4M4SA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in complex with gdp and formate ion mimic aif2gamma*gdp*pi complex (a formate ion substitutes for pi)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSADVNAPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIAFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 108
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m4sA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m4sA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m4sA01
1X1RA 3C7KA 5L3RA 4DCNA 2DYKA 4JVMA 5HKKD 1JECA 3QIAA 4B2IA 2GVZC 1W46A 4OHXA 4CDGA 4Q03A 3IKJA 1XCPA 3LQRA 2JLRA 4F4JA 2YOFA 1Z29A 4TYNA 3GLFA 4JLMA 2YKGA 4TZ0A 4B2LA 1G5TA 2H17A 3W5HA 2XB2A 1G7TA 3W5VA 1Z22A 3AVQA 4LJYA 1RRFA 4XSHA 3GLIA 1BH2A 2ODBA 4MUAA 5D3MB 4IEIA 2QI9C 2H5EA 4YXWD 3AQ4A 1NSFA 1ODFA 3L0IB 4OQFA 1E0AA 4J0QA 1YZLA 4B3XA 4MGIR 4D81A 2J0UB 4US0R 2FDCA 2ZRGA 3AF0A 1P2UA 2WAXA 2C96A 4TL9A 4KLNA 5IRCD 4PO9A 1QFYA 1HY3A 4R2HA 3GQBA 2F3RA 1NJFA 3KJEA 1FX0A 2B92A 4TTRA 2PT5A 5BYKA 3QBVA 1CXZA 1KO8A 2DWQA 2DFNA 5CLLA 1F2TB 4LDJA 4DZZA 1TQDA 4E5UA 1ZM7A 2FEOA 1NBME 3IEUA 1OB5A 5GADl 1XD9A 3T06B 3K70C 2GEDA 4GOJA 2VRWA 2XTNA 3QF7A 3EC1A 3IPYA 1TADA 2XNDD 3J81k 1F2UA 2QGZA 3W2HA 2VEDA 3TSWA 4OHYA 3C16C 1F6BA 1UKYA 3DOFA 3CPEA 2ZROA 4U9UA 4NP6A 1AS3A 4UQOA 1NRJB 2ZJ2A 3Q7QA 3TSOA 1S8FA 2O8BA 4ZKDA 2Q0HA 5BN5A 4LUCA 5EZ6B 1J90A 3C14C 4EUNA 2GJAA 5FA6A 3D7MA 3GJ6A 3IO3A 4HDCA 4WZAE 3SJBA 2H1LA 5EXTA 2I1VB 4CGZA 3E70C 2QTHA 1DELA 5KTYA 5KNCA 3U3RA 2D4HA 2XTMA 2CEAA 2DFTA 2P3SA 2J0UA 1XZQA 2ZSFA 5HCIA 4IOKA 2ZS8A 4Q9JA 1MABB 4JZKA 4C30A 3QEJA 5FBQB 2VP9A 3R7WB 3IHLA 3TUIC 2ZXUA 4P33A 4HE6A 3GFTA 1AMOA 4JKIA 4R98A 4DWJA 4Q9LA 1JJ7A 2VSOA 1QRAA 4JT4A 1D5CA 4EPTA 5B58C 4Q7LA 4L8GA 2GJSA 2ZITA 3ZD7A 4PGOA 2QTZA 3E2IA 1X3SA 1CEEA 4O3MA 1ZNYA 4DCSA 2GPJA 2YINC 1XWIA 3P4YA 4BPRA 2IEYA 2IYVA 1XEWY 2PEYA 1D9XA 1UDXA 2ZRBA 4FW9A 3IGFA 5FOWA 1AN0A 4A9AA 1DAMA 4B3BA 2ZUBA 4LJ6A 3BJIC 8OHMA 3SZRA 3MFYA 2IF0A 2WOOA 2ZJYA 3QFSA 4M4SA 2NO7A 3DO6A 2ZVPX 4CRWB 1AA9A 3GLFE 3TQCA 1YR6A 1RFLA 2QAGC 1R0YA 1TLLA 3RVBA 3K0FB 3RNLA 1RJ9A 3NWJA 4D82A 1ZU5A 5ELXA 5JJLA 1AZSC 1Q12A 4BFUA 1DAHA 1KI8A 1NY5A 4EPYA 1QUFA 2OCYC 4L16A 3CZQA 1GDDA 1N6PA 3GLIE 4JLNA 2GF0A 3TGPA 1J2JA 1Y3AA 4V0ME 4EKDA 3O8RA 1CULC 1VCMA 1Q82D 3VR2A 2ZE8A 4WXRA 4OI0A 2A78A 1U98A 1FZQA 1OXSC 3R7WA 1I2DA 3B6EA 4QFMA 3W90A 5A5GA 3T35A 3VAAA 2R62A 4YAOA 2OCBA 1T9HA 4QOSA 3CR7A 2D06A 4RVCA 1V5WA 2QP9X 4BZPA 3DZDA 3ETLA 3TIFA 4A2QA 2QTFA 5DO9A 3T5GA 4ERNA 1HH4A 1EP2B 3CRVA 3PEUA 4TTQA 3QVUA 4NYIQ 2ZRFA 1Z47A 2G3YA 4W5HA 4WW0A 2NZJA 3ZBTA 1L4UA 2BSAA 3QXHA 5SZHB 2Z4SA 1YJNB 5UKDA 2RC5A 3AV0B 4KFTA 1YJ9B 1NN1A 3RYTC 3CIOA 5IHPA 1JEEA 1OXUA 3QVVA 3WP0A 3V9PA 5DIFA 4CEHB 1G18A 121PA 4M0LA 4QXAA 4MRNA 4V0KA 3AVXA 1DDGA 1E9RA 4WOPA 3UWKA 1GO2A 1ZCAA 2A7QA 5GJCA 2HT1A 4WBSA 3FWYA 1H85A 3LA6A 2KSQA 1Y63A 3EA0A 5AJYA 3MWYW 1Q1ZA 2ORWA 4JLJA 3CF2A 3K1JA 3LX5A 3AF4A 4NYJQ 4TQAA 1A1VA 1QFZA 4EPXA 1VQLB 3HU1A 3P1JA 1X8JA 3ZS9A 4P6VF 2GBLA 3C5CA 1IJEA 4QNRA 3X1DA 1YRBA 1ZM3A 4QHSA 3CC2B 1WQ1R 1Q22A 4ZI3A 1QVGB 4UNPA 2XITA 5FFMA 4QBFA 4Q02A 2JLXA 4LRWA 1XPUA 1VYUA 3CF6R 2KBEA 3E1SA 3CKLA 2Q6TA 4C0LA 4AD8A 2FFAA 1MO6A 1KO1A 2GHIA 3GLHB 5J4VA 4N0DA 4B32A 1W34A 3DL0A 2JA1A 5TVKA 4K81B 1AK2A 2AKYA 3M1IA 4KYIB 4GI7A 2PCJA 2ZE7A 1UEIA 3TW4A 5C46F 1UBGA 3QKTA 4BFYA 5GV8A 1N5KA 3W6NA 4EJSC 3RRYA 1KK3A 4ON9A 3KKMA 1A2BA 2CDNA 1J9ZA 5KDLA 4IXMA 4LZZA 2YNMA 4CEHA 1VIYA 1IY0A 1HQYE 2CHGA 2ZYUX 1OIXA 5K8LA 3THWB 1SKQA 1T8TA 2Q9AA 2BPOA 1L7VC 1Z6XA 4B76A 1SHKA 2PH1A 5E7MA 2GXQA 2ATVA 2W6ID 4UNNA 4HLUA 2G0NA 5SZKB 3RANA 3SYKA 4E22A 3VKHA 3F3YA 4R7ZA 4CF7A 4DDWA 2QGNA 4U02A 5B64A 3B78A 2WJJA 1N25A 3JQPA 4HI0E 1VQ7B 4HLDA 1KOFA 1P73A 1U9IA 3I8XA 4DSUA 4JBYA 1IN8A 4C0KA 1Z6TA 3OIUA 4B75A 3PVSA 1E2LA 5A4JA 3WYAA 4ILEA 1XE1A 4N3GA 3C5HA 1N6KA 4W5JA 1NKTA 3W5IA 2B7BA 3LO5A 2QG6A 1OH5A 4DDUA 3GLHA 4A4DA 3GJ8A 3BERA 1P9WA 3UWOA 3WXMA 4BFWA 4QJ5A 2IXFA 4WA7A 3IQWA 4G1BA 2XZPA 2F55A 2NG1A 2BEKA 1S3GA 3W8RA 2R6CA 2QE7A 1JPNA 2VBCA 1HV8A 2ZJBA 5AUOB 3WMEA 1XB2A 4HZIA 1GL7A 2VF7A 4FI3C 1W48A 2IYUA 2KE5A 1FTSA 6Q21A 2BHRA 3WNDA 4QC2A 2FOLA 2WWFA 4AY2A 4PX9A 3C8UA 1FUUA 3CNOA 3EWSA 3A4MA 1N6OA 3FHCB 2V6JA 3VO2A 1IN6A 1VYVA 2ZI7A 4KV9A 2XB4A 2RGAA 3U3MA 3E1YE 1Q3TA 5L3SA 3QPVA 4FD2A 2GWHA 4ARZB 2XZOA 5JCPA 3VX4A 3IEVA 2QN6A 1XTKA 5H1YA 4EFLA 3BH6A 4NCIA 4URZR 2CJWB 2PJRA 1P72A 3VQTA 4D2IA 2QQEA 1GVHA 1E98A 2O5VA 1QHHB 2CL7X 3T1OA 5EMNA 1U90A 5JCZA 3GP8A 1ZM4A 2ANBA 4Q7JB 1ZIPA 1XTJA 2GILA 1AQYA 2AHOA 1G64A 1G8FA 3FPKA 1S3SA 4LV8B 4OHWA 4A36A 1DADA 4Y7CA 1W2GA 3TBKA 2ZRNA 5E7JA 5AUQA 3I5YA 1AKEA 5J4HA 2IX3A 4RKEA 1KO5A 2IW3A 3NKVA 4NL4H 5F9FA 5DYIA 4B35A 2VHCA 2ZVQX 5FR1A 4URUR 3HP1A 1NN0A 1W36C 2ZQ5A 2OXCA 4GP7A 3TR5A 1DEKA 4OQMA 3Q3JB 2HJVA 1TL7C 1VQ9B 3WMGA 1K9MD 5LDDC 2RGDA 3MRSA 1LF5A 1W4BA 2GZHA 3DDCA 3SQXA 4LBZA 4AYWA 1IQPA 2ERXA 1CJVC 1MV5A 5FUYA 1OFTA 4LJ4A 4CEIB 3AGPA 3OZUA 1CJUC 2MSEB 2CVHA 4IEEA 1E2PA 1YE8A 