4M4SA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in complex with gdp and formate ion mimic aif2gamma*gdp*pi complex (a formate ion substitutes for pi)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSADVNAPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIAFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
molecule tags Translation
source organism Sulfolobus solfataricus
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
total genus 108
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m4sA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m4sA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m4sA01
5FH9A 1LS1A 4DUGD 1Z8FA 1NVUQ 2VPPA 4IDPA 3CCQB 2FPMA 3VKWA 2JASA 4URVR 1G41A 3C5CA 4YAUA 4PAOA 2ZS9A 2OT3B 3A4MA 2QTHA 1DS6A 1ZUIA 4AD8A 4IXMA 4BLOA 5CYPA 2AHOA 4TZ6A 3CPWB 2BKEA 1DAKA 3BAFA 2ATVA 4JT4A 1CJMA 2GETA 4P6VF 1DAGA 1AIPA 3QXSA 4TN1A 3FMOB 4A8JC 2VYQA 2ODEA 4UQOA 5JLJA 1IN4A 3WMFA 2FPKA 1CKEA 2VP6A 4KO8A 3E1SA 1VHLA 1NN1A 4Q21A 2HF8A 3LD9A 5FUXA 2BPOA 5LD2B 1KDOA 4QBHA 2VHCA 1N6RA 3BORA 1YHQB 2R6CA 1G3UA 1W0KA 4Z54A 1L4YA 1JB1A 5AWFC 3LQQA 1N6HA 2DPXA 1P9WA 1QHGA 1CR0A 2IYQA 1N6PA 2ZRHA 1UBCA 2JJ2D 4HEJA 2IYUA 5CYOA 1M1KD 5EP4A 1SQ5A 2QP9X 4FMCF 3SQWA 4KLZA 5H8WA 1RJ9B 4DQLA 5E7JA 1HY3A 1NIPA 2F3TA 1N8RD 1DAHA 3GJ7A 5CJ2A 3EW9A 1DEKA 4R9UC 4A0FA 4BZQA 3KQKA 2NO9A 5AUQA 5J4HA 3K0CA 5FBWB 2QSYA 2H92A 1ETUA 1MO6A 1N5JA 3C8UA 2RC5A 2XNJA 4DSOA 3AVPA 2ANBA 2AWOA 3ZZUA 2RB4A 4D4KA 4RSGA 2C04A 3QEOA 4FD2A 4KITB 2PBRA 3QKTA 2I3BA 2IYXA 1DELA 1Q1ZA 3HU2A 2PCJA 2ZUBA 4PSVA 1AA9A 4DT1B 5AJZA 1YZTA 2QM8A 4I1UA 4MGKR 1TUIA 2GBLA 2YWFA 4IXNA 3ZBUA 121PA 1GKYA 3PVSA 2YOFA 2CK3A 5E4FA 4D2IA 1VQ6B 2H57A 4FMBB 2ZRAA 1G6HA 4B3DA 2FU5C 5JCPA 3FWYA 4NE2A 5EUQB 1GNPA 1OPXA 2FFAA 2V9PA 2Q9AA 4QL3A 4K1XA 3U5ZB 3Q5DA 2XZLA 1BX0A 3WBJA 4W5WA 2IBMA 1NMYA 2GF9A 5FPTA 4TMTA 3ZGXA 4NCJA 1Y63A 4G0NA 1A5TA 2IW3A 4LC1A 4IOKA 2QENA 3I1FA 3IHLA 3AM1A 2WJVA 3CONA 2UZIR 2ONKA 1CNFA 1GUAA 1WXQA 4FMDF 2AKYA 4QNRA 3MAAC 3VU9B 5FOSA 1PZNA 4BLQA 5KSOA 4AI6A 1M6NA 3U2QA 1Z28A 3FB4A 4LJ7A 4YAWA 5GVSA 2CL6X 1XTIA 1C1YA 4AKIA 2ZE7A 1E3MA 4GMDA 1Z63A 3NHAA 2WAYA 5HZHA 4TL7A 1IY0A 1G21E 5LB2A 4ZIRB 4MDFA 1W2GA 4LYAA 3TSZA 3IBGA 3OJWA 2IYSA 4LHWA 2PJRA 1AGRA 5EXPA 1FRQA 1R8SA 4OHZA 1FPMA 1LS6A 1JJ2B 2ORWA 2RMKA 1P7CA 4YLGA 4U7DA 2DWPA 2BCJQ 1CRPA 3LFUA 2AK2A 3IIMA 4PQYA 2C2HA 2JIZD 3B6EA 2N1BA 3KFVA 1RRPA 1IN5A 1YHNA 3L43A 2DETA 1ZJ6A 5HZKA 1JQJC 1QG2A 1YR9A 2C78A 2BEJA 2JCSA 2W2XA 5TV2A 4P3YA 1RE0A 2FV8A 2WJHA 3A4NA 1D6JA 1S1CA 4B47A 1I7PA 3OEHA 1GNQA 3MJRA 5L3QA 4ZIRA 4NYJR 3MWLA 1SKYE 3PR1A 4OL0A 2H18A 1S72B 2XAUA 4L9SA 1Z2CA 1TEXA 1OXTA 3A37A 3D7MA 4DLUA 4HB2A 2JLRA 2FGJA 1QHHB 1E94E 1G4UR 1OIXA 8OHMA 4F38A 4M1WA 1S4QA 1XTSA 4Q1CA 1TUEA 2PH1A 4B34A 1LTQA 1CP2A 1UBGA 4KBGA 2QGZA 1UKYA 1E9FA 2B8WA 3TR0A 5J4KA 4BFWA 4AF6A 2ZYUX 4LC0A 2ZJBA 1M90D 4YXWA 1R10A 4G3XA 4E22A 4A15A 1E2NA 2ZR7A 3QBVA 4A1FA 3ZBTA 2IHBA 3K9GA 4RZ3A 1VQPB 3KQHA 4BPBA 1YKSA 4B3BA 1KI1A 2FOLA 1M34E 1KI6B 3EPJA 4CEHB 3L0SA 3BC1A 1SZPA 2Z6VA 5E7IA 2YJTD 5LBIA 4UNRA 4NP6A 2YZ2A 4XVRA 1GRQA 2QMOA 1CIPA 1G5PA 1P6XA 2CK3D 2BF4A 4NKRA 3W8RA 1G8PA 4CEIA 5L8VA 4LHXA 3SJCA 4G5OA 2FE4A 2QG6A 3DM9B 1ODFA 2GQFA 2PZEA 2PZFA 1G6OA 4US0R 3QXXA 3SFZA 1DE0A 3MLEA 4XJXA 3THXB 1AM4D 3OIVA 2BMEA 2PLRA 1YITB 1MKYA 2J7PA 1MT0A 3LW7A 1G7CA 2HV8A 3QKSB 2JDIA 2GCOB 2VLIA 2CEAA 1F2TA 2D74A 1X8LA 2ZITA 2JATA 2RGBA 4B2PA 2XXAA 2FX3A 1CJKC 1H8HA 3C16C 3OIWA 4BLSA 5UKDA 3CW2A 1SHZA 2QE7A 4OI0A 5DO9A 3C14C 3RAPR 4TQ9A 1VYTA 4AKHA 4MGZR 3EA0A 5DI3A 5ANRB 1T0JB 1NBME 3LXXA 3CRRA 2NTYC 3QKRB 3EARA 4HB3A 2HYIC 3TSWA 1OIVA 5EZ5A 4JT2A 4M9XA 1EG7A 1FQJA 2HUPA 1XEXB 2WJYA 2DWOA 2G9NA 2HYDA 1DPFA 1HH4A 2O8DB 1JA1A 3B60A 4MQBA 5DYIA 1EFUA 1BMFA 4B48A 4P33A 5EUMA 2GBLC 3Q3JB 2QY9A 4IDQA 1GZSA 4LJ4A 2BEKA 5GV8A 2EU8A 4A36A 1OH6A 2YWHA 4RY2A 1GP2A 1NLZA 1VYUA 1XBTA 4RFVA 1OYWA 4US2R 4PC2A 4MYUA 3PITA 1NMZA 4DCVA 1VQOB 1FL9A 3EC1A 3AV0B 3GEIA 5KYKA 5C4MA 3W5HA 3WP1B 1NG9A 2D3WA 3T1VA 4G1VA 4L5BA 3G0HA 3DMDA 1KK1A 1MRNA 5EXXA 4I1SA 4Q1FA 4BE7B 3UMSA 4HUQA 3T1QA 2ZRMA 1S3GA 1FZQA 1CRQA 3SR0A 2VNIA 1QFJA 2WWWA 3P32A 3S1AB 1IB0A 3AP3A 3LBHA 3CLVA 2KE5A 4MGIR 2KJQA 4RZ2A 4TYYA 2HJGA 3AB3A 1W5SA 4LYJA 1KI3A 4D81A 4AWXA 1OFTA 3B85A 2WZQA 1E9RA 3LVRE 4QJ5A 1YRBA 1Z22A 2GF0A 4AYTA 1SXJB 1UADA 2LKCA 3T35A 4A82A 2RHMA 5FTLA 1EXMA 3O8RA 4TZ0A 4C0AC 1HT1E 1KKMA 2X1VA 5FR2A 5J4YA 4TMKA 3W8NA 1JPNA 1P3JA 4OHYA 3AP2A 5KUTA 1R8QA 3AVXA 3QPVA 5K8LA 2V3CC 3WBKA 4TMXA 3GQBA 4F4CA 4LV6A 3MSXA 3V4RA 2OFXA 1KOFA 3BE4A 4PC3A 1BYIA 3AKCA 2IYYA 4ACAA 2OHFA 5AUOB 1YZUA 2QTLA 4DQKA 4CT4B 1UPTA 2CHGA 4X8OA 2HLDA 1JECA 4PPQA 4LJAA 2RGDA 4LY6A 4Q4HB 4TWZA 4E07A 1N0VC 3PEYA 4ASUA 4LJ5A 3DKPA 1FQKA 4HLDA 4MUAA 2ZE5A 5AN9A 1FUKA 2H8KA 2VL7A 4JL8A 3VR1A 2E9SA 2GVDC 2ZRDA 1KZGB 4YDHB 3THWA 3L8YA 1GTVA 1X8JA 3LRPA 2XGJA 1UKEA 2O52A 2VIIA 2C96A 2G88A 4A9AA 3VR6A 5E3HA 1YU9A 3C4JA 1W46A 4TSFD 4WXPA 4GPTA 1W4AA 2P6RA 3UPUA 3EZ9A 3CCRB 2F7SA 1Q81D 5FOWA 