3VO2A

Crystal structure of zea mays leaf ferredoxin-nadp+ reductase iii
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
296
Chain Sequence
TSKKQDEGLVTNKYKPKEPYVGRCLSNTRITGDDAPGETWHMVFSTEGEIPYREGQSIGIIADGEDKNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNDQGEIVKGVCSNFLCDLKPGADVKITGPVGKEMLMPKDPNATVIMLATGTGIAPFRSFLWKMFLEEHEDYKFSGLAWLFLGVPTSDSLLYKEELEKMKEMAPDNFRLDFAVSREQTNAAGEKMYIQTRMAEYREELWELLKKDNTYVYMCGLKGMEKGIDDIMLNLAAKDGIDWMQYKKQLKKGEQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
publication title N-terminal structure of maize ferredoxin:NADP+ reductase determines recruitment into different thylakoid membrane complexes
pubmed doi rcsb
source organism Zea mays
total genus 99
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3vo2A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3vo2A02
3CXCB 1DDIA 2XEXA 4TMXA 3W5UA 4N3GA 1E62A 3W2GA 3PENA 1R5NA 2YWHA 4B3XA 1GAQA 4TN1A 2C78A 3ZBUA 1YITB 1DDGA 2RC5A 3W5HA 3AVXA 1QUEA 4QFMA 4RCYA 3J81k 3CCUB 2VNJA 4PC2A 4ZV4A 1KJZA 1NDHA 1SKQA 1OB2A 2OK8A 1G7SA 2VNHA 1DG1G 3WYAA 4MYUA 1OB5A 1SM4A 2HMAA 4NCNA 3OZWA 1JA0A 1FNBA 1QUFA 1M90D 4K1XA 4C43A 4YAOA 4UAJA 3CCVB 3CPWB 1GJRA 2NPFA 5GV8A 4RD1A 2D74A 4LBZA 1KC8D 1JJ2B 1VQ4B 1CQXA 3CW2A 3U6BA 1TVCA 1B23P 4YAFA 5TR9A 1W35A 1GO2A 2DCUA 1QGAA 4DQLA 4YAUA 1FNCA 2HCJB 1IJEA 1BX0A 1EFUA 3WBJA 4RD0A 2B7BA 3ZZ0A 2YWFA 1IJFA 4ACBA 3FJOA 1VQOB 3CRZA 3VNUA 4WQMA 3AGQA 2VNKA 2PIAA 1EP1B 1EXMA 2BV3A 4LC0A 3CCLB 2DETA 4G1BA 1VQ8B 3CCEB 4P6VF 1YJ9B 3CC2B 1AIPA 3VMFA 3ZC3A 3U2QA 2QEXB 1QFJA 4J0QA 4LBVA 4RD2A 1ELOA 1BQEA 1D2EA 3CCRB 1TTTA 5H5JA 2YWGA 3AGPA 1XB2A 2VYQA 2QN6A 2AHOA 3ZZTA 1FDRA 3CCJB 4DQKA 1EP3B 3WXMA 1GVHA 3QFCA 1Q81D 3VNVA 5TV2A 1W34A 1UMKA 2XNJA 4H9GA 3OJXA 1Q86D 1YJWB 1VQ5B 3AVVA 4F7DA 3V76A 3CCSB 1N0UA 1TLLA 1YJNB 4B47A 1KK3A 2E1RA 4RJLA 4PGOA 1KRHA 4ZCMA 4FN5A 3CMAB 2VZLA 2B5OA 4YAWA 1YIJB 2OK7A 3E1YE 4ACAA 2BPOA 2OTJB 1CNEA 2ZITA 1ZM2A 3AVWA 4ZCIA 1IB0A 2QA4B 1VQNB 1R5BA 1EP2B 3CMEB 3W2FA 3WNDA 2DEUA 3G4SB 1YHQB 4B44A 4M1KA 3P27A 1QH0A 2C77A 1Q82D 1TUIA 4RD3A 1CNFA 1A8PA 1YI2B 4C0SA 2GPJA 1HA3A 3P26A 4ZCLA 3QSYA 1QGZA 2QMUA 1QVGB 1F20A 4Y9UA 3G71B 4PC6A 4FK8A 4M2LA 3QFSA 3MMPA 1F60A 5TY0A 5THXA 3MCAA 1EFTA 3OZUA 1M1KD 2BMWA 1K8AD 1G7CA 1NJID 3CC7B 3SJZA 1W2BB 2YWEA 1GR1A 4LBYA 3E20A 4MYTA 2XNCA 4ZGQB 4P3YA 4TMVA 5HXBA 1ZM9A 2J7KA 3AVUA 1D1NA 3LVBA 3W2IA 1JA1A 3B78A 4TMTA 1QG0A 3OJWA 2BM0A 4NBSA 1XE1A 5FA6A 1G7TA 1S72B 3A1FA 1ZM3A 2OTLB 1KK0A 3G6EB 1I7PA 1H42A 3JQRA 2DY1A 3CC4B 3W2HA 1EWYA 1VQ7B 4HE6A 4PC1A 3QFRA 2X3UA 3AVTA 3WBKA 2RC6A 1FRQA 3B8HA 4U9UA 2QTZA 3FPKA 3LRXA 3CCMB 2BSAA 1FNMA 1KK2A 3JQQA 1VQ9B 1VQPB 1W87A 1S0UA 1WDTA 3AVYA 1KQSB 5KSWB 3I56B 5AN9A 3I1FA 3U6KA 4FWTA 4HE5A 1FNDA 2DERA 3WNCA 5EMNA 4YALA 1R5OA 1JNYA 2BGIA 1FRNA 2PMDA 4B4DA 1QX4A 5H59A 3MHPA 4RCZA 1GAWA 2QTLA 4N3NA 1VQ6B 3QE2A 3ZBTA 4RD6A 4TMWA 1VQKB 3WNBA 1BJKA 3B82A 1JB9A 4B48A 5JBQA 3I55B 1BX1A 3WY9A 1G7RA 3W2EA 3CB4A 1K9MD 4M0LA 4Q7JB 1AMOA 3CD6B 5GV7A 3VO2A 1Q7YD 2EIXA 4AF6A 1VQMB 3LO8A 4PC7A 4TMZA 4AC9A 3OW2B 3ZZUA 1D8TA 4Y9RA 2HDNB 4EH1A 4B43A 1B2RA 1N8RD 1VQLB 3W5VA 1K73D 1DARA 2BGJA 1H85A 2BM1A 3CCQB 2BF4A 2GQFA 2BN4A 1QVFB 4QHYA 4M4SA 1QFYA 4R71A 1EFCA 1OGJA 4Y7CA 2VNIA 2PLFA 4YHBA 2B7CA 1ZUNB 2CRVA 4RD4A 2QDXA 1KK1A 2CNDA 4LBWA 4G1VA 1KD1D 1E64A 3LYUA 3OZVA 4PC3A 5DSZA 3ES9A 4ZGNB 4M53A 3JQPA 1ZM4A 1U2RA 1N0VC 2FX3A 4AF7A 1J9ZA 2EFGA 1KTVA 4BPRA 1OGIA 2R6HA 2BVNA 4IW3B 3QFTA 1E63A 1QGYA 1QFZA 3VO1A 4G5GA
chains in the Genus database with same CATH superfamily
4WT7A 3OC0A 2YYZA 1ZK4A 1Q7EA 1WXWA 2B2CA 2JD2A 3A2MA 4OOXA 1IZ9A 2IDMA 4PLYA 5AJZA 1W4AA 3X1WA 1FTQA 4P7FA 1U4SA 1OT5A 3ZD6A 3OPNA 4A1OA 5H3CA 2FWNA 1Y3HA 4R81A 2NNLD 5JS1A 2YY6A 3ENZA 4AQ7A 3W04A 1V5GA 4BFUA 1E2KA 1UJ6A 2J0VA 3Q7SA 2FWRA 2C3PA 1AOXA 1NLYA 3DHYA 4OHVA 3KE8A 3ZBUA 4RF4A 1JAZA 1QRRA 1PLJA 1Y81A 5A7GA 3C6MA 5CLQA 3O94A 1XD9A 5EC8A 4DLZA 2QD1A 2YS7A 2C03A 1T91A 4LZOA 2UZ4A 1TRHA 2VYND 4WCFC 4EA6A 4R54A 2PGNA 3H9UA 4MPRA 5HMLA 1T2EA 1CW2B 4YS6A 1X87A 4HDAA 1QTIA 4WK4B 1X13A 1YX2A 3H2JA 1SC3A 2MSDB 3QPVA 4W99A 2GNPA 3R0VA 3T3PB 3QXCA 3M49A 1M33A 2GBLC 3EZFA 3T94A 2HSJA 2WWGA 3C7DB 3G6WA 3MTQA 1IWPB 3B9PA 3EAQA 2ZIEA 3H6KA 3EXHB 4HP8A 1LFDB 4TRNA 1J7KA 1YIDA 4Z0PA 2VYVA 3NBYC 1ZOSA 4GVPA 4UDXX 1OB5A 2GILA 2IV3A 1T0HB 4RF3A 1VF7A 2CCGA 3IHLA 2NACA 2ZUUA 2GD6A 1QUFA 4G8BA 4J4HA 4BJ6A 4G0ZA 5IT9A 1Z0IA 4Q01A 4TKVB 2HGSA 4XDYA 4DR2B 3NNSA 2PQ2A 4V1CA 4I4LA 1II8A 1YB1A 1NFQA 3CCVB 2PZJA 3C4QA 3DKIA 4JVNA 1WXGA 4NEQA 4UUBA 2Z0MA 5FPHA 2C2ZA 3BMCB 4FDUA 4A7PA 4C76A 2TRSB 2HA6A 3QVGB 4P9NA 4RVDA 5AHRA 5LN1A 1GY8A 3ADOA 3IXLA 1QKKA 3PRYA 4PFKA 4Q9KA 3CH7A 3HZZA 3NIWA 5H16A 1JJ2B 1G8GA 2OO3A 3W8NA 3TQRA 3KDAA 2Q2VA 1ZK2A 3GRCA 4JYCA 4QU5A 4C03A 2B2XA 3K4HA 5K0TA 2NO9A 3TJZA 5AI8A 2Z5GA 5EGSA 4DTCA 2ZUCA 3TGLA 3IIJA 2RE8A 4NXNB 3N0RA 2VYNA 2RHBA 4YRDA 4Y6PA 3DMYA 3F97A 3IX7A 4LXXA 5JROA 1OIXA 3NTUA 1YS2X 2VS1A 4ZOLF 1SZPA 2VH5R 2R1ZA 4N01A 3LY8A 4NULA 4AIRA 5CDFE 1K9VF 2CL6X 3CIFA 4HFJA 4IQFA 2SBTA 1O7JA 