1G9XA 3WNCA 2OTLB 2FF7A 1KJZA 2GJ8A 5BN3A 2CJWA 4WVFA 5CDFA 5HZHA 1UAAA 2DBYA 1G3QA 1KI9A 1G291 4ZCIA 1P2VA 4ZCLA 4JLVA 2JDIA 4C0SA 3LWNA 1KI3A 1ZC4A 4G1UC 1OH8A 3KB2A 2E1RA 4PPFA 4BLOA 2G6BA 3TAUA 2BGJA 1JXOA 2GAAA 3G6EB 5AN9A 1US8B 2DHRA 2F1RA 2I3BA 2OZEA 2IA5A 2QE7D 3GJ7A 1GM5A 2JLYA 1TNDA 2QSYA 3VR3A 3EZ2A 5TDHA 2WOJA 2BOVA 1ZBDA 2EFGA 1FW6A 3GLHE 4OK3A 4BE7B 1XCMA 1J70A 1DOAA 3SHWA 2KB0A 1JB1A 1CR4A 2G0TA 3VR4A 2CHQA 4C4PA 1QBKC 5GJWC 5KDOA 1E2GA 1D2EA 1VYTA 2ZR9A 4PC2A 2R44A 2FU5C 4Q1AA 5DN6A 3ZC3A 2J87A 4POAA 3TAHA 4M2LA 3QF4B 4HATA 2X3UA 3X2SA 5FOSA 1VQ6B 1JA0A 2FSFA 4IJMA 4CEIA 2JLWA 1YVDA 4AKEA 1MOZA 3BGWA 2W0SA 3ADDA 1A4RA 1A8PA 3EZ6A 1CF4A 4NU0A 1KI6B 2WVJA 2AD5A 1VQ5B 3LH5A 3FMFA 3VU9B 1MKYA 4BEJA 3K0CC 1FRNA 1OGJA 4IDQA 2C98A 2A5DA 4KVAA 5AUNB 2GXSA 1M6NA 1XD2B 3ECCA 2P6NA 2O8FB 2GJKA 3K70B 4HAWA 3RSLA 4B3GA 3BE4A 3TQFA 2FFQA 2OAP1 3KKQA 5IF9A 4G5OA 4N1AA 4YDSA 2JIZA 3BH0A 2O0KA 4DLXA 4JBXA 3SE0A 3G0HA 1US8A 2RCNA 4MGKR 4N0EA 4Q4AA 1CKEA 3TK1A 1KRHA 3BH7A 4MH0R 1G19A 1TX4B 1WBDA 5KSPA 2ZI3A 1YZKA 1OE0A 1NVXQ 3L0PA 1M7GA 2WWYA 1BX0A 2RGXA 2QRZA 2R6DA 2WBLC 4FCTA 4XWAA 4EDHA 4Q18A 5DI9A 2ZI9A 4V0LA 5THXA 5FOUA 3IILA 2H18A 3CRW1 1Z6AA 4YDHB 4C0HA 2XSZA 1XEXB 1AS2A 3QBTA 5AUPB 4EH1A 1N6LA 2CNDA 4IOMA 2PMDA 3AKCA 3QF4A 5AK0A 1KIMA 4YAFA 3VNUA 3TW8B 3KUDA 3IIKA 1W4RA 1MRSA 4US1R 1CTQA 1HEIA 4AG5A 3BIFA 3FFBA 3OF5A 5DI3B 5H68A 4MKFA 421PA 2W6JD 2IHBA 4ITRC 1Z28A 4TMZA 1G3IA 2P0EA 2XGJA 1XD2A 2WJYA 5BN4A 4ZDWA 3KKPA 4QGAA 2QRNA 5LBIA 5CDFE 1ZNZA 1U0HC 2HV8A 1T3LA 3A37A 3NEJA 3NXSA 3U44B 3CCJB 3ICQB 1OHHD 2KBFA 1B23P 3ZYCA 1XD8A 4AWXA 4EPWA 4Q4LA 1F20A 4LJ8A 3UK6A 3KB1A 4LPKA 5FR2A 4D4LA 2Z83A 2MSDB 1D9ZA 3NDBB 3PEVA 2GETA 2YWGA 1KK2A 5L3VA 4C0BA 2DFKB 3BC1A 2ZYWX 4NKRA 2F43B 1VQ4B 1EXMA 3B1XA 4YC7A 4A6PA 2F7SA 2GA8A 4X8HA 1D1NA 3T1TA 1UBEA 1JALA 4LSGA 3HWSA 1N3BA 2QAGB 2RGGA 2CCJA 3FKSA 3NH9A 2UZ3A 2FPMA 1NMXA 1R0ZA 2ZM5A 1K5DA 2CNWA 3MSXA 3OESA 4L4UA 2VP2A 3W2GA 4DIDA 3DHWC 3UKDA 4YMUA 2DR3A 2X77A 3KZ1E 1VIAA 2F1HA 4HDQB 4BFTA 2CCKA 5J4KA 4TQ9A 3DMDA 3VHXA 4HB4A 1ZD1A 1X1SA 5KUTA 1XEFA 1CR0A 1JA1A 3L0OA 2PIAA 4TN1A 2JIZD 3HU2A 4AKGA 2ZE6A 1KZGB 1ZNXA 3MUFA 4IRUB 3EIHA 3PV0A 4PPGA 5FBWB 3PIRA 4LYHA 1NBMA 1IJFA 1Q44A 2BGIA 1M74A 3U44A 4LWZA 3V00A 2ODNA 4URYR 3MCAA 5JJIA 2P67A 4GBMA 2IYRA 5CM8B 2QU8A 4DT1A 1G7CA 1T0HB 2GVDC 2QDXA 1N2CE 4NTZA 5JSZB 2V1XA 3D6TB 1HA3A 3GLGB 4JYBA 1HE8B 2XSZD 3LVQE 2EFEB 3IHWA 2ZUDA 1CJKC 3B1ZA 2ZAMA 1IBRA 3QFRA 4GZLA 5D3QA 4BFVA 3GMTA 5FL7A 3ND9A 4JBWA 3I55B 3T1QA 2C03A 4DC9A 4RJLA 1O87A 1E64A 2C2HA 3LLMA 1WP9A 3UPUA 3OEHA 4KHZA 2KI5A 4JSYA 4Q1FA 2DFLA 4TL6A 2Q3HA 1UFQA 1CLUA 4RFSA 4ASUA 4PQRA 4D0LB 2OFXA 3U6BA 5EE0A 2ZRMA 4Q5IA 3UMRA 3D8BA 1FNCA 4IVRA 3I32A 3F5FA 1XDBA 3ZZUA 1G7SA 3G82C 1XBTA 4JL5A 4DLRA 1A7JA 1X6VA 4XVUA 1QGZA 2ZS9A 2RGNC 2DPXA 5J5CA 4L5BA 2A5YB 3DM5A 5FOXA 3TUJC 2EYQA 2EVWX 1N0UA 3RS3A 3H2YA 2R2AA 5KU1A 1DVRA 4Z8XA 1E3MA 2RAPA 2QQ0A 1G4UR 3QENA 3RLFA 4A0RA 2GAOA 2YVUA 2BCGY 3M0EA 1GNPA 1KJWA 2H92A 2ZANA 4QGHA 521PA 2X2EA 3EPHA 4GPTA 3FKSD 4KCGA 4LPSA 4XH9B 2D62A 2REXB 3KJGA 2JLSA 4M9ZA 5FOTA 3EX7C 4M1SA 3GLGA 1SVWA 2CNWD 5EXPA 2L0XA 2H57A 3NH6A 5DHFA 4GT1A 2HDNB 1T4GA 4Q4JB 4L15A 4PHHA 2P6RA 1KO7A 4CT5A 1VHTA 1AGRA 2VLIA 2IYQA 3SR0A 3AEZA 4S2EA 5HE9A 4Z54A 1P9NA 4TWZA 4DBLC 1I4DD 1ZD8A 1KSFX 3FPAA 4FMCB 4TT3A 5GJBA 4G5RA 5DHAA 3I8SA 2Z43A 3I4LA 3KJIA 2IS1A 2QUZA 3GCGA 3EPKA 4V0MA 3HYRA 4M1MA 1UM8A 1XMVA 2WJGA 1NBMD 3ZQ6A 1ZW6A 4TL8A 3RDPA 1FFHA 2EYUA 4D4MA 3PEYA 4C7OB 1OXTA 4ZGQB 1GAQA 3GJ3A 1U2RA 1U8ZA 1DAIA 3BK7A 4JVLA 4I1VA 4BLPA 3RWMB 1FNMA 4NCKA 1RRPA 2MSCB 1UF9A 1SXJC 1BO6A 2YV5A 3CWZA 1E96A 1EK0A 3FE2A 2OEPA 3KTAB 3Q5EA 5KYKA 5FL7D 4KSCA 1YHNA 1XEWX 3ZS8A 2IYWA 4AIIA 4B71A 2GQFA 2CCGA 2VH5R 4HYYA 4MRVA 1S1CA 2X19A 4QBIA 2JLVA 1L4YA 2HLDA 2IK8A 2QEQA 4QM7A 4RZUA 4M9SA 4W5WA 4LYAA 2VF8A 1UJ2A 1NIPA 2YHSA 3H84A 3OE7A 3OEHD 4IOLA 1SHZA 2G83A 4MYCA 3K0AA 4Z8YA 3WP1B 4LV5B 2HEIA 4C0AC 4ASUD 4C2TA 2GJ9A 1IONA 3CUEF 4OKSA 1N6IA 3V4FA 5JI2E 3REGA 4KBGA 3AP3A 5FH9A 1S9HA 2BBSA 4C9BA 2J0VA 2EIXA 4DKXA 4G3XA 2FH5B 1P7CA 4B47A 3A1SA 2OILA 4W7SA 1MRNA 2WMOB 1DBSA 2A30A 3GFPA 1X8KA 2SHKA 3WBKA 4RKFA 3ZBUA 3QPWA 2V8OA 4XIGS 1Q86D 1SVSA 2B8WA 1YI2B 2AKAB 2JEOA 2QM7A 1BS1A 2ZSDA 3ZQJA 1WB9A 1OYYA 1CBUA 5EUQB 1NMYA 5D3MA 4ZIRB 3QUSA 1KQSB 2YOGA 2RKOA 3EAQA 3Q72A 4GNKA 5E3HA 1OIWA 2KJQA 2BCJQ 3KKNA 2XX3A 2XAUA 3BBPA 3OIWA 2HF9A 2OK7A 1YZUA 1MH1A 1GRNA 1KI7A 4D4JA 2FWRA 2ZE5A 1FTNA 4DB4A 1JI0A 2DEUA 4YMVA 4MKIA 3NEYA 3CNLA 4AK9A 2C9YA 3AF1A 4TZ6A 3NC0C 2B8TA 1SVIA 1NVVR 1QG2A 1F2TA 3G71B 4LBYA 4U5XA 4A8JC 5EXXA 1DO0A 1KO4A 4IVQA 2PMKA 3FJOA 2HUPA 1R2QA 2OUKA 4O25A 2J46A 5J40A 4A2PA 2GCPA 4IDHA 5KOYA 3AF2A 2WWIA 3BOSA 2G9NA 3LX8A 1W36B 1NY6A 2GF9A 3EASA 3P4XA 5GV7A 1KZ7B 1UMKA 2AL7A 3RHFA 3ZLJA 1JQJC 4TYYA 1TQ2A 2PBRA 3U3OA 3GLGE 3CCSB 1BIFA 1P61B 1YZQA 2A9KA 2JCSA 2WPDA 2WMNB 4M1OA 2TMKA 4O2RA 4KBFA 5JECA 2XNJA 4DUGA 3DM9B 4HUTA 2ZRKA 4U7DA 3CLVA 4NDZA 2VNKA 4K8OA 1KMHB 3QXXA 