3W2IA

Crystal structure of re-oxidized form (60 min) of nadh-cytochrome b5 reductase from pig liver
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
271
structure length
271
Chain Sequence
b'TPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-cytochrome b5 reductase 3
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
total genus 77
structure length 271
sequence length 271
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w2iA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w2iA02
3JQRA 4B3XA 3QFCA 2BSAA 2VYQA 4ZGNB 3QFTA 4NBSA 1YJNB 4TMTA 3LO8A 1FNDA 2RC6A 1SM4A 1VQOB 2YWGA 3CRZA 4RJLA 1K8AD 1QH0A 1YHQB 1VQMB 1B23P 3U2QA 3CCUB 3CPWB 3QFSA 4BPRA 4G5GA 3VNVA 1QGYA 1KQSB 1ZM3A 3CCLB 4QFMA 1FNMA 3CW2A 3U6KA 2VNHA 4K1XA 3CCRB 1VQNB 4FWTA 3CC7B 2VNKA 4J0QA 3AVWA 1KTVA 4U9UA 4DQLA 3ZZUA 4MYTA 2QMUA 1W2BB 3AVTA 3OZVA 2VNJA 1M90D 3WNDA 2BMWA 3ZZ0A 1BX1A 1VQ7B 3CMEB 3VNUA 4FK8A 4PC7A 2HDNB 1N0UA 2X3UA 3CXCB 3CCEB 1VQ5B 3P27A 3WBKA 1ZM9A 1G7RA 2QDXA 1FNBA 4EH1A 5FA6A 5KSWB 4ZCLA 5AN9A 1KK0A 3ZZTA 1S72B 3AVYA 4Y9UA 1QVFB 1G7SA 4QHYA 2YWHA 3A1FA 4HE5A 4B44A 5GV8A 1QGAA 1ZM2A 3QFRA 3WY9A 1OB5A 3ZC3A 4TMWA 4MYUA 4R71A 3G6EB 1N8RD 3W2HA 4PC6A 4AF7A 2QEXB 3CCSB 2QN6A 1DDIA 4TMXA 1EP3B 4M1KA 4M0LA 4AC9A 1WDTA 1ZUNB 4RD4A 1GAWA 1E62A 1DDGA 1SKQA 1EFTA 1FDRA 4LBZA 4LC0A 3W5UA 3G71B 3G4SB 2XNJA 4RD1A 3CCJB 1W35A 1IJFA 4ZV4A 1Q86D 4PC3A 1JJ2B 1R5NA 2XNCA 1GR1A 4C43A 4ZGQB 3WNCA 3B78A 1NDHA 4B4DA 3OZWA 4FN5A 1NJID 2J7KA 1OGIA 4M4SA 4PC2A 1IB0A 4Y7CA 1DG1G 2FX3A 4H9GA 3J81k 1YJWB 2BV3A 1OB2A 3V76A 3MMPA 2R6HA 1VQKB 1G7CA 4YAWA 1KRHA 2HCJB 1VQ8B 1YIJB 4LBVA 4RCZA 4UAJA 4ACAA 3CCQB 1G7TA 1VQPB 4RCYA 1FNCA 4C0SA 1D2EA 1OGJA 2OK8A 4YHBA 1I7PA 2QTZA 3E20A 2EFGA 3MHPA 1GAQA 3W5HA 2VNIA 1IJEA 1FRNA 5DSZA 3W2IA 2B5OA 3I55B 1EFCA 1QG0A 3ES9A 3WXMA 1U2RA 1QUFA 1QFJA 2CNDA 4TN1A 4Y9RA 3WNBA 5EMNA 1VQ6B 1VQ9B 4WQMA 1K9MD 1GVHA 2OK7A 3CCMB 3CCVB 1YJ9B 1Q82D 4RD2A 1EP2B 4DQKA 4YALA 1D8TA 1AIPA 1JA1A 4AF6A 5TV2A 1KK2A 3LYUA 2DETA 1QGZA 1UMKA 4B47A 1JNYA 2BF4A 1N0VC 2HMAA 2OTJB 4P3YA 1FRQA 2C78A 4F7DA 1R5BA 3WYAA 3OZUA 5H5JA 2DCUA 2BGJA 2RC5A 2YWFA 3CC2B 3OJWA 5THXA 3CB4A 1XB2A 2B7BA 2BGIA 4YAOA 1QX4A 1YITB 2DERA 2XEXA 1TVCA 1BJKA 2D74A 4M53A 4ACBA 1EFUA 2VZLA 1EP1B 4N3NA 4TMZA 4NCNA 1R5OA 3PENA 1D1NA 2PIAA 3JQQA 4LBYA 1JB9A 1KJZA 2BVNA 2CRVA 4IW3B 1KD1D 2QA4B 1QVGB 3VO1A 3ZBTA 4YAUA 1F60A 1A8PA 2BM1A 1XE1A 4B43A 2OTLB 3P26A 4G1BA 3QSYA 2BPOA 1DARA 1TUIA 3AVXA 3B8HA 5GV7A 1QUEA 2GQFA 4HE6A 1TLLA 4LBWA 1ELOA 1HA3A 2DY1A 2GPJA 1KK3A 1ZM4A 2PLFA 4RD6A 3FJOA 3VO2A 1M1KD 4PGOA 1QFZA 3I1FA 4ZCIA 3I56B 1K73D 1BQEA 1CQXA 3JQPA 3OJXA 1B2RA 1VQ4B 1TTTA 3AVVA 1F20A 3U6BA 3W2EA 3W2FA 3FPKA 4TMVA 1VQLB 1Q7YD 2C77A 2EIXA 4Q7JB 1GO2A 2PMDA 1QFYA 1EWYA 2YWEA 3VMFA 4G1VA 4YAFA 4M2LA 5JBQA 3E1YE 1AMOA 1CNFA 1H42A 3ZBUA 2QTLA 3CC4B 3WBJA 1W87A 3CMAB 3LRXA 4P6VF 3CD6B 4ZCMA 1S0UA 2E1RA 3LVBA 2BM0A 4PC1A 4RD0A 3AVUA 2ZITA 2DEUA 1CNEA 3W5VA 5HXBA 1E63A 5TR9A 4RD3A 1KK1A 1GJRA 2B7CA 3MCAA 5H59A 2AHOA 1YI2B 3B82A 2BN4A 1Q81D 1E64A 3AGPA 2NPFA 1EXMA 3SJZA 5TY0A 1W34A 3QE2A 4B48A 3OW2B 3AGQA 1JA0A 1KC8D 4N3GA 1J9ZA 1BX0A 1H85A 3W2GA
chains in the Genus database with same CATH superfamily
