4M4SA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in complex with gdp and formate ion mimic aif2gamma*gdp*pi complex (a formate ion substitutes for pi)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSADVNAPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIAFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 108
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m4sA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m4sA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m4sA01
4IXNA 1KAGA 4KFTA 4NKRA 4M4SA 2V54A 3K0CC 3UK6A 5KU1A 1DARA 2WSSD 1EP3B 2EFDB 3D31A 3FWYA 2QI9C 2ZRBA 4XTRA 2J0VA 2X8AA 2WWXA 5AWFC 1NMYA 2OO7A 1SVLA 5DNYB 1VQ6B 1A82A 4I1SA 1W0KD 2C78A 4BASA 3K9GA 1T6NA 3T15A 1XEXA 5BN4A 1Z29A 1OH8A 4NYIR 2VNKA 2C98A 2ORVA 5JECA 3DEFA 3QFRA 4URVR 1ANKA 4U9UA 1NI3A 1JJVA 5F2EA 3OZXA 1XDBA 1W4AA 2MMCA 4RJLA 2O8DB 2KI5A 5FOVA 1CRQA 3I73A 5CJPA 2PEZA 3VR4A 1TEXA 3KJHA 3U3JA 3N5CA 3DL0A 1YI2B 3OEHD 4D4KA 5M04A 1SHKA 3C8UA 4L5BA 2UVQA 1PJRA 3U6KA 2CCKA 3KKMA 2ZSAA 1XF9A 1XEWY 3W2GA 1GAJA 4TT3A 4V03A 3QOFA 1R5OA 4Q66C 2P0EA 1OGIA 3FHTA 1KZGB 3B1ZA 3LQQA 4AD8A 3K0CA 4ACBA 2W6JA 4ZI2A 2Z4RA 4FMDB 2X3UA 4C0JA 2O8CB 3WBKA 4TMZA 4GOJA 2MSCB 4JBXA 5FOSA 1JEEA 1NDHA 2ZYUX 3SR0A 4EKDA 4FMBB 5A4JA 1KK2A 1GJRA 1D2EA 2YWEA 2R9VA 1M90D 1GVNB 1TL7C 2ZR0A 1NNEA 1OXXK 2O8FA 4C43A 1TEVA 1AZSC 4M1WA 5EMNA 3A1TA 3AKYA 1QHGA 1XWIA 3FKSA 2CNWA 4O2LA 2IX3A 3I72A 1JAHA 2RGEA 3E70C 4MYTA 3CLVA 3PEUA 3VO2A 4RKEA 3JZMA 4LHVA 2AXPA 1KIMA 2G0TA 4MKIA 1BYUA 2JJ2D 2R62A 4RZUA 5AJZA 4MYUA 1LY1A 1II9A 3AVWA 1NSTA 2G6BA 4EQ6B 3D3QA 5KPDA 3HU2A 1S72B 4D4LA 3HYRA 1W4RA 2CE7A 1DDIA 4CEHB 2F3TA 1ZMXA 2O8BB 4EFNA 3IBGA 4PC1A 4A2PA 4P4UA 1OKKD 3WYAA 4LY6A 5CB6A 1VQ9B 3KTAB 4MGIR 5GV8A 3SE0A 1FNMA 1IQPA 3IKJA 1W48A 5FOTA 5F9HA 1IM2A 3K9HA 2Q0HA 3LV8A 1SULA 1HT2E 4N0DA 3GJ4A 3U4QA 2B5OA 1YZLA 4B75A 2JLSA 2DPXA 3SYLA 2Q3FA 2G3YA 2GPJA 3PUWA 2GTPA 1EFUA 2IHYA 4PFSA 4ERNA 1FQKA 2ZRNA 1VQNB 4BZQA 5FH9A 1E2PA 1D8TA 2EU8A 1NMXA 2ZEJA 4KV9A 2YOHA 3JQQA 3DOEA 3EX7C 3A36A 4Q7JB 2W6IA 2W00A 2JIZA 3MWLA 1NMZA 1IY0A 4B3DA 5SZHB 3W8NA 2BF4A 1KI6B 3LDAA 1OFHA 1FNCA 3D8BA 3LLMA 1NLFA 3AKDA 4EFLA 4OI0A 4DLYA 3BH6A 2EFEB 1G8GA 1VIYA 4M9QA 3TNFA 1XU4A 1UBGA 1GNPA 3HR7A 3BWDD 1DEKA 5THXA 2PBRA 3OEED 4Q18A 3ADCA 2OSBA 2BMJA 4M0LA 3F5FA 1CJMA 1L4YA 3KXLA 2QNRA 4TMVA 3GJ8A 5EQTA 3EWAA 2V1UA 4Y0AA 3K70D 1X1SA 4RVCA 4KO8A 3NEJA 1D9XA 2ZJ2A 3CMEB 5KDLA 3X1YA 2WV9A 3CONA 1AS0A 3OIVA 1JQJC 1GRQA 5FPYA 2WJJA 2D7DA 1ODFA 4B48A 1F48A 1IN5A 1GO2A 2BBTA 4YXWA 1PLKA 2ZRKA 1W0JD 3MAAC 3EPHA 2VL7A 2NMVA 1NSFA 2NPIA 2ZRIA 3LW7A 2P3SA 2CCGA 2XNSA 2ZS8A 2QEXB 2KB0A 4II7A 2GNOA 2Q9AA 4URUR 1XEXB 2DR3A 3TW8B 1K5GA 2C95A 2REOA 4KU4A 1KI7A 1U8ZA 3WRXC 2G9NA 1Q1QA 1IJFA 2JLQA 1COWA 2OTJB 2YVUA 5EXSA 2BMEA 421PA 2GJKA 2QP9X 4HDQB 5FUVA 2JLXA 2QGNA 4DCTA 4DSNA 2PMDA 2DFKB 1KI8A 2N42A 5H70A 5BYKA 1AK2A 3RSOA 4HUQA 4F92B 4PC2A 2V7QA 1XTSA 4Q5IA 3ZIAA 4G1UC 2D74A 3TBKA 5BW8A 5C46F 1WBDA 4PC3A 3EAQA 4X8LA 1U8AA 3ND9A 4OHXA 2WPDA 3IO5A 4PHGA 2OT3B 2IYUA 4V02A 3ZBUA 1T91A 4RCYA 1GIAA 4RKFA 3JZAA 3GLIB 4ACAA 2IC5A 5IHPA 3MLEA 3DM5A 1F3OA 2FF7A 1E2NA 1KOFA 3LD9A 2VP0A 3UMRA 2FZ4A 3LWNA 5CDFE 1RRFA 2OAQ1 3SC3A 1V43A 1BX1A 1JNYA 5L3QA 1BO6A 1YR8A 1M7HA 3TQCA 4TT3D 3QUSA 1AJEA 5KHOC 2O8FB 4PPQA 1P7CA 3I3SR 5AUQA 3X1WA 5EXTA 4D81A 4QOSA 3Q7QA 1OHHA 3VKWA 1Z47A 1N6HA 5KNBA 1OIVA 1N0WA 2W6JD 5TXGA 4UJ5A 4D4MA 2H8KA 1OXTA 3KUDA 4JLJA 4QFMA 1BKDR 4MYCA 4EPWA 4FCWA 2BCGY 1QBKC 4QJ5A 4XJXA 4Q9KA 2P6NA 4TTRA 1E2GA 3B13B 3NC0C 4OI1A 3UWKA 4WZAE 4Z51A 1HE8B 4B73A 5D3QA 4I1VA 1U0HC 3B78A 4NCJA 4WXRA 2BVNA 2FPMA 4DXAA 5C4MA 3O8CA 4WQMA 3RABA 2IXFA 2O5VA 2GETA 3CF6R 1L4UA 3B1VA 3FPAA 4FINA 3GFPA 5IK2A 4WAUA 4HE6A 4G5SA 4QG7A 2VHTA 3FKSD 1YRAA 2CNWD 2VEDA 4PX9A 2BEKA 5JFGA 3O8DA 1NBMD 2OLKA 5L3SA 3CUEF 3W2FA 1S2MA 4PXAA 4WW0A 3ZLJA 2ZQ5A 1K9MD 4ZO4A 1WRBA 2RGDA 1IXSB 1P73A 4JVSB 4A2QA 4MDEA 2BCJQ 4LZZA 1G3UA 4A9AA 1FQJA 1F20A 1W5TA 1WDTA 2OBMA 3TGPA 1KMHA 3U4QB 3BS4A 2V6IA 2F1RA 2GVDC 3BBPA 2QL6A 2GCNA 3LY5A 4NHOA 1KJYA 3X1ZA 5KO2A 4PC6A 1KSGA 4LDJA 3SJAA 3VR5A 3RWMB 1S1MA 3BFXA 4EPVA 3DVLA 2QPAA 3C16C 1KK1A 2QMOA 5TR9A 2CL7X 3KFXA 3N70A 3QXSA 2CVHA 3W3AA 1VG0B 4WXPA 3NHBA 3ZVMA 4E09A 2GESA 3P1JA 3BE4A 4RCZA 5G3ZA 2KJQA 4IVRA 3T5GA 3EPLA 5FTNA 2O0KA 4W9MC 1EFCA 2VNHA 2IA5A 1QVRA 1YKSA 2AWNA 4BFYA 1GUAA 1N0UA 1T4GA 2VPPA 5FTLA 1YZUA 2IK8A 1CR0A 1SVOA 2IXEA 4JLMA 3KJIA 5JWOA 2CJWB 3QVUA 2C9CA 2YYZA 4OJKA 4HUTA 4HE5A 4TTPA 3EA5A 5FBQB 1NY6A 1ZRHA 4QRHA 3DO6A 4Q1AA 4R2HA 1TQDA 1P60A 1J9ZA 1U8YA 4D0NA 4I1UA 5FUWA 3EC2A 1ZM4A 1QHIA 4TMXA 3VU9B 1Q20A 3A4LA 1VYTA 2ZUBA 2JIZD 2RCNA 3CZQA 4ILEA 4AG5A 1HUQA 1P9RA 4G5OA 4YLGA 1Z0IA 3CRVA 4PQYA 4PZLA 3H0KA 3KB1A 2A78A 2XITA 5KSYA 2BC9A 3VO1A 1PZNA 1PUIA 1KI9A 2A5YB 1GKUB 1MOZA 2GJAA 2QMEA 2QPTA 4BECA 2Z0MA 3OJWA 2NO9A 3AVVA 2O52A 2YWGA 1VQPB 2QZ4A 2R6FA 3BB3A 3P20A 4NE2A 3LH5A 3U5ZB 4TL9A 4P33A 2CNDA 3KQUA 1OE0A 1F5NA 3GP8A 2YWFA 1X1RA 1E2LA 4IEEA 1G6OA 1QVAA 