4RCZA 2CE7A 1GZSA 1TU4A 4JLBA 1NN5A 1ESMA 3REFA 5JWRA 2FSHA 4GRAA 2ZJ8A 3KQHA 4LYFA 1E99A 2QMEA 2IUUA 1WA5A 4OQNA 1F3OA 2YOHA 3ZIAA 2JAQA 4UXIA 4MA4A 5HPYB 2VP0A 5JBQA 1MABA 1A2KC 4D4KA 3L43A 2WTUA 2ZREA 2OO7A 3GJ4A 2HLDD 2QNRA 1ESNA 1NG1A 1AJEA 1W4AA 4DDVA 4PR0A 2JLZA 4GOKA 4DEYA 2IBMA 2OK8A 4TLAA 2OLKA 3ADBA 1Z06A 4EPRA 5JMTA 4PQYA 3CXCB 4V03A 2W2XA 1ZM9A 1R7RA 4G0NA 3ZJYA 3K09A 1VG1A 3GPLA 1K8AD 2BBTA 3NVAA 4KVGA 2QBYB 2OSBA 2JJ2A 1NLYA 2PZFA 4CVNA 5EE9A 2IHYA 5EUMA 5KDDA 1SGWA 1W1WA 1XXHB 2YWHA 1DG3A 1E2IA 1Q0UA 2O52A 4TLCA 1S96A 2QA5A 1WBBA 2G88A 1TU3A 2NQ2C 1LB1B 1Q1EA 4FMDB 3K0SA 1GKYA 4Z51A 5K8UA 3PR1A 1UADA 1G6HA 1KMHA 1E2JA 3PENA 5FPSA 3A36A 3B9QA 4OHZA 3X1WA 1GKIA 3A6PC 3IBGA 1XJCA 3K0FA 3CRRA 4M53A 1XMJA 4Q1CA 3QFTA 2FPKA 4HAZA 3L0SA 4F7WA 2CMKA 3I62A 5C4GB 4Z1MA 1LTQA 5H5JA 1TEXA 3QFCA 2REOA 4XTCS 5TV2A 2Q3FA 3EZ7A 2B21A 3ZZTA 1COWA 1T5LA 1D6JA 1DO2A 4MKHA 4MYHA 4LJ7A 2NPIA 1B0UA 4MRPA 4DCVA 5KO2A 5FUXA 2ANCA 2AN9A 2FSIA 2RH5A 2ZSBA 2CVFA 3PUYA 1H65A 1W0KA 2DWPA 3FMIA 3LAWA 4TTPA 2RHMA 4NYMR 2O0HA 5G41A 2QM8A 2QY9A 3BFKA 4URWR 4AC9A 4P4SB 2WPDD 2QTLA 3B1VA 4B34A 4JYCA 2EFDB 5JLJA 4PAMA 3KUCA 3NG1A 4DUGD 2VP4A 1G6OA 2X8AA 3PEWA 1OB2A 2NTYC 3AM1A 2V54A 3RRZA 3ZVNA 1CS4C 2OCAA 2QBYA 1SVKA 4KAXA 3RABA 2QP3A 3PUXA 5B2ZA 821PA 3SJAA 5CJ2A 1E2DA 2CBZA 2BVNA 1ZVQA 1RE0A 3QEOA 4YQFA 1E2HA 1OFHA 3LW7A 2BEJA 4UNSA 2BN4A 1IN5A 3OIVA 3W3AA 3ZIAD 2R8RA 1X8LA 5JJKA 3TMKA 1EGAA 2F9LA 4JL6A 5JEEA 1J99A 3HJNA 4OI2A 1KSJA 4QHYA 1QDEA 4ZCMA 3KJHA 2IT1A 4P32A 4DLSA 1IXZA 4IHQA 4LC0A 4HAYA 3ADKA 1GFIA 4EPVA 1GKUB 3CX6A 2NO0A 2V6IA 1G1MA 4X8OA 4BLQA 4BLRA 5AJWA 2EWWA 2Q3MA 1QUEA 4YALA 1CRQA 4LBWA 2V55B 1GUAA 2AWNA 1Z63A 1OV4A 4B48A 1E0KA 4KXFB 3CCMB 3EXAA 3UANA 2GK6A 4QJ4A 1ZMXA 4YAUA 1NL3A 2QTVB 5EQTA 2ZJAA 3LY5A 1FUKA 4W9MC 1UPTA 3CCVB 2ATXA 2JJ2D 1CP2A 1GRQA 5KPJA 1D2NA 4ZV4A 3JVVA 5EP3A 1G3UA 2B7CA 3Q85A 3H0KA 5A0FA 5FOVA 2VNHA 4ACAA 1V43A 1FRQA 1BYIA 1WRBA 1HTWA 4QNMA 4IW3B 4Q7MB 1CR2A 2FZ4A 1NG9A 1LFDB 4IXNA 4C0QC 1NN3A 1G8HA 2GXUA 4JLOA 4N3NA 2NZ8A 4WIAA 3ICEA 4C0JA 4AYTA 1P9RA 3CWQA 1ZNWA 3NC1C 4XD7A 1Z83A 3BXZA 4Z1MD 3RS4A 2XOKA 2QL6A 1E9EA 4AF7A 1VTKA 1ZUHA 4JLKA 1W2HA 2ZU6A 3KFXA 1COWD 5DSZA 2I1QA 3THWA 2VQSA 2GCNA 4O0MA 4C2UA 3LD9A 5KSOA 4TLDA 3PFIA 3CC4B 3VMFA 1QZXA 1W0KD 4CW7A 4D6PA 3CH5A 4GL2A 3AVVA 1C1YA 2FMXA 4MDFA 3S1AB 4XTRA 1GITA 5JEDA 1NF3A 3LVRE 1YU9A 3PUZA 3KQNA 1PUJA 1AM4D 2OXRA 4AG6A 1QGYA 2JLUA 3OEEA 5C2JB 1OSNA 2G77B 2N1BA 3DEFA 3ZGXA 2CL0X 4HB2A 3SQWA 2FA9A 2VO1A 3W5JA 4HB0A 1W5SA 3JQRA 3AB3A 2ZRLA 3WHKA 1R5NA 2H16A 3NBXX 1T5IA 3EIEA 2ZRCA 1AKYA 3ZZ0A 2VNJA 2XNSA 4A0GA 4PQFA 3PXGA 1NNEA 4CEJB 4M1YA 3SNHA 2ZI4A 2ZRJA 2MMCA 3CZPA 1ZAKA 3GFOA 4F4IA 4URXR 1I4TD 1DAEA 4ABYA 5LPNA 2OCPA 1Q81D 1TF2A 1T0JB 4QBHA 1II9A 3C15C 3QXSA 3UXMA 3CCLB 4UXJA 3VTKA 4IDOA 3SFZA 4PSVA 2FFBA 2QT0A 2VHTA 5H70A 3BORA 3KXKA 4PHFA 4GZMA 1W7AA 1Q21A 1F5NA 3CONA 4V0NA 4WZ6A 2W00A 5HCNA 1XF9A 2R6FA 3SFVA 2FGKA 4B6FA 4LJ5A 3NHAA 1D8TA 3CCQB 1NLZA 4QGFA 3CC7B 5CIQA 3PCRB 3SU8A 1NVVQ 1P6XA 3CBQA 2IWRA 4ARZA 2C77A 3VO1A 5IT5A 2FPLA 1QX4A 3S1AA 4XWOA 4BUJA 3CB4A 2FG5A 1PUIA 3AVWA 3T15A 1VHLA 4Q1EA 5H59A 1KDPA 3LVBA 2PLFA 1AS0A 4AKIA 1R8QA 1SVLA 2YYZA 1QHHA 2UVQA 5EZ5A 1II8B 3Q9LA 2PCLA 4MGYR 2RHDA 3MHPA 4B2PA 4BWYA 1DS6A 4QM6A 5JHHB 5EP2A 3BFVA 1W4CA 4EQ6B 3LRPA 1MO3A 2J7PA 1WF3A 4JVSB 5AJXA 4DCTA 4P0TA 4XD7D 3UMSA 4I4LA 1YJ5A 4HSEA 3DKVA 2XOKD 4BLSA 3THXB 2GESA 1K73D 4WAUA 4FK8A 3KDSE 3CPJB 2IYTA 4TQUS 1T3HA 2BIFA 2WV9A 4OK5A 2F6RA 4RSGA 4HE5A 2J7KA 1OJLA 3U3KA 3HR8A 2EFCB 4EIWA 3KQUA 1EFUA 1TVCA 3BWDD 1HYQA 4JL8A 1NDHA 4R9UC 3WYGA 4LJAA 1VMAA 4M8NE 5GJVC 2RGNA 4F7DA 2A5FA 1N5IA 3MD0A 2XNCA 3QXCA 4DLUA 1TMKA 4OJQA 1IY1A 1GRRA 2ZSEA 4Q01A 4WQMA 3Q7PA 2RC6A 3TVDA 2FX3A 1SXJB 4P4UA 3EPLA 3TR0A 5LD2C 1J8YF 2ZI6A 3BS4A 3WNBA 2ORVA 1KDTA 2BJWA 1FP7A 3OFNA 1HQCA 4HUQB 1E69A 2N46A 3A4NA 3MJRA 4Q7KA 3CRQA 5DISB 3TUZC 3AF3A 4HZUB 4WZBE 1KNXA 4XWKA 2PLRA 2GTPA 2VA8A 3LV8A 1EFHA 1KI1A 5C18A 2O8DB 3QSYA 2BM0A 1EP3B 1N8RD 1MR3F 3O8CA 3MWKA 3I56B 4ZDJA 3ASZA 1SKYB 3ZVRA 1RZ3A 2J1LA 2NO6A 3THXA 3QE2A 1T8UA 3MWJA 1SM4A 2NO9A 3CF0A 4JLPA 4BFXA 4OI1A 3QKSB 3DMNA 4HLUC 3K8YA 1E4YA 3B13B 2N42A 1EX6A 3A8TA 2BMFA 4RZ3A 5J4LA 3AUYA 1E94E 4V0OA 4PC6A 2PX0A 1S72B 2HYDA 3TE6A 2FEMA 4KJZA 2QMHA 3PUVA 3TVTA 2P5TB 3IO5A 1U9IC 4HAXA 4BGDA 5FTMA 2PEZA 2WM9B 3HDTA 4MKGA 5G3YA 1GP2A 2JDID 1N6HA 3MLEA 4NYMQ 3ZVMA 1KI6A 3U2QA 1SXJA 1QHXA 4I1SA 1AQUA 1FMJA 3OIYA 5GVRA 1F60A 1G7RA 2C95A 3VU9A 4A8JB 4ESHA 4LX0A 2WKPA 1PJRA 3M4YA 3RRMA 3VX3A 2J7PD 2RMKA 4MRSA 2O8FA 3U4QB 4HDOB 1L2TA 2HCJB 3FYHA 1H8EA 4TLEA 4HZUA 2QZ4A 3CRZA 1G3MA 1MO5A 3AH8A 5E95A 2X2FA 2Z5FA 3AP2A 2VZLA 2JJ1A 2C78A 2WHXA 4GOXA 1LW7A 3HR7A 2R6GA 1BMFA 5DN6D 1VQMB 2OE2A 2LKCA 4Q9HA 2HXSA 5BQ5A 3K0EA 3CD6B 4JT2A 4PHGA 4P31A 2BKUA 4CZ2A 2O8CB 721PA 4GP6A 4DHEA 4M1KA 1E62A 2IXEA 3TLXA 1XEXA 3K53A 3BB3A 1FNBA 3JVUA 2QPTA 3CR8A 4BZXA 5GVSA 2GCOB 1Z3IX 3AVOA 2ZJZA 3OFND 4PC7A 3LDAA 1LF0A 3P20A 4M9QA 1U99A 2C5LA 