3W2IA

Crystal structure of re-oxidized form (60 min) of nadh-cytochrome b5 reductase from pig liver
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
271
structure length
271
Chain Sequence
b'TPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-cytochrome b5 reductase 3
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
total genus 77
structure length 271
sequence length 271
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w2iA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w2iA02
3ES9A 1KK3A 4PC6A 1F20A 1H85A 1H42A 2BPOA 3ZZUA 4TMZA 2EIXA 1Q82D 4C43A 1EFTA 1TUIA 5H59A 1S0UA 4UAJA 3AVVA 1G7CA 3U6KA 1CNEA 1QX4A 1M1KD 1F60A 2VNIA 4RCZA 2RC6A 4TMWA 3VNUA 4NCNA 3OZWA 2YWGA 3QE2A 1VQPB 2RC5A 3CCJB 3JQPA 1GO2A 4RD2A 2YWEA 4YAWA 3MCAA 3WNBA 3P26A 4C0SA 3VMFA 4YAFA 3W2EA 4ZV4A 3AVWA 4PC3A 4M53A 1S72B 1VQMB 2OK7A 1M90D 1EP2B 2QN6A 3OJXA 3CCLB 1E64A 2B7BA 2QA4B 2DCUA 4NBSA 4MYUA 1B2RA 1FRNA 2BGJA 3B8HA 3CCMB 2XNJA 1CQXA 2QDXA 3W2GA 1N8RD 4P6VF 1QGZA 1EXMA 1IB0A 1DDGA 4ZGNB 2YWFA 3QFSA 2YWHA 1DG1G 3OZUA 3W5UA 1OGJA 2DERA 1FRQA 1G7SA 1VQ6B 1AIPA 3PENA 1FNBA 1ZM3A 3AVUA 5EMNA 3WNCA 5TY0A 1YJNB 2OTJB 4YAUA 5FA6A 2PLFA 4YAOA 1XB2A 4J0QA 1A8PA 2BMWA 1KJZA 4BPRA 3ZBTA 3AVXA 1BX0A 2GPJA 1IJEA 3I1FA 1D1NA 1W34A 1YJ9B 2J7KA 3AGQA 5DSZA 2PIAA 1N0UA 3E20A 1VQKB 4AC9A 1NDHA 3AGPA 3WXMA 4Y9RA 3CCVB 1HA3A 1GJRA 1NJID 1QGYA 1QG0A 1FNMA 3VO1A 5TV2A 2BVNA 3CCQB 2BV3A 4FK8A 2C78A 3CW2A 1Q81D 2BM0A 1QUFA 4FWTA 3W5VA 1K73D 3I56B 3B78A 3G6EB 1SM4A 1EFUA 1W35A 4IW3B 1WDTA 3CRZA 2VNJA 3CC2B 4RD0A 1OB2A 2GQFA 1ZM9A 1W87A 1QFYA 1DDIA 2C77A 4QFMA 3CD6B 1E63A 4HE6A 4RJLA 1VQOB 4LBZA 3CXCB 4N3NA 1JJ2B 3AVYA 4YALA 1EP1B 3CPWB 3JQRA 2FX3A 2VNHA 1Q86D 4FN5A 2HCJB 4RD3A 1ELOA 3W2IA 2B5OA 4MYTA 5KSWB 5HXBA 1IJFA 1TVCA 2VNKA 4M1KA 3CMAB 2BF4A 4ZCMA 4TMTA 4TMXA 2OTLB 1VQLB 1GVHA 1AMOA 3WYAA 3ZBUA 2X3UA 1YJWB 1K9MD 4LBWA 2BM1A 1OB5A 1R5BA 4RCYA 2EFGA 3LRXA 2B7CA 2QMUA 4R71A 3ZZ0A 3ZZTA 3OW2B 4RD1A 3I55B 1I7PA 5JBQA 1D8TA 3A1FA 4U9UA 3MHPA 1E62A 3W2HA 3G4SB 4PGOA 1TLLA 1Q7YD 2DEUA 2E1RA 5GV8A 1QUEA 1KC8D 4LBVA 3QFTA 3OJWA 3U2QA 3P27A 1QH0A 3QFRA 1VQ7B 1OGIA 4TMVA 2NPFA 4YHBA 4Y7CA 1JA1A 1W2BB 5AN9A 1VQ9B 1KK1A 1GAWA 3VNVA 4RD4A 2QTZA 1EP3B 4F7DA 4M0LA 1YHQB 1DARA 1BJKA 2XEXA 4Y9UA 1TTTA 1UMKA 3CCEB 1ZM4A 3CCRB 2BGIA 2QEXB 1BX1A 4B4DA 3AVTA 1YI2B 2BN4A 1GR1A 4ACBA 4H9GA 3CCSB 3W2FA 3FJOA 5THXA 4PC7A 3E1YE 3WBKA 1EFCA 1FNDA 1VQ8B 1R5NA 2VZLA 3WBJA 1N0VC 4G5GA 1QFZA 2XNCA 4HE5A 1EWYA 3B82A 3SJZA 1QFJA 4Q7JB 4ZGQB 3J81k 3V76A 1VQ5B 1KRHA 1KD1D 1D2EA 3LYUA 2OK8A 2HDNB 2AHOA 1QVGB 3FPKA 4PC2A 1KQSB 1YIJB 4K1XA 3CC4B 1G7TA 4QHYA 4AF6A 2HMAA 1JNYA 3LO8A 1SKQA 4B3XA 2CNDA 3G71B 2DETA 3JQQA 4ZCIA 1GAQA 4B43A 2R6HA 1J9ZA 1KTVA 4P3YA 3QFCA 1FDRA 4LBYA 3ZC3A 1FNCA 1B23P 4M2LA 1JB9A 2PMDA 1KK0A 4N3GA 2DY1A 4B48A 3QSYA 1VQNB 4B44A 3CB4A 4PC1A 1K8AD 2QTLA 2BSAA 1KK2A 2CRVA 1U2RA 4G1BA 3CMEB 3WY9A 1ZUNB 3VO2A 3W5HA 5TR9A 4RD6A 1G7RA 3MMPA 2D74A 5GV7A 3WNDA 4DQLA 4EH1A 1YITB 1BQEA 1R5OA 4B47A 4DQKA 3CC7B 5H5JA 4WQMA 1ZM2A 4M4SA 4ZCLA 4LC0A 4TN1A 2ZITA 4G1VA 4ACAA 1QVFB 1XE1A 1CNFA 3CCUB 1VQ4B 2VYQA 4AF7A 3OZVA 1QGAA 1JA0A 3LVBA 3U6BA
chains in the Genus database with same CATH superfamily
3B85A 3QEMA 4GI7A 4X24A 3O21A 4ALMA 4FB4A 1UFQA 4ITRC 5TMEA 1ISHA 4LJ6A 4M1YA 5EGNA 5I7EA 4OFXA 4KHPB 1GNLA 2ONZA 4MCHA 4FNAA 3HVIA 3HYLA 3CT6A 2Q6KA 3HQ4O 3MWLA 1OPXA 1IOZA 3N2EA 4HG2A 4J9VA 1EWQA 2G17A 3ZKAA 2QSYA 1XAJA 5BT9A 2HHJA 2W6MA 3ELYA 4YJ2B 3UCXA 1AKRA 3HLTA 3ON5A 4FFWA 3UJ8A 2N1BA 1SZJG 4BO0A 3DQPA 4LG1A 5HK9A 5JRZA 1N6HA 4GPBA 3ELUA 2WZBA 3G2MA 2J0UB 3MERA 2VSXA 4N39A 3PQ5A 1ZX1A 3P2IA 4RY9A 3GEDA 4HFJA 4TS4A 4JT4A 3FTNA 4CF4A 3I6MA 4RLFA 2HCFA 2R8PA 5AJZA 3SDZA 3R0QA 2RGXA 3OLCX 4BP3A 4CDRA 4BQEA 4EKYA 4IZ6A 1T5TA 1H2ZA 3ESDA 3IPCA 1TAQA 3AOEA 2B69A 2C31A 2VJNA 4IIJF 3V33A 5AVRA 2EYQA 2WUDA 2ZE6A 1DINA 4ITVA 4HIZA 2V3VA 3F46A 1RRCA 1GL3A 1OI3A 1SKYE 2V9CA 1YA4A 5JEDA 1M34A 1S2OA 5L95A 2V3CC 1VHTA 3E4DA 4RZ3A 4UHEA 2RC5A 4YJ3A 3ZR4B 3Q8XB 3PCXA 4Y9DA 1NBME 3LWZA 4JR2A 4EGFA 1NXOA 3O82A 4GNRA 1KGSA 1XD2A 2ZLBA 4Q9DA 3TG2A 3TX6A 3L49A 3LX5A 3RC3A 2LCIA 1U5AA 3AUXA 5D6OA 3QELB 4UU8A 4WNCA 3ESQA 1R8YA 4NCKA 2GXUA 4U2BA 1EAMA 3ANMA 3HUFA 5JJLA 2GLUA 2J3KA 3C1UA 4YQYA 5IFLA 4DCMA 3DZGA 3L05A 1UD8A 1ACLA 2VP5A 3OAAD 4QUJA 3ZLJA 4MHTA 4I1OA 2CFIA 1K6JA 2RGDA 4KR3A 3OW7A 1OASA 121PA 1SCNE 3B60A 4IINA 4NARA 1NZFA 5D3QA 3ILVA 4PC3A 3R5KA 3RUCA 5HWSA 2PZJA 1V5EA 3QNWA 4WVFA 3C6YA 5KEIA 4UAVA 4MV3A 1M90D 2DJ5A 1ZWKA 1USKA 2ID9A 3H3XA 3FB4A 3HUDA 4DHEA 1GAEO 3G8BA 2V7QA 2RGGA 2QVYX 4DLBA 5H0IA 1AK1A 4NBSA 1KI9A 1MJGM 1PTKA 4UTVA 2FSGA 4NOJA 1KFKB 1R4NA 2R1VA 3AR7A 3VJMA 3DFFA 2PH1A 2M6LA 2XQGA 5HOEA 2YV3A 3N2LA 2LV8A 1LKZA 3EOBI 4BXOA 5SZIA 4WKGA 4EG3A 4DR6B 3JTMA 5I4KA 2R4UA 1PNRA 5D6NA 4JB3A 3ZVNA 3WL6A 4PFJA 4AP5A 2BFBB 1E58A 5K0EA 1KPIA 1ODKA 2EW8A 3FNIA 5FPPA 3OPYI 1Z33A 4ESOA 4L0MA 1O95A 2AF3C 5JNLA 4XWWA 1ADCA 3DM5A 2FWBA 2HH9A 3CIFA 4JA2A 1U31A 2Q6IA 3PENA 3IIIA 4Q6WA 5IDXA 