1RQPA

Crystal structure and mechanism of a bacterial fluorinating enzyme
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 5'-fluoro-5'-deoxyadenosine synthase
publication title Crystal structure and mechanism of a bacterial fluorinating enzyme
pubmed doi rcsb
total genus 77
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2003-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 1rqpA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 1rqpA01
2Q6LA 2Q6KA 2C2WA 1WU8A 2Q6IA 2CC2A 2V7UA 2CW5A 5B6IA 5LMZA 2C4UA 2CBXA 2V7TA 2Q6OA 1RQRA 2V7WA 2WR8A 2C5BA 2F4NA 2ZBUA 2ZBVA 2V7XA 4CQJA 2C4TA 2V7VA 1RQPA 5FIUA 2C5HA
chains in the Genus database with same CATH superfamily
2ALJA 2VJNA 3FHLA 1PV2A 1KH1A 4NBSA 1Q7EA 1WMBA 1QXSA 3OOHA 3E48A 1ZMBA 2QGFA 3PXBA 2VJYA 4JUAA 4C7XA 2OD2A 3MT0A 4MR8A 4PIVA 4ON9A 1XPUA 3QLEA 1VE7A 3NT2A 1OPRA 1G8GA 4LHXA 3UMRA 2HK9A 5PGMA 3VX3A 2G80A 5FORA 1FFAA 1TZ2A 1E89A 4R31A 3WYNA 4MGEA 1E1KA 4FBGA 1HTBA 4AY5A 1XF1A 2HB6A 5KQRA 4G8DA 1UKCA 2HQRA 4REMA 1OH8A 3OBBA 4UBLA 3ITKA 4HDRB 1PR5A 1YVRA 3LZ6A 5K6TA 1J9EA 4RA6B 3ILSA 3JQFC 5KDDA 3F2IA 2ZRIA 3G9XA 4YPOA 2OTJB 4NWIA 2QRJA 4QUEA 4G0XA 1POXA 2OCAA 4ZJYA 3P9QA 1YI2B 1Z5OA 3CT6A 4EGSA 3GMDA 3RABA 1F4VA 2AX4A 3MS7A 4OHKA 1A77A 3EVBA 2WLTA 4TKMA 4X1IB 5FADA 4D3DA 1MIOB 3R6DA 3ONDA 5E2AA 5B1IA 1I36A 1R3DA 4OJNA 4A36A 1FTQA 1O8BA 3CPXA 2ZTUA 2GOYA 1SOMA 2FMFA 2OY0A 4I3FA 4WIAA 2NUPA 4R8MA 3W7VA 1TQHA 1QFXA 1UJBA 3Q85A 5F3DA 3LGAA 3JQGB 2DMRA 1GFIA 1FW6A 3KE9A 5IFKA 4MULA 2X0JA 4JVSB 3IMGA 2R6CA 3IUQA 3PXAA 4N5MA 1SJ9A 1E9EA 1CS4C 1JEJA 4A73A 1IVSA 3EGVA 4ZK6A 4HZUA 3GARA 2CVPA 5U1PA 1ZOIA 1M66A 3VYSB 1DAKA 2ZIVB 3G1WA 4C88A 4P0QB 1AZSC 4MI1A 4KYIB 1EVIA 3B9RA 3TXXA 4BLVA 1AKRA 1BWPA 4R5MA 4GC5A 3AEZA 1GT6A 3LCVB 4CEIB 1EJ6A 2YXPX 3IV6A 1ENZA 3BDIA 3ITEA 4D7AA 4WERA 3EWIA 3G1UA 2FGKA 3L46A 2BFCA 4RY8A 5GJCA 3PYMA 4CCAA 4CNQA 5ICGA 2IU0A 5CLFA 1B16A 1YMUA 2BRUC 2YV3A 4INJA 5BN4B 4RV5A 5U4XA 3EMDA 4GYYA 4YLGA 2GZ3A 2H52A 2IHJA 5IJ9B 4OQQA 3OTWA 1U2EA 1SKAA 2JIBA 4P83A 4UNRA 1U1FA 3JQBA 1DCFA 2IXFA 3LYAA 4L8LA 4EUNA 4OP1A 2Q3MA 1GQQA 4CV1A 3W4KA 3ORQA 5DCYA 4K6GA 5J5AA 4EHNA 2AFHA 4PX9A 1TL7C 2HAEA 3JZMA 1G1MA 1NN5A 3HJCA 1WZ2A 3NYRA 2JAOA 2A5LA 2BY4A 3FF4A 1FJ2A 3MGGA 3FTQA 4C21A 2OAP1 3NBFA 2B82A 3LWNA 2BH9A 3A8TA 1TK2A 3CTMA 4J94A 3RWOA 2Y1WA 1VIMA 3KKQA 1IN7A 4R8LA 3QE4A 3UWOA 4OHFA 5D5QA 1AZWA 1L7OA 2RE8A 6Q21A 2WJJA 3CUYA 4QKQA 2IZZA 3U4AA 3EJWA 3IJ5A 4Q4DA 1Z5WA 4KCGA 3E58A 2VNHA 1QO0A 4LVUA 4HVTA 1RRMA 1DXHA 1BGXT 1PT5A 1H93A 1JVBA 4M36A 4AK9A 3V4LA 2QT9A 3ID6C 5BR8B 4YROA 5HKKD 2Q5IA 4YBRA 3OLQA 5GIPE 4NHOA 1X1TA 4A8TA 2QRNA 3EEYA 3KJGA 2BIFA 3EXFA 3R23A 3RBVA 5BW5A 2OD7A 4EPWA 4AJEA 3PDHA 2P0EA 2B1JA 2X1VA 4XPIB 4WADA 3Q0TA 3TVTA 1Y1PA 1GNLA 4UATA 5F7ZA 1N5DA 4A9AA 1NUTA 3MRVA 4XN0A 1D2GA 3MCAA 1JVSA 1ZCZA 4Z0PA 3KYCB 1ZJ4A 3IQGX 2JAQA 5DYTA 1VRCA 2O3QA 4E1VA 1ZGJA 2AEEA 2XUHA 1CUHA 3GRVA 5F76A 3EMKA 5FTKA 3DH0A 2GEJA 3L77A 4OM8A 1S89A 1W34A 4K2AA 4RSRA 4AG5A 3F6PA 4KQ6A 4BO8A 1QGED 4LKOA 3BQJA 4N9QA 5A5FA 2QYHA 4NCNA 3NBXX 2PYZA 2ONZA 3KT0A 2ZG6A 3AOEC 2CSUA 4BFSA 1ORVA 3L1HA 4CM4B 3TPFA 2C1XA 1YFJA 1NMZA 3DXZA 4RXTA 5JJLA 1U2DA 5GJWC 2ZYGA 1QB8A 3R3WA 4MPPA 5T4EA 3DP7A 5AXDA 5K8IA 2Z04A 5ALRA 5BYJA 3IHWA 4E5NA 3AM5A 3N75A 5B1YA 1U80A 5LQKA 1KDZA 1LQTA 3D9QX 3QVTA 3KJXA 5DSZA 5KO2A 3H1TA 3UOGA 3IIIA 3QHAA 3DOOA 5A3QA 3M1YA 1C8KA 2E1PA 2OBRA 2E7ZA 3TLZA 4P9NA 2J9FB 1R0WA 1NLZA 2QTAA 1XQ1A 5E0KB 4KB5A 2ZWMA 3RUIA 5C32A 3FOWA 4OMUA 4ZTBA 5DHFA 4ZFNA 3WRYC 4FDVA 3SI7A 3PGXA 1JDSA 1QHSA 3ER9A 4WZTA 2AOTB 4V03A 2QZJA 3V8VA 3ZE6A 3L7DA 2O8CA 1PFGA 1SVSA 4WFJA 1R4ZA 4EW1A 4BQEA 2GAOA 5EWMA 1P9WA 1KU0A 1SUIA 3MAJA 4IJMA 3VSBA 1A2BA 1HSZA 2C29D 4MI9A 3RBZA 4MHTA 1II8A 1JQ5A 1NC1A 1Z6AA 1XK6A 4BDTA 2I2BA 5KWJA 5A4MS 2OA0A 4DT1B 4YLYA 2XTZA 4KNYA 2HWWA 3IOMA 1E2MA 2ZXEA 3N07A 2ZYDA 2AG0A 3MHTA 3ZKWB 1N6OA 3ZE9A 2KB0A 3I23A 1YCGA 3O26A 4I4NA 5LPNA 3JX9A 1E79A 5KOYA 3A1EA 1P2BA 4GG1A 2I6UA 1YCFA 4PXYA 5DNCA 2QTLA 1L5SA 2I71A 4YUVA 1X3LA 3OJLA 2F64A 2WKRA 5AOBA 1CEXA 5JCXA 3HXMA 4XD2A 5AVWA 3LLVA 3JWGA 3VV2A 4DR5B 3CLRC 3QYAA 4Z9XA 3WGUA 1KJYA 2XQJA 3RSGA 3EULA 4OXRA 1GGHA 1XROA 2DWPA 4V0ME 4CG3A 1OIXA 2WHQA 4WZBA 1M2KA 2E18A 1IN1A 1M0TA 3HB1A 2BCJQ 3HP4A 4KQGA 3FWPA 4FT4A 1OWNA 3KFVA 4LVOA 1YF3A 4L7VA 2CXUA 5T4FA 2B98A 3UV3A 4CR8A 3HWSA 4ER6A 1LWNA 3WQSB 5CVTA 5JWRA 1WVMA 3EIWA 1P33A 5E6UA 1GGNA 4XLAA 2A9QA 1JECA 3B9QA 1CY4A 2XUIA 1TZCA 5A4KA 4ZT7A 4ZJPA 2I1QA 2J07A 2D0DA 1QGYA 2WC1A 4CIVA 3WL6A 3PL5A 1H2AS 2VK8A 2ZI3A 4HHEA 3RVMA 4KFSA 1GSIA 1ZJJA 3EQ8A 4JVNA 4LI3X 5CD1A 4B48A 1O89A 4KOEC 2J9YB 5TMPA 1YIOA 4LMBA 4ARZA 3BB3A 3EQZA 4HL6A 4LE2A 1UEXC 3K30A 3THOA 1U1GA 4BLUA 1MOPA 1MP0A 2P5UA 4WA8A 3U17A 2A7QA 3ROGA 2X53S 2J3KA 2KLBA 3Q3EA 4NK5A 1M6WA 4OJMX 5JVDB 5ALQA 1MO3A 2FEMA 4LCJA 2XVAA 1LW6E 1GAQA 4ND7A 4ZVMA 4AP6A 5CFZA 3HXOA 1WD5A 1DTSA 4ROXA 3AIKA 4JB3A 1XMQB 3TI7A 4ITVA 3CVOA 1U4SA 3N6XA 1Z73A 4B6QA 3OZBA 2A9JA 4HRVA 3ZD9A 5A1JA 1Z2PX 3QVLA 