3W2IA

Crystal structure of re-oxidized form (60 min) of nadh-cytochrome b5 reductase from pig liver
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
271
structure length
271
Chain Sequence
TPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-cytochrome b5 reductase 3
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
total genus 77
structure length 271
sequence length 271
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w2iA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w2iA02
1JB9A 4DQKA 4M4SA 1EP1B 3ZC3A 3JQPA 3AVXA 2ZITA 1QFYA 2AHOA 5EMNA 1J9ZA 1GO2A 2YWEA 4C0SA 1SM4A 3LYUA 4G1BA 1G7CA 3CMAB 3W2EA 1TLLA 1XE1A 1QX4A 1KK1A 4RD4A 3CC2B 2OK8A 1K73D 1R5BA 3U2QA 1OGIA 3LO8A 2BMWA 5DSZA 4PC6A 1R5NA 4NCNA 2B5OA 3MMPA 1GJRA 4N3NA 1G7SA 1YI2B 3P27A 2DETA 2QTLA 2BPOA 2BF4A 2CNDA 1BJKA 4TMVA 1VQ6B 1H85A 1EWYA 1N0VC 2C78A 4FWTA 4M1KA 2BV3A 2RC5A 2BSAA 3ES9A 1KJZA 3B82A 4B3XA 5KSWB 1TTTA 2BM0A 2PMDA 1EFCA 4R71A 1KTVA 1K9MD 2R6HA 2HMAA 1FNMA 1KC8D 2YWFA 3AVYA 4Y7CA 1D2EA 5H59A 1W34A 2QA4B 4TMZA 4RD3A 1QH0A 2OTLB 1FNCA 1M90D 2YWHA 1G7RA 3ZZTA 3CPWB 1VQKB 1I7PA 1HA3A 4TMTA 4LC0A 3JQQA 2HCJB 3FPKA 4RD1A 4PGOA 4P3YA 3WNCA 1QG0A 1VQLB 3W2GA 1EP2B 3ZBUA 1B23P 4PC2A 2HDNB 3I1FA 4M0LA 1YITB 1Q86D 3I55B 4YAOA 2EIXA 2XEXA 4QHYA 1Q81D 4B48A 1KK2A 1QFZA 4BPRA 1XB2A 1DG1G 3W5VA 1N0UA 1E64A 2EFGA 3AGQA 3WNBA 3WYAA 4YAUA 2BVNA 2DEUA 4TMXA 1QGZA 1KK0A 2YWGA 4ZCIA 1EP3B 4MYUA 4RD6A 1ZUNB 4IW3B 1YHQB 1GVHA 2BGJA 2X3UA 4U9UA 3PENA 3I56B 1UMKA 2NPFA 1JNYA 1VQOB 3ZZUA 4B43A 3W2HA 2QEXB 4PC3A 2PIAA 3G6EB 4AF6A 1G7TA 1QGAA 3CMEB 1Q7YD 3VO2A 4H9GA 2GQFA 5JBQA 3W5HA 3QFRA 3B8HA 2GPJA 4YAFA 1FRQA 4WQMA 3WXMA 1ZM3A 1W87A 2QDXA 1B2RA 1QUEA 3CCLB 1KD1D 3A1FA 4C43A 4G1VA 3MCAA 1AIPA 1NDHA 1DDIA 4ZCLA 3U6KA 1H42A 4Y9RA 3WBJA 4Q7JB 2RC6A 1R5OA 3WNDA 1VQ8B 4AF7A 4ACAA 1W2BB 4M2LA 1QVGB 4Y9UA 1VQ4B 3W5UA 1VQ5B 3E1YE 1BX1A 4RCYA 1VQNB 3QSYA 1Q82D 4ZCMA 1F20A 4RJLA 4YHBA 1E63A 2BGIA 1VQPB 1ZM9A 3U6BA 2XNJA 3CW2A 4B4DA 2VNIA 1A8PA 3AGPA 4M53A 3P26A 1IB0A 1TUIA 1CQXA 1SKQA 3FJOA 1QVFB 1YJNB 3VO1A 4G5GA 1E62A 1ELOA 4F7DA 3CCEB 5TY0A 3CC4B 3OJXA 1IJEA 1GR1A 3QFTA 1YJ9B 1GAQA 2FX3A 3CRZA 1M1KD 2CRVA 2XNCA 4UAJA 1KQSB 1EFTA 4TN1A 2VNHA 3AVTA 1BX0A 2B7BA 4ZV4A 3E20A 1W35A 4YAWA 5HXBA 2J7KA 3AVVA 4K1XA 3ZZ0A 1OB5A 3WY9A 3QE2A 3AVWA 1D8TA 1FRNA 4B47A 4EH1A 1K8AD 3OZWA 3CCSB 3VMFA 1DARA 4YALA 3W2IA 4MYTA 3OW2B 4FK8A 4RD2A 1FDRA 1QUFA 3LVBA 2DERA 1EFUA 3CCUB 4N3GA 4HE6A 1TVCA 3VNUA 4HE5A 4ZGNB 3CCMB 2BM1A 5TV2A 5TR9A 3ZBTA 1FNBA 1QFJA 2DCUA 3CC7B 3OZUA 4FN5A 3QFSA 1OB2A 1VQMB 2E1RA 4PC1A 1VQ9B 1S72B 3AVUA 3QFCA 3SJZA 5FA6A 2QMUA 3CD6B 1YJWB 3W2FA 3G4SB 1NJID 4QFMA 4RCZA 2OTJB 4LBWA 4TMWA 1AMOA 3VNVA 4RD0A 4B44A 3CCJB 2BN4A 3JQRA 5THXA 1OGJA 3J81k 1JA1A 1BQEA 3G71B 4LBYA 3LRXA 1WDTA 2D74A 3CB4A 1VQ7B 5H5JA 3MHPA 1N8RD 2OK7A 4PC7A 4LBZA 1F60A 3CCRB 5AN9A 1S0UA 1IJFA 2C77A 2VYQA 1CNFA 1YIJB 5GV8A 3CCVB 2VZLA 1ZM4A 1CNEA 5GV7A 1EXMA 4DQLA 1U2RA 2B7CA 2QTZA 4ZGQB 1JA0A 3CCQB 1DDGA 2VNJA 3OZVA 1FNDA 1QGYA 3WBKA 4P6VF 3B78A 1KRHA 1D1NA 3V76A 1GAWA 4J0QA 4AC9A 1KK3A 2PLFA 4NBSA 3OJWA 4LBVA 2DY1A 3CXCB 2QN6A 1ZM2A 2VNKA 1JJ2B 4ACBA
chains in the Genus database with same CATH superfamily
1LTKA 1AKQA 2JFGA 4LKRA 4HATA 1QV6A 3CLHA 6YASA 1C3LA 1ZBQA 3BF8A 1N5RA 3OX4A 4KTTE 4DTIA 5JZ9A 3UJPA 1U0SY 3JQPA 1E8NA 4AB1A 2WD8A 4YK7A 1EG2A 3CLSC 2OM2A 4U7DA 4JQSA 5AI4A 4E6PA 5DH9A 4RIIA 2P0YA 4KLCA 3Q8LA 4FSHA 2Q0QA 2O2ZA 1Z18A 3AWDA 2CN1A 3MCVA 4XD2A 2HR1A 2JBAB 3GD5A 4OQLA 2XPCA 1SHLA 1XZPA 1N7JA 3I05A 1YKGA 3NBQA 3GFGA 3PHLA 1FDUA 3WLOA 3PE4A 3ZPXA 3A8IA 1MVNA 3KNZA 2P2NA 4FB5A 2YVQA 3D6JA 1FEZA 1P4SA 4RSHA 1AUOA 1AUXA 4IJVA 4YJFB 4UZFA 2NAPA 1WXWA 4LAFA 1LPPA 1Z16A 3FVVA 2BJWA 1Z35A 4ZJUA 1HX7A 3LHIA 3C3KA 2C3MA 4YX9A 1EX7A 1UOEA 1ZC3A 4L4ZA 1W0KA 3PC6A 3E7FA 5DIFA 4C0AC 3OM0A 4HOYA 2R1VB 2ZB2A 1GXSB 4NPCA 2AWOA 4MKGA 5AK4A 5GONA 3M81A 3X43A 2NW6A 2JZOA 2QYHA 3E9RA 1T0HB 1VGRA 5TQJA 3AR9A 4DA9A 4ARZA 5JMWA 4N3NA 4PBTA 4R9UC 5LA6F 2PU7A 2CXSA 4X45A 1OZAA 4L28A 4BMYA 1KI6A 1IOVA 2QI9C 2B83A 5JRJA 4MYRA 1YL5A 3KDAA 3PFHA 4IHJF 4GM4A 3HB0A 4P3XA 3IVMA 4PLCA 3CNEA 4R1OA 1NTOA 2RHHA 4G0XA 5DTIA 3ZIAD 4A8JB 3RYCA 4ZZ3A 5C51B 1XCPA 2GCPA 1P80A 5HJ7A 3K9BA 2XAAA 3ZJVA 4DBZA 3H13A 3WYBA 2CLIB 2QSUA 1DADA 3UW1A 5KTNA 5JS7A 2C5EA 3ONEA 3ZGYA 1DTSA 1ZJ4A 2I34A 2AQKA 1Y9DA 4F96A 1JXOA 5FEUA 1XZNA 1ZK2A 5JASA 1U63A 4DV2B 2XLBA 1FIUA 2IOFK 3T3OA 4XPZA 4X8IA 2Q5QA 4NZMA 1FP7A 3P97A 3BGWA 4ARAA 1CB7A 5ILGA 2YXBA 5EYPA 1G8PA 4OOSA 3Q39A 2PO5A 1Z6AA 3NTLA 4L16A 3P0EA 3G9ZA 3Q40A 4YJ3F 4Q3KA 1KDZA 3A58B 2XUOA 3HPQA 3VM6A 3D8BA 4Y7CA 1HYEA 2D8MA 2O54A 1XTJA 2GJ9A 4FOOA 2XHEA 1GAJA 2DFVA 3OZGA 4KAFA 4UUQA 4YP5A 4KXXA 1FDVA 1BHSA 3AM4A 5H4GA 3UXMA 2I87A 3RHTA 3WIVA 3HCAA 1CIPA 5JJIA 4ZFNA 1E0JA 2OUIA 2VT6A 4DYVA 1PDOA 3C3PA 2PX2A 2ATEA 3DLBA 1J5PA 4NLLA 3C7AA 4BGUA 4CETA 4LYYA 1A7UA 5I7UA 5JC1A 1P91A 1ODIA 4TS1A 4CR7A 4KWIA 4AY2A 4TKMA 4MVJI 5TGDA 3I58A 1BIFA 2WR8A 1WS6A 2XE4A 1I1HA 3ICPA 3D5TA 