1RKQA 2DT5A 4RTMA 1GIAA 2ZRFA 3PD1A 3WG9A 4C08A 1N36B 3AR6A 5LB2A 3WNCA 2P9TA 2DR2A 2ZIXA 4H7FA 2JJ2A 2OPHA 7REQA 2ZJFA 1PDOA 1W5AA 4WOJA 5HSGA 2I99A 3W5IA 1XB2A 3TLZA 1G5PA 1XD2B 3N8IA 3AY6A 4HLUC 1RKUA 2Q2OA 1QHNA 1X80B 2GESA 4IMIB 1A2KC 2XQKA 1XNRB 1YBFA 2ZZEA 3AVXA 4MDHA 4P2BA 2OHHA 1JSLA 1J07A 4MRAA 1LF0A 4B6EA 5D1NA 1P6XA 4MUXA 3KDAA 2JGEA 4RHFA 1S1MA 1YJ9B 2QQEA 1I7SB 4MIOA 5A1TA 4G84A 3W04A 3TD6A 3AETA 2J08A 2FX2A 1ULUA 4X20B 4YASA 4EMBA 5EHZA 5JECA 1MXHA 4H4EA 2Y27A 1PK8A 3FF1A 4AY4A 3E20A 1X39A 3ZHBA 4Q1AA 1O54A 2E4YA 4YP7A 2IHVA 2IE0A 2OM2A 1NDHA 3WXMA 2B36A 3EBOA 3I9V1 4WTOA 4N8DA 5G2OA 3SM9A 3ZS8A 3A4MA 3BD6A 4GOND 4A73A 1SQSA 4BMOB 2HRCA 5KNBD 4OI1A 4QARA 1P19A 1OXUA 1CRZA 3L4SO 1KZHA 4TLDA 3X1YA 4AICA 7AT1A 4FVTA 2Q7OE 4QU9A 4NJOA 3BQMB 3ICQB 1T9GS 4E70A 2QVGA 4LWPA 1XPOA 1FZTA 1DAEA 2R1VB 1TQHA 5LP6B 3DGFC 4GQIA 3OC6A 3EIWA 5JZBA 2H4ZA 1A98A 2XYHA 1WOMA 1ICIA 3LPDA 5B37A 4YMGA 2GEKA 1DLIA 3AW9A 3FSRA 3HU3A 5IVIA 1PF7E 4EIWA 1AXEA 2CNBA 2Z5GA 3UEOA 1T2UA 1E3SA 3HJUA 5AM2A 3LQRA 2ZYRA 2Z58A 4FLFA 1QBKC 3PQEA 3HMKA 1HY3A 3SBXA 1DC3A 1TC1A 2V6BA 3MAJA 1GZ5A 2OZVA 3V8BA 1UWLA 2X9GA 1XDUA 3RR2A 1U8EA 1W4RA 1Z22A 2ZBGA 1KAQA 4LV6A 2A58A 3SQOA 4QFCA 2X8WA 4ND7A 2KS6A 1LSUA 3CVOA 4GR4A 3TQTA 2AZXA 2HSZA 1I2AA 4MQEA 4OGKA 4LNUB 1P0IA 2VLBA 3ANSA 2A5YB 2XB6A 3IMGA 4RCVA 2R7MA 4XJVA 5B1HA 3PI7A 1W94A 1JHPA 4EX7A 7REQB 3ZVMA 1YBHA 1JA9A 3L4EA 2DLCX 1JPNA 3LX6A 4OLBA 1ZUNA 4HDCA 3KJZA 3SS8A 1FTQA 2YICA 4K9OA 3FGPA 4BJ3A 2Y1OA 3QKSB 2BMFA 2PD3A 2PZMA 2Z4SA 1II8A 1HQDA 5JCZA 4A4DA 4CT4B 2DPGA 2O7SA 2Q41A 3QQ5A 4J3FA 4YMTA 3Q8KA 1E5TA 3R7NA 4J49A 2JFVA 2X85A 1EX1A 3SYMA 4ZTZB 1NRJB 2DPXA 1Z56C 1DPGA 3AC0A 4BTVA 4OOVA 1JPUA 1NUTA 4YGYA 5KQPA 4FPXA 5KHOC 4C29A 3MQFA 3Q6QA 1JQDA 3DFKA 2XNKA 3KCQA 4B34A 3EVFA 4RD3A 2PN1A 1NHGA 1WL8A 4IIGA 4A0GA 4KAAA 5B55A 2XMQA 3NX4A 4F60A 4KPYA 4L8WB 2AOVA 4LY0A 2OAEA 1N6OA 2EOAA 4QL3A 4PF1A 1CFZA 4NBKA 5FI3A 3AF5A 4RJKA 1SCQA 1DIBA 4RF5A 2HWYA 3ANNA 1TNDA 3VC7A 1TGYA 2GN8A 2HXYA 2VHQA 1HFWA 1K7YA 2X6RA 5I4CA 2WSYB 1SIBE 5CMLA 4RHEA 1ILWA 3AJEA 1OZGA 3DVRX 2J4DA 1UC9A 3U7JA 2HJHA 2MWMA 2P2NA 5MN6A 5ULLA 5ED4A 1MX1A 3RD5A 3ZY4A 4DTCA 2BCEA 3PC6A 3I2HA 1B6RA 1Q3HA 1M73E 4WXMA 4B3TB 1WZ2A 1OSNA 1YJWB 1SZDA 3INGA 5JSZB 1UOEA 3FHLA 2P78A 3H8WA 1XDSA 4YQEA 1NF3A 1N92A 2GEBA 4YDSA 4ZYVA 1RHKA 1TO6A 1Q7CA 4JP2A 2ZI3A 5D3KA 3S2YA 3ZZNA 2PBZA 2OHXA 4BMDA 3M1YA 5KOHA 3BCFA 5CFOA 2ZWAA 4MLCA 1XXHE 4O4IA 5EJ2A 3SBDA 1ZVKA 4TYNA 3IP1A 821PA 1N8KA 4MQEB 4MVYA 4TKOB 1ZGZA 1LDNA 3HCRA 4HJRA 1TDJA 1B93A 3V4OA 4V0SA 2WWXA 5BSHA 3TGWA 5F21A 3ZZ0A 5K6AA 1HR0B 3OIDA 1ZIXA 4YCJA 3UQYS 2ZPTX 1MJFA 4RD1A 3I55B 2AVNA 2WJWA 3C6KA 1EFKA 2NN3C 3VSBA 1JQJC 1Z4JA 2EF0A 1P74A 1YQUA 4KLNA 1P62B 1YZYA 5DK6A 5FT9A 4HF7A 4ZO8A 4LZWA 4US0R 2WKRA 1R0LA 3IBFA 3OETA 3ZKWB 1GSOA 2X7XA 2LKDA 3H4MA 4RK0A 2Z9DA 5DP1A 3E82A 3IUMA 1HE4A 3E35A 1IMJA 2IHNA 5CEEA 1Y82A 5DASA 3UYLA 3ZCVA 3OZAA 1G98A 2DEUA 5JVDB 3L6UA 3NOOA 2E5FA 3GV0A 3RS8A 5KTOA 5B6IA 5CVCA 5FUBA 1KC8D 4RPGA 2BONA 4WZZA 2CMKA 4LI3X 4NMWA 3RSLA 1YJQA 4HN4B 4BVEA 1YI0A 2L0XA 3I9KA 1YI8A 3WTCA 3GPCA 5K2OA 5EIWA 1VLYA 1FTGA 1ST3A 1WXEA 4WESA 3GLGA 1V71A 5MGNA 4Y2HA 5BV7A 1DI0A 4Z4UA 1EUZA 2A7QA 2AE2A 4GDMA 5CVJA 3HN6A 2P3QA 3QYJA 1HDCA 1KVSA 2C4KA 5TQVA 1DBSA 3YASA 3BCSA 2GZHA 3LL7A 2FF7A 2CVOA 3KPJA 4HTAA 4L8GA 3U26A 4XUGB 2WZQA 2W6PA 1XZPA 1HT0A 3BWDD 3KOMA 4O4LF 1MJNA 4UTZA 5TX7A 3RU9A 1E0AA 4Z4QA 2QRLA 4RAQA 1F3LA 1W5EA 5A0TA 3CUKA 1ACMA 4O5OA 2V7QD 1E2FA 4C6SA 3HYTA 3C7KA 1GFZA 3K1ZA 5EIBC 3I62A 1SQ0A 5EHIA 4LHXA 1FLNA 3FOAA 4UM5A 2PBRA 4D9FA 2BGIA 3ZCTA 1ZI6A 3R7LA 2FZCA 5CA1B 2QEXB 2QY6A 4JBXA 3FWPA 3ER8A 4UZSA 3CUEF 1AKNA 1WHTB 5DHTA 2WM3A 5TJHA 4DYHA 1GNQA 1T9HA 2VK1A 4KKUA 5D7BA 3H2IA 3PFCA 4DEXA 3W2FA 4F5WA 1M2JA 1QF7A 4ZHQA 3LC7O 2E49A 4LOJA 1O1YA 2OBTA 1AKVA 1DVRA 1PVVA 1RM3A 1SBIA 2IZZA 2VDWA 3G23A 3K20A 3NIBA 4IV8A 1JEDA 3TTTA 4DE5A 1MZVA 2CNOA 1VJDA 3WBJA 4LXTA 1N2GA 3CZ4A 1UXHA 3OLQA 4A2WA 4HGOA 4DLAA 5KYYB 1PNVA 4X0EA 1PGOA 5HCUA 3PUZA 2Q1UA 5D5HA 2AH5A 1XDWA 3H2KA 3ZHXA 4M0PA 2PRYA 4PXSA 3HRHA 3KTDA 4U7DA 2QPTA 3JYNA 4UJ5A 2Z3ZA 1X7ZA 4KGZA 3N8HA 2V97A 1G20E 1M8GA 1P2DA 1ZITA 1SC4A 4B73A 1HYQA 2MSEB 2YFQA 4B3RB 3OWHA 4COKA 4MINA 1A9XA 3ETJA 1U63A 4D6YA 1KQ3A 4H1HA 2OGTA 1GZ7A 5ED0A 4P7GA 3KHUA 3PC7A 4GMFA 3ZWWA 4WCFA 2AHOA 3A2KA 4B3BA 4KVGA 4P33A 4LYYA 3BRWA 1ZMOA 3MBOA 1X1TA 5EMHA 4WESB 3IAM1 2RHDA 3D4IA 4JB2A 2BGUA 4EJ6A 3DAYA 4QXOA 3BSWA 4QJ3A 4EA7A 4Y6PA 1Y33E 3HDGA 2JG3A 1G7TA 2RH4A 1N2EA 2V7PA 3S6JA 4AN4A 3RREA 1Q57A 2R8EA 4DNXA 2AOTB 1NXTA 3H86A 4JI8B 4IOMA 2V0NA 4NCXA 3I92A 3BRQA 4ZRNA 3QPAA 2PS3A 3PDIA 1C3LA 4UMVA 4ZCIA 1X7XA 5CCDA 4CM1A 1YRBA 5SY4A 1ZNWA 1OXMA 3L0YA 2CV2A 4DPLA 3GJQA 5K8UA 2PUAA 1U8UA 1UJCA 2WSBA 1G4UR 1XWWA 3HC7A 4F1WA 4F04A 4BQIA 1ENYA 2XGJA 2JFZA 3FCAA 5SYMA 1V0FA 1NW4A 2WFLB 2GJ9A 2QRZA 2OKGA 4ZRMA 2ZUDA 3SD7A 3H5TA 2PH7A 5B1IA 4CRWB 4LOIA 2V59A 2OXEA 2R4QA 4RKQA 1FU7A 2BSAA 1TM3E 1YU9A 1Z0SA 2QRKA 2FEKA 3OKXA 3GZJA 4ZHQB 