3VO2A

Crystal structure of zea mays leaf ferredoxin-nadp+ reductase iii
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
296
Chain Sequence
TSKKQDEGLVTNKYKPKEPYVGRCLSNTRITGDDAPGETWHMVFSTEGEIPYREGQSIGIIADGEDKNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNDQGEIVKGVCSNFLCDLKPGADVKITGPVGKEMLMPKDPNATVIMLATGTGIAPFRSFLWKMFLEEHEDYKFSGLAWLFLGVPTSDSLLYKEELEKMKEMAPDNFRLDFAVSREQTNAAGEKMYIQTRMAEYREELWELLKKDNTYVYMCGLKGMEKGIDDIMLNLAAKDGIDWMQYKKQLKKGEQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-terminal structure of maize ferredoxin:NADP+ reductase determines recruitment into different thylakoid membrane complexes
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
total genus 99
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3vo2A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3vo2A02
2B5OA 3AGQA 3FJOA 4HE6A 4ACAA 4YAOA 1AIPA 1QVFB 3QFSA 1JNYA 2YWHA 2EFGA 4AF7A 3W2EA 4YAWA 1FRQA 3WNBA 2CNDA 1OB5A 4PC1A 3VNUA 1KK0A 1DDIA 2RC6A 5TY0A 1KD1D 4LC0A 4F7DA 1W34A 1KK2A 1ZM2A 4TMWA 1CQXA 4R71A 3OZWA 1H42A 1QFYA 3AGPA 4H9GA 1CNEA 3ZZ0A 3QE2A 4ZGNB 1GAWA 3QFRA 5FA6A 3U6KA 3CCSB 4TMXA 3AVXA 4U9UA 3CC4B 3CB4A 1BX1A 3ZBTA 2EIXA 2DERA 2C77A 2RC5A 2X3UA 1K9MD 3QFCA 2OTLB 4LBVA 4MYTA 5HXBA 2VNHA 1M90D 1ZM9A 3VMFA 2DEUA 4FK8A 1QVGB 3W2IA 1HA3A 3WXMA 1QX4A 1M1KD 1R5BA 1FNCA 1H85A 2B7BA 2BN4A 4Y7CA 1EP3B 4IW3B 1VQ7B 3OJWA 1VQLB 3E20A 4YAFA 4PC3A 1VQ6B 3AVUA 1YJWB 4G5GA 4PC7A 3B78A 4HE5A 3B82A 1CNFA 1G7RA 1SKQA 1VQNB 1GR1A 4EH1A 2CRVA 1DG1G 2DY1A 4LBZA 1YI2B 4M4SA 1OB2A 3QSYA 3W2HA 2DETA 4DQLA 2VNKA 3I55B 3MHPA 3QFTA 1KK3A 5AN9A 5THXA 4AF6A 1Q7YD 3WBJA 1A8PA 4RD0A 3CCRB 3OZVA 1DDGA 1N8RD 1EFTA 1YHQB 2YWEA 2BVNA 1DARA 1KTVA 4Q7JB 1YJ9B 2QN6A 2OK8A 1YITB 3CD6B 1VQ5B 5DSZA 3CCLB 4N3NA 2YWGA 2DCUA 2J7KA 4WQMA 1GAQA 2AHOA 2VNJA 3CCVB 1IJFA 5TR9A 3CXCB 3G71B 1YIJB 3OJXA 4LBYA 4MYUA 3VO1A 1QGZA 1VQ8B 1WDTA 4M0LA 2ZITA 2OTJB 4ZV4A 5H5JA 1EXMA 1QUEA 2GQFA 4RD2A 3ZZUA 3AVWA 3W5VA 5KSWB 1NJID 2D74A 2QDXA 4NCNA 1VQPB 1W2BB 1J9ZA 4P6VF 3ZBUA 4RJLA 4ZCIA 3W5UA 1QGYA 4RD1A 3LVBA 1JA0A 2FX3A 4B43A 1ELOA 2NPFA 3W2GA 1D2EA 3WY9A 3JQRA 1EWYA 4TN1A 3G4SB 1N0VC 4AC9A 1E64A 4PC6A 1W35A 2HCJB 1QUFA 4ACBA 5GV8A 1NDHA 3CRZA 4FN5A 3JQPA 3CCUB 2VYQA 4ZCMA 3CCJB 4RD6A 2BM0A 1QG0A 1EFUA 3OZUA 4P3YA 4DQKA 2XEXA 1B2RA 1I7PA 3J81k 1SM4A 3VO2A 3CC7B 2BSAA 4QHYA 2E1RA 4M1KA 1R5NA 2PIAA 1GJRA 1Q81D 4YAUA 3FPKA 1F60A 3MMPA 1JB9A 1OGJA 1FNMA 1VQ4B 4UAJA 1OGIA 1QH0A 2VZLA 1XE1A 1KK1A 3I56B 3WNCA 3U6BA 4RCZA 1D1NA 2BGIA 1Q86D 1ZM3A 4M2LA 3WYAA 1K73D 5JBQA 1TLLA 3CMAB 1ZUNB 4RCYA 3I1FA 1BQEA 1FNBA 4YALA 2BV3A 4C0SA 1JJ2B 3AVVA 1FDRA 4B48A 1KQSB 3CCEB 1U2RA 4ZGQB 3G6EB 1XB2A 1FRNA 1QGAA 4RD4A 3P27A 4J0QA 1N0UA 2BMWA 4G1BA 2BPOA 3ZZTA 1YJNB 4C43A 3CMEB 5TV2A 2PLFA 3CPWB 4G1VA 1G7TA 1VQKB 1KJZA 4NBSA 4Y9RA 3V76A 1UMKA 2GPJA 2VNIA 1KC8D 4TMTA 1K8AD 1IJEA 1EP2B 4RD3A 3B8HA 2C78A 3LO8A 3CC2B 3W5HA 3PENA 2QEXB 1BX0A 2HMAA 5GV7A 2QTLA 1D8TA 4FWTA 3ES9A 3CCQB 5H59A 1TTTA 1IB0A 2YWFA 1R5OA 3AVYA 1S0UA 4BPRA 2QTZA 1KRHA 4TMZA 3WBKA 4K1XA 3SJZA 3ZC3A 2BF4A 2QMUA 4N3GA 3LRXA 3VNVA 1BJKA 4B47A 1GVHA 1F20A 2HDNB 3CCMB 3CW2A 3W2FA 3U2QA 3WNDA 1QFJA 3P26A 4LBWA 1EP1B 1B23P 3JQQA 1AMOA 1FNDA 2BGJA 4B4DA 2BM1A 2B7CA 4QFMA 1Q82D 1GO2A 5EMNA 1G7CA 3LYUA 2XNJA 1VQOB 2PMDA 4ZCLA 4PGOA 1ZM4A 1W87A 4PC2A 4B3XA 4Y9UA 1VQ9B 3MCAA 1S72B 1E63A 1VQMB 1TUIA 1TVCA 3AVTA 2R6HA 4TMVA 4M53A 1E62A 4YHBA 2OK7A 3OW2B 3E1YE 1EFCA 4B44A 1QFZA 1G7SA 2XNCA 2QA4B 3A1FA 1JA1A
chains in the Genus database with same CATH superfamily
6ABPA 4QOSA 4TV8F 3E3NA 1N8SA 3A7DA 4RQUA 4R0VA 1F2UB 5TS3A 4F04A 4RORA 4HFJA 4PM4A 4N0MA 3H2YA 3QFSA 4YQFA 1LX6A 2V5VA 1OFTA 3PHHA 2DPLA 4ALJA 3L6CA 5F52A 1XXHE 2NYRA 5K3EA 3B2EA 3G0CA 4GH5A 1A9YA 2JFGA 5FUWA 2D3TA 3QX9A 4LJLA 5H16A 5F76A 1EFLA 5ILGA 3WP1B 5JVDA 1QYXA 3C3CA 2PUAA 3WP0A 1YIDA 5AW2A 3VNUA 4N76A 1JJVA 3FVVA 3C2QA 3R3SA 4R9SA 3BSWA 2RC6A 3SJPA 3D6TB 3KIPA 4IY1A 4ZV9A 1NN5A 5DNCA 5D01A 3A9CA 4JLAA 4LSMA 3A1PA 2ZIVB 3AZQA 3NFRA 3RVPA 2Q62A 3RIXA 3I3OA 1YDEA 1VI5A 5KPJA 3GMTA 4X8HA 2NPOA 2O2IA 3HL0A 3L3BA 4NLLA 5ENDA 5K0NA 5J58A 4R81A 4X7PA 2EJVA 3ZWWA 5IT5A 4GPZA 1YCHA 1YGYA 2PKQP 1N2XA 4M8NE 4YP0A 3K2IA 4JC5A 1RYDA 1LPAB 4WUVA 2P62A 3AR5A 2QLJA 4QJ4A 1R27A 1A77A 3TE6A 4XN0A 3ZWMA 3AFMA 4KBGA 2WYOA 4XQ9A 5BNFA 5CFPA 3OESA 5EJ5A 1W5AA 2IW3A 1ORIA 2WWTA 2Q9BA 3RI3A 1AC5A 3O8OB 4B0OA 1H3EA 3V7UA 4L85A 4ZZ3A 4N18A 5BYBA 2XQGA 2D0OB 3RYIA 1N5IA 4ZEOA 2IXGA 2IYYA 1V3TA 1ZM7A 2YMLA 2GF2A 3I1IA 4PCVA 5IH3A 3T5MA 1WW8A 1Z2EA 4B75A 1SQSA 1WRBA 1W6RA 5J4KA 1N9ZA 3UOAB 3BF8A 4HIZA 3IO5A 2JAPA 4Z0PA 3WDLA 5KNDD 3L7DA 3WQBA 1A69A 4ER5A 2PDAA 1NXXA 1LEHA 2V5UA 4P5DA 3NH9A 3RU9A 1V1JA 4P7GA 2N0SA 1HYBA 1F2VA 4K6GA 2WZQA 2PWBA 1GARA 2J3LA 3W2IA 3PP8A 4RSGA 2Q07A 2OUKA 3GBPA 2NTJA 3FKQA 2OBBA 1MW9X 4TYQA 4ZD6A 2H17A 4ZO8A 1YBFA 1Z8HA 4X8IA 1U28C 1I4DD 2HF2A 2VPTA 2W6JD 2JBAB 6NULA 2C0CA 4NYIQ 2O2HA 4OKSA 3SGLA 1IN4A 4GLJA 1OWLA 4NZMA 1A8UA 5KVVA 3EZ7A 3UMCA 2C8VA 1CZUA 1P9OA 2I33A 2GHRA 4CCWA 2ZE8A 4TTVA 4IICA 1MO5A 