3KUCA 5L3SA 3AVUA 3QUSA 4TYNA 2OFOA 2R6FA 4TLAA 1JBKA 2G6BA 2NG1A 2IHYA 3GLGA 4RFSB 1UAAA 1RVDA 3OEEA 1D2MA 1ZRHA 2QN6A 1OFIA 1XEWY 1G7SA 4J0QA 1E1RD 2IT1A 3MGCA 2G77B 4PPGA 1ZP6A 3U7EB 1QVGB 4DCNA 2F1HA 4AG5A 2Q21A 3C15C 2VSOA 3FMFA 2HCJB 3WNBA 4NCNA 4O0MA 2CLCX 4KVAA 4JL5A 4PPNA 3VQTA 4JBWA 3QKSA 1MABB 1N6OA 4JVMA 3IEUA 2CMKA 3K53A 4LSGA 3I61A 2EWVA 5FUVA 1UFQA 1F6BA 4V0MA 4D80A 1CBUA 2VH5R 4XSHA 1IJFA 2VBCA 4RFSA 2CCJA 5D3QA 2PX0A 3RNLA 3JZMA 3OJXA 1FTSA 1Q21A 4XTCS 3QKRA 3HP1A 4TQUS 3LXRA 1JAHA 3CM0A 4URWR 2VQSA 2VTKA 2JJ1A 2QU8A 5FTNA 4BFYA 1W7AA 3MWJA 3VR4A 3MCAA 1JR3E 3G71B 1KSFX 2W6JD 1KQSB 1IXZA 1E0SA 3B9PA 1GFIA 1G3RA 2BM1A 4JL6A 4PAMA 5FPKA 4DCTA 1MRSA 2BBTA 4JLDA 2REXB 5DI9A 2IS4A 3IQXA 1CJVC 4P4SA 2DY1A 1R2QA 2QORA 3SYLA 1KO8A 3AVOA 2O8CB 3A8TA 3TQFA 4YMUA 2BM0A 2DFLA 3SC3A 2O8BA 3RRNA 5GV7A 1OYYA 2R6DA 3BGWA 3RYTC 3CNLA 1A2BA 4QGGA 5H70A 1AS3A 1DTSA 3B8HA 4Q4LA 2N42A 1YJ5A 1W36D 2QAGC 3I8SA 5H5JA 4KI0A 3BWDD 2GCPA 3KUDA 4UNSA 1Z6GA 1A7JA 4K81B 1QG4A 3MJHA 3CWZA 3OFNA 3FJOA 2FSFA 3PQCA 3U60B 3KKOA 3I56B 1OGJA 1CNEA 4D4LA 1GR1A 2GJKA 3GLIE 3U3JA 4PO1A 1Q1BA 5A4JA 4NYIR 1E2KA 4PXAA 1DAIA 3TJZA 4NONA 4BPRA 1RRCA 3IQWA 4M8NE 4B71A 4BRUA 5KNCA 3RWMB 3UWOA 4URUR 3PEVA 4KAXA 3VMFA 2QP4A 3I4LA 3W5VA 3LX8A 4W5JA 5SZHB 2WVJA 5KSPA 3EIHA 5JHGB 3ICQB 3TAHA 4DLVA 4K46A 5JI2E 2ZE8A 5JCZA 2YOGA 1QG0A 1M2OB 2IS2A 5J40A 3QOFA 4EPXA 2OZEA 4WZ6A 4A2QA 3X1ZA 3CRMA 4ILEA 3LVBA 3FE2A 3DEFA 1SM4A 1H42A 1OGIA 3J81k 1NN0A 1QGZA 2B7BA 2YV5A 4JYBA 4URYR 4I99A 3V00A 5CJPA 1IN7A 4UKDA 3ZJYA 1IJEA 4ZI2A 4NL4H 4KHZA 2WIBA 2C5LA 1G19A 1XXHB 2FSIA 1E6CA 3THWB 1E2JA 1Z0IA 4IDNA 4L4UA 3M0EA 3IBYA 1X1RA 5FOUA 1SXJC 2OXRA 3AP1A 3VR2A 4F93B 3M1IA 5TMPA 1NJID 3PCRB 1U98A 2NQ2C 5FPHA 2VHTA 3I62A 1V5WA 3HR7A 1N5IA 1G3IA 3U44A 4ZKDA 1KC8D 4ZV4A 2Z43A 2ZAOA 2I1VB 2CLSA 5TARA 1XEWX 1KYIA 4LGMA 3HU1A 2ZM5A 1HTWA 1HV8A 3B1XA 1YI2B 2J59A 2VHQA 4PPFA 4US1R 5HPYB 1X6VA 1N25A 3TGPA 2QQ0A 1DDGA 2BMWA 2V55B 3KJEA 4GZMA 3LH5A 5KNDA 2HDNB 4RJLA 5HCNA 5AJYA 1VQ8B 1KZ7B 5B2ZA 4ZCMA 4LWZA 2GXAA 4OHXA 5FA6A 4LDJA 1P61B 3PFIA 2ZVPX 4Q4AA 2HF9A 2ATXA 4QRHA 5EXTA 5EP2A 3QVUA 3UMFA 4EPWA 1GNRA 1ZD8A 3ZYCA 2BKUA 4L15A 3EZ6A 1Q0UA 4F4IA 5DHFA 2XZPA 2QA4B 1GILA 4A4DA 2IF0A 2C95A 1J90A 4GBMA 4Q7LA 3VHLB 3W2HA 1RYHA 3NTUA 3PUZA 5G40A 521PA 1OF1A 3SDZA 1W4CA 4GOJA 4TTPA 3EPLA 3CCEB 4FXPA 1OXVA 2UKDA 3D3QA 4S35A 1XU4A 2KB0A 4JJZA 3SYKA 3QVVA 3VAAA 5G53C 3LV8A 4Y0AA 2H16A 3KX2A 4P31A 1FUUA 4KXFB 4PO9A 1N6KA 1T3LA 1QHSA 3HPQA 1IN6A 4BFTA 2Q9BA 3CO5A 2J7KA 2ZYTX 5JRJA 3U4QA 2P3SA 1MOZA 1YZNA 4NBSA 1E2IA 1FNNA 2C9OA 2JAQA 1TMKA 4M9SA 2J0QA 1ESNA 1A2KC 3DOFA 3QG5A 3SJBA 4RD6A 5EP1A 5KDLA 2JJ1D 2VHUA 1P62B 1SXJA 4FW9A 5GJCA 221PA 4C7OB 1KO1A 4YMVA 4MYHA 4JBXA 2JDID 3A1WA 1KNXA 4B75A 1Z0AA 2LCFA 3SEAA 4Y9UA 3QKUA 2WWFA 2ZEJA 4RKFA 4IFBA 3CF2A 4B3CA 2TMKA 1OIWA 2IK8A 4OJQA 3Q5EA 4JLVA 4ZDIA 4O3MA 2OCPA 1IAQA 3E5HA 4RZUA 4Z1MA 3QG1A 1ZCBA 1W5TA 4FMDB 1XFAA 4TQAA 2ODBA 2RGCA 4BASA 4HATA 4NPHA 4A0HA 3ZS9A 1DG3A 2BGIA 3FKSD 4BLPA 4QFMA 4HYYA 3LNCA 4IVRA 3WP0A 4R2IA 1PJRA 2VSFA 2BBOA 1CTQA 4N1AA 3T34A 1BYUA 4DSUA 3QFTA 1MO3A 1R6BX 3GJ0A 3H1TA 1U0JA 1Q57A 2GA8A 3CWQA 2IS6A 2GAAA 1WMSA 2GXQA 3L8ZA 5H1YA 1QHYA 2D2EA 2PIAA 4EFNA 2IEYA 1XXHE 1QHHA 1J7KA 3F5FA 5JWHA 2PT7A 1GO2A 2EQBA 2QMUA 2CRVA 2ZSEA 4TMWA 3LW8A 1WB9A 1NVXQ 2DCUA 2ZUDA 2P5SA 4L16A 4LX0A 2BIFA 4TYQA 3FMIA 1OXXK 3CH5A 1G8HA 1W36C 4C0QC 4M9QA 2QM7A 3IUYA 4UNNA 2JA1A 4R71A 3A1SA 4FIDA 1VQLB 4WZBE 3GLHA 4L8GA 3SQXA 1TAGA 1H8EA 4LHZA 5J4VA 4D0NA 4UJ3A 2HXYA 5CIWA 2V4ZA 5AR1A 4EKDA 3ND8A 2Q6TA 4YXWD 2ZIAA 3AGPA 3PEUA 1W0JA 3FMPB 4Q9KA 2QBYB 1XTKA 3LBNA 3U61B 3LO5A 1TQ6A 1YZKA 4NCHA 4V03A 1AZSC 1N2CE 2BWJA 2ZI7A 4HDCA 4HLUA 5FBRB 4DLRA 1Z6AA 4KFTA 4ZPXA 5CM8B 3CPHA 3OIUA 3P20A 1QHIA 4B6FA 1VQNB 5DIFA 4A8JB 3C41J 4BFUA 2EFCB 5D3MA 4V0LA 5KSZA 1XJCA 3PUVA 2IX3A 2QT0A 4O2LA 3CRVA 3VTKA 5EXSA 1W35A 2CE7A 1F60A 4TLBA 2QTZA 3DDCA 3W34A 3NWJA 1E1QD 1LV7A 3MHPA 3EA5A 1N0UA 1N5LA 2XEXA 4IVPA 4DIEA 2PZGA 1VKJA 2F55A 3RRZA 4YONB 2C98A 5DN6D 1D5CA 2V7QD 1QGYA 1U0HC 3ADKA 4JYCA 3X1YA 5DI3B 2VNJA 4AKEA 2FZ4A 2LWIA 3K8YA 5JEDA 2CE2X 3AVYA 1W49A 1M7HA 3CC7B 2IYWA 3TIFA 4TL6A 1KGDA 3WYGA 1UM8A 3ZLJA 5CB6A 4C0SA 4JLMA 4B73A 3B7GA 1GDDA 2C9CA 3CX8A 3LAWA 1YJWB 3AF0A 2PLFA 1GKUB 5JS8A 2B8TA 2GDJA 2VNHA 4KBFA 4M1YA 2ZRPA 3PEWA 4BEJA 3RABA 3GLFA 3KFXA 1ANKA 3K70B 5JRZA 3ZS8A 1ZAKA 3A4LA 4KU4A 4C0LA 1MO4A 4U02A 2QTFA 3WHLA 2C03A 4ZCLA 3NBXX 2MMCA 3RS4A 4FK8A 1Q7YD 3IPXA 3KJGA 4IHQA 3LDAA 3W2GA 2GZAA 3VR3A 1DAEA 3DPUA 5CK5A 4K8OA 1BOFA 2ORVA 1OXUA 1Q22A 2ZYWX 5M04A 4RD4A 3AVTA 4B3XA 1E32A 1XMIA 1XD2A 1ZNZA 5F3WB 3CRZA 3DMNA 4PZZA 1G5RA 3SYNA 2PCLA 1R0ZA 1IXSB 2FH5B 3H86A 4M1OA 3WHKA 1XZPA 2CL0X 4BEBA 3U7FB 4OHVA 3S1AA 4IVQA 4PHGA 1AS0A 1KMHA 2HT6A 2ZI3A 1T9HA 2WAXA 1OKKA 3W6PA 4WW0A 4OYHA 2FFQA 2O0JA 1ZC4A 3GEHA 4NYIQ 2GHIA 3SN6A 2DEUA 1KDPA 2FEOA 4AYXA 4URXR 3TVTA 1XX6A 1ZC3A 2WM9B 4MYCA 1I4DD 1TF2A 1SVMA 1ZBDA 3CX6A 3P26A 3QF7A 1DOAA 4Y7CA 3WNCA 1FMJA 2B5OA 2ZRCA 1Z07A 