4QXQA 4RH3A 1M6NA 4BFXA 4A0FA 4DSTA 5JY1A 1DI0A 4LJ8A 1NVDA 3SZRA 1IM2A 2YZGA 2Q8PA 4FZVA 4ID9A 2YMQA 2XNDA 4YTEA 2JLQA 3GJTA 2WYWA 1LDYA 5LYJA 4A0RA 1Y4AE 1YQQA 2C5FA 4WKCA 3I55B 1I6LA 4YAOA 4NV3A 4KWTA 4BVGA 5AVYA 1M66A 1KSGA 4WW0A 1H69A 5AM5A 4D7AA 2I3BA 3MWEA 1PS0A 1IXZA 4JCOA 5IJ0A 1PX0A 1S3GA 4NOKA 1SN7A 1P9NA 4WZAB 5G3YA 4AS2A 4FYPA 2L18A 4E88A 4RY8A 5IKEA 1XKXA 4Q48A 1GNSA 3HN6A 5JSZB 2BEUB 4LF9B 5HZMA 3CRQA 2DIEA 5K51A 4AQ7A 3PXXA 4IIJA 3RIGA 2FSVA 5C4GB 1L5LA 3WLEA 1WLSA 5KWJA 3H11B 3I9FA 2HU8A 5K0GA 3KP1A 4UPEA 4C0JA 3KEWA 3PVCA 1J4AA 4L22A 5KYUB 3GIWA 1YXMA 3DE5X 3A31A 1PF7E 2ERYA 5HZHA 2HA3A 1L5HA 3BMCB 4ZI7A 4LCJA 4L4RA 2P9EA 2LNDA 4R0NA 3S5UA 4E0FA 5CT4A 1DBQA 2R8PA 3KUXA 1R6AA 1WOYA 1YHQB 2QX9A 3L07A 1MJ5A 4ZU6X 5KIAA 4XM3A 5LQDA 4EEXA 2OKCA 2G4LA 4L5BA 1PL6A 4Q19A 2IYQA 4DG8A 1GNLA 3K8ZA 1R6UA 2II6A 4GRDA 3PNYA 4N5NA 5B58C 4II7A 2VDQB 3BREA 3PFIA 3ZZUA 2XD9A 3SG0A 3OY7A 4EZIA 2YV4A 4JP2A 4BQSA 5BSHA 1E2NA 4QAQA 3IEXA 3BHJA 4EMTA 5JJLA 3AZQA 4Y8VA 3CLSD 4WLEA 4CM1A 1HZZC 3Q11A 4CGZA 4XFJA 1PR0A 1PGJA 2JGAA 4L07A 2PIAA 3CURA 4QBGB 5GPBA 4CM6A 2PXHA 1KU6A 2ZU6A 2WYUA 2FSHA 2V7GA 3N2YA 4BBZA 4F9FA 1P17A 2QM8A 3X44A 5BVGB 3VO2A 1VCIA 5CK4A 3MBOA 4I4LA 4ZXFA 4X0CA 3F47A 3STTA 3ROPA 2JI8A 1UKYA 4N9WA 2O6HA 4KQKA 4HXEB 4EITA 3OZAA 2OGWA 1EVKA 2TSYB 1RXWA 1KMNA 4RTRA 2PUVA 1B14A 1KZ9A 1WQ3A 4RHEA 5ECDA 3JQ6A 4DMHA 3P2IA 4WXYB 5AHXA 2IXBA 2Y0BA 7ABPA 4NMLA 3CH7A 3RTBA 3HCWA 2GEBA 1N3BA 3IMFA 1MRSA 1IBLB 2V8OA 5K8CA 1G38A 5YASA 4LEIA 4CEIA 3ZQKA 3RS2A 1W9XA 2VTBA 1RWMA 3C5CA 4JLVA 1DDIA 1TGVA 3SE7A 3AVQA 5ADVA 3E9ZA 3T7AA 2JGNA 3P9SA 3BIXA 2FPMA 4D25A 3OKCA 5K0NA 4I46A 2Q7OE 4D2IA 3N58A 4Y18A 1R5OA 3CCBA 1CY2A 1XWFA 2YOHA 3EHEA 1U28A 4HLUC 4LGYA 2RI0A 1V4BA 4JP3A 1GPBA 1GFZA 1H8EA 1V8DA 3PYMA 1DRVA 3LG2A 3HY6A 3OWXA 5JVDB 1QIKA 3AEZA 3L0SA 4D99A 2R68A 5F23A 2Z3ZA 1JAHA 3DHEA 4F2WA 1OZGA 3OF5A 5ALVA 2V6BA 1NM5A 4LN1A 4EHAA 2FQXA 4RKQA 3RVOA 4NFHA 1C7QA 3GZJA 5FJJA 2ODWA 5KQGA 5BSWA 1PFQA 2C5GA 5DN6D 1TX4B 5TQVA 1Y98A 4TQ9A 1RLUA 4Y2XA 5D3QA 3HKDB 4A2QA 3THXB 1AKVA 1P2SA 3UAZA 3IQIX 4Q3CA 1VQPB 4YCLA 5IT0A 3ZDAA 5IVIA 3TMAA 3A6JA 3MM4A 5DNDA 6PFKA 1LI4A 1VA4A 4AG5A 1G2PA 1O9BA 2AZTA 3RRYA 2MU1A 2ERCA 1DOHA 1EMDA 4EG8A 2PY6A 5A3VA 1XTUA 1M5RA 2IK8A 1DRUA 1VB3A 1UZLA 3VTZA 1JJFA 1SIUA 1Z6ZA 3PLNA 3RW9A 2H1SA 1SQSA 1ZRSA 2B99A 1AK9A 1FU8A 3BD6A 4HEQA 4KN5A 4OHPA 5BWBA 5M34A 4DV4B 3O8OA 3M6UA 3SSOA 3GEDA 4UE3S 1K68A 4DKXA 4EI8A 1RTKA 1YFZA 2Y67A 2AW5A 3PVSA 3N6XA 4HLNA 4NECA 4OXXA 5ALIA 5J5AA 3V3KA 3FPFA 1NOKA 3W1WA 3KJIA 5CTJA 1NW7A 3K9FC 3CMCO 3MAGA 3TLZA 3TBHA 1NYTA 3HYLA 4NAHA 2B4YA 3H9CA 3IPYA 5REQA 3IPLA 1MO3A 3TAUA 1W4ZA 1UPXA 2QVYX 5FNZA 4K6HA 3K31A 5G4KB 4KHZA 1UK8A 3HDQA 1N5LA 1F14A 1E77A 2HL6A 4H7KA 3ND6A 3KVNA 1C1DB 4HHEA 4AP6A 4Z0HO 4BC0A 2V4DA 1V9LA 1UBFA 2FK7A 5TJHA 3F1LA 1HQDA 1AQNA 3B12A 4XWOA 2PKWA 2Q9CA 3BX1A 1L5NA 3RFVA 1MC8A 5DWQA 4YLYA 3G5MA 1G20E 4C7OB 2XYGA 1GL3A 2ZSBA 1QQ7A 5DMHA 1ZRHA 5DMXA 4X65B 4YBZA 3EN0A 4HX2A 3I5MA 1X39A 3TQCA 2ES4A 3PFCA 1SO8A 1UMCB 2PZLA 2MSNA 4L3WA 1H1LA 2WNIA 3TXXA 3TKLA 1K7SN 5LMUB 1PGOA 3SYKA 2UYGA 5ETJA 4OX9B 2GZSA 3H8VA 1ZICA 3X1ZA 1J90A 1GQQA 3CTPA 2H5IA 2QXYA 4GR9A 4EGCB 4Z7JA 1U2GA 3OJ0A 4R7ZA 2OA0A 4P80A 3WDLA 2FJUA 3R7NA 3RF7A 1P29A 2E6KA 1Z7BA 4DIEA 2GH1A 3ENKA 3BF7A 1W4CA 5LNK1 3HGTA 4FMDF 4K86A 3FUUA 3C8UA 1Y81A 3OP4A 2M6LA 3R75A 4B2IA 1O9GA 3CCUB 4N3GA 1A96A 1VPLA 1WMEA 2CL5A 2SICE 2WM2A 3KQOA 5B12A 3IBYA 5FYDA 5EJ9A 2F4VB 4IZHA 3O95A 5BNFA 2A5GA 3RRXA 1OX4B 2ZL6A 1K63A 3GOQA 3OUTA 2WF5A 3O7MA 4R68A 4XGNA 3OEEA 4RFSB 3HFGA 2HF8A 6REQB 2HNBA 4EHNA 2C7PA 1A4IA 1A9RA 3C45A 3ABOB 1MVOA 2L17A 2VBVA 4ROSA 4RHYA 2DF8A 1BDIA 1A97A 2WYIA 3KJNA 1FDWA 3BH6A 1P6UA 1GNTA 4OYLA 2PUEA 1UBTS 2DUJA 1G291 5TVGA 5M2QA 1PR3A 4G5SA 4UE2A 3I32A 3OTIA 4ABYA 3OUZA 1B6SA 3PR1A 1G17A 2W90A 2GN4A 4URFA 3UB4A 2WB4A 1B7GO 1NZJA 3ANNA 4RELA 4UUOA 5NULA 2E1RA 2VJIA 3AVUA 3HEBA 4G8CA 1FUIA 5K8LA 4RHFA 1AK2A 2YFKA 2P78A 4G8BA 3NHFA 3SC4A 3H5LA 4PSKA 3GDOA 3N0RA 3ENVA 4QDTA 5DBHX 3LY9A 2Z8YA 1FU7A 3KZKA 4N9QA 1FK8A 1IUNA 1AURA 1GYRA 2H4XA 2G77B 5A7HA 2VKQA 4HRXA 3QXJA 3RAPR 4UXIA 1BTOA 3C8ZA 3B1JA 5GONB 3ZV6A 1N1EA 2QXTA 2GM3A 4YCDA 1KP3A 5DU2A 2G6TA 3RUDA 2CXHA 2I7CA 2I7DA 1GY8A 2NZ8A 3N0XA 5K8UA 4V0NA 4RIFA 1AMOA 4S3MA 4CCYB 2HBRA 1XZDA 1QHIA 3T4UA 2BN4A 1Z29A 2DLCX 1G3UA 4KE8A 3RROA 1FTNA 2WDPA 3PKJA 1YL7A 4W1SA 3B70A 2CNWD 3WLJA 2APJA 2WWXA 3L82B 1QIIA 3QX7A 1K6EA 4H0CA 2CXXA 5FFNA 3KYCA 2WICA 1Q3HA 5K4HA 1CRWG 3AL2A 4BNXA 5EJ4A 1UBEA 3OFVA 4YI3A 4I3HA 3ZY3A 3VKVA 4BMVA 3TGLA 3I01A 3C6QA 5DLQC 4GWLA 4N5IX 1J49A 1FQOA 4FLEA 1FXUA 2RJOA 3BWYA 4PHHA 4PF1A 4WDRA 1L7AA 2AHRA 1E1CA 1ZW1A 3GRAA 3ONDA 2XWQA 2CKMA 2F17A 3KKEA 4L2IB 1JQKA 4DM3A 1E99A 2C00A 3W8RA 2QSYA 4EPYA 3W3ZB 4W63A 4B6SA 5M04A 4CTMA 1CNFA 1RU3A 3CA8A 3EEFA 4OLJA 1YIJB 1R8YA 4Y1RB 3GX1A 2V8BA 1YAHA 4PE5B 5KOYA 3FYHA 2VZLA 5C7OO 3HWWA 3AHGA 4LGCA 3VDNB 1DEKA 4BHTA 3IV6A 1WXFA 3PUIA 2ZIXA 3Q7SA 4J0CA 4ZREA 2O3UA 4TTTS 3IIIA 