3W2IA

Crystal structure of re-oxidized form (60 min) of nadh-cytochrome b5 reductase from pig liver
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
271
structure length
271
Chain Sequence
b'TPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
molecule keywords NADH-cytochrome b5 reductase 3
source organism Sus scrofa
molecule tags Oxidoreductase
total genus 77
structure length 271
sequence length 271
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w2iA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w2iA02
2OK8A 1R5NA 2VNJA 4M1KA 3CRZA 4G1BA 3B78A 1N8RD 1CQXA 3CCRB 3VMFA 1F20A 1BX1A 3AVWA 1FNDA 2OTLB 4DQLA 1G7CA 2VYQA 3FPKA 1FNMA 4B43A 3WY9A 2X3UA 4B3XA 1IJFA 1EXMA 1B23P 1OGIA 1W87A 1VQPB 2HMAA 3W5VA 1IB0A 1M1KD 4RCYA 4AF7A 5JBQA 3QE2A 1VQ5B 1KD1D 2ZITA 1CNEA 3FJOA 2GPJA 1ZM4A 3JQPA 1FNCA 1GAWA 4TMZA 1ZM9A 1KJZA 4M0LA 1S0UA 2E1RA 1ZM2A 4UAJA 2QEXB 3QSYA 1IJEA 1DARA 3CXCB 1OB2A 2YWFA 1OGJA 1JNYA 1D8TA 2B7CA 3U2QA 1TVCA 1BX0A 1VQLB 3CCEB 2DY1A 4NCNA 1QFJA 2QN6A 2BN4A 1JA0A 4PGOA 1EFCA 3CCSB 3AGQA 1QFYA 1K73D 3WNDA 1EP1B 1ELOA 4Q7JB 3OZVA 3CW2A 1HA3A 3W2FA 4ACAA 1FNBA 4TMWA 3VO2A 4RD1A 1E64A 1JJ2B 1GAQA 3AVXA 3VNUA 4ZGQB 4TMXA 4J0QA 4FK8A 2VNKA 1KRHA 1YJWB 4MYTA 4LBWA 3WNCA 3ZZ0A 4RD3A 2NPFA 3G4SB 3LVBA 4YHBA 1TLLA 4B47A 4YAUA 4AF6A 2C78A 4PC6A 4PC1A 1FRNA 1QUFA 4F7DA 3CCMB 4BPRA 3W2EA 4FN5A 4M2LA 2BM1A 5HXBA 4Y7CA 2AHOA 1BJKA 1D2EA 2YWHA 1OB5A 5H5JA 4NBSA 1VQ8B 1N0UA 4Y9UA 3AVUA 1YITB 3ZZUA 3AGPA 1YIJB 1GR1A 4M53A 1BQEA 2YWEA 3I56B 2RC6A 4YAOA 1QVFB 1EWYA 1DG1G 4TMVA 1G7RA 1FRQA 1TTTA 4RD2A 4YAFA 5DSZA 2D74A 1U2RA 2DEUA 1WDTA 3AVVA 4WQMA 3LRXA 3OZUA 1F60A 2BPOA 1K8AD 3B82A 3W5HA 4K1XA 1QX4A 1EFUA 4G5GA 1K9MD 3PENA 2YWGA 4YAWA 3CD6B 2BV3A 4Y9RA 3A1FA 3W5UA 3QFCA 1W2BB 4QFMA 4IW3B 4ZCIA 2XNJA 3E20A 3U6KA 5THXA 3MHPA 1Q81D 3CCQB 3AVTA 4N3NA 4HE6A 4RD6A 3ZBUA 1KK0A 2B5OA 3G71B 2B7BA 1W35A 4B48A 1I7PA 1H42A 3J81k 3W2GA 4PC2A 1VQ7B 1UMKA 2EIXA 4B4DA 1VQ4B 1A8PA 3CC4B 3WYAA 3W2IA 2QTLA 1NJID 3OJXA 4AC9A 1YI2B 1VQNB 1GVHA 3ES9A 3CMAB 2BGJA 1ZUNB 4DQKA 1AIPA 1VQ6B 1GO2A 3JQQA 3CC2B 3I1FA 1Q86D 4ACBA 4LBZA 3ZZTA 4TMTA 4U9UA 3ZC3A 2DCUA 1G7TA 1Q82D 1QGZA 5GV7A 4RD4A 5H59A 2BGIA 1YJNB 5EMNA 1B2RA 3U6BA 4ZCMA 4C0SA 4LBVA 2BMWA 3JQRA 3P27A 4B44A 1JB9A 2CRVA 1QUEA 2HDNB 1YHQB 2HCJB 1S72B 1SM4A 1XB2A 2BSAA 1VQ9B 1R5BA 1QGYA 3G6EB 1NDHA 4RCZA 3VO1A 3MMPA 4P3YA 2C77A 1YJ9B 4PC7A 3CPWB 3QFTA 2VNIA 3W2HA 2OTJB 1M90D 3WBKA 1XE1A 1QFZA 3B8HA 4ZV4A 2QDXA 4ZGNB 1VQKB 3WNBA 2GQFA 3LYUA 2DERA 1DDIA 1KK1A 3ZBTA 4PC3A 1E63A 3QFSA 3V76A 2RC5A 1QGAA 2QMUA 3WXMA 5AN9A 1H85A 3CMEB 4N3GA 1JA1A 4EH1A 5TR9A 1R5OA 1EP2B 1KK3A 4LBYA 2QTZA 1FDRA 2R6HA 4M4SA 4P6VF 1GJRA 2OK7A 1SKQA 1VQOB 4H9GA 1Q7YD 2QA4B 3CCJB 4TN1A 4G1VA 4FWTA 3E1YE 1D1NA 3OZWA 4C43A 1VQMB 1TUIA 2FX3A 3CB4A 4HE5A 4QHYA 3OW2B 3CCVB 1DDGA 1J9ZA 3LO8A 1QVGB 4LC0A 1KQSB 2BVNA 4ZCLA 2XEXA 2J7KA 1E62A 1N0VC 1AMOA 3OJWA 4RJLA 2PMDA 1KK2A 4RD0A 5TY0A 2VNHA 2PIAA 5TV2A 3VNVA 3SJZA 1ZM3A 2PLFA 2DETA 1QG0A 2EFGA 1EFTA 1G7SA 4YALA 2BM0A 5KSWB 1QH0A 1KTVA 1EP3B 4MYUA 4R71A 1CNFA 2VZLA 2CNDA 3AVYA 3P26A 3CC7B 5GV8A 3QFRA 5FA6A 3I55B 3WBJA 1KC8D 3MCAA 3CCLB 3CCUB 2BF4A 1W34A 2XNCA
chains in the Genus database with same CATH superfamily
2C88A 1OLSB 5BWNA 5IRCD 1W4ZA 4KQHA 3IOMA 2LR0A 1E2GA 3ZDXB 4G0MA 5L6MB 1FTYA 3F90A 1R0RE 4RPJA 5A04A 3Q41A 1Q14A 4B8ZA 1O0SA 2K4MA 4F7WA 3ENQA 5JSQA 1CQIB 2PK3A 2BSXA 2PSFA 3PF8A 4L1KA 3C16C 3JD4A 4RTPA 2JA1A 4OQFA 1R9MA 4DADA 3FFAA 4WIAA 2EYUA 3AHIA 4Y98A 2QQGA 5TGZA 3W1WA 3DW1X 4BBAA 2VJIA 1KETA 1ULUA 5JG7A 4OQQA 3SIPA 3TQSA 1KO7A 2WJGA 4BO2A 1RJDA 1L5YA 4TZ6A 1W581 2MR6A 3IQEA 1X7WA 4QNRA 2Y1DA 4HMPA 1ZJYA 1S7CA 1E0KA 3OZCA 1UUFA 4RETA 5D3MA 2ZGVA 5TS3A 5CXQA 2I7TA 3NCTA 4MARA 4N0DA 1YZNA 2WD7A 4F2DA 1JAYA 2YFQA 1L5QA 4OMFG 5KJEA 3CH6A 1E32A 1WA5A 3KB8A 1QE0A 4IV5A 4RJ2A 2ZSJA 4Q1BA 3T9FA 1W36C 1UKYA 1ENYA 2XUIA 3LJKA 5A7HA 2O2CA 3S44A 5HJEA 2R44A 4XIYA 4M36A 2EL7A 1ZI8A 3IDAA 4LAFA 4F86A 3O84A 3MMXA 1G98A 2CDAA 2EFJA 3ENZA 1SPBS 2ECOA 5HVNA 3FGPA 4JYPA 4IGAA 3QMMA 2GFQA 1ECPA 4K8RB 2IYLD 4PCLA 4AJJA 1FJGB 5TSDA 2YDXA 5MN5A 3VKHA 4ML3A 4XIFA 4XYEA 4C01A 2D3LA 2JFPA 4NG5A 1LBSA 1MX1A 2AZTA 1VBFA 4HYEA 4HDMB 5F7JA 5JHGB 1IQ0A 3LKZA 4UZEA 3OIFA 5KNCH 1UBRS 4RVOA 1WOPA 4BFWA 1IB6A 5JNTA 5IT4A 3LPDA 1PT9A 2CKMA 1SBTA 4LWQA 3HB7A 4YRKA 3U7EB 2XAUA 2GXAA 1ESEA 3QU7A 3T9DA 5A4FS 4F6RA 3B60A 1OFGA 1NDUA 1L5NA 1BH6A 1KBOA 2VF4X 3DNPA 3GA7A 2XZDA 2V97A 1V8OA 3ZU5A 1SKBA 2Q3DA 1R0KA 1R27A 2HK8A 2I7XA 3OEED 4JSRA 4G01B 3TS1A 1V0JA 5FPTA 4ZXFA 3L1VA 3BY1A 3ZV6A 2XADA 1TQ4A 3EEFA 3ZR4B 4LOAA 3CCEB 4LDQA 3OZAA 3CXRA 2VWPA 3BQNB 1Q3TA 2WLSA 4NESA 3A27A 5ADWA 1O8CA 2PANA 3JQ8A 3RVKA 3KUXA 1Z8NA 4CGZA 1QVWA 4YJGB 1BS9A 2VBCA 4PBRA 2BELA 3BXZA 2NZVG 3FSJX 4JKOA 3CX7A 5TVGA 5T7BA 4MWOA 3RSHA 4EO4A 2OHFA 3M4XA 2ZUBA 4PS0A 3O1JC 2HJWA 3OOHA 4MWSA 1MQ9A 4I4TF 3D6VA 1JYFA 2BFOA 2C2XA 2HF7A 4O5OA 4DA0A 1FNBA 3Q0IA 5AW4A 1EUYA 4FX5A 3FNFA 1EAMA 4U1RA 2IU6A 5CVJA 3T53B 3V8BA 4JBYA 