2A 1TUBA 4TUYB 1BF4A 2IW3A 3KLSX 3K5LA 3DM1A 3DDYA 4JI4B 4Q6GA 2E1BA 3OW7A 1A2TA 5M5WB 3S1MB 2O4XA 4WBNB 5DN6A 1RJTA 5EPLA 2F0WA 1KU9A 5EZYA 3GVKA 3OEEA 5CA1A 4HBNA 1Q43A 4B08A 3SR1A 5IGBA 3NHHA 1V1PB 3X3NA 3HKDA 4LFCB 3S1NB 1F9RA 2KEDA 1SMYD 3K6OA 3P1HA 2WKCA 4DV7B 1D6EC 2DY7A 2FFKB 4YY3B 1EY6A 3MWYW 1I4HA 1LTRD 4CJ0B 3MXUA 1FYCA 2EE1A 5KX5B 3BS1A 1DOLA 3M7GA 4U673 1JOOA 4ZLTF 1MBYA 5I9PA 4IUNA 2PW7A 3CRKC 1RSOA 2LZJA 3HRZC 4S3SA 4A3BB 4A93B 2Z6BD 5CB4B 1SSOA 2EY1A 3GTJB 5IYZA 4DR7B 5KRUA 2EY5A 1V43A 2M00A 1PLFA 3CP2A 2ZT9C 1Q5OA 4XLCA 1SXTA 3HOUB 4A3GB 5C3EB 3BYYB 3D6CA 2EYFA 3RYHA 1LTID 3FDTA 1S4ZA 4YEJA 2ZNIA 2OYQA 4A3KB 2GV9A 1EYDA 1JWUD 3C46A 1COWA 1WTRA 3RYFA 1KZLA 3VYRA 4DFAA 1SYEA 4DAVA 4LF9B 1PKVA 4F88A 3KBXA 1WVLA 1L0XB 4XOPA 3DWPA 4HSPA 4NDXA 3DHQA 4BA2I 5IT9E 1PRTD 3ND8A 1JICA 2F4VB 1X3PA 4F6RA 4HR7B 3H0GB 2OT2A 2ZINA 1WN7A 1TY2A 3T1HB 4KV6A 4PV1C 1QWYA 3QF7A 1CHQD 3TP5A 4B3TB 1GUGA 1LV9A 3NWTA 1VMPA 4CGYB 4XYQA 1FNUA 1WPBA 2VNUD 5C5MA 1UD6A 4OO1H 5FPOA 1F9PA 1EZ6A 2XZOA 1DD2A 5K1XA 3VQYA 3I4LA 3GP7A 4LF7B 4RCNA 4X1KA 3I3CA 4II2A 1PDQA 2W6JA 1TUBB 2B2WA 1GUSA 3U9OA 5C4HA 5DNFA 1JCKB 5LYJA 3CMMA 5FO8B 3BA8A 1QNKA 1HQRD 4PMCA 4FLYA 2VWKA 2ZXPA 4I55A 3GQBA 4GLXA 4RHRA 1IBKB 5JVG3 1BCPC 3VR5A 2A68D 3Q0AA 5EZYB 3JATB 1UEAB 3BPZA 5CA1B 5IJ9A 2CW0D 4IUUA 3D4WA 2EZVA 3HKDB 1EY0A 2VJJA 1NR2A 2ZZQA 4HSVA 3ZYYX 1Z5WA 2ZXHA 3IAYA 2F0OA 2K01A 4XQFA 1F9SA 3LNNA 1UAPA 2JA6B 1EQTA 3OPOA 4K0KB 1MSHA 3A8IE 2JVDA 2NVXB 2IX0A 4MIUA 4IQZA 1Z47A 5EYPA 1BCPB 4O1NA 1IYVA 4JMQA 1H9SA 3QOLA 5GONA 1NSNS 1TS3A 3VR3A 3TMEA 1K28D 4FXKC 2H4OA 3NUCA 3D4DA 1OXSC 1FGBD 3OFNA 2K6AA 3QOJA 3PUYA 4KTAA 1V0EA 2TSSA 3MXPA 2HHHB 2YIBD