4B74A 2PL3A 1Z63A 2AFIE 3I4LA 3QG5A 1NN5A 1QG4A 3NKVA 3QNUA 2H57A 3GJ5A 2BGJA 2CE2X 5J40A 4BEJA 3SJCA 2B8WA 2Q9BA 2ZU6A 2JJ1A 2ORWA 3PITA 1UEIA 4YXWD 1G7TA 1E0SA 2IYTA 2DWPA 4FWIB 5JJLA 4NYJQ 3I8SA 1IXRC 4U5XA 3BFKA 3SHWA 3AVXA 2KWIA 3RC3A 2ZIAA 5KNDA 5LDDC 4K8OA 4A6PA 1NVWQ 3QQ5A 2XNJA 3J81k 2ZUCA 1LS1A 4HUQB 4DLZA 5KSZA 1M34E 1ZJ6A 1V5WA 3GLIE 4QBIA 4A0FA 5JRJA 3BH7A 5A5GA 2VQSA 2FEOA 4IDNA 1COWD 1GDDA 3MWYW 3LFUA 4GFDA 3VR1A 4TYQA 3FVQA 5E95A 5B30A 1Q86D 2JA1A 4IOKA 3TK1A 3AVTA 4ZCMA 2FFQA 1P4SA 3VFDA 4C2UA 1F6BA 1Z07A 1XEFA 4GP6A 4BE7B 5GADl 1TQ6A 3V9PA 1KSHA 4XWOA 4DUGA 1TTTA 1Z0AA 1BQEA 2GKSA 3ZIAD 2MSDB 1HQYE 2JGNA 2VHQA 4P0TA 1UBCA 4Q4JB 1XZPA 3U7FB 2GAAA 4YDHB 3KDSE 1KJZA 2WPDD 4UKDA 1AN0A 2FGKA 2FDCA 3HU1A 1G1MA 3LVQE 4XSHA 5UKDA 4POAA 4Y0VA 3VHLB 1MO5A 1E1QA 3CCSB 2QA4B 1EG7A 1SVMA 3LAWA 2IF0A 4UNPA 3B9PA 4BLSA 4D0LB 4ZV4A 4HYYA 3ICEA 2QEQA 3RDPA 3EIQA 1GNRA 1RE0A 4HDOB 4IOMA 2GEVA 3FYHA 2WWYA 1Y3AA 2IYXA 3KFVA 3PUXA 3TKLA 1FZQA 5JS7A 1M6NA 2BWJA 3H84A 2HMAA 5JWHA 3DZ8A 1WCV1 1DG3A 1KY3A 1TPZA 2MSEB 4F4JA 4JLOA 2IS1A 1YIJB 2GJ9A 3C41J 2OLJA 4MKHA 4JKIA 1II0A 3VX4A 4IOJA 2J0SA 2NPFA 4HZUA 3A1UA 1M1YE 1E1RD 3EPKA 1R0YA 1KSJA 2W83A 4MRSA 4JSYA 3GJ0A 3MG9A 3QKRA 1TLLA 1CTQA 2NIPA 2QUZA 2VF8A 1ONBA 3MJHA 5HZHA 4TMTA 3TAHA 3SBDA 4Q1CA 2CVFA 2HXSA 3V4FA 2GK7A 4MA4A 1BOFA 1EFTA 1S96A 5TV2A 1XEWX 1KNXA 1ZD8A 2D2EA 2FU5C 2VSXA 4PO9A 2OK8A 2ZRHA 5DN6D 4C0AC 1Q1EA 2WIAA 2BV3A 2R6DA 3RSLA 1TMKA 3BB1A 4JLVA 4XOIA 4P31A 3B6EA 3DOFA 1N5JA 3PXGA 2DHRA 2VSOA 3NC1C 2G1KA 3NG1A 5EUMA 5FFMA 1RKBA 4RD0A 2O8DA 1FW6A 4E22A 4FD2A 2WVJA 3AB3A 3SZRA 4HAZA 1XTRA 4IKEA 1YRBA 2VP9A 4PPFA 3W2HA 2ZSBA 3L0OA 2IW3A 1Q7YD 3DHWC 4WIAA 4JKYA 2HV8A 1NN1A 2AK3A 5G53C 2OEPA 3S1AA 4NDZA 4QGAA 1VDZA 3FJOA 4NCNA 2P5SA 4H1VA 2NO0A 4UXJA 5DI9A 4A6XA 4AYXA 2J7PD 3JVVA 1TX4B 2W0SA 4QBGB 2VHJA 1N6KA 1OXVA 4DSOA 1KJWA 1CEEA 4Q1FA 1SM4A 5EZ5A 4LWZA 3AP3A 4LHYA 3HU3A 4AG6A 4BLRA 4CF7A 5HCIA 2VP2A 4I81A 1E2DA 5AK0A 3CX7A 4D6PA 4JLDA 3JQRA 1GZSA 1P72A 2OFWA 2YV5A 3B1XA 3QKUA 3QPVA 3AGQA 2FV8A 3HWSA 1XCGB 3QXCA 2KBEA 2AHOA 3M4YA 1OB5A 4LV8B 4LHWA 4NH0A 3W6NA 2Q21A 4OK6A 3W3ZB 4URZR 2O8EA 2IWRA 1YZGA 1LS6A 2GF0A 1Z2AA 2AD1A 3LRPA 1C1YA 1D1NA 1XP8A 2Q9CA 2ZE5A 2WMNB 4B34A 3PUZA 3B5JA 3Q7PA 3F0TA 1H42A 3QF7A 1O87A 5TARA 3IEUA 4KBFA 1EWYA 5J4YA 3CC7B 4EPRA 5HE8A 4IJMA 3JVUA 1E9DA 3THXA 1E9BA 3GFTA 4Q9IA 2ZREA 1NJGA 1QDEA 2VYFA 3B60A 4HB0A 2F55A 5K8TA 4C0KA 1E63A 4D26A 3NVAA 1B2RA 3U7GA 4R7ZA 4RD2A 5GJVC 4HATA 2E9SA 3SOPA 3FB4A 3K0EA 5FPTA 1OH5A 2HT6A 3C4JA 2JJ1D 1ZNYA 2IYVA 3CF2A 4DEYA 2OILA 3ZD6A 1OSNA 3A1VA 2QPOA 1N8RD 3U3MA 3QJYA 4EPXA 2EQBA 2XOKA 1A4RA 2A5GA 2GCPA 4JS0A 2BKEA 2QTVB 3TR0A 1H65A 4ITRC 3G0HA 2J45A 3QXXA 4CEJA 2GCOA 1S9DA 4RZ3A 4TL7A 1CNEA 4B44A 2VNIA 1U81A 3GMTA 5CJ2A 4YONB 2REXB 4KAXA 1VHLA 1SVSA 2ORIA 3AUXA 4HB3A 2QT0A 2ZRDA 1UM8A 2F7SA 2JCSA 2PX3A 1A2KC 2EYQA 2R65A 5F3WB 2PMKA 2BM0A 2H18A 5DO9A 4B33A 4OQLA 4HI0E 1KK3A 3P26A 3PENA 3DPUA 4GMDA 1FX0B 1JXMA 1ZNWA 1FL9A 1XFAA 2OESA 4Q9JA 2CLCX 2CL6X 3CR8A 4G3XA 4JMPA 4TYPA 4HZIA 2PEYA 1XMJA 1KI6A 3P32A 4DUGD 1CU1A 2EWVA 1K73D 3DDCA 5C2JB 3I61A 1Q44A 1G3RA 2OV2A 5AUOB 1MABA 1AGPA 1JALA 4LI0A 1G8FA 2ATVA 2NOAA 1E1QD 3SNHA 3VR2A 3FMPB 3M1IA 4XSGA 1JI0A 4OI2A 4HZUB 1IJEA 1KC8D 1JPNA 1N0VC 2KBFA 2ZRGA 2KSQA 1H8ED 2RGXA 2J1LA 4LC1A 5L3RA 1G8HA 3MFYA 1VQLB 1Q81D 1AM4D 3QF4B 3QKRB 4TN1A 3PEVA 4Z8XA 2WWHA 3W2EA 4KI0A 1VECA 1VKJA 4NU0A 4FN5A 4D2IA 3RHFA 1ZM9A 2FSHA 2LKCA 1TF5A 3RRZA 1Z6GA 2A5DA 3B82A 4B3BA 3P27A 4A8JC 4CT4B 1S3GA 3I8XA 2DFLA 4LHXA 3C5CA 5FBLB 4GL2A 2IHBA 2F43A 3G4SB 1YZNA 4G5RA 2NO1A 2QN6A 4BFZA 3TJZA 1QX4A 1I2DA 1JR3A 1T8TA 5EE1A 4P4SA 4B3FX 2FWRA 2PIAA 4LBZA 1ZM3A 4ZIRB 1OGJA 3VKHA 2ANBA 1E2FA 1WMSA 3C7KA 4TLBA 4D82A 1NLYA 2QROA 3CB4A 1ZCBA 3AVOA 3WNBA 4JLBA 4MGKR 4NYJR 1OF1A 4JBWA 3ZGXA 1ETUA 4C30A 4ZDIA 1P2SA 3U44B 4NTZA 3K0SA 3SQXA 2QY9A 1XD9A 4OJQA 3S1AB 4XWKA 4HLUA 1KKLA 1QHHA 5TY0A 4B43A 4DCSA 4HLCA 1P2VA 2WMOB 3EPJA 4JJKA 4B2IA 4PHTA 2D4HA 3IBYA 2VO1A 4V0NA 3AQ4A 5C18A 2EIXA 3OF5A 3NH6A 2FSFA 3GLIA 4HB4A 3W6PA 2P2LA 1T3SA 3CZPA 5L3VA 1W47A 3CX8A 1E9RA 1WA5A 1F2UB 1FUUA 2GILA 1L2TA 4JT4A 3KKNA 4WVFA 3VR6A 5IRCD 4A8JA 1GG2A 4L16A 4XD7A 5JJIA 3CMAB 3WY9A 2ZUDA 4TLAA 1J2JA 4TYWA 1GFIA 2P67A 3MUFA 2O8EB 1KDTA 1D9ZA 1ZNZA 5HKKA 2EFGA 1TVCA 3W34A 4TQUS 1HV8A 1GKYA 4MQBA 4M9XA 3SDZA 1GAWA 2FH5B 2ZI7A 3B2EA 4Q19A 3T06B 1TNDA 2OAP1 4ARZA 2ERXA 2ZS7A 2WJYA 2P6RA 1JA0A 3THXB 1UPTA 2PT7A 2YINC 3C5HA 3QFTA 5EZ6B 4OQFA 2EFHB 4Q7KA 1XJ0A 3IIMA 4CIDA 4GT1A 5FR2A 2W0MA 2D62A 5K8LA 2LKDA 3TVTA 1ZINA 3RWOA 2AR7A 1KGDA 2ZRCA 4X8MA 4XVUA 2VF7A 3Q5EA 2GZHA 3PUYA 3AF3A 1E4YA 3E20A 5E4FA 4DQLA 1H8HA 2VH5R 5BXQC 1FDRA 3LXRA 2G0NA 2CDNA 2RKOA 2I1QA 1FP7A 3SYNA 5J4KA 1D2MA 3GLHA 2QM8A 3H86A 1E79A 3W5VA 1W1WA 1DO2A 5CIWA 4HAVA 2OUKA 5KSPA 3WRYC 1E99A 4N3GA 5CM9C 2ZPTX 5E7JA 4A36A 1UJ2A 1VQ4B 4F38A 1B23P 2ZSDA 1QHYA 3QENA 3A37A 2GCOB 1AIPA 2C9OA 2ZAOA 4AK9A 4CEJB 3L8ZA 4AKEA 2ZYWX 2RC6A 2ZJYA 3WMGA 3EZ9A 1CQXA 