4M4SA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in complex with gdp and formate ion mimic aif2gamma*gdp*pi complex (a formate ion substitutes for pi)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSADVNAPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIAFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
total genus 108
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m4sA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m4sA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m4sA01
1TUIA 1DBSA 2QGNA 4C0KA 1LF0A 1Z8FA 2YC4C 3KXLA 3CWZA 3ECCA 3JZMA 5EUMA 4ZGNB 3CCQB 1E64A 2PZEA 4IDQA 2AFHE 5FPYA 3RWMB 3UANA 1PV4A 1RYFA 4WXRA 2K5UA 4EJSB 1E1RD 3QEOA 4WQMA 1JR3A 5CJ2A 3FMFA 1TVCA 2BGIA 1HTWA 2XX3A 2CRVA 1AK2A 4OI4A 2B8WA 3UXMA 2EFEB 1PUJA 4OHVA 3CKLA 1JBKA 5LDDC 2O8EB 1I4TD 2OBMA 3TR0A 2F9MA 3FFAA 1IJEA 1YE8A 1IB0A 3M1IA 3QE0A 5JI3E 1G8HA 1AM4D 1GAWA 2BM0A 3TAHA 4PTLA 4Q19A 1GM5A 2DB3A 2CHVA 5KDOA 1CRQA 5B2ZA 3EA0A 2QPAA 1LFDB 1Z63A 1XBTA 4ERNA 4MITA 3KTAA 3WRXC 2DHRA 1PLKA 2OK8A 3AF0A 3LDAA 1A4RA 4OQNA 3QXXA 4P3YA 3K70C 1YRBA 2ZI6A 3GQBA 1HA3A 2VL7A 2YVUA 4ZGQB 2QP4A 3LW7A 4C0SA 1Q7YD 2UKDA 1E2HA 4P4SB 5SZKB 5KHOC 5AJYA 4DB2A 3HWSA 4TQ9A 4A4DA 3GLIB 5B58C 2VHUA 4B75A 5JRZA 1X8LA 1ZJ6A 2ZSAA 4RFSB 3TSWA 1P72A 3KQNA 3P27A 1N5IA 1P9RA 3QI2A 1T4GA 4O0MA 4KFSA 2YZ2A 4E22A 1G6HA 4KXFB 3THXB 4B73A 3WBJA 1YZTA 5FH9A 5K8LA 4KVAA 5KU1A 5KSZA 4URYR 3RRNA 5EUQB 1S3SA 2X1VA 2NO1A 1GSIA 2SHKA 1J90A 1NVUQ 1P75A 4E5UA 3WNDA 3VU9A 2ZYUX 3A1WA 4TMXA 4FCTA 3R7WA 2PJZA 5BYJA 4Q4HB 2ODWA 1L4UA 1KZGB 2VHTA 2X19A 2OEPA 3PFIA 4AF6A 2WWIA 2ZR9A 3DL0A 3PEVA 3H0KA 3NH9A 1TU3A 2OV2A 3AF3A 1IY0A 1OV4A 3KUCA 3VR4A 1C9KA 1CIPA 5G40A 3X1YA 4Q21A 3I56B 3A4NA 5TY0A 3C15C 1OIXA 1OXSC 1KI3A 2OSBA 1EFHA 3EPHA 2GQFA 4LYHA 4WAUA 1E62A 1HE8B 3CZPA 3BOSA 1T3SA 1WXQA 1Q81D 2AHOA 3CCVB 3GLFB 1G3MA 2VYQA 3RDPA 2ZI7A 2GKSA 4MYTA 4LJ7A 5CLQA 2O5VA 1NN3A 2WIAA 1SM4A 2IC5A 2Z83A 3ASZA 4DCSA 2DFKB 3PUZA 5JWRA 1XCPA 2PMDA 3Q5DA 3C14C 4NYJQ 1WMSA 5HCNA 1VG9B 5E4FA 2FG5A 2FFAA 2ZRBA 4IVPA 1L7VC 4IXMA 1RVDA 721PA 4GRAA 1VMAA 1ZINA 2KE5A 4C7OA 1P2TA 1N5LA 3P4YA 1BMFD 1XZQA 2YWFA 3GD7A 3BXZA 2OXCA 1OH8A 1OIVA 5D3QA 4BEBA 1E69A 1Z22A 2IXGA 1AJEA 1SZPA 3QNUA 4W7SA 4P32A 2WJIA 1IY2A 2BKUA 4EPWA 1QGAA 3WHLA 1N6LA 4D82A 1G8FA 5FPKA 1CULC 3C4JA 4PAMA 1IJFA 3W2IA 1NN0A 1P2VA 1BYIA 2ZYVX 5JHHB 3TVDA 1TL7C 1NLZA 5LBIA 1E94E 3QKSB 1YR8A 3AV0B 4OHYA 4DBLC 2FSFA 3W2EA 1YZNA 2UZIR 3M0EA 1XCGB 3X1WA 1QZXA 1UKEA 1VCOA 2IYLD 4B48A 1GNPA 1VDZA 3TK1A 5GADl 3OE7A 4RY2A 2AD1A 3ZZ0A 1E2MA 2KJQA 3S1AB 4FD2A 2XTMA 1MH1A 2F9LA 3OEHD 3A58B 2H92A 2QMUA 3ZBTA 4ZKDA 2RC6A 2PBRA 2ZI5A 1KKMA 1H8ED 3QEJA 6Q21A 4F4CA 1KNXA 2RHDA 5AUQA 5EE5B 4UQOA 3UG7A 2QA4B 4JKYA 3G0HA 1CJKC 4IOJA 3QPUA 5HE8A 1J70A 1GVNB 2LWIA 3KUDA 1P2UA 2Q3MA 4A0FA 1AQUA 4F91B 1NVVQ 4PC1A 2GTPA 2BHRA 1UF9A 1W0JD 3IIMA 4FN5A 3E1YE 4ZCIA 2CEAA 1XPRA 1KSJA 2QTZA 1YJ5A 2N1BA 2FMXA 2JLQA 3SOPA 1NG9A 4B44A 3ES9A 2W2VA 1I4DD 3DMNA 5M04A 1XB2A 5K8IA 4CIDA 4MYHA 1E0AA 2AFIE 2YOFA 3I3SR 2CLSA 1A82A 4Q1AA 5SZHB 1RC8A 4QJ3A 3RC3A 3T5GA 4Q1EA 2V4ZA 2ZUDA 4CYMA 5AJWA 1Q3HA 3KTAB 4D6PA 2W0SA 3DZDA 3L2OB 1NSFA 4X8MA 3E1SA 1JAIA 4YXWA 1R8QA 1DADA 2GJ8A 3K9HA 4JYBA 3ZZUA 3RS0A 3UMFA 3JVVA 1N6HA 4DLSA 3CCLB 2A78A 4NH0A 3Q7PA 3QENA 2VP9A 4EAQA 3GPLA 4M4SA 3ZLJA 4URVR 1UKVY 1VCNA 3LBIA 5FTNA 1QUEA 4TMTA 1AMOA 1E79D 4R9UC 2WWGA 5C18A 4V0NA 4TMWA 2F43A 3ONWA 3LNCA 3X1XA 2RB4A 2BSAA 1DG1G 2MMGA 4US2R 2GXAA 4OKSA 1L2TA 4S2EA 1UBCA 4UXJA 1T0HB 4NPHA 2ZE8A 1OFIA 1VQPB 3BB3A 3NEYA 5DYIA 4C0BA 1ZD1A 2D62A 4P6VF 1FRQA 1IN6A 3GJ7A 2XNDD 5IHPA 5HXBA 4AG6A 2OE2A 4KVGA 4MKIA 3FKSD 2VEDA 3VU9B 4DLVA 3G5UA 1EFRD 1NNEA 2NTYC 3WP1B 4ARZA 1XEXB 2GPJA 2V9PA 4QKQA 1E0JA 3HJNA 2C5LA 1GAQA 4ACAA 4TT3D 3U7GA 2KBEA 3ADKA 4IJMA 4RZ2A 2JAQA 4P31A 3IO5A 5A5GA 1HQYE 4JSYA 2AR7A 3B1ZA 4LOAA 4BFZA 4DLWA 2ORWA 2RGGA 2ZAMA 2FH5B 1AKEA 1SKYE 1N6OA 4RCYA 1DG3A 4Q02A 3SYLA 4EFMA 1MO3A 5L3RA 4KHZA 3KQLA 2ZS8A 3KXIA 2CK3D 3LVRE 4PAQA 1P5ZB 1XD2B 4TMVA 4D25A 1SULA 3KJHA 5EJEA 3KB1A 4F4JA 4C0QC 1UKZA 1COWD 4QRHA 2BWJA 3G6EB 4M9ZA 3T5DA 2RHMA 1NMXA 4DLYA 3ZS8A 4YMSA 2GXQA 4OHZA 4DC9A 2ORVA 5D3MA 3UPUA 2BN4A 2PIAA 5FR1A 4G1BA 1DAMA 1A5TA 4TL7A 1KO5A 1HE1C 4NCIA 2J0SA 3AF2A 4YAUA 1KAOA 2OBNA 5FI0B 3EPJA 5KOYA 5LD2C 1KD1D 3AF4A 1BYUA 1LF5A 1D2EA 1JB9A 2F3RA 1YVDA 4N3GA 4HUQA 2WKRA 5JECA 4M1SA 4MH0R 1T3LA 2WWFA 2BEKA 2N42A 1VQMB 4E07A 5CB8A 3GMTA 1MR3F 2XJ4A 4BFVA 4HE5A 3I62A 1PLJA 1W4BA 3VKGA 4MRNA 4PQRA 3R8CA 1E9FA 3LH5A 1G17A 2B7BA 1G41A 2GBLC 1AGRA 1KI7A 4G01B 5EXXA 1KTVA 1QF9A 2QMEA 2QROA 1DAEA 4GP7A 1VQNB 1OYYA 1G4UR 4RD1A 1GKYA 1CF4A 1ANKA 2PLFA 3SJBA 2E87A 1CTQA 3OEHA 2B6HA 1Q12A 4AI6A 3IEVA 4U5XA 1OSNA 2L0XA 2P6NA 3A8TA 1BQEA 1RZ3A 521PA 4POAA 5G41A 1X8KA 2KI5A 2QDXA 2J41A 2ANCA 1E2GA 4IDPA 4LX0A 2HCJB 4GI7A 1YJWB 1ZUHA 1JA1A 4RD4A 1S1CA 2GESA 4FMDF 1W0JA 4Q00A 3W8RA 3NKVA 1MO4A 3K9NA 1IM2A 1G9XA 4B6EA 2NO7A 2QT0A 3AP3A 3IHWA 3MG9A 3AQ4A 3QVUA 3BORA 4JMPA 4D4MA 