3TZ6A 4OJKA 3RLIA 4FHEA 2Q21A 4UHCA 1UD3A 1NNLA 4GI2A 2YWDA 1QHFA 1GAQA 3VNUA 1VI5A 1BC5A 4NFHA 1M0TA 1FXWF 4CL8A 3ELDA 3G2KA 2YHBA 4NCKA 3KKEA 3LXRA 4N39A 5FNZA 4KYUA 4R6WA 4AP5A 1NTRA 1V8FA 2WT9A 1N2CE 4UVHA 4B3GA 1JE1A 5BNZA 1RQNA 3WISA 3GDHA 1BS1A 4UU7A 5DT9A 3JAWA 2GZ1A 2W6CX 3G4SB 3ZTYA 4BLRA 1H1LA 1BMFA 2JZOA 2PCJA 1A7AA 4TQUS 4EGFA 3MTAA 4KREA 1NQWA 1NZDA 3NZEA 4HDKA 821PA 4MP8A 1NFRA 2ZS9A 1NRJB 1UP4A 3N0VA 4ND3A 4F7DA 3GJRA 4DKXA 1GT6A 4G4SO 2E21A 4NC9A 3VH1A 3FIUA 3UQYS 4GZ3A 1SZJG 1EE1A 1M2VA 1PR9A 3C7DB 3GN1A 3PFIA 3A9RA 1E5QA 2GZAA 3DAYA 3EUWA 4QFDA 4Y7CA 3GGCA 1UP7A 5JYBA 3EXAA 1WSVA 1H6AA 1O08A 1VBMA 1FVOA 2FEXA 5JNWA 5CYOA 5EG5A 4U2KA 5EE0A 4ZHQA 3VVLA 3W3AH 6CHYA 4AROA 2QBYA 4ABTA 3AVUA 2EP5A 2GVNA 2P2CA 2Q0SA 1YZUA 2QGZA 2DQKA 3AOGA 3P19A 1BAPA 3A1CA 4L9WA 4QELA 1HKUA 1QZUA 3TPCA 1I8DA 4CM6A 3WQBA 4AX4A 3R3WA 3ZGYA 5DYYA 1D4FA 5IYQA 5T8KA 2Q29A 4LTMA 4R9RA 2A1IA 4Q12A 3V3KA 2X23A 3Q5EA 3I56B 2H06A 2NNWB 3TW6A 1T36B 2BSQA 1EWYA 4ZHSA 2H5JA 3D7SA 1XTPA 3INTA 3OX1A 4IZHA 2Q1TA 4JSYA 1O54A 5J4KA 3HXOA 2H1FA 1P8JA 1N6OA 3E0QA 4KR7A 2P6PA 3BFKA 2QX6A 3NM6B 1C9EA 3QTBA 4G3XA 2ZTVA 1HZZA 3FWPA 3E05A 2AKEA 4Z51A 3DVQX 2QMOA 4F85A 3NIDB 1Q84A 2QHXA 5EKDA 5MN4A 1Q1BA 3VKFA 4M9CA 2XH8A 5L7WA 4G4JA 1FFYA 2G83A 2JBHA 2GZ3A 3C3DA 2PBZA 4P83A 1GGFA 1E3TA 2MINB 3A4NA 3OWOA 3AKDA 2Q7OE 1VHEA 1T6ZA 3ESAA 1E5XA 4RNCA 4EJ0A 5KC8A 5KYTA 2PBRA 2MYTA 3E3NA 1SN7A 2XTMA 4BAGA 1EKXA 3I5AA 1QTQA 1VL5A 1HQCA 5K0NA 1ZJ5A 1HETA 2FGKA 3ANTA 4ZVOA 5JMOA 2QPAA 3PFCA 4EFKA 2BBWA 3UV6A 2WMYA 4X45A 3WGUA 2YWRA 2ID7A 4LFBB 2OO5C 5FPKA 3CF2A 4LJLA 1K3FA 3E5NA 3WKBA 2CXSA 4C7XA 4AULA 5J63A 5HCIA 4NNPA 3K05A 1Y6QA 5DTIA 4KO3S 3ASPA 3UMBA 3K0CC 3H2BA 4YO8A 4XOTA 1HFKA 4OJNA 5ESRA 5FD8A 1ZH2A 4QFMA 3EGOA 4INAA 4MUAA 1P7WA 2JGMA 4JL8A 5ALHA 8AT1A 2ZAOA 1HI9A 4RHCA 1JHMA 4YACA 1C7ZA 2BGUA 3I0ZA 1CCWA 3G0CA 1I3NA 2CD9A 3L1JA 3GL9A 4RLSA 3F3SA 5DGTA 1RIFA 3MHPA 2FEAA 1PK9A 2D5IA 5JNRA 3NCHA 3G0DA 2X77A 4J16C 2P0AA 5E0KB 4O1HA 5EINA 1T0UA 2FVXA 2Z5LA 4DG9A 2VP2A 2R9VA 5CFQA 3DA8A 3LIIA 3ZWBA 1KHTA 3FG9A 4C0KA 3A2KA 3EDYA 3B48A 3ZLBA 4GSYA 4EX6A 2I7CA 3HP1A 2P6OA 2AQIA 1K6XA 1WEHA 2ADFA 3QWHA 2F43B 1N78A 4LIPD 1UPBA 4MB2A 4CIBA 1PV2A 4WXRA 1L8XA 1ZNYA 3F49S 2Q6KA 1Q12A 1K3UB 4DLBA 1PQWA 3HYLA 1JQKA 2EDAA 4LK2A 4Q4AB 2QLTA 2IODA 1OH5A 1CU1A 1ZH8A 3OO0A 4G85A 3I34X 4NABA 2BEKA 3G02A 2ZYHA 3BGVA 1HLGA 3F2VA 4KQWA 5ALDA 4XVUA 3THXA 5F7XA 3K2QA 4CEHB 1DCFA 4X90A 5LUAA 3WJAA 1GYRA 4KQ1A 5FTNA 3GJTA 2X9VA 4LGYA 5FX2A 4YP1A 3DLHA 4IIJB 3DO8A 4B8WA 5DHFA 3MELA 4KO2S 5C4IA 3WQHA 1G8AA 1ZN9A 3A4VA 5EA2A 3P2MA 1WKVA 1ZVMA 1EJ0A 4OXRA 3ZH9B 4UKDA 3FNGA 1MKYA 4LCBA 2Z2IA 2OEPA 2OGUA 3F98A 1O94D 4OYLA 4ZOEA 2VRBA 1GGNA 3AUTA 4PZZA 2AYXA 5CP8A 5I8WA 1X14A 4XI9A 3VPXA 3ZZTA 5IFLA 5JHHB 4HDSB 5HZAA 2ODPA 2W6QA 4JAVC 4WFKA 4Y2UA 3BTUA 5DEIA 3VJLA 4DE5A 4XPIA 4R8KA 1EG2A 2KMLA 4GYKA 1QGZA 5CDTA 3V8NA 4F3YA 5CD1A 3FYUB 1OREA 4FLEA 3ADPA 2PQ2A 3FFWA 3RU7A 2ODWA 1JVSA 3UEOA 3S68A 1P3JA 2X22A 4ED9A 3VX3A 3QOFA 3K2BA 4H59A 1I0LA 1QVRA 4MQEB 2D3WA 5HMMA 1YE5A 1ZQ9A 1NATA 2C8KA 3L7DA 1FCJA 2C1EA 2F9MA 3DE6X 4IGFA 3N2EA 5TB5A 1FEZA 2AR0A 2QGNA 1QYDA 3FD8A 1QYXA 2QMZA 4XVQA 2KE5A 4RDCA 2WQZA 1F8FA 4Z4SA 3BTOA 3FZYA 3P1JA 2WILA 3N1UA 3VR6H 4DLZA 3INGA 3JQRA 1WLYA 5FORA 4OJQA 2P75A 5T5QA 3OT1A 2BGNA 4RA9B 4ZI3A 2O59A 4ETMA 2PUWA 2ZSBA 4EYSA 3O4HA 1DJPA 1PZFA 4WLUA 3H19A 5KWSA 4TT3A 1S72B 5LA6B 3ZW7A 4C4SA 1WQ3A 1AKYA 1Z25A 1LDBA 3QVUA 5FBRB 1W96A 4FNAA 3NANA 4NZZA 3M6WA 1AZTA 5BN4B 3KNZA 1R0CA 2Y6UA 1LRLA 3NEJA 1CQIA 1M1NA 5CLQA 4EUHA 5K5EA 4FDMA 3SNKA 2CFOA 4B2PA 2GR9A 4O0LA 4EY6A 3PA6A 5EE9A 1UC4B 3AMVA 1VMEA 1D7OA 4PC7A 4KBGA 5J5CA 2LKDA 2IYZA 3AUXA 5CB8A 5K4GA 2C58A 1N1EA 3GFBA 3TL2A 1C2TA 5DBOA 2ZIFA 2UXCB 4WK4B 3DDSA 1JQJC 4Z4YA 1O6CA 1AXRA 1KI3A 2VYVA 1T4MA 4GZLA 4PCVA 3GFOA 1DEKA 1GV1A 1EB9A 5K3AA 2IYWA 1QFZA 4EJMA 3E2IA 5AI4A 3AI3A 3W4KA 1TU0A 1U0NA 4DNQA 4L51A 1NP3A 1W9HA 2YY5A 4EVSA 2WM3A 4EYEA 2ZR7A 1DHRA 3JWPA 4JR0A 4CIAA 4D9EA 4QQKA 1ZI6A 3LFTA 2N42A 4N01A 4WN9B 1R4MB 3BJMA 1YLOA 1MO2A 3Q6RA 2NZUG 2FUNB 1LXCA 1BE8A 2J4DA 3D8RA 3EXHC 3F1LA 3G7NA 3GD5A 3HEBA 3I64A 4FT2A 2A14A 2NUPA 4JB2A 3MT9A 2ONYA 1DRKA 1JHOA 1QZTA 4N12A 3QWIA 1T4CA 5CFNA 3FOZA 2DPGA 4BO7A 4HDMA 1X77A 5F1PA 2AN9A 1DWUA 2DPLA 1DAHA 3A4IA 4YCJA 2RGYA 3S55A 3S8EA 1NWCA 2QW0X 4DTIA 1R5OA 2FN8A 3EZNA 3KXPA 5HKKA 2VJKA 3E8XA 3IQXA 3EFBA 4N4AA 1PYGA 2AFVA 3WK9A 1IXYA 1A9SA 5INTA 3H5AA 2PL3A 3D6NB 3PQ3A 4NMHA 5CVUA 1TUEA 3P0EA 3ZX5A 2R6HA 4QTTB 3ELBA 3EBOA 1A72A 3LVRE 2FR0A 2G1KA 4BP1A 1XQ1A 1N34B 1GL7A 3HXLA 4CPDA 3WLKX 2FW1A 1PKXA 4XIJA 5AKGA 2QA4B 3EGDB 4UU8A 4F2HA 1OPXA 2VK8A 4IMJB 4LE1A 4TVSA 3Q12A 4G1VA 2EG9A 2PH7A 1FYFA 1GKKA 1IPFA 1F7UA 3WVNA 1OX4B 2WU4A 4Y67A 2W98A 3NAMA 2IEYA 3G5TA 2QU8A 1HVXA 2BFMA 3PQ6A 4X20B 3QHQA 4HSEA 4H1TA 1VE6A 3D8SA 4XVHA 4CIXA 1HSOA 5C32A 5HUQA 2RD2A 4QHYA 1WD7A 3JTEA 4YJGA 1E2QA 2G0TA 3DHEA 3TQRA 4LY6A 3WRYC 2H1HA 3LO8A 1E1RD 3L7IA 3QW2A 1E3EA 5CJJA 4CMBA 4IKPA 3T9EA 4D4MA 