2EIXA 3TK1A 2BN4A 2RGXA 4DUGA 1NVVQ 1Z0DA 2IC5A 3K0FB 4PC6A 1ZUNB 2ZUCA 1KAGA 2GXSA 2JLVA 4FCVA 4NMMA 4FWIB 3T15A 5JHHB 3PV0A 3GJ8A 5L3RA 1I4LD 2FZLA 4GP7A 2A78A 3BK7A 5F9FA 1A4RA 2O8EA 5DHAA 4GOXA 1LFDB 4DZZA 5IHPA 1S3SA 1TF5A 5CB8A 1ONBA 1JR3A 2PEZA 4CVNA 5FBLB 4OQLA 2A3RA 4PSKA 1US8B 5EZ6B 1KJYA 2FNAA 2ZJOA 4NH0A 4LZZA 1KJZA 4NHOA 3TW8B 3ZQ6A 4ARZA 3BOSA 2E87A 3VR5A 5JSZA 4PGOA 2C99A 2BGJA 2GK7A 2KBEA 2QGNA 2V1XA 1VCOA 2GCOA 4G5SA 4XWKA 5EMNA 5IT5A 5C4GB 4G1UC 5L3SB 4E09A 1KK3A 4Q4AB 4B44A 2OCBA 4GNKA 4EH1A 1M1YE 1LY1A 4DDWA 4D25A 1NKTA 1Q86D 1E0AA 2QL6A 3DVLA 1JA0A 4N0EA 2QNRA 1AMOA 4LPKA 4DSTA 4XWOA 4Q4JB 3AH8A 2XTMA 4CT5A 3ADBA 2ZRFA 3CXCB 4PAQA 1DBSA 5G3ZA 2Q9CA 1ZYUA 1T5LA 2RH5A 5DLQC 4YQFA 3NDBB 4EQ6A 1KI8A 3VX4A 3AUXA 4EPVA 4LOAA 3FYHA 2QQEA 1KD1D 2W6ID 4CW7A 3U6KA 1NY5A 4I4LA 4ZI3A 3R9XA 1FFHA 1Q3TA 5KTYA 1NF3A 2ZSDA 3VHXA 4RD1A 1W47A 2OBLA 2RKOA 5JECA 2WKRA 3EZFA 5FBVB 2FEMA 1F48A 2ZE6A 4EUNA 1AKYA 4HB0A 4MKGA 1B2RA 3AF3A 4DDVA 1T3SA 1YQTA 3R7WB 1E4VA 4WOPA 2QAGB 1WBDA 2QRZA 1ZM3A 1KO5A 4BFZA 4EPRA 1COWD 4A0RA 2F43B 1UKVY 4JVNA 4CIDA 4G1BA 1P73A 3QQ5A 2VF8A 3OE7D 4QNMA 1I2MA 1TU3A 5L3QB 4P4TA 4Q1EA 2XITA 1GRNA 1OE0A 3IIKA 4N0DA 1ZD9A 3ECCA 3KDSE 2WSMA 1EESA 2QUZA 4LJ9A 2ZTSA 3L0IB 2O0KA 3RS7A 1CR4A 4L9WA 5TXGA 4LK2A 2R2AA 3FFAA 2Q0HA 1NVVR 1D9ZA 4LUCA 2R62A 1G3QA 2Z4RA 4G5GA 5IF9A 2IXGA 2JJ8A 3LWNA 5KPJA 4XIGS 1LNZA 3K0AA 1F5NA 1UJ2A 3C5HA 3KXIA 4LRWA 2A9KA 4Q19A 5HXBA 1DVRA 2QZ4A 2ZRBA 3EX7C 2G3YA 4EPYA 1T8TA 1EK0A 3BIFA 1OLOA 3ZVLA 4TMVA 1CU1A 3REGA 2NGRA 3JZAA 4M1KA 3K9NA 4DKXA 1VPLA 2ZS8A 4JS0A 4Q9IA 3SBEA 1D2EA 1VG1A 1G8FA 4KLNA 1KTVA 3IGFA 1KIMA 1T0HB 3E20A 3GEEA 1GAQA 1KRHA 2OLKA 2FF7A 1SVSA 1VYVA 2BMDA 3K1JA 4R2HA 3RS3A 2HJVA 2DFKB 2ZPTX 3KKPA 4RCZA 1CJTC 3SE0A 3I5XA 3ETLA 4LI0A 1GG2A 5H59A 3KJHA 3T61A 3K0FA 4MKIA 2WKQA 1IN8A 1E79D 1FX0A 1KI2A 2B92A 3KL4A 2D2FA 1FP6A 2OAP1 2VEDA 3EXAA 2BJWA 2L0XA 4P4UA 4PHFA 1ZUHA 4D0LB 4FCTA 2AD1A 5BWMA 2J0SA 2VP2A 1Y3AA 3EZ7A 2W0MA 4RD0A 1M7BA 1VQ5B 2XXAB 3MRSA 1Q12A 3GJ5A 3KQUA 1UF9A 3HYRA 4U9UA 5AUPB 2WOJA 4AF7A 5EJEA 5JI3E 1NJGA 1K5DA 2C77A 4GMXA 1EGAA 5HE9A 3IDQA 3QI2A 2VHJA 4P32A 4TLCA 5D3MB 3GP8A 4I1VA 1W48A 1QDEA 2OCYC 2OFWA 3KXLA 2X2FA 3LLMA 2F1IA 1OHHA 2J9RA 4C0HA 1U90A 2PX3A 2CL7X 3NIBA 3B1YA 5JSZB 2O8DA 4H1UA 1II0A 4HLQB 2G1KA 4B33A 4RVCA 1D8TA 3E1YE 1T5IA 3CNNA 3TQCA 1K8RA 4DIDA 4E5UA 1M8PA 1COWA 1Z06A 3AUYA 5TR9A 4UJ5A 1N5KA 3H4MA 2V54A 3ASZA 4Q7MB 4D4MA 3Q8XB 5EE1A 2FFBA 1ZU4A 3GJXC 3E2IA 4F7WA 1VMAA 1P9RA 2F1RA 2X19A 3CPJB 3DHWC 4PHTA 3GLHE 3RRMA 4YALA 1W1WA 4WXRA 3X2SA 3OEHD 1DDIA 4QBGB 3NXSA 1S9HA 4JLOA 1GAJA 2AR7A 2XOKD 3N70A 2ZROA 1ELOA 3R8CA 2CXXA 1G18A 721PA 4ZO4A 3E70C 3NVAA 1P2TA 1FDRA 4URZR 1PLKA 1ZW6A 4DEYA 2A7QA 5B57C 1KI4A 3OIYA 3MMPA 1IBRA 5LDDC 1GL7A 2CBZA 4GI7A 4DBLC 1IY1A 2IL1A 4LHYA 3CF0A 2VP4A 2ZSAA 1S8FA 3CCUB 3H84A 1Z2AA 4JSTA 2OM2A 2WJJA 4RKEA 4BGDA 5FI1B 3KB2A 3OESA 1GSIA 1SVLA 4QGFA 3QXHA 5JFGA 5G41A 3QFRA 1N6LA 3CZQA 5AJVB 4Q9LA 5FI0B 3QFSA 2P0EA 3KKQA 2YC2C 4V0KA 2OEPA 1QF9A 2R6AA 5HKKA 4IKEA 4WAUA 4GSYA 2FN4A 3RWOA 3GFTA 1BH2A 2GPJA 4ABYA 1VG8A 4YAFA 1IOZA 4YMWA 4BZXA 1HE8B 5JMTA 4YHBA 1Z0JA 2I4IA 3V9PA 1NBMD 1GRRA 2NO6A 4AURA 1E9DA 2YKGA 4CYMA 2XZOA 1G7TA 3ONWA 4OQFA 4GZLA 2R44A 4JLKA 1AGPA 2X77A 3A58B 4IOMA 4OI4A 3LO8A 1RPZA 2ZETA 1R0YA 4TL9A 3R8FA 5G3YA 4NYJQ 4D82A 4OK5A 2FJUA 3GJ4A 4GP6A 1E69A 2GJ9A 1AJEA 1XCMA 2KI5A 4LYHA 2BCGY 4PZYA 3NHBA 1L2TA 3IILA 4R98A 4M2LA 1AS2A 2ZJZA 3TLXA 2V8OA 1UDXA 1OB5A 2UZ3A 2G1JA 1IHUA 2XTZA 3N2EA 5AJXA 4IOJA 1HQYE 2XNDA 4ZDKA 2EFGA 1MR3F 3L2OB 1WA5A 4TTQA 1TTTA 4JKYA 2WTUA 3JVUA 4HE6A 5KO2A 1SHKA 4KFRA 4N3NA 2F9MA 4AIIA 2XB2A 4KCGA 2GEDA 3SJZA 5C2JB 3W5UA 2ZU6A 2AN9A 1GIAA 4BLTA 4CEJA 2ZRJA 2BC9A 1MO5A 3BB3A 4HAXA 4BUJA 1F20A 3ADDA 2ZYVX 4O2RA 3I8XA 3KTAA 1YR7A 1CR1A 1E1RA 2OO7A 1XTRA 2XB4A 4X8MA 3DZ8A 3I72A 1AZTA 2XSZD 5KHOC 4TT3D 3L0OA 1E9SA 1RRGA 2JIZA 4XVUA 1ZM4A 1EX7A 1PUIA 2VP9A 4PO8A 1HYQA 3BFVA 3SBDA 3SI7A 1GAWA 1VG0B 2QSZA 1Z0KA 3B1WA 1EFRD 4JLNA 4CEJB 4WZAE 4X8HA 5SZJA 5JWOA 2QDXA 3B9QA 4OK6A 2PT5A 4ZCIA 5BN3A 1NJFA 1CULC 2YNMA 1LF0A 1QVRA 3BH6A 2J46A 1E64A 2QA5A 3KB1A 1QH0A 4IEEA 1ZMXA 4BECA 4AY2A 2CJWB 4O25A 2AFIE 1Q20A 4D26A 4KFSA 3BD9A 2ZRNA 1S96A 3ES9A 3CC4B 2RGEA 3B1VA 5GVRA 4DB2A 5FL7D 2GZHA 4CDGA 3FFBA 2LKDA 3CC2B 3ZIAA 1KKLA 4ACBA 3IKJA 4DXAA 4EIWA 3LX5A 3QENA 5F98A 3R20A 3M6AA 4JVSB 4DLTA 4P4SB 1TNDA 1QBKC 1JALA 2V6IA 4W9MC 1P9NA 3IHWA 3PG5A 2ZI4A 1KK2A 4H1VA 2GEUA 1JI0A 4FINA 4TLDA 5HE8A 4TMZA 4MRNA 2GWHA 1XDBA 2GKSA 1KO7A 1QRAA 3CZPA 3RS0A 1AKEA 4ITRC 2P6NA 1CR2A 1RFLA 3CUEF 5GADl 2QI9C 3ZZ0A 3IPYA 2ODWA 2WIAA 4GOKA 1QFZA 1PV4A 2OTLB 4Q7KA 2IYTA 1R0WA 2VP0A 2FPLA 3WMGA 2WWYA 2WV9A 3KZ1E 3V4FA 4F91B 3FHTA 1TL7C 3WNDA 4Q18A 3CCVB 4OQNA 1XP8A 4PX9A 2PL3A 5B30A 4ON9A 5LB4A 2JLUA 1ZM7A 2RHDA 1G8YA 1K9MD 3BB4A 3T06B 1P72A 5BN5A 3IEVA 1VTKA 4B3FX 5BW8A 2YVUA 2W58A 3L82B 4G5RA 3TW4A 4FN5A 4DLZA 1WBBA 3REFA 3NBFA 2J0UB 1H8HD 3MG9A 3NC1C 1CQXA 1VCNA 4WIAA 2J0VA 1VIAA 4ZKEA 1EX6A 1E9AA 4TSFA 