4YCCA 2C58A 4QAJA 4RMNA 1AQUA 4MYCA 1C14A 1KS2A 2PBFA 3W34A 2LCFA 2H2GA 1EPUA 1WZIA 3CLHA 1HGXA 5TEWA 3G68A 1XPJA 3JQ7B 1SFRA 4FFMA 1I4OA 1P29A 1NRKA 4DQDA 2IDJA 2BEUA 2VO1A 4FDVA 3WQZA 3UXHA 4JI6B 2FSIA 4HWKA 2ICAA 2CLFB 1GTL1 1CZOA 2LUOA 4IL5A 3BZWA 4G5XA 2VDKB 1PL0A 4MUBA 1EM8A 3RRYA 3K0SA 2JK1A 1QWSA 2NUAB 4ENTA 1D0VA 3A4IA 3ZU3A 4Q21A 1SC4A 3Q2IA 4ND6A 1MGOA 1MBZA 2M6LA 4EI7A 4HLUC 3UKOA 2XZLA 3AI3A 2ZYDA 4G4IA 2QX7A 1WW3A 5BNZA 1E3SA 2OQRA 3LBNA 2DMRA 1FX0B 3VMFA 3JALB 4KLAA 2R5FA 1M0TA 3T1HB 5AKKA 2ZE5A 4J6FA 4MB0A 4EECA 4EGAA 1P2TA 3HE3A 1IY9A 4M1ZA 3PD1A 1ISSA 5IBPA 2FN3A 1L9XA 4GBGA 4WLVA 1NQOA 4FD3A 2MSWA 4WZBA 4EHFA 2CMGA 1W4RA 4X05A 2DFDA 1CC1S 1PP4A 3KJXA 4GZ5A 1Y4UA 2R66A 2K4MA 4MQFB 3OW7A 1OJLA 1XA3A 2RHMA 3FDIA 3KYIB 1T3ZA 1FK8A 1ID1A 1Q1EA 1G3QA 2AD5A 3LC2O 4QTTB 5G53C 3UXMA 2JFBA 2G80A 4BBAA 4YRAA 3M6AA 4FP9A 5I7WA 5EJ7A 5JECA 1Y7LA 3KPWA 5TQ2A 2C0PA 3EZ9A 3E22A 1EVLA 3LX8A 4OI1A 5KKAA 1S89A 4Y2UA 4IICA 2HGZA 1IK4A 4YELA 4MV7A 3ZWPA 5TMDA 3KSZO 1SY7A 1LI7A 1EK2A 2Z58A 1WWKA 2GDZA 3BH4A 1YJXA 2M6SA 3TH5A 2HRCA 3MJSA 1HTBA 1P4RA 1IHOA 4JP1A 4CT5A 5BPHA 3KQOA 4JR2A 4KUGA 2V3CC 2JH8A 4Q5IA 4DUGD 3KQVA 1VLLA 1ZS9A 4IVPA 4OXQA 1E3JA 5DXAA 2N46A 1ZVQA 2L0XA 1DFHA 2YXEA 3DVSX 1T6NA 1U99A 4AYTA 2WYRA 2LBPA 3ITDA 1W36B 3DQPA 1YZFA 4Q9LA 5ECDA 1TT5A 3M0EA 3C5CA 4G0XA 5B3JC 3Q6IA 2H3HA 3ETCA 5AQEA 1AKEA 4ME6A 4YRRA 2JG3A 1SVIA 1JIIA 3FUTA 4MH0R 4NL4H 4KUEA 3UWSA 5LIRA 3DYVA 3AUAA 3GWGA 2EYQA 4OL0A 3PQ4A 2PZEA 3RSFA 3SXJA 5EHZA 5KOIA 5L45A 2VPYA 2GNOA 2ZI6A 3UANA 2OZKA 1IHPA 3SZ3A 1KTIA 1NMZA 1TX4B 2EKPA 1FU4A 3FPAA 3HKBA 4GOXA 2HV8A 4GNRA 4K9MA 4PLGA 3TQIA 4OX9B 4ZQFA 4ZCSA 2C83A 1GLVA 4X3CA 3TTVA 4D79A 4G9GA 5ULLA 3AR7A 3H9GA 1PTJC 2GAFA 3C1AA 4RAQA 1JPVA 3DF7A 4MWOA 3VPFA 4YCDA 2F67A 1ZD1A 5FO0A 4OD0A 4PFQA 4XSGA 3G4SB 3HFGA 3T9CA 5CFRA 3WJ2A 1YS9A 3E6AA 4CLHA 3HN7A 1R6TA 4IIFA 2WJ3A 1LDNA 2ASEA 1QC5A 3SJ7A 4B80A 1LDGA 1CNFA 2WY2D 1T8UA 3EGCA 1FQKA 3GUHA 4LHVA 3FYTA 1AO0A 1H66A 4DUGA 3DTVB 4JP2A 3QSYA 3OOWA 1PV1A 1UJCA 3EY9A 4WADA 1G21B 2BR3A 4PCAA 2D7JA 4IIJB 2JBAA 3OKPA 1QYCA 5CNKA 2Z30A 1ITZA 1J2YA 2QTAA 2ZVJA 2VHYA 2ZUVA 4LVOA 5JXWA 1JSRA 2DUNA 1B7GO 3T0IA 4ZFNA 4Q9NA 1JAYA 4KAFA 2GSDA 1B76A 7MHTA 5J3OA 1U9CA 4J7UA 3B7WA 3H3FA 4G9EA 1ENOA 3ENQA 1J6UA 4MP8A 2NZ8A 3VAYA 4Y2HA 4NYJR 1RYFA 4UHJA 4YWHA 1NP6A 4LX0A 4ARVA 3BF7A 3LLMA 4RDXA 5AVVA 1WCV1 3DUWA 1GTVA 1JEDA 4M6WB 3NHWA 1S6YA 1MPTA 2DXIA 2GSWA 3MQ4A 4LVNA 3DV9A 4U5QA 4GOMD 2ZAIA 1NPYA 1ZCFA 4NCXA 3DZDA 4HZUA 3BGVA 1VMIA 2E82A 2R6ZA 1DUVG 2VN8A 4QJ4A 3CR7A 3K6KA 3N0TA 1R7RA 3NHUA 1V0JA 1LSJA 2R8ZA 4QYXA 4QXQA 5IN5A 4E5PA 3FB4A 4FVTA 3MJVA 1GR1A 2Q3HA 3PSAA 3RFXA 2ZRIA 5FF9A 3OJLA 1UD2A 1UMDA 3HCDA 1FXWA 3SQWA 4ZQGA 4BNKA 2JZNA 3KVRA 5D1HA 5TXGA 4ZP1A 2PUAA 3T5GA 1XELA 4CG3A 1YULA 2DWQA 4UFOA 3GRKA 4K6HA 3RGWS 4LC9A 4KKTA 4P82A 5JSQA 2CXOA 1E1MA 3JY6A 1Z4MA 4QVAA 3OEWA 3E0XA 4JT4A 3SBDA 4A0FA 2Q6KA 2KYRA 3NT2A 1FDUA 2XAAA 4KZPA 2B30A 4MVYA 1MABA 4PM4A 4YP1A 2H5EA 2YS6A 2A1TS 3QVLA 5I8ZA 3WRWA 3TQHA 3ZNOA 3GCGA 5G0SA 4JT2A 4ENVA 1GUAA 5FIUA 1U1FA 3RYIA 1Z74A 2CE2X 4YMTA 3UQYS 4KV7A 1GRNA 4N54A 5J5AA 4D5EA 2QPOA 1UFRA 4FYPA 3U44A 1JHOA 1PNQA 4RZUA 2VTBA 4ES6A 3Q9SA 1WG8A 5FI1B 3WL3A 4EPWA 1VQ7B 3HA7A 4PYQA 4O4JF 3TIXB 3WFZA 1SA0B 1XZMA 2XF8A 4MLPA 4KI0A 4R3NA 1E9SA 4TKZA 1TECE 1FRQA 1D1TA 2JHFA 4S3MA 4XARA 5LU9A 4IZ6A 2Z6AA 1E1CB 1FRFS 1ZMOA 2DQ4A 1PJLA 3HNRA 2QAIA 5SZKB 4MDFA 5F76A 4GR4A 2PZFA 1BA2A 2WJAA 1UINA 1YZKA 3NGXA 4G0QA 5ES3A 1FYEA 1NC1A 3VHLB 3UJBA 4DWJA 1DAMA 1M72A 3GVPA 1M7BA 4N0MA 3W6UA 2C9ZA 4IIBA 3L6EA 4PNPA 1VTKA 2ZJ3A 3B9QA 3FCUB 3K35A 3SMVA 2Q8NA 1I4WA 3QELA 4JB2A 2VK1A 4KODA 2VZ9A 2OYCA 1VLJA 1PGNA 2L2QA 4W6QA 1V11A 1AZTA 2HPHA 1DPFA 3LOUA 3ONDA 2E5FA 1TEHA 2NXWA 1I4EB 3CZAA 3WGOA 1NAIA 4HNGA 3TI7A 1WJGA 3CXRA 1EVJA 5B1DA 4UUOA 3EFEA 2J3LA 2V9ZA 1K3UB 4W4TA 4UNQA 1M2VB 1CETA 4H7HA 3PPXA 3ADCA 4MUGA 1YQXA 4PF1A 4EY7A 2FUEA 3CSUA 1TTHA 3I6QA 3WLOA 2LWIA 5CGQB 1CEYA 3TF5A 2R68A 4AL4A 2DPGA 1JNYA 3C4VA 1CYEA 1LJLA 2JGMA 2OAGA 1UZAA 3PHBE 3RFTA 3UMSA 5LMUB 1VHWA 5FCDA 5LYYA 3CWQA 4LFAB 4BNHA 5JPDA 3F96A 1X1CA 4IAOA 3ADDA 1AUPA 1FZTA 2IXEA 4NCJA 4XYGA 5IC6A 4EEKA 3K09C 3JWHA 2J0EA 1ZICA 3H2BA 4LY9A 3TLBA 3WIEA 4D4LA 1H2BA 2FMUA 3NUGA 4HRVA 4JOQA 3UXEA 2FKNA 1OH8A 3WL4A 4Y2JA 3ICPA 2PX2A 2GXQA 4UTZA 1JVNA 4ABTA 2FP4B 4FFBA 1GZ4A 1BFUA 2ZTSA 4FQ5A 4QULA 5J1SB 3LCMA 3B2NA 5JBIA 2JFNA 1BCSA 1KZ6A 2OBMA 3F9RA 3MGBA 4JJ7A 1YJBA 1WO8A 5I45A 3OWXA 1OQAA 3D6VA 1J0DA 3M34A 1QG6A 1FJ2A 2BKAA 5EWJA 2FPUA 2GFIA 4M1YA 4NI5A 1OX5A 3KKKA 3PQ7A 5JRDS 4YRBA 3SJCA 3I55B 4V3BA 2PH3A 2BY4A 3KQTA 1YOVA 1V39A 4D9BA 2P5TB 5LR6A 3NEYA 2PVSA 4HEJA 4MPTA 3G9ZA 4Z3DA 2ODPA 3OIGA 3GARA 3AILA 5D1NA 5J2TF 2Q28A 2QXYA 1PV4A 2H11A 1JSXA 3AR3A 5KWVA 4K2HA 2AOTB 4H6VA 1T3GA 2GTHA 1PQYA 3E61A 3MGGA 4PE5B 1B2LA 5F33A 5EPEA 1UAAA 1Q2UA 2Y9PB 3DTTA 3B51X 4JLJA 2AJDA 2Z8YA 4GUDA 1JQBA 4JQSA 3WP1B 3VHXB 2FZLA 3ECCA 5AESA 5TMPA 1SHZA 4TYYA 2YMLA 4QELA 3KVYA 5JZVA 3P2EA 1IAQA 4YGXB 3KOWA 3FRIA 3I23A 3OJFA 2YCLA 1W96A 2PGJA 