3VO2A

Crystal structure of zea mays leaf ferredoxin-nadp+ reductase iii
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
296
Chain Sequence
TSKKQDEGLVTNKYKPKEPYVGRCLSNTRITGDDAPGETWHMVFSTEGEIPYREGQSIGIIADGEDKNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNDQGEIVKGVCSNFLCDLKPGADVKITGPVGKEMLMPKDPNATVIMLATGTGIAPFRSFLWKMFLEEHEDYKFSGLAWLFLGVPTSDSLLYKEELEKMKEMAPDNFRLDFAVSREQTNAAGEKMYIQTRMAEYREELWELLKKDNTYVYMCGLKGMEKGIDDIMLNLAAKDGIDWMQYKKQLKKGEQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title N-terminal structure of maize ferredoxin:NADP+ reductase determines recruitment into different thylakoid membrane complexes
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase
total genus 99
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3vo2A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3vo2A02
1DARA 4PC2A 1FRNA 2BV3A 4LC0A 1YITB 1QFYA 4TMXA 2HMAA 4QFMA 4B43A 1Q7YD 3CRZA 1EP1B 1FDRA 3CCQB 3ZZTA 1UMKA 1D2EA 3OW2B 4B4DA 3CCLB 4M1KA 1F20A 2C78A 2BSAA 1N8RD 1G7TA 2QTZA 4YAOA 4YAUA 3QE2A 3W5HA 3CCVB 4P6VF 4Y9RA 3LRXA 3CC2B 1W2BB 2BMWA 3WNCA 4MYUA 3QFCA 1DG1G 3AVWA 1AMOA 3CC7B 1Q81D 3AGQA 3QFTA 4Y7CA 2OK8A 3ZC3A 3V76A 3G71B 1GAQA 3CMEB 3U6BA 1ELOA 4YALA 4B3XA 3FJOA 4G1VA 1BX0A 1M90D 5THXA 1JJ2B 2YWEA 4Q7JB 2B5OA 1S0UA 1VQMB 3WBJA 2VNKA 4RD0A 1ZUNB 4PGOA 1G7CA 1G7RA 1G7SA 1A8PA 2R6HA 1EP3B 2RC6A 3W5VA 2J7KA 2AHOA 1OGJA 1ZM2A 2E1RA 2OTJB 1XE1A 4J0QA 3P27A 1VQ8B 3I1FA 4H9GA 1JNYA 3WBKA 5GV8A 1KK3A 1OB5A 2YWHA 3W2IA 1CNFA 1CNEA 1EWYA 4TMVA 3LVBA 5AN9A 3QFRA 1FNDA 1S72B 1KK2A 4TMZA 2BVNA 1D8TA 1ZM4A 2B7CA 1NDHA 3AGPA 5KSWB 1BJKA 2EIXA 1SKQA 4DQLA 3CPWB 3CMAB 2YWFA 3B82A 1GVHA 4G5GA 2HCJB 3A1FA 4Y9UA 3I55B 1YJNB 2DCUA 1W34A 1K73D 4RD2A 2QA4B 4ZGNB 1TTTA 2XNCA 3AVTA 2QN6A 2VZLA 3OZUA 5TR9A 1J9ZA 4R71A 4RD1A 1GAWA 4RCYA 1EFCA 4ZCIA 1R5OA 3W2FA 2B7BA 3VO2A 2QMUA 3VO1A 1B23P 3AVYA 2BGJA 3E20A 3LO8A 1QX4A 1QG0A 1H85A 3B78A 4RD6A 1K8AD 1ZM9A 1IB0A 3ZBTA 1H42A 4TMTA 1OB2A 1VQ9B 2PLFA 1GO2A 1KRHA 2QEXB 1TLLA 1QUEA 2BN4A 4YAFA 3CD6B 3P26A 4RD3A 1VQ5B 3VNVA 3OJWA 2RC5A 4HE5A 4ACAA 1EP2B 5HXBA 3U6KA 1VQ4B 3CCUB 1VQPB 1VQOB 3AVXA 3CCMB 4LBYA 3G4SB 1SM4A 4UAJA 1EXMA 2DETA 2VYQA 1AIPA 2ZITA 4IW3B 1FNCA 1VQLB 3WNDA 1FNBA 4YHBA 2BM1A 1VQKB 3CXCB 4PC3A 2DEUA 4AF7A 4K1XA 4M4SA 1FRQA 4PC1A 3PENA 2YWGA 1N0VC 2OTLB 5TV2A 1I7PA 3B8HA 3QSYA 1XB2A 4C43A 1QGYA 3WXMA 1GJRA 2PIAA 3CCJB 1JA1A 4TN1A 4N3GA 2HDNB 5H5JA 4ACBA 3ZBUA 3G6EB 1QUFA 2NPFA 3MHPA 4C0SA 2GQFA 3OZWA 2DERA 4QHYA 1BQEA 3AVVA 1KK1A 2VNHA 1TUIA 1D1NA 2D74A 1QGAA 3W2HA 4RD4A 4WQMA 4M53A 4YAWA 1VQ7B 1YJWB 4ZGQB 2EFGA 4LBZA 1QVGB 5DSZA 3U2QA 3OJXA 3FPKA 1R5BA 2OK7A 2QTLA 3CCRB 1W87A 4NCNA 1IJEA 4B44A 3ES9A 1HA3A 5JBQA 1FNMA 1EFTA 2VNIA 5EMNA 3LYUA 4PC7A 1EFUA 1W35A 3JQQA 3WY9A 3W5UA 5GV7A 1WDTA 1IJFA 3CCEB 2PMDA 3ZZUA 4AF6A 3MMPA 1ZM3A 4LBWA 4EH1A 3JQPA 3AVUA 4ZV4A 2BM0A 4G1BA 3JQRA 3CW2A 5H59A 1E64A 1VQNB 2X3UA 1YHQB 1QGZA 3QFSA 3CCSB 4M0LA 1QH0A 2DY1A 3SJZA 3MCAA 1NJID 3E1YE 1Q86D 2BF4A 1GR1A 2XEXA 3ZZ0A 4F7DA 1KJZA 1KC8D 1TVCA 4U9UA 1K9MD 3CB4A 1BX1A 3I56B 4AC9A 2XNJA 1KK0A 4NBSA 1VQ6B 2FX3A 1QFJA 4BPRA 1E62A 2CRVA 4RJLA 1KQSB 4HE6A 2GPJA 1YI2B 2CNDA 1DDGA 4PC6A 4FN5A 1Q82D 4M2LA 3WYAA 3J81k 3WNBA 3VMFA 5TY0A 1KTVA 1JA0A 4DQKA 4FWTA 2QDXA 1R5NA 3CC4B 2C77A 1OGIA 4RCZA 1F60A 4FK8A 2BGIA 1KD1D 4B47A 2BPOA 3W2GA 1JB9A 1B2RA 5FA6A 3VNUA 1YIJB 1N0UA 1CQXA 4N3NA 4MYTA 4ZCMA 2VNJA 1DDIA 4TMWA 4LBVA 1U2RA 4P3YA 3OZVA 1YJ9B 1E63A 3W2EA 4B48A 1QFZA 1M1KD 1QVFB 4ZCLA
chains in the Genus database with same CATH superfamily
3HZHA 1M8GA 1HG0A 3L0PA 4Q4HB 2X23A 3TRIA 1ECPA 3X43A 3WMEA 1RHMA 1YOBA 2VTDA 3PGA1 2I4NA 4OA8A 4ALJA 3QYAA 4ARBA 4ZI2A 4R54A 4C3ZA 1Z17A 3R4VA 3W9BA 3TIVA 1AS2A 2QMEA 4M8LA 1T6ZA 2DF8A 4ZQGA 3KZCA 3CNEA 4X6XA 4G89A 1ZJ6A 5BSTA 2PMKA 1ENZA 2PQ6A 4UTVA 1NZDA 5A4AA 3NAGA 3C1OA 3M3PA 3SC2B 2W6JA 2BFCA 1BXZA 1EQUA 3BZBA 4YUWA 1YLOA 1W44A 1NVDA 2YWCA 4NICA 1NUTA 1R4MB 3HN6A 4XI9A 3WIOA 3IE1A 4WWVA 1WHTB 2HA4A 2WINI 2WPNA 3LCJA 3GEEA 1DEXA 1KXJA 1WTHD 2XYPA 3FNQA 3ICCA 1T5SA 4PLWA 3ZIDA 4DILA 5IFLA 1Y7PA 4FCTA 4XWTA 4EG3A 3GT0A 5JG7A 1Z47A 4RNCA 2BD0A 1HVXA 5J1SB 1KC1A 1VLOA 3WNQA 5K8CA 1U4OA 2OOKA 3KKZA 2DPXA 4BQSA 4BVJA 2V54A 3WJ2A 4UNQA 3M6MD 2JJQA 4PYNA 4KC0A 4UFNA 1H6AA 3HHEA 4JEMA 4OM8A 2OPBA 3GDGA 5CM8B 4OBXA 1OZFA 4B3BA 3WB0A 4OGKA 1TK2A 4R81A 4J3NA 3SYRA 3U39A 4AZTA 5HX7A 5LL6P 4Y6PA 1NN0A 3RGGA 3V2IA 2GEKA 2ZYIA 2CJWB 1F0PA 5I7RA 4F60A 5A4FS 2GGSA 2M1ZA 4NU6A 3CMEB 2AUMA 4UUNA 4DRXB 5IHPA 2LIVA 3RKRA 3S8EA 4Q1AA 1R0SA 4U3JA 3VSDA 5GAJA 3DTYA 1C3JA 4C2UA 3UNXA 1AUVA 2HMVA 3CG0A 4GYJA 3S8YA 3ETLA 4GLBA 4IAOA 2JIMA 1P17A 1UZMA 2CLSA 1RLOA 1G3IA 3HDGA 4L9WA 2BWJA 3JQFC 5LC1A 2H54A 3WLOA 1K6XA 1UK6A 2CLEB 5HKBA 2UUBB 4OA5A 1ZIXA 2WICA 1GSIA 1S3GA 4LHXA 4TLDA 3BL6A 1FVXA 2I6UA 3IO5A 4WPGA 1TJNA 5F78A 4ZVSA 1USVA 3F2VA 5LNK6 4EY7A 3UAGA 1GOTA 4LOJA 2PZEA 2UZ4A 5IXYA 5LUAA 4ZOBA 2QTNA 4OJYA 2BI8A 5I9TA 4ER6A 4FZJA 4LHZA 3WSWA 4BNVA 1OXBB 5JRDS 1X19A 4AAYA 5BUCA 2R1UA 1U5CA 2NUTB 3WGIA 1KBOA 5TQ0B 5EG5A 1NVXQ 