4LC0A 1VLOA 1WSWA 1Y9ZA 2H3HA 3MJRA 3GRPA 1DQRA 2EZ4A 1YX2A 1R6TA 1XXHE 2VYND 3LPAA 2PH1A 3O95A 1FP6A 3C45A 4GP6A 3TE6A 1TM7E 4YI3A 2PMCA 4I1UA 5JZVA 1X8XA 5I4IA 3F7MA 4P32A 1FFSA 1YE8A 3AKYA 2EFDB 4BASA 4C0JA 4LXYA 2FLKA 2O3QA 2RGDA 3UWMA 3KFXA 3UGKA 4HUQB 1KY5A 3AEUB 4WUVA 1J42A 1J1ZA 1L8LA 1GYPA 5M04A 4ZFNA 2E55A 2JFOA 1KP3A 4JVSB 4PLGA 4F84A 4IWXA 1KI2A 1Z2NX 2FSPA 1V16B 1YB5A 2QT0A 3TLXA 3H0EA 3UB2A 2IPNA 1H0SA 2XB6A 4PM4A 3ZY6A 1DQYA 1FDIA 2JAPA 4RK4A 3GMTA 1GPYA 4OP7A 1L5SA 4MRMB 3P0IA 4R68A 5ELXA 4E15A 3ND5A 3ZCVA 2XDYA 5BYKA 4ARCA 1NONA 5BSRA 2H8GA 3OUTA 4WX2B 3U4GA 2OO7A 2I3DA 4EPTA 1U0RA 1T26A 2ZWOA 3KBBA 3UWPA 2X6TA 1QJ4A 1TXGA 4TMFA 4TX1A 1ESZA 1A7UA 4ERXA 4RCVA 1JQBA 1JECA 3Q8XB 4EK9A 3TZLA 2VWGA 2OV8A 2XDQB 2HEGA 3WTBA 1I0ZA 1HOTA 3SKBA 2E4WA 5C8YF 2NQ8A 1KSFX 3O0TA 2IYSA 2O06A 4JH0A 2B2NA 2JZCA 1Z83A 1WNTA 2VTKA 5HCUA 3FKQA 5KKNB 1EXVA 2ZTMA 1C3JA 2PRSA 4LS3A 2IUUA 1CZUA 3VR4A 1E99A 5AESA 4LQCA 3OJCA 4QDTA 4YB8A 3MM4A 5T64A 3VU9A 4G0WA 3FWZA 1D09A 1VLJA 1IHOA 1LGYA 1ZJZA 1O6ZA 1E6WA 3ZDFA 3R7NA 3T4EA 3B89A 1N8RD 4K3VA 4M9QA 1CERA 4IUYA 4TLCA 5BOSB 3DMGA 4ICIA 1T36A 1T6NA 3AXTA 1XQYA 2GFIA 4H6WA 5JWHA 4I55B 4G41A 2B3DA 4QDJA 2NV6A 2A92A 1RWPA 2NQ2C 2NUTB 2PA0A 2OB2A 5JFGA 5H9VA 3ZNOA 3C4QA 2RGNA 2I4NA 3I76A 2W37A 2EJCA 3LYHA 1FBNA 5AK0A 4JCCA 2R5NA 5U4XA 3ITKA 3GPDG 3UA4A 1WZNA 3HJHA 3GH1A 3H1GA 1NB9A 4K86A 3O5AA 2MINA 3EA0A 4NOMA 2GILA 2J3MA 1IY1A 1QZXA 1CY0A 2PS9A 2QJRA 3BK7A 2RBKA 5HF9A 3RSOA 4EX7A 4YLYA 1G18A 1PJAA 3CHYA 1UZLA 4TS3A 5K1ZA 4BP9A 1B00A 2CWDA 4FTWA 1FYVA 1VQPB 1MHPA 1Y0RA 2Y2UA 4YJFB 2QRNA 4UATA 3DVRX 3I42A 4Q19A 2Q8QA 3MGGA 3R20A 2WYOA 3DNFA 3K5WA 5HBRA 6ABPA 2OWEA 5JBQA 4Q39A 5ERYA 4HZGA 3DT6A 3FI9A 1T2FA 1J23A 1XC7A 1GNQA 3RS4A 3S4YA 4X1IA 3KZKA 1BMQA 1NF9A 2OFFA 3ZWNA 1R4ZA 2OBSA 2OQIA 3BREA 4FHCA 4RH0A 1LLCA 3S8YA 3MTBA 5CA0B 1IBMB 1ORVA 2GT1A 5HOEA 2VRWA 1NF8A 1N8SA 3QLUA 4U7GA 4PGFA 3WSTA 1U3TA 1OWPA 2IYAA 3HDTA 1FZQA 2QUKA 3PHGA 5CM9C 4CMKA 4R9SA 3KSZO 2MYPA 3NIWA 3GEMA 3LPCA 4LHYA 3SQNA 4CFZA 1PJBA 4HQLA 5HIAA 2P11A 3JYHA 1AUXA 4K46A 3TTUA 2V6GA 1M2FA 2YWFA 5LU9A 3K0AB 1IZ7A 3QXSA 2RDMA 1B3RA 3CRW1 4XM2A 5EIAA 3EGXA 3VZDA 3ZDEA 4EG5A 2I4IA 3AOEA 2AN4A 1IK4A 1YTLA 4HL6A 5BXYA 2AV6A 1KE2A 3AWIA 1NG9A 4UEQA 5KC9A 3DAPA 2BKUA 1RRPA 1PNVA 3K32A 1BQ4A 5EIBD 3ZPNA 1EM8A 3SEJA 3JYLA 4R1SA 4WI1A 3ZLUA 4W1QA 4J8PA 3ABZA 4A03A 5CVTA 4FYWA 4QUJA 2P2GA 4DMHA 3AV3A 5CDGA 4BZWA 3COPA 2OV4A 4O25A 3RC1A 3PSHA 3LG2A 1T2DA 4FZRA 3ROKA 3BNWA 3EULA 2JAQA 4L3VA 2C3MA 1AQ6A 4CEHA 2D9RA 3Q7EA 3OZVA 1ESDA 3WP1B 1GG2A 3HEAA 2HSZA 3M1LA 4HR7A 4J0CA 3WGHA 4JC0A 2F55A 5LQJA 3PVDA 4IHAA 4WOPA 1GNTA 4P58A 2NUBA 3BK1A 1KSJA 3FBGA 5E6UA 4DM7A 1KYTA 1E92A 3KM0A 5EJ7A 3QVGB 1G3RA 3MUEA 2OBFA 3QU9A 4F91B 4FS3A 2HCFA 1NASA 1V6SA 2WP0A 3AY7A 1OYWA 4JJGA 1GZ5A 4XAQA 1RQGA 3CPSA 4ZCRA 1K6JA 2PMBA 3KZXA 3QVVA 2ATVA 4FHFA 4JKIA 3SHVA 3KAJA 1WPQA 5AHWA 4K9MA 5DYIA 4GLLA 2X41A 4KLNA 4Q1DA 3HI4A 3KSAC 4H6VA 2AEEA 1NV8A 3RC7A 3CZRA 3B9PA 4BU1A 2Q4EA 1XFAA 3P9NA 2NPFA 2Z2JA 3W4IA 3D3WA 1I94B 1WAMA 4KIGA 4NE9A 5HUJA 2JAOA 2WV7A 3KCQA 3OC6A 4X8IA 1P3DA 2H6EA 2VT6A 3I3SR 2B0CA 3JAKB 4MQEA 1FU7A 4UXIA 4ZODA 2BFAA 3PUIA 1OC2A 4N65A 3IAS6 2ZSFA 5F3DA 2Q7DA 4TRNA 3WQSB 4OK3A 2R47A 2A1UB 1PSZA 3NBQA 3ZLJA 4LHZA 1R0ZA 3RUPA 1XTRA 3KELA 4KMSA 4RA9A 1H8HA 4FYVA 2WUEA 3LSTA 4P5EA 2SCUB 4KYIB 5H5JA 1SD5A 4MGYR 5AHOA 4XLZA 5AKKA 1SK8A 1DCKA 3MAJA 4FCCA 2N0SA 4CODB 1BLIA 1Z2DA 4OEHA 5LA6A 4A2QA 3FOFC 2IK8A 1LSSA 1L5MA 4QDKA 5AK3A 3PRKE 3V8QA 2WNSA 5TGTA 1Q0LA 5BN4A 4FMCF 1L1EA 3PC7A 1GR1A 4GL2A 2PDAA 2YY6A 2QLNA 2HU7A 2WRZA 2I2XB 3OPQA 4X7PA 3E7PA 4G97A 5EERA 3CCBA 2G04A 4D98A 1A9RA 3N5CA 3IBSA 1M8GA 4DRYA 2YRWA 3IEPA 4E5SA 4XD7A 3G0OA 2P69A 1ADBA 2F1HA 2DFKB 1H0RA 1T6YA 3NEPX 3FCUB 2PY6A 1KEKA 3K15A 4HDQB 5LMCA 2O48X 1U8UA 3IKVA 4IO1A 2LUOA 4OSEA 2J9ZB 5A5EA 3C6KA 5EIEA 5HP4A 1PFVA 5AJVB 3OHSX 4ZEWA 2OZKA 3SHQA 2B8TA 3CLSD 3OZEA 1T5TA 2B3TA 2VT7A 3BMNB 3SVLA 3CRQA 4HBZA 3WGQA 3HB1A 3CUUA 3C3AA 2JRLA 4PYQA 1XCMA 5C7YA 1UXGA 4Y2RA 5CLGA 1L3BA 1Q1QA 1C29B 4I1PA 3O4GA 3AETA 3E7WA 4GOJA 4D8YA 4WN9A 3E23A 3F5QA 4MXDA 3VSAA 1XK7A 3UJ3X 3WL7A 4G5SA 4EHJA 5ADHA 2WG1A 4QEKA 2UZ1B 3KO8A 1J2RA 2B1QA 4HPJB 1W0CA 2TS1A 3WRXC 4IDFA 3L4JA 3EF0A 2BJWA 2G9UA 2ASEA 1N2EA 3IOBA 1E9FA 1NF3A 2V7UA 3STTA 2AYYA 1ZXLA 4JBWA 4B2IA 4JDPA 4B2LA 3NRCA 4OX9B 3RLFA 2H7XA 1YUBA 4HN9A 3PA2A 4D8TA 4I8IA 1GA6A 4Y9RA 2HCBA 2DR0A 3QUTA 3RCBA 4MMZB 3TX6A 4CHGA 2AA3A 2PR7A 2FSVA 3F5DA 4GC9A 4YMLA 5KJ6A 1RZRA 1V8ZA 3CVYA 2D4HA 3QK7A 4E6PA 2G8LA 3EQ9A 3T7JA 4UU1A 1S6YA 3DMHA 4Z4WA 3ZK8A 1WP9A 5BSEA 2BH2A 4I4TB 3V4LA 4PZLA 1NXXA 4OQDA 4JNCA 4OOXA 4R2WA 2JJ8A 4MVJD 1QCYA 2XWQA 3FKSD 2DT5A 3MB5A 4FW9A 2IXBA 5KYVA 3T7SA 2RGEA 1Q81D 5HRCA 2EQ5A 2P1DA 2F00A 4B3TB 3FPLA 3EGDA 1GQ2A 2HMTA 1PE0A 2ORED 2RGGA 3ECSA 4MROA 1C0LA 4K6FA 4WDRA 4P4UA 2UVQA 2HV9A 2CSUA 3MWFA 1VA5A 1OX4A 1THTA 2CNNA 4E12A 1DX9A 3O3OB 4GOXA 4MS3B 4X20A 3MBKA 2NACA 4YXFA 4Z9XA 2EQBA 1ZRMA 4KSBA 2D8AA 2YJ3A 3RC3A 2ZPTX 