1RQPA

Crystal structure and mechanism of a bacterial fluorinating enzyme
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
291
structure length
291
Chain Sequence
b'RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-fluoro-5'-deoxyadenosine synthase
molecule tags Transferase
publication title Crystal structure and mechanism of a bacterial fluorinating enzyme
pubmed doi rcsb
total genus 77
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2003-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 1rqpA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 1rqpA01
2V7TA 2ZBVA 5FIUA 2F4NA 2C5HA 2V7WA 2WR8A 2CBXA 2Q6KA 2Q6LA 2C5BA 5LMZA 5B6IA 1WU8A 1RQPA 2V7XA 2V7VA 2CC2A 2V7UA 2C4TA 2Q6OA 1RQRA 2C2WA 2ZBUA 4CQJA 2Q6IA 2C4UA 2CW5A
chains in the Genus database with same CATH superfamily
4FFWA 2EFYA 2ZE6A 4F9FA 1C9DB 4RAQA 1TYBE 1KVRA 1ODFA 1ZGGA 2X6QA 1YMQA 3GIDA 1JIQA 3WIBA 1M7BA 1YI0A 4UVDA 4MITA 2J9XB 2VL7A 4HOYA 4TXHA 3EXHC 1NNEA 1YV9A 1A95A 4QFBA 3VR2A 2QG4A 4O63O 3P94A 2PD6A 1UWKA 4LXXA 2JG3A 3IP9A 1YOVA 3KYDB 2J7PD 3KL4A 1MJGM 4BJHB 4C43A 4UTRA 4Z4IA 1Q1EA 5D2CA 4ZVRA 3U7JA 1NRWA 4DIKA 4FC6A 4NJMA 3RODA 4BP3A 3NBFA 1AF4A 4YCLA 3BGIA 5DLDA 5A04A 3ONFA 5I45A 3T5BA 2XKKA 2POCA 2QT1A 4H7DA 1WIWA 2CZGA 3FZNA 1GYRA 4EEZA 4HAOA 5IKXA 3NGXA 3NHZA 1QJ4A 3OAAA 1P44A 2O2XA 5GGXA 2XOXA 2JJMA 2Q9BA 3BT7A 3BYZA 3H42B 3OJWA 1NVMB 2MSEB 1YHQB 2JD2A 3ONWA 2F3UA 4KAXA 4UPDA 3W1WA 3QE3A 5GIOE 2B30A 3U3ZA 3JQGB 4OV6B 1GJRA 2PVSA 1QKJA 4PYMA 3VPAA 5JSFA 3HXMA 3K09A 4DV7B 4LOHA 4IRXA 4ZHQF 1NYTA 2VKTA 3AETB 1RE1A 1A1SA 4NJOA 2R8ZA 2JHGA 4KC0A 4M8KA 3GU3A 2C2KA 5HEKA 3SQWA 1PZFA 1LDNA 1ZSYA 3P97A 2QVXX 2CNLA 2PWAA 2W2LA 4NMXB 5C37A 1WUTA 3TB4A 4DRZA 3KBOA 4EJSB 5AW8A 1ZZEA 1THMA 3KWLA 2WF8A 1SVOA 4X63A 1QH8A 4LHWA 2C8LA 2EZ9A 2FSVA 3KL2A 3PT5A 4ZODA 3KLOA 4C6RA 1ZGBA 3LVQE 1LPBB 3EAQA 1X7WA 1SQ5A 4INOA 3T15A 4K5QA 1TJ5A 1CUFA 3M2TA 5AW7A 4W5TA 2NO4A 2A3RA 2BTQA 3GWZA 4FFOA 1MORA 1NXQA 1W76A 1NUTA 4QU0A 1EWRA 1J0AA 1PAUA 3HR8A 4LJ4A 1RMQA 1XZKA 2H3HA 5C4GB 2G9NA 4ZOLF 2Y0EA 1BNCA 3FW1A 1F2UB 3W5UA 1R9GA 4BZXA 1QH0A 1NNSA 3ACBA 3B3FA 4JLJA 4S1TA 4EGSA 4OL0A 5ALNA 2NTJA 2Y9MB 4GZ5A 3WMFA 1KSHA 3FLAA 4AWBA 5F4OA 1JLSA 1F48A 5KEIA 2AUMA 3LL4A 4CIAA 2YC2C 4W9MC 1U04A 1Z35A 2DJIA 2KX7A 4XTRA 3TQIA 2JIPA 1OXBB 5KNDA 3BWEA 4FHGA 4F1KA 2NSHA 2A58A 3DCIA 4AJHA 1EFRA 2QGFA 1ZISA 3OOYA 5J2TF 4YN3A 2IIVA 1SVMA 2BTOA 4OP2A 3JZFA 2FGJA 2ZXIA 1U3GA 2NO7A 2ZUBA 4KX5A 4YYEA 3THXA 1RWQA 2BFPA 1I2ZA 3GH3A 4AXXA 4D46A 5JSKA 2GEVA 2I8LA 3ZGNA 2C2MA 1SXGA 1VKHA 2Z8XA 3FY4A 1MAAA 4EB6B 3QFFA 2EKQA 4AY6A 3LPDA 3BXHA 4TN5A 2RG1A 1P8JA 3A70A 4G81A 2DF8A 1JR2A 2BAGA 4CQLA 3U16A 5FI5A 3T1QA 4BWFB 1C7ZA 1XTBA 1FDTA 2COUA 3QKTA 5DBOA 1L4BA 3UMGA 1FNSA 3RRXA 2VNIA 5CLJA 1J9GA 1E2NA 1DRWA 2JDIA 3WWOA 1FYEA 2XTJA 4E14A 4Z0TA 4EHJA 3OWHA 5T7BA 1DPGA 1DJNA 1VHDA 2BLNA 2WWFA 4HFJA 4C2UA 1XCMA 1JEJA 3UMVA 4UM9B 2DX7A 3C74A 5F23A 5K4GA 4DUPA 1JKJB 2C4MA 3VU3A 3QPUA 3SGLA 1C0PA 1U94A 1CRQA 5L4NA 1EFCA 5IYNA 1H6AA 2ON6A 2Q07A 3JQAA 5EUCA 5EJ8A 1XEXA 3CURA 3D59A 2VYFA 3GLRA 4QYIA 4G1VA 1KEZA 1E5XA 1YJXA 1QB7A 3DE7X 1U8XX 2GJSA 2I22A 3EFBA 3IAHA 1QRSA 1UBHS 5EEHA 4K2AA 3OZXA 4DSUA 3E20A 1VM6A 4PPFA 1YWGO 3I3OA 3P52A 4CLOB 1WM1A 2O7VA 2B83A 2GEKA 1L1EA 5EJ4A 2RC6A 2ZIVB 2VPIA 2O8FB 1QX3A 4JI5B 4JC5A 3IJPA 4URFA 4UOEA 1FYDA 3DC2A 3DCNA 3OM1A 4J0EA 5HM8A 4QUIA 4WLNA 1L5FA 1OASA 2FFQA 2GRJA 3F5FA 1EGVB 2WSYB 1T36A 2A9FA 3FTNA 2R1VA 3K20A 3O26A 2G76A 4JI3B 3PDHA 4BRUA 2NZUG 2GZ1A 3AKYA 3Q8MA 1BXGB 1WDWB 2ZSFA 1RXUA 2HBZA 4XONA 1T4MA 1QH9A 1YCHA 2JLAA 3L8ZA 4FOTA 4IX9A 1IMJA 4OHBA 3C1TA 4PZUA 4RVOA 2XWBF 5IAGA 3F46A 3SHQA 1ZXLA 2VNSA 3OQOA 4K46A 2XB2A 5EEGA 2JFVA 1PFQA 3PSAA 4O1MA 4XD7A 1MGPA 2DE0X 4HAZA 4LWPA 4P0TA 4OQ4A 2IXFA 5CFRA 3HB1A 3VC3A 3PPYA 2HBRA 4MMYB 1A82A 4J8PA 5AKZA 3AEUB 3B6ZA 3ZGZA 1GSIA 3R7AA 4EUHA 2D3TA 3RD5A 3RDPA 2WMOB 4UCXA 1CD5A 4EG8A 1P2TA 1JHAA 3B53X 1I30A 4WLFA 3LGXA 2IU0A 2VJNA 1IOZA 1SXIA 2DUUA 2R8OA 1RLMA 4KFSA 2Y99A 1AMOA 5J2TA 1EFTA 1U4NA 2C00A 3HCFA 4PEVA 4QXOA 1OWLA 3KU4A 1FPMA 5CT4A 2WPNA 2Q5CA 4FN5A 2CFRA 3U3JA 3UPTA 3TN7A 1HLFA 2W6JD 3HRKA 3JRNA 4GYKA 4F1JA 4JJ8A 4N54A 2FKNA 2JAWA 2OVFA 4R0NA 3ZU5A 4H6VA 4LKRA 4PBRA 1LDGA 4Q4LA 4W5WA 1G5HA 5MDHA 4JLMA 1G6HA 3HJCA 5B57C 4OQPA 1SO8A 3MGGA 4RLHA 4QXQA 4E4RA 1XQ9A 3ZDDA 4RFSA 2VQDA 3TW8B 1U3VA 5JLJA 2QN6A 3ICEA 5AJZA 2KI5A 2WVHA 1KYIA 4I3GA 4GLOA 3VVMA 2EG9A 3PA6A 4RMIA 1L5VA 5AW5A 4RWEA 4CCYA 4DF3A 1T8SA 4DC9A 1H2XA 2PXAA 1SUEA 2AOVA 2VG8A 5KTSA 2WIKA 1IG3A 1VLLA 1ZHFA 2C1ZA 4A1OA 1EDEA 2EATA 2ZTNA 2Q7OE 2C58A 3OT5A 5D3KA 4R81A 5H0IA 5FI1B 5CAEB 5C1DA 4YRSA 3INTA 4DC1A 3K9WA 1EWKA 2ONYA 3UA4A 4Z4CA 1DCKA 2DBZA 1DAPA 1J9EA 3ODPA 4R1MA 3W8RA 2BZGA 1XVUA 3O95A 4TLBA 3ETDA 4N7RA 4ISBA 1KZHA 4GOMD 2C78A 3OTIA 2BGKA 4W8OA 4N40A 1DO8A 2ZIGA 1ZI9A 1Y0RA 2A7QA 4TS4A 2NZ8A 4L50A 1GR0A 5TPWA 2C61A 4BB0A 3AYXB 1ZXXA 1H1DA 1VL0A 2C29D 2FEWB 1TUEA 5IDYA 1Y4AE 1ENPA 3Q6RA 1GV1A 4B6QA 4DSNA 5CG1A 1JW9B 2AFIA 4LFAB 2E4VA 