4NICA 4HTFA 5AH0A 1JA0A 2ONZA 2P79A 5CP8A 3INNA 4J76A 2VPYA 4U7FA 4F9GA 3QE3A 5GZ6A 1ZC4A 3PQ3A 1VKJA 2HMWA 3BY1A 2X0IA 1OFGA 4JVMA 1I13A 5JW6A 5CRIA 3WRYA 4DILA 1JHDA 4N0QA 3N8IA 4D9KA 2V9PA 4DCNA 4Y6LA 3EEOA 1D4ZA 2NTNA 1QAOA 2RHTA 3SGLA 2Y77A 1F51E 3CUWA 1VJ1A 1OZ0A 2FZCA 4BL5A 4LZWA 1V8OA 1E0DA 2O3TA 1EWVA 1VSBA 1Q1GA 3QITA 3ETCA 4H27A 5CFPA 1OWLA 3OECA 4CQLB 5K6RA 1WXXA 2FVGA 3CNLA 3IQDB 3KUUA 3MCUA 3OJWA 2JI4A 3RS5A 2XRZA 5IAGA 1P73A 2Z9CA 4UVHA 4YAJA 4I4TA 1XZCA 2MSKA 3S2UA 3U81A 1KYIA 5FTKA 5LVAA 4YFYA 1JW9B 1GRRA 3K30A 3F8SA 1FP6A 2F6RA 2JFYA 4KR6A 4P84A 1IQ0A 1XALA 1PWEA 5L3QA 1M7GA 3ONFA 1IB6A 4J0HA 4O2BA 1KMHA 2C8KA 2NSJA 3DOFA 3QKTA 3LL7A 3PVZA 1SCUA 3QVUA 4IILA 4KQIA 3UFXA 3GLGB 1DMRA 1I4DD 1VIDA 1X80B 1NLFA 3CUYA 3CVYA 3O8LA 4HWRA 3W5BA 2DKNA 4XGQA 4NQZA 2I22A 2CXRA 4MCIA 2I03A 3OAAD 5JAOA 4RTSA 2QUIA 2G9ZA 3FMOB 4NBNA 4A7PA 3FCEA 4NBTA 2X8KA 1LPOA 2J0QA 1XA3A 2RGNA 3PIDA 5T41A 4Z6KA 4P7FA 2NQ8A 1LBSA 2YJNA 1Y37A 3AJ9A 1P8JA 2O50A 2Q5CA 3IAS1 2WSYB 1BXZA 3DVQX 2JW5A 3KT3A 4LIPD 3I9NA 3SI7A 1PYDA 3KD2A 1S6YA 4MSUA 1EFRD 1ESZA 1PFKA 1RWOA 4Q7KA 4C3OB 3H65A 2BMWA 2IBMA 5D00A 4IUDS 2O3SA 1T3SA 2QMZA 5DBFA 4AAYA 3ORSA 2AFRA 4PC6A 1UC5B 1CVLA 1T8UA 2EG5A 4NCNA 2GMWA 3AEKB 2FSSA 3BOSA 1SB9A 3QBJA 3TMKA 3PX3A 5CK5A 5JG7A 4DIFA 4DWOA 1ARZA 5E6TA 5HCUA 2Q3FA 1Z13A 3G9XA 2ODEA 4BJ6A 4M22A 4L0CA 4BQQA 4RTMA 4IIVA 3SYTA 3DMFA 2QY6A 5JLJA 1UPUA 4YY3B 1P9LA 3PSAA 5CA0A 2GDJA 3LDGA 3P27A 2OV2A 3H2HA 2VSOA 1M34B 1XCJA 4HDCA 4M89A 2OWDA 3DGEC 3ZOZA 4Q4AA 1IAQA 4OQZA 4U0JA 2QSZA 2ZK7A 3WDSA 1C30A 2BF4A 1INLA 2ADFA 4J3FA 1T34A 4Q39A 4B6EA 3HY4A 2GBFA 2I4LA 4GEGA 4GBMA 1GNQA 3OU2A 3OZTA 4XQ9A 4H35A 4BUZA 2PMKA 1RQXA 3K6RA 2V3WA 4G0YA 1ZVJA 3A6PC 1IN8A 1QQTA 2J5KA 1NVXQ 1ZI9A 5CNIA 4CEHB 3RUEA 3L93A 4M6WB 2ZE6A 2WC1A 3V8NA 1JDBC 1MG0A 1BMQA 2GYVA 4KGVA 4D56A 2BSAA 1OTYA 4YT2A 1PV4A 1NIPA 3B82A 2PJZA 3EGDA 4F8YA 4KLRA 4QNNA 3RU2A 3GNSA 4Q05A 2QN8A 3F0TA 3PRHA 4LZPA 3EG9A 4CVNA 1NBMD 1PFYA 3N3BC 2ZB4A 3R7SA 2DYKA 1U5BA 3F3SA 1HOTA 1RAHA 3JAMA 4ARIA 2NUPB 2FMFA 3EARA 2CBGA 3OOJA 2I2FA 4CL8A 4XQFA 1YHNA 2P5YA 5FOXA 5DCLA 3O31A 4MJ7A 3ER9A 3BZUA 1CJCA 1JPJA 1M90D 1ZJ6A 1T9BA 4YMUA 3HCPA 3K0CA 2MYUA 1P8AA 1FJHA 5KKNB 2IS4A 1MJGM 2G5TA 3EE6A 3NEYA 3ZHXA 4ZODA 4K8OA 3STHA 1CERA 3PFFA 2DM6A 5AJHA 3RSQA 5FL7D 4N01A 2XXAA 3K5HA 1OBCA 3PWSA 2ODPA 4IQ4A 2Z0MA 3T61A 2ODAA 1IN6A 4QO7A 5BRAA 4QVJA 1XZ8A 2BHNA 2FA9A 4KMOA 1BWPA 1B23P 1B8PA 1GKLA 1WXQA 4XUDA 1L5OA 4PC2A 1F38A 4KPUB 5IM4A 3I1FA 2CMGA 2J3QA 2BC9A 3JD2A 3KT8A 2IBTA 2BBWA 1XZKA 3FPHA 4Y67A 1JZSA 3HGMA 2XX3A 3KCNA 1ZD1A 1BMDA 1Q81D 3EVCA 3KCQA 1FL9A 3ZH2A 9LDTA 5HKOA 9MHTA 2BI4A 1IBKB 3JQAB 2HLDA 1NHGA 1T0BA 3KO8A 3LNCA 4TXLA 4X1IB 3LBFA 4XWGA 2QL6A 2J9RA 3I8XA 3X2FA 3O3CA 5BT8A 1G9SA 5MFPA 2EKDA 1N2XA 2JHFA 3ICWA 3GUVA 3L1VA 4NK5A 3S70A 3W4KA 1LV7A 3ZU2A 3RAEC 1FFDA 3JPYA 1FTGA 3E0QA 1BXGB 1IDN1 5EQTA 4E21A 1CS4C 1VHJA 1XFDA 3WYAA 2XXBA 4IDQA 3IE0A 3IODA 4J0KA 4KVAA 4E5VA 2AF4C 4IYRA 1ODFA 3OOWA 3M4JA 4FHDA 3DMDA 3KVRA 1E66A 3JYHA 3P94A 3RY8A 1I3NA 3GEEA 1MO6A 1BD3A 2FPWA 2WTMA 2KSQA 3A05A 2LCIA 1VE5A 2VT3A 3D7RA 4TUYA 1QGZA 2J59A 1KK0A 3ITDA 2UZ4A 1AK1A 3RUIA 4R9NA 1NQWA 3DEAA 2FG7C 2H2GA 1PEAA 2ZRPA 3A8JA 2ZI5A 1A9YA 1IONA 1E6CA 2ZSEA 4ZO4A 3M70A 1PJ8A 3OKPA 3TZCA 5JNRA 1ULZA 1YCGA 3GAMA 4OG2A 1J07A 5FBQB 1U0EA 3DV0B 2X3UA 2PMWB 5HIIA 3DVLA 5LB2A 4ZQGA 2R1UA 5A3SA 3VH3A 4D46A 4DUYB 3F71A 5HF6A 5EUQB 4FFWA 3AETA 5G0SA 1N25A 2C2XA 4MIEA 1VE3A 1X3SA 4FI3F 1TFRA 4IGFA 2G07A 1ZNZA 2VSFA 3CVWA 3ZX5A 1FX1A 1RBYA 4QJ4A 4LJ5A 3QF4B 4WLOA 1VLYA 2JJQA 5KNCD 4MDFA 2F1JA 1ND6A 2Q1WA 2GD2A 3HE3A 1QTRA 1Q6YA 5ENVA 2SCUB 2GZ2A 3SAJA 3F6SA 3WJ1A 2VDLB 2VHQA 4PLZA 5JATA 4FDTA 4JKIA 2I3GA 2AJTA 2V97A 3AJAA 3OOSA 4YJKA 4BV3A 2EFCB 2AI2A 4PYRA 4E31A 4IVNA 1L1RA 3JQ9C 3AHIA 3RYFA 4YEJA 3IKTA 3D64A 4RMIA 1CXZA 5CB0A 3UT5A 3OD1A 3KKMA 5A9SB 2PWYA 2ST1A 4EOGA 1F5SA 1SUFA 1XNRB 1FRQA 2FB9A 1WDMA 2JLBA 4NAUA 2O48X 2DHRA 2VYCA 3LXRA 3QMWA 1ZM3A 5A4IS 4DLZA 3EIUA 3MRVA 3CH4B 2ZUVA 3H2ZA 3PNVA 4KQ2A 1H9BA 1COWD 2W98A 2ZVQX 4WT7A 3R7FA 4E4TA 5JDCA 3REGA 1QDEA 4NS4A 3FI9A 4WRRA 1OH7A 3NHPA 1YVEI 2A86A 5THQA 2Q4RA 2RD2A 2A5LA 3CUEF 1DP4A 2XUHA 3FFTA 5CVCA 5DBGA 1QHFA 5TF4A 2JLWA 1YDEA 4UTOA 1EUCB 1PKXA 1KO8A 4JJFA 3IBTA 3WGKA 5BUQA 3HJHA 3ZIAA 1YJAA 1BFUA 2P9GA 2V55B 2YN4A 2GA8A 3KXDA 4EY7A 2J6HA 5CT8A 2QR3A 2VDOB 2WMNB 1N32B 1GLNA 4UNRA 1HZEA 3GGPA 1QF6A 3F78A 4AKGA 5BR7A 1GCAA 3DOUA 2J4FA 4IDGA 4L72A 2DTXA 2ETVA 3K0SA 1SVOA 3A1WA 1RIFA 2HEIA 4KO1S 2IZ1A 1VQ5B 4UVDA 3LC7O 1GV0A 1IHUA 3ZE0B 5BNZA 3RPEA 1CUEA 2A84A 2IPOA 4G1MB 3HACA 3LP8A 2GKOA 1CSEE 1SXHA 1D07A 1RLIA 4G81A 4Z53A 3TLEA 1EFAA 1V71A 4CI9A 3T5PA 4FYKA 3ZCQA 2ZKIA 3DR5A 2O59A 2HXSA 1PG5A 1K2WA 4WDQA 4QICA 4UD6A 2BKXA 1QO0A 1E3ZA 2B6NA 4IJQA 4MR7B 3T34A 5GONF 4B4DA 4Q02A 5EWMA 3C16C 3AF0A 3KYCB 1DJNA 1WV0A 3JQGA 1YUMA 4HLDA 4DUGA 4M53A 2WUWE 4Y1FA 3KB2A 4LY0A 3SVLA 1XG5A 4C4ZA 5AXAA 1D0IA 1E3XA 1U1IA 5DVZA 2X42A 3DZGA 3EAFA 4K0KB 3DONA 2QRHA 2V7VA 3NM5A 