1U8UA 3U44A 3W6PA 5F1OA 1U8XX 1OLSB 4LDPA 3ZHCA 4NEQA 2A5YB 5HUJA 1Q7BA 5REQA 3HSSA 4ZEVA 1MGOA 4ZGNB 1WSBA 2HPHA 1VG0B 2PYZA 4XIYA 3HN2A 3EC1A 1GUFA 3B3FA 4RVUA 5I9LA 4LJ9A 2J07A 4Y2YA 3A2LA 3A9SA 1HE8B 2G8LA 1NONA 4U2GA 1EKXA 4OBEA 2QXYA 1RLIA 4RS3A 3RHSA 1FNDA 1GKYA 3JZDA 1Q14A 4ZRNA 3CUWA 2QLJA 4EA6A 5DH9A 1QHEA 5T8KC 1TEZA 1M0EA 1ZI9A 2TRSB 2VAWA 3L0BA 3V8VA 3AYZB 3UYLA 4NE7A 4K0RA 2CUZA 3MTAA 1L7VC 3RSSA 3TDNA 4D2IA 2D7JA 3QG1A 4J3JA 4CYMA 2LNDA 4A26A 1C4XA 1NBOA 4LYJA 4RCVA 1FLAA 3ELDA 5E6SB 4P1VA 3FWHA 1NP6A 3BN3A 4MKHA 1RI3A 2B0JA 3W8FA 3QJGA 3T3OA 1XYVA 3FIUA 3KXDA 2H4YA 4PQFA 4IDFA 2BP7B 2EKQA 5ETJA 4C3VA 1R00A 1L5RA 4DHEA 3QFHA 3H1GA 5E3IA 4EG6A 5HOQA 4TS9A 1E3QA 2J33A 3SYRA 2C4MA 5HOEA 1MC8A 3MN1A 4AJKA 2NUPA 5EJGA 3UHJA 2VNKA 1E0JA 2ZJBA 1UP7A 2OOKA 1P2DA 3JATA 2WP0A 3G2PA 4WI1A 2BIFA 4DQLA 3GUYA 2C59A 5EQTA 1WDMA 3DAYA 5LXTB 1HVXA 5LD2C 3AVTA 1O96A 3RKUA 4AROA 2Y1CA 4J1NA 4QXAA 3RC9A 5KDOA 5F1PA 2KS6A 2O1SA 1JL3A 4Q6BA 2J3LA 5K5EA 1OYVA 3DZIA 5ESWA 4PC7A 3L7MA 1WP9A 2QL6A 2XYQA 1PGQA 2HQ1A 3QRWA 3GLFE 1NJGA 5BQFA 1NV9A 3CXCB 3RV3A 4L28A 3V7UA 5BWCA 2W58A 1XRSB 3BH6A 3DTVA 3EOZA 1CJSA 3CPXA 3DGEC 1WQ3A 2BLNA 3GJ6A 1ADJA 1M2VA 3G2OA 5FL7A 1UL1X 5LOVB 2C03A 3MF4A 2QGFA 4X1IB 1Y4DE 2IYLD 2XITA 3GN2A 5KAMA 4C88A 2HBQA 5FUBA 1E7YA 4ZO7A 3M6XA 4FHEA 2F8MA 2A1TS 1RWOA 3GROA 3WLQA 1S72B 2GN0A 1ENOA 1Z82A 3KKKA 1RRVA 2XUAA 2YVUA 3ZDFA 4J4HA 4AJLA 4X71A 1SK8A 4L8VA 2CNNA 2OWEA 2ZRGA 4UTPA 5JCJA 5LN1A 3PGKA 4G09A 4S05A 4BQRA 1N8TA 1VP3A 4FSDA 5A7HA 4B2LA 3CC8A 1PGPA 4G86A 4GWGA 1Z8HA 2IITA 3V5NA 3C48A 4MCAA 4BEWA 1TI7A 2P5UA 4JB0A 3UUWA 2B92A 4OD0A 4M0CA 9ATCA 1IN7A 4UEOA 3K70D 1WXGA 1NRWA 3ITKA 3UMMA 3PNOA 5TARA 5A1TA 1TUGA 2OTCA 1IZ9A 4JVOA 4XASA 2G6TA 3N7AA 5SYNA 4E07A 4L57A 4G1MB 4E31A 1QRDA 1L7QA 2ZWOA 2DWCA 5CB8A 3R5XA 2QEXB 3DA8A 5DBFA 4DMRA 3S0JA 1P8AA 4ZVVA 5IT0A 5E7IA 4ZZIA 4LZJA 3UAGA 1C30B 2K2WA 3IAM1 1ZI6A 4CNBA 2RAUA 4FZ3A 4U02A 4EFDA 4V1CB 5ADUS 4G0UA 4PANA 4F9EA 1ZD4A 2N1BA 2VKQA 4B3GA 4GPD1 4J0EA 1I33A 4RD4A 1MU0A 3SHQA 4D9JA 5FBQB 1RNLA 4AYWA 4WOKA 3QWFA 3RB8A 4DGSA 3NM5A 4RIEA 1GPLA 1JIKA 2L42A 2FEOA 4R0NA 2EC5A 4RFLA 5H0IA 1X8LA 1F0NA 5T4FA 4HNGA 4TTQA 2NU6A 1KI2A 3OEWA 2XNJA 2CYCA 1Y3HA 2O0KA 4J8PA 4YAJA 1QM5A 4TGLA 2VQEB 4I0WB 2W98A 2WWIA 1VQ1A 4ZVOA 1X7WB 3X1KA 3FOFC 2BBTA 2HDOA 2WJZB 3EZ9A 2O8CB 1NBIA 2VJIA 1Y9ZA 4M7WA 5IAGA 3ANMA 3NETA 3LLSA 1QK4A 2NTYC 2QYHA 3A3YA 4OB8A 4UHDA 4L85A 2F48A 3QVMA 1AB6A 2R65A 1J8FA 4IHQA 5LQDA 2V58A 3LNTA 4BMVA 1OGIA 2Y0CA 3H65A 4FC7A 1YO6A 4V0LA 1P62B 1DOAA 3QUTA 4GOMD 5GZ1A 1UKZA 1AKQA 3T1YB 2ZJ3A 4CMCA 4F45A 4OV6B 2WKSA 1THGA 4FDMA 4NV1A 1JAXA 1P1FA 1U2QA 2CJWB 1RBYA 1WPXA 1VLLA 4AX8A 2XMBA 5JNWA 2Y71A 4QFBA 4UCQA 3FZQA 1M2WA 2OECA 4HYTA 5HVNA 1EX1A 3BTOA 3PDIB 3OLXA 3P94A 2E4UA 2UUBB 2FKAA 2QTRA 3SC2B 2WM2A 3INRA 5FA8A 1YR2A 4NL4H 3EJ6A 1GY8A 4JR2A 1L4EA 2ZTLA 1PX2A 1EGMB 4JU9A 3ENZA 2WTNA 2QR2A 2NUTB 2FRVA 2ODBA 2VJOA 2OLJA 3FTPA 3NALA 4GMXA 4WJKB 4YP7A 5CK4A 4ZOLF 1KFJB 2V7GA 2P90A 3F8SA 1NJSA 1BHO1 2HIHA 2HWUA 2WMNB 5B6JA 3ASYA 5T4HA 4YYEA 2J0EA 4OUDA 4UFNA 4UUMA 2CV2A 5EE5B 3NM6B 3U60B 4KPYA 3UA4A 1N2EA 4RACA 4CLEA 1XJ5A 2C29D 3L8MA 3MILA 1EX9A 3PXAA 4MO9A 5IN5A 5EJ4A 1GGMA 3TXAA 1FFSA 1QQ6A 1WUTA 5AHKA 1YE5A 2FSHA 3DDHA 5IK2D 1KYXA 1AD2A 5HE8A 4B6GA 3SICE 2OCBA 1N6KA 5LL6P 3RTCA 5EHIA 3K70B 1HMYA 1OKKA 1SULA 4ND6A 5DX8A 3NB0A 3LAWA 1QC5A 2WTBA 4GI1A 2WJ3A 4Q48A 4IF4A 4DUYB 4COOA 1QUFA 4DC0A 4DSUA 4EG3A 2BEWB 2X1LA 3T41A 1SU8A 1EVZA 2C2MA 3BMCB 2FW0A 3OT5A 2UXCB 1V0FA 1EGHA 3EAQA 3D1LA 1G0NA 1RABA 2FPUA 4E11A 1PHPA 6ABPA 3NONA 4QEZA 4YCDA 3U3MA 5JY1A 1P2BA 2WE8A 5AXCA 3SYKA 1KQFA 5HTOA 4NE9A 3QKRA 3CCVB 1M1NA 5H4HA 3H19A 3TMYA 3ZGNA 1XMSA 4D9CA 2VXYA 4DMMA 2C31A 2HU2A 2GZ2A 2NU9B 5KNCD 3GU3A 3OOEA 4YR9A 1I51A 1P2VA 5G1PA 4E2FA 2Y1WA 5M04A 2C61A 2JFOA 3PQ3A 2PT6A 1P8JA 3RU3A 9MHTA 1EQ2A 4MITA 3IULA 1JQDA 3C3KA 1XZCA 1WXFA 3FCCA 4MW7A 4BO6A 2PUJA 4RULA 2FSGA 2CV1A 1H5QA 4E5VA 3CJQA 1R9GA 1TC1A 1L4YA 5F2KA 1A3CA 3NEJA 2I0FA 2QTTA 2YR0A 4Q1BA 4BNUA 4WZAB 4C14A 3DFKA 1JNYA 4GRAA 1W7AA 4G0NA 2ZL6A 2JJ2D 3AEQB 2R7AA 2WR8A 3I0ZA 2ARKA 3TWOA 3WFZA 3O1LA 4ITUA 4PBTA 3ROMA 5B1EA 5LP1A 3MOGA 5AM0A 1VL8A 1JBKA 2IGBA 3VYRB 4CKZA 3RCBA 1HQYE 1L7BA 5AW5A 1P80A 1V1RA 2VDNB 3MTDA 1WOPA 1OFIA 2BFBA 3P5SA 4G5SA 3H97A 4R31A 4YRFA 2WFLB 4WK2B 4A9AA 