1DHRA 1NP7A 1O08A 1S2NA 3CO5A 4Q3NA 4R1OA 3OWXA 3RVSA 1NFRA 3UKOA 4E0BA 2PZGA 2CHGA 4WOCA 2C5FA 4IOKA 4R84A 5AUPB 4NFHA 3OETA 4V0MA 4WWVA 3WNDA 5AM5A 4B34A 4KR3A 2VDPB 4E09A 4XLCA 1G6KA 1UD2A 3A4IA 4AJ4A 1BKSB 1YZTA 2N1MA 2HO5A 3NHSA 5GOZA 1U7WA 4HX5A 1KC1A 4KNWA 2YWGA 3VDQA 3UC5A 3HK2A 3B1FA 2MR6A 1G20E 3N07A 4W4TA 4CRWB 5L3QB 1IBLB 3AHJA 4CKYA 1V9SA 1TXGA 3P19A 4RMNA 1K8YB 1HEIA 1XTTA 2HMAA 3EC2A 3BMQA 3WA7A 3BIFA 3BWBA 2XCQA 3IP8A 1FNBA 2A1UA 5IARA 4BFVA 1G3UA 4QKQA 1OILA 3JQ9A 3U48A 4XYGA 1E20A 4N6GA 4YECA 4V1CI 1H1TA 1ZH2A 3N7UA 4D41A 4WN9B 2F1RA 3O82A 3IIIA 5FEMA 5J4HA 1HWYA 1VQKB 1T0IA 3V8QA 1J07A 1FQKA 3HB7A 3PJDA 5AJTA 4GI5A 2XYRA 1W4LA 2WILA 1N75A 4N12A 5DEIA 2VJOA 3SIXA 3IIKA 2Z09A 3BE8A 3M4JA 5D86A 1VG8A 1U6IA 1VIDA 4ISCA 1QCYA 3AEKB 3CUYA 1ZFNA 2VI5A 1XLTC 1AO0A 5FJJA 3TCNA 3SLNA 4IMIB 1A2BA 1QG4A 4OI0A 1FFYA 3IQEA 3C45A 3CVWA 3MA0A 2PUEA 1JKJA 2VLBA 4L72A 2PD4A 3HKDA 1J06A 4CM9D 3KTAB 3NNSA 3BQJA 3OUTA 2GJPA 4GICA 3NALA 3PUWA 4TRNA 2IK8A 5KWJA 5HUQA 5MHTA 1RWKA 1WQ4A 3IBGA 4UBKA 5FA5A 1A9QA 5LYJA 1CJBA 5C4IA 3T9FA 2RG7A 5TPZA 4BAGA 2XNKA 3ZDBA 2FR0A 3WP1B 3GFSA 4XH9B 4B75A 1H9AA 1MC4A 2A5LA 1NTOA 2H5EA 3U80A 1CQWA 1GAEO 4WKCA 5B4VA 1KJIA 3MRTA 4TTTS 2PZKA 4MVJM 2AR0A 4XIYA 5BN1A 3EG9B 1KGDA 4PLFA 3BIWA 3KUUA 4N5IX 1FRFS 5HF9A 3CRZA 3DCJA 1H2YA 2WAOA 1SVIA 5H80A 3B7PA 4XOIA 1DC4A 1P9NA 2GH1A 1P60A 4KVZA 1JT9A 2HGZA 3TBFA 2PWYA 3HXOA 4F3NA 4ZTZB 1XRQA 2OV1A 3CP2A 3HCEA 2A9VA 1Q7YD 3BN3A 5K0LA 5AVVA 5I9IA 5JBQA 1DIGA 1O95A 1QIHA 2OHFA 3FMVA 3HUTA 3OCUA 4QUKA 4U2EA 5BQ5A 3SBEA 5EE5B 1EIWA 2GJ4A 3HB5X 1WVGA 3MFYA 1EAYA 4MWCA 4CT4B 2PUDA 3V4OA 1NLZA 1QM5A 2H4YA 1DEHA 1T5BA 2ZL7A 2NV2B 2ZE8A 3MBKA 1VMEA 1EXVA 1VPDA 2G7MC 4M46A 4BMOB 2JIRA 1E98A 1JRLA 1U0RA 2F9FA 2O5VA 4MUFA 3WSTA 4M9UA 2P9GA 5FPQA 3E0XA 4L5CA 5ES4B 4UDYX 1V39A 4K9NA 1NC3A 3LTNC 1EIZA 2FW0A 3K6RA 1GARA 3R9XA 5KQMA 4I6GA 3GR6A 4ZXFA 1QLHA 3RRBA 3N70A 4FW8A 4G5QA 1ARZA 3H9EO 1XDSA 3H9BA 5JANA 2XADA 1TC1A 2FJPA 2QM7A 4LZOA 3VNBA 4LF7B 4B48A 4JI2B 1AV7A 1QZTA 4M1YA 2EJVA 2WD7B 1VRVA 16PKA 1YQWA 3OQIB 4ILEA 4L0DA 2HCBA 4ZAGA 1JA1A 2G72A 1UDXA 3HCNA 4G0WA 2ZTUA 3SI7A 3H8SA 3BE4A 5B58T 4WW0A 4O8CA 4AZ3A 3G2IA 3OY2A 4UVEA 4BDSA 1P6UA 2CWWA 3PHCA 4P7KA 1Y8CA 3CQ9A 3O4GA 2RHOA 5DWQA 4RNCA 1V9LA 3CW8X 4TUYA 3Q1LA 1O94A 2GD6A 2XMSA 1JG3A 1IN6A 2IOHA 2PU7A 1O97D 5TARA 3ZGOA 5JBIA 5LWHA 2OXRA 3KB8A 4MR8A 4RV5A 4LMAA 3FZQA 3CCVB 3NTRA 4KL8S 1YJQA 3OE4A 4FXPA 5EJIA 5F7JA 3ZHTA 1LSUA 2YW9A 3IIJA 3VNAA 2WB2A 4DUYB 1GSOA 4F1WA 3VVCA 5H9WA 2IHTA 4P4GA 1FX0A 4CFZA 4XW2A 2XWQA 1NVFA 4PS0A 3P7MA 2JFPA 1MT0A 2ZVJA 3MINA 3LUJA 2O7QA 2BGNA 4Y0AA 2PU5A 3T51B 5CW2A 5AK5A 3BS4A 3M89A 1LSSA 4EIWA 3ZWPA 2C2YA 1DT3A 2C83A 1OPXA 1ORRA 3Q3EA 4IDGA 3AL0C 2RI0A 1R8JA 2V45A 4JB2A 4Z49A 3QWBA 2X0DA 1FNCA 1IUPA 5HS6A 4KPGA 3P0FA 2QLLA 3LP6A 2O8DA 3H1PA 3LLUA 3DVRX 2IHBA 3GMIA 4OA8A 2WWIA 1SCIA 4GE0A 5EE1A 2XCLA 2PBRA 1SA0B 4XLHA 3I5AA 4JI6B 1J39A 4JWTA 2IIBA 5K6RA 3EZLA 3WA6A 2EWWA 1MLDA 1O8CA 1X9IA 3PTZA 1RXWA 3G9ZA 4CG3A 1M1NB 2J9FA 4TGLA 3WDLA 3WK8A 2GESA 4KPFC 5JH7B 2ZBUA 4JY7A 4PQYA 1AHPA 4F2WA 1NVBA 1CEEA 4U1RA 1ECBA 2ODNA 1UF9A 4S12A 3RS3A 2X2OA 1L4LA 3A27A 2HHLA 1DG3A 1PGOA 4BV9A 3DAGA 1I1OA 3KLMX 4PAOA 5CTAA 3FCOA 4DA0A 3SYKA 1TU0A 1T10A 2GK3A 3DOEA 1NRKA 5U4QA 1C4XA 1VA5A 3BRWA 1KMHB 4TXLA 2ATXA 3ZBTA 2PBFA 4I5DA 4GGMX 4OAQA 3LSYA 3TD2A 5C8XA 2PUWA 5JARA 1NNI1 4LNHA 1JI3A 4HN9A 4O59O 2B4TO 3W2GA 3ZV3A 3U4CA 2YV1A 4E2ZA 3V8VA 1AD2A 3BKWA 3NWOA 2NVUB 4DIEA 4P86A 1SXHA 3ESYA 2E18A 4NFSA 5A71A 4Z7JA 5CT6A 3NXSA 3OZDA 4S1OA 4XR6A 4AF7A 3DE4X 2J3QA 4FR5A 3VC7A 3PA8A 5EN4A 4E5KA 4RTNA 3AVVA 3QHAA 4ZO9A 1E18A 3CNLA 3AONB 1IRXA 4G5GA 2EX4A 2IBTA 1YLOA 4HWSA 3CSUA 4IS3A 1L5LA 1KH1A 1AUQA 1T9AA 1Y34E 4W82A 4A23A 4BECA 2AOXA 4TMVA 3T3OA 2WNHA 1G8GA 5ERYA 1OY1A 1S96A 4KLZA 1O4WA 4G2TA 2Z5LA 1F0PA 4A8JB 3AVYA 4EHNA 1FLAA 3H8JA 1OB5A 1D6SA 1FJHA 1R4AA 2CXQA 2HM7A 2ZJ1A 4ID3A 4MUAA 3ZTTA 3QTTA 4NMMA 4S2UA 1ESNA 1C3OB 1FA9A 2DY0A 5EE0A 3L49A 5EKUA 3U49A 3WK6A 3K6SB 5AJYA 2CXHA 3DG9A 2CLKB 1B6GA 1QLWA 3FDXA 2KBEA 4X44A 2E9SA 4NNJA 2MDTA 3W4IA 2ZPTX 2CF4A 1SZDA 3LYAA 5EMNA 1GXSA 1ODLA 5IW8A 1KSGA 4QQKA 4X1YA 3ZEAA 2YOFA 4I1PA 2XVAA 4CMJA 5HJ7A 1KY5A 2GPSA 2VJBA 3IGFA 3R8XA 3RAGA 3EMVA 4QNNA 3EPPA 1D1NA 4P5EA 4DIBA 2GB4A 4GXQA 2W2MA 1O54A 1GPYA 1QHXA 2QRVB 2PV7A 4MUEA 2O50A 2P78A 4ASUA 2AFHE 4NEHB 3E1GA 2FPPB 2PLRA 2VAWA 3QW4B 3GJ7A 2CXPA 3DDOA 2OC4A 4RVCA 2GEJA 2X8JB 3DWIA 3TR5A 4U7PB 2Q45A 2R44A 4Q4DA 4EKNB 4MCIA 2FPGB 2VZ0A 4H27A 4LV6A 1YHYA 3BJEA 5C31A 4C7KA 4EENA 5LJIA 1RQGA 1QK4A 3JQAD 3KJQA 1LF5A 3ORYA 3WQQA 1B8PA 4K26A 2OBNA 5KMGB 3TSZA 1PQYA 2B2XA 5A2QA 2C3OA 4JD5A 5TR9A 4HBZA 3K2BA 1MX3A 1XDUA 1UAGA 5TT0A 4G09A 1RKQA 1Q57A 3G9TA 4PXSA 1K0UA 2AS0A 3P2EA 3TX6A 3VZDA 2CMFA 2WWXA 2WHPB 3HU1A 2Z83A 3QXHA 4KN6A 2F4NA 3L43A 4HB0A 3WLKX 4S0ZA 2YRWA 3PNKA 3H75A 2FMIA 3D0RA 3A1SA 4GNKA 4QREA 2K5UA 2L2QA 3DBHA 1E3ZA 3NBYC 4KVAA 2FK8A 3HB9A 4O2AB 4B79A 4QODA 1L7MA 4KTTE 1YGYA 4FEAA 2F43A 4M7PA 4RESA 2DQSA 