3FOFC 4ALLA 1XI2A 1ISIA 1E62A 1FC0A 1KO5A 1K1EA 1ELOA 3CH5A 2JIZA 3IOYA 4QV2A 3TIVA 4J9VA 1JALA 1F2UA 5HIJA 2WLSA 5EIBC 5J4LA 3GVJA 2PUDA 1C0PA 3QXSA 1DUSA 1XYVA 1GZUA 4OQQA 3D7NA 3TLCA 2FTKE 4UARA 2B8NA 1QH8A 2CNOA 1O89A 1R4ZA 4YP1A 1VCOA 2NPIA 4H18A 5IDXA 5IEJA 4LY9A 5KYYA 3HRHA 1SIWA 3GYGA 2W83A 4PYKA 2UXCB 2I1WA 1BHQ1 4KQJA 4Q4DA 5F76A 4MLZA 4Q3BA 3G13A 3IH5A 4XWYA 2P75A 2H1IA 4KPYA 1WEKA 3VKHA 2V9ZA 4ZVUA 1KYVA 2VQDA 3G23A 3PYLA 3W79A 3PWKA 4YRQA 3AUUA 4LXYA 5TNXA 1TZMA 1X87A 1W93A 2C2KA 1W35A 3DUWA 4ZQBA 3UPDA 3HJUA 3BB4A 3MNFA 1FSPA 5EL0A 2HF2A 2H5EA 1CRQA 2ZRDA 5I3ZA 3L8FA 3VHXA 1KARA 2EZUA 3LUDA 2Q1YA 3AJRA 4DMUB 4NOMA 3S4YA 1BVHA 3PNQA 5HF5A 2Q9UA 4WLVA 3GN2A 3DF9A 3F9RA 1Q11A 1Q92A 4H17A 3TLGA 2C4UA 2VAWA 2NNWB 3FLMA 4Q7MB 3FM9A 3AL3A 3ZY4A 4QJ3A 3ASRA 3WMWA 3UHPA 3OU7A 4B81A 2ZTHA 3R3XA 1WCIA 1WY5A 3N8GA 5DLDA 3PCTA 2O52A 3RSZA 3I1IA 1IN1A 4YALA 3VQTA 1IUPA 4NCBA 4FQ8A 3NBMA 4YDSA 3FNHA 1T6YA 3F1KA 4D5EA 4H4EA 4LE2A 4AP9A 2R4QA 1A0OA 3HLYA 3FHOA 4Q1EA 4PZ0A 4V0RA 3BHIA 4G86A 3DG9A 4ZPXA 5BT9A 5LZ2A 3BYZA 4XQEA 4RADA 4MMYB 3VZRA 2FQYA 4A5SA 5LQNA 5L6LB 4E3WA 1D1PA 1RM0A 1TVCA 3ZI7A 2V4UA 2XBUA 1PK7A 1U3GA 2VXCA 4C0WA 1SCUB 5HSGA 5JHGB 1B8UA 4GVPA 4MGZR 2MSDB 4LQDA 5ESWA 3IEUA 5FHQA 4QBKA 8OHMA 1MUUA 1P75A 1SD2A 4EO7A 1D6JA 2GEKA 3KDSE 3BCDA 3B1VA 3UAOA 1SFRA 1GGVA 1QF7A 2XA1A 2YIMA 1NQAO 1O5IA 3H4IA 3GAZA 4RENA 2OV3A 3V34A 3VPXA 1A7AA 1J7KA 1ZDMA 2CUNA 4IIJF 1CZUA 5H9VA 2JA2A 3TZKA 5JD6A 5LSAA 2EZTA 4HRYA 2JIQA 5C2JB 2O8CB 2VO1A 1Z7GA 2PKQO 2OMEA 3VU1A 2CDBA 1VQ9B 3L9XA 4ZI7F 5ITZA 5SZHB 3QFCA 3O2NA 4CV2A 1WCV1 1ZGBA 4U8GA 1SOWA 4WNIA 4QQRA 2QTVB 3T9FA 2RG7A 3WGJA 5I9NA 3VDRA 5EVJA 4E11A 1IBRA 1K6XA 1KYTA 2ZSFA 3H9BA 5DGTA 3BY2A 1N75A 2HTFA 3HI6A 3DF7A 3DKKA 3HU3A 2J7PD 3R3YA 3NEPX 4Q16A 4PGGA 4I9NA 4QFMA 5FBRB 5IXJA 4HVTA 4RCZA 2GJRA 3CVVA 3HUEA 4L9AA 1NWHA 2P2DA 3HJNA 4W5WA 1THMA 2IYWA 1NLUA 3UKDA 2H85A 1IPHA 3I34X 4ZTBA 4G97A 4TMWA 3EOZA 4MNTA 2HK8A 5AVOA 3M2TA 3AEQB 5CA0B 5H68A 3JQRA 3DTVB 3Q3GE 4Q9NA 1Z2DA 1TMGE 4IFBA 2ZWAA 5IX8A 1SG0A 4JSTA 1OGJA 3NKVA 4JA0A 1YRAA 4X94A 4EB6B 1IXYA 1F17A 1C30B 2PLAA 1JKIA 4H08A 4UTVA 2UUAB 3CNBA 4QUIA 1ZD2P 3N8DA 4G8JA 4OHRA 4JLJA 2HADA 2IW3A 1G8FA 1TIBA 4L4XA 3I61A 2QV0A 3JQAD 3Q3HA 1VQ7B 4TTRA 3LP6A 4OOFA 2X13A 2ZRGA 1H9AA 4LV5B 5HIKA 1MTZA 4F3KA 4RPDA 4RF2A 5DN6A 1SUDA 2Q6OA 4W8HA 2R96A 2PSFA 1HETA 4JFRA 1KMMA 1XKQA 3R44A 4PGFA 2P6MA 5J47A 2EFJA 2QRQA 1JJBA 3FN4A 3G9TA 4NATA 4AG3A 1JAZA 1XZHA 3GEPA 3NHJA 3P9KA 2W2QA 4TV9A 1JXQA 3CONA 3AP2A 2PM8A 3FFAA 3MSXA 3R41A 1ZIOA 4K9NA 5JH7A 5KOJB 3S8YA 4EVSA 4QZVA 1PVVA 2X14A 3EQ2A 4Z8YA 1ZH2A 1R9NA 4FD3A 5FWXA 3DAPA 4FYYA 2WZQA 1M2OB 1XSEA 4R1PA 2H2AA 3Q41A 6NULA 3CNOA 5I48A 2ZR8A 3CM0A 1DVRA 1CJKC 1J23A 1EM8A 2XUDA 1QQBA 3FPPA 2BFWA 4RH1A 4TSFD 1H23A 5HA5A 5ULLA 3WNQA 2D3LA 3B89A 3A36A 1O5TA 2O0MA 2ZRJA 4GC9A 3VVBA 1JQLB 2OZLB 2QBYB 3STUA 3GJRA 5ALKA 2RGGA 3TSCA 4HS9A 1SZDA 5L51A 1OT5A 1R0YA 3ONNA 4U2DA 4BGVA 4KKXB 2DFTA 3M3DA 2J45A 1NG9A 1KRHA 1IXRC 5E6RB 3H18A 5C4IA 1JQ5A 2W6JA 3V76A 1DO0A 2B8JA 4JBHA 2HJVA 3BFJA 5DCWA 3L04A 2L82A 1YE8A 2BFDB 4Q3NA 2Q2OA 1KH3A 2QZJA 3CSDA 1XO1A 3NTUA 3PQFA 1AHIA 3V33A 4Z1MD 1VC2A 2VP3A 1WVMA 4C7MA 1LEHA 4HS4A 2VJBA 2YXLA 4NZNA 2X1MA 1XU7A 4QYSA 1U8FO 2AZDA 4PRYA 1DAPA 1ZNQO 2ECFA 2O7QA 2V6FA 4QGHA 4HH4A 3LYAA 4DPKA 1GPMA 3OQNA 4YJGA 2GEJA 3WE7A 2OO3A 4DGQA 4JIGA 1E69A 1CY7A 2IXFA 3TE7A 5KWEA 2OEPA 4GRIA 3PP8A 2W0SA 3R7WB 3L4KA 5BRJA 4MR8B 3C14C 3AJDA 1PJBA 2WJJA 1NQ5A 2QQ0A 2YWEA 1E59A 2JIMA 3TTYA 4WKBA 3PL1A 4G5XA 1U8TA 3LYUA 1VSUA 3LQQA 3SR0A 3V1YA 4FM9A 3F8WA 3UJ9A 3COVA 1A95A 2ZIGA 1NATA 5B7NA 4DREA 2FW1A 3A4YA 3NYWA 1I5RA 5JXGA 5IT9A 4H7IA 5IXSA 4D4IA 2J67A 2OK8A 2Q6KA 3KHTA 2HU7A 2OCBA 3GLIA 4AO6A 2J9ZB 4JHXA 2D1FA 4B84A 3PUZA 4WN3A 3AETB 1DT5A 3QV2A 3NLLA 4FXPA 2LBPA 1G8MA 2FPRA 3I2FA 2X8BA 2C9DA 3TBFA 1GLVA 2NYUA 2R60A 3JAWA 5CJJA 2V98A 2BGNA 2WA1A 1VA5A 5AVKA 1PJ6A 2XUGA 4UXJA 3O1LA 2BFFB 1IK4A 1R5NA 2QZPA 2HA7A 4UDXX 2ATIA 1M72A 1NLMA 2BTOA 1ZP6A 3MMPA 4IDFA 1QIMA 2ONKA 2QUZA 3BAFA 5HILA 3O4VA 3PRYA 3R9WA 1SUCA 5EWLB 3FF1A 1JZTA 4OYRA 5EUMA 1HZZA 5LP6C 4X95A 2EBUA 2M5SA 1GZ7A 1QYCA 3BGOS 4JGGA 4CWAA 3KT0A 4P12A 2MYTA 2V1XA 3JAKB 4O5AA 5EWJB 1N08A 3E9YA 4ZANA 3ZU6A 2W42A 1A9OA 2AKYA 1HDRA 2EV9A 2NU6A 4IJWA 1NONA 3EGEA 4XAQA 3HADA 1JKMA 1OSNA 5I47A 4LRYA 4NE2A 1PZEA 2FN4A 4G5RA 1Z88A 3K4HA 4R8MA 5EIBD 4CKEB 4W4TA 5EHZA 3AFIA 2QRUA 4OB8A 3ZWVA 3RS9A 5DISB 1FSSA 4AW9A 1HXHA 4YCBA 3WK4A 4A6DA 1M6YA 2VP5A 4JLAA 3DZJA 3JQEA 3KUCA 4O2RA 5H02A 4BO1A 2D6FA 1PQYA 2BM0A 3HNRA 1DQZA 1ZD5A 2CJFA 2CNWA 2OD7A 3O3NB 1BKYA 4Q18A 4QRDA 1PP4A 1P5RA 2HWUA 5C4MA 3QOXA 3N8NA 1VKHA 1FNMA 4XVHA 1I3CA 4URXR 4ZQCB 4WCDA 4RS3A 2O7RA 1J0DA 3LLMA 4HLUA 4CL2A 4MV0A 1M1NA 3ZQJA 4L76A 2Z1DA 4EEKA 3JZIA 2N9UA 3F6RA 5A9TA 1Y3IA 5F2NA 3SOZA 1DU4A 1P45A 2YY5A 2ZWOA 3H2KA 3L2OB 5K0LA 1VHTA 5JZOA 3DTNA 4G37A 1I7PA 2V6MA 1IVSA 1YB5A 4WA8A 3TJZA 1D5CA 3SWWA 3I83A 4NMXB 5J2TA 3ORRA 5DBOA 3HXMA 4Z99A 3EQ8A 4S1VA 2QTWB 