2DY0A 5J5VA 1LSUA 2ROQA 4J0EA 5BUQA 1EWYA 4OGGA 5JY1A 2DH5A 1HM5A 2XMDA 1J4AA 5BQPA 1X8LA 3DV2A 4WASA 4QFCA 3X1XA 2UZIR 5EKDA 1UODA 1XCLA 4L8YA 5A4FS 1O4WA 1RRPA 3CVXA 2VJMB 4BNTA 2B2NA 4B8ZA 2R5WA 3FAZA 4AJ9A 4YQEA 4C5AA 1KQPA 3JR7A 4A92A 4KKXB 3OX3A 2DULA 2IIQA 2OCDA 2X5NA 4GGOA 3B3JA 4H31A 4MP6A 4B7UA 3EY9A 5B64A 3SNKA 3K31A 4Q3BA 2PUCA 1TM2A 3WLNA 4HDMA 1HNZB 1BFKA 2A4MA 1UFKA 2ZS8A 3HRKA 3PUYA 4AS1A 2M32A 4BGUA 3EDQA 4G5YA 2AHRA 1F60A 2F1IA 3OAAD 1JKMA 2O48X 5G02A 1TA4A 3RWBA 2QG6A 2YIVX 2PK3A 1DAMA 2Q3BA 4CM3A 1E7QA 4CLRB 2IUEA 3R5TA 1YQEA 1SPXA 2OPBA 3IJPA 4WKOA 4ESEA 5IH7A 2QGZA 3I55B 6NULA 1AE1A 3ESXA 1YA8A 4BJ6A 1AXRA 4KIUA 3TLGA 4ALLA 5BVGB 2B7BA 1CIPA 3DKIA 4IYJA 3BL6A 4LECA 4WCFA 1H23A 3H87A 2A1UB 2ZWPA 1JDBC 4QD3A 4V2UA 5FYDA 2D13A 1N4AA 4BPRA 3GIWA 3HCAA 4YRAA 5C2JB 2GRUA 1S7GA 1QCCA 4MV7A 3SP1A 3UT6A 1TD1A 1HDOA 1M2VA 4UEJA 4FN4A 3FM9A 2EDAA 3SZOA 1EJBA 1YAHA 3TZKA 1O0CA 2OUIA 5FYQA 1U28C 1W4ZA 3BB1A 4PZLA 1E6WA 3FGOA 4TTTS 4X5OA 3L6EA 3BFPA 1MR3F 1NYRA 3R75A 5L3QB 1T8PA 4PE5B 4B6RA 3DOFA 3RYIB 4E5KA 1YR8A 3SQLA 4QLAA 4DV1B 4QYIA 2HN9A 3G5LA 5M3BA 3CKKA 5NLLA 2QW0X 1G20B 2WJYA 1U2GA 2CF5A 2RARA 2FWNA 5CCDA 1GYQA 3R0VA 4ND3A 2VHTA 3MILA 4ZDWA 1C9NA 2O7QA 3LT0A 2YWCA 3DFFA 2C59A 1C1DB 3G68A 3E3OA 3GGOA 1TXGA 3KSUA 2B8WA 4B0PA 1C80A 1T2DA 4FONA 4INZA 1JBQA 3K0CA 1BDMA 4Y67A 1JPNA 3O9MA 1DWOA 2N1MA 3O4VA 5L7TA 1SHZA 2EZUA 2XHZA 3SG0A 4UCXA 3S28A 5TEVA 1B1CA 3HVKA 3GAMA 4DEXA 4LJ6A 1VQ5B 4CEJA 1II9A 2JAXA 3GJ8A 4H60A 1L5RA 4HNAB 4N3AA 4CI9A 4U7PB 3TCNA 4D6YA 2P2DA 4OHUA 2AXPA 4Z4FA 1BCRA 1KDOA 3R6GA 3I2YX 3I8OA 5AJHA 3DAFA 3CRVA 4M53A 2ZP1A 1MQ9A 4BX9A 1QGZA 3BGDA 1DMSA 1QIEA 1V8OA 4UEKA 5I8ZA 3SD7A 2JARA 4RIHA 2SNIE 2PNJA 4BQQA 1E7RA 4QV2A 2QRQA 3HP7A 1AKNA 1LDGA 1KC3A 3TLAA 5DXJA 1VPEA 1N7IA 3FNRA 3H2IA 2R60A 1E2DA 5THQA 4C05A 4ESVA 1IC6A 1X1RA 2PZBA 2H4JA 4FPXA 2MMCA 4X92A 3K35A 3TNYA 1LB1B 3WGLA 2BGWA 4P7GA 4GOOD 2AUTA 3BGWA 4MMYB 3SZ3A 4AJ1A 2VOEA 1Q57A 1NW7A 2HMTA 2R1TB 2QOEA 2XYVA 1HEIA 1TRKA 3HZOA 1A9TA 3RTAA 4TUYB 3PC6A 3BWDD 4HQKA 1XNHA 4FZJA 1KI3A 4IQFA 3ZD8A 3KNZA 1A3CA 3MERA 4OBWA 4PZAA 4W82A 1PYDA 4C7JA 4G1CA 2ZIFA 4PO9A 3GA5A 4DILA 1GG9A 2X14A 4LPKA 1Q14A 5L4LA 4A8HA 2WWYA 2AFIB 4BLQA 2QZSA 1WCWA 4JP3A 2Q1YA 1QIIA 1VCMA 3ZU2A 5JBQA 3S3TA 4HYQA 3DT8A 4FFSA 4KVAA 1GZ6A 5EEHA 3VPAA 1ZQ9A 1X92A 2HBZA 2OLEA 5FV4A 2PWYA 4HFNA 4YO7A 5FUYA 2E1BA 2ZUBA 3QNUA 3MTGA 4XGQA 4CCSA 3B3QA 3LQYA 2VJPA 4UNIA 3WX0A 3LNNA 4PICA 1RYNA 4U2GA 3FVRA 2DG2A 1OC4A 4DQLA 1JJBA 1MC4A 2Q9BA 1VQ9B 3PKJA 5CVJA 3QE0A 4XLEA 1CQIA 3MS4A 3R24A 3NCTA 4C2BA 5BRJA 2PBZA 1Z6XA 1PJAA 3PQFA 4XORA 3A70A 4GM1A 4XQCA 5J3OA 1NSTA 5KNBH 1YBVA 3MMNA 4UPVA 1Z7BA 2NZYA 1PKEA 1LI4A 3V9AA 3HGMA 4CE6A 2B20A 3KS9A 4Q03A 1A9PA 4UW9A 3UJ8A 5EFOA 2H29A 1JFTA 1EINA 3ZLTA 3UZUA 5EHZA 3A31A 3X2EA 4Z4YA 3UMVA 1RKVA 2JH3A 3IALA 1UOEA 1E9BA 1EKXA 1X39A 4P22A 3G3EA 2D1SA 4PN3A 2XDYA 4CM9D 5ALFA 5HKOA 1G3IA 4BO1A 2ZLBA 4P36A 4Q6BA 4CLDA 1QU2A 2OBYA 4PYRA 1U2RA 2ODWA 4BFVA 1ZOOA 1FNBA 4KQFA 1EFPA 3LQQA 3MMZA 4M49A 3PXEA 4PXAA 3F3YA 3UKDA 1JE1A 5E7QA 4DARA 2J67A 3T54A 2PSHA 2HUNA 1A9OA 3T3GA 1UKVY 1GXSA 2AI2A 2AR7A 1HR0B 5JAIA 4GOKA 3RKRA 3X1YA 1YVDA 3PD1A 1SQSA 3W5SA 5K3FB 4YECA 2O54A 1PLLA 1IXSB 1HE1C 1MH1A 1SIBE 2QAIA 3DKRA 2H7CA 3MS2A 2GJKA 1MJ5A 5EKTA 1EK1A 1KETA 2X3UA 1CJCA 2HCFA 2VIIA 3F5SA 3QW2A 4DW8A 1V8BA 2F9MA 3HFRA 3N2YA 2QRGA 1C9KA 4U2DA 3GJ0A 5BUSA 2J0UB 4AMGA 5EMNA 1OWOA 4PCVA 4C4TA 5FTWA 1S4MA 4HLUC 2W93A 3I2KA 1KRHA 1CV2A 3JAKA 3C7KA 5H16A 4E0BA 3HDHA 2UZAA 2ZM6B 4FD3A 3U4HA 4MEAA 4CN8A 1PNRA 3S5JA 5HQ3B 4HJRA 1CW2B 5ES3A 1ISMA 2PUEA 1VPVA 2RHLA 3F7NA 3G0OA 3QWHA 3BCDA 3WYGA 2JVIA 4V1CB 2QMUA 1L7DA 1SPBS 3MRTA 4L7QA 2WUWE 1UP4A 5M34A 4B87A 4A2WA 1X0XA 4PIMA 4LF4B 3MAGA 2CJYA 3LUFA 3TNDA 1PEKE 1T2NA 2EQ5A 3F46A 1AIPA 3PP8A 4O2AB 1L8XA 1XEAA 5JAUA 1MPXA 2WMDA 4XRRA 5L40A 1Y37A 3LSTA 4ETNA 2OL4A 2Y1FA 5BPFA 1WNTA 4P6VF 2N3ZA 4F72A 1IHOA 4ZGQB 2QRLA 3F4KA 4GGMX 4PLCA 5TMDA 4LFBB 2Y6VA 2ZRHA 3GQBA 3WWEA 3ZDRA 3C41J 1H2RS 4MW2A 4XA8A 4BGDA 5TR9A 3G2MA 3S2SA 5J4HA 4R16A 3H5AA 3IESA 4LHWA 5ARBA 2VBUA 1K4KA 4TQAA 4QYSA 1EWKA 3OIDA 1WOSA 4UASA 3U81A 1AOXA 2VXYA 3DDCA 1KMIY 1XC7A 3MA0A 2JI8A 5HG0A 5A04A 2AUNA 3T5AA 2PVPA 3E4DA 3WYCA 3QWIA 4I5IA 4YRQA 3U61B 2XVMA 4OYLA 4QU0A 1IH8A 3L7CA 5ERYA 5FFMA 3EVGA 2Z5LA 1NW6A 3GQVA 3MFQA 3PU6A 1K98A 2ZUCA 4CF3A 4PO1A 4LFCB 1NVXQ 3L84A 2H4XA 5LBUA 2VPZA 1U2ZA 4HB3A 4HDQB 4PF1A 3U44B 1GA1A 3VH2A 1Y9ZA 2PPLA 3EFBA 3PIDA 1ZD9A 3S4YA 3TRHA 1U8EA 3Q3AA 3RS2A 3OE5A 1WP6A 5E9WA 4MV5A 3PNQA 1SB9A 1UWLA 4UD2A 1ISIA 2JLSA 2PXXA 4MS4A 4LHSA 6ABPA 2B2CA 1GUDA 2I8AA 4QDOA 5FB3A 4BO2A 2Q6OA 3X44A 3WGVA 5BMVA 5KYXB 9MHTA 4UBNA 2R7KA 4PZ9A 1ATIA 2GD1O 1TPYA 1E1NA 2BONA 3N58A 3Q3VA 4P80A 3B89A 3ZI4A 4M60A 1SCAA 2PNFA 1VYTA 3IDAA 4RJIA 3U80A 3G49A 4LJ9A 4FYIA 4LWOA 3CCBA 4QNRA 3WOHA 4XYGA 2QTRA 1KQOA 3TCKA 1JIJA 5H9VA 1W4RA 1W85B 4TLAA 2CZCA 4YPFA 3HC7A 2WIKA 1HY3A 1X1CA 5BQXA 2JGAA 1KBOA 1Z8NA 5K3DA 1N5IA 3DZIA 2QRVB 4O5OA 