2IP1A 1EM8A 4BNXA 3GEMA 4BZPA 3R7WB 2Y1WA 4MHTA 4MSUA 1OXUA 4UNRA 2XWPA 4D8VA 1XQ1A 1NVEA 1SXJE 4UU7A 5E38A 3UHOA 1T9GS 3DBHB 1MQ8B 1PD0A 1XPJA 2RH5A 4QULA 2OAP1 2VT7A 4HAVA 1HO3A 3ZKWB 2DB3A 4DQ0A 3UYLA 4E1BA 5CDTA 2P3MA 1ZMRA 3JZAA 3WZMA 4PLPA 3OP4A 3OQHA 2QX8A 1UH5A 4K6FA 2PLNA 3BSYA 4R7TA 1B42A 3DWFA 1WETA 2JA1A 3B1XA 3SQXA 1NV9A 4HMQA 4B84A 2BP7A 3FLMA 3K0SA 3KCQA 4Q1EA 4KQ1A 1ZI6A 3NX4A 3STYA 3OJLA 5CYPA 1XZMA 1R7RA 4YRLA 1J0EA 5L3ZA 1DAMA 3K9HA 3D4OA 3TI9A 1V96A 2H9YA 3GYBA 2OYNA 1HL7A 1T5OA 3H9JA 1V8OA 1KI3A 1GQRA 2Q9UA 4X97A 4D4HA 5IFLA 5KYNA 3QE4A 4H0NA 1KRXA 1NQTA 3CUTA 1QFZA 4I5EA 3G2MA 1JBEA 2BONA 1N1EA 1E1DA 4G0PA 2VPYA 4MICA 5TF4A 5FV7A 1XK6A 3UJ9A 2WWHA 1TK3A 1WMAA 1TMKA 3WS7A 1XP8A 2QUAA 4BNVA 5AVWA 2YMQA 4EUNA 1IZZA 3KQNA 2AEFA 3WMGA 2IVFA 3S1LA 4OXYA 1RXCA 2QSYA 3QGMA 4KR7A 1KFJB 3L8FA 3LWZA 2GZSA 1NI4A 4IAOA 4X71A 5T8KA 1K8RA 4U00A 1JMYA 4JBHA 4C5AA 3S70A 2JGRA 3AIOA 5IM4A 1HX7A 1P1BA 1R0LA 3QPCA 2NXWA 3DFFA 4OHVA 1GO2A 5KC9A 4R7GA 5E95A 4LSGA 2HXYA 4CIDA 4L2IB 5KVQA 3NDPA 1N0VC 1QVRA 2ADMA 4FQ5A 2HJGA 2V6MA 4NBWA 4MYCA 5L3VA 4JXXA 3I53A 4PLZA 1BDHA 2B4AA 2XGMA 1QPGA 4Y9UA 2QAGA 1G8KA 2DUJA 3I45A 4MGIR 1AX9A 4UUQA 4D3ZA 1P0FA 3G13A 4H3KB 2GZMA 1JEYA 3DOIA 3B36A 3LOUA 5DH9A 1UKEA 4EW3A 1T5HX 1U9IA 4L8LA 4MGZR 1FDRA 4P84A 1EGAA 4TTIA 1GQYA 3RW9A 1QH1B 2CXNA 3IIEA 4GLBA 2FMXA 5CFNA 1JIIA 3BICA 3K05A 4KXNA 4YXFA 4UUAA 3A4MA 5F1PA 2HA6A 2IBSA 4YMUA 4ZK2A 2P41A 5JMTA 1K63A 5DYYA 5IVDA 4AXBA 3W2TA 2EW2A 3HAGA 1K4YA 1FU7A 2V0GA 2GN9A 2NQ8A 1GWNA 1PZXA 3CH7A 4OTZA 1L4EA 5DS0A 1XZBA 1FSFA 4FBMA 3WBFA 2UUBB 4QSMA 4PFQA 5JAHA 3MT7A 1XF1A 2Z9CA 1O03A 1V4NA 4JKYA 4XB6B 1OYVA 1TAQA 5G53C 5K4HA 2XX3A 4KH0A 3ELBA 2V31A 1R8YA 1DJPA 1QRDA 1AKEA 2EEPA 2TS1A 2Y2VA 4M0UA 1XL1A 4UNPA 4WFJA 5EKDA 3T1NA 4A8TA 2QTCA 4C0JA 1L7EA 2JLQA 2EZUA 3L4BC 3NWEA 1E3DA 4BNUA 5K0EA 3UHPA 1MKYA 3CTAA 1Y98A 1E7RA 2RGNA 3JALB 3OVMA 3GP8A 5JSHA 2J8ZA 2ZAOA 4PICA 2H17A 2OV3A 4YMHA 5BNWA 3BBLA 2G88A 4OFXA 2C7GA 2UXCB 4NJEB 1I9GA 4F4DA 3A6PC 3ZCRA 1YZUA 4Y6OA 4B6PA 3G6EB 3W06A 2JLXA 3RG2A 3VR5D 4KQMA 4HUJA 1KF0A 3GMTA 2Z3ZA 2EDCA 3N76A 2ODBA 4MZXA 4DQUA 5DN6D 4NKRA 4OMFG 3Q9UA 4R98A 1CUVA 5T5QA 3IURA 1MN6A 4RA9A 5TQ2A 5C5IA 1ORTA 3IQIX 2F8SA 2XMRA 4FYVA 2CKDA 4IM7A 3THYB 2YQZA 5BV7A 2OWEA 4G5YA 3NR2A 2RB4A 4YAFA 5B12A 3B7GA 1GCOA 3B13B 3F1LA 1PX0A 4JNCA 2XOEA 4TXJA 1A2QA 4MQMA 4YIKA 4EEKA 5JOQA 2IY9A 1A97A 3L7OA 3FX2A 1V0JA 2WY2D 1FFXB 4K8OA 1GUBA 2BL4A 5CB4B 1PFUA 3WGQA 2NMVA 4CKEA 1HFEL 1EAMA 3PVZA 4HWKA 3AUYA 3NOOA 3THRA 3H8WA 2XMGA 4CETA 3AWIA 2IE0A 4AMZA 4Z7NB 1MQAA 1FVOA 2X1LA 2J9GA 4I2NA 4G56A 3DOUA 3OLQA 1ZEJA 1E1RD 1RAFA 2EJTA 2VHVA 3C8ZA 4MQFB 2R2GA 4RK4A 2JEYA 4V03A 3DAPA 1JFVA 1GA1A 1A98A 4FZVA 1I6MA 4EG4A 3QEBZ 4WFKA 1UZAA 2DECA 3IX7A 4KJXA 4PE5B 5IBPA 5TVGA 4Y9TA 4YAEA 2CYBA 3RRNA 3P9KA 1CQJB 4DC0A 3I9NA 4D5EA 1G5RA 3ESCA 1XB2A 4BZWA 1M6WA 2H2HA 1C30B 2I6UA 5JSYA 4ESEA 1CJCA 4X41A 1R0BA 4AWXA 4EMBA 4ARBA 2OG2A 3KCNA 4FMBB 4F5YA 1RZRD 2JATA 1G60A 5IWCA 3T3GA 1CWUA 1SVSA 1UJ4A 2V8OA 2E4XA 4EY5A 3EOZA 4I8XA 3TO5A 3WK7A 1Y4DE 2O2CA 4M7WA 5KNBA 5MFPA 4ZGWA 3FG9A 1UMDA 3P9PA 1WCIA 1KDVA 1T5DX 4J9VA 1W0KD 2ORIA 2ZSBA 3CTPA 4AU1A 5GTDA 3UAWA 3OKPA 2GXUA 2HWYA 3PFCA 3DOCA 4QUGA 3EE6A 3O8DA 1FFWA 2C0PA 1SHZA 4UCQA 3BEDA 2M2IA 2P1DA 4I9UA 4P2BA 4D8XA 4DMUB 5K0CA 4LWZA 2XT9A 2FR1A 2BEKA 2MR5A 2QGZA 3DHEA 3GAFA 1UEJA 3LU1A 4Q18A 5REQA 2CJWA 4ZZIA 1U0EA 3LG2A 2UVQA 4ODIA 1DXQA 3EUAA 3OZEA 4ZTUB 1IL0A 1HY3A 5A6VA 5KJFA 4ZI5A 1OFUX 2NO5A 1U80A 5FBQB 4B4OA 4DDTA 2GILA 3IV9A 4GEKA 1Z62A 3EVFA 4XDGA 3CONA 2AI2A 4U7TB 1LTKA 4NRDA 1Z9BA 2HHAA 3D9QX 2QQ0A 3E58A 1GILA 3OPQA 5CXXA 5DGHA 2QBYB 3R75A 2O05A 5LQNA 2E4ZA 2C42A 2PZJA 2ZW9A 4KDEA 5DOVA 3RC3A 2WWTA 2DFVA 1T9KA 2XDYA 2Y1KA 4MVJP 3OMXA 5B6JA 1UT8A 4WBSA 1RD4A 2V9PA 2WKWA 1U3DA 4PLYA 4WJKB 4XWYA 4YUAA 2VTEA 5DYWA 2YASA 4CR7A 4E15A 1PQWA 4LNUA 3UB3A 2F55A 4MWGA 2FTKE 3RIEA 1TM2A 1FTNA 2IHYA 1AS0A 2P3SA 1CT9A 2PL3A 3CRQA 3FJYA 1DIRA 2P79A 1QK3A 3IBYA 3QHQA 4DLKA 3OBBA 1E3EA 1RBZA 2GOYA 3PCRB 2WJVA 3LY7A 1OFIA 4OKIA 3SYTA 4QBFA 5JCOC 1Q1GA 2Q0QA 4FEEA 2GM5A 4DHEA 1DEKA 4CMBA 3LF1A 3AEQB 3NVKI 4DANA 4KXUA 2Q3BA 1Z08A 2AFVA 2QG9A 3C5HA 5BQOA 1U7ZA 4BLQA 3DV2A 2Z98A 1L8XA 4KQ9A 5ICEA 4R6XA 2OV6A 5EHGA 4K9QA 1C9JA 2V0CA 2IP2A 3PHJA 3UGQA 1UDWA 1JIUA 1XZFA 2QLMA 3CE9A 3LIIA 3LPAA 3F7TA 3W7VA 5CLGA 2C54A 2OK8A 5BWBA 2C97A 3DZKA 2XTAA 1Z7GA 2B61A 5KYWB 3LY9A 2E1RA 2RI6A 5K3CA 1CJUC 1SKYE 2Z6AA 1FEZA 1JFFA 2P91A 4Q9LA 1JKIA 2WJAA 1L4HA 3B9RA 3THWB 2X86A 4LHXA 4I7EA 1RQLA 4IRMA 1V5GA 4M55A 3V34A 3UMMA 4GC9A 2PT5A 3BJIC 5I7HA 1CP2A 1QFJA 1ODIA 1U8YA 1ZMBA 1OFGA 3I28A 4HDRB 2JB9A 4NH0A 2XVXA 4Y2SA 3R1IA 1N2GA 3ENWA 3ROKA 2Q7XA 4JXKA 4PO9A 3WIEA 2VSQA 3KYCB 3PE4A 4ENUA 1OVGA 2OYRA 1OAAA 3I72A 3OPNA 1BGVA 2BELA 1O7JA 1J49A 3KOMA 2QYSA 3M6XA 3OESA 5HA5A 1L7BA 4UHHA 3TL3A 1E2FA 3RU9A 2UZ1A 2ZRFA 4QDJA 3DXYA 1PYGA 1K06A 2ZSJA 5E1BA 2C20A 3G2PA 2Z08A 5CJ2A 1XC7A 1C1DA 1NF9A 1PE0A 1SC1A 4WOBA 6NULA 3H4TA 5DLYA 1PDVA 2P1RA 3G6WA 5FPPA 