3D7RA 3QVXA 3HKCA 4ZMRA 2M6SA 2GZ3A 2OAQ1 3MK31 1YBHA 5HWSA 3SZ3A 3DNFA 5GQSA 3LG2A 5EI5A 4DC0A 4RW0A 5F3WB 3RY8A 3JXEA 1D7AA 1FE8A 1YIAA 2VZ8A 4NOLA 2Z9BA 2OL4A 1H4QA 3THSA 1UPXA 3IEKA 2H0AA 5L4LA 3GJ6A 4QQKA 4TTIA 3RIMA 4J0QA 3CLRD 2JD2A 3JD0A 3CH4B 4RTKA 3HAGA 5EE5B 5CNIA 1JI0A 3EXG2 3P27A 4L5IA 4QJ4A 5IAKA 3UWPA 3MD9A 3IT3A 5E7JA 5JJIA 4R1PA 4MO9A 1WBJB 4U7FA 4HQNA 2O8NA 4UXHA 3EPKA 1FJXA 5YASA 3UJ6A 3OP1A 1TGYA 3O9MA 5JXJA 3GFBA 1DQNA 4WINA 4WRRA 5T4HA 5C8XA 4GVXA 2ZRAA 3HJTA 2WA2A 4OQLA 4I55B 2F1IA 2JVKA 3OFSA 4HBGA 4IUDS 2W2KB 1PAUA 3SF8B 1KVTA 4PCLA 4YI3A 3E8MA 3C7AA 4FC6A 5NLLA 4YJ2A 1J33A 1LTKA 2JFGA 3DKIA 3R23A 3JASB 1OQAA 1W94A 4IOJA 3A05A 4KR9A 2OPHA 2VA8A 1ABFA 4O0LA 4OI4A 1TQHA 1CB0A 2EWWA 3HA3A 3BZWA 3SHTA 1U7XA 1JSXA 1JR2A 3AB3A 5DF1A 1ST2A 1ZJ5A 3M9WA 5HM8A 3GJ7A 2YWFA 1Z6PA 1JEQA 3OE5A 3ZHVA 2XY4A 2QI9F 2QRPA 3W6UA 4RMGA 2HCJB 1GVNB 2QYHA 4K0RA 1NLYA 4JFAA 3A4MA 4WBSA 2XMRA 2QS9A 1K73D 5T4BA 2VP6A 2PRJA 4LSMA 3AUAA 3QKUA 1E3WA 3PVZA 3MM4A 4GVPA 3T3DA 4TVSA 4YT4A 1ZK0A 4PAMA 1PK9A 2DHCA 5DW3A 5C5IA 2XNCA 1T9AA 2FGJA 2W71A 5GGXA 2RGBA 4N1AA 4NDNE 3T95A 2QVLA 4TXJA 3OZUA 4YO8A 5TR9A 1Z6YA 5FL7D 3W5IA 4GOND 4KOEC 6GPBA 3C1TA 3RSZA 3TQRA 1TO2E 2A1TS 2P2ZA 2UZ0A 3D4BA 3JVIA 4PO8A 1P2BA 2WZQA 1GTG1 1V35A 2DTXA 2OESA 2FMHA 1CIPA 2G5PA 2P2CA 4HKTA 5EMKA 3VA7A 2B7BA 4YTEA 3ZTWA 3IKVA 2JBHA 1LLDA 3UPDA 2XCTB 4Y7DA 1OBVA 3MS4A 1L4UA 1G42A 1Q2XA 4BWGA 1FY2A 5HCIA 3EC2A 1VMIA 3GEBA 3H4MA 2NADA 3I34X 1IZ8A 3PFFA 5KTOA 3THRA 3PFBA 3AF0A 2ZRDA 3OCJA 3WQRA 3GLSA 4D3YA 3KJHA 4M60A 4KSBA 3REQB 5L95A 1DXOA 3WWYA 1QCCA 3R3ZA 2P5YA 3AOGA 1BDJA 2B25A 1BXKA 3ASRA 4MUAA 2GYWA 1OX4A 4BO4A 1QIEA 2KI5A 3NTUA 1KVRA 1RQRA 2XUPA 4WOPA 1XCPA 3BC1A 4N41A 1JSLA 1BKYA 3BS4A 1H3EA 2QU7A 2Z58A 3RBAA 1L1FA 2HSWA 4QNNA 5GZ6A 2XOXA 2MSLA 3W7AA 3H2BA 2VPTA 4AXBA 2WTMA 3KRTA 5BSGA 3RGWS 1KAOA 2FCRA 2J85A 5HXBA 4DIDA 5CB4F 4B09A 3THYA 1P77A 2Q2NA 3HCOA 3JTEA 4ASUD 3I72A 3BGSA 3Q10A 2JGDB 3CNQS 1DDOA 2HDOA 1X3SA 1N5MA 3ASUA 3B1XA 4LVCA 1KVSA 4HF7A 4YRJA 2C61A 3N2ZB 4X85A 1F8YA 2DETA 1HT2E 1R00A 3HJHA 2Q3CA 1VE1A 3MTJA 3VR6A 4KR3A 3LVFO 4KUHA 4D9EA 5CR9A 5AVSA 3GJTA 3CRRA 4KX3A 4FJ2A 5HF8A 3R7LA 4GZ5A 3OKAA 4ZWNA 4TRRA 3SX4A 4KN8A 4U7JA 1USIA 1CUSA 3CONA 5F3RA 2NZXA 3DYVA 1MXHA 3KXKA 5EZSA 3VAAA 4YXWD 1MB0A 1X7XB 5AJTA 3LLMA 1W73A 2OZKA 1CUHA 3PGVA 3FE2A 4U2EA 1O5OA 1QHYA 1DJMA 1MUUA 3FKSA 1U1CA 4FEYA 3E5MA 4M7WA 5CLHA 5I9LA 1N05A 1YKGA 4PC1A 2C1ZA 1W0CA 5EE1A 3ZV4A 4F5WA 3EIQA 5ALHA 1JE0A 1Z37A 2NYUA 4AQDA 4TV8A 3NANA 1R8XA 4RVDA 1QGYA 3WXMA 3L05A 5EHZA 4LYJA 2QVZX 2ZE5A 4MGZR 5JUWA 3FTFA 3RM3A 1COWD 2ZI9A 2VF7A 3I05A 3KWMA 4JX9A 1UFVA 3SZLA 3JZDA 1ZA1A 3T9BA 5IHXA 5D7BA 3LKVA 4DA4A 2NZVG 3QJ5A 2ZIZA 3R3VA 2ZB3A 3SHVA 4FI3F 2WOOA 4FWBA 2QR5A 4EAAA 3MEQA 2RHLA 4KHZA 1UMBB 3A6LA 1RM5A 4D02A 4D4JA 3WIVA 4IWNA 4EVRA 4KLCA 3BAFA 3KM0A 4QU0A 2Q5HA 3SNKA 2YMQA 4GFDA 4PXAA 4C89A 5B1HA 1YB7A 1R64A 1SGWA 3LPMA 3MMZA 1XX6A 2M5SA 1NY6A 4IPTA 2NPFA 2J0QA 4AK9A 4KYTA 3INYA 2CFTA 4C0SA 3CRQA 2BW0A 2Z09A 4GG1A 3LOQA 3LFUA 4P80A 1Z5NA 4QNMA 1Z34A 3MBIA 4GL2A 2JZNA 1VTKA 4MPJA 3T53B 2IYLD 2AD5A 2QRKA 3UAXA 4RX1A 1GUBA 4ZT4A 5JSUA 5JXIA 3Q98A 2UZIR 1Z3IX 1VPWA 3KTDA 1JJAA 2HO5A 3J80A 3THWB 2WA1A 2A9JA 3SQWA 1T6NA 4LVNA 1SC4A 3UATA 4DUGA 3I0NA 4HNSA 3OZTA 1RQGA 1YFZA 3AQIA 4MR9A 4UQPA 3GRYA 2PFGA 5DTQA 3N70A 1G4UR 2DT8A 1UF9A 2D7JA 1UJ5A 3KQLA 1I33A 16PKA 1JXQA 4XPIA 1UADA 3ORSA 1G9SA 2OK7A 4XQ0A 5AI9A 5DWDA 3UM9A 5HVNA 3AFHA 2CHGA 4TMFA 1MX9A 4WLNA 1D5CA 3G9QA 3H9UA 5GOZA 3RSQA 2ZZEA 1JWAB 1DVRA 4KH0A 4Z4HA 1WM1A 4L57A 4N40A 4PN3A 4DYVA 3PQFA 1E43A 1XEWY 3B5JA 4G07A 1HDXA 5TXGA 4IZIA 4YB8A 3TLGB 3O84A 1HA3A 4JJ4A 4TLAA 2V7XA 2AJTA 1N57A 3OC6A 1RTKA 2EFCB 3T1NA 3UKDA 1TEZA 1SH7A 1DC7A 2ZSIA 1KPGA 1X74A 3HACA 3BICA 2V7BA 1SD2A 4NEQA 1ATIA 3K92A 3R8CA 5A62A 1AF4A 1D1SA 1DS6A 1TJ3A 3N53A 3R6WA 5TGZA 4I5IA 3K5PA 5ALLA 1WD5A 5IK2A 2XDAA 4G5QA 4RESA 4A15A 1FLAA 1ODIA 1U0JA 4L3VA 4LBWA 4YC7A 4BFWA 3UQYS 1E1CA 4KQJA 1E1YA 1NVTA 1QZXA 1PX0A 1MA0A 1ZGHA 221PA 2JI6A 3I09A 4E0FA 1NBIA 3MOIA 4O4HB 4Q3CA 1RXIA 3RAFC 2JAOA 5E6UB 2WUFA 1MAWA 2XNKA 3CPSA 5DP2A 2R86A 1MNQA 3D4PA 2C0CA 1NLMA 1SXJD 4IIBA 4Q12A 1WZCA 1D6SA 1LWOA 1PW5A 4BVHA 2ODTX 4EG1A 5HIAA 3I62A 2GTIA 4YRZA 1THZA 1GTL1 1ORWA 4BVAA 1CUVA 4DCTA 1OFHA 1KY4A 3C4VA 3PRYA 4R98A 1UBOS 3VO9A 4L7QA 3PEEA 4ETWA 1L5SA 2FWAA 4TYQA 2AMLA 4WK2B 2PUJA 1YJAA 1ISHA 1IEVA 1U80A 1FSGA 2Q2WA 4F11A 1XD9A 4E4TA 5CA0B 5K0TA 4PTZA 1S3IA 2F00A 3Q8WA 2H4HA 2BF4A 1Q3TA 2HCBA 4OP3A 4Q1FA 4WLFA 4LZJA 1CK4A 3UMJA 3PF8A 3BXPA 4JEHA 2Z08A 5CIWA 4KXWA 5DWVA 5AIBA 4GE3A 4M7PA 4Y6LA 1YDWA 4D9HA 2DR2A 3NWPA 5F98A 2IU4A 2Q3DA 2OCKA 4AUKA 5DK4A 1N2IA 3L5OA 5CX1A 5FLKA 1MJ5A 4FFBA 4Q39A 4PX2A 1GY8A 1HNWB 2CDAA 3M9LA 4GNRA 4OQQA 2I67A 1DV1A 3CLKA 4MJXA 5I4BA 2CRVA 1RCTE 1H8HD 4MYRA 1UBGA 2FW8A 1EBBA 3TSWA 1MOPA 4B3FX 5AFSA 4TWIA 1TEVA 2PZAA 2O05A 3BB1A 3FMOB 4O2BA 4BRSA 1M34E 3FVVA 5JYDA 3ZQUA 4A8TA 2OXFA 4NOMA 1RLJA 1YI2B 2VC2B 3AJDA 4ZXFA 4KYUA 1IUPA 2H65A 1SBIA 3LDHA 3NYWA 1NXTA 3CVOA 3FMPB 