1E69A 1QVFB 1VG1A 1GRRA 1E94E 2C2HA 2ODNA 5J4HA 3GJ3A 1DAFA 4NCHA 5JBQA 3AKEA 2EWWA 5FTKA 5KNCA 2OBNA 2D3WA 2XOKD 4W5JA 4A1FA 1YZKA 2B92A 4JL8A 4JLPA 1EESA 1QUEA 4QBFA 1W35A 2CXXA 4HLDA 1VCMA 4AWXA 1P9WA 4X8OA 3P4YA 2CJWA 3FKQA 4DIEA 2FFBA 2PCJA 1MABB 4ABYA 3TUIC 3QFSA 2QT1A 2F3RA 2HEIA 3SN6A 4Q03A 4BZXA 1E6CA 1ZC4A 2FOLA 1VYUA 1Z83A 2FGJA 4HAYA 2H5EA 5JLJA 2BOVA 3A6PC 4YAUA 4A0GA 1QG2A 2ZROA 2BIFA 2QE7D 3VU9A 3AV0B 5E7MA 4PAOA 2QAGC 3SJZA 4LYFA 4Q4AB 2ODBA 3K0FA 5JCZA 1A8PA 2GAOA 4HAXA 1YJWB 1VQKB 2JAQA 3QY0A 4LBVA 1DG1G 1XJCA 2C9YA 5BWMA 1J8MF 1KDOA 2WKPA 1CJKC 1TU3A 3QBTA 1NKSA 5FBWB 3K1JA 4K46A 4RFSB 2BGIA 1LVGA 2F9LA 2XZOA 4BFWA 3UATA 2ZE6A 5DH9A 1XMIA 3W9YA 2A3RA 4LGMA 2F43B 4M1MA 2G77B 4ESVA 3EW9A 1KI4A 3IIJA 2JLZA 2XJ4A 5IDVA 2ZR9A 4KXFB 4L9SA 2J0UA 4P4SB 2JASA 4URXR 3MCAA 2YZ2A 4DVGA 4YALA 2B8TA 2OFXA 1N6OA 2QTHA 2MMGA 2W58A 1G9XA 1I4LD 1GRNA 1OPXA 4RZ2A 3FE2A 4DDUA 3TUJC 4URYR 3NBFA 5KTYA 1AS3A 4NCKA 1Q3TA 2XNCA 4CZ2A 3X1XA 1M7BA 1LW7A 3LBNA 3X2SA 4BUJA 1CBUA 4HSEA 3TR5A 2AN9A 3CCJB 1EWRA 1QHHB 2HJVA 3PEYA 5B57C 5TDHA 2ZYTX 1JR3D 2RHDA 4PAMA 3QKSA 5HPYB 3AF2A 1CRPA 2QAGA 2RGCA 1UFQA 2QENA 2W2VA 3RAPR 1E9AA 2ERYA 4C7OA 1VCIA 1Z6TA 2WZQA 3CD6B 1I4TD 1X3SA 2RHMA 3QPUA 4PHFA 4I1OA 4DKXA 2DB3A 4QGFA 2FZLA 2TMKA 3UG6A 3EXAA 3PUVA 1CR1A 1U90A 4AY2A 4RD1A 2XB4A 3AF1A 3A4NA 4OK5A 4A8JB 3FOZA 2NQ2C 1Q57A 4IDHA 4Q4JA 3H1TA 3OZVA 1I7PA 3CIOA 4PSVA 4Q21A 2V3CC 2KE5A 5H1YA 2VLIA 2ZJOA 2BBWA 3WMEA 1WXQA 1OFUX 4MUAA 1TUEA 521PA 3IIKA 4RY2A 1OYYA 4ARZB 3SBEA 4TTQA 4F7WA 2A5FA 1GILA 4N1AA 1S4QA 5E7IA 3T61A 1RRCA 4UNRA 2IYLD 3ND8A 3TRFA 1OXSC 1YR9A 3H4MA 3V76A 1N3BA 4LYHA 1G5RA 1EGAA 5KSWB 2ZSFA 4JVMA 1VQ8B 3KXKA 5ANRB 3TE6A 2GJSA 2Z4SA 5FR1A 4KFRA 5LD2B 3C15C 1GL7A 3CH5A 5HKKD 1IN4A 4BRWA 2FE4A 3WP1B 2ZI5A 4HDCA 1EWQA 1R5BA 2SHKA 4QM7A 3NDBB 3GLHB 2ZITA 2WICA 1T9HA 1X8JA 3PG5A 4AYWA 4N3NA 5SZKB 4TLDA 1VQ5B 1CP2A 5CB8A 3AP1A 4UXIA 2AX4A 1IB0A 1O3YA 1N6RA 5JWRA 3BAFA 1SKQA 3G71B 4YAWA 4NONA 2XSZA 1ZU4A 3Q5DA 3PFIA 4RD3A 2A5JA 1EFHA 4M1YA 4WBSA 4Z8YA 4QHYA 4V0ME 2F9MA 4B6FA 1H8HD 1Z5ZA 5DGXA 3CC4B 1AQUA 3MHPA 4XIGS 1QZXA 3SFVA 2C04A 1Q21A 4M9SA 2WOJA 4IVQA 3LO8A 2NZ8A 3IQWA 3L0SA 3G6EB 1YHQB 3MJRA 1XPUA 2VP6A 4O0MA 2A9KA 1GP2A 2GF9A 4KVAA 3ZVRA 4DQKA 4B2LA 1RPZA 4CT5A 4C0QC 4G1VA 1TF2A 4OKSA 3PR1A 1Y63A 4JLAA 4I99A 3SYKA 4BLPA 3FMIA 1M7GA 1YJ9B 3REGA 3IO3A 1Z6XA 5DIFA 1K8RA 3PCRB 3NDPA 2BJVA 4C0LA 1G8PA 3LQRA 2J0QA 2WAYA 3ZJYA 4LK2A 5HZKA 1JBKA 2W6ID 1D5CA 4MGYR 4CRWB 1Z0JA 2H1LA 1KKMA 2IUSA 3BGWA 1CIPA 3GEHA 3K0FB 5JI2E 4TL8A 3B85A 3A1WA 4NZYA 3FGNA 2R8RA 4ON9A 4DLXA 5JEEA 4TYYA 4OI4A 3CW2A 5EE5B 1FMJA 3H2YA 3THOA 1HQCA 1SVIA 1E2QA 4Q01A 5DLQC 3SU8A 2FPKA 4D4JA 3KXIA 2R44A 1JR3E 2GRJA 2XAUA 1BMFA 1CNFA 4QHTA 3EZ2A 3WNCA 3KKPA 2J3EA 1FTSA 4CGZA 3MGCA 2PJRA 3VQTA 2J0UB 2GDJA 4WA7A 1C4OA 5SZJA 3WNDA 1FTNA 3BB4A 5G40A 2YKGA 1QVGB 3CRRA 3GD7A 4B2PA 2J87A 2WJIA 1GSIA 1MKYA 2XTNA 4DIDA 2E87A 1E2HA 1VQMB 1JECA 1UBEA 2IEYA 5FL3A 1C9KA 4FWTA 1ZUIA 2VHUA 1UKEA 2QSZA 3QG1A 1RW4A 1DO0A 2WWFA 3TSWA 2QU8A 3KQHA 1OXUA 1S0UA 1M1KD 1E2MA 3EWSA 1US8A 2OCYC 3C14C 4BLQA 5CITA 2PZFA 3LX8A 2ZXUA 5CYOA 1G7SA 1IN6A 2H7VA 3K0AB 3BOSA 4LSGA 1G16A 1JXOA 3QKSB 2QAGB 4C7OB 4B6EA 3I5YA 2IF2A 2FJUA 1YITB 3EZ7A 3SEAA 1N2CE 4DCNA 4R9UC 4NPHA 4OHZA 3P4XA 4CVNA 1EFRA 3GEIA 1E32A 4LJ9A 5AUNB 4G01B 1N6NA 3W2IA 1W2HA 3ASYA 2D7CA 1F60A 5SZIA 5GV7A 1XTJA 4Y9UA 4DWJA 3Q9LA 1W36B 2V7QD 5LB2A 1W44A 3FFAA 4ZCLA 4QBHA 2QG6A 3CM0A 2ZE8A 1SZPA 4GNKA 3OW2B 1KRHA 4K1XA 4ZCIA 3AUYA 4ZPXA 4LYJA 1M74A 4F4CA 3GFOA 4QKQA 4JZKA 1QF9A 3LW8A 3GLFA 4MH0R 5F9FA 1W34A 3G5UA 1JAIA 3W5UA 3I56B 3UKDA 4BLTA 2XX3A 2A30A 2DETA 1FX0A 1L7VC 3RS3A 4FK8A 3KJEA 4TLCA 2XB2A 4DCUA 1CULC 1VHTA 2ZJ5A 3EG5A 3KKQA 2Z6VA 1RC8A 4GI7A 1EP2B 4XWAA 2YJTD 4LJ4A 3U2QA 3UXMA 2RAPA 4EJSA 1K6MA 1N6LA 1TADA 4NBSA 3AF4A 3TW4A 1XJQA 3CF0A 3GLHE 1OJLA 1SXJB 3QSYA 1UF9A 3U6BA 1OHHD 1E62A 2HT1A 5KOYA 1SVWA 3RNLA 4GZLA 3IPXA 2ZR7A 4BLOA 2WWWA 1XCPA 3CNOA 3T35A 1DDGA 3ZD7A 3DMNA 2V55B 3QF4A 3T1OA 4ZGQB 5FTJA 8OHMA 1P62B 4LJAA 1QHSA 2WSSA 3PV0A 1KYIA 121PA 5EP4A 2Z5FA 4PO8A 1KNQA 3K8YA 4NCIA 4LBYA 1XPRA 5IK2D 4JSTA 3AVUA 3AVQA 2QQEA 3IUYA 4CYMA 4U7DA 5CLQA 3TMKA 1W0KA 3PJRA 4KSCA 4YDSA 2ODEA 3CRZA 3WYGA 1Z0KA 4M53A 2BBSA 2J41A 4FMCF 1VYVA 5FTMA 5GJCA 4B3CA 3LVBA 5KSOA 2OCBA 3K09C 1E0KA 3TIFA 4Q00A 3OIUA 1FNDA 1VCOA 2O0JA 1D6JA 3KQNA 1WE2A 3RC8A 4TWZA 5KPJA 5AUPB 4DLVA 4ZIRA 2XSZD 4IFEA 4FCVA 5KDDA 4PAQA 3LO5A 3Q72A 4F93B 2F6RA 4KYIB 3HDTA 2H16A 5AJWA 4QM6A 2OBLA 3U44A 3RLFA 1W5SA 2VTKA 3CCMB 4DZZA 4LUCA 4LRWA 1AKYA 3WYFA 1JPJA 1R0ZA 5LPNA 3PQCA 4CEIA 4EFMA 2VHCA 1XD2B 3LX5A 4QGGA 1W7AA 4I4LA 3RS4A 2UKDA 5JI3E 4E07A 4QJ3A 2W2XA 1ZU5A 2ONKA 4DDTA 1Q1ZA 3FTQA 4UNSA 2BMFA 1XNJA 1QHNA 4ZI3A 5TB5A 4QJ4A 1E2JA 4KJZA 4WOPA 4PANA 2ZI6A 1AA9A 2NTYC 1LF5A 1JJ7A 1F2UA 1OLOA 5D3MA 1WP9A 1NY5A 1DAMA 1ZP6A 4QXAA 2F1JA 4L8GA 4HAUA 3B1WA 2ANCA 1MO3A 4M21A 5AJVB 1BJKA 1NIJA 4BZPA 4EH1A 4Q4HA 2NGRA 1KDRA 3IPYA 2D06A 4PPNA 3B7GA 3ES9A 5DI3B 