4M4SA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in complex with gdp and formate ion mimic aif2gamma*gdp*pi complex (a formate ion substitutes for pi)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSADVNAPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIAFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 108
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m4sA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m4sA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m4sA01
2QROA 4NYMR 3M4YA 2QMUA 5F9HA 2QTHA 2O0JA 4BLRA 3I56B 2E87A 1B23P 5DN6A 5TDHA 5IK2D 3I1FA 2OV2A 2FX3A 5CJPA 2BVNA 3AF3A 3GFTA 2CMKA 2ZR7A 2J1LA 4PHTA 3EWSA 4YMSA 3QY0A 1H42A 1KD1D 1U8YA 2ZRNA 2QSZA 2DFNA 2WJVA 2C03A 2VF7A 1OGJA 2NZ8A 2DYKA 4NYIR 1OH6A 4B3GA 4G1BA 1JA1A 4B33A 2FMXA 2WHXA 1EP2B 3OESA 4POAA 3RANA 1EP1B 1Z83A 4C0QC 3UIEA 4PAMA 3FHOA 1GVNB 3ECCA 2F1HA 2IWHA 1KDOA 1G3UA 3A36A 4PZYA 2YWHA 1Q3TA 4V0OA 1QZXA 3KQUA 4FMCF 3DOEA 5L3RA 1G17A 3QEOA 1GAJA 3SZRA 5JJIA 1FRNA 4MYUA 2V9PA 3GJ8A 4DDVA 4NYIQ 4OK5A 4C30A 4F7DA 5L3QB 4LDJA 1OV4A 5FUYA 1FRQA 3VO1A 2CVHA 4TQUS 2NIPA 1PZNA 1VDZA 3FYHA 4A8JC 2NGRA 4ESVA 1N5LA 4A0FA 2DPXA 2WSSA 3CIOA 1ZM4A 4UXIA 5SZJA 1JR3A 1E0JA 1XZPA 2ZI5A 4EKDA 4JLNA 4GPTA 2GRJA 1QVGB 1CR0A 2ODBA 5AJXA 2XZLA 3QSYA 1NDHA 1BMFD 1U8ZA 4I4LA 4HSEA 5C18A 2VP2A 4XVRA 3OJWA 1D9ZA 3HP1A 1P4SA 1QH0A 5FOSA 4P4SB 4IRUB 4PSVA 4KVGA 3CC7B 1P75A 4B4DA 4BEBA 3QPUA 2ZAOA 2IF0A 4NDZA 5JFGA 1IBRA 1WF3A 4MDFA 2ZSBA 1XTSA 2GDJA 1OB2A 4EJSB 2ZVQX 1XTKA 4BE7B 1L2TA 5DI3B 1KI6A 2NTYC 3L8YA 4DCTA 2REOA 1G291 4IVRA 2FFBA 3OEEA 4HAZA 1G6HA 3ADCA 2QAGA 4P6VF 2R6HA 1Q21A 4Y0AA 4C7OB 4MA4A 4N3GA 4TWZA 3GFPA 4D25A 2IWRA 2IXFA 1ZP6A 3P20A 1E2JA 3F8TA 2IUSA 1Q0UA 3SBDA 4ZCIA 3E1YE 1GNPA 1MOZA 2ZSEA 4Q48A 3B85A 2H17A 3QXHA 2VL7A 4Z51A 4NCHA 4Q9KA 2KBFA 2JLSA 2PMKA 3KXLA 4Q4JA 3BB4A 4PHHA 4IW3B 3CRW1 2GJSA 1XF9A 2ZRIA 3GCGA 1C4OA 4Z1MA 3R7WA 2CNWA 4X8HA 3GLGE 4RVCA 1KY2A 5KPJA 1COWA 3SDZA 4JKIA 1AIPA 4C4PA 4YMWA 4BFTA 2JDID 5EJEA 1YR8A 3PEVA 4IVQA 2O8BA 1MO4A 1XEWY 1KJYA 2CJWA 2D7CA 2HUPA 1ZM9A 2BBTA 2GF0A 1E6CA 5FBLB 2BKEA 1KC8D 1DAHA 4FI3C 3AKCA 1HE8B 1Q7YD 5CM8B 3FE2A 4MITA 1F2UA 4YMUA 1GZSA 1KI7A 2YWEA 3CCUB 2OEPA 4WZBE 3QFCA 4TLCA 3VR3A 4OHXA 4AC9A 4DLRA 4QFMA 1N6OA 2WJGA 4DDUA 5J5CA 2J0VA 2QAGB 4DLTA 4ITRC 1R10A 3ADDA 3MMPA 1MRSA 3BWDD 3O8BA 3QBVA 2OT3B 3QEJA 4JSYA 4U00A 3VR2A 1E9BA 4I1OA 2RGEA 4M9QA 3FFBA 4AIIA 5A5GA 1NRJB 2CHGA 3QFSA 4EJSA 1R0YA 1GILA 2HJVA 1QGAA 1RJ9B 4P3YA 5AUQA 3AGPA 4AY2A 3ADKA 2X8AA 3MG9A 4KFTA 5IRCD 2D7DA 2OFWA 1FMLA 4G5OA 1BKDR 3ZD7A 2HV8A 1GKUB 2QENA 1KNQA 2ZS7A 2QGZA 1II0A 4EFMA 1ZNWA 2CCGA 3ZVNA 2Z6VA 1WRBA 1QUFA 2JASA 1PLKA 3CPJB 2FGJA 1W47A 3ONWA 3LV8A 1OIVA 3VAAA 3E1SA 5JI3E 4RD1A 2BEKA 3AVQA 4TMXA 2IL1A 1A5TA 1KK0A 1DO0A 4JLAA 4PC2A 4DLSA 4QXAA 3OW2B 2OBMA 1G1MA 1AK2A 2VNKA 1YJ5A 4W9MC 4D4KA 4RCZA 3CXCB 3G71B 1KDRA 2ZJYA 1N6IA 3LY5A 1KYIA 5CLQA 3AKEA 2JLXA 1W5SA 2KWIA 2C2HA 4W5HA 1B2RA 5B30A 1GL7A 4RD4A 2WSSD 2YOFA 4Q9HA 5L8VA 3GLIE 1TUEA 1YITB 3EIQA 2XITA 4IOJA 1IB0A 2Q9AA 2IUUA 1JXOA 1YJ9B 4OKSA 4A1FA 3ZBUA 1M1YE 1TQ6A 4FXPA 2MSCB 1J70A 5E7IA 1N0VC 2Q9BA 3B5JA 4NMMA 4FD2A 2R6FA 1D5CA 1KO8A 4XOIA 3ZVRA 1HT2E 2LKCA 3WRXC 2WWYA 3AUXA 3HPRA 4AYWA 4DT1A 1OYWA 1II8A 2Q3MA 4JJZA 1FP6A 1ZM7A 2O52A 3LVQE 4JKYA 4TTQA 5HTKA 4ZV4A 3L2OB 5HZHA 4HAWA 1N6HA 3KX2A 1US8B 3FTQA 5DNYB 3W2IA 2J59A 1A7JA 1SVKA 4K81B 4L5BA 3K09C 3ES9A 2OXCA 4WOPA 4EDHA 1QFJA 1AZTA 3RS0A 4UNQA 5KSZA 2O8EA 4WAUA 3QENA 2AK3A 3NEYA 3C15C 3W5UA 2NOAA 2V55B 3LQRA 4TMVA 1MO5A 3MJRA 3PFIA 5KNCA 4AKHA 1VHTA 3DL0A 4F38A 3TJZA 1I4DD 4V0LA 2JGNA 1D1NA 1JECA 1XBTA 2XJ9A 1IQPA 1Z08A 1XWIA 5KU1A 3UMFA 4C0JA 1YRAA 3TUIC 3UKDA 1CNFA 1P9RA 1X1RA 3A1WA 4HUTA 4PR0A 1Z0IA 2JAQA 5LD2C 3LO5A 4Z8YA 2QT0A 2XSZD 4PXAA 1EXMA 3GLFE 3LQQA 2GJ9A 5L3SA 4TYNA 1HA3A 1Z6AA 2VP5A 3IHLA 3UWKA 2G1KA 3IIJA 2JDIA 5IT5A 1DE0A 5FL7D 3Q5EA 4LYFA 3B9QA 3IPYA 5EXTA 3KUDA 2WMNB 5JWOA 3IEUA 2ZEJA 1PLLA 1BH2A 5DYIA 1JEEA 2OG2A 3VU9A 1IJEA 1CJTC 2AR7A 3QE2A 4ZGNB 1ZMXA 4R2HA 1U94A 5GVRA 4QHYA 2GVZC 1DAEA 4LJ8A 4Q1AA 1DG1G 1IM2A 2V8OA 3DM5A 3BORA 4YXWA 1GL6A 4C43A 4IXMA 1OXXK 3P26A 4BEJA 4EFNA 5FH9A 2ZYWX 2I4IA 5AN9A 2WVJA 5GV7A 3X1ZA 4DB2A 1N6KA 2J0UA 2QTFA 1GRRA 4XJXA 3GD7A 3KKQA 1XJQA 3S1AA 2H5EA 2CHVA 4QBGB 1EP3B 1E98A 3REFA 4HDOB 1UDWA 1IOZA 2EFEB 5DO9A 1YIJB 5SZIA 5EZ5A 2G0NA 3QKSB 3U3JA 4WZ6A 1H85A 4X8LA 1E2PA 2PT7A 1YZTA 4PC1A 4QGAA 1JALA 1NBMD 4YAUA 4TMKA 4LYJA 1JBKA 4A36A 4M1KA 3EZ2A 1OHHD 2BWJA 2IT1A 5J4LA 5D3QA 5D3MB 3KJEA 2C9YA 4Q9JA 4HATA 4JZKA 3R8CA 4CEHA 4B6FA 4UKDA 4Q5IA 3NBXX 1KK2A 4C0AC 1E2QA 4JJKA 1E2MA 1S9DA 4TSFA 1NNEA 2VEDA 2GKSA 1W2HA 1TX4B 4HLDA 1ZM2A 2DWQA 3K0CC 4PPNA 3KJGA 2QA4B 3IIKA 3GJXC 4OHWA 3TUZC 2G83A 1BYIA 1JR3E 3CRMA 4MUAA 5FUXA 4UNPA 5FI1B 2WIAA 2ORWA 4RCYA 4D0GA 1XPOA 2L0XA 1YR6A 4HYYA 1MKYA 1S1MA 2P5SA 4BZPA 1W4BA 3FPKA 4WQMA 3CZPA 3LVRE 3I5XA 2VSFA 5GJBA 2EQBA 2RAPA 2ZETA 2WM9B 3T5DA 1AJEA 4FN5A 2XEXA 4DSNA 1DAGA 5DE3A 2LKDA 5EP1A 5AUPB 