4YMVA 2HT1A 3CRQA 4LV8B 1XEWY 4PQYA 1R8SA 5BWMA 1SQ5A 1XTJA 1MT0A 3VR5A 2XJ9A 4GNKA 5CJPA 3RS5A 1IAQA 3O8BA 2QM8A 4XOIA 5CK4A 2PX0A 3SFVA 3QPVA 4KO8A 3TQCA 1JJ2B 1FUUA 3GJ3A 2GZHA 3V9PA 3T1TA 3OIUA 3OJXA 1SXJD 4BFYA 4XVQA 2V8OA 3CC4B 5DH9A 5DHAA 1KO1A 2VHQA 5F2EA 2FSHA 2WZQA 1IONA 2A5FA 4WZBE 4FWTA 4Y0AA 1OJLA 2DFLA 3WMGA 2YWEA 2IS4A 4F7DA 4K46A 4RVCA 2QAGA 4N0EA 1W44A 1XWIA 3DDCA 2P6RA 5DI9A 1O87A 1E0KA 1HYQA 3AF1A 3EWSA 4QM6A 3U2QA 1KAGA 2D4HA 2GCOB 3T06B 4QJ4A 4M1TA 1KOFA 1CXZA 2D74A 1E79A 2EYQA 2OLJA 4M21A 2GEDA 3CCUB 1T8TA 4IDNA 5J4LA 1CJUC 4LYAA 5A0FA 1GILA 2IEYA 3NIBA 4RSGA 3KB2A 4CEIA 2FGJA 5CDFE 1Z5ZA 3CXCB 4JZKA 3DMDA 4URZR 3B9QA 121PA 1MRNA 1FPMA 1TPZA 3OJWA 3CX7A 3LXRA 1FP6A 3EPLA 1V43A 2OM2A 1FMJA 2C8VA 2PEZA 1BX1A 1FX0A 2UVQA 3FFBA 4PHFA 3CRMA 4HAYA 2XNDA 4QBFA 2GK6A 4PX9A 2GCNA 2FU5C 4JL5A 4ARZB 3SNHA 3TUZC 1TX4B 3VNVA 1LNZA 2OAQ1 5B57C 3FHTA 4LBYA 4TSFD 1S9DA 2JDID 1EFRA 3THOA 5CM8B 1O3YA 1SVIA 4LDJA 2A30A 1W0KD 4TT3A 4V0OA 3W8NA 1B2RA 4HZIA 4L9SA 4M1YA 2OCPA 3ND9A 2ZI9A 4KAXA 1JR6A 2P6UA 2MSDB 1QVRA 5EXTA 2GJKA 2H1LA 3IHLA 4DIDA 2YNMA 1YKSA 4OYHA 2XZOA 2NZ8A 4BZXA 2WMOB 3V4RA 4DUGD 5A4JA 1WQ1R 5J4HA 1E9DA 1T6NA 2EVWX 2CK3A 3NBXX 3OIVA 3RWOA 4NMMA 3VAAA 3CCEB 1GIAA 3QUSA 5E7JA 1RPZA 2AKYA 2VP2A 4D26A 3LQQA 4WXPA 2W6IA 5FL3A 3AKYA 4YAWA 1YIJB 2X8AA 3VO2A 3BC1A 3CPHA 4MUBA 1ZU5A 3E2IA 5KPDA 1TEVA 1VKJA 3P1JA 1VQ9B 2BMDA 2ZYTX 5FOWA 3QXSA 4RJLA 3A4MA 3VR1A 1BX0A 4PAOA 3PITA 4HUQB 5UKDA 4PSKA 3K09A 1AN0A 1PJRA 2ONKA 3W6PA 4BE7B 1CS4C 3WBKA 4IOLA 1GRNA 2WJHA 4PC3A 3U4QA 4EJSA 1KC8D 1KO8A 4QG7A 1OHHD 2ZSBA 2JGNA 3MWYW 2AL7A 5JWOA 4PGOA 2C96A 1Z6AA 2E9SA 2O8EA 2PCJA 1DELA 5FBLB 3Q3JB 4I4LA 2H7VA 1W4RA 2RGDA 1OLOA 3QKTA 5DIFA 4TTQA 5EZ6B 1DAFA 2Z6VA 5AR1A 1RJ9A 1DS6A 3GCGA 3ZD6A 5DO9A 5JEDA 2P65A 2DWOA 3CRZA 4FWIB 3EZ7A 2VO1A 2V6JA 1AS0A 4A8JA 2H17A 4TLEA 5IF9A 3TRFA 3W5UA 3B1YA 4LC1A 1U2RA 1KK1A 1I4LD 1QDEA 3MSXA 4FMCF 3LLMA 1G8GA 3QG5A 5FUVA 3TSOA 1W36D 1TUEA 2GVDC 4P4SA 4DRZA 2CE7A 4A36A 4B3BA 4YC7A 1S0UA 3TUJC 2CMKA 1UDWA 4IEEA 4C0LA 1XTKA 2LKDA 2OFWA 1JQLB 2ZEJA 3EZ9A 4V0KA 2E1RA 5AJZA 4EQ6A 5FBRB 4US1R 4JLDA 3MMPA 1R4AA 4LHXA 1AIPA 3SDZA 3L82B 1KMHA 2ZJ5A 4URWR 3AKEA 2ECKA 2BMWA 4TLBA 1GWNA 2IW3A 4KBGA 4DDTA 3W5HA 3B7GA 1G8PA 3PVSA 2AN9A 2BV3A 2J0VA 3LFUA 1FNBA 2ATXA 2GWHA 1E2JA 3L0PA 5CM9C 1BO6A 3O47A 1TU4A 2V7QD 1OE0A 3ZD7A 2ZIAA 3WYGA 1RRPA 5L3SA 2C9YA 5JCZA 1SXJA 2X2FA 1BKDR 3IIJA 4R71A 2PZGA 4MKHA 2FE4A 4WOPA 3AB3A 4Q66C 1XDBA 5GJBA 3U7FB 2H16A 3QY0A 3C5CA 2BC9A 1I7PA 2VHJA 1IXZA 2Q21A 2ZE5A 1FUKA 2JA1A 1M34E 2GEVA 3ASYA 1TEXA 2FPMA 1E6CA 4RZ3A 4UAJA 1UDXA 4E03A 4CEIB 2J45A 3I4LA 1E2DA 3Q7QA 4GOJA 1DEKA 1Q86D 4RD2A 2G0NA 1Q0UA 3FMIA 4TLDA 3D7MA 3UWKA 5IT5A 1NSTA 1Q1ZA 5K8UA 3LA6A 1YU9A 2GJSA 1FX0B 2JASA 4U7DA 1R0YA 4K1XA 2AXNA 4XH9B 1W5SA 3HU2A 2RGNC 3C8UA 1CR2A 4M1WA 1VQ4B 3EXAA 5LB2A 2R6HA 2QTVB 3WYAA 1NBMA 2O0JA 5B30A 4Q4JA 1KY3A 2ZS9A 5H70A 2FSIA 4L4UA 1KNQA 2F1RA 3Q5EA 4NBSA 4WZ6A 4TN1A 1P60A 4JVLA 4M9QA 4NYMR 2QE7A 3JQQA 4R2HA 3KJIA 4TSFA 3V4FA 2JDIA 1JNYA 1W2HA 2EWWA 4RFVA 2IWRA 3BB1A 4DXAA 4A2QA 3X2SA 1QG0A 2QBYA 3KZ1E 2VNIA 1W0KA 1II8A 5HZHA 2ZRKA 1Z6XA 1UM8A 4ZV4A 2BDTA 3A1VA 4LJ6A 4B71A 1GG2A 2HJGA 3FWYA 2NO0A 2NO9A 1AZSC 3AKDA 4EIWA 4IW3B 4C30A 2J7KA 4DUGA 4KLNA 2QTLA 1OKKA 3K0SA 4BPRA 1N0VC 4E09A 3GFPA 2BVNA 4AYWA 1LTQA 4N0DA 2ZRHA 3A1SA 4LGMA 2Q3HA 1F20A 3THWB 4WZAE 1TF2A 1ZUIA 2BCJQ 1GR1A 2ZQ5A 3AEZA 1YRAA 4NYIQ 4G1VA 1NJID 4B6FA 3BFVA 4Q7LA 4DLUA 2XSZD 2D7DA 5SZIA 2ZYWX 5E3HA 4W5JA 1OFTA 1E9SA 1FTNA 1XF9A 3I55B 2BGJA 3CF6R 3SBEA 4A2PA 3U4QB 2ZITA 4R98A 2VPPA 3L0SA 3NH6A 4DEYA 1OXVA 3DOEA 1D8TA 1A2BA 1S1MA 3CLVA 1Z06A 3QE2A 4JLMA 3B5JA 4JVSB 5JRJA 1KJZA 4MGIR 3IO3A 1E9CA 1C4OA 5FR2A 4AIIA 3VKHA 1IXRC 3BD9A 3FMPB 1KDRA 3X1ZA 2AD5A 3ZYCA 2RGAA 3QSYA 4HLCA 2OHFA 4NP6A 3BWDD 4PPQA 1RJ9B 4G3XA 4YMTA 2F3TA 3PIRA 3QFRA 3TQFA 1E98A 1EWRA 5EP3A 1RRGA 5KUTA 2IS1A 3DM5A 1EFTA 1NKSA 2HLDD 1P61B 4A8JB 4PHHA 4LHZA 1Q1QA 3QF7A 4MRSA 5H1YA 2VP4A 4CEJA 3IQWA 1DOAA 1JPJA 4F93B 3FB4A 2J46A 3QF4A 3V76A 2PMKA 2VBCA 1G1MA 2AK3A 4UJ5A 2VLIA 1UBGA 1ZAKA 1FFHA 4O25A 1D9ZA 1HT1E 5GVRA 1M74A 1RRFA 3I8SA 2JLWA 1G7SA 4AKIA 2XTZA 2G0TA 3CCRB 3NHAA 4EQ6B 3FPAA 3LWNA 3G82C 2JLSA 2OUKA 3RSLA 4LK2A 5HZKA 2CVHA 2JIZD 1KMHB 1PLLA 4RZUA 2P0EA 4DLXA 3MWKA 3NBFA 1OB2A 4JJZA 1E4VA 1GAJA 1ZM2A 1XTIA 3ETLA 1PVOA 3U7HB 3DHWC 1UKYA 2ZJYA 5FOTA 4OJQA 2V55B 4DSUA 1XMVA 2X3UA 1EWYA 1KIMA 1Z28A 4XD7D 1S72B 3W2GA 5L3SB 3BGWA 2QUZA 1D9XA 1F5NA 1SXJB 2GF9A 3LLUA 4I1OA 4WVFA 4C2TA 4YHBA 1XJQA 4MRPA 5C1BA 1QVFB 1DARA 3O8RA 1XEXA 2V7QA 3RNLA 1DVRA 4BFSA 4EPTA 2BF4A 2ZJBA 2GILA 1E9BA 3IIKA 2IF2A 1A1VA 4IHQA 4FINA 2NO6A 3CM0A 2CBZA 2QENA 4P0TA 2HMAA 2J7PD 1F2UA 4MKFA 1FP7A 2CCKA 4W5HA 4TLCA 4MGYR 2GRJA 4JBYA 1OXXK 3ZBUA 3VHXA 2R6FA 2Q9BA 1XD2A 2ODEA 2R65A 3CH4B 1X86B 1T5IA 1R7RA 1WP9A 2RC5A 1TQ2A 4QHSA 3N70A 2B21A 4GSYA 1KDPA 1JJVA 1IBRA 2R6GA 4CEHA 2R44A 4Q7JB 3EC1A 3T15A 4JL6A 2XXAA 2CXXA 5DGXA 1OT3A 1KMQA 3C16C 4NU0A 1AA9A 4KYIB 3W3ZB 