2ZJOA 4NONA 1GOTA 5AR1A 2X1VA 4I81A 3FB4A 2VYQA 1XTRA 4G1VA 3CCEB 1M90D 1H8HA 1OFUX 3CM0A 3QE0A 4FCWA 4LK2A 2WJVA 3W6PA 4DJTA 3QQ5A 1KHTA 3LNCA 2YC4C 4DSTA 5DI3A 1RRGA 1OIVA 3W6OA 4D0GA 4ZI2A 1E32A 4TMWA 1TQ4A 3U4QA 1XJ0A 2OAQ1 1UBCA 3R8FA 1G8YA 1M2OB 4YMTA 3FFAA 5JRZA 1ONBA 3ZD6A 4Q4HB 1GAJA 2HYIC 1G17A 2R9VA 3A1UA 4PO8A 1TUEA 4DSOA 3OW2B 4UAJA 1R8SA 1FMLA 2W58A 1A82A 1P2TA 5F2EA 2F43A 4PPNA 4Q66C 3FHOA 1L8QA 1HT2E 4XSGA 1E1RA 1XJQA 1XU4A 3B1WA 2IC5A 2QAGA 1NMZA 2O8CA 1E9AA 4TYQA 5B30A 1UKZA 3TRFA 4DLYA 4NYJR 5JFGA 4MUBA 1R5BA 2BMEA 4DEXA 2BMJA 4PC3A 1R0WA 5CJPA 3SDZA 4TSFA 4YLGA 1LS1A 1VCIA 1QVAA 1JPJA 3BB4A 1QG0A 5G53C 3K70D 1GWNA 3QJYA 2AXNA 2OTJB 1K6MA 4DLWA 4TLBA 1H8ED 2R65A 3N2IA 2Q21A 4A82A 2QT1A 4QG7A 1TEVA 3UIEA 1YQTA 2AK2A 2BBOA 2QPOA 2ZIAA 2VP6A 3IDQA 5HTKA 1SXJE 1N5JA 3FDIA 1FNNA 1OPXA 4NHOA 1O3YA 4A6XA 1E9FA 2ZTSA 3QKRB 3R20A 5BWMA 1KSGA 2XNDA 3ADCA 4PTLA 4B4DA 4BFZA 4A15A 5JI3E 4EFMA 3GLIB 3CNNA 2QENA 5FL3A 3VR1A 4ESVA 2IWHA 4RFVA 4M21A 4EJSB 1N0VC 2CE2X 5JSZA 3RS2A 1QH0A 1C4OA 1N6NA 621PA 2Q9CA 5C4MA 2VPPA 2F9MA 1GIAA 1OXXK 2AFHE 1EG7A 3D3QA 4LY6A 1E9CA 2ZYTX 1GNRA 1SKYE 4B3DA 3LXXA 5FUWA 3VFDA 4PAOA 2IXGA 3U5ZB 3FGNA 4ZGNB 4ZO4A 1Z0IA 3QG5A 1H8HD 2Z4RA 3EARA 3IIMA 3NBZC 4F38A 1IXSB 5EE5B 2LKDA 1XZPA 1KAOA 1LS6A 2ZRIA 4EAQA 3V76A 1TAGA 1FQKA 1XTIA 1E2KA 3LLUA 3Q8XB 1CQXA 3T34A 1Z2AA 1N5LA 3RS0A 3O47A 2CLDX 4BFSA 3VKGA 3SI7A 2AX4A 1NSTA 4OYHA 3ASYA 3EWAA 2J0QA 1G20E 1UBFA 2YWEA 2PZGA 1YR9A 5M04A 4D80A 3NIBA 4H1UA 3UG7A 2PT7A 2O8BB 1VKJA 1WDTA 3LO8A 3QKRA 3A1WA 2VSXA 1YHQB 3DZ8A 1QHGA 4IDNA 2OBNA 2BMDA 1WE2A 5DGXA 4IKEA 2AXPA 2W83A 3IIJA 4GMDA 4FWTA 1E1RD 1ZC3A 1UKEA 3GEHA 2ORIA 3CH4B 2FV8A 2IUTA 2RGEA 4EJSA 3FMOB 4IDPA 3LBNA 4BLTA 2GXAA 2OHFA 1UDWA 1SVMA 3T12A 2ONKA 4M1WA 2CRVA 2IL1A 3IUYA 4Q4JA 1KTVA 2OESA 4TSFD 5TR9A 3FKQA 4FINA 4KLZA 2JJ8A 4E09A 2GRJA 4DB2A 4M1TA 1I4LD 2RGBA 3L82B 3LQQA 2LCFA 3AGQA 5FUVA 3L8YA 4AYXA 4L9SA 1TUIA 2IYXA 1NVUQ 5JRJA 5DE3A 2WWHA 1DDIA 3U7HB 3W2FA 2D74A 1KK0A 5FI0B 2F3TA 4MRRA 1S9DA 4K46A 5IDVA 4FWIB 3F8TA 4C7OA 2F1IA 3PG5A 3EZ9A 3SHFA 4NCNA 3SN6A 1JR6A 3EZFA 4Y9UA 4JIMA 2C8VA 2BMWA 3QG1A 3L2OB 1RYFA 1ELOA 4P4TA 4TMVA 3X1XA 3VR6A 4RD2A 4MYUA 2EFHB 2P65A 1QHIA 1VG8A 1VQPB 5JZVA 3KTAA 3X1ZA 1OXVA 1RJ9B 2RB4A 5P21A 4C43A 4LJ9A 2XXAB 1GAWA 3BB1A 3K9NA 2HCBA 5EP1A 4RD4A 5EXSA 4OI4A 2G1KA 3X1YA 5KHOC 1Z0AA 1F48A 4KI0A 2J45A 3I72A 3R8CA 4TT3D 4JLDA 4F92B 1Z6YA 5G3ZA 4F91B 4A92A 1K8RA 3SYNA 1M7HA 1NKSA 1Z5ZA 2EQBA 3M6AA 1XCGB 1HE1C 3EW9A 3KL4A 4B6EA 1E4VA 2WAYA 2BKEA 1XP8A 4ZPXA 1EP1B 4QKQA 221PA 1GVNB 3EPJA 1YKSA 1Q1BA 3GJXC 3CRMA 3JQQA 4KO8A 5AJZA 4ZIRA 3TSZA 2ZU0C 1QVRA 4DLZA 3U3JA 3U60B 1VG9B 2WIAA 4R2IA 4TL7A 3A58B 5CYPA 1Z8FA 1IN7A 5FPHA 4AURA 5J4YA 2V3CC 3U7GA 1UKVY 2C99A 3IPXA 5HZKA 4CYMA 3GEEA 1U8AA 2EU8A 3ND8A 1LNZA 1Z6GA 1NI3A 3WMFA 1ZJ6A 1DARA 3WRYC 3OE7D 2QAJA 4PZZA 2NO1A 2W0MA 4QGGA 1ZM2A 1WMSA 2ERYA 3U7EB 4IVPA 2ZS7A 2E87A 1HURA 4GMXA 3DKPA 5KPDA 2XXAA 4GFDA 4BEBA 3U6KA 2W2TA 4XVRA 5TY0A 4RD0A 4Q21A 4UKDA 4PAQA 1M8PA 4A0HA 4OL0A 1JQLB 1KKMA 3F0TA 5LB2A 1SQ5A 4II7A 4KFSA 3NTUA 2ZI5A 2W6IA 4PZLA 2VL7A 4EFNA 1MT0A 4LI0A 1G21E 2UZIR 3CX8A 3CW2A 1S2MA 4K1XA 1W87A 4FXPA 3QXJA 2YWFA 1ZRHA 2ODWA 2BDTA 3MAAC 3QY0A 5FI1B 3RAPR 5LD2B 2IS4A 3FHTA 2GDJA 1QHYA 3GJ5A 3P26A 3LBHA 1VQOB 3KFVA 3MMPA 1YIJB 3SYLA 4Q48A 3CMAB 3B82A 1J8MF 5KNDA 2IS2A 3BFXA 2G1JA 4DLVA 3K9HA 1VQ8B 2CHVA 2D3WA 3P32A 2JLQA 1IHUA 3VR5A 3B85A 2C9OA 4Q9IA 1VQNB 2AR7A 1ZD9A 2J3EA 2D7DA 4XVQA 3K9GA 2WWWA 4A2WA 3C4JA 3THOA 2E9SA 5JWOA 1NP6A 1LY1A 3Q5DA 3W5UA 1JR3A 3QOFA 1BJKA 2FFHA 3A1TA 1XRJA 2A5GA 4MDEA 3PUWA 1G5PA 5L8VA 3SJCA 2D7CA 5CIWA 4GDFA 2DETA 2WWXA 2WSSA 2IYZA 2GK7A 2VHQA 3KQKA 4B3FX 1ZUNB 2WICA 1GG2A 5G40A 2ZAOA 1GNQA 5CM9C 5F9HA 2OBLA 2VHUA 4DDTA 1JNYA 1FL9A 1TF5A 1XXHA 1U0LA 3C41J 4DIEA 1X86B 2A3RA 4P3YA 2WZQA 4JVNA 1G5RA 2REBA 1BQEA 2I4IA 2YC2C 4UJ3A 5KSYA 1R10A 4QL3A 4YMWA 2CK3A 1BYUA 1FQJA 2OT3B 1GL9B 2MMGA 3K0CA 4NZYA 1G8GA 1GR1A 1UEJA 5HXBA 1W44A 2A2ZA 2FGJA 1ZYUA 2AWOA 1JJVA 2QPAA 3O8BA 3PITA 4QHTA 4AI6A 3UMFA 4DQKA 4QBGB 5C1BA 4RZXA 1TPZA 2EW1A 3VHLB 3UG6A 5F98A 1E9BA 2ZRPA 3EIQA 1ZCBA 1CJTC 4PSAA 1RW4A 3NBYC 2IYLD 4KFRA 1W36D 3SC3A 3G5UA 4FMCF 1G3RA 1G16A 2OBMA 1OH7A 1KI4A 3W3ZB 1E0JA 2OV2A 1JAIA 4NPHA 2XJ4A 3AVPA 3GEIA 2QSZA 2OFOA 4OQLA 2AD1A 2V9PA 4P4SA 3U7FB 4FMBB 1P62B 2IEZA 4B33A 5L3SB 3BRWD 1QHSA 4RY2A 1XPOA 5CLQA 1QHNA 5JS7A 1GL6A 2ZRHA 2BWJA 1CJMA 3A4LA 1RKBA 1VCOA 3CCRB 2JGNA 2DWOA 4G5QA 1VCNA 2DCUA 3KQLA 1KNQA 1R6BX 4KODA 3LFUA 1Z0FA 5FBVB 4QJ3A 4X8LA 1E79A 2VHJA 3B9PA 1KMQA 2GZAA 3CPHA 1PLLA 4YHBA 4OJKA 4PO1A 4UNQA 3W2IA 5TMPA 2KWIA 4LCBA 4D25A 2EWVA 3NHBA 1XNJA 1Q20A 4MGZR 1YRAA 2IS6A 3FVQA 1XPRA 2NIPA 3QKUA 3CX7A 1CRPA 1W47A 1AZTA 3B7GA 1NJID 2QA4B 5TXGA 1IAQA 4DQLA 1N6RA 4PC1A 3GD7A 1VG0B 1P4SA 2BF4A 3AVUA 4Q9KA 3N70A 1JR3D 3AKDA 4LV6A 4US2R 4LHVA 5KSWB 2HF8A 3LXRA 1PVOA 1GSIA 1K5GA 2YJTD 5FBRB 4ACBA 2WSSD 1KD1D 1RPZA 4Q47A 3KXIA 3RC8A 1Z08A 3W2EA 1A5TA 1RVDA 3FOZA 1PLJA 5FTLA 