1E3XA 2LCIA 5DGXA 5JC1A 1ATZA 4XZ3A 4CT4B 3G2LA 3VOBA 4W9MC 1U8ZA 1E4YA 2AN1A 1KY3A 3MCVA 3LQRA 3EHDA 5YASA 1YGYA 2R8BA 1CZUA 2CHVA 2PSFA 3D43A 2ETVA 4GVLA 3C3AA 2OXTA 2UZ1A 3TQSA 5JAUA 3KXLA 3VVCA 1K4YA 4GRDA 1L6RA 1W581 1GGNA 3A1WA 2AF4C 1ML4A 4U2KA 1D3AA 1JIUA 3C6YA 5SV2A 4IH9A 1ODCA 4P93A 1X8JA 5GZ3A 4KQFA 5L3VA 3D2CA 4Q7MB 3IUSA 4CMJA 3TQTA 1RJWA 2ZRDA 1AMUA 1ZW6A 5AJVB 4BTLA 3EXG1 4ISCA 4B8YA 3DV0A 1L7RA 4KR0A 3DKIA 1DZIA 1CUGA 3GC6A 1P4AA 5KTTA 3AEZA 3D7NA 3WAGA 3W04A 1LCIA 2PGLA 2CMKA 2WTAA 3K5WA 1Z4QA 4MS1A 4ESEA 2NYUA 2C94A 3S27A 1G8AA 1XXHB 1ECJA 4RVNA 1XWFA 3COWA 2C5HA 3D3QA 4I9GA 4GMGA 4LA4A 5I8PA 1PR1A 2XECA 3C6KA 2YASA 4AY3A 4WZEA 2QQEA 4R01A 2CHFA 5DBHX 5JWOA 1DBPA 4F6RB 5IU6A 5HF9A 2YC2C 4EUHA 2H85A 1UH5A 3CIFA 3DP9A 3X1ZA 1G6OA 1QKKA 1SZPA 4LOHA 3BZUA 3PJFA 3H87A 4U5QA 2NP6A 1YZ3A 2XSZA 2PT9A 2F3PA 4MWGA 2Q3FA 3E5MA 3P0JA 1GL9B 2I62A 1ULTA 4TTSA 1E9FA 2KBEA 1PI3A 1ZIXA 2IPXA 1JDBB 5C0OE 3AVOA 2BKVA 1P29A 2PTHA 3U4DA 3PLNA 4RVSA 2P1ZA 5JD3A 3A0UA 3ITEA 5CA1A 3KKPA 2AK2A 4ZIRB 2ZTUA 2BZ0A 3U5TA 4IVPA 3DE1X 3MT7A 4YREA 4ARZA 1ZYUA 4R2WA 3AI3A 4DIEA 4A0QA 1F8GA 4NZOA 4FM9A 2JH9A 1BNCA 1NR5A 3VC7A 4RLZA 1ZHFA 2D4AA 3T7KA 5E38A 5B2ZA 1VXOA 4EJ6A 3BC1A 3D5TA 5HGJA 3WSWA 2VJPA 2EIHA 3F7OA 3H9GA 1G3RA 1P5FA 2BSXA 1E0KA 4H4CA 1HEYA 4QUIA 3U19A 3CINA 1E2IA 1JLKA 3AW9A 3GK3A 4Y2RA 1JSRA 2Q0QA 3RUHA 4BKPA 1HTTA 3MHTA 3QUBA 5ERYA 4MJ7A 3W5BA 5J1TB 1CUYA 2VDWB 2E6UX 1W1WA 2VWPA 1GKIA 4HXEB 3S99A 4Q3BA 4U7GA 1DTWA 4PHTA 2AUMA 3DR5A 3UWKA 5FX2A 5DGCA 4B2IA 3DSRA 1JLSA 1M7GA 2A84A 2XNSA 3JRNA 1X6VA 4L4YA 3OVMA 4FEEA 4GYKA 2GAFA 1NA5A 1OTYA 1R9MA 4BV9A 2NP7A 3C3EA 1VQ4B 1G1AA 5C5IA 1BEUB 1G9SA 4HDRB 4PX5A 4DT1B 2EARA 2W7TA 5BWMA 4HSEA 2O14A 3DKPA 3JYNA 2RAVA 3QTBA 5DRTA 3II6X 5AVTA 5FULA 3CZPA 5E6UA 4RZQA 1RE1A 1VPLA 1W4CA 1JR3D 1WSWA 4M9UA 4IJWA 1J97A 3PXEA 4M88A 4YT5A 1OBVA 1XA4A 5E4YA 3Q3VA 4E32A 3NTOA 2ZSDA 1T6XA 3RANA 1DBWA 4P86A 3HRIA 1Q0ZA 4WZBA 1JR2A 2PMDA 1UDCA 2DC1A 3SR4A 2AFIE 2C2BA 4BZZA 2JG3A 5HW0A 5IZCC 4TMFA 3WGTA 3QITA 4O4JB 2ZL7A 1V47A 2QJWA 2C5LA 4G1VA 1GFIA 1SKYE 3QY0A 4HFJA 2GXQA 4YAFA 4UCWA 1QSGA 2P9EA 1GZUA 1TQ6A 4WCDA 3RSHA 5CCBA 1GQYA 1TTHA 2O2XA 2O54A 1R6DA 4L5IA 4PHFA 3EIUA 3E1YE 4OAPA 4EG1A 2E82A 4MV6A 4EG0A 3JRXA 1R4ZA 1XHLA 1C4KA 3RFUA 1I24A 2V3VA 4OFXA 1YL7A 4BN5A 3D4OA 3H5AA 3N3AC 1SUSA 4R4JA 4CN9A 3NHUA 1QV6A 3QM1A 5DI3B 3ND8A 1Y7LA 4HDSB 4C08A 3LRXA 3FUXA 2F3QA 2O6HA 1G6HA 2W4IA 2Z9DA 4RANA 5DNEA 5K0ZA 2OHJA 4JOQA 1HE4A 1KKLA 3CLUC 3HBJA 4CCYA 2RGXA 2DRIA 3J81A 1CT9A 4UCXA 1YZYA 3SD7A 3C98A 1RKVA 1M1ZA 4E3WA 1ZJWA 3IOMA 3B1YA 1YCDA 3THOA 1HFEL 2WMYA 1H9CA 4NTZA 1OV4A 3G3EA 3LT5A 3N6RA 2JLVA 1JQBA 1XF9A 1RQ7A 3FVVA 4O1MA 1CNEA 4Q66C 3VI4B 3ZJ4A 1JHRA 2VVTA 1HYHA 4D4LA 5TR9A 1XFOA 1P9WA 2HA0A 4HIZA 2X8AA 2IY8A 2ZI4A 3OZRA 4BO3A 4CIWA 1BU8A 4S1VA 1H0SA 2AHOA 1G2IA 1GSAA 4EB6B 3ED5A 1JHVA 3TW8A 4E3ZA 1CS0A 1ODSA 2HREA 1GSOA 1WUHS 2PHZA 3C5VA 1YULA 2E4YA 3PEVA 5J2UB 4YRMA 2V7QD 4PXSA 1CG6A 1PWEA 5L46A 2H6EA 5AT1A 3UJNA 2CVHA 3NEPX 4FIZA 5ITSA 1UPAA 3IVCA 2XZPA 4PRYA 2EJUA 4CEJB 4C1NA 4A8JB 1YRQA 2ZULA 3GZTB 1E1CB 3PFNA 1Q1EA 3BGDA 4QQNA 3FOCA 1E32A 3P2EA 1GL3A 3VISA 5FWXA 1HR0B 4EHKA 1TAHA 3RSQA 3EQ6A 2W8BB 4DJEC 4DIOA 2IDJA 1QHSA 1YQUA 3IV9A 3VPAA 2EKPA 4OHWA 4KKVA 3FAKA 4F86A 3EZ2A 3LXRA 3DFZA 5KYGA 1YR6A 1NVEA 2MU1A 2KBFA 1SCQA 3CPHA 5IM4F 4L4SA 1ISFA 1FUKA 1Z68A 3AB3A 4ZYLA 1QS0A 1C41A 4YJKA 2B1QA 1P7VA 4LSMA 5DFAA 3O3NB 1HV8A 4OQ4A 1SJ9A 5JCOA 4Z7OB 4MGKR 3ZCSA 3F6YA 5KVVA 1JXQA 1ZOOA 4N8EA 1OX4A 4IDQA 4LFCB 1FUYB 1P5JA 2CBGA 2QSZA 1KBZA 3ESCA 3KTDA 2F9LA 2VUHB 5AKZA 1TYEB 2V1XA 4RH0A 2I1LA 4EUKA 3K6JA 3KL2A 1H6AA 1E1KA 3U4HA 4FYKA 5BQOA 3CPWB 1PBNA 1AN9A 2ZI9A 1VJSA 2CUKA 2B4QA 3VNVA 2GHTA 2E3JA 4F3CA 1H69A 4WOJA 2X53S 2AX3A 3GJXC 2AB0A 