3JQEA 4MW9A 4CBVA 3R5SA 2P2ZA 3HY6A 4LC9A 2V9ZA 3QUCA 3PQ4A 1A1SA 4C0WA 1LS1A 3IOCA 3DAOA 3F2VA 5EIAA 1FXUA 1P2VA 2QYSA 3ADKA 5J1SB 2UUAB 2XUOA 2BD0A 3O0DA 4RD6A 2XDWA 2BHTA 3D4OA 4M8KA 4MTCA 3H9JA 1NNI1 3HCEA 2D74A 5GV7A 4IHAA 2HWXA 4DQLA 4O1HA 1C3JA 1Q74A 5AI9A 3T12A 5FAKA 4F3TA 3U3XA 2FEPA 2BH9A 5HE8A 4N6OA 4B47A 2CZGA 4DQKA 2IP4A 3R3YA 4PNZA 4WCDA 3VYVA 2W2LA 1WMAA 1X7ZB 3BL6A 4DREA 1FX1A 4Y1GA 3M82A 4EYKA 2RGNC 3ZTTA 5I4BA 1OU4A 1A9XB 1L7RA 3KUKA 4GMKA 5IZCC 4JI2B 3HI6A 2QRVA 2ZOSA 3NPAA 5FD8A 2QTMA 3TLBA 5A4AA 3A8KA 3GXOA 4AUMA 1NOJA 5KYKA 3EGXA 4BKOA 1DE0A 1NURA 3LC0A 4QJBA 3N53A 2VYQA 2VRWA 4RVOA 4WCFB 1OKKA 4MW2A 3ZQKA 1ND6A 1XRJA 3EAQA 1NA5A 4XA8A 5AWFC 3ZDCA 1O5IA 4UXJA 5TPZD 1BWSA 1V37A 3D5EA 2O2EA 4EGAA 2WJVA 4Q7EA 1H1LA 2WD7A 3PNOA 1SVSA 2FW9A 4HH3C 3LNTA 3MT0A 3PFHA 5AJWA 1ESCA 1ZK3A 1AC5A 3PHCA 4JCOA 2ZUTA 2CV0A 1CVRA 2VVTA 4UCQA 4EP1A 1JT9A 1PJTA 1BS1A 1C1YA 4IF4A 3MD9A 4OL9A 2H31A 3MIIA 3U13A 4DGSA 1DKUA 3B8EA 3OQPA 1IHMA 1I4EB 1PR1A 4P7JA 1U6IA 1U0RA 1NP3A 4AKIA 1XZMA 2QTGA 1DOHA 3ZH2A 4E5KA 1OLOA 4DIUA 2RAPA 2ECFA 5E4JA 4DWVA 4U6QA 3GLIB 1WJGA 2XIQA 2FPUA 3OZIA 2H9YA 3PEUA 4UHCA 5AKEA 5L8VA 4C1BA 3FTEA 3SE0A 3ZGLA 1RTKA 1EH5A 4B6QA 4NENA 1GV0A 3SFTA 1BKDR 1WORA 3EVNA 1MXFA 2JGDA 3OE5A 3IUBA 5HIAA 2JCYA 1RJ9A 3IHWA 3NHRA 1E1YA 4Z9XA 4HRAA 2QQGA 1U2DA 1OBHA 3NHWA 3RFFA 1DRVA 5A9SB 5IAEA 5CB0A 1SVNA 1R0SA 2QZSA 2X1MA 2HBZA 5AKJA 2YJ6A 3HHPA 3QXGA 4RCZA 4MV9A 5BWBA 4JJEA 4BU1A 2AD1A 2RB4A 5EL0A 2OYCA 3KAQA 3GGCA 4WOPA 5E4FA 1GA4A 1DIRA 1X38A 2JFQA 1T9DA 4HWSA 1AUPA 5AI4A 4OXNA 2OQVA 4E32A 4ARCA 1KXJA 1O0CA 1KIFA 5JC8A 1Y6FA 3BK1A 4K9PA 4UAUA 4CG1A 4R2XA 2A78A 2EZTA 4F96A 3QE4A 1VG9B 4XX0B 3OEED 3R7FA 4JYZA 3D7KA 2GN9A 3N75A 1BYUA 2OVBA 4BP1A 2ZRIA 4YREA 1QE5A 4LSWA 4KSCA 4XN0A 3FZQA 1ZW6A 1PFYA 2QRJA 3MRSA 4WZBA 3LOPA 3P26A 4LTNA 5BSKA 4XW2A 1YA6A 3EK2A 1E4VA 1T25A 2J3QA 4RMIA 5JQWA 4YDRA 1N6IA 4LRSB 4P5DA 4J3NA 5KI6A 5I9MA 4XWOA 3C48A 1JXAA 3VR4A 1ZN2A 4NDNE 4XDYA 3OLWA 4ZEWA 5IZ4A 4EZIA 4NYJQ 3EY9A 2GD6A 5KVVA 4FNOA 3PPWA 4JJIA 3JRNA 3OO1A 1DAHA 1N7JA 1X1SA 4JSRA 3PGLA 3JAWB 2QD2A 2EARA 3F3SA 4WZAA 5JISA 4RF2A 2M1ZA 4ZOLB 3ABQB 4GWGA 4A0RA 2LZJA 2R6JA 3FOEC 5E0OA 1EINA 1Q1EA 5H16A 1FJHA 5C1IA 4F3NA 2IITA 3PPXA 1YVPA 1VIAA 2OTCA 2PJUA 3EGEA 2HDWA 1DFHA 3BK2A 2C4UA 1Y8AA 3G2NA 1QHFA 4OGFA 3ZY6A 4AJLA 4ZOQI 5DYYA 2FQXA 3QF4A 3NXSA 4XL9A 1E92A 4R5HA 3JYQA 2IS1A 4LEIA 5DM4A 1HXHA 2D3WA 3AHEA 2B0CA 2PYDA 5CDTA 4QT0A 5EEHA 4CLOA 2RGUA 1H4SA 1ZUHA 3O3OB 3C43A 4XFKA 1EVZA 3H1EA 1I3NA 3TLGA 3W5UA 1TM7E 2P77A 2ZDHA 3MD0A 5GOTA 5J59A 1LFDB 4Z4VA 4RQUA 1CQWA 1DX4A 4LKOA 2YYYA 5A6VA 3QVOA 4GRDA 2X4DA 1H2WA 1MEOA 3K05A 3NTOA 4KODA 4MYDA 4LJ9A 4OHYA 2P8SA 1BMFA 1NXVA 3JD2A 3WK7A 1C9DB 1RLIA 2SKDA 2IIQA 3CKLA 1IK4A 1OZFA 2I1QA 1Q6YA 4A23A 1MTZA 5A9TA 2LIPA 4PLZA 3ORQA 3FKSA 1TQ6A 2E3JA 2OMKA 1IZ9A 4LW8A 4UQPA 1MLDA 4D1YA 1E7SA 2QX9A 4DYVA 4YPVA 1JFFB 4YB8A 1QNLA 3AI7A 1REQA 2P2SA 3GOHA 4US1R 3GVKA 1BE8A 4WZBB 2CCJA 4JU8A 5FI1B 2QX8A 2GM4A 3OFVA 3HO6A 4QXPA 5TE9A 3WLRA 4F4DA 3U7FB 1HNWB 4AP9A 4WAUA 3KTAB 1E2UA 1RI4A 5LD2B 2O8BA 2WSSD 1N0UA 1VQKB 3BERA 4LPSA 1M66A 2HLPA 5JZMA 1IIBA 1JR2A 2A0WA 1EM8A 2OAGA 4PYMA 4R2HA 5AOVA 2DWCA 4D4HA 1DMSA 3HVJA 4HQOA 1HT3A 3HCNA 2MTBA 3RRBA 4ZZ3A 4XQCA 2RARA 1R10A 3KK0A 1C8VB 1FVOA 1ZZGA 3D3QA 5IARA 3RVPA 5LP1A 1X1CA 1O6ZA 2PRZA 3HVUA 3OKCA 3PK0A 3C3CA 2CXRA 4OG2A 1JJFA 4Q1FA 1BEEA 5DM1A 4FFMA 2HF9A 3WIEA 2GRAA 3VA7A 3Q5GA 4GICA 1T5LA 4BVLA 1I2MA 2DTEA 2FX5A 4HN9A 1ZSYA 4AJ1A 4ND6A 1IQPA 1TO2E 3LECA 3A2LA 2BV3A 1NJ1A 4URUR 4YJ3F 4CLOB 2JIDA 5ERXA 1K8YB 4MW0A 3FYSA 3ME5A 1QRRA 3V97A 4BFXA 5J5CA 1QUFA 1TU4A 4HR7A 5FOUA 3WVNA 5EJGA 4IGKA 3UPDA 1SM4A 4GL2A 5TPWA 5LCXA 4LSMA 4DFDA 2WNIA 3Q1KA 1N75A 2PX6A 5A3VA 4XD7A 3PGKA 3HXMA 1EE9A 2V5VA 4L2IA 1HT2E 4FZRA 3Q38A 4IY1A 4B7XA 1VE1A 3BZUA 2ONKA 4ETNA 1PV4A 1MVOA 5MN4A 4KOEC 5G0WA 2L69A 1PQWA 1PDWA 1W0KD 1V7CA 2VA9A 5ITVA 4N5IX 2VAWA 4QEDA 4GX1A 3CU5A 1YV9A 1K0FA 2VRNA 2O2IA 1W9HA 1U2EA 1SC9A 2IF2A 2QRQA 1LI5A 2Z43A 4NZOA 4N18A 4TL8A 3RT1A 3WSVA 2IDKA 3AR4A 1E43A 1EGHA 2RHTA 4O5AA 1QANA 2JBAB 3EB9A 4RPHA 4PTYA 4TGLA 1T5SA 3KEFA 2GZ3A 2QXTA 3A7EA 3C3WA 3NHAA 1VQOB 3LQ6A 2ZQZA 3PNPA 4N3NA 4BE7B 2W2LD 3AVYA 3V8QA 4YV1A 4YALA 2DY0A 5DLEA 3GDFA 1CJVC 4E21A 1NFFA 2O8BB 2X8JB 2VNHA 3QJ5A 1I0ZA 3AEXA 1FVFA 4CM4A 1PYOA 1KQPA 4NPHA 3A9WA 4W1SA 5I7FA 3A1VA 1M33A 3OT4A 5GGYA 1QK4A 2WHYA 1UAGA 3GIWA 4OBBA 4AQDA 4DY4A 1GCAA 3EG9B 4P58A 4XKWA 1X1AA 2XDQA 4O2BA 5CFNA 5JNWA 3M9WA 4GSKA 2EFYA 2UKDA 1NVEA 5KIAA 4ZOBA 3VH3A 4BYGA 3MRVA 3RYHA 4TUYA 3MTQA 3RARA 8ADHA 4V1CA 4US2R 4D8YA 4KR9A 3MPOA 1MDBA 1RU3A 2JAWA 3WFZA 2CB0A 4GPD1 2G6BA 4XSVA 4QICA 3U3KA 3EA0A 1JBKA 1OAOC 3RSQA 2QN9A 1FLVA 3WL4A 4UU0A 4DRYA 4X8HA 2CVHA 2X1LA 4LXIA 3U3OA 2Z2KA 1JEQB 4QNMA 2V4DA 2GBLA 3KSMA 5J5VA 1AGXA 2ERCA 4DL9A 1YRAA 4Y0AA 1VG8A 2OBMA 3DUFB 3UHOA 3Q2IA 5BQPA 1KZ4A 1LSSA 5KOHB 3IUEA 4W82A 2REBA 4QFBA 4AJNA 4AJOA 2HHAA 4HYQA 1OX4A 4RKFA 4CQLA 1YMVA 4KP7A 3VPAA 4CMKA 3BMQB 3SR0A 2NG1A 