3GUCA 3PUJA 4PVDA 4MQBA 3ZBPA 4AG5A 5EE3A 4Y6GB 4FHDA 4YT2A 1QIKA 4PTYA 1U7XA 3SPXA 4CDMA 4FB5A 4KPFC 1N08A 2QZ4A 4I1OA 2FWIA 2WQ6A 5JJIA 4DYDA 2A4KA 5AKHA 4D56A 4F4FA 2Z2YA 1TYDE 1EPUA 1P0FA 1BJRE 3IS3A 4E2XA 1DUSA 1O5TA 3UUEA 5BNWA 5IWAB 2ODBA 1E3ZA 3I53A 2HZ7A 1II8B 1YJ8A 3O8OA 4P7FA 1MIOA 2VDJA 4MHTA 3TLMA 3LRTA 4I55F 1WCV1 2ZWMA 5AN9A 4YP6A 1G0OA 3ODPA 3BBPA 3OURA 4XCXA 1JW9B 1TQDA 1D7AA 4FZVA 1WSDA 3DZDA 3BS4A 3LFUA 2ZQ5A 2GX6A 2V7PA 1GPLA 1E2DA 4IOMA 1K5PA 1QIEA 3NXSA 1W4CA 5KHLB 1K8XB 3ZW9A 5BSKA 5IHPA 3OQNA 2XYPA 3ILHA 2W2XA 1ECJA 4L8VA 3WOVA 1MPTA 2PSHA 1CJMA 1BO6A 2OZEA 3I9FA 3NBZC 1KSFX 1OV6A 2J5XA 2E4ZA 4RE5A 1D6NA 3T9AA 2HXSA 4J0CA 4FQ5A 4DAOA 3I2YX 4YRMA 5IDWA 4OQXA 4G85A 3VTFA 1GCUA 2CJFA 3I30X 1HZZC 1XAGA 5CVVA 3FWHA 3S5JA 3RRZA 4H3SA 2V03A 3ZE6A 2JW5A 3MTIA 2ZUBA 4ZKDA 3HXOA 5JTUA 1U7TA 4CEIA 2TMYA 4EVQA 1UQUA 1ZH2A 5DXFA 1B3BA 2J67A 5E6SA 1QQ5A 1RYYA 2ORVA 4RENA 1UM8A 1P19A 2C2HA 2ZETA 1KOFA 2UXCB 1MF7A 3F0TA 3BXGA 3LHIA 3V8EA 1C81A 2DYKA 3P71T 4N1AA 3KQTA 4CQMD 1RP7A 4UD2A 5G3YA 1VXOA 2JIZD 3EGEA 4MV7A 2G17A 3C6ZA 1QGZA 3OP1A 1E7RA 2CVQA 2EQBA 2IHZA 3BGIA 2V31A 3GGOA 1IWOA 1NXQA 3L8EA 3OQIA 1EK0A 3P9KA 3EPJA 3BD7A 4PG6A 5DI3A 3RVKA 5FBKA 4R8LA 4Z1OA 3KEMA 2PYDA 4QYXA 3HYLA 3COWA 4E70A 3LYAA 1YFZA 5C31A 2NUTA 3IUNA 4O4JA 3KXDA 1KY2A 1W9XA 1KAHA 1XWFA 2C4NA 1N0HA 3O2NA 5BRJA 2Q0QA 3DV2A 4LS3A 2J0UB 1IIBA 4WVLA 1N3BA 1DJNA 2NXCA 3ANTA 3PD0A 4M6WB 4U6NA 4RM2A 5LQRA 1QOQB 4Z4SA 1ZMBA 2WUWE 4G89A 4YJHB 3IT1A 2RGYA 2H57A 2QA5A 1HO3A 3ICQB 3EIEA 2YKGA 4WJLA 3COZA 3GRPA 5LYJA 2XGSA 1K63A 2PX2A 2QZPA 4MXDA 4YK7A 3WWEA 4EJMA 1Z82A 5A4MS 2F8TA 1UK9A 3AXSA 1VJ0A 1I80A 4DCJA 1XC7A 2FUG6 4Z4EA 4LJ7A 4F93B 3EY9A 1GT91 5JSZA 3ZDDA 1U3CA 2BUAA 3AHGA 5HGXA 3W8NA 2FX3A 4MWBA 2G82A 4BN0A 1KAMA 1NBWB 1ZUHA 2EJBA 3HBNA 2HCFA 1Q12A 5AR1A 4AO7A 4HNQA 2ZM5A 3OCZA 2LVBA 3C70A 5IKPA 4IXMA 4ME6A 2XOXA 3QYAA 1FTNA 1JYFA 2ZPUA 2Z0MA 4OQMA 1VPLA 4U6QA 5CJPA 1GQSA 1UBJS 2AQIA 2B6HA 2I76A 3OTQA 4DANA 5JS8A 1TEVA 3AY6A 5IWCA 4P7BA 3IAM1 1NYRA 4UREA 1ZIXA 2DPXA 2OD9A 2D1SA 3S99A 3A0UA 3A3OA 2GYVA 4Q24A 1G38A 1U2DA 3IIEA 5IKXA 4PLYA 2H6EA 4NSNA 4D3ZA 2O1XA 5KHAA 4HZUA 2BKLA 4YLEA 3PV0A 4EW6A 1J8VA 2QZSA 1PFVA 5CB0A 2JCYA 2AKYA 5CDGA 4TQUS 1OLXB 5JAOA 3KPYA 2GA8A 3USZA 2O2CA 3EQ2A 3VU9B 4MR9B 3LH5A 4DSZA 2NO0A 2YMMA 1L4GA 1W9HA 3VR1A 4A0HA 1KRWA 3QFFA 4QVGA 1JNXX 3CVJA 2WABA 3EDRA 3FHLA 1ZOPA 3T4UA 3UMRA 1UXGA 3CEPB 4IVNA 4GG1A 3VO8A 3KDAA 2F17A 2IHYA 4KVZA 1K6XA 3TZBA 3K0HA 1D04A 4GP7A 2HRCA 5JPDA 4MOWA 2B0JA 3GMSA 1JEYB 2I3BA 3PNYA 4Z86A 2QRKA 1P7CA 1E9VA 3UPUA 2Z98A 4IFBA 4YMWA 3KE8A 2ERYA 1VB5A 3IUQA 4C20A 5ENZA 3G05A 2HC9A 5K09A 4EYKA 2BSAA 5KX5A 5LOVF 1P8JA 5FWDA 2XPCA 4LZLA 1T9ZA 2QENA 3GUZA 4NMMA 1W59A 1CRZA 2WM2A 3FOWA 1KNQA 1JLKA 4MDHA 5IMSA 1O9HA 1ZGBA 2W6IA 2IVFA 4QDOA 2AEMA 3AIIA 3O82A 3OW7A 1H6AA 1WVGA 2QGGA 4KXNA 5FBQB 4DNXA 4ENWA 4Q00A 1VGVA 3CNNA 3HUTA 3KKOA 3O1IC 1JEAA 1F4VA 2EHJA 1HMPA 3PXUA 1YR3A 3PDIB 4KK4A 3KLPX 4X90A 4ZOCA 1Y9AA 2P1RA 4MV9A 4A23A 4BLRA 4MIEA 9ATCA 2PBZA 3RYCB 4RIGA 4ETIA 5EZQA 4K6FA 4DVGA 1E8DA 1M7GA 2FKAA 2XOKA 3ON5A 3L6RA 5KIAA 1SKMA 3QBJA 1EX9A 4G63A 4CUZA 3JS5A 4QVIA 2JI4A 1O9GA 1QG6A 2I7VA 1M5TA 2A94A 3GLTA 4RK7A 2XI4A 4TUYF 1BG6A 5HIAA 2J45A 3I4LA 1YZTA 3OFNA 4G24A 4DMUB 2YIVX 3RRXA 4DEYA 1TMOA 2HPAA 3N6RA 3H4MA 3L2OB 3NBKA 4ER6A 5E1DA 1H05A 2E5WA 3KSUA 5CCXA 2FF7A 1R6AA 2G72A 3RKRA 3NW9A 2PQ2A 5DTMA 3ESQA 2Q3HA 2WSYB 2CVFA 2GRAA 2HSDA 3AW8A 4PSDA 5L3QA 2NMVA 2ZYGA 1XAJA 3AVVA 4MV4A 4U5XA 1ID1A 4DG9A 4LK2A 3R6JA 5CEEA 3KTAA 5JAMA 4BIIA 2HA2A 4FGJA 3AQ4A 2QG6A 3OUUA 3NETA 4J0KA 3SZUA 3TLJA 3KTOA 4J03A 3TR6A 3GN1A 1UK6A 4GHWA 5CT6A 1J8YF 5JZSA 2QTAA 4E2YA 4M7WA 1W44A 5EZYF 3PC3A 2GQ0A 3Q2IA 4WY5A 4NZPA 5TGTA 2IUEA 5BSRA 1BW9B 1RLIA 3RARA 3MLEA 1NT4A 1YCFA 3ASQA 3ROGA 5FD8A 1WW3A 3OIYA 4D02A 4J2HA 5PNTA 1N5RA 4ZQIA 3I83A 3TOCA 3NTRA 1W93A 3CHYA 4E1BA 5GTDA 2G9RA 3W1EA 3RTAA 4HLDA 3VSAA 2F1OA 3BT7A 2WJJA 4GOJA 5F7JA 3PEYA 1VGRA 2QTTA 1DS6A 2Z2ZA 4KH1A 4QYMA 4BNFA 4CQLA 2WYVA 2F55A 2Y77A 1WKBA 5EESA 5FFNA 1FCJA 1ODIA 1ZZEA 2X9GA 2E6KA 1VBFA 2LTAA 4P22A 2I7CA 3DOHA 2YJ5A 3DWFA 4UUMA 5BQFA 5CD1A 4G25A 1HE5A 1CRWG 2FW0A 3SYMA 3H94A 1BE6A 2A84A 2SBTA 3ICWA 4FEEA 2W2KA 1IONA 2VDKB 3PIDA 4PHCA 3EXHA 2WWWA 1G0NA 3IAEA 3VISA 3B8HA 3SFVA 1WHSA 1FFXA 2F8MA 3J80A 2AI1A 1VSUA 2UKDA 2DBVO 4P80A 3TQQA 3UJAA 5KS2A 3MWEB 3VV2A 2Z57A 3F74A 4Q3BA 4EGCB 3LHDA 5COQA 3FUXA 2JI8A 3PR1A 4GPD1 1EJ6A 4KSCA 4K28A 3CPJB 1TYBE 1L7DA 4TWJA 4B2IA 4NYJR 4WA8A 2FR8C 3OM1A 3RFTA 5I47A 1GP2A 3QLUA 1UXHA 3CWQA 3QU2A 1LXCA 4ZVQA 1NQWA 2Q3EA 1N9KA 4MS1A 2X8LA 4X6LA 4TKMA 5ALXA 2AUMA 1E2MA 2FFQA 4CLHA 4H7HA 4EYGA 4FT2A 1FJXA 3GOHA 1JFTA 3VPDA 4KO3S 1EUQA 4DLPA 1FP6A 5AOCA 4A2CA 3TO5A 3O83A 3RAGA 3AR3A 3QBEA 4DQVA 3A3GA 1M33A 2ZP1A 5KYYA 2VXYA 1BH2A 3KR0A 4L78A 4BQFA 5IFKA 2P0YA 1SY7A 2B7LA 1RHKA 2ZSJA 1JRLA 4Y67A 3T06B 4MS4B 3Q88A 2HMYB 1QF6A 1JZSA 2XXBA 2ATVA 4L5AA 1TMGE 3TSCA 3QUAA 1RZRD 1CLUA 1XLTA 2V96A 4ALLA 3HEMA 1U8XX 3FDXA 4L22A 4HQRA 5FULA 2CB0A 4PIMA 1BWQA 2E4YA 