2HX1A 4RDJA 1A5TA 4MWGA 2NP7A 2VYCA 1A04A 3ZWBA 4CN9A 2XVZA 3JWHA 3L4EA 1Q84A 2A5JA 4XTCS 5COQA 5ED4A 2ZJAA 3QUQA 3GYGA 1N7HA 4BMOB 4ALNA 4EJ0A 3TX6A 1FF9A 4YJ2B 2OFXA 3GUVA 4NZZA 4Z54A 1J25A 4RKRA 4UFPA 2H1FA 1SXQA 1AO3A 3HB0A 4WN3A 1A8SA 1J8FA 4WN9A 3U0BA 1X42A 4ZI7F 4KSYA 1WF6A 3HZRA 4O02B 4N01A 1X7YA 2RGXA 4HUQA 5DBEX 2VYFA 3NE5B 3UCEA 3VVMA 4YYZA 2HDNB 4OHBA 1KGDA 1E2GA 3ICVA 3OMXA 4B83A 4RKFA 5I5EA 1JHMA 5BNZA 2D7DA 4KN6A 2LE0A 3RSHA 4OBEA 5BR1A 1A8PA 3MGAA 4RD3A 5IYWA 5COBA 3E0XA 3MLBA 3IQXA 1GHTA 2WTMA 4MJLA 3IXQA 1VHJA 1M7BA 2HA2A 5FWXA 2CMGA 3NORA 4XTRA 4BB6A 2D0PB 4BO0A 2QL9A 1P1BA 3IDFA 1H66A 1DG1G 2WG2A 1Q0PA 5JD5A 5TRDA 3QQPA 1QHHA 4D46A 5CB4F 3N2KA 1XXHB 1GGFA 2IUTA 3WTCA 4CKEB 4F06A 3WAKA 1YUNA 2UYYA 2JA2A 2MT9A 1T3GA 4ZU1X 1SCUB 1XRNA 1PO7A 2L2QA 5FAKA 2IDKA 4M87A 1X80B 4RMGA 2ODEA 3QEOA 4RVOA 1D0IA 4PG5A 1G9XA 4PY2A 1NOIA 2DWUA 3DPUA 2X85A 1AB5A 3E3AA 3G9TA 1RZ3A 3B2EA 3F49S 4KN8A 4PX5A 2VI5A 1UINA 2V7QD 4JBHA 1QS0A 3DDZX 4TXNA 3TW8A 4B9AA 4E46A 1SCJA 3WNBA 1S8OA 2JEYA 1F4LA 2PGAA 2Q0QA 4GLLA 4FB5A 3L6RA 3QLJA 1WX1A 1ZXLA 2NU8B 3PQ5A 4YEJA 4OF4A 2PG3A 2NYVA 2X42A 4U2KA 4ZCTA 3GCXA 3IB3A 4TSKA 4KR2A 4LN1A 2FSSA 1W87A 4S1TA 4OL0A 2GF9A 2CHEA 5DK4A 1K7EB 3FR8A 3R3YA 4J76A 4P2NA 2DHEA 3S2EA 1M2JA 4DSOA 1MPTA 4N5HX 1OJLA 2WPNA 4QPJC 1JLHA 1VQMB 3S8MA 4ZZ1A 5IKEA 3OJCA 1E64A 1YFKA 1EUDA 5IC4A 1E3WA 1NU8A 2A35A 2KWIA 3IODA 4ML3A 3V1UA 2AZXA 2NU9A 3L0SA 1T4BA 1U7XA 1J42A 2Z83A 4WUVA 5ALEA 3SF8B 1EXVA 3I5XA 2QPAA 3BWMA 3CLUC 5FJIA 3TEFA 3WWDA 5HW0A 1YMQA 4G25A 2LUOA 2W2OA 5DISB 1XZMA 1KZ9A 4MPTA 3OH8A 4OO3A 1L7AA 3H0CA 3LQEA 4HMOA 4W7SA 4EHBA 4EKDA 4EUKA 4F5WA 1KU6A 1PZXA 3I1IA 2K2WA 4MGHA 3ZIAD 2AXNA 3HA2A 3BYZA 4AZ0A 1VL1A 3C3DA 4RTJA 3ES9A 3PNLA 4D9KA 1XNQB 2OCIA 2VSQA 2VWQA 3ANSA 2PUBA 3QJGA 3AHIA 4E33A 4D80A 2HSZA 4TZKA 2UUOA 1OH5A 1CY2A 1JA9A 2C98A 3PHBE 1FQOA 1P2DA 2JFZA 2ZBQA 3NP9A 4ABYA 1U63A 3DMGA 2PYDA 3C6YA 3SHFA 2RGUA 3OZWA 3RUHA 1Y0BA 2E87A 3MPOA 1GNRA 3SM3A 1RI2A 1MDBA 1XFDA 4RVUA 4XR4A 5AVJA 4RVSA 4PFQA 4X66B 1AD2A 1KI6A 3TAUA 1C3OB 4KK3A 1YL6A 3TI9A 3UWKA 4EY8A 5FP0A 3CNBA 5TXGA 4GR4A 2BMAA 4JC5A 1AMOA 1EXMA 3HGTA 4R8SA 4BO4A 1HK7A 2F9FA 4OLBA 3TECE 1TCAA 1E92A 1I4DD 3UG6A 3UJ7A 5JJCA 5BWBA 1IOZA 1MFZA 4W9NC 2QNRA 3ANTA 3VR6H 4WW0A 5FTLA 5JRDS 1EBFA 2VAXA 3C3YA 3H8JA 3QMMA 2JZCA 2BISA 3MQ4A 4MR7B 4K0KB 4P9SA 4J0JA 2FPSA 1W93A 4EVSA 1KI7A 4QG7A 3OW7A 2V0CA 2IOFK 4O08A 3SVZA 2W22A 5TGTA 3R8XA 1AF4A 2IYAA 3U3RA 5AN9A 3PYXA 4PZDA 5BN3A 1XQXA 1LPSA 2X2OA 3OWXA 1DX6A 3PLRA 4EPVA 4QAJA 4MUGA 3UKJA 4QX6A 4ZVSA 4ZI7A 2C54A 3HSKA 1L3IA 4JITA 4Y2UA 1S2LA 2PX0A 4EHAA 4P84A 2ODTX 5CLJA 4OPMA 2UYGA 4OBXA 1EQAA 2A30A 5CAEA 2VHXA 4IFEA 4TYMA 3L7IA 2PRYA 4TMXA 5CTJA 5CFPA 4Q7EA 1YAJA 4YEDA 2QAGA 3FNIA 4EG5A 3QVJA 2I7XA 1QIDA 3DBOB 1FBTA 1JG3A 2VXCA 4ACBA 1UKZA 3AR2A 1NVEA 4Y2SA 2I62A 5B37A 1JYFA 2B99A 3D7MA 1JHXA 3NNDA 4KSBA 1Z0UA 2XA1A 3R3JA 1NZJA 2YJZA 3ZU3A 1MX9A 4QUAA 5KTYA 1ADJA 1CNMA 2FMIA 2RC5A 3CCFA 2ZYIA 2XT0A 4Q9HA 2IBMA 3DZCA 5FDFA 3OZEA 5K0TA 2W6NA 1ZPDA 3WLAA 3ECSA 4P32A 3KYJB 2OG2A 5CEJA 5CFRA 2JD2A 2CC2A 4MS1A 3A4VA 4ESHA 1YTUA 4YRDA 1E3XA 5A06A 2RI0A 7GPBA 3R5HA 2C7QA 3GZ4A 4CKWA 1B3RA 1C7EA 3PS9A 2EFGA 2AUMA 3NTUA 4D9GA 5A6SA 3AM3A 1CZHA 3SIXA 2ZSDA 2BOVA 5IC6A 2O8NA 1OYOA 4N8EA 3T4EA 2Z3VA 4TV8B 5HTKA 4B76A 3ZZTA 4PNHA 4RZSA 1YJ5A 1P0IA 2FF5A 5TMBA 3CFYA 1CJMA 3ANYB 4FZRA 5B30A 4PC3A 3HVRA 1HRDA 1P9OA 3OQMA 1HNNA 3ZCRA 3LC1O 3P0IA 2XDQA 4GMHA 4FX2A 2O9JA 2DWCA 3S40A 3GA0A 3MD9A 3S70A 1F48A 3U3ZA 1LBTA 2GYYA 1DHRA 2FK7A 4UAUA 1C81A 1X7WA 3IUEA 4IGEA 1GL9B 3RH0A 1NJ8A 4OA8A 5DB4A 2XF8A 1N3LA 2YJ5A 5BV7A 2YHIB 1I0LA 4UREA 4PBSA 2VDRB 3TQTA 4ERNA 3L9XA 2EBWA 5C8YF 2YZGA 1JEOA 5GONB 5KWSA 4WOJA 1YR6A 4MKFA 1D4FA 4HFRA 4HXFB 2I2FA 3OWHA 3IMFA 3FSGA 3QY9A 1WABA 3DYVA 1L8OA 2VC2B 2VTEA 3X1ZA 4HT3B 5LCXA 2O07A 4FSHA 1O96B 3LRXA 1K8AD 4Q9NA 1C3LA 2VJJA 5G1PA 1E1QD 3P0EA 5EXTA 2V3WA 1CSEE 1EWTA 3ROEA 5EE0A 5EJ2A 3FGNA 3S2GA 3V4FA 1XJWA 5FBKA 2A9PA 1TO2E 2LTAA 3DAYA 2GM5A 4E03A 4OGWA 4AP5A 4CV0A 2VHJA 1YDEA 2Z5VA 4G56A 1W5FA 1WO8A 5AM1A 3CRW1 5DTIA 4Z2AA 2X5OA 3RAEC 1RLOA 3G82C 4Z9BA 2G3YA 2XI4A 1DB3A 4M8NE 5CURA 1CF9A 3U7QB 1UD5A 2A94A 3KVYA 2YWEA 4J4TA 3W5CA 4Y6QA 1JX6A 4PFKA 3DKKA 3SC2B 3SQMA 4IIEA 2W6OA 4C2AA 5HZKA 5KOIA 3AG5A 5DT2A 5FOWA 3TJRA 4OX9B 1TMYA 1KE1A 1GRCA 3QVSA 3T7SA 4N3BA 3L7NA 3C6KA 4JCOA 4TYPA 5J40A 1AA6A 4BWGA 2RGNC 1LVUA 3ZGLA 4ARVA 4DLZA 2MSEB 3NOVA 1VGQA 3PGJA 4JLUA 5DSTA 3WGNA 5ITZB 1AQYA 4Y0VA 1O6FA 3KWLA 4UXIA 4DMMA 2DUUA 3MWKA 5AHKA 4DRZA 1G2QA 4X3CA 4HBGA 4E13A 1AGRA 4OMDA 4PHFA 3DEKA 5EJMA 3OPYB 3VNAA 4WOPA 4NBTA 4G6IA 2VPWA 4DZTA 3LCMA 3A05A 5H8WA 1NKSA 2CFCA 2COKA 4MRSA 2CB0A 2LD4A 4MUMA 3M33A 1KAGA 1Z4JA 3VC1A 4KKVA 4YREA 2CYAA 1P18A 1Q9SA 2PLWA 2XH8A 2C5LA 3MOGA 4FYWA 2ID9A 1Q12A 2HADA 5TPWA 3ZUPA 3EG5A 4KHPB 1L7VC 5CA1B 5LZ2A 4QDUA 4JBLA 4HYTA 5K0FA 3LYLA 5TARA 3BL8A 1I4OA 2NVBA 2OT3B 3G7UA 3PUMA 2AZTA 2OORC 2ZSHA 3C5VA 3IVMA 4GXNA 4HDAA 4WVLA 3ZI7A 3FCAA 4DR7B 1OT5A 