3M2TA 4DQUA 2VUHB 4GGPA 5D00A 3TW0A 2BEWB 5K9ZA 4GM1A 1PQPA 2ZTNA 3PVDA 1HE3A 3HWRA 3MILA 3O3CA 4JENA 1OB5A 1L0BA 1NYQA 4CMCA 1SXJA 1ZESA 2CYBA 3IAHA 3OLVA 4L2IB 4E3ZA 5AP9A 4YMHA 1QE0A 1H5NA 1SBQA 3QPVA 1XBTA 3K9NA 4BY9E 4R71A 1JJVA 3PKZA 2YH2A 4CLXA 1ZN9A 4HDSA 5GM2A 1OHHA 2GJRA 4R8SA 4Z9BA 1DO0A 1CRLA 1L5WA 2HKIA 3RF6A 3PDCA 4XGIA 1LB1B 2QMOA 2QTRA 3H5NA 4JKIA 4KI7A 1IDOA 1UMCB 2CN1A 3I8SA 4FFPA 4MA0A 5BYJA 4IIJB 3UK2A 5JBQA 3ER9A 3STUA 1PDVA 1PS0A 1L4UA 2C1XA 4JSYA 3AIKA 1QR6A 2ID8A 1XAHA 2PRKA 1D7AA 1E62A 3HADA 3NYQA 2JLSA 4MP6A 2CDAA 3Q7QA 3SQDA 4HNTA 5JY6A 5ALRA 2YIJA 1TLLA 1BKYA 3L0ZA 3LZDA 1R8SA 3L7JA 4M55A 4PZEA 1JDUA 1A2BA 5I9SA 5DYGA 4E4YA 5JPDA 4CM4B 4RDKA 1ZVMA 3Q98A 4N0DA 1VYHA 1JQAA 2Z9BA 3GA7A 2RJ3A 2W6ZA 3KUDA 4JXKA 5ESWA 1P4GA 1YVRA 2ORIA 2XDQB 2YXEA 3JXEA 4QTTB 2R5NA 4EARA 1WUHS 2FXIA 3FYHA 3RYHB 4TUYB 2Y0CA 4BB6A 3LTEA 2WK1A 2JAPA 1VQ7B 1RSZA 1NVDA 4DY6A 2G1PA 2B98A 2NXNA 3AU9A 3EYWA 3AQ4A 4WD3A 2QWXA 2GHIA 3AEUB 5JBIA 4RSMA 5F52A 4WKOA 3ONYA 1W4ZA 5D85A 3OZFA 1XP8A 4R1TA 4MUNA 1HQYE 3NRJA 1P61B 1G8FA 3HA7A 2FRXA 1WMBA 3DTNA 4WKPA 4AXXA 4D42A 2HI0A 1W88B 4BC1A 4DQDA 1JXMA 3TEFA 3REOA 1J2JA 2BKEA 3GCDA 1YHQB 1ND5A 1OX4B 2XEXA 4CQLB 4MDYA 4PABA 4PE5B 1FFDA 5ALTA 1Q2UA 1CHNA 1X15A 4CG0A 4G8BA 4CM6A 4EBFA 4CETA 2WHQA 4KR2A 4UMDA 2R96A 3B36A 4JQZA 4B9AA 4F0JA 1K0UA 2GDZA 3IEKA 3D43A 1E3MA 3DCJA 3KLOA 2VF7A 4TRMA 3ENQA 4UEWA 3A6FA 3NGLA 2B4TO 4L6AA 5BWOA 1J7JA 4W7HA 4YIHA 3DWFA 2XUAA 4J0JA 1OIWA 1W6UA 4AYWA 1E4YA 4XORA 3DEJA 4HDNA 1NI4A 4IVPA 3BTUA 3FBGA 3ZU2A 3OA2A 2PAAA 3CNBA 1XCGB 2WOOA 1WMDA 2J3EA 3Q9SA 2AWNA 4EG4A 3ZGOA 4OFWA 1C41A 3FKQA 3NC0C 2ZRPA 3NDBB 2H6EA 3RUDA 2P30A 3IALA 3TLMA 4DB4A 2VNAA 4Z1MA 2ZT5A 3QW4B 4M60A 1XQXA 4HXFB 1EA7A 4JBLA 3VR6H 3ZJYA 4HNUA 3EGDA 1L7QA 4LDJA 3P9XA 4KXUA 3UKOA 1D2RA 4OQQA 1E4EA 1MIOA 3FKSD 1RRKA 3Q88A 4TL7A 1YULA 1IEVA 2Q3HA 1BN6A 1PLLA 3IAS1 1W48A 1YZ3A 2RGAA 1T2FA 1P39A 3O4RA 4JQCA 3UC9A 5IDWA 3RC1A 1GKUB 3IMFA 3G2OA 1L7EA 1HDXA 1S3FA 3GZ4A 2RI6A 5HBRA 1NWHA 3KFVA 4DQ0A 1IL0A 4DZTA 4EITA 4UTPA 5HP4A 3DP9A 3NFRA 3QVKA 1LRLA 1NUUA 3LCCA 2NXEA 3TGPA 4V0LA 1NRXA 4NCIA 5GONA 3WGZA 4CCSA 4IJ5A 4NG5A 1CUGA 1KAGA 3ZI7A 3NLLA 1XTRA 1Z0UA 2XTJA 1C4WA 2D1QA 1KFEB 2C1EA 1ADJA 1BXRA 4OJNA 8GPBA 5LKAA 1TZBA 2WFAA 1IEQA 1QRSA 5ESXA 3HCDA 5IU6A 4O1IA 1L2TA 2F7SA 2VBGA 4XIYA 1M1NB 4GYJA 1DEAA 2PK3A 3IA7A 5J2UF 4B43A 2R6HA 2PT6A 3TVDA 2Z30A 4PAQA 2YWBA 4YEJA 1E8DA 2EJWA 3LXRA 3MYRA 1T8PA 5DNWA 4XM3A 1TM4E 5FWAA 4YJDA 1BS9A 4BRSA 4E13A 1V0EA 2IW1A 1IXZA 1VF7A 4AZ0A 2P69A 4RM2A 4J0HA 4LOLA 1DSSG 2CLFB 3TTVA 2M6RA 4ZANA 3BMOB 3A9TA 1XFAA 3DMNA 1M6WA 4DW8A 1V8DA 2HSJA 1VPDA 5ESRA 3L77A 4RANA 2F1JA 2D06A 2P7IA 4QUAA 1ZGHA 1HG1A 1M0TA 2WIAA 3KP1A 4HDNB 1NI4B 3TBFA 2G0AA 5K09A 2HPHA 4KG7A 3FPEA 4F46A 1Z4KA 3LDFA 2IH2A 4JR0A 3AKCA 4XD7D 4DMHA 4K6FA 3FYUC 5EZSA 5AVZA 4HAVA 2NO0A 1WLYA 2PU5A 4OSPA 4KH1A 5BV1A 3K9FC 4ZQEA 1JI3A 1JT2A 1MRNA 2HSGA 2ATVA 1MO2A 3MF4A 1VYUA 2JEZA 2Y68A 4LZOA 2YJ3A 5AJUA 1P4RA 2HPVA 3R44A 1I8DA 1VCHA 1R5JA 1IZ7A 4I1VA 5D3MB 5C34B 1E4EB 4I6GA 3ZGYA 2WOJA 4H16A 1TAGA 1YVUA 2WYIA 5JE8A 1NUAA 3BMCA 4M6WB 3HJRA 4DUGD 1E7QA 2RK3A 5IS2A 2OLEA 2J0SA 2EQBA 3RJ9A 5FJIA 2GBPA 2WDPA 4RF3A 3JWHA 1U04A 3VSEA 3R24A 5TVGA 1VPWA 3WLPA 2ZUFA 4KQIA 4WT7A 2CK3A 3N05A 1GNPA 2BBSA 5FPYA 1GYPA 5GQSA 3MSCA 6REQA 1I3KA 1Y9AA 1ISPA 5K3OA 2CUKA 1XD8A 1XO1A 2DBVO 1WZCA 1E5LA 1PL8A 2I29A 3DFMA 3U6BA 2IEYA 3EZXA 4QDZA 3ZCPA 1BXRB 1R37A 1KI3A 1VP9A 3IS3A 3P1JA 4L8YA 4OXIA 1UPTA 3UJCA 5IH7A 2JAHA 4JYMA 1OX6A 4X1KA 1COZA 1E2DA 1PZEA 1H85A 2RHGB 5NLLA 5AUQA 3TL6A 3R6GA 4P1VA 1E9EA 1T9AA 1Q0TA 3K8QA 5GMOA 4KDEA 3S5JA 3WGKA 2N47A 2CHUA 3OTIA 3ZDAA 3OEHA 3DTTA 4Y8VA 2J3MA 1E2KA 3HACA 4PICA 2I4LA 3ZK9A 1GU7A 1T5BA 1ZBDA 1GGFA 3DZCA 4U7HA 4N0EA 4W9NA 4YRTA 1UKZA 5U4QA 4MVJD 3SS9X 4JI7B 1YQEA 4G4JA 4G9GA 2BLNA 3T7KA 2UUBB 1E1RA 1GUFA 1M67A 4MKIA 2HMUA 5DW0A 3RYFB 4BIIA 1EEXB 1F8GA 1QO0A 3I5MA 3QHAA 4OYHA 4KXNA 3OOCA 5GJCA 3SS7X 1GQOA 3K0EA 2IPOA 4L57A 2CLHB 4JT2A 4NG4A 5CYFA 4MOWA 4DR2B 3N2IA 2XYGA 5CRIA 1EUQA 3DNFA 1UPFA 4B9EA 4FQ7A 2NU9B 1EZZA 2C0QA 2BRUA 5B4UA 1JDSA 4KFTA 1GR0A 5LZ7A 4AG5A 2VYCA 1OT5A 1A2OA 3BILA 5JCOA 4Q4JA 1LX7A 1JV2B 3EIOA 1WXXA 1IAVA 1Y5NA 5HDQA 4DVJA 3SDSA 3T3HA 1UANA 3LY7A 1EX7A 4GKKB 4G09A 2EP5A 3IAUA 4OQZA 1U7DA 2ZBRA 1EU1A 1KEWA 4W1PA 5CIYA 4FM9A 1PSDA 4UBKA 4ZJUA 1N1DA 2NQ2C 2Z1MA 3BWEA 3KQWA 1WD7A 2CXOA 3V4VB 5TB5A 4FSXA 1IOVA 4DLSA 1ISIA 1XZKA 2B1GA 3T41A 1RHUA 3AJ8A 2NVUA 5T3UA 1ZMTA 2AN5A 2VWGA 5C3UA 3MTBA 2VQSA 3TKAA 4O6VA 3M4JA 4KXQA 4OBXA 3FNGA 2Q6OA 2COUA 1Y4DE 2JKZA 3L07A 1CS0B 3TD9A 5BQFA 3JD0A 1XX6A 2FK8A 1D0VA 1VHQA 2R86A 3L8MA 3QTBA 4IXNA 4S1WA 5HKKA 1M6VB 1D5CA 2HQOA 2PQMA 3GRYA 4OHRA 1FFXB 1Z7YA 4ABTA 1KYQA 3KQVA 3A9CA 2GXQA 4X1KB 4L51A 1HYBA 1JQKA 2R4TA 3CCLB 1JQEA 4B75A 1NRWA 1OFTA 1QRUA 4D5EA 4FS3A 2Q6VA 1NV8A 5K5EA 4AMBA 3W6OA 1IATA 3LWBA 3L46A 1ZWLA 5TJ9A 4YA6A 3IQEA 3H4TA 2DBRA 4LDPA 4GX2A 3ZDDA 1XMVA 1YWGO 4KK4A 5DCWA 1O2DA 1PX0A 5EHNA 1RZ3A 1GUZA 