3H5RA 5DLEA 4B2YA 1BU5A 4B3HA 1QIJA 1KO4A 4M76B 4OJNA 2PGAA 3I2FA 1W2WB 3ZY3A 3VAZA 2E4UA 3BOSA 5FPYA 3TH5A 4UU1A 3HB1A 1WUKS 3N2KA 3QBTA 5DE3A 1MQ9A 1YIDA 2I6SA 2PN1A 1FNSA 4CHGA 4ROXA 1SOUA 4LZPA 4A8JA 4AJLA 4CL2A 1F60A 2ZSFA 1MC1A 4MV9A 1CQPA 5CJJA 3NT5A 1M2VB 4LGVA 1VI5A 3OA2A 4Q24A 3B3QA 2JCSA 2CXNA 1GKKA 3H84A 2F3SA 1Q2UA 4G2NA 1RD4A 2Z8XA 1FPMA 1IZ0A 3RAJA 1HKUA 1JPVA 2D0DA 4M87A 4OKIA 4UC0A 5FWDA 2HM7A 3W04A 5IBCA 3GJRA 4AG3A 5TGTA 4GX1A 1R3UA 2YZ7A 3DG9A 3I23A 1OU4A 4ALKA 4X7FA 3LX6A 1QFXA 4KGDA 3AUUA 1DLIA 4MVJA 4UEQA 4HZUA 5AVKA 1DEHA 2J08A 2BRUC 1IATA 4GW3A 3RWMB 5JWHA 1OA1A 1NPTO 3EA4A 3K0CA 4ZEOA 1GG2A 3FTCA 2KB0A 1E63A 1IIBA 3FHCB 5KOHB 4IIVA 1R12A 3ZGYA 4B2IA 2X2FA 3FR8A 3HO8A 1YB2A 3IMGA 1X70A 2H4YA 4HUJA 4NV0A 2NTVA 1T34A 2WG0A 2CJWA 3IVGA 3Q6NA 4GZLA 1S96A 2CNLA 4KR0A 4XJXA 1R27A 2WKWA 5BN5A 2VUIB 3QA3E 1DARA 4LJ4A 3W9SA 2OFWA 3QU9A 1E3MA 3R9KA 4QT4A 2UZ1A 2O0KA 1Z9BA 1SUEA 5K01A 3BSSA 1VE7A 2BV3A 4RSHA 1PFVA 1PFWA 3N1UA 3UWKA 4EB6A 3G2IA 4FFLA 3VKUA 3DPUA 3ZD6A 3BC9A 1IVYA 2HK8A 2GCEA 4JT4A 3V1KA 5B3KA 4OQPA 4EG0A 4P9SA 3WX0A 1UMKA 4PLFA 2I2WA 1Q7RA 4B4DA 3NDJA 3OX3A 4FZRA 3FLMA 5HZGA 1S5PA 3B7PA 4JC0A 3OJFA 5K6AC 4L5YA 2RHJA 1N8RD 3UHPA 1NVVQ 3NHJA 3Q9SA 4FUQA 4ZI3A 4HAWA 2I7CA 4XQEA 3U9TA 2FSIA 4CNBA 4JY7A 3OLXA 3D4LA 4NS1A 2QX4A 2YXBA 3QFHA 3TIGA 3ZE6A 5AK4A 5DGTA 3ZVNA 4EA7A 1C7JA 5IVIA 3U3KA 3MCUA 4OFWA 5EJMA 2AOVA 5BSHA 4N76A 4EHNA 3IEXA 4NATA 1RZVA 3BMCB 1CY4A 2GK3A 3PKIA 1W2BB 1BE8A 1ZUHA 3PD7A 5DHQA 1T9GR 4DXAA 1KI6B 2P6OA 5CFRA 3C3AA 3CU5A 3PR1A 4OHUA 1XELA 4YRGA 4KE8A 2QTWB 5ALFA 4PCAA 1NZFA 3A1DA 4TKOB 3EHEA 4DCSA 4LZOA 3RDPA 1P3DA 2M6LA 4UMEA 1F5SA 3D64A 3GGCA 1Q57A 3HHPA 3JYLA 4IIDA 4QXAA 4FDTA 2QJWA 2NWQA 5AJHA 1YR3A 1P4AA 1T2AA 4B74A 2Y1OA 4ARIA 3GBPA 1C0LA 2JKVA 4NNOA 2DH6A 3B9PA 2X8BA 4IFEA 3KUDA 4QTTB 1R9MA 1WE2A 1Z0SA 2ZTMA 1JTFA 4BB6A 4Q1DA 3V4OA 1SXPA 1K7XB 3QLVA 4P0PB 2HCRA 5CFOA 1MX5A 2X1VA 3OQ1A 4MVJM 4O8CA 4QUHA 3ZOZA 1U0LA 3BNWA 1VIMA 1ZVQA 3FJOA 1M34A 3AUSA 3M4ZA 5DHTA 4DCJA 3WL8A 3KWJA 2EC5A 2A9KA 1V2GA 4KFTA 3SF8A 3QX3A 2F43B 1T0UA 3RLIA 1EFAA 4EYEA 3L02A 3BJMA 1VKRA 1CRWG 1EEHA 1SIWA 4QYTA 3BL8A 2H1LA 3OEHD 1L5LA 4D8UA 3FOFC 4TWZA 5EJ5A 1DINA 1SXHA 2XAAA 4HQKA 2PS1A 1NFFA 1WX1A 2XMZA 3SQMA 3R6JA 2NW6A 4YJFA 4Z4UA 3HFJA 3NORA 4L5JA 4OP7A 1YMVA 2AZDA 5G53C 5IYZB 4CETA 2IT1A 4N0DA 5KU7A 4I9FA 4WGGA 2W2MA 5AW2A 3DDNA 5JZ9A 4RD0A 2C7BA 3GZNA 4M9QA 1FDOA 5K3OA 5J43A 1PFUA 4NCJA 4NZ9A 1J2RA 3KQVA 3IIKA 3EFOA 3GH1A 4MQUA 5EWMB 3EIWA 4IEFB 4M46A 3F1KA 3IJRA 3W4KA 2PWBA 4P0TA 4ZAWA 4MW4A 1A4XA 3KZ1E 4JP2A 2X0EA 4MX8A 1KYQA 5BVGA 2OORC 3CZMA 3F6YA 3QPVA 1L8AA 3AIMA 1SUWA 3DAOA 2I29A 1CR6A 2VJNA 1Q0RA 3N0TA 1HLPA 4C5BA 4EEKA 3BJEA 2BSXA 3KNZA 5ALVA 1UK7A 4HWSA 5J1TB 1GKYA 2PX8A 2X1LA 3ONDA 3P0JA 4F06A 1NC1A 4DVJA 1GQRA 1XVUA 1O6CA 1E6UA 3TB4A 1KEUA 4XM1A 2G5CA 4IOKA 1JNYA 1NG1A 1Z7YA 2VUTA 2VYFA 4C6TB 2YXEA 3W8EA 2VWPA 3E61A 1X8XA 1TEHA 1G6Q1 3EGIA 3PQ6A 1QANA 1AVTA 2PLAA 3H1EA 2GKOA 4MEJA 3K9CA 1XRPA 4H35A 3G0BA 4LS3A 1Z0JA 3L7LA 4EVSA 4BMZA 3IEMA 3A1WA 3A1PA 1Q22A 1WCWA 3HADA 4OSOA 4GZMA 3QFRA 1JBKA 4HH3C 2D13A 2J3HA 1BKSB 1DTSA 3HV2A 3NDIA 2M6RA 5FPTA 3WQSB 3KC2A 2OV4A 1UDBA 3MWDA 3SIPA 3REQA 1HDYA 3ZGXA 1RWKA 3KAQA 1EVEA 1LLQA 3F8SA 4IDAA 4NOJA 1EXVA 4PYRA 4F8YA 3H0CA 3QRWA 3AV3A 2DLNA 3QF4B 5EKUA 4BP1A 4DG9A 1SC6A 1C4WA 1QIIA 4D4LA 5B55A 3WICA 2BT4A 1XMJA 3WYGA 4UZUA 5F4OA 4LTDA 4MGKR 5JS7A 1SU6A 2AZXA 3H0EA 2GEJA 3KYBA 4AJKA 3EG9B 2HNKA 1JSZA 1Y3CE 3UGTA 3CPWB 1C3OB 1CKEA 2GHTA 5LXTA 3I8XA 3QU7A 1JYSA 3GN1A 1GVHA 3LT1A 5TF4A 3VVMA 5JEEA 2ONKA 4Z54A 5JY1A 4QVJA 1LF0A 1Y8QA 1ZRSA 1GQOA 1VLLA 3I4FA 3EGCA 2JFXA 1E89A 3KLOA 3EXAA 4V3BA 1R4AA 4RC9A 2A88A 4RKFA 4TXHA 3OPXA 1NDQA 4R16A 2XUQA 1VZ2A 2IH4A 2WE8A 3KR1A 4F4UA 2E1BA 2YL2A 2ZVDA 5AHRA 3CVUA 4YCJA 2V0GA 5EHQA 2GJPA 1JG2A 3G2MA 2PXXA 3S6JA 5TEVA 5JAMA 3RLFA 1I4WA 1PL8A 4JLKA 3ER6A 1VXOA 4PS0A 3ZXSA 1GIAA 3CZ4A 4CV1A 1PR5A 2MSDB 4CLOA 5D8DA 1EWQA 3MT9A 4ZU3A 3GJYA 1JUDA 1SVSA 4RV9A 3ADCA 2QMUA 1RAEA 2J3MA 5FV4A 1Q1GA 3AJAA 2FUCA 4RQUA 3DFZA 1X7XA 3PSAA 2NU9B 3VPHA 3AOEA 1Q0UA 1WLSA 4OBBA 5D5QA 4ZZ1A 1H85A 1OIWA 3VOSA 2HQRA 4Z7OB 1OJLA 3FW1A 1U0BB 5JMOA 2ZR8A 3H75A 4M1OA 4QXRA 3WYNA 4X65B 2JFBA 1A5ZA 1W0JD 2JN9A 1KNXA 3TK1A 4OFBA 4FN4A 1CRPA 4HDAA 2WR8A 1GAXA 2QM0A 3JQCA 5HE8A 3OKCA 2C3OA 1MO2A 4KMSA 1CWUA 1KS9A 2VHJA 2O52A 3K16A 2A4MA 4CI9A 3SR4A 3ZJVA 2XB2A 1XRNA 3Q88A 3KVYA 3OJWA 2A0YA 3TN7A 3K71B 3RSLA 3I6YA 1JW9B 3U13A 5L3SB 5MHTA 3RTCA 4KVGA 4HE5A 3DV0A 4X71A 5EJ4A 1Z0KA 3U6KA 1F17A 3ZWWA 1MT3A 2IKSA 3PA8A 1USWA 4TUYA 3SE7A 3F5FA 2R68A 5B1EA 3X1DA 1NXOA 3IDSA 5ICGA 3AERA 3RRYA 1JLRA 3ILYA 1A9ZA 1HUQA 1K9VF 4I1IA 4E08A 3G4SB 4QOFA 1J0AA 4DCMA 4H6XA 1PTKA 2ZWVA 4I7EA 4J3JA 3KP1A 2ZTVA 1P80A 2ID9A 3QYFA 4FYKA 1SKYB 3FZGA 1RIFA 3GVHA 2HLDD 1NI3A 3WLPA 1OIXA 2AT1A 3IPXA 3V4SA 4DSTA 2FG7C 1QOZA 3GFFA 3MWYW 4NZOA 1OW3B 4V24A 2C0PA 5IVHA 1QU2A 3AW9A 1DCTA 2ARKA 3F6BX 1BCRB 3GHYA 3B9BA 4LQDA 1Q50A 1OAOC 1FFGA 2YS6A 4RK6A 1KSGA 3OH8A 1W5FA 2FPMA 4Z4CA 5G3YA 3FMGA 2BJHA 