2PYIA 2IS4A 3LUKA 1THZA 2CDAA 2P2CA 1IOWA 4GOOD 5KDDA 3VNVA 1LI7A 2VRCD 4IUYA 3W8EA 1GTMA 3I5XA 3PD7A 4DUZB 1VZ3A 2BGRA 3PS9A 2CBXA 4H59A 3NBXX 1YU6A 2FJ0A 5FULA 1RVV1 5KJ1A 1T5TA 1G8AA 5AKIA 4DV6B 4XUCA 3GJ3A 3HB0A 4MQBA 2AJCA 4TWRA 3Q6QA 3HVKA 2FOXA 4ZIRB 2CMGA 2D3NA 4X1IA 4DQDA 5LKRA 1TLLA 4IIXA 1O96B 2HQBA 3IDSA 3UPUA 1OXVA 1CUCA 2ZL5A 3ORRA 3DF7A 1I6KA 3S2YA 2GRAA 4Z99A 5BRAA 5LZ2A 1F60A 1I80A 3ICOA 4KFUA 1WUJS 3P0RA 5J47A 5FR1A 2LTAA 2DKFA 3OQJA 4PSAA 3Q87B 3TOZA 3KDPA 1S7CA 1KETA 3OAAD 3FLBA 4JODA 4LJ7A 5KYWA 4KKSA 1SULA 1ZUHA 1XVAA 4X84A 1LBTA 3T61A 2A1UB 1R0CA 2D2EA 2OOSA 2HAEA 3QHPA 421PA 3A37A 4HD8A 4JEHA 4NU5A 1XU9A 2HIAA 3AHDA 2Q41A 4IIJB 4F4CA 2OXIA 1G8PA 2GO7A 3ZY6A 5HIIA 4I8IA 4LJYA 3K4QA 3EIUA 1AK1A 4BNMA 1YOVB 2FZKA 1SOUA 3H11A 1V43A 2Q5OA 1JKXA 2Z8YA 4QOJA 4D74A 4MAMA 3SZUA 4ES6A 3HVHA 5C18A 4KR2A 4JOQA 5CJPA 5HZAA 4P9SA 3ABSB 1VE9A 3CCBA 3CPXA 1JF8A 1MVNA 3I9FA 3ZD6A 1QCDA 2OD7A 2W7TA 1ZAYA 2C7VA 1FBTA 3AV3A 4DLVA 2GZAA 3BHIA 4JYMA 2M6RA 1UD3A 1NTRA 3ECSA 4J4HA 4XUEA 1PCXA 4XI9A 2PIAA 2Q99A 3O8CA 4E08A 2VZ9A 3PNSA 1DBVO 1O2DA 4MA5A 2PN1A 1G8HA 1TAGA 4NE9A 5FXMA 1RSZA 4GVLA 4XWAA 3L5OA 2QUBA 3S29A 4WA8A 2RSLA 4B3GA 4W5RA 2EBWA 5DOZA 1PTKA 4CDMA 1USGA 1IZ8A 1MB3A 2DTXA 2FR8A 4FT2A 4EABA 3C48A 1W88B 5CEJA 3KLPX 5DWDA 3AFNA 1LZLA 5KHOC 3TG8A 1H6DA 4J0DA 4MW0A 4RPLA 1I3CA 1B0AA 1OBCA 1YSCA 3NJRA 4Q1AA 5I3CA 4UEJA 4YASA 5K8VA 3CNHA 1EFDN 1P6QA 1ZL0A 1YJAA 3PDCA 1AOXA 1CEXA 4A91A 1WXGA 3TTVA 3UN1A 4ZYYA 3EQ2A 1TGYA 1Q0UA 1SG6A 2FSIA 3V2GA 4CG0A 2JLRA 1CDOA 5H3LA 1W59A 2GREA 4Z4SA 2BW0A 2BUCA 2WSMA 2RHGB 1AGXA 5AUNB 5LL6P 3QE9Y 2CUZA 2QU7A 1IWBB 4QQRA 4S3MA 3DEIA 1NN3A 1JAYA 1XN4A 4DQKA 2CSUA 1Y7PA 4OXRA 4IGFA 3IP1A 5C9ZA 1Q84A 2NT4A 1GD1O 2FPKA 3IVCA 1CJMA 2J3DA 3RFVA 3ZUPA 2JJ1D 5FLEX 4JJ6A 4LRSB 4O4LA 1DC6A 4O5AA 4EUEA 4DV2B 4R5MA 3OBIA 4BN0A 2BFCB 4YH1A 3AERA 4K6KA 3T3EA 2N1BA 2VO1A 1NHGA 5TRTA 5KSPA 1K68A 2QGNA 3UY4A 3COJA 1ECPA 2ZU0C 4GUDA 4JGIA 2WRZA 5F2KA 5A9SA 3I61A 1PFKA 1PFYA 5BSTA 2WTUA 4AI6A 2WOOA 1AM4D 2I7TA 1GEEA 2QR5A 3TSWA 2FCRA 2J0UA 4NQRA 3E7XA 3TTSA 1O95C 3IKJA 4CM1A 4FIZA 4ZEMA 2QRQA 3ZKWA 5B2FA 4CKWA 1U3FA 5LDDC 3EEFA 3KUCA 1Q92A 3KQPA 3G2HA 4I8DA 4R9SA 5DKFA 3ZY5A 4E5SA 4YRTA 5I4IA 4GF5A 4XGNA 2GEUA 2GWRA 4ZJUA 4KDRA 4MUMA 1WHSB 3GPIA 4PC2A 3CCFA 3MAJA 3OCWA 2VH2A 4GH5A 4DZTA 5C1PA 4LFCB 5K09A 4RV4A 2CFSA 1XE3A 3T7KA 1K97A 3CP8A 3FFWA 1LPPA 1Q12A 1X74A 2QI9F 1T3HA 3FCSB 4YRFA 3LWBA 5B58C 1V47A 2QT9A 4RYDA 1D8TA 5EJFA 4IH9A 3AGPA 1V26A 4J7UA 5LXTF 4OYHA 3TM4A 1WL8A 1QHEA 4DTCA 2JGDB 3I1YA 3MFQA 1VE7A 3FFBA 1NMZA 4KK3A 1J21A 3SFTA 3HJNA 1HKHA 3K9QO 3I64A 3WYCA 4F2DA 1ISMA 2G77B 4G0OA 4NYJR 4BE7B 4BX9A 2Z6UA 1M7HA 3WMWA 5AKXA 1X15A 2QM8A 3PNMA 3PSHA 2G9RA 4D8TA 5P8WA 4MQ6A 1WSAA 4GYYA 4OPVA 4K6CA 3ZHSA 3RKUA 5JXHA 2VVTA 3RFTA 3JYHA 1P4GA 3EZXA 4CIVA 3PR2B 4A73A 1EK1A 4PTZA 2FN4A 4XVQA 1RYMA 5F3RA 5HUJA 3NTXA 4GVXA 1YZKA 4HRAA 1O9GA 3WL5A 3LLCA 2PUVA 4CLEA 2IH2A 3IHKA 2XAUA 1X1EA 2JCGA 2VJDA 2BKVA 3CN7A 4GI7A 4KKUA 5CDFA 1F2TA 2XE7A 2ZTGA 3KZNA 4GX0A 2C3MA 4N49A 1TA0A 2CD7A 2YVUA 3A0RB 4FEGA 5TGTA 5JYDA 1PEYA 2VUTA 5GP1A 4ZHSA 5DTMA 2I9KA 1QG2A 2ONJA 4BXOB 2YXPX 3OZFA 1T9CA 1MCZA 3RS8A 3SBDA 1LK7A 5AVRA 2AFRA 2QYTA 2PUHA 2BEVB 2QRGA 4KSCA 3SSMA 1LPMA 3QLUA 1EFLA 3VYRB 4CQMB 2JCXA 4RKRA 3H2ZA 5DBFA 1GPNA 3OI7A 1T2NA 1N2CB 3QG5A 4TSKA 2VP6A 3HP1A 5LUAA 2Y6VA 3MTIA 5EXDA 3IXLA 2BGJA 4JEIA 2IUUA 3OZAA 4OH1A 3QA3E 4EX7A 2ZRGA 4MI6A 3HU5A 2X0IA 2AD5A 3O8LA 1MENA 4NCBA 2VNKA 3I1JA 3ZXUB 1YDGA 2XUIA 3E4DA 2LP4Y 3NGMA 3NUQA 3RSHA 3E9CA 3P0IA 3L3BA 4ABTA 2BF7A 3I30X 3L84A 4ESOA 2VH5R 4LCBA 1EESA 5I51A 4L8GA 4UJ3A 2G8LA 2XUJA 4D8YA 1PEAA 5DBGA 1LDBA 3IAS1 4K05A 2UDPA 2SKCA 4E2YA 4PNZA 1MPTA 3C3YA 5A5FA 2VJKA 1IB0A 2X4LA 4UHBA 1M8KA 3JQPA 2H1FA 2POQX 3GUUA 3FSEA 4DNQA 2PXCA 4KQXA 4Q6WA 3CCLB 2F1OA 3IAXA 4YBZA 4OGWA 2AD1A 4F06A 3IUJA 1EWYA 5T4BA 3RG8A 3VGJA 3DZIA 4URWR 1H5UA 4B73A 1Y6GA 2DFTA 2ADFA 9MHTA 4BLRA 3VAZA 2ZAMA 3C3WA 3CISA 3PJEA 1US8A 3UENA 3TQQA 4HAIA 2JGLA 3GJTA 1WEKA 1KDTA 2HNBA 4IMJB 4UM8B 5FF9A 1U2DC 1CLUA 3N8KA 1P62B 1NJ6A 3H2KA 3MQ2A 4MEJA 4RDIA 2CLDX 3GOQA 3R0VA 1FTGA 5IMBA 1CUJA 3KUXA 3NUZA 2VA9A 3PICA 3ISTA 3RSLA 3UWKA 4BC1A 1I4OA 4BLVA 5L95A 1G18A 3CCUB 1PR4A 5BYBA 2EQAA 3PJRA 4LOKA 4KI0A 4PAMA 1NXVA 1KEVA 4KQIA 3FWKA 4CZ2A 3ABZA 2VCYA 3DKVA 2P62A 2IITA 4ZC8A 5GIPE 3GX1A 1TKAA 4L15A 2ZJ4A 3WYFA 2WJ4A 3LT1A 1EFRD 8ABPA 5JBNA 5K0TA 3VRHA 4MRSA 2DPLA 3FETA 5LYJF 2P35A 1NF8A 5EWLB 1R0RE 1Z0IA 3BJMA 4X3PA 2I80A 1TJ3A 2EXXA 3MINB 2PQ2A 4HVAA 4MGYR 3NW9A 4NYMQ 1SU8A 1VMKA 4NONA 3ETEA 1M3SA 4NXNB 2UKDA 4H08A 5BQXA 4KOAA 3MGKA 4EPWA 4QU9A 1X8KA 1FSZA 1ABBA 3AI2A 3A05A 4YJKA 1QS0B 3CEAA 3AK4A 2ZTMA 4CMHA 3H05A 3M5DA 1TAHA 2AI3A 1QIKA 2YOGA 1A76A 2DPMA 2TMYA 3IPCA 2JDID 1Z88A 1E9BA 3DHWC 2GAOA 4KBFA 4TKLA 2ET6A 2H0QA 1MG0A 4EVIA 2Y1CA 1K4KA 3TLJA 4U63A 3ZU6A 5HZGA 3CVXA 1EHIA 3DEFA 4U7JA 1K28D 2H1CA 3IXQA 4TL8A 4WXMA 5JLAA 4G67A 4ZT5A 3D8TA 3GQBB 1QE5A 3PPIA 4NWIA 4O2AA 1AK9A 2A2ZA 2E4AA 1U3UA 5FAXA 