1AGPA 4B74A 1Z0DA 5CYOA 3DOEA 1Q3HA 5BYJA 4TYPA 4JS0A 4Q1BA 4G5GA 3D31A 2OFWA 1QGAA 3JZMA 3ES9A 3HPQA 3G4SB 4LHXA 1VQKB 2WJIA 4KITB 5FTJA 1JR3E 3JZAA 4G5SA 1PV4A 2PZEA 4IFEA 4Y0VA 2CK3D 2V1UA 2J5XA 2ZRDA 3WHLA 3I5XA 1E9SA 1ZUIA 4LBVA 1M1KD 1H42A 5ANRB 1IOZA 2ZJ5A 1JXMA 1CNFA 4OBEA 2Z6VA 1XXHE 1E6CA 1Z0KA 5JS8A 3R9WA 1EFCA 4M9XA 3ZDQA 3R9XA 2IF2A 2FZLA 4UJ5A 4DRZA 2B5OA 2DY1A 4BQSA 3H4MA 2OM2A 1I2MA 1E63A 4JKYA 2XTZA 1VPLA 1KYIA 4BASA 4PANA 2BV3A 4FN5A 1XX6A 4GSYA 1QG4A 1RC8A 3K09C 3HU3A 1XMSA 1KI2A 3T5DA 1TTTA 1CU1A 3T61A 2BC9A 5L3QB 2R6HA 2J59A 4HAUA 1TF7A 5BXQC 1EFRA 1Q57A 5K8IA 4LHWA 1DAFA 1NVWQ 4Q19A 3AKEA 3AKYA 3WRXC 1T6NA 3CCUB 1KGDA 4Q00A 5FTNA 2J0SA 3GJ0A 3TNFA 1E79D 1Q7YD 2QORA 4I99A 1ZIOA 4BRUA 4CEJA 3BAFA 3VNVA 3CPWB 2W2VA 2NMVA 3ONWA 1RYHA 4IOJA 4JLAA 2BM1A 4IFBA 2CXXA 1BOFA 5E7IA 3MJHA 4LC1A 5E4FA 1S0UA 1CIPA 3EG5A 4DCUA 1OGIA 5KNBA 2W6JA 1OYWA 1TQ6A 2GBLC 2P2LA 1XTSA 2QP4A 1DG1G 4H9GA 1QFJA 1QVFB 1J7KA 3P27A 4I1UA 4Q4AB 3W9YA 4QRHA 4UXHA 2ZUCA 1T91A 3OEED 3H1TA 4RCYA 1EWRA 2HXYA 2FJUA 3AUXA 4YMSA 4ZDIA 3SS8A 1E2QA 1OHHA 1ETUA 2JATA 5HR5A 1SVOA 3E20A 1IY2A 1E2FA 4Y0AA 1Z0JA 4F4CA 4LHYA 4FMDF 4RD1A 3TJZA 3IBYA 4HEJA 4RD3A 2WKRA 3O8DA 1DAKA 3EC2A 4HAVA 4NE2A 1AIPA 4PXAA 4A1FA 5FTKA 4X8MA 3LBIA 5L3QA 4D26A 3MGCA 4HLCA 4KYUA 3OAAA 1ZINA 1FP6A 5CK4A 1PLKA 2JASA 1OFIA 1U0JA 3N5CA 5K8TA 1II8A 2V7QA 4I1OA 4C3ZA 3I92A 3RWOA 1OKKA 3FTQA 2C04A 1YZNA 1CNEA 2NPFA 4URVR 2K5UA 4EQ6A 2R6AA 3THYB 1KY2A 1OF1A 2VNIA 4AF6A 2J41A 1KK1A 2WIBA 4KU4A 1G41A 3AVYA 3H86A 4BECA 3SBDA 1E0SA 2XJ9A 2IYSA 2HMAA 2H7VA 3KKOA 3QI2A 4D0NA 1YITB 5EE1A 1M1YE 5SZJA 1EWQA 2FNAA 3SEAA 2D2EA 4ZDKA 1FPMA 2ZEJA 2ZPTX 3T1VA 3BD9A 4V02A 1R0XA 3SOPA 4HB3A 3PJRA 2GKSA 1Q1QA 3OZXA 1KJYA 1NLFA 1ZP6A 1RRCA 5LB4A 2CLCX 4F93B 1E2EA 4OK6A 1XFAA 2FN4A 3RS7A 2PJZA 4UNRA 1FOEB 3AP1A 1KDOA 3OJWA 1CR1A 2P6UA 1EFRD 1S4QA 1NIJA 3ZVLA 1P5ZB 1YJWB 1LVGA 3I1FA 3PQCA 1E1QA 1KAGA 2LWIA 4HUQA 4L9WA 4A0FA 1DE0A 2ASEA 4S35A 1IM2A 4MQBA 4AKHA 4TMXA 4NBSA 1M34E 1PZNA 1IB0A 4TMTA 4BPBA 5AWFC 3B8HA 5CB6A 2H8KA 3B2EA 5F3WB 4OHVA 5SZIA 3TH5A 4XJXA 2O8DA 4NMMA 1EESA 3RSOA 2ECKA 1WXQA 4G01B 3THYA 1OW3B 1E9DA 4MYTA 3B60A 1HT1E 3OHMA 3SJZA 2VSFA 3NBFA 2QEXB 1S1MA 3LW8A 3KX2A 4PZYA 2IUSA 4CT4B 2V4ZA 2IYYA 3N2EA 1Z07A 4JSTA 2WSMA 1T3SA 4MITA 3V4RA 3MG9A 2QROA 1W0JA 1B2RA 2BJVA 5FPTA 4LYJA 3QKSA 4KSBA 1U81A 4E03A 1KKLA 4DLTA 2A5JA 2GNOA 2P5SA 5AJVB 2NOAA 2UKDA 5DYGA 3L8ZA 3EA5A 1G4AE 1E2MA 2RGCA 2PX3A 3I73A 1G8PA 4DVGA 2Q9BA 1QF9A 4TYWA 1JEDA 1FNDA 4DT1B 3QPUA 1RIFA 1Z2CA 4RD6A 1YR8A 1ANKA 4M22A 1KSHA 2AFIE 1W35A 3OAAD 4NH0A 5FBLB 1KDRA 1P2SA 5IK2A 2ZYVX 1SULA 2OLJA 4BZQA 1HUQA 2GEVA 3CMEB 2V7QD 5DH9A 2DERA 3WBJA 1OKKD 1SZPA 5EJEA 4A8JA 4FCVA 3W34A 1GILA 2ODEA 1DAGA 4E07A 5HE8A 1JBKA 2GZDA 2VIIA 3I61A 5TARA 4PHTA 4NYIR 1II0A 4B44A 2XEXA 2HJGA 1P60A 3CO5A 3E5HA 5TB5A 3B1YA 4NCJA 4RFSB 5DNYB 5HKKA 5CITA 2ZR7A 2NGRA 3A1VA 1OLOA 1W2BB 2J9RA 1U8YA 2VTKA 1W49A 2Z0MA 2FSGA 3OZWA 3WY9A 1R4AA 1FDRA 3HYTA 4B43A 1LV7A 4JJZA 2CL6X 4CIDA 4LHZA 5CB8A 2AK3A 1EX7A 3IQXA 2DB3A 1DPFA 1P75A 1R5OA 2O8EB 1KY3A 4KFUA 3W8NA 1XMIA 4YXWA 1D2MA 2ZETA 1M7BA 4JJKA 4OQXA 4Q1DA 1N0WA 1SXJD 4RZ2A 1BX1A 3RS5A 3HPRA 2GCOA 4TMKA 2WKQA 1E1QD 5EP4A 4B73A 3TKLA 2OG2A 4YAWA 5EE3A 3MWLA 2O0JA 1EWYA 2PL3A 2WWGA 4XOIA 4PPQA 3B5JA 2F1JA 4PSKA 2Y8EA 3U61B 1WCV1 3AVTA 1XTQA 3WYFA 5J47A 3GLFB 4ZKEA 2JJ1D 5DLQC 1JJ2B 4B3CA 2XZLA 2D2FA 2C9CA 3RRNA 2VYFA 2YZ2A 4PFSA 1E2NA 1MO4A 1OT3A 4YONB 1BMFD 1W0JD 4Q4HA 4O2LA 3I3SR 5H8WA 3OJXA 1IXRC 4Y9RA 2WJHA 2B6HA 1DTSA 3UATA 4WXPA 3VKWA 5KSZA 3ZH9B 2BBWA 2ZSAA 1JAHA 1EFTA 1OH6A 3OZVA 1JB9A 1VDZA 3DVLA 5BW8A 1C9KA 1VECA 4DSNA 4BRWA 4HLQB 1W5TA 1ZU4A 1P3JA 1FX0B 3KXLA 2O8EA 4JMPA 1GTVA 5FPKA 5FPYA 5JWHA 2QMUA 2GEUA 4NCHA 2CLSA 3RC3A 1YZTA 3QNUA 4LGMA 5B57C 5JHGB 4R71A 1NJGA 4DXAA 5IK2D 2ZR0A 4LOAA 1YZGA 2VP5A 1KC8D 3NDPA 3K9LA 1GJRA 2ONJA 1BKDR 2ZRAA 3SBEA 2HT6A 3FMPB 2FE4A 1I7PA 3R9IA 4FIDA 1IN4A 4U00A 1F2UB 1YR7A 4H1VA 2QMOA 5CK5A 3DPUA 3K0AB 1U94A
chains in the Genus database with same CATH superfamily
2CV0A 5L3RA 3DD1A 4ZOLB 2WB2A 3QIAA 4B2IA 4QODA 2C4HA 2ZIZA 3LSTA 3WGGA 2SKEA 1I1HA 4CDGA 3E9CA 4KQXA 1XCPA 4BGVA 2YOFA 1Z29A 3KKKA 4U2BA 1SWVA 3U1BA 2Q45A 4M88A 1GFZA 1SC4A 1YL7A 3VDNB 4BKUA 4LF5B 1FXWA 2D0OB 2H17A 3W5HA 1HYEA 1G7TA 3W5VA 1QQ5A 4L08A 2XB2A 1Z22A 2E4XA 3LPCA 1MQAA 1GARA 4GMKA 3O2QB 4KQKA 5DYNA 2II6A 4TKOB 2ODBA 4MUAA 5B1HA 4IEIA 3ZLVA 5M2QA 1O0CA 3AHHA 1S4MA 1TM2A 2BUCA 1NSFA 1YQDA 3AQ4A 2Z2IA 3KDAA 4KWHA 3WFJA 2P2GA 1YZLA 3DYIA 4YECA 4FHCA 4OA8A 4US0R 3AF0A 1P2UA 3GDOA 4KLNA 3B6ZA 1FVHA 5CH8A 5IRCD 4XFJA 4O2AA 4XDZA 3WB2A 4R2HA 4F60A 2GFIA 2ZBUA 1I24A 3O90A 3N2LA 3WWOA 1NRWA 2B92A 3VBCA 4CQJA 2C8JA 1IULA 5JCOA 5EHQA 2FB9A 5C8YA 2J3QA 2DWQA 2VUSA 2DFNA 2FPIB 5AHWA 3U62A 2QK4A 2OGZA 2ZSHA 5B7GA 2H1OA 2YV1A 3GEMA 1NRKA 1WXWA 1E5QA 3RSQA 3IEUA 4PN3A 1QZ3A 2XYHA 1TAUA 5GADl 1FU4A 3A3YA 3T7KA 2HJ9A 4GOJA 1I6KA 5G1OA 2BGMA 2XRZA 3G68A 3EC1A 2E1BA 2O2XA 2P91A 2ZSJA 4A1OA 1QYDA 1E5XA 