1OKKD 1ZM2A 1AN0A 2DWQA 3G5UA 4C3ZA 4Q5IA 3GLIA 3O8CA 1VECA 2Z0MA 1PLJA 2K5UA 2IUTA 1WF3A 3EAQA 4IRUB 5SZIA 3EASA 4V0NA 2JJ2A 4MDEA 2IEZA 1ZINA 4HDQB 3EIQA 2A2ZA 2OAQ1 3C7KA 4II7A 2IS1A 2OK8A 1MV5A 4PC7A 1CXZA 1RJ9A 2ZS7A 3NBZC 5A0FA 2NZJA 4QKQA 4HUTA 1G20E 5DE3A 3FTQA 1LF5A 3A1TA 5FOVA 1E2FA 4PTLA 5L3VA 1GITA 2NO1A 3GCGA 2ZR9A 1X3SA 1YIJB 1NL3A 4KODA 4UNPA 1BKDR 1OXSC 2CNDA 4Q02A 1N3BA 5IK2A 1C9KA 1I2DA 3UIEA 3O8DA 2GTPA 3W5JA 3ZC3A 4DEXA 1H65A 4I1OA 2QRNA 3F8TA 4JLAA 2JLZA 1E2MA 1E9EA 1NI3A 5FTKA 1S1MA 2WHXA 2AK3A 4BZPA 1UBEA 4LJYA 4HE5A 3HJNA 1J99A 4S2EA 5EP3A 1E2LA 3SJAA 5J4LA 2REBA 5EE9A 1U2RA 5J47A 2B21A 1NDHA 1Z0FA 4Q9JA 5EE5B 2IA5A 3PIRA 3RRYA 2GEVA 3U3MA 3ZDQA 2PEYA 2UVQA 2CVFA 2D4HA 2J3EA 1PLLA 4JLJA 1QZXA 1Z47A 2PMDA 4IDHA 4QG7A 2V1UA 1DAMA 1T6NA 1ZNXA 5FTMA 2F1JA 3EC2A 1SKYB 1W87A 4RZXA 3OW2B 4HI0E 2H17A 1WP9A 3U3OA 4TL8A 2NIPA 4G01B 1U94A 1Z29A 2CVHA 3KXKA 3UMRA 3VU9A 1II9A 3QE2A 1NNEA 2ONJA 1XMJA 1V43A 2CJWA 2Q3HA 2XJ4A 4WQMA 5BYJA 1EWRA 3GJ3A 2GRJA 3W90A 1RW4A 2PMKA 4LV8B 4IW3B 4MKHA 3U44B 2ZJ8A 1E0KA 3NH9A 2WPDD 5LPNA 1E2PA 3CPEA 3CCLB 2NZ8A 1GL9B 3THOA 4IOLA 4OBEA 4PSAA 4B2LA 4F92B 1LW7A 3G82C 3B2EA 4PFSA 1P4SA 4C7OA 3VO1A 1G4AE 4Z8XA 3LA6A 1EWYA 3T5DA 1VCMA 3AGQA 4I81A 1QVFB 1HQCA 1E2EA 2IYVA 3CKLA 1K8AD 1FNBA 1KDTA 1H8ED 1TF7A 4JLBA 4KJZA 1P2SA 1T3HA 1Q1EA 2KWIA 1JEDA 2OBNA 2OUKA 2X8AA 4Q00A 3X1DA 1AQYA 5FOXA 2ASEA 1OV4A 2HEIA 3P27A 4HLCA 4UXHA 2O8CA 3ZVRA 2GJSA 1W34A 2RGNC 4JSYA 1YR6A 3CCJB 1X1SA 3W5IA 5ELXA 3R7WA 4NU0A 5CM9C 1OSNA 2IF2A 4YMSA 1DO2A 1GL6A 3CMAB 1YJNB 1OFUX 2IUUA 4C2TA 1ESMA 1R4AA 1XD2B 1XD8A 2N46A 1VQ7B 1W4BA 1VHTA 3PUXA 4DJTA 3QFCA 1N6NA 3Q7QA 1XE1A 4MRVA 1PVOA 1KO4A 1OW3B 1JR3D 2FMXA 4WBSA 3QJYA 4B74A 2QEXB 4JZKA 1FRNA 3AKDA 1JR6A 4EFMA 3SOPA 1KMHB 1Z6XA 2XSZA 4NCIA 4PHHA 4B2IA 4ASUD 4IJMA 3TUZC 1JJ7A 4QM6A 2GCNA 3MD0A 4KV9A 3VO2A 1K5GA 1Q1QA 1Z6TA 1G3MA 5FPSA 1BJKA 4Q66C 1J2JA 5BXQC 2WOOA 1NMXA 4CEIB 1EFRA 4PQRA 4KYIB 3QF4A 4A2WA 4BFXA 2ZREA 3L0PA 1YE8A 1K73D 2AWNA 3HYTA 5F2EA 2DFNA 4OQMA 1QUEA 3GLHB 1P2VA 1KI7A 1E99A 4C43A 3NG1A 2Y8EA 3ICEA 3MWKA 1G291 2ZANA 1N6IA 4MITA 1XEFA 2IXFA 2MSDB 5K8IA 2QBYA 1HUQA 1Z6YA 1C4OA 1OH5A 2QE7D 1TEVA 2H7VA 3PUYA 1HT2E 3KQNA 3FKSA 3SHWA 4OHWA 1DG1G 3THYB 4QGAA 4AG6A 3GLGB 3ND9A 5F9HA 5TDHA 4QBFA 1E0JA 2RGGA 1XXHA 3QXCA 4DCSA 1US8A 4Z1MD 4MA4A 1WQ1R 3EWAA 2Z83A 2W2VA 4DVGA 4HAZA 1XWIA 5HKKD 5K8UA 4HAWA 4U5XA 3ZH9B 4Z8YA 3MFYA 3Q72A 3ZVNA 5FTJA 2EFDB 5FR1A 4YC7A 3P4XA 4M4SA 3PXGA 4ARZB 3K0CC 3D8BA 5JBQA 2RGNA 4C30A 3BH7A 4BQSA 1L7VC 1VDZA 2NPFA 1UMKA 2GXUA 4LYFA 3CCSB 1KMQA 2OSBA 1W44A 1XCPA 3W2EA 1E4YA 3BFXA 1QFYA 5CITA 1FNCA 1E62A 2GESA 1EWQA 1KI9A 4CRWB 2J1LA 4ESVA 2DBYA 2Z4SA 2D06A 4TYPA 4Q4JA 2QAJA 3P1JA 3R9IA 3FVQA 3W2IA 1GOTA 2QROA 1Q44A 3Q7PA 3KKMA 4V02A 2NPIA 1F2TB 2GJAA 1QHNA 3GLFB 4WVFA 4M0LA 3X1XA 2ZVQX 1A8PA 3RANA 5CK4A 4DHEA 2JLSA 2WICA 2WWXA 3CIOA 1RC8A 3WMEA 2O8FB 1CF4A 2CLDX 3I73A 5KPDA 3GPLA 1U9IA 2YHSA 2WSSD 3QE0A 4JVLA 1JJVA 5FPYA 2ZXUA 4OKSA 1Z08A 1OJLA 3SNHA 4EFLA 1YJ9B 4NCKA 1HA3A 1NKSA 2EYQA 4HLUC 1NSTA 2FFHA 3I3SR 3JQPA 1IONA 2R6HA 4HZIA 3FKQA 3QSYA 4C0KA 3ZZTA 2QEQA 4JBYA 2B7CA 4OK3A 4Y9RA 1U99A 4F4JA 2OTJB 1YR8A 3AQ4A 2NO0A 4ZDWA 4M1TA 4Y0VA 5C18A 1OH8A 5B64A 3DKVA 1YVDA 1TU4A 1VCIA 2BSAA 1VQKB 1KK0A 2RC6A 1KJWA 1EFCA 1GWNA 1E1QA 4M53A 5HCIA 1CJUC 3UG7A 4BFVA 6Q21A 3OAAA 3T1TA 5DSZA 5IDVA 3W6NA 2MSCB 3T12A 2FG5A 4C2UA 3QPUA 5AK0A 4LBVA 5CLQA 1YRAA 1E79A 2BBWA 3B82A 4N3GA 2FA9A 5BQ5A 5IRCD 2XTNA 4OJKA 3TMKA 3VKGA 3V76A 2GJ8A 1T91A 2WMNB 2RAPA 3K9LA 1TQ2A 5FL7A 4BRWA 3I55B 2IYZA 5FUWA 2V6JA 2P65A 2ZQ5A 3DOEA 4P0TA 2YYZA 2RCNA 2EFEB 1KNQA 1NY6A 2WWIA 4QHSA 1XMVA 5BN4A 3K0SA 4X8LA 2BOVA 4EDHA 4DB4A 1TQDA 2HT1A 1OHHD 3AF1A 4DCUA 2E1RA 4NDZA 5FFMA 4PZLA 2CCKA 1SVKA 3LBIA 5CDFA 2YOHA 3UWKA 2WKPA 3EPHA 2P5TB 3HWSA 2X3UA 1TLLA 1W2HA 4DDUA 2GAOA 1T8UA 1BMFD 3GD7A 4FI3C 3U6BA 1OB2A 5E7MA 1NBMA 2AKAB 3FHCB 4YMTA 5BYKA 2EW1A 3TNFA 5KSYA 2MMGA 4HAVA 1SKQA 2W83A 1FX0B 1RZ3A 1D9XA 1GVNB 1U9IC 2P67A 1E96A 1Z83A 3LQRA 3QNUA 4LHVA 5DH9A 1HE1C 2JLXA 4MRRA 3U3KA 1P75A 2V7QA 3RDPA 2OILA 1AK2A 1P2UA 4B35A 3RSLA 1SVOA 1NG1A 2ZJ2A 3DM5A 4EJSC 3OF5A 3PUWA 4XD7A 1S9DA 2W0SA 3RVBA 4G5QA 3T5GA 3B1ZA 3VX3A 5P21A 1U8YA 2J41A 2NO7A 4Q7JB 1OH7A 4RD2A 4A6XA 4DLXA 5KU1A 3KQLA 4ZGQB 3B5JA 4JKIA 4YDSA 2OK7A 3JQRA 3BXZA 1A1VA 1E2GA 2ZRIA 3EZ2A 4NTZA 3TVDA 4QJ4A 5JJKA 5HR5A 1WDTA 1T4GA 5JEEA 1GJRA 2VP5A 2WSSA 3AVVA 3KTAB 3N2IA 2A5GA 1G9XA 3OZUA 2OG2A 4JMPA 1EFTA 2O0HA 4EQ6B 1NLFA 3ZIAD 2FWRA 4HSEA 1BIFA 3PENA 4LCBA 3RS2A 1Z5ZA 3UKDA 2CNWD 1IXRC 1R7RA 1E2HA 1L8QA 1FNMA 3BS4A 4GDFA 1JB9A 3BJIC 3NEJA 4A8JA 4B3GA 4TYWA 3OFND 3KJIA 3IO5A 2HCBA 2BMFA 4Q1AA 3K0EA 1FTNA 1DARA 2J87A 2Q3FA 2ZJAA 4B76A 2R6GA 4WA7A 4DRZA 3W3ZB 1UEIA 3HDTA 1SULA 1H85A 2F43A 5KNBA 4GRAA 1F3OA 5GJWC 1CEEA 1QGAA 4JLPA 3W9YA 5JJIA 2CHQA 1IM2A 1KSGA 3HR8A 3H0KA 3H2YA 2QPTA 1O3YA 1X86B 3D6TB 3JQQA 5JJLA 1II8A 2JGNA 2HXSA 3SU8A 3QEJA 1G8GA 1RIFA 3CRW1 3AVWA 4LBWA 3GMTA 1ZNWA 2QMEA 2EVWX 2VSXA 1SXJE 2IYLD 