3DDWA 3RQIA 4ER3A 1EI9A 3IE1A 5IEBA 1AXEA 1Z36A 4EATA 4CFYA 4AP6A 1TM7E 3U3MA 2D1QA 4EB0A 5IJ0B 4FHCA 4PIMA 3X1WA 3O74A 4YALA 2ZTSA 1NW5A 4KPUA 1AKQA 1AKUA 1GPMA 1MMFB 2G6TA 3EGVA 2VAVA 4QXAA 1Q1NA 1UBNA 2QY9A 5I7FA 3K31A 3GHHA 3W8DA 2V3CC 2P5YA 2B6NA 2R97A 3B6IA 1GZDA 3OA2A 2B99A 3U62A 4D26A 1XHLA 1W7AA 4DYDA 3AUTA 1H9BA 4MHOA 1HLPA 3G79A 3LECA 5F3DA 4EL0A 5DWVA 2C5HA 3FH0A 3A9CA 4KLAA 3NHPA 3I2GA 1YX2A 4X6YA 1IU9A 4KPUB 1U2QA 2ZIXB 3BUSA 1XZPA 3I05A 4BO8A 4AMBA 3FFTA 1FU4A 2GM9A 4I9HA 3SM3A 2VSOA 3HXKA 4FFBA 1K88A 4XLTA 4NOJA 4DJAA 4RIIA 3CM0A 4BVBA 1SOVA 1OU0A 5JNRA 4PYOA 3P26A 2JANA 4BYGA 4OQLA 5U1PA 2YFYA 1QVGB 2Q4EA 3H4IA 3FSRA 4FVTA 5EMHA 4EGFA 4FE7A 2QRNA 4JN6B 3ET5A 2AOWA 1N2CE 2NTVA 2X0RA 4PX5A 1RWWA 3HVRA 1EK0A 2F48A 1E96A 3V1UA 3OUUA 4FQ7A 5CXSA 3DFUA 4MJXA 2WHRA 4UKDA 3KSBC 4U39A 2JIDA 2ORVA 2OY0A 1CY0A 3OQVA 1ML4A 2VBIA 2FSFA 4IDHA 4DZZA 3QXCA 4WZEA 4Z51A 5C8YB 3SVTA 3GGCA 4U6NA 2O4UX 3QVGB 2O4CA 2RHWA 3W2EA 2FPUA 3IPXA 3L0PA 3DB2A 3LFHA 2MYPA 3VSAA 1KK1A 5A6SA 4JI0B 1Y37A 3CFYA 1DWPA 3LX5A 3HXLA 3MLAA 4Q1DA 4L4RA 3LO5A 4HEQA 2I54A 4J29A 4EUFA 3LPCA 4Q9IA 3ZHZA 2OTLB 5BN4A 4FZRA 5CW1A 1ZHHA 1VGVA 1SVLA 4CLDA 3CNBA 5IX8A 3MILA 4U9UA 1QCCA 2IOFA 1BLIA 4JOBA 1Y9AA 1EZ1A 4QAQA 2P0YA 1WY5A 1S2DA 3MS2A 4O08A 4TROA 4BP8A 4B87A 2FEAA 5K6TA 1TUBA 2B4YA 4N41A 1GGNA 5HRAA 3A4LA 3HC7A 4HGQA 4OIMA 2ZK7A 4FGJA 1RI4A 1Y89A 3TAHA 1D04A 4FGUA 2RHCA 4OOXA 3Q5EA 3TKAA 2R60A 3DP7A 2I9PA 4LWOA 3W04A 4ZT2A 1IIBA 5AHKA 3Q7PA 3VOSA 1J0BA 2JKZA 4TYPA 2QPOA 4IQ8A 5FTJA 2J46A 1RKVA 2D59A 2GFQA 2OGTA 4MRAA 2CCGA 1P3JA 1POWA 4WDQA 1KOJA 1L7DA 1OZHA 2OORC 3DE5X 3KKMA 3DWGA 3MELA 2ZVDA 3OLVA 3P0HA 3U81A 3ZK9A 3KJXA 4CR6A 1C7IA 3SHVA 3ZQKA 4R8VA 3B3QA 3KQVA 5HF5A 1Z75A 4WACA 1MC8A 1TGVA 4KV9A 2TMDA 1LRJA 4BNHA 3OQBA 4N82A 5D1NA 5L3QA 2ZKIA 3H4MA 3LPNA 1KJNA 1UQTA 2HCTA 2JI6A 5EZYF 1A8PA 2C7OA 4OKSA 1VJTA 4FKBA 4Q03A 3R3ZA 4AN0A 2G83A 1ZICA 1BC5A 2R1TB 4A10A 1JH9A 1X1CA 3I9MA 4MQ4A 3CZRA 2CF6A 4HFRA 5TJ9A 1BH6A 2K87A 5JC1A 4XARA 3C1UA 4UFNA 3L4BA 1N6IA 1ELOA 4PGAA 1P73A 3S81A 2X8LA 1MB9A 4PYRA 1XA0A 2B2CA 2E82A 5A6SB 3TYXA 4FZJA 3L18A 2XGSA 4YRBA 4ZOCA 3OO1A 4K03A 2A0UA 3GJ4A 3GCWA 2NNLD 1M1UA 2UZ1B 2OM2A 3BZUA 3SF8B 4A0FA 2Z9DA 1XJQA 5FIUA 3HBMA 3S27A 4RNDB 4MKIA 1KDPA 4P4TA 3LO8A 1P39A 4NR0A 4QAJA 3I73A 3VKGA 3EFEA 4FCWA 4CLOA 3PUYA 1HETA 4C2AA 5BWLA 2AHOA 2XE6A 1K5GA 1WPRA 1GUDA 5D5QA 2NU9A 1PWHA 2EJUA 2I2BA 2YHIB 1Q6ZA 2C99A 4L7QA 4WAUA 4XTCS 5IP5A 2BFFB 2B4QA 2UUOA 4E7PA 1TMGE 3ZOZA 1C3VA 4L5JA 1VPVA 1J8DA 2HD4A 4XD7D 4XORA 1XZLA 4RLSA 3U17A 1CRWG 1XD8A 1AUOA 2FFAA 3QV2A 2K7FA 1B93A 1XQWA 1RWVA 5EQJB 1JZTA 4UQOA 3L46A 1HG0A 4MS4B 4HDNA 2QV7A 5A0TA 4NOLA 2RHBA 1RXYA 3RIMA 3LJKA 3UK6A 1OZAA 4PQEA 3K9NA 2VPXA 5CA1F 2XEDA 1UJMA 2O7NA 5E6TA 1PD1A 2VK4A 5G0SA 4DDHA 1E2PA 2VHJA 1CPYA 3VSDA 3WOVA 3GQBA 2VOJA 2PKYX 1D1PA 5CCXA 4QPNA 4RCZA 1ADBA 1UQRA 1N5JA 5CVDA 3UAZA 5B4TA 3QEOA 1L4KA 4QVGA 5B1SA 2YINC 3ORQA 1YR7A 4OAPA 2DMRA 2F43B 2VXOA 3AQIA 1AURA 1JTVA 4AP5A 1N05A 2DQYA 1NLMA 2AYYA 2GCNA 3JALA 3MAAC 4INPA 4N5LA 3O92A 3O1HB 4C4PA 4B0PA 1JTFA 1TCCA 1V4VA 1YQEA 1ZD4A 4RFLA 1C0LA 4B2YA 1GTZA 1R9MA 3LV8A 1JEYB 1W4RA 5JXIA 1E1YA 4X3OA 2HDOA 2D0DA 2YTZA 3RKRA 2Y0PA 2IYUA 1DX4A 4NYIQ 4ZXPA 1M90D 5JD5A 4JLPA 1N6KA 1LJLA 4HYTA 2ZYDA 3AF5A 1IHXA 1V5FA 1N6HA 3CX4A 3A6FA 1V95A 3LQEA 5K4AA 1CS0B 1QOQB 2G1PA 4ALJA 3EVGA 5K01A 2JL1A 3O8NA 1RYEA 3CY6A 2I99A 3L1KA 1V8BA 1QKIA 4JLBA 3BA6A 4DADA 3EA4A 1XTKA 1YRLA 5DHAA 5KOJB 3BTSA 2H1SA 2P6OA 3FUXA 3RVMA 3KQYA 1I4LD 1EDOA 4DLBA 4W8GA 5AK3A 2GBCA 4G0YA 1S8OA 4RY2A 1XEXB 1TIKA 3C6BA 1YOBA 3LX8A 5MFZA 1TA4A 2Q27A 1FF9A 4HH1A 5HKKD 5AD1A 2CD9A 2Q4DA 3PENA 5F9FA 2RFLA 4M83A 5DM4A 4AS1A 4HYYA 1LW7A 4KIFA 3KZ1E 1RAAA 3HJUA 3Q8LA 1JHYA 2JLVA 4KVFA 1M6HA 3FROA 4ITRC 3PC2A 1D4FA 1HT2E 4G2NA 4FP9A 4PS1A 3LUHA 5D7NA 4MP3A 5DZSA 5E1DA 3F6RA 4RF3A 1DXYA 4ARAA 1KIMA 4V24A 1T91A 2J45A 3SMVA 2C4KA 3UOGA 4WNAA 1YHZA 2C2ZA 3ZDCA 3U19A 1CJTC 3OHPA 2JVIA 2YDYA 3WGZA 1R2QA 3BD8A 1JEDA 4GWKA 4QHSA 5J4YA 5FL7D 2GNAA 1QK5A 2ZWIA 3E1KA 3UWPA 3ASTA 5BY2A 4ILKA 4KLRA 2JHPA 3DTYA 1JZSA 1I1NA 4MVJD 1HDXA 1QIEA 1NZDA 4XOPA 1UJ5A 2QHXA 4JBWA 2LDBA 2TECE 1G291 4MRMB 5ALRA 3ST7A 3TH5A 1GRNA 4TX1A 1U5CA 4GS5A 3TSCA 3PQDA 1BJKA 3RBZA 5I48A 4IXMA 5I7WA 1VI2A 1OR8A 3GEPA 3KLBA 1NR5A 1ZBQA 2ZIXA 4Y2GA 2VNHA 1CDZA 1F9EA 1HDEA 2QV0A 5A7GA 4MV9A 4CQMD 2M1XA 4Y18A 1GPBA 4XUGB 5M04A 4DBLC 3IP7A 3LQRA 2J6CA 2WQZA 1HH4A 3IRUA 2PG3A 3MS7A 3IEUA 4AY3A 3AF2A 3AESB 2BM9A 3KOZA 1V3QE 3EGXA 3R0ZA 1Q11A 5KWEA 3NT4A 4OJQA 4W8HA 3SHFA 3VKFA 1V5EA 5HOEA 1XPRA 5LPNA 5G0WA 1Q91A 5HQTA 5KO2A 3H9CA 3VGPA 1J7JA 2I2XB 5TGZA 4PGOA 2YXDA 2IYVA 5IJ0A 1R0KA 3EW9A 3KUKA 5TQJA 3A3NA 1NWHA 3PGA1 4TKVA 1I9CA 1N2CA 3SU8A 1RHMA 3QPVA 5LMNB 2HLDA 1UFRA 4F56A 3BAZA 4F4JA 4BO4A 4B4DA 3OPYI 1XDBA 4DGSA 1F12A 4KAJA 2QMQA 3IUEA 3AB3A 3LVFO 3JVIA 4FKMA 4U2DA 4DR5B 1REQA 1NA5A 2AWOA 5ESDA 3L1IA 5JMOA 5CAEA 1U3CA 2W93A 4R69A 2BM1A 1P7ZA 1HE4A 3FMPB 3U26A 4OPMA 4UC0A 4GOLD 4F9GA 2VJLA 1YQDA 1A71A 