3K2BA 3PUXA 3QE3A 1OGYA 4PBTA 4ID9A 3REGA 2P6UA 4F72A 1ORRA 3WZMA 3TFOA 4X97A 2NG1A 3NBXX 1RAAA 4DLLA 3TLKA 3H5LA 2WT9A 4FYIA 2C3UA 4L8WB 1D6JA 3RRJA 1WXDA 2Q6VA 4WFQA 3WNQA 2Y9PB 4IIBA 1MEJA 1TKAA 5EVJA 2Y27A 2NZ2A 5EJ9A 5JDCA 3TG8A 3L05A 3D6NB 3R7SA 2PE3A 2CLHB 3DLTA 4C04A 4CM6A 4GDFA 2MT9A 1I7NA 3DMDA 1NX6A 4DB4A 3ZX4A 4X62B 4LRWA 3A1DA 4HEQA 4OMUA 3TDMA 4D92A 1NVVR 2JFPA 3GXOA 4J0GA 1UPAA 4QL3A 4DPLA 3ZHSA 2PT7A 4BX2A 1QDLB 2PZGA 3BE4A 1IZ7A 3NDPA 3DTVD 4II3A 1T8WA 4HR7A 1QO0D 4MCHA 4NTZA 3OBBA 3JRNA 2IIVA 2VP9A 2XE6A 2HF7A 1E9CA 1D6SA 2ZS7A 1GADO 3E3MA 3MJSA 3KJXA 3Q40A 2CZGA 10MHA 2JHPA 1LWNA 1B00A 2J9FA 1PJRA 4MUHA 1X7WB 2QD1A 3AH8A 1LJ8A 1Z28A 3HLKA 2XODA 3WKCA 4I1YA 5KU1A 4IINA 2QWXA 3SHWA 2H00A 1ZSVA 4UBLA 1HEYA 1MIHA 1Q0SA 3L41A 1IHPA 1KO5A 1YNOA 3D54D 3DMFA 1PWHA 1SUDA 2I54A 3KBOA 4XJSA 4X66B 4KYIB 4ZREA 4LV6A 1Z8FA 2X5OA 2C0QA 2QUZA 3WHLA 1V8OA 3A1FA 1MB0A 1C8BA 3B2NA 3ECSA 2Q99A 3R7FA 3KHUA 4XRGA 2BWJA 2WDZA 1PP4A 2XRMA 4HB0A 2OOKA 5EMMA 1UT6A 2W2TA 5JZ9A 1OC4A 4TUYA 2GCOB 4TXLA 5G40A 4OLBA 2D5IA 3WWCA 2EFGA 1MXFA 2EAUA 2QT1A 2EBUA 3ND8A 1J7KA 1QKIA 4GVLA 4L73A 3GARA 5EA2A 5HA5A 4IQ0A 1ODJA 3HFSA 3K5PA 1V8BA 4B6EA 1Y82A 2O3UA 1EXWA 3AY7A 3GLRA 3TRIA 3ZLJA 3RW9A 2NSLA 1B93A 3NOVA 3R0JA 4KWHA 1AVTA 4QBKA 3CLUC 4WSOA 1V35A 5KAPA 3X3HA 3I09A 5DYWA 3BRWA 4F85A 1Y4ZA 4C29A 4BUZA 4GRIA 4PO9A 1PJ2A 5BN4B 4OBBA 2D0PB 4A03A 1W34A 4EPTA 2B2CA 4QUGA 3HKEB 4EJFA 1FDOA 2OAP1 1RTKA 1X1DA 2J9YB 4DCGA 3K6SA 2Z2KA 1U3VA 3DZHA 4XLZA 5K3OA 2PS0A 3RSFA 3EAFA 2A4MA 3CPXA 4YCNA 3FCYA 5KUTA 4LJAA 5CT9A 4BNHA 1XQWA 2GFQA 1MB9A 3WMRA 2H7XA 4K6CA 4BAZA 5BWCA 1H42A 1HYGA 1BS2A 2B4TO 1H3FA 2O2JA 2ODEA 2YRWA 5HSGA 2FDCA 1ZD9A 1X8LA 1GG2A 4MUJA 4UC0A 1NAIA 1AZWA 1T4CA 4H9GA 3AI7A 5MFPA 1VIVA 5HMLA 4K9RA 3KU1A 1R7RA 3H5AA 4HDQB 5KYTA 5J1SB 5AM5A 1ZJJA 3SC4A 2WF8A 1DT5A 4CW7A 2JFHA 3LM8A 1ZRMA 4JL8A 3MT7A 2O19A 3TXAA 4BNDB 3KWMA 4I55A 1IN8A 3CSDA 1TMYA 1F0KA 3WK7A 2IYRA 4DBZA 5TF4A 2DH5A 1RJFA 4FLFA 2JJMA 3HL4A 2CV1A 1TVEA 2AXNA 2X3UA 2G3YA 4MPTA 4BX8A 4QRIA 3M5WA 3QPDA 5TQ2A 1IH8A 3D6JA 4YRGA 4HZGA 5JH7F 3K4PA 1LRJA 2P91A 2PWYA 2QI9C 2X9QA 3LP8A 3TW6A 4ZVRA 4UUAA 2RI0A 3ZGVA 3V8BA 5FPKA 2WM3A 5T8KC 2C8KA 2C07A 2I22A 3TSZA 4PX2A 1WCIB 3T5TA 3MOSA 2IT1A 3HUFA 2ZRAA 3ZVRA 4ZPJA 1MU0A 2DQSA 3QFHA 3QU5A 5BVHA 1S01A 1Q95A 3IYLW 4LRSB 2PR7A 5AICA 2YJ3A 5IDYA 2ERXA 1EP3B 1EDBA 1KY4A 2X2FA 3WRYA 5B4VA 5JY1A 4B76A 5B5SA 1YC2A 4P2BA 3JQAB 4CPDA 4PYLA 1RC0A 2JCGA 3AT1A 2AFIA 3LQ4A 4JC0A 1R15A 2RKOA 4AQDA 1XZQA 3OQIB 3QEBZ 3FWNA 4A16A 2IDMA 4IH1A 4DSOA 1EDDA 1N0IA 1NZJA 3F6SA 2C4KA 4NZZA 4Q6BA 4Y2QA 5TJHA 3N75A 2HLDD 1PLKA 1Z26A 1SKQA 1DELA 3RSLA 4U7GA 4ZMSA 5IZCC 4WK2B 4XUGB 4N7JA 1NNI1 4CR7A 1SKYB 1U1DA 4O59O 2ZRPA 1Z6GA 4Q4CA 2DY1A 3CMCO 4L4XA 4WCFC 4LNUA 2C2BA 4PO3X 3KLOA 3HB0A 1YDMA 4PQFA 1AMNA 3QSYA 1GGMA 1X2BA 2IGTA 2XQKA 3FOBA 1I7SB 2CMKA 3LP6A 3THSA 1IJKA 1Q7RA 1YBHA 3RREA 3WGKA 3LC1O 4IDDA 3KLBA 4K9QA 3OUTA 1M2FA 4G09A 1RE0A 3QEMA 4ILKA 1KI8A 5ESWA 1PGJA 1PS0A 2ZJYA 5C4MA 2I3GA 4KEAA 3KXIA 2WVAA 4GWGA 1U1EA 2BFCA 3NIDB 5ARDA 1NMYA 1CX9B 4RE6A 1G20A 5FQOA 2WPDA 1IEXA 4OXRA 4C0WA 5JLJA 4MIOA 1Q50A 2C7OA 3OKCA 3IP3A 3P1JA 1DDGA 2X76A 3IV6A 4LTMA 1X7GA 1Q3TA 1YVRA 3O26A 1DFGA 4OU5A 1B73A 1X1RA 2V59A 1Q14A 2FRDC 1XZAA 2OSVA 2YHAA 4CDNA 5I9NA 3ZJTA 4KPYA 1R74A 2WSSD 3CW8X 4WTOA 2G5GX 3WRYC 3F6PA 2W4MA 4FEGA 4J0IA 4QZVA 4F8EA 3ROXA 2OY0A 2X1LA 4WLEA 5JAZA 2ZZQA 3KZCA 3OZEA 2A0WA 1RW4A 4J0EA 3RKUA 4URVR 2AYYA 4QVKA 1T2UA 1G2PA 3MPOA 4ENUA 2BKVA 4EO9A 1K8QA 2O8NA 2HAEA 3C3KA 1NP7A 5JD6A 4MRAA 4H7KA 3HB5X 2ILTA 2YIDA 2EZUA 3TOXA 1YIJB 3AR7A 3S28A 3P9QA 4PYMA 2V7QA 2WEKA 4ILEA 4LYJA 2VSQA 1T9BA 3JX9A 4GEKA 2JG3A 3TQFA 2D7DA 1H66A 2Q5FA 1HDIA 1VFNA 1VB3A 4JLOA 2A3NA 2JEZA 1WDTA 3MYYA 3QQPA 1UFQA 1G18A 1WCXA 1URPA 3NNNA 4XOIA 1WUHS 2HBYA 5H9VA 4RFLA 4AROA 5G53C 2WRZA 1RQ2A 5SZIA 3LL7A 4UHKA 1SAYA 4LJSA 1DADA 4BQPA 5DTEA 7REQA 4Q9IA 3G1TA 4RABA 4RKQA 5B1EA 1D3AA 3T95A 3S3TA 2E0IA 2LKDA 3L4JA 1VMKA 3ZPXA 1K7SN 5LP6A 4AP5A 3PQFA 3VO9A 1DXYA 1DV1A 1L3CA 1RQ7A 2Y1WA 4W99A 1QS0B 2FZGA 1MG0A 1XNHA 1XR3A 3E8MA 2OCKA 3VX4A 4CFZA 3GLGB 5CAEA 2C83A 2BFMA 3E84A 4EG4A 1QP4A 1O8BA 3PYMA 2A57A 4V0ME 2YTZA 2ZBEA 3JQGA 2B8TA 3LWZA 1RI3A 5AIAA 5L7TA 1FQJA 5CLFA 2HK6A 4G0PA 4P2GA 2G83A 4YJ2F 4LGYA 1NSYA 4PN3A 4MVJA 3PCRB 5HG0A 4EX7A 4A2QA 3FOFC 1RBYA 4FKZA 5EJMA 1DQSA 1XTUA 5LA6B 5HXAA 3RYCA 1JH9A 1YOVA 3B7GA 4HRAA 4BKPA 1GPBA 2R5NA 3L8YA 3EBPA 2DQKA 2QMEA 5DM0A 3NV7A 1KEKA 4US1R 2V58A 3DPUA 4GP6A 3F8WA 4I4NA 4Q4HB 4BBJA 2H5EA 5IBQA 4J1TC 1JHZA 3ONFA 4K9SA 3VZSA 3UMMA 2VJKA 3S2ZA 3FDZB 1YVPA 4TN1A 5FADA 2OO7A 1PTJA 1TIBA 1TQ4A 3T94A 3O73A 2XCQA 4KRXA 5LMNB 5C7LO 3HFGA 3DVQX 4I50B 2HL6A 4PX9A 9ABPA 5AVSA 1SOUA 3ZK9A 4JJKA 1IBLB 4EAAA 3OPYB 2HSWA 3PQDA 1E4OA 3FFTA 1K8ZB 5IAKA 4CDRA 1EE1A 1NVXQ 4GQNA 1YB2A 4DK1A 4FGUA 4IOKA 4PG8A 1K27A 3JQPA 2AG8A 2QXTA 3E9QA 1LQTA 3G2QA 3HCWA 1KEVA 1KC1A 5B3KA 4M0UA 2YMPA 4FM9A 3RWOA 1BVUA 1CV2A 1YR2A 4IHKA 1PQWA 5F1KA 5LZ5A 2AW3A 4UQOA 4R2JA 4GR9A 2BR4A 4MAAA 5EHGA 2P9EA 1YE5A 