3GLIB 4HH3C 1O0SA 3HUDA 4M0MA 1T2NA 4CMGA 3PKIA 2FV8A 2HHLA 3NC0C 1R0LA 4ILKA 4MWDA 221PA 3NXKA 4HLCA 1HX7A 4I1SA 5EE1A 1P77A 5MN5A 1R4NA 4O2AF 3UK2A 5JRJA 3LP6A 1WD7A 4B46A 1DAHA 2FVYA 1VHTA 5BRJA 2PSJA 3BWXA 2B37A 2X0KA 1K2VN 2FPGA 3HADA 4GR4A 4QYIB 2G9NA 4D3XA 4RKRA 3TE6A 1RW4A 1PFKA 3OZVA 3K0EA 4CIXA 2XVAA 1YR8A 3ABQB 3AX6A 2IYNA 2YV1A 3JVIA 3RODA 4AK9A 1NG9A 4G9EA 3ESQA 3KEQA 1M67A 1KPHA 3OZTA 4JLPA 1ULHA 1WD5A 1WXIA 1E9AA 3DBVO 1E99A 5DLPA 3MS2A 4ZP1A 1F6WA 3PC4A 4W1QA 3ZH2A 1KQOA 4DR7B 1Z83A 4F9FA 3W6UA 2HO5A 1KSHA 3L7LA 4P31A 5AJXA 1RKXA 2IYEA 2XTNA 3C3JA 1MT3A 1GU7A 2BAGA 2O2JA 1X3SA 4P35A 2P9FA 4QEDA 4P0QB 2F59A 5ICEA 5M7EA 2VDOB 1VOTA 3NORA 4IFTA 1IK4A 1NF9A 4C4RA 1M8GA 1JEYA 2H07A 2B94A 4R5HA 3ND7A 3X1WA 3WKDA 3CVOA 1T3TA 1QPBA 2FEWB 3FGNA 4N1AA 3RIXA 2P41A 4JITA 2EBWA 3THRA 2DUMA 3EEBA 2F3SA 3EVTA 3ZZTA 4LHWA 3KG2A 5TJ9A 2G77B 1V5EA 3TLZA 4NPCA 4UM9D 4QHYA 1XDUA 3EXEA 5AM3A 1R6BX 3QPCA 5JISA 3L8GA 2R00C 2C98A 3AJ9A 4YIKA 2VJNA 2PSEA 3I5AA 3RWOA 5KYYA 1YHZA 3NUZA 3OO0A 1VJTA 5EUBA 5CM2Z 4PM4A 5KOJB 2XKKA 1F48A 5AP9A 2A5LA 1AF7A 3QEJA 4DNPA 4DR3B 4KZKA 2I34A 2H2WA 1HH4A 2RI6A 5HF8A 3EXIB 4WHMA 3UGJA 1Z0UA 4EPRA 2PZEA 4NSNA 3OQBA 1NB9A 2BF7A 4NONA 2AW5A 1RI2A 2G40A 2WF6A 3KALA 4J6EA 1ZDMA 4LVUA 1HDCA 2VWHA 4Z1MA 2OHFA 5T4BA 3UT5A 4C7OA 3QPBA 1RDFA 4JK3A 2ZBVA 4FJ0A 4J2HA 3BJEA 4JEIA 3VR2D 3WDKA 1W8DA 3HC7A 4CM6A 1Q84A 4FNMA 4FW9A 1C4OA 2OXCA 3BDVA 5C4GB 4MB6A 3DAPA 2NVOA 3HDHA 1IN5A 3OZBA 4MWEA 4NJEB 4NMLA 4CLRB 3A4VA 4OPVA 2W93A 1IYZA 1JBQA 1ENZA 2XQJA 1I6MA 3OQHA 4N0EA 3GZNA 4NCXA 1SKQA 1G9TA 1TLTA 3FR7A 4O4HA 4I08A 4NF2A 1USVA 1JTFA 4B87A 1ZFNA 3EISA 3DONA 2VHXA 2EG5A 3KOMA 2PD3A 3PWTA 1J07A 4AZ3A 3PQ8A 5B5SA 3FUWA 3ZGZA 3RARA 1B8PA 1P0MA 2NPIA 1EUYA 1DRUA 2JZNA 2BTEA 1Z4MA 2MWMA 2N46A 1N2JA 3I01M 3Q8WA 1Q86D 4PC3A 3ZDDA 4KN8A 4A6EA 4CV0A 2GRAA 4C43A 2F17A 5AW7A 3K92A 4I36A 1KYIA 4QDTA 1XMVA 1NXOA 2ZWVA 2XUOA 4EPVA 2WHRA 5KAPA 2OL4A 5EJ5A 4QTTB 7GPBA 2J08A 5ALEA 2C4TA 1IB0A 2XGSA 4C6HA 5CEEA 3K8QA 1EIWA 2P11A 1QAQA 3IQZA 5D8DA 3AUJB 3LY7A 4X6LA 2ILVA 3IJ5A 2LZ0A 2V03A 1NVTA 4LYGA 3D3EA 5DGIA 4F2WA 2ICAA 2PL1A 6NULA 4QREA 5BP7A 2LIVA 1E59A 2PJDA 3LQKA 1KMIY 3A4LA 1XDBA 4RNCA 1NX6A 2DM6A 1GQ2A 1SQ6A 1BN7A 1Q77A 2QRNA 1FVXA 2RDMA 2LWIA 5KW9A 1D0SA 5DX1A 1C9DB 1O95C 4CM1A 5JI3E 5BRAA 4CMKA 2GFQA 1E1RA 4PS0A 2OESA 4PZLA 4FFLA 4F3KA 1LSSA 3CSUA 4X62B 2EGGA 4UM9B 1NWCA 4FYHA 4U0JA 4OL0A 4QYMA 1U7ZA 3T7EA 4R6WA 4BB0A 5BVGB 2R84A 3NJRA 4QKQA 1QP0A 1XZJA 1ZLXA 2B0CA 5LB4A 3Q6NA 3Q9LA 2Z3ZA 5GOZA 1F9EA 3CUKA 3DZCA 3EVDA 3QLVC 3SN6A 4E33A 4LKRA 3STHA 4IJQA 3I9NA 1NMEA 4M49A 3PNQA 4FCVA 4CLXA 2VNIA 2CWWA 2HLDA 1N1MA 3EMDA 3MG9A 1EUQA 1R8JA 1T0PA 2B5OA 2I3DA 2ISQA 2Q2QA 3OICA 3PIDA 5KQRA 3KQKA 2BBOA 1QH1B 4F6LA 5JZ9A 4M76B 1CK4A 3Q8KA 2J0VA 2QD2A 3C4VA 2YL2A 4G2TA 3GA7A 3QXGA 1EU1A 3SYNA 4MIKA 1IATA 2CKDA 3ILVA 3WQSB 5IG2A 4IFBA 4A0SA 4TN1A 1MX9A 1TQDA 2ZK7A 3NC1C 1AQ6A 1CPYA 5DM1A 5DYNA 1OYWA 4CV3A 3LW7A 3RY8A 1W4AA 3AFNA 4II7A 5M5BA 1Y6GA 3MJSA 5BNIA 1NUHA 5ER6A 1OH6A 5TMEA 1YZQA 2Q7DA 5ADHA 2BDTA 2UZ3A 2EZTA 4IXWA 3Q3CA 3BOSA 1GUDA 4JLVA 1VLMA 2BI8A 4C05A 2IZ7A 1R0CA 2Z8ZA 1MPTA 3GB9A 2C54A 4NEGA 5JH7B 1ESMA 2BGWA 2ACEA 1RXVA 1S3FA 1GUBA 1S8OA 2P2YA 2O23A 3S8EA 4I4IA 3D1VA 1W6UA 1KK2A 1UBEA 3ABRB 1YRLA 2DYIA 1ZUWA 4RHFA 3S2IA 4C89A 1E5VA 5EZYB 3SEFA 2CFCA 1YDEA 1CTQA 1EFPB 1CHNA 2ZATA 2YIVX 3ZIAA 3X1YA 2FPPA 2Z2YA 1EZ4A 1JRLA 2ANBA 2Q5FA 2UYOA 5G0VA 5JXJA 2GN4A 2NIPA 2ZTSA 3C3DA 4UOQA 3EFOA 3GLGA 5DN6A 1SUIA 4GZMA 2DCUA 2XVXA 3LM8A 4UDOA 1AKTA 5AVJA 4CM8A 2ZIXA 4OLHA 2CB0A 5BNZA 1T6ZA 2E48A 2RC5A 2PUVA 3Q5GA 4JLUA 1JYSA 4NQRA 3W6ZA 2IQ5A 4EF4A 2E4ZA 1MEJA 3TLGA 1O97D 1JYEA 3DDUA 4TKUB 4X54A 2YHAA 5AJWA 4BP1A 4DMUB 5D2CA 3TBKA 2DR3A 2AUTA 4EUSA 2JLWA 5AVRA 3B1VA 1PWXA 