3U9LA 1VXRA 3O2NA 1IIBA 4UE3S 3CLRD 4YLEA 4AJOA 3W5HA 1K66A 2WM8A 4HBZA 4ZT5A 2V7VA 3ZY5A 4G2NA 3C6XA 3MOIA 4HDCA 2DP4E 4DZZA 2A1IA 2H4ZA 3NHBA 2EG9A 2HA3A 2AMVA 3RFVA 4NYIR 3C7AA 1GARA 3TRJA 1H3EA 1U04A 4YXWD 3CW8X 2F8LA 3ABZA 2R96A 4BLSA 3DONA 1S9DA 3K6SA 4ZHSA 2YX1A 5L7WA 3Q3JB 3U5ZB 2E4ZA 5IDXA 4NAHA 4BXOB 4Y0AA 5EE3A 5K4HA 1HE3A 2CVQA 4DJFC 3CCUB 3GUZA 1HVXA 1UWCA 4V0SA 2B1IA 1F2DA 4Y2RA 1X3SA 1L1QA 3AEKB 3LM8A 4LNUB 2OXFA 1R12A 3W3AD 3ESAA 4ZOLB 4YUXA 4R71A 1G63A 1AKUA 1SK8A 1G1AA 2CUZA 3DWEX 3HNRA 4DC0A 2HSEA 3PQ4A 4EA7A 1E2JA 1QYCA 3ZGXA 4WBSA 2OOSA 3L8DA 3OD1A 1G4HA 4FR0A 4Q7KA 4TT3A 4GS5A 4X1OA 5AUPB 1ULHA 3RC3A 5B57C 1ZAYA 3CD6B 4PM4A 2GM9A 4US1R 3DBHB 4EB3A 3ELWA 1E3IA 3Q2IA 2ZBGA 4D0SA 3JTMA 5DPMA 4LSMA 4TN1A 2XMCA 1VA4A 5EIAA 1FDRA 4Z4RA 4PS1A 5G53C 3H94A 5KTKA 2JI4A 2X76A 3VO9A 5IASA 4JYAB 4M9CA 2R6HA 1W73A 3C3EA 4MYDA 3M1IA 4F56A 5EWJA 2BI4A 3S1AB 2B7CA 3QI2A 4GKBA 1OFUX 2XAAA 2ZQZA 2EJTA 2JAUA 5C8YA 4BMCA 2GPWA 2YY7A 4MWZA 2PZFA 3FPHA 3ONEA 1AK2A 1RCTE 1T5TA 1V9LA 2JFGA 3LC0A 1W0KD 2J4DA 4HATA 4O4LB 4XSVA 4EIWA 4B6EA 4WDRA 1T5DX 1W75A 3L8YA 3HAGA 3STXA 1ZLYA 4R69A 3LECA 1YNSA 4HG2A 3F47A 4AUKA 4HQ0A 3ZK7A 4EP1A 5ICFA 2VP9A 2NADA 4XKWA 1TD9A 2QP4A 5G41A 4XKJA 3UB3A 1G5PA 3OX2A 3RVNA 1U0EA 1P4GA 1RVDA 1VJCA 2OCYC 3NBQA 4KEAA 3AXSA 4MV4A 3OEEA 2PKQP 2HR1A 3C14C 3HGQA 1ZKDA 2OYSA 1H85A 1YA4A 2VYVD 5HF8A 2X15A 1J97A 1M8GA 3UPTA 2C4KA 1P1CA 1WP4A 2VRCD 5EQDA 3IMKA 4AJKA 5E6RB 3ONVA 4BMPB 2PS1A 3V33A 4EH1A 4Z4VA 2ESRA 4CTMA 5F7XA 4RTSA 4R6WA 3E1YE 2J08A 3C5EA 5AXAA 1Y7TA 3A1NA 2OBMA 6ADHA 2FPIB 4OY3A 2W98A 2GBCA 1OA0A 4JLVA 1LJ8A 1XZJA 4YJHB 2FEOA 4X61A 4ZT6A 4INAA 1L5FA 2QR2A 1PT7A 16PKA 4X8HA 3FBTA 1Z12A 2OHVA 3DNMA 2D4HA 1MKYA 4HIZA 3HJBA 3DCJA 4M1EA 4MYRA 1KK3A 2HEGA 5CRIA 4CMEC 3GLGA 3LGSA 2A3NA 4IZOA 5DX0A 3R41A 3ZGZA 1WB4A 1WTAA 1M2OB 2ZTGA 4W5WA 3EGDB 4LVCA 1P2UA 3DHWC 3PHIA 3SFTA 1JQBA 1XU9A 4JLKA 5D1NA 1XBTA 1A69A 2XUPA 3WJ2A 3IQEA 1OH7A 3LBFA 2C20A 4E09A 5KNDD 3N8KA 2C7BA 5B7NA 5JWHA 3TW0A 2WF8A 4GLJA 4JGIA 3REOA 1QKIA 2WIJA 3SJZA 2P77A 1W2HA 3VSCA 5FEMA 1MX5A 3WO0A 1KOFA 1YQGA 3REQB 3LXRA 2D6FA 1J1IA 4FC7A 1BQ3A 3CRRA 1SCDA 4P4SB 4NIMA 5FPPA 1KR5A 2Y0BA 4QQKA 2DFTA 1O9BA 1YASA 2XODA 5HIKA 1MG5A 3CR7A 1G7SA 1DAHA 2CF4A 1VPTA 4WBXC 4JNCA 3ADCA 5A9RA 1KTIA 2C9BA 1CETA 2X8JB 1PU2A 2EAUA 2EP5A 2OESA 2HQSA 4LV8B 1U7OA 4QOIA 2C4VA 2D0IA 4B4WA 4ZJZA 3W4JA 1QE0A 1WORA 5HZHA 2BGGA 2DLCX 2NU6B 2OXRA 5EVCA 3V46A 1ISPA 4YJFA 2J3IA 2I5PO 1U9CA 4MKHA 3RUCA 5JXGA 4Q7QA 3PCRB 5L3SA 1TF5A 1OWMA 3SWWA 2QEQA 2GNPA 3ZOZA 4DPMA 2R11A 2O5VA 4GSKA 4AZWA 1Z36A 2CWWA 4YAIA 2DPGA 4ZCSA 2BZ1A 2IA5A 4PRLA 2CLOB 3RSZA 4ZYXA 2B1RA 1ISSA 3O21A 4QJBA 3CCRB 1GKLA 3ZTTA 4GWKA 4YAWA 5A9TA 5K8LA 2O4CA 1FX0B 5JJKA 4B43A 3KP1A 3D26A 3A6EA 2A2ZA 1E77A 4OL9A 2GLUA 1ZONA 5IKMA 2OZLA 1T36B 4K88A 5LDGA 1CUVA 3EGOA 1XZQA 3QLTA 3UAWA 4NMXB 5I9SA 1MB9A 2I6GA 2JKZA 4NBRA 2FUNB 1NV9A 1DKRA 1ZNWA 2FMXA 121PA 3G88A 3PC8C 3DO8A 3EXEA 3HB4X 1V45E 4BKQA 3BE8A 2JJQA 2E5WA 5HZBA 4RZQA 4GKVA 5CM2Z 4E0FA 2AIRA 2Q5EA 4OI0A 3A35A 1EWQA 2P2GA 4PANA 4JUIA 3KXKA 1EFTA 3AL2A 3Q7SA 4KLRA 3LPLA 1A2KC 3VNVA 3IIKA 2R8BA 4IIFA 3OTQA 5IG2A 1TM1E 1YB7A 1ZVKA 1ZI8A 3V9PA 3DBRA 3KZ1E 3PFWO 4KNWA 4K0RA 1YRQA 3LPNA 3RS7A 3H1AA 4C4AA 3OFNA 4I1SA 3KUXA 2F1HA 2O7RA 1PVDA 4RVHA 4MLDA 3IYLW 2IP4A 2AFVA 3FYCA 1L7XA 4GYJA 3WJ1A 4D3XA 2CZQA 3DE7X 1P91A 3DFIA 1VTKA 1KY5A 3M5WA 4QVIA 4DUGD 2YIJA 5BSGA 3R6LA 3PEVA 3OLXA 4FLMA 3OKCA 3ZLVA 4CGZA 1E6EA 3GDWA 3L0OA 3OCJA 1XJCA 2UUBB 5JLAA 2H00A 1OKKA 2CLMB 3V8NA 3WGOA 4JT8A 5AKJA 4FW8A 4WBNB 4UXJA 5HNKA 2HHJA 3B38A 1LC0A 3FMFA 3K4QA 1SC4A 1GZ7A 5KCZA 3WNZA 5GWXA 4J16A 1Y9DA 3C4JA 3GLKA 4LXGA 3PNBA 3U19A 1LLDA 1XRQA 2EZ9A 4CQLB 3B7GA 5HXAA 4AI6A 1Z2DA 2V55B 3FNFA 3BXEA 1XP5A 3GFSA 3UJBA 1FRFS 3ZHRA 2W48A 1HT3A 1CRPA 5LB2A 2QB5A 4GPBA 1VZ2A 3LX5A 1Y3FE 4CMAA 4DR3B 4MQ5A 1N6RA 4GPD1 5C4IA 3W8FA 3PDIB 1SHTX 3QFHA 3EYWA 3PT9A 5FH9A 4M8KA 2YZKA 4FMBB 5JANA 1W5EA 1HDXA 4R4JA 2WJGA 4N6GA 4PCAA 5AWFC 2ZXUA 5IVHA 2XNKA 5DHRA 2VTKA 2AS0A 4HQRA 1RR6A 1MW9X 4N6OA 4PTZA 4TKZA 4A6PA 2QTGA 4TX1A 2ZATA 3H7AA 4FDUA 5AJZA 3PUNA 2J87A 4Q3AA 3KSAC 3MSXA 3S8YA 3I4CA 2W70A 1FP6A 5LLSA 1RYMA 2QG9A 4NNPA 5LOVF 1T0BA 4ETIA 1XMJA 4K9LA 3ROPA 3TW4A 1TK3A 1ZCFA 4RM3A 4ISCA 1RYBA 2CHGA 2AQKA 5C7LO 3IV9A 4MQFA 1QWSA 3I0MA 3DKPA 3NKFA 2QSUA 1ZVVA 4OPSA 1Q1AA 3FI0A 4GOXA 1BWQA 1FSZA 2DUMA 1NBEA 2I4TA 4IM7A 5J5CA 1K6EA 1OFVA 4YAUA 1B15A 3O7WA 4DABA 4DHWA 4HUTA 1JG7A 2A3RA 1V11A 2BGMA 3LT2A 3HO6A 1WOMA 3R9IA 2WQ7A 2FB9A 2EQAA 2JLWA 2G08A 1VKNA 2I2WA 4KBYA 4TKUB 4R9SA 4U39A 2X6YA 1C30B 2W2VA 2GERA 4ZC1A 2G0TA 4GICA 1L4LA 3UPUA 1Y7LA 3P0RA 4ZQIA 3V6MA 4ENTA 3AF0A 3HM2A 3MIZA 3JZAA 4R0VA 4RF5A 4AS2A 5KNDA 4BFLA 2ZBEA 4QEZA 3ZWAA 4YV0A 2Q2VA 2JI6A 4NV3A 1I10A 4WLNA 5HGJA 2VRNA 2YNMC 2DB3A 1THGA 2O5RA 3IDSA 3EIXA 2WJPA 5ALTA 2QIOA 2D1QA 4MICA 3ZW8A 1FDVA 5KQPA 3EODA 3ZCVA 2D7CA 1XAHA 2P0AA 1M5RA 1KRXA 1WW2A 2JGFA 1N5RA 4PLWA 4WNCA 2HRZA 3WY9A 3ZCSA 1ESEA 1BAPA 1TJ3A 2ZBRA 