1YAJA 2RGWA 3BWDD 5ERGB 3FKJA 5F1OA 3U1TA 1MQ9A 4F9TA 4F5EA 2D59A 5CVJA 2QY6A 5JBIA 2XE7A 4XVUA 2E2WA 5C8DA 1ZW1A 1DC8A 1U6JA 1EB8A 1UFKA 5EIFA 4N8SA 2F3PA 2ZIUB 1P7VA 1SBNE 3KZMA 5EUBA 5IZ4A 1A7UA 1T5BA 1TRHA 2JZNA 3I39X 2CNOA 4OP7A 3N2GA 3K8ZA 4WCFA 1KH2A 1XZBA 2FPXA 5AI9A 1XVAA 2FU5C 3TWOA 2WKRA 1YUBA 2E18A 1R5NA 4I8IA 4GPBA 4R7GA 5FI0B 5HIJA 4YAUA 1D0SA 2GO1A 2PGOA 4I4CA 2H1IA 2YV5A 3EZ6A 3IA2A 4TVOA 2NU7A 1USKA 4GZ6A 1SELA 3EVCA 5DMXA 5GY7A 1U81A 3WGVA 5A2QA 3PG5A 3GEIA 5CB4A 1MABB 1OGIA 1XMSA 1B42A 1J09A 2W2LD 4KXWA 4NV1A 5AYVA 4KFTA 1XEXA 1ST3A 4FZ3A 2VTEA 1ONSA 1QJ4A 2E4VA 4Q03A 4I4TF 1UWLA 1YZQA 5BO5A 4DLYA 3LVRE 4E5YA 1C9MA 5H4GA 3CX8A 4INJA 1H2WA 3C48A 4CFYA 3VR4H 1ZESA 4TKOB 3CX7A 2ZRMA 3P4UA 4GSYA 4PN7A 1DOHA 1PS9A 2EKZA 3INGA 4PAOA 5B64A 5HCNA 4ALKA 3O4FA 4I4IA 3KPVA 3PFHA 1SIBE 2HPZA 2PZLA 1FF9A 2AOUA 1TLLA 2BCJQ 3BA1A 1Z33A 3FETA 3MSCA 4H60A 13PKA 1MO4A 5FR1A 4BNZA 3ETLA 3CZRA 5A3SA 3ROKA 3VOAA 1PR2A 1I1HA 1XALA 2Y1KA 3IHTA 3VZPA 1ACJA 4HYTA 4YO7A 1V2GA 3TKAA 5L3ZA 5BW8A 1WZNA 4E4YA 3I8XA 2J6HA 2GEUA 4MW0A 3SYNA 3WGQA 1XL0A 5ADVA 5LMCA 2VTDA 3K9QO 3QVGA 2WJYA 1U1GA 4O4JB 3K92A 3SVLA 1WWKA 1QKKA 3O94A 5A62A 4OX9B 2OCAA 3K9LA 4BQIA 1N0UA 4MPDA 2V45A 1H0HA 1MJHA 1VYHA 2B4RO 3IQZA 2IYZA 4FQ8A 5A6VA 1SOAA 3KD2A 4P4NA 1NF8A 1CYEA 1DCMA 4Q9HA 3LT0A 3QYPA 4TKZA 3TZCA 1SXGA 1KC3A 3OEWA 1AQJA 4K3UA 5DSXA 1J97A 5GINE 4KR6A 5M3BA 4DLWA 1OXKB 4GIBA 3MW8A 4K5QA 1BOOA 1S4MA 1BVRA 1VLZA 2P2SA 3IXMA 4QUBA 2NV0A 4JUFA 3TD9A 5GZ3A 1QP7A 2CFRA 3MGAA 4E3WA 1KVQA 3M9WA 3U61B 9MHTA 3OQVA 2GK4A 4FUQA 1PUJA 2ODWA 5DIZA 5GONB 4ZEXA 3DL4A 3WKEA 3E9CA 2AOWA 4ZYXA 1E2BA 4HEJA 4LJYA 4OCZA 2XZPA 2Q8NA 3B52X 4JBIA 1ZQ1A 2VJCA 1ZGZA 4AO6A 4EY8A 1H94A 4AJJA 5JNVA 1WCYA 3QE9Y 1UMKA 2FH5B 4R2KA 2PN1A 3A2LA 2C7QA 2JIRA 2JFQA 3BFVA 4OMFG 1NJSA 5T8KA 1AKTA 3SSAA 3LP5A 3W5JA 3W9SA 4JJIA 2J4CA 2IDJA 3FZNA 3VR5A 3W7AA 3KJEA 5ARBA 3BPSA 3QVKA 1R8QA 4OYRA 4X60A 5BSFA 2GXSA 1XO1A 1WM1A 1XTPA 2PLRA 1BDBA 4OQ4A 4WXPA 3IOYA 4YCDA 3VC3A 1ESCA 2F1KA 5T3YA 4YRSA 3UJNA 3T3NA 5KTSA 4FWTA 2GVNA 1OBVA 1KR5A 2BR3A 3M6WA 1NJGA 3HKDB 3KO8A 3UK7A 3G0BA 2DWCA 5DBEX 3MZ0A 2EBWA 1QOPB 3SZRA 3QXJA 4P4LA 3A6FA 2PXHA 3IRUA 1BHO1 1S0UA 4ZO4A 5HDQA 1ANKA 4TMZA 2XXAA 2O4UX 5DWVA 2HTFA 3R24A 4OHPA 4WINA 2WU1A 4YONB 1A2QA 1VLHA 4EOGA 4ZHQB 1FDVA 1F8XA 1O94A 1NOKA 1JKFA 1N3LA 2Y4OA 3EPRA 3L0OA 2XCLA 4ZA2A 5I7RA 3PHCA 5TGZA 1YDHA 3LBAA 2XB6A 4AZWA 2L18A 1FEZA 1JPUA 1XD2A 1GGVA 1E3XA 1TD1A 3HSSA 3ASSA 1LI5A 3K5IA 5KAMA 5M2QA 1W0KD 3DZFA 1HLDA 5J43A 1FSPA 4J7XA 2UUBB 5AKYA 1DQNA 1KYYA 4I1SA 3WZ2A 4F1JA 1M6HA 5I7SA 3T7TA 5JARA 3NIWA 3RROA 1X1QA 2XRFA 4CLOA 4RO0A 5DCYA 3E03A 3T4PA 2R2AA 1I4TD 4TLDA 4B9EA 4RYDA 1Y3DE 1V8FA 4LBWA 1JAIA 1EP1B 1N5DA 3NBYC 1I3NA 2HY7A 4TV9F 4ERNA 4BP8A 2PUHA 1XQYA 3P97A 4EABA 4Z1MD 1Q82D 1M10A 1LCIA 4Q4AB 4YB8A 2CLKB 1GO2A 1ZRNA 2E49A 2VBCA 3FNBA 3NJRA 1OILA 5DXAA 3R6DA 4DNQA 2FSUA 3LW8A 3TUIC 3KHTA 2GPNA 2IOYA 1HT1E 2V98A 3KUDA 2D9RA 5DNDA 5K0EA 3ZWKA 4OHYA 2H4WA 1U4OA 2BC9A 3UXEA 1V45E 2HIAA 1OKKD 4CBVA 5F7OA 2PD3A 4ZI7A 3IILA 4N9QA 1JEEA 4ZJYA 5L6MB 4AMVA 1ZM4A 1KDYA 1HC7A 1X42A 2WFZA 3GP5A 1B8PA 4XQCA 1QFXA 2RSLA 1RM0A 2R8EA 3FJYA 5CM8B 1OWOA 5JALA 3QUBA 1NN0A 4W82A 1MVOA 5AQ1A 1L5NA 2EYUA 1CYDA 3CNHA 4N5NA 4JEMA 1VQMB 4O5AA 3L7AA 4A8JA 1SXQA 2RGBA 4WHMA 1YAHA 2D13A 5DULA 5CNMA 2WF6A 1QIFA 3AEYA 1XLWA 3SIRA 1KVTA 4M53A 4ZHSA 4Z9YA 3C3PA 1ZIDA 3MCUA 4Q39A 4R1PA 1NX9A 4O02B 4PXYA 5JTTA 5CM2Z 3ZQJA 4ZVOA 1ILEA 4PZDA 2PZBA 4IGAA 1BDJA 1BN6A 2CVZA 3IJ5A 4KWCA 3S40A 1QTIA 4BQQA 4PONA 4XCVA 3OHSX 5IYZF 3V3KA 3TLGB 5C53B 2ZE7A 5C34B 2PUEA 4OQLA 3LBFA 2CEAA 2L42A 3DO6A 3B3GA 5JD4A 4E2WA 2ZU6A 3B12A 3RYHA 4DF3A 1RZRA 1DLIA 2YXBA 2ZUUA 1FFAA 2O3JA 3D43A 3EVZA 4YJFB 3BF7A 3V8PA 4CLOB 2XMGA 4D81A 2VATA 1C8VB 2IPAB 3E82A 1DRWA 3IAAA 4BMYA 1LVUA 5JQGF 3E9DA 3KSDO 3DOJA 1J0DA 2RGCA 1XVVA 2P5TB 2YFHA 4FFWA 3ZXIA 1BFUA 5E3HA 4TZ6A 2MHCA 4Y7DA 4YXWD 3O1JC 4M1YA 1N4AA 1VL5A 3T15A 4MVJM 1FRQA 2O2GA 1T8UA 4QA9A 1WEHA 3SJCA 3BK7A 1DXHA 2DFPA 1C41A 3EISA 4DCMA 4J94A 2LE0A 2GMWA 4MUFA 3ZQUA 2ZBFA 4D74A 3COSA 2DPMA 3LDAA 4LZNA 2FFBA 4HLNA 1NM5A 2AR9A 3HCFA 1XRNA 3ENKA 4Q02A 4C7XA 2FOIA 2JGAA 4UTRA 4L74A 3W0LB 4JI5B 4CKEA 5KNBH 4FSHA 3M34A 5DZSA 2WJHA 5K6RA 1EK5A 5LZ2A 1CRPA 4TMWA 1CVIA 1O57A 3K09C 2CBXA 4QUHA 3O91A 1XFOA 4GM4A 4WLOA 2ACWA 3UM9A 1V0JA 1CUDA 1KHHA 3C15C 4CG2A 1WL8A 5E6TA 4ZAGA 5LPNA 1H69A 1T8TA 2WD7B 4K26A 4Q9AA 4LWOA 3ZJ4A 5JYEA 1NUQA 3ZTTA 4MKHA 3UOWA 4BMZA 5ALLA 5I48A 4EI2A 2ZJZA 1CNEA 1RZUA 4TWIA 3JWJA 3MMNA 1OTYA 2AL7A 4P8RA 4B87A 2QUIA 2DM6A 1IC6A 1GAWA 1GQ2A 2W2PA 1NN3A 1JDUA 5EMLA 1H8ED 2PMKA 5FL7D 5GADl 1S3FA 2BSXA 1P4SA 2YW2A 1M8KA 1FK8A 1T6BY 1TFRA 1E1KA 2WF5A 1L5HA 4RTRA 3BRQA 1TA0A 1HRKA 2JGJA 3T7SA 3ROZA 3UWDA 3B8EA 3DD1A 1FSSA 4JHLA 2J3MA 3QV1A 4YEDA 2ZRFA 1TUBA 3MJ4A 4XM0A 4OP1A 3WGYA 4DBLC 4DIMA 4LZWA 4EO4A 5FYDA 3WHPA 2ZXHA 1FYFA 4UMVA 1O6CA 3T9DA 3AHHA 3HDGA 4JI1B 1JG2A 4RK4A 1UT5A 2OQ2A 3ABRB 2IP1A 2JH3A 1J7JA 4HPWA 5AM4A 4CIDA 4ENQA 5JFOA 1Q7BA 1LNSA 4DN6A 1QVGB 2ORIA 3G0OA 