2VIIA 3ZDQA 3EPKA 3OZVA 1XFAA 2ZAOA 2IXEA 2IYXA 1NKTA 2HXSA 4NONA 4Q4JB 2IYUA 4FIDA 2OO7A 3MHPA 1YQTA 2ZRNA 4UXHA 2PCLA 4BRWA 3ZVNA 4JLKA 3ZVLA 2BIFA 5FBQB 2GCPA 1ZMXA 1R0WA 4JJKA 3NEJA 2ZU0C 4ILEA 5LPNA 1BOFA 2QEQA 2QBYB 2HYIC 2GZAA 1IN8A 1II8B 4OQFA 2A5DA 4C0HA 5CLLA 4O2LA 1EFUA 2WMNB 1DAGA 1E4YA 2Z5FA 4XTRA 1R0ZA 3B2EA 1XEFA 1E2FA 3Q8XB 1WBBA 3VR2A 3QXHA 1E2IA 1G5PA 2ZPTX 1X1SA 2A9KA 1Z0JA 2DWPA 3EG5A 1WDTA 5KNCA 1GFIA 2GK7A 2QAGC 1TLLA 5FTJA 1Z29A 2QPTA 1R2QA 1SVSA 2A7QA 1T3HA 1VG1A 3OF5A 3AVUA 3TKLA 3AM1A 1DDGA 1J9ZA 1M1YE 2V1XA 1QRAA 2AWNA 3VHLB 3U44A 4PXAA 3EARA 5DN6D 1B23P 1OFUX 2D06A 2Q9AA 3IBGA 4I1UA 4KODA 3RANA 2IYRA 2ZRJA 4CF7A 3A4LA 4MRRA 2KSQA 4EFLA 2V6IA 1XTRA 3EX7C 3ZVMA 5CITA 1GUAA 1XTQA 4QM7A 4AWXA 2C78A 4QJ5A 2ZR0A 4B43A 1E1RA 1EG7A 4I99A 4GL2A 1KI8A 2TMKA 3K53A 2IUTA 3AVQA 1E2PA 3WY9A 1TAGA 4NDZA 1W4AA 4EPRA 1QHYA 2O0KA 1EP2B 4TTRA 1OW3B 1YR6A 3EZ6A 2RH5A 3PV0A 1YI2B 4Q4AA 4JL8A 1KI9A 3GP8A 4HYYA 2VHCA 4BFUA 4XWOA 4M1KA 1G3IA 1HEIA 3OESA 4B2IA 1TNDA 5FUXA 4H9GA 3H1TA 1ZC3A 1NVXQ 1K5GA 3B6EA 5FOXA 4NCHA 5GJWC 1YZUA 3FPKA 2AWOA 4ABYA 3PUVA 5JZVA 4CEJB 3RSOA 1FQKA 1ZCBA 3IPXA 3QF4B 1LS1A 3CBQA 1J99A 5THXA 2C98A 3NG1A 1IQPA 4AKHA 1UPTA 4HAWA 3LX8A 1AQYA 1OXTA 2FEMA 1W36B 4XVRA 1W87A 3WXMA 2WWXA 3W6NA 2GCOA 3EW9A 1KI1A 3GLHE 1OH5A 3CNOA 4EPVA 3B85A 3EIQA 5H8WA 4U02A 3JZAA 3GEEA 1Z2CA 3K09C 2ANBA 4FCVA 4X8OA 5L3QA 3AVPA 3B82A 2A2ZA 3OIYA 2DCUA 1XNJA 1GTVA 2HXYA 5EXPA 5EE9A 4PANA 5C2JB 2G88A 3REFA 2ZE7A 1NRJB 1G7TA 4EJSC 3U3KA 2OILA 1J2JA 4G0NA 4BRUA 1NDHA 2ZREA 2WV9A 4HZUA 1Q57A 3HP1A 3LX5A 4ZKEA 3WRYC 4CT5A 3TBKA 4XD7A 4GBMA 4D4KA 4M22A 1N6RA 4L15A 2OFXA 1QHNA 3Q72A 4GOXA 1M8PA 4RKEA 3K0AB 4QGAA 1P73A 5JS8A 1GNRA 1ELOA 1JI0A 4DLTA 3QPWA 3SBDA 1GVHA 2RCNA 2VF7A 5KSOA 1F2UB 4B32A 4LCBA 3KKOA 3SS8A 4BFXA 2Q0HA 4A8JC 2J7PA 4URXR 2QT1A 3E70C 5DISB 1U0JA 4ZDKA 1EXMA 1S3GA 4A2WA 2QY9A 4GT1A 4ASUD 2GJ9A 2Z0MA 4CEHB 4LY6A 5ANRB 3TLXA 2R8RA 2WJJA 2XXAB 2RGCA 1XX6A 3TMKA 4OHXA 3RS7A 1XZPA 2YOGA 1XXHE 5KSWB 3RABA 3B1XA 1OB5A 1E2KA 1P9NA 1II9A 1VCMA 2B92A 2WVJA 3RS2A 2JLUA 4GMXA 1LB1B 1EK0A 1KGDA 4XTCS 1W34A 2CDNA 4KFRA 4A9AA 2WKQA 3ZC3A 1BMFA 3RS4A 1ONBA 1DPFA 4GOKA 4IDOA 4XSGA 3M6AA 4LUCA 2C9CA 4B2LA 2CE2X 4DVGA 3AVXA 4PZYA 2BJVA 1QHHA 3GLGE 2XZLA 2F6RA 3MCAA 1P2SA 4AK9A 2FNAA 2Q3FA 1KRHA 2QTFA 1I2MA 3K8YA 2OFOA 3LO5A 3HR8A 4C0JA 3SYNA 4EUNA 1BIFA 2REBA 5FTMA 3D8BA 4R7ZA 3I5YA 1SXJC 4MRVA 4UXIA 3BAFA 5KDDA 3OAAD 2VRWA 3T35A 4B4DA 1I2DA 2QP9X 2ZVPX 3CNLA 4KSBA 4Z54A 3MGCA 3SZRA 4IEIA 4B34A 3RRMA 1FMLA 3JQRA 3FVQA 2DY1A 2IYQA 4IKEA 3U44B 4Q9JA 2BOVA 4BUJA 1KI6B 3E20A 5FOSA 4UNPA 1ZNZA 5BXQC 3VO1A 1H8EA 3DOFA 1D5CA 1Y63A 4QGGA 1XTSA 5G53C 2WAYA 4V02A 2W6JD 5DN6A 2BBTA 4OJKA 4M0LA 2OK7A 1OYWA 3EASA 4HB0A 1J8MF 2VH5R 5K8TA 1W7AA 2IWHA 4DLZA 3DPUA 4LJ5A 5FPTA 2XB4A 2O8FB 2FV8A 1P6XA 4FMDB 4OQXA 2P5TB 3W9YA 1CNFA 1AGPA 1ZVQA 1GO2A 5TR9A 2R6AA 4ESHA 1IHUA 1G5TA 1TF7A 3TNFA 4Q4AB 3BFKA 4PPNA 4HAUA 3CW2A 3RC8A 2H57A 4A15A 2FPLA 3A1TA 2CCJA 4HDCA 2YKGA 2VNJA 1P3JA 4YLGA 2GAOA 2JLZA 4BLOA 2IHBA 3HDTA 1JXOA 2JATA 1MABA 1ZYUA 3TE6A 2OXRA 2QL6A 3VFDA 4A92A 4BLRA 1KY2A 3ZH9B 3B8HA 3NBYC 4M2LA 1D1NA 2FN4A 5FUYA 2CHQA 1Y3AA 3EAQA 2J0QA 4FW9A 4Q48A 2YHSA 4LJYA 1W1WA 4GPTA 3GLIE 2Z43A 1KSGA 4NYIR 1ZIPA 2PX3A 2O8DA 4V0ME 4MDEA 5G3YA 2BJWA 3OW2B 2DETA 1JALA 4G5QA 3TSZA 4NKRA 2BMJA 1E1QD 2F7SA 2MSCB 2WAXA 1HQCA 5L3QB 5BN3A 4BLPA 2ZRAA 1QVAA 1KI4A 1QGZA 5JHGB 2C9OA 5JLJA 1KK3A 2H5EA 3A37A 1UJ2A 1JJ7A 2I4IA 2D7CA 1WF3A 2QZ4A 2EYUA 4DKXA 4QBIA 2WPDD 5JSZA 1Q1BA 4HZUB 1LW7A 2IX3A 4ZPXA 2WJVA 1X3SA 1ZD9A 1V5WA 2QG6A 3CF0A 4NCJA 1OF1A 1JXMA 1QFYA 1JB1A 4HSEA 3FKSA 3KDSE 2O8BB 4HATA 3GFTA 4EKDA 1E2QA 2ZE6A 1Q21A 2QQ0A 4ITRC 3I92A 3EC2A 3KJEA 2ERYA 2ZROA 2CVFA 1LY1A 3GJ4A 1XCMA 4QGHA 1PUIA 1OH7A 3VR6A 2WICA 1F2TA 5JI2E 1Q20A 1E9AA 3F8TA 3AGQA 2YOHA 3GLFE 3CX6A 4LBWA 2R6DA 3IBYA 4HLUA 2KWIA 1UAAA 1DO0A 3LVQE 4M8NE 4KSCA 2F1JA 4RZXA 1WRBA 2CNDA 4UNSA 3W2FA 3CPJB 4KU4A 2RGEA 4FK8A 4Q18A 1XJ0A 1M7GA 4FI3C 2R6CA 2NGRA 2GETA 4ASUA 4M1OA 1COWA 4QNRA 2VNKA 1SGWA 2PH1A 3BFXA 3KJGA 2QEXB 5EMNA 3GLGA 2WWWA 1DTSA 2GXSA 3THWA 4N3NA 2H8KA 3EZFA 3TAUA 3O8CA 3D6TB 3MLEA 3CCMB 2FOLA 5GJVC 5KSYA 5DI3A 2NG1A 5FA6A 4C4PA 3U3RA 3CMEB 5F9HA 3P20A 4HB3A 5JJKA 1QHHB 2C2HA 3H2YA 1Q44A 4PHGA 3SJAA 1W2GA 5BW8A 3KQKA 1DO2A 4AC9A 1X8JA 1M7BA 2EFHB 2WOJA 3IUYA 3U5ZB 2XNJA 2ZJAA 3A1UA 3LAWA 3PEUA 2VYFA 4QXAA 4B2PA 4U00A 2ZJZA 2XNCA 1GJRA 1NL3A 3BB4A 5EE1A 2IYYA 3CIOA 4C0AC 1SVKA 2JLRA 5FOUA 2J87A 1ZNXA 1JR3D 2ZRDA 3OAAA 3KKQA 5SZJA 4BZPA 1T5LA 1EFCA 1ZIOA 3TH5A 4C9BA 2YC2C 3CH5A 3Q85A 1W5TA 1LV7A 2JEOA 3QFCA 4UNNA 4PC7A 1XD8A 5FTKA 1Z2AA 1RIFA 1S4QA 4S35A 4KI0A 3I32A 2RAPA 4NYJR 3AGPA 2O8CB 1CJVC 1JR3E 4BQSA 3A36A 3K1JA 1RFLA 1Z6GA 4LV6A 1J7KA 2W6JA 1P7CA 4HE6A 2BMEA 2CL0X 4AYTA 1KJYA 1N6KA 1XD9A 4RD3A 4TYNA 1Z6YA 3N2IA 2GDJA 3NWJA 5H5JA 1NLFA 3OHMA 2ZUCA 5P21A 3AP2A 2DR3A 3AVTA 3ND8A 4PPGA 3FOZA 3OZXA 1RE0A 2OAP1 1QH0A 2QPOA 4B3CA 1Q22A 4LHWA 4QHTA 5FBVB 3CRVA 2OCYC 2C77A 