3K09A 1N5LA 4FMDF 5DISB 2JATA 2UZ3A 3GJ7A 4YMSA 1U99A 3DZDA 2VA8A 4DBLC 1XBTA 4CDGA 2F1IA 3PEWA 2JLWA 4DDVA 3VR3A 4AKIA 1VPLA 4NMMA 2XGJA 1NN0A 2Z83A 1FNNA 2JJ2A 2YC4C 5G41A 1TAGA 3CXCB 2F1HA 2IWHA 3U3KA 1GL6A 5JRZA 5EP2A 3FMOB 4FW9A 1BMFD 4C2TA 2CEAA 1G5TA 1S9HA 1US8B 1W2GA 5IF9A 1JB1A 4OHVA 3W5HA 1Z0FA 1VQ7B 3GCGA 4JL5A 3W6OA 2ZRJA 1DAKA 1GR1A 4E5UA 4GZMA 3KX2A 5EE3A 5GJWC 1G291 5AJYA 3OE7A 3ZS8A 1P6XA 3MWJA 2VP5A 3E2IA 3A1SA 4OQXA 4B35A 2JLVA 5JHGB 6Q21A 1GKIA 3OIYA 3BXZA 3T1TA 1T0JB 2ZYVX 2PX0A 2E1RA 1NVVQ 4H1UA 2V1XA 1UKVY 3X1DA 1Z08A 1YR6A 4TLEA 3ZBTA 1ZNXA 1UMKA 1BS1A 1MRNA 1GITA 4BFUA 1RVDA 4US0R 1Q22A 2P6UA 1UBFA 2IBMA 1VG8A 1EXMA 3NEYA 4GRAA 4C0BA 2X77A 5BQ5A 2Q3HA 3GLFB 1J99A 1DADA 3VNUA 4M2LA 4V0MA 2QTLA 3W5IA 1R7RA 1R6BX 1EFRD 1SQ5A 2IEZA 3RYTC 5LB4A 3WXMA 4EDHA 3E5HA 2QMUA 3CNLA 3GLGB 5E3HA 1A2BA 2ZJBA 4F4IA 1SXJE 2V8OA 3F8TA 4DLTA 4EJSB 1B0UA 4Q1BA 3CO5A 5TVKA 4LJYA 1T3HA 2Q3MA 1GWNA 1MT0A 3AF0A 4HLUC 3ZH9B 3T34A 4K81B 1F2TA 2XTMA 4DLSA 3IHLA 1E9CA 4MRPA 3T1VA 5AJXA 1HT1E 4JL6A 2OE2A 3NIBA 2ZAMA 1G3MA 4EAQA 3GPLA 4KFUA 4Q4AA 4M1TA 4A92A 3CCVB 4U02A 3SQWA 1KMQA 3CWQA 2DFNA 3D7MA 1OFTA 1X6VA 2ZANA 3L82B 1P61B 4KCGA 4DSUA 1DAEA 1MV5A 4KLZA 5B58C 2ZVQX 3OZUA 3CPWB 1SKYB 2VSFA 4W7SA 3OIWA 2ODWA 4RFSA 4MRRA 4PQRA 3IILA 2VRWA 4RD4A 1DELA 2XTZA 5BYJA 2ATXA 3QEJA 1QGZA 2NO6A 5FI1B 2QTZA 1ZBDA 1P9NA 1CKEA 1TQ2A 1XXHA 4FMCB 4AKHA 2FSIA 2QDXA 1UKYA 1CR2A 4JYBA 1DAIA 1XE1A 3WBJA 1LF0A 2CHGA 4DB4A 1KK0A 1ZD1A 1OW3B 2JDIA 1I2MA 1QFJA 2BMWA 5EE9A 3ZS9A 4Q1EA 2RGNC 1AGRA 1ZAKA 2BKUA 2QMHA 4RZXA 4HAWA 1LV7A 1R8QA 4IDPA 4J0QA 2WKQA 5JHHB 3KZ1E 2CBZA 5LD2C 1K5DA 3LLUA 1MO4A 1FRNA 4FCTA 4B3XA 3KQKA 5F98A 1ZYUA 2OG2A 4CEIB 2FPLA 2NZJA 4LYAA 4AYTA 2GJ8A 5CK5A 4A4DA 4M8NE 4LOAA 1NG1A 4IDOA 3PVSA 3I92A 1JQLB 2GXQA 3CR7A 3RRYA 4DEXA 4C0HA 1NN3A 3L43A 2OXCA 5K8IA 2BHRA 2FA9A 3CCUB 3BIFA 3IGFA 2JLRA 4KFSA 3AVPA 5FPKA 5D3MB 2PCLA 1Z8FA 4Q4LA 1PVOA 1BX0A 2WJGA 3NHAA 4DCVA 2WKRA 2IS6A 1W2BB 2PZGA 2VZLA 5KUTA 4Q4HB 3MRSA 5ELXA 2ZSEA 1XCMA 4AKGA 1CJVC 1FP6A 5DSZA 3QFCA 3G82C 5JSZA 1N6PA 4AF6A 1OFIA 4M1SA 3THWA 1IN8A 2GZDA 4KHZA 3NBYC 3FHCB 2VP4A 4WZ6A 1A5TA 1T5IA 3SHFA 1YE8A 1IBRA 2HLDA 4RSGA 3W90A 2I1VB 4G1BA 2DY1A 2RGNA 4URWR 1E9SA 2FEMA 3PIRA 4XVQA 1UADA 2PT5A 1Z0DA 2YNMA 3R7WB 3QXJA 4JVLA 4OHWA 4N0EA 1EX6A 3ONWA 4OL0A 4S2EA 2QAJA 1DVRA 2N46A 4JVNA 2FX3A 2B7BA 4TL6A 2ZU0C 4DT1B 2GEDA 2PZEA 4UNQA 2XJ9A 2GHIA 4KYUA 3E1YE 1QGYA 1BIFA 1NBMA 3T12A 1J90A 2WHXA 2BMDA 1Z6YA 2ZS9A 2R6AA 4Q7LA 3QEOA 3BRWD 1N5KA 4QC2A 1NL3A 2LWIA 5A0FA 3BD9A 2HJGA 4CW7A 1L8QA 4QNMA 3CCQB 3GLFE 4MITA 4D0GA 4B4DA 3QE0A 2J59A 1N6IA 1T8UA 4UJ3A 3VNVA 4TSFA 3WMFA 2WJHA 4AF7A 2BDTA 3N2IA 1RIFA 4Q9HA 1XTKA 1DPFA 1Q3HA 4ESHA 4U00A 3OE7D 3GLGE 2GZAA 1HEIA 1KZ7B 3BFVA 1E0AA 1YJNB 3LNCA 1DAHA 1SHZA 5CM8B 4FXPA 1R8SA 4P6VF 4C3ZA 4R71A 4JJZA 1CF4A 1TQ4A 2FFHA 2IYYA 4TMWA 4EPTA 4LC0A 1EX7A 2Q6TA 5JEDA 3QIAA 4FI3C 4IRUB 2UZIR 2C96A 3EASA 4OHYA 1PUJA 1GOTA 1F2TB 1M2OB 3TH5A 1KTVA 4DSTA 3NWJA 2B7CA 3FFBA 3K70B 4YHBA 2DEUA 1S3SA 3AM1A 2Y8EA 3W5JA 4BFTA 4F7DA 2GXSA 1SKYE 2HUPA 3SS8A 3UMSA 2R6CA 3U7HB 1P2TA 2IS4A 1XMSA 2B6HA 5LBIA 2A2ZA 3I62A 4Q02A 3M6AA 2GVZC 4GOXA 221PA 1KAOA 3FHOA 3CRMA 1KO4A 4ZKEA 1W36C 1FFHA 1KO1A 2GK6A 4Q48A 1I4DD 2RGAA 2G88A 3CPEA 2A7QA 4LJ6A 1R0WA 3U61B 4AURA 1II8A 2IYQA 1XXHB 2ONJA 1OV4A 1YJ5A 2YWHA 1HYQA 4BPRA 3V4RA 2AKYA 3IQXA 3ASZA 1DTSA 4TMKA 3VKGA 1R5NA 5C1BA 1AMOA 2WWGA 4HLQB 1U9IC 4PO1A 4YC7A 5FPSA 2HXYA 4R98A 2DBYA 2IUTA 2CLSA 2GXAA 4IOLA 3REFA 2ZRPA 1E2KA 1RFLA 4A15A 1QH0A 5FL7A 1CLUA 1SXJC 4JIMA 5B64A 3HPRA 1U2RA 4V0LA 3HYTA 1X86B 3K0AA 5JZVA 4GPTA 3I55B 1Q0UA 3AGPA 3ZC3A 1LB1B 3HPQA 1YU9A 5FOXA 2JDID 1IY2A 4RD6A 5EXPA 2REBA 2ZE7A 3EA0A 2WSMA 4P32A 2H92A 4BFSA 5B2ZA 3L0PA 2EYUA 4DHEA 1E9EA 1ZIOA 4MDFA 2HCJB 1NVVR 1KO5A 5KYKA 2QRNA 2WM9B 1RRGA 3CBQA 2FFAA 2QBYA 3CNNA 2ZI9A 2VIIA 2IUUA 3UG7A 2VNJA 3Q85A 4YQFA 2IYWA 1AZTA 1OT3A 2CMKA 2FN4A 1YZTA 5JSZB 4IFBA 1G6HA 4KSBA 4NYMQ 3V00A 3THWB 1GL9B 2QP4A 5IT5A 2OZEA 1N25A 3ZVNA 4S35A 4MKFA 1KO8A 2EW1A 1KDPA 1J8YF 2ZVPX 3TSOA 3QBVA 2HYIC 1U9IA 1IHUA 1XPOA 3OZWA 5H59A 1CR4A 4O2RA 2ZJ8A 4LJ8A 5CLLA 3JQPA 4HB2A 1ZM7A 2ZTSA 4XD7D 1W46A 4W5WA 1KI3A 2XXAA 2FNAA 3QXHA 1AKEA 1HA3A 2OK7A 1S8FA 1SXJA 4E03A 1MH1A 4Q47A 1E64A 1YZQA 2H17A 3RRMA 1J7KA 4BEBA 2JLUA 2CHVA 4UNNA 2K5UA 4DDWA 1T3LA 4OK3A 1E1RA 1FRQA 1M8PA 1MRSA 2HLDD 1NVXQ 2ASEA 3BC1A 4PC7A 3AP2A 2L0XA 3AEZA 1J70A 2IL1A 3L0IB 2GWHA 3THYA 3NXSA 4PTLA 3DKVA 4V0OA 1NG9A 1XMVA 1QHXA 4UXHA 4G0NA 3CPJB 1HURA 3OFNA 2OCPA 4AI6A 3Q8XB 1RJ9A 1HTWA 4M9ZA 3ZZUA 1OYWA 2CK3A 1XX6A 2I4IA 3OAAA 4O25A 4L9WA 5DN6A 2CRVA 1E79D 1ZCAA 4A0RA 4TYNA 4LPKA 3L8YA 5GVRA 3U3RA 4EIWA 4LCBA 1A1VA 2WTUA 1OB2A 3DMDA 1P75A 1KQSB 2OM2A 4AC9A 4KBGA 1E2IA 4B47A 4LJ7A 1EK0A 3EIHA 2Z43A 3BH0A 2WOOA 5JMTA 2YOFA 1QFYA 5JJKA 4KITB 2AD5A 1PV4A 2R6GA 4DC9A 2EVWX 3K9LA 4B71A 4TSFD 3I32A 1WQ1R 2V4ZA 4P3YA 1G41A 3ADDA 1FUKA 4C4PA 4XH9B 2BBOA 2HF8A 3LVRE 2J7PA 1XD2A 3ADBA 1E4VA 4QGHA 2RMKA 1R10A 2JLYA 