1MJGA 2FFRA 3E35A 4GMXA 1IN4A 2FEPA 1VQLB 1KEUA 2RGXA 1IWBB 1A2KC 4OFZA 1U8XX 2PS9A 3LFUA 1UK6A 1EUZA 1XNJA 2H65A 2ZDGA 3IUSA 4HEA6 3N2IA 4F4CA 4UBLA 3DO6A 5SY4A 1NAIA 2PA0A 2GFIA 3K73O 1TA0A 4Y9TA 2OBLA 5IK2D 1GNRA 1VXRA 1IHMA 3IUNA 1TCVA 3DVSX 4HO1X 1P1CA 1OVMA 3QEOA 5T64A 2IS6A 2GRUA 1GG8A 3H5AA 1BQ3A 1WBDA 2X2EA 4OHXA 3T5DA 1EE9A 4HXGA 4WX2B 3C3CA 3D7SA 5AJWA 4DA6A 3UMSA 3NIBA 1GM5A 3EFOB 5AW3A 1KFJB 3IE2A 4W1PA 3MFYA 3EDRA 3OFND 5H81A 1XZIA 5ITWA 2IIQA 3BEDA 1QGUA 2RHBA 1II0A 3OI7A 3HA3A 4C30A 4YPOA 1LSOA 1I6MA 1ECCA 1Y8CA 2WIAA 4G0UA 1RYZA 1QS0B 4OXYA 2ZYUX 1W75A 4GGOA 1GPKA 1V6SA 2IYYA 4F5WA 3ETGA 5D1NA 2YFHA 1NKSA 3U4HA 2ORED 4YRKA 1V6AA 1FFEA 3CSSA 2OMKA 1B73A 1HTBA 3ZWWA 4EJ6A 1QU3A 4NBUA 1MHPA 2FWJA 3QPCA 1NVKA 1PVDA 4HDRB 2JL1A 2N0SA 2AFIB 1KVRA 2P11A 4FS8A 4G6ZA 4MPJA 4OXRA 4ZEXA 5EE0A 3KHUA 2C0PA 4CNBA 1EVIA 2B94A 1MGPA 3QPWA 1U2PA 2PKYX 3IEIA 4A8PA 3HO8A 4QYXA 1RYEA 4US1R 4W82A 3N2NA 3NM6B 4DZZA 2DPLA 3DZCA 3NHKA 3O8CA 4E5YA 1AQ6A 3DUFA 4UFPA 3O38A 5BV0A 3ORHA 5KHOC 3W2HA 1K7EB 3OAAA 3V2HA 1WCIB 2DR3A 3HN7A 1OE0A 3N2KA 3O74A 2IEYA 1RJFA 5FCDA 3IT2A 3WBFA 4G01B 4MIKA 1GD1O 2RGCA 4O2AB 2XUZA 4RPLA 1Q9SA 2PTGA 4N5DA 5DM1A 1TW2A 1TCCA 3WL5A 3X2EA 1YMVA 4YCNA 3BIWA 2IXEA 4URVR 1ZM7A 1MNQA 4BQNA 1YACA 3SC2A 5DK6A 2CV1A 3MWGA 4J6EA 2X5NA 4BCCA 4QVAA 1KI7A 4CFSA 3GLTA 2XT6A 2D5AA 4MB0A 3H0KA 3PHGA 4DW8A 4DR7B 3CG0A 4HR7A 2OHHA 3IJEB 5BO5A 3LPMA 1ZOLA 2WUDA 3N3AC 4MVJE 3U9LA 5I4CA 3WJ7A 1XMOB 2WWHA 1HT1E 1TRHA 2NXWA 2Q0HA 3VVCA 1Y0BA 5EJAA 1B2RA 3H1EA 4KK4A 3VHRA 2V59A 2XYQA 1AO3A 2DR0A 1MABB 2EJUA 1UJ6A 4OQMA 4WK6A 3TDKA 5HW0A 2OKGA 5FI0B 3TNDA 1M6EX 4ZJPA 1K28D 2EKQA 1PDVA 3IRVA 3MTEA 4TL7A 4CF6A 5AQ1A 2IDZA 5J3OA 3TLYA 4DCVA 3VSEA 3EVTA 4O2BF 4BKMA 2I2DA 3KZ1E 4KK3A 4DJDC 5F4OA 4XWKA 5K0BA 3NI2A 1JWLA 4BQFA 2VSQA 4MQ5A 3WLLA 4F6RB 1XTPA 5TPWB 2BZ0A 3B1XA 4DSUA 3D8RA 4JYCA 1LTHR 4NMHA 4BZXA 1SU6A 2MJLA 4UBNA 1W6UA 4QGBA 5AKXA 1OFIA 2RK4A 3UMGA 1VQ4B 2BEVA 2EKLA 4XOTA 3IIJA 3I73A 4MA5A 1PJ7A 2DRIA 2GWRA 4WINA 1PU2A 2IKQA 3T1NA 4RCYA 4CMJA 5IZCC 2NU7B 4DMRA 3WZMA 721PA 4OKIA 4HADA 4LHWA 4ND2A 3HDJA 3DEKA 4IR7A 2VJKA 2GEFA 5BP7A 2FPGA 3SF8A 1USKA 4RY0A 3T8YA 3WLRA 1NBMA 1N0WA 2FSUA 2EWWA 4I9HA 1EK2A 2B2XA 1RFGE 1XZLA 3PUHA 4OI2A 3I9OA 3T3IA 1WF3A 2ZULA 2ZEJA 3GRPA 1LJ8A 1FFSA 3BORA 3D0RA 4H1UA 2A0YA 4O1MA 1VTKA 4BNWA 2VWPA 2YX1A 1Z0UA 1SCIA 3OPYA 1SUSA 3I1JA 1YX2A 3HJRA 4MUEA 4N40A 4NV1A 5CTAA 5A06A 4HQOA 1T9HA 2E87A 3C43A 3QW2A 5JSKA 4RL6A 4QT0A 1FLNA 1SRRA 4ABTA 1ZONA 1Y8RB 4NMWA 4WI1A 1G98A 2P8JA 1H4QA 2WZCA 5AKLA 4DV3B 5CA0F 1GEEA 2NXEA 2Z2JA 4RIHA 5CDTA 1I4LD 1DTWA 4L8WB 3MCZA 5FL7A 1KPIA 2VJCA 3TQQA 1UKVY 1CF9A 2E4YA 3DQQA 3MCTA 5JAIA 5CB4B 4BO2A 1QHNA 1R0WA 3QXHA 3SLDA 3EWNA 2BGWA 4NE7A 3T9AA 3OJXA 4CTNA 1OI4A 4JJAA 1AQLA 2BFMA 4GQNA 4OQDA 1K27A 1E4EA 1SUPA 4GI2A 3ZHVA 4CF7A 4Q9LA 5JBNA 4Z4RA 3D6NB 3M34A 5FWXB 3W9UA 2WJ6A 3OZBA 1LLUA 1J24A 4KXVA 1A4XA 4Q00A 4DA0A 3V2UA 3U4GA 1C9KA 1RQ2A 3I5UA 3O8QA 3V4PB 2QDKA 3U80A 3I2GA 4TN1A 3K0FA 1WHTA 2CD7A 3ZU3A 1WKBA 2Q5HA 1VHEA 5EIXA 3E20A 1NOIA 3T95A 3SNKA 2I8LA 4YAWA 2VP9A 2OTCA 1C29B 4LFCB 2Z9DA 2PBZA 2ZZGA 4ZIRB 1IPEA 5ARBA 2YHUA 3NNDA 2JAXA 4P4UA 2GS9A 3KKQA 5BSUA 1I2CA 1QKIA 3PLAE 3AFGA 4OJQA 1ZD8A 3A2KA 5B1HA 5MFZA 1ADFA 1V9SA 2XDWA 4OJMX 3OZWA 16PKA 4JBYA 5FV7A 4ZYTA 4DT1A 1JE1A 1X1BA 3THSA 3Q7QA 3KKNA 5FR2A 3W2IA 1WRBA 1L9XA 3OCCA 2BEJA 3X1YA 1P44A 4JN6B 1UFRA 4OMCA 5B5SA 3ELUA 3V8RA 1FFWA 3UA3A 1KGSA 2QV7A 2BUCA 3AMVA 4XJXA 3SS9X 4IIYA 3PXEA 4YRNA 5IM4F 2D7DA 4P1ZA 4PNHA 1R74A 3D3WA 5K3EA 3EA0A 4QSMA 3VR4H 4OHVA 2HX1A 1IQPA 4FLMA 1F7VA 3C3MA 3O4HA 3QX8A 5DHAA 1QZ3A 4PAMA 4WLUA 4DB2A 5GJBA 1J56A 1M0WA 2Q7XA 5ALYA 3RAFC 3ZDCA 1N34B 3KJHA 5I9SA 1PNVA 4RGVA 2OXCA 4RQUA 3S55A 1NC1A 1VPEA 4WLFA 1IHXA 1II9A 2CL7X 3LMKA 3QOYA 2EJVA 4E5KA 2H4WA 1NRJB 1QGOA 3DXZA 5AJTA 2CYBA 4GI5A 1ZVVA 3ZDEA 3VKGA 3EFBA 1Z3CA 2BKLA 1D2MA 1JAYA 1KOJA 4C5CA 4KR7A 4RM2A 2OV4A 3C4JA 2JRLA 3F7OA 1FFYA 2V0NA 4P31A 1GR0A 2GF2A 3Q7IA 3GLIB 3A9VA 1VQMB 4TUYF 5FTLA 3LDUA 3KDPA 3OZFA 1EWTA 4TXMA 4C05A 3BWEA 1YRBA 2FZKA 2BGTA 1COWA 1XCOA 3DXFA 3AHFA 4RSGA 2EZ8A 4KXMA 3OSUA 4OUKX 4EAQA 5HJEA 3B3JA 3BE5A 4HRAA 4ZCPA 2QTCA 3W2FA 4PBRA 1VKZA 2ZJAA 1SJ9A 4XLHA 4LVUA 5GM2A 4FS3A 2CL6X 2D5CA 3B7WA 3HDYA 4UMVA 1KDYA 5T4HA 4ZTZB 1Z37A 3MWDA 3IHTA 5DHSA 1DRJA 4MMZB 4YUAA 3NHZA 5B3KA 1RHMA 2OZVA 3IAAA 5BV1A 4I5GA 3DEJA 2X9GA 1DMSA 3VR6A 4JGBA 2FQ1A 2GUWA 5K03A 4AYWA 5DEIA 2PZBA 4DA7A 2RE8A 1UJMA 4JJ7A 3V5NA 1J70A 3QMPA 1E6UA 5DULA 3A04A 5BQXA 1M3SA 1VI5A 1LBEA 4ZALA 3VZPA 3FNRA 5IYRA 1AM4D 1J7JA 3QVMA 1G3QA 3FUCA 1U7ZA 1PEKE 3UN1A 4AS3A 5EJMA 2ZL7A 1SQFA 2CVQA 3DBVO 3TCNA 3CB4A 3DDSA 2EWMA 3CTAA 4JC0A 5BOVA 4EFMA 4ZDJA 4M0KA 2W2LD 2G70A 2GVDC 3C3DA 4DCTA 1N7IA 3VO9A 2WTUA 1JILA 1XK7A 4Z86A 1I18A 2A3NA 4N47A 1AQYA 2QGZA 1DTEA 2HHHB 2ZTMA 1IVYA 3GFFA 1JDZA 3OLVA 4ZHQA 3WLPA 1YVPA 4IAOA 4QT4A 3QA3E 4MS1A 1O08A 1JG6A 2RH5A 4WE3A 2BT4A 1GGFA 2PZAA 4L9SA 2IL1A 1JVBA 1KJJA 2Q2VA 3DZIA 3AESA 3KSZO 4JP8A 4V0LA 2BGMA 