1AKVA 1E2UA 1X86B 2JIRA 3M3HA 4KXXA 3FTFA 1L8AA 2B3DA 2HF7A 1DDOA 3QOXA 4FFBA 3ZX4A 3STUA 1VJDA 3TIIA 1NONA 2DT5A 2XLBA 4I3GA 3EZLA 1JHYA 4EJFA 3VDRA 4EUHA 4JI2B 1A72A 1TKAA 3F5FA 1T0PA 4HFJA 2OHIA 3CX3A 2JRCA 2Y0DA 2PV7A 4KO1S 4X1YA 3T38A 3T3IA 4JELA 3DFUA 4NG5A 1R0YA 1GP2A 2ZUTA 5IAOA 2F48A 2VJKA 4MQBA 5GY7A 1K6IA 4U3JB 1UOPA 5T64A 3C3AA 3ZX5A 4AJ2A 4CLHA 5JWOA 3KFLA 1D1SA 4EG4A 3VNUA 4YQFA 1FRQA 5IVPA 2Z6BD 1HQKA 4GRIA 1X14A 2V8OA 4GH5A 1ZU4A 3C1OA 4LY0A 4HOYA 4MVJM 3FGZA 2IKSA 2XYQA 3HG7A 3ANXA 5GVRA 4G0NA 1UD2A 2J5KA 4KI0A 2O7SA 2IHYA 3EW9A 3HYTA 1IDOA 1OVGA 2PEYA 4RV9A 1XDWA 4BO3A 2GB4A 3AVOA 1YZKA 1KJJA 3VHXB 2OHOA 4XQEA 3C24A 1IAVA 1GQOA 4F1WA 3G0DA 4MUHA 5ALNA 2QVZX 5F5NA 4QFBA 4K05A 4TKVA 3I9LA 3VUFA 4G37A 1YZGA 1WLSA 2NXWA 4N0EA 5GJVC 3IVCA 4UU8A 1L5GB 3DWFA 3W6OA 4DY6A 1ISRA 2AJDA 2DKOA 3GEIA 2W2PA 4CU5A 1UBCA 1WDMA 1RYYA 2OENG 3T3OA 2WU4A 3L92A 1UDCA 3PIIA 2DCUA 3S29A 4M1QA 3OJEA 2Q3HA 4DKXA 4UVHA 2IYRA 4ALJA 1IHXA 2M9MA 5KYTA 1RLUA 3TLBA 5LD2B 2MWMA 1KKUA 1PG2A 2QDKA 1N2BA 1V3VA 2QQEA 4PW0A 3O38A 4XQGA 4AMUA 5HCIA 3DXYA 4CYMA 4Z3DA 3SE0A 3L7BA 3WFIA 1VI6A 3HN2A 4FYXA 4PZEA 2V7WA 3T7JA 1N9GB 1HEYA 4ZMSA 1GZ4A 1EP9A 3EQ7A 5DIZA 2A4KA 2PXHA 1N1DA 1TYDE 2EBUA 3CZQA 4UTXA 4Z8YA 5K3SA 3SZGA 2XV1A 4RZIA 4RZ3A 4G67A 2VPIA 3WLFA 5JSUA 2EFEB 3UV7A 2CUNA 2D9RA 5ETJA 1TT5B 2AN9A 5IBCA 2AOUB 3K0FB 4BLPA 1C7ZA 1YJQA 4JLJA 3K5PA 4RPBA 1XDSA 1YHYA 2BI8A 2C97A 2GD6A 3KUKA 3OZAA 2CV1A 3NUGA 4ICIA 4R2XA 2X0DA 1E5DA 1N6KA 2BEVB 3VKWA 5IT9A 4FW9A 4W4TA 1X7GA 2WQ6A 3STVA 2RMKA 4X7PA 1U1IA 1ACLA 2PFSA 4IIXA 4NE2A 5IEBA 2CL6X 1JR3E 4C1BA 5LOVA 2C7RA 4EYEA 4LMRA 2CJXA 1ABFA 1QH1A 2WJVA 4QUZA 2HMUA 3AJAA 3DFKA 4EOGA 1NDQA 2CD7A 4TXLA 3MUFA 1GZVA 5T3YA 4D5GA 1TA0A 1EVKA 1ZK2A 1VHEA 2NZUG 3H99A 1XZBA 1KE2A 1A5SB 5JPIA 3GPLA 5LMNB 1QX3A 5KYVA 3NKVA 4IDFA 3O4FA 3I73A 3VX4A 1Z4IA 1ZHHA 1QX4A 1KEVA 1R0ZA 3HR4A 4MMZB 4ZVVA 2JNWA 2WVGA 1LNQA 1C7FA 2X0RA 4KUEA 4OBBA 3TQHA 4WKNA 5FQOA 4F0JA 4HTFB 5SY6A 3D8NA 4K6FA 4ENWA 2CD9A 5EHGA 5CVUA 1T1IA 3QVKA 4PC7A 5IAJA 3VJRA 3WNDA 1Z75A 3DDOA 3ILVA 1WBJB 4Q02A 3ZH2A 4L51A 3D4IA 3CNEA 1AKMA 2H2FA 3OSUA 1N1EA 1HWYA 4MJXA 4C03A 4EG8A 2IBSA 3IP3A 5BUZA 4YRIA 3G9ZA 4X7BA 4XX0B 5CNIA 2W6JD 3H6HA 4WPGA 3W5AA 2BZ0A 4H77A 5AVKA 4EY7A 1N2EA 3JD3A 5J4KA 4HDRA 3OIGA 2EERA 3BREA 1QFSA 4MIEA 1ZLXA 4DQ0A 4RA6A 3AY7A 4F6CA 5K03A 2LW7A 3ICOA 1PD0A 5I3ZA 5EERA 2NTEA 4DRYA 5IBPA 1KJZA 4NONA 4MWSA 3B20A 4HDSA 2VSYA 1Q0ZA 3KXPA 1P0PA 3UWSA 1UT5A 1OD6A 3RJTA 3G0GA 1YOBA 3NT5A 4YQZA 1EUCB 1EGHA 3GG9A 3P9NA 4WI1A 4X1IA 3RVRA 5M04A 3GO4A 1MIOA 3ZGVA 1EA5A 3DW1X 4LK3A 4P0PB 2XNCA 3O1LA 2C5BA 1BFDA 3BH6A 1L5NA 1L5MA 1DKNA 3JQGA 2I6FA 3IUBA 2OSVA 4D0GA 4G0WA 3QE3A 1GPBA 4GQAA 1GM5A 2JGRA 1TZKA 1S5PA 3D6TB 4L73A 4LYHA 3TKYA 4NBNA 7ABPA 3K2EA 3RT9A 2FHSA 3LCRA 3TCXB 3ENZA 3JQAD 3WGGA 1A8IA 1NWHA 1OGIA 4LGCA 3CONA 6REQB 1GYPA 3Q40A 5B7QA 2BVNA 1B8VA 1VMKA 3O90A 4CEIA 1U3GA 2PKEA 2H4YA 1KEZA 2FWBA 5I7WA 5HDBB 1ZG3A 4J43A 5BN4A 2J5QA 3CZRA 2P4SA 3DHYA 5IJ9A 2BZGA 1CFZA 4ALKA 3T0GA 4DR4B 3DE2X 5YASA 2FSUA 2ST1A 3U13A 4IUYA 4MIKA 1BRTA 1XEWX 2RB4A 3TXAA 2IXTA 1H0HA 3LXXA 1V9SA 4R41A 4D4HA 3IULA 2AG1A 2HQOA 4QODA 1HLPA 3K0HA 1M1NB 4B3FX 4RS4A 4YAJA 2JHAA 3TGPA 3GMSA 3TFQA 2Q46A 3R6JA 3O1HB 3PUXA 3V4PB 2V0GA 3LY7A 3O8NA 2A6PA 4PPQA 3WLQA 1HSOA 2BELA 2FG6C 4ND1A 2VQDA 3O1JC 4IV5A 3SMQA 3W05A 5HTOA 3MWGA 4JC4A 4AJNA 2P91A 3M5DA 3WHLA 5G0TA 1ZN8A 2EC5A 3PRHA 4J3FA 2VNKA 4GPAA 4X91A 4AKEA 1BQEA 1NN3A 4KXFB 1O6CA 3MM4A 4LA4A 2PU5A 3OKXA 4ZHQB 1KEUA 1CP3A 3MTJA 3QJ5A 5I7FA 3NUQA 2BGJA 2D2IA 3B52X 4CBVA 5DNUA 1TUGA 4FILA 4LF8B 4EENA 1CJBA 5IABA 1YU9A 5AW3A 3BSFA 1F20A 1G3MA 4QBHA 3ZWCA 3JW8A 2FI1A 2FSFA 3PT5A 2JGLA 3ONFA 1YJ9B 1KH2A 4N5IX 5JVDF 4URYR 3LQ6A 3DEFA 2DTDA 3OT5A 1EFAA 3NNNA 4EA6A 2X13A 5HE9A 2XADA 3D02A 3HBJA 4L6IA 4X63A 1OROA 5IUNC 2X2EA 1IULA 1R0XA 1L7QA 2C9ZA 2IYQA 1KFCB 4PIPA 1G3UA 4NZYA 4XPIA 5BWOA 2OTCA 1BX1A 1RQRA 3OHPA 3NAMA 4NFHA 1ZUNB 3O83A 4OH1A 2W4QA 3IBFA 4B17A 2LIVA 3KYCA 4Q3LA 2XUZA 4JMQA 3GGPA 4KO2S 4MVJD 4Y0NA 1U8YA 2WV9A 4ZVQA 1BDHA 4MW4A 5AHRA 1EUZA 2O0HA 3DLPX 13PKA 1B8PA 1H0KA 2YOFA 3Q3HA 1Y1QA 3CRZA 1AUXA 1D2NA 3RD5A 3ZEAA 5B3JC 5MN4A 1WE2A 2QQ0A 1ISFA 1DUVG 1FXWF 3OE1A 3LCJA 3VGPA 1GNPA 1PFQA 4LV5B 5F2OA 4BMZA 1ZNXA 2FWJA 3VKVA 3NDRA 4U0KA 1X8KA 2LP4Y 1PNQA 3HCPA 3D3WB 4FNOA 3TMAA 1YQUA 4RHTA 3T9FA 2I3GA 4TLDA 4CM4A 2VP5A 4BWFB 3ET4A 1SXJB 2OP1A 1UK9A 1FIUA 1F8GA 1WUYA 1Y1RA 2AC4A 1JJ2B 3FDJA 2HMYB 3LH5A 4OK3A 3H5NA 2IYUA 2HCJB 3OZUA 4Z4WA 1JKJB 2QNBA 4LCEA 4P33A 4LJAA 1IBKB 4MDFA 2ZAOA 2JA1A 4W1QA 3KOUA 4RC9A 2VQSA 1WA5A 2PUDA 2BF4A 3E4CA 4BB0A 1URPA 1PP4A 1C0KA 2J9FA 2Y6UA 1M5TA 3IMCA 4ZGBA 2PANA 3CKLA 1Z56C 5IX8A 1FXSA 1XAJA 3IAM1 2C5HA 1ZHFA 1VG0B 1EQ2A 2C3UA 1CEQA 2O8VA 4UHKA 3R7WA 3CNHA 3HKCB 4URVR 5ITVA 1HURA 1SZJG 3E5RA 1VJ5A 4BNVA 2G17A 1LC3A 3DVAB 1G6OA 4NFSA 1TGVA 2AOTA 2C0QA 3CN9A 1NRKA 4O3MA 3SSNA 3TSOA 1PJTA 1XDZA 1XZGA 1FS6A 3MYYA 4TMKA 3GFRA 2WF9A 3WB0A 3P9PA 4RPHA 2PQ0A 2CLHB 1LPAB 2WYWA 