5JNWA 4W8OA 5DB4A 3KNZA 4L6AA 3I2KA 2WE8A 2QTRA 4JDUA 2ID7A 3B1FA 1JIKA 4HTFA 3E9EA 2KLHA 3FUCA 4FIDA 3RAEC 3CUVA 1PR6A 4XQGA 1GGNA 2ZUSA 1W4AA 1YNSA 3AVUA 4OYHA 4DOMA 3FZYA 1ODTC 5HTKA 2BY4A 3I64A 2H4JA 5ALPA 5F98A 2VDOB 4WRRA 1E9AA 4TTAA 3Q7PA 4C22A 3L0CA 2CW5A 3N2KB 4XR4A 5SY6A 3PEWA 2WP8J 1G7RA 5DTIA 4O4JF 4MQLA 5LUAA 3FAKA 3DBRB 2I1VB 3COPA 1W96A 1MGPA 4D0GA 2VDUE 4C06A 4LBZA 4GKBA 2VI5A 4YEJA 5L95A 2X3FA 3WGHA 3PT5A 4KKSA 3ISVA 4GOLD 1CY8A 2RGRA 3B3FA 3OKXA 1XJ5A 3V8QA 4Y6LA 1MOZA 4MUBA 2DETA 1E4YA 4DQLA 1QLJA 3OZSA 3BULA 3D7MA 3T3MB 4EHFA 2B25A 2COUA 2QVGA 4H7JA 3ZZMA 8AT1A 2JAOA 2HW8A 2CHQA 5EJGA 3GRRA 3F3YA 1WG8A 2JEOA 4K0KB 4WW0A 2W98A 3ACDA 3FB4A 1A8HA 3ROMA 4DEVA 1ADGA 3VYWA 5A0FA 1CUFA 2WOJA 3JQ6A 4IMJB 3SC3A 4DIDA 2QNBA 1FMJA 2F1HA 4PZEA 5DBHX 3I01M 3P4YA 4BKMA 5E9AA 3UPDA 4Q4HA 1G291 1CUEA 3D8BA 4QULA 1O89A 4AECA 4AY2A 2YVQA 3KB8A 1S9HA 4FGLA 1TKRA 2VXCA 4N3BA 3C8DA 4RV9A 1U2TA 5F21A 5C8YA 1Y1PA 3RLFA 5HIKA 2DPHA 5JXHA 1BDIA 3FHTA 4Q7JB 2EGHA 2BFAA 3FYTA 3L4BA 3OFVA 1Z39A 1GPDG 1GZSA 1Z35A 2P9ZA 2QAGA 2FWMX 4KPUB 5DTJA 4O8ZA 2W48A 4LN1A 3ML1A 4MI3A 2PZJA 3WK9A 1UBLS 2JGDB 4N3NA 1R4NB 4OI0A 1Z5PA 5TSDA 1RWMA 2ZVPX 4NQRA 5FF9A 2BCGY 2PX4A 4YPFA 1AJEA 4WQMA 1U3TA 3QA9A 3ZDCA 4CCSA 4TV9A 3IIKA 3Q7TA 2H4HA 4A1OA 3G71B 2NU6A 2WWGA 1PJ7A 3AX6A 2AYXA 2WDPA 3NPAA 2RARA 3AO0B 3IP1A 3KLNA 1YUNA 2DR0A 1Y1LA 3K31A 1K6JA 1FFHA 2GN2A 1Q21A 2YQZA 4BGVA 4M0LA 4Q3EA 4CM5A 2WJZB 3BD9A 1Y7LA 2AQHA 1MA3A 3ABIA 3FNEA 2OTJB 4ZVLA 1BEUB 4LI0A 2EP7A 4XR6A 3H1BA 1XTKA 4TT8A 3FLAA 4CR6A 2FEXA 4CT5A 4GLFA 4CM4A 5IJ0A 3RRBA 1GZVA 3ZWYA 1RFGE 4A1FA 7REQB 3R40A 1MDBA 1R16A 4J4BA 4Y6RA 1MB3A 1DP4A 2BFPA 2WK1A 4V0MA 1GL7A 4N39A 2XY4A 3TZQA 4JC4A 2ZAMA 3JD1A 4JP8A 3B1YA 4TTSA 5KNCH 1QK5A 1YSCA 3IIIA 2X9VA 1GKLA 2XBMA 5ALQA 1M1XB 2XMPA 3NHUA 4BWGA 5HUJA 1US8B 2OYCA 4NCNA 2GM9A 1BDMA 1GNPA 3TIGA 2XWBF 5I9BA 2CD7A 2R00A 2VUIB 1P81A 2VA8A 3LX4A 4NZYA 4B7AA 1ZAYA 1BHJA 3NAGA 1ZCBA 2JLCA 3DFIA 3T52A 2XTMA 1ADCA 2CGEA 1NVKA 2HXGA 4FLMA 4BOYA 3C3JA 1IZ0A 1ELOA 2C5GA 3CF6R 3CKMA 4QDKA 3OCUA 1U63A 2X6XA 1WMBA 4OB6A 3HN2A 3UMYA 1I8DA 1JECA 2C88A 4KYTA 5J4LA 4I36A 3DF9A 2XADA 5KOJB 1QLWA 3GFVA 1HZZA 1PBTA 3PKJA 1U0TA 1F6DA 1I2ZA 3LWBA 4IJKA 1PL8A 2CMGA 3DOEA 1EE9A 3VPHA 3NTLA 3QX8A 4DLXA 1UOQA 2PO5A 1U3UA 4G0XA 1AK2A 4GYYA 1DJOA 4ITVA 4MQUA 1OIVA 1OLXA 4QBFA 4UPVA 1SUEA 5HJ7A 1WSVA 1OV4A 4AJKA 3ACCA 4R0NA 5P21A 2X2OA 1G5TA 1XD2B 1XVLA 2JLZA 4LXYA 2CNBA 1RXEA 4Z0NA 1CW2B 4LGCA 3X2SA 1FRZA 4OKIA 4ZCMA 2MSEB 4RACA 5HF9A 2ZVJA 3W4JA 2NM0A 1OZAA 3FLEA 3W7VA 1M75A 2XYQA 1EBFA 4P5PA 1XGKA 4JLVA 3AM5A 2O0LA 1QCCA 1ZCFA 2KMLA 4XM1A 3J7AC 1TCBA 5H4HA 4GE3A 4ZZ2A 4COKA 3EG9B 4DTIA 1THMA 2FR0A 1JEYA 4X91A 1VJTA 3SP1A 4CL2A 2I7TA 1V8DA 3LHSA 4IWXA 2AZDA 3ZV7A 5IULC 3LQ1A 5FTWA 2OMKA 1OHHD 3DVAA 1YC5A 2OGWA 3EFOA 2GK3A 4Y9TA 3W8RA 3NWEA 1DKUA 3G8YA 5J35A 2BJHA 3VO2A 1P80A 1DIBA 1RKUA 4HDKB 1PSZA 4LC1A 1OCEA 1SBIA 3A6GA 4AO8A 3N86A 3R6KA 3PUMA 1OAKA 4EJSA 3CO5A 5JS2A 4B6GA 4NESA 3GZNB 2CXTA 1VBNA 3DEYX 5MF6A 3MD9A 3I58A 1XZKA 1SULA 2J9FB 2QORA 3P9CA 2HBQA 2R8XA 3GCWA 2NU7B 3KSBC 1S96A 4DZRA 3C3EA 2UZIR 5B53A 1OFUX 2Z58A 2J5RA 1NFFA 2OHHA 5K3FB 2I91A 3DHYA 3BCSA 3O8QB 5JCJD 3CPSA 3OZAA 2VP0A 3ROQA 5D85A 5KOJA 2J41A 2OTCA 3FOEC 2O6HA 1DCTA 2C42A 5HWSA 1FSGA 4B85A 3G5AA 4GU5A 5G41A 3BTOA 1L5RA 2OO5A 4H59A 4MQEB 1EXVA 1BMFA 3N8HA 3RYFB 3N8NA 3Q9NA 3QJGA 3FNFA 3AUUA 3D6AA 2VAWA 3AHIA 1BS9A 4XDHA 4ZCTA 1S1MA 1OJLA 4PYOA 4TLMB 3DT9A 4EG0A 7MHTA 3IEVA 2QQ5A 3PWSA 3A1WA 2ORYA 2YV4A 4N5MA 1LQ2A 2CLIB 3H0EA 4E1VA 4CU2A 3JQEA 2OPHA 2FN9A 1RZ3A 3EF0A 1SH7A 4L5CA 5M34A 1MPXA 2PX6A 1OXUA 4HTFB 3RYHB 7MDHA 1FMFA 1P0CA 2D54A 3QKSA 1T6YA 4GLLA 1M6VA 1MG5A 1PZFA 2A9KA 2OHXA 3BXFA 1E6EA 4ARUA 1UD8A 1O4VA 4MQMA 3LXXA 2JJ1A 4RD4A 1NC3A 2HLPA 4J0QA 4BLSA 3QF4B 1K5HA 3PPIA 1ZVQA 4C05A 2FQWA 3HKEA 2FPIA 4LZJA 4MVJI 3AK4A 3C1UA 2QSZA 4UBKA 2FVXA 3BUSA 1PU2A 1U8YA 4QSHA 3USCS 1XK7A 2AN9A 2CFSA 4QYSA 2OV2A 4AJEA 4D44A 3EQ9A 4DM3A 4DYHA 3ESZA 1KJJA 4LXUA 3CPWB 1F8GA 4XEHA 3PQEA 1ZUD1 3T3IA 3U4HA 4DCTA 5BQXA 2VPIA 5I5GA 5KTOA 2XWQA 2X8JA 3WX0A 2Y4NA 4PRZA 4XD2A 5BRNA 4HPXB 3OPNA 4BMCA 2BT4A 2BEWB 4DWVA 4M99A 2VPZA 4LJRA 1RI5A 1YOVB 2OZPA 1P45A 2XTNA 1TEHA 4M6WA 1J2EA 1ZY2A 1VQKB 1JHOA 1O8CA 2YZGA 3ICVA 3LSYA 4ZT2A 3RG2A 1L1RA 5GONA 3ME5A 5EGNA 1XXHB 5GIPE 1PS8A 1CP3A 1E5DA 1YJCA 2CUNA 5IYPA 1NMEA 4KW7A 2HBRA 1EVJA 1N8KA 3EZFA 2VZ0A 4NK4A 4OUKX 5DIFA 2ENUA 3OQBA 1HYHA 4LSGA 3UHFA 1NXWA 5TQ2B 3IERA 2A67A 4LY6A 4FS3A 4CIWA 5K0ZA 1O9BA 1YDGA 1W36D 1G5QA 4DMCA 2QMQA 4U2CA 2J08A 2PXAA 1IY0A 2X15A 5E9WA 4BV3A 1EHIA 4IL5A 2FSIA 3I2GA 1NT2A 4HNHA 4M0FA 3EMVA 4XWAA 3A1EA 2IU4A 3AUYA 6AT1A 1Y5RA 3IDOA 3O9VA 1FLAA 5KEIA 2JGDA 3D6UA 3R74A 5BQ5A 4F4UA 2ZIZA 3HGMA 3RAPR 1DTEA 2Q21A 3G3EA 1XA3A 1RVV1 4EPYA 2GZSA 1T4DA 1N1MA 2JIOA 4HATA 5A4IS 4KGXA 2VHUA 4JQSA 1E2PA 2G76A 1G42A 3I52A 1Z08A 1DX9A 4P2NA 1FU7A 3VNSA 2ZVDA 3AFIA 3PDWA 3UMBA 4U9HS 5CMLA 1GVHA 1JU4A 1SHUX 2ZDHA 2B35A 1LNQA 5SY9A 3U2QA 4FNGA 2G70A 4G0MA 3NRCA 4LEIA 3WGMA 3Q8KA 3UA4A 4QXOA 