5JD6A 1EFPB 1GZUA 1Q2XA 3LMKA 3RTDA 3HTXA 1OA1A 2A9PA 1L4KA 4BCDA 1B42A 1RKBA 4OKSA 4HPJB 1HDZA 1OCEA 3U81A 1GNSA 3OPXA 1OW3B 1H2HA 2C9OA 4QATA 1FRQA 4U4AA 3H05A 3BY2A 2IDZA 3H2HA 4X6XA 4INPA 3O8OB 3SJAA 3BXEA 1TVKA 3QX3A 2PRIA 3PIRA 1TZMA 1PX2A 1XEAA 3M4ZA 3N28A 4JBYA 4LCEA 4TVBA 1UFRA 4KUGA 3GVCA 4C88A 4C4AA 4UOZA 1U6KA 2O9JA 1IRXA 4JP5A 1HURA 1PR3A 1R0BA 1V7ZA 1XL1A 3VYTB 3DZ8A 2WWGA 3BWMA 1HE5A 4YAUA 2IF0A 1I4DD 5FA6A 3AJDA 3CLUD 4RELA 1ZHHA 3RVSA 4Q9IA 2WFMA 3W3ZB 4J0QA 4Q7MB 1CG6A 1W75A 2ZR7A 4FC7A 4GYKA 2DQYA 1Z4QA 2YWRA 1KI7A 1EFVA 1P75A 1JDBB 1PKEA 1RYEA 2SBTA 3KHSA 3VAAA 3LQEA 2NO9A 1NDUA 4C0BA 4D0NA 3CH6A 4EQ6A 1JG7A 5G0VA 3NKFA 1XVTA 5DU2A 1Z4LA 1JB1A 1BX0A 4P4GA 3A25A 4UHFA 4WK2B 4Z1MD 4Z4FA 3GEIA 2IK8A 3NCTA 1TAHA 2AJ8A 1CUZA 3NOXA 3VKWA 1G19A 4W5NA 1H0KA 3KSAC 2M2IA 3PDHA 4MB6A 3P9QA 4P98A 1TCUA 4BUJA 4ECAA 3MB8A 2VPTA 5EYPA 1PJ6A 1MT3A 1P33A 3A0UA 2PT9A 2P91A 3MS7A 2DHRA 4JLOA 2C4VA 3VR5H 1JUDA 2YNMA 4R0MA 4NQRA 1NYLA 4X3CA 2HX1A 3A3PA 1S2MA 1B6GA 1HE1C 1V95A 4BNUA 5JSUA 4YJGA 4EA6A 2UXCB 1VZ3A 2E4XA 2G70A 3S2ZA 3N6RA 3QEAZ 1L7NA 4QDOA 1QV6A 2O52A 4B40A 3EXIA 3QY0A 1CR2A 3KYCA 4AFNA 1P4MA 2OCPA 1KORA 3TRJA 1F0YA 4CEIA 2J31A 2NO4A 3COSA 5A02A 3DV0A 1RYFA 2WZDA 2OFOA 3A0RB 1AVTA 2VN8A 2YVLA 4IRXA 1WNTA 2IYQA 4TKVB 1QF9A 1U7PA 4FK8A 4BVHA 2ZXIA 4B2LA 5B7GA 2XBMA 5IUJC 2J6HA 3NUGA 4B6PA 4C7MA 1GTVA 4R2WA 4YRIA 3L6DA 2X14A 4RVDA 3M6IA 3NWJA 4OB6A 2G5TA 3HH8A 1A71A 2B61A 1H6AA 3G6EB 2RGYA 5FUMA 4OAPA 4KXVA 3W3AH 3R09A 2IJGX 3JQCA 1XRMA 2PSFA 4ASUA 2AYZA 3AYXB 3NHFA 3S2FA 4XWKA 2IHYA 1EUYA 2XUJA 3ZH9B 2H48A 2WD8A 1RVV1 2MSCB 3AM4A 5KTTA 3HBMA 2ONYA 1ZW1A 1T5HX 2IHZA 1TW2A 2V54A 4AS2A 5H8WA 3IULA 5KS2A 4YQZA 3O84A 4YP0A 3SZOA 5FR1A 1Y4AE 3MJEA 4OVKA 5F78A 1H1DA 3BL5A 3ZCRA 3TQCA 4EFNA 3HCPA 1N08A 3F6EX 2OHOA 4E31A 3KE9A 3BQNB 1R64A 2AUMA 2L19A 2C3MA 1P80A 4EQ6B 5M7EA 2V8OA 2AOUA 1DBRA 2GETA 3Q3EA 1Q91A 3KTFA 3BXOA 5I9BA 2H4YA 4DV7B 2DGDA 1JNXX 3E9ZA 3K09C 4ME6A 3RTEA 3L1UA 2CLCX 3KQHA 2E2WA 4ZCTA 4L8JA 3NOQA 4QYWA 3ZHUA 1OC4A 3ETCA 4N3AA 1LD3A 3ZIDA 5KKNB 2Q0XA 2VJQA 3FNEA 3LBIA 2H9IA 5G3ZA 1LSOA 1NI3A 2VQ3A 5A5EA 1IEXA 4WINA 1N7GA 2MINA 2VAVA 5KB3A 2IU0A 3NBZC 3QWHA 4QYSA 1UC8A 3MBIA 5AVYA 2IFTA 2ZIWB 2FFQA 4D2IA 4OHZA 2ONCA 1BEZA 2GHQA 4RQAA 4U8HA 4D41A 2FPGB 3NT5A 3I9JA 2CK3D 4CJXA 3BCRA 3ZDXB 3K15A 2O07A 4N3CA 5F7JA 3ZU6A 4LWOA 2O48X 3N5CA 1O57A 4HNQA 4CEJA 1T0PA 1PFKA 3WGJA 4AN1A 4AI6A 2PDAA 2JHFA 4G1FA 1EJ2A 4GC5A 4KMOA 3N7UA 3AY0A 3ICCA 1Z6XA 4P4NA 3O2NA 3NHJA 1V48A 1F6BA 1HE8B 3MCTA 3MUEA 2R00C 4CF7A 2OBYA 5C8YB 1SOVA 1QDEA 5E1MA 5CLJA 1O4WA 1GPYA 2R65A 2WI8A 1KF0A 2PMCA 4JT8A 5HQ3B 2C7OA 1RRVA 4KYIB 3GP5A 5UKDA 3RC7A 5FOWA 2VK2A 4HS4A 4RCYA 3VO8A 3A6GA 3VFDA 2AFHE 2NQTA 3WLNA 5GZ3A 2EJTA 3U49A 4AJ2A 2QMUA 2PJRA 4QUZA 3AUYA 1ZLYA 4ENVA 1SXQA 5COAA 1Q6ZA 1QVAA 2IEDA 4GPIB 4AN0A 4KQFA 4IOLA 4B4OA 4YFVA 5DV9A 3AJAA 3DZJA 3F1KA 4Y18A 1WMFA 1T6ZA 2IVZA 3JU3A 3BXHA 1CEXA 1N3YA 3F8TA 3ORYA 4C06A 4R3WA 4IYRA 4AX8A 1XEFA 1CP3A 4UE3S 1NC1A 2AOUB 4UUQA 4X71A 4ERXA 1RXVA 4N47A 4E22A 1W0CA 3MHPA 2VCHA 2EQAA 1U0LA 5REQA 1NQAO 3OCWA 1J90A 3RM3A 3MMXA 3P0JA 4NYIR 2C1ZA 3GRCA 3QU9A 3AIIA 5LMCA 5JASA 3BHIA 3EA4A 1GU0A 3A3GA 2MINB 1YS7A 3TO5A 6GPBA 1PR5A 3EC1A 2EG9A 3G02A 4ZAZA 1ORDA 1PJAA 1T8TA 4QJ4A 3EXFA 4EDHA 3GAMA 2JLWA 3DLAA 5GGXA 4F6RA 5ICSA 3QFRA 3RAEC 1ZU5A 2XCOA 2VQFB 2J0QA 4MLPA 1N5OX 2YOGA 1UBNA 2FQWA 3LPLA 2O4CA 4MWEA 4QUDA 1USVA 3DEIA 3JS5A 4KPGA 5LA6A 3EH2A 5FPSA 2XKKA 4DMGA 3K6RA 2B1QA 1MZPA 3RW9A 2NP7A 2O8FA 1ORWA 3A4VA 4RLHA 2ZWVA 5JAOA 1WV0A 2BDUA 1GADO 4O33A 4KH0A 3SLRA 5A3SA 4HWGA 2WILA 1FPMA 1PJ3A 4RTSA 4YRLA 4HEA6 1F2TB 4N9QA 4GBED 5I8PA 1F8YA 3KQUA 3RYCB 1B0ZA 2FZKA 2DFTA 1U65A 5L3RA 3OTWA 3R7DA 3RLFA 4Z49A 5A3RA 2VUTA 4YRDA 3PJFA 3PHGA 1XNQB 1IBRA 3D4BA 3STVA 1YI2B 3WO1A 1X8JA 4P12A 2QU8A 2UVPB 5I47A 3PSHA 3WLQA 1Z34A 1AM4D 5TS2A 4DV5B 3K16A 4XQ0A 5F98A 1HM5A 4IDQA 4NSNA 2FPPA 5K3CA 4V2IA 3P71T 3E1YE 4FILA 2X0NA 4R1MA 3MHTA 2Q3MA 1JWBB 3FUUA 3H9BA 1U9IC 4KO4S 4M87A 2WMYA 1CY4A 2HCRA 3G2LA 5BMOA 1SUDA 4E09A 2OFXA 1UDBA 4O2BF 3ST7A 2X9QA 2XNCA 4Y2VA 1YB1A 1J24A 1KP3A 2I6UA 3NNNA 5LLTA 5F64A 5JS2A 2V6IA 4GEGA 4WOCA 3KU1A 4TTQA 3FTDA 5LB4A 5GINE 3TOSA 4FMCF 1H2AS 2HV8A 3WYEA 4YCAA 3GCWA 2UZIR 4D5GA 5TLSA 3PX3A 1IQ0A 2H1VA 1UP7A 3HCAA 4FFRA 4DUPA 4URWR 3MC1A 1XZAA 1RT9A 2H59A 2VDLB 1Y1PA 1LPBB 2ZBVA 1D04A 1N6NA 3Q3VA 5AM5A 5G40A 1XVVA 4JJ7A 4MVJF 1J0CA 2IH4A 3BT7A 2VSOA 3R4CA 1JL3A 1RXIA 5LOVA 3DBRB 3FJYA 3TTUA 4CL8A 2F9MA 5DZSA 4PRYA 4CL0A 3HJHA 4FR0A 4GXRA 3KAPA 4JOBA 1TPZA 2VHYA 2GR9A 3L6RA 2OCXA 2RBEA 4YR9A 4AW9A 2RHRA 2OXRA 4M1QA 4Q47A 5JSQA 4Z8YA 3GVJA 4L3WA 4CMHA 3CC4B 1BU5A 4LSGA 2GZSA 3B7GA 1BWRA 3I37X 3L9XA 3GT0A 1Z37A 4ENSA 2DFLA 2WP8J 3JD1A 5KYUB 3JAMA 1TX4B 2EQ5A 3RTBA 1E3DA 1O96B 1B16A 1S6YA 2WJ4A 3DOEA 3IJEB 3ND5A 4MUHA 5ILGA 3FUXA 2QUAA 2OMEA 5HJ7A 2RGRA 2PGAA 2YNMD 4HH0A 4JX9A 2O8FB 1ZVQA 1SHUX 2X0IA 2D7DA 1B8OA 2XCTB 4QRHA 4TV9A 4Y1FA 4BO1A 3NRCA 4P3YA 1AQNA 4OXKA 4RKYA 4BAGA 3HRIA 2WYOA 