4G5GA 3CNNA 1T9HA 2OTJB 4JIMA 3LBNA 1MABB 3ZVRA 4DB4A 4RD0A 1K8RA 2ASEA 3MUFA 5JFGA 2QRNA 1GP2A 1M6NA 3JQPA 1FZQA 1KKLA 3QXCA 1Z0FA 3R9XA 3EA5A 3WHKA 1GOTA 1JQJC 3J81k 2JJ1D 2QP3A 4KYUA 2W00A 1VIYA 3AVVA 1ZM3A 3AKCA 4X8HA 1FQJA 1K5DA 1F60A 1TQ4A 3HYRA 2G83A 5CDFA 1BJKA 2O8DB 3ZQJA 4GFDA 1UEJA 4MYCA 2YYZA 1OH6A 5BYKA 1G19A 4LYJA 4PPFA 5TVKA 4AD8A 3SN6A 1H85A 3SQXA 1GL7A 4TZ6A 2FA9A 4HDQB 3CUEF 3OEED 2QGZA 4D0GA 1HT2E 4RD6A 1NVVR 4KFTA 1G3QA 5ELXA 2F55A 4Q01A 3ZIAD 2OG2A 3L8YA 4GMDA 1MRSA 4W9MC 3ZZTA 3AUXA 5JSZB 5J4KA 5CK5A 2ZETA 3NBZC 1E96A 4HAZA 2W2TA 2XEXA 1EGAA 3E5HA 3FE2A 4X8LA 4DWJA 4PQFA 3KQUA 1XE1A 4AY2A 2WPDA 3K0CA 2IXFA 5F98A 1QG2A 2GHIA 1WE2A 1SKYB 1FNCA 3IKJA 5EP1A 5JCPA 1K8AD 3TVTA 4B47A 2GJAA 3SHFA 2CCGA 4G5OA 2WKPA 2IBMA 4C3ZA 4ESVA 3G71B 2WM9B 1VHTA 2J5XA 4HAVA 4Q1FA 4OHWA 4IFEA 1YZLA 1FDRA 1XRJA 2FF7A 1D2MA 2O0HA 1QG4A 3AVWA 3KQHA 3TJZA 1H65A 1F2TB 1U9IA 4IFBA 1N25A 1E2LA 2J3EA 4JLNA 2HJVA 4TMKA 4TYPA 3TW8B 1P62B 1S9HA 3SJZA 1ZNYA 5B64A 1XXHB 1ZCAA 3T61A 4BECA 3QG1A 421PA 1G8YA 2R2AA 4PZLA 4J0QA 1VQ5B 3VR3A 3BH0A 2ZXUA 1RRCA 5CIQA 5FUWA 2O52A 3GLGB 3AH8A 2FJUA 5JWHA 2DERA 4IDHA 3THYA 1JEEA 2ZRCA 1E32A 5DI3B 3IGFA 4QHYA 1YHNA 3CPWB 2IYTA 4UKDA 1TQDA 2VP0A 1SVMA 4V0LA 4TQAA 3SHWA 1NY6A 1ZM7A 2IK8A 4A6XA 5LB4A 2JCSA 4EH1A 5AUOB 4TL9A 3P32A 3W5JA 1B0UA 2PEYA 4LRWA 4JT2A 3B13B 1NIPA 2CNWD 4KITB 4IRUB 1OHHA 3ADDA 2HUPA 3L43A 1Z0AA 1VQLB 2RKOA 2ZSFA 2XAUA 4JLPA 2QM7A 2ZR7A 1CJTC 1DAHA 2GZDA 1E9RA 1D2NA 2ZRPA 4YQFA 3HYTA 4DSTA 2N46A 1VTKA 1G20E 2D2FA 4JT4A 2HEIA 5HTKA 4F38A 3MAAC 3FJOA 3CO5A 1UFQA 3QOFA 1KO7A 5DE3A 4O3MA 2IA5A 1PZNA 1F48A 2H18A 2RGBA 3GJ0A 1EESA 5TARA 1UBEA 4HB4A 4L5BA 1KHTA 4XIGS 4D2IA 1HUQA 1YZQA 2WIBA 2YJTD 5FFMA 4M1MA 1P4SA 2YV5A 1DAKA 3PCRB 1Z6TA 3WNCA 3OZUA 3VX3A 4I1SA 4I1VA 4I81A 4EPXA 3T34A 4G5SA 2WSSD 5KSPA 1TF5A 1KYIA 4TYQA 4YXWD 4DCUA 4LWZA 4Z8XA 4PC2A 3B78A 1ESNA 5BQ5A 1KDTA 3F0TA 2XGJA 3SFZA 1GL9B 3K0FA 4HLDA 2WWHA 3ICEA 1R0XA 2NQ2C 4DLRA 1DE0A 2FWRA 4DT1A 2CL7X 4AG5A 1Z0KA 2D3WA 2J0UA 2G1JA 2J9RA 3UK6A 4A6PA 5FOVA 1CR4A 3I72A 3ZQ6A 4QFMA 3CCJB 3NC0C 4MQBA 5L8VA 4BPBA 1S2MA 3T1OA 5GV7A 1U99A 3MJRA 4DQLA 4HEJA 4OQMA 1UMKA 2BCGY 3U6BA 1K6MA 1N6PA 4ZIRA 2OZEA 3F5FA 5DHFA 3ZS9A 2FDCA 2G3YA 1XMJA 5LD2B 2FSGA 4KFUA 2ZJOA 3AP1A 3MFYA 4L8GA 1L8QA 3K0AA 2GVZC 4D4LA 2JJ1A 4BLQA 2B7CA 1VYTA 2DFNA 3FHOA 2VSOA 4DIEA 3CC7B 4LPSA 1NJGA 2IT1A 4KBFA 4B33A 4OI2A 4TQUS 3CMAB 5TV2A 1A8PA 3QQ5A 2P5SA 1MO6A 2HDNB 2FEOA 2XITA 3U60B 1GDDA 2G6BA 3AUYA 1G3UA 1W47A 3RRZA 2IUSA 5E7IA 4II7A 4DQKA 3OEEA 4MUAA 4IXNA 4XWAA 3CD6B 4HDOB 5AWFC 2BBSA 2BBWA 2HCBA 5FBWB 5J4YA 3GJ5A 3ZIAA 4AF7A 2CJWA 2WOOA 1N6NA 5KPJA 3H86A 2ZSDA 4TLAA 1VPLA 3UKDA 3K70D 4C43A 4DSOA 1W46A 1T8UA 1XMIA 2HYDA 3CR8A 3NHBA 4B76A 1KDOA 1XP8A 4UJ3A 2OT3B 4HUTA 4Z51A 3EWAA 4TL8A 3I5XA 1YJ9B 1T91A 3NVAA 1Z0IA 1U94A 1X1RA 2V54A 4Q9LA 1FNNA 4ZDWA 3U6KA 4TMZA 3SYKA 2XOKD 3LBHA 3P26A 1X6VA 5E95A 4ZCMA 2REOA 5JS7A 1R10A 1FW6A 2C99A 1GNQA 1FOEB 2C95A 2VSFA 4JLAA 1K9MD 2ODNA 4Y9UA 1QHSA 3PR1A 5IRCD 1CNEA 2GAAA 3L8ZA 4YDHB 1N3BA 1G3RA 1YZKA 3GEIA 3BH7A 8OHMA 4NZYA 1JEDA 2FFQA 3IPYA 1NMZA 1HURA 1FTSA 2G1KA 4TTPA 2CHGA 1A7JA 5IK2D 1UBFA 5EZ5A 3QKRA 3KFVA 3W5VA 1CP2A 2Q6TA 3CRW1 3PEYA 5EQTA 1CQXA 2PT7A 3UATA 5JEEA 5L3VA 3B1WA 3SU8A 2QSZA 3T1QA 1F6BA 5AUPB 5DSZA 2REXB 4JYCA 2QORA 5C46F 3THYB 5C4MA 2KB0A 5AJXA 4F92B 1SHZA 5AK0A 1KI6A 4F7WA 1IOZA 1U8YA 1NN5A 4OL0A 2QSYA 2P2LA 2XSZA 5KO2A 1MO5A 3QBVA 1FNDA 1CEEA 3PJRA 4A0RA 1Z3IX 1ZNWA 4Q9KA 1GKIA 5C4GB 2O8FA 4ACBA 2IUUA 2IEZA 4QC2A 2W83A 4XSHA 1Q3TA 1VYVA 4P4TA 2CNWA 1VQ8B 2JLVA 2WHXA 3WYFA 1NI3A 4US0R 4MGKR 3CR7A 3DO6A 1M1KD 2FPKA 2J59A 3H84A 4OQLA 4PSAA 5EP4A 1IN7A 1UEIA 1QBKC 1VECA 2WWYA 1ETUA 4W5WA 821PA 4DCTA 4QL3A 1EX6A 1XPOA 2Q9CA 2RGNA 5H68A 2IYVA 2VZLA 1TTTA 4AKEA 2ZM5A 1E9EA 3CONA 1NIJA 1U8AA 2HLDA 3CX8A 3M4YA 4HLUC 4TL6A 2GNOA 1W35A 3W2HA 5DYGA 4ZDIA 1CBUA 4H1UA 2ZS7A 2ZUBA 1NN1A 4UNQA 2ZJ2A 3LV8A 1S8FA 5E7MA 3SC3A 1VQOB 1NF3A 3CPEA 1VQKB 2HF8A 3QKUA 1OGIA 2VP6A 1W48A 3F3YA 2XNSA 2WSSA 1II0A 4LPKA 2WSMA 4NYMQ 4G5RA 4CT4B 3VTKA 3K0FB 3CZQA 3ZGXA 3VKWA 1G291 1T0JB 4PC6A 1VG8A 4PO8A 4DT1B 1KO4A 4Z1MD 1IXSB 1CLUA 2JIZA 2J0UB 3NDBB 3ICQB 5KNDA 5CYPA 4BASA 3P4XA 1D6JA 5CIWA 3I61A 1XJCA 3HU1A 4B35A 2RMKA 2NZJA 3R20A 4D0LB 5HKKD 4IOKA 2OCBA 2WBLC 1OXUA 3CCSB 4ZIRB 2JLYA 2J1LA 5GV8A 1UADA 3DKPA 2QQEA 3RRYA 2ZTSA 1FRNA 3AVYA 4LHYA 4B3XA 2XTNA 1CU1A 3HR7A 2VF8A 3PG5A 4HB2A 3A6PC 2O8BA 4BGDA 5J47A 2Z4RA 3L0IB 4FMBB 4OK5A 4JLVA 1RKBA 1N8RD 1KSHA 2C03A 1M7HA 2IYWA 4KV9A 3BE4A 2ZRMA 3CRRA 4YAOA 2JJ2D 2LKCA 4QBGB 5EE0A 5H59A 2F1IA 4LHVA 1DAIA 2BKEA 4F4IA 4Q1BA 2NPFA 1CKEA 1LS6A 2I1VB 3R7WB 1XEWX 4LC0A 5TB5A 2MSEB 1R5BA 4ZI2A 1G18A 2QMOA 3DM9B 221PA 1NVWQ 2CJWB 2EU8A 1Z0DA 4IVQA 5TMPA 3HPQA 1J8YF 1MOZA 1LVGA 3I8XA 4M9SA 3RS3A 4EPYA 4BLSA 2R9VA 4RCZA 2PT5A 4WA7A 1HH4A 3WP0A 4AYXA 3OZWA 1GITA 3EZ2A 2IYZA 5EP2A 1XMSA 4AURA 3PUXA 4PO9A 3FHCB 1OPXA 2XOKA 3FKQA 2W6ID 2FFHA 3SI7A 1C1YA 4LYFA 3KKNA 4LV5B 5G3ZA 2EIXA 4DCNA 