4I4TB 4BB9A 5AM5A 5JVDB 3H2HA 1AQIA 2UU9B 9LDTA 3W05A 4WDRA 1OXVA 3W5VA 2ZJFA 4HYQA 3RRFA 3CEJA 5AW4A 4UPEA 4RLSA 2XWBF 1ZRHA 1L1FA 5JJLA 1Y1SA 1TL7C 4EATA 5K51A 4WZZA 3WGTA 4EHBA 4JYMA 1RKUA 5DMHA 2C57A 2D5AA 2ZTVA 3WGZA 1UDCA 2BEVB 1ZWLA 3ZCXA 4CL0A 2HK6A 2HBQA 2CT8A 3LPAA 4P81A 2FF7A 3O91A 3ZKWB 2ZU6A 3ZV7A 2OAQ1 5KWJA 1SBNE 3J7AC 4CM7A 1N0IA 1RE1A 2RH8A 3ASYA 3D64A 3HU1A 1DJPA 1RIFA 4AN0A 4DMGA 3EXAA 3A31A 2VF4X 2H57A 5AM0A 3HEAA 1KJ9A 4AROA 5CA1B 2C9CA 4AMZA 1S8NA 3AHGA 3VR5D 2E4YA 1UBFA 2QMYA 3KT0A 4LMRA 3DS8A 1QK5A 1LV8A 3AEUB 4FIDA 4J0JA 3LYUA 1JLMA 5DSZA 3C3XA 1R6XA 2QN9A 3BORA 3STWA 2WNSA 4LCJA 2AF3C 1H2XA 3I6ZA 1FYWA 1K6EA 1SB8A 3L6OO 4N1AA 3CG0A 1Z34A 3TRFA 2M1ZA 3CBGA 4RPIA 5A3JA 5KB3A 2B36A 1W30A 5ICEA 5JH7A 2QRUA 4HFRA 3WMRA 4I19A 1NVVQ 3QFTA 2IP1A 2YIMA 4CFZA 1XPUA 2RI6A 3I8XA 1QGYA 4QFBA 1XA0A 3T7DA 4HV4A 3UJHA 3VR1A 5A1JA 4FEAA 3BXOA 1KVSA 2D5IA 5CBKA 4GDFA 2AQKA 4A26A 5DX0A 1ZGAA 3C48A 4GZMA 1H5UA 2FRXA 2Z4SA 1HXHA 3DDCA 3HUEA 5BNTA 5IANA 2PUFA 3K1ZA 4E03A 4C30A 1LWNA 4NE7A 3A32A 4JLPA 1GYRA 3KB2A 3NGLA 1U9IA 4PAGA 4XJTA 3Q3GE 5CFMA 2EW1A 3GJRA 3ZY2A 1GARA 1RQXA 3GZNA 3FVWA 3V34A 2HMWA 3O2JA 3V33A 3IE1A 2EG9A 3PFGA 3KEGA 4AJ1A 1J1UA 2J8ZA 4CKYA 2WIKA 2AK2A 4U3JB 2XITA 3JSAA 3VR5A 2IXTA 1B1AA 4GP6A 1OI2A 2A1UA 1R64A 3R44A 4HUTA 5BNFA 3ACDA 4S2UA 2E48A 4H7DA 4LZAA 2PLNA 1NVDA 3A2NA 3TEMA 3PHCA 1G17A 1NUUA 2F64A 1EAMA 3JD1A 1JLSA 2C8JA 2ORWA 4D5GA 4NCIA 4DHWA 1NQUA 4NF2A 1FC0A 2XDQB 1I51A 2GAAA 4JXJA 5CTJA 1DTEA 5C32A 2EFCB 5H68A 3MYRA 3QK7A 1XO1A 2MSLA 3LLCA 4CRWB 1XNQB 1NNSA 3JTMA 3HR8A 4AICA 2QN1A 3T3GA 5IDQA 1BWPA 5KWSA 3MMXA 2QJWA 3QU7A 3UBMA 1G98A 3L0IB 3NHLA 4KAXA 4YV1A 2HA0A 3PHJA 4TV9B 1W59A 4JBWA 4L3OA 1JT2A 4Z9YA 4H7JA 3KXLA 1XFOA 5FOVA 1M83A 4OFXA 1X1DA 3TLEA 2P91A 1RI4A 1XEWX 4E15A 1JV2B 1PK8A 2VCEA 4A8JB 3P0HA 4UAJA 5D87A 4NV3A 2OBTA 4NWIA 2H29A 3WYNA 4AY6A 1FSPA 3GDHA 2DYIA 4RYDA 9LDBA 3E8SA 2GGSA 3Q4GA 4FEGA 4BO0A 1V16B 5GPBA 1WF6A 5JS6A 3EVTA 4IINA 2CEAA 2AJLI 4OQ4A 3RROA 3RVJA 5ICCA 4BEWA 4HGYA 5DNVA 3WRVA 1UJ5A 4HAXA 1GCOA 3AEZA 3LT0A 1UD8A 4JBHA 4XI9A 3X43A 1LTHR 1GO2A 1LSOA 1RI5A 1U7ZA 4B40A 1U6KA 3LO5A 3FVRA 3HM2A 4Q37A 1LDBA 4PINA 3RVNA 1FNCA 3VSEA 5IYZB 5FTNA 2W6NA 1U8TA 2VEDA 1VPVA 3VMMA 3WMFA 1MAHA 4EOGA 5JCPA 5EVJA 2J09A 3C6QA 1SOWA 3QPBA 1V3TA 2ZBRA 4RK4A 1BD4A 3VU0A 3PG5A 1IJFA 5KSOA 1Q0PA 3DMFA 4G0WA 3PC6A 3I83A 3IH5A 4BXOB 3S6JA 2O5CA 3CRZA 4URVR 3LL4A 3TZBA 2XYRA 5FTKA 5HA5A 4Z51A 4NP6A 1L4EA 1V2GA 2W93A 2ZVDA 3PFWO 4Y6LA 3PA6A 3CNLA 3FI0A 4MKZA 5CT6A 3Q2OA 4AS1A 3GLKA 5H4GA 1ORVA 1CEEA 3V1NA 3EF3A 4UE3S 2QTVB 1LPSA 1Z0SA 3RTCA 2J6CA 3AIMA 3DZKA 4FZRA 4XGQA 2O3TA 2W2OA 4BE9A 2IY8A 4I5EA 1W25A 3UXYA 4MV4A 5B58T 3K6RA 2FSHA 3VVBA 3BJMA 4K03A 2RHHA 4PAWA 5ALKA 2ZPTX 2HZ7A 3H86A 4OH7A 2XMSA 2DLDA 2PK3A 3N6VA 4QEDA 5ADUS 3U4HA 4XIJA 1WZCA 2AZTA 1K3FA 2H4FA 3UKJA 4PHCA 4F84A 4RULA 2FOIA 1OILA 2JZCA 1JG4A 2R6JA 1PKEA 1U98A 2O7SA 1OWLA 3PEEA 4HLQB 1A5SB 4G1EB 4KRXA 3DE7X 2JJ2D 2WZDA 3K0CC 1XWFA 3ZOZA 5GJBA 2AOUB 2QNBA 2FFJA 2NM0A 3IO5A 3K15A 5I9BA 5IJZA 3H2KA 1GDTA 2Z1NA 3SQDA 4HDKB 3NOOA 4W8GA 4YJGA 1N9GA 4M49A 1C2YA 1FQJA 2VUTA 1FDOA 3EULA 4LF7B 1P19A 3N1UA 4EX7A 4X8HA 4G26A 3AY3A 1RD4A 1THGA 1ZU4A 3PIDA 3CZ5A 3H5IA 3N87A 1TJYA 2VBFA 2PE5A 1VI6A 1ATZA 3NHSA 4X8OA 3QEOA 3PNSA 3WLLA 4RA6A 2IOQA 1J00A 1KYVA 1PWHA 3F3KA 4CCYA 2BL4A 4Z1MD 2QPTA 3O1JC 1ZJZA 4PX9A 4OP7A 3BDVA 3BWDD 4M87A 1JSZA 1CUAA 1Q86D 1SK9A 1C3OB 3RI3A 1YR1A 4R3UC 5JLJA 5KYTA 1Z2OX 1L5SA 2YR0A 3RHSA 4C21A 4GQIA 2VP6A 1HZZA 3PA8A 5CVEA 3MBIA 5JNSA 5EQTA 3GLGB 2JFVA 3D59A 3WYFA 1SG6A 1Z5OA 5AM3A 1CUHA 5J5VA 1SMKA 4LE1A 5AI6A 1U2GC 2OLJA 3AU8A 3DR3A 3LIPA 1J0EA 4KXQA 3L4JA 1RZ3A 4TTPA 4WBSA 5LOVF 5KINB 4MIEA 3ZG6A 4ZDKA 1SR8A 2JJ2A 2NVOA 5L40A 4U2GA 3LNNA 2V65A 3C1OA 3F6SA 4MA0A 2AC7A 3Q0EA 4L6CA 4F6LA 3KJNA 1BVHA 4RIGA 3O74A 4G8CA 5KAMA 3E4DA 3IP7A 4H1TA 2C7OA 3LWZA 4QEKA 2MDTA 1DBWA 3QY0A 2X9GA 2XMQA 5J2UA 2VXYA 3KE9A 4ZJPA 1FBTA 2REOA 3VH1A 1P4HA 4RJIA 2E18A 1DMSA 2JJYA 2ZWVA 2HCRA 3A7DA 3GNQA 2F4NA 1RKQA 3OKXA 4PO3X 4IOKA 4LF9B 3OICA 3T41A 4LWPA 5IULC 1JNXX 4N0PA 3Q8WA 5CXSA 2YQZA 4O4IB 5G0VA 3NBKA 3W79A 5AH0A 1TCBA 3QXSA 1T24A 3L7DA 4XDGA 2J67A 2YQ5A 3WL7A 2DLCX 2ZQ5A 3L8GA 2V6IA 4HH3C 2A1TR 1DAEA 3FR7A 3GEDA 3PFHA 4XCQA 2P6NA 5JW6A 5HF9A 2Q6IA 3U5ZB 2QSUA 1SELA 4GSLA 1WB5A 4MARA 2Q6OA 3TLJA 1F3OA 4J0EA 3OEED 1I80A 5H70A 3HZOA 3RYHA 3S99A 3WO1A 2VUIB 3DYIA 4DIUA 5F7ZA 4US0R 2Q5QA 1T6XA 4BNDB 4EL0A 2Y4OA 3V2IA 3BXXA 3BXFA 2R60A 4NPAA 5KYWB 3TOCA 1QBKC 4ALLA 1ZAKA 2V96A 4L07A 4NBUA 4RTJA 1ONPA 1QQBA 2XVZA 4ZKDA 2HEGA 1H94A 4LOKA 5CPFA 4P8RA 1Z73A 2RHWA 3GAFA 2YHUA 1Q3TA 1GEGA 2NUPB 1QH1A 4KBFA 4M36A 1GCUA 4O4LB 3ASPA 3DHWC 3GJYA 4MV9A 4A91A 3R3XA 4TYNA 1YONA 2OZLA 1YASA 2W2KB 3UT5A 4UNRA 3PCXA 3SLGA 1W2BB 1BXRB 4Z3KA 5DXFA 1Q16A 2FRVA 3PUIA 1F2TA 5A3VA 5CH3A 2P75A 5G0UA 2PZ8A 2XDYA 4UMEA 4PTYA 2QUJA 3GPDG 2PHZA 4NQRA 4Z4FA 1P33A 3NUZA 4U2CA 5CFPA 4B87A 4BGDA 2AE1A 1L5RA 5DM1A 5JV5A 5I7OA 1KS9A 1U11A 4KQKA 4IHAA 4BVEA 4KNWA 1Y6FA 3AVUA 1A97A 3D1VA 1SK8A 