2XW6A 2QGZA 5A06A 4RELA 4MVJP 4W4TA 3JZDA 3UAWA 4OHYA 1F6BA 2MHCA 3OLZA 3RARA 4ZOLA 5HA5A 5F4BA 4CMBA 1DBQA 1AS3A 1H2BA 2YWBA 3Q7QA 2WNIA 4IGFA 2Y3IA 3U7JA 3LUFA 3QTLA 2O8BA 1XZIA 3QNWA 3H18A 1X7ZB 1BS2A 4ARAA 4ZKDA 3A8IA 2Q0HA 4LQDA 2DKFA 3SFTA 2BDEA 2SCUB 3CRNA 2AQKA 2IEAA 2XLBA 4UOEA 2GJAA 4HDCA 1A69A 3IO3A 4OM8A 3L5OA 4NMXB 1XZBA 5EXTA 1POWA 4TTTS 1R4ZA 3GOQA 3GJTA 4IQFA 4NCXA 4EW2A 3A3BA 3ENQA 5DM1A 4ZAZA 3WK7A 1I4EB 5KJFA 2PJDA 1T1SA 3O74A 1B8NA 4NENA 4F1KA 1T9DA 2I22A 1EXWA 3DWFA 5EINA 3FHJA 2L82A 5IBPA 5LXTF 4DV1B 2IZ1A 5LL6P 4UU1A 5LYJA 4MULA 4KK4A 1PQUA 1YHYA 1M10A 3PUNA 3UF0A 5T67A 3WKAA 3H7IA 3AEUB 1PFUA 3F9RA 3I6QA 1UBOS 4OU4A 4BCDA 1GGKA 4QTYA 1DX6A 2I1WA 3LP6A 1RHMA 2FPIA 2JS7A 3BJEA 2PSEA 4R98A 5K0LA 3ZCRA 4Q9LA 1HPLA 4AKTA 4DWJA 4HN9A 1QRAA 1UMCA 4V3CA 4EPTA 1YQ9A 4Y2TA 2ZITA 1L5VA 5KKCA 3ZD7A 1CEEA 3E2IA 1VHOA 2BFPA 4W8HA 2A1TR 3IERA 3Q8LA 4X41A 4DCSA 1VKHA 1RAIA 3GQVA 4WOJA 4YR9A 5IC5A 1KY4A 4I2NA 4A9AA 1IY8A 2H9AA 2VDKB 1N36B 2NNLD 1B8UA 1DFHA 4UBLA 2WM3A 4BBPA 5TE9A 1XA3A 2ZUBA 4N6GA 4ZI7A 3MFYA 4XGKA 1IDOA 1XR3A 2HPZA 2IF0A 2YR0A 3PLRA 1O6BA 4NARA 1X7ZA 4QO7A 2SCUA 2GHRA 5CU7A 2PKEA 3T5BA 1PZFA 1TKRA 1AXRA 1PGPA 2HSZA 1QGDA 1RFLA 2QAGC 2W43A 1YIDA 3FFWA 3LFTA 3N6XA 4P82A 3N8DA 2OHGA 5FQOA 3RVBA 2BMAA 2HD4A 4L8LA 1Q12A 4CIVA 1UFOA 5P8WA 2OCYC 3GLIE 5A3SA 2GF0A 3DH0A 5EXDA 3TGPA 3O8RA 1SG6A 3WX0A 3Q5GA 4FS8A 1OU4A 1WHSB 4C2AA 3GA5A 1DQYA 1U98A 3P7MA 4L85A 3ORFA 2XXJA 3AEUA 4MK4A 2Y0CA 3B6EA 1ETHA 4XX1A 4QFMA 4K88A 5GP1A 3ULKA 5A5GA 3T35A 3OX3A 5LIRA 2I2WA 4YAOA 2XE8A 3IUBA 4WGGA 1FDVA 3F46A 1JHMA 4YRCA 2D06A 3UJ3X 4DC1A 1V5WA 1XNHA 1WMAA 2QP9X 2PM8A 3DZDA 3ETLA 4EKIA 4QICA 4XZ3A 2GJPA 2HTEA 3CLHA 3UJAA 1HH4A 4ERNA 2PPLA 5LIPA 4Q3NA 5KC8A 5JDCC 3RLIA 3I2IA 3QU7A 5DRYA 1LJ8A 4B0PA 5JSFA 2G3YA 2FTKE 4CN9A 2NZJA 2ENWA 5HIAA 2WUDA 3EXEA 1YJNB 3RS8A 4IXDA 3DVQX 3VZQA 1GGMA 1RHUA 2UYHA 3RJTA 3FUXA 1YJ9B 2Y9PB 1NN1A 1MX3A 6AT1A 1JEEA 1I1OA 3BYZA 3OTWA 5KIAA 2CLKB 3QVVA 4DUPA 4RJIA 4CEHB 3VV3A 4EUFA 5EJ8A 1ATZA 1DDGA 3WQRA 3WFZA 4HDKB 1JH9A 4IUYA 3CUTA 5HEKA 1J8QA 1H6CA 1I0IA 2KSQA 4AJ1A 3MWYW 1Q1ZA 4DA9A 4JLJA 4LMBA 2O2CA 5JCXA 3K1JA 5E0KB 3RVNA 5ITWA 3O3NB 3QHAA 1N1GA 2YXPX 4TQAA 1SVUA 2JIDA 3MTJA 2DQYA 1WX1A 5BV0A 3RAEC 1QP7A 3HXMA 3KUUA 3N58A 4WNIA 2LCIA 5JE8A 3HXLA 4P6VF 2FHPA 1WHSA 3CW9A 1RXIA 4YRDA 1DIRA 4MS3B 4QHSA 2I3DA 2OYNA 3KBOA 4RK1A 4F6LA 3UBMA 4Y2QA 4ZEOA 4KMSA 2XITA 5DNEA 3AFIA 2EBHX 2OB2A 1K0UA 3OUTA 1VL1A 3D6HA 3DUFA 2RBEA 1KFEB 3DJFA 3G2HA 1E6LA 3LA8A 2OZLB 3CF6R 1BHO1 4RV5A 3E1SA 4X95A 4ENRA 3NAZA 4AD8A 3N0VA 1LBEA 5KX5F 1MO6A 3Q8MA 2FLKA 1PQWA 4LYGA 4O2AF 4B32A 3ZZ1A 4QLAA 4MUKA 1V47A 3LNTA 3NHSA 3LS2A 1NPYA 2YXLA 2R85A 3A3NA 4D7AA 1Q5PA 3CISA 4BFYA 5C8YF 3A4IA 5F52A 5AM1A 4DOMA 1GHTA 4PZ9A 3B6MA 3IHKA 4WFKA 1DRKA 3B3FA 3KD2A 5G4KA 4PYJA 4FOPA 3C3DA 3DOUA 4CEHA 4PLPA 4C22A 5AVQA 1IY0A 3FYUB 1CIVA 1PNVA 4HDKA 4DV4B 2O57A 3N28A 3LSYA 2Q9AA 5IN4A 4WOKA 1UBRS 1XOIA 2PH1A 4UTXA 4O8ZA 3T5MA 2W6ID 3FYTA 2C9MA 3HBNA 3K8ZA 4E22A 3V4LA 3QE3A 1IOVA 1BDJA 2QGNA 3I9OA 4MA5A 1O58A 3P94A 4U02A 3I2HA 2VQ6A 4ZMRA 5B64A 7ABPA 4XIJA 4HI0E 3IA2A 4KGXA 1KOFA 4RNCA 5FT9A 8ATCA 1SCBA 1OBVA 2IELA 3SS9X 2MDTA 3IEMA 4MVJA 4DSUA 5TJ9A 3L7BA 5A88A 4PBRA 3LJKA 3TSYA 5KNDD 1CRWG 1PZXA 2NSHA 3E7WA 3SYTA 5K2OA 1E2LA 2LIVA 4UU7A 2YN4A 2FCAA 5IYNA 1KXZA 2OZLA 1N6KA 3AC0A 4W5JA 2BGUA 2B7BA 1HG0A 3JTEA 5A2QA 5EHGA 1ODIA 1U65A 2JHCA 3HN7A 1DCKA 3MTDA 3MB5A 4MEAA 2Y4OA 4MPPA 1QO0A 4WKGA 3WKBA 4YVFA 1Z4MA 1HRDA 3O3MB 5AVKA 3V7FA 1F06A 4JA0A 4QJ5A 5CXSA 4BFWA 4DLBA 4EATA 2QLMA 5EJ6A 1LLFA 3IQWA 4KR3A 1HOTA 2YYYA 3AR2A 1A27A 3FLAA 1TEZA 2NG1A 1S3GA 4G1MB 1HV8A 2HREA 4CKZA 1QRRA 1Y37A 4YAEA 4HZIA 4YPVA 5AVSA 2H85A 4NJOA 1W48A 4ZQFA 2ACVA 2BHRA 1A95A 3WNDA 3BGOS 2P1RA 3DMTA 3M4NA 5EVCA 4PX9A 2AMLA 3C8UA 3RAJA 4K3UA 4KQ6A 1WKCA 2LPMA 2ZUSA 3ETJA 3FGPA 4ZT7A 2WB4A 3QVLA 1IN6A 1DB3A 4JK3A 4KNYA 2XB4A 3E1YE 1Q3TA 1HEUA 1P1BA 2Y1LA 4MI3A 1JXQA 1K66A 2ZL7A 1H2ZA 2HJSA 2JBHA 4ARZB 3IEVA 1PL8A 3VX4A 2QN6A 5H1YA 3FSJX 3GCWA 1ZMTA 2RJ3A 1MGOA 2F90A 4ZREA 3KLOA 3DVRX 1P72A 3FDXA 3NIGB 1VSVA 3FJ1A 1GVHA 3CCCA 1ZIYA 2BKXA 1E98A 3B52X 4ITVA 4I5EA 3T56B 2V8BA 4GX5A 4L6AA 5K7SA 1P18A 4Q7JB 4Y6GB 4BAUA 1ZIPA 1XTJA 3EFEA 2VYVD 4JENA 4DWOA 1IPHA 1J0DA 2GO7A 4JR2A 4LNUA 2DXIA 2ZYHA 4WLNA 5DOVA 3FTDA 4D9CA 1G64A 1G8FA 4OHWA 3ZJTA 4OOFA 3E0QA 4WZLA 1W2GA 3TDKA 5AUQA 1GPBA 4IKPA 2YNMD 5SYNA 4Z3DA 2P2YA 2VWQA 1Y8AA 1Z5OA 3OBIA 4ILKA 3NBAA 5CAEB 5F9FA 2VHCA 2PKXA 3FMGA 2TMYA 4LVCA 3IV6A 4BN5A 2OXCA 1PL0A 5H02A 5CFLA 3GRVA 1LPSA 3JAWB 3Q3JB 3D3KA 2QAIA 3BAZA 4POOA 1IG0A 4OB8A 2BE9A 4XASA 1J9EA 5LDDC 2YZKA 2AC2A 2O5RA 4QECA 5JBIA 1LF5A 2ZIFA 3ASSA 1JVSA 3DAFA 4X63A 5F77A 4LBZA 1IQPA 4GNRA 4PBSA 4CEIB 3ZV6A 4CQMB 1CJUC 3HFGA 4TUYB 1G59A 2GPYA 4B7UA 1E2PA 1YE8A 3A06A 3TZHA 3CA8A 3MT8A 3O83A 2OTLB 2NPOA 2FWMX 1C29B 3H9NA 1R6DA 2VJAA 1JHZA 1RR6A 2JGJA 4CG3A 4ECAA 2PH5A 4UDYX 5IKMA 1AHHA 4WVFA 5I7OA 1Z0ZA 3R7NA 3R41A 3ZCXA 2WSBA 2O2JA 2Z98A 5FV4A 1KI9A 2PBLA 