2CUKA 2QM8A 1NVVR 4KWTA 4ENVA 2IY9A 2W2VA 3GOQA 4NMWA 4PZYA 3HR7A 3N59A 2OWDA 3IDQA 4RMIA 2HRDA 2DHEA 3BYZA 4G5YA 2FEAA 1JKIA 5G0UA 5JNWA 1SBCA 2I65A 4MKRA 5C8DA 2CK3D 4HSGA 3FCXA 1PT9A 2B9VA 4HG2A 5DH9A 1QIFA 1W49A 4HYEA 4KFCA 2JH8A 4KWEA 4R8RA 4RE5A 1XBTA 4D3ZA 2G8NA 3DVAB 3C6XA 2A1IA 1SXJE 4LDQA 3IESA 3I2GA 2IW1A 4QULA 3X2FA 5JO9A 4E4YA 5K45A 4HNTA 3DE6X 5LDDC 1KZ1A 3IBGA 1DADA 1Q1EA 1JZTA 3CLTD 3NS7A 3ZDZB 2DG2A 5JI2E 2Z3VA 4MP6A 2C9ZA 2YCBA 5CK4A 2GEUA 2UVDA 3DMTC 3L7JA 4XB1A 4HFNA 2FWIA 5BWOA 2VPZA 3GEDA 8OHMA 4FHZA 4FJ1A 2OQVA 3OT1B 2JIBA 3SMQA 4RJTA 1I32A 5CCBA 3DE7X 1Y3DE 1ZCAA 3AVPA 2XUOA 3KT8A 3BCSA 3E9YA 2Z9DA 3O9VA 5ALEA 2OENG 4G0WA 1J21A 3DWEX 2JVJA 3H6GA 3Q1KA 2HUPA 3FWHA 2YZKA 4H4CA 4Q3LA 2RGEA 2A4KA 3I6IA 2B94A 3MTDA 3D1JA 5TT1A 1W59A 5J35A 3R6LA 4B1FA 4DUZB 3P96A 1DCFA 3NHSA 3KOWA 3PPWA 2D5BA 5CD1A 2G1KA 3C16C 4HGNA 2PSFA 3DL4A 4JUFA 3W05A 1COWA 3L6RA 2ZYTX 4FOLA 3QW4B 5D01A 4PX9A 4PY2A 3WTBA 3ZHOA 5EIFA 2FNAA 4LJLA 2RE8A 3D9QX 1P4SA 4QT0A 4M53A 2A0XA 1YJWB 2P1RA 2NZJA 4II3A 2ZR0A 2ZWIA 3DKPA 4GICA 3TM5A 3EK2A 4EBFA 1G8PA 1IY2A 3LY8A 3PHGA 1CQWA 2O1WA 3Q87B 3PWSA 3UFXA 3VV2A 3W3AH 3L1IA 3TLJA 4RA9B 4XD7D 4LRQA 3AMVA 3E18A 2VKQA 2G8LA 4MRRA 1U31A 4HGPA 3NB0A 2PBLA 3G0DA 3VPGA 3AL2A 2J3KA 4KKTA 1DU4A 1D2CA 1NI5A 1YE5A 5EP2A 2P30A 3FUUA 4OMCA 1N92A 4A92A 4DEVA 1ZK2A 3VZRA 4B44A 1PEAA 3EEFA 5C9ZA 1TMKA 3H42B 4RIGA 4HAXA 3BDVA 4ZU1X 1VRWA 2FAXA 5FADA 2CF6A 3IUBA 2IQIA 1KJ9A 4O08A 2B2NA 1P33A 3D43A 4E3ZA 4ZT5A 3LUDA 4OXIA 4Q4CA 3NPAA 2AG8A 1JSCA 1YNSA 1UXJA 2QGNA 2XE4A 3CF4A 3D8BA 4M9CA 4XZ3A 3VPBA 4Z0TA 4DMFA 1MW8X 1N4AA 2W11A 1A72A 3ZZUA 5IW8A 1H22A 3LGAA 3I12A 4XSHA 2IWHA 4LXQA 4S05A 4ER0A 1QHHB 3WRXC 2P4EA 4LJ8A 4WGFA 2VA9A 2GAAA 5JZSA 5LU8A 5BURA 1PR0A 3LCUA 3LHIA 1UBHS 4UMDA 3V1UA 3I0MA 2SCUB 4KQ9A 2AI1A 1QIKA 2WHEA 4AO6A 3F73A 4WT7A 2KS6A 1AO3A 4GC9A 1Z5GA 4WKOA 3K6RA 5JAUA 2UKDA 1WZNA 3HPRA 3DZIA 1GYRA 5L40A 1C2YA 1BD4A 3P2OA 5AXAA 1T1EA 1U7OA 2IELA 3GEGA 3OQ6A 1FBTA 4IXTA 3RJ5A 2EZTA 2C7VA 2H16A 3CEAA 3K09C 4CLRA 3ZV6A 1H66A 3KQPA 4ZAVA 1AGYA 1FDTA 1N08A 4MI1A 2VRWA 4OU4A 3A6JA 3A1NA 3MCAA 5DMXA 5IJ0B 1OVMA 4LFCB 2EFYA 2PUDA 2GZRA 3V1MA 2IIQA 1X1AA 3LC7O 4KITB 2P5TB 3ZHRA 2XITA 3G2QA 4XWYA 4ZAFA 2H1OA 1E96A 2J7PD 4PANA 5DCUA 4DLVA 1V1JA 2ATXA 4GOKA 2YZMA 3KELA 2X3YA 3LXRA 1VIAA 4TWBA 4M8NE 4CM6A 2CB9A 2NNLD 1G1MA 1ECBA 2GWHA 2G6BA 3Q6MA 4G36A 3RVSA 4CMEA 1E3QA 1SXJA 4PBTA 3E27A 1PLLA 10MHA 1W75A 1Z4NA 4YJHA 3OZDA 1EM6A 5I9SA 1RVV1 4R1UA 3WRYA 5LJLA 5BWLA 4Z2AA 2VFAA 3T1QA 4BXOB 2Y1FA 5FOVA 4D0SA 1DBWA 2FWBA 2I8AA 3I37X 4MYHA 5FQOA 1ISGA 1OLUB 1RWNA 1VL1A 3PDIB 4PG7A 4INAA 4N47A 1C1HA 2QVGA 2UZAA 3HEAA 3VU9A 4JLAA 3TR6A 4BNJA 2CD9A 4LX0A 4CM9D 4DNTB 3I6MA 4JQOA 2VOEA 1DZIA 3E6AA 4QVAA 2V5AA 3Q3VA 2Y68A 1EGHA 1LTHR 4RTQA 3DT8A 2ASVA 5ESXA 1KWKA 1KEZA 1UBTS 3KSMA 4OJQA 5KZMB 4INPA 3V9PA 4CCYA 1SC9A 1W8DA 3RSFA 3AUFA 2J9FB 4KLNA 1KPHA 4X7RA 5KKAA 1W96A 2A94A 5F52A 5F4MA 4GMFA 4UCQA 1P0MA 3MRSA 2YOHA 2XZOA 2ODEA 3ITDA 1LFAA 1P9OA 2PRIA 1WO8A 2ZUCA 1YZ3A 3K4PA 4GOXA 2HBRA 1IN6A 3LRTA 4JOBA 4NYJQ 1R5NA 5FA8A 3T9AA 4ADSG 1ZXXA 2JFHA 2ZI5A 1OV4A 4ENWA 2V7UA 4J9VA 3KR2A 3IQGX 4RY9A 3W5JA 2QTAA 3D4IA 4Q93A 3PHIA 1YRYE 3O2NA 1BVUA 4UAVA 3FYCA 4XQCA 4DDMA 1EVYA 1V6CA 3O7WA 3FHLA 4TX1A 3PUNA 3D6HA 4LJ9A 4IQGA 4BN4A 3IEVA 5JT1A 1CQXA 1HLDA 2RAPA 1VYVA 1W47A 4BVGA 3EAQA 4IIUA 4AZ0B 1EA5A 2QL5A 1DDIA 2NN3C 3IELA 2HJRA 4D3SA 2DWQA 2QKYA 3KJZA 2R2AA 4FNMA 2FN3A 4JASB 1ZOLA 3KBOA 4BQNA 4AW9A 4DDUA 2XE6A 5J4LA 2QBYB 1E6LA 4U9IS 3NAMA 2CLFB 3OSZA 1KSHA 2BFAA 4C3VA 1G64A 2WFLB 3MW8A 4HQOA 1NZJA 4RMHA 3VSCA 4BN5A 1XRLA 5BPFA 4LI0A 5EGNA 3L07A 3K1JA 4Z8YA 2TMDA 3CPXA 1G3QA 1TRKA 5KHOC 1M6EX 5CNJA 2KPOA 2N1BA 4YH1A 1KA9H 2QY6A 3IP8A 4EENA 1C0IA 2AQKA 3QX7A 3DLCA 5HIIA 3ZIAD 4LCJA 2PGIA 4CIVA 1K8XB 3KX2A 5DNWA 1LS6A 3EIXA 1L5NA 3PIIA 4TLBA 2XDQB 2XGSA 2EX4A 4HUQA 1CTQA 2Q28A 2X0KA 2WP0A 4UUQA 3TLYA 4FT2A 3AY0A 4JNCA 1XMPA 1HV8A 1PWHA 3QVMA 4IOMA 2SKCA 4RA6B 1C3EA 3L01A 4MINA 4JQSA 4XGKA 5IC5A 4HH0A 4CR8A 4XWOA 1EP1B 5IM4A 1LV7A 4MWDA 5A6VA 2I66A 1TD9A 5SICE 1RPJA 2I2DA 2C4KA 4J76A 2EFEB 3PYLA 3GRCA 3U7FB 5DN6A 4RBNA 4KV9A 1K6MA 3QUBA 4MB6A 3H6HA 1BE1A 1G8HA 1UC5B 3JYOA 4CFSA 5L45A 1NW9B 1LW6E 3EEIA 2WM3A 1L7QA 3AR6A 5LIRA 2ABWA 3HBAA 2H1SA 4TRNA 4FMBB 5KNDD 1NV9A 1DEAA 4XCVA 4XJSA 3MSXA 3ZVLA 3R7DA 1MQ8B 1OFUX 3R4CA 4TVBA 3LRXA 1UJ6A 3RUPA 4X97A 3T3NA 2BI4A 4HDQB 1YDEA 5ARBA 3QFCA 1LDNA 1XHLA 2QQFA 3AV0B 2JLUA 3AHDA 5G0TA 2VUUA 1XZLA 2NV6A 3IB3A 3ANSA 4Y18A 4XE5A 5DBIA 5AXDA 4WY8A 3RS3A 5AM1A 4BO5A 1W4LA 1ZPDA 2KHZA 4H15A 4J49A 4EHIA 5KYWA 3QEMA 1PEKE 4LQ4A 4FD2A 4O5OA 1TPZA 3K9GA 1ISMA 1D2MA 1UINA 3RC3A 1ONNA 4M0PA 4PF1A 3FFXA 3I9V6 2RHDA 1GCIA 4KXVA 5DIFA 2X41A 3O1IC 3G71B 4NCHA 4ZT2A 5JBNA 1NP3A 1TO6A 2BEWA 3HCPA 3B7WA 2ZI4A 3DBLB 5COAA 1RQXA 2GTHA 1C9MA 2GNPA 4RADA 1J8DA 4UEWA 2C7QA 5IDYA 1ID1A 3UB4A 5C5DA 1P1JA 2P75A 1E1DA 2EBUA 2VEOA 2X7JA 2X2EA 3IAUA 3HCAA 4QLBA 3H13A 1VSUA 1IN4A 3LQ1A 3TR0A 5HZKA 2IS4A 4B2PA 4X00A 4LDAA 3T1OA 5IVKA 4GI2A 1T25A 3G2JA 3VZSA 