2FEAA 2YDYA 2ZOSA 3IAXA 3UO8B 1Q7BA 3W2IA 1LLUA 5DNDA 3ZDCA 1C9YA 5DRTA 4A9AA 1L4YA 4ARIA 1JLKA 3DO5A 4D3FA 3OEEA 4NYIQ 1E66A 2ZCUA 3QOYA 4YCSA 4F93B 2J4CA 2ZTMA 1Q14A 4LRSB 1DJMA 5CPBA 5LNK6 2JCSA 2QJFA 4P4SB 5B1IA 2ZRMA 1JKJA 1M10A 4XXHA 2BYTA 3E1GA 1XE1A 3IPCA 4HNAB 2WABA 3UQZA 5C5DA 4MUXA 2ZBPA 2GPAA 5FHRA 5LBUA 2VT3A 2PZKA 2ZJ2A 1A7JA 4BJHB 4IRXA 4L27A 5AR1A 1NJFA 1G0OA 2R2GA 4RAOA 2RB4A 2H1VA 1KU0A 3A3PA 4KFTA 4HE6A 5JARA 1XUOA 4QUZA 3F74A 3FPBA 5ICSA 4RZIA 1N92A 2HBZA 2CHGA 4GD3Q 5GIOE 4WVFA 5ITVA 2OQ2A 4XUGB 3VNRA 4W5RA 1XLWA 2F1RA 2QUAA 2YZKA 3CMCO 1QE3A 1UBOS 1E2EA 4IMIB 1KDYA 1VL8A 3T52A 1XCMA 1FNMA 3WGVA 3H5VA 5I47A 1J0XO 3A27A 3S70A 5JDIA 2TMGA 3Q3HA 3TE7A 1KY4A 2B1IA 1KU6A 2PX6A 3THSA 3A4VA 1WL8A 3RU3A 4RKWA 1MJ5A 3M1YA 2GK4A 3U3RA 4D9MA 3ZHUA 3QBVA 4IZIA 4CTOA 2D1YA 1BWQA 2WBLC 1RHMA 3IBCA 3NDPA 4O59O 1W87A 3IFSA 5BQ3A 4RJTA 1GZ5A 3PRHA 4JITA 4CM3A 1ORHA 3ZXYA 3ZE6A 3EQ9A 3ZDFA 1KQSB 1ZSYA 1WV1A 4P35A 4ZEWA 3ZY4A 5T4FA 5CVVA 2AV6A 5I9TA 1HQCA 2NO0A 2HNKA 3DC7A 2VXOA 3UV3A 5K4AA 3V3KA 3CF6R 1K5HA 1KYZA 1RXSA 1IN1A 3NHKA 3AG6A 1XLTC 1PUXA 3OIDA 1EHIA 2IZ5A 4KQJA 3U4CA 1CF4A 3ZE2B 3MOIA 3QKUA 4HZIA 4TLDA 1IZ8A 1FRNA 1WF3A 4JLWA 4TSKA 4I1YA 3V1MA 1CLUA 4IS3A 4D9CA 3IT3A 4KI7A 2AE2A 4RCZA 3HKCA 5EZYF 2QBYA 2XWPA 1ATIA 2YVQA 4ZHSA 1U8YA 1HTWA 3E3NA 4H6XA 4HUQB 3GA5A 1Z5PA 3I2IA 1JQDA 2R9VA 4D43A 2IS1A 4EKNB 3EVCA 1N6IA 2OILA 3RJ9A 3GXBA 1J99A 2O2CA 2RAPA 3ELWA 4DY4A 1YFJA 2D3TA 5FPQA 4OREX 2WLSA 1TM4E 2BFPA 3D2BA 2BJHA 3M1IA 1HTTA 3NEPX 1Y63A 1NXPA 2DQZA 3EIHA 5DPMA 4KE6A 3FGZA 4E2YA 1BDMA 2VLIA 1XN1A 2ZKIA 3PFFA 1TI7A 3E9NA 3NX4A 3WG9A 3HLYA 3I1YA 4OP1A 2P9HA 5DOVA 2VKQA 1JU3A 2PAFA 1JJVA 4TTIA 2O8DA 1K4KA 1I0IA 2E4WA 4CXMA 5JAQA 1D4OA 1CY8A 4KK3A 4CT4B 4Q3CA 5BSWA 3OAAA 5F3WB 4C89A 3UMGA 2QJRA 5HRUA 4KGVA 4EW3A 2EP8A 4BX0A 3NRCA 3FCYA 3LSTA 4BNUA 3G2NA 4CM8B 4ZI7B 4ZYLA 5L53A 5AW0A 2G08A 4G84A 1BX1A 1PR1A 3A9TA 5HG0A 3V3TA 5HXAA 3U7EB 2Q0QA 5JSKA 1BMTA 4BMZA 5IJ9B 1E4OA 4QEZA 2Q3BA 3CF2A 1EWKA 3I12A 1J7JA 2DF8A 4XYBA 1BJTA 5HBRA 4PG5A 5EUMA 4KRFA 2JFXA 5GV7A 4QOJA 2PSFA 1HT2E 2BTOA 2EIXA 4PSKA 2D1SA 3BYZA 3G3EA 4UARA 4CL2A 1ONSA 4LJRA 2G6BA 2BDEA 3G2PA 4XKJA 1CJUC 2JD1A 2H9IA 3VBEA 2BFDA 1OV6A 2QQ0A 2IS4A 5FLYA 4TRJA 2BISA 4WKOA 4IDAA 4HVTA 1VMKA 4JBGA 2NV0A 2DM6A 4RY2A 3HBJA 1KI4A 1MAAA 3U4AA 3V2HA 5J47A 4J9UE 1LLFA 4QPPA 4PR0A 3FD8A 3CU5A 4GSKA 2P68A 2C59A 1U3GA 3IBGA 4RV4A 1OXTA 1P2GA 3BFPA 3OMLA 1B0UA 1X94A 2F55A 3KV3O 4HX5A 1BXGA 1EZ1A 3SHOA 3NHMA 4ER0A 5JRJA 1JDPA 3BFKA 3QITA 4N7JA 4YIHA 2PRSA 1NW6A 3TR6A 1V8DA 4BLTA 5IDXA 2QV0A 3DAGA 3WV4A 2QLFA 3L0PA 1VIAA 3HCWA 4ZMRA 2I80A 4L9AA 4M7WA 2Q0SA 2QTTA 3D8RA 1DOAA 1QDUA 2VDWB 5BN3A 4P3XA 2CB0A 5FUXA 1QO7A 2RIPA 2JFFA 3E3LA 5TB5A 1PVVA 4NBRA 1Q19A 3AFNA 4D46A 4YUZA 1XYYA 1N7GA 2WJHA 1RNLA 3HUTA 2C54A 2VQDA 1W2HA 1ZH8A 3QUBA 3H1PA 4KFRA 3REGA 3SSOA 3R6KA 4JP5A 4GT1A 4MX8A 2PY6A 1POXA 1XRQA 3GQBB 2H8GA 3DE3X 8OHMA 4J0KA 1CUXA 3W5JA 2JA1A 4B2YA 1XU7A 3ZDRA 1ZUNB 4EW2A 4L15A 4RQAA 3OFSA 2HPVA 1US8A 2IS6A 5AXBA 4G1VA 4BGEA 5FH9A 3DB1A 2J9FA 2A3NA 2OB1A 4MVXA 1PW7A 3ES9A 4U7FA 4W5HA 1GU0A 1E69A 1PZXA 1TAGA 3AX6A 1WCIA 2C4MA 1B3RA 3C39A 4HRAA 3O38A 1G0NA 2QJTA 3VU9B 3Q88A 3QI2A 3OPYA 3DXFA 3MWLA 5BUCA 2KWIA 3CRNA 2GT1A 4ZHQB 1WS6A 3UK1A 4CDGA 3QFHA 1L0BA 2GI4A 3PXGA 4E3ZA 1QRAA 3DWFA 4Q0MA 1YCFA 4EJMA 4F3KA 2FPIA 4D3YA 1KDTA 4HBZA 1VJGA 2UVPA 2X4LA 5LDDC 3TOXA 2VPQA 2PFSA 2ZYHA 1V4BA 1E2HA 1EA7A 2HMTA 2XECA 3HS3A 4GX2A 4HWGA 4XEUA 5ERYA 1EUZA 3UG6A 2A8YA 5KC8A 4BKRA 2XEXA 2OKCA 3ER6A 4CN8A 3FNBA 1Z5WA 4UZEA 3OTIA 5DCWA 2I3BA 4XVQA 5DRYA 1QGDA 2HSZA 1CQZA 1P45A 1ZOIA 4LUCA 3WJ1A 3WB2A 1OBFO 5LKRA 1C9MA 3I9FA 4KMSA 1NFFA 1T9BA 2JFZA 4N3GA 1TQHA 3NBUA 2IKSA 4L6AA 3W8RA 1UQTA 3BAZA 4P5DA 2R44A 4NY1A 2Z2IA 4BKPA 5CIWA 2XCOA 3HRKA 1CD5A 4FE7A 1YJ5A 1CUIA 3O92A 4HPJB 4RU1A 5D8DA 3TUJC 2W6PA 3RT7A 2WQ7A 3CX6A 4HMPA 3H11B 4HPXB 5K3CA 4YJ2A 4RCYA 1T9HA 3IUPA 4UEOA 4B6RA 3BK2A 1YNSA 1XQWA 5EHXA 2PX0A 2D2EA 3KBBA 2Z5VA 3GOHA 4CL8A 1FS5A 5ALLA 1E0DA 1EFKA 1X7ZA 4UQOA 4P4NA 4BX8A 2B6HA 4FNOA 3LDHA 4LCBA 2GPBA 4UHKA 1GZUA 2G1JA 2OMEA 3EZYA 2XGSA 5KOJA 3QTLA 1YB4A 3H5RA 1CK4A 2ENWA 3R8CA 3AEKA 5L3QB 1PU2A 2OHOA 3UAXA 4DV7B 2EFJA 2FDXA 1ZVVA 1JJFA 2DWPA 3N8NA 3BCUA 1TQ8A 1RMYA 2YYSA 3G1WA 3QX8A 4OYHA 2R4TA 1JTEA 1ISGA 1SUAA 1ZGCA 3W9BA 1DQZA 3VR3D 4F45A 3GEBA 2QT0A 3L46A 3PQEA 1WTHD 3ETLA 2E0IA 4N5HX 5JD3A 4L3VA 1JALA 3AT1A 2NPFA 5JC1A 2VP3A 2Z6UA 1P7CA 4DN6A 3FOAA 4E21A 2HRRA 3CRW1 5E4YA 3DZHA 3PB3A 2NZXA 1V2HE 3H5NA 4UDYX 4BYMA 2QYOA 1SZJG 2VUHB 3U6BA 1KR2A 4M8LA 2WYIA 5DCYA 3U4IA 4DMMA 1MJGM 3VQTA 1OH7A 4F96A 1XPRA 2DCUA 4NH0A 3DSRA 1JECA 5G0TA 2IHVA 4Z99A 4AZ3A 2G7MC 1EFUA 4J7CA 2V45A 4BATA 1LRLA 4UMDA 2OSBA 1N5MA 3AV0B 1DLJA 3DKRA 3EVGA 5C3UA 3LQFA 4KVGA 4R31A 4TVSA 3QEAZ 4Q93A 4J7AA 2GHRA 4XOPA 3ESDA 2C20A 5IS2A 1U3CA 3PR3A 4QX6A 1W4CA 4F86A 5TF0A 3JYQA 3L0OA 4Y2XA 1C1YA 4R69A 1FDVA 3C70A 4GW3A 2GBIA 3UJ3X 1MZVA 2CXSA 2PLWA 3ZX5A 3RLFA 4M54A 4MUMA 5H81A 5DCLA 2ZM5A 2ZZFA 1DJQA 2WJ6A 5GOZA 4BVBA 4DIEA 4IM7A 1KJQA 