3QKUA 1W4BA 2EFCB 1GV1A 3D0RA 4WCVA 1WU7A 4D74A 3H6GA 4XQGA 3SSNA 4C76A 4NATA 1WVGA 3NM4A 1Y7IA 2QT0A 3H1TA 2Z2KA 3ZNQA 1SBTA 5CU7A 4IYRA 1DQPA 5I9SA 4RFSA 3SHFA 5LNK1 1TW2A 2B4TO 5JQGB 5EHXA 4G8BA 2HF8A 1FLNA 4KHZA 3P2IA 2YXPX 5HJ7A 1MKYA 5KNCH 4UBMA 2X0EA 4FMCF 1FMFA 1RKUA 3OTIA 4R2XA 5FL3A 3GEHA 4L2IB 3TIVA 4HDQB 2OXEA 2Z1NA 4KGDA 4UUOA 3UV7A 4DIUA 3E3OA 1S2IA 4URYR 4OM7A 5BMVA 4HZGA 2BISA 4PRKA 2NUAB 2JGFA 2JAHA 3C5EA 3KPWA 4HNQA 5BORA 1ESZA 3E3AA 4Z4ZA 3LQQA 3RRJA 2ZJZA 4XQ0A 4TLCA 1NL3A 1GZ6A 5JVDF 4H7HA 5BWOA 2HJ9A 3ILYA 3UA3A 1QVGB 2Q4DA 2R47A 3ER8A 1IEXA 1MP0A 3O2QB 5FPYA 5JLAA 1PL6A 2BM1A 3E5HA 2LR0A 1XE1A 4MTCA 2GPTA 2P3SA 4QNMA 5D5QA 4TKMA 3ZGVA 4RDLA 1NFQA 2X2EA 2YZMA 1P4SA 2ADMA 3FHLA 1EXNA 1H1TA 3R0ZA 2VP2A 4KMMA 1UADA 2YZKA 2NTEA 3NT2A 2YV4A 2UVDA 2IY9A 3B9BA 5ELXA 1X7YA 4J0KA 4XGNA 4C20A 2V0GA 2HRRA 2I2WA 5EKTA 3OCVA 4E15A 4GQBA 2Q9AA 1OREA 3R41A 5AKJA 3MJCA 2W0MA 3IE0A 1FUUA 7REQB 5FD8A 1EB8A 3QI2A 5CTJA 1OPRA 4NMWA 3FOZA 1AKEA 4PX3A 1KDOA 1DFIA 2I4LA 5DKFA 3LG2A 3RVRA 3EVNA 2WTMA 3M2TA 3BH7A 1ZM4A 2DX7A 4QARA 4HGNA 1DBVO 4GL4A 3AHDA 3IP7A 4ND8B 1LWNA 4XJVA 1FDTA 1MF7A 1T9BA 2OQVA 5DXAA 3WGGA 1M1KD 1ODLA 1U2PA 3EUEA 2Q5EA 721PA 4Z4QA 4JI4B 2AQHA 3IVXA 2TMDA 5JO9A 1C7FA 2X19A 4Z9AA 4B7AA 3A6HA 4PW0A 4YUZA 3B1KA 5DGTA 4DV1B 3SQDA 5BWNA 4Q4HA 1XPJA 3KE9A 2XDAA 4LDJA 4XX0A 1SVKA 2SCUB 4Q34A 3P9CA 2GBGA 1VI2A 1ZK4A 3IALA 3FWYA 5B53A 4EPXA 3HFJA 4Y1RB 3JALA 1BXGB 3HGMA 4RMGA 3UCEA 4BRWA 2VQFB 4YQZA 4BZQA 2QS9A 1UZLA 2IW3A 3M6LA 3ZWKA 4DLKA 1YFLA 3M82A 2D9RA 4FU0A 3KUXA 3P71T 4N39A 4X9XA 5FB3A 4ZYXA 2AXEA 5KCZA 1NXQA 1YR7A 2AHRA 1PDVA 2H5IA 1RP1A 1VHOA 2JB9A 5JZVA 5JXIA 3GPLA 2Z98A 3U56A 4G37A 4BAGA 2RHWA 1W2WB 4ZTBA 1BKDR 3KZKA 4FDAA 3IOCA 3EN0A 3GQVA 4IJKA 3X1DA 2WF7A 1U81A 3DVQX 1ZN7A 2DP4E 4C3ZA 3OTGA 3ZH9B 2QMZA 2ZJOA 3TR6A 2GJ9A 2WM8A 5DNYB 4ZOBA 4GBED 2B1IA 3CNBA 3QMPA 1EFHA 5A4JA 1GDHA 2FUG6 2FZWA 2ZAGA 3C3XA 3QLUC 2MINB 5CTAA 3CLSC 2GEDA 3WQHA 2MCFA 4L6IA 2P6RA 2IYXA 4J0HA 5I9NA 2HKIA 4IAOA 3H9CA 3GN1A 1RHUA 1N3LA 4BXOB 3EIEA 2VWQA 3DO8A 2Z8YA 3L8YA 4CM9A 4M1SA 3C6ZA 3H8VA 2WIKA 3HJRA 3H04A 3RPEA 4EEKA 4TYNA 1P60A 4D9HA 1ZL2A 2D5LA 5BSXA 2NTNA 2WWGA 4G9GA 4WXPA 3O93A 4LY9A 1H65A 2ZE6A 3VPDA 4KFSA 4BO9A 2R6CA 4WCFA 1A8HA 3UJ3X 5FPSA 4Y2QA 2H3HA 1TVMA 4CMIB 1B1AA 4RPGA 4TT8A 4K0KB 4CQLB 1C7JA 1E2BA 4IDBA 3KL9A 1U8EA 3N2KA 1LNQA 1PKEA 3ROQA 3EEFA 3KWFA 1FSSA 3VUFA 3NJ8A 3MCAA 1QB7A 3I1JA 2DUUA 2Q2OA 3FN4A 5IN4A 5K6AA 2Z30A 1BWPA 3Q6MA 3NT5A 2ZBDA 3DAFA 1N6HA 3QBEA 1WDWB 3C0KA 3O38A 2H4XA 4KKSA 2IHTA 5FWNA 5L45A 3T61A 3CN9A 3G2HA 4MVJP 1N5OX 1BFDA 3STTA 3VBCA 4QO7A 3NHBA 5COQA 4MVJG 1XU7A 3AUUA 5AK6A 2HCRA 2BKEA 3WK6A 2IXDA 1RI5A 3O6VA 4GBGA 3AHIA 3Q3IA 4WK0B 1YFZA 2HA5A 4OHXA 4LXIA 2WWHA 3HCBA 4MQEB 1W29A 3R6GA 1CUCA 5AWFC 5EPUA 3KTAB 4RXUA 3B13B 2P2DA 2ZBEA 5BW6B 5AKEA 1ECLA 3BIJA 1UMCA 3AILA 4PPQA 1YZGA 3D6NB 4Q9HA 1XHEA 1W48A 3OEHA 3UPDA 3VPCA 1JIQA 3EF0A 1U8TA 1QG6A 4J43A 4QWWA 3JRWA 3P20A 3O7MA 2RE8A 5DHFA 3EYWA 4YP6A 1TKAA 2B25A 1SUEA 4URHA 3RC2A 5FL7D 1S6YA 2Q2VA 3ZV3A 1CZRA 1JHOA 1QRTA 3D64A 1T0IA 3MERA 4RVDA 3K09C 2X2OA 3BSWA 1FFYA 4UMFA 2VQ6A 4OPOA 1A9OA 5KREA 2VYFA 4YUXA 4IXTA 2WTUA 3EBPA 3W5JA 2AR9A 3OZAA 3UXYA 4Z4EA 2PYIA 2XE6A 4LRXA 4AWBA 3VAZA 3KXIA 3MXTA 5DGHA 2Z04A 3ANXA 2X86A 5DTIA 4EVIA 1CUUA 4PR3A 3SBOA 3O4IA 2PUWA 2QZ4A 2VYVA 5EERA 1CUXA 1U9CA 2EZ9A 3U44B 1MVLA 1U8AA 3SS7X 4I1UA 4HUQB 2PUCA 1NF3A 1SHLA 1GG9A 2COUA 1A2OA 1PNOA 4TRMA 4YJ3B 2R8OA 3TTTA 4DIMA 4EYSA 2XCTB 1C0KA 1RIIA 3AL0C 3A9UA 3M6MD 4WN9A 1QGUA 4LNUA 1FK8A 3SJAA 2VT3A 5ALPA 2IHZA 4BCDA 1EX7A 1LLQA 4RA6A 5BQ3A 2BGLA 3U17A 1T6BY 4I8IA 5DCWA 1Z28A 4D79A 2XAAA 4X7FA 1GYQA 4RESA 3IKVA 5FYDA 4B81A 1KFKB 1TU4A 1YRAA 2E7ZA 3INNA 3U6KA 5HZAA 3F7NA 3CCRB 1PUIA 1YOVA 2UZ0A 2BDEA 1MAVA 