5HPYB 3DVAB 2JVKA 3BHMA 2R0QC 4ZVSA 4OGWA 2AVDA 4R9RA 2VEDA 2IUUA 4EFDA 5FX2A 1A9XB 1W73A 2B0CA 1REQB 1Z33A 3D9QX 1DC7A 1NYRA 2IQIA 1N07A 5D6OA 1ZM4A 4CU5A 3R6WA 4I0WB 3RT9A 2O5CA 3PVDA 1M1NB 2DBRA 5GV7A 1YBFA 2D0IA 4ISCA 5ALNA 2A14A 1YB6A 4EF6A 2GEUA 2G5PA 5L3SB 2CXQA 1E0KA 5JI2E 4QQNA 1JB1A 2G1UA 3JRWA 3R4CA 4MWDA 4XGIA 4FGSA 5JXWA 3VKUA 1N8KA 2BE9A 5A4JA 2P65A 1SCKA 1STOA 4XQGA 2WYOA 4I8IA 3UQYS 5CBKA 4PHCA 5KSYA 3ESBA 3ZQ6A 1TPZA 1O7JA 1U2ZA 1NPDA 2W6ZA 3BULA 2ZJBA 4QIHA 4WV3A 3SU8A 2H8KA 2B8TA 3AXTA 2ZI9A 3PUNA 1TZKA 2A9FA 5DNYB 3UXYA 2XLCA 5IYQA 4E5UA 3DMYA 5B55A 4UBIA 1UFKA 3E8XA 4MKRA 3EW7A 5BUSA 3OJOA 4C21A 1FUYB 1OBFO 3ELDA 3STXA 3TZLA 3NH6A 4MWTA 1U80A 2IXAA 4L95C 5C1IA 5LLTA 1RYNA 4BWGA 4Z4EA 1OLXA 4A1OA 1WW8A 1KI2A 3AVXA 1D6SA 3ZYCA 4XSHA 3W4IA 4KACA 3E1KA 2XVZA 2GREA 4HNQA 3RSHA 2OFFA 4HB0A 3CX7A 4P0TA 3M6WA 3DE4X 3HKBA 4I66A 5KNDD 5G1OA 3QY0A 3FWKA 1ZOOA 3ZK7A 2NO7A 5AVSA 3HR8A 4UBJA 1ZHHA 1EYZA 1YZ3A 4JOCA 2QMEA 5JNUA 4HQ0A 5T3YA 3MOSA 4R4JA 3QLVC 1YR2A 3GAAA 5IN4A 1CEYA 1TVEA 1W96A 1YJ8A 4FCTA 3TIXB 1XQVA 2EC5A 2VDWB 3NS7A 3WQQA 2WG0A 1HWYA 1PT6A 4J0DA 4MRPA 2I80A 4CEHA 4WWVA 4RTNA 1B8NA 5EFOA 2DKFA 4K9KA 3TAHA 5CGQB 3EUAA 4Y1GA 2RK6A 5EHGA 1YC5A 3KPJA 3KU4A 3KL2A 4GVXA 1PYGA 1KJ8A 4PIVA 4LUCA 1N9ZA 5J5CA 4DL9A 1T6ZA 1UM9B 5SZIA 2PH3A 1P33A 1CUUA 4ND6A 5L3RA 1ACJA 1W2GA 1XHLA 1A27A 1ZKMA 1XRJA 3P2EA 4KO8A 4MI3A 3D3KA 2ESRA 4N6NA 2O8FA 5KJFA 1SOUA 1ICEA 2K4MA 4ZVTA 2UZ1B 1UWLA 4MIOA 5I7AA 1U81A 4D44A 1WE2A 4AKTA 3T7TA 4HGNA 4AZ3A 3DL0A 4YGYA 1XC7A 4WZLA 1CYDA 1H2AS 4RY9A 1YASA 4A0SA 5IYNA 1N1MA 3JQ9A 1TQ6A 1J2RA 1GT91 3A32A 2HO5A 5DP1A 1TT5A 2AS0A 3W77A 5AKGA 2WOOA 2YYSA 2J7PA 4C5BA 2GNAA 1H85A 3G8AA 2UDPA 5KYGA 4KFRA 1Y3CE 4RF5A 3L8EA 2FHSA 2PHZA 1ZVQA 2KQUA 1DLIA 1FMCA 2H51A 3FFWA 5EESA 5I8PA 2FG5A 5EP3A 1O4VA 2QPLA 5C18A 1Y9AA 4TXJA 2RC5A 3WOVA 2QRZA 3IALA 2H9YA 4XN3A 1KJZA 2XVAA 1FTWA 1UBSB 3MVEA 4FILA 4W7SA 5D5HA 4MRAA 3LKZA 1Y7PA 1TTTA 1LF0A 2XGOA 2ZYAA 4B5KA 4X06A 1U7XA 5BN4B 4BVJA 5F1OA 3DBRA 1Y7HA 3LZCA 4MA4A 3EQ7A 3ONUA 4O4LB 5J2UA 3PQ2A 1Y3HA 2E89A 2WJYA 2Y1GA 2ALJA 1PKVA 4X3PA 2P9JA 1XD2B 4P5DA 4HB3A 3PFNA 3AUAA 5FULA 4FKMA 4JJEA 1V2GA 1PJ3A 2I2WA 2D13A 1WPCA 4GEKA 2FPIA 4XKJA 4B6JA 1Y8ZA 3VX3A 2REQA 2IS1A 2DBZA 4R2KA 3WWCA 3PEWA 2FETA 4YRFA 2GFQA 821PA 3U44A 1RSZA 3TTVA 3I8SA 4FOLA 2JARA 2PJDA 3T0FA 3UMVA 3KSAC 2VDPB 2QX7A 1JBKA 4RX1A 1DG9A 2CFIA 5E8RA 3AKYA 2WWVD 1UDWA 2HDWA 4LC0A 3WB1A 5JISA 3L84A 3PTLA 1T10A 4IZ6A 2NZVG 4HN2A 5AW1A 4H7FA 2HCJB 2W37A 4CEJB 4RD1A 4UJ3A 3KKPA 2CMHA 4B8ZA 3SX2A 3SYRA 4M88A 1PFUA 1X1DA 2YCLA 1W9HA 1ODKA 2NZYA 3E3LA 3OSZA 3Q3JB 4WN9A 3U3ZA 1BCRB 3DDOA 5TS3A 1NMXA 3WHIA 2HDNB 4DM7A 1ODCA 5BMOA 3NKFA 2PGDA 3OPYB 5F9MA 4DLRA 3HBFA 1L8AA 1WQ4A 3GNTA 1ZLYA 2AOVA 2AK3A 4TSFA 1EDDA 2PEZA 3LX6A 3ZGXA 1YONA 1G21E 3OTWA 3MMNA 1DRKA 4HQLA 4J7AA 1PJTA 4JXJA 3MSCA 1C7EA 2BDTA 1YB1A 1T2UA 5AXCA 2M2IA 3FLBA 1M1XB 4D8UA 1ZK1A 2I3AA 4D81A 1EVJA 4KB5A 1AVTA 1XCGB 1MX5A 1NXWA 3OQBA 3P0HA 4KOAA 4PO1A 1Q19A 3MCWA 3E84A 1YZGA 5LIRA 1H22A 2GCOA 2QTRA 4WAUA 3P32A 2HGSA 3KPYA 1CUGA 1FP2A 1N7HA 1JR3D 3FKJA 1H6CA 1DAMA 1E4EB 3DLAA 4F56A 4ZVRA 1VZ2A 4J8PA 1OA0A 5K3BA 1EXDA 5I51A 3KEOA 2FOXA 4XSVA 4DLAA 3BJEA 3ZXSA 4Z1MA 3E5HA 3CIFA 1L8OA 1TLTA 4F92B 1NUTA 2WKQA 1KZGB 2Q6IA 1TF5A 2CF4A 3OX2A 4Y0NA 4GI3A 4TV9F 5JH7F 5AIAA 3REQA 4CCAA 5BQ3A 4U9UA 1JJ7A 2F1RA 1VLQA 1YF3A 1MAVA 4HFMA 1I36A 5KVQA 4A2CA 4ARUA 2VP0A 2AMJA 1ECBA 4RHUA 4KMMA 2X8AA 4XLCA 2AOWA 1JNYA 2MINB 2A92A 4R2WA 4CLRA 5CDFE 2C54A 3DHWC 4H6VA 4A2WA 4JQZA 3ROQA 4ZO9A 3LJKA 2IY9A 2XTAA 3A6ZA 3EEBA 3NVDA 4IIHA 3RVSA 1UD8A 1M2VB 4YIHA 2A1UA 2IC5A 1KH1A 1PT9A 5IAJA 2QTGA 2QRLA 2PD6A 4L78A 3D59A 1YA6A 1ISSA 4L57A 1CDDA 4FYHA 1BHO1 3PQDA 5HP4A 2JZCA 5BV2P 3EODA 1FF9A 3HYCA 2C1EA 2VWGA 1BJRE 4IDEA 1IMOA 4EHJA 3N0TA 4Z4HA 2XT0A 3TTTA 3R5JA 4NYIR 4P7BA 3D3WB 1TQDA 3FY4A 1USIA 3NHAA 4U5QA 2C82A 1GTRA 1AKRA 2GN2A 5C3MA 4DIDA 2FH5B 1CEQA 2F3UA 5SZKB 1I1NA 1BE8A 3QENA 1W59A 4AVYA 3NO4A 1VPTA 4KOEC 1RMQA 3QUQA 2H08A 3M2PA 2FMHA 1XTZA 2HXYA 3BJRA 2HJRA 3GRKA 4FNMA 3OO1A 2WT9A 4FT4A 3R0ZA 3M6AA 5DX0A 2VFAA 3KT6A 3LWBA 3ZVKA 3PDHA 1Y3AA 4BMNA 1B8OA 3VSBA 1YK1A 2VNSA 4V1CI 2XGJA 3DDYA 3C6MA 4QOEA 4WOCA 5A9RA 1CWUA 4V2UA 3F73A 4MW4A 3R5KA 4JC4A 2KWIA 2J9YB 1FSZA 4OLFA 4XSGA 5TMBA 2B21A 2WE8A 3PGVA 3X1DA 3L41A 4UMFA 1V3QE 4IDDA 5F5NA 5IUKC 4NEGA 2OBSA 2DT8A 4QU8A 5A03A 7REQB 1CW2B 1LGYA 1LNZA 2GK7A 2F1MA 4YELA 1YDHA 3BCFA 4U02A 3AFHA 2VAXA 4WXRA 5CFRA 1K4MA 1V3VA 2ZSUA 2WIDA 1S9DA 2QNIA 2DU8A 4M21A 3EVAA 1V95A 3SQLA 1X9IA 3LC0A 1OWMA 5I7RA 3B6EA 3FWNA 3SJ7A 2HGZA 1XQYA 2GZ3A 2ZDQA 4G9EA 4XOIA 4US2R 1Z9BA 1ZM9A 2RKOA 1NKVA 1MOPA 4L6CA 3B52X 4CXMA 3AF5A 1I5OA 2HT1A 3NP9A 3NYRA 2PZJA 4IMJB 4NNJA 2OECA 1JIJA 3RUAA 3KQNA 4WXPA 2R11A 3SR3A 5DYWA 5DGDA 1NSFA 3WADA 2EYQA 1LDBA 1M76A 1GYQA 2QM0A 3LYHA 1HMPA 2CEAA 2YJ5A 4Z4IA 2A57A 2V7QD 4L75A 3WISA 1R15A 1Y1PA 3HVIA 1X1QA 1F8GA 3EB9A 2DCMA 2HV8A 1TM3E 3H86A 2OB1A 4B3GA 4TKUA 4R5HA 2Q46A 2QX4A 2BR4A 5CBPB 