3ZD7A 1X8KA 2ZAMA 3FHOA 4XOIA 5CIQA 4XSGA 4QBIA 2H5EA 1QX4A 3UATA 2XNDD 3D31A 1DADA 2XNSA 3FPAA 3SS8A 1VG9B 1XTQA 2Q3MA 1D1NA 3CB4A 1NN5A 4HUQB 2QP3A 4EJSA 4LJ6A 3TBKA 2DR3A 5DYGA 3W6OA 5FBQB 3RS5A 5C1BA 5CLLA 421PA 1BS1A 2R65A 3EPKA 1P60A 2ZRGA 4D4JA 2DYKA 4HAYA 4F7DA 4Z51A 2O8BB 4BLRA 2VNKA 4GT1A 2AD5A 2CDNA 4DDTA 1XJ0A 3I92A 3DZDA 4QM7A 1EP2B 2DERA 3A1UA 4MH0R 1TADA 3I5YA 2W00A 2VZLA 3TH5A 4C4PA 5DGXA 1XJQA 3BRWD 4M9ZA 1NN3A 1GVHA 4MUBA 3FOZA 4ZGNB 2NMVA 1JXMA 1KY3A 1OFHA 4U00A 5SZKB 3RC3A 3CRQA 3GFPA 1M74A 3WYFA 4QJ3A 2BV3A 1DO0A 1KI6A 4OI2A 3WY9A 2ZRLA 1J8MF 3N5CA 3QIAA 5KSWB 1G7RA 5EE3A 4DSNA 3GLGE 3U7HB 1J9ZA 2CCGA 5DISB 5K8TA 2XJ9A 1KSHA 3B78A 4H9GA 1FP7A 2ZJYA 2YWGA 1VQ9B 5KDDA 1R0XA 3K0AB 3HU3A 3JVVA 1XF9A 1B0UA 1KY2A 1SXJD 3GFOA 4MRSA 1EP3B 4QC2A 2WJGA 3NDPA 4Q47A 1ZIPA 3FDIA 2W6JA 5KOYA 4A92A 2XNCA 1Q3HA 4B6EA 2NOAA 3VNVA 3DO6A 4RD3A 2JEOA 2FGKA 4QOSA 2OBMA 2OV2A 3G6EB 1YZGA 4TLEA 1XRJA 5A5GA 4TTRA 3CX7A 4LBZA 4MKFA 1XB2A 2BVNA 4HAUA 2DB3A 2O8EB 1JNYA 2GZDA 5JS7A 1ZD1A 2ZRKA 2ZI5A 3AKEA 1LVGA 1QHXA 2A5FA 2QT1A 2ZI6A 3FPKA 3U3RA 4EPTA 2ANCA 4A6PA 1BX1A 1JEEA 3LY5A 2FSGA 5E95A 2GNOA 3LVQE 1R5BA 5JZVA 2AX4A 4CZ2A 4A0GA 2OESA 4LPSA 4UNQA 4M1MA 2REOA 1FW6A 3TAUA 4M21A 4AC9A 4UXJA 4LV5B 3ADCA 1W2BB 2F6RA 2H1LA 1RYFA 1MABA 3W3AA 4Q48A 2KBFA 4B32A 4C0JA 1XPRA 1KSJA 2J7PD 3Q9LA 1A82A 4RCYA 2BHRA 2IUSA 4A2PA 4DLSA 1E9BA 2J45A 5J5CA 4Q1BA 3BB1A 2A5JA 4XD7D 3UK6A 3SZRA 1EFHA 4XH9B 3SHFA 1CLUA 4B4DA 1G1MA 3X1WA 1G16A 2WJIA 4QXAA 3OZVA 2MSEB 1I4TD 2YWEA 2IXEA 1G17A 1TVCA 2A30A 4PC1A 2J5XA 3K70D 2IWRA 1J8YF 4PR0A 3ZQJA 1ZNYA 1DAFA 1G64A 4JIMA 1P5ZB 1FMLA 2Z5FA 3NKVA 3QBTA 3OEED 1E63A 1L4UA 1QVAA 2I1QA 4KFUA 2XX3A 4HB4A 2ERXA 4Q1DA 5LD2C 2O5VA 2D7DA 2G0TA 2BDTA 1NLYA 3W2FA 1SGWA 2VYFA 1TX4B 3IIJA 1IY2A 2AL7A 3BERA 5C46F 4M1SA 4HZUA 1II8B 1VQMB 1U8AA 4NZYA 2CHVA 3O8BA 4LJ8A 5EE0A 1HEIA 3TE6A 3AKYA 3TSOA 1ZVQA 4OI1A 3A6PC 2ERYA 5JWRA 3F0TA 1JQLB 4MRPA 1JAIA 4M22A 4DWJA 5KDOA 1MH1A 1O87A 5IK2D 5GJVC 2J0UA 2FSHA 3QY0A 4C9BA 5B58C 3NC0C 1WCV1 3GLFE 2OE2A 1IQPA 1W4RA 3VFDA 4EJSB 4ESHA 5DN6A 2AXPA 3OZXA 5TB5A 1LB1B 1D2NA 3U4QB 1QUFA 5DNYB 3K9HA 1ZU5A 4NYMR 5AJWA 1M7GA 2G83A 3WRYC 3RSOA 2GVZC 3AEZA 4Q4HA 5CDFE 1JPJA 2GK6A 3VNUA 1NRJB 2BJVA 3ZVMA 1U0LA 1AQUA 3B13B 1KDRA 2OLJA 4LBYA 2VRWA 3TR5A 2ZJ5A 2QPAA 5H68A 821PA 1W36B 5FL3A 4XTRA 1EP1B 4CF7A 4DLWA 2D62A 2ORIA 3A36A 2GILA 3BBPA 4D6PA 3UXMA 5EQTA 1VQ4B 1K6MA 1WRBA 2WWGA 1VIYA 4QHYA 2YC4C 3LLUA 2DFTA 1NVWQ 2OXCA 1W0JD 2AFHE 3I32A 4XWAA 3A1VA 4AK9A 3TUIC 2CNWA 4BFSA 1NIJA 3BFKA 2BMJA 1U8ZA 1UKZA 4GL2A 2C9YA 3AF4A 4V0OA 1B23P 4W5HA 5TY0A 3KKNA 3OE7A 4MYTA 3QF4B 1XTJA 2HLDD 1JXOA 2IYRA 3RLFA 1ZM9A 1XD9A 1RKBA 2JLWA 4FCWA 1UEJA 3CMEB 2ZI9A 4JJKA 5FOTA 1NSFA 1WE2A 4IEIA 2ZSBA 2A5YB 4POAA 4CEHA 3K09C 3NBYC 4YAOA 3SFVA 3WXMA 1XPUA 1YZQA 2R8RA 2OCAA 2P2LA 4C0BA 5HTKA 3RC8A 4Q03A 3UG6A 2BBSA 1E2DA 3THYA 1XCGB 1ZCAA 1E9CA 3CBQA 4BWYA 4DT1A 1ZIOA 4PANA 4QGHA 1E98A 4KSCA 4KYUA 1FNDA 1J70A 2ODNA 3CR8A 2QTVB 3CH4B 4UXIA 3AF2A 3WRXC 4AYWA 1TQ4A 1BQEA 1F2UA 3AVQA 1KHTA 3GJ6A 2WWHA 1UDWA 2VO1A 4ZDJA 1SVWA 3THXA 1HURA 3CCMB 4CGZA 4KVGA 2EFHB 2W6IA 4ERNA 5TVKA 2ZU0C 4GFDA 1CS4C 3OZWA 2WMOB 4QHTA 3NEYA 3MUFA 5GJBA 4KSBA 4AKGA 4NYMQ 2JLQA 2F3RA 1Q82D 2DHRA 1XZQA 3EG5A 5FUYA 1E2QA 2JLYA 4TT3A 4DLYA 1TPZA 4IFEA 3EIEA 2X2EA 1R5OA 4FWTA 2VA8A 3OHMA 1N0WA 4OQXA 1XNJA 4HDOB 3RHFA 3UANA 3G4SB 3FGNA 3DL0A 621PA 1GM5A 3F3YA 2B6HA 2PJZA 3Q85A 2VF7A 3EWSA 3TKLA 3ZD6A 1S2MA 1F2UB 4R7ZA 4EAQA 2KSQA 4Q9HA 1XMSA 1OT3A 1XEXA 1Z3IX 2C8VA 3NH6A 4FMCB 2QAGA 3CR7A 2ZR0A 1KAOA 2F9LA 2R9VA 5AUNB 2HMAA 3BH0A 3K70C 1RRFA 2D7CA 2YINC 4MGYR 4XVQA 3MWYW 2IWHA 3WYAA 1FOEB 2RGAA 1W0KD 2W2TA 3TUJC 3T1OA 1SVIA 2WPDA 2ZSFA 2XOKA 2O8FA 4DC9A 1UBFA 3P4YA 3U7GA 3OAAD 4W7SA 4D0GA 2P6UA 4B43A 2FDCA 1YZLA 2WBLC 3GLIB 3VKHA 4HZUB 1XPOA 1G5TA 3M4YA 2AXNA 1R5NA 3HPRA 2EYUA 4PQFA 4E03A 1GKIA 4UAJA 1BO6A 3O47A 3QPWA 1PUJA 5THXA 2G0NA 3K09A 2QMHA 3QXJA 1S0UA 4IDOA 1NP6A 2ECKA 2QPOA 2A5DA 3CD6B 2EWWA 2SHKA 3ASYA 3CNOA 3R9WA 1U81A 3CF6R 4Q01A 3IO3A 3PJRA 3TRFA 4V0ME
chains in the Genus database with same CATH superfamily
4NX2A 4TTVA 1NVUQ 2ZVDA 5JZ9A 2JASA 4KRGA 5CEFA 3FAKA 3GCDA 4FDUA 2BFCB 4PAOA 2ZS9A 1BW9A 2OT3B 2QTHA 4JJIA 1P33A 3OEWA 2FEKA 4IXMA 4KDRA 2P4SA 2UZAA 2AJLI 3CW8X 2AHOA 3PI6A 3WGTA 3UBTA 3CPWB 1NW3A 2DLCX 1ULBA 3ENVA 2BKLA 3IKLA 2W4MA 3QBJA 1C41A 5ESXA 2G5PA 4P6VF 1N3IA 2PBFA 4MEAA 4TN1A 3FMOB 3ZGXA 3T3HA 1U1IA 2VYQA 2Z9DA 3HCCA 4ND3A 1V7ZA 1XDWA 1OILA 2C5SA 4MQMA 5EZYF 3WMFA 3E1SA 1QYDA 3SNKA 5C7IO 3IT0A 5LKRA 1A8IA 1DDOA 5A0TA 4E70A 1QTRA 3C3KA 3D4BA 3KR2A 3RYIB 2WJWA 2PKRA 4F0JA 2VHCA 1GG9A 1N6RA 4CL2A 5BWOA 4MIOA 4JUFA 3BORA 1V7PC 4GM1A 3V1NA 4AZSA 3M83A 2FW9A 3H18A 2QXUA 3NHYA 4S2UA 2OOKA 2IYQA 2ZRHA 5EQDA 3OFSA 3JARB 4JITA 1R66A 2JJ2D 2JHAA 4HQRA 5SY4A 4DPLA 1AKUA 2Q2NA 1WP6A 1QBGA 2TMYA 2QP9X 3LHSA 4KLCA 2XCUA 4KLZA 4TKVB 1RJ9B 4DQXA 1UMCB 5E7JA 3SQWA 1NIPA 5CJ2A 4D9IA 1CUWA 3OKAA 4JN6B 1BDMA 4YP5A 5DLYA 4C4TA 1YKFA 5AUQA 2F9FA 3NHPA 4IV8A 