1BROA 1VHLA 4JSRA 4MKZA 3IOYA 3C8DA 1QR6A 5MGBA 4C14A 3GA0A 3HS3A 4W7IA 5GZ1A 4I1IA 3WLJA 1PSWA 4M7OA 2GUGA 3BF8A 3GARA 4J07A 2C2BA 3N0TA 4N4AA 4S2EA 2G4CA 5B1DA 2YWHA 2FEMA 4F7WA 5EHXA 2WT4A 1KH3A 1XL0A 2HJWA 1FDIA 3OLYA 4IXWA 1RIFA 4UBMA 1XDWA 2VHZA 3TX2A 4JI4B 4EVSA 3HJHA 4LRYA 2X8WA 3AGQA 4LZAA 3REGA 1X1RA 1X77A 2PGXA 4J2HA 4IVQA 6LDHA 1P2SA 2CNOA 4LY3A 4PLWA 4BO0A 5AM1A 3QMPA 4QRIA 1TI7A 4KRXA 5FTWA 4BOYA 2WUEA 3RVQA 3QI2A 5A4AA 3ZD7A 4Q4AA 3B1ZA 4C7MA 2OZLA 2SICE 2WTNA 3AKEA 1ZH6A 2LZJA 2RHTA 2A88A 3IOBA 4DR4B 4OGGA 1ZIXA 4HK4A 4IZHA 4M0CA 3VSCA 4Z4EA 3PFNA 4YXWD 4U5QA 4C08A 4DLAA 5ED4A 2AQIA 1N6OA 3CNOA 3RC9A 4ZZ0A 3ER8A 4G5FA 1F6BA 1HLGA 5SY6A 5TDHA 1KDZA 3X1XA 2WFLA 4PPNA 3ZE6A 4EBBA 5JVDF 5DCWA 5LP6F 1BU5A 2SKEA 4X95A 4IIJA 1DFHA 1SQFA 4OH7A 3FGZA 3CF2A 3ET4A 2E4YA 3GRVA 4IIHA 3RGWS 5B2EA 4GKVA 2WUGA 2ODAA 1ZK4A 1GG5A 2NU6B 3DBRB 1S72B 1L3CA 2ATCA 3AOGA 4B74A 2FZLA 5EC8A 3JQDA 5C32A 1JDBC 1ZLYA 4O29A 4YUVA 1DKRA 5CNIA 4DKJA 3TB6A 5IF3A 4V2IA 5I9LA 1CCWA 3O93A 2HZ7A 2FWMX 5BPHA 3B60A 4IGKA 1ULAA 4RH3A 3MMPA 3OD5A 4ZD6A 4MA4A 1TO2E 4JJAA 4KSBA 4K6HA 3TEJA 3U40A 1EXDA 4MW5A 2FJUA 4Q1CA 4FMDF 4TMFA 4D3SA 2ORWA 4EGAA 5K3AA 1AHHA 3OPMA 2EFCB 2YWRA 2FX5A 1JR3E 3BMXA 4KE6A 2PGDA 4WK6A 1SK8A 2C92A 4BKMA 4KJZA 4D44A 4FWIB 1RRKA 4FINA 4RPCA 2VZ8A 4EAQA 2ESRA 5C2JB 1XRSB 1O5OA 3UGKA 4WJZA 3WHLA 1VLYA 5CBPB 2PGJA 2Z43A 1ECCA 2CNDA 1OWPA 2D0IA 3AR5A 3QVVA 1UODA 1Y8QB 1ZKDA 3RK0A 1GNPA 3WGYA 5KJCA 5IEJA 3GG2A 1VPLA 1CUIA 1LLQA 4RD0A 1N1DA 3RC7A 4YELA 4BPRA 2H1RA 4M7RA 2XNDD 3FYUB 4Y7CA 3UHFA 4J1SA 5I47A 1XTZA 2B1JA 2VBGA 2ZJ3A 1RBMA 3R24A 1VQ8B 3A0UA 2CSXA 3GRAA 2Z56A 4BQFA 3JYOA 4FN4A 1C7QA 1MABA 2WIAA 3IEKA 4HNQA 4RY0A 2QORA 3E6AA 2FPLA 3IA7A 1JP7A 3WL7A 3WRXC 3NORA 5LSAA 4DR6B 5IZCC 2ANBA 2KM1A 3PNOA 3QXSA 3I42A 1NULA 1XRRA 3BTUA 5JZOA 3QMWA 3U44B 2DUMA 3OZBA 3Q12A 4L7VA 4N47A 1DRVA 2XMZA 2YBEA 1F8XA 3C3MA 3MQ4A 1F3LA 2APJA 4P80A 4AO7A 3MLEA 4KN9S 5HQ3B 5BR1A 2KBFA 1MA3A 4N0QA 1LBEA 4R2MA 3TDMA 2PAFA 1I51A 4FOLA 3BREA 3ZH2A 4AIIA 2XBLA 2AC2A 1EQUA 3MQFA 5IT5A 1XMJA 1M1YE 2C59A 2DKNA 2QQ5A 3L0CA 1QVWA 3NEYA 4YQYA 1C2TA 4RGBA 4W9NA 5T3YA 4DIUA 2GCOA 1EEXB 2RARA 1AIPA 1L5QA 3T0GA 3B85A 3TL2A 4B9EA 1PDWA 3LF2A 4D8WA 1GNSA 3UAVA 5B3LA 1I94B 5T67A 5DI3A 1HTTA 1ZD1A 3ZDYB 2RGCA 4HTAA 1I2AA 1GQSA 3L7BA 4V2UA 4QPPA 4TUYB 1Z16A 3D54D 2H5LA 4AC9A 1DBPA 4E30A 3THXB 4ONEA 4US0R 2Z95A 4BZZA 5F33A 1W8IA 2FSPA 1U0LA 3IDZA 1BKDR 1Z39A 3DL0A 5FH9A 3QE2A 3A58B 4E46A 3NPAA 1CQPA 4FD3A 1PR3A 3V4PB 2QMZA 4RPHA 5F5LA 1EHCA 4JCOA 4GEGA 3TOVA 2PE3A 1FFCA 3PXCX 3HKCB 4XDYA 2R6ZA 5ALHA 2XV1A 4F7DA 5EXEA 5KCMA 4E31A 2ZM5A 4WXHA 5H83A 3P0EA 2D1YA 3K6KA 2EARA 2IYWA 4JDUA 5BYKA 1WDMA 1D4OA 3R3XA 5JDIC 1BCRB 1T9GR 2NUTA 3ZD9A 4MVYA 1DO2A 2XYPA 3MWKA 5BVGA 2PS9A 1NC1A 1VIMA 4R1TA 2VBTA 4YLEA 3CA8A 5KDLA 1U8CB 1NT4A 2CLCX 1JHDA 4EW6A 4ZALA 4X5OA 3QSYA 2IZZA 3TI7A 3VYVA 2VBSA 1MXFA 2ZB2A 2I7DA 1N6LA 5CBPA 4NK4A 3LX4A 3OLXA 3H87A 1I6WA 3I37X 1NE2A 2IQIA 2C5EA 1X8LA 4CN8A 2JFXA 1Z6AA 2GGSA 4OX9B 5J1SB 2CVZA 4UEKA 3DMPA 4LKOA 3GLFE 4IHJB 3WYBA 1WULS 4A0HA 5HR5A 3E2IA 1L0BA 5A5GA 1NX6A 5JDCC 1LW6E 1RKXA 4KK4A 1OI2A 4Y2JA 4DDMA 5JZSA 1TT5A 3F6SA 3PQ4A 4BFSA 2B0CA 1U4OA 1ULUA 3MRVA 1ETUA 4KUHA 5CX4A 3U7IA 1XVTA 2SCUB 5AI5A 4AS3A 1DMRA 4D99A 5C4MA 4UBLA 1L5GB 4IJKA 3FNIA 3I6MA 3B3JA 1QPBA 3I52A 1R15A 3HDQA 1PU2A 2CL5A 4ECEA 3L77A 4ZQHA 5DGCA 3RRZA 1T35A 1K7EB 1W52X 4FHEA 4QOGA 1NUSA 3NBAA 1GA6A 1Z17A 4R05A 4F8EA 3A31A 4MW1A 3ND7A 3KO8A 2NQTA 1I3MA 1PR5A 5KNLA 1S2LA 4PFJA 2WYRA 2I7CA 2XD4A 4UJ5A 3OF5A 2X3UA 1AGRA 3TTTA 3NHWA 4CLHA 3PYXA 4DG5A 1I0ZA 1XWFA 2IZ7A 2HHCA 1WHSA 4YJ3F 5JS6A 4LRTB 3F6EX 4Y0NA 4NDZA 1KFKB 2J87A 5TEWA 4JLKA 3TW4A 4C5BA 1KYXA 1Y7HA 3OOJA 4O4IF 2ZIUB 2YIMA 2YN2A 1V45E 2C95A 1PR1A 1FMLA 3R41A 4KR9A 4LTNA 3LDFA 1FVFA 5D8DA 5TEVA 2ZS7A 2IXBA 2NADA 4BGEA 2DLDA 4JENA 2AW3A 3T34A 4ZHQB 3LT4A 2OYCA 1GAWA 1DUSA 3CVJA 4LYEA 4X20A 4CCSA 1YUMA 4LSMA 4HAXA 1GCGA 4BX0A 5K45A 1IPEA 1GGEA 4FI3C 2QBYA 1CNEA 4X07A 4YAJA 2CGEA 2WPDD 4FYMA 2OTJB 2I5PO 3NV9A 4GMXA 5AI8A 4OX9Y 2EKZA 2G63A 1VQNB 4DAOA 4NMLA 2E5LB 5HUHA 4DNOA 3DE6X 2B34A 1NN5A 2DPGA 5H59A 2MHCA 1H2RS 2X4IA 1HT3A 3U5ZB 4BNZA 5I4CA 3ZZ0A 3DEJA 2ZVPX 1QTQA 2VUSA 4JJFA 1RJGA 3KR9A 5AHXA 1AUXA 2A9RA 3E3NA 5C0OE 1TU3A 3LQFA 4D0SA 3A36A 3U13A 1W1UA 3OCYA 3F9CA 1ZN9A 2HF9A 2XOKA 2AN1A 5FHQA 3VPXA 4RZIA 1ZIYA 3GLFB 3PHBE 3B2QA 1LRLA 3VR6D 5BN4B 5EJAA 2I67A 4PXAA 1KO8A 5JASA 4E4TA 1WXQA 3DMTA 4YO8A 1IATA 4B6FA 1Z83A 3CMEB 4YCJA 4UM5A 4M0KA 1JG2A 4DR7B 1P4MA 3WTBA 4G0NA 1IB6A 4DUGA 3RYIA 1R5NA 3RJ9A 4ZICA 4ZAZA 3I2JA 5FEUA 5CXUA 1UT6A 4DE5A 3ZX4A 4CMIA 4BS9A 3OQ6A 5DYGA 4ARZB 1GPWB 3IJEB 1KI1A 3AEXA 3V1MA 4QTXA 1VDMA 3CEJA 1QIDA 4QFDA 3IUMA 1V1RB 2GF0A 1QX4A 2O3JA 1Y8AA 2D2FA 3W2HA 4KB5A 3GDHA 1FX1A 3W0LB 5FOSA 4RTPA 1LC0A 2ODPA 3RYCA 2VP3A 3UK0A 2C57A 2CC2A 2XVZA 3EXFB 4NEQA 2Q6OA 4YMGA 1PBTA 3TPFA 4HDOB 3I34X 3OZIA 4HTFB 4ZO7A 1LPSA 2IEZA 3UT0A 1W25A 1RE0A 2XB6A 5JATA 1RPJA 4Q7MB 1C1XA 4G4IA 1F8UA 1X0VA 1IJEA 1UADA 