5FFNA 4CIAA 1N3IA 4WXHA 3FX2A 5EJGA 3IEUA 4JLAA 4NOMA 4I3HA 1TF7A 2B0JA 1UBLS 3EZGA 3I5AA 3L05A 3LTEA 2QR5A 2ISQA 4MHOA 4DT1A 5AK3A 3CF4G 3UENA 3PPVA 3D2BA 3VDNB 1L3BA 1XAGA 4UQPA 3ZKWA 1XQBA 1ZKMA 2V3CC 3O47A 3BWBA 3QX3A 4C7OB 1EDOA 1Z3IX 4GL2A 4TS1A 2G1AA 4S12A 1JHUA 4OJQA 2OXIA 2XA2A 1W4AA 2CY0A 5IJZA 3CX8A 2XZLA 5A0TA 4HXGA 3U56A 1N3BA 5JQGF 2EKQA 5E1BA 1HH4A 3D0QA 1YZHA 4NVRA 5EC8A 5FULA 1N05A 3I2FA 1AKWA 2G1JA 5E38A 3I9NA 3UNXA 2ONYA 2RHJA 2C4NA 1K2VN 3BWVA 3KQPA 4KXYA 1RW4A 1W0CA 3PV0A 4NDAA 3R20A 1OUMA 1E9AA 2RGCA 2C42A 2FUG6 3BTUA 4ZEWA 1ESDA 1MC8A 1DAEA 2I66A 4P3OA 5F4JA 3MINB 1GU1A 1RVV1 4K9DA 1LLUA 4F7WA 1RXEA 2JG3A 1TJPB 4J0QA 2B9VA 3NALA 5GOTA 1E96A 1QSGA 2IE0A 2PZJA 4BAZA 1QPGA 3TJMA 4Z2YA 3JQ9A 3RC2A 4DCGA 3NHFA 1WG8A 5KC9A 5DYIA 1QO9A 3K8OE 2D5BA 2CVOA 3ZWQA 1PT8A 4I1YA 3UAOA 3M4YA 4HB0A 2C2WA 1RHUA 1VCOA 1Y34E 3SSMA 4DWVA 1EFVB 4N54A 4Q9KA 3SXUB 4DBLE 2PE5A 2FTKE 1RZRD 4AX8A 1G8KA 4Q9AA 1MO4A 1P8JA 1WBDA 3E2IA 1HO3A 4IDEA 3HA3A 5ICMA 5L3ZA 3ZW9A 5H3CA 5J3JA 1FDTA 3QEAZ 1NXQA 1UC5B 1EXNA 1AXGA 2DPMA 1IZ9A 2PMFA 3CE9A 3D6UA 3IKLA 4W5JA 4YA6A 5CK4A 4Q4AB 4I4IA 3DE3X 2WW8A 4Q3EA 4Z3KA 3UHFA 4KI7A 4BFYA 1F3LA 3OLWA 1E94E 3HK2A 2GTHA 2Y68A 3K4PA 4W9NA 2TMGA 3ZIUA 2BP7B 1D6NA 2VUUA 2X9VA 4PGMA 4D97A 3ZBPA 3VR2D 3WXMA 1CQPA 3MK31 5JVDA 5TNXA 2DBZA 1OTYA 1E6MA 3KB6A 4GWLA 1UEIA 1OBFO 2XQIA 4Q3OA 4TUYF 5D8DA 4A10A 1S2MA 2QORA 1JMYA 1M1XB 2VK4A 3IKVA 4I4LA 3SN6A 3E61A 2PZAA 3GPCA 3PGA1 4UOZA 4YASA 3M4ZA 3EDCA 1Q3HA 1BU5A 5DM2A 3CEAA 3C3PA 3AVTA 4IO0A 4JENA 2HF2A 2PD3A 3AB8A 4G65A 3ZDXB 4M0FA 3GXBA 4YS6A 3VTKA 5JPDA 1P2FA 1C0PA 1UBTS 2I2DA 4JA2A 3WBFA 4FFNA 2CCKA 3ZK8A 3S99A 1CVLA 4IGKA 1S1MA 1R6TA 2A84A 1R5BA 3HCOA 4I50B 3SAJA 2VJMA 1KARA 4V0KA 3RROA 3PPXA 5HJ5A 4U2EA 1BWRA 4QPCA 2HC9A 1T0IA 3HZZA 3K72B 2Q7OE 3HR7A 3I9FA 1GQYA 1FXWA 3ZTWA 3BG5A 4P08A 1Z8FA 3ZHYA 1H69A 4C0SA 2XXAB 4YYEA 3B7WA 4DLUA 4GMXA 5TJHA 3KQYA 2DLDA 1OWLA 1U0SY 3E5NA 3MCTA 4CI0B 3EZNA 3T9EA 4D3ZA 2IZ0A 3HUTA 3RIMA 8GPBA 4F8JA 1W48A 4FXOA 2DQSA 4DRXB 3EHDA 3L8GA 1XLVA 4F9GA 4ABTA 3KKOA 4JODA 3TZLA 1LV8A 4E5SA 1I51A 1W0JD 3KAJA 4DY4A 1W6RA 3AY6A 4CLRA 2VRWA 4A82A 4P92A 1V95A 5JRJA 4AKTA 3EH1A 4JLOA 1IATA 5AT1A 4EQZA 5IDYA 3I42A 1Q16A 4RFVA 5TGZA 5BVGA 4FM9A 1EU1A 1GDTA 4KNVA 2VJOA 2XX3A 1PJ8A 2A1UA 1DRWA 1XMPA 2FQQA 3E3LA 2QA4B 3QG5A 4BGIA 3S27A 4BE7B 1ENYA 1MNAA 1ONSA 2CEAA 4FP9A 4N0DA 4X6UA 1HDYA 6PFKA 3AFGA 2BSAA 1PGQA 2H08A 4RPGA 1QPZA 4YWHA 1J1ZA 4ARUA 2NAFA 5AQEA 4ZAWA 1W2BB 1MVOA 3HI6A 4EYGA 1HFKA 1CQWA 2HK8A 1U7ZA 1M6YA 2V4ZA 1JV2B 3E9CA 3TSWA 4BUJA 2Z6QA 3KHTA 3HDVA 4EHJA 2WOOA 4ND5A 4KMRA 5IZCC 1JLMA 4YO8A 3AIMA 3ROXA 1W5TA 2NVOA 3E27A 3SEAA 2HA0A 4CR7A 3KUUA 2XJ9A 4LYEA 3KJQA 1TCBA 4EI7A 3GEBA 3EGWA 3PRJA 3Q9LA 2OECA 5L3QA 5B7GA 5BO5A 2F90A 3EXHB 4AMYA 5LWQA 1RWPA 2FLVA 2GO7A 3RYIA 4OH7A 3I4LA 4MV9A 4QOGA 5K0ZA 1E8NA 4FE3A 5GP1A 2I76A 3E03A 3TQCA 5ER9A 1G20A 5SZHB 2V1XA 1RYZA 1EZZA 5DYYA 1DJOA 4BNYA 3CXCB 1A0OA 1NVDA 4C4OA 1R3UA 2GZRA 2P6OA 3HBNA 2AKAB 4MUKA 5JQGA 1XA3A 1I18A 1C1DA 1M2EA 3AFIA 3GFBA 4QVKA 4ZQGA 1P1KA 1R0SA 4D9HA 4HGOA 2B5WA 4DNXA 2YKGA 1GR0A 1GKIA 1GCIA 5FXMA 2VHEA 1LNSA 2FDXA 1D2CA 2H7VA 2ZSKA 3B5EA 3DWIA 3V3TA 3ZGNA 1ZI9A 2J6IA 5BSEA 4Y9UA 2PMWB 4PYJA 1YQWA 4HNAA 4IX9A 1U3UA 2VUIB 3DDUA 5I48A 1AHPA 2X6RA 1PW5A 2GPSA 1H1TA 3JRXA 2PU7A 2O3JA 2Q0HA 4YT2A 3UUWA 5B2EA 4NJEB 1UPUA 3IP5A 4DA7A 3WL4A 4KXUA 2IOHA 3AKCA 2QGNA 3KAQA 1M1YB 3QSGA 1GDDA 3K7EA 4MTCA 3CBGA 4OQMA 4TM8A 3BUSA 3G2JA 4O2AF 4ND4A 3I01M 3QEBZ 2AOWA 2CF6A 2ZJ4A 3EXG1 4ZYTA 5SY4A 1F0NA 4UTRA 2NXEA 2QUHA 3KXDA 3Q4GA 3LQ1A 3ZHSA 5CPFA 5BR4A 2PYIA 4F6RB 3INGA 2WJ4A 5K8CA 2WB2A 2H5LA 4ZV4A 3QENA 4IDCA 1A9ZA 1HORA 2Q49A 5GINE 5CH8A 4B34A 3P9KA 1VSBA 3TPZA 5IYPA 4TMVA 1XLWA 1GZ5A 2MTBA 1DWQA 4QICA 4XDYA 1CUZA 3DQZA 3IAFA 4O3FA 2R7NA 2WDZA 1PK8A 3ROTA 2R1TA 3WQQA 5JY6A 5MHTA 2XYGA 2W4IA 4TUYA 4CQMB 5JH7B 1PG0A 2VHYA 1G6HA 1VJGA 4OD0A 1SQ0A 3CLTC 4J2TA 3TZ6A 2FCAA 4Z4IA 4UM5A 2GEKA 2VP0A 1IJKA 2JHPA 1Y42X 3UJPA 4CL8A 5K0BA 1O54A 1BHJA 3CTAA 1K5HA 2AFIA 2H8GA 4UBOA 4DIFA 5DLQC 4Q9DA 4DN6A 1BFUA 1J33A 1JHRA 1RI5A 4X7FA 2Q3JA 3L6OO 5I7UA 3OKFA 1G3QA 3LO5A 6GPBA 1UBUS 1F9EA 2FW7A 2Q1SA 3OKAA 1NJ5A 5LD2C 4UHFA 4FOTA 1QMPA 1W4LA 2O7VA 3I34X 3IEIA 3R9XB 3NM5A 4RGVA 5E1MA 3AV0B 4W1PA 4U63A 3K20A 4UM7A 5AW7A 1HNXB 4INPA 1IL0A 3Q1LA 2F8SA 4OOXA 4NNJA 3CZCA 2ISSD 4B6OA 4F38A 2BN4A 1MT0A 2IYXA 4KOAA 4K28A 3KJIA 1UFQA 2HUPA 3T5CA 2V5UA 4TROA 1WULS 1G0OA 3IPXA 1Q1GA 2F3QA 4LOAA 3QIAA 3ZJVA 3AIIA 5K8VA 2OORA 4FMCF 4Q00A 3W8RA 1YS1X 1GPNA 2F43B 2WZNA 2G9ZA 2H1HA 1SCBA 4ID3A 4JB2A 4MV1A 3MWLA 1N2OA 5CX1B 5H02A 3V3KA 4NTZA 1TJNA 1ML4A 1WDWB 4MLCA 4ARBA 1YHQB 1WPRA 4DANA 4C6TB 1E7SA 2P2CA 3VR3D 1CQJA 3L0BA 4QG3A 1DWPA 1JXAA 2H0RA 2E6KA 3OMLA 3RT7A 2WUEA 2H9IA 5JW6A 4YI5A 1T1EA 5FA5A 3LOUA 4GKKB 2F00A 4GL4A 4M9XA 2JEOA 1Z39A 4Q39A 2QXTA 1R2QA 4YJ2F 4EHIA 4RD4A 2A86A 1P0CA 4LW8A 3VR5D 1W0JA 5A0FA 4BP8A 4CL2A 1NATA 4F71A 5CP8A 3ZC3A 1NW4A 3AQIA 1I3OA 4GBGA 4PABA 4XFDA 2Q62A 