4EA6A 1NI5A 4J3FA 5FBWB 2HSZA 4RULA 4XWWA 1T8YA 4RQUA 3T6KA 3AVPA 3PXEA 4ZI7F 5IWCA 1U2EA 3ENZA 4NJEA 1QIHA 2PRSA 2P5YA 1J2UA 4J94A 4D4KA 1QIDA 4DNQA 1Q0TA 2PBRA 1QRUA 2CC2A 3I8OA 3D26A 4G25A 2IYXA 3QYPA 3WZMA 3BCDA 4TN5A 3HU2A 3O6VA 5EMLA 2B9EA 3H16A 1ORHA 2WT8A 4NDNE 4NMXB 3PKIA 1B8OA 4I1UA 3RVDA 1DSSG 4R1TA 2D8MA 2GBLA 3ETJA 3N75A 3ZBUA 4Q05A 2YVKA 5JG7A 2IH2A 4J91A 4II3A 1HDYA 1CNMA 1RBYA 2DFPA 2MIIA 3GVXA 3N74A 4UHFA 4ZQCB 3ZIDA 1F2DA 1NR1A 1XCLA 3KHUA 1VQ6B 3KPJA 4DMMA 2BZGA 2AGVA 1CUXA 2ZRAA 3U4AA 5K1ZA 3FWYA 3AOGA 5TPWA 4E5NA 3I76A 1T1GA 2E4AA 3IVXA 3P9IA 1C30B 1KF0A 1MNAA 4MLZA 2ZWPA 4MW0A 4R7TA 4BJ5A 2PQ2A 5HQTA 5IKMA 2RHJA 4QL3A 3CP8A 4K1XA 2Z2ZA 3Q5DA 4CKCA 4BIIA 1BX0A 2M5SA 2F1OA 4R2XA 4W5WA 5G0TA 1I3MA 2GF9A 4H4DA 4PF1A 3QEMB 4ZAWA 1ENYA 1OLXA 2X5NA 2Y1DA 4O4JA 4TKUA 4ZOCA 5KZMB 1A5TA 3R3JA 4HAIA 4LC1A 1ZK3A 1SPBS 3PPWA 3LK7A 4MV9A 3ZWMA 3TFOA 3IHLA 4RNDB 3AY6A 4ER5A 4WI1A 5EJ7A 4KBYA 3AM1A 3WS7A 1V0EA 4E1VA 2ONKA 1CNFA 1GUAA 2FPWA 3Q41A 1YWGO 2HKIA 3AR4A 5FOSA 1NQOA 4M76B 2G28A 4BLQA 5TSDA 5TLSA 3F6BX 4P93A 3BSWA 3LC1O 1E7SA 1RWQA 1GFZA 2ZJFA 2ZYRA 3FB4A 3R77A 3P9QA 1ADCA 4MEJA 4AUMA 3H04A 5GVSA 4D1YA 1ZDMA 4AKIA 1E3MA 2E5FA 5BR4A 4GMDA 1Z63A 4NBUA 3WP0A 3R3YA 3FPEA 4G89A 4W8HA 1L7MA 4N6NA 3SMQA 4ZIRB 1SUFA 1ZWLA 3MOSA 4J0KA 4LYAA 4X9XA 3OJWA 1DBRA 1UJ4A 1ISJA 1MQ9A 1PYDA 2IYSA 2J30A 13PKA 2LE0A 2Y1EA 1PYGA 4GUDA 5KIAA 3SDBA 3ID6C 5ESDA 4OHZA 1HSZA 1KOGA 4YLGA 1O96A 3DF7A 5HRCA 1P7CA 4F6RB 2VJNA 3ETNA 2DWPA 2BCJQ 3LFUA 1OMOA 1SUEA 4JUAA 3IIMA 1ACJA 1Z16A 1SPXA 2AS0A 2C2HA 3P5SA 3VPFA 2GWRA 3L7JA 2DU8A 2CV2A 5HZKA 2JVKA 2DETA 1DLJA 1VBNA 1ZJ6A 5ERXA 4ZCSA 3Q0EA 2C9MA 3OEHA 5L46A 2IDKA 1ZA1A 4WY5A 1S1CA 3R3XA 3RBAA 4BTEA 1CUYA 1GNQA 3F6EX 3WLLA 5HW0A 4ZIRA 4HFNA 4UUNA 2XAUA 2A0FA 2VF2A 5JBIA 3FG9A 1N9GB 2GR9A 1OXTA 3ZLVA 3DXFA 3TG8A 4PM4A 1L5WA 4HB2A 2QD5A 5AHRA 4FGZA 5IU6A 1QHHB 1VHJA 1JR4A 1G4UR 1OIXA 1X1QA 1E58A 2Q1XA 2SCUA 1CCWA 2FE1A 1S4QA 2Y0CA 2KM1A 3GC6A 3R6WA 4GOMD 4M1WA 2JFHA 3LOQA 1UBGA 4B34A 2PDAA 3HRKA 1U6IA 4AF6A 2PLNA 4OJTA 4BX9A 4LC0A 4FDVA 3A6EA 2AYZA 1BMQA 2QD1A 4KWEA 4OM7A 4J1TC 1QMGA 1GQFA 3J81A 2JS7A 1WKCA 4G3XA 5L9AA 4A15A 3LQ4A 2I1LA 2GSDA 4IDGA 2VT2A 3ZBTA 4RZ3A 1GPAA 3EWNA 3KPVA 3H65A 4R0NA 3UVEA 4B3BA 5A1JA 1ONOA 1QAQA 2R68A 2WA1A 1T0PA 4QXRA 1SZDA 3L0SA 2P75A 1SZPA 4UNRA 5LBIA 4AP6A 2C2ZA 4CT0A 1LI7A 1DQSA 2WABA 4MB2A 2XQVA 5JJCA 2B94A 4IILA 1M1ZA 1QHFA 4KI7A 2HMUA 2FPPB 4UW9A 5DRYA 1S2GA 4NKRA 1JJFA 2CZCA 1NXVA 1G8PA 3N5KA 4OLFA 1QC5A 2FQYA 1X1CA 4HK4A 4KOEC 2VH1A 4GOND 5L8VA 4H1WA 2AFHA 2A0XA 1YQWA 1X15A 2RI1A 3UJ6A 1B8UA 2PZEA 3DV0B 4QZVA 2VAVA 5EUCA 4ZVOA 2G71A 3T7TA 3MRXA 4B7XA 4XJXA 1AQ6A 1V9CA 2Z95A 1G5IA 1TQ8A 2PLRA 1YITB 3HDJA 2QJWA 1P1CA 2HA6A 3E7FA 3IUEA 3JYNA 3UY4A 1HFKA 4UMFA 2JGDA 1V45E 1NFQA 1QV9A 3KVYA 1FFXA 2CEAA 2D74A 3FMVA 3PNKA 5A4IS 4BLSA 1H8HA 1YH3A 2WD9A 3BQ9A 3SK0A 2DE0X 2QE7A 5FWNA 1CY1A 3GFQA 4OI0A 4TOIA 1BMDA 1P17A 3DWEX 3W4IA 4C4OA 2A4KA 4MVJI 3MMSA 5A5EA 3HE3A 3CRRA 4GR9A 2HYIC 3EARA 2MR6A 2LD4A 1RKUA 4LNUB 3TRKA 2JGRA 2FY8A 1G0NA 2OZLA 5EZ5A 3PQ5A 1FQJA 3CNQS 2WJYA 1AHIA 1J0CA 4INJA 3AM4A 4DFDA 4DV0B 1L3BA 1DPFA 5K8VA 1KFCB 1NP3A 1JA1A 4GECA 2JGDB 4FBGA 2O2CA 5DYIA 2IYAA 4U6NA 5KCMA 1BMFA 4B48A 1HT0A 4WHMA 1VE3A 5EUMA 4LYDA 3Q3JB 4B31A 4FDLA 3REQB 1GZSA 5IANA 2YIVX 4A36A 3ZNOA 1Z45A 4MV3A 5HS6A 2VYNA 5B1DA 1Z7GA 2VBTA 1JZTA 5HBGA 1TMYA 4WL0A 3QX9A 4NU8X 1Y98A 4AJEA 1BRTA 4YS6A 4NVRA 3PITA 3CZ5A 3SEQA 2WV7A 3LWZA 2OZLB 2X42A 3AIOA 3EC1A 3LQYA 2HQBA 3C74A 2J3KA 3FNRA 3IDOA 3L79A 5J5VA 1XRMA 3OPMA 1A8QA 4FLFA 1BVYF 3AO0B 4M36A 4G1VA 1IOVA 2R00A 4C6TA 1X7WA 1WMBA 3PC2A 1QO0D 3HJBA 1DWOA 1JJIA 4MR8A 4N5IX 3WI7A 3FM9A 4AG6A 3UMSA 4HUQA 3FUUA 2FW8A 1BAPA 2ZRMA 1FZQA 3GRVA 5KOYA 3H9BA 1IB0A 4HIZA 4IJWA 3UHOA 2KJQA 5DTQA 4YT2A 2HJGA 3DGFC 1W5SA 2Z2IA 2P8JA 2WF7A 3FYDA 3T0GA 3KVVA 3JQBC 2WZQA 3LUPA 5I6DA 1U1GA 1YRBA 3QNMA 3COJA 3WGNA 1SXJB 1UADA 2LKCA 2VOEA 3ZI0A 5FTLA 3VHRA 1EM6A 4GPBA 4AP9A 2JJMA 1HT1E 2Q5EA 1CUAA 2B1IA 2CUTA 2B3TA 3NYQA 4TMKA 1ZMRA 2EKBA 4WY2A 5ALFA 3V97A 5AVQA 1GG5A 2P9ZA 2WFLB 3KHSA 1EK5A 3AP2A 1R8QA 3RIEA 3V46A 3ZCXA 3UOAB 3C6MA 4UFNA 1T1JA 1AKQA 1D09A 4MKXA 1XQ1A 3GQBA 1ZH6A 2IYNA 3K5HA 2I4LA 3HGTA 4FSXA 4LV6A 4OH1A 4Y7DA 4YK7A 3E35A 3B7PA 2XCRB 5E6TA 1FB5A 3NBMA 4RMIA 4ACAA 1BFKA 5TVGA 2CLIB 3OFVA 2IYPA 5KEIA 1UPTA 2HLDA 2AA3A 1JECA 1MC1A 2VYND 3BWCA 4I66A 4LY6A 4TWZA 3BWYA 3EVZA 3WRXA 2VJJA 3NHUA 2VG8A 4II2A 3DKPA 4HLDA 3QA3E 1KWGA 2ZE5A 1T36A 1FUKA 1CUFA 1O95D 4TLLB 4LRQA 2GVDC 3UYKA 1X9HA 3FZQA 4YDHB 4RTLA 3K96A 5GZ3A 2Y1WA 3AERA 1X8JA 1QVWA 4MV8A 3B5EA 3ZCPA 4RMHA 1CB7A 1WTAA 3H7AA 2C96A 2CBGA 3KE8A 3VR6A 3LA8A 4IIJB 4QQ8A 5E3HA 3ZDZB 5CFNA 3LT0A 3L8FA 3RJZA 3ZV4A 2C20A 4TSFD 1F4PA 3UT0A 3MS7A 4GPTA 5EWJA 4CF3A 1W4AA 2PSFA 1T2DA 1U7ZA 1YUMA 3EZ9A 4LY0A 3RUAA 1NB0A 3KUCA 5E1OA 3AVUA 5G1OA 3QUSA 3FNEA 4NV1A 4NCAA 2ZB4A 1TM1E 4Y8VA 3COSA 2JCVA 4GO1A 4TLAA 1JBKA 2FZKA 5A03A 5C7OO 2ZTHA 3LC7O 4RFSB 4DY6A 3GLGA 3BNWA 3OEEA 1D2MA 4PX2A 3DOUA 3N8GA 