4F3CA 1SB8A 4GBGA 2EIXA 4B3CA 1K7SN 1KRWA 2VAPA 3CC4B 1C5KA 3KWMA 3ZCXA 4F5ZA 4NF2A 1U9JA 3GQBB 1HOXA 2NZ8A 5CT6A 2OQ2A 3GBVA 5JZMA 1J0AA 4BVBA 3UYKA 2LZJA 2C84A 2C9OA 3OZSA 2JKYA 1OMOA 1PNQA 5H1YA 1CRWG 1G5QA 3CF0A 4M60A 3S2IA 4HUQA 2GPSA 3OWHA 1ZK3A 1JI0A 2PGLA 3D1LA 3UUGA 2O3RA 2HWXA 4Q01A 1BDBA 1DOZA 4GMFA 3T0GA 4DNFA 2I3AA 4R5MA 3RTDA 2UUOA 4ZDJA 4UQLA 1LPSA 2G8NA 4N82A 3A3OA 3W5IA 1VCMA 3BSYA 3WADA 5FUQA 4U9UA 3M6IA 4GYYA 3KQTA 3N3AC 3IMEA 4KQ6A 4WBNA 3DB2A 2EIHA 3SC3A 1G9XA 3AF4A 1I4TD 3G2NA 3H97A 4LHVA 4NR0A 5A6SA 4H7FA 5IJZA 2J5RA 5C80A 1XD8A 1GPH1 2I6TA 5G40A 1WMDA 2VUIB 2R11A 3PEEA 3TSOA 4Y7DA 5ED0A 1RABA 1GDHA 3LL7A 2RK3A 4I5IA 4UW9A 4D9BA 3DOUA 3QW4B 4Z5XA 1JWAB 2VQFB 3H2YA 3ZGOA 4BN5A 5SY6A 3GLIB 3P32A 3FY4A 4PCUA 4EYQA 4CTKA 4FMPA 2VHZA 2HLNA 3K30A 2XDQA 3GMSA 3N8IA 1JVNA 1U3FA 4CKEB 2Z4TA 4RSRA 5EJ5A 2Q46A 4CT0A 3R9XB 2H3EA 4UUPA 5FI5A 4B75A 3ZDBA 4J7AA 3NUQA 2ECQA 4N5NA 5DYGA 1LS1A 3O4JA 1KMMA 2BZ1A 3BHMA 3D2LA 2A7QA 4KBYA 3RTAA 3NUZA 2H2GA 2OCAA 1W2HA 2ZSIA 1OH7A 1XNQB 3VKGA 4Z4FA 4RCZA 1EZ1A 1E8MA 3TNLA 3ZW8A 1AMNA 4HNHA 4V1CB 4DA4A 3T7IA 4EPRA 1XLWA 5BOSA 1PJTA 1FS5A 3CSSA 3G13A 1XFOA 4LMAA 3A14A 3FA2A 4X8LA 2EBFX 5F1KA 1K7EB 1H23A 4C30A 3REGA 4I55A 2WZDA 5K4AA 2RK6A 4KFTA 3EFHA 5EP4A 3KSRA 3CP8A 1SCAA 4CLEA 2NUTA 3FX2A 4IV0A 1QO9A 2VP0A 1LZLA 1UK8A 4FE7A 4PSUA 1XDBA 2GRUA 2Y1FA 3VYTB 4IKOA 4WJZA 1HEUA 2FY8A 2RHWA 5ECYA 4ZU1X 4XWKA 1NW7A 3MOGA 2HBQA 3VZPA 1XZGA 3G0GA 1L5OA 3KPVA 5HIIA 4D9JA 2QDXA 4MH0R 3VTFA 2VAXA 3SF8B 1SY7A 3WWCA 4C7KA 4GKKB 4IICA 4E32A 3KUDA 4NS1A 2QENA 3GFFA 2OP1A 2PKEA 2DERA 4BQOA 1KFBB 1DJNA 3DP7A 2XUJA 1N7JA 1P0QA 2RHDA 1KK1A 2IOFK 2Z30A 2PX6A 4NDNE 4YJFA 2WSSD 3KYCB 1DC7A 4KVAA 4FYHA 2CLKB 3F9CA 1QGAA 1ZD5A 4JJFA 3TG2A 1DT3A 3DMRA 1GILA 1ECFA 1X1RA 3IPCA 3PQDA 4GKBA 3AB3A 3LUHA 4KE9A 2Q0QA 2GB4A 2Q4RA 3CWZA 1WETA 2YS6A 4EP1A 5KTNA 3KYJB 1JYSA 2QAJA 1GLVA 5CA0A 3N2GA 2JGDB 4P35A 2CT8A 4TYNA 3A58B 4Z8XA 3AF2A 3SSNA 4ZV7A 1QWSA 4KUEA 2C8LA 2WD8A 4XQFA 1JP7A 2INGX 3CGGA 3FGOA 4K9LA 4F04A 3K0AA 1KEEB 1QCZA 3RPEA 3KYDB 5JRJA 2Q4OA 3KTAA 1XDWA 1IUNA 3MLBA 2HU8A 3ZDCA 1I6KA 1WIWA 3HJAA 3HYSA 4ONEA 3CCJB 1I4WA 2BKLA 4PXSA 2V7QD 3H6HA 3VKWA 3EEOA 3JWEA 2DYKA 1MB2A 3DTVD 2V74B 1JPUA 2PZKA 4C7VA 4QVGA 4RY9A 4BEVA 1IDOA 3OEEA 1WBJB 1S4QA 2W6NA 1FL9A 3IVCA 3OZWA 3PGXA 1VQMB 3CEAA 3FB1A 3SCZA 5A5DA 1RM4A 3IAS1 5EHQA 1XNRB 2IXTA 5K2MA 5LMZA 3IXQA 1K6IA 3W3ZB 2VHQA 4DNRB 1JS1X 1WTCA 3TMKA 5KTYA 4L2IB 1OY1A 2QTAA 1CVLA 3LAWA 1QCDA 4M0PA 5FO0A 3FMFA 4YP5A 2ADOA 3CN7A 1KQSB 3EIOA 4ARAA 4PIMA 5AW8A 2I4RA 3BD8A 3VR0A 4BLSA 3G82C 2F4VB 1H9AA 3C14C 4KPGA 4FSXA 5CD9A 4KR2A 2C42A 1LTKA 4ZO7A 4MDFA 2P90A 3NJ4A 4PQEA 4K9SA 3BJRA 2RBEA 3MG9A 1FUUA 3VVBA 2PIAA 1AOXA 1SIBE 5TV2A 3H42B 4LYGA 1WORA 4BV2A 2CXUA 5L3VA 4I9FA 3O3CA 3OCJA 2KX7A 4HGYA 1QMPA 3FAKA 1T0PA 4IDAA 3RJ5A 2QW8A 1XAIA 3ETLA 3A6KA 4BUCA 1XVVA 1KNQA 1RWXA 1Z4MA 3EIQA 3F3KA 3K7EA 4HX2A 1NMEA 1K92A 4EHLA 2OGZA 2IE8A 2ZPAA 3GUCA 2B1RA 4FS8A 4PR0A 5A3SA 4E09A 4R1PA 1FDOA 1PTJC 1WUHS 4DR7B 1SRRA 4LV5B 3RABA 4B6SA 3IKMB 5JNLA 1JIJA 3AUYA 1FA9A 1XNHA 3I92A 4XGNA 3CC7B 5GV8A 2AQKA 4TLBA 2VF2A 4XXHA 2PTGA 1U8AA 4WZLA 4P93A 2HT1A 1XWWA 2A1UA 2QTNA 1PW7A 2C2MA 3CIOA 3FKJA 3HKEA 4GAEA 4NMMA 4UAUA 4XSVA 3RI3A 4DJDC 1M8PA 3IV6A 2Y76A 3OCXA 3UJCA 1EDDA 1DWPA 1TUGA 4Q1AA 1MFPA 2BF4A 2XCRB 3MBIA 4RK1A 1W34A 1XIVA 2SCUA 3MUNA 4WN3A 5TIIA 1OH8A 4UM8B 4XOUA 4PWZA 5C7OO 4C0XA 3EN0A 5FFNA 4AKEA 3F8SA 3KOWA 3DF7A 3UJDA 4F11A 1NJ2A 1WJGA 1O89A 1TD1A 3KV3O 1UMDB 2O0JA 4G1BA 1DWOA 1NW9B 3FZEA 3CC8A 4AZWA 3PLNA 6Q21A 3UV7A 2E5LB 1ID8A 5ALTA 4BRWA 2B7LA 2D0IA 3ZHRA 4D5EA 5CEFA 5ES4B 5LMNB 1NRXA 1P2DA 1U0FA 3GGSA 3GJ5A 4HDAA 5EWJB 1WDMA 3MN1A 2ZRBA 3HC7A 3PGA1 3R76A 5J2TA 5E8RA 3TLGB 5J4LA 4J0GA 2OLKA 3ABQB 2UZ4A 5KAPA 3DKVA 4XWYA 3I2IA 3G8AA 2QG9A 2W2VA 4PZPA 1HFEL 2A0UA 1Z4PX 1GG8A 3BMNA 4DQLA 2PUTA 1A2BA 4PN7A 3QEBZ 1ZCBA 4JUIA 4KDEA 2HJGA 4LZWA 4IDBA 5EZYF 5JSZB 3IO5A 1X9HA 1P80A 5IBPA 3TGWA 2D2VA 5HA5A 1TIKA 2DBQA 4HBGA 1G5IA 2Z58A 3OJFA 3JQFC 3PJDA 4HEA6 1NR7A 4ODIA 4W6QA 1JDBB 5DNWA 2C2KA 4QDXA 4ZMRA 3N3BC 1M6HA 4TMKA 4ZAWA 4G8BA 5IAOA 1RHUA 3E8SA 4MW0A 4UVIA 1LTQA 1N5MA 2ES4A 2FOLA 3LRPA 2C4HA 4J75A 2QVXX 5DRYA 3TO5A 1GOTA 3ZWQA 1BJTA 5L40A 4CF4A 4WEOA 1KD1D 4XLHA 1SURA 5FPPA 2BFWA 2HIGA 3MGKA 5E6RB 5B1IA 4X63A 2F59A 4CU2A 1AK2A 4K0RA 2GPTA 3SBDA 3H1EA 4L76A 2GN2A 3FM9A 4MDYA 4U2CA 1KF0A 2OM6A 3IVGA 3IQHX 2HHHB 4Y2SA 2G3YA 2JFVA 5G4KA 2UUPA 3DTYA 2BIFA 5HCNA 2I3ZA 1N5KA 2QMYA 4XKWA 3PSAA 1SHKA 4XSHA 1BXKA 2FRVA 2DFNA 2NO9A 1PQPA 2VATA 1I6LA 5DYNA 4ZDWA 1BS2A 3ANYB 4S04A 5IM4F 2CHUA 2RK4A 7YASA 1WM1A 3FRHA 2BZSA 2Q2WA 4YCMA 5DTMA 3I9KA 2JIOA 3JR7A 3N87A 4UPEA 5J4HA 7GPBA 1WKBA 1U7DA 3NAZA 1JG6A 4GI1A 2Q6LA 1C7RA 1T5OA 4H6PA 4RPHA 4DW8A 2REQB 3T41A 1B0PA 1TQ8A 3HCDA 1E0DA 3LE8A 5CAEB 3RR2A 1G3UA 1NT4A 2B82A 4C03A 5LJLA 3RTGA 2DUMA 2VJAA 3A1SA 3FF4A 1SCJA 1C4WA 2ZSAA 3UWOA 1CIVA 2FQ1A 2ZOSA 3K94A 3HBAA 3OCCA 3KJNA 4HAOA 4YLEA 3HZOA 3GQBA 5B53A 4Q37A 5C5CA 3FCYA 2NVUB 