4OLBA 1M7HA 3AZOA 1Y42X 1Z4NA 1ZNYA 2ZKIA 3USCS 4U9UA 4MV5A 3CNHA 1T8PA 5F98A 2X77A 3ZWNA 3MD0A 2RBEA 4FMDB 4IJ6A 3QF7A 5LJIA 1WOYA 5HRUA 1XEWY 2IHVA 4GUAA 3UYKA 3ZQ6A 3WNDA 3NOOA 2X5JO 4J29A 4PAOA 3PYXA 3T1TA 3EBOA 2FSSA 1QFXA 1RXSA 4Q05A 5IPFA 3M1YA 3FYUC 5E4TA 2WC1A 3MRXA 1EJ6A 3C5CA 4Q82A 4R1OA 4DEYA 4DV2B 3B2QA 1E7SA 1DFGA 5JU6A 2O19A 3B1FA 2XB9A 1RHRA 2A92A 2AZ4A 1QAMA 3CO5A 1HK7A 4Q9KA 2M6LA 3P27A 4UAGA 4RV4A 4OKNA 4X20A 4ZI5A 3WL7A 4U7WA 3IPCA 3ZE6A 4OIFA 4JI2B 4C87A 5DRYA 1Q7TA 1YUMA 2OV8A 3TGWA 4Q93A 5LPNA 1XZIA 4ONEA 1A0OA 4ZALA 2VHJA 2PKCA 3WHPA 2EJBA 1O96B 3B5IA 1KH3A 3HN6A 4WA8A 3LIPA 1EFRD 5CCDA 1UJ4A 5KSWB 4Y18A 4DMLA 3O0TA 1HORA 5CEFA 3VU1A 2OSBA 3A1DA 2C57A 1S9HA 3ABZA 2GD1O 3IELA 4AUNA 1Q44A 2QNBA 4WLUA 5I7EA 1T5TA 3BC9A 4HEHA 2EF1A 3ZD9A 2MHCA 1HZZC 3PEYA 4ZPXA 1G7SA 2YWHA 3GCXA 3DTTA 3NHRA 3OIFA 5DCLA 2XXJA 2XMQA 2FN3A 2Y9MB 3DL2A 2NSLA 4KBFA 2QI9F 1QGAA 5FTLA 3FWKA 3VJMA 3MGBA 3ZCPA 1M2VB 4G67A 1GCOA 4O33A 4ERNA 1P2TA 4N8SA 3JX9A 4QOSA 5K3CA 3W77A 2BJHA 1C0EA 1SB8A 4AP9A 1P7CA 2GPBA 2ZYTX 3O47A 4P4GA 3RSCA 1A9RA 1G20A 1V5WA 1RLTA 4BUJA 2PCJA 4CJXA 3WLNA 1SQSA 1L1FA 3A0RB 3NH9A 4JV5B 1JAZA 1N2XA 2ENUA 3E2MA 3U9TA 3URMA 3ZQ4A 4KJZA 1CZLA 5KWEA 2EJVA 1J7KA 1GFZA 1N8SA 3N05A 3PC3A 4Y2SA 4XA8A 2XMDA 3EZYA 1GFSA 3U7HB 5ADWA 4XI9A 1G3QA 2E55A 1DDIA 1J42A 1T10A 3HXKA 4GE0A 4ZQEA 3EAGA 4MS3A 1CHDA 3PUYA 1DTSA 1V1JA 1OI7A 2WAMA 3I9FA 5AI0A 3L8HA 3QW4B 1WDTA 5SY9A 5ECWA 4N65A 1JTEA 2QNIA 2RIRA 1F2UA 3UJPA 4N7BA 1OKKD 3T4PA 1TKCA 2ZJFA 3HWRA 1VE5A 3K30A 1IG3A 3L7DA 4YASA 5A71A 5IJ9B 1BHJA 4MIYA 5ITWA 1UQTA 2MT9A 3B89A 5K0CA 2X85A 1SK9A 3O0DA 1BCRA 3SG0A 3A2KA 1WXEA 3GNLA 1PZGA 1AX9A 4H7IA 1VYUA 1T36B 4WW0A 1KO1A 4XTRA 4MVJA 4ZV4A 3L9WA 1DX9A 1AXGA 5B30A 1H5NA 4LGMA 3U0VA 1B6SA 1L9KA 4B5KA 4ZVSA 1O08A 3NDPA 5C7YA 4WUTA 2DT8A 4PG8A 3VU9A 2VEDA 2H5JA 4QATA 4EKDA 2A58A 1RVDA 3ZHQA 4YV2A 2PUGA 2ABWA 4LISA 1SC3A 4Y9DA 1KMQA 3BGIA 2O0HA 3EE6A 1WDLA 1MQSA 2N3ZA 1DG1G 2WG2A 1MABA 5TQJA 4EY4A 1NT2A 1A8SA 13PKA 1RJ9A 1ZPDA 3EVGA 5EE0A 5BN4A 2NU6B 1W5SA 1SC1A 1RM0A 1C9YA 1OB2A 1XMQB 5B7PA 4E1AA 4BFZA 1URPA 1J8MF 4LTNA 1CQZA 1RRFA 4K6CA 3UFBA 3IA2A 3FLMA 3RAGA 4E14A 3DDCA 4ON9A 1NFRA 2WIBA 1TM3E 2D54A 3RUFA 4ZYTA 2QY9A 1N5RA 2PMWB 2AIRA 2V9ZA 3DLCA 3FMVA 4LHSA 3DOHA 1KC3A 3WYBA 1OBCA 5KTSA 3ZDAA 2GJKA 2PCLA 4ZN6A 4LHEA 3KQUA 2XB2A 4B09A 2XZLA 1BKYA 3EXHA 3FTEA 3E18A 3CWZA 1VB5A 4DC9A 4RK0A 1YI1A 3RLFA 4UVHA 4AKTA 4LE2A 3O8CA 5D6NA 2C7GA 4JCOA 4JI1B 4QPCA 4BVAA 4N41A 2WPDA 1V8OA 1KAHA 1JHUA 2VC2B 3BRQA 5D5HA 4OOVA 3DULA 3E9YA 1NJ8A 2EGUA 3IUPA 4IVNA 3SOZA 3UOAB 4FQ7A 1W30A 4P4SB 5F73A 3MIIA 1MX1A 2Q1XA 3OQJA 2ZJYA 2OMEA 3MXOA 3MHPA 5AOCA 3G2MA 4H59A 3SSAA 3TL6A 3WJ7A 2JJMA 5IULC 4ZKEA 5LDHA 2OXIA 1Z9BA 5LYJB 1QVRA 2Q0HA 1RRCA 2GCOA 2Z2JA 3I55B 3PGJA 3U7JA 2VP5A 3TEMA 1JEQA 3B3AA 3V9AA 4BQOA 4RF2A 1C5KA 4YCCA 1JQAA 2DHRA 4OUDB 5HIIA 3WXMA 1E4EB 2PU5A 4CPDA 3DNPA 5KS2A 1MAWA 1U94A 2BE9A 3DHNA 4IQ8A 1QFJA 1IVNA 3ENNA 1C4WA 2RMKA 3GEMA 3I05A 4WKCA 2O57A 2R6AA 2OZLA 3WNBA 3ZY3A 2ZBPA 3JQGB 1CB7A 2JZCA 4OOSA 3DZGA 3QNMA 4W5JA 4Q1CA 4DBZA 2OXRA 4PZ9A 1UFRA 3O9MA 3EA5A 4IS2A 2AMVA 3CZMA 3ILHA 3K6RA 3ASZA 1QC5B 1F3LA 2TMGA 4DG9A 2H1WA 3CTMA 4PWZA 4RD2A 2A0UA 4N7JA 5L7TA 4EEZA 4BFWA 1I3NA 3H3FA 3KPJA 1TZ2A 3PFCA 3HP7A 2XYVA 4Y2UA 3D3NA 5FYQA 4DCVA 1Y63A 4LXTA 2P3LA 5TV2A 5HKLA 2PXAA 3NWPA 2BGUA 2SKDA 2W11A 5B1SA 4PCLA 1ZXLA 2WU8A 2J3QA 3KWJA 1ES9A 1QGZA 4L3OA 5HSGA 2PMCA 3E35A 3H8SA 4D43A 4LXGA 3TTVA 3HBMA 1PF7E 1ESEA 3I3OA 1YK1A 2ZTMA 3VSCA 2IHNA 2HMAA 1TPZA 2R1VB 3G23A 2XKBA 4IHJF 1JDNA 2V6IA 3VYUB 3E53A 2JGMA 3SX0A 5A4DA 1GR0A 2NSHA 2IX9A 2RHOA 3VYVA 1BO6A 1LXCA 1LSUA 1XEXA 2ATVA 3EWSA 4OMCA 1MORA 3HACA 3CLKA 2D8AA 4Y0NA 2AV6A 5EXEA 1CJBA 3GRKA 3JQBA 1MENA 4GOKA 5TDHA 3F3SA 3Q10A 