2GFQA 1YQEA 1YQDA 4FR0A 1DRVA 3ZDRA 2YWXA 1PFKA 2NUPB 3H5OA 1YB6A 3A10A 3I9NA 4TVOA 4WKCA 4OOXA 2FFQA 2HXSA 1FFWA 2DBVO 4RETA 1QV6A 3EW7A 1TA9A 1GCGA 1KDZA 4EUNA 3M4NA 3ZE7A 5BVHB 3MWEB 2IUFA 5CPFA 1IY9A 1T9GS 2C3MA 3KYCB 4CN8A 4YP6A 1SZPA 2CVHA 3R5FA 3U9LA 2J0SA 2KBFA 4PGOA 2OBLA 2NZUG 4G5OA 1Y5LA 1LI7A 3EH2A 1EE9A 4H7DA 1HNZB 4RORA 1GA6A 3LBNA 2ZYWX 3M6AA 2EJWA 5SZHB 5AVRA 2CJPA 4KRFA 4KWIA 2YMLA 4B46A 4NYMQ 2UVPA 3K0FA 5MFPA 1XMVA 4Q47A 5CK5A 3GRFA 2VZEA 1C0KA 4QVIA 1T4CB 3EFBA 2R79A 3GVCA 1Z26A 1M8PA 2Q2QA 3H1AA 3LKZA 4NMXB 1QK4A 1NF9A 3OEHA 3KHSA 5DTMA 1QFSA 2XRZA 2PLRA 3I1FA 4LE0A 1L7RA 3N8NA 4OOSA 1FX1A 1W88B 1XD8A 2XB4A 1WOSA 3FIJA 3SYNA 1N7HA 3Q2IA 1IEXA 4MCHA 2ODPA 3VR5H 2H5EA 1GLGA 2RGCA 3KKPA 3U62A 3ICPA 1J07A 4HDMB 4LF8B 1MV8A 1RWWA 4LJYA 3OO1A 1KJYA 3MINA 4TMVA 4OXNA 1UMCA 4F1WA 4PWYA 3CSUA 3X1ZA 3N3BC 1QF9A 3DEZA 1G3UA 4U9HS 1HLFA 2FH5B 3CE6A 4QWWA 4BVFA 1N25A 3ZGZA 1NLUA 4B8ZA 1B8VA 5EWJB 1I6WA 2YV1A 3QVGB 4BKQA 4M1QA 1PWZA 4BX0A 1SC3A 2R66A 2ZZNA 1PZFA 3TLXA 4K9SA 2JGMA 2ZU6A 4MVWA 3KOXA 2GCPA 3OIGA 3QTTA 2JFZA 2Z3WA 1MEOA 4P3XA 5K03A 1V26A 5F4JA 3T0GA 3AGPA 1YI8A 2HA2A 1XXHB 4OLAA 2WQ6A 3PXAA 3T0FA 2J5RA 2JAXA 2VSFA 3THXB 2IHVA 1CUCA 3AL3A 5JSFA 3KL9A 1XWFA 5AHKA 3SBOA 4CKCB 1JDNA 4MZXA 3STWA 2FE1A 3PVSA 4JXKA 1YJNB 3EOBI 4NR0A 5ALDA 3RIHA 2XUKA 5TRTA 4OHMA 1TVMA 2C2XA 2PWZA 5KTNA 5FBVB 2VDWA 5J2UF 1QLWA 3ECAA 3URKA 3A4IA 4DDTA 4QODA 1WNFA 2V58A 3IIJA 4TZTA 3ND9A 1K3FA 1Z25A 3A3YA 4HADA 1BVHA 2C5EA 2IHZA 1UKCA 1FVOA 2V0CA 4B2LA 1GTRA 3QPCA 1Z0AA 2GZ2A 4R71A 3K6SB 1BYIA 2VIIA 3O3CA 4YT8A 4IVPA 5I4IA 1U1IA 3UAZA 1HDOA 4P4UA 3QE0A 3ROZA 5K0LA 4N9WA 1JG6A 1H0KA 2GBLC 2QSUA 2DFTA 2WT8A 1M5UA 1SRRA 1ZVKA 2OT3B 3FLEA 1EU1A 4CGZA 5HJ7A 3KUUA 5LD2B 4NYJR 5EPOA 2C2HA 2EX1A 2K2QB 2CLLB 1QG0A 1ECJA 3QLTA 4Z4TA 5IZCA 2VHCA 5ELLA 4ZMSA 5M04A 3Q3AA 5ARDA 4LXYA 3N3AC 5SYNA 3MTIA 3KOZA 2APJA 4XONA 2C1EA 1E4EB 2ETVA 4PZDA 2B1GA 2YUIA 1E2JA 2FG6C 2RG1A 3V80A 1B1AA 4PXYA 4L07A 1MDFA 2BEJA 2OGSA 5DYNA 4D8TA 4DQDA 2FPGA 3NIWA 3PK0A 4TLCA 2VSXA 2PX2A 3GD5A 1MORA 3KLBA 3PNYA 5FOTA 2ZBUA 2YASA 3B3JA 4YAFA 2F1HA 4Y9DA 3P26A 1JE1A 4FFDA 3U56A 4MGEA 1U2PA 4X7PA 5H83A 3JD4A 1FFCA 1ZVMA 3R77A 1F8UA 2XT6A 3PDJA 2JGEA 2VXBA 3IOYA 3FPLA 1E94E 4G4SP 1Y0YA 4JB0A 4MVJG 1MAUA 4RDCA 3SFZA 1ZGJA 3IUJA 3O93A 1ZMOA 5T4FA 1I1OA 1V3QE 2GN1A 3T38A 4DA6A 5F35A 3ADDA 2GJ4A 4LBYA 1E2EA 2WF8A 4O59O 2WSBA 1M5TA 5LQDA 2FZGA 1FFBA 3G2LA 5LQCA 4LJKA 4KVFA 4A36A 2P62A 1YOVA 2VSQA 1Q0ZA 4OH7A 2J0UB 4MPTA 4D9FA 3TPFA 4P35A 4A16A 1QTIA 3K0AB 4IW3B 4EI7A 1W0JA 5DW0A 1ZK3A 1DXHA 4B3MB 4FZ5A 1R9NA 3HVJA 2OSBA 2WIJA 3T9FA 1CJVC 1H23A 2UZ3A 4KR6A 1ZOPA 1FNBA 3VTKA 1PQYA 3X1XA 1GPLA 3ZW7A 4US1R 2LR0A 4BTVA 2GA8A 1XNRB 2NU6A 1ZJYA 4FMDF 2VR1A 2P5SA 2VDVE 1E0JA 1JEYB 1SPXA 2IYEA 2Z2JA 3STVA 4EM6A 1CEYA 1E7RA 4GMKA 3V97A 2Z5VA 3SKXA 4F9FA 2XECA 3C3BA 4E88A 2GA9A 4Z7JA 2FGKA 1X86B 2IZZA 4Z3KA 2GMWA 1TYEB 2LWIA 2OP0A 3HPQA 1GR0A 4ZC8A 4IKEA 2YJTD 3AH8A 2JK0A 1W5BA 2ZI6A 1K7CA 4QYIB 1BWPA 3DHEA 2ZYRA 2Q6KA 1XTUA 2D2XA 3EWSA 3N2LA 3U3DA 1XB2A 4UBMA 5AM2A 1QCDA 2O50A 4G25A 3VO8A 1L4HA 3M34A 4DKXA 4IM7A 3TR5A 5KSZA 2P41A 2GZHA 2A7QA 2NT4A 2F3TA 4OL9A 4ETMA 2YJZA 1IG0A 3BKXA 3O6VA 1NOIA 3V7AA 1QK5A 3ML1A 1GN8A 1L2TA 2BP7A 2I7XA 3KEGA 4NXMB 1A96A 3PT9A 4FE4A 4NULA 3JQ7A 4ZGWA 1DUVG 4OUDB 1WXDA 4CU2A 1V25A 3OTWA 5TQ2B 4ISCA 4C1NA 5M2QA 3DJFA 3EMDA 3DMFA 1TF5A 2XH8A 2PY6A 2BBSA 1P91A 2OCBA 3VHXA 4IL5A 3FI9A 1T4MA 5DSTA 1NQTA 4JLWA 3OP4A 3R3WA 1TOAA 3W78A 4A10A 3PTAA 3BMQA 4BP8A 4ZOLB 4I5GA 1A9OA 2R11A 1YUNA 2X7XA 3JVDA 5JARA 1PJLA 2G06A 2CK3A 2H31A 4H2DA 1S02A 4FKMA 1OKKD 2PX4A 5ADHA 5LLTA 4HCJA 4OP2A 3OKXA 1Q0QA 3DUFB 3ROKA 1AHIA 3OG9A 4X07A 1AKMA 1NASA 1PDWA 1PR1A 1ZBQA 4IRXA 4NBWA 1D1NA 2PS3A 2A1UB 4PLYA 4AJEA 5I9BA 5AKYA 4F71A 3WB9A 4PGFA 3ZKAA 1JLHA 1GKUB 2WAMA 4BMPB 1WB9A 2ZS7A 3NBUA 4CFYA 4RD4A 1XUOA 4KN6A 2ILVA 2EKLA 3W3ZB 4RDKA 1ZAKA 3P0RA 2IYXA 4JJ6A 1QVGB 3CNNA 3ABIA 1V8PA 2I55A 1WCIA 1Z2EA 2WD7A 1E1QD 2P4UA 1XZGA 1EFDN 2AJBA 3DBRB 3TKLA 3WGNA 3KALA 2ZPUA 4Z9YA 4E1BA 1Q6YA 3E3MA 4Z7NB 5ALMA 5ALPA 4OQXA 3DWGA 3MAJA 4KO2S 4OYHA 1I1NA 2QSZA 4GBED 1CVLA 4S0XA 4UMVA 4XSGA 3V48A 4I81A 1AH2A 3IQHX 1T9ZA 2RHMA 2X6XA 3D3WA 1UD2A 3CCRB 4MMYB 1GHTA 4P5DA 3RVKA 3JAWA 2CE2X 3W77A 3WOHA 5FWXA 1VGQA 5KNBD 1R0ZA 4B17A 2JJ1A 4W5JA 4NYMR 3GRVA 4JROA 5D1HA 2XCSB 3JALA 4QOGA 3GC6A 3SEZA 2Z8ZA 1FDIA 5I8WA 4NS4A 4F8EA 4MIOA 4PC7A 2PUVA 1RI1A 4NCBA 3JQ8B 2XADA 2VPYA 4C05A 1ID8A 4YLGA 4KQHA 2IYRA 3EXIA 4M0DA 4M8KA 5REQB 5K3FB 1QIHA 1NATA 4ZALA 5JBIA 1M76A 3MPUA 4BO0A 4UNRA 5DHUA 1N2EA 1SQ5A 1P7CA 3A1EA 4G6ZA 4XD7A 4JV5B 2OB1A 2R5FA 1PRYA 3VR2A 4ZFNA 4HRVA 4FGLA 1MEJA 2RHOA 3L8MA 3M9XA 4P25A 3OIVA 2E4VA 2BEUB 4UHBA 1LNQA 4IDEA 1D0VA 4F56A 3BEDA 4FMDB 4L76A 1JP7A 2DB3A 1YJ5A 5K4AA 1VL5A 1QGZA 1L8XA 2XCUA 1JQBA 1PDVA 3OPYA 4WA8A 4RTRA 1UM9A 2O20A 3VSAA 2QPTA 2JFPA 5AJVB 3RYIA 3DTNA 4Z4EA 5CFLA 4HT3B 4YUZA 1C5KA 4D9MA 5MN5A 2X2OA 5B4UA 1HF3A 1PD1A 3RFFA 2VATA 1BX3A 3BH0A 3GXBA 3GLIB 5BSYA 1KEEB 3KOOA 2ZZMA 1DKMA 1ADCA 2IXFA 3OJCA 