4WT7A 1YXMA 4UVIA 3JQQA 4B40A 1F3OA 1FP2A 3TI9A 2ZSEA 4D9MA 4O4HF 1J0XO 5COBA 2ACEA 4XVQA 2BM1A 3G0IA 3NIGB 2XBUA 3LKVA 4YV1A 3NAZA 5C5DA 2QX9A 4G0OA 4GYJA 2PAAA 1IN1A 4JX9A 4UOQA 3WL5A 1LPNA 1S8FA 1XF1A 4DQ0A 2YOFA 4C3OB 3GT0A 4HO1X 4PANA 4Q4AA 2BFNA 5EWJB 4W6QA 5DPMA 3W78A 1VQOB 1U9IA 4PR3A 2Z8ZA 3QEMB 1LDMA 4WOCA 2OVFA 4D98A 5CXXA 4RLZA 2ONZA 2JHCA 3DZIA 4PLPA 1EESA 4YRCA 4M0KA 3GZJA 3MD0A 1VQ9B 3F1LA 4DYVA 3KPWA 1PSDA 3H97A 1TM5E 4C4ZA 1XQ9A 4DG5A 3THOA 2X4IA 1S4QA 3DV9A 2Z5FA 4PX5A 4AN1A 5WRFA 3RG8A 3T54A 3H5IA 4MEAA 4DV2B 2R6HA 3OZ7A 4PICA 3ASYA 5GJBA 1ZO8A 3S8MA 4MW6A 4EECA 1O03A 1JJAA 4TXMA 3ZR4B 3QTTA 5JO0A 4FW9A 1T9DA 1JQAA 1YS7A 3RVNA 2E6UX 4MR8B 2OBMA 1E62A 4OXYA 3TIFA 2JZCA 3MWJA 2AGVA 2J07A 2LDXA 4WWVA 2P3LA 4GOMD 4ARZA 3AW9A 3ZWXA 1RS0A 3NWJA 3Q6NA 2X8WA 4DHWA 2PZKA 3NXKA 3HU5A 4EENA 3W9UA 3CTAA 3A8TA 4WASA 3ZHBA 3LLCA 1JA1A 3UJDA 2WF7A 5EIXA 3O2QB 1ZINA 4GPTA 1XHLA 4OPSA 4WJZA 4C0HA 4C0QC 2C29D 3H83A 4UQPA 3I0ZA 4YAOA 2J46A 3LMKA 1U8TA 3VSEA 1JHXA 2JCSA 2XR1A 1FY2A 3O6VA 3A6LA 2JIQA 1AKMA 4N5IX 5FTJA 1XA0A 3NQ41 3HVJA 2IU0A 2O7VA 4C4SA 3AJRA 4DLZA 5EEGA 3H2BA 4BNWA 4KR9A 4MITA 2O1WA 2RGNC 1DO8A 2ZKLA 3Q4GA 5FJJA 3TKYA 5EP3A 5BT8A 3AL0C 1WPQA 1VHOA 4XLTA 2ZQYA 2EZ9A 3DVAB 1XNQB 2ONYA 1ZR2A 1DDIA 1MJNA 1HTBA 1II8A 1UP6A 3IOCA 3N9IA 3PD7A 4KKXB 4LG1A 1BWSA 2Y66A 5IVIA 4MARA 3DBRA 1PG5A 5J5CA 1RQNA 2H4FA 3JYLA 3N3AC 3P96A 2NOAA 1GUFA 3JV7A 1GQOA 3KQYA 3O8BA 2NXEA 3HXPA 4FP9A 4QD3A 4BVGA 3LQEA 1A5SB 5BWNA 2HSJA 4UBOA 4QPJC 3SFZA 3VFDA 4XORA 3C85A 1IBRA 5D6OA 3RJ9A 2FDRA 3PITA 1IHYA 3EAGA 3Q98A 1QF9A 2PSDA 4I1VA 4IXWA 1DBWA 4JUDX 1HY3A 3DMTC 1YJQA 3UTCA 1ISHA 3HCOA 4GBJA 4C0BA 4DR1B 1PKVA 3AGPA 1WDLA 1S2MA 2QE6A 3OOHA 3BJMA 5FWYB 4QYWA 4ALNA 2Q6TA 1XP8A 3V9PA 2O5VA 3GJ7A 4JIMA 1ADFA 4D0RA 1MX9A 3CCSB 2L19A 4WFJA 2V3WA 2Q1TA 2AYZA 3D64A 4NG5A 4YFVA 5T4FA 2A6PA 2GD0A 1RAGA 2H3EA 2OLEA 3K15A 5F33A 1G5IA 1ZK3A 5BT9A 3RYFA 3CEAA 1TT5A 2XWPA 2VYVA 5FEUA 3Q85A 5C32A 1KKUA 4FLEA 4RYLA 3M9XA 4BFYA 3U9SA 1ZISA 4UNPA 5LDHA 3TI7A 1A5TA 2J9XB 4J4TA 5FQNA 5B1HA 1YR9A 2YWXA 1JMYA 4WNAB 1DWQA 1Z34A 1EP9A 4NBLA 5FV7A 3E8XA 3KKLA 3BH7A 2X9NA 3FX2A 1P33A 3MFYA 3WK6A 4F5DA 5ER9A 5FTNA 2R7MA 3RVDA 1P18A 1T5LA 1ULTA 3ZYZA 5BVHB 1HA3A 2HT1A 3N28A 1B0UA 4S1PA 4ZOEA 4GXTA 2POCA 4M21A 3ADBA 4TUYB 4ZEVA 1Q0LA 4NV3A 4HWRA 5K03A 3K6RA 4DT1B 2NUAB 2H11A 2IS6A 4I9GA 3FIUA 3U1VA 4XWYA 2YFKA 1N5OX 1NXVA 3MERA 4L4SA 5D3KA 3WGNA 4HJRA 3B7PA 2C04A 3KKMA 4I5EA 1EHYA 4G2TA 3NAQA 3SVZA 2VDQB 1VL8A 3INYA 3JVIA 3I6QA 4OAQA 3T9EA 1W36C 3S2YA 2IY7A 4FYYA 1NLUA 4TZTA 3AM4A 4WGGA 1TAHA 2C9MA 4YPVA 2V7WA 3THXA 5JJKA 4DWJA 4P33A 3OPOA 5SYNA 4L07A 1WUIS 2IHUA 4RAQA 5CEFA 4WUTA 1H2FA 3AB3A 2P2CA 5IJ0B 1ZC4A 2XUJA 4PNHA 2IEAA 5IC5A 3T1VA 5GIOE 2VPXA 2QYOA 2OV4A 5EOVA 3K9GA 1ZH8A 4QUJA 3U3DA 1J1UA 4DPKA 3WIUA 3ZV6A 3IAXA 5DLDA 5MGBA 3AMVA 3ER9A 3TW4A 2H2IA 5GZ6A 1WU8A 3P2JA 4XYLA 2BFEA 1E0SA 2JFBA 4E21A 3TGPA 1WKCA 3FVTA 1J39A 1W75A 2OZVA 3OA0A 4BPBA 1KK3A 5L6LB 3IUJA 2BYTA 2RIRA 1GZ3A 2LRHA 1FXUA 4X9XA 4P82A 1T9AA 4W5RA 1PT8A 3FWYA 1JVNA 4FOTA 5EN4A 2EWVA 1NAHA 1Z06A 2A58A 1CZNA 4DJDC 1IY8A 2YYSA 4ZVPA 1JHUA 1LLQA 4A8HA 2H3HA 1DEOA 3A9VA 1BGVA 5BOVA 2XMDA 1GZ6A 3W8FA 1J5XA 1L4FA 3I5AA 4FE3A 3HG7A 4P34A 4UTVA 2OBSA 2XOEA 2QN6A 2JAWA 5FNZA 5EYPA 2J3KA 2OR3A 4F84A 4YRQA 4N47A 1F14A 1EJBA 4MLPA 1WP9A 1D4FA 2AXPA 3CD6B 2FSPA 3ETGA 4FMPA 1X7XB 4Q18A 2DCUA 4WI1A 4FYJA 4LGVA 1BJTA 3WGGA 2XGJA 3G68A 5FBZA 3X43A 4W9MC 2QM7A 3I9MA 3HYRA 1ILWA 4EYSA 2HV9A 3GVIA 4D4IA 3OJXA 4E5UA 2RBKA 2Q3MA 3SX0A 4IIXA 4GXNA 4C1NA 4DREA 4ARVA 1YA8A 2JHAA 4GBED 3QF4A 5IAJA 1Y34E 5ER6A 5B58T 3B2QA 1LK0A 4X94A 4B35A 4HZIA 3MBKA 3MCTA 4U00A 4A6EA 4IHQA 4YAIA 2BUBA 1EUDA 2XWSA 4CMCA 1T8SA 2IDKA 5CJJA 1ZK2A 2FPUA 3QF7A 1YQDA 4PPQA 4BUCA 1KEWA 4BX3A 4DMKA 2RK6A 1Z4LA 3AL2A 2Q9CA 1XMQB 1C1HA 1QV6A 1KP2A 3OPQA 1JJ7A 2WV9A 4I46A 1KDVA 2PAFA 2I4OA 1UEIA 2IS4A 1OPXA 2V6IA 3I6IA 5CK5A 1K06A 2W22A 2W00A 4EF5A 1OZHA 3H7IA 3ZWQA 2B4AA 4ZRMA 4J29A 3ZLBA 1AKNA 3ZZUA 3AVWA 3JQGB 1HLFA 2CLSA 2QVLA 4IIGA 3W5IA 3FMVA 5KSWB 5K8IA 1J56A 2D5LA 2WHRA 3A9RA 3KDPA 1ACLA 2I2FA 2NV2B 4J7UA 3F5DA 4OUDB 4YBRA 3M5PA 1ARZA 1CQZA 1HLPA 1OX6A 2H9AA 3A4NA 4PQYA 3TTWA 2PUFA 1VSTA 1DIAA 2QY9A 2Q3LA 1A96A 5DHRA 1FL9A 4DLNA 3W77A 2R1UA 2PVSA 3OG9A 5U1PA 2Q3FA 3ZTWA 1WB6A 4ZCIA 2HJHA 3CEJA 3WAKA 5J4VA 1BCRB 4YUWA 2HD4A 3K6KA 4OPOA 4FJ1A 2F1RA 5ILOA 4ZOLB 2HR1A 4MI1A 3HBMA 1BROA 1RWPA 2I80A 3HB9A 3IJRA 3B9QA 4PGMA 3SE0A 5JXJA 1XPUA 1E0JA 3P8ZA 3OPVA 1JB1A 5DVZA 5AWFC 1P1JA 2BZSA 2HJWA 4Y2VA 1P61B 5EP2A 3W2GA 2GTPA 2KS6A 4NP6A 4YTEA 1E6WA 1JFFB 2VJYA 3WIEA 4Y0AA 3QMPA 1SHTX 1Z0AA 2GM4A 3JCZA 3JZFA 3M6LA 3IPAA 2ZIXB 5F5NA 1N0VC 4C88A 1TKBA 3OPYA 1NPDA 3L1JA 4CG1A 4B3RB 1D2MA 3V97A 1WF6A 3F3KA 1O58A 2NACA 3G8BA 3OLQA 4P5EA 5HJ2A 5JDCC 3VR2A 1ONNA 5A02A 2IU3A 5A4JA 2ZB4A 4B83A 4QDUA 1X7DA 4EG6A 3WAJA 3GJYA 1UL1X 4BEJA 3V4ZA 3JYQA 4BXOA 5JROA 4QBHA 1J0BA 4XX1A 1WUKS 2QN2A 2WIJA 1GPUA 1QFMA 5DI3B 3C3AA 4MUXA 3VDMA 4J1NA 2ZYRA 1FUEA 3Q87B 4MPRA 2M98A 4RKYA 1WNTA 1B74A 4ZQBA 