4Q4HA 4X7FA 1LTKA 2P5SA 5K8JB 2W5UA 1N5DA 2PUDA 3MCZA 2AUNA 5ALJA 2FE4A 3DOUA 2V7UA 3I45A 1YA8A 1JFLA 1TYEB 1EZZA 1I2BA 2EYUA 2FAXA 4LYGA 1G2QA 4KZKA 1VQ8B 2QUIA 3CCEB 2R7MA 3FYUC 1WOMA 2JIZD 4PSDA 5FPSA 1U0EA 2X42A 1G6HA 1R9NA 1LF0A 4OO3A 4R8VA 4EK9A 3UJ8A 3V7NA 3S2UA 1WZNA 3P71T 5MGBA 5EEHA 3FUWA 1Y6JA 2IYOA 4PR3A 4XA8A 4XSVA 3K96A 5KZMB 5IM4A 1H6AA 4BMCA 3TB6A 2R5WA 1JGTA 2FZGA 2ZUSA 3F4LA 5IDYA 2FMKA 2QL9A 2WIFA 3TPCA 5KQSA 4PZLA 4LV8B 2OYRA 4PLPA 5M04A 1D2EA 5DLQC 4IJKA 4X91A 4X8LA 2OFXA 3TL6A 3WSTA 3ZWAA 1JR3D 1NYTA 1Z07A 2H51A 1FP4A 2IELA 3JD0A 2ODTX 1F0PA 1UADA 2BTQB 2RGCA 4ERXA 2GEJA 3ISTA 1KQ3A 2IA5A 2V6GA 1XKXA 3R3WA 4P1ZA 5EKSA 3R6LA 2V6JA 1N6RA 4MW9A 3THWA 2X2OA 4WFKA 4DB4A 4EABA 5AKXA 3GVHA 2WMNB 1R66A 3ZUPA 5D2CA 3QMPA 1G3RA 3CX3A 5DN6A 2AFVA 2QN7A 4GM0A 1MENA 4YN3A 1Y7PA 2WPDD 3NU1A 3RYFB 3T3DA 2DGDA 4AK9A 4D41A 4MYRA 2GA9A 1DKMA 1NX9A 3EGWA 2JIZA 2ZT6A 1QG2A 1G21E 3D4IA 1SBYA 3NORA 2IHBA 2N42A 4HQRA 2PX3A 2B4QA 3CVVA 1VLZA 4MIYA 3KBOA 1Y5MA 1ZD8A 2IOFA 3GEEA 3L18A 3W06A 3VU1A 3U13A 3CNNA 1DADA 2VAMA 4G5HA 3TL2A 4TX1A 2VHJA 1A8HA 1VBFA 4GBMA 5AI4A 3U62A 2HPZA 4DLWA 2YN2A 1T4CA 2BF7A 2AN4A 2XUKA 1IZZA 1CS0B 4KN8A 3REQB 4BV9A 5JY6A 4DUPA 5F77A 3WGNA 2EP7A 4JLSA 1PW5A 1JR3A 2HHLA 4F4DA 1GL3A 2X2EA 4CGYA 4HGQA 1S9HA 1L8OA 4P4TA 4MI9A 1OFVA 1Y9DA 5G2OA 5IF3A 4JFRA 1EXNA 1FFHA 1ZGJA 3GVCA 1D09A 1K9SA 1N3IA 1LXCA 1R27A 1YZLA 3DFMA 4QAQA 1ZMXA 1PQ4A 4JVOA 1YVPA 5B2EA 2D9RA 1C7ZA 3EE6A 4DMLA 4NE2A 1ZN9A 3RHZA 4R0NA 1QH0A 3QVMA 2XTZA 2C77A 2DBVO 1ORDA 1TUIA 4JJAA 5HJ5A 1PWXA 3I2YX 4G24A 2MU1A 4OIMA 2Z04A 2RDMA 4L8WB 3NWJA 5EJMA 4OJQA 3WLSA 1S3GA 4F2DA 5KQLA 3QVJA 2ODEA 1LQTA 4IVRA 5C52B 4MZDA 4FKBA 1FFXB 3RUAA 4I6GA 2RJOA 4PZPA 4B74A 2H1RA 3GVKA 5BSHA 2GESA 4R9SA 1Z4IA 3U7RA 4NABA 2VF8A 4RMIA 4DC9A 3A6KA 4LQCA 1RE0A 2IZ0A 1VJ5A 4MUHA 2EGHA 2LP4Y 5E3HA 1H6CA 1V0EA 3ACBA 4GUAA 1CDDA 1F5SA 4TL9A 3EFOB 3ESYA 3IV7A 1T8WA 1BFKA 2D1FA 5CA1F 3ASVA 1G59A 1CUJA 3T95A 5C2JB 1E1YA 4I5GA 3UMJA 1G8JA 4CI0B 1T0UA 5IYNA 1EGQA 2RJNA 5TF4A 1FDIA 1R9GA 1E3TA 3EAGA 1SQGA 3WRXA 4OP2A 1MB2A 4R40A 3DBOB 3WVNA 4BLQA 1K8AD 4BO3A 4CQMB 4BS9A 1N77A 3B1WA 3PDUA 3MJCA 5CFNA 4DS3A 3DMDA 5JYBA 2VJLA 1WP6A 4INOA 3B20A 1IHXA 1VYTA 5FPYA 1XZKA 1TUBB 2NU7B 4ZOCA 4KKSA 1HEUA 4U7TB 4XWKA 3ILYA 4JGBA 1TA9A 4U2DA 4MYTA 2EKBA 3FRJA 4WGFA 1WVGA 4YACA 3ZD9A 2WJ4A 3OJ0A 2WUGA 3P9KA 4G8JA 3X44A 4KR9A 7ADHA 4KO4S 5M5BA 3IKTA 4R8KA 4P86A 1EDBA 3H2ZA 3A26A 2F1LA 5A8AA 2GAOA 4XR9A 1V1MB 3DOFA 3JQ8B 1S2IA 5DGIA 2HBYA 1I14A 4RS3A 1HRDA 2ZT5A 1E2BA 3RNLA 4OK3A 4I50B 3L7KA 2VNAA 3MFQA 3MTBA 3SLNA 2JANA 3V8QA 1PYDA 4CLOA 1E79D 1A7AA 3GG9A 4XJXA 1IULA 4BMSA 1XHLA 4ZIRB 1IDOA 4FCTA 5TJHA 2B25A 5L46A 2IF2A 5EJIA 2ZR9A 2FK7A 2AKEA 4KK4A 1Y8RB 4UM9D 1KK0A 1E3IA 1UEJA 4CEHB 2BI7A 4E22A 5HFJA 2PVPA 3MG9A 4YJ3A 1XZBA 2IPNA 4RW0A 5JNUA 3K1AA 4FFLA 4OK6A 2QIOA 3L1HA 3OG9A 3PSHA 2A9QA 2WHPB 2ZRDA 3I6MA 3VZCA 1GNVA 2GCIA 3UK7A 4DBVO 4U9UA 1RYBA 2IQ5A 2ZBEA 5KIAA 3VC1A 4ZGBA 4NFSA 2HWWA 3CUVA 4M9CA 4U7WA 4AO8A 4BRSA 3ADKA 1Y4DE 3KR1A 2F8TA 5C1PA 1KJYA 2Q5LA 2GKSA 3CQ9A 4K3VA 3D3JA 4WCFA 1OOEA 2IXFA 3D8SA 1CJMA 1X42A 4F1JA 1EFAA 2OCXA 1Y3FE 3CP2A 4U7DA 1NW7A 2IYRA 2ZAMA 3CS3A 4DSAA 3EHEA 3GNLA 2XCLA 1VL2A 2NSJA 4A2WA 1RPZA 2K87A 3FOZA 1C4KA 4LJ7A 1Y8AA 1H5QA 4MKHA 1E79A 4J8PA 2W2TA 2ZDHA 5E1OA 3O4IA 5KQPA 2WJIA 3TBFA 5IXYA 1Q0TA 2A9PA 4FCCA 2XVAA 1YR7A 2DT8A 5IVIA 2O5EA 1O8BA 1VHEA 1DIAA 1T0BA 1XMIA 2RHJA 3R75A 4ZVKA 4TLAA 4QDTA 3FN4A 1TAQA 3WK6A 1VCMA 1ZYUA 3D7MA 3PJFA 2QB5A 4OYRA 3I53A 2PO5A 1U0OC 3O0DA 4LDPA 1KOGA 3ONYA 1PR3A 1XTIA 2C4HA 2CXXA 2VJBA 5BWMA 2DKOA 1EFVB 1O54A 2HK8A 2WFLA 4HN9A 1NV9A 3QMWA 4OGKA 2EFHB 3O8DA 3KQYA 3OSUA 4TXHA 3SJPA 4UULA 5EE0A 4L7QA 3VO9A 4BNIA 4BUCA 4GXNA 5GAJA 3UFXA 2DTDA 5JCJD 1SU4A 4EKIA 3CZQA 3PJDA 4LGMA 4J4TA 4QDOA 2FSFA 4Y8VA 4DFDA 2NO4A 1BVYF 5BR1A 3WIDA 4PTLA 4CMJA 4BMNA 2BZGA 1P0CA 4XWYA 4RKEA 3DLBA 3QKSA 2Q3DA 2HDWA 3H8SA 2DFVA 1QPBA 2ZZGA 3OURA 2NU9B 1NN1A 3WRYC 3ITNA 4INZA 3TUIC 3WZMA 3CH4B 2A94A 3Q5GA 1VQKB 1MRZA 2I7DA 4L7VA 4F9TA 3I01M 1PG0A 1BRTA 1J0AA 3IYLW 4FC7A 2BEWB 3AKCA 4LG1A 4WOPA 2B4AA 3S44A 2I6GA 4FR2A 3KLOA 4A5OA 1SOAA 4OI2A 3CPSA 3EUEA 2AZDA 5AVTA 4KR6A 2I7XA 4ABYA 4KN9S 3JZAA 2QV7A 5JHHB 2JFOA 3TDMA 1Z6TA 1OVMA 2JGAA 1O6GA 4O5OA 2O8CA 3DMTC 3GD5A 5DM0A 5ELLA 1VCOA 2Q5EA 2OHVA 2C3OA 2B1RA 4AUEA 2R8XA 3H4TA 4FHFA 2ZKLA 5CXXA 4E2ZA 1XR3A 1VLOA 1GRQA 4YAGA 1L5KA 2WMOB 4WY2A 3PRKE 3MT7A 4J3FA 1Z4KA 2AYYA 4WXRA 3JATA 1KEZA 5ECGC 2N1MA 5LSAA 3V1KA 2ZE7A 4EB8A 4M0EA 1U0NA 1XTZA 2GAIA 2V6MA 2WQZA 4HLUA 3LO8A 5JCJA 4H4DA 3WGKA 1M74A 3RQSA 1DOHA 4OI0A 4RJKA 3UICA 2NMVA 3GFPA 2JFWA 1USWA 3L05A 4Q4DA 5U4QA 1CQIB 1ZY2A 2PXHA 2P5UA 5BMVB 4PCLA 1KMNA 4XN3A 2BUBA 3EEBA 1DLIA 4NR0A 3UJNA 4RIIA 2VBUA 3CV3A 2OCPA 4JS0A 4R2IA 4BU1A 5J23A 5AKHA 3MJTA 3U0BA 5MN6A 1L4FA 2JHCA 2VHZA 2HO5A 3K94A 2WWFA 1Y5RA 3LG2A 3DV0B 2QP3A 3IIKA 4FZVA 4F11A 1H85A 1R6BX 4LF8B 4PZ9A 1M1ZA 4MS1B 4Z9BA 2ANCA 1SKUA 2XHZA 1DVRA 4B34A 3NONA 1IY2A 1JZQA 3SEQA 2DWUA 1NW3A 4Q15A 4KAAA 4CDNA 1R0CA 3NB0A 1O94C 