2HNBA 3GT4A 1CVIA 3DZFA 1N57A 2R68A 1L1FA 3ZZ0A 2C4UA 3INYA 3BHMA 1V35A 4DB2A 1XQVA 5DCUA 1WDLA 2NQTA 2XCQA 5SYNA 5K3FA 5JMTA 1T8UA 3CF6R 3UUGA 5LM3A 1KZ6A 2R6FA 2WP0A 1LK5A 3KKLA 3OZFA 4UTOA 2AKEA 5TVGA 5K3AA 3ETCA 1TW3A 1C2TA 2OHJA 1VLLA 1K1EA 3QF7A 4DMRA 5LYJB 1OC2A 4LTNA 1PCXA 3EEQA 2CNBA 4MWBA 4Q1DA 1DJPA 2PT9A 3H6KA 4FUTA 1NVVR 4RELA 3W2GA 4P7FA 4BUCA 5DP1A 1UD3A 2J0UA 3M6VA 5K51A 1DADA 4QPDA 4P2BA 4MRNA 1P6UA 3EUFA 4WACA 5JYEA 5K20A 1ILEA 1J00A 3CWZA 4Q15A 4Z1OA 2B8TA 1C1XB 3AF5A 4JJEA 1PEYA 3BMXA 4YDSA 2OCKA 1BLIA 2ZB7A 4B3IA 5HQ3A 2BDUA 4HJXA 3E22B 4KRXA 4DV7B 1TM5E 1XL1A 1QE5A 3WS7A 3RYCB 3SDZA 1RXYA 2QIPA 3GOQA 2OFPA 4NV1A 5JO9A 4V1CA 4UE6A 1VQ4B 2VEOA 4MQMA 2B92A 4M76B 3HNOA 2YMMA 1RAAA 3ORHA 1W5SA 3EQ9A 4N5LA 3CM0A 4EABA 3GT3A 1F9AA 4B74A 1D07A 4W6QA 1YQ9A 2IGTA 2B34A 2IIBA 2YTZA 3SX4A 4O2AA 4DFDA 3HBMA 4TWJA 3C6QA 2P6NA 1C3XA 1KDTA 1FUEA 2FPKA 4ZIRA 3ESZA 1FYXA 1N5LA 5ELXA 2GCNA 1QP4A 2TYSB 2QJTA 2D4AA 4W1RA 4C0AC 4B4VA 4K9NA 3DR5A 1Y6FA 3EK2A 3GWGA 3TRDA 4ZZ0A 1L9XA 1XVTA 2W2LA 5LIPA 4AMZA 2C2ZA 3O5AA 3UXEA 1R6BX 2EEZA 2OVBA 4H4CA 4HVCA 2DOKA 2JAPA 4MO2A 1I5EA 1XWFA 2UZ4A 3ASPA 4ZPXA 4ENVA 1XU7A 2VDNB 3QBTA 5AI9A 1ZSVA 2E9SA 2WILA 1FPQA 4CM1A 5G4KB 1FPMA 2PH5A 3LYHA 2VPQA 3P2JA 4LZWA 4G5HA 4M1OA 4ZAZA 2C96A 3FYHA 1PJBA 1R0RE 4CODB 5AI8A 3RK1A 3U44A 4Z53A 2VKTA 3NV7A 4CMEA 1UWKA 4JR0A 1FNSA 3FXAA 1KJIA 2MSNA 2ZPAA 4PQYA 1BC5A 3ENQA 1KJ8A 1XZPA 2PLAA 2RB5A 4QYXA 4RMJA 1YZFA 3Q5EA 2I6XA 3EW7A 3CLHA 5TC4A 3MPUA 2E37A 4JL5A 2PLNA 5A5EA 1S8AA 1JB1A 3A3BA 2BFOA 2IIPA 3FRJA 3PF8A 5LQNA 1IBRA 5KYXA 1ZBQA 1ADGA 1N8SA 3GGDA 4A0SA 2BMWA 3CC2B 4GOND 3IOYA 4BBZA 4BEJA 2YNMD 4Q6WA 1CUJA 1VKHA 2PZ8A 2IBTA 5DLYA 1IPHA 1ZRHA 2Z2XA 1JP7A 1PSZA 4GM4A 4KWHA 4PAMA 4JI1B 2GRJA 4E94A 4L9AA 1M8FA 1NW9B 4ATNA 2Q5OA 1KIFA 2PM8A 4XX1A 2BPOA 1WVGA 2CNOA 3P9CA 2WVJA 5A6VA 1P7PA 4HGNA 2Z9BA 1VOTA 3VOBA 2DE0X 3FSJX 3IQIX 4WLUA 4ZD6A 1IZYA 1W85A 2VVTA 3G8AA 4KGDA 3A4NA 1DRKA 1ID8A 4HNVA 3BMQA 1U0FA 4DWOA 2QRVA 4WVFA 3AR7A 5LXTB 4DYVA 1KA9H 3PC7A 1XXHE 4B84A 2YJ6A 2HHCA 2YWGA 3ZKAA 3FRHA 1UPBA 2F3SA 4O1HA 3VAZA 3U7GA 3LX8A 3M6MD 1X2BA 4G0YA 2R5NA 1FTGA 2Q3LA 3VDMA 4AIRA 4YJ2A 1IPFA 1PZEA 1X7HA 2QA5A 3AF2A 2BE7A 4B1FA 4BVEA 4F4FA 5H82A 2B21A 5EPUA 1E69A 3E9ZA 3WL3A 4QIHA 1PJCA 5BNTA 1AA9A 2R1ZA 3B70A 4PONA 5CGZA 4LAFA 2W2KB 1RJ9B 3HFSA 1NI4B 4XLHA 3O84A 3D0OA 4BTVA 4KKTA 4DNRB 2G6TA 2GX6A 1VQPB 4EF6A 2EJUA 1JRLA 2XUGA 4TM7A 1L4YA 1RQNA 1K9VF 3N8HA 1JH8A 2Q41A 2Q8PA 2Q8QA 2Z1NA 3IIMA 1U0LA 2I33A 4PSUA 3P1JA 4MK4A 3ZDFA 2EZ4A 5GMOA 5KPJA 3OA2A 1U02A 3OPVA 3RBXA 4BX2A 1PZFA 2ZIZA 3GVKA 5LB4A 3WO1A 5LQUA 1HC7A 1VFPA 2OBTA 3ISXA 1T9HA 2P62A 3A2MA 4MH0R 2PRZA 4RJKA 3KQHA 4YMUA 3L4BC 3UMGA 1SOVA 3ZVLA 1XXHA 5ARCA 5IAKA 4CKEA 2RSLA 4RPCA 1UIRA 1MJGA 2VZ0A 2Y0EA 3K1ZA 4EY4A 4ER5A 1SCUA 1GUZA 2Q5CA 1HZZA 1X80A 2QT0A 1T8YA 1TZJA 1YI1A 2IS6A 1OZGA 1QHIA 2HZ7A 2BTEA 2RAPA 2X7JA 2ZUSA 3AJ8A 5KSWB 4J1QA 1Q0SA 5FL7D 1RT9A 4NFLA 2PH3A 3MTQA 4CQNA 2VDVE 3W06A 1Z47A 4KLCA 1SC3A 2BCGY 1ZIXA 1JPJA 2VZ9A 1O6ZA 2JGKA 2NVWA 2Z9CA 5AHOA 3WLJA 1YUBA 1N2IA 4XWTA 1KERA 3CLVA 1DQYA 3NJ8A 3OM0A 1L5WA 4RPIA 4TV8F 2NU8A 1PL8A 1OXVA 3DA8A 4OK5A 2ZL7A 4NK4A 4RNCA 4YK7A 1ZINA 3M6UA 3GLSA 5AKKA 1MW8X 2R8YA 5E6UB 1NQVA 4BASA 3Q8LA 5AOVA 2PAFA 5F4MA 3E9YA 4L5IA 3GUHA 2AFRA 4A6EA 2RD2A 1K7XB 3TIVA 2CXSA 2MYUA 2J3QA 4BYGA 3IL2A 4RVNA 1NVBA 2RK3A 1UAAA 4WCDA 2Q1TA 2LNDA 5I9MA 3WAGA 1UR5A 4FGZA 2GBPA 4OIFA 3QWBA 5A05A 5HIIA 1VQ6B 4P0TA 1AX9A 3SF8A 4F5ZA 2X4DA 2X8KA 3ODGA 4IOJA 1U0BB 2V6JA 2X0IA 3BD8A 3V2GA 3RB8A 1RWNA 4GZMA 4BO5A 1SVMA 3V5NA 3TIGA 2D59A 5CCXA 1S2NA 5L6MB 3DD5A 4IUDS 2EF0A 1YU6A 3F6EX 3NHZA 4B5KA 3A4MA 3H3XA 1ZX1A 2H2AA 4A15A 2ZUUA 1DG9A 5GONF 5C5CA 5INTA 1YZLA 2ZJFA 1SHLA 1JQJC 3BOSA 1H5NA 1J2TA 3FD8A 4LY3A 5AK0A 3GNTA 2VLBA 3K6KA 5T4BA 3B3GA 3GYBA 4A6XA 2I1WA 4WXEA 4YXFA 2CZGA 2A5DA 3TB4A 5LYYA 4YCCA 1HKHA 1PGOA 2AC2A 3TM5A 3BJRA 3MBOA 1Q74A 2OOKA 3P5BA 4BVHA 3AZPA 3P4UA 4MIYA 4KN5A 1F0YA 4BCDA 1AUPA 4F9EA 2BHSA 4XVRA 5AIBA 4LMAA 1GUBA 2WJ6A 3AG6A 4I4CA 4H1UA 1C3OA 4LJ4A 2PUVA 3Q7PA 5FPKA 3NWEA 5F1KA 4S05A 4B71A 4N5DA 1XZCA 3MIIA 3AI1A 3PKIA 4H3KB 3CO5A 3TKLA 2NO1A 1L8LA 4QOSA 1L1EA 1DAPA 3B36A 3H8SA 3OWOA 5IUJC 4G3XA 5JYBA 1PZHA 2E4AA 3WB2A 2VYQA 2A92A 1KBQA 3O91A 5C81A 4MR7A 2Y05A 4OCZA 1GPDG 1BMFA 3KCNA 1XHEA 5AVRA 2IEZA 1OZFA 3ASRA 3OU6A 1N33B 1D2MA 3T8YA 3L8HA 4FMDB 1NLUA 2V96A 3IPYA 1UQTA 2V6MA 5EHNA 3ZWMA 5BOVA 2F4NA 1XMSA 2F3RA 1D6SA 3BSSA 3FOBA 4LE1A 5F5LA 5FBQB 3ENNA 1BDJA 2EEPA 3D8TA 4D2IA 1YCDA 2H6EA 2A5GA 3EHEA 4M7WA 1GTJ1 4HAZA 4JT9A 1NRWA 3G2NA 2C7GA 1E5TA 1VLVA 1SFRA 1Y5MA 2EX0A 4CMHA 2PX5A 5LP1A 3RARA 3OCWA 1CDOA 2WTXA 1U3WA 4M1ZA 5CA1F 3O3NB 1P1HA 1QZUA 3LC7O 3QX8A 1DIAA 1M33A 2ZXHA 4DM7A 1JWAB 3LY8A 4DG5A 4PS0A 3ZV5A 2Y0CA 3I01A 3LG2A 1Z4OA 2GMWA 2W6IA 1GV0A 3GMIA 3IHTA 3L8MA 3NEPX 1RXVA 2OYNA 5CNJA 2RCYA 3L0ZA 3SQOA 4MVJG 3TL6A 2J45A 3BGVA 3E0QA 3ORYA 2J09A 5JAMA 4FINA 1DQSA 1Z88A 1L4KA 2BFPA 2D00A 3BTOA 3CNQS 3F7OA 3WP1B 4NOJA 1PUIA 3GRZA 