3SX4A 5G0WA 3GPLA 2WSIA 3WGLA 2XUAA 1FX1A 1NXSA 3PCTA 5I9LA 1M6EX 5EHZA 1GCAA 1V0EA 2GNPA 1DC4A 3BSFA 1UPXA 3O4JA 1IJBA 1HLGA 2HA3A 1MMFB 4UNQA 3GVLA 2W2OA 1KYWA 2O8VA 2W6ID 1F12A 1NDQA 3C5VA 3H42B 3KAQA 3O47A 3ZY4A 4B7ZA 2IZ5A 1AN9A 3QWIA 1I32A 4BTLA 4OJTA 1Z7BA 1BN7A 3UXMA 5JZVA 2E1RA 1E1DA 3U13A 1CF4A 3NWOA 1UZMA 1Q81D 3H2HA 2E55A 1ML3A 2FSVC 4IQ8A 1H8EA 3BRSA 3UFBA 2HWUA 5KYNA 2VBVA 5LIRA 4UHCA 5KMGA 5G3ZA 5AW7A 5JNLA 2WKPA 4OOVA 1JS1X 4HPJB 3AG5A 5SICE 1UBGA 1DWUA 1JIVA 1FP1D 3F6BX 3LAWA 4H7PA 1EZ4A 4UMEA 4ZXFA 3UBMA 4BJHB 3O7MA 2CUKA 2PEYA 3SU8A 1EIZA 5HK9A 4RGYA 5C4IA 3ER8A 1HFJA 1E2HA 1P9WA 2WM8A 3NHBA 4EB3A 2C9BA 2ID4A 2HDOA 3CZ5A 2PMCA 4NBRA 2BGIA 2C7PA 1DC6A 4J6EA 4M55A 4Q3LA 4RNDB 3IALA 4NRDA 1DI0A 4OLJA 3P7MA 5ED0A 1E7WA 3FMIA 3ZCPA 5K45A 5FCDA 3M8KA 1FS4A 1I1OA 4TQAA 2C97A 3IBYA 4JYPA 3SSNA 4P26A 1Q5PA 4RL6A 2GWRA 4TWBA 2IWRA 3MTAA 1U1IA 4IQGA 5ENVA 1IHOA 4BXOB 2C8JA 2CMDA 3H5RA 2P3MA 5AKGA 2WHPA 1LBHA 3G5MA 3KQLA 1ULZA 1Z0KA 1WSAA 3N70A 3FCUB 4Q3NA 4WLFA 5IZCA 2O06A 1AOXA 4KU4A 4X45A 5JDIA 3SQXA 3S55A 2JA1A 4R16A 2CJPA 1CUXA 1N75A 1SXJC 3GGGA 1M7BA 1YACA 5CXQA 1KDTA 3KSAC 4B48A 2VH2A 3FI0A 3L4BC 4ZCPA 2J87A 3CCEB 3UJBA 4DSNA 4BVKA 3O93A 1EI9A 3GD5A 1UK7A 4KN9S 4EMTA 2Z43A 5DBFA 2EHDA 1YTLA 3YASA 1VG0B 1X80A 2OFXA 2OXCA 4UDNA 2WUEA 3PB3A 2AFVA 1M6VB 2XITA 5AHOA 1DCKA 2FN4A 4CKEB 5JPCA 4DXHA 4JB8A 3U37A 3L0BA 1C1YA 4I9NA 2QKYA 4NEQA 1RI1A 1ZMTA 3IQGX 3ZZTA 4W4TA 1ZL2A 4LNAA 4ZJPA 2WJ3A 1AB6A 1E5TA 2HYIC 2EERA 3MM4A 3AR2A 1A2OA 2F1MA 3DVLA 2GS9A 3HA2A 4GC5A 4NU0A 4JB3A 2DB3A 3WV4A 2TSYB 5AVUA 1GKIA 1IULA 3UV6A 4A6PA 1YU6A 4M0MA 1JE1A 3PGLA 2JVJA 1O77A 1G3QA 1JI0A 1NW9B 4INAA 4CCYB 2CKMA 2YMQA 4EGAA 4YLYA 5LD2C 4KREA 4UDXX 4YP1A 1JU3A 2C7RA 3GHYA 1FP7A 4JBHA 2J7PD 1KJZA 2QGFA 4QXRA 3ROTA 3Q3IA 2HU5A 4PBSA 4WESA 1T3HA 3V76A 3ND6A 5HBRA 4GPIB 1E77A 1ENZA 1VDZA 2CHFA 4ZYZA 1GLGA 1L5QA 2O3SA 4RCVA 1E3EA 1LRKA 2DULA 1R8JA 1Z37A 2VYND 1FDTA 2YN4A 3H9CA 3MA0A 1ZKDA 3RC1A 5JBNA 2Q3JA 4I5FA 3VI3B 1E9EA 1EFAA 1EG7A 2BAGA 1XMIA 3VNQA 2QVZX 2GJ9A 4CIXA 3O3MB 2OILA 2RGDA 3H9QA 4EI7A 2B78A 1LBQA 5HZAA 4Z2YA 1TZBA 4H6WA 4ZAYA 4JYMA 1E1NA 2C4TA 3TQIA 4EI9A 1QHIA 4JY7A 1WXGA 2C20A 3MWGA 4R3UC 2WHPB 2D00A 1PGPA 1DJQA 3ZIAD 3E23A 3T5PA 1PK9A 4WN9A 4E5NA 1OF1A 4BLTA 4IXTA 5H59A 1XYYA 4LZZA 4XLLA 3KL9A 5I5EA 4J3FA 4M8LA 1EQ2A 1C9JA 2BHTA 1IK4A 2VSXA 3EXG1 4DARA 3AVYA 4EKDA 1H8HA 1IHDA 1U8UA 5HNKA 4LSZA 4HG2A 1Z75A 4GZ5A 4I9UA 5HKKA 1VIMA 2VBIA 2X2PA 2HJVA 4XX0B 2H1LA 3K70D 2C7VA 2O0KA 2R7KA 3S1SA 1PVOA 4TTRA 1BMFD 1R3DA 4LXXA 4TGLA 5MDHA 1FXWF 1GN8A 4OB8A 3A4YA 721PA 2XCTB 4O33A 1AHHA 4NBKA 3TZKA 1U02A 1QYDA 3GAFA 4CL0A 2C98A 5AKZA 3B5JA 1SVIA 1YCDA 2DQZA 2ZB2A 4IDQA 4IIUA 4MWDA 3D4IA 2XQVA 4V1CA 2VDVE 1AZLA 1V41E 2DG2A 2W43A 3W2FA 3N1UA 3PNKA 3FYHA 4PAAA 4XVHA 4EUNA 2VRCA 5LZ4A 4FD3A 3VAZA 1PL0A 4URFA 4CCYA 1T4GA 4RV4A 2VJAA 3PGKA 4G7XA 1UPCA 4X1IA 4UFNA 2GAAA 3QVVA 1M34B 5JI3E 1B15A 1YI0A 4MVJD 3GA5A 1RWKA 5K4HA 3CVYA 4PZCA 1AS3A 2GZRA 2WAYA 1CVRA 1UMCA 1LSUA 5DNUA 1P1HA 2ZTNA 2PGLA 4JUBA 3EXHB 5EMNA 1DWPA 3RY8A 1HQYE 2QN9A 4NMWA 4EFNA 2PUWA 3GJ3A 1QO7A 4NH0A 3V4VB 5IBRA 4A5SA 1KDOA 3ZJYA 3IT3A 2O8BB 3NS7A 3I6ZA 2G9VA 5EWJA 1YB6A 4BVHA 4ZHQF 2QMOA 1W73A 2X5XA 2B92A 3STXA 1F4LA 3LKDA 2Q29A 4I4LA 4NQZA 2GB4A 1Y9DA 3MFQA 3GFRA 4JFAA 4DCUA 4GMXA 4IDGA 3ZE8A 2IYLD 1Z25A 2AMVA 3ENQA 2Y92A 4Z6KA 1CFJA 2QRLA 5DP1A 2ATXA 3KOXA 1Q11A 4AFNA 4ESOA 1Z22A 1EGAA 2HU8A 4JA2A 1TFUA 2H51A 2IPNA 4KV9A 3D2CA 3RTBA 4B7XA 1IRXA 5EJ7A 5ED4A 2PE5A 1BDHA 1BLIA 1TUEA 4XX0A 1RIIA 4AWXA 4YT4A 1NVMB 1OYVA 1PT7A 1R64A 3QKSB 2CXOA 4CN8A 4U7PB 2FSSA 3E5RA 3NTXA 4O0LA 1D8AA 4PLFA 1ISIA 3CMMA 4QQNA 4DA6A 4EJ6A 1SR8A 2FUEA 2AOUB 1GZ4A 1M9NA 4FYHA 5IK2A 3DLIA 2FPIB 2AUTA 1S6YA 1S2LA 1U8AA 2B5OA 2DJIA 2B4YA 2IW1A 1V16A 3LGAA 4FNAA 3EWNA 4KDCA 4X5OA 2C2ZA 3JR7A 5TPZA 4OOSA 2FFAA 3MF4A 4GAEA 3MYRA 4LXIA 2V55B 3AV0B 3BGVA 1BH6A 3PXCX 5HDBB 4KR0A 1OYWA 1MOQA 4CTOA 2XMZA 3D1JA 1IN6A 1Y8QB 3BWBA 2O8CB 1ZMXA 3MGCA 4FXOA 2AXEA 4R8RA 5F3WB 2GZ1A 2H48A 1ZI8A 3BJRA 3LUFA 4ASUD 4RTOA 3C24A 1CQIB 2CK3A 1U28A 2IELA 1EUDB 2BIFA 2HIMA 1NPYA 5KJEA 5TPWA 1XXHA 1N6RA 2EKBA 1UUFA 2HRRA 3G9XA 1E1RD 2R66A 3A6JA 4F3NA 1J90A 3W6UA 1TU3A 3PZBA 3A3NA 3ZDAA 4BECA 3HWWA 1WSBA 2NUPA 2C9CA 1CTQA 4HH0A 3RK0A 4GOXA 2FFHA 4G5SA 2V3VA 3IE2A 5K8TA 3W79A 2LP4Y 2FPLA 4IO0A 5JAHA 4P3OA 1US8A 3PFBA 4YIHA 4D3XA 4MZXA 1ZXBA 5E7MA 3V2UA 3A70A 4RMNA 1XZEA 5F2EA 4R1TA 4X7MA 3HKBB 1DZIA 4MJLA 2SICE 4AWAA 3FYUB 3L5OA 1BGXT 1NXOA 3HY4A 3T7IA 4N12A 5HOEA 2RD2A 2OXFA 3E1GA 2FMIA 1FFCA 4MQ5A 4I1RA 2YINC 3AUKA 4UUOA 4FFMA 5EIEA 1L7BA 3IQXA 4R2HA 4TMXA 1SOVA 2QIPA 4KQ9A 1S89A 1O0SA 2AVNA 2HQSA 4U9UA 2QE7D 2C03A 3FPSA 3N7AA 4OXKA 3ONNA 4DL9A 3SXPA 3WA7A 3B6KA 2C1ZA 1XNJA 4OJKA 4B6OA 4X7CA 3DNFA 5K4GA 3A36A 2CKDA 2DE0X 1GUAA 2ZRKA 5FWXA 4G8DA 1GSAA 2EIHA 1JUDA 4TXJA 3P2KA 1ZIYA 3VXKA 2O5RA 2EATA 3I34X 3HXLA 4MYTA 4H3HB 4TPKA 4XUDA 4DNFA 2DECA 2ZZNA 4JXZA 1M90D 5EPOA 3WGZA 4MLDA 1PZGA 4RDIA 5EC8A 4B3CA 5EEHA 1K4MA 1VF7A 4WNAA 3RF6A 1U1CA 4NAHA 4PIPA 4MUKA 