4BVAA 2CFTA 1PP4A 2C7VA 1RYYA 1W8DA 1YHZA 1G63A 4U2EA 3JYOA 5DU2A 4KTVE 4BRZA 5I4CA 3GFRA 1ZVQA 3GAZA 3DDUA 1Z38A 1KQPA 2VDRB 3LQQA 1E64A 4BJ6A 4I1SA 4U0JA 1AB6A 1BXZA 1EFLA 3MS4A 3AP2A 3COJA 2ZCUA 4HXYA 3W8RA 3BB1A 4C4YA 2C92A 4ZTZB 1YQGA 4WA7A 3N8DA 2VNKA 1QTNA 2C9YA 1SZCA 2BD0A 4FHGA 3WIUA 5MDHA 3EPKA 5G1OA 2VA9A 3WIOA 1GPKA 1ZMTA 2B37A 2G5TA 2Q0XA 3OPXA 1O94A 2EGHA 4OD0A 4X62B 1WB9A 3P8ZA 3PV0A 1NE2A 4K7JA 4DZRA 1B41A 5F1OA 2P2LA 1X1DA 4MWEA 5AUQA 4DIUA 1Y8RB 2UU9B 4QPDA 2PRKA 1KARA 1ZEMA 5F4JA 1BEEA 4ARUA 2BP7B 1VKRA 3UNXA 3ZIDA 4JB0A 5HFJA 1RM3A 4FQ5A 1Z5NA 2B4QA 3LLCA 4RKRA 4TTIA 1ZIOA 3E3AA 3EVFA 3L4EA 4MPRA 1E60A 3GLIA 4GG1A 2QXYA 3W6UA 1VB5A 3IBGA 1J20A 3MQFA 1E6KA 4NZOA 1IU9A 1JHPA 1YK1A 4KKXB 4CKEA 1JAIA 2X1MA 4IJ5A 2AVDA 1PLJA 1DEXA 2CNKA 5DX8A 2HDHA 2W90A 1PTKA 1IATA 2FJ0A 3NEAA 5EP2A 4QBTA 4FZ3A 1QR2A 3DUWA 5E8JA 2QN3A 5JBNA 2FETA 3ZXSA 3ZKAA 3RVLA 3QUAA 4YMWA 5ALQA 1S2LA 2Z2YA 1XN4A 2QP9X 3MXOA 2XWBF 2GBPA 4R1MA 3C43A 3CKYA 3L0DA 3GWGA 3CLRD 1Q77A 3PNBA 3ZE8A 4CMIA 2FH5B 2A5GA 4UCQA 4NCIA 1DG1G 1UQUA 4HQKA 4ZANA 1WUKS 1G7RA 4A8TA 2YS7A 1H2YA 3FLMA 3FYUC 1AM4D 3Q8WA 1AQYA 4XYBA 4DBZA 2OHIA 1K06A 4R9UC 2VBGA 4G4SP 3TGPA 3F71A 5JNUA 1I80A 3U81A 2F9LA 2YXNA 4DYDA 1XD9A 3D8TA 4Y9SA 4LJYA 1ZGCA 3VR3D 1CK4A 4BQSA 1UFRA 4QKQA 5CCDA 1HBJA 3VR1A 2XTZA 1RC1A 4PONA 5BSXA 1E1QD 1OYOA 1T2NA 2HDOA 2NXWA 2QMQA 3L8MA 4K87A 2GJ4A 4LYFA 3H2IA 1LDMA 1PWYE 3KYCA 1MUUA 4IGKA 2XQGA 4RTLA 2CDNA 3O8QB 2BTEA 2ECFA 2RGAA 4EW2A 1UD5A 2GD0A 3PE4A 4RGYA 3GP8A 9LDBA 2DJIA 2XMQA 3LLVA 2XCQA 2QXUA 4OPSA 2X6RA 5TRDA 2B99A 3PFBA 5KW9A 2JH3A 2PVCA 2LIPA 1TEVA 3KL9A 3GRRA 4R2JA 1UPXA 2AFHA 3NGMA 3UG6A 4MUBA 5JCXA 1WW2A 4AY6A 2JGDA 2X0NA 4O02B 4ZQHA 4IVQA 3W34A 4E4YA 1ZICA 1OXSC 2VZEA 3R3SA 1JUDA 5JJKA 5T41A 4D46A 2PH5A 3TM4A 2A9PA 3B3FA 3O73A 5BPFA 2IUYA 4B32A 5DHUA 2ZWIA 4N8EA 4X92A 2O23A 2WWHA 1RHJA 2YJ6A 3G05A 3DWEX 1GGJA 3OE5A 3KYDA 2PH3A 4F38A 4ZO8A 4XGIA 1MA3A 4BE7B 5IJWA 1JSZA 4W8OA 1B0AA 4M21A 2ZAIA 4PZAA 3ABSB 2GA9A 1CUJA 3PUMA 3I8XA 4KQFA 5DNVA 1KEZA 3FFTA 4K1LA 1V48A 4BOYA 1FQOA 4ZDKA 1JU3A 4BV9A 3PUZA 4AP9A 5ERGB 2GYWA 5DN6D 3O3MB 1FP1D 1U3VA 3KUKA 4NYMQ 3IB6A 2DBRA 2B1GA 3D0RA 5K8UA 3W2GA 4MPJA 1ILEA 1KDOA 4TQAA 1KTIA 1NFFA 3DV2A 1CY2A 4XGQA 4L2IA 1M9NA 1W5AA 1VQ4B 1F51E 4DZTA 3WYAA 1MMFB 4F2PA 4QUEA 1M1YB 4OUDB 3BD6A 5LZ4A 1E1RA 4A6XA 5IX8A 1VB3A 1HO3A 2W71A 4XVRA 3X1DA 3T1NA 4CNQA 2VYNA 4NVRA 5EWMB 2Q5CA 1P8AA 2Y68A 2WABA 2D1QA 3PHLA 4KEAA 4B3SB 1WXEA 4XUCA 1K66A 1WHTB 4DQKA 2BJHA 1DAGA 2VDVE 3FYHA 4QEDA 4XORA 1NXTA 1DBQA 2VJLA 3GW8A 4HPXB 4KWCA 4P3OA 1KNXA 3WKEA 1Y0YA 3BZWA 2YMLA 2J6HA 1KAQA 3HKDA 3INNA 1I9GA 2LCQA 2EOAA 1SU8A 1PEAA 2GSWA 3LCVB 4JYCA 4FMCB 1UOPA 1ZN2A 2R5FA 1F0NA 4FDAA 5H82A 2DCUA 1XZEA 4GOLD 5CNIA 1ZD2P 3KQWA 4XJXA 1OT3A 2C00A 3GVCA 2WWYA 4A15A 4RDHA 4CF6A 4D80A 2P2YA 2DTEA 2HMVA 4UHKA 1YJNB 4G84A 3TLJA 1AVTA 2BMFA 2CVZA 3ZE0B 2F48A 2QVGA 1UZMA 5DXJA 2DC1A 4L9SA 2HLPA 4BATA 2XCOA 5JWOA 5F1YA 2Z6VA 4NOKA 3GUVA 1MVOA 4HX9A 2Q2VA 4C0SA 1RWMA 1G4HA 4R1UA 2R4QA 4HEA1 3W6OA 4C4TA 4CLOB 1K1EA 4QXOA 1DBIA 1HE5A 2ORVA 1IHUA 1YA4A 4NYMR 3ISXA 1TPZA 3L0YA 1NSTA 3UW1A 1EGHA 2OPHA 4D3SA 2JLYA 4A7PA 4AK9A 2GZRA 3NFYA 3HCPA 4H4EA 2HDNB 1F48A 4IIGA 1YHQB 1DLJA 3UWSA 5SYNA 2QF7A 4BQIA 3I9MA 3KTFA 4ZMSA 3OFSA 1HM5A 1VQ9B 1YIAA 3MIIA 1JZTA 3BXXA 3T0IA 3IXMA 4QJ5A 3H5LA 3WHKA 1UMDA 2ZE8A 3EWIA 5KVSA 3LC1O 1RADA 1EIZA 5LZ8A 3PHIA 3GV0A 2EZUA 3MMPA 5GINE 3VOTA 3U3KA 1MEJA 3N59A 1RMQA 4LYDA 2XOEA 3CUSA 3ASZA 1W9MA 3M6XA 2NU6B 5CHYA 5EWJA 2QI9F 4WLEA 3WFZA 2CZGA 1M2GA 3DXYA 1GDTA 5MHTA 2PN1A 5EXSA 1L5GB 5BN1A 3LC7O 2VNIA 2HSEA 3GG9A 4QE3A 3VC3A 4MAAA 2PVPA 4LSZA 4NZMA 3H2KA 1PS9A 3BHNA 4V0LA 2A9VA 5CB4B 3QLJA 1HH4A 5G53C 1SB9A 5CRIA 2AZDA 2M6RA 2NIPA 4CMEC 1USGA 1Q20A 4FNGA 4EF4A 1NPYA 4NX2A 2FQXA 2VQ6A 2GQFA 1EUDB 2Z2KA 3VYWA 2PAFA 5J43A 1EQUA 2H2IA 4I5EA 4JIMA 5TQJA 5LJIA 4KH1A 3WLRA 1FQWA 5K3BA 3A3GA 5CT4A 1DTWA 1OTXA 3C3YA 2VAMA 2PE5A 2I0FA 5AVUA 1U9ZA 2GHQA 3LLUA 3OZ7A 5A4AA 4R0NA 3B13B 4WZAB 1I5RA 4JC8A 4Q3AA 3AESB 3ON5A 3D4BA 3IV9A 5CT8A 1MAWA 5J1TB 1DO2A 3OZXA 3S1SA 3R41A 1WV0A 1ZK4A 3ND9A 3PF9A 2P9GA 1YCHA 1E6EA 1OZFA 1EBBA 5E6RA 4CR8A 1E2BA 3DOCA 2R1VB 3ZWVA 4R6XA 2CDRA 4H1HA 5DHAA 1SC6A 2IUEA 4Q3NA 2WWXA 2BDTA 3I0MA 4Y18A 3B12A 5HIMA 2BFFB 2J0EA 4EI2A 3OKAA 1ZRHA 1VSUA 5ICFA 4N18A 4BRSA 4YASA 3GO4A 4IR7A 3HM2A 3GVIA 3SF0A 1Z7BA 3ZCPA 1C9JA 1AMUA 4Q5IA 1KOFA 2RI1A 4DTCA 3CVWA 2AG0A 2ID8A 5J23A 5GM2A 3A9SA 1GJRA 3COVA 2H1CA 3KQSA 1SKQA 4WW0A 3ZDZB 4HD8A 4C2AA 4ECAA 1SXPA 5J3OA 3MT0A 5DBGA 5LLSA 4BDSA 2QVZX 5HNKA 2BJVA 1XEFA 1T1JA 5G41A 1SQFA 4KPFC 4EVRA 3A3BA 3T3NA 1IYZA 2HREA 4HYYA 2ZBPA 5A9RA 2IBTA 5KQPA 3N53A 2BONA 2WU1A 2REQA 4RZHA 1HC7A 1A9TA 1YASA 3NBZC 4C43A 2V1XA 4OG2A 4TXLA 3TIIA 3G0HA 3X1JA 5CAEA 1V9SA 4ZQCB 4EATA 5ITVA 1ZD1A 1WB5A 1V0EA 1ZUHA 2HV8A 2YZNA 1R0YA 2ZQZA 3EDQA 3L01A 4IEFB 4MUYA 4MVJG 5K0CA 3KOOA 3TSCA 2ILVA 3K9GA 4MQFB 2AB0A 2EEPA 3WV4A 4F0JA 4X06A 4KDRA 3QQPA 2F2TA 1E3MA 1CR1A 3V3TA 3LCUA 4ZO9A 4Y6PA 