4XWKA 1S96A 621PA 1R5OA 3U3MA 1G4AE 3BRWD 3I73A 1QX4A 5HPYB 4C7OB 1R6BX 5BN5A 3MRSA 3MWJA 3SEAA 1M90D 1NP6A 4MDFA 4NHOA 5EE3A 3ADBA 1E3MA 3QKRB 1RW4A 1E0SA 1ZUNB 2NOAA 5IK2A 4LJ4A 4LJ8A 3PEWA 2ZANA 3PQCA 3GJ8A 3LY5A 4TWZA 4DZZA 5J4VA 3LO8A 3WMEA 1SKQA 1MV5A 2XB2A 2VSXA 4GDFA 3AVOA 2LCFA 1XPUA 2BBOA 3CWQA 4YONB 2V1UA 5FL7D 1WB9A 3SJCA 3QXJA 3X1DA 1VYUA 3DKVA 3UMSA 2O8CA 1ZW6A 4NL4H 1VG0B 3BJIC 3K9GA 1Q82D 1E2NA 1G21E 1GKUB 4PFSA 3UIEA 3W34A 2QAJA 4R2IA 3KFXA 4D0NA 2DPXA 4DJTA 3W90A 2BEJA 2F1HA 5JMTA 4CW7A 1YJNB 2GEUA 3QBTA 4V03A 2IHYA 1IY1A 2AX4A 2ZVQX 3K0CC 2IL1A 2YWGA 2ZU6A 4OK3A 1N6IA 4NCKA 4QGFA 1ZD8A 1JAHA 4Q7KA 3QJYA 4A0GA 5GJCA 3ADCA 3MWLA 2X2EA 4DDVA 3OIWA 3N2EA 1FL9A 2EFCB 3RYTC 1VQ7B 4ZDJA 2EFGA 4JLJA 3CC2B 3FYHA 3R8FA 3IQXA 2CLCX 2P67A 1EP1B 2EWVA 3RHFA 1U9IC 2AKAB 4B3FX 3FGNA 3FDIA 2FZ4A 3C5HA 4GZLA 2X77A 4MGZR 5F3WB 4LJ9A 2I1QA 3QVVA 4KLZA 1N5KA 2HT6A 3GEHA 3V00A 4JSTA 3GJXC 5FTLA 1QHXA 3GLHA 1P9WA 1Z08A 5KYKA 5KDLA 2OLKA 3EIHA 4TZ0A 4JKIA 4Q1CA 1U8ZA 4B3GA 3HU3A 1VQ6B 1US8A 3VMFA 4Q5IA 3TUIC 2PJRA 1N5JA 3SQWA 4DSNA 4G1UC 1KI2A 2B5OA 3PXGA 4D4JA 3ZJYA 4PO1A 3T1VA 4BEJA 4Q03A 2ONJA 2KBFA 3QFTA 2DWQA 3IDQA 4Z1MA 2EQBA 2WJGA 2BMFA 1QGYA 3HPRA 1XU4A 2F43B 2JJ8A 4IVRA 3BIFA 1YZGA 1SXJE 3TIFA 5HKKA 1SHKA 1GRRA 5TXGA 3IILA 4CGZA 1JECA 3LVBA 2JLXA 3R9IA 3CF2A 4LSGA 1ZU4A 1G64A 3D31A 4JLBA 1H8HD 4CDGA 4M53A 5JJLA 1H42A 3W3AA 4HLQB 1K73D 4TYYA 4MA4A 2G9NA 3PENA 2OESA 2PL3A 3KKMA 1N2CE 4D81A 2D2EA 3Q9LA 2W2XA 2OTLB 3GJ6A 1BH2A 1G5RA 2BPOA 1IN5A 1NBMD 4DDUA 2ORIA 4CVNA 2JJ2A 4ZI3A 3R9WA 4GP6A 4Y0VA 3OFND 4EDHA 2NPIA 1CJMA 1XXHA 1TQ6A 1E2EA 3K9LA 4HI0E 1NLYA 2QE7D 3U3JA 3U3OA 1BS1A 5FPSA 4Y9RA 1IN4A 4A0HA 2A5JA 3DEFA 4QNMA 1W36C 2EW1A 3REGA 1M2OB 1NBME 4Q9IA 1KSFX 1QHIA 3FMOB 1ESMA 3LW8A 3NDPA 2FZLA 3H4MA 4U9UA 3K70B 2QRZA 2I3BA 1QFJA 3KX2A 1W4CA 4BLTA 1ODFA 2GXUA 1OKKD 4WBSA 5BN4A 2IS6A 3U61B 1N0WA 3MD0A 1Q1EA 2FGKA 3NC1C 4WW0A 4A82A 2Y8EA 5KTYA 4KJZA 5D3MB 2OCAA 1Z47A 4IOMA 3LXXA 4BZQA 1G6OA 2QA5A 4DDWA 4JBXA 4QOSA 2QNRA 4Q9HA 3VQTA 2VNHA 3BS4A 5AJVB 4P4UA 1JPNA 2CL6X 1OGJA 1WCV1 3GFOA 1AKYA 2QI9C 2ZI3A 3FTQA 2QMHA 2BM1A 3SR0A 1GL6A 2VP5A 1TMKA 1YR9A 4A1FA 2FFBA 4NCNA 5AUNB 2WJYA 3LQRA 1EP3B 1NG1A 2IYSA 2QTHA 1OFHA 1YR7A 3I1FA 3WNBA 3W6OA 2PLRA 2ZRLA 4PSVA 3EIEA 5KNBA 1QUFA 4FMCB 5FL7A 1G7RA 2W0MA 4OK6A 1U0HC 4OI1A 1G16A 2MMCA 4LJAA 1FNMA 1KK0A 2NMVA 1HV8A 1VIAA 4MKGA 4LZZA 4UNRA 2VTKA 4JVMA 1CR1A 5JBQA 2HF9A 3C41J 4QBHA 1W49A 1KJWA 1DDIA 1HY3A 3NTUA 1U81A 2ZJ8A 4M9XA 4DHEA 3B60A 2YWHA 4JLOA 5F9FA 2UZ3A 1GZSA 1A2KC 1VHLA 1N0UA 3SE0A 1ZBDA 2ATVA 4K8OA 1VCIA 1KQSB 2PZFA 3BK7A 3RVBA 3CB4A 1U0LA 2ZRGA 3GLIA 4H1VA 1R5NA 5J40A 2NIPA 4P33A 4RFSA 3L0OA 5JJIA 4V0MA 3GLHB 1WBDA 2IF0A 1ZC4A 4Q7MB 1ZM4A 2DEUA 3UWOA 1AS2A 2R62A 4URUR 4YMWA 5GVSA 1ZRHA 3DVLA 1KZ7B 2A5GA 2ERXA 2GA8A 2XZPA 2AK2A 5CYOA 3THXA 1EWQA 2RGXA 1QFZA 4LBVA 1US8B 3PUYA 4CZ2A 3TGPA 5J5CA 3RLFA 1EX7A 4PZZA 3IEUA 4BFTA 1RYHA 5DNYB 4OI0A 3DZ8A 4PR0A 4NTZA 1E99A 4O2RA 4XJXA 3BBPA 4Q1DA 3UMRA 4BFWA 3TR5A 1E63A 1AZTA 1NY5A 4ON9A 1L4YA 2YINC 3LD9A 3MJHA 4Q4LA 2GF0A 4XVUA 2IS2A 3VX4A 2EFDB 1E1QA 2GBLA 3JVUA 1YHQB 5TDHA 3K0EA 5DLQC 1WA5A 1TADA 2QAGB 4Q4HA 2QU8A 3T12A 4LBZA 1MKYA 1ZP6A 3KXKA 4N1AA 2DYKA 4Z8YA 5IDVA 4EFNA 1NMYA 1NJFA 1OIWA 4L9WA 3KKPA 1U90A 4WIAA 1SVLA 4GZMA 1QVGB 1AS3A 4JVNA 5HCIA 4CRWB 3TW4A 2C04A 4PHTA 5FPHA 3B1VA 4FCWA 2VA8A 2VQSA 4K81B 4Y7CA 2HV8A 1G7CA 3VNUA 2A3RA 5HR5A 3GLFA 3WMFA 1ZM9A 4DCVA 4BWYA 4YMUA 1H8HA 3LRPA 5HE9A 4ZCLA 2ODBA 1U98A 4TYWA 2ZI4A 4L16A 4YDSA 3RAPR 3C7KA 4C2UA 1Z07A 5AN9A 3U7EB 1GRQA 5CB6A 1W2BB 3OFNA 3BERA 1CRPA 4NE2A 3NXSA 4D80A 4ZO4A 2ZRIA 3G4SB 2ZSEA 2G77B 2W58A 2DFTA 3QIAA 3QFSA 4Q47A 4YALA 2A5YB 2FX3A 3UG6A 4KCGA 2B8TA 3O8DA 3D3QA 2WTUA 2Z4SA 3QKSA 3B9PA 4JBWA 3W5IA 4YAFA 4FXPA 4B3DA 3PUWA 2OBLA 3OE7D 4LI0A 2CLDX 4JS0A 1Z83A 4DEXA 1F3OA 4MYUA 1CR0A 2V3CC 1SVOA 4OBEA 4RKFA 2QN6A 3N5CA 1JA0A 1YITB 5EXSA 4HAXA 3S1AA 5FI1B 3KL4A 4B74A 1KK2A 1QHGA 2DBYA 2P3SA 2AXPA 2ZRFA 4AKGA 3BH6A 1SVWA
chains in the Genus database with same CATH superfamily
3DBHA 4XB6B 4LY3A 5F33A 1LF0A 1Z8FA 1W9MA 3AEYA 3CWZA 3TW6A 1XN1A 2IOHA 4IDQA 5FPYA 3UANA 1PV4A 2HLNA 3DEZA 3RK1A 1J0XO 1N9KA 3IRUA 4WOJA 3UHOA 1E3JA 1E1RD 1ACJA 4DNOA 4WQMA 5CJ2A 3RSZA 3FMFA 3HUFA 5KVQA 3ZIUA 2IYAA 4OI4A 2B8WA 1P9OA 2XBMA 2GNAA 2H85A 1JBKA 2X76A 2OO5A 4JH0A 1WSDA 2GR9A 1X7WA 3GVLA 2OBMA 4FIZA 5CHEA 3SIRA 1RAEA 2VK4A 2VYND 3BZWA 3FFAA 5I8PA 4LSMA 3QA3E 2VDVE 3SXJA 4CU2A 2FW1A 5E9QA 4RKYA 3QE0A 4J6EA 4ZAVA 5A4KA 5A06A 4FUTA 3D8UA 3G6WA 3C8MA 2W5UA 2FUG1 1V3UA 2CHVA 3IRVA 5IXJA 4GKJB 2BCEA 4QXOA 1QLWA 1O5TA 5IC5A 5A9SB 5J43A 3T5MA 1Z63A 4MITA 4H7KA 3I2JA 3S8EA 4G4SO 2C1XA 1PL0A 2HA5A 4OH7A 2JFNA 4WNIA 1FIUA 2OSVA 1YI1A 3QXXA 2R8ZA 1XZMA 1G8JA 3QUBA 4WOBA 3RRXA 1TRHA 2J5RA 3S99A 1HA3A 3UYKA 3T53B 2FWMX 3A3KA 1QJ4A 3URKA 4DJAA 3GX1A 4HNVA 2YVUA 1ODKA 2ZYAA 4OHRA 1IHXA 3C1OA 3N3AC 3WGQA 3WL4A 4BO1A 4QARA 4BAZA 5AW6A 2UKDA 5SZKB 4W8OA 1UD2A 5AJYA 2QW8A 4OU5A 5HDBB 3HWSA 1KPHA 