3L4BC 1HQKA 4DV2B 4ROTA 5LQSA 2VDLB 1EESA 4EZIA 3E82A 1MR3F 4ESEA 2DAPA 3K73O 2YFKA 3IJPA 5BOSA 1XNGA 2PV0A 2EKQA 3OTHA 4PVDA 2OXEA 3P9SA 4U5XA 3SNKA 3FROA 4QU9A 4ARZB 2OZVA 3O3CA 3KKPA 1QGED 5T6BA 1KI8A 3OF3A 2DQSA 4IQGA 2Z2YA 1ZXBA 4HN4B 4BGUA 3U56A 1LTQA 3W7VA 1Z3CA 4PC3A 1ZN7A 3F46A 1Z2CA 4ZGNB 1K28D 1D5CA 3FFTA 3D3WA 3IVGA 4B3DA 4M53A 1RAAA 5D00A 1N0VC 1DQPA 2OV1A 4B35A 4L22A 2EATA 1F1JA 4AQDA 2F6RA 3IURA 5ABPA 2QYHA 4DARA 5KREA 4B3MB 1JU4A 3BTSA 4Q48A 5K0NA 5L6LB 4JQZA 4DNRB 4URFA 1A7KA 3C3JA 3IELA 4B75A 1P8JA 2DFTA 3E5RA 1WDWB 1MB3A 3HH8A 3EEOA 3HAGA 1Y8QA 1PHRA 1ESZA 3GYBA 3MT9A 5B3KA 2F8SA 2UUOA 3ASRA 2D0PB 2XUDA 4QPJC 2I3GA 1TM1E 4MJXA 3SX4A 4DDMA 4DGQA 4UBMA 3S2GA 4F3CA 3NHPA 3HXQA 3GLFB 4A2CA 3NHRA 4TV8B 1CUUA 1H5NA 3G8AA 4YVFA 3SQLA 4K0KB 2RG7A 4CMGA 2IS2A 4M0DA 3GT7A 2C2OA 3M9XA 4P53A 4EYOA 4Q3AA 2GO1A 2Q5JA 3OX1A 1OU0A 1TKRA 3NP9A 4V0ME 3E2IA 4B4OA 4QBGB 1RXEA 2VOEA 3FGPA 2OGZA 2P35A 3SI7A 1XYVA 2QE6A 3AJDA 2CHFA 4DR5B 4AI6A 3CKKA 1PJ5A 4DDVA 2XT6A 4FMBB 5JD5A 1CXZA 1C7JA 2PGLA 3PQ3A 1XZQA 5DTMA 4C0XA 2QMOA 3CUWA 3V80A 4I55F 4C0WA 1K98A 5AVXA 3OA0A 2ZJ5A 5LFAA 2H2HA 4OXIA 4PIMA 2ECQA 2KB0A 3BMNA 4K1LA 3N2YA 1TKAA 2P9BA 2NPIA 2ZTNA 1YRBA 1QS0B 3B89A 4B8YA 4ZV4A 4N5IX 4DK0A 4Q7KA 1GGFA 4RK1A 2J08A 4DRYA 1R0SA 1KP9A 4UM8B 1I3KA 1ZOPA 1Z33A 1BLIA 1IM5A 3H75A 3Q12A 4CQLB 1LK7A 5EPUA 3UF0A 3TFOA 5LA6A 2E37A 5FTMA 1GCAA 2JI4A 1K8YB 1V5IA 3A6DA 4KEAA 1DG1G 2FPPA 4NCNA 1XE3A 1Y7IA 3OETA 4INAA 5C34B 2DFKB 2C5GA 3LRPA 4QDXA 3CF4G 3FPEA 4MZXA 1JEOA 2LDXA 2OG2A 2GHTA 4K1XA 3EXHC 4U8GA 3OCXA 4X0EA 3N0XA 2Z09A 3KSUA 3UUGA 1Z6QA 2I2CA 2ZCJA 2JLUA 4GYKA 3SZLA 3EXG2 4DB2A 1I3OA 1VJRA 3GFTA 1GG2A 4NZNA 3LDFA 5ENVA 1EX9A 4II7A 3IQFA 4IDCA 1S01A 4B6JA 2IXDA 1N5LA 1V3QE 1VKRA 4HD8A 1XD2B 1XRNA 1D2CA 4L28A 4QWMA 1YJAA 5TVKA 3TLYA 4C07A 5I4CA 5KJFA 3H13A 3FZNA 4HEHA 1M1YA 3KWFA 3RSQA 5C8DA 2QZJA 1NF8A 3ZCQA 3ONUA 4GU5A 2UUCB 2V1UA 4Q34A 3OSZA 2IGTA 1MVLA 3HCEA 5MFZA 1EXDA 2C9YA 4BCBA 3CONA 1SD2A 4CEIA 4IMPA 1SVUA 4LDJA 1GTJ1 3RJTA 4RD0A 1HE3A 3OZSA 1RXVA 1A9RA 3CJRA 1NQXA 1NXTA 2XXJA 1ZK0A 1U65A 2WAAA 3AIIA 1C3JA 4ND2A 2PUEA 4L76A 3TZKA 1X1RA 2GA8A 5IEJA 4PG8A 4JBNA 2EKDA 2R00C 4A03A 1GPJA 1AKWA 2QVCA 4Q1EA 4ZXFA 4B73A 5TE9A 1F8UA 3P2MA 3USCS 2YXNA 5EINA 3COZA 3B6IA 5GVSA 1U8EA 1XQ1A 4NCHA 2J5RA 5CR9A 3S2IA 4AIIA 1QVWA 2OGSA 3HSSA 5FUWA 1USUA 3ELBA 4YRIA 1TF5A 3P97A 1I9CA 5J2TA 5CTAA 2F43B 3TAXA 4V2UA 1TYBE 3HZHA 1KI9A 2OV3A 2ZSBA 2QN8A 1Y9AA 3DF9A 4P4LA 5E1BA 3BMOA 3HYSA 1EAYA 1KH1A 2SHKA 2C3UA 2DHRA 3CW8X 2QQFA 3N07A 4D56A 5C1OA 3DHNA 3GLGE 4PZ0A 1M8KA 2M5SA 1P7VA 1QV9A 3EDRA 1S02A 3CISA 3LDUA 3N2ZB 1SBIA 4FYYA 4PYMA 3GY0A 4ZJYA 2X6TA 4JHXA 1TD1A 2W0MA 5HIMA 1PJ2A 2ID8A 2QG6A 4L74A 1OZAA 4TZTA 4WK6A 3GRPA 1GUDA 5BP7A 1FMJA 4Y9DA 5CB4A 4DVJA 1RQ2A 1ULBA 3CLRD 1CUVA 3IOMA 2J3HA 2HTFA 1VHTA 4P32A 3MPUA 4RKYA 2PS9A 5AXDA 1HK7A 1XFAA 3D7NA 4ZAGA 4EMUA 1VBNA 1GPNA 2NPOA 3GGCA 1KXZA 1MPXA 2BOVA 2Q6LA 2WT4A 4P80A 4UXIA 3RW9A 4EMSA 3FHTA 4CT0A 4UFNA 3HU2A 3MMZA 5F4BA 4GXQA 3ET5A 4QPCA 3DCYA 3OP1A 2H08A 1BRMA 3ICQB 1JG6A 2NXCA 2VL7A 4XRGA 4LHXA 1NVMB 2QYTA 3PCTA 3QTBA 1BKDR 1VHQA 2I6QA 2H5IA 2P6PA 3MILA 3PL5A 3OTGA 4LJ9A 3TRJA 4CF3A 3IUNA 4X6YA 1DIHA 1P62B 3AETB 4IS2A 3H2IA 5BOVA 1Y5IA 4DJTA 1P9RA 1T0JB 1W2GA 2XYQA 1LFAA 5F4ZA 3IOYA 4QDJA 2GARA 4BNTA 4EF4A 5B2ZA 4RQBA 1YB7A 3CVWA 5JJKA 1Z08A 2RI1A 1N0UA 4RZ3A 5G1NA 1EG2A 3NPAA 5IAGA 3HPQA 1KK3A 4DANA 2VTEA 4OHXA 3OM0A 1JQLB 1PR0A 4N65A 2N47A 3PJEA 4A0SA 1E1QD 4G97A 2C4UA 3VX3A 2HQRA 4R16A 4CLRB 5SZJA 5C9ZA 4NE9A 1XK7A 1JYFA 3GJ8A 4YAWA 3I62A 1EK1A 2A1IA 2F62A 3HXLA 3P7MA 3LBHA 4AMVA 2FQYA 2OZEA 5BV7A 2AJCA 5IMSA 1WA5A 2I4TA 4JUBA 4WUTA 3E1YE 5DTJA 3U40A 1VSVA 3TQTA 1W36C 3AL0C 4ALMA 5ALDA 1OYWA 1Z0AA 5IASA 2JW5A 2JVKA 4ZVQA 4X7CA 1GL9B 1XZIA 2RIRA 1QGUA 2ST1A 4K86A 2GETA 3THXB 1PVDA 2MYPA 1I2ZA 3GLIA 5LKAA 1SUWA 3FM9A 1DEOA 4UDNA 4U02A 4QG7A 2GWRA 3CLRC 2C31A 1F48A 3DPIA 4X60A 3VKFA 1E61A 3W8DA 2E1PA 3ND9A 3WKCA 3WWOA 3ZEIA 1W5TA 2YHIA 1B6SA 3CESA 2VHQA 4KQHA 4MCHA 4MMYB 3DEYX 4KIGA 4K9KA 1C30B 2XT0A 2GNAA 1OI4A 4FOSA 3QVKA 4G63A 4CV3A 3OF5A 1FXSA 2FI1A 4A0QA 4DKXA 1XCGB 2VWPA 3HDYA 5F5NA 3E9CA 1MVNA 4GMXA 3WQBA 1S9DA 1T2VA 1YF3A 4H1HA 2CV1A 4D3XA 4P38A 1N5OX 3EW9A 3OCYA 5JYCA 5AKIA 4QSMA 4ER6A 4MW0A 1TO1E 3N8DA 3KEWA 3SDSA 1MIOA 4JLNA 3RTDA 1P3Y1 3KUKA 1ISJA 1P74A 2HYDA 4P9SA 4M2LA 2QK4A 1E1QA 3BK1A 1GRVA 1AQ6A 2EEZA 3ED1A 3UA4A 1G9TA 2G5TA 4IFBA 5IZCC 3A25A 1M0WA 5CH5A 3CH5A 5TPZD 4BV3A 2KX7A 5IWAB 1V9SA 1AK9A 2J4DA 3X2EA 3O83A 3DDWA 3L7BA 3ZWKA 5L3SB 1RKVA 4CQNA 5JMPA 3OZUA 1DAFA 1G6KA 1PIWA 3UTCA 4Q3BA 3ZDBA 4ZCQA 4NDAA 4Q4JA 1C1DA 1WZUA 2FGKA 3TD6A 3ZXXA 4CLEA 1ZESA 1EI9A 1CY0A 4HT3B 3T3IA 3FPCA 1BS9A 4MW6A 2B8NA 4IJWA 5C80A 1Z22A 2P2DA 4ZI3A 1H2HA 4LXGA 4DV5B 3COVA 1JW9B 1P5HA 3CZMA 3F0TA 3PC8C 2AHRA 2WAMA 3LA8A 3TXXA 4AMYA 4DCMA 5JTTA 1PGJA 2YJ4A 4OAOA 4IVQA 2FEPA 4P7GA 1U0JA 4NVRA 1ZRSA 2XH8A 3A1EA 2MINA 4F8JA 2OR3A 3FWYA 4CMIA 1NW4A 2CD7A 2IGBA 1E7YA 2FUNB 3L7CA 2FW0A 1LWOA 3RAJA 3OCVA 5HXBA 1PUIA 2GREA 3H97A 2PZGA 