5JRDS 3BTSA 1VF7A 1XL0A 3BMQB 1KQ3A 5FUYA 1J7KA 2OHJA 2J6BA 3HCOA 5HM6A 1BCSB 4MVJP 1C1XB 4M99A 4HWRA 2C9MA 4CLXA 2SKCA 1KK2A 1UM9A 4OQLA 3R6LA 4LWZA 2X9QA 2CL7X 1O5OA 4UZFA 2WD9A 1N07A 3KQMA 2DF8A 2DKFA 4TXMA 3DDWA 5CX1B 4EAQA 1NJ1A 2GX6A 2YQ4A 1DGQA 1ML4A 1DDOA 4FKBA 3UQZA 2E0IA 1HMYA 1JEYB 5F98A 1QG0A 4NEHB 4YTEA 5HM8A 2EFGA 1Z06A 4HXFB 3HB4X 2RHMA 2C98A 3B2QA 1L4UA 1Z7YA 1Y5NA 3IOCA 3QIAA 4A23A 3JXEA 4YQZA 4MJLA 4IJMA 1TO1E 4Q15A 4AO6A 3RT7A 1Y8RA 2DU8A 3ZI4A 1YGYA 2ODBA 1FTSA 1X2BA 2XW6A 1QH9A 1Z47A 2YWJA 1NX9A 2A86A 1ODCA 2BP7A 3LTEA 5CEJA 3BWXA 3L0PA 3GVJA 1PFWA 2DQZA 5IULC 4KAFA 3ZXXA 4C7OB 4P22A 4FFBB 2QNBA 3GCDA 2IVZA 3T1TA 1FF9A 2C2HA 2KB0A 3O8OA 3Q87B 2R6FA 4G4GA 5ER6A 1QHYA 3SQDA 4U63A 4ZC8A 4JI8B 1X7ZA 3QUCA 4FGLA 2VJCA 3LOUA 1FTWA 2Y1XA 4LDJA 1WUYA 4BMZA 4MAFA 4R9NA 3ASQA 3VI3B 1XD2A 2AJCA 5F2EA 2WWRA 3L18A 3LP6A 2GBGA 2J7PD 4WNYA 3KG2A 1QYWA 1QB7A 3DEKA 1EFHA 4W5RA 2FNAA 3EXEB 2MCFA 3WJ7A 1XZJA 2G88A 5AKLA 5KNCD 1PS8A 1V45E 4LA4A 3G5UA 2H8KA 1DFIA 2QUZA 5CVVA 4PABA 1TPYA 4WUTA 5CPFA 4F3TA 7MDHA 2OORA 4RKWA 4Z7NB 1TE2A 3NONA 2WI8A 4LJSA 1NAHA 3T9BA 3TIVA 3ZD6A 1HNNA 4Z8YA 4AVYA 1CBUA 2RGBA 3UMRA 4Z6KA 2FAXA 3HVRA 1V7QA 4OAOA 4JR2A 4KFRA 5T4BA 3TM5A 2B61A 3ZS8A 1MX5A 1VLLA 4D5GA 1W5TA 4A8PA 5BWMA 2IXFA 1FNDA 3GLFA 2YV5A 5CK5A 5JWRA 1YAJA 3SSOA 5TJHA 4GQAA 3A4MA 3PLAE 3C4VA 3OFVA 4J7CA 3GT4A 1OFTA 1PR1A 1QSGA 2G25A 4P1ZA 3WLEA 4COKA 5C7IO 2YIDA 5KQLA 3KQUA 5HILA 4WV3A 1UDWA 2UZAA 3GJ6A 1FNMA 1P74A 4BQFA 2OCDA 3FBWA 3QNWA 4GLBA 4DFDA 5TE9A 1QHGA 2B0JA 2X3UA 2R6GA 4XKVA 4KNWA 1KXZA 4ZYWA 1B23P 1P9OA 1OGIA 1Q0QA 1USWA 1V43A 3QX3A 4GPBA 1CP2A 2ZUUA 4FNMA 1O57A 1RYNA 4MV1A 3O8QA 5LXTB 3MMSA 1PQUA 4ZVPA 1S4MA 2QLMA 5IN5A 1I6MA 1P61B 1VPWA 5F4ZA 5C1PA 4BX0A 1J21A 1P1CA 1F3LA 1Z0SA 2WV9A 4I50B 2O7NA 3JRWA 4K9QA 4ZT2A 3SZOA 3CVXA 2MT9A 4XLLA 6YASA 1KPGA 1LF0A 2XXAA 1U2EA 1USVA 2BUCA 1ZM4A 2X0IA 3QKSB 5K7SA 4BFUA 4RLZA 2FDCA 3RYTC 2ZUDA 3PUYA 1KJZA 2BC9A 4BTLA 3OJEA 2QRZA 1UODA 2TMDA 2HRRA 1S3IA 2YHSA 1W88A 3DJFA 1DTEA 3WQRA 4UAJA 4P7FA 5ALEA 1TNDA 4DPLA 3WKDA 5TQ0B 2GWRA 3WLJA 4BX2A 4OY3A 5KHAA 5JAZA 4Z4VA 4E5PA 4HVCA 4LDNA 5ALKA 4RJTA 4ZVQA 3DCJA 3TG8A 1K7YA 1NA5A 5IEBA 3RIXA 2ZYAA 4MVJA 1Q11A 3FKSA 4UD6A 4GH5A 5AVKA 1KC1A 2GKGA 3DOOA 1OD6A 2OGWA 3FIJA 1BX0A 2QM0A 3IP1A 3ER9A 1GAJA 1VQLB 3HYNA 4FJ2A 1RRVA 4UM5A 4AW9A 4C08A 1PX0A 5J5VA 1JFVA 2IPAB 2PCLA 4HZUB 4Z2AA 2NUAB 1GA4A 4FYMA 2W11A 4IX9A 3TLAA 4NAVA 3RJTA 4DV1B 2J4FA 5DASA 4RQAA 3ESXA 5K3CA 3W3AD 2GJSA 4PYKA 5JSHA 1WCIB 1NMQA 4FZJA 2RH5A 4OUDA 1J2EA 3ZDRA 4BB0A 3CVVA 4L28A 5NLLA 3LXXA 4I2VA 2O2SA 4NBUA 3E58A 1HF3A 3Q3CA 5EWMA 4DLPA 4I1VA 2FZ4A 2DIEA 1WHTA 5LQDA 4JI4B 2V7GA 4RIEA 2VSXA 2Q7XA 1MFZA 2W2NA 3BH6A 2HZ7A 5FWDA 3HM9A 3MC1A 2FHPA 3I9NA 3EDOA 1IY9A 4WKGA 2JCXA 4MSUA 3U5TA 1TAUA 4YCSA 1JFFB 2IYOA 1BA3A 4ND1A 1WG8A 2HBRA 3GXBA 3RU9A 5LC1A 1E3DA 1KRHA 2JASA 1WTAA 5HUHA 2D59A 1KRXA 1YJWB 4MYTA 1Z34A 4XRRA 5BMVA 5AI6A 3K4HA 5EFOA 4FFLA 2ZJFA 5PGMA 4Z7OB 2NSYA 3DUFB 1U4OA 5GOZA 2BGGA 4RD3A 5EKXA 2P9CA 5AUNB 1VE9A 1ORDA 2YC4C 4D43A 4ZT3A 4B1FA 3WSVA 4WCVA 2JLVA 4RSHA 4GO1A 3VAZA 3WL4A 3S0JA 1K8XB 3CH5A 2G6BA 2RH8A 1YOVB 1E9SA 3VDRA 1VLMA 3O74A 3WLQA 4LXIA 2XGMA 2I71A 1PGOA 3GFSA 4C7JA 1ITZA 1DRUA 1XVAA 4M87A 4BPRA 1T1RA 1EFRD 2C5LA 4FN5A 4M2LA 1UEIA 2YBEA 4Q7EA 3V2GA 1F6DA 3IAEA 5B2EA 4IHJB 1M7HA 3GRCA 3MJDA 3C5EA 3CF6R 3TMAA 1HURA 4G5HA 4BZZA 1VJCA 1H2BA 2YWHA 1VCIA 3H6KA 4O4HB 5FUWA 3RQIA 3ASVA 2GEKA 3JVIA 4LE0A 4DCMA 2GERA 3KB1A 3NH9A 2WY2D 3LGAA 3LBHA 4GWKA 3DZ8A 3R7AA 2OHVA 3CU5A 3RYIA 2RHLA 2VJMB 4IRXA 1F1JA 3TVDA 1VJ1A 3MXTA 1IEXA 4YRFA 5CFMA 3BWMA 2NQTA 1TJYA 5F5NA 1E9RA 3R5HA 1SBYA 3BKWA 3TFOA 2NP7A 1KY2A 2HIHA 5CK4A 2XMDA 3JQDA 3K0KA 2N9UA 3ABOB 4HQFA 4YCNA 2NU6A 3I2GA 4LYEA 3TJMA 1USUA 2ALJA 2C2BA 1SOWA 3AKEA 3RIMA 3PNVA 2C3UA 2IYPA 3QPWA 3LCJA 4MRRA 2EZ9A 2M9MA 5GJBA 2I1LA 2IU0A 5CB4A 3CLKA 1QO7A 2EBUA 1OAAA 4DQ0A 3NQ41 3CH4B 3K8OE 3CTMA 3GNSA 3SDBA 4DA8A 5K45A 4IYRA 3DT9A 4CM1A 5TDHA 4AJ9A 1EUDA 3PRJA 3GZJA 4K6OA 4RMIA 4YUWA 3G8CA 4EIWA 2JI9A 5SZIA 1XZAA 2GOYA 2J32A 4URHA 5HQ3B 3TUIC 2HWYA 5D3KA 2I1VB 3UMCA 1DV1A 2SNIE 4WZAA 1XT6A 8ABPA 5KYWB 5IVHA 1A9ZA 3AESA 4EUKA 1NWHA 3QF7A 5DH9A 5I4KA 1Z7EA 4OHWA 4LECA 1DUIA 2XKAA 5H3LA 4B31A 4DN6A 4AI6A 3CM0A 2WSSA 3PR2B 3JQ9A 5B30A 1XYGA 2AX3A 2H48A 1SOMA 4C0WA 2VK1A 1SHUX 4TWZA 1SZPA 3BSFA 4XTCS 1A9PA 3DLAA 5DXAA 5G3YA 3SK0A 2J33A 3W7AA 5BYAA 2AZXA 1RPZA 5BY2A 3U7HB 1TB4A 2XMSA 4MS4B 3AEKB 2NM0A 2BFFA 3I2JA 3W5UA 3KZOA 3QFCA 2TRSB 4XDYA 3K31A 2NZXA 3BOSA 4XOIA 4PO3X 1Z45A 5ICCA 4RXUA 2J9FA 4H15A 3MJ4A 3D2AA 1Z8DA 2C9ZA 4TLDA 4MLDA 4N3AA 1NTOA 3K8YA 3UC9A 1P5RA 4RELA 3GLTA 4WNAB 5TGDA 2A57A 4GF5A 1NRIA 5L45A 3AVTA 5EE1A 2XNKA 2TMYA 4JLVA 4HE6A 2FGJA 2PX3A 5LP6F 1M6WA 1RWVA 3ZXUB 1LZKA 2P6MA 3AKZA 3G71B 2P68A 1X1CA 3GNLA 5EEGA 5KU7A 2A88A 4O59O 5TXGA 1GTG1 2V7QA 2V9ZA 2ZBQA 2QZ9A 2RHCA 1I7PA 1NVVR 5ALYA 3DTVA 5JDIC 2CXXA 4D9IA 1KI6B 1ZC4A 1LA2A 4JJ7A 2CY0A 4OI4A 1U6IA 4LK3A 4CM8A 1EE2A 2WZPP 4G0VA 2PUVA 3R5TA 