1U98A 1XB2A 1P5ZB 4DLWA 4LPSA 1LTQA 1IOZA 4EUNA 1ZUNB 3CRW1 4UAJA 1PLLA 3ECCA 3TLXA 2FSGA 1QUFA 2BPOA 2G1JA 4BWYA 1JJ2B 2JEOA 3OJXA 2BJWA 3EIEA 2DWOA 3T1QA 1YHNA 2IYSA 2YOGA 3UANA 2C77A 1E2EA 1XXHE 4LBWA 3CCEB 2W2TA 2ZJZA 1MR3F 2QTFA 1G18A 3K9NA 3DM9B 1HY3A 4A82A 3WHKA 3K53A 1II8B 3ZYCA 1NJFA 3DKPA 5FA6A 5DI3A 2QM7A 4R2IA 1WBBA 2QQ0A 3B9QA 3NBXX 1KY2A 3NTUA 4RFVA 3O8BA 3NH9A 2B21A 3WP0A 3CKLA 4M1OA 4Q1DA 4Z54A 4TZ6A 1G19A 1TF7A 3A4MA 2WWIA 2ZJAA 3VTKA 4GSYA 1ELOA 2C03A 2YC2C 4PPGA 3R8FA 1KD1D 4EJSC 2O0HA 5J4VA 3IDQA 3QE2A 5G3YA 4YMTA 4Z1MA 5BN5A 2XNDA 3I5XA 1EP1B 3ICQB 1U0LA 3CX6A 3LXXA 4MKGA 1UEJA 2G83A 2HCBA 2ZRAA 1NP6A 4NYIQ 4YMWA 4OQMA 4BPBA 1NJID 4M22A 2J5XA 2ZRMA 2PLFA 3KKOA 1WF3A 3D6TB 3UMFA 5H68A 3RS0A 1G20E 4P4TA 1RRPA 1NF3A 1AS2A 3O8RA 2HF9A 1Z3IX 1FMLA 2WIBA 3QPWA 3VMFA 2DYKA 4ASUA 2EFCB 1R0XA 1KHTA 2CL0X 5K8UA 2BN4A 2OHFA 1VMAA 3KUCA 2QBYB 5FL7D 5HCNA 1U94A 1E9FA 2C99A 1IN7A 4MYHA 3ZZ0A 1OH6A 1KI1A 4ZKDA 2ZM5A 2DFTA 1GVHA 1UKZA 3BJIC 3EZ6A 1E3MA 2XZPA 1VG9B 4ZDWA 2CHQA 1UDXA 4PSKA 2HDNB 3HR8A 3OHMA 1QRAA 1T0HB 3RS5A 1KSFX 3ADKA 2I3BA 1XRJA 3QI2A 5BN3A 3LA6A 1G3IA 2CLDX 2P5TB 5FOUA 1G64A 4Q9LA 2DERA 1U0JA 1Z28A 4JYCA 4FIDA 1LFDB 3Q3JB 4QHSA 2DCUA 3GLGA 2FG5A 3UWOA 4ZGNB 3FPKA 1W36D 3TSZA 2X1VA 5L3QB 5P21A 5TMPA 1HH4A 1E96A 2YHSA 2ZRFA 2XXAB 2GBLC 4BQSA 1NBME 5L8VA 1ZUHA 3AKCA 1QGAA 2ZRLA 4AIIA 4IW3B 1RYHA 2FMXA 1G21E 1FNBA 3FMFA 4TQAA 3UPUA 1Q1BA 1JR6A 5FBVB 3IEVA 1AQYA 5GVSA 1H8EA 4YMUA 3ZZTA 1VCNA 1NVUQ 4WZBE 1KI2A 3AVYA 5J4LA 2AK2A 3WHLA 1NIPA 1ZW6A 4M1KA 1XD8A 1CXZA 3MWKA 2X2EA 3CPHA 4HEJA 4IVPA 3THYB 1T5LA 1OIWA 2QP3A 5FUXA 1LNZA 1SXJD 2HYDA 5HTKA 1NRJB 2R6HA 4GOKA 4PGOA 1S1CA 5DYIA 1RJ9B 2GXUA 3F3YA 1UDWA 2QSYA 5HR5A 5L3SB 1CJTC 4V0KA 4L15A 5FBRB 3B8HA 1G5PA 3UIEA 1HE1C 4L4UA 3HP1A 5H5JA 1W49A 4NL4H 1DE0A 4TZ0A 3QKTA 4PR0A 1KMHB 5DHFA 4OYHA 4DLUA 5JS8A 1H85A 4Y9RA 5AR1A 1GTVA 2V6JA 2ZETA 4JLNA 1QG0A 3OFND 4JT2A 2ZI3A 1PLJA 1YVDA 3KJGA 1Z2CA 3OEHA 2J46A 4LV5B 5CK4A 2GBLA 5C4GB 4EPYA 2OTLB 3GEEA 2CCJA 4GDFA 2CK3D 3OAAD 3A58B 2ECKA 3TVDA 4C9BA 1OIXA 3A8TA 4F91B 1SGWA 4ZDKA 1MO6A 2VBCA 4KVGA 4A0HA 3ZQJA 1R2QA 4ZDJA 1W4CA 3BK7A 2VYQA 3CH4B 3N2EA 3VX3A 2IXGA 1BH2A 5JCPA 1YQTA 4XTCS 4IEIA 1Q82D 1JEDA 2BM1A 3CC2B 3RRNA 1G7CA 1ZD9A 4O3MA 2QRZA 2XEXA 2XZLA 4YAOA 1QFZA 2AKAB 3ZDQA 4UQOA 4JLKA 821PA 2J7KA 1KO7A 3AH8A 4GBMA 2PLRA 3VHXA 1XZQA 2RH5A 4MUBA 2BSAA 4LHZA 2WAXA 1G4UR 3BERA 2IYRA 5EP3A 1XTQA 1ZC3A 2LCFA 5FOWA 4DLRA 4DRZA 4LX0A 3RVBA 4QNRA 4JBYA 1CJUC 1JA1A 3GJ6A 5FUYA 4US2R 1P3JA 2WBLC 1P2UA 1TU4A 3SFZA 3KB2A 1GAQA 3M0EA 4NYMR 5EUQB 1VTKA 4DJTA 4BRUA 4MGZR 5EJEA 5KDOA 1ESNA 2O8CA 2AL7A 3RANA 5J5CA 1Q12A 1A7JA 3U60B 4GMXA 1CS4C 2RB4A 3FDIA 1N5IA 1K8AD 2GEUA 2RC5A 3ETLA 4D25A 3O47A 1DOAA 3HJNA 4GP7A 4IXMA 3I1FA 4C0SA 1G3QA 4Q7MB 2RGGA 5CIQA 3R7WA 5CDFA 4PSAA 2GQFA 1GM5A 3MD0A 3KQLA 3CRQA 4OQNA 3L2OB 1YR7A 4KLNA 4DT1A 1BYIA 1OKKA 3K70C 1WB9A 4G5QA 4US1R 4BFVA 1FPMA 1G8YA 2AWOA 4DB2A 2PJZA 4PQFA 2BEJA 1FOEB 2RGBA 2AFHE 3E1SA 4OBEA 4B3GA 2X19A 1DBSA 4B76A 4X8HA 3GQBA 5EXXA 1IXZA 3EARA 4EQ6A 4XVRA 5EE0A 4Z1MD 2D2FA 2QGZA 1G4AE 2XNDD 2GA8A 2J9RA 4IHQA 4CEHA 5AN9A 2DWQA 2OFOA 5HXBA 4KODA 2O8BA 2X2FA 5EP1A 1W87A 4YAFA 5DHAA 721PA 1Z06A 2P65A 4PHHA 5CYPA 3CCLB 5FI0B 1R4AA 2ZI4A 1TUIA 2C5LA 1DAGA 1X8LA 3KTAA 1SVKA 4TQ9A 1NLZA 2R2AA 2NO7A 5GJBA 5J47A 3R9WA 3B1YA 4G5GA 4Y7CA 2OXRA 4B32A 4ASUD 1D2NA 3CWZA 3R20A 3R9XA 1OH7A 3BORA 4LV6A 1IONA 3NBZC 4IDQA 3U3OA 3VAAA 4A2WA 1DS6A 1E0JA 3TQFA 1IY1A 5FPHA 1VQOB 2IYZA 4MRNA 5DYGA 3EC1A 3MSXA 3OESA 3R8CA 4MRVA 1G7RA 2IS2A 1JB9A 1ZM2A 2JJ8A 3OEEA 4NP6A 3TUZC 3TAUA 1ZIPA 1ZVQA 2N1BA 1ESMA 621PA 3EZFA 3ZVLA 1X8KA 3RS7A 1Z6AA 3LBIA 3SJBA 1GNQA 2C8VA 2IT1A 3T5DA 2QE7A 1Z22A 3CCRB 5DE3A 5H8WA 4W5HA 3LBHA 5HE9A 1UAAA 2WJVA 2OCAA 1G17A 3GJXC 2AXNA 4H9GA 4BGDA 1E98A 1NKTA 2QORA 4BFXA 3KL4A 4QL3A 3W8RA 3SI7A 3U7EB 3IHWA 3MMPA 3ZQ6A 1RYFA 3QVVA 4D80A 3R9IA 4PZYA 2V9PA 4LJ5A 1XTIA 1W4BA 1W0JA 1VIAA 2QA5A 1IAQA 2NG1A 4PZZA 4YMVA 3RS2A 2PH1A 1RZ3A
chains in the Genus database with same CATH superfamily
3PFHA 4KWCA 1NLMA 4XYMA 1KAGA 1XELA 4MTLA 4ZREA 1L8LA 4M4SA 1LV8A 5BNFA 1H3EA 2RGRA 4F60A 1CQJB 1JDSA 4H18A 2YYYA 5KQMA 4Z9BA 4EFKA 1I7SB 3GX1A 4PTYA 3OC6A 5DTMA 2WWXA 3VPSA 1NMYA 2CNLA 3HCWA 3MB8A 4MUHA 4DIBA 4QDKA 5DNYB 1A82A 4PZEA 3NASA 4GECA 4KXUA 2A3NA 3OTGA 1T15A 3ZD8A 2HBZA 3SMQA 2XQKA 5E38A 4P7KA 3U9TA 4WOKA 3PD1A 2B8JA 5EKXA 1LQUA 1XEXA 4P84A 5J63A 4BYGA 2JBHA 1OH8A 1ZISA 5JECA 1Y8RB 2VUHB 5F2EA 4TWAA 3OZXA 2OPHA 1W4AA 5AOAA 5HFNA 2O8DB 4PONA 1PD1A 4PCVA 3ISXA 3ZJTA 3RSHA 2R4QA 2EWMA 1JHPA 2J5BA 3FDXA 3R7AA 3VR4A 1M8GA 3VDNB 4XQ0A 2IHNA 3K8ZA 1YJ8A 1YI2B 2XZDA 3VHXB 1SHKA 3C8UA 4M87A 3N8IA 2XA9A 3SXJA 4F1JA 2EKQA 1GCGA 1KPIA 2XWBF 2FJPA 3U6KA 3ITEA 1J8FA 4UD6A 3LIPA 3L4BC 4IV0A 4YRRA 2DPMA 1GAJA 3GCZA 4H0CA 4QUDA 3I12A 4Q66C 2P0EA 3ZKWA 4K88A 4ZT2A 1OGIA 1KJJA 1YHYA 3P0IA 2XGGA 2PUGA 1MGPA 3L0ZA 3B53X 5AHOA 4ZI2A 4TM8A 2HGSA 4K9MA 2O8CB 3WBKA 2BTOA 3LBFA 4ZOEA 3EZXA 3KLBA 1P2GA 2XCRB 