4B6SA 2XWSA 4OXNA 2IX3A 3ODGA 2X0KA 1O95C 2W6QA 1JPJA 1E77A 2XB4A 3NWOA 4OHCA 4URUR 4DLAA 1AMUA 2VAPA 1HE8B 2W43A 1B41A 1D9ZA 4CM4B 5JJBA 2HT1A 3NHYA 3AERB 3C8HA 3N3BC 3KYJB 3M6LA 1R10A 3DL4A 5JEDA 1IJBA 1XJCA 2F2TA 1WOYA 3G5UA 3SKVA 1NQVA 3HCNA 4DJEC 4IP0A 3SZOA 1KIAA 5E7QA 1Q1NA 3HP1A 4N39A 4Q24A 5TPZA 2NSLA 3PFNA 2OFPA 4ZZ1A 4M8SA 1OPRA 1RCUA 3V9AA 5DNWA 4Q16A 4A23A 2O8FB 4ZYWA 2FPRA 2X5JO 5A05A 4OHKA 2PYZA 2WG2A 4R2LA 5HIJA 2CNLA 3H6HA 3LHFA 1SOVA 4PC1A 1V9CA 4JHLA 4JLBA 5FNVA 1IHUA 5ETJA 4BFZA 5AD1A 4TSFD 5D3QA 1TIBA 3E05A 2YWRA 1BG6A 2RH4A 2WHYA 3PNQA 3TIIA 3JVIA 2RGNC 2X9VA 3KQMA 3NDRA 1X80B 3CCMB 2A59A 3PHLA 1U80A 1AC5A 2ZRLA 4GI1A 1BGXT 4HDQB 4HQLA 4ZQCB 4DA8A 4K6GA 1N06A 1SAYA 1FFEA 1UXGA 2BKVA 1CR4A 1XZFA 3DM9B 3K0AA 1OX6A 3P9IA 2Q41A 4KWIA 1MMFB 3CEHA 3SSAA 3S29A 2NTJA 5EUCA 1NASA 3VDQA 1UKAA 3C1UA 4JL8A 1U28C 1SCNE 2XMDA 3D7KA 1XRMA 4YJHA 1WHSA 2J4FA 4IIJF 2FU5C 4GVXA 3KUUA 3JQAB 1ISFA 4PCUA 1LDEA 2DJIA 3AVYA 3AW8A 4ZT5A 3KZ1E 2GCPA 3IRVA 3RV4A 4NOMA 1XAIA 2G5CA 1QOZA 3H6GA 3B1FA 4J0IA 4HXFB 2OAEA 1AUQA 4M8IA 1P7PA 4FB5A 2GR9A 1R5OA 3AEQA 4B3BA 5KDDA 1KVUA 2GCEA 2Q62A 3HVUA 3LBYA 4NZ9A 3DULA 2X8LA 3UAWA 1C7QA 2B7LA 1OLSB 1DC3A 3LUJA 1EZ4A 2Q2NA 5CAEB 3FOBA 5EMMA 1DX6A 2Y99A 4RF2A 1Z6YA 4IIEA 2Y0EA 1QX4A 4AJHA 4B6GA 4N7RA 4Q1FA 2O19A 2C7VA 1M1NA 4TSFA 3G79A 3A8KA 1N07A 1K86A 1GKIA 5EYPA 4Y18A 4FNAA 3L07A 4JK3A 4K7JA 4NJMA 5DTIA 2Q4RA 3PGKA 4YRMA 1P72A 3HSYA 3PR1A 1BE6A 1KHHA 1R74A 2QRNA 5FA8A 3Q6NA 3JWIA 1IFXA 2LVBA 1X70A 4M9SA 3GA7A 1C8LA 1S5PA 1I8TA 1E94E 2NTNA 3C3KA 4F5EA 1XQXA 2BMEA 2K2WA 1X3SA 3LT2A 2RHOA 1VGVA 4MDYA 2ZYIA 4FDLA 1H4QA 3MCUA 1BD3A 3H7IA 4ZCRA 1WD5A 1K3TA 3HVJA 3TLXA 1TYCA 1P2FA 5CMLA 4BUJA 5BSFA 3RRXA 5BXYA 1AU9A 3OPXA 3GP8A 5I4BA 2VH1A 2WIJA 3RF7A 2SKCA 1A76A 1RJDA 4ZYUA 3RSHA 3IODA 5JC8A 3DHEA 4TTSA 4P34A 5C53B 4OPOA 2O2DA 3HN2A 4MPDA 1JEQA 2JJ8A 5JSZA 3PYLA 4YCJA 2Q9AA 3EOAI 3LLVA 3LKBA 4CODB 4U9HS 1UK7A 5JNTA 1G8FA 1Z28A 1NBHA 1UFQA 4B3IA 4P3KA 3RFCA 4QQRA 3UC5A 4B5KA 1V0FA 3NHBA 1II8B 1AMOA 4FGUA 1J8MF 3EISA 4DV0B 3DBVO 5JI2E 2PL5A 4AF6A 4LJAA 1C29B 4PLHA 2G82A 1TB4A 2ZZEA 3BN3A 4HDNA 2ODNA 3IA7A 4ALNA 3ZDYB 4EKDA 4X95A 3W6NA 4BNJA 3ZGOA 1K68A 2PWBA 1TMOA 5A2QA 1U9ZA 3OW2B 3Q8XB 2XNDD 4ND8A 5B64A 1NXOA 4WE3A 3RNOA 1CVLA 2P0YA 4FYKA 4Y9TA 1J90A 2HDNB 3E70C 4E5SA 4F4IA 1JXMA 3BJEA 1L7AA 2I1WA 4JI2B 2IBMA 1CZNA 4MVJE 1IL0A 2BWJA 4NFHA 3WIOA 3BE5A 1N0HA 4P3PA 3IAEA 4FYXA 2HJGA 3HCPA 3CUSA 4KP7A 4RL6A 4Z4ZA 3H9BA 3BC9A 4MROA 4ZO8A 1THZA 1UEXC 3PF9A 4LK2A 4P36A 4BB5A 1IVYA 1HLGA 4C7MA 5BSGA 1Y7HA 2PWAA 1ODLA 3HKEA 5EKDA 1A9PA 4AP6A 4NAVA 2YVKA 3RVPA 5I4KA 1QFYA 4C6RA 2P2LA 2F3RA 3K6JA 2V7VA 4AY2A 2QRPA 5CDFA 2CZGA 4GYYA 5KTPA 2PSEA 1HG1A 2BEUB 1U6JA 1EFCA 2PEYA 2JLWA 1QFSA 1G8PA 3A6JA 4WX2B 2HLDD 1ZBQA 1DO8A 3UB4A 2ZE8A 4PQRA 1D0IA 3BGWA 3LK6A 4PPYA 2VDQB 2YJZA 1MDFA 5JADA 1ADFA 4O4HA 4GC5A 5GJWC 4DCCA 2ZB7A 1KNQA 1YGPA 1W93A 2ADOA 4XTRA 3U9TA 2C96A 5E6UA 4H0NA 2GEKA 3M6MD 3TIGA 5CUQA 2VJOA 1LX7A 3IEXA 1Z82A 1AKRA 3K20A 4P22A 1RWPA 2DJ5A 1BCRB 1C4WA 2JS7A 4G0YA 4GQAA 4AD8A 2VF5X 1U2GA 4JODA 3WGHA 4DG5A 1C9EA 2XNDA 2OXRA 1LBHA 2R5NA 2I4MA 1WQ3A 2ZP1A 2ZRCA 4KH1A 3RVOA 4QREA 2HA5A 5AW8A 5AW7A 4PFJA 3NJ4A 1WOOA 4F6RB 1A2QA 2QVLA 2WF7A 4S35A 5EP4A 5KYKA 4XM0A 2O8NA 2FFBA 4IW3B 5LQDA 3EZ6A 1GVNB 2C5EA 4ZPXA 4CDRA 2D7CA 5CLJA 1ZUIA 4GNKA 2JKYA 5EEGA 3CFYA 3R7SA 1R8SA 3F71A 5CM8B 2JFGA 3I4FA 2X0RA 2PH5A 3HCOA 2AEFA 2Y77A 3AFMA 3K2EA 3K9WA 3WLFA 1UT6A 3SJUA 5JAHA 4MEBA 4I4NA 1K2WA 4ENPA 1SCIA 4WY8A 5FD8A 3QVWA 4JAVC 5TQ2B 5AMXA 5IEBA 2ZSAA 1K6IA 1KIMA 2HLDA 3PHHA 1ZJ5A 3E22B 4KQWA 4U39A 4Q3KA 1VC2A 3T7EA 1P31A 2ATIA 4BJ1A 4MDEA 4L08A 1RI3A 4ZU6X 1R5NA 3CNQS 3G23A 1UUFA 4B3XA 3QGMA 1D9XA 3N9IA 3OQIA 1SVSA 3QLTA 4IIXA 3NAZA 4GGMX 4OLFA 1VLMA 3EGXA 3RTEA 4C6HA 2D1QA 2LE0A 1R8QA 3IOBA 3ZLJA 4J0HA 5KI6A 1C50A 2AA3A 1NX6A 4LSGA 4U2EA 3LRTA 3OTWA 1R0XA 2O3SA 3GGJA 3Q40A 4I4TF 1JJ7A 1LC0A 2X0NA 3LZCA 4Y6RA 3LGAA 3ZTYA 3R8XA 2AMYA 5IH7A 5JVDF 5KYVA 1S4MA 1B74A 4HS9A 1JHUA 4MB6A 4BAGA 4D4HA 4DCVA 1KPGA 4A6PA 5LQAA 3TX6A 3BJZA 1T5SA 3M83A 4QNRA 5T4EA 3S27A 4DLSA 1I1OA 3N74A 2W71A 4ZT6A 4AKGA 4HGPA 3WBBA 3ETEA 4W82A 3GNTA 1VBKA 1OBVA 3UK6A 2C4NA 2OK8A 3ZTTA 1V1JA 4EYSA 4XH9B 1DC4A 4YT4A 3R9XA 2QZPA 3U7QA 2FUKA 3LX4A 4IIDA 3VZQA 3P8ZA 1INLA 4A2PA 4M55A 2OESA 1N05A 2OCIA 3M4ZA 4JZYA 4QXOA 2VSXA 1Y9ZA 2CXQA 4J07A 2YZNA 3RO7A 1EK6A 1EXVA 2E1BA 4CTNA 2EDAA 4F3YA 4LOLA 5KPJA 2Q27A 4LGCA 1SCDA 4ZWNA 3ZEAA 4EFMA 1Z0FA 3WDMA 1PGOA 5EZYA 1Q1ZA 4C0JA 4F0JA 4A8JC 1L5MA 4PYKA 3ZGNA 3D8UA 3EC7A 4FOTA 4LZZA 1LUAA 4EGFA 5GINE 2LKDA 1T4GA 1TC1A 1EYZA 4FJ0A 4PLCA 2A5FA 4RK6A 3ZH2A 1DCKA 1HWYA 3GEPA 3MTAA 4OHUA 2PPLA 2OGUA 4E7PA 4ESVA 1HQYE 1RAFA 1WP9A 3D7RA 3TMKA 4DJAA 5JSUA 3S81A 5AKZA 1YWGO 4HI0E 1BX0A 1MVOA 2IYYA 3TAHA 1V1RB 4G2NA 2V58A 4RORA 1ENZA 1S8FA 2QMQA 5FL3A 1E8DA 3MT8A 1AVTA 4NRDA 4TWIA 3AY0A 3FPLA 2IEZA 3DT6A 4YJFB 1J97A 2QW1A 1Z06A 2X76A 1F51E 3AOGA 4N0QA 4EDHA 1D2NA 3VNUA 2GN1A 2AN5A 4QYTA 4E46A 1JI3A 2WM9B 1I1NA 3IBFA 1OI3A 1O97C 3IB3A 4URWR 5DV9A 