4OQZA 1G291 3AJEA 4Y6RA 4ZCLA 1SCUA 2JDIA 4UCWA 3ZY2A 4GX0A 4FZ3A 2PAAA 3AI3A 3BDVA 4KMMA 4E3ZA 3KZKA 1H2EA 1Z37A 2J3JA 4MVJE 5A04A 4JOSA 2I3BA 3WO1A 2DHRA 2F1RA 4ME6A 4XA8A 2EDAA 2QE7D 3EAFA 1I80A 3GJ7A 2W2OA 4EJ0A 4F6RB 3RIYA 1AUOA 1OWOA 4U7HA 3IBTA 3F78A 1UK8A 4X3CA 2N75A 5TDHA 2JCGA 5CVTA 1Z2EA 4D97A 2WOJA 2BOVA 1EE9A 2CLFB 4FSXA 1GQRA 1BVRA 5GGXA 4IQ4A 1XCMA 4IDFA 3H2BA 1DLJA 1G0OA 4Q9NA 3PHIA 2O8VA 1CR4A 2IKQA 2JA2A 2Q8PA 2HRZA 1FTYA 4AJIA 3HK2A 3DF9A 1HL3A 2H65A 2R4UA 2RG7A 3RIEA 1HNWB 2ZR9A 4HEA6 4PC2A 1RQRA 4CTNA 1U63A 1E8DA 4PV7A 4WMLA 5DN6A 4DZTA 1K06A 3TAHA 1JFRA 3IEPA 4CWAA 3PIDA 4HATA 4H59A 2W37A 3X2SA 4R1UA 1RHRA 1JA0A 3LPMA 4GI1A 4CEIA 1EEXB 1YVDA 3VRHA 4TKMA 1D03A 2JFHA 5LUBA 3DXFA 2PSFA 1A8PA 2AJ8A 4MGEA 4KR0A 2ZBGA 4Y2RA 1E6KA 1XNRB 1EFDN 3GH1A 3IUQA 5BSWA 5C7IO 4KXWA 2BHTA 4ZOCA 1SD1A 1WVGA 2D59A 3K0CC 4KN6A 1FRNA 4OHBA 2G06A 3BKWA 2C98A 3UJ6A 4KVAA 2O7VA 2GXSA 3G5LA 3LPAA 4XPIA 3GVIA 1K5HA 3E7DA 3TW6A 5BN4B 1ZUWA 4BMSA 2O8FB 3PFHA 5AIAA 3TZLA 1WQ3A 3IALA 5LP6C 1WP4A 2OAP1 3KKQA 4JB2A 1EVYA 1GU7A 3NBKA 4FE4A 2O1WA 2P9GA 2C31A 3E27A 1UD5A 4FYXA 5KHAA 4LDRA 1NW8A 1G60A 3BH0A 3BD8A 1AXGA 2QVBA 2BUAA 1T8YA 3I53A 3WLNA 3QYFA 2Q5EA 5LSAA 1TTQB 2PUVA 4JBHA 4Q4AA 1C7FA 4IH4A 2BGNA 3PWKA 4MUFA 3T7TA 5HRAA 4XRGA 1NE2A 2HUNA 4QXMA 2C4KA 1FY2A 3WGHA 1G19A 1TX4B 1LFAA 2PVSA 3GNTA 1WBDA 1YZKA 1ENZA 2NYAA 1KEZA 1TK3A 2AQ8A 1BX0A 4FBLA 4LISA 1FFSA 4FCTA 4EDHA 3OCVA 3ZD9A 1ULBA 1R4NA 3IT3A 3OUUA 4V0LA 1L1QA 3KPUA 2WF5A 5DHQA 2I67A 3D81A 3HWX1 3WL6A 1C5KA 4EMBA 5BR4A 3HVIA 5J63A 1LLUA 2CNDA 1N6LA 3BMXA 1PNQA 3H1EA 2H1IA 4IOMA 4OPMA 3R8XA 3ZY3A 2G08A 3HFRA 1MVNA 4GM4A 5TS3A 1KIMA 3ASPA 1CUFA 3HMQA 1OREA 3IIKA 5HSGA 2AI3A 2W2KA 1HEIA 1N75A 3GD5A 3RFUA 1XZMA 1NPDA 3HKCB 3BIFA 3HSYA 4J75A 4JU9A 5DI3B 1XUOA 2VBFA 4MKFA 1V25A 5CLIA 4JOBA 4Y2XA 4UQLA 1I7DA 1ZUD1 1WG8A 2Q0QA 4RH3A 4BBAA 3IPAA 5AH0A 1IPEA 3BA6A 5BN4A 3KKPA 4QGAA 3NFYA 2JJYA 1IWBB 5FADA 3V34A 3ZCVA 4BB0A 3VR3D 3JARA 2YXBA 3KYDA 2HV8A 3WLSA 4C5AA 3CCJB 2AN3A 1OHHD 5SY9A 2P9JA 1APBA 1YJQA 3ETEA 1WCIB 5G0WA 4X62B 3VU3A 3W06A 2OKCA 5FR2A 4D4LA 3ESBA 3VR4D 1VM6A 3WK9A 4CIXA 5FX2A 1NYLA 3FOWA 4WXMA 5ADVA 1NPTO 3E61A 2CXTA 3OPYB 2E48A 4NOKA 4ETWA 4BVBA 4NBUA 3DE4X 4RV4A 1D1NA 1RI5A 3T1TA 1OA1A 1JALA 4BP9A 4G0WA 4C03A 4RTMA 3HWSA 2CCJA 2M9MA 4PVCA 3SVLA 4BV8A 1TVEA 2IOFA 1N2XA 4BVAA 3MTIA 1UZNA 3SBXA 4R01A 4L4UA 3OLYA 3UTCA 4UDXX 4CQLB 1CS0B 4E51A 1LK5A 2CVOA 3D0KA 2DR3A 5K1ZA 4A91A 2VDNB 3KZ1E 1SVNA 1VIAA 4OQPA 1OZHA 1U8FO 2CCKA 2FPRA 1F8GA 1R0BA 1QIJA 2W11A 2X6RA 2NO5A 3H9EO 4HB4A 1U0FA 1JA1A 3DDUA 2I9PA 4IX9A 4CLEA 3CBGA 1WD7A 4FHZA 3QW2A 2PIAA 1NU8A 3HU2A 1XVIA 3JASB 4PY2A 4F11A 4GKJB 2KYRA 3LX6A 3FM9A 2HK9A 4IRUB 1LPMA 1ZICA 3MJEA 3JQ6A 4RJKA 4UAUA 2WV7A 3NKFA 1RLMA 2CN1A 1LQ2A 1QAQA 1ZMOA 1Q44A 2P8SA 2BGIA 5IARA 2ZT6A 4Y7DA 4HQLA 4ARIA 2CUTA 4OUDB 1JVNA 3NIDB 3T5PA 5FWYB 5A5EA 2P67A 1WCIA 1T24A 3LDFA 1JDUA 2FSVC 3HH8A 3ZE1B 1JQDA 2IYRA 5CM8B 2QU8A 1T0HB 5JSZB 1CDDA 5NLLA 4N4AA 4P4GA 3UAGA 4YFYA 2EFEB 2GEBA 2PS9A 2Q1WA 1CJKC 3LM8A 4FP9A 4JJ8A 3ROGA 1TIPA 1ZGAA 3QVTA 1B43A 4RW0A 1KJQA 3UQYS 2F3PA 5D3QA 2OD9A 3U56A 5TQVA 1YAJA 3GMTA 5FL7A 3RIMA 3UFBA 1UP7A 4QVJA 4I55F 4LOLA 3NHMA 1PR6A 3DE5X 3GBSA 4O4LF 3PXEA 2B4KA 2NU8A 4RTRA 1JLLA 2HCRA 1VE9A 1NE7A 3BIOA 1WP9A 3V33A 4CQLA 3GHYA 2UUOA 1JIIA 1KU6A 4J3JA 4KHZA 5HIJA 3DG9A 3FPSA 1KARA 3TXYA 2OFXA 2GLTA 3TQOA 4EY5A 2ZRMA 4Q5IA 3UMRA 4QYSA 3D8BA 1J8VA 4FVTA 1PZHA 4DLRA 4G6IA 1XDBA 3G82C 3ZPXA 2UZ4A 1A7JA 1JP7A 3UGKA 1C9MA 1F0KA 2CXQA 1H9AA 1T29A 3AWDA 3OZRA 3V32A 3WBFA 4F3NA 3JASA 4L5BA 4QEKA 2A5YB 1DFGA 1EB8A 3DM5A 3HJGA 5FOXA 1N0UA 4O2BA 2P79A 3EISA 4PYIA 4RAQA 4BMXA 5KU1A 4IPTA 1QPZA 4UEKA 1Z17A 5AW9A 1XVTA 2RAPA 2VWHA 2QQ0A 3NAMA 1UT5A 2Z6BD 1Y34E 2B82A 2M6LA 3RLFA 2C00A 3RFVA 4A0RA 2RG1A 2GAOA 4DPMA 1YJBA 2BCGY 2PKQO 4V24A 4Q7QA 1GNPA 1YCGA 4QGHA 3HZHA 1GRVA 4PZAA 1C2TA 2X2EA 3EPHA 4GPTA 4KCGA 4LPSA 3MMZA 4G8JA 2REXB 1WY7A 2JLSA 3KJGA 4HVTA 5FOTA 3UWSA 4M1SA 3URMA 5JRDS 3RUIA 1D2HA 5AVJA 3IOEA 2H57A 1V8DA 3BXGA 2CUZA 3Q3CA 1MJFA 3IR5A 3PE4A 5A1TA 5JAZA 1N3IA 1LLCA 4DJEC 5ALDA 1S8AA 4ZN6A 3FG9A 2WJ6A 1VHTA 1S3FA 1AGRA 1FRVA 5BOSB 5H3CA 1I18A 1HDRA 3SR0A 1CQZA 1KE1A 1TIKA 4Z54A 1PU2A 3CE6A 4IIJB 5HQ3B 5TT0A 4AP6A 1I4DD 1RPNA 1ZD8A 2QLLA 2YYSA 3CINA 1EUYA 1CW2B 1Z82A 4TT3A 4LZPA 3E9EA 4C1BA 1Z8HA 4YUZA 1IRIA 1BAPA 3GFQA 4DLKA 1J8FA 3DZFA 2G9RA 4F4FA 4M1MA 5TQ0B 4AXXA 2XDWA 2EF0A 2H5LA 2XB8A 3PKJA 4DMMA 2EYUA 3IT0A 3NASA 3QI7A 3Q3HA 1C9DB 3C43A 2IY9A 3PWZA 1OXTA 4IDCA 4ZGQB 1GAQA 2GAFA 5K6AA 1WP6A 4OHCA 4X7PA 1JLSA 4CM9D 1R8JA 3BHJA 3HYLA 5JXJA 2VRBA 2I65A 2QD4A 3NNDA 1YE3A 4JVLA 2CF4A 2WMDA 2FRVA 1MNAA 5JSYA 3S55A 4IKOA 3F71A 4R5HA 3PSAA 3UUEA 3VOTA 1SXJC 4MPJA 3BY2A 1BO6A 3CSSA 4RK6A 1XHLA 1MHTA 3QWAA 1ZA2A 2KMLA 5KYKA 3QU9A 1V8OA 1G5QA 1XEWX 1SQ6A 2B98A 3CZ9A 2CCGA 3BGDA 2GPTA 3BDAA 3RAGA 2HLDA 4QM7A 4LYAA 4OLJA 2VF8A 1OWNA 4R69A 3KZXA 4JP3A 4CG1A 4XKJA 1K28D 1VJTA 3GARA 5CCEA 3GYBA 4C2TA 2AJLI 5JI2E 3V4FA 2YHBA 