4Z0PA 4IJ6A 5MGNA 3AUUA 3A35A 4PYIA 3BMOB 3RIGA 3ICPA 4E5YA 1E1RD 1V4BA 3DMRA 3UMGA 3F5QA 1XZIA 2Q21A 1AQIA 3FFWA 5FPPA 2VSOA 3FMFA 3CLUC 5D2CA 3VQTA 4NCNA 1KFKB 1J25A 4JL5A 3T1NA 3H3FA 4ME6A 4AT1A 1JXAA 1LTKA 1MABB 1N6OA 4MJ7A 3G8DA 4D6YA 5IXSA 1OX4A 1T5TA 3IMCA 4U2KA 2P0AA 3L7CA 3ELUA 1XN4A 1SCAA 2Q8PA 2WIFA 3OPYB 3R3VA 3TB4A 2F1MA 2ZIFA 4V0MA 1O58A 4QULA 4OV6B 4RFSA 4P3IA 2C07A 3RNLA 2H29A 3U17A 3OJXA 4CHTA 1DCTA 2IH5A 4TQUS 3NV9A 1FFBA 3PA6A 4GG1A 1Z12A 4LYYA 1MGOA 4PZUA 4DTIA 5EQJB 3UUFA 4DQ0A 3LXRA 4M88A 1JAHA 1O94D 4URWR 4BB5A 2Y05A 4CCWA 2VTKA 3E9ZA 2WHPB 4FC7A 4IZIA 3B70A 1GQSA 2ACEA 3OZCA 5FTNA 2C3OA 3WLEA 2O9JA 5KJ1A 2C2MA 4R3UC 1V7CA 3X2FA 1JR3E 3RGGA 1WS6A 3G71B 3BY1A 1IXZA 1J0DA 5D85A 3ZW9A 1PQPA 3NS7A 3GK3A 3QU2A 3LT4A 5FKJA 3S28A 4Y9TA 3UWPA 1BVRA 3RYCA 4JL6A 4X0EA 5FPKA 4A6EA 4Z9AA 1BDIA 2B4TO 4P4SA 2DY1A 1DU4A 4YTEA 1SOWA 3CZMA 5AXCA 3SZMA 1NW6A 1C29B 1DX4A 3AVOA 4WK4B 4DCPA 5KBYA 2BM0A 2OTCA 3SC3A 4BAGA 1SEPA 2VATA 4LVCA 4NLLA 3WRYA 2O8BA 5GV7A 1V7QA 1PF7E 2KS6A 5CR9A 1PWHA 1SU4A 3AUJB 2QI9F 1U1FA 5J5AA 1EHYA 1T1IA 1RQ7A 4JGIA 1E4OA 2IDJA 4RPCA 1VLMA 3GOHA 3KYCB 4QFDA 3INYA 3LQ1A 4EUKA 3ZGZA 1YD7A 2JBWA 4LZLA 3BWDD 2NTJA 3L0YA 1U31A 4O4HB 3ONVA 4O59O 5AKXA 2ISSD 1A7JA 3G6WA 1TO1E 5IN5A 5C4IA 1QG4A 2Q5OA 2R60A 1VMDA 3CWZA 3DQPA 3MJHA 4I19A 3FJOA 3PQCA 1AB5A 2CMFA 1MB9A 3OOJA 2H2IA 3I56B 1IHYA 4NZ9A 3VBEA 5B1SA 1BXZA 1CNEA 5JSKA 5ILOA 4D4LA 4AX8A 2GJKA 4PO1A 1T2EA 5A4JA 1EXNA 2R86A 3C1UA 3MTDA 4MR7B 5DFAA 4EOGA 2BSQA 1DAIA 3TJZA 2H31A 4NONA 1NV8A 5CCXA 2ZWOA 4BRUA 4BMDA 3PC8C 3QVSA 3SGLA 3KAQA 3RBXA 4C22A 2XPCA 3L4KA 3VMFA 2QLNA 3FETA 3GGGA 4D6XA 4DR3B 3W5VA 3LX8A 3Q40A 4W5JA 1U3TA 5SZHB 2WVJA 5T5QA 4KNVA 3H2IA 4UTOA 3PUJA 3GNSA 4RY0A 5DNWA 3L3BA 4KTVE 4V3BA 3W9BA 5KYXA 4L8JA 4XOPA 4FGSA 3MXTA 1MNQA 4DLVA 5L4SA 1L5MA 2PMWB 4UBMA 5H0IA 6NULA 1X38A 1QG0A 4JQCA 5IJ0B 5LR6A 1J24A 3FYTA 1RHRA 2YV3A 4N9WA 4OB6A 4EPXA 1L4NA 4PX5A 4DV4B 1ZIXA 3DEFA 4K0KB 1NJ2A 2C54A 5BRAA 4I50B 2NUAB 2YV5A 3BIOA 4D8WA 3CB2A 2EL7A 1TECE 4FXUA 1K5PA 3IJEB 1D6NA 3M4ZA 5LNK6 4R81A 1G9TA 2NNWB 1PFKA 1P1IA 2QL9A 2WIBA 1B8PA 1MEEA 1XXHB 2C5LA 4K40A 3UA4A 5U9CA 2FKNA 3THWB 1Z0IA 5K0NA 4IDNA 4N76A 4NI5A 1U7HA 1GADO 3CSSA 2O14A 1A5AB 3DB2A 3E2MA 1USGA 4LZNA 5DBOA 5FHQA 5T4BA 1Y9JA 2AEMA 4Q15A 4RSRA 3S6JA 1NJID 1V16A 4GSKA 1R0CA 3PCRB 1CUVA 1J2YA 1C50A 2HPVA 2WU3A 1U98A 2NQ2C 2QTTA 4K03A 1Q77A 4TKLA 1VHWA 2VHTA 4BVGA 3T7IA 1Q19A 2O2JA 3HR7A 4Q3CA 2HDOA 2NUAA 4I50A 3WLHA 4HNVA 3MW8A 3RGWS 1FS6A 4J16C 4U0KA 4CMIA 3BICA 1KR5A 1VPDA 3A9UA 4ZV4A 2Z43A 3CZRA 1HTWA 2LZJA 2PH5A 5CBKA 2Q6VA 3Q9UA 1YI2B 1KVSA 4G4JA 3HYNA 3I83A 1QQ7A 2VHQA 3NT4A 4RPLA 4WPGA 1N25A 2V6BA 2QQ0A 3S0JA 3SHTA 3KJEA 3UH1A 4FJ2A 1PQUA 1M2JA 2P0YA 3D6MA 3LH5A 3SX4A 5F1PA 1WPCA 3V7FA 5CLGA 5HCNA 3UKJA 3KTFA 4MUFA 4YAIA 4XWYA 4AG3A 3ZLTA 1GNLA 1N7IA 1VSBA 1B76A 1MFPA 4WEQA 3WMWA 3DPSA 5C35A 2QNIA 4LDJA 2XIQA 2DC1A 3PFIA 1JDPA 1Z4JA 4MI6A 4Q4AA 1XDDA 2HF9A 3C3EA 4UBIA 3AUFA 2BDEA 4WOCA 1DRVA 4EPWA 1LVUA 3L1VA 4XCVA 5CVJA 3EZ6A 4Y3UA 1P4GA 1ZJ4A 5DHFA 1XYVA 4A4DA 3PL5A 1PAUA 1WV0A 2IF0A 1J90A 1XELA 3U4IA 1PZHA 4JC4A 4BVFA 4BCDA 4OREX 4RTJA 3W2HA 2RIPA 3NTUA 5G40A 4D98A 1R9MA 3SDZA 1W4CA 3UHJA 4DR7B 1SCJA 3ADPA 3JQ7A 5I47A 4YQYA 4QPPA 1IQUA 4BU0A 2HPHA 1QR6A 1XL0A 2PGLA 3S40A 4EYOA 4W5RA 4FXPA 1OXVA 3D3QA 5EZQA 4KAJA 2L17A 3MRVA 5G53C 1OYVA 1F3LA 3OOSA 1MLDA 1T2VA 5K05A 1GNTA 3RSGA 2C8KA 4UBLA 1FUUA 4KXFB 4MQUA 3AB8A 1EWQA 3DFMA 4OU4A 3OE1A 4Y9SA 4WNYA 4FZ3A 3WDSA 1NBEA 1WO8A 1QIIA 2HK6A 4BFTA 3CO5A 2J7KA 1IPFA 1B0PA 2GEBA 2ZYTX 4QPCA 5LBTA 2VDUE 1MOZA 4YJHB 3U4QA 4OPOA 1YZNA 2JAQA 3OTGA 3EIOA 3OJEA 4M9SA 3BCRA 3DOFA 4GGMX 4RD6A 2BHSA 2V4DA 2P35A 3M1AA 5KDLA 4PNZA 3S2YA 4D0SA 5EHNA 4MYHA 2C42A 1XA4A 3YASA 1HKUA 1Z0AA 1M2HA 2LCFA 3FCSB 4PTYA 3ERCA 2YFHA 5TRTA 4RIIA 4C7MA 2PS0A 2WYOA 1JG3A 3V55A 4OOVA 3LWDA 4JI5B 1LUAA 5TQ2B 1F06A 4JLVA 4CR6A 2EFJA 4UD2A 3T7SA 3UK7A 1VKOA 4DSZA 3E5HA 4RZUA 1MHPA 4LXTA 1EMDA 1ODCA 1ZCBA 4MR9B 3TLCA 3PNYA 1XFAA 2ODBA 3DKKA 4FSHA 1U2QA 1B93A 4A0HA 3KU1A 3W77A 4F3NA 4P26A 3AF5A 2BGIA 1V9LA 5J2TA 4ETIA 3SSNA 2O8VA 3BSFA 3HA5A 5M2QA 3CPXA 4XCXA 1NC1A 1CTQA 2OY0A 1N33B 4N1AA 1YASA 3KTDA 4HGOA 3ANNA 1BYUA 3HYCA 5EAIA 4HNTA 4CLDA 4DBVO 4LS3A 3QFTA 3HACA 1R6BX 3GJ0A 1U0JA 1Q57A 2GAAA 4QYIB 3E7PA 2OBBA 1VPVA 4CV3A 1QHYA 4EFNA 3VRHA 1M2OA 2DHCA 2XVMA 1XXHE 3HDGA 4MR9A 3VDQA 3A2KA 2FPSA 2OHJA 3IIIA 3BXXA 4O08A 1RKQA 2B1RA 3NOOA 4DYDA 3I6MA 1D7AA 2CRVA 3VYSB 2UXCB 2Y67A 4MNTA 2I4MA 4KW7A 1WB9A 2ZG6A 3DAGA 2ZUDA 4LVOA 2C94A 4UCFA 4LX0A 4TYQA 5LU9A 4LF9B 4JEUA 8LDHA 3A1NA 2QM7A 3BMCA 5D86A 2KYRA 1DMSA 3GRAA 3RTDA 1QIKA 2HMVA 1ADFA 3GUCA 4YRJA 2WF9A 4I08A 3H5RA 2I67A 2DPHA 4ZYTA 4Z99A 2J4FA 4B4KA 3GGJA 2BLNA 4TS3A 4LHZA 3OW7A 3WSWA 4HOYA 4D0NA 3A4IA 3EOBI 3VSBA 4YI3A 4H27A 2HXYA 1JTEA 3OIDA 4ECAA 3ND8A 4R1SA 1XHFA 3HO8A 1ZN2A 2QBYB 2VR1A 3U61B 2ZFUA 1YZKA 4XX0A 5JXHA 2MINA 2GPWA 4YAKA 1EP9A 4JI0B 1T9GR 2ZI7A 4HDCA 3W9SA 3INNA 3M9LA 4TXHA 4KFTA 4LVUA 4WCDA 2BEVB 3CPHA 4N7RA 3P20A 