2XNCA 3OEHA 2GAAA 1E1RA 4A2WA 4BFSA 4LHZA 3KFXA 3QPWA 3AQ4A 1F48A 4LBWA 4I1VA 2XNDA 4RD2A 1SXJD 2PEYA 4YMTA 3SYLA 2Z83A 4LV5B 2JJ1D 1M7GA 1K73D 2IBMA 3W5JA 3OEHD 4P4SA 4MKIA 3G5UA 2DWPA 3QFRA 2DBYA 1CXZA 4TTRA 4HLUA 2ODWA 3JQQA 1TL7C 1R4AA 1MO3A 4MKGA 1W5TA 1QVRA 4PHGA 5JRZA 1W0KA 2AWNA 2EYUA 4ZPXA 3K0FA 5CM9C 5FPYA 3MWJA 3T1OA 3WMFA 2ZSDA 4NTZA 3PG5A 4RFSA 5JCPA 2ZRKA 4Q03A 4B3BA 1Q81D 2FSFA 2OXRA 2QPTA 3AVWA 3U2QA 2JJ2A 1AQYA 2QPAA 4LPSA 2ZR0A 3NBZC 1DELA 1AS0A 2B92A 4GBMA 3U3KA 1Z47A 2J46A 2ZI3A 4CF7A 2AKYA 3E70C 3IILA 1J99A 4YMVA 1KRHA 1KOFA 2Z5FA 4BRWA 1FNCA 1G7CA 4LI0A 2VYFA 4FWIB 4M1YA 1Z0JA 2EU8A 3AVTA 1N0WA 4DIEA 1VG1A 1H8EA 3Q7PA 3ADBA 3R8FA 2OLKA 1G5PA 1K5DA 2R6AA 1W44A 2ZRBA 3OFNA 4KI0A 3WP1B 5C46F 3GLGA 2IHBA 4DCVA 4MGIR 2W58A 4KJZA 3FDIA 2FPKA 4U5XA 2G9NA 4GSYA 2IYLD 3Q8XB 5H70A 2ZYTX 1MO6A 4IDPA 1T6NA 5BXQC 2JLWA 1VG0B 2WWWA 4HZUA 5SZKB 4JLJA 1PUIA 1WBBA 3PUZA 4D4MA 5KNDA 3UXMA 3MCAA 1ZC4A 5FTMA 4G5SA 1M34E 2OILA 2HCBA 2V7QD 4L16A 2FSGA 1JAIA 3EIHA 4PHFA 1KMQA 2N1BA 2G77B 4W7SA 3V00A 1WB9A 2ZRDA 2IEZA 4IDNA 2PLFA 1NMYA 1CR2A 2H57A 1E0KA 3H4MA 4XWOA 3NHBA 4A0HA 3T15A 2ZI9A 2ZRPA 3OF5A 2DCUA 3E2IA 2AHOA 1KDTA 1FX0B 4B71A 1CS4C 3HPQA 4LY6A 2IC5A 4UXJA 1NY5A 3HU3A 2YC4C 3RLFA 3VTKA 5LD2B 2ZU0C 3EZFA 1CKEA 4OK6A 1DDGA 3K9LA 1FZQA 2WJHA 2EVWX 1S4QA 2IYQA 3EA0A 1E2KA 2BBOA 4OHVA 2NPFA 4QRHA 1ZUIA 2HJGA 4LJ4A 2GK6A 1KSJA 2IXEA 2O0HA 5HKKD 2C5LA 4DVGA 4JLOA 2FSHA 2GCOA 5BW8A 4QJ4A 1IN7A 4QM7A 1G7SA 4Y9RA 4BRUA 4A6PA 1DDIA 2V1UA 2ATVA 3U6BA 3THWB 2FFAA 4F4JA 1NMZA 2AD5A 2IYSA 4GI7A 2C77A 4MUBA 4DLZA 2WKPA 3MWYW 2PZEA 3THWA 1KO1A 3AUYA 3JQPA 1IXZA 3JZAA 2FZ4A 2ORIA 2IK8A 1VQKB 1OXSC 4O2RA 1T9HA 1VYTA 3CF6R 4Q7KA 1T3SA 4BZXA 3WBKA 2OCBA 3K9NA 4ZIRA 2C04A 3AP3A 3B1ZA 3IBGA 2P6NA 1UKYA 5BWMA 3NDPA 3BH6A 3X2SA 3NVAA 4Q9LA 1VQ5B 4DIDA 4HLCA 4M22A 5G3YA 3SHFA 4BLPA 1E63A 4JVSB 1W36C 1ODFA 2QM8A 1LV7A 2OZEA 4LJ6A 5JEDA 2WMOB 1FX0A 1SXJE 2ZRAA 2A5GA 1YI2B 5JHGB 3SI7A 3ICQB 3BB3A 3PIRA 4RD0A 4IFBA 2FG5A 4O3MA 2A2ZA 2OCPA 4P4UA 4GT1A 1IN4A 2AWOA 1NN3A 3KJHA 1HQYE 3OIVA 3GPLA 3U3MA 3KB2A 4TQ9A 4Z8XA 2A3RA 4Q4AA 1YKSA 1MV5A 2F55A 2BHRA 3SJCA 3LW7A 4GOXA 5GJCA 5KPDA 3C41J 3QFTA 3BBPA 2Q9CA 4TYQA 2ZJOA 3EXAA 4LC0A 4IEIA 3RHFA 721PA 4JLBA 3SN6A 1JPJA 5BN3A 1TEVA 4D0NA 4EFLA 5FUVA 5H59A 4HAUA 5AWFC 2RHMA 3CCMB 2GBLA 1XNJA 2PEZA 2RGGA 5AUOB 4YAFA 1EESA 2ZAMA 2XXAB 1NLZA 4G3XA 2BN4A 1FTSA 4J0QA 4I81A 2QMOA 4Q00A 2WJJA 2GNOA 1Z07A 2X19A 3V4RA 1BYUA 4OQXA 2EWWA 2QQ0A 1XP8A 2OAP1 4PAOA 2ZE5A 2ONJA 1GNQA 4F91B 4TTPA 1L8QA 3C14C 3CCEB 1XEXB 4KFUA 3EA5A 2ZQ5A 3RRYA 1XTJA 5EE3A 1SXJB 2ZRJA 2CJWB 3NBYC 3TSWA 1WBDA 1QGYA 3G6EB 4Q02A 3LDAA 2LWIA 4H1UA 1QGZA 2GK7A 2NPIA 3FKSD 3AVXA 2MSEB 4M4SA 2WIBA 2OCAA 2ONKA 3KKOA 3QVVA 4HB2A 4AYTA 4ZGQB 3VR6A 1G8YA 3LWNA 1OYYA 3OEED 5FBWB 3RVBA 1G7TA 2VTKA 1E9FA 1ZAKA 5FOXA 1VHLA 3HR7A 4UXHA 1MT0A 4JLVA 4BFYA 1FNBA 1VQPB 3DDCA 3UMRA 5B58C 1VG8A 3CMAB 1TF7A 1XPRA 1XPUA 1VCIA 3K1JA 4NONA 2UKDA 1VMAA 1IN5A 1Z2CA 3CCSB 2FEMA 2H18A 3C4JA 2QP9X 2GEVA 1F2TA 1EX7A 2GETA 4PPQA 3QXSA 1E99A 4OQNA 1SGWA 3HYRA 4YAOA 4ILEA 2QMHA 4DSOA 1YQTA 1N5KA 3CCRB 3SR0A 4Y9UA 4C0LA 3Q7QA 1DADA 3GFOA 2GBLC 2FF7A 4PTLA 4BFUA 5H68A 3K70D 1N5IA 1Z5ZA 3GLIA 3U60B 2DB3A 3AV0B 4YAWA 2AKAB 2MSDB 1SM4A 1Q1QA 3RAPR 2BM1A 2NO0A 2RHDA 3CH5A 4C2TA 2C9OA 2CNDA 1NN1A 5FPHA 4BLSA 1XD9A 3THOA 1WP9A 2F1IA 2CRVA 1ZM3A 2E1RA 5CDFE 4A9AA 1NY6A 3U3RA 3MJHA 1OFHA 2WWIA 2D4HA 4Q7MB 2JJ2D 4ZO4A 5DYGA 1UAAA 5JLJA 2QRZA 3AVYA 5CYPA 2F3TA 3L0IB 5EP3A 2CLDX 4B76A 5KDOA 4IXNA 3TAHA 2BMDA 2FPMA 5C1BA 1CR4A 1AS3A 2V6IA 2E9SA 2ZM5A 4Q1EA 2DFLA 1GR1A 2A5JA 1FQJA 2AFHE 4URWR 3NC0C 2FE4A 1KO7A 3F5FA 2IYWA 1KNXA 3GMTA 3O8DA 2OBLA 3SFVA 1PV4A 1P9WA 1E62A 3BK7A 2QZ4A 5HXBA 1NMXA 3NWJA 1QHXA 4LZZA 5BQ5A 1E2NA 2XXAA 2QQEA 1N5JA 4A8JB 4JVNA 2ANBA 4LV6A 5B64A 3SOPA 2QSYA 4NCIA 4OYHA 4DZZA 1S3GA 4EIWA 4B3DA 4MRPA 5DLQC 2FOLA 4ARZA 3C7KA 2V54A 1VQ7B 5G3ZA 5IK2A 1UKVY 2X2FA 3CW2A 1LF5A 3VHLB 3GLHA 2D2FA 2FA9A 1E1QD 1Q12A 3Q72A 4URZR 4Q4HA 2P3SA 4TL7A 5DGXA 2NO6A 1NL3A 5JS8A 2OTLB 3FFAA 1OH8A 1KHTA 2VHTA 3SJBA 1GRNA 2GJKA 2SHKA 4DT1B 2WKQA 5E4FA 1AKYA 1G7RA 1JR3D 2OSBA 2QM7A 2ZRLA 5BYKA 2B6HA 3V4FA 1GTVA 2QE7D 4ACAA 2OO7A 3A8TA 3NHAA 1NVXQ 4F93B 1N0UA 5FL3A 1GJRA 1CQXA 1YZLA 3M6AA 1JI0A 1M8PA 4TLAA 3K0AA 4A8JA 1E9EA 2ZRGA 2QTVB 4GP6A 1Q44A 8OHMA 3VR1A 1KSGA 2OFOA 1NVVQ 4DEXA 5L3VA 5EMNA 5KSYA 4MDEA 1EWRA 3MAAC 2H16A 3QKUA 2BJVA 1R0WA 4M9ZA 1G8FA 1RIFA 2JIZA 2RMKA 1T0HB 3B9PA 1SXJC 4KSBA 4HLUC 1ANKA 2R6GA 4TZ6A 4OQFA 2PMDA 3MWLA 3ZVLA 4PX9A 3NIBA 3PUVA 1Z2AA 3U6KA 2WBLC 3N5CA 3U3OA 4MH0R 2ZE7A 3QNUA 3GP8A 1E79A 2VH5R 4PAQA 5JSZB 3VX4A 2CCKA 3IQXA 4R2IA 3VMFA 1MR3F 4LGMA 2XOKA 2BOVA 1I7PA 3WXMA 1M7BA 3QUSA 3QPVA 2WZQA 4DUGD 2OAQ1 1G3IA 2O8BB 2RH5A 4V0MA 4ARZB 3KKPA 4NL4H 1E2DA 4JYBA 3GLFB 4ZDKA 2GXAA 1Q1BA 5FOTA 1DOAA 1HV8A 1DAKA 1Z22A 1J7KA 4R71A 3I73A 1BS1A 1U2RA 4WBSA 2C98A 3RSOA 3QG5A 4NBSA 2P0EA 1O87A 4Q1BA 5DHFA 2FJUA 3W8NA 1YR9A 1EFUA 3WMEA 3ZIAA 5DHAA 4TMTA 1QHNA 1XTQA 