2GUGA 2XOXA 2Y8EA 3GH3A 3O9ZA 3OQIB 4IPTA 4RE6A 5E38A 4MKGA 2Q7XA 2JJYA 3DV9A 3F8WA 4NZYA 5KKCA 4C7OA 3QSYA 1IPHA 2A9KA 4CM9A 3LQ2A 2GPWA 2AJDA 3TD2A 3OT5A 4ZFNA 4W7SA 1L5HB 3EEFA 4BTEA 4FLMA 3QKRB 3QV1A 3KWMA 1QG4A 3AKYA 4PIMA 2A0YA 4MQ5A 4Q4DA 2AYYA 3KB6A 3FDIA 1D0SA 2AHRA 2A1TR 4JVOA 1NG1A 1D9XA 4JJ6A 1NVUQ 1UC5B 4ASUD 2YDYA 4DSUA 1GPH1 3VO9A 1QOZA 3KETA 2QLLA 4CG3A 4EH1A 3LHSA 4FUQA 4UHBA 1NI5A 2GREA 4MJ7A 4RH1A 1QIDA 3REQA 3RT9A 3GNTA 1F4VA 3VH1A 3DOHA 2GK3A 4EUEA 2C7PA 2NZUG 5H5JA 2CV1A 4X41A 3O38A 1R0KA 1X7WA 3KTOA 5SV2A 2WLTA 1RNLA 4LC0A 3LPAA 3ZHRA 5JI3E 5KOIA 2FA9A 3D3WB 4DNQA 5J23A 2X3FA 1WWKA 4LX0A 3FVVA 3V46A 2A14A 4LFCB 4M7OA 2ZVDA 4IUDS 5CXSA 1XKQA 2CHVA 1YS4A 4LRXA 1DAIA 3VAZA 1B73A 1G21E 1Q14A 3CLVA 3ESBA 4LMPA 2DM6A 2IXAA 2JHCA 3WYGA 1RPZA 2QGFA 1GQRA 3PLAE 2IBSA 4KX5A 3RKSA 1XQ9A 4DNPA 2CC2A 1F0NA 1I3LA 1U1IA 4B17A 4GZ3A 4DV6B 3SN6A 1SWWA 5KVSA 3ZE6A 1GUBA 1W2WB 3M1LA 1Z7WA 2K7ZA 3N8DA 221PA 1ZN8A 5ILQA 5IBCA 1XZFA 5ICGA 4EF4A 1CDOA 2XUDA 3M6FA 3BJZA 2MU1A 5BOSB 3O3NB 4MIYA 2QJFA 4E5YA 2P6RA 2IS6A 3KELA 4WN3A 4OATA 7MDHA 3QXSA 2QM7A 3MTGA 3FCEA 4BFSA 1WRBA 2F1OA 4CR6A 2O2XA 1D03A 3I52A 1VJRA 4RSRA 1TA0A 2NUBA 5BMVF 1G1AA 1PGPA 2PBFA 4G1CA 2CE7A 2YVAA 1ZJ5A 3HG7A 1EFTA 4B3FX 2GLTA 5C8VA 4OSEA 1S0UA 2F9FA 5HMLA 4YAKA 1H5QA 1Z5NA 3B2QA 2IYVA 3QTLA 3CM0A 1QAQA 1GNVA 4I50A 3T94A 3H94A 1Z4NA 3LHIA 2HQBA 4NULA 2W83A 2YYZA 4HY3A 1NJ2A 1M6HA 2GKGA 4B81A 3ICWA 3ZWCA 3F98A 4LHWA 2W6QA 3TMAA 4MUIA 3T4XA 5CT5A 4I3GA 3EIFA 2QRHA 4UU7A 2NXJA 4I4IA 1IN5A 1NBHA 1VQPB 2QXUA 4W4TA 4M9CA 4YRQA 5GONF 3BN3A 4HQKA 4YRMA 3CPHA 3BF8A 2PMKA 5SICE 3MFQA 4NAUA 1JI0A 2NTNA 1U3VA 4JNKA 1U3GA 4G3XA 4M0DA 3V1LA 5BR7A 1J1UA 5T4HA 1GPNA 3WWZA 3DTVB 3EC2A 4BU0A 4RD2A 5C4IA 5IAAA 1G5TA 4W5HA 1C7IA 3U7QB 1AOXA 1ZAYA 2ORWA 2V7VA 4HKTA 4CMGA 3MFYA 3STYA 2OSBA 3WJ7A 4EY3A 2HU5A 2A59A 1TI7A 2FMFA 1K4MA 2YINC 2Z2YA 4XQEA 2JJ8A 1L7BA 4YAFA 1JMKC 1PWXA 3OM0A 1ZVVA 3EGCA 4QOIA 4S3MA 5H68A 3JQAA 3Q7TA 1JG1A 2AA3A 2CXSA 1EFRA 3AVWA 1ULTA 3DDNA 1NXPA 3PHLA 2W2QA 4DR1B 5JTTA 1IB6A 2RCYA 3LQ1A 2HV9A 2RIRA 2EDCA 3KVYA 5DSTA 3W5SA 3TQSA 2J48A 2QUBA 1A4XA 3TK1A 3AM1A 4YYZA 1C8LA 2I7XA 2QR2A 2UZ0A 5EA2A 1SU6A 3GRAA 2QT9A 4WADA 5FPHA 1UM9B 3H2GA 3LF1A 4I55A 4ER5A 3QENA 2IELA 3X1WA 4DV3B 5EJ4A 1L3IA 5FBRB 1RPTA 5L7YA 1UOQA 1FFAA 2JJQA 3B2EA 4YJHA 1HH4A 5GADl 4MXDA 1DV1A 2VBVA 1UBUS 1SUPA 5CNKA 5FJJA 1AG9A 6PFKA 2YBDA 3ZHVA 3RHZA 3MRTA 4MVCA 3NTLA 3IUNA 3DZKA 3UY4A 1EZ4A 4C7XA 3FMPB 5IW8A 3V8NA 1AHPA 1DWPA 1ZD3A 2AJTA 2DERA 4AMYA 3I6ZA 4G8CA 4KITB 1YGYA 2YQ4A 3U16A 3UFBA 3DOCA 3GUHA 1KKMA 4KBFA 4IDEA 5DHQA 2DIEA 1G8AA 3SKXA 5KVAA 5F9FA 3GT3A 3N87A 4XH9B 2Z8XA 5EN4A 4M1EA 5HBGA 4CV1A 2ZJ1A 2FK7A 2W90A 1Z5ZA 3PZRA 1K5DA 3WRXC 3MJRA 2XGMA 4NOMA 2AEEA 2HJ9A 3GARA 3LPNA 3LYLA 4ZODA 3I8OA 3K7EA 2JFHA 2W6ID 3PQ6A 4P7FA 5K51A 3BM5A 3T52A 2JC3A 1J2RA 3K32A 4ND8A 1RYNA 1CJCA 4G37A 1O6CA 7ABPA 4PLCA 1H4QA 2V1XA 3O4HA 3DDSA 4J0DA 4BNWA 4BUCA 4L5IA 2OCLA 3HY4A 2CF5A 3LBHA 3ZGNA 4P9SA 4MPPA 3RHTA 4CLRA 3DXXA 1ZEMA 4BRZA 1AHNA 3AHJA 2EVWX 1QQ5A 2GPJA 4GGOA 4GOOD 5KJCA 1CEEA 1D4FA 1IN4A 3L1HA 4W9MC 1HZZC 1KO7A 1SCAA 4KACA 1IXKA 1CE8A 2J32A 3COYA 1A9SA 4X20A 3TFWA 4L07A 1ZD1A 2A9OA 3OY2A 5FQOA 1SVKA 2BISA 4WZLA 3A1TA 4NU5A 1UBMS 3SF0A 3VKUA 3QH4A 1Y48E 4J4TA 3DE0X 4P6YA 2CLEB 3EEIA 4JOCA 1K5HA 4QPJC 3PNQA 2O1EA 4RY0A 4YHHB 2XXBA 1Z2PX 4TYMA 3A9VA 1MPXA 1QS0B 2VHEA 5DNCA 2C58A 5ENVA 1J00A 2JF0A 1EG2A 2C5GA 4IX9A 4KBGA 5BPHA 5FTLA 2Y1WA 3LQFA 1NJID 5EZYB 4CR8A 4ARVA 2JRLA 4OMUA 1F4PA 2CFOA 2VHVA 4MMZB 4UBIA 1KJJA 5B3KA 1L3BA 3CTPA 1D0IA 4JS0A 4YJHB 2BVNA 2B5VA 2Q3BA 3EZ6A 1Z0ZA 4IMPA 4JBIA 5SZHB 2PUBA 3CVUA 3ZG6A 1XC7A 5DRYA 1POXA 1PRYA 3WL8A 4G41A 1AQUA 3RIYA 5DHFA 4AG6A 3CW2A 3TNDA 2HHHB 2WINI 1BE6A 2QYOA 1PVDA 2K87A 3CN9A 3SAJA 1BTOA 2N42A 3AHCA 5K0FA 3BHMA 2GT1A 4BOYA 1I0IA 5BN4A 3WAKA 2IYAA 1TPYA 1G3QA 2W71A 3IQWA 2GCPA 2EJCA 5EIOA 1M6EX 1YA8A 5FR2A 5KCZA 1O89A 3HP4A 3CRZA 1E9CA 2R97A 4DXAA 5DVZA 3QLUC 2QAGC 4RV5A 2L17A 3H9CA 3TNFA 1U0NA 1R8XA 1BJTA 2HADA 1ZI9A 2RBKA 2SKCA 3P52A 3G5UA 4HO1X 5J1TB 5CG1A 1X7YA 1TECE 4FZ3A 1W87A 4EI9A 4FKZA 3NVKI 3QWBA 4X1IA 1VPVA 2F1HA 2GFIA 3F9IA 4H1UA 2GDJA 2ZIFA 4JBWA 1KEEB 3RWBA 4PHTA 3ZDRA 4AJIA 4E03A 2FPWA 5DWQA 3D6HA 1I13A 2Z09A 4RJLA 2AW3A 2OZLA 3IUQA 4JLUA 4M3NA 5AHKA 5IKEA 4LBZA 4JLWA 5JZVA 3QEBZ 4E14A 1L8XA 3EVBA 4HVTA 4R54A 4HAYA 4C07A 1NBMA 3KKQA 4GW3A 9ABPA 5A8AA 4PV7A 4LJLA 2HY7A 2WIKA 3LFHA 1KAOA 1F0PA 3OWXA 2FX3A 3DBHA 5BP7A 2JD2A 2X6XA 1O4VA 4XMYA 4BEJA 5CUQA 1SEVA 5IC5A 4BMNA 2HL6A 2XI4A 2V5AA 3EXEA 3NHYA 1X7GA 3FHTA 2QLJA 3RAJA 2QT1A 3UMGA 4FHZA 4L3OA 2JDIA 1JFRA 2EW1A 2I34A 3OX1A 4V0KA 3ZE8A 5LWHA 1HZEA 1P8AA 2VJJA 3W7AA 5PNTA 2YUIA 3NO4A 1NW8A 3K9WA 2BBOA 5BR1A 1UKEA 2GFQA 3F78A 4JGGA 1T1EA 3U9LA 1F9EA 4XSHA 1GKLA 4X6YA 2XRZA 3MLAA 1ZONA 4FEGA 5IN5A 3TZKA 3LZCA 3X1DA 3H0KA 5GP1A 1J22A 2AZ4A 3VC2A 4ZCMA 1T2NA 2W00A 5E1BA 4MZXA 2J5QA 2IL1A 4DLXA 2F55A 4DJDC 3A6JA 3K1YA 1K9VF 1CQIB 1X19A 3BGVA 2X3UA 2O8VA 2LWIA 2OR3A 