3AL3A 2F3TA 4HK4A 3HACA 3I09A 4RVGA 2JIMA 3ABRB 1QLJA 1QHFA 3P0JA 5KJCA 4N5NA 1QVZA 2ZWOA 1DI0A 4LRWA 3B9PA 4BJ1A 2C5AA 2I6QA 1KJWA 2F2TA 1O95C 2V59A 3FDXA 3W5UA 1N9KA 4Q9JA 3RLIA 3SY8A 5IYNA 1Y9AA 1NE7A 2KLHA 4MWDA 1ZMTA 4XLLA 4CHTA 4DMCA 3WIVA 2XQFA 2YQ4A 3WICA 2ZYHA 3HS3A 4PN7A 3FVVA 3R4VA 4ZO4A 4DA0A 4TZ6A 1KEWA 3DC7A 4TV8A 1EX6A 1GSOA 2R4UA 1QMGA 4ZOLF 4CV2A 3TNJA 2SCUA 2MINB 2XGOA 2FPUA 1TKCA 5CT5A 1DBIA 2GN1A 1JEDA 3EXHC 3I6MA 4GT1A 4DQVA 3TR0A 1F12A 3KO8A 3CVVA 3ST7A 5EZ5A 1NP7A 1YJ8A 1RMQA 3JSAA 4U9HS 1V16B 4AN4A 4BNNA 4FR5A 2A0KA 4MW6A 3W5VA 1K27A 1Z0ZA 3OPYI 3PGMA 2VLIA 1R37A 3T06B 3GP8A 2F4VB 4HF7A 2O8DB 3WL7A 4KO8A 3NETA 1R5JA 4OOFA 3M7IA 2WWFA 2GHIA 4J07A 3HO1A 2DSTA 2NT3A 1FMFA 1JLLB 1C0LA 3M4JA 1W36C 4YWJA 2HO4A 3D7NA 2ZXFA 1G5HA 2YHIA 3MVEA 3RS3A 4ALIA 3U0VA 2PMKA 1WEHA 4MP3A 1GQRA 4PRZA 3CLSC 5GONA 3R1IA 3A2KA 4II3A 3OI7A 3CPSA 3OHMA 1U1EA 1WV1A 4O4LF 1GADO 5BQ5A 3VSAA 2Q6LA 4LXXA 5LP6C 3PG5A 3BF7A 1O96A 4WV3A 5F78A 1KKMA 4H08A 3MUNA 2QYOA 4CR6A 3N5CA 1JS1X 1ODJA 4LPSA 4N0QA 3HBAA 4NC9A 5JS2A 1CUWA 4Y2GA 4P12A 5TQ0B 1DFGA 1VE6A 1PKVA 2NQ2C 3BS4A 3I5UA 3RVBA 4AG3A 1NY6A 2OAEA 3BMNB 5HBRA 5LMZA 5JZMA 4FE4A 2XNSA 1WZCA 5DSXA 2RKBA 1G21B 2IEIA 4JUDX 4V24A 4RO0A 2W6MA 3D5EA 4X00A 1BKSB 5BT9A 3Q10A 2AOXA 2G72A 2RHRA 2EW8A 2YVLA 3NIFB 421PA 4E5YA 1V3QE 1TLTA 4YMWA 1IBSA 1RJGA 1SG0A 1DO2A 1RBYA 4JLPA 5LJIA 4X65B 4X95A 3U7QA 4PSCA 3Q7IA 2ID8A 2VDWA 1NJID 1EBBA 3HJAA 2OFFA 3SC2A 2Y4OA 1MB4A 1XTIA 2BYTA 1OV4A 4BB9A 3MMPA 2IZOA 5EMLA 5EXEA 1DAGA 1GT91 3T56B 3EVFA 4KR9A 5ECWA 2ZSJA 3NOOA 1ZL2A 3ZDYB 4WDQA 2O2GA 3ABQB 2I4OA 4H6PA 4UHBA 3LUHA 4LHYA 2BGNA 2YHBA 4FLEA 1TLFA 4K86A 1LGYA 5ITZA 1ZZGA 1QZXA 2CSXA 4AICA 2B9EA 4C0XA 2EDCA 1PT9A 3IAXA 1QHXA 2WIFA 3LKZA 1R4MB 3WLLA 2UYOA 2V7EA 3OPYA 5DBFA 3WVNA 2GBIA 3FLBA 2V45A 4EKYA 4HKTA 1IY1A 1ZGBA 1ZXBA 3AILA 1J0DA 1JFVA 4KJXA 1X1DA 4KU4A 4R98A 4Y6OA 2OG1A 3PUKA 1ZISA 5EAIA 4ZALA 1BN6A 3NR2A 1IEXA 4HRXA 5AM5A 3P4XA 1EYZA 1ORHA 2VDQB 5DTRA 2CEKA 2VHVA 5GOZA 5EMKA 3H1BA 2A0XA 2HREA 3Q72A 1QUEA 4OU4A 4D99A 4KUHA 2IYOA 3P9XA 5CLGA 3RF6A 3X3HA 3ZTYA 4D9IA 5CA1A 5CITA 2BGUA 2XHEA 4OQEA 1EWVA 1SQ6A 4G5QA 4C6RA 3D7LA 3GU3A 2X22A 1NR1A 2JAHA 2CNNA 4IFIA 3NM4A 3RU9A 3A37A 3UVEA 3WR5A 4DLRA 4HN9A 1JJFA 4LVNA 2I80A 5I45A 5KNCD 2ZPTX 3TOZA 3UK2A 4EF4A 3MT9A 1JXQA 2ZTLA 3K8ZA 2GZDA 4XKVA 1YV9A 1LK0A 1ZRSA 2J5RA 2Z8XA 1VDMA 3KQTA 3KOZA 4FDMA 4QGSA 2G4LA 1W5BA 5F73A 3AM4A 4Y2YA 3ZWVA 4AY3A 3RYTC 4CIYA 2OYCA 1JAHA 1FSGA 5T5QA 2D3NA 2D1FA 4B6FA 4NMLA 5DBOA 5BMOA 2PMCA 3Q6MA 4EKEA 4Y2VA 1WM1A 5FI3A 4JP1A 1XTSA 2Y2UA 4D81A 3PEYA 2HCTA 2D2EA 1VG1A 2X41A 3KR1A 2DHQA 1Z06A 1WCYA 1CY1A 2HW8A 1IOWA 2H7YA 4I6GA 4LY9A 3N28A 3BILA 5AIAA 3GLRA 1MOZA 5MGBA 4QC2A 4BXOA 1J8DA 3UY4A 1WSVA 3IAEA 1MX1A 3IQWA 4LJLA 3VDQA 2C3OA 1ODTC 2NG1A 3GMTA 3G85A 3AEKA 4NU8X 3OIVA 4LNUA 2ZJ6A 3K92A 5HRAA 4ZOLA 3VMFA 2KW5A 5HGXA 1UC4B 2WYUA 1LLCA 2ZROA 3RYHB 4FKZA 3CINA 2A8YA 1A98A 5KQSA 3ZBUA 5F2NA 2WG1A 4NCIA 5H81A 3AF4A 2G7MC 1V5GA 1V5WA 3WBJA 2ZT8A 3IA2A 3DBHA 3TQRA 4DLLA 5BYKA 1FJGB 5DM60 1TUIA 2FN7A 3VYVA 2XVYA 2XY4A 3BZUA 1WQ4A 3HDQA 3IBGA 1B7GO 3OA0A 3PHJA 3RFUA 4QFMA 1XTTA 3NFRA 5B58C 4MS3B 1BD4A 1JTVA 1XNJA 1MGPA 4XOUA 1X19A 2J46A 3WP0A 3DB1A 1YDGA 1ODSA 4G1UC 1P4SA 4JAVC 5HQTA 1F2UB 3S1AA 1UZMA 2I65A 3E7WA 4JKYA 1TC1A 1QIHA 1UXIA 4V0LA 3BH4A 2WD7B 2QLBA 1A8QA 2ZVJA 2JCXA 3JSXA 4S1PA 3DVQX 3FPCA 5TF0A 4BBAA 1GV1A 2PGDA 2PGNA 4O4LA 5FBHA 1Z6PA 4NLLA 1KK1A 3JQBC 5DMHA 2AD5A 1L8QA 2ZYUX 2D2XA 2Y93A 3QBDA 4IPTA 4NMWA 5FKJA 5CFLA 2WJWA 1CYEA 1PW7A 2A78A 1Y3BE 2XB6A 2JBWA 3E9DA 5C80A 2IYTA 3HWRA 4WBNF 4L95C 4P7BA 1ZGAA 1P1IA 3QVVA 4DTCA 2EHJA 3KPYA 7MDHA 2ZWVA 4J1NA 3HI4A 2Y1OA 2OBLA 3CF2A 1J8VA 4KO4S 4BRUA 5B3LA 1RZVA 2HDOA 2VKQA 3UO8B 1UBEA 3JYPA 3TZEA 4MQLA 3QH4A 4FUQA 1YZVA 4RQBA 1H9BA 4FMPA 2ZRCA 5B3JA 5E6RA 3BHNA 1COWD 5KNDH 3ESQA 4EFMA 1LDYA 2R6ZA 1RMTA 2AVNA 1MH9A 1YBHA 1N0HA 4FWIB 4PX2A 4EGJA 2IU3A 1JHVA 1JHPA 1I80A 1N08A 1EVYA 2JK1A 2FKNA 2Z2IA 1T3SA 3ODPA 1LCIA 1ZW1A 3R0XA 1F6DA 1U6JA 2FPIA 4MYTA 4RVDA 3AV3A 5AI4A 4F97A 1NUPA 1UKEA 4YMVA 5C35A 4YJHA 5LL6P 1EEXB 3G6EB 5FWYB 4L5JA 4X0EA 2C2YA 3HCDA 4IF6A 4OXKA 3CS3A 2ILTA 3PXGA 3GDFA 3H2ZA 3C85A 3JYLA 1DSSG 3R5FA 4X07A 3T5GA 5AVQA 1RAEA 1M8JA 1M73E 1OY1A 4Z7JA 3BXOA 4GLBA 1M2OA 4K87A 5HJ2A 2A88A 2VP3A 3EGDA 5DGHA 1HL7A 4OB8A 1D9XA 3ZCUA 2FMHA 1FLAA 3LHSA 5BQOA 5B55A 2IS1A 3TWOA 4XOPA 3TQFA 1DC7A 4N0PA 2BKVA 3AYZB 4IQ0A 3L07A 2VNIA 5CW2A 4DIEA 1FYFA 3OOSA 2H65A 1Q7CA 1Z4MA 1SGWA 1TMGE 2R1VB 3O92A 3OM1A 3W5DA 5AVXA 4BCBA 3UOWA 2GCGA 3EA4A 3ACDA 3EBPA 3RG8A 3REQA 2FSIA 3RS0A 3S5UA 4P4SA 3GFGA 3BXXA 1NYTA 2ZE6A 4HWSA 1H2EA 5B53A 3AERB 2RGAA 3K9BA 4IX1A 3M6WA 1Y6QA 2GPJA 3EF0A 3VC3A 1MT3A 2PQ2A 4G9EA 1E9SA 1O03A 2FMKA 2R97A 5CJPA 2X8JA 2ORVA 1CP2A 1U2DC 1Z37A 2VCYA 3OFVA 4JSYA 5KKNB 2IYEA 4DA9A 5LZ9A 4G9BA 1VG8A 3E9RA 1VKRA 3N87A 4I19A 2PT7A 2ZI4A 2NU6A 5KSOA 3WJ7A 1QGDA 2GK7A 2CXQA 3N2KB 2YVQA 1BZYA 4KYVA 3MJDA 4XSHA 1YHZA 2Q5FA 3M82A 1U7DA 2FHPA 1WCIB 3I1FA