3KXKA 3FOZA 1W2GA 4GP7A 5EE1A 1AN0A 4O25A 1J8YF 1E2FA 4BUJA 4E22A 1CEEA 1SKYB 4NPHA 1YJNB 2P65A 2ZVPX 4Q4AB 2H8KA 4HLQB 1W48A 1W36D 3B6EA 4MRVA 3AEZA 2WPDA 1F2TB 4B44A 3EG5A 5FOUA 2BMJA 4CZ2A 1B0UA 1H65A 5TB5A 2O8FB 4CIDA 1PJRA 4FCVA 4C7OA 2WV9A 2REXB 2XAUA 5EQTA 2XSZA 2GESA 2PJZA 5HCIA 3GJ3A 1Z28A 4JL5A 4DHEA 2JLVA 2C78A 2KBEA 2FV8A 1IXSB 2FN4A 2OUKA 2A5DA 4NH0A 2QEQA 3W6OA 3RS5A 2BMWA 1R8SA 2VHCA 1U9IA 2I1VB 3GQBA 4A15A 4MGYR 5JZVA 3GEEA 3FMPB 2ZYVX 2PT5A 1KMHA 3Q5DA 3L0PA 3SQXA 3TH5A 1E4VA 2GPJA 2ZU6A 4XTCS 4DSUA 1OPXA 3AGQA 3W2HA 4Q1CA 1ZCBA 4D4JA 2J7KA 1TAGA 3CBQA 1S2MA 2GZHA 4FMDB 1DS6A 4PFSA 5JS7A 1NIPA 4BLTA 3KTAB 2O8FA 5AJYA 3MHPA 1T8UA 3HJNA 3QIAA 2IS4A 4UJ3A 2VHQA 1HUQA 4RKFA 5FTNA 1XJCA 2D74A 4AKEA 1XCGB 2IEYA 5AJZA 4KFSA 2IHYA 1UF9A 4LSGA 821PA 1MABA 3OZVA 3LW8A 4LPKA 3AP1A 3EZ7A 3ASYA 1IJFA 1JJ2B 3BERA 1CIPA 1JB9A 2HLDA 1CJVC 4Q9IA 1FNMA 3LO8A 1OFIA 1RVDA 3NH9A 4JL6A 3A4LA 4RSGA 4V02A 3W9YA 4JL8A 3BFXA 1QG4A 3CUEF 1KDPA 4IFEA 4LHXA 3VQTA 1VECA 1MRNA 2QDXA 2ANCA 4G5QA 5AJVB 4I1UA 3DMDA 4HUQA 2W6JD 4B3CA 3W6PA 1X3SA 3PITA 4ACBA 1TQDA 2NO1A 4L15A 2YYZA 1GAQA 4ZKDA 2HDNB 4HDQB 3D31A 3E5HA 3QVUA 1K9MD 3W3AA 4V0KA 5BN5A 2A78A 4BFXA 1OHHA 3MFYA 4AKIA 2XNJA 5TARA 4FMCB 4ESHA 2PCJA 2D62A 4PO1A 3WNBA 3FGNA 1PUJA 2IYRA 1Y63A 3Q9LA 4XVUA 3X1DA 1N6LA 2YJTD 1CULC 3HWSA 2XB4A 1XFAA 3ZYCA 1W2BB 2Q0HA 3T34A 4A4DA 1UPTA 3VR5A 3RSLA 2CE2X 2NO7A 5DI3A 4KVAA 4IOKA 2XJ4A 2J7PA 1R5BA 3L0OA 1SKQA 1KY3A 2HYDA 1F5NA 4Y7CA 3SYKA 4DXAA 5B57C 4PC6A 1G8PA 3J81k 1XTRA 3FKSA 1G8GA 1Q57A 1ZD8A 2WAYA 4MQBA 1LW7A 3IBYA 3BAFA 1T5LA 4Q1DA 1ZU4A 3TMKA 3VNUA 1Z6YA 5DISB 5EUMA 2BV3A 2D3WA 5FTLA 3GJ5A 3B1YA 2ZROA 4CEIB 2BEJA 4ZI3A 3QE0A 3IUYA 1J90A 1KKLA 3QXCA 3KXIA 4E5UA 4TT3D 4G01B 2VP6A 2F43B 1QFYA 2ZYUX 4E09A 5JSZA 1OKKA 2ZRHA 2B7BA 1OFUX 4XH9B 5A4JA 2RKOA 4YDSA 5BN4A 2WJIA 4Q7LA 3TQCA 2OLJA 5AK0A 3A1TA 2ZR9A 5H5JA 1H8ED 1G16A 2W6IA 1FL9A 4KXFB 2QU8A 4KODA 1JJVA 2VP4A 3W5VA 1XD8A 2W6ID 4NE2A 4E03A 2QRNA 2W2XA 2QPOA 3GLGB 1EWQA 3CCLB 1XD2A 4E07A 2OHFA 3DO6A 1OXVA 2ODEA 2BSAA 4OQLA 1CP2A 3CRZA 1U98A 5C4GB 1AA9A 4NYJR 3SYNA 4BGDA 1ZJ6A 4V03A 4F4IA 2ERYA 5HKKA 1MABB 2CLSA 3KDSE 5TXGA 2CE7A 3B1XA 2VPPA 1JEDA 4ASUA 1VQ8B 3QKRB 4UNNA 2FSIA 1QBKC 3IHWA 1ZUHA 4HB3A 4IHQA 4P31A 1XXHB 3QF7A 1R5OA 1G8HA 4KLZA 3H1TA 3LXXA 1US8A 3ZGXA 3ZVMA 3ND8A 1Z6TA 4MKFA 4PO9A 4PO8A 4PC3A 1EGAA 2BCGY 1T4GA 3KKMA 1NIJA 2F7SA 5FR2A 2C96A 1F20A 1GFIA 3DKPA 4CEIA 1G19A 5GV8A 4BECA 3T1TA 1U81A 4HUQB 1GDDA 4FIDA 3CNOA 1TVCA 3LX5A 3CRQA 4XIGS 1P72A 2REBA 3MRSA 3KJIA 4YLGA 5TMPA 2NO9A 1BX0A 3M1IA 1JA0A 4GOJA 4X8OA 2HXSA 1VPLA 4HZIA 2EFCB 2HYIC 1TLLA 2WJYA 3L0SA 4I1SA 3GLHE 3CF2A 2QY9A 1GITA 1N2CE 1WE2A 3MWKA 4L9SA 1CJMA 3OZWA 1EFCA 4A6XA 4CEJA 1TQ2A 5EE5B 4EJSC 1R6BX 3RYTC 2FU5C 3W5HA 3OFND 1A4RA 4QC2A 5KUTA 421PA 2XTNA 1FFHA 1G5TA 4LBVA 1LTQA 4C9BA 3KFVA 1NVWQ 2W6JA 3W90A 1P2SA 3T35A 2MMCA 2XZOA 4CRWB 4NU0A 3QKSA 1TF5A 2P67A 3RWOA 2GQFA 2G6BA 2HCJB 1E9DA 1AGRA 4QM6A 1QDEA 3S1AB 4K8OA 3ZD6A 2WPDD 4OQMA 2W83A 5EUQB 3MUFA 2HLDD 1CTQA 4DDWA 3CX7A 2GXUA 4B34A 1XE1A 1KMHB 1VCOA 3DZDA 3KB1A 4LV8B 1TPZA 1F3OA 4OJKA 2RGXA 4QJ5A 5F2EA 2P5TB 5J4YA 4YQFA 3ASZA 3SC3A 2ZUCA 3G4SB 2OESA 3AKDA 1ZYUA 4RY2A 2HT6A 3LD9A 4PPFA 3ICEA 1ZW6A 3IEVA 4OK3A 1AGPA 2IYUA 3HR8A 1D2EA 2OE2A 1QHYA 3MD0A 1UBCA 2ZPTX 1G4AE 2VNJA 1E2IA 4M9XA 3X1YA 5CITA 2XNSA 1G64A 1HEIA 3DOFA 5IF9A 4TMWA 4IJMA 2XGJA 2NG1A 3L8ZA 2J7PD 4KYIB 1CLUA 2VRWA 5A0FA 4U9UA 3CCJB 4KHZA 3CMEB 2B5OA 1RRGA 3BH0A 4LHVA 1NLYA 5SZHB 2AK2A 2QTLA 5EXSA 4TL9A 1OXTA 1U9IC 1FTNA 1S1CA 1EFRD 1NSFA 1G3QA 4U7DA 2CLCX 5IDVA 3BOSA 1E32A 1OE0A 2QAGC 2V7QA 4ERNA 3I92A 4P0TA 3TRFA 3F3YA 4DLUA 5LB4A 1M7HA 5KYKA 1KI1A 1Z0DA 1Z6GA 2R6DA 3D8BA 2QBYA 1G3RA 1VKJA 1VIYA 2Q21A 4GZLA 1P9NA 1YE8A 2R44A 4V0NA 3ZDQA 1M1KD 4M1SA 5CLLA 1I2MA 4QBIA 4NCNA 4PGOA 2HF8A 5FL7A 4A0GA 4BPRA 2D06A 5UKDA 3TQFA 1X86B 3P1JA 3RNLA 3SJAA 4RD6A 2F3RA 5FPTA 2JA1A 2VP9A 1JJ7A 3THXB 4NCKA 1COWD 1W4AA 4TSFD 3CPWB 1XEXA 2HXYA 3EPHA 1TU3A 3SU8A 1XB2A 1S9HA 2K5UA 3QI2A 3WHLA 1IXRC 1R2QA 1MH1A 3Q3JB 3I55B 1N6PA 4IKEA 5HZKA 2XOKD 4D6PA 1UFQA 3RABA 1OXUA 4AK9A 1ETUA 2J87A 4M9SA 1E1QA 4TQAA 1A2KC 4QBHA 1VQ9B 1SVOA 1S96A 3ZZ0A 3DMNA 4QKQA 5FTKA 3AVOA 4S2EA 3VKWA 4NP6A 2YVUA 2GWHA 1SVLA 2XNDD 2F1JA 4AG5A 3U7EB 4CT5A 4QGGA 5K8IA 2QP4A 1E69A 2V4ZA 2ZI4A 1GKIA 4N0EA 1O3YA 1Z0FA 4Q18A 4Q47A 4UJ5A 5FBQB 2QEXB 3I8SA 1C9KA 4KITB 3HYTA 4TL8A 3TW4A 1S3SA 4PANA 2FWRA 2EWVA 2X1VA 3R9IA 3UG6A 1PLJA 2H7VA 4M1TA 4MRNA 4LOAA 5DN6D 4Q1FA 1IY1A 1SXJA 3A1UA 4FCWA 3VNVA 1SHZA 3SE0A 2CVFA 5FBVB 1KZ7B 2ZRCA 4AURA 1QHSA 2GZDA 2YNMA 3CH4B 1U0LA 4WXRA 3THYA 4KSCA 2ECKA 2J9RA 1NJGA 1GUAA 1YJWB 1DO2A 1R8QA 3P4YA 3CPHA 1CRQA 4RZXA 3E20A 3C8UA 4JBYA 4B43A 2N42A 3NKVA 1XRJA 3U4QB 3WBJA 2QP3A 2FEOA 1F60A 2DERA 1FOEB 1AS2A 4PQYA 1E2LA 1Q86D 1RE0A 5L3QA 3H2YA 2O0KA 4YC7A 4EQ6A 1RYHA 2IS6A 4HDCA 3KZ1E 3TR5A 5BYJA 1QX4A 4GMDA 1KI6B 3T06B 1NKSA 2FH5B 4US2R 2BIFA 5E7JA 3A4NA 1QRAA 1LS1A 2Q6TA 5KSWB 4EPXA 1D8TA 2ZJ2A 5F3WB 2AN9A 