1JEJA 3WGGA 1CEQA 1U2GC 1H93A 1HTWA 1ZGAA 1D2GA 4IRUB 4XUDA 1R50A 5DISB 4TTJA 5AW9A 2BFCA 2DLNA 3EQ7A 4KE7A 4LSZA 4ZQIA 3FIJA 1D4ZA 1OQAA 1QDUA 2NZYA 3L5KA 2VF5X 1RWPA 3L8YA 2JS7A 4C0LA 2CWWA 3NIDB 4ZI5A 2W9XA 3WKAA 5J2TA 3D64A 1I10A 4FQ8A 1CUSA 3ZHTA 4JI3B 1P2GA 1W1UA 2CMFA 2OQRA 4DBLE 4ZYXA 3JYPA 1XG5A 5BNWA 4MWDA 4CMBA 2KMLA 1N7IA 1O94A 1QR2A 3P9YA 4M0KA 2BKXA 4OLFA 3ZZTA 2HTEA 1LW7A 3ZXUB 2X5JO 4EEKA 4M22A 5ADUS 5CK4A 3OPYA 2I3BA 1W9XA 1Z7EA 4EW3A 2VBFA 3KZOA 1XMXA 1UT8A 1SBZA 4YP1A 2ECPA 2V45A 2WJIA 1I2ZA 1KH1A 5DGTA 1BU8A 1T1SA 1A7JA 1K92A 1CK4A 2ZRLA 1ZFNA 4MS4A 2WD9A 2JJ1A 4GKBA 4ND1A 4DZRA 4HB0A 3B3GA 3FBWA 4LDRA 4V02A 5CTAA 1ML3A 1N2IA 4XNFA 4RKWA 1WUYA 2G0NA 2I6QA 1ONSA 2GN4A 2B94A 2N3ZA 2FFHA 4R9VA 4BO2A 2YZNA 1GM5A 1HDEA 2FMXA 3T4EA 3DDZX 1MVNA 1EE1A 1ZK0A 2VWQA 2V7TA 1FYWA 3AWDA 2ZBDA 3GBPA 4QYIA 3WV5A 2QIOA 4BJ5A 3U2QA 2DECA 4MUBA 2HU2A 4PG4A 1XLUA 3CGWA 4E4RA 1ULHA 7YASA 4P08A 1ZSVA 1L5GB 1DG3A 1NVMB 1WXGA 4YUZA 5IVPA 4CXMA 3ASUA 3JQAD 1OZ0A 3PC8C 2GXAA 2NPFA 4BO4A 2ZDGA 4ZK6A 3QLTA 1YR1A 2YWCA 2VP9A 3WWYA 3NTRA 4AY5A 1D9ZA 2QJRA 1BCRB 4JI5B 4HQNA 2IHJA 3TIXB 2I1LA 2HMYB 5AN9A 5EC8A 5IN4A 4KB5A 1XF9A 4KNWA 1L1RA 1JIJA 4E15A 3QE9Y 3Q40A 2GYVA 2C5BA 4BB9A 5JHHB 3KOZA 3QPCA 4J7UA 1IXYA 1L4BA 3W1EA 5C1PA 3CNQS 1CW2B 1BKSB 1I4WA 3C8DA 3QNUA 3RTAA 2FOXA 1I1QB 4Z9YA 3ZQ6A 1O5TA 5AKIA 3ZJVA 4RUKA 3LQQA 2XUFA 3KD2A 3M5DA 1N2SA 3R4VA 4XUCA 4ZGGA 3PXBA 1BMQA 5FTWA 3BXPA 1EPUA 3FWNA 3AHHA 4J4HA 2GXSA 4JELA 3ZWNA 4JZYA 1K6XA 2PX8A 2AFRA 4BDTA 3PHJA 4M9ZA 4INJA 1R8QA 5DBGA 4OGGA 2FZEA 1HMYA 1S4QA 5LVAA 1D8AA 3NTQA 1YZVA 5HOQA 2B4YA 1A8HA 3NKLA 4WA8A 1NYTA 1DWQA 3U4QB 2Q5EA 3H83A 1RE0A 4PYNA 4EB0A 5JH7A 3HXPA 3BD7A 5EI5A 3B89A 4N49A 3KXKA 5EZ5A 4E5PA 1FYFA 1U1CA 3R6JA 4NPAA 4HDMB 3FDXA 4GXQA 4S0ZA 4UC0A 3D7NA 3ZD8A 1GVNB 3EDCA 3NEYA 5F4MA 2ZJOA 2GCIA 2ZREA 3BCHA 5CP8A 2IX3A 1GUYA 1WW2A 3SVLA 3M3PA 4MR9B 2H1CA 4CCYB 4D8TA 1XJCA 5TC4A 1H2FA 1M3SA 2VXYA 3LYUA 4PANA 1GZSA 5D5PA 1C3OA 1UK6A 1OC2A 2Q9UA 3B9BA 1VYVA 2O23A 2V7UA 1ZMRA 4CR7A 3KEWA 2L42A 4UCFA 3AJ9A 2EKLA 5G0SA 2QQ0A 1YR3A 1ZIDA 2QYTA 4HWRA 1RI3A 2Y6VA 2M1XA 3DMTA 4BKMA 5AESA 4E4TA 1PUXA 1YS1X 2EV9A 3C5CA 3TZ6A 3X1KA 5KBYA 2WA1A 2VP0A 2G1UA 3CA8A 5LFAA 5GTDA 3G71B 1BHQ1 1V8BA 2FSVA 3ITDA 4WY5A 4DDMA 2Y4OA 1IK6A 1WEHA 1Z26A 5CD9A 1PT7A 3JQQA 1PW5A 3UH1A 1RC1A 2JANA 2HMSA 4JJGA 5K4HA 1BO6A 3QA3E 3JR3A 2C2HA 3VNAA 4XCVA 4C0KA 3UA3A 4GSYA 4RK5A 3QFCA 2PZAA 2BFWA 4DPMA 2CF4A 4PLGA 1B23P 4M2LA 4RDJA 1XCJA 2CMGA 2OHIA 5EP3A 2PMDA 3AFMA 4PSCA 1ZCFA 3MMSA 3IPRA 1YOBA 3DKRA 3PF9A 1D6MA 3R3WA 4KGXA 2AK2A 3HA3A 3VHXB 5CLLA 1GRQA 1YQDA 4EWLA 3VU0A 4NEQA 4XRRA 3C1AA 5H3CA 4QTYA 2RHCA 4V03A 3RRNA 4RTJA 4G1BA 2EKDA 2O3TA 2ZB3A 3T3PB 1ULSA 2FUNB 4X91A 3AUTA 2HGZA 4JC5A 3L0OA 4Q93A 2FDRA 2PCJA 1YR6A 5C1OA 2YY7A 3DJYA 3F96A 2JK0A 3W2TA 4HAZA 2O1WA 1SR8A 2WWRA 1QWSA 2ZRKA 3OIYA 1EUCB 3IEIA 4MV4A 3TMKA 3DULA 1R9JA 4UDYX 2F90A 4A8PA 3G0HA 3EXG2 4NEGA 2JH3A 3WK4A 2H2IA 1YITB 1VJ1A 1GPJA 3ET4A 1UQTA 3LHDA 1MC4A 1EXNA 1NP7A 2Z0MA 1P73A 5JH7B 1JZQA 5EIBD 2EJVA 2QXYA 3G89A 5TQJA 3ZV7A 2UU9B 3BB4A 3GK3A 4O8ZA 5BSGA 1HI9A 1UBKS 5JI2E 3QUSA 1PKVA 2JLRA 1PJCA 4D74A 3I64A 5EJ5A 5LZ4A 3HXLA 4AYTA 4REQA 4W99A 2G25A 3O1HB 4DILA 2H7YA 3MUOA 1Q1AA 3N8GA 4J16C 4YRFA 1ZLXA 5EESA 4B85A 1E9DA 2H63A 2QPLA 2GRJA 5J5AA 3I61A 2R60A 4JY7A 4Z9FA 1NBMD 3OZVA 3M3HA 4KYVA 3TS1A 4L95C 4GXNA 3OQNA 1JLLB 3FWHA 1H6DA 1YNSA 1FDUA 2WIBA 5AKZA 5LYJB 3M81A 4AZ3B 2RBGA 2FRDA 2I2CA 2R1UA 1VJSA 3S8EA 1J5PA 2VYNA 3EF0A 3G9XA 4JLMA 4WA7A 3T1OA 3TLYA 3H17A 1TK3A 5JCJA 1MX9A 2R5WA 2DOKA 1XNJA 2JDID 1A5BB 2SCUA 3HRKA 1MAWA 3D0OA 3OI7A 3VOBA 4AVZA 3NHMA 3F5QA 4LPKA 5ALXA 4PWYA 2IDMA 1I1NA 3E70C 3DKPA 2OYSA 3HYNA 1SN7A 2NTEA 3OTQA 4K40A 2QGGA 4ZVQA 3AUSA 3GLVA 1XZIA 4XJXA 1AZLA 2QJTA 1ZK1A 3OM9A 1TJ5A 4MAFA 1LU9A 4EMSA 1SBNE 2AUNA 5KWJA 4CKCB 1YJ8A 2QTWB 3IX7A 4C43A 1TZJA 3CR7A 5I3CA 3Q6NA 2PL3A 4OO3A 4PU0A 3AOEC 4RDCA 4TV8A 4XAQA 2QE6A 3DBOB 4I2VA 4IHQA 3PT9A 4YLEA 3TBHA 1FSZA 1H94A 1SVLA 3QBJA 2X40A 3CX7A 5AVXA 3DLBA 1USGA 1BAPA 2P0EA 3MQ4A 4KE9A 3ZJUA 2BCJQ 1DKRA 4S1OA 1W0JA 1T34A 5KWIA 1P4JA 1W2HA 2HK7A 2XODA 2EXXA 2W2KB 1ZISA 2XBLA 3WJ1A 4XYMA 1UINA 2R5FA 3HBJA 4LY9A 4E1AA 2VWHA 4NEHB 4U39A 3IA2A 4JNCA 1LPOA 1RLTA 3ROTA 2BR5A 1WDLA 3QJGA 3JQGA 3T1TA 1WB9A 3E9MA 1O94D 1W4AA 2JLAA 3T38A 4MI1A 1GSAA 3UT0A 1ODSA 1YB6A 2HA4A 2XOKD 4BWYA 2O8CA 1FNSA 1TJPB 2C2GA 3CX6A 4RPBA 3HV2A 5FV7A 2DR0A 1UBLS 3AEYA 4MCJA 3RDPA 3TUZC 4REQB 4IDAA 3R0IA 4N7MA 5ANRB 1JGTA 1IY8A 3EZNA 5C5IA 4JXXA 4EHJA 1PHRA 1Q0QA 2JHPA 3N8NA 1A7KA 4BO3A 2H85A 2IYYA 4QSMA 4TV9F 4UZEA 4TMFA 1J4AA 3K9CA 2LDBA 3KYDB 3L7OA 3UHJA 4DR4B 4C0XA 4XM1A 4E5VA 3PIDA 1BRTA 2AMJA 2D62A 2QVZX 3B38A 1QHIA 1VHDA 4RLQA 5MHTA 5K0CA 4G07A 1BE0A 4HSGA 4K9KA 1GLNA 4MO9A 2ZYWX 4G4SO 4QO8A 3OX4A 3RTCA 2BUAA 2PQ0A 2FHPA 5GJWC 4IG9A 1ZINA 3TQFA 4ALLA 2C4NA 2C9CA 2CBZA 1IZZA 3F5SA 4M86A 3EY4A 1U0BB 2FETA 4P32A 2CFSA 4XLLA 4CHTA 4ZMBA 2RG1A 4I19A 3RSCA 4HUTA 5K99A 3ITEA 3MS4A 4TXLA 2AR0A 