3KTFA 3U7FB 1YTLA 4C78A 1M3SA 1CDZA 1LV8A 1ZX1A 2E85A 2WUFA 1XB2A 3NU1A 3O8NA 3UMJA 2JAUA 2QTMA 1OZGA 1VMIA 2WHYA 2XBUA 2HWWA 3D1JA 4QOFA 5ALFA 5DT2A 2VRBA 5CBPA 1E3MA 4LPSA 3GJYA 2BWJA 2Y1FA 4CCAA 1OH5A 1T9GS 2QOEA 2AJ8A 4RMJA 1RMTA 3WRXC 3QEAZ 2HV9A 4EI2A 3OOCA 3Q7TA 5E7MA 1Y5IA 5KJ6A 3HO6A 1LI7A 4ER3A 1TVCA 4E2ZA 2BFBB 4GZ5A 1ORDA 2HF7A 3UV3A 1YA8A 3E84A 2CFRA 3BYZA 2VZLA 1M2FA 3L2OB 4ECEA 1TK3A 2GKGA 1SKMA 2RK6A 3GPCA 4WOCA 1HI9A 1N7IA 3UB4A 3R8FA 3GGJA 1NG1A 2X8JA 3CZQA 3RSOA 1YA6A 3EIXA 2C5EA 3PKZA 3VVMA 5HZGA 3OMWA 5TT0A 3SZ3A 2PIAA 3JQQA 2UVQA 3GFSA 3ZWCA 1XJQA 4ZO9A 1W2GA 4RY8A 1Y3CE 1J8DA 3WYCA 1KXJA 4LHVA 1XVAA 2QT1A 4EDHA 5JQWA 3V34A 3DYVA 2OOSA 4L50A 4KXQA 3I83A 4JJ7A 3JAWB 1JQ3A 5J4VA 4QLAA 1XALA 3H13A 5E3HA 2JFWA 3NANA 4O4LB 3VDRA 1CF4A 3KBBA 1GUZA 5FEUA 2Z5GA 1PAUA 1RYEA 5C8XA 1UK8A 2CLOB 5IARA 1QWOA 3CP8A 1FC0A 2FF7A 3GCDA 3IESA 4WFQA 4CEHA 1L5WA 1VFNA 3HY4A 4QUKA 2XXAA 4ND2A 3GJ8A 4Z7NB 4HWRA 1ODIA 4WLFA 5SYMA 2VK4A 3R3JA 3Q0EA 4GOXA 3DUFA 1BMTA 3EDYA 4F2PA 5A3VA 5B6PA 3OFND 3ZIDA 5JASA 4H7EA 2WM3A 3L5KA 1NW6A 1OAOA 1PLKA 3ESAA 4I8XA 1BGVA 1MC1A 3V7NA 3VX4A 5CDHA 2WF8A 1KYZA 1JHYA 3LWDA 3JZAA 3QPWA 2W6JA 2ALJA 3OZGA 4P54A 4AB1A 1J23A 3OX1A 1OZ0A 3K9BA 2QUBA 1LPNA 5IHPA 4FFSA 5JS1A 1ELOA 1TYCA 2RHBA 4I5EA 4GDMA 5B37A 4CZ2A 5JWRA 1O0CA 2GPJA 1S2MA 3RSZA 1J1IA 2GEBA 4XUDA 4D6XA 1NNLA 4A27A 3SYLA 3IAM6 2R11A 2HNKA 4YAEA 2CXTA 4CG1A 3OKXA 1KVTA 2AEFA 4D92A 2HQOA 4I5IA 1T9ZA 3G1WA 4DJTA 5CVUA 3QVVA 2GJSA 3V7YA 2IODA 2H5LA 2BONA 3M5PA 2H4FA 5A4KA 1LBHA 4OA8A 4P5PA 3E05A 1NJFA 3X2SA 2FZCA 5F4JA 2RGNC 3ZY2A 3WWCA 1PJZA 3G9XA 3BZWA 2E1PA 3U3OA 1I3CA 4M87A 1B2RA 2CNKA 3CPJB 1J5EB 1RJGA 1EUCA 4HGRA 3VR0A 2PUHA 5C35A 1MB3A 1APBA 2QUKA 3AKDA 3WLLA 2B1JA 1SG0A 1F20A 2LCQA 1QNLA 4NARA 1KZ1A 1YE3A 2FLVA 1SCBA 4OGGA 1USWA 3I6MA 3QENA 5CLGA 3P1JA 2IV2X 4A36A 2OZKA 3ABSB 4NBLA 4B7UA 3KYBA 1DTWB 2VAXA 3I6YA 5DW0A 5JYBA 1ZJ5A 2QY6A 2Y67A 2KWIA 4LVCA 1KA9H 5EA2A 2YMLA 2IHYA 1KEEB 2RI1A 5DIZA 3WFIA 1IAQA 4ZMRA 1XTKA 2W22A 3WGIA 5HM8A 1HEUA 2H1VA 5L8VA 5IJWA 2F1IA 3ONYA 5FOSA 5D85A 3KB1A 1T8SA 3FSRA 1F0PA 1NYQA 3KJIA 3TINA 2CD9A 1GYPA 4Y7DA 1GNPA 1D4OA 1REQA 3LSTA 3ADKA 4FD3A 4MK4A 4NZZA 5FOTA 4RETA 3VH4A 1L5VA 3PD0A 4ODIA 4HNSA 4Y9TA 5E6UB 1U3CA 2XUDA 3TF5A 1V3TA 4FKZA 1VKNA 1ECGA 4WVLA 1EQAA 3KOOA 5EC8A 4KPUA 5IT9A 4DV4B 2FVGA 3ZV5A 3IIEA 4U4AA 3T3MB 5BUZA 1NX9A 4WACA 1EGVB 1SG9A 2VDQB 4RDCA 4XYMA 3ZHOA 4YV1A 5IKPA 2PGIA 3FRHA 3PUIA 5JTUA 5GM2A 3JWGA 4PO1A 1V37A 2QPTA 1YQGA 1LNSA 2WFZA 3FZEA 4TMYA 4WZBE 2XDQA 1O1YA 5DI9A 1RBZA 1GITA 3SIXA 3VR3A 4KPEC 2Z4TA 4KO8A 3CPSA 4W82A 2AN5A 5L4LA 2FPIB 3O4JA 4QU0A 5K09A 1SC4A 3S5JA 1L4LA 4QEKA 5TE9A 1JDSA 3K53A 4LTDA 3ET4A 5CT5A 3T1NA 2O2DA 1U0JA 4HL6A 1YZFA 1G59A 4PU0A 1E43A 1ZD2P 4QBFA 3CX4A 2ZSKA 3SBDA 3UQZA 3ADOA 4N6NA 4OQLA 4G89A 4QVAA 2DBQA 2HYIC 3NHSA 2LRHA 3LCMA 5DU2A 4RY2A 5A6VA 2XDWA 3NVAA 2W43A 3QTLA 4WY5A 3DT9A 5CG1A 4GI7A 2C2WA 3K4HA 5JRDS 1AHPA 2DFPA 3HR4A 1EHYA 3TLAA 1MVOA 3OBIA 2QQ5A 1JKFA 1T8UA 1VBMA 2VBIA 2BTOA 3DOCA 4W8OA 4QG3A 1V9CA 1U63A 1R0BA 2FMXA 3SKYA 1OXSC 1V6SA 4D81A 4DM7A 4I1YA 3V4FA 4E7OA 4MI1A 3I5MA 2JASA 3PEUA 1JA0A 4GOOD 4HDKB 4OJNA 4U7TB 2ORVA 1ZN8A 4EKNB 5ECDA 1J9ZA 4JDPA 2HJWA 1O77A 3ESRA 1OFHA 5FKJA 4QHTA 2YY5A 4FXPA 3WL8A 1U2GC 1SCIA 1AMNA 2V8BA 3IQDB 3L84A 1I9CA 2JJQA 3MBOA 3N59A 2M32A 2VBCA 1TA9A 4BATA 1E2MA 3PDCA 3ORHA 1OTHA 2JKVA 3ILSA 4RVFA 4CQNA 5IYPA 4IHKA 2XJ4A 4AJJA 2J87A 2XDYA 2AZXA 4V02A 3RC1A 2CJPA 1BZYA 2WJIA 1W75A 2PAAA 4I50F 4R9VA 2FEMA 3FIJA 5TRDA 3OPQA 1BS1A 4C6SA 1XLUA 3C7CB 2QORA 3BJZA 3BFVA 4OBBA 3LTNC 5K99A 3BY1A 2ADOA 2V4DA 5FIUA 1EUZA 4WESB 3DFIA 2EJWA 3DMRA 1RHJA 1XLVA 1RYMA 4K9NA 1V4BA 1Y9EA 4RJIA 5B4TA 4MVWA 1JDUA 4TZ0A 1PIWA 1GPAA 3G88A 3DM5A 3PCXA 1M8PA 3ETCA 3FDJA 4JL8A 