4AMVA 4DL9A 4I9FA 4WKPA 4B6FA 1VQNB 2FXVA 3LPNA 4INZA 4A8JB 4MS1B 5CNMA 3N0VA 5TGZA 4M0EA 1U5BB 4BFUA 5BSUA 4YJ3A 4K2HA 4JJAA 3ZWCA 2IXBA 1VJRA 1WW3A 2FQ1A 2QT0A 4PABA 5H4HA 3CRVA 5HUJA 1XQBA 1IZZA 1W35A 2VH2A 2XD9A 1LZLA 4LDRA 3W34A 2R1VA 1D2AA 1E1QD 3FNIA 1CZKA 1Y5RA 1N0UA 3E9DA 1C30A 1N5LA 3D4IA 4W9NA 3AF6A 2PZGA 2QXYA 4J2OA 1YI1A 5ALNA 1DKRA 4JD5A 2F55A 3VGJA 5IT0A 2WAOA 5BQ3A 4K6GA 2QN7A 3KBBA 4YONB 5FBKA 1D5CA 4HH4A 1E5DA 4AN1A 5B1EA 4PLTA 1Z38A 3ESRA 3X1YA 4R1UA 3TCNA 4OOFA 3VH3A 4AKEA 5EKDA 1PV1A 3DG9A 3AVYA 4Y18A 1M7HA 4Y6QA 3V2IA 4UMVA 3DR3A 4L4SA 3WJ2A 4N5LA 1X14A 1DJLA 3LZ6A 3ZLJA 4XASA 1DOZA 1XVTA 3IAFA 3ZY5A 3DZIA 1DBPA 2C9CA 3ASSA 4L8FA 3T95A 1F6WA 2PLFA 3S29A 4OLJA 3AX6A 2L42A 3U3ZA 4CKZA 2ZRPA 3A4TA 3VU8A 2XUZA 1B4DA 3UF0A 4EB0A 3KFXA 1ANKA 1JIXA 3ZCRA 1AY0A 1T9ZA 4Y0NA 2A9OA 2AZXA 1NW5A 2RK6A 2ZKLA 3LKZA 4YLEA 1EE9A 1QYRA 3KQPA 3ZS8A 1WZCA 4LW8A 1MO4A 1WHSA 3O1LA 2QTFA 3DJFA 5J2TF 1GR0A 3NBXX 2MMCA 4KN8A 4C05A 5EJMA 2Q9UA 3QVJA 4BX0A 4FK8A 4JLWA 3IPXA 3QUAA 1I6LA 1ADYA 1COZA 1QSGA 5GZ6A 4CV0A 3MUNA 1KVRA 3W2GA 3KR0A 2FPOA 4YJKA 5CBPA 1R4MA 2H3EA 4IIGA 3VR3A 5F9FA 2IV2X 1DAEA 3DPUA 1GQRA 1F8FA 5JVDB 2WJ4A 1Q22A 1CEXA 1QOPB 5M04A 1HE4A 1XMIA 1E32A 3MK31 3RR2A 3CRZA 3UFXB 1APBA 4EG6A 4M8IA 3FLMA 2EJWA 2IOFA 1A0OA 2YCLA 3E7DA 3SYNA 2FH5B 1IXSB 5AIBA 1Y8RB 5JPIA 1KXZA 5JVDF 2JGIA 3WHKA 1WHSB 1XZPA 1TRKA 2Z2KA 1N92A 2DXIA 4LTMA 4JLUA 3ULKA 1CZOA 2Z08A 3S1AA 2R8BA 4IVQA 3SWWA 1JHZA 1QORA 2HT6A 5DS0A 1Y34E 2ALJA 2ECFA 1EB8A 3HABA 3MB5A 3CR3C 5DW0A 7ABPA 5L7WA 2JFXA 4WOKA 1YLOA 1XVVA 1ZC4A 2Q5QA 3GEHA 4WFKA 3DVRX 3URKA 1SY7A 1VLYA 2GHIA 4FYHA 2COEA 4RDHA 3RJ9A 2QVGA 3AEQA 4AYXA 4URXR 4ABTA 3MRTA 1E1KA 4PCUA 2WM9B 3TVTA 3K9WA 2ZOSA 4V39A 1ZBDA 3P26A 1DOAA 4FHGA 4Y7CA 4R6WA 3CE6A 2VDWB 4P1ZA 4RXUA 2EIXA 4UBNA 4WCVA 2BN4A 1HL7A 5A7HA 2ADOA 2RGXA 2GPAA 1WLYA 1EWTA 4YDRA 1T43A 1CQIB 4NBVA 5E6UA 2MYTA 4MGEA 2I2FA 1UBUS 3IMGA 2GXSA 3R3SA 1TYZA 4FCVA 5M3BA 5JHHB 5GIOE 1J23A 3PV0A 3CUSA 1FFAA 4FMPA 3GJ8A 5BSFA 2RE8A 1JAYA 2FQXA 2Q4RA 4YCAA 2FPPA 1ZFNA 1FBTA 2YJ3A 4FXOA 3T0IA 1MJGA 4K05A 5DHAA 1XZMA 2G5GX 4NF2A 4HTAA 4HRXA 1K75A 1A7KA 4P2BA 1S3SA 1TF5A 2GPYA 3H5IA 5KKCA 2IZ1A 3FFXA 1VKRA 5GINE 1NE2A 4HXGA 4EKYA 3LYHA 4OQLA 5K9ZA 3PHLA 5I7UA 4X5OA 1KJYA 2FNAA 2ZJOA 3EK2A 3G88A 1X39A 1KJZA 4YUWA 2H65A 4NHOA 3FUWA 4HPWA 1DXYA 2VXOA 5E6UB 2PMCA 3JASA 3VR5A 5JSZA 2OPHA 4RIGA 1L3IA 1KAMA 4G5SA 1VCOA 1FFXB 4UBKA 5C4GB 2ZIXB 4OTZA 5JCJD 1LRJA 2ZRQA 5A3VA 3RG2A 4JLSA 5L3SB 1KK3A 2PUWA 4EG1A 3L5OA 4BJ3A 4FHEA 4MPJA 4FYKA 4GNKA 1S2LA 4AJ1A 5LYYA 1KVQA 1LY1A 1PSWA 4DDWA 1E5XA 4HQOA 2DQKA 2ZYSA 4P82A 1TVKB 1YB6A 2R6R1 1JA0A 4N0EA 3F5MA 4FOOA 2HDHA 1P0IA 4LISA 3ADBA 2ZRFA 5I7RA 3CXCB 4DIBA 3A05A 2NP6A 1T5LA 1L5KA 1MX3A 2HQRA 3E5NA 5DLQC 3UT5A 4EQ6A 1KI8A 4YQFA 1CUHA 1SQGA 4K3UA 4QDOA 2EIHA 4YGXB 3MA0A 1DJMA 2GRUA 5DHSA 1KD1D 2OR3A 3U4DA 4MV7A 3BTSA 1JTFA 4LXUA 1EVEA 5TJHA 2WU0A 5KTYA 3WLIA 4MIKA 2ZPUA 4COKA 3P0RA 4B3SB 2NZ2A 4CG0A 1W47A 4JUBA 3OUUA 1L5HB 5IN4A 3EEOA 3RADC 4GVPA 3WQRA 1UK8A 3B6JA 1F48A 2ZE6A 3U0BA 4MUIA 3X1MA 1CZHA 1NBAA 3ODPA 4EUNA 1MA3A 3PSAA 3AF3A 1C81A 4JJFA 5DYTA 4XIIA 1YQTA 3R7WB 2J85A 5EJFA 2I9KA 2BT4A 2QAGB 1NOKA 3ASQA 4X92A 3FLAA 3ABZA 4HFRA 1ZM3A 1KO5A 1NBOA 3EG9B 1YGYA 3FYSA 1COWD 1CUCA 1OI3A 2R7LA 3BK2A 3HY3A 4G1BA 1DCKA 2FOXA 2BZSA 4CIDA 5BUZA 2O07A 5HIIA 5LZ5A 2X2OA 2V96A 3AMVA 3KWFA 1OAOA 1SC1A 1SQ0A 4P4TA 5L3QB 1QB7A 2OP0A 1J4AA 1CS0B 3BCFA 4R31A 1QOQB 2IHNA 3MINB 4FN4A 2B82A 4XW2A 1J09A 3KZXA 4X93A 3RS7A 2CLHB 1CR4A 5TRDA 2BR3A 3VR4D 3KTOA 1KFJB 4HDNA 4UDNA 3T4PA 4CL3A 4GX1A 4DNXA 1HDEA 3H17A 1M3SA 4LUCA 1G3QA 4W1RA 1VE9A 3VA7A 4CUJA 1Y89A 5T57A 4A0QA 2ZL5A 2FSVC 2XI4A 3EXFB 3OFKA 4H3HB 1L5RA 2P2NA 2HN9A 3VAZA 2D1TA 2WYWA 4E46A 4G6IA 1EZZA 3C5HA 3QVLA 4P38A 1RJEA 2FRDC 4M54A 3K2QA 3FBWA 1A9YA 4UC0A 4FWBA 1RBMA 1NVMB 3KAJA 4H7HA 1JFFB 3GAFA 4PV7A 4WNIA 3RVKA 4PLZA 2E4ZA 2OV8A 4ZOLA 2RK3A 3VPBA 5IZCA 1UXGA 2OORC 3BKXA 1X42A 2GCIA 2PBLA 1TE2A 5K3BA 4P7KA 2NGRA 4DLNA 3JZAA 4X63A 1QTQA 3OEYA 5TF0A 4F1JA 1ZS9A 4IGIA 1FX1A 2Y1LA 4LZPA 1HQKA 1DTWA 1JSCA 3OM1A 4N0QA 4KXXA 1KTVA 1QCZA 4KMOA 3NU1A 3LBYA 2JB9A 5ALTA 1TK9A 5JNRA 2UZ0A 1T36B 4QDXA 1GAQA 2OLKA 4R1MA 4RE5A 4PSUA 5AW7A 1CDOA 4F3TA 1VYVA 1KH2A 3K1JA 4R2HA 3ZDXB 2IEBA 2HJVA 2HQ1A 4Q3OA 1JFFA 4RV4A 3ZWWA 4QREA 5JNLA 1DGQA 1R88A 1GG2A 4GI1A 2P9TA 3MN1A 3HY6A 4QUHA 1JWBB 1PJAA 4AWBA 4BO6A 1G38A 1C8BA 1VFNA 2JGKA 4MDFA 3KL4A 2OAP1 2VEDA 3EVTA 2L0XA 3GN1A 5BWMA 4D0LB 1ZUHA 1V47A 2VP2A 3EZ7A 4J7UA 1IUKA 3VISA 1VQ5B 3OPQA 5KTKA 1DHRA 2FMFA 1UF9A 4GKAA 3HGMA 3ILYA 4FB5A 5JI3E 5EJEA 2X8JA 5CNKA 3IDQA 2QV7A 4K9KA 4BNJA 4IIUA 3ZTYA 1O6GA 2X0RA 4XDYA 3O8OA 3UUEA 3ZOZA 3I9MA 2GASA 2ZVJA 2DAPA 2ETVA 2X2FA 5BO5A 3PDUA 1U2PA 1M75A 3FBTA 1Z33A 2AN5A 4OQZA 4KUEA 3SYMA 2O8DA 4H1UA 2BSXA 1II0A 5JH7F 1CQJB 1P5FA 4CM4A 1OA1A 1T9BA 1EFPA 4KQIA 3E1YE 2YQ5A 3PFCA 4L8LA 4POOA 2WC1A 3HBLA 4L28A 4P36A 2J3IA 3OUZA 1NQUA 2WUFA 2ZJ6A 5ER6A 4LXHA 1UXKA 1C1DA 1RHKA 1OROA 2HPAA 5TR9A 1KP3A 4LX8A 3GZJA