1JYFA 2CFTA 2W4MA 2P4UA 4MP3A 3VTAA 4DHWA 1TJNA 3QQPA 3NB0A 1ZH8A 3DB1A 4ENQA 1RAHA 2V7EA 5BW4A 4EUKA 4JUDX 2DCUA 1DQNA 2BTQA 3ABOB 3AUFA 2Z6BD 3TAHA 2GNOA 4D9MA 4XOUA 1Z36A 2D00A 3P94A 5EUCA 1IUKA 1WVIA 2DFDA 2PZKA 3L7IA 5A4KA 1CDZA 1WG8A 3NGMA 3D3KA 1IM2A 4ZGNB 1JDTA 4CMIA 4YRPA 5EWMA 3QFSA 1ZBQA 4DBLC 1U8TA 3N0TA 5IC6A 1TUGA 4KQGA 3JQFC 2HZ7A 1I2BA 2TRSB 4GDFA 2ZYHA 3X2SA 1G7SA 1M72A 2HIMA 4MGKR 2JGAA 2HCTA 1Z5WA 3JAKA 3SZRA 1QC5A 2TS1A 4R1LA 1RZRA 1E98A 2HA2A 3JASA 1G5IA 4G63A 1P4SA 4JU9A 1JIVA 1UBGA 3R5HA 1YRWA 1NVVQ 3QUBA 1IY2A 1KPHA 1QXSA 1JIUA 1U2TA 3L3BA 5IJZA 3VHQA 3AY7A 3U61B 5DBIA 2HLHA 4RMNA 1Y37A 2EFJA 2OTJB 3P2YA 3ESAA 4ZTBA 4JEUA 2PE5A 2J7PA 2WWYA 2O8CB 1SB8A 3STHA 2YTZA 1A8PA 2UYYA 5EAIA 2FR8C 2G1AA 5EJIA 3F6BX 1OD6A 4MARA 1KFBB 1M2EA 1U3DA 2OGSA 3DPSA 3S29A 5KNBH 1E18A 1YAJA 4QUBA 4XYBA 5E6SA 4LYAA 3DQZA 3FAKA 4P2GA 3UJHA 1DAGA 4ZT5A 5A05A 2ZRNA 3PA2A 2X7JA 5JARA 2W2TA 5KYTA 2CSXA 1F2UA 2NTJA 2WT9A 3RVMA 1JDJA 1NM5A 2IYTA 4FYHA 4L4XA 2ORYA 2J7KA 4TXNA 3HKCA 3LCJA 5FBQB 3DDOA 3D7SA 3LBNA 4KPUB 4EGCB 5FLXA 5HFJA 3FDJA 2G4VA 4PSDA 5TARA 4AC9A 3SC4A 3U37A 3G1TA 2IEIA 3DBVO 2HLDA 3CYFA 4BEBA 2AI1A 1GCOA 1T9ZA 4DN6A 5EKTA 5CFLA 1FJ2A 3O93A 1W19A 1K3TA 4IH1A 4QXMA 4EVIA 1FX0A 2E21A 1V43A 1CQZA 3FXAA 2NPOA 3NATA 1E8NA 1GZHB 4I50F 3HV0A 4UATA 2FPMA 3C6ZA 1F2DA 4MGYR 3E0XA 3TPZA 3B6EA 5KDOA 3WGIA 1D4AA 1U9CA 2QMQA 4HNSA 4EGJA 1ECGA 1ANKA 2V6FA 1KI6B 3EPPA 2GBCA 2X7HA 5CT8A 1OZHA 4EO7A 3LDGA 4BXOB 3KR0A 5BV2P 4YLGA 1HBJA 4NFSA 3VAYA 4P25A 1VDMA 4U0JA 3C98A 3P0HA 1K5PA 4WMLA 1PD1A 5CM8B 4ZAGA 1KWKA 4L16A 1JHMA 1NW6A 5EWMB 3GFVA 2NVBA 3NHSA 4WFIA 5T41A 3HPQA 4P3IA 4WEQA 3T9AA 4RDHA 2YZ7A 3DMGA 3NHZA 3V3KA 4B79A 4ZJYA 3THXB 1P7PA 1VG1A 5LR6A 3WLSA 3E1GA 3IEVA 2HW8A 1DTSA 4K3VA 4OM7A 3E1KA 3C3YA 3K8ZA 4QTUB 4OOFA 4WRRA 1H8HA 2F1KA 1AGNA 3K96A 4KSBA 3TSCA 2BEUB 5LNK1 4FX5A 4GSLA 2NT3A 3BAFA 3PA1A 3IVCA 2CDRA 5IH3A 3X43A 3QI7A 3C3AA 4Y6LA 3HL4A 1BG6A 3WB2A 3SLGA 1OFHA 1T43A 2WAXA 1GQ2A 4FMDF 4D3DA 5CFPA 3HXQA 4IOJA 3KSDO 1Q7TA 4G4IA 5ALEA 2XAAA 5EY5B 4HZUB 1BEUB 4OMCA 5IABA 4K46A 4XASA 2R6CA 4QOFA 3HFJA 2A1UA 5CU7A 5T64A 3KYBA 2YL2A 3FMIA 4TQ9A 2BHRA 5FEUA 5B53A 3IVAA 3K4HA 3PXCX 3PR1A 4X7FA 3C8MA 3ZLVA 1JHUA 4IH9A 1OAAA 2RHLA 3JQDA 4WZBE 3MSXA 4V38A 1JJ2B 3OZCA 2UZ1A 3PFNA 4I55F 5AOAA 1LK7A 3ZWVA 4BKQA 4MQFA 3OCVA 5K3EA 2BP7A 2NXWA 1ZL2A 2XRYA 3SZLA 4BWVA 3B5IA 1YS9A 2CNLA 5FTMA 3VTKA 5L4NA 2X77A 2DWOA 1C7JA 5CPBA 5D87A 3V9AA 4OKNA 5B4TA 2IXBA 1EGMB 2C5LA 1GY8A 4H7EA 4X1OA 2IIVA 3O8NA 3Q6IA 2H1LA 5KSWB 1U94A 3B1KA 4GX5A 3T5DA 3VPDA 1VIVA 4L8LA 1XQ1A 2IUYA 3HDVA 4WZAE 3UVEA 1LF5A 2ETVA 3QVUA 3M1IA 5JJKA 4RZ2A 1OBVA 5KC9A 4IFTA 2VNKA 1OTHA 4I1SA 3FW1A 4TWIA 2FKNA 4GAEA 4OK6A 1IN7A 1GGNA 4GI1A 1ZKMA 1XZ8A 4DV2B 3DLHA 2Z98A 3I83A 2Y0BA 2ZCUA 2CYCA 4HAXA 4PZZA 1MC5A 3CV3A 4KQCA 2WPDA 2KM1A 2ZUVA 3VZDA 2ENWA 4CUZA 5BXQC 1AMNA 3S2SA 1K9MD 2VT3A 4FEEA 1BA2A 3IKVA 2CJWA 2JI6A 3PHBE 2W6CX 4LUCA 3W8RA 5E4YA 3SHQA 4D98A 5K6AC 2EGUA 4YRSA 4U6NA 2WG0A 3A1WA 3N0WA 4QECA 4KVFA 3W8EA 1Y3DE 1PT5A 1T8WA 4KFCA 4DADA 5CD1A 5TVKA 4UPDA 1SHZA 2AS0A 2PKRA 3RRJA 3TDNA 1E7YA 4DIBA 1KFJB 1MO6A 4N5NA 3ZHQA 2VHZA 3E27A 2KLBA 2P9BA 4WBXC 3O73A 4RJIA 3HXKA 1T8SA 4LV5B 1VSTA 2HMWA 1PWYE 1WXDA 1ZGCA 1ONBA 1Z08A 2DH5A 3A06A 5DBHX 1RWQA 4C6TA 4MA5A 3O1IC 4HUQB 1NLZA 2YOFA 5BSVA 2Q8QA 2VAXA 4GPAA 3VZQA 1I2DA 3H1AA 1M2HA 1EK2A 1D07A 1HGXA 5IDVA 4CNQA 4A5OA 4JQYA 1KC3A 3DM9B 3G0DA 2WFZA 4DDVA 3R6LA 5LZ2A 4JHXA 3PUHA 1E1DA 1I7DA 2I4TA 2PD4A 1MVLA 1XUOA 2A0UA 3CRNA 3QIAA 3R2JA 4ILKA 2OXIA 3WGMA 4DSZA 5A7FA 1N9GA 1T1GA 1CZNA 3FLAA 4D9JA 3GZTB 2R8ZA 3INYA 4HGQA 4AL4A 4BZXA 3GXBA 2W93A 1YS2X 4BN5A 3SHVA 5K6TA 4JMLA 5JNUA 5LZ8A 4MGZR 1KBZA 1SBCA 4RBNA 3DMDA 4A8JA 1N7HA 1UC4B 4X7CA 4RIIA 1GHTA 1Q1ZA 4BNXA 3EZGA 4FIDA 3T8YA 4WERA 3IAEA 1UP4A 1FDTA 2GCOB 4JL8A 4OY3A 4KLCA 4XWYA 1RQRA 4TMVA 1E7MA 3EZFA 4UQOA 5AO9A 1DAFA 4BVJA 3DEYX 3U80A 1YI1A 2Q28A 4EA8A 5JRJA 1K8RA 5JWRA 1QDLB 1OXKB 3P9ZA 2NYAA 4IXDA 2OM6A 1NZJA 4N54A 1Y5MA 1KOFA 3KZ1E 4REOA 1PSZA 4TSKA 3G7SA 4CM5A 3L8ZA 3RBAA 2ZB7A 4E88A 1RM0A 3R5XA 3LNCA 3SSNA 4BCBA 1U2QA 2R8YA 1KU0A 2K2WA 4MW6A 2ZTGA 2F43A 2IGTA 3IBCA 4NONA 2CJWB 2QLFA 4YCMA 1DC4A 1JQLB 5KNDA 1U1EA 1Q0RA 1GKKA 1ZM4A 4MLZA 1JSZA 3ICVA 4PSKA 4RDIA 3D8NA 4CKBB 3ER6A 3KZVA 1USIA 1NL3A 2EYUA 2NVOA 3U60B 1YB4A 2BFEB 1P1JA 1ULZA 1ENPA 3AEQA 4XYLA 2YJ4A 2GEUA 2ZI5A 1KMHB 1QFMA 3ZEAA 3OOSA 4O02B 1N9ZA 4YCNA 2O8DA 2WHPB 1F8UA 3CG4A 1KYYA 1VQ8B 2IKSA 4QOEA 3RANA 3OD1A 2PG3A 5ECGC 1GRRA 4YV0A 5DWDA 3DH0A 5AH0A 3IOEA 4C6TB 3GN1A 5IC4A 1RZRD 2HJVA 4LRWA 3WYDA 2W4IA 2E82A 2GAFA 3VNSA 1ENZA 1MQAA 3ONDA 4P38A 1UXKA 2XA1A 3BIXA 3KKLA 1LDEA 3CURA 2W2OA 1NMYA 3EBPA 4HH1A 4K6OA 2W2MA 5HJ2A 4H59A 5DEIA 3B52X 1L1EA 1AGPA 1I80A 3HJBA 1HKUA 4KLZA 4KMMA 1IUNA 3T99A 3GLIE 1VGRA 1U0JA 3RC9A 2Q3FA 4EF5A 2J7PD 5IWCA 1SUSA 2CBGA 2FCRA 1JPJA 4Z4RA 4QU0A 4S12A 1P0MA 3DONA 2PFSA 3HMQA 1I7LA 1QFSA 3NFYA 4QTXA 2R9VA 4H60A 1G6OA 4DNOA 5AD1A 2BEVA 4OP1A 5I7SA 3CVVA 1W93A 2G5GX 2G8NA