5A6VA 5FUMA 2PMFA 1VLQA 5CITA 1QO0A 2A0UA 4GYWA 4KLNA 3C7CB 2IX9A 2RH5A 2Z95A 3KLPX 4LZNA 3X1XA 1OYYA 4C0KA 3BSWA 3IAAA 1QO9A 5JI3E 2C84A 2HPAA 3DDOA 4GZ3A 3H3JA 2DETA 5EWLA 3U31A 1T43A 3GUCA 4NNJA 1X8LA 4NG5A 4JMPA 2Y66A 3TD9A 5IWCA 5IDWA 2CNWD 3KHTA 2CUNA 3ZGVA 1YMVA 3UPTA 1WMBA 4FX5A 5F7XA 3V4PB 3O8OB 1R37A 1JHMA 4Y3UA 1GAJA 1L8XA 1LNZA 4H77A 3O21A 4HADA 1VB3A 2E4ZA 5BYAA 2PUJA 2MTBA 4Z4WA 4ZO4A 3TXAA 1FL9A 4ZT3A 3SF0A 3ZK9A 5JQWA 2J6BA 5K0CA 1HO3A 2CY0A 1PDVA 2P3MA 2QR5A 4FYIA 3OEHD 4BNGA 4XLLA 1KQOA 2WFZA 5H5JA 2ZRFA 1XLTA 2L42A 3ZIDA 4PYNA 3LP5A 2WEKA 1KERA 3VA7A 1CNMA 1ZNQO 2OPHA 3OT4A 4J0CA 1AV6A 4F3TA 2I29A 1YBAA 3EA5A 3T7TA 1L5HB 4TV9F 2BBWA 2PT9A 2BGGA 2YRFA 5F35A 2VTBB 3C4JA 3R74A 1OFGA 3V6LA 1FJHA 1EP3B 1NDUA 2ZWMA 4U7JA 3FFBA 4LRUA 1IOZA 5FUBA 3ZYCA 3QKIA 4NLLA 1Q81D 1YFLA 1FY2A 1NZFA 2CN1A 1M8FA 2IU3A 2PH1A 3UTDA 2P1ZA 1LBQA 2XNJA 1AA6A 1ENPA 1P5ZB 2QRQA 1UC8A 4GOKA 5DWDA 3S4YA 3S2YA 1XIVA 1XGKA 5TMBA 5P8WA 3LWBA 1IBCA 4W1SA 5F4MA 4C5BA 5I3ZA 3AVVA 1NLUA 1VJ0A 1A5BB 4CTJA 1OBHA 2VK2A 3ZDXB 4DDHA 1ZI8A 3JTEA 1E3QA 3QELB 3A1NA 3U48A 3VO8A 2I66A 2VT7A 3HWX1 4XM2A 1PS0A 2QKYA 5TARA 1IWBB 1L1EA 4ATNA 3D4NA 4YMGA 2HHCA 2PBZA 4N8DA 2X8AA 3I1IA 5IYZF 3O03A 5CA0B 4FN5A 3MPOA 3CMAB 4UFPA 5A3RA 3BRQA 2QLNA 3GJZA 5M3BA 4B76A 2F9LA 4ZZ0A 1E6WA 4XPIA 1HEYA 1YIJB 1NONA 4LTNA 4CV0A 2BPOA 3M3PA 5TDHA 3ESCA 3RM3A 3L9XA 4D6XA 3D9QX 1SWWA 4AMUA 2FK8A 4F1WA 1IEVA 9ABPA 2XCSB 1HNZB 2EJUA 5BSUA 3DBRA 5ESXA 2CF5A 1CB7A 3H17A 1F8YA 4RGQA 1ESMA 4AJOA 3W2FA 2NAFA 4DRXB 2L82A 2JC3A 5MN4A 1Z8HA 1O0BA 1RMQA 4O2RA 3JVVA 5FI5A 1JF8A 1TT7A 3DW3X 1HX7A 3P27A 1ECCA 4ISCA 4EJFA 3KJQA 2AEJA 3PQCA 5KMGA 4E08A 1HLDA 4HDCA 3E9QA 2QEQA 2JGJA 2XOXA 1ARZA 2CC2A 4BWGA 4RSGA 3VR6A 4DTIA 1H4TA 1C3VA 1PVOA 1YI2B 4GLFA 4HWRA 4MVWA 3V8VA 2OWEA 2B4KA 4HQFA 4B9AA 2A7QA 2Q1WA 1ODJA 1NFRA 4EUHA 4J16A 3LCCA 3CB2A 3K4QA 2QAGC 4FQ7A 3F3YA 4MTCA 3CG4A 5FOTA 1BCSB 4AZVA 4LN1A 5HNKA 2ZXFA 3O4GA 4FK8A 2YCBA 2FFRA 4NBKA 1X14A 1N2XA 4O63O 1RAEA 3AESA 1DO2A 3COPA 1KO8A 1PDWA 3SKXA 5FOQA 1JX6A 5EWJB 4M0CA 1ZOOA 1H3FA 1AE1A 1ZMTA 3TW8A 2XI4A 2RONA 3QLUC 3ANYB 4C4XA 1PK9A 1GKYA 5IAEA 3BHNA 3F6YA 2VAWA 4H3HB 4XOUA 2WIDA 1AB5A 1ZIOA 2VJCA 5LBIA 4Z7QB 4X94A 5E3JA 4P4UA 1A71A 1JWBB 3BXZA 3DL0A 3PNOA 1I2AA 1HPLA 3NM4A 1EVYA 3IV6A 3KG2A 1NOIA 3TR5A 3M81A 1AGYA 2JAPA 5A9TA 4DCJA 1GNLA 2VZ8A 1NZJA 4HYEA 4EHIA 4LBYA 5DLEA 2ZXEA 3OT1A 3F8WA 4Y2TA 3GFVA 4RDHA 4L51A 2XOKA 3OIVA 3HG7A 1Z5UA 4OUDB 3UMVA 4HG2A 5E8JA 4P3YA 4H08A 4LJ4A 4RWEA 2JEZA 4O1IA 1G8SA 1UR5A 2QRVA 4IV8A 2BP7B 5DYNA 3VAZA 1Q7TA 4DWWA 3ER9A 1TUEA 2AFRA 1MIHA 2OHFA 2CUKA 1PJAA 3NO4A 3HKDA 7REQA 1JA1A 2NTYC 1LNSA 1ILEA 1KZHA 2XVXA 1AZLA 1WUTA 1KP2A 4D1YA 4PX5A 3Q9LA 5IFLA 4OJYA 4QO7A 3NCHA 3FI9A 4EQ6A 1MEEA 4HCJA 3G7UA 5KU1A 1W85B 2QZZA 2MMGA 4RHUA 1STOA 1PJ7A 1QH9A 2R8PA 3HYTA 5FOUA 5HFAA 3TSAA 3UB2A 2MSKA 4WZAA 2WFMA 3EH2A 3GJSA 1F1BA 3FUUA 4KO3S 4MSUA 1NC3A 1N8KA 4PCVA 3W4KA 3CT4A 1HDYA 4RHTA 4PLTA 4A2QA 3IAHA 1UKCA 3T7CA 3VHRA 4JI3B 3WBKA 1NE2A 2WTAA 3RTAA 4DJJA 5F9MA 1P4SA 1OFIA 1SUEA 2CUZA 1DNPA 5LZ4A 1XVTA 4J3JA 3PEYA 1PV2A 4JASB 4KTVE 4JV5B 1YAHA 5DP2A 1NLZA 4FR0A 1MC4A 1Q57A 3D6HA 4O4IF 2NN3C 1VPTA 4V38A 1DGQA 5DGHA 5JWRA 3G2IA 4B7ZA 2FW8A 1DEXA 3HGTA 4MGZR 4CFSA 3FPFA 4BIMA 5KJ6A 4M83A 2LV8A 1VQ9B 1G5PA 2VR1A 2KM1A 1U5BA 3MD0A 5JD4A 4YAIA 2F4VB 1KKMA 1FE8A 2Q1TA 3INTA 3IR6A 4PAQA 1EUYA 1GQOA 5DHUA 1Y6QA 3FG9A 1I94B 2H59A 5SZIA 4G0NA 2AK3A 3IE2A 1N2JA 1JG1A 2G3YA 1ZJ4A 3NIDB 4LIPD 4MS3A 1A82A 3BKXA 5FUVA 3ZK8A 4KYUA 1BO6A 1U04A 3SR4A 3V4ZA 1B15A 4IV5A 1FNDA 2XF2A 3IKLA 1LVUA 5AHXA 2NZ2A 1CRQA 3T12A 3S68A 1QCZA 3PFCA 4UU1A 4ZQIA 1X2BA 1ORTA 2JH9A 2XWJI 4O4LF 4H16A 4OB8A 4ROXA 3GN2A 4UCXA 4ZVLA 2WB4A 4KFCA 3KCNA 4D9IA 3KJZA 1E3LA 5J3JA 3GZNB 3D43A 1YR6A 4M7OA 1GYPA 3KQLA 1WM1A 4IGEA 3LW7A 4ZVNA 3O3NB 1GAWA 1Y1PA 2VG8A 3OD5A 4L5IA 5TGDA 1E9DA 3TIFA 5ITZA 3EZGA 3PFBA 2XIJA 2A1UB 3HJTA 3R0XA 4DRZA 2HCBA 2WUEA 2JFUA 3DT8A 5TT1A 3KCQA 3SG0A 3UYKA 1LRJA 3EFBA 8AT1A 3RJMA 2GJSA 4FDAA 4ZMSA 1UD4A 2R8YA 2IYUA 4EITA 1MEJA 1NR7A 1ONNA 4X71A 2GN9A 4HATA 3CVOA 4RSMA 3TTSA 1CZRA 1NVKA 3EK2A 3OJCA 4NV1A 4J2HA 4U1RA 4Z4TA 4F46A 3HBFA 2Q5CA 4PGAA 3WSWA 1K06A 1XJWA 2EFEB 3F8TA 1N8SA 2ZWPA 3JQEA 1M5UA 1KAQA 4PBRA 3WYGA 2QXUA 4KSYA 4MEAA 3WIUA 2F1MA 3IOCA 1RQGA 1WKVA 3EXIA 5A4FS 1AB6A 3K2IA 4K9SA 1L4MA 3PX2A 1J1ZA 3VDNB 1GR0A 3H18A 1M54A 1T1RA 4ZTBA 4ZOQI 2CV2A 1EQUA 5ECWA 5EIBC 5EJ8A 1DL5A 3ONFA 4MRNA 2WWXA 3HYNA 3VO2A 1OAAA 1UBTS 2Z4RA 4B7CA 1XFDA 3SS7X 4TLEA 2XADA 1ZG3A 3UMFA 4BNXA 2JLZA 1FVHA 2VDOB 2PMWB 1IQRA 2IFTA 5FAKA 1KEWA 2R8RA 2H92A 1AF7A 2G83A 4BZPA 3QEMA 3G85A 3R9KA 3GHHA 2VP2A 2A84A 4EI8A 4OQXA 1R16A 1C3XA 4EH1A 4V0LA 5LOVB 4B43A 1G6OA 3JR3A 4WCDA 1T3TA 2SCUA 2I33A 2ZIVB 3DBLB 1BN7A 2Q9BA 3D4BA 3KUCA 3EUFA 3OOYA 1X19A 4AVZA 2QVXX 4GGPA 1K73D 2XSZD 3ODPA 2UZAA 1BDHA 2CKDA 3IDAA 4AJPA 3TLAA 2FN4A 1BWSA 1Q11A 3HWRA 3ROFA 4XFDA 3TVYA 2VBVA 2ZETA 4RM2A 1NSYA 3FFAA 1HOTA 4KYIB 3PVCA 2BFFA 3Q9NA 1SIUA 3T99A 1CVIA 1H6DA 1MCZA 3GLFE 1EIZA 4QVKA 4F1KA 5KWIA 1MTOA <