4X00A 1C1YA 3QKRB 5B7QA 1ZJWA 1M5RA 3TE6A 4LJRA 1OB2A 1GTG1 4QDUA 3U4MA 3BK7A 1L4UA 5ADWA 5FL7A 3DO6A 3GF4A 1QYDA 1WHTA 3ZWVA 1JLRA 2BCGY 2HREA 3LHIA 1AK2A 1IQPA 1GUYA 2IY7A 2QUJA 4POAA 4CTNA 4DJDC 4HV4A 1CUSA 3KQMA 2VDQB 5F1YA 4YMIA 5G3ZA 1CEQA 3BXGA 3GO4A 4CMAA 1MOQA 3ICQB 2ID9A 3NIWA 3I2FA 3M9LA 1W30A 3NTQA 1R3UA 4KO2S 4BO2A 3AEYA 3NWJA 5BMVF 1BQ3A 2W4MA 4RY9A 1C9KA 1GKKA 1P74A 3PIRA 1JWAB 1R6VA 1RZVA 3V5NA 2REXB 1H2HA 4AYXA 1N5RA 4MVCA 1VQ9B 4HFNA 2D2XA 4NH4A 1NBME 5TB5A 1WEHA 1GCAA 3CKKA 5IUJC 2GPAA 2VAPA 5BUCA 2A5DA 2P7HA 3V42A 1F8FA 3ZIUA 1PSDA 4MCAA 1Q7BA 1T0BA 1TMYA 4BIIA 1J20A 1KFBB 1RXEA 1E0SA 2A9JA 2JBHA 2PRKA 4DLUA 2C9MA 4GYJA 3QUCA 4TMXA 4JYCA 4W1RA 2MSDB 3SYRA 2JI4A 3UW1A 4MQEB 1E1CB 4J2TA 1NQ5A 5BVHB 4F3TA 4RZXA 4UU1A 2YV5A 1XZNA 2DHDA 4RZUA 3F8WA 2ZLBA 3KAPA 3DW3X 3HMQA 2F3PA 4F9TA 1ATIA 1CY6A 4OQYA 3UK1A 4LSWA 3PDWA 4DTIA 5KX5F 3CRW1 4FSDA 4O4HF 2VYVD 5EXSA 2WZQA 1XFOA 2OZEA 2V6JA 3RSCA 3E4CA 4KRYA 4UHEA 2MWMA 4PGMA 1LNZA 4FFRA 4ZGGA 3AF3A 1M1YA 1LZKA 2P2DA 3IE2A 2AG8A 5K3SA 4CEHA 4RZ3A 3GL9A 4AKHA 4Y2VA 2NAFA 2UYGA 3LYUA 4AO8A 3VMMA 1VLHA 4PCAA 1WP9A 3IDFA 1HOTA 1HT0A 2OO5A 3OURA 3A3BA 3EULA 4L9RA 3NV7A 3VYUB 1IIRA 1ZRSA 2BJWA 3QZUA 4RD2A 2CLHB 4XYMA 1K89A 2J1LA 3K5PA 3T3DA 1ZK1A 3LCCA 4DCJA 2IYEA 4FHDA 4Y98A 3WL3A 4ZCIA 1XTUA 2HUNA 3EZGA 5KNBD 3DLBA 2PNFA 2O2EA 3A6DA 3CTMA 3WRYC 3C2QA 1CB0A 5BWOA 1MO3A 3HY6A 1N1MA 3SICE 3FDZB 2OORA 3EJWA 3BRQA 3FYSA 3G0BA 3LT2A 4EF6A 1W44A 4MKXA 3LCJA 3DL7A 2HMSA 4Y6RA 3JARB 5AKEA 5DX1A 3ZCSA 4ZVNA 3PE6A 5SY9A 3WISA 2OEPA 1UZLA 2X0EA 3DXFA 5JRZA 5FAKA 2OBFA 4AURA 1BEZA 3CB2A 4IF6A 1EA5A 1IN8A 1BS1A 4OGFA 1T29A 3USES 4QQ8A 4OB8A 1VHJA 2RGWA 1YRYE 1MQSA 1NNLA 1IE3A 4RM0A 2OBMA 4Y7DA 3ONDA 3ZE0B 4CUZA 5KNCD 1N5OX 1PDOA 3R2JA 3UQZA 2QL5A 1CDDA 5FD8A 2VZLA 1SBZA 2JKYA 4KQGA 1V11A 3LZCA 3QV1A 4IHQA 4B4UA 2C5AA 1PJ6A 3T7TA 4O3MA 1PR9A 4KPYA 1KMQA 4UBNA 3TIGA 4AROA 1MAVA 1OLSA 1PT7A 3F5MA 5E0KB 4JYZA 1G41A 1UJ6A 3IQWA 3PR3A 3ZHYA 4ZI3A 3T3NA 1E6WA 1W5BA 4PAWA 4PX9A 4EJ2A 1ZBDA 2P65A 1BMDA 3EH1A 3IAS6 1SPXA 1EM6A 4A27A 2X0KA 1SUWA 5LN1A 1N08A 3AWDA 3TXAA 2V98A 3ACDA 4ZVPA 1EINA 3UM9A 1PJRA 3A1NA 2C7RA 1UP6A 1Y80A 1Z6XA 3H2HA 5AFSA 1KO4A 3PG5A 3O0TA 1GGVA 1DDIA 2G06A 1XNHA 2I3ZA 3TVDA 2ODEA 4MV5A 1P1FA 3MUFA 4G7XA 4DQXA 3QQ5A 3I01A 4U7HA 5C52B 2IDKA 1OGYA 3PXBA 2IWHA 3COWA 4BAZA 4J4BA 3N74A 1WB9A 3Q38A 3ASVA 4RF4A 5BSVA 3TMKA 1N92A 1KVQA 5LD2C 2QL9A 3WQHA 3NEJA 4LVNA 3I5UA 1YACA 1Z82A 1TL7C 1LRKA 1C30A 2CNWD 3BQ9A 1KERA 3G3EA 2XSZA 3I8SA 4NBNA 1YS2X 2PQMA 3C7AA 3DGEC 3NHFA 4LJ5A 1EP2B 1WA5A 4CEJA 4FYWA 3KDSE 1J2JA 1ZGAA 2FSGA 4TVOA 3N8NA 3QX3A 3ZJUA 3UOAB 4DY4A 4K81B 1L7XA 2XNDA 2HWWA 4MR7B 1BX1A 4OM7A 5COQA 4F5ZA 3JQQA 2XB4A 3BXXA 2SBTA 1M0TA 2NZYA 4E5MA 1DADA 1KXZA 3H18A 4R40A 5CBKA 4G5SA 1XMOB 2YV4A 1CUEA 5AVXA 2FEPA 1IBCA 1QDEA 4JB3A 5C81A 4FJ1A 1DAIA 2XVMA 3ND9A 3UV7A 5KU1A 3DTNA 3LQ6A 3DDSA 2WTXA 4Z9AA 1P1CA 4MWEA 3WADA 3C14C 5JS1A 1JIXA 4G4GA 4PO8A 1TJNA 2JAQA 2VXBA 1IY0A 3G2OA 5A9RA 2ZRPA 2XZTA 1CUAA 3DT9A 3O9ZA 3PFGA 2WJWA 1Z2DA 4FMDB 4U0JA 1YQ9A 1DI0A 2DWCA 1JSCA 4AF8A 3PTAA 3L05A 4K9MA 4WFIA 3WZ2A 2BGGA 3KU1A 1JVSA 2YZKA 5ALTA 5BR4A 3CRRA 2GFHA 2GZ2A 3C3DA 4IJVA 4EYKA 2ICAA 2WMDA 1W4BA 5FNVA 5ABPA 5JAOA 3FHTA 5LOVA 3FMOB 1KP3A 1PJBA 3W3AA 4PY2A 1JMKC 4RULA 2YR0A 4PG6A 4NESA 3OA0A 3V7FA 3WLRA 4B83A 2RDMA 4ZAFA 5AR1A 1TTTA 1DPFA 3OO0A 4LJKA 1Y7TA 3VO8A 1ZEMA 1M8GA 2A4MA 2ISSD 2VZEA 3C7KA 3K4HA 2YWCA 3UC9A 1JUDA 2O2DA 2DOGA 1W1IA 1LBSA 2O2GA 5KKNB 3GRRA 5LBUA 3OKCA 1QR2A 2UUPA 1K3TA 2M1ZA 4P08A 4D57A 5CURA 4YAOA 5A3RA 1F4LA 3S1SA 1N2SA 5CFPA 1E63A 2PRIA 1MOPA 2BEWB 2YY6A 2OBYA 2PLWA 2ZPUA 4NMHA 4BYMA 1WXIA 2F3RA 3JQ7A 4RXTA 1M73E 2L69A 1H42A 1W0JA 3PYLA 1B16A 2GDJA 2ZE5A 4JIMA 3S3TA 1I3KA 1Q7EA 4FUTA 3FGPA 4YV1A 1SCBA 1GPJA 4MS3A 3WL8A 5CLFA 1ODSA 4FMCB 2EZ4A 1N2ZA 2OAQ1 4KDFA 5CYOA 4ZC1A 3RBAA 3WLFA 4A8JC 2HWXA 4Z4YA 3WRXA 4QSHA 3JYNA 1GGHA 2VBFA 4XUDA 2EGGA 3TEMA 3QWFA 5I3ZA 3WMXA 3PF9A 4DARA 1U2GA 1U4SA 3NAQA 5EJ2A 1JJIA 1T25A 1ZP6A 3MF4A 4EY6A 3NASA 3KKOA 4EKIA 5AW0A 3GLHB 3GLQA 3KEWA 1ENZA 2DR3A 3E9NA 3ZV5A 4CG1A 1OAOC 1W8DA 2VHTA 2JI8A 3IOMA 1PGPA 4OQXA 2OK7A 1I10A 2NUTB 5LU9A 3EXG2 3M1AA 2BUBA 2WSSD 1GDTA 5IZ4A 2DTDA 4RKFA 3NCTA 1T1RA 1XXLA 2MYUA 1FDUA 2BSXA 1WB5A 3IP3A 4C04A 3FAZA 1PJLA 3DOFA 1HMYA 1V71A 5HRCA 1IY8A 1Q83A 1SELA 3EPJA 3C3EA 1BH2A 3CHYA 1DL5A 4DJFC 3GUHA 1LS1A 1YBAA 3H1AA 1L7NA 2B69A 1F6WA 2YS7A 4RQBA 4POOA 1NLYA 3DQQA 1LI4A 4FYKA 3L6OO 4GZMA 4LX0A 2NU8A 1OX5A 4IX1A 2E48A 1BWPA 1H4TA 1T4BA 2AZMA 4QBGB 4DQVA 4HXFB 2L0XA 3H5VA 3HN7A 1RWXA 3AVUA 1Z4JA 3BFJA 5BN3B 3L6DA 3O9VA 3K0FB 4W5NA 1XZ8A 3HWWA 4RADA 4W5OA 3O8BA 4ZOEA 4BMVA 2D6FA 4CPDA 3ORFA 2EP8A 4YCCA 3ZC3A 4H16A 4IUDS 4LW8A 4TM7A 3ETCA 1JFSA 4B8YA 5ALVA 3R4VA 5JR3A 4MW7A 4X1IB 4LBWA 2PTGA 4PZLA 3W9BA 2O8CB 5BYAA 1REQB 3EZNA 5BN3A 4MV6A 2FDCA 3ZE8A 5JALA 3WGGA 3WSWA 1GPUA 3SR3A 4GMHA 4EQZA 5IPFA 2VCEA 2C5SA 4L8YA 1OUMA 1K08A 3FB1A 5K5EA 2HA0A 2VP4A 4TWJA 4QTUB 3I4LA 1W87A 2GQ0A 3IV7A 2QEXB 4KFRA 1JDVA 1WUHS 