2OTCA 3ONNA 2A8YA 2BTQA 4P83A 2W2LD 1RQ2A 2DBYA 1U7DA 2G83A 3WKAA 1CYEA 5EZ5A 2IQ5A 1D4ZA 2FWMX 4U9UA 2QLMA 1ZGZA 1ATZA 1I3LA 2I22A 4KI7A 4OEHA 1CQIA 4QLOA 4AZ0A 3A2MA 3B53X 3F6RA 3QK7A 3KZKA 1BX1A 1L7EA 3P2MA 4G09A 1PT6A 3DT9A 3W34A 2XYVA 5A71A 1T36B 1FUYB 3BHJA 3II6X 4UZFA 5IBRA 4ZT7A 5J3JA 2K7ZA 1F38A 4QOJA 1E3SA 2R62A 5J59A 1QFJA 1VCOA 3ME5A 4MOWA 3V1TC 2P79A 3AU8A 3IKMB 5AT1A 5CLLA 4DJJA 1E2GA 1YMUA 3U4QB 4BEBA 4ZT6A 3NIFB 2XIQA 1FP4A 4IDDA 1KE1A 1YE8A 4K9KA 4YBZA 3R3SA 4H7IA 1UP4A 5JLJA 3CRVA 4I19A 2ZTUA 1OTXA 4CKBA 1E2PA 4IJKA 3ESRA 4QOEA 3S3TA 3ANLA 1WDKA 1AKYA 4EWLA 2QGFA 4IMJB 5C4IA 3UV3A 3FNBA 2J7PA 1N6LA 4MO2A 5AVQA 5IYNA 1KJ8A 2JHAA 4FN5A 3KLNA 2DPYA 5EMHA 2OUKA 4QFCA 2VNSA 4K26A 3W6OA 1CF9A 5A03A 4QSMA 4MB0A 2I3DA 3OJLA 2H0RA 1BA3A 2GK6A 2CL7X 2FRVA 3DVQX 4BNWA 2F1JA 1DT5A 2A3RA 1IHOA 3AWDA 4PG4A 4POOA 1A71A 2C5FA 1KRXA 4JXZA 3PQ4A 1JHDA 3BORA 3HI6A 3CC4B 3UXHA 3NG1A 2V1UA 2DWCA 2NXNA 3DW1X 2JPDA 3UWOA 3RYFB 5KTKA 1SWVA 5CVEA 3CH6A 3GUZA 1W6UA 4N0EA 1CZLA 1BDMA 5BN4A 3DW3X 2W6MA 3PT5A 4MCAA 1ZI6A 2HN9A 2HYDA 2RHWA 4MYTA 2IGTA 1AS0A 3JSXA 4K81B 4WKPA 2RB5A 5A5GA 2IYQA 4J7UA 4EPWA 3ASPA 1X9GA 2C0QA 4LKRA 4MV5A 4P4TA 1G17A 4YFVA 2J87A 1EDBA 1ZIYA 4Q9IA 3GCXA 4WXEA 4F6LA 1BQ4A 2YNMC 1TTQB 1KFCB 2PG3A 3TLAA 3U7IA 3CJTA 5EP4A 2I71A 3HYNA 1F9AA 3DO8A 1Y4UA 4AYWA 3VKGA 2PKQP 4RQBA 1E7YA 5DBOA 2EATA 3EXHA 5E9QA 1CG6A 3EGVA 3C6KA 4N48A 3R3XA 1T6BY 3ABZA 5AYVA 3RIYA 4E5UA 2LCIA 2YHIA 3KQUA 1ZCFA 3CW9A 4IS3A 3QPUA 1NX9A 3KSAC 2P5UA 4EOGA 4Z1MD 2ZUVA 3PXDA 3BSFA 2HNAA 2L17A 2AZTA 1CDOA 4B7ZA 1DL5A 2XB8A 2EP7A 3TZCA 4DMRA 2PFKA 1XPRA 3NIDB 3ZD7A 1YR2A 2O8CB 2YXNA 3B51X 4QFMA 4OHBA 5FUBA 3H4TA 1O58A 1B3RA 4W7SA 3SR3A 2CWWA 4I4NA 2VCHA 2Q6OA 1FDVA 1I9GA 4URXR 1TIKA 3H2ZA 1E0DA 4EARA 4XR6A 1NIPA 3TOCA 4PAAA 2WHPB 2WT4A 3FPGA 3K1AB 1S7GA 2BUBA 1RFLA 4DAOA 2CLDX 1S8OA 1UXIA 1G98A 1LRJA 1VA5A 3EUEA 4AO8A 5BVHA 1SVKA 2HMWA 4YAUA 4MUXA 1N6OA 1I4LD 3D81A 4PYKA 1K4KA 1YA8A 3GCDA 3UANA 1RYBA 3ZIAA 1I0IA 3GJXC 2DE0X 3NM4A 4M7OA 4WXYB 5H3HA 3P32A 5BXQC 3KKNA 2J3JA 2L19A 2JIZA 3HVUA 4PAWA 1YJBA 4EKIA 5K8IA 2O7VA 4M54A 5J5AA 1Y7HA 4MUMA 4FS3A 3G23A 4G8DA 3CC7B 2CV2A 2FPPA 3GIRA 4Q6WA 3TKYA 3FPSA 2XD4A 1N77A 3LIPA 4CEJA 5HG0A 4F1KA 5KVSA 2YZGA 4IIHA 1JIKA 1PR2A 4ABTA 1W9XA 5T64A 2CB0A 3WIDA 4JBLA 3OCZA 3EQ2A 3Q5GA 4Y6QA 4BO6A 4L2IA 4L4YA 2H6EA 1XCJA 4P5EA 1ELOA 3HU5A 1EWRA 1SELA 5HZAA 1C7FA 4YALA 1J8MF 1R50A 3CO0S 3DD1A 3ESYA 1VKOA 1W93A 3HI4A 3FN4A 3KPJA 4CKWB 4MUJA 4AT1A 1ZR2A 2YBDA 4DQ0A 5KNDA 3E8SA 3HP7A 2GXUA 3M1YA 4RY8A 4YRCA 4LJAA 3GVPA 3K6JA 4OAPA 4KKVA 5D3MA 3UMRA 3W5BA 2A3NA 3W79A 4XVCA 3PWZA 2IHTA 1I2MA 1PNRA 5K6TA 2VHVA 4TL6A 1NUHA 3LF2A 1N5OX 2IU6A 3UGJA 1OFVA 4MRNA 4WY2A 2PL3A 1XNQB 1NI4A 1QYWA 3KB6A 3PUVA 4IFBA 5B64A 4HJRA 4PNEA 5B12A 2ZATA 2YWEA 4Q7JB 3AEXA 1VL2A 3WLHA 4TVKA 1KL7A 3GD7A 3C41J 2IS6A 1GD1O 1C8BA 3ELDA 3IAM6 1V9LA 3AEQB 1OT3A 2BDEA 3VR4D 1PS0A 1ZHOA 3IC5A 2H7VA 3BE5A 2NYAA 3VRHA 1ZUNB 3SS8A 1T5IA 2PJDA 4XKJA 2XMGA 1W36B 2Q9CA 3NGMA 3LPDA 1B00A 1QG6A 2ZYSA 4Y1FA 5BV8A 4I3HA 3IFSA 1MENA 3K6KA 1UWLA 3CF4G 2JFUA 2I2BA 1OGJA 1ZM2A 1JQ3A 2CBXA 2MYPA 3G2PA 3QY0A 2O8FA 1QWOA 1JFSA 1B41A 1CV2A 1JG3A 2DLCX 2Q2OA 1XEAA 5E6SA 2BE7A 4GZ3A 5LQJA 4KLZA 2W70A 5SYMA 3R8FA 3A4VA 1G9XA 4F2PA 3G13A 5T6BA 3GUHA 5KJ6A 2CXHA 4KODA 4RPDA 3OCVA 2LW7A 4AZVA 3FOAA 1AGRA 2XT9A 2I7VA 4QGGA 3G5TA 1SCKA 1ZP6A 3OWOA 1NNUA 5JRJA 4WACA 1MH1A 2Z95A 1UZAA 3KE9A 2FR8A 4MS1B 3EWIA 2QTVA 3M3HA 3O5AA 4ZHQF 5JVDF 2HF9A 1UAAA 4IO1A 2KW5A 5A05A 1RRCA 3PCTA 3CP8A 1CU1A 2Q0SA 4CQLB 2X9QA 2KQUA 4Y1RA 1DKNA 4D45A 3UAOA 5IT9A 1RYEA 3L9XA 1FNDA 1PYGA 2AZMA 1VCMA 2D6FA 3P5SA 3DUWA 2I80A 1Y7LA 4RXUA 1VG0B 1XZDA 2HTEA 4V0RA 5FUVA 4A8JC 3QUTA 4A0FA 1RXVA 1RHRA 2GZDA 5LYYA 3WDKA 1EPUA 4D92A 1C1DB 3HR8A 3UXEA 1D8TA 3A3PA 4R1QA 3ZHXA 1ZM4A 3O8QB 5JO0A 2BCEA 2DMRA 5HZHA 5K3EA 2BZSA 1QC5B 1JAXA 2H17A 3U49A 4DLRA 2XF8A 5GONA 3KUXA 3TDKA 3V8MA 1U02A 2WHRA 1RRPA 4TV9F 1IB6A 2Y77A 4NJMA 4Y9SA 3ORRA 4PAGA 4PO9A 1W2GA 1CETA 1BXGB 1K6JA 1Q7BA 5DZSA 5J4YA 5I48A 4GE0A 4BVLA 2NP6A 3MOSA 1YR9A 1UBLS 3A37A 3D2LA 3IP5A 3WA7A 4JODA 4JI7B 4V0NA 2DSNA 1HTWA 4ERXA 4IG9A 3BERA 5DYWA 2ZREA 3PEUA 2G1UA 5JSZA 3ZQ4A 2WV9A 4PIMA 1DFHA 4MQFA 1OLSB 4ML3A 2OBTA 2QN6A 2Q1YA 4WCDA 3F3MA 3FA2A 1DT3A 1G59A 1MPXA 1LUAA 1XVTA 1A1SA 2I3ZA 4YBRA 1SCUA 2OXCA 3PQ8A 3KSRA 3DO5A 3QE4A 3R7WA 4MARA 3S7ZA 4EHDA 1YE3A 2R85A 2A5GA 1K5PA 4KOAA 1Y34E 1U7WA 5DYTA 1NUUA 2VTEA 5IS2A 1BOFA 2H8KA 4JYZA 4C20A 3GVJA 2VJOA 2BR4A 3L1VA 4NFHA 3TAHA 1AA6A 2RARA 4OHYA 2GXQA 3HCCA 4OIFA 3AVYA 3HVRA 2X7HA 3E20A 1ZHFA 1E2FA 2VHUA 3D0QA 4LMPA 4X3PA 3GGJA 3OZRA 4JYCA 3GFQA 2KVOA 1QX4A 2X5NA 5EJIA 1VP3A 3SZMA 3ORQA 3V8NA 1SPBS 3EPRA 1YV9A 1C80A 1O4WA 1WBBA 4ZQFA 3B20A 1GZ6A 4RUKA 3IT1A 4CL0A 4DCNA 3RTAA 2WHQA 1OI4A 3LBHA 4HEA1 4OTZA 5ENZA 1MKYA 2V9PA 1GCOA 3C4JA 4C5AA 3RK1A 2I4OA 5ED4A 3BCUA 5HDBB 2F9FA 3LJKA 1U28A 1P7PA 1CIJA 4NPCA 1RS0A 2G04A 3TRKA 5IWCA 5EQJB 5A0FA 1M2OB 2X0FA 4EYKA 1PJCA 2WZNA 2REOA 3FFAA 2QRJA 4G5FA 5G02A 5GJBA 3LH5A 1A88A 3LVRE 2QD2A 3K8QA 3JQ9A 