3DCNA 5EYPB 4BAUA 2OYSA 5B58C 3GLIB 3JQ8A 3OM8A 2VT7A 3NDRA 2ZSAA 2NVBA 3TSWA 3UXHA 5CUQA 1R37A 4F9GA 2N3ZA 3QI2A 4CKWB 1UAYA 4MA0A 3X2EA 3E5NA 3G1WA 4N8SA 1GTRA 4CTOA 1M1NA 3LIPA 4LOIA 4C3OB 4KFSA 4E22A 3LQEA 4MJLA 1SU6A 3THXB 3IOBA 1QF6A 3B3GA 3WBJA 3AHJA 3Q40A 1E43A 1FDUA 4KKVA 4UE6A 4YCBA 2DJ5A 3X43A 1FU4A 5HA5A 5DHPA 3D54D 4PCVA 2AQKA 2JJQA 3RAJA 1E66A 3PDIB 3RRNA 5KSZA 3OJEA 2X1VA 4W5NA 2E5FA 2VNAA 2YS6A 3AUUA 1IBMB 1YS2X 2HHCA 2W2QA 2CMDA 1NVUQ 3UMGA 2D1YA 3AR3A 2PGNA 1N5OX 3C6YA 3NX4A 4BCCA 2A0KA 4DNPA 2VHTA 3JXEA 3PFIA 3SSMA 1JN0A 1V5FA 1X1EA 2ISCA 2NW6A 2WWIA 1CRWG 3PEVA 3HY3A 3NH9A 2GM4A 3DVRX 2OV2A 2R5WA 2F9FA 4Q37A 4JI1B 3G9TA 4LYEA 2BEUA 2ZZFA 4NFSA 4IG9A 1RQRA 1OIXA 1CIVA 2C58A 1JG6A 1Z5OA 4PLFA 1EFHA 1SG0A 3G8CA 4WAUA 2YN2A 1I1QB 1QTNA 1UFRA 4J1QA 3BOSA 5LWQA 1I6MA 1WXQA 1UPUA 3U7JA 2VJIA 3CCVB 1ZX1A 3CQ9A 1P4GA 3ZI0A 1K7EB 2AZXA 2ODQA 4JQSA 4MYTA 2HF2A 2WIAA 2IC5A 3OUZA 3R24A 1XTTA 1HDEA 1KZ1A 2VT3A 3JARB 3D2LA 3PUZA 2PGJA 2PMDA 3CUSA 3G2QA 4YJ2F 1OI2A 1WULS 4DWVA 1GNVA 4NYJQ 4NESA 1WMSA 2LDXA 3JQEA 4MMXB 2ZXHA 3F47A 2CXSA 2HK9A 2FFAA 3IUQA 2ZSUA 3RC7A 3LA8A 4F3YA 1KC3A 4I2VA 1CZKA 2QRGA 2PNFA 2QZPA 1RVDA 2CMGA 3HRHA 3PQ5A 4OOXA 5TQ0A 4F3KA 3QEKA 1ZINA 1N5LA 3MEQA 1W29A 1YR3A 4QIHA 4GW3A 4J0HA 1K0UA 3HUTA 3RC9A 1ODJA 2H1VA 1NSYA 1SUWA 4OAPA 3VYWA 3W4IA 2RBKA 4BEBA 5KNLA 1G63A 3FNHA 1AJEA 1A9QA 1BFDA 3AIMA 3QNUA 3KVNA 1L4NA 4W7SA 3N0RA 4C78A 5L53A 1YKFA 2C3OA 1ZGAA 3GW8A 3N86A 4PLVA 3K0BA 3AOGA 4D82A 4NXNB 1CULC 3C4JA 3PI6A 1IJFA 1NN0A 4PAMA 1BYIA 3L9XA 4R2LA 2VR1A 2ZTLA 2C7PA 4JUFA 2DWUA 3KE9A 1YR8A 1V47A 2Q3EA 3OOCA 1QQ6A 1TQ8A 1TYDE 3KQPA 1SWVA 1DPGA 3OICA 4OHYA 5AVUA 3TL2A 1NQUA 5U9CA 4NBLA 3DV0A 2OFPA 2R00C 2DTDA 1WLSA 3PE3A 4HWOA 1UKEA 1VCOA 5K5EA 4PZCA 3WGKA 4OHKA 4YAJA 4RY2A 2NYAA 2EXXA 5EQFA 3S1AB 2IYNA 4RHXA 4IEFB 3DEAA 4G86A 4ADSG 4BWFB 4KR3A 1AUXA 4IYJA 3Q11A 1OX5A 2HPAA 1ILWA 2PBRA 3VO9A 1PEKE 3JASA 3LC1O 3KETA 3QEJA 1TW3A 4Q9AA 4WD3A 1KNXA 3DBHB 4Z9XA 4MPDA 4UUPA 1KFJB 5AUQA 2ZPUA 1ODSA 3FPHA 4GPD1 4UQOA 2HOQA 3M6XA 3MUEA 5CXXA 3DEHA 2D5AA 5HIMA 5REQA 3G0HA 5F77A 4E5KA 4L3OA 4D3XA 5FUQA 1J70A 3AF6A 2UXDB 1ZS9A 3ADOA 4XR9A 4A0FA 4BQFA 4PC1A 1XPRA 1W0JD 1UBMS 4DNFA 4FGKA 2CEAA 4J43A 4OHMA 2N1BA 1JG2A 3DBLA 5DHRA 3JPWA 4CIWA 1Z4JA 2HU5A 2QD5A 3SKYA 2DUUA 3NLLA 3TBHA 1L7PA 3BIOA 5AVQA 3WA7A 5FLXA 2WT9A 1IH8A 5ABPA 1C0LA 1NJSA 2YIMA 5EN4A 4ZVMA 4B0PA 1E0AA 4L6CA 2AFIE 2YOFA 2YASA 3VR5D 3GCDA 1UQUA 2K7ZA 5FHRA 5LUBA 2PE3A 3GIRA 2AYZA 2PT9A 1RC8A 3T5GA 3BL6A 2V4ZA 3NRBA 4ND2A 4UE3S 2AN5A 4P7GA 5AJWA 4B9EA 4DQ0A 1QR2A 3RPEA 5F64A 5CXQA 2ECQA 3FPGA 2CY0A 1WXIA 4GLOA 5CT9A 2JH8A 2W0SA 4X8IA 3BZUA 3DZDA 1L5NA 1NSFA 3HN2A 2YIDA 2E6KA 2GTIA 2JBWA 3OVMA 4YXWA 1CUWA 2JVIA 5F35A 5KWJA 2DBRA 1MU0A 2GJ8A 4X92A 3UMFA 1YQQA 4JDUA 3JVVA 2VPXA 4XARA 3G5LA 3TGWA 2O9JA 1R8XA 3H6KA 4DREA 1LDEA 5HUQA 5DNUA 4MARA 3F6EX 3QSGA 4C6HA 3AJDA 4M4SA 2FMHA 3QPCA 5SICE 4G8DA 1PEDA 1UKVY 3KDAA 3PLNA 3V7FA 2QU7A 3JQ8B 2P9QA 2WZPP 2IYEA 4TMWA 2VUTA 5AK5A 1NR7A 4US2R 4OFZA 1L2TA 4OP3A 1G66A 1RI5A 2XUFA 4W63A 4S2EA 4BO9A 1LBSA 3RIHA 1X15A 2V0GA 2ZE8A 5EEGA 1QS0B 4EW2A 3JTEA 4RJTA 3QE3A 1NE7A 3QU4A 4HQOA 1OLUA 3SD7A 2PIDA 2WQ7A 1JHYA 3VHXA 3D6JA 3JAMA 4C01A 3ASTA 5DV9A 2DYIA 4BNKA 4MA5A 3D3KA 4PCAA 1E1DA 3FXAA 1AUPA 1VKOA 1ZOLA 2P6PA 5IASA 4PLGA 4P83A 5ILGA 2B1RA 4F46A 3WP1B 5D7NA 1I0LA 3LI2A 1XEXB 2V9PA 4ARZA 4H0CA 2QI9F 5AXCA 4LAFA 1JG4A 1EUDB 2C5LA 2WINI 4FGJA 4LWOA 3JQFC 3SS7X 5LQRA 4QYMA 2PH3A 1A88A 2CF5A 1HQYE 2ZB3A 3IO5A 4JSYA 2AR7A 4LZJA 4BFZA 3QU2A 5DBOA 4IQFA 1H22A 1M2OA 4LF8B 2I2BA 4FDLA 2FX5A 2XWPA 3FZNA 1MO3A 4IGAA 1GQFA 3NT4A 2EKQA 1IYZA 3E0XA 4BO0A 5EWMB 2HIMA 3KQLA 4NC9A 4HEA1 3LVRE 2L69A 4B9AA 4PPYA 1XD2B 4KX3A 4UHEA 2EKZA 1QP0A 2RG7A 1RQLA 1Z62A 3DZFA 2YYSA 2X0FA 2DQKA 1E1NA 5SY9A 2ONCA 1JDNA 2X8JA 3ND5A 4MSUA 4C0QC 3AMVA 5SY4A 3WGOA 2HKIA 4OBWA 4YMSA 4Y8VA 5D1HA 4DC9A 2YH2A 4KR0A 4EJ6A 1NTOA 4MW9A 5BNIA 5TQ0B 1NBHA 3PPXA 4NH4A 4RHYA 5AW2A 4K0KB 1QIHA 2BGNA 3ZGLA 4TL7A 1B7GO 5A3RA 1HE1C 3OZBA 1VA5A 3E35A 2ZIVB 3H8JA 4TWIA 2A0YA 2GD1O 2OBNA 5AK6A 1I2CA 2DIEA 1RIIA 2PLNA 2R4UA 3EOBI 5CMLA 1V3VA 5AVYA 5KOYA 3OQ6A 3EPJA 4R3NA 1D2EA 1JB9A 1AC5A 1YVDA 4IJWA 5ALRA 2WKRA 3TNDA 2O2JA 1WXWA 1A7AA 2N42A 4J94A 4AJKA 2E6UX 1VL8A 3F97A 1TCVA 4BVKA 2EZ8A 2XJ4A 4JQOA 4F5EA 5LDHA 2QL5A 4HE5A 1R6UA 4MUNA 4RF5A 1TM7E 1MPTA 1YI0A 4B7ZA 5D2CA 4UVDA 5BMVF 4ZVSA 2WAAA 3WGUA 4PQRA 1L7RA 3DV0B 4X93A 3LH5A 2BD0A 5A3JA 3JWGA 4OU4A 1G41A 4X6YA 5BRNA 3UUFA 2ZJ7A 3EVFA 4N9QA 5LMUB 3C70A 1QORA 4E2YA 2NTNA 2QMEA 4O59O 4L57A 3WGIA 1WJGA 5F3DA 5G0WA 2XE6A 5JC8A 1G4UR 2O3JA 3GZ4A 1U8EA 1N3YA 2BHNA 3FB1A 5JDIA 3JQBA 5FWNA 3R77A 1QQBA 1SIBE 2JD0A 1R6AA 1RACA 1CTQA 3GMDA 3SHTA 1EXWA 3SJBA 5BSEA 4X5OA 3ZCSA 3IEVA 2L0XA 3QTLA 4L8LA 4MP3A 2QZJA 4UBMA 4AI6A 3I9KA 2HDHA 3KZXA 3AHCA 3EF1A 1BQEA 1RZ3A 2H6EA 2JKVA 4EVQA 4YV7A 3ME5A 2QDXA 1V5VA 1YA4A 2J41A 2RK4A 2ANCA 2Y2UA 2Y92A 4K3VA 1YOBA 4IIYA 4IDPA 1BXGB 3DBLB 4E31A 1XZEA 1YJWB 1ZUHA 1JA1A 4RD4A 2GESA 