1TYZA 4MQFA 4TV8A 3LUKA 1MCZA 4CMGA 4EENA 2IUFA 2EJVA 4UTOA 3RRBA 4OYYA 5EMJA 3DT8A 4ER6A 2V7XA 3BGIA 4B84A 1UZNA 1VLHA 3ZYZA 5ESWA 1ZOLA 4BQQA 2EWVA 3Q8LA 2Z6AA 4P1VA 3BY2A 1W9XA 1GR0A 3H3FA 4WESB 4Z0HO 4DMRA 1KQFA 5LFAA 2CV0A 4QXQA 4MVJM 1C1XA 1NM5C 3HB9A 4GVXA 3AB8A 2BGJA 4JLBA 3V9PA 5DNYB 1N3LA 1EHYA 5JD5A 3NI2A 4Q21A 4YR7A 1XWIA 1C3EA 1QG4A 1KA9H 3CVOA 4ACBA 2H51A 2QQFA 3A3YA 2Q9AA 4K9KA 5A9TA 3WMFA 3ME5A 2IOFA 3E9CA 2IW3A 4Q3CA 2IYNA 1UBTS 1RI5A 2I34A 1NBMD 2UDPA 4BJ5A 5JI2E 1DC6A 4RVCA 2X4GA 3OECA 3ASTA 4HQ0A 3SDSA 2IY8A 5EIWA 5JVDA 4ETIA 4MW9A 2ATXA 1ACMA 3KE9A 2NU7B 4XIGS 5JLAA 3IS3A 4IVRA 1TU4A 4QDOA 1M3SA 3I3OA 4I9GA 2QRPA 3LX5A 4H7JA 1CY6A 1XZLA 4AJKA 2CYCA 2ODAA 2TMGA 1MABB 1WUIS 4JX9A 4D8VA 4D97A 1RHKA 1XCBA 2WE7A 3AHDA 1P0MA 4XD2A 2QR3A 3GFPA 3TK1A 5C31A 2FSIA 4QYMA 1GM5A 1SEPA 2AC4A 4PPQA 4M1MA 3BMOB 3T15A 1J9GA 1LPNA 4RXTA 4EO7A 4IP0A 3CJQA 3OTQA 4BNZA 2BMWA 3NAQA 1CZKA 4BNYA 4BO1A 3V1LA 1XL1A 4B44A 3EXEA 5TRTA 4X7RA 3UMFA 1EGVB 1O6GA 4HMQA 4NJEB 4FI3C 4UUBA 3KT0A 3I6ZA 3IO3A 3MD9A 4OKIA 3GROA 2Q8PA 5E9AA 2RFLA 1Z0JA 3LLMA 3UM9A 4FB4A 5K0SA 1GZ6A 1YL5A 4GWGA 4TOIA 3PFHA 5LCXA 4RDXA 2J9YB 4HXEB 1PSWA 3BMCB 1XF1A 2QP3A 4V2UA 1C9NA 1BU8A 4FMBB 5KNDD 2VSFA 2J1LA 4IXMA 1N75A 4G0YA 2BTQB 2EX0A 1G291 1JEJA 3H13A 2NZWA 4F2GA 2UUAB 3EYWA 2Z43A 3CPWB 1W4CA 3MT7A 1YJXA 1G41A 1N3YA 2WJYA 4QUKA 4ZQIA 5JMTA 2VWQA 4HH3C 3RS2A 3HDGA 3H1PA 3PNQA 4FR2A 4P5DA 2H0AA 2JD1A 1H4TA 1T15A 3JZMA 4L5BA 4H3HB 4RYLA 2ESRA 5DSXA 2I99A 3UT6A 4LV6A 4EKNB 1XJCA 4GSLA 2OAQ1 1M76A 3OEYA 1VQKB 3A1VA 4ZT4A 5IYNA 1Z6TA 3LYUA 2P0YA 2GJPA 2AS0A 5GY7A 2YR0A 4FKZA 1KMHA 4A5OA 1MQ8B 3L8GA 2XOXA 3K9HA 2JBAB 1YHNA 2C59A 3C3WA 3PXXA 1JA9A 4NH4A 4EMBA 1N36B 4OA5A 1SAYA 3KKLA 5JT1A 4FSDA 1F2UA 3ZWXA 4ZVTA 4IINA 3T5AA 4OOEA 3PR3A 5LXTA 1HQYE 2Y1GA 3ENKA 2VUTA 1UL1X 3BE8A 1TKRA 1ZHOA 2QW1A 3LNCA 2AE2A 5HR5A 3H5VA 2MU1A 2ZSUA 4I50A 4MEBA 3UPDA 2PSHA 4LHEA 1DXHA 3KJIA 1VJGA 4FINA 4Q34A 2IX9A 1M72A 4G1CA 4G5XA 1JA1A 1BGWA 3M6LA 1EP2B 3QKSA 4LBYA 2V7BA 3EQZA 2GF9A 3OMLA 2H1IA 3TQQA 2QTZA 1DC5A 1LH0A 1FYEA 1UQRA 2FMFA 3AK4A 3FNBA 3CX6A 5DGXA 3GRZA 1IMOA 5C1IA 1CULC 4D82A 1T34A 1SVNA 1M83A 5H83A 1FDWA 5TQ0A 5K8VA 3SS9X 3G8BA 4W1PA 4M4SA 1OXUA 5IMBA 3IBTA 4TZ0A 2DWOA 2NYUA 4TS1A 2BFBB 4B7CA 2FPGB 3OTWA 1T2UA 2XUZA 3TI7A 1QGED 4E2YA 2JLUA 4J0EA 2QP4A 4QAJA 1V26A 3L0IB 3S29A 5IDQA 5EY5B 4JELA 2XDWA 3S2YA 2OG2A 2PT6A 1QO0D 4RJKA 5AIAA 4NH0A 3UGQA 5AI5A 2O4CA 5CFPA 1CT9A 3RBVA 2QLLA 1U2PA 1JTEA 2NUAA 1LQTA 4TS9A 1II8B 4ENRA 5LD2B 2P5YA 2J3LA 3L46A 1V35A 1AHPA 3M2PA 4Y6OA 2FDXA 2WG0A 3C5HA 1WCIA 1K86A 3T95A 2CXOA 3BXHA 4UAVA 5IT0A 1YQTA 2DFDA 1BXGB 1ZA2A 5IAKA 4RPGA 1I14A 4ITVA 1FB5A 2GD6A 4QPZA 2ZJOA 4UUOA 3A8TA 3FRJA 3HDHA 3UMJA 1DZ3A 421PA 3PITA 1E7RA 4B4VA 3D64A 4LHSA 5BQ3A 3ZVLA 3KVOA 1QFMA 1XBTA 2NYAA 3KEFA 5JFOA 4DIEA 1SD2A 3PEFA 2CD7A 4JL5A 3PX3A 2YYSA 4D6XA 5BWBA 1UJ6A 2E18A 5B7GA 4QVJA 4EDFA 1CHDA 2BGRA 2G0AA 2PL5A 3CSDA 2H4XA 1AQIA 2E37A 3BSSA 5AOVA 3VNAA 5C0OE 4O08A 4QUAA 4QSMA 1DAPA 1SOUA 2DQ4A 2GHRA 2W0SA 5ULLA 4KP7A 5HZKA 5K0TA 4LV8B 4V0OA 4H0FA 4WKPA 2IH2A 5ETJA 1IXRC 1ZDMA 1ZD4A 5LP6A 1IN1A 2ZT7A 3UPUA 5CVDA 2FN4A 3VU1A 4M1OA 2LDXA 2CCGA 2X9NA 1YOVA 2E4XA 1XDUA 1CZLA 1Y80A 2GKOA 4Q3EA 4MQ4A 1Z82A 1PD1A 3OIGA 3AVYA 4Z9FA 5DFAA 2O8DB 1W36D 1C1YA 1MH1A 4IH9A 4NBTA 3ITDA 4GL4A 3OTHA 4OHVA 3G49A 4RL6A 1R10A 4CQLB 4IHJA 4WKCA 4LZAA 1KBZA 4O4HA 4UZSA 3KQNA 2A2ZA 2Y6VA 2IS6A 2ZTLA 1CEYA 1KJWA 1WEKA 5D1HA 2JIPA 1NUHA 2H1SA 3DE0X 3MOIA 3UFBA 3TSYA 1GPAA 2KBEA 3ELWA 1GNSA 4OH1A 4LZLA 4C4ZA 1E2LA 4M8KA 5AVYA 4EFNA 5KPJA 4M1KA 2QN1A 5JXHA 2XMBA 5B12A 1QH8B 3PJGA 1L4GA 3UTCA 1Z6AA 2IHJA 1CZNA 1O8BA 1MF7A 4YV0A 1MP0A 4F3NA 3O7MA 4XW2A 5PNTA 3HPQA 1FSPA 1RXEA 4RVGA 4HLUA 3HV2A 2H1LA 4DHWA 1W46A 2RHJA 2I65A 1Z36A 2R87A 4FIDA 4DA9A 2CBGA 3MRVA 4RHEA 2C8VA 4F12A 5HX7A 2D5BA 3GWZA 1MH9A 4JJ4A 3IHWA 5GP1A 2XBLA 3HI6A 5GJVC 3OPYA 3GJ4A 4LG1A 2P6NA 5SYAA 2VF7A 1LDGA 2EKLA 2Q1YA 3BIJA 4Q47A 1O9GA 4FYYA 2QPLA 2E4ZA 4PFSA 4LOLA 2QT1A 3LBIA 1NJGA 3DMPA 4D4HA 3PQ5A 2HSWA 4H2DA 1VPDA 5TPZA 2HT6A 1JHZA 4F1JA 2O8CA 2WP8J 4IJUA 3VR3A 2F3TA 1E2DA 2QQ5A 4WEQA 5T8KC 1E9BA 3T3DA 4ENPA 1QQTA 2O8CB 3PNSA 3QUBA 1SQ0A 1U1FA 2JGEA 2MIIA 5HJ2A 1P4GA 3CNEA 3TKLA 1V71A 3TCXB 1E1QA 2ODQA 2XKBA 3V1YA 2FVYA 3VZRA 2NZYA 1BFKA 2W0MA 3D1JA 4P92A 1JIKA 2HA5A 2YFYA 1PGQA 4JQZA 3T1YB 3O8CA 1PBNA 2ZIAA 1VQ5B 1S96A 3HJUA 3PCXA 3QBJA 4ZARA 1CNEA 5F64A 1LKZA 3EUFA 4KWTA 3AYXB 5BRAA 3ZIAD 4GKJB 3MOSA 2R00C 3EG9B 1H2FA 4MS4A 2CLIB 4TV9B 4IDGA 3IPYA 5HG0A 2I4MA 3UGJA 3TOSA 3HSYA 3O91A 5AJXA 1NJ5A 4C7MA 4RHUA 1F6BA 2Y05A 1Z7GA 3BB3A 1Z5VA 2FFQA 4R98A 2OKCA 2H7CA 4L73A 3WMXA 3RFVA 1L5HB 1EGAA 1A7KA 3I12A 2QD3A 4MMYB 3QSYA 1N2HA 2EF1A 1E98A 4OO3A 1QZZA 4F4IA 1M8JA 5ARBA 2XZOA 4JBNA 4DCSA 1VRWA 4QHSA 1S2NA 3HHPA 3Q11A 4PPGA 2WTXA 3SM3A 3UCXA 1JWLA 4Z7JA 2HF8A 3Q6NA 3NDRA 4RKEA 4W5JA 1COWD 1ISJA 1R4AA 4O4IF 4OFBA 1TUBB 5B7NA 1T0BA 4M0FA 2H4ZA 3JZAA 1T3GA 3NV9A 2JARA 2HADA 4Y0AA 4Y2GA 3OPMA 1TYBE 5DM60 4NE2A 4LRXA 