5FTMA 1Q74A 2NXJA 1QS0A 1P3JA 2N9UA 1FEZA 1WXGA 2WJZB 2WE7A 5C8VA 2WKSA 3DGFC 1OPXA 2QVCA 5P8WA 1ISIA 5GZ1A 5JSQA 1PBTA 2G63A 5EXEA 3LZCA 1YJQA 4X8LA 3M5CA 2BHNA 1CLUA 3GRAA 2PGNA 2HQOA 3WE7A 3FPJA 2ZITA 3PC8C 5BW4A 1V39A 1WY5A 1ULHA 4BS9A 3ZVKA 3EC1A 2ODAA 2J8ZA 2P1DA 3U37A 3RHZA 2Z3ZA 3HLTA 3G05A 1SOMA 1ZLXA 3AHIA 1SHUX 2EW8A 1UKBA 3EGEA 4PZLA 5LMUB 3TEMA 4UM9B 4ZHQB 4JGGA 3DYIA 4ZJYA 1F3LA 3IP3A 4OAQA 4UASA 4IHJB 3UJPA 2OM2A 1U9CA 3VDMA 1N7JA 2MOKA 4GS5A 3F3SA 2DEUA 1BD3A 4L0CA 3CH5A 2ZRCA 4OBWA 2IU0A 3X3HA 3WGUA 1E98A 5FKJA 1X80A 1KDVA 5IJ9B 5K4GA 1AB6A 3D54D 4P2NA 1CDZA 3EVDA 3WS7A 3ESCA 5LP6F 1GEEA 4XX0A 3DL7A 3HBNA 5DHSA 3RC1A 1HYHA 5AW3A 4QG3A 1N0VC 4EFDA 1WXEA 2UVQA 3G1TA 4ZVNA 2IPXA 5IJXA 3T4PA 1EQ2A 5I47A 1DPGA 1JQAA 1E6KA 1FOEB 1RLMA 5D51S 3ZLBA 3K9LA 4QYSA 2VXCA 1N6PA 1G16A 1KMHB 1KI1A 1PSDA 3LS2A 3G0CA 3KT0A 1DELA 5F5XA 5FXMA 4B32A 4BVKA 2YHUA 5BQ5A 4G0NA 4JR0A 3ZS8A 2ES4A 2J5KA 3PUIA 4P9NA 2CNWA 4PIPA 1QOPB 1Q91A 4RIFA 5KI6A 5C1DA 1XZAA 4FU0A 3CC8A 2PEZA 3IAFA 4IGKA 4EFNA 5K8LA 2AA3A 3P5BA 4X93A 2BE9A 3AI2A 3UXYA 2COEA 2E37A 1E7MA 1DAOA 3ZBUA 1Z4QA 1SG6A 3G6EB 1MP0A 1YL7A 3DDHA 2QD3A 2DAPA 2NU7A 1KORA 1RXWA 1FPQA 1WZIA 1BS1A 3UN1A 3Q3EA 4Q05A 5DCWA 5EJAA 4MI3A 2Q9AA 2FWRA 1T2NA 2B4TO 2IYFA 1ZC4A 4IXDA 1X2EA 1XCOA 1G20B 2VOJA 3V3TA 5JIBA 2DHDA 2Y1GA 2CZQA 4YAIA 5KX5F 4LF4B 2JLVA 2J48A 2HHAA 2JZCA 2ISCA 2BEUA 3TYXA 2ZUDA 5A7HA 3HBLA 1G21E 4JYMA 1E9AA 4RKWA 3PLAE 2XKAA 3ROXA 4WQMA 2X4IA 2Q2VA 4Z4SA 3KTAB 2OCYC 1PG5A 2ZROA 3T8YA 3OTOB 1KFJB 4H1VA 4LRXA 1IIRA 3DBIA 4HWPA 4RZ3A 3FETA 5A9SA 4KK3A 1GPNA 2XA9A 3TS1A 4JGIA 2OB2A 3CLRC 3OJOA 1P4RA 1TAHA 2FN9A 3RUAA 1B73A 2Q1SA 5LYJA 1PS8A 1P8AA 3GRKA 2FF5A 1CS0B 2YHSA 4XDGA 3NBKA 4RULA 4BP9A 5J5VA 1AQLA 3CF6R 4D6PA 3D8UA 1EESA 4YV7A 4G8JA 4HMQA 1DBSA 2CXXA 3KXIA 4XFKA 4E94A 3B3GA 1U7ZA 1Y8AA 1NLFA 2PT7A 3UFBA 5CG1A 5A0VA 1DO2A 5A5VA 2P7HA 2PX0A 3BA1A 5AJUA 2FP3A 1U2ZA 3PE4A 1PUIA 2X5XA 3BF8A 1VLHA 3CLSD 4IYRA 1BAPA 1JAYA 2O2XA 2E1PA 4RLZA 2Q3LA 2VAWA 2AMVA 2VJDA 3MB8A 3CKYA 1IQRA 2ATCA 3MQFA 3QKSB 5KJEA 4B3SB 2QX9A 2Z2XA 2WG1A 4HYTA 2P69A 5F2KA 4NZYA 2Y1LA 3SFTA 3BY2A 2BONA 2OCDA 3H5NA 3FB4A 5KNBA 3TW0A 5I9IA 3AOEC 6PFKA 5IM5A 1RWPA 4KZKA 3J7AC 3NBAA 4D96A 1RACA 5BSKA 3ORFA 1RXSA 1KZYC 3TXAA 4B79A 1GGFA 1IBRA 1Z0UA 1Q1QA 1YA6A 1KY2A 3G9ZA 3R1IA 3HXTA 1CT9A 3HGTA 1NVAA 4MRPA 3UMYA 1OFIA 2H59A 4HYYA 3UHFA 2RAVA 2ZIAA 4AWBA 4E6EA 5DISB 3F74A 4N3AA 4I99A 3AHCA 3OT5A 1LK7A 4ZCQA 4BYGA 4M83A 1QU3A 3CFYA 1VSTA 2I54A 3CZ5A 3IE0A 3T5GA 4YMUA 2QOEA 1J7KA 3VYVA 1D4AA 2O1XA 1PI3A 2JIDA 5L53A 5LLDA 3GAZA 3UF0A 4LHVA 3F6EX 1C9DB 3DEIA 3I8OA 5KU1A 1Z2CA 2OMKA 2WKPA 3TSZA 1WWKA 1HL3A 4BECA 4ETNA 1W5EA 4DQUA 3NHZA 2CFIA 2CEAA 3ETEA 2M6KA 1QKJA 4KEAA 5FBQB 5LBTA 1FUEA 3A6ZA 2G4CA 4RGQA 2JHCA 2ZAGA 2DGDA 5KAPA 4KBGA 4B9EA 1YC2A 3UWMA 3IQZA 5CUQA 1BXRA 1NXXA 2CKMA 4F9EA 3EASA 4PG5A 3EZYA 3P0IA 5IT4A 4GWLA 4C7OB 2XZLA 1QQ6A 4GQNA 2AHRA 2B99A 3AKZA 2ZDHA 1VPEA 1BFUA 3C39A 2LDXA 4NAUA 1LDYA 5CVTA 3CIFA 1D1QA 3VJKA 1WCYA 3A4NA 2R8YA 3QLJA 4KQGA 2HPAA 4MJLA 2QQEA 3LXXA 2GPJA 1B1CA 4IFTA 1C1XA 1QGUB 4E5DA 1V8BA 2ZBGA 3NTLA 2MSKA 2BIFA 1H4TA 2ZDGA 1PW7A 1SXGA 3RK0A 3L40A 3SR0A 2WIDA 5F3DA 2GM9A 2QP9X 5D3KA 5DLQC 4IILA 1Z0DA 3VUFA 1V47A 1YUMA 3LPNA 3L8DA 1F48A 1M6HA 4ON9A 5DLYA 1K3UB 3LPCA 1E1LA 2WYWA 3AM4A 3GLHB 4N39A 1LX7A 1XMXA 4XCXA 1RR6A 4QBHA 3RTBA 1H2YA 1AKNA 3DZJA 3QSGA 3NHWA 2DWPA 3ZDYB 2J0VA 2NZ2A 1CUBA 3ZU4A 2A9FA 4EK9A 4AZ3A 1Y0BA 3A1VA 2OY0A 4FK8A 2NO9A 3WA6A 5KOJA 3CZAA 4WZAB 2HJWA 4QDUA 1ODLA 4CTNA 2IOYA 3BXFA 3L7BA 4DZZA 1J5PA 1EFRD 2P9QA 5FA6A 4GL4A 5T4EA 4D57A 3MOGA 2XVAA 5JH7A 4GBGA 2INGX 1UMDB 5JZMA 4HLNA 1IXRC 5A4KA 2ISSD 4BNDA 3OLCX 4LDPA 1CQJB 5HK9A 3R5KA 4NPHA 3O4HA 1RLUA 4A91A 2NYVA 5IBPA 3H9BA 3ZW8A 4UW9A 3V42A 3JVUA 1M2HA 1T91A 3T5BA 5LMCA 2FZ4A 3UMMA 4CV0A 1M0TA 3S2IA 1Z5VA 1DIOB 4E2XA 4GXTA 4JYBA 4MIEA 3ED5A 4CGYA 3MIIA 4EABA 2RK3A 5FBLB 4EW2A 4DK0A 4ZCLA 1N0WA 2ZOSA 3D6NB 5DHPA 1GARA 2R751 1PR6A 5TPWA 2PXHA 2GX6A 3VDNB 4XYEA 4CM1A 2O6HA 4CKWA 3CS3A 4XN0A 2OGUA 4QTUB 4Y6OA 3VJMA 4TKUB 4FHCA 5FI0B 1I24A 3TJZA 1ZUD1 4JBGA 5LFAA 4HQ0A 1F0YA 1GRCA 1L5HB 3KV1A 1LPPA 1ULUA 2GJ8A 1T8YA 4LI3X 1E32A 4AUMA 3FTNA 1S1MA 3ZZTA 3F6SA 4NCXA 3WGJA 1TYDE 1V0FA 1XN4A 3B1WA 3DEAA 2O8VA 3H5LA 1BMFD 3HCFA 3BJRA 4TRMA 2JCVA 4XKWA 3TXYA 1F2VA 2ACEA 3WB1A 5BN3B 3GLGB 4RPLA 1GQ2A 1L4NA 2FU5C 4D0RA 4DV5B 1NG9A 3F97A 3DEKA 2ZRBA 3GNSA 3I04M 2JGLA 1O6FA 3FWYA 3L8GA 3W5HA 2YQZA 2A9RA 5JEDA 1ZUNA 1N78A 1MW9X 4H18A 3T94A 1DI0A 1FFHA 1NPDA 1Z62A 3CC2B 4GSLA 1K5HA 1SBQA 4DSAA 2PXAA 1ZFNA 1GZHB 4CF6A 3BGIA 1RKUA 4U7PB 2JHPA 1WF3A 3N8KA 5KTMA 2PAFA 2OAEA 4RVSA 3GPLA 2IIPA 3NV9A 2G80A 1R0XA 2FK7A 4M0EA 3M2TA 3DOJA 4EPTA 2OAGA 2DJIA 1VGVA 1CB7A 1N9GA 2C9OA 3MS2A 1K7EB 1J9GA 3L49A 4OMDA 3K96A 3QKTA 3D26A 1VL0A 4URYR 1YS6A 1NJ8A 1KDOA 1PV2A 1UPTA 1ZVJA 2Y1DA 1XWWA 3AVQA 4ID9A 1SBTA 2IPMA 1NOJA 2KMLA 5T67A 5IVDA 4IDCA 3AIOA 3CLUD 3RPEA 3UAYA 2AXPA 2P6NA 4FEEA 3K70C 4MZDA 2Q4OA 1I7QB 1XZ8A 4TKZA 3TTYA 3VKFA 1T0PA 3N2GB 2AEMA 3DD5A 3K8OE 2KE5A 