1OFTA 2BKUA 4HAXA 2KSQA 2JATA 4HE6A 2VBCA 4R98A 2F9MA 221PA 3K09A 1D9XA 3IO5A 3PV0A 3V76A 2YZ2A 2ZSAA 1UEIA 2CHQA 3TKLA 3UANA 1GOTA 1NBMA 4A82A 2WWHA 2HT1A 1IN6A 4D82A 4KYUA 2EYQA 3BGWA 2VSOA 4L8GA 4XTRA 3QF4B 4G0NA 1KO5A 5G41A 4C2UA 3VX3A 5HE8A 4IDQA 3CNNA 4NZYA 4PZLA 3CM0A 2GJAA 1II9A 3SBEA 3UATA 4BLOA 2CEAA 3WNCA 1E96A 2WWFA 1KSFX 2MMGA 4JLMA 5K8TA 2OK8A 1JAHA 1E79D 1XCMA 1LF0A 3EASA 3OAAD 4FWTA 4KO8A 3CCVB 3T61A 2VF8A 2RC6A 1XX6A 4OHYA 2YC2C 3EC2A 1SKYE 4M53A 3A58B 3I8XA 4IOMA 1E64A 2H92A 1Z6XA 4DKXA 2BBSA 1DARA 3CB4A 1JNYA 3R7WB 3L82B 4EPVA 4ZIRB 1FPMA 2PL3A 3T5GA 1JR6A 1IONA 5G53C 4OI1A 3LFUA 4ZDIA 4JVMA 2FFHA 1P60A 3TAUA 4PQFA 1ZNXA 4UAJA 3AF2A 5C2JB 2BGIA 1FUUA 1RW4A 2ODNA 3RRZA 3OJXA 2ZSFA 1BIFA 1DVRA 1T0JB 2GILA 2NQ2C 2BDTA 1VQNB 1HT1E 1UBEA 2ZJZA 3GJ7A 1Y3AA 3NBFA 1Q22A 2JLUA 4LRWA 4Q4HB 1G21E 1P2TA 3W34A 4JVLA 3TVTA 4M0LA 5FPKA 1JQLB 2IA5A 4M8NE 4TN1A 3BE4A 2V3CC 3KQHA 2OCYC 3BRWD 1ZNYA 4BFWA 2ZITA 3ETLA 4ZCMA 5LPNA 2GCOB 2RGBA 1A1VA 1XEFA 4LJ7A 4TYWA 2DFKB 1VCMA 1TTTA 2ZUDA 2B8TA 3ZQJA 4NHOA 1RC8A 2IW3A 1EG7A 4US1R 1YR7A 3LLMA 1UJ2A 1ZUNB 3PEYA 3ZBTA 1RFLA 5TV2A 1N8RD 1RRCA 3OIWA 1QG0A 1G20E 2IXGA 3MGCA 4D4LA 3NG1A 2XZPA 1XMIA 1IY2A 1ZD9A 3AM1A 1QHIA 4MRRA 4B48A 2IYTA 1E9AA 1KIMA 3AF0A 2YOHA 3GJ0A 1FW6A 1P61B 4PSAA 2N46A 2QL6A 2Y8EA 3ZS8A 3OIUA 2D2EA 1WQ1R 1HYQA 2QA5A 1KI4A 2W2TA 3QJYA 2F43A 4G5RA 3LBHA 4II7A 3RS3A 4HEJA 5EZ6B 5J4HA 2IYZA 4B3XA 4DLWA 4FINA 1J9ZA 2VQSA 1H8HA 2ZJ5A 1E94E 2RGNA 1JQJC 2J5XA 4N1AA 5AUNB 1ZNZA 2RC5A 1GNRA 3SFZA 4UNRA 3DVLA 3W5IA 2PZGA 4LBYA 1A8PA 3RS2A 2PX3A 1TUIA 3PEUA 1OH7A 1TEXA 3U5ZB 3I4LA 2J0SA 1L4UA 3CR7A 3W2FA 1XJ0A 2ATXA 1P62B 4A0RA 4XD7D 1G4UR 4JLDA 4XD7A 1CU1A 3K53A 1L7VC 2ZS8A 2A30A 3KUCA 1YZQA 4B47A 1R0ZA 1OKKD 4Y0VA 1UBFA 5DH9A 2RGDA 1VTKA 1OGIA 5EP2A 4EPRA 1R7RA 1T5IA 2ZTSA 3NEJA 3TW8B 4B32A 3NDBB 1KZGB 1SULA 2R9VA 3R9XA 2RGCA 2ASEA 3K9GA 1LY1A 4QL3A 4B35A 3T1QA 1D2MA 2GF9A 4C0HA 1CRPA 3TLXA 1W4CA 4C3ZA 1Z3IX 2QMEA 4URYR 1EX6A 2R65A 3JVVA 5LB2A 4MYHA 1W35A 4DJTA 3OAAA 1NI3A 3W6NA 1BQEA 2WAXA 1OB5A 1LFDB 3QQ5A 5LBIA 3K0AB 4TZ0A 5JWHA 4DEYA 2GCNA 2XTMA 3V9PA 2BJWA 4O0MA 5KTYA 1CNEA 4MRSA 4W5JA 1HH4A 1P5ZB 2VP0A 3ZZTA 1QFZA 4HE5A 1KJWA 2QGNA 1SVSA 2VLIA 4JBXA 4B3FX 5EXPA 2GEDA 3KQKA 3K8YA 2JLYA 5CYOA 3BFVA 3BC1A 3EPLA 3C16C 4IDHA 5DSZA 3B1VA 3WMGA 3EX7C 1G6OA 5JCZA 2DFTA 1QF9A 3IKJA 2VO1A 3HDTA 3KTAA 4JBWA 3LBIA 1UKZA 2G88A 3A4MA 5CK5A 1D2NA 1D6JA 1WXQA 4EPYA 2NMVA 1BMFA 3KQLA 1ZIPA 1K8RA 2G0TA 2DR3A 2UZ3A 1G3MA 5KSPA 3SS8A 2IYXA 4DCNA 4S35A 3CO5A 4FCTA 3TBKA 3FWYA 2OTJB 4F92B 1NG9A 4CEJB 1TNDA 2EIXA 4KU4A 4TLEA 2O8DA 3WYAA 2BM0A 4B2PA 3AH8A 2IS2A 3A1SA 3CWZA 4R9UC 2CNWD 2CDNA 2B7CA 3TGPA 4HB0A 3EW9A 2F9LA 3BH7A 1SQ5A 5J40A 3CRVA 3H0KA 2XB2A 2WSMA 2R6CA 5FFMA 1SVMA 3I61A 1UDXA 3CC4B 5CDFA 3R9WA 1RYFA 2I1QA 3NTUA 3OIYA 3TE6A 1P73A 4QG7A 2QNRA 4WVFA 4CDGA 3TUJC 4DLXA 4ZI2A 1WA5A 3U7HB 4JLPA 4Z1MD 4DLVA 3BIFA 4TMZA 2PX0A 2QG6A 5CK4A 5GJWC 1E2EA 5THXA 4I99A 3UWOA 4DUGA 1E0SA 2ZIAA 5JRJA 1T91A 4RD3A 2GXSA 3ZZUA 3TVDA 1KTVA 3B8HA 2ZS9A 4ZDJA 1EK0A 1YU9A 2QN6A 2IYVA 4Z54A 3G82C 4D2IA 1S8FA 4ZKEA 2ZE6A 4B75A 4URXR 1Z0AA 1IY0A 4G5GA 2C8VA 3AVVA 3MSXA 2A5YB 4YALA 4AD8A 2PBRA 1W34A 2Z4RA 3A1VA 1QHGA 3FMOB 1QHHA 4X8MA 4LJYA 4LWZA 3REGA 1AM4D 3WHKA 4M1OA 3ZLJA 2ZE8A 2W0MA 4B2LA 2O8CA 1KK1A 1BO6A 2KI5A 2VHUA 4YONB 2A9KA 3ZH9B 1DTSA 3W3ZB 2WOOA 2VSXA 2BBWA 2J45A 4LX0A 3VU9B 1LB1B 4WZAE 4Q66C 621PA 3OZUA 4MYTA 1P3JA 2ZRMA 2ZRFA 4EH1A 5TR9A 4C0SA 4EAQA 4DQLA 4DBLC 1W87A 1Z63A 5DIFA 2OBNA 2OK7A 4Q19A 2QORA 1M2OB 1NVVR 4IEEA 1N6RA 2DEUA 1W46A 3QXJA 3WYFA 5F9FA 1G5RA 3CNLA 1YZNA 5FI0B 1OSNA 1J8MF 1GSIA 3QXXA 1XMJA 5FOWA 3EC1A 4OI0A 1Q82D 2UZIR 2O8CB 2W00A 5FPSA 1HQCA 1K5GA 1W1WA 1Z8FA 3BJIC 2JLRA 3RS7A 1N6NA 1YHNA 3B60A 3UPUA 1OLOA 3U7FB 1QHHB 3I72A 3TSZA 2ZJ8A 1NKTA 1V5WA 1ONBA 1W0JD 3EARA 3IDQA 3OE7A 2O8DB 4DB4A 4Q4LA 3D7MA 3DKVA 2XX3A 3B2EA 1BX1A 5TVKA 2HF9A 4HAYA 2JJ1A 1FUKA 2JCSA 2BCJQ 1M74A 2BF4A 1CF4A 3BXZA 5M04A 4US0R 4LJ5A 2CK3D 4ZCLA 1VQOB 3WY9A 4DQKA 5KO2A 5FUWA 3UK6A 3P27A 4G1VA 2B8WA 3R20A 4LUCA 3WYGA 4KBFA 2IF2A 3AF1A 3AF4A 4M21A 3THYB 1DBSA 1WCV1 3FHCB 4YXWD 5JJLA 4K1XA 4RKEA 3M0EA 1II8B 2GEUA 2CK3A 4HZUB 4ON9A 4JSTA 2BC9A 1SHKA 5FR1A 4AF7A 4QGHA 1X1SA 4RJLA 4KV9A 4P33A 2HMAA 4C0KA 3PEWA 1GM5A 3K70B 3CZQA 4RZ3A 4JS0A 2WOJA 4YHBA 1FQKA 3BS4A 4BFZA 5JI2E 2ZI7A 1W36B 3VHXA 4MYCA 4LBZA 4XVQA 1E4YA 5H1YA 4LYAA 1BJKA 1N25A 1S72B 2XTZA 2PCLA 4F7WA 1G9XA 3PUXA 5KDLA 4BWYA 1DAIA 3PR1A 4BFVA 1K8AD 4CGZA 3PQCA 4CT4B 4L9WA 4QJ3A 3LAWA 3N2EA 4O2LA 1YVDA 1G18A 1KGDA 1TF2A 3RS4A 5CJ2A 3DM9B 3B7GA 2KJQA 2ZI6A 4DCUA 4QGFA 3GJ6A 4PPGA 1GL9B 3NXSA 2C99A 5L3SB 3IO3A 3T1VA 1P7CA 2YOGA 3VO2A 4M1MA 5C4MA 5DI9A 3SQWA 1AZSC 2R62A 1EFRA 2ZANA 5GJVC 4DWJA 5KOYA 3TNFA 2AXNA 3SHWA 2ZJAA 4LJAA 4PQRA 4WXPA 1VYUA 1VQLB 4CYMA 1L4YA 5FA6A 4KCGA 2F6RA 4OJQA 5IHPA 1RJ9A 3CR8A 2QBYB 4C0BA 2F1RA 2PIAA 4P4TA 3LRPA 4ZDWA 3U44B 2NZJA 4AKGA 3RRMA 521PA 3W2EA 2DY1A 3BFKA 4B6EA 1QVAA 4P32A 4IVPA 3CCQB 1VQ4B 3ZJYA 