3AM5A 1TM3E 2EHDA 2W2QA 2Z1NA 1CUUA 1Z17A 4MNTA 4NONA 1KI6A 5A05A 4DSTA 4E5DA 5JAUA 3ZLTA 2HK6A 4L57A 3WIEA 3UBMA 5D00A 5DN6A 4C22A 4U7FA 2PL1A 2YV4A 4Y30A 4PINA 1TW2A 3DE4X 1T5BA 2CL5A 2IYQA 4WGFA 5JAOA 4EUFA 2IE0A 4AWAA 3GJ0A 5I7FA 4B4UA 5H3CA 1XA0A 4GQBA 1B42A 4WESA 2X2EA 1J90A 4K8OA 4HUJA 2JLRA 3UBTA 2R84A 3QELB 1Y63A 3RC2A 4ZZIA 5LL6P 4RVHA 4H1UA 3RC9A 1P73A 1N8KA 4IY1A 2JLSA 1PZXA 1V1RB 2H0QA 2CV1A 4GR9A 3G3EA 3JQEA 3DDYA 2ZDQA 1FDTA 4O4JB 4ZA2A 5L95A 2JK1A 1XVTA 2CFIA 1ZMXA 5ALRA 1G20B 4UDNA 1D03A 1NYLA 1VE7A 4L4ZA 5B1HA 3ZBPA 3K96A 4BY9E 1MC1A 1NW8A 3KP1A 1YZVA 4HEHA 1J09A 1US8B 3HRIA 1NN0A 4R5HA 2C9DA 4ALMA 3EWSA 4NBVA 1MOQA 2NU7A 1MDFA 4NECA 3UK6A 1RXVA 5KUTA 1AF7A 2RH4A 4XUGB 1DIOB 2HR1A 1LBTA 2W2OA 2AJTA 3HVIA 4ESHA 1MJ5A 4B47A 4YAUA 4KNVA 3PB3A 1MABA 4JJEA 2NOAA 5EGNA 2DHEA 3WLTA 5CFRA 1P2VA 4Z9AA 5T4FA 4E08A 1X39A 3LUDA 4EWLA 9LDTA 2H4HA 1F0YA 1B8OA 2RCYA 2JN9A 1C7EA 2EFCB 1CR4A 2OLJA 2VHTA 2YZKA 3JALB 3OEWA 5FPSA 1S7GA 3VC2A 3VDNB 5HXBA 5AVJA 4EI8A 3PQCA 4KGXA 2NTVA 4D0NA 2GPBA 4KKTA 1XU4A 2W5UA 3KPJA 4KIJA 4F4DA 4OGGA 5DGHA 4ZIRB 1L9XA 2GM9A 4NJEA 4AY2A 4G23A 4IIFA 3BIXA 2A84A 2ZBDA 3Q0TA 3M8KA 2IWRA 3ICWA 2WUFA 2W7TA 1GTJ1 2IDKA 1RXYA 4Y0NA 2YW2A 4TUYA 2CUNA 4JJAA 1XG5A 3JYQA 3V9AA 3P5BA 5JJ5A 5A4DA 2DOKA 4YT2A 4KIFA 4Y2JA 3VR5H 1UFVA 5FA8A 2PX8A 4I5GA 2XHZA 3Q3EA 3AH8A 4CKYA 3OKCA 2BTQA 1I3OA 1IEWA 3HRKA 3ZGLA 2J08A 3Q98A 1V25A 4UNQA 1V0FA 1QIGA 2XGGA 3FCEA 2IZ1A 4E07A 2GFHA 2IV7A 3R9WA 3QEKA 1NQOA 2W6ZA 4L8VA 1NI4B 2VDUE 1YTUA 1TLTA 4D4IA 1Q16A 2BZ0A 5ESDA 3U1VA 4GM0A 3H1FA 3FHJA 1KJNA 2VDPB 1MV5A 1J39A 2JFYA 2V0NA 5AOBA 1FSFA 4BWGA 1UOOA 2AGVA 2X8JA 3I9FA 2B69A 5JAHA 2AR9A 4DQVA 1JFTA 4WLFA 4G0ZA 2DEUA 3W6NA 1Y98A 5K01A 4V0QA 1UXIA 5K6AC 1EIWA 5D86A 2WZQA 2AZMA 2JBAA 1L4BA 2FSHA 2HHAA 2QTHA 3D4IA 2DAPA 3KDSE 4MP3A 3CE6A 4RY2A 4EJSA 1I5OA 3HNRA 4R1NA 1IVSA 1GPWB 3TJZA 2XI4A 5IJ0B 3U37A 4D44A 2Y1WA 4B2YA 3NTXA 2WICA 2H9YA 3ISVA 5E7IA 3SBEA 5H80A 1P6UA 3W9UA 1KS9A 4DR3B 2G9VA 1FZTA 3BXFA 4MPPA 2ZUSA 3T5PA 1K9MD 3ETDA 3T3GA 3PENA 4KGZA 4A26A 1XTTA 3GA5A 1IBKB 4CE6A 3NTUA 4AQ7A 1PT7A 4LC1A 1QKIA 3JPYA 3KIPA 4L5AA 3VNRA 4YDHB 4E2ZA 1KO8A 4HNQA 4NOJA 1TAGA 1U1CA 1M10A 2MSEB 5CYPA 5LZ5A 3W06A 4AO8A 5IVKA 1XELA 2B4KA 3NYQA 1W2BB 5FWYB 3X1WA 3UKOA 2FUEA 4EHBA 2VEDA 3KXDA 4P3KA 4MV4A 4K6KA 1C3OB 4RSMA 2Q3FA 2XNJA 5FP0A 1JR3E 2ZBVA 1G6OA 5EKTA 3AU8A 5T67A 3LK7A 4DMLA 3L4BA 1RPTA 5ALNA 1W75A 5FDFA 1GPUA 1IM2A 1C9DB 1N3IA 2FPGA 2YH2A 4C0BA 4TKOB 1VJTA 3QI2A 2VSOA 2NSLA 5IHXA 4B3JA 1FQJA 1H2XA 1NVAA 3LQKA 4G1UC 2G1AA 3WOHA 5EHXA 2J9XB 1MB4A 1R5JA 4GYJA 1YR6A 4LN1A 3D6UA 1HWYA 3R3JA 4KQIA 2GAOA 2EBWA 3I61A 3VH3A 3THWB 4I9HA 1VMDA 4RJJA 4W7HA 1II8A 2PFKA 1J9EA 1U5CA 4EKIA 4Z4IA 3ZGZA 1SZDA 1WXQA 2WWIA 3SVTA 3EJWA 3RUAA 4X7EA 3GI1A 3ASYA 2HJRA 1XLVA 3EGVA 4EABA 2Y93A 4CNBA 2GNPA 3CIFA 2WWWA 3TOVA 5BW5A 1BDIA 2X40A 2YINC 4D56A 2P4QA 4O29A 1CUAA 2F1RA 2ZTGA 2D1RA 1Z37A 2Z3ZA 3B1JA 3HFJA 4XDHA 1XEWX 4AUNA 3FMPB 3O8DA 3BA1A 3E15A 4GWLA 3V00A 1SXJC 5DBIA 4PGMA 1JYEA 3M5DA 2Q6TA 4MICA 1SU6A 4PZ9A 2CHEA 2M1ZA 2ZUVA 3OU6A 3B7GA 1Q0UA 1XXHA 3O4RA 3I1FA 3DHWC 4C4XA 5EUQB 4KQMA 5TF4A 3SEZA 4LBZA 4KXMA 3FYCA 4FBLA 4BC0A 1D1SA 1JPVA 1MD9A 3BQMB 1W1UA 2H31A 2YCBA 4MPDA 2I5PO 4NZPA 3AI2A 1N2GA 3DBLB 4US0R 2JCBA 5DI9A 2WWVD 2X2PA 2Z9CA 1PJZA 4LDZA 3UK0A 1SCIA 3CONA 3PG5A 1FU4A 3OBIA 4EQZA 3V7WA 1GHTA 1IN5A 2FK8A 1YDMA 1J6UA 1GKIA 2V96A 5SICE 1NRKA 3R7SA 1Q7EA 4AFNA 3EIFA 1UFQA 2VQSA 3DV0B 1XNGA 3HWRA 3NTRA 4P2GA 4QBGB 4V2IA 1IJKA 3VC7A 1E2IA 1JIUA 2GASA 8ATCA 2VYCA 3MTIA 3P2JA 4ZEXA 5JH7F 1XKQA 5BQ5A 4QBHA 1WDKA 3B6IA 2O2XA 5JMPA 2YTZA 4HSGA 3TLKA 3U61B 2O8DA 1P4HA 3O9VA 4EGJA 3MWJA 3UICA 4MR9B 4CQLA 4WCFB 4P0QB 3FCXA 5D6NA 5EAIA 4N7BA 3EVAA 3DHVA 4JB8A 5BV7A 3KL2A 3BEOA 4DIDA 1ZHFA 3AUKA 3G5MA 1UDXA 2OB1A 1PI3A 3UKJA 2XLBA 3ID6C 4K9PA 2FPXA 2YHIA 5EFZA 1RFGE 3WK6A 3E1GA 2RHOA 4IDHA 4IIUA 2ACWA 3CWQA 1KIMA 4P4NA 4A0QA 2J7PA 2DUUA 5FBLB 3SJAA 1WBDA 4DCPA 1V3QE 3ERCA 4ILEA 3QVWA 3G6WA 4JP8A 2Y0CA 3FVQA 1XMPA 4CT5A 3AHGA 3TR5A 3EHDA 2BFEB 3VUEA 2DPYA 1QHHA 2VOJA 5KNCA 4OOVA 4ADSG 3E3OA 4UFOA 1P1IA 2AMYA 1BZYA 2I22A 2IYVA 1MIOA 3L6RA 3OO1A 3OC0A 1P75A 2OD2A 4J4HA 2X0JA 2FPMA 1OFUX 4JT9A 2PKRA 3LUFA 4MV5A 4Q4DA 1Q2UA 3TTVA 3V4OA 2ZSEA 4AN1A 3WHPA 2Q27A 2R5WA 4M1WA 3T4PA 4A10A 1EVEA 2V98A 3FSGD 4RS4A 3RVDA 3LQ2A 1CP3A 3ACCA 3BRCA 1SHZA 2TYSB 3K4PA 4DBVO 2F8SA 3QIVA 4XUDA 2OTJB 2J5QA 5IZCC 3WBKA 2GH1A 2ZJ2A 3EUEA 4RABA 2DB3A 4WADA 5B4TA 1AO0A 2LP4Y 4OK5A 1I4EB 4G1EB 3RS3A 4WACA 2IBSA 4XB6B 2B34A 2JHFA 3ZX4A 3BULA 4ZGNB 3Q1KA 1DSSG 4IPTA 2XCSB 4Y6QA 1ULSA 1VIYA 1QIDA 3U48A 1U94A 2ETXA 3A26A 2V7TA 4CKWB 2GWHA 5E4YA 2PKXA 3HXTA 4KFSA 2DXIA 5FFFA 3L0ZA 4RKFA 3M4NA 1J8VA 1RJ9B 2OL4A 3R3HA 5IBRA 4QUGA 4CV3A 2HQRA 4YEDA 4A0HA 4PSAA 2XVZA 5IDWA 3HMQA 1LDYA 2DUWA 1ZXXA 4P3PA 4BO8A 2GCEA 1IXSB 1Q3HA 3OBBA 1FMJA 3H5IA 3A2MA 3CMMA 2DBVO 3R1IA 1KI9A 3FPEA 1KOGA 2ZUEA 4NNJA 4NAHA 4MV3A 1ODLA 3EG9A 4NYJR 3M4YA 3WDKA 1YONA 2ZWMA 3RK0A 3TR0A 2FXVA 1XRQA 1A76A