2BJHA 4BFWA 4N8SA 1NMQA 4ZHQB 1TTHA 1NR7A 3CC4B 3EGOA 4F38A 2BFCA 4BRUA 4KE7A 1SEPA 3EOAI 4NABA 1IIBA 2HA4A 1U3CA 1Y6QA 5DHRA 1WDKA 1C7RA 2JFNA 1AS2A 2E85A 4BMDA 4Z8XA 4YT8A 3PE3A 4XLAA 3F98A 3K0AA 3R3HA 5IK2A 1YJ9B 1QGED 4L7QA 5I5EA 3NDBB 2WPDD 1JVSA 2KX7A 1N2CA 2WT4A 3RYIB 2GJ8A 2A1TS 2EKZA 4TQAA 2VTEA 4CUZA 2CRVA 1LXCA 2DWUA 3RG2A 4ZYLA 3R2JA 2DB3A 2COUA 4PPQA 1A9QA 2PFKA 2XB9A 1E6EA 1GSAA 1SVSA 4EYKA 4Q0MA 1EFTA 4QUBA 2Q2NA 3KEFA 3WLNA 2OQIA 1UBOS 4PAGA 5ARCA 1Z7WA 4DB4A 1VECA 1LNSA 5IJWA 1DCTA 3SJPA 1G8GA 3EXFA 4EUSA 1UK7A 4Z3OA 2VP6A 2VH2A 3OCJA 4UUAA 3Q85A 3KTAB 3QUAA 2O5VA 2ZRMA 2CYAA 2P1RA 3CX3A 9GPBA 3B20A 4M86A 4D4MA 2D5LA 2GF0A 5EHXA 4JBXA 1QNFA 2P6OA 4W5QA 5CHYA 4Q37A 2HWYA 2B35A 3DFZA 1PKEA 3EMDA 4WZBA 5ICCA 4FFMA 2QW0X 1OJLA 3EMKA 3UJHA 4H4DA 4WBXC 1FLVA 3MIZA 1M9NA 1RKQA 5J2TF 3VYWA 4S04A 4PQRA 3EQ6A 1US8A 5ICFA 1NQUA 1ISJA 4H16A 3WMGA 1CEEA 4BOYA 1XN4A 1XLWA 1ZD9A 3FROA 5AUOB 4B3FX 8GPBA 1USUA 2XB8A 1NRIA 2OBMA 3KKLA 4RKEA 5H4HA 3U7QA 4AICA 4HQ6A 5E9WA 4KDRA 3RH0A 4MKHA 3SHOA 1UZUA 1TC2A 1TFUA 3A9SA 3L5OA 4GX2A 2QAGC 3FCXA 1VP3A 2CXUA 2QWXA 4XJVA 5JNLA 1SXIA 4G0NA 1KOFA 5ELXA 2AZXA 4YIKA 4CIBA 1AUVA 2AJDA 4LYHA 4CM7A 5ADWA 1MFPA 1L4KA 3P9ZA 3WB9A 1U8CB 1WTCA 2CHQA 1G8YA 3BMXA 3E1GA 3NNNA 2GPWA 4MS3A 2N1BA 2RI6A 1HLPA 1KNXA 3LQKA 1U1CA 1HL3A 1WEHA 3E7XA 3KWMA 4WESB 5K4AA 3BCHA 2C5AA 1E8MA 3OESA 4O2LA 3KJXA 5DGIA 3OZUA 3S3TA 4C87A 3INYA 4UZEA 5FI5A 4JSRA 4NS1A 5CR9A 3H1BA 3IOCA 2VJDA 1VKNA 3CSUA 2JLAA 1DIRA 2H3HA 4LECA 3BIFA 3JVIA 3QKIA 3X1KA 2MYNA 3OMLA 2Z6AA 3EY9A 3SYLA 2P5SA 4OQXA 2GSDA 2QSJA 2GO1A 3CD6B 4A92A 1S8FA 1SZCA 4F5YA 1KJ9A 3TG2A 3V7WA 3G4SB 1D04A 4DG9A 1YS9A 2PUCA 3OEWA 1NX6A 1GRNA 4MWSA 1EE2A 4C0KA 1QX3A 1UODA 3QLTA 4MEBA 3PD7A 4JJ8A 2COEA 2XECA 3K6JA 1JBEA 4YMLA 4Z2YA 4RWZA 4CKYA 5JDIC 4XM0A 3LQYA 2I4IA 3I6YA 3VA7A 5LP6A 3ANSA 1YJ5A 4FHGA 2AR0A 4KXQA 1ULTA 4D4GA 3JZMA 4OGGA 2R5WA 1TT5B 3FOZA 3MERA 4RA9B 4DIOA 3M82A 3RV3A 4UNQA 2IE8A 3ICQB 4RM3A 4IZIA 4IS2A 5IPFA 4DR6B 2DBVO 2OQVA 1LPSA 2Q99A 2XNKA 4X71A 1EXVA 2HF9A 3B7PA 4PONA 3J80A 5HQ3B 1ODSA 4B40A 2DPXA 4LSMA 3Q3EA 3QLUC 3ZLBA 3MHPA 3LPNA 1YRQA 4M60A 5B2ZA 5JAUA 1PNOA 2V45A 1DAFA 2YZ2A 4GP7A 1K7XB 2J9FA 2NT3A 1A8QA 2O1EA 5EQDA 3R9KA 3OG9A 1S0UA 3LCVB 1Z45A 2JGJA 3PNLA 5A6SA 1PUJA 3HG7A 2JS7A 1UZNA 2JD2A 4PHTA 2C77A 2Y1OA 2YV5A 5AVXA 4G0WA 1KVQA 1Y1TA 1FPQA 4LYFA 4HGPA 2YJTD 3I6IA 5HRCA 5A0VA 3PPVA 5ESXA 2ZJ6A 1XRQA 2FQWA 4UTZA 4AJKA 2O8BB 1E61A 1TB4A 1K6MA 1ZRNA 1SQ0A 3CWQA 3ED5A 5BN5B 3H5IA 2AEFA 5HX7A 1PL8A 3NFRA 1S7GA 2QRNA 4RGBA 1CY6A 5L7YA 3T5MA 4ENPA 1IE3A 5K6TA 2WWGA 4R3NA 1Y1RA 4V0MA 1FUKA 3H5OA 1K8YB 4G1EB 3TRHA 1N6IA 2OR3A 2PN1A 4X1YA 3SE0A 1ZJZA 2JNWA 3ZE2B 3VYRB 4IUBS 3R8FA 2X85A 5HRAA 3NWJA 2DYIA 3PFWO 2AD5A 4JU9A 1R6TA 2H1HA 4DCPA 1Q1ZA 3VJLA 3KSMA 5KPDA 4HGOA 3PQ5A 4B7XA 2RI1A 1QONA 4UCXA 4BB6A 2OESA 4UQLA 1O6ZA 1UOQA 5HUHA 1CX9B 1P7VA 3AFOA 4TRRA 3IUEA 3GRFA 2IOYA 2R25B 4WXHA 2HMUA 2VF2A 1C7JA 4LI3X 3ZJUA 1T8PA 2J1LA 1NSYA 4CF5A 2M6RA 4IRMA 4DARA 3GMSA 4BWVA 3DO5A 4E5SA 1GCOA 1VSQA 1C3VA 4U2CA 1ZM2A 1MZPA 3PNKA 5JPDA 2ZXIA 1SVKA 1KEEB 1ZQ1A 2EFEB 3QM1A 3R0VA 2OZKA 3TJMA 4TM7A 3EC7A 1E18A 1JB9A 1XQWA 1CLEA 2MYPA 4OQPA 1C1XA 2F9LA 3LHFA 3VOSA 4L6AA 3ZY6A 2DH5A 2CYCA 5GMOA 2FUCA 3MBKA 2HRRA 3N1UA 3M3PA 5L9AA 1AV7A 3ICOA 1C80A 1ZH6A 3ED1A 3PJEA 4AKSA 2AJBA 4YUYA 3D4NA 3GJQA 3TPCA 2PWBA 2WV7A 4FN4A 2XVXA 2RB5A 3QX9A 2QRPA 3PL5A 2A0WA 3RADC 2IYRA 4V0QA 4LTNA 2FXVA 4QDKA 4Z4QA 3W6UA 2K6GA 2ZJ3A 1TVMA 2WZBA 1YQTA 4D4KA 3IXQA 1UBKS 4P8RA 5TMEA 1S2DA 1ISGA 1KERA 3EZ9A 2YVUA 1KK1A 2NGRA 2QJOA 3DDNA 3LK7A 3MXTA 4O1IA 4XB1A 5AJYA 3REQB 1X92A 2OAP1 3HJCA 4P4TA 3KSDO 2FW9A 2AXQA 4GW3A 4U3JA 5BV7A 2XCUA 3P4XA 2W4IA 1JLKA 2HCRA 2BFPA 1TZ2A 3TD6A 2OM6A 2OLKA 3NDPA 1RFLA 5DTMA 4CI0B 1ENPA 4FGWA 3LOUA 4J03A 5DSZA 4ZCTA 2K87A 3IT1A 4GXQA 1K92A 1PUXA 4IICA 3I9MA 4NENB 3M9LA 3G0GA 1CZKA 3V1TC 2QF7A 5BSEA 2B5OA 3IA7A 2PT9A 4H0FA 1VHLA 1RTTA 4JT2A 1UBHS 4LWZA 1SCQA 5JPIA 2WRZA 3VSAA 1M0SA 4AJ4A 2W0MA 1UC8A 3N74A 4F71A 2B30A 4GOKA 1G5PA 1SKYB 1W36B 1UPAA 1YR3A 1JF8A 3C3AA 1DKQA 2B0JA 2CMKA 3SM3A 3A7EA 4B3DA 3GL9A 3KL9A 4BGIA 2CJPA 2CUKA 1JIUA 1FVFA 1QG4A 2IHVA 3OOEA 4Q9HA 3RYHA 3OZDA 4G24A 3AW8A 4BQPA 4HVCA 3EA4A 3IEVA 2CNDA 1BJKA 2ZYSA 1IJBA 4V0OA 4JI8B 3VZDA 4REQA 3DEHA 3GMIA 2YC4C 3C8MA 3L1UA 1DGQA 1EWYA 1N0VC 1UZAA 3OF3A 2C78A 4QPPA 1T35A 3SNHA 2V65A 3U13A 4DCSA 3K2IA 2O8DA 1V0JA 3KB1A 4N54A 4PPFA 4HDNB 2WJAA 2Y71A 4XCXA 4WZAE 3IDQA 3V6LA 3PXCX 1VCNA 4XRGA 3T5CA 4E0BA 3CEPB 2LDBA 4TVOA 3LAWA 4E12A 2J41A 3OWOA 3BERA 1J0AA 1I8TA 3E81A 5U1PA 3CX8A 1GQFA 3IVCA 1JPUA 3PA2A 1I51A 5KSWB 1P2FA 3AOGA 4NI5A 1HE2A 2BFOA 3CY6A 5KX5B 3QP9A 4ZVNA 2NXCA 2G9RA 1CR1A 1RWXA 3PG5A 4NBRA 4D9MA 5DO9A 1KQFA 2YYYA 3JW8A 3D1LA 1SVWA 3IKLA 3EDQA 5CVJA 3BFKA 4TVKA 4TMZA 5IWCA 1QDUA 4EX7A 4IDBA 3KETA 4N3BA 3ZY2A 3C7KA 2W2LA 2NX2A 1YZYA 1QXSA 2D3NA 1CY1A 4FYXA 2ZUFA 2JFHA 2Z8XA 3TW8B 5ILOA 1SAYA 3D7LA 3LLSA 4EQ6A 2AXPA 3LVQE 3K9QO 5A2GA 5CNMA 4E09A 1T4CB 5IZCA 4AWBA 