3LBNA 1XMSA 2IUTA 3HU2A 1AKEA 1BOFA 6Q21A 2GJ8A 2EFDB 3FMIA 3LA6A 1GIAA 3TR0A 1T3HA 4JT2A 4DDTA 3WRYC 2GTPA 1JPNA 3LNCA 3O8CA 1NN0A 1UMKA 4D26A 3WNDA 3DZ8A 1R5NA 1TQ4A 4A2QA 4JIMA 1NSTA 4GDFA 4MKHA 1KQSB 1CBUA 2DWOA 5AJWA 1RRPA 3JQRA 3I5YA 2FPLA 1UKEA 1KSHA 1GVHA 4QOSA 4XSGA 4EUNA 2GA8A 2IX3A 1NLFA 4JLKA 2P2LA 1U90A 1GWNA 3LH5A 2FDCA 4WA7A 1WDTA 2CXXA 4CEHB 3PCRB 4FK8A 1QG2A 2Z4SA 1W7AA 1E9SA 2C9CA 5D3MA 3UG7A 1ZVQA 2GAOA 2IS1A 4B73A 2BPOA 1U99A 4H1VA 1Z06A 4D0LB 3KQNA 3GLIB 2G3YA 2AL7A 1TADA 3PENA 5EP4A 4GOKA 3AP2A 3CKLA 4N3NA 1JB1A 1XXHA 1NBME 4EPTA 4LHWA 1QUEA 3HU1A 3LX8A 4DCSA 1W4RA 4A2PA 1XMVA 4OL0A 1EFHA 2ZREA 2A5FA 2VNIA 1IN8A 5EE0A 4AWXA 1T3LA 4PZZA 2UVQA 2CBZA 3H86A 3I3SR 4OI4A 4QNRA 5CIWA 1KAOA 1EWYA 2JLZA 3U7GA 3PJRA 3RDPA 1E2GA 1UM8A 2QUZA 1U0HC 1CJKC 1KI2A 1UEJA 1V43A 1WMSA 5JMTA 1AMOA 1XD2B 2P6UA 2Q3FA 1RZ3A 1KI3A 3W2GA 1HTWA 3PUWA 3BB1A 4EQ6B 2GCPA 2QAJA 3H84A 1PVOA 4JT4A 3IPXA 3ZQ6A 1C1YA 1GG2A 5B2ZA 2O8EB 3U4QA 1E2HA 2O5VA 2DETA 3K0CA 1XZQA 4QBFA 4ASUD 3AVPA 121PA 4DC9A 2GZAA 1J2JA 3K70C 5G40A 3PVSA 4F4CA 4YDHB 1ZINA 1GRQA 3EZ9A 4LJ9A 1VQ6B 3VR4A 5J4KA 2VZLA 4FMBB 3THXA 2H1LA 1FDRA 3SEAA 3F0TA 3UMSA 1E9CA 1Q1ZA 5ANRB 1T8TA 2RB4A 3FB4A 2C95A 3EPJA 2PLRA 1JXMA 3I32A 3IIMA 1CR1A 3QOFA 3U61B 3N2IA 5KNBA 1OH5A 2IYYA 1EFTA 1DAMA 1OJLA 1RPZA 4GNKA 3B78A 1H8HD 1E9RA 3OZXA 3C5HA 3K0EA 1VIAA 3EZ6A 4TLBA 4OHZA 3K0SA 3RC8A 1F6BA 2G1JA 5JJKA 3GEIA 4LC1A 3FHTA 4UQOA 3JVUA 4W5WA 4TT3A 3N70A 2EFHB 4HI0E 1K6MA 4PSKA 2Z0MA 1U8AA 2AD1A 2J41A 3VKHA 2AFIE 2WTUA 4GL2A 5HCNA 1NG1A 4RFSB 4Q01A 1P6XA 1IAQA 1OF1A 1F2UB 3QF4A 4Q21A 5CB6A 3TSOA 2PJRA 5TY0A 2CCJA 3VKGA 4PC7A 2V1XA 3ZC3A 3GLHB 1N3BA 4AYXA 4FW9A 5CIQA 4GZMA 1E0AA 3TK1A 3DHWC 1X8JA 3U44A 2YKGA 1CJUC 4H9GA 1LVGA 2W2VA 5FBRB 2RCNA 3CWQA 5KHOC 4B74A 3QBTA 4URUR 1NF3A 4NCJA 4XWKA 4BPBA 2WWGA 4M2LA 3QG1A 1A82A 1YZKA 2X2EA 3KKNA 1Z29A 1OIWA 4JYCA 4Q4JB 3FMFA 2OM2A 5HE9A 1YRBA 1XU4A 2A7QA 3B1WA 3WP0A 3VFDA 1DPFA 4AG6A 1AQUA 5E3HA 2EFGA 4OI2A 4B2IA 1VCNA 3AKYA 2VYQA 4TYPA 2VHJA 3MLEA 2W0SA 4BASA 3SJZA 1LS6A 1Z0KA 1RKBA 4OBEA 3X1XA 3GJ4A 3KL4A 4NYMQ 3K0FB 4K46A 1XCPA 3CC2B 2CL0X 2I3BA 3EWAA 4FMDF 4MGZR 2WICA 4LCBA 1OW3B 5K8LA 3O47A 4L4UA 2J0UB 3C5CA 2DHRA 1DAFA 2BMFA 1ELOA 1G41A 2ZJBA 3P32A 1S0UA 1XXHE 4CVNA 2FZLA 1QVFB 1ZD1A 1XEWX 4QNMA 3CPEA 3LVBA 5JWRA 2QI9C 2V6JA 3TIFA 4Q7JB 1GKYA 1RRFA 1ZIOA 1NJID 3FVQA 3IQWA 4TYYA 3W8RA 4IOLA 3K9HA 4AF6A 4LK2A 2HEIA 1HURA 2FGKA 4XWAA 4UNSA 4LYHA 2WWXA 3A37A 3EIEA 3NC1C 3GEHA 3QKTA 1VG9B 2ZXUA 5ELXA 1YZUA 3LLUA 1TU4A 2VIIA 3AB3A 4G1UC 1E1RD 1KAGA 5FOVA 1ZCAA 2KB0A 4LHYA 4KFRA 1P2UA 4QHTA 4KLNA 1P2VA 1W49A 4CW7A 4WW0A 3O8RA 2VA8A 3PUYA 2AXPA 5AR1A 3L43A 2PZFA 3CX8A 1NJFA 1I2DA 1Q20A 2ZUBA 1DEKA 1ZBDA 1X6VA 2GVDC 4XSHA 3B13B 2QE7A 5EXXA 1X8LA 2WKRA 4V0ME 5JECA 1OT3A 4IDOA 1DG3A 3JZMA 4RZ2A 1FNNA 2JJ8A 1SVIA 4TLDA 4ABYA 3D6TB 1KJZA 5JHHB 4BZQA 4TL6A 3CX6A 4DLYA 1ZRHA 2RGNC 4D80A 4EPWA 5K8UA 4KAXA 4N0DA 1HE1C 3CF0A 1HY3A 1U0JA 2BMEA 3ZIAD 4D81A 4AI6A 1SZPA 4RZUA 1NP6A 2CL7X 2ERXA 4A92A 4U02A 3ND9A 3FJOA 3FKQA 2YINC 2OFXA 1KO4A 1OIXA 3SNHA 5KSOA 1XDBA 2ORVA 3AVUA 2QTZA 2YWFA 3CONA 3ZS9A 1X8KA 4HAVA 1I4TD 3FPAA 5F98A 3NH6A 2YHSA 1FP7A 4R7ZA 1LNZA 5E7MA 3A6PC 4GRAA 2BGJA 5EE9A 1FNDA 1KKMA 1R0XA 1A2BA 3EAQA 2X77A 3OHMA 3IGFA 2FNAA 1VYVA 3PXGA 1UADA 4NYJQ 2RGAA 3LXRA 4GMXA 5LDDC 4URVR 2EW1A 1VQMB 5HPYB 3D3QA 2Z43A 5E95A 1Q3HA 1KK3A 3B82A 3T12A 2R2AA 1GO2A 2J0QA 4HB4A 2X3UA 5JEEA 1XTIA 4RFVA 5GVSA 2JIZD 1NVUQ 3GLFA 3CRRA 2QT1A 4BQSA 2PH1A 1FMJA 4BLQA 2GHIA 1ESMA 1I4LD 3G0HA 2R8RA 3CD6B 1ZU5A 2TMKA 1W0JA 3OE7D 3X1WA 4WIAA 5JBQA 5J47A 2GXQA 4M1WA 3DEFA 1NN5A 1YHQB 3Q85A 2YWGA 5GADl 2P6RA 3CLVA 2B21A 1ESNA 1GP2A 1Q1EA 4GFDA 4DRZA 3P4XA 3QKRA 5CB8A 4QHSA 5P21A 2YV5A 2LCFA 5KDDA 1UBGA 2JLQA 2VNHA 2FFQA 4JMPA 4KBGA 3EPKA 3I62A 5H8WA 2KE5A 4MGKR 4NKRA 2AX4A 1M6NA 1KI9A 1GAWA 1IHUA 1E3MA 1TMKA 2JEOA 1ZC3A 2CL6X 1W0KD 1YZGA 3RC3A 1KI8A 3RRNA 3RWMB 5J4VA 1M90D 5FTJA 4DSTA 2J3EA 3BD9A 1SVWA 5HR5A 3DPUA 2Q3HA
chains in the Genus database with same CATH superfamily
4PYLA 3M4YA 2QMUA 1G0NA 3F9CA 1T9ZA 2FRDC 2HUNA 3JQ9C 4AJNA 1UPBA 3I05A 5H82A 2CFRA 3TI9A 3I56B 2E87A 1B23P 3IAAA 2B3TA 2NTVA 3VVBA 1D04A 3V7YA 3I1FA 5CJPA 2BVNA 3GFTA 4D44A 2CMKA 1NE2A 4PHTA 5IAEA 3E0XA 3QY0A 1RJFA 4RVGA 1U8YA 4OGGA 5BXYA 4ZU3A 3OJLA 2I7CA 4EY4A 4NYIR 2ZIZA 5KKNB 4G1BA 5DYTA 3P5BA 1ND6A 3DEAA 4X92A 4DWVA 1V1RB 4POAA 1YDHA 1JYSA 1Z83A 3OZGA 4JMLA 5D5PA 4C0QC 2A9OA 4QA9A 4D3ZA 1E5QA 2XQJA 3UIEA 1RYBA 1R4NB 3ECCA 2F1HA 4WN3A 2IWHA 1G3UA 5JS2A 1M54A 4OCZA 4QELA 3RTBA 3WK9A 2XUKA 2J3LA 4HDRA 2AB0A 1ACMA 1BHQ1 1QZXA 3SBXA 3WMWA 1F4LA 1RZUA 1ULSA 2WA1A 3DEYX 3LQ4A 1AN9A 3OM0A 4FMCF 1PUXA 1GAJA 3QEOA 4LK3A 1PSDA 4S0ZA 1YASA 4MYUA 2B6NA 3DMHA 5A4AA 1OR8A 1QCYA 3L7IA 5DNVA 4DDVA 3W5BA 3OO0A 4NYIQ 1E9VA 4C30A 2WUEA 1KYWA 3UWPA 1FRQA 3HFSA 4RDIA 1DX6A 4XGNA 4HPWA 5IZ4A 1F9AA 2AV6A 1KQPA 3CNHA 3GLQA 1WEHA 1FMCA 3N7TA 4TQUS 4X1YA 4AS3A 2R8ZA 2Q4TA 5JE8A 1XQWA 2I7TA 2SCUA 2IV2X 2DHCA 2ODAA 3DAOA 