4N0DA 3VYUB 5ADUS 2PS9A 5FNVB 1MUUA 4C9BA 1QX4A 2ZKIA 3SBOA 1N2CA 3EARA 2P2DA 4ZVMA 1MAWA 1G9SA 4BNLA 3ZVMA 2YBEA 4JXKA 1B3RA 4E12A 3KFVA 2J30A 3Q6QA 4Z51A 4Y7CA 4B17A 4BTVA 1NYTA 4C7VA 5C46F 3PJRA 2QX8A 1KMHB 2PKYX 2QU8A 3BCRA 3ODGA 2B1QA 4YAGA 3RRFA 2XKJE 3CLRC 4GQBA 1OIXA 4CR8A 3T5CA 2R6GA 4LUCA 5B6JA 5HKKD 3LQKA 3HEBA 2YXDA 2B1GA 1XEAA 2VQSA 2HMSA 4KPGA 3ZCTA 3CTMA 1PJZA 4DMFA 3DE6X 2RHGB 1QSGA 4CIAA 5KZMB 5K20A 3PUVA 4B6RA 3R5TA 1OB2A 2C3MA 4WZZA 1P4AA 3UATA 4ZGBA 5ALIA 1ESNA 2FW1A 4CTKA 1ZH0A 5H1YA 5K3FA 4YI3A 1P1BA 2CUZA 3PIIA 1OA0A 1ZOLA 3I55B 2W6NA 2IUFA 2I8CA 3B6EA 4GR5A 4IF4A 1D1PA 4QICA 3QOFA 3UUWA 1JSLA 1X0XA 1Z0SA 4M49A 5A7FA 4KR2A 3N5KA 1Q20A 3OIFA 3RUAA 4R1OA 2YC2C 3FPJA 3EUEA 3AG6A 4EG1A 2NXJA 1CUBA 4FC7A 4JYBA 3KZNA 4CGZA 1CUYA 4JQOA 2AEEA 4Q21A 3TLYA 1E3LA 1A2BA 2Z2XA 3PTLA 4ZOLA 4LDAA 3NWPA 2A2ZA 3ORQA 3HJGA 4GM0A 1XUOA 3WFIA 4HUTA 3ICEA 2CFTA 4Y2PA 3OSUA 3G89A 5E2AA 4BV9A 4FPXA 1TD9A 3ASZA 2KBEA 4G07A 4OJNA 4ZO6A 4MGHA 1A8IA 1PV2A 1II0A 4BNNA 5K99A 4MDEA 3IVCA 4Q1FA 1G5FA 1JR3D 1JHYA 5BVGA 4KQFA 1AT1A 1CRLA 1DMRA 3EN0A 2QQFA 3MJCA 3RK4A 3VU3A 3ZNQA 1ZDMA 4D3FA 1GPMA 2IA5A 4C7JA 3I61A 1EQAA 2OWDA 1SOWA 5CA0F 3V5NA 1OJ7A 4G9EA 2A0YA 3HZHA 3AHEA 3L1UA 4FR0A 4YJFA 5CA1A 1GAQA 1Y6RA 3DSRA 3O3CA 4IBOA 4UE3S 1JHAA 4QUKA 5JIBA 1NSTA 3MXTA 3RRYA 4DNOA 3Q41A 1QPGA 2W8ZA 5JXWA 5J23A 1QO0A 2YZKA 1E7YA 1V7QA 4N54A 2IV7A 4L5YA 1AE1A 2QR3A 1JV2B 1IEQA 3CV3A 3TIIA 3VU8A 4DV6B 2HMTA 1K4YA 4WOKA 1GQRA 1GR0A 2GCNA 4LNUB 3DOCA 4G0YA 2KW5A 5C4GB 3DM9B 2WF9A 1CJTC 2A9VA 1Y4SA 4FJ0A 3FZQA 5JW6A 2AHRA 3AYXB 3G6KA 2C5FA 1J1ZA 3IQDB 1RYEA 1IZYA 3RS5A 1HXHA 4L7VA 3NI2A 1UF9A 3KYJB 4MB2A 2XUFA 4G9GA 4RD2A 2O8BA 2LXNA 2W58A 4M8IA 1T26A 3AONB 3PFNA 1TGYA 4BJ6A 2VK2A 3L0IB 3BXZA 4XJTA 3GH1A 5I8PA 4KQJA 1SD2A 1Z7WA 2XCIA 2ZYWX 3GJSA 3LCCA 1KBZA 3MCZA 3PE6A 5AVKA 2Z6BD 2BFCB 2FQQA 2I3AA 3PJDA 5ALZA 1SQGA 1NBIA 3W5DA 1LLUA 1DZ3A 2HDHA 2ZANA 1Z38A 5AJHA 4HQLA 4DZZA 2X85A 4MRMA 4FFNA 3SLNA 4PYJA 1WETA 1G4UR 4LQCA 4H1TA 4GLOA 5DP2A 4Z7QB 4RJLA 3AEUA 1YZ3A 4FMDF 2PJRA 3UC5A 4GD3Q 3DE0X 3RIGA 2QXUA 4TROA 5THQA 4HN9A 2C9DA 2XA1A 2AX3A 1HDRA 3TUJC 1VBKA 3CLUD 3PICA 3R3HA 4R51A 5A4AA 3OJ0A 2X7JA 4MA4A 1Y9ZA 4I8DA 2NPFA 2NP7A 4IQFA 3TMYA 2OC9A 1F9EA 3QITA 4J7CA 3DCIA 5TVKA 2FAXA 3AVQA 4J0JA 4PGHA 1D2EA 4F1WA 4BVFA 5IT9A 2DLCX 2GNOA 3RE1A 2QM3A 3QE0A 2HJSA 2HU2A 2IC5A 1KORA 2ZWVA 3IA7A 1I6LA 5GM2A 4IFTA 5F73A 4B6FA 2F62A 5DYYA 1R4NA 5BP7A 3RU3A 1VIYA 1X7ZA 2A9RA 3N53A 3DCJA 4G5HA 5ICSA 1XG5A 2JI6A 3DKPA 3R6GA 5LMZA 3VR6A 2JFZA 2JANA 3QIVA 3CBGA 4LZOA 5T5QA 3ZLVA 1KI4A 2XLCA 3H11A 4BKQA 4C0JA 5FPTA 4AXBA 4RD6A 4YRLA 3U3XA 2I4RA 4RDLA 1ACMA 2GILA 2ISCA 1N57A 3KQPA 3FN4A 4JT9A 2FFRA 4X7BA 5JO9A 4ES6A 1XDWA 3K0FA 4YRTA 3AB8A 4QU5A 4EGSA 1D1SA 4R1NA 3L6UA 1QGOA 2ZZKA 1NF3A 4BZXA 1T13A 2DHQA 3MJTA 2R4TA 1THZA 3CH5A 3IEKA 2QD5A 3JXEA 4D4GA 3RS4A 4HDKA 4EUHA 1SQFA 3TLEA 1I7PA 1G3IA 1MX1A 1WNFA 3E7XA 3QLVA 3TL6A 3ZV3A 4CM4B 1KXJA 4EJSB 3N7TA 2ZWAA 1IM5A 3I9JA 1JQDA 5G0SA 1HE2A 4RY9A 5I7OA 1SHLA 1YBMA 2Z3VA 4C6SA 5DBIA 1ICEA 3HCDA 4KXLA 1CUVA 3NHKA 3RUIA 1YQQA 3D8UA 2P8SA 2Q50A 4G9BA 4UEWA 3TKLA 4CM7A 2CNLA 4CM9A 1YRAA 2QN1A 2R44A 3FI9A 3TLCA 3FHJA 4UZEA 4MR8A 1J0CA 2SKDA 1PL7A 1X13A 3DHEA 5EP1A 5DU2A 2AG1A 2MSNA 2LPMA 1P2GA 4QTXA 4C76A 4HUQA 4KGDA 4LMPA 1X1BA 1ZM3A 1DAHA 1MAVA 2AN4A 1YKSA 3OOCA 2XNDD 3QOXA 4KXYA 5AD1A 5FH9A 4ATNA 2FA9A 1K73D 2PJDA 5J2TA 1EDEA 1V8PA 4FBMA 4MW7A 1XZHA 1J5EB 5ALGA 2IL1A 1XZCA 2NZYA 5T3UA 4RCYA 3I12A 1T9KA 3JQAD 1ZJWA 2QPTA 1FNBA 5IVDA 4NEGA 2HCBA 2O8FA 5EJ8A 1N92A 2WUVA 3HDVA 5AI4A 1XX6A 3WS7A 2QLFA 4AJ2A 3HV2A 3HU3A 2Q3BA 1FDRA 1B6GA 2EQAA 2ZT7A 1NSFA 1VDMA 2E4XA 2REXB 2AT1A 2ZAOA 2QZ9A 2Y1FA 4N5HX 1XB2A 5AM1A 3NORA 5HKOA 3QVUA 2NVWA 1Z4JA 4OX9Y 5C1IA 1ZD3A 5FTMA 4KQEA 4YT8A 2H7CA 4ARIA 4L5BA 2ZSFA 4LHEA 5IT4A 1XMXA 5CB4F 3WWZA 1RPNA 3K1JA 4NYMQ 5AHWA 5JMPA 2WB2A 4HN2A 5HKLA 3T1YB 1G4HA 3LBYA 4AWBA 1O2DA 4P1VA 2BZGA 1UBKS 1G21A 2ZT5A 1TZMA 3OH8A 3LCMA 3Q5GA 5HTOA 4E2FA 3CEMA 3DYIA 3CNBA 4YMLA 4P9NA 3VBEA 1B26A 2ZI4A 4HB2A 1OBOA 4UNSA 1BPLA 2XUIA 1FP4B 1G7TA 1Y4AE 3GB9A 3GAZA 3BGOS 3W2TA 1XN1A 5EJ2A 2A0UA 3SBXA 5JADA 2OAGA 1VYTA 5L3SB 4E14A 2YQ4A 4OLAA 3AHFA 3MTDA 1G3MA 4F7WA 5DRYA 3H2SA 2FQ1A 1UEXC 3QEOA 4BFCA 4TMTA 1FXWA 2BL4A 1SCNE 3FYUA 5LU8A 5BMVF 3SC6A 1TZJA 1TT5B 2ZZEA 1WZCA 2R65A 3EIXA 2YHUA 3OA2A 1IE3A 1XKXA 2GCEA 1EFHA 4OGKA 4X1OA 3C6XA 3ELBA 3T9FA 1N2JA 5CCEA 3DDWA 1IQRA 4BNUA 1Y6GA 3IAUA 2GBIA 1RXYA 4Z3KA 2QEXB 2C58A 3KL4A 2GBLC 3ZCRA 3ANMA 2QYTA 2FG7C 2ZUEA 1A27A 1T1JA 5DF1A 3GJRA 5IBCA 1OLSB 2H54A 1ISRA 1UZAA 3WB2A 1SWVA 3AF5A 1FBTA 3S7TA 1BA3A 1E2QA 2OBRA 2FDXA 2QL5A 1UBNA 1Q57A 3A1VA 2G0AA 5CFZA 1H4QA 3RFXA 1MW8X 4FCWA 4PLVA 3SF8A 5FRDA 1L5VA 3F71A 4NZ9A 4A82A 2OO3A 3BZWA 4XLFA 3M2TA 3P4XA 4KDRA 4RF3A 2Y0BA 4UHDA 3RC3A 2BF4A 1RJEA 2P67A 2FZ4A 1SB9A 3AF0A 3TBKA 2H63A 1XTTA 1ESMA 1N9GB 2AH5A 3GLGE 2FQXA 1P3Y1 4CMEA 1NRIA 2W2NA 3I8SA 3TX2A 3WI7A 2NADA 3CR3C 3GGDA 1CUGA 3DTTA 1ZRSA 1DX4A 3RWBA 4RDKA 4Z4FA 1PUIA 3NH6A 2P6PA 1VCNA 3CW2A 3AEZA 3K2EA