3KU4A 3AFNA 3PHJA 4FMDF 4Q00A 3OQMA 1YZFA 3D6FA 1MO4A 3DAGA 1RKUA 2IHUA 3G02A 1WMEA 3MG9A 3IHWA 1NW3A 1NVMB 4JMPA 3BORA 4G9EA 5FNVF 4B6JA 4YMVA 5I5EA 1ULAA 3QELB 4FHCA 1IRXA 1BRMA 2FLKA 2I34A 3MLAA 4PQYA 1R8SA 2G72A 4YUVA 1GU1A 3GLFA 8ADHA 2G76A 2XJ9A 1N34B 5ADVA 2QM8A 4C6TB 4S05A 4C6SA 1ABEA 1CUSA 1Z33A 3DS8A 1FBTA 3GJ3A 1C3JA 2XWBF 2RD2A 4XVQA 3M4ZA 4HQKA 3T9CA 3CC4B 5DH9A 1KO1A 1DKPA 1I24A 1I01A 1IONA 1TD9A 5EHGA 4FWTA 5JT1A 2DFLA 2YWEA 3BK2A 1GTZA 2IS4A 3HB9A 4K46A 4RVCA 4YACA 1IJKA 3BRQA 1QIIA 3G2JA 1JUDA 1O87A 2H4WA 3FDZA 2EW2A 3CYFA 4CNBA 1GRVA 3EWSA 3GR6A 4GWGA 1U65A 3I1IA 3QLVA 5DF1A 3O3NB 3JRNA 4AJLA 2A67A 1KOFA 2EYQA 2FETA 1R74A 2I8CA 2GEDA 1SRRA 3M6MD 3RBXA 5J4LA 3FDXA 4CFSA 3SYMA 2IEYA 2ZZMA 2ASVA 1OLUB 3KB2A 2AN1A 4OJTA 1PNQA 1DC6A 1JMVA 2H0RA 4HS9A 3CXCB 1DXOA 1SURA 3O2SB 3DKIA 4LZAA 4P36A 4URZR 4ETMA 3EWIA 3PUIA 1MRNA 1FPMA 4ZZIA 1V43A 3ZEIA 1N1GA 3ABRB 2PEZA 4DM4A 1BX1A 4B4UA 3T7CA 4HAYA 4OIFA 1SQSA 2GCNA 2XCIA 3SR4A 4MVJD 4Y3UA 4ARZB 1PNTA 1GZ4A 3NAGA 1KZ4A 2Q5CA 1UJNA 5B57C 2QTVA 5GGXA 1QYWA 5TRDA 4KE7A 2QVLA 5DWQA 1MFZA 3THOA 2MOKA 5T8KA 2G0AA 3FSRA 3W3AH 4TT3A 3W8NA 4V0OA 5CFOA 1MIHA 3NVKI 1DQYA 1YS7A 3LCRA 3O93A 3JYHA 4L9SA 4HDSB 4M1YA 2Q3DA 1OAOC 3KEFA 2C84A 4KAXA 3H04A 5EXTA 2BFPA 3MW8A 3L4KA 2RHWA 3IHLA 2YNMA 2HCTA 2A0UA 3K9BA 4M89A 1OBOA 4NBWA 1W85A 3Q6RA 4P2GA 4BZXA 5J4HA 1WQ1R 2Z9CA 3ROKA 1KFBB 1T6NA 2EVWX 2CK3A 3CG4A 1WX1A 4HRYA 5HILA 3CJTA 4B6GA 2WR8A 3CCEB 4AT1A 3PHLA 2O3QA 1J21A 3E9DA 3OLYA 5EL0A 2J4CA 3I9V6 1YJAA 2CLKB 4EW6A 4U7TB 4QSMA 5J9FA 4OLJA 4YAWA 1YIJB 1Y6ZA 2X8AA 3CPHA 1H1LA 4BMPB 3E2IA 5E38A 2NAFA 4ETIA 1TEVA 2OD7A 4QU9A 1E8MA 1U8XX 2ZYTX 2XI4A 1PFKA 3G59A 3ZQ4A 2G80A 4NAHA 4TPKA 1NVFA 2GPWA 2N1MA 1MC5A 2XUOA 4FWBA 1LUAA 2INGX 4GE3A 5FTWA 3ZY2A 3Q6IA 3W6PA 1A9ZA 3C3AA 2OGWA 3PDHA 3PWKA 4AKSA 2BGWA 1D0VA 4F2PA 1XDGA 5AQEA 4TRJA 4H4EA 1VSBA 4L95C 1Z4PX 2P35A 4EJSA 1DKNA 2FR0A 1O94C 4QG7A 3IE1A 5FYQA 2QL9A 4RHCA 2BFFA 2BH2A 2JGNA 1SIOA 3MWYW 1B6RA 2AL7A 3ROTA 4BNIA 2WHYA 3T38A 5E0OA 2VPYA 3WI7A 2XA1A 2JBHA 3UEOA 4OQ4A 4LRTB 3KYDB 1FVHA 1DQPA 2OHVA 5DU2A 4UHBA 3D6HA 2A9OA 5FBKA 2F4VB 2JLAA 2RGDA 2YXBA 1OLOA 5EZ6B 1LDBA 4TTQA 3RCBA 3AEQA 1F4LA 4QO8A 2FR8C 3AI2A 3O5AA 5AR1A 3GCGA 2KLHA 2WTEA 4R1UA 3B48A 3ZD6A 2YWCA 3M6VA 3Q12A 5JEDA 1TQHA 1QRSA 3CRZA 4REQA 4JGBA 4DMMA 2VSYA 1PWZA 3DF7A 3UGKA 2V6JA 4MCIA 1AS0A 1YULA 2LRHA 3M81A 2BI7A 2O3SA 3KOUA 4WV3A 4R7GA 4P1ZA 2XUPA 4RA9B 3TRFA 1X80A 2EATA 2F3PA 3HSYA 4CTNA 3B1YA 1O0BA 2ZZGA 1DZ3A 1RP7A 5T67A 3COSA 3TBKA 1DZIA 5IS2A 2CVPA 3QG5A 1TFRA 3TG2A 1VIVA 1EK6A 1J1ZA 3AOEC 5M3BA 4FFLA 3ASPA 2Y1EA 4HPWA 1EUCA 3C7DB 2OXIA 1G98A 2I7XA 4O4HA 3PE6A 3ETHA 4YC7A 5T57A 1DXQA 4L28A 1MC4A 4TN5A 3TUJC 1SXIA 4DA6A 2B20A 1WUTA 3OWOA 2AV6A 5AJZA 3JS5A 2I5PO 2CZCA 4AZTA 1YGPA 3OP4A 4US1R 4JLDA 4J7XA 4EQ6A 5KU7A 3U56A 1U0BB 1M6HA 3SDZA 1KMHA 3ORSA 3MINA 4Y1EA 3AKEA 2ECKA 1EHYA 1Y4DE 3K0KA 4XQGA 1ECGA 1NHGA 1R50A 1NI4A 4KBGA 4DDTA 3EF3A 3PVSA 2PLWA 2AN9A 5IYPA 3LFUA 4GMKA 5CA1A 1Q95A 2FQWA 2VUUA 1DTWB 2AS0A 4R9SA 2GWHA 1E2JA 2NXEA 2QT9A 4LDZA 5JROA 1UJ6A 3M82A 3EUAA 2OCXA 4L75A 3INNA 4HIZA 3QJGA 4E32A 5DNDA 5JCJD 3PA6A 2MWMA 3ESBA 2JIPA 3WYGA 1RRPA 3HZHA 1PIWA 1XSEA 3JQCA 5JCZA 1SXJA 5L3SA 1XMXA 3IP8A 1I32A 3IIJA 4JLSA 2PZGA 4PSDA 4RH3A 4GZ5A 1A8HA 1JMYA 1E7YA 3WVNA 3FDZB 1KRXA 4Q66C 3M4NA 5GJBA 1Z35A 3S5JA 3K2IA 5KAMA 1VLYA 1TVKA 2C2GA 5EKTA 4AO7A 4ZT2A 2IPXA 1I7PA 4LQLA 3DNMA 3G5MA 2RJOA 4PO3X 3PRJA 4YJHA 1FUKA 3NUQA 2EV9A 1SC6A 4RLHA 4PFQA 3TPZA 2H1SA 1EVKA 1TEXA 5LNK6 2XD4A 2LZJA 3T3EA 2VNSA 1CCWA 4Q9DA 4XAQA 4LG1A 1Y1QA 2EDCA 5CGZA 5BRJA 3PHIA 1DEKA 2W2KA 1VHOA 4RD2A 1UDBA 2HU7A 2PMFA 2JFGA 3BA1A 4K2AA 4QTUB 3UWKA 3WB1A 2OWDA 1BPLA 1LQ2A 4MQ5A 2ECFA 3D2BA 1RJFA 7REQA 5KYXB 1JJBA 2YHAA 3L6CA 5G0SA 5C8DA 4N41A 4K88A 3HU2A 4FKBA 5G0VA 1M8JA 4FZ5A 4Y2TA 2G25A 3I42A 2QTVB 2O0JA 4QTTB 2XTAA 4INAA 4JNCA 2AW5A 4FB5A 3ZV4A 3L5OA 1JXAA 2Q6OA 1KNQA 1FSSA 3D5TA 4TN1A 1P60A 4PGMA 4DV5B 4LIPD 4Y9TA 4JVLA 4R2HA 4CE6A 2JDIA 3OEWA 1W2HA 1SC4A 4RFVA 2FQXA 2IWRA 3QGMA 4HF7A 1Y7IA 1JYEA 5EJ7A 4KKTA 1W0KA 2HCFA 1II8A 4MWTA 5EY5B 5SYAA 1UP7A 3R7BA 1EA5A 3KL9A 3F6YA 4J16C 1W85B 2YJ6A 3LCUA 1L7OA 2HMUA 3Q0TA 4KO2S 5FWYA 5K1ZA 4NSNA 5BWCA 3RU9A 4MLZA 4ZOBA 2GBFA 4UNIA 2HMWA 3H8SA 4A73A 2W11A 4PYLA 1TIBA 2GKOA 3ORQA 3UJNA 3RSHA 4G0OA 2NUBA 4N0DA 1CUZA 2QD1A 2J3HA 1H1LB 3NUZA 1KVTA 1P0IA 4UPVA 4LGMA 3V80A 1T9GS 2BFAA 4NU5A 1K88A 3CB2A 4Z4UA 1F20A 1Y33E 3WV4A 4FZRA 1LK7A 4WZAE 1ZUIA 1BHSA 1KAEA 3AEZA 3NHFA 2XOXA 1NJID 1VSQA 1P7WA 3LBYA 3H4IA 1VM6A 2QR3A 4HK4A 3WYDA 4EG4A 5LOVB 1L8LA 2ACKA 4H6WA 1Y4UA 2I1LA 3A10A 1BROA 2WC1A 5TRTA 3LXMA 4R98A 2D54A 4U0KA 4KV7A 2P78A 3ZLBA 4P5DA 2LXNA 1OXVA 1L5WA 3DOEA 2CFIA 2PA3A 3GWZA 1FNSA 1XRMA 3B5JA 3NS7A 4JVSB 3A6HA 4RPKA 5FR2A 1E9CA 2ZTHA 3VKHA 3TTWA 1BWRA 1XTZA 2D5CA 4OGFA 3VNQA 3FWZA 3ZYCA 4JXXA 4KR2A 1L0BA 4AN0A 3AEQB 3EGEA 2VDMB 2PKWA 4TGLA 5EJAA 2QX9A 1JDZA 1RYMA 2W8ZA 3KYIB 4ZVTA 3ZWBA 4G3XA 1EHIA 1ZGHA 2VDLB 3E9MA 3QBDA 1KYVA 3TQFA 4YNBA 