4UHJA 2AI2A 2C2YA 3STYA 2V5UA 1GCAA 3CV3A 2H2AA 2BHNA 2GD6A 1JR3A 1KQNA 2ZI5A 1AGXA 4GPTA 5EY5B 3BA1A 4WPGA 5I7RA 4GPEA 5AJXA 2PFKA 2X2OA 1ZXXA 3GGSA 4YPOA 1NDHA 4LQDA 1B76A 1U8ZA 2GPNA 3KEOA 4I4LA 2H4WA 4PONA 4I1IA 4EF5A 1YJCA 4GAEA 3LRTA 3QVKA 4LNHA 4DIOA 3FW1A 4P4SB 4IRUB 4PSVA 4U63A 3H6GA 3K4QA 4KVGA 3V34A 4R0VA 2DQ4A 2P2CA 3TTWA 1IBRA 3HKEA 5EZYA 2B8EA 4R1NA 2GDJA 4EJSB 2G80A 1SC9A 4FFLA 1HK7A 3L49A 4LEIA 1KE1A 3SZGA 4QASA 1MGOA 2Q5FA 3P4UA 5DI3B 4D3YA 1KI6A 4TWIA 1J49A 3IPCA 1KIAA 3N0RA 3QEMB 4R1OA 4DCTA 5KJCA 2V9ZA 1U1GA 4IVRA 2BP7B 2FFBA 1P7ZA 1XZJA 1UBKS 4LDNA 2RGUA 3PCTA 3EWIA 4HAZA 4O1MA 1I6KA 4EG8A 3DH0A 2QAGA 1IQ0A 3HWX1 4RAQA 1OZAA 4P5PA 4MA4A 4N3GA 5DBFA 3GFPA 4H6WA 1EIZA 4BKPA 2IXFA 1GRVA 3IT1A 1ZP6A 3C4VA 5JFOA 3F8TA 1WZCA 3FVTA 3IUMA 3RIGA 3VOAA 2O6HA 4WSOA 4YYEA 4JI0B 3MOIA 3PUHA 3MOSA 3SBDA 3F6PA 4MZXA 1MOZA 3D43A 5HK9A 2ONZA 1O95C 5JBNA 1X9HA 3QXHA 3MIIA 5GWXA 1VGRA 1XDGA 4NCHA 1SXIA 3Q15C 2GFIA 4D1YA 3OI7A 1ZAYA 1G5QA 2ZDQA 4MV8A 4PHHA 3V33A 3GCGA 1KQFA 1C7EA 4Z1MA 3R7WA 2JFOA 1FDVA 2PZLA 3GQBB 1LK0A 7ABPA 5KPJA 1COWA 3SDZA 2OGWA 5FO1A 3R77A 1NPYA 1ITZA 5H83A 4EBBA 3G0IA 4C4PA 1U6JA 4BFTA 4FFSA 1ODKA 3URMA 4QPCA 5IN5A 3O4IA 1WD5A 3CEHA 3MIZA 2O8BA 4ZK6A 4G2NA 3K96A 3IQGX 3EUWA 2JAHA 3MRTA 1K5PA 1CUSA 2GF0A 2HUPA 2O3RA 2RK6A 4NJEB 4R51A 5FBLB 3RR2A 2HX1A 4AMVA 4MZDA 3UT6A 3R9XB 2WK1A 2FEKA 3AKCA 4G8DA 4H6VA 1KEPA 2VDNB 4XN3A 3CTPA 4HJRA 1KQOA 1LX7A 4MITA 4YMUA 5J2TB 1KI7A 3KFLA 2YWEA 3VPAA 3CCUB 5K0ZA 2G1PA 3X2FA 4WZBE 4TLCA 3OA2A 1Q0PA 3OZTA 5IUJC 2AEJA 2IDMA 2WJGA 2HAEA 4CN9A 1N2CA 4EB6A 4DDUA 1QK5A 5I4IA 2QAGB 4E88A 5E2AA 2P5YA 3NUQA 1NXPA 4IZIA 5GIOE 4YRBA 3RVNA 4UZEA 3QEJA 2BE9A 3E27A 3LQEA 4U00A 2JRCA 4I1OA 3C3CA 4QUGA 3FFBA 3TQQA 1KOGA 1K68A 2ESRA 2ZIXB 4LOHA 5JYCA 1NRJB 2CHGA 3HLYA 2ZYIA 3MWEB 4OQYA 5EHNA 1R0YA 3LDHA 3UWSA 1JQKA 2HJVA 5CLIA 1SIWA 5FF9A 2VT7A 1P91A 4XGQA 3PQ8A 5I3CA 4AY2A 3G5LA 2Q0QA 3UQYS 1WXXA 1U9JA 3S2YA 5LOVB 2CDCA 3HA7A 1D2HA 1FMLA 2A14A 3NALA 2BFFB 3B3AA 1TYZA 2HV8A 1GKUB 2QENA 2WYUA 4I2VA 4IG4A 4ME6A 1Y1RA 3TLEA 1FLAA 2QGZA 1IJKA 3KYBA 4CDNA 4NOJA 1C14A 3ZVNA 3V1YA 4XA8A 4INOA 3NEPX 3CPJB 1W47A 3ONWA 4RKQA 1Z5VA 4JJAA 1FA9A 1L4LA 5LSAA 2HQRA 5JI3E 4RD1A 3A6HA 1TD9A 1TM3E 3V1KA 5CT6A 2SCUB 3OW2B 4DLSA 1Y1QA 3JX9A 4PBRA 5IXJA 3KZNA 4ZPJA 4BNXA 1OBOA 3OIDA 4KVZA 3H9NA 3MLBA 3KR0A 4I36A 3WOHA 3E9DA 3ZCVA 1RQGA 2WTMA 2X6TA 3VR4H 2J4FA 5KTNA 1W5SA 1GGKA 3UCEA 4R2MA 1GL7A 2WSSD 3IAEA 3QE4A 2IGBA 2AN4A 1SG6A 2X8JA 2Y68A 4RVFA 5JQGB 1GGJA 4AS1A 2XITA 4IOJA 4J90A 2OBSA 3KVNA 1YJ9B 3HZOA 5EJ5A 2MSCB 1FIUA 2ZB2A 1YC2A 2Q2NA 1BSVA 1ID1A 2NUPB 2I7VA 3ENWA 3NM5A 5BY2A 2J3IA 3EOZA 4WLVA 3ZDBA 2WWYA 1KO8A 5EJ7A 1V9SA 3O1JC 3ABZA 4G41A 4R8SA 3ACCA 4GYYA 1FP6A 1M0TA 3LVQE 4L76A 2Z3WA 5HDQA 3STHA 2EJVA 4B0PA 3ZD9A 1VMKA 2V5AA 5DEOA 3ZY4A 4MP6A 3HNRA 4RDJA 3H94A 3WRXA 5C9ZA 2A9FA 3W2IA 3A10A 1S8OA 3TG2A 2XQIA 3K09C 4FD3A 3FYCA 5IP5A 2OXCA 5E1BA 4UNQA 3KHSA 2AK3A 2IYPA 2NOAA 2QT9A 1QO0A 1IZ8A 1P2FA 1V4NA 2V03A 3DOJA 5K8UA 4BY9E 3QIVA 1Y8CA 5BOSB 1V47A 2P68A 3UJ9A 1RLUA 4FUQA 1J1IA 2G07A 4V0LA 4XDZA 2WSLA 1DXHA 1ZGGA 2VTBA 1Z08A 1GKKA 1IM5A 4CKBA 2JNWA 4KKSA 3LX4A 4R7TA 1EUDA 1KZ1A 1KXJA 1UANA 2O7RA 3FPGA 3UMFA 3EGDA 4CODB 1ZBQA 5HYVA 1QQBA 1N2XA 2HK7A 1OB0A 1WM1A 3BCRA 3JD1A 2GSDA 2XYPA 1RJGA 2H7YA 3A1WA 3ITEA 2JAQA 4K40A 1XMOB 3TCNA 4ENVA 3H8VA 3FZQA 4XKWA 2WKSA 5IM4A 5L3SA 3GLFE 1YVEI 2FZCA 2Q50A 1Z6AA 3IHLA 5TQ2A 4BQEA 3CISA 2ZZNA 2Z3ZA 4K28A 3T9AA 1SVNA 3AUSA 2FZEA 5I3ZA 3GUVA 4LYFA 4B31A 3TLAA 1T8SA 1G6Q1 3SIPA 4DRYA 1NU8A 2QUIA 4AG5A 3MJEA 1OV6A 2HSJA 2R86A 2YIMA 3KBOA 2Y92A 2XIQA 3IC5A 3QJGA 4QWMA 1HDYA 1GD1O 4YECA 5EXDA 3VU9A 4R9NA 4TV9B 3SLRA 2J67A 3QE2A 1A76A 4CM6A 2L18A 4Q3NA 4QUEA 4MV3A 3IJ5A 4ZVPA 1JE1A 1V3TA 4RVDA 4QHYA 1QSGA 2GVZC 4W5OA 4WV3A 1DAEA 1N9GB 4Q1AA 2V8OA 4YXWA 3DM5A 4CMKA 4RMGA 4NBUA 4C43A 2ZUVA 3BQ9A 1SBZA 2ZYWX 3A6KA 4I4NA 2WVJA 3CLSD 3X1ZA 1N6KA 4L4ZA 1HC7A 4RA9A 1Q7GA 4JNKA 4M1EA 1HLGA 2QTFA 4ZYWA 1KMNA 1NMQA 4XJXA 3BWYA 3GD7A 1PL0A 1XJQA 5K6RA 1N36B 4M8LA 2H5EA 4PFKA 5JAPA 1JUDA 1UR5A 1E98A 1JEQA 1X13A 3AI7A 3M5DA 3DJYA 3UJCA 2YQ5A 1C0IA 2EFEB 3F6RA 4QVKA 2FQXA 3CY6A 1A9TA 3OCYA 3L8MA 1NX9A 2G0NA 3B1FA 1X7WB 3QKSB 2W7TA 4TUYF 4WZ6A 4XJSA 4DFDA 1E2PA 5LMNB 3V4OA 1YZTA 1CUIA 2YWCA 4KE7A 5K4GA 4DKJA 3PTLA 1PGQA 4QGAA 1PQ4A 2JHGA 4H3VA 4JP2A 1Y4AE 3HVIA 1SOAA 2OAGA 4LYJA 4M1KA 3EZ2A 2BWJA 3SY8A 3WKCA 1GGEA 1O9BA 2FK8A 1R0SA 2C9YA 3KJEA 2H4FA 3OCUA 4QIHA 5CBPB 2AVDA 4R1MA 5BUQA 3RUPA 4F84A 2VBVA 4B6FA 1RI1A 2FP3A 3HCAA 1ZI8A 2BDEA 2OA0A 3KUKA 3DLPX 1VM6A 3V55A 3ZLTA 4ZI7B 1MDFA 1KK2A 4G23A 4XJTA 2UU9B 1K28D 1JWAB 3P8ZA 3M1LA 4HCJA 2VEDA 1O96A 1PBNA 2PZAA 3HVUA 4YI3A 4F9GA 4XEHA 1W4LA 4HLDA 3W9UA 1ZM2A 1PTKA 5BN3B 5HIIA 3E18A 4A7PA 3FN4A 3IIKA 1AF4A 5DW0A 3TUZC 4WK6A 1BYIA 2ZPUA 3R2JA 5EPOA 5FUXA 1TTHA 3I6BA 4EB0A 2MSNA 4RCYA 1NUHA 1BE8A 1B14A 4HC4A 2EF0A 4CPDA 4BZPA 5L46A 1W4BA 3LVRE 3SMVA 1I94B 1FSFA 2VSFA 2RAPA 1A9QA 2RCYA 4F60A 3HXQA 1NXQA 5HJ7A 2V6GA 2IIQA 