2C83A 5DOZA 1YONA 4E2ZA 1R9JA 4X1YB 4CCWA 3B85A 2REBA 4MUGA 2LTAA 1MQSA 3KZOA 4WWHA 5JAPA 1ZIPA 2HI0A 1QAOA 3DHWC 5AICA 4E3WA 3U7EB 4RK1A 1FIUA 3ZQJA 2MMGA 1M0EA 2ZSJA 2PDAA 4UEKA 2IDKA 3ZNQA 2RHCA 2EU8A 3GI1A 1E6WA 4MP3A 2BKXA 1TX4B 2W2PA 3CBQA 3PLRA 1ADFA 3OLWA 4GKBA 4HFRA 3DCJA 4ZAZA 2ADFA 3SAJA 3HMQA 1JX6A 2O2HA 5J2TF 3WSVA 1OXXK 5HRCA 4EMUA 2HBZA 1TUBB 4JGBA 1XAIA 3FSJX 4YV1A 5F1OA 4Y30A 2AUNA 1LBEA 3JYQA 1JIJA 4MR8B 1SXJC 2A0FA 3EVAA 4M9UA 3ZWYA 2IH2A 1XZPA 2B4RO 2IZ0A 3EA0A 3R5JA 3WRYC 4UHKA 5L4SA 1WXQA 4C6RA 4ENQA 3ZOKA 4OBEA 3PNQA 2MINA 1NBEA 4MJ3A 3A2NA 3UWDA 4NENA 1II9A 3FXAA 5CB4A 5KO2A 1TFRA 4I1SA 4IG4A 3K2IA 2WRZA 2DZDA 3W2TA 1E2UA 3BMNB 3CPJB 1XRRA 2ZT8A 4K0KB 3O2SB 4K6GA 5CHYA 4NPAA 4YIKA 2YQ4A 5JS1A 3ANXA 4P7JA 5FBKA 2F1LA 4TQUS 4FW8A 1IQUA 3TL3A 4Z3OA 1PK7A 4QG7A 5EXXA 3VR4A 2XR1A 2ZXFA 4KXMA 2POQX 1V4VA 4IIGA 2VXOA 2C1XA 5EUCA 4EPVA 5JQGA 1DJQA 2R00A 2J0EA 3U44A 4A2CA 4B33A 2YINC 5AMXA 1PTJA 3FOCA 3JYNA 4GT1A 1XA4A 4C4ZA 3UJ8A 1NN3A 4U5XA 3HABA 3KL2A 3W5SA 2ACVA 4EJ2A 3ZCRA 3QQ5A 3D7KA 1CJMA 4JLNA 4PZPA 1NAIA 3AEKB 5EESA 3L0YA 4YMGA 3C5WP 1JECA 2FYTA 4F6RB 1SBHA 3DXYA 4V1CA 4WZZA 1T1JA 5AESA 6YASA 4DIMA 2B7CA 1KZ6A 1ZZGA 4YV2A 4M0KA 3DCIA 2V7TA 1LBQA 3QBVA 1EX6A 3H05A 4I36A 3KQTA 2XNDD 3S2UA 5IYPA 3F7NA 4Q4JB 1XP5A 4UUAA 3SVZA 1V6AA 3V00A 1NB0A 3PRHA 4MPRA 2R65A 5L3RA 4MV6A 1Y37A 1YJCA 1Z06A 3MJSA 1J09A 4KO1S 4UZEA 4XEHA 5CAEB 3F1LA 3R7AA 3HB7A 3FH0A 2HF8A 1YB4A 2Z2IA 1J0EA 3CUKA 3TZQA 5ALXA 2IYAA 2VEDA 1PWEA 2I34A 4ND3A 2HIMA 2PH5A 4DHEA 4I1PA 1YS2X 4B71A 2JLYA 1ZN2A 1QHNA 5H3LA 4XOIA 3ADOA 5CX4A 5KJFA 1L5OA 3LO5A 4O4LA 5HP4A 3FF1A 1Y3FE 3WWZA 2WM2A 1TMOA 4NTZA 4W5NA 3ETJA 1PNTA 5H0IA 1LJUA 1Y9DA 3ZE1B 3H86A 2WJVA 3LTEA 4AY6A 2HJVA 2ZJ7A 4MDYA 2B4KA 3PUXA 4ANFA 1YRBA 3QXXA 5FFMA 3C3KA 1NR7A 4QEZA 2PR7A 4DV6B 3FRIA 4JLDA 3NX4A 3TW8A 4X63A 3VZDA 3W5AA 1AD2A 4B6OA 2YY6A 3LL4A 4G23A 5J40A 3GXOA 1MN6A 2F3RA 1F2TB 2Q50A 5BMVF 1P0PA 1BCSB 1C1YA 2MCFA 2V7QD 3LXUX 4IIEA 4UATA 2J6HA 3RS2A 5LQKA 1DQSA 4WJLA 4DIOA 2EP5A 4R0NA 5ALIA 4C78A 1BWSA 1Z38A 1PD0A 2ZJ8A 3ZWKA 1OY1A 2C2OA 2X4GA 1HL7A 1T3TA 3RJMA 4A73A 4CG3A 4C2AA 4QJ3A 4IJUA 2C4MA 1J70A 4IQ8A 3RT7A 3TINA 3O95A 1LSOA 2GN9A 1GCAA 2DM6A 4KFSA 4FOOA 1V9SA 3FOZA 2JI4A 3GRRA 1A76A 4GHWA 4GKJB 1HEYA 2WHYA 3VNVA 3LOUA 2XWSA 4F6CA 4R0MA 5L3QB 5HRUA 3HDVA 1Y0RA 5AM5A 4RVGA 2H92A 4JL6A 3TNFA 5C3MA 2JLAA 1O0CA 1M7HA 3H8JA 1MJGA 3O73A 4IIJA 1FX0B 5H68A 3U40A 4QUJA 3B38A 1OH8A 1XNHA 1RSZA 3CCMB 3CX4A 1S9HA 3KIPA 2E82A 4BQRA 1FS6A 1TFUA 3VZQA 5C7IO 4URWR 3SSNA 4UNPA 2O2ZA 2RBKA 3GH3A 3O47A 5A1TA 4AIRA 1TO1E 4BMNA 1SM4A 4UAJA 3V1LA 2ZJBA 4I1YA 1M8JA 3F71A 3GDWA 4N8SA 1L3BA 2R4QA 3NOVA 4UMFA 4MVYA 3SG0A 5EHXA 1ZH6A 5JTUA 3JR3A 1DPFA 4HDNA 2J33A 4LRUA 4OH1A 3TQQA 4BASA 3OD5A 3PPYA 5JMTA 4D44A 2RK6A 3OAAD 4Q34A 1QSGA 5HDQA 1TZBA 3SIXA 3CV3A 3T7IA 4PC3A 3HWSA 2NVWA 1JU4A 5SY6A 4WXPA 3W8NA 5KQGA 1QM5A 1N36B 1YBFA 1AT1A 4GEKA 3NP9A 5JZOA 1V96A 4I6JA 1ZH8A 4WASA 4R8MA 4DG8A 3WFJA 5J23A 4MIKA 4DWVA 3E9NA 4MUIA 5CH5A 3RASA 1CE8A 1JG1A 1PWXA 1XJCA 1DC4A 2C8LA 2JF0A 1OR8A 3L7AA 5DVZA 2UYCA 2WWTA 2HJSA 1WG8A 1L4FA 2C29D 4BNFA 1KI7A 3RUFA 3BAZA 1MFPA 2ZR9A 9MHTA 4Z9AA 3NDRA 1FSZA 1O6GA 2FE4A 2GEBA 3BFXA 3P52A 3DZBA 3EOZA 4DSUA 2EHDA 2OZLB 3D4OA 2BELA 4K6OA 4H1TA 2X86A 3ZBPA 4LFBB 2ZAOA 4HD8A 3L6EA 1CVRA 4XM0A 5U1PA 2QM7A 3O3NB 3DB2A 4NBNA 5T41A 4HEHA 3W5CA 4N54A 1PO7A 1GTJ1 1V6SA 1X3LA 3GT3A 3DULA 2H9IA 2XZTA 3OESA 2Z43A 4W5WA 5HFNA 2JW5A 3C7DB 4FBGA 5BQOA 1EZ1A 4UUBA 5KPJA 2EDAA 4QRDA 1PEDA 2JK1A 4RLSA 4Q66C 4XB2A 5J5CA 4GEGA 4J0EA 4K7JA 5IDQA 1P5RA 1XDDA 2FW9A 4DRZA 5BSXA 3C8MA 3SFVA 1GU7A 4WAUA 4U2CA 1K08A 5JAIA 1Q92A 4RWZA 2NQTA 3K05A 3DMPA 3G6WA 3GUVA 5KW9A 2FG5A 3TNLA 2IYOA 1TVKB 3ZH2A 3V6MA 5HQ3A 3PLNA 3A2LA 3HP1A 4QTZA 5ERGB 3VHRA 1FQWA 3GUYA 1K66A 2RJOA 3G1WA 3Q2KA 2NUAB 3AVVA 1E6EA 1KJNA 3K9BA 3M4YA 1MO4A 1MJGM 2HFJA 2OV2A 4WSOA 2BAGA 4MSUA 5IAEA 3LUAA 4CG2A 4FDAA 2JLZA 3TF5A 3MC1A 1G8AA 3E15A 3P2YA 2AN5A 2GUGA 2IP1A 3ICVA 5HJ2A 1RI5A 1JDSA 3T3PB 3VQTA 2EFGA 4FDVA 4YN3A 5AW7A 1X92A 5HOEA 1YR1A 1W1IA 2YVKA 3H7AA 4DYHA 2YWDA 4FFPA 4DFDA 3IA7A 5KPDA 4QDXA 3FPKA 4ZO6A 1U2TA 3PJGA 2QM3A 5F7XA 3FNGA 5C31A 5JZVA 2PX3A 4H17A 4RGYA 3WLMA 3U09A 1X7ZB 2ZIFA 2BFBB 2ZTNA 2QRQA 3E0XA 3GEPA 3JRXA 1E4YA 5ALYA 4XYMA 1MABB 4CDGA 1QH8B 1U3GA 2ZZKA 1LI4A 3NEYA 5IPFA 4HNAA 4DCGA 1N0HA 1FUKA 1HQYE 4XVQA 4XIYA 3B1VA 4Y67A 2CLIB 2AK2A 1F8XA 5FI3A 2X13A 4DLYA 5PGMA 3M3DA 5FWYB 3ZG6A 4RH3A 1I9CA 3ZZ1A 1UD5A 4N8EA 4TSFD 4B6SA 4BEJA 4DVGA 3K1TA 4CV2A 2EJTA 1PYDA 1WDTA 3K1YA 3QV1A 4I9UA 4JU9A 4XLAA 2VK8A 1G5TA 3ERCA 3UB2A 1LB1B 3MELA 2Q5QA 2LRHA 2R7AA 4G5RA 1MD9A 2PR2A 4OK3A 2D1YA 1D03A 4FEGA 1N2CE 4Q01A 4DV2B 3KDAA 1Z2OX 2GHIA 2PVSA 2CXQA 1J99A 2PEYA 4ZV4A 2RCNA 1NW8A 2C95A 3E7XA 3OIUA 1N3BA 5HZBA 2QAJA 2QUHA 4BZQA 4K6CA 3ADBA 2CY0A 2Q1XA 1B6GA 3WMWA 4MYSA 4NDZA 1QVWA 3JCZA 3KG2A 4L08A 1T2VA 3V4VB 1U1FA 4B82A 1NWHA 1JDTA 3A4TA 4EUHA 3I64A 3N58A 3O31A 3EMKA 5IZCC 1VE5A 2FXVA 1MOZA 4OQZA 4UDNA 4AWXA 1EUZA 1J8QA 1JKJB 4M0LA 1U0SY 2XMPA 1PNOA<