2EQBA 2VAPA 4JI5B 1IJKA 2D0DA 4C01A 3JQQA 3OF2A 4EX6A 1GN8A 4DF3A 2F4NA 4MW7A 4OAOA 4PRZA 4QU0A 2OSVA 3G1UA 1E1NA 3COJA 5KQRA 3FPKA 2Q6VA 4PGOA 3WNCA 1EP2B 1BCSB 2XMDA 5TC4A 4KGXA 5LQKA 3L4JA 1HV8A 4X1KA 1JEQB 1ETUA 4ZQHA 5G53C 4TQUS 2HTEA 3N2EA 1ISFA 3AR2A 1FFGA 1NW3A 1KBQA 3HDVA 4DR3B 4FINA 2RHJA 4WBNB 3LQ4A 2IIVA 2YXNA 1E3WB 1ADBA 2W4QA 4QHYA 3EEIA 2PG3A 4YN3A 1WMFA 4I1SA 1FS6A 1RLTA 2NYRA 2A4MA 3KWLA 4PX5A 1JUDA 1GUBA 2ZQZA 2FN7A 2ATVA 3H4VA 3OQJA 5KVAA 2QJWA 3IIMA 5CD1A 2BFBB 3GGGA 1LBTA 4QODA 1TUEA 3QPVA 3TK1A 1PSWA 3L4BC 2GHIA 4GRAA 2PV0A 3IIEA 3AK4A 4PYLA 1ML3A 3K9WA 4ND8B 1U04A 1A9SA 2VRCD 3BUSA 1Y5MA 3D8NA 3OKAA 4IG4A 4O3FA 3RS3A 5KDDA 3HJFA 4IKEA 1N2CB 4RZUA 1NPTO 1XLTC 3LPAA 4Y3UA 3AM5A 5IFLA 1U7WA 2A88A 4MJ3A 4YMIA 3DJYA 4ZHQF 1RRVA 4WOPA 1PZFA 4RVFA 2WVJA 1JMVA 3RSOA 1ZINA 2HF7A 3ILHA 5B36A 4DUZB 5HMLA 2FEKA 3A7DA 3KSRA 4HH0A 1AMNA 4I55A 3QU5A 1AA6A 3RJMA 2BFEB 2Q4DA 2RGDA 2Y6UA 2KB0A 3EXFB 3GVPA 4O4IA 1UP4A 3O1HB 3CVJA 1G8AA 4MKIA 4R1SA 3SM9A 3H0EA 2AG1A 1QO7A 4R2XA 3UAVA 5FO0A 4RESA 1RC1A 2OCKA 1CZHA 2GN6A 3AILA 4EW2A 1RE1A 2AJ8A 5KNDA 5H70A 4MRMB 5GVRA 3DHYA 1H3NA 2BI8A 4ZVQA 1KRXA 2FLVA 3AO0B 1DKLA 2W2TA 3KXKA 2H2WA 3PC7A 4KE9A 4WZ6A 4EY5A 3K9HA 3GZNA 3FHTA 2CMFA 3OX1A 1JI3A 4HBZA 2NUTB 4JX8A 4RLSA 1H2WA 4DG5A 3IRUA 2UYCA 1V8PA 1XROA 1US8B 3DLPX 3GEBA 2XZOA 1MIOA 4NCKA 3CO0S 4DNPA 1MC1A 4ESVA 2D06A 4OBXA 2HA2A 2H7VA 4G5FA 4JLNA 2NXJA 1Q7YD 3HWSA 1TOAA 5JBQA 1TO2E 4TZ6A 2X86A 1JSCA 1NMSA 1XA4A 4AIRA 3LUBA 1U6IA 5CG1A 4EJSB 3U37A 3HCDA 4MQFB 4Z0NA 1E96A 1YTUA 5DI3A 2C42A 4E2YA 3B60A 4Q3LA 4ENVA 1M2JA 1CUZA 1XJQA 4UM9B 3EVDA 4INPA 1DKPA 4XL9A 1QRRA 1OI2A 1MB3A 2R6ZA 4NTZA 1T36B 2A0XA 3E3NA 2P0EA 3T5TA 4C7KA 1TKAA 2DE0X 1C81A 4UNNA 4XEUA 4EG7A 1GZDA 3ZXYA 2JVIA 4FYVA 3U6KA 2VR1A 2FNAA 2HJWA 2X8LA 2ZJOA 1CDEA 3H84A 2R65A 4KI0A 1PJQA 1VBFA 3CLUC 1BVUA 3SC6A 4EO9A 2FJ0A 2RC6A 1T5OA 1BVRA 1VE9A 1G4UR 1VQ8B 2XCLA 1QH1B 4QBHA 4CIDA 4CTKA 2Z58A 4ZEWA 2GGSA 3ADCA 2DFKB 4QXRA 3VBEA 4UEWA 4Y6GB 4DXHA 5CDYA 1I6KA 1U99A 3CXRA 1AKMA 2C83A 4WCFB 4M76B 1HEIA 3L7YA 4IM7A 3W5UA 1SXJB 4O8ZA 1YZKA 3HJAA 3QI7A 2OO7A 4GPBA 5AM2A 4NP6A 2GJPA 1BXRA 4RL4A 2RAUA 5HFJA 4ZYYA 5JALA 4E33A 1XZJA 4N5MA 1PEDA 1CR4A 4MZXA 5F33A 1Q7CA 2PWZA 2QUKA 2BWJA 2PL1A 1RCFA 2GAAA 1I2ZA 3M9XA 4JK3A 5IMBA 3SJUA 4BB5A 3DB2A 1E94E 2FUG6 2ISSD 1KDVA 2I3ZA 5DJ5A 1A2QA 3EGIA 4BWFB 4J2TA 2NTVA 3W06A 2OBTA 1VJDA 3LOQA 3MW8A 1CCWA 3Q7TA 1TYEB 3GJSA 1U11A 4HDMA 4O33A 5CFNA 1G66A 2H1CA 5JYEA 5GY7A 2YV1A 2VNIA 2PAFA 5KZMB 4P4GA 3WQZA 3BB1A 2ZYHA 3RDPA 3ZCXA 2C4NA 3IUYA 3KB6A 5E0OA 4FFPA 5EJIA 2X23A 1T6BY 4OK6A 5DHQA 2HYIC 4CL3A 3OQMA 4A26A 2M1ZA 2XODA 2D3WA 2I4RA 2YH2A 1K88A 1SUBA 2KJQA 2GCIA 3MLAA 4PAOA 4Q6BA 5E6UB 5HKLA 5LBUA 3WLTA 3OJFA 2BEWB 5EC8A 2OPBA 4RK1A 3UBMA 4ETNA 1QE5A 2OHVA 3E61A 1W8DA 4MV3A 1SZPA 4CL0A 1IXSB 3SXUA 4FEEA 3NIFB 1JP7A 1ZUD1 1NNI1 5IYZB 2G71A 1JRLA 2FX3A 2IXDA 1I2MA 1ZOPA 2A9OA 2B78A 2G83A 2H6EA 2H9AA 1N2BA 2A9PA 2OENG 1QHXA 1DHRA 2HBZA 2HQSA 5JWHA 4AO8A 1V1MB 1DIGA 1NW5A 1QAQA 1U8AA 1N9GB 2A30A 2DVMA 2H4JA 4NZZA 4UDOA 2AZMA 1R4AA 4LRSB 4CMAA 4LS3A 1RYMA 2I4OA 4NOLA 4FUQA 1NF8A 4NCXA 3PT5A 1PZMA 4X1YB 3ZXXA 1JFTA 4OHBA 4B3JA 1E0AA 2VDRB 3AVVA 1W5BA 1OXXK 1M8KA 2ONJA 5BN1A 1WSVA 3LP5A 2QD4A 1G5HA 1PQUA 2YVKA 1PZHA 3IKVA 3CP2A 4X6UA 5IXYA 4QM7A 1XPUA 1CLUA 1T8YA 3GJXC 2FEOA 1W2HA 2H17A 4MQMA 3A06A 1CP3A 3BB3A 4X24A 4YJHA 1ACMA 4Z4YA 1HDCA 1Z3IX 4UBOA 4W1RA 4CDGA 3QYJA 1LQTA 1FX0B 1WQ1R 1L4YA 4P38A 3D1JA 8AT1A 2HSJA 2ET6A 4BEVA 3QWIA 2ZYGA 3P1JA 3S44A 4AT1A 1VLHA 4DLSA 3L7CA 1V11B 2Q5LA 3D3EA 2YRXA 4K9QA 1QYRA 3WICA 2HUPA 3NTVA 4ZI2A 3LS2A 5K0TA 4EGQA 3ORFA 3UF0A 1S5PA 5JO0A 4ZDWA 1KXJA 1TKCA 2BP7B 5DBEX 1OU0A 4QJBA 4QLOA 3FOAA 5EHQA 4QUHA 2P2SA 3WQBA 2P3MA 4FDAA 4AVZA 1WXIA 4FHZA 3S81A 4MHTA 2VBGA 3GRCA 2JASA 1G8KA 2HXGA 1T3TA 3DFMA 1U7TA 3HUTA 4NK4A 3UWKA 2NV0A 3G0OA 4G5QA 2ZBFA 2GK3A 3IJRA 4OGKA 3TX2A 1IN7A 3VKWA 1RJEA 2PVCA 3B1WA 2DOGA 2ETXA 5KMGB 4FZRA 2K7ZA 4C03A 5KX5F 5FWNA 3ZBTA 1GQSA 4L85A 2A7QA 1M1YA 3UOAB 3WWPA 1R8SA 3UZUA 1X7ZA 2GZHA 3C3YA 3ESXA 4R83A 2GSWA 4QVKA 1J8MF 4JI0B 3QLVA 4ON9A 3WQRA 3EBOA 3SJZA 5JAMA 4LHVA 1ABBA 2QM7A 3BMNA 2IH5A 2BL4A 2PU5A 1YOBA 4LVCA 3QPBA 4GYJA 4HF7A 4POAA 2ZE7A 4WBSA 4WA7A 2Q4BA 2O9JA 4NDNE 1XZFA 2WHPB 5BQOA 1W4BA 4C1BA 3TEFA 2LE0A 3KOYA 4D1YA 2J5BA 5ALEA 5CITA 5JS1A 4MQUA 3ESYA 4O29A 1F2TA 2K5UA 3N2LA 4KI7A 1U9CA 5D3MA 1O54A 1FOEB 2JIBA 1SC3A 4FKZA 5A4DA 2IGTA 1A3CA 4X6YA 3A4NA 4OKSA 4XTCS 3T3GA 5IUJC 3N5CA 2EP7A 4HB2A 3DMRA 1IDOA 3TGWA 1RXVA 2C5BA 2H16A 4LJAA 2HQBA 4KLAA 4O4HA 4XQCA 2BGUA 2Q4OA 1YQWA 1NJGA 3MTAA 4IFTA 5IN5A 5KSOA 1W1WA 4MGKR 3ULKA 3LHKA 5E7MA 1E7RA 3K6SB 4EJMA 2WI8A 4P25A 4F1JA 4F4FA 4YRAA 1QQ5A 3CLUD 3GPIA 2NO4A 2G08A 3KJEA 4CM4B 1K0UA 4XIGS 5A2QA 3T1HB 4JSYA 4F21A 2V0GA 4GKKB 1E9DA 2OBBA 1YKSA 2ACVA 3QVTA 5EPOA 5LOVA 5HE9A 3KQTA 4JY7A 5KSZA 3WOHA 1EVZA 3COSA 3RK4A 5AN9A 4UCWA 5DTQA 4XLTA 1ZMBA 3NCHA 4GLLA 4ZAGA 5A4MS 2K2WA 1BQ4A 5I5GA 1ZAKA 3U09A 2O4UX 4Q47A 4F4IA 2XIQA 1ADJA