3CZAA 4EDFA 1AJEA 4C1BA 4FN5A 2G04A 5A4IS 2XEXA 1X3LA 4MINA 5AOCA 3HDHA 5EP1A 3RFVA 3CKMA 2QWXA 5AUPB 1JEOA 3OEHA 4C7MA 2Q3DA 3PKJA 3ZN2A 1QIFA 1I8DA 1T25A 2VRCA 4A2WA 4IZOA 4LHZA 3DDYA 1FFBA 2VJKA 3PC8A 4QEZA 3QPWA 5LZ7A 1Y7HA 4LKRA 3WV5A 4JROA 3B5EA 2W6ZA 4I1VA 1E3LA 4B9EA 1SXJD 2PEYA 4YMTA 1BG6A 6ADHA 3MMNA 3N0TA 3M7IA 1M7GA 1K73D 1Q1NA 2D0DA 2IBMA 4OTZA 4M0PA 2F9FA 1Q6YA 3PQ2A 5KZMB 5CCBA 4KPYA 2B2XA 2IHVA 5E6SB 3AG5A 4GE0A 1UT8A 1ZN7A 4TTRA 4ZJYA 6ABPA 4FEGA 5A7GA 1MO3A 1MVNA 3C4QA 1WX1A 2QMQA 1F14A 4PHGA 5DNEA 4HLNA 1W0KA 5CM9C 3T1OA 3EVEA 3V4LA 2EHDA 4RFSA 4LRXA 2ZRKA 3CU5A 3VNQA 1Q81D 2FSFA 3AVWA 2G5TA 2QPAA 3DLCA 4LI3X 2ZR0A 2TS1A 3VR0A 4DGSA 5DYYA 1DELA 4BO0A 1L1FA 4GBMA 16PKA 1FE8A 4H0FA 4G6IA 1D2GA 4JP3A 1VMDA 4JLSA 3JQGB 4N49A 4CF7A 1J99A 1NDUA 1W2WB 2I6TA 5C7LO 3KPWA 4L2IA 1KRHA 5FNZA 1KOFA 2B3DA 4O2AA 5CP8A 4BVLA 4HNVA 3D7SA 1G7CA 4LI0A 3STXA 5CA1B 1S3IA 4FWIB 5DCYA 3GVXA 4B7AA 3TJRA 2AE2A 2EU8A 4IJKA 1X7YA 4UBJA 4YMLA 3S2ZA 4HDSA 1X39A 3AUUA 3DW1X 2XQFA 5DRYA 1I6WA 1U5AA 4LJLA 3ADBA 1K3FA 3HYLA 1F8GA 1G5PA 1KA9H 2R6AA 1K7FB 4W63A 4BDTA 2C1EA 2DOGA 1T2EA 3LBYA 4UEKA 1C9EA 2FZVA 2W58A 1ISJA 1SBNE 3CFYA 3FDIA 4U5XA 4ZVLA 3OZEA 2G9NA 2IYLD 3TPFA 4RJIA 3UF0A 4GC5A 4IM7A 4QU5A 2HLNA 5H70A 1TW3A 4FGLA 4B2LA 4CTOA 1T6NA 5BXQC 4L9RA 1KXZA 3D4PA 4EITA 2BHTA 5A04A 5SZKB 1MJHA 2HO4A 4E15A 3C5VA 2JJMA 1OLSA 5LZ4A 1CZOA 2COEA 3CINA 1ZUD1 4G5SA 1M34E 2O5CA 2VC2B 2XF8A 4K6OA 3QLVA 2FSGA 3EIHA 3FFXA 2W90A 2LUOA 2G77B 4W7SA 1WB9A 2DVMA 2J9XB 3RTDA 4X7BA 1Y0RA 3ZNPA 4JUIA 1VHOA 2PLFA 2A8YA 1NMYA 5FHRA 1CR2A 1RQ7A 1RPAA 2HPHA 3KT8A 3SEQA 2ZRPA 1JG2A 3E2IA 2AHOA 1MG5A 2DMRA 2O3SA 3PYMA 1FX0B 4FNMA 3VO9A 3FCXA 4B71A 1YQWA 2IC5A 4JVOA 5CNJA 3ET5A 1WNTA 2PN1A 3WDLA 3H5TA 4ML3A 1R3UA 1CKEA 4OK6A 3N2ZB 1FZQA 4QTUB 2WJHA 2Z5LA 3W04A 2PSJA 3GZTB 5EJ9A 1S4QA 2IYQA 3EA0A 1O0CA 3EZYA 1DUSA 3TD9A 3AR8A 2WUWE 4W1RA 2R8EA 2ZP1A 3H5NA 3LPAA 4YK7A 3WBBA 4F71A 1ZUIA 3SLGA 1KSJA 3HU5A 1DUIA 4JWTA 3AC0A 1E1CB 2Q29A 1UFOA 1ZHHA 2WU8A 2CB9A 2FSHA 2XT6A 2Q3CA 4HQOA 3CWCA 3ZHOA 4Y9RA 1U2DA 2QX4A 4QM7A 1HNZB 4A6PA 4BXOB 1YRLA 1PNTA 4YQEA 2ZK7A 5BN4B 4GM4A 3PT9A 3C7AA 4PGMA 4C4RA 4I5GA 3CLRC 3THWB 1W581 4EA9A 3PFFA 4YR9A 5JARA 1JEYB 2GZ2A 4DW8A 2IYSA 1YA8A 3FH0A 3O2QB 4JR2A 1ISSA 3OQHA 4WNIA 1IBSA 1W1IA 1DBWA 3LJKA 1KO1A 1PR9A 1M9NA 3ANMA 2HU2A 3QHQA 1IXZA 4M0FA 1JHAA 1P44A 2FZ4A 2ID7A 3DTYA 5CHYA 2O59A 2ZGVA 4O6VA 3SJUA 4RDCA 2X7JA 2VK8A 2JI9A 3QPAA 5AVKA 1NPTO 4ND6A 3CF6R 4Q7KA 1T3SA 3T52A 5F4JA 1T10A 4DPLA 3AP3A 2WJWA 2IXDA 3M34A 2RH9B 5JATA 3NDPA 1P80A 4UMVA 4ENSA 4P12A 2C1ZA 2ILVA 4Q9LA 5JDIA 3DXXA 2YMMA 3FYUC 5KNLA 4HLCA 4M22A 1E63A 5F51A 3G6WA 5FQNA 3SHFA 5IW8A 1ISGA 1Q6ZA 2HHJA 2OZEA 2QM8A 4J0KA 4Z4SA 2WMOB 4JODA 4ZALA 1SXJE 5BQ3A 1MJGA 1VP3A 3FPFA 1V3UA 2A4MA 3GCZA 3IUPA 3KKEA 1JJFA 4IV5A 4OMCA 1XALA 5GGXA 5JHGB 3AHIA 1U4SA 1JXQA 1NVBA 3PNMA 4RS4A 3ICQB 3PIRA 5CAEB 1Y3HA 2AS0A 4BUCA 1NW6A 2A2ZA 4I5IA 4GT1A 2O5EA 4BU1A 1NN3A 2IUFA 3OIVA 2HA6A 1FEZA 3KB2A 1A69A 3RVRA 4X06A 4JJ4A 5BR4A 1PL6A 4HOYA 3W6ZA 3PR3A 3MRVA 3L5OA 3TEJA 2XMRA 5D6NA 2CUTA 5EAIA 2Q9CA 3EXAA 4FFMA 4YI5A 4LC0A 3AR3A 3R5TA 4JLBA 3H5OA 3G2HA 4ZV7A 5BN3A 1IVYA 4EFLA 5FUVA 1P4RA 1O7JA 2AF4C 5E1OA 3HRHA 3QKWA 1SUSA 4Q3AA 1LI4A 3A1CA 5DTIA 5TQ0A 2RHMA 4L5CA 1XCLA 2GN6A 3UKOA 1GLNA 1ZUWA 4ZQGA 3MBIA 1NBOA 3CO0S 5HKLA 2PEZA 2RGGA 2XV1A 3X43A 2WFLA 2WUFA 5LA6B 4L7QA 3OECA 4FZRA 2XXAB 3SX2A 4LS3A 2G5GX 4V1CI 4G3XA 1GUFA 1BGXT 3GJQA 1T43A 3D5EA 1K6IA 3ZXYA 3DBHA 2Q4RA 2NV6A 5GONB 3AEXA 3GT4A 3MTBA 3WOVA 4ZZIA 2QN3A 3BHIA 3TXYA 1CS0B 1BYUA 1P0MA 4OQXA 1C81A 1EINA 3AWDA 4P08A 5IEBA 2OAP1 3FNIA 4O4LB 2ONJA 2I3GA 4XZ3A 2X13A 3WAKA 5TQJA 2Z9BA 4F91B 3C14C 4DY6A 1GU7A 2DECA 3PA2A 3W5CA 3EA4A 3K15A 3NBQA 4KFUA 5THQA 1SZDA 4YJ3F 5EE3A 1ZEJA 3OJ0A 4CM8A 1SXJB 1GADO 4HNQA 4E7PA 2JS7A 1QGYA 3G6EB 1YNSA 3KVOA 4Q02A 2BRUA 4HN4B 1WSRA 4MLZA 4RF5A 1WSBA 3FTPA 3KKOA 2WD8A 3E8XA 4HB2A 2I8LA 2ONKA 3UMJA 4LTNA 3VR6A 3RYFA 5CDHA 1K9SA 2IEGA 1F8UA 1G8YA 1OYYA 1U1EA 3R6WA 5D84A 2A6PA 3HKCB 3FVRA 3TW0A 1KZ9A 4I3FA 1YONA 4WK4B 1BOOA 3R7SA 1TC2A 2RHCA 5KVQA 4R4JA 3FSJX 3HNPA 1MT0A 1BKSB 1MJFA 3RU7A 3DLAA 2X6WA 1NVMB 1TTQB 1XZIA 3DDCA 4FYMA 1XPUA 1VG8A 2HA5A 4DDMA 4RVSA 1V6CA 5DM2A 4PRYA 2XUDA 5EUCA 5ALTA 3PC6A 1IN5A 4GX0A 4R6WA 4CI9A 3PIDA 4O4HA 4UAGA 4V24A 1KYVA 4ZT4A 2Y9PB 4KKXB 2X1HA 3QXSA 1E99A 2WDPA 4GG1A 4YT2A 4QLOA 4TUYA 1J6UA 1BHSA 1JN0A 1P7VA 3WHPA 1A72A 5HW0A 4BNWA 3ETDA 4E46A 4EELA 3ZHSA 2J6HA 2JZNA 3WJ7A 5KOJA 2X0DA 1J0EA 3SR0A 2OP1A 1J00A 3AEKA 1FBTA 1DADA 3Q7QA 4H31A 4F5WA 1RWQA 3Q8LA 1N7IA 1DQRA 2GBLC 4PTLA 4BFUA 3K70D 1VRWA 1EM8B 2EG9A 4WBNA 3AV0B 1IVSA 3NUZA 2HSWA 2R5NA 3MUOA 1H1TA 3N5KA 1FU4A 1SM4A 2WTNA 3W4KA 4KPEC 1WMEA 2BM1A 2J6CA 2YN0A 4PYOA 5BT9A 3ZHRA 1UOEA 5C8YF 2LV8A 2R11A 4XQ9A 4QDZA 2C9OA 2CNDA 1NN1A 1DFHA 3LBFA 2NSDA 1A8UA 5M34A 4JUAA 4EHNA 4FFDA 2BFDA 4RF2A 4RL4A 2E1RA 4JJFA 3I8OA 3LUGA 1CQJA 1QYXA 3C6YA 3WYBA 4ZANA 4Q3EA 4A9AA 4OHMA 3MJHA 5JC1A 1WOYA 2D4HA 4LMPA 1ZK2A 5DYGA 