1JEEA 1L4FA 1QQ7A 1A1SA 4FMBB 5B37A 3R0JA 3FPLA 4JN6B 3R7LA 1T0PA 2YWEA 4E11A 4MVCA 1M90D 4FDTA 4Y6RA 5IW8A 1GXSA 1T9DA 1NNEA 3S28A 4PSCA 2O8FA 2C5BA 2PK3A 1H2XA 5LU9A 3D8SA 4M1WA 1AMUA 1XWIA 3FKSA 2PZ8A 5JZBA 1D2GA 3VTFA 2VJOA 4MVJH 3KWJA 2X8JA 3OLCX 3VZBA 1FDUA 2R11A 1TJYA 2RGEA 2OECA 3CLVA 4ZZ1A 4CM6A 3JZMA 1HDGO 4UUMA 1ZOSA 4MKIA 5LQKA 3TNDA 1LUAA 4FYMA 1USVA 1X70A 2X5KO 1BS2A 3FCOA 4TPKA 1T0IA 5BRNA 4M83A 1II9A 3RTBA 3II6X 1E7MA 5TPWB 2G6BA 5BR8B 4EQ6B 3JARB 3KUKA 3N7TA 3HU2A 3JD2A 4O4HB 4WZBA 4D4LA 4U7HA 4OATA 4G36A 3JQFA 1XNRB 3ICWA 4WZAB 5T6MA 4CEHB 3OPMA 1IBSA 1HZZC 2VQEB 3TRIA 3DKRA 4RTLA 2OBSA 3WYAA 2FPXA 4LY6A 5CB6A 2Y0DA 3DZIA 1L7XA 2ONCA 3R74A 3JRNA 4QYWA 4MMYB 2OHGA 1FNMA 4FZJA 4NOJA 3UCXA 3UY4A 3IKJA 4UVGA 1EZ4A 2V4UA 1RLTA 2Z5GA 3WGTA 1GA4A 2NVOA 1TRHA 1SULA 2HTEA 2RARA 5A4KA 3D54D 3TRKA 4EJFA 3CVVA 3EEOA 1JLLB 1V7QA 4KDFA 4DNQA 4MEJA 3EDYA 3WGKA 1GUBA 5DM1A 3RTCA 1LBTA 1JDVA 1SCDA 4ERNA 5AW4A 2DFDA 2Q99A 3D02A 2CD7A 1AU9A 3L3BA 5ULLA 4BV3A 1ZMOA 3IKMB 1IWOA 3LKDA 4H1HA 3SQDA 2WZPP 1D8TA 1JHQA 2EU8A 4YGYA 3R3WA 3EX7C 4I50B 5FBZA 4N5NA 3ZJUA 3A36A 1Y89A 4FDMA 4E2XA 2EQAA 2OBXA 2HLHA 3MWLA 3N76A 4L72A 5D5QA 3ILHA 4I0WB 4L3VA 2VPTA 3R6DA 3TOVA 4B6OA 1YOVB 4CCWA 3W8NA 5FRDA 2RHBA 2W11A 3RJ5A 4OI0A 1OFHA 1FNCA 1WSVA 1OWPA 1NLFA 4KV7A 5T64A 4BTLA 1PS9A 3BH6A 5T3YA 3TNFA 2H1HA 1PDOA 3GXBA 1UBGA 3HR7A 3OURA 3KIPA 4DJJA 3BWDD 1DEKA 2X76A 1T2NA 4Q18A 3KQYA 2EW8A 1J39A 1RAFA 4P9NA 4M0LA 5IABA 2GZSA 4RY0A 2Q3LA 3OZ7A 2AEMA 3KXLA 4H35A 1JSLA 3GMSA 4TMVA 1N1DA 3CXRA 1PYOA 4K5QA 4W8OA 4Y0AA 4YCJA 1X1SA 4ZAGA 3WIDA 4KO8A 3U3ZA 1D9XA 1FYFA 3CMEB 2ZJ2A 3G88A 5G1NA 3X1YA 1FSPA 2WI8A 2WP8J 1AS0A 3OIVA 3V1YA 2A94A 5EZQA 1JQJC 1ODFA 3WLKX 4L8WB 1LLFA 3LYHA 4B48A 5EZYF 3WIBA 1GO2A 1QCDA 2BBTA 4BEWA 1ZUWA 2HLPA 3LYUA 2ZRKA 1P5HA 1VJGA 1W0JD 3HGMA 4D8YA 3AUJB 4IRXA 2B8EA 2BGTA 1JDTA 2IXDA 3L6OO 2NMVA 2ZS8A 4XM0A 1XYYA 2KB0A 1DKRA 4I9GA 1GQOA 2GNOA 2Q9AA 4II7A 4Z9AA 5FULA 2KLHA 4CWAA 1QF6A 1NR5A 1MLDA 1D2AA 1GTZA 1XEXB 1WVIA 3AI7A 3H4IA 3OI7A 4PO3X 4A2CA 4BATA 4XFKA 1WR8A 2IIQA 1G2IA 5HX7A 4J0EA 5DVZA 4X93A 2X9NA 3NJ4A 2VKTA 2JLQA 4JI7B 2VDWA 1COWA 5EXSA 4MJ3A 3UHJA 4EW2A 3E1GA 2QD4A 2BMEA 3PC7A 4CM8A 3D6NB 2QGNA 5ARCA 4DSNA 4ER6A 4F1KA 4KR7A 1IK6A 5BYKA 1Z2OX 2FK7A 1QR2A 2VQ3A 3R5HA 4LE2A 1AKVA 4B4WA 1N08A 4BWGA 1JU3A 4XFJA 5BW8A 1WXXA 4F92B 2D74A 4C0WA 1FSZA 1YI0A 2NLOA 1CETA 1KJQA 2JHFA 2H52A 2VUIB 3DTVA 3EAQA 3M49A 3IQDB 1DDOA 3ZKWB 4I4TF 2B0JA 2VYVD 3BXGA 4PYQA 1EQUA 2JCGA 2B1RA 1SOMA 5I51A 1OTYA 4RCYA 4ZAZA 3E5NA 3JZAA 4ACAA 4DMMA 4PYOA 4ENSA 2IJGX 1F3OA 1MG0A 2FF7A 3UENA 4M0UA 4MW9A 3HCAA 3T1NA 3K8OE 3LWNA 4WSOA 3WKAA 4B9EA 4CPDA 4CUKA 1XALA 2VBIA 2ZBFA 4CV2A 4ROXA 4QU8A 1T6ZA 1F1JA 1O95A 1RRFA 4RJKA 3Q5GA 1EWKA 3B9BA 1BX1A 2GNPA 3HKEA 5L3QA 1YR8A 1M7HA 4TT3D 2FPUA 3PP8A 2QX7A 5JU6A 4UCFA 2O8FB 3V4VB 1SD1A 3I3SR 3JWIA 4DV6B 3L4EA 1BW9A 4EX6A 1IWPB 3AWIA 5CVVA 4BNWA 1JFFB 5C8DA 1C3JA 1WUTA 1Y9EA 5EA2A 3GLKA 2I8AA 2PZMA 1N0WA 4NZMA 2W6JD 1KS2A 3WRXA 2X8JB 2SNIE 2VDVE 1PZMA 1I5OA 5F5LA 1XWFA 3Q9SA 1OXTA 3LFTA 4QFMA 3OF3A 1QBKC 3PTLA 4WJZA 2C57A 4MVYA 4RVSA 3P19A 3UWKA 2VDPB 5IT4A 4WZAE 3RGWS 4Z51A 1AGNA 5LZ4A 2G8LA 5D3QA 5CAEB 3MIIA 2CNBA 1VE5A 2G07A 2OKGA 2BVNA 4GZ3A 5KYUA 4G63A 2ECPA 2O5VA 3ZI7A 3CF6R 5IDYA 3NWPA 3HB9A 4MWDA 2EGGA 1W73A 4RGBA 5MGBA 1YB2A 1VPVA 3DAPA 1KZ9A 2P6MA 4RS3A 1YRAA 2CNWD 3E27A 4PX9A 4ZVLA 5JFGA 2OLKA 5I9MA 1RWOA 1S2MA 3WLLA 4MO2A 1K9MD 5F3RA 5K0CA 2BTQA 4LZZA 2QUKA 3QOYA 1MIOA 1RYYA 4X60A 4A9AA 3TGPA 2I80A 1WHTA 3IQEA 3KQTA 4NV3A 2V6IA 1BQ3A 10MHA 1ULSA 1AXEA 4HC4A 4RO0A 3KEMA 3A10A 3PC8C 3D6FA 3ECSA 5KYXB 1KSGA 1QO0D 2NN3C 1U2GA 3H5AA 3KT8A 1CZRA 4LDJA 4W8GA 4RMJA 3Q8LA 1P0QA 1S1MA 1XLWA 4D9MA 2HIHA 1JRLA 2XPCA 3F6SA 4ZYTA 4HMQA 3FROA 4ZC8A 2WSIA 2FSPA 1J0BA 2UAGA 1HYBA 3EIFA 1AUPA 4WXPA 3V7AA 1R6XA 2CVHA 4E0FA 4ARUA 1XP5A 2M32A 3JQEA 5J35A 3QVOA 2JH3A 2ZIFA 3AR6A 3MTBA 2OC9A 2FR8A 3BHIA 3IPLA 4IVRA 4J75A 2GEFA 2H4FA 1MX5A 1EFCA 2V74B 3EMVA 4C3UA 1XF1A 1A76A 1LWNA 2IA5A 5IM5A 2QRMA 5FTLA 1YE3A 2VPPA 3QWAA 1SVOA 1UXGA 1V16B 1RI2A 1ZHFA 2Z6QA 5JWOA 2DUWA 3U37A 4JJ4A 2E55A 3QU4A 3JYHA 1Z68A 4C21A 2HQSA 2ODAA 2NYRA 3BM5A 5FBQB 1K4YA 4XWYA 1ZRHA 2AS0A 3D43A 3GZTB 4MUGA 4QRHA 4WDQA 1DEAA 1P60A 1M8JA 4RYDA 4DIOA 4B7AA 2I91A 3EC2A 1PSWA 4Z4TA 2I3DA 2ZYIA 4TMXA 3BAZA 1Q20A 3A4LA 3CZQA 3DMYA 4ILEA 3WL5A 3GPCA 4YN3A 4G5OA 4PCAA 3O6VA 4MPTA 4PQYA 3L46A 3NCTA 2XITA 3R6KA 3H1EA 1PZNA 1S8AA 3F71A 2A8YA 1GKUB 1MOZA 2GJAA 3PB3A 3RTDA 4RHEA 4JYMA 1C0KA 3SZ3A 1CUAA 2NO9A 3AVVA 2QZ4A 3P20A 4GNKA 6AT1A 4M0CA 1C80A 4TL9A 2PUTA 4YNBA 2NUPA 2CNDA 1OE0A 1F5NA 4H59A 3TW6A 2CFCA 3R7SA 1U28A 4PBRA 2TSYB 2H4YA 1JHOA 2NV6A 2VJMA 3F3SA 1MOQA 3IBSA 4GM0A 4TTSA 4IEEA 5ALUA 1G6OA 2CEKA 2KLBA 4EY7A 2RONA 3UQYS 5CLFA 2PL3A 2H1CA 4F8EA 1O0CA 1WVMA 3PC3A 4JGGA 5AMXA 2X0FA 1QG4A 3L4JA 3NKVA 2EAUA 3PUNA 1L6RA 3FM9A 3BX1A 3ASQA 1GLVA 2HO5A 1DWOA 1U6KA 4QULA 2XGOA 4QQ8A 3SF0A 4WGGA 3NHKA 5EERA 1G7TA 3WQRA 5JTUA 2FWNA 4CM8B 3C5WP 3KSAC 1AKQA 1C0EA 2C59A 2W2KB 1IXRC 5KNDA 3BFKA 3RUHA 3KAKA 4FHDA 1GQFA 5ADVA 1SHJA 2QL9A 3J81k 4RJIA 4D8VA 1LS1A 1SCBA 4JVOA 1EZ1A 4P1VA 1ZCJA 4JUAA 4LQLA 1RKXA 1DRVA 2GPAA 2P7IA 2QM3A 3DTVB 3HN2A 2XE7A 3LPLA 1Y1LA 4KEAA 4QBIA 4ADSG 4DA0A 4A0FA 4B8WA 3PQ8A 4G1EB 3SG0A 3PXEA 1BHQ1 1PK8A 5D01A 5F7JA 5A5GA 4CIWA 4IDNA 3QH4A 2P9CA 5B4VA 4LY3A 3A6DA 3GFBA 5IU6A 4BCBA 1E6LA 2RHLA 2WPNA 4TYQA 1PGQA 1XA0A 3FVQA 4PFKA 5CURA 4GI3A 4J07A 1YXMA 2X58A 3GCDA 3M7IA 4J0KA 4ZGBA 1P4SA 2Z09A 4XD2A 1F6BA 4C2UA 4DS3A 1Z07A 1XEFA 3QOWA 3MERA 2IYEA 4G0WA 4CNBA 3DP9A 3RVMA 1DJLA 1FP4B 2A1TS 2E4UA 4DUGA 5IYZA 4FXUA 2A86A 2GKSA 3JAKA 3HKEB 3MJFA 3ZKAA 3FUXA 3ZIAD 2E5WA 3K73O 3U7FB 4MIEA 3KDSE 4GG1A 2WPDD 4XXHA 1AN0A 1BW9B 3HU1A 3A2NA 1G1MA 4QUBA 1YJBA 3IODA 3A6ZA 1E3IA 2ZVJA 2M98A 4I19A 4Q3CA 1NW6A 1C1DA 3TJRA 5LZ2A 3N7UA 5K1ZA 1EG7A 1ZK4A 3TZKA 4DLAA 1BCSA 1T34A 1BN7A 1Q5PA 2OCLA 4UNPA 1MTZA 5G0SA 4ZV4A 4HYYA 3QVWA 1TCCA 2NVWA 5BOSA 4FM9A 3DEKA 3EIQA 1GNRA 3KHKA 4XGKA 1RE0A 3FYHA 2WWYA 2B94A 4RZIA 1Y3AA 2PYDA 2VJYA 4A6EA 1MX3A 3PUXA 2FW8A 5JS7A 3OCUA 2IDZA 4NF2A 4BEVA 4HNVA 5KYUB 2J5QA 3TAXA 5IT9A 1NJ1A 3E7XA 2ZZMA 3WBFA 5I7FA 1VBNA 1J2RA 2EP7A 2XH8A 3JTMA 1ZJZA 4R9VA 5CFMA 3Q3GE 5HIIA 4D3SA 4WK4B 4V1CI 2P69A 2IS1A 2PM8A 2PZKA 4G0ZA 3C3PA 2FB9A 3L7KA 4ALIA 3EVDA 2J0SA 2NPFA 5MDHA 2X8BA 3PT5A 2IQIA 3A1UA 3EXIA 4TRNA 1P1JA 1E1RD 4QPPA 3EPKA 2BTQB 2X8LA 4P2NA 1KSJA 3AEUB 1MIOB 1ODTC 3GJ0A 5JAUA 3GVLA 3HVKA 5JNLA 2IBSA 4ENTA 3TF5A 4DF3A 2P79A 4E14A 2H4XA 3UT0A 2GEKA 2VF8A 1RXIA 2LTAA 4TMTA 4Q1CA 1UBTS 2JGLA 4XUCA 3UZUA 3PDHA 2Q4TA 4JR2A 5ALKA 1FFDA 3V8MA 1EFTA 4S3MA 5L45A 1KEWA 2QVCA 3E48A 3F6EX 2D2EA 4RKRA 1M66A 1PJ4A 1GZDA 1QCYA 2XUIA 2YZMA 3A32A 5COAA 2WIAA 4C0AC 1ZJ5A 2J3HA 2PV0A 2R6DA 1KAHA 1P0PA 1U2QA 3BB1A 3C4VA 1UQTA 3B6EA 3DOFA 3HJHA 1GZHB 1VB3A 3TG8A 3VDXA 3DOHA 4EI8A 3DXZA 4YRKA 1BN6A 3RROA 5FFMA 1Q11A 4RD0A 1B4DA 2HH9A 2RGYA 5FADA 5CH5A 3NM6B 1CUDA 4FD2A 2WVJA 2JVJA 1OX4A 4OPSA 5DYTA 1I4OA 1XTRA 1EE9A 4IKEA 1RXSA 1XUOA 2VP9A 5EMMA 3W2HA 2PL9A 3DHWC 4AUNA 4E7OA 2VS1A 3WJ1A 5D5HA 5M29A 1C41A 4YLEA 5K3BA 4XUDA 5G53C 5KCZA 2WAOA 1J09A 3NV9A 3W1WA 5JJ5A 4BIMA 4G1CA 2XECA 3SC2A 4BMDA 3BULA 3JVVA 3LX6A 5AVSA 3ZLBA 3I2GA 3ANXA 4RM3A 4WWVA 2AOWA 1AZLA 4LNUA 5AICA 4JC0A 3O84A 3RK0A 4D1YA 4DSOA 1KJWA 2HZBA 3KHUA 1BQ4A 1ORVA 5DF1A 1P4RA 1K0UA 1YKFA 3JD4A 5HW0A 3KSBC 4XJVA 3RHSA 1CC1S 4E88A 2F8SA 2ZFUA 3QU2A 4OBWA 5A7FA 2YDXA 3DOUA 3B3QA 4NV1A 4WCVA 5AK0A 2CXQA 4YP6A 4D6PA 2F1OA 3QPVA 3DBHA 1XAHA 5JH7A 3AGQA 3HWSA 3JRXA 2WU8A 5FV4A 4P7FA 2VJMB 1I80A 1KFJB 1PKVA 3QXCA 4K40A 2Q3EA 3N7AA 3ERCA 2JFXA 3VNBA 1R6AA 4X84A 1JIIA 2XKBA 3NIGB 4YJ2F 5C34B 2Q21A 2PUAA 4AS1A 3ZHVA 4F0JA 4EHFA 3FAZA 2WLTA 2IWRA 1YZGA 3WGUA 2O8EA 1AA6A 1LS6A 3Q3VA 3ZU3A 4RAQA 3IE1A 2YBDA 1D1NA 3A3NA 2ZE5A 4XSVA 2R3SA 3B5JA 4V38A 4BN0A 2R4UA 5J4YA 4KBFA 5CD1A 4IIFA 3CC7B 5EMJA 4EPRA 4IJMA 2C2WA 2I67A 1E9DA 3AMVA 3D6UA 1JDBB 1E9BA 2W42A 1YA4A 1PEKE 3JW8A 1QWOA 2AV6A 5A4IS 3SQNA 4F6RA 3CLTC 1E63A 4GI5A 3G2KA 4DXDA 1SPXA 3QELB 3U7GA 4AJ4A 1E1KA 3M6IA 4LMPA 2E9SA 3DE5X 3SOPA 2JCVA 5EWLA 3HBJA 1OH5A 3C4JA 4DEYA 2HW8A 2P9QA 3LZCA 4NICA 1TVKA 1ZOLA 5CB4A 1PFQA 4L78A 4JNCA 4B3HA 1YB5A 2VATA 4U8GA 1PIWA 3U3MA 4QYTA 3VPFA 1A8UA 4BNJA 4H7DA 4LRUA 3ID6C 2VK1A 1R74A 2A5GA 2E0IA 2GCPA 2BKEA 1XSEA 2YWBA 3JQGA 1QJCA 2J45A 4ZAVA 3LYLA 3DDZX 2A9JA 4RZ3A 1L7PA 5IYZB 5K3SA 5TIIA 1MA3A 3FPPA 1QYIA 3Q12A 2VNIA 3GMTA 4NFLA 5ABPA 1I7LA 2NNLD 2REXB 4XLHA 4ND1A 1ZGAA 2Y4NA 1Z0UA 3HBFA 2F7SA 1DQYA 2JCSA 4MRMA 1EM8B 4PIMA 5LU8A 1N57A 1VE6A 1UZUA 2BM0A 2I4TA 6GPBA 5CBPA 2H18A 3KR2A 4B33A 3DDYA 2ZR8A 1BCSB 2H9AA 3IUMA 3LLSA 3P26A 1AZWA 4K9SA 4EECA 5LLTA 4TM7A 3WAJA 1FX0B 4HVCA 3RU7A 1JBQA 4EZBA 3R5FA 3ZCXA 5D86A 4ML3A 1ORHA 1XMJA 4K6GA 5K6AA 3OCXA 2EJVA 2W4IA 3K0KA 1PW5A 3I61A 2J85A 2WABA 2X1HA 1G3RA 2X85A 2XMZA 2JJMA 4I4CA 3Q6MA 5ESWA 4BO4A 3EVFA 5C7IO 2YRXA 3NJRA 1QGDA 1E1QD 2RI1A 3PHIA 3PEEA 3FMPB 2JHAA 4R16A 5LL6P 1DBWA 4WNCA 4XSGA 5C5DA 4OI2A 5DHQA 5G0VA 2F8LA 2HGZA 1KC8D 1Z4PX 3B8EA 5B6JA 1JPNA 4BY9E 1BX3A 1H8ED 2KSQA 3ADPA 3BL6A 3K32A 5L3RA 2I7TA 1WCWA 1GGKA 2Z4TA 1Q81D 1AM4D 1V7CA 3QF4B 2OCIA 1Z7WA 2XHEA 3GUHA 4MCAA 1BCRA 3PEVA 5AVUA 2AZXA 3H2JA 2XE8A 2XOEA 2WWHA 1F7VA 1VKJA 4MKXA 5HJ5A 4NU0A 2BI4A 4CKYA 1QGUB 4MYDA 3RHFA 5LYJF 5I8PA 1UJ4A 1T9GS 4BV8A 5C46F 3L0CA 1HNZB 4F4HA 1S3GA 5C9ZA 1CUEA 1SEVA 2O2EA 1DBRA 2Q6KA 2HNBA 2DFLA 1O4WA 4LHXA 1GPMA 2JGJA 4HWKA 5JSKA 2VTBA 4B3SB 3G4SB 4J1NA 2HSZA 1IBLB 3UV6A 2Z57A 4JKOA 1DLIA 1T8TA 3L0DA 2FMTA 2UUCB 4KE7A 3TDKA 3F7OA 4BNKA 2DZDA 1VP9A 1M75A 2GD6A 4KE9A 1VE1A 2ANBA 4EHBA 1X39A 1E7YA 4WL0A 3RC1A 4WJLA 4FSXA 4JI8B 4D82A 1O0BA 4KKVA 1HOXA 4PRLA 3NATA 3NX4A 2ZZEA 1C3OA 3A27A 1DZ3A 2WFAA 1MAAA 3PE6A 2L82A 2BFDA 2H1IA 2O8VA 2VNSA 1XD9A 4KE8A 1GNLA 3LBYA 4OJQA 1YE5A 4H6PA 4HLUA 2MCFA 3R76A 3RVKA 3C5EA 3JQFC 1AQ6A 1VJ1A 4HLCA 3Q7EA 4L6IA 2R7LA 2WMOB 3QPCA 4JJKA 4PHTA 4MWOA 4URHA 2I1WA 3SC2B 1GU0A 3SZOA 3NALA 4NOMA 3FDFA 2Z2JA 3VI4B 1YRLA 2WZNA 4LNHA 2W2LD 1APBA 3AQ4A 4LNUB 2DLCX 2Q8QA 2KMLA 4MZDA 4YCLA 2FSFA 3CB2A 2E49A 4HOYA 3GLIA 4HB4A 4G5HA 3AY7A 3CZPA 4J94A 1QB8A 4QQNA 4GMGA 3FF4A 1RS0A 3DBHB 1EJ2A 1T1SA 1FUUA 1WA5A 2GILA 4M9CA 4ZO7A 4EA9A 5JH7B 1HDEA 3KP1A 3PNBA 1N78A 1ZR2A 1PCXA 4G7WA 3NC4A 5JMPA 3QJGA 2Y9MB 1F0NA 1CDDA 3D2CA 1M6EX 3GBVA 4BP8A 3OHPA 3TLZA 1HI9A 1RR6A 4PS0A 3WLNA 1J2JA 4GPZA 2P67A 5C52B 3UGKA 2O8EB 3AEQA 2I2FA 1TA4A 2IXTA 2EFGA 3PFGA 2C1EA 3DTTA 1NX9A 4B83A 2FH5B 2O06A 2ZI7A 1Y1TA 1TC2A 4JUIA 4BZWA 5CVTA 1ZO8A 1QCZA 1JYEA 1N3YA 3O90A 5IVDA 5A1JA 2WTBA 1UPTA 5EZ6B 4Y2UA 4DTIA 2DBQA 2EFHB 4LEIA 5FR2A 2W0MA 4K86A 4D45A 5K8LA 2LKDA 2ZYDA 4IWNA 4MAAA 5HM6A 4XVUA 4X8MA 3UC9A 3Q5EA 5I47A 2O54A 2GZHA 3AF3A 1CS0B 3T0IA 4KXQA 4Y98A 2OBBA 5FUMA 1GAXA 2HO4A 4Q6BA 2BFAA 1ZGZA 3V4ZA 3ZGVA 1FDRA 2O1XA 1U5CA 2RKOA 5CRIA 5CB4B 5KMGA 1TM1E 4DA8A 3EOAI 2QM8A 4C7XA 2VPZA 3GUZA 1AN9A 3KYDA 4AIRA 4XIFA 2IODA 3P5SA 4W5OA 1W1WA 1FVOA 1DO2A 4TTJA 2C7VA 5CIWA 5KSPA 4XA8A 1QRSA 1E99A 2PO5A 4G0VA 3VU3A 2YZ7A 5BWLA 5EEHA 4WJKB 3A1PA 3IOYA 2C9OA 1YS4A 4AK9A 4MIOA 4AKEA 2R7KA 2ZYWX 3WMGA 1RHMA 1N8NA 1KIFA 1M2EA 2C3YA 1CQXA 3ANNA 4BVJA 1E69A 1QVFB 4WK2B 1VG1A 1Y6RA 4YCBA 5K7SA 3U4DA 5MF6A 3M81A 4GEGA 4OHMA 1X74A 2C2HA 4MRMB 4O4LF 5E3JA 5JIBA 4COOA 5ITSA 3ISTA 1Y6JA 4EHNA 5CBPB 4W1PA 4Z4WA 1EUZA 3C3AA 2FCAA 3ZX4A 4BQOA 3K3PA 5JAHA 5FTKA 3DE1X 2WY2D 2OBNA 2JANA 1B6TA 1JQKA 1N2OA 2D3WA 3EAFA 3UUEA 4A1FA 2VJIA 1GUFA 1IG0A 3B12A 4J2TA 3I6IA 3KQQA 2R1TA 1KPGA 1GKLA 4JB0A 4RVOA 3WYNA 2ZCUA 4M0PA 4K7JA 2X3YA 4HGPA 5E6RA 5FEMA 5HFJA 4ARSA 2CXXA 3L6RA 4HLDA 3FOCA 1VCMA 4Z3OA 1K2VN 1P9WA 2I76A 2CJWA 3AHCA 4RX1A 4X8OA 2HA3A 5FWYB 4ABYA 2XV1A 2YV1A 3AJEA 5U4XA 2QT1A 3HI4A 4J3JA 3ZZ1A 1WSDA 3CLSC 4Q03A 4BZXA 1E6CA 3AR3A 3A6PC 1RCUA 2UYCA 3Q98A 1H2FA 4RLSA 3VU9A 4BFCA 2O2DA 3DDNA 5E7MA 4CFYA 1K66A 1KQFA 2QAGC 4RIGA 5CCEA 3HR4A 4LYFA 4YROA 3NRCA 5GZ3A 1CF9A 1XHFA 4DCGA 1A8PA 4IIBA 2GAOA 1YJWB 1BCRB 1L9XA 1VQKB 2Q4DA 2XBUA 4LBVA 3M6VA 3E9CA 5DRTA 1VI5A 1TTQB 4AZWA 3G17A 2ZYAA 1XJCA 1Y1RA 5BWMA 3CLTD 3Q6IA 5CTAA 1CJKC 5FDFA 1O95C 4D9NA 5CR9A 5AW6A 3K1JA 2BSXA 2IITA 2BGIA 1LVGA 3MCWA 1YQWA 2EEZA 2O2ZA 2ZE6A 5ITVA 5LA6F 7ABPA 5DH9A 5HMLA 3T5PA 2UZ0A 4NPCA 4KKSA 2G77B 4KGVA 1Z2DA 2FPPA 5IDVA 3RG8A 1G59A 1NW9B 2JGFA 3TO5A 2J07A 2C3PA 1Q0SA 2JASA 3E4CA 2O19A 3AI1A 4DVGA 2C0CA 2B8TA 3EF1A 2LRHA 3UMCA 5DX0A 5JMOA 5M2QA 1G9XA 1GRNA 1MNAA 3A6FA 3TE7A 3TUJC 3IRVA 1PFYA 4NCKA 3TGLA 5ERYA 3VU0A 2XNCA 3VDRA 4CZ2A 5A1TA 2YXBA 2AG8A 2NV2B 2DPHA 1H1TA 3LCCA 2BFDB 4UATA 3AC0A 3OD1A 3X2SA 1CBUA 1YB4A 5K4HA 3KVOA 2ZBPA 2PSFA 2HJVA 2MSKA 4FBGA 4TOIA 1AF7A 5CT9A 3TMAA 3ANTA 4NAUA 3KZNA 2WM3A 1JR3D 2WJZB 4F6LA 1HFKA 5DW0A 5EGNA 2RHDA 3QKSA 4KVFA 2OWDA 5CMLA 3VKFA 4CT0A 2C61A 1QYXA 4NJMB 1VSUA 2ZATA 1VCIA 3CUYA 4UHCA 4Z9XA 5KX5B 3JWPA 4QVKA 1KTIA 4KXWA 4CUZA 4N8DA 1IJKA 2DB3A 2A0WA 4LYYA 2FZLA 2H1WA 3KOYA 3USCS 4GGPA 2XB4A 3AF1A 1JG7A 1SKBA 5JOQA 3OTHA 3IV7A 4TWRA 1NMSA 3JATA 3B6MA 5CDHA 4PSVA 2V3CC 5CLHA 2P4SA 5P8WA 4LYDA 5H1YA 3WMEA 1DC4A 2JEYA 1DNPA 1TK3A 2VYNA 3NYRA 5D8DA 5FAKA 4JBLA 3THSA 3SBEA 3SD7A 5L3ZA 1TU0A 2E37A 3BRSA 5E7IA 4Y9DA 1C9DB 2Y76A 1UQRA 4J9UE 3GVPA 3DR3A 3ND8A 3TRFA 3WL4A 3WSVA 4UNRA 3H4MA 1SWWA 2B5WA 2Q0QA 1SBQA 5CXSA 1Z6PA 3ZDRA 4YJGA 2D0IA 4RXMA 2I7XA 4JVMA 3KXKA 3RVPA 4QE3A 2Z4SA 3E1KA 4MI1A 5KEIA 3HCDA 6ABPA 1K8QA 3SXUA 5J2UA 1GL7A 1U3VA 2C4UA 4B4OA 3G5LA 3PC6A 4MP3A 1BRMA 1UK8A 1E6UA 4H7KA 1THMA 4Y2HA 1T9ZA 3TQHA 3WP1B 5CDSA 5KMGB 4ZOLF 3ABSB 13PKA 5A05A 2SHKA 4HVTA 4ZAXA 1WSBA 1T4MA 3IUPA 3PG5A 1T9HA 1JYFA 5KWSA 1TPYA 5SZKB 1VQ5B 4ITVA 4RDJA 1B74A 1XN4A 1XZMA 1IB0A 1O3YA 3W7AA 5JWRA 3SQMA 1SKQA 5JXIA 3A6EA 4DGQA 3N3AC 1RRVA 1SBZA 1ZU4A 2C4NA 2AC7A 1GCIA 2HU7A 3I5UA 3LRTA 1RD4A 4U2EA 4W9NA 4GVLA 1U28C 3O7MA 3HY6A 2F9MA 2EL9A 4MICA 3RG2A 1ZN8A 3OY7A 3N07A 4XIGS 1GZ3A 3FVVA 2G04A 4Q39A 1JG2A 1MQ8B 5F76A 5JC8A 1GEEA 4M9SA 2NZ8A 1EA7A 3MJRA 1AK9A 1H0KA 2ZGVA 1IM8A 1F8FA 3C8MA 2IRWA 4FUQA 2A9KA 2CLFB 3ZVRA 5ALJA 2R1TB 4B2LA 1JMVA 1RPZA 1HX7A 5E6RB 4C06A 3MJTA 1K63A 4CT5A 1TF2A 1XRMA 4XDZA 4ZYYA 1IVYA 5A03A 1CRZA 2C4VA 1T3TA 1MA0A 2VCEA 2C4WA 1JDBC 1RE1A 2NSLA 5DRYA 2QUHA 1QU2A 3S8MA 3EDCA 3S3TA 3LMKA 3PHJA 3DMPA 4EO4A 4IS2A 2EKZA 3ADOA 3L02A 4DR6B 4H3HB 1KF0A 3ZHSA 3AQIA 2CJPA 2GPTA 4PLCA 3SGLA 1T2DA 3P2KA 2Z2ZA 1U80A 1YQ9A 1HDXA 1WXDA 4R8RA 3FCEA 2ZBVA 3DO8A 1VMIA 2QUBA 2D2XA 4KYVA 4JC5A 4LXTA 3DL2A 1KKMA 3DHNA 2IUSA 3BGWA 1KC3A 3GEHA 5IVIA 4EDFA 2HK6A 3NAMA 1YDEA 2XQIA 4S1NA 3AEXA 1UDRA 3P96A 4O5OA 4M38A 5KYYA 1J8DA 2CT8A 2AEEA 4NBRA 4ZQHA 1R6TA 4TYYA 1J6UA 1FMJA 1I10A 2P5UA 2VDMB 3LK7A 1MVNA 3THOA 5LLDA 1SVIA 4R1LA 1G2OA 1XQXA 5DLQC 4D3XA 4MO9A 4Y1EA 5K0FA 3PUMA 4N76A 5CJJA 2FWAA 4D46A 1XR3A 3K1YA 2XAUA 1BMFA 1B0PA 2VTEA 1NGSA 3EZ2A 5B4UA 1B41A 4EVRA 2IP1A 2W22A 3WQSB 5HILA 4CGZA 4Y3UA 2ZKLA 3MGCA 1JAXA 1N4AA 2PJRA 1T35A 1FTNA 1RM4A 3FIJA 3TEFA 2YKGA 3TD6A 3CRRA 4RDXA 1A4UA 5IS2A 4WFIA 2J87A 4KXNA 3C70A 1MKYA 3BD6A 4DIDA 1SELA 2IHUA 1UBEA 3S2UA 4RV5A 5FL3A 2PN1A 3Q7TA 4KAFA 4FKZA 2VHUA 4IDGA 1AB5A 1V6SA