4TT3D 4EFKA 3SY8A 1KS2A 3ER9A 1E9RA 2H8KA 2WIBA 4TV8F 2WB4A 4W7HA 1JS1X 2QENA 3AHEA 1EDBA 3IUNA 3EPHA 4P4LA 4OUKX 4GSLA 1FSPA 4CGZA 3LYHA 4O2LA 2ZYAA 3QVXA 1L4GA 5F5XA 3SJ7A 5C3MA 1H05A 1WPGA 3FDZA 3CZQA 2WSLA 1YBVA 3AJEA 1DV1A 2K6GA 3KOXA 5CB4F 1KHTA 4ESVA 3R3VA 5EJ5A 1P45A 3BXZA 1B73A 1ECGA 5ER9A 2WFLB 3VBEA 4G36A 1QF9A 1C2YA 4P7FA 2F59A 2PANA 2UYYA 4QGFA 5DPMA 5EYPA 3ZWNA 1POXA 1Q86D 2HSGA 3BJRA 5G1NA 1YMUA 4RFSB 1X87A 3GRKA 1QHSA 2AK3A 3MSCA 4R01A 2CNKA 1YIAA 4B44A 1G3MA 4IR7A 2A94A 4U2CA 2C2XA 1I1QB 3E22B 3WB0A 2IH5A 3FNRA 3Q9SA 3MXTA 4R1SA 5JNWA 4XWGA 2QAGC 2AZXA 4I55A 1VQ6B 1IHUA 5JAZA 4UFPA 2ZS9A 1EFPA 3GJ8A 5AMXA 4B2LA 1PVDA 3GJSA 2PR7A 4IOJA 4K3UA 4N5MA 4L5YA 3RSFA 1XMSA 1HC7A 2A86A 1QZXA 3B52X 5DMXA 5F51A 2OHJA 3FNQA 1KQFA 4K6OA 3A6HA 4A0QA 1QNLA 2BFDB 4EW2A 3EZFA 1KQSB 4X0EA 4WZKA 4BVGA 3H1GA 3LMKA 1F2VA 1U8TA 2FH5B 1QO7A 2XUQA 5CIWA 4BL5A 2VHUA 1A3CA 4P3KA 4DS3A 1YBFA 2QVYX 2X40A 3OKFA 4ANFA 1YS4A 2CV2A 1OI4A 1QC5B 1RKUA 3SOZA 2AN5A 4QC2A 5MN5A 1R5BA 3LI2A 3P2YA 4NZPA 3HJFA 5JQGF 1WSWA 1AZLA 2ZBPA 5DP1A 2AGVA 4YWHA 4G65A 4PQRA 3II6X 4PGHA 1P7YA 1PG5A 5IHXA 1TIPA 3MB5A 3CT6A 1TE2A 4WESB 1QH8B 2QM0A 2DPYA 3M4NA 4PINA 3ROEA 1MA0A 3AV0B 2H2FA 3CPEA 4ENPA 3GZJA 1CIVA 1MRZA 3K1YA 4A2QA 3PA1A 2PK3A 4NABA 2ZT5A 1KH2A 3OCXA 4CDRA 3PXDA 4WZBE 1LK5A 3FKQA 3VZQA 3D4IA 1L4YA 1M6VB 4ZV9A 3RSSA 1MIOA 2V4DA 1NJSA 2EQBA 4ER6A 3OTHA 4TQGA 2QG6A 2OXEA 5KPJA 1JG4A 3DJYA 2RD2A 2Z6BD 2Z2XA 3AFIA 3NHUA 5ETJA 1XPUA 3U9LA 3F7MA 1QQ5A 1KQNA 1JLMA 5KZMB 3H5NA 3ICVA 1RLOA 2VUIB 2GA8A 4X0CA 3C3AA 4LRWA 1DNPA 4K9SA 3RTGA 1GLNA 1HK7A 1ZCBA 3LFUA 1E3WB 4NFLA 4QDTA 4DA9A 8ADHA 1UBKS 1Y6JA 1RFGE 1RVDA 3MW8A 3R3SA 3HP4A 2CCKA 4KREA 2NZVG 1G3QA 2X7HA 4FHZA 3S5JA 4DCTA 1GKLA 4TLAA 1NKSA 4WBNF 2G40A 1SUAA 3D6UA 4G97A 3AIMA 5E2IA 2Y4OA 2B3DA 3FRHA 2GUWA 3O7WA 4JT4A 4W5QA 1SWVA 7MHTA 4B3IA 4LE2A 1DCMA 1TTHA 3UJ7A 4KKXB 1IDN1 2XTMA 1XVIA 1NBMD 1PJ3A 2EX1A 2Y1LA 3H13A 1NVKA 4GM0A 4YB8A 3ROTA 4IDDA 1P5RA 2GCOB 3C3PA 4JSTA 2XWJI 1GDDA 1VSQA 4I1SA 4PU0A 3Q41A 4GAEA 1NBAA 2P6NA 3MTBA 5HKKA 2QM3A 3SLDA 2JIOA 4X1OA 1BCSA 3EIXA 5BQ3A 3TFOA 1HVXA 1YNSA 1FJ2A 2NPOA 3EGEA 5EP4A 1OH6A 3EAGA 1F0NA 2HXGA 1ZMTA 2JHAA 4E5YA 3ZWYA 1XIVA 1YAHA 1ZCAA 3N6RA 4P36A 5ECWA 4F3RA 1IDOA 2CZCA 2K2QB 3RYHB 2PA0A 3HQ4O 3K4PA 4YA6A 2V4ZA 1GFZA 5KTNA 3HEBA 3BXFA 3A6EA 3GA7A 1F2TB 1VKRA 5AW6A 1R5OA 4EHKA 2OFOA 2ST1A 4C3OB 5F35A 4FB5A 2A9OA 4FYXA 1DARA 2G0AA 2EGHA 3D3JA 3LH5A 2XQJA 3LRTA 4NAHA 4TZKA 3COPA 3GLIA 3BILA 2VOEA 5TSDA 3TQTA 3IO5A 5EXPA 3RFCA 3TR0A 3F4LA 4F92B 1YFJA 1GZHB 2IEYA 3OX3A 1WXFA 3K6JA 1TLFA 4RA6A 3JQFA 1Z0FA 3D4PA 2CJPA 3GJ6A 3RQSA 2RBGA 1YB6A 5HMLA 4DMHA 5DLQC 3CWZA 4NY1A 1ORHA 1YVUA 3LP5A 1B8OA 4LBYA 1AKMA 1WTCA 2J7PA 3AR7A 1DKOA 3EH2A 3G0DA 3M5WA 4I1UA 2F67A 2B8JA 2Y9PB 5FBRB 3STVA 5J4KA 5DM70 4Q7EA 1NAIA 4IDNA 3SJCA 1P5ZB 1FNDA 4TKUA 1HURA 3FNEA 4XRGA 5FUMA 5IH7A 4DWWA 1Z4NA 1BXRB 3A3KA 4BPBA 1WOOA 1U3WA 5DMHA 2C7BA 2OT3B 5AOBA 7REQA 2H1HA 4I9FA 3WG9A 3F6YA 1JPUA 3WJ1A 5JISA 5LR6A 3OSUA 5I4BA 2QRPA 2ZRDA 3B1YA 2R8PA 5IAOA 4ICIA 3KXLA 3M70A 4PYIA 3C6YA 1VJ1A 2QXYA 1QP8A 4RBNA 3L8MA 1OBVA 4PAGA 1LFDB 4WBNB 3PDIA 1MX1A 3DBRA 3KVOA 4QPZA 3KB2A 5JCXA 2D8AA 1SRQA 4NG4A 3OOHA 5G3YA 1CF2O 2AUNA 1RYBA 4L27A 1SBQA 4OA5A 1PO7A 2GTPA 4D9MA 3JD3A 1T6ZA 1GZ4A 3A1CA 2BR4A 3BJZA 1CUGA 2J33A 3MCWA 1Z6YA 4O2BA 5AW2A 2ZSEA 3WLIA 3LC1O 3MJ4A 4RE6A 1AMUA 3COSA 3LUPA 2IE8A 4UU0A 2ZATA 3U3XA 1M5UA 1BE8A 1JHZA 3IVRA 1QAOA 2IVZA 2W43A 3M3PA 4I9GA 1TD9A 3R4CA 3L1UA 4L95C 2ZBEA 4AJEA 3IE0A 4LE0A 5E4JA 2P9QA 3TAXA 5I7SA 5B7GA 3E3MA 5JFOA 3HVIA 4QJIA 5IH3A 3QBJA 4O4JF 1J8MF 1HDYA 1NL3A 2C8VA 2X53S 1U9IC 3GDOA 3GMDA 2I6GA 3IHWA 1DQZA 3DLIA 1E9CA 3BGSA 1DRKA 2DYKA 3OIUA 4KQJA 1U1DA 5FL3A 4EG7A 1FIUA 1P5FA 4XQEA 2XIJA 3L79A 2MCFA 1MRNA 4KTVE 2QYOA 2ZR7A 3TTUA 1N2IA 2PS1A 4Q21A 4KQ6A 1G8SA 2VF4X 4GQIA 1J33A 4FYIA 3RKSA 3ZLVA 4HEHA 1BIFA 5KAMA 4AJPA 2JVJA 3NE5B 2AUTA 1MOSA 5AH0A 5IN5A 4AQDA 1EYZA 5DCUA 5KNDD 3RLIA 5EPOA 3AVWA 3UGTA 1FLNA 2YJ6A 4JOCA 3QPBA 2WWVD 1X39A 3LK6A 4M0PA 4BFYA 1C1HA 3UIEA 3ZZNA 3DFMA 3GXBA 4F97A 1R0SA 3DV0B 1EK6A 3IMFA 1GGMA 3Q3HA 4JI1B 4K7JA 4L4XA 4BMCA 4D9CA 4YCMA 3KQOA 5TLSA 2ZUEA 1KK2A 2PX8A 3UJ6A 3V7YA 3VU8A 1EP1B 2CFCA 2EKBA 3PQ3A 2EHDA 1VSVA 4OBBA 5ALXA 3RFFA 2BI8A 5BSMA 1NWCA 1CUUA 4EYOA 4D9FA 4LDJA 3FNFA 3MTAA 3TZKA 1ZRMA 4XOTA 3G89A 3HI4A 3PKZA 4GECA 1EX9A 4HDMA 4MJ3A 1KAOA 5LZ7A 3TZQA 3CIFA 4HY3A 1ZO8A 4EYQA 1BXRA 4JLSA 4U7WA 3RTCA 3TRDA 2V7QA 4QM6A 3ODGA 1Y3AA 4MWDA 3FPSA 1CK4A 4XYEA 1JIJA 3FPPA 1ABEA 3HFRA 3GPBA 5GMOA 4LUCA 3A6ZA 3FDJA 2ZR8A 3TLCA 4QJ3A 4B3SB 3N1UA 1M9NA 5ALLA 5FUBA 1WSVA 1GADO 1E0KA 3EDQA 1APBA 4YAKA 1KWKA 1YRWA 2QZPA 4TS1A 3TRFA 3K16A 1YO6A 1GTVA 2HNAA 3U1TA 3Q3VA 4ROSA 4DHWA 2PGLA 5AK4A 1JX6A 2DVMA 3PHGA 1U5BB 4WKNA 1T5SA 3FJOA 2FFHA 5K05A 1RKBA 2QTAA 1JA0A 5EZSA 4BFTA 4YFYA 4XWKA 3EQ9A 5KQLA 1XPOA 1VRWA 4IIVA 2HPHA 3A3YA 3EXFA 2GKSA 1ZY2A 4AS2A 4EUSA 4X9XA 1S3IA 4F6CA 3GIWA 3V8RA 4Y8VA 1R6BX 3T0FA 2YW2A 3GUYA 4G8DA 1R64A 4LYGA 5G0UA 3TQHA