1FJGB 4HGYA 4YS6A 1CQJA 4REQB 5HOEA 3DHVA 1NKSA 1NX9A 3E4DA 2HLDD 2OHXA 4MWGA 5I47A 4PHHA 4KGZA 4KOAA 3QF7A 3C43A 3Q38A 5H1YA 1X7HA 3IQWA 1DOAA 2M1XA 4DIOA 3N74A 1NOKA 3FB4A 2UZ0A 1ONPA 1EUCB 3WMRA 4M46A 4O4HB 2G1AA 1HDRA 1G1MA 3EIFA 4UJ5A 1MHPA 5CDSA 3DWEX 3LL7A 5GVRA 1F5SA 4IH4A 1RJGA 3I8SA 4AKIA 2G0TA 5ECDA 3A2MA 3NHAA 4EQ6B 4RQTA 2I6QA 3G82C 3E9NA 2JH3A 3QKWA 4YJ3F 3ML1A 1ZHFA 2CVHA 1KMHB 3HN6A 1RPNA 1XC7A 1QOZA 3MINB 3QUCA 4YQEA 3PRYA 2XUGA 4BB9A 3WL8A 4F21A 6ADHA 1NI4B 3P9ZA 4X61A 5D8DA 1E4VA 1XTIA 2WLTA 1B8VA 4WBNA 1PVOA 2ZWAA 1I5OA 2B2NA 5GP1A 5CA1B 3CUWA 1ST3A 2D5BA 2IELA 2P1ZA 4WZBB 3UZUA 2R0QC 2HBRA 1XMVA 2BHTA 4S1NA 4WCDA 2WY2D 1FU8A 4XD7D 1U2ZA 1S72B 5L3SB 2YZMA 4EATA 3TBFA 4Q34A 1SXJB 3LLUA 3BMOA 4EY3A 4G8CA 4TKMA 3RK4A 4G7XA 2OAGA 3QIVA 3HADA 4MRPA 4YAKA 5I4CA 4C03A 2XZTA 3RNLA 3V8MA 2JIQA 4PX5A 1XZHA 4UUOA 4TM8A 1C3LA 3FF4A 1E9BA 2GSDA 3RH0A 3RVMA 2Q4DA 4GLBA 1TVKB 1BTOA 4FYWA 1LPOA 3NCHA 4GC9A 4Q0MA 1KXJA 1OPRA 2YFHA 2QENA 4W9RA 5K2OA 1A1SA 5MHTA 1TK9A 3CGWA 2OLEA 3A27A 1HMPA 4REOA 4DA9A 4HN9A 2FQQA 2GYYA 2GRJA 4YBZA 5TGDA 3IR7A 4MKXA 2A9QA 2W2KB 3PQ3A 4Q15A 2ODEA 1XVVA 3H5TA 4F1JA 1X86B 1R7RA 1UD3A 1UBOS 1FPQA 3C5WP 5F4OA 1KEPA 3DZGA 3MF4A 5I9LA 3PGKA 2CYAA 2G07A 4BNJA 4CEHA 4JDPA 1K97A 4Q7JB 2X6XA 4DRXA 2XXAA 1VLVA 4GMFA 3TLYA 1AA9A 4KYIB 1JLSA 3EPKA 4DYHA 1J2UA 2JGDA 2PWZA 2IXEA 5IMBA 1YDEA 5TGTA 1JZSA 1KEWA 2OD2A 2DLDA 5I4KA 3CUYA 4JLKA 4RZQA 2BIFA 3D0OA 3V2IA 3ZVLA 5BP7A 3V7AA 3HYLA 5M29A 1HPLA 5LIRA 3EEOA 2GCPA 1ZMXA 2EF0A 3NEJA 4ILEA 4HLNA 4TRMA 5DWDA 1II8B 3ZXUB 3IBTA 5AHKA 4CM7A 1L7MA 2VLBA 4C0HA 5C8XA 1OC4A 1P4RA 5HKAA 4MI9A 1E4YA 3IQHX 3LCJA 4XTRA 1R0ZA 4QSHA 5IVKA 1E2FA 3Q8XB 4MPTA 1WBBA 5FWYB 4GU5A 3KAQA 3NRCA 3A0UA 3QXHA 2VF2A 3NM5A 2A9KA 2DWPA 4HT3B 4RIIA 4R8VA 1U8UA 2BFCB 3ZDYB 4EB6B 1BN6A 4OP2A 1GFIA 2QAGC 3KOMA 1TLLA 1EFLA 1JRLA 1VKRA 4A26A 4TVSA 4Z7NB 3H2BA 2ETXA 4RKRA 3BMXA 3OF5A 2IIBA 4QTXA 5E4TA 3TKLA 1TGYA 5LQNA 1J9ZA 3LPCA 1ODTC 2AVNA 3A1FA 4F6CA 1VLMA 1QX3A 1Z26A 1I14A 2AWNA 3VHLB 1NKVA 3U44A 4PXAA 5DN6D 4ENVA 3W78A 4HNGA 1B23P 1WMAA 2PZJA 2C29D 2EHJA 2X14A 4NZOA 5HJEA 1U1CA 5K51A 1J1UA 3A4IA 4L3WA 4EFLA 4UZUA 2C9MA 1WUHS 3ZVMA 3QVJA 1XO1A 5I8WA 1JQAA 2ZR0A 1F17A 3E53A 1E1RA 1PKEA 3DCJA 4I99A 3L5KA 1KI8A 1Z0UA 4E5PA 2ZRQA 3DDWA 5DGTA 1TAGA 4K5QA 4EPRA 1QHYA 1XKLA 2A88A 4Z4EA 1IJBA 1P31A 2HA4A 1MJGA 1YI2B 3HXQA 4N76A 4JL8A 1U5CA 3GP8A 4HYYA 1QK4A 2VHCA 3NNDA 5LWHA 4CR7A 2JNWA 1G3IA 1HEIA 1T2NA 1C2TA 3DP7A 3EVBA 2BGLA 3KZKA 5FUXA 1L1FA 2HM7A 3DQZA 3JRXA 4MI6A 1NVXQ 4CM8A 1KQFA 1QXSA 2N75A 3B6EA 3QU5A 4NCHA 1XALA 1YZUA 2IDMA 3FPKA 3GAFA 3WJAA 2WPNA 4JLPA 2ZJ0A 4JLWA 2IZ5A 2ID9A 2BFMA 1FQKA 5KCMA 1A04A 3O21A 3K6SA 1WTCA 4LZLA 1CK4A 2WDZA 4EA9A 4CKCB 3MQFA 1VZ2A 5BWNA 4GR9A 1H3FA 4HAWA 3BSFA 5T6BA 3ZDAA 4ATNA 1H4SA 1AQYA 4LDNA 1QQ5A 4FZ3A 3Q8MA 2CBGA 4WBXC 1WKBA 3KUUA 1E5LA 3WXMA 1PSZA 2EARA 3IQEA 2C83A 1Z12A 3LLSA 4MAMA 4WLOA 3UHJA 3WGHA 1ZUWA 4E2XA 4QT4A 4DHWA 3OCJA 3T3IA 2OBYA 4O2AA 3IQFA 4HGQA 4EPVA 4YPVA 5EZYA 5H8WA 3GRRA 4ZREA 3DLTA 4WBNB 2G28A 4PYQA 5F4JA 4X8OA 2G1PA 2PUJA 2GI4A 1CPYA 3DMRA 3C3JA 2XT0A 1GTVA 2HXYA 3BE8A 1K89A 4R9RA 3UWMA 4ZHQA 2C07A 5C2JB 5JAMA 3HBJA 3KEMA 3REFA 4GI3A 4YXFA 1DG9A 4WEOA 3U3KA 4CV3A 2DFVA 3FDFA 1J2JA 4X91A 5LA6A 5PGMA 1NC1A 4ZYXA 3BMOB 3LX5A 1HDOA 1ATZA 1TM5E 4CT5A 3M83A 3SF0A 5JNRA 3D4IA 1AB5A 3E9CA 3AWDA 1N6RA 5I9BA 3O1LA 1M34B 1QHNA 1SH7A 2FR1A 4GOXA 5HBRA 4BQOA 2FWPA 3PRHA 7AT1A 5HUHA 2JCVA 4MPRA 4LOKA 5EIHA 3WRVA 3F9RA 1ELOA 1JDPA 3JD1A 5JTTA 1TTPB 3SJUA 3U62A 4WZZA 1H5QA 2C5AA 2XYHA 1W94A 5KSOA 4X07A 2HRDA 4LJKA 3A7DA 1GQOA 4K6GA 2GTHA 2GK3A 4FDMA 4GXQA 5LR6A 2Q0HA 4XLTA 3E70C 3GJRA 4ZDKA 1RBQA 3F3KA 1KMIY 4RDLA 2QY9A 3F90A 2RJ3A 3MBOA 2Z0MA 1FE8A 4CEHB 4DRXB 4QNNA 1M0EA 2XXAB 3TMKA 1N2EA 2C4MA 2OYNA 4P82A 4IHJA 5T4HA 3U5TA 2HSJA 1Y3IA 3AFIA 3CRNA 2P2NA 4QGBA 3A8JA 1O58A 3IX7A 3TCXB 1V41E 5AM3A 5B1YA 3RABA 2JGDB 4L50A 5LLDA 3K1YA 4II2A 3JQGA 1P9NA 1BX3A 1II9A 2B92A 3ADPA 3L1UA 4YT5A 1V4BA 3RS2A 4DZTA 3BCFA 4UM9B 4JXKA 2UYOA 4AJ1A 2R1ZA 4XTCS 4RTLA 1W34A 1MJGM 1V0JA 2IQIA 3AC0A 1I30A 3OIDA 4JYPA 4A9AA 3ZC3A 2E1PA 1EWKA 2Q4RA 3QITA 4IZIA 4KN9S 1Z3CA 4EG0A 4KREA 4W4TA 2CWWA 3I0NA 1PWEA 1P2SA 1DQNA 2H08A 2PTGA 4AK9A 2FNAA 3AM4A 3MTBA 3PYXA 3ZHQA 1KRHA 2QTFA 1I2MA 1QH8A 3K8YA 3WGGA 5U1PA 2E7ZA 3LO5A 2AXQA 3HR8A 3CT4A 3L6DA 3SYNA 3GUHA 2A7XA 4R2MA 4MRVA 3AJ8A 3AR4A 5K3AA 2FPWA 1RWKA 4H18A 2XBLA 3IAS1 3KLNA 1DBVO 1RS0A 2BL4A 5DTMA 3SLGA 4JJAA 3T7DA 4BO5A 1USGA 4F12A 5BYAA 2H63A 3E5MA 1UBNA 2BEVA 4TSRA 3GJQA 3P0IA 5EIBD 4Z54A 5IKPA 4G89A 3K72B 3QMMA 4B34A 4D44A 1ODCA 1FMLA 3JQRA 1REQA 2Y1OA 3LPMA 3A0RB 1A95A 3V1LA 4U9IS 3U44B 2KS6A 1SWWA 1JEQA 2C4VA 2FY8A 2YWXA 1XMOB 5BXQC 3HWWA 4QGGA 3GFRA 1GGEA 2WAYA 4V02A 4KGDA 1W25A 4UTPA 4N9WA 3K4PA 4H77A 1GPAA 2VH5R 3TO5A 4RK4A 1J0EA 3IOMA 3LP8A 4Y2QA 4H1WA 1W7AA 4U2FA 4ALNA 2Z8YM 2HRCA 2XB4A 3RHTA 3EDYA 3DNPA 2P5TB 3W9YA 1U7XA 2CFCA 4MLCA 1IWBB 1PGNA 4RZSA 4XGQA 4QRDA 5EI5A 1UWLA 1T1EA 3BFKA 1RC1A 4HAUA