5IJ0A 3UH1A 1UAAA 1JILA 1SQ0A 2G7ZA 3UXHA 5AVWA 2QRZA 3AVYA 3DDWA 5CB0A 2F3TA 5K20A 3NYIA 1V8FA 2CDRA 4IXNA 4LF7B 3JQEA 4N12A 1CR4A 1O8BA 3H1GA 5HJEA 1AS3A 2A86A 3EEYA 2A5JA 2AFHE 2I3ZA 3PNPA 4URWR 1ORWA 3VPDA 4YEJA 1CETA 1KFBB 1KO7A 2FE4A 2X7HA 3RJTA 1PV4A 1E62A 2QZ4A 1BGVA 1NMXA 3NWJA 2DG2A 3BT7A 3MT7A 1VMIA 3YASA 1U4NA 3AILA 2HZ7A 1NW8A 2V98A 4JVNA 2ANBA 3KC2A 3AFNA 3SOPA 3CLUD 3UGJA 4ZXPA 2C97A 4DZZA 3N53A 3ODGA 4XNFA 3RT9A 3JATB 2EX0A 3HSYA 1VSQA 2N47A 3C7KA 3WJ2A 4F12A 5JMOA 4L3VA 1RE1A 1H6BA 4FFVA 3CW2A 1V11B 1XL1A 4JFRA 4LWQA 1LEHA 3MINA 3N8DA 3OKCA 4DDHA 4JQYA 3HZZA 4UEOA 1OX4A 3WL5A 1RHUA 3Q72A 1EWVA 3QUCA 5JH7B 3I83A 2FPOA 3C74A 3MS4A 3HGQA 5JZBA 2P3SA 5DGXA 5JS8A 4O2BB 1SHJA 4N39A 1KARA 2XUZA 4GI3A 2CKDA 2JFFA 3GOHA 2FW6A 1PTJA 3HB4X 2F17A 2OSBA 1NVTA 2B6HA 3ZHCA 2OO7A 3A8TA 3JATA 1NVXQ 3NHAA 1BEUB 4KOEC 4F93B 1ENZA 1JT9A 1SWVA 2ZTUA 3M6MD 5ADUS 1JI0A 3PXEA 4LF4B 2VSQA 2PD3A 2EP8A 3FVWA 3BJZA 5E9AA 2WDZA 3W5JA 1DMSA 5BSXA 3TLBA 1ACLA 1UZAA 3N3BC 5EIEA 3C8DA 2CMFA 3CX4A 3TSYA 4MPDA 1YUMA 3KE9A 2N0SA 2ZSKA 4X7CA 4HAIA 1L7AA 4KVFA 4M87A 4XPIA 3WISA 4QQFA 2VQ3A 4QUAA 4IJ6A 1WETA 1T0HB 1BQ3A 3B9PA 2FG7C 4HLUC 3KQSA 1LPAB 2PMDA 4WJZA 2B83A 1U63A 1TYBE 1XHLA 4F3TA 1T1JA 1Z2AA 3U6KA 5J2TA 1AOXA 3L40A 1E79A 4PAQA 4ZGGA 1T5HX 3L02A 4EY8A 5KOHB 1FMTA 2YUIA 3HACA 4OO3A 3VX4A 4WKCA 3EIWA 1J2YA 4YP9A 3R1IA 4D98A 2XOKA 1W5AA 3GMDA 2FSSA 4OLJA 5HZBA 1I7PA 3WXMA 1DC3A 5ELMA 2DYIA 1RQNA 2WZQA 4MPJA 1WZUA 1G3IA 3B8EA 1EIWA 1ZH2A 5WRFA 3LCRA 1T4CB 3ESAA 1X0VA 5AW9A 4ZDKA 4YMIA 3GRZA 3L0CA 1AUXA 5AVOA 3NORA 2DT5A 3GEGA 3T7KA 1U2RA 2M6SA 2PRSA 1SHLA 3TQTA 1O87A 4I9GA 2FJUA 1EFUA 1G4HA 4NXMB 4OXNA 1DCFA 1SXQA 1XTQA 3O90A 4FW8A 4F8JA 3BEDA 4BP1A 4M6WA 5CFQA 2XODA 4OM7A 2HRQA 1Y1KE 2YVKA 4JOSA 1RWPA 1ADCA 2A88A 3EYWA 3M5PA 2VXYA 4NSNA 4Q4AB 3WO1A 1RLIA 1XGKA 3I6IA 3KEMA 1O94C 4TLMB 1WDWB 4POOA 4QQRA 2H4ZA 5CVEA 4GC9A 2X41A 2IQ5A 2DC1A 5FOUA 1TM1E 1H65A 4F3CA 3LDUA 4CIDA 2HCTA 1UUFA 3HZHA 4FCVA 1RRVA 3AESB 2REXB 1R3DA 3JQ7B 2WU0A 1GDHA 4FC7A 2QX7A 4WD3A 3H8SA 4Q6BA 3OCXA 1L5OA 1Z4OA 5L4LA 1M2KA 4IH1A 1MIOB 4RVNA 2JLVA 1L0BA 3GIRA 1IQUA 1LPPA 1P0PA 2WIJA 2FV8A 3K0BA 4CQLA 4DXDA 1HDZA 1Y81A 4MWTA 1T1GA 2GYYA 3H0CA 4Z2YA 3RS5A 4WKPA 1G8AA 2OTCA 3K2IA 2SKEA 5KWEA 2VXOA 3ETHA 1W88A 2I1VB 1YD7A 1J42A 4C05A 4HEHA 3DOHA 4QPZA 2IPNA 1NUAA 4I9UA 2ZYVX 3EUEA 1KMHA 3EH1A 4U6SA 4YJ2F 3Q5DA 4FJ2A 4EEZA 4YRGA 2BH2A 1JHUA 3OH8A 4J2TA 4LSZA 4AMZA 3GU3A 3PHLA 2VPIA 4XTCS 2Y2VA 4HQNA 1KERA 1C7FA 1Y9JA 2XWBF 4TUYB 5LP6B 3WKDA 1ZCBA 4X1IB 4D4JA 2RE8A 1YB7A 3DEZA 1M2NA 2I9PA 4BLTA 2BFPA 1VL0A 3GP3A 1T8UA 3O2NA 4WKGA 5AJYA 1RI5A 4GSLA 4P83A 2R1TB 4N7MA 2WFZA 1J2RA 1YL6A 4Y7DA 2RBGA 5KQLA 1FSPA 3KNZA 2QQGA 4YO8A 3HY6A 2K87A 4OJYA 4QYSA 5TE9A 4V39A 4LSGA 5LCXA 3EXG1 4NNPA 2P90A 3GBVA 4BV9A 2RH8A 3V2IA 3N28A 4G24A 1ZGJA 3ASYA 1IJFA 3S6JA 4UCXA 3LO8A 1K98A 3DZGA 4L0MA 4V02A 4GMHA 3CUEF 1KDPA 4IFEA 3UGKA 3VQTA 2XTAA 5JDIC 4NBNA 4J6EA 1T2NA 2I4NA 4LVNA 1Z2PX 4TV9A 3COSA 2PBFA 4D9IA 1LFAA 2PRJA 2YY5A 3HXKA 3Q3CA 5E9QA 2W6JD 4JA2A 4ISCA 5FLKA 5JVDB 1QP8A 1X3SA 2A1UA 1IOWA 1JBEA 4ACBA 3PXDA 1TQDA 1N2OA 1QMPA 2WJZB 3DXFA 2R7LA 4TV9F 1J33A 4Y2XA 5JCOA 4HDQB 1EXWA 1E3SA 4F0JA 4L6CA 4JBGA 1OAKA 3EAGA 5EFZA 3QVMA 5JLAA 4JN6B 1T4MA 3MFYA 3HO6A 5TARA 4B87A 4EEXA 4ES6A 4RIFA 4ESHA 2FWJA 4UU1A 2D62A 1XTTA 4DR7B 3HB5X 3I1YA 5EEGA 2X15A 1X9IA 4CHTA 1PUJA 2FFJA 2DBRA 1HO3A 3WL7A 3S55A 1U2GC 1U28C 3FDZA 4IIHA 4M0KA 4TVOA 3I5UA 1WSAA 4W82A 1IRIA 3ZYCA 1W2BB 4DJJA 2ZZGA 3RJ9A 3ZCRA 4JU9A 3RSLA 3JV7A 3TOSA 3W8FA 4GX5A 4C2AA 5FI3A 1U3FA 4BO5A 1R5BA 5JAQA 1KQGA 3GZNB 1SKQA 4E5DA 1KY3A 2AF3C 2HYDA 2IP4A 2QJRA 3VDXA 1F5NA 3SYKA 2QLLA 5HR5A 4PC6A 2HWKA 3GGOA 3FKSA 3O4JA 1H9AA 1V45E 1EGMB 1N4DA 4GOOD 1E5DA 2ISCA 4Q1DA 1T5LA 4ZT7A 1CY7A 2ZBPA 4F1KA 3D6UA 4QV2A 4B7UA 3E48A 3OPQA 4UHBA 1YHYA 1N1EA 3L1KA 5EWLA 1VLJA 2ECQA 1UDCA 1PGJA 2GM3A 4M83A 2JKZA 4HO1X 5EKXA 4C3OB 1J90A 3EE6A 3JR3A 4LRTB 2JZCA 2FWPA 3KXIA 3B6IA 3LPCA 1ZKDA 3W8EA 3UK0A 3Q40A 1Z5NA 1SCDA 1Z2NX 1XZKA 2YFHA 3PD0A 4HPJB 4LGCA 3FWPA 1O1YA 4IDAA 4YDSA 5BN4A 4G4JA 5U4QA 1HTBA 3SKYA 2ZYDA 1G38A 2CVPA 2GRAA 2WWRA 3A1TA 3JTEA 5HK8A 1ZHFA 3HCDA 2QU8A 2ACEA 2Z6QA 3UCFA 2FAXA 5F35A 1S2IA 5JMPA 1GZVA 2WAOA 3O4VA 3TPCA 4CE6A 1XD2A 3UJDA 2QJTA 2X6XA 3DO6A 4LZAA 5LYYA 2NP7A 4EYKA 3KLMX 1D4OA 5C4GB 3ZQ4A 4P93A 4UFPA 4NK4A 1AA9A 3HJFA 3OUZA 3NXKA 3ZZ1A 1LC0A 4HWKA 1UPCA 3BMQA 4PLHA 3GROA 1Y6FA 3KCNA 1T4CA 4NEHB 1MABB 2QN8A 3BPSA 5TXGA 3WFZA 1R6XA 3NHMA 2P62A 4ASUA 1JEDA 1VQ8B 2YRXA 2YZNA 4OSEA 3VZSA 5B53A 2FSIA 3LA8A 4MICA 3IHWA 4W5NA 3ETNA 1ZUHA 3MCWA 1KVUA 3KPUA 1XXHB 1R5OA 1G8HA 2YXEA 1P0IA 1MD9A 4X7EA 1VIVA 3BSYA 1AMUA 3MTJA 4LCEA 1FFXB 3ND8A 1KJ9A 4PO9A 3O1LA 2BCGY 2J3MA 4HZGA 1NIJA 2F7SA 2HF2A 4Z7OB 5A3JA 3WTBA 3BMCA 2X1LA 1U81A 1QH1B 4HUQB 4OFXA 3AO0B 3DMTC 2RJNA 3PTAA 4IX1A 2VDOB 3MRSA 2Q49A 5CFZA 3H9UA 2J48A 1Y34E 1NA5A 5KTKA 1L7QA 1SB8A 2VYCA 4I4IA 3D2LA 4L8VA 5LWQA 3IAUA 3A70A 2QD3A 4J7AA 3PJEA 4AO8A 2PKYX 2Z2XA 2I03A 1JLHA