1GZ4A 3T0GA 1Y5MA 3KETA 3GQBB 1CY0A 5LP6F 1N3BA 2C3UA 1NQAO 1MQ8B 1XG5A 2JEYA 2ZSJA 4JH0A 1E7WA 5LA6F 4BPRA 1QCDA 2CL6X 2Q07A 5K0TA 3DKVA 1CEQA 2AXQA 3V2HA 4HAZA 4XQ9A 2V5AA 3E81A 4GI2A 3VPXA 5AXAA 3SWWA 4BRZA 4Z1MD 5PNTA 1Y5LA 4LY0A 4XOUA 2AKYA 2C2KA 3RU2A 1DO2A 5BOSB 1R2QA 1SQGA 4F1WA 3QOYA 1VQNB 4XLZA 1CSEE 4GKKB 2GSDA 2Z9BA 1VTKA 1KJ8A 1G291 4HAOA 2Z6VA 1EE1A 5IAJA 4C30A 3E9DA 2HEIA 1DG3A 3PP8A 5GJCA 2YHIA 3UGQA 4MYTA 4EY7A 4I3GA 4JT9A 2FSPA 1KMCA 2EJCA 1T1JA 1V2HE 2W8ZA 3JAKA 4MDHA 1XQBA 1F17A 2GZAA 3IQWA 4R1UA 4B45A 4RTLA 5IMSA 2C7BA 2BMWA 1J2YA 4HRXA 3BWVA 3P8ZA 2GFHA 2ESRA 4COKA 1TJ5A 5ED4A 1QZUA 4P5EA 4IIDA 3V2IA 1SVOA 4ARIA 3PXBA 4C03A 1KJIA 1SEVA 1U5AA 2DWQA 4JLSA 4C7BA 1VBKA 1Q1NA 1SD1A 3LPLA 3R7DA 1N3IA 2DSNA 3UCXA 1E2HA 4V24A 1NV8A 4EJSC 4DCMA 1KWGA 3GMTA 1R4NB 1VQ5B 1AHHA 3TSAA 3WBKA 4TSFD 1KL7A 5K0GA 4TWBA 1SXJC 1D7AA 3KAKA 5EL0A 5EZ6B 3BL6A 1EM6A 2X7HA 4DA0A 3WP0A 1A2KC 2P2CA 2C2OA 2WIDA 3MT8A 1I1HA 4ZQBA 2B4AA 4LFAB 1EJ2A 3D8SA 1GT6A 1QIHA 1U90A 2AFHA 3HJGA 5F35A 4KTVE 3G0CA 3N8IA 1ZUD1 1NE7A 4IZHA 5EJFA 3M6VA 1EK5A 2XKJE 3DYIA 3KOZA 4MW5A 2M98A 1WTCA 4X7RA 4JL5A 4WJZA 2WUEA 2GILA 5EUQB 2HO4A 1K86A 3NVMB 5DP2A 1UK6A 1UJNA 2NU8B 2QRVA 1E2PA 1WMFA 3T38A 3CNQS 3SXUB 5HEKA 1E2KA 1BXKA 3HFRA 4JXXA 3KOUA 4BHTA 3HJCA 2PZAA 1BQ3A 2QW8A 1GPMA 2Q8NA 3SIWA 1D2NA 1VRCA 2NAFA 4QT4A 1PJSA 4U3JB 1H0KA 1ONOA 2UYYA 4EMUA 1BVRA 3GBPA 1E1RD 2I6UA 4C2AA 1GA1A 2IH5A 5FI3A 1NOIA 1C1YA 1OLOA 4IJVA 2ZR9A 1CY4A 1AS3A 4ZDJA 1FPQA 2XIJA 2QSJA 5J59A 3FSJX 4JFAA 1F9AA 1U1CA 2E4VA 2O3TA 4N18A 4N9QA 3G8CA 4G81A 3W6NA 5CDUA 3CCBA 4BNYA 4HVLA 3QVUA 2H08A 3CCSB 1J0AA 1JG1A 2YXDA 1QLJA 1UMDA 2EYUA 3PJDA 1AUPA 1HT2E 2JJ1D 4HFMA 3I04A 3N2LA 4J7AA 4R7ZA 4QZVA 3OTWA 2ZZKA 1V5FA 3HA5A 3WE7A 5BN3A 3EDQA 5IYQA 4F92B 3FPCA 4UDXX 1NN1A 1IWPB 2X42A 4QDXA 5FT9A 2GLXA 3DUWA 1E77A 1OJ7A 3SLRA 1EVYA 4XB2A 3BGWA 1E6UA 3WDLA 3W7BA 1GQRA 2PM8A 2XA2A 2HLDD 2RONA 4DNQA 2UUAB 3HB4X 5I8ZA 3MPUA 4PYIA 3NBKA 3F71A 1OLUA 4JP5A 4KOAA 1CFJA 5I45A 3LX4A 1F12A 1R8QA 1E1QA 2IYTA 4Q9JA 5CFZA 4JR1A 5KQPA 2XMGA 1Z17A 2WT8A 4Z4TA 3R0XA 2D0DA 2H51A 3W3AA 4HCJA 1RZRA 3M89A 4PLVA 3NMUF 4UBKA 5FFNA 3RT9A 4C6RA 1QBKC 5KNDD 2JGDA 2VJJA 4P3XA 2EOAA 5G0TA 3PG5A 3CTAA 2Q3DA 3O83A 2HWYA 1RC8A 2MSKA 1UM8A 2A9PA 4ZDWA 4HVCA 2CNOA 3SZLA 5C5DA 4DEVA 3K9FC 1IPHA 1WE2A 3A05A 3QVGB 4O4HB 4Y2VA 4DQDA 3QBJA 5GQSA 1SXGA 1BWRA 2ERCA 2FOIA 2VJYA 2A7QA 4JELA 4LECA 1NRXA 3I4LA 1HPLA 5DS0A 4YP0A 5AJTA 4IO1A 4JSRA 1YJXA 1YOBA 1PT9A 5GPBA 1TLFA 1KGDA 3ZNPA 3PHGA 1Z6YA 1CE8B 4GC9A 5IDXA 3THYA 3KU1A 5C8DA 3RKRA 1Y8CA 3QHQA 1U0NA 4RQBA 621PA 3ZCXA 1PYOA 3QVXA 3UMGA 2CDCA 3TR0A 1H8HA 3C8UA 3RTDA 4EZBA 5J2TF 3GP8A 3I9V1 4INJA 4JXKA 4RCZA 1ZJ4A 2RGWA 3MQFA 4C22A 3ZIAD 1SKBA 4LJRA 4L0QA 1N57A 2XUJA 5F9HA 1V9LA 3L77A 1OUMA 1XDDA 1I8TA 4TV8F 4I2VA 3NV7A 3LLMA 4OVKA 4I6GA 1W76A 3FX2A 4JVMA 4YYZA 1K75A 3MJDA 5E6RA 4K7JA 3OKFA 5ABPA 4Q6WA 5A0TA 2DIEA 1BKSB 5AVYA 2REOA 4CV1A 3PA8A 4DLLA 4YHBA 2YV3A 3R9KA 3WXBA 2ZAOA 4NVRA 1ULAA 2ZIFA 5ULLA 5F9MA 4DJAA 2Y05A 3M2PA 4QDJA 3K1JA 5IKMA 2IEAA 4QO8A 1M2JA 3QK7A 5AESA 5KO2A 4H15A 1TO6A 1YB4A 4TSKA 1DAIA 5J47A 4W63A 4JAVC 2FWIA 3CISA 4TV9B 2ECKA 2Z08A 2QJOA 1Z6GA 1X80B 3GZ4A 4FS8A 5L7YA 1JEOA 1QHXA 4KQIA 5KOYA 3AW8A 3FI9A 4MPDA 5DV9A 4I5DA 1YDMA 2JL1A 1XQ6A 2WT9A 3AWDA 3H11A 4JQCA 5KYXA 1QQAA 4L76A 2AG0A 2R6FA 4XFDA 3I6BA 4L5CA 1HDYA 5E9WA 3WLIA 4LMBA 5LLSA 3T9BA 1M9NA 1XMOB 3DLBA 4BKOA 2CYBA 5IS2A 3Q3AA 1U9IC 4N0MA 4ZVNA 1CUIA 3SC4A 1JN0A 1UBHS 1P0QA 4B6QA 4C2BA 3FYSA 4AU1A 1U2EA 4R8RA 1M6WA 2KE5A 2ILTA 2VQSA 4RAQA 3CN7A 3D2BA 2QRUA 3WR5A 4P53A 1DQZA 3ZV7A 2HM7A 1THTA 3KBOA 1P33A 4JLJA 4LXYA 1PHRA 2VS1A 4WK4B 4UU7A 5ALKA 3RRMA 4KXFB 5KSPA 3H2GA 1XZ8A 5AYVA 4DQKA 2PRIA 1MJGM 2VP3A 4ITRC 4CTKA 1Y7TA 5BSHA 1ZK1A 1B42