4KBGA 3NCTA 5FH9A 5BOSA 4INZA 2J0VA 2FH5B 3A1SA 4W7SA 4YO8A 1NYRA 1MRNA 4IIJA 3GFPA 5JPDA 2A30A 2Q1UA 3CLSD 1X8KA 3T7IA 3ROFA 3QPWA 1N8SA 4XIGS 2AMVA 3DMPA 1KQOA 5B1YA 2B8WA 1YI2B 2ZSDA 4BMZA 4WBNB 1BS1A 1QF7A 2R8EA 1ZN8A 3N5KA 4X24A 1NOJA 3QUSA 3PKZA 3WWZA 1KQSB 1RP7A 3PS9A 3LYHA 4B3JA 4K9NA 1N08A 4WZTA 5LMZA 2AQHA 3W8FA 4Z49A 5CX1A 3CVYA 2XX3A 2YY7A 4QQKA 2XVZA 4XXHA 3BBPA 1K7EB 4AS2A 3DWEX 3OIWA 3QIVA 4G4SP 5B36A 5JAPA 1YZUA 1MH1A 4YQYA 1KI7A 3A2MA 1M0TA 4AZSA 1YBHA 5ELLA 2Q2VA 1FTNA 4JCCA 4NG5A 2DEUA 2EX0A 2PAFA 1X39A 4MNTA 3JRWA 4AK9A 3AF1A 4YJ3B 3SHTA 4NRDA 2E89A 4U5XA 1QG2A 1F2TA 4KKVA 1K8YB 3RSSA 2D1YA 4Z9AA 1AG9A 2V9ZA 4JUCA 4E2FA 4JI4B 5L46A 1KO4A 3FUVA 3FJOA 2OUKA 2PBFA 4GGPA 1VRVA 2XA1A 3EEQA 3EH2A 3HKBB 4U7GA 5BSMA 4A2PA 3AF2A 3BQMB 1SUIA 1CY1A 5BT9A 5DNAA 3VDQA 2Z95A 3EASA 1HE4A 5GV7A 1SPBS 3G2OA 2AL7A 4GEGA 4OMFG 5A4AA 3KYCB 2EHJA 3WO0A 4HH0A 3VPHA 4PGFA 3KLMX 2Q5QA 2Z3WA 3U3OA 4J7UA 2OBFA 1RP1A 3OFVA 4R0VA 3R40A 5B3JC 2A9KA 2YXDA 4M1OA 5KTKA 3CKKA 4S04A 2DR2A 2TMKA 4HXEB 4D45A 4HUTA 4RIIA 2AF3C 4WNYA 1QIHA 3CLVA 3MIZA 3ORQA 4G09A 5BWNA 1SBYA 4LOIA 4RHCA 2VNKA 3ZHSA 4LE1A 5IW8A 1PFKA 1KMHB 1EK2A 1W5FA 3ZDEA 1J2TA 3F97A 1UC5B 2OXFA 3OCWA 1N2JA 5K3EA 4RA9A 1ML4A 1JEYB 4EYKA 4JLBA 1S2DA 3RVRA 5C80A 4GICA 3VVCA 4AY3A 5KTMA 5JWRA 1JX6A 3GGPA 3J80A 1MN6A 1MZPA 2IUUA 3EWIA 4FZVA 4MVCA 4MQEB 1F3OA 1P4JA 1RKVA 2YOHA 3P0JA 4OXYA 1YDFA 1Q1AA 4KQCA 4MA4A 1IVNA 2CWDA 5JBQA 2HU8A 2VP0A 2XEDA 4UXIA 1WV1A 3L43A 3ZHUA 2D2VA 2WTUA 2BZ1A 4AJHA 4RAOA 1BW9A 4R16A 1ESNA 1XO1A 4EUSA 2BTEA 1W59A 1W4AA 1U8XX 4BMYA 1GZDA 3DE2X 1IVSA 4DEYA 3BWYA 2WC1A 1MC8A 2PX8A 4EPRA 1D6NA 3E5NA 1RCFA 3BILA 8ABPA 1YS9A 5JMTA 3V2HA 1K8QA 3V4ZA 2J6CA 3CF4G 1UODA 3KJQA 1M72A 3TIXB 2IEBA 3HKBA 3TL2A 2NUAB 4DCMA 1ZM9A 1OYVA 3E22A 5PNTA 3HUTA 1AGYA 5JTUA 1QX3A 3GP5A 2YIMA 4HK4A 3ZU2A 1OCEA 1F12A 1MAAA 1VG1A 2QKYA 3UGTA 3NVAA 4KVGA 4U3JA 3WJ1A 2PZFA 1NLYA 1RQ2A 2BHLA 3FA2A 5KDDA 3FWKA 4ZVMA 1J0EA 4BKRA 4KE9A 1UWVA 3KEFA 2QA5A 3DB2A 4UE6A 4U6SA 1TU3A 5B1DA 3N7TA 3GLKA 4PLYA 1EVQA 3W77A 4OBBA 4PYMA 1KMHA 1M6WA 2YY6A 1GYRA 3FNHA 4ZZ3A 3ZY4A 3L02A 2WG1A 1JEYA 3X1WA 4CDMA 1STOA 2Q9UA 3LY8A 3QUQA 4YCDA 3DZHA 4ZVKA 1VF7A 3QFTA 4JBIA 3ZI0A 3CWCA 3GGGA 4NAUA 1V5IA 1JKMA 1P5RA 1WXXA 2CMKA 2IXBA 3LY7A 4XQ9A 4D8XA 2ECQA 2VPXA 4MW6A 1ZJ5A 1LTQA 2LD4A 4TWAA 4W9RA 3H3FA 1B8OA 3IXLA 2ZZNA 1JFVA 3CUWA 4MKHA 4AIRA 2RHRA 4MRPA 2FF5A 2A9PA 3MJTA 1N7JA 3WGVA 2FSIA 3FUUA 3L46A 4JP1A 2ZQZA 3FMIA 4BNDA 3RYIB 4HWKA 3QK7A 1VJ1A 1LBSA 2QY9A 4AU1A 2Z9BA 3NC4A 5EJGA 3UM9A 4JBNA 4ENSA 3B1VA 4N8EA 1RWQA 4PAMA 1IU9A 3NG1A 3L06A 3QEMB 4ND4A 4F9FA 2X8AA 3G2IA 3PEWA 1OB2A 3ESQA 5I9MA 3AM1A 1NZFA 3LRTA 1CS4C 2EX4A 5T6BA 3A1PA 1PFQA 4ZJZA 2JAXA 3IAEA 3LP8A 3S2FA 1SVKA 3CP8A 4KAXA 3RABA 3HCFA 4I6EA 4YRAA 4RTLA 1Z75A 4RGYA 2QUBA 4I14A 821PA 1QAMA 1U2EA 1Q0SA 2CBZA 4ESEA 3DMFA 3A14A 1MX9A 1ZVQA 4NBRA 1RDFA 1E2HA 3KVYA 1KAHA 3OIVA 3UWMA 4PG8A 1SKMA 2P9CA 1VGQA 3TMKA 1EGAA 4PHCA 1J99A 2GVNA 1KSJA 1QDEA 4ZCMA 1XF1A 1PEDA 1PTJC 3SVTA 2NQTA 1I3KA 4J1TA 3ADKA 4FFWA 4XLEA 2QW0X 3GEGA 1TO2E 3L7YA 2XH8A 4BLQA 3T3NA 2CT8A 2C42A 1LSOA 5AJWA 5DBFA 4B4KA 4BVGA 1C1XB 3E5RA 3SVZA 3ZWOA 4HWGA 4MR9A 2X0DA 2AWNA 1QONA 1OV4A 4GI2A 1QOPB 3FCUB 4B48A 3FCCA 3QYPA 4MP3A 1NF2A 2UZAA 3EXAA 2G04A 3LPLA 2GK6A 2Y77A 3UANA 1ZMXA 1NL3A 4CLRA 4E94A 1XRQA 4X06A 2OENG 3P19A 4IZOA 5GM1A 5JZMA 3CCVB 4Q93A 4L0MA 3K9CA 5KPJA 4ZV4A 1FE8A 2QNIA 4FJ1A 1G3UA 4YNBA 4H6VA 4Z3OA 2VF2A 4R1OA 3PHJA 4KWIA 5EKUA 5A0FA 3QUAA 3E9RA 4PSDA 3H1AA 1CR2A 5HKOA 2FZ4A 1A4IA 2ZL5A 2WD9A 4BX2A 1NN3A 2E1PA 1C7IA 2XGGA 3JPWA 1KWGA 1U9JA 1AO3A 3OZFA 4X92A 1TA0A 1ILWA 4NDAA 5TS2A 1M1UA 6YASA 5JARA 2YYAA 2WTBA 1JU3A 2QYHA 2I33A 5BQPA 2ZBEA 4NJMB 1Z83A 4E31A 1V0FA 2BLNA 2OPHA 2QRQA 4PZPA 1HLDA 1T1GA 4JLKA 5GINE 2ZU6A 5IM5A 1W88A 5JNRA 3IOYA 3I6MA 5DSZA 1NTOA 2I1QA 4WBXC 4C6SA 5JXIA 3AHJA 4EAAA 5ICFA 2OXEA 4WN9B 4EFKA 5M3BA 1KEVA 4IHAA 3CC4B 1QZXA 2IPOA 4TLDA 4YPFA 2O54A 2BZGA 3AVVA 1L4HA 4YIHA 3BCHA 4XTRA 4F3RA 5JEDA 4OPOA 4ENPA 1C1XA 1WSAA 1YB6A 4O1HA 1NJSA 4AS1A 4MB6A 5DP1A 2JLUA 4K86A 3Q6RA 3FVVA 1YCDA 3C3PA 1ODTC 1OSNA 2G77B 3RKRA 4R40A 4ARBA 2N1BA 5IKPA 5JYBA 3EDOA 2FEXA 3DEFA 5F7XA 2XE7A 2B6NA 3K71B 1RRMA 2K4MA 5BNIA 4TS9A 1F9EA 3CJQA 3RCBA 3T95A 3IAAA 3ZNOA 4HGRA 4BWFB 2JGAA 2HLHA 1DHTA 2HHAA 5G0VA 2VOEA 2H16A 5H82A 3WHKA 3OQHA 2I6TA 1HOXA 4F3TA 4X7MA 3MOGA 3ONEA 3TSAA 3PXGA 4YGXB 3USZA 2HBYA 3PCXA 4B6SA 1ZAKA 5KINB 4M0UA 4UREA 4KIUA 3DWIA 4I08A 4J7XA 1JTFA 5LPNA 1E3ZA 1DTEA 3N2ZB 2OCPA 1Y1KE 1T0JB 2ZGVA 3OWOA 3QXSA 4UTZA 3CCLB 4UXJA 1HKUA 1JV2B 4MV5A 3TYXA 5AM4A 4AX4A 2FFBA 3QWBA 4XM0A 1A50B 1P2BA 4G84A 4ISCA 2RB5A 4NJMA 3KXKA 4HH3C 4X20B 4BXOA 3S1SA 4M3NA 1JG3A 1Q21A 3EVZA 2AEFA 3Q2OA 4L4SA 4V0NA 4WZ6A 3WJ2A 1MF7A 3KB8A 4XYMA 1JFFB 2EBUA 4NCAA 2R6FA 1EJ6A 4B7CA 1NFFA 2YN0A 4DPKA 4LJ5A 4NV0A 4X94A 4WN9A 4A23A 1HTTA 1D8TA 2NTNA 1RLOA 3BHNA 4MVJD 4XUEA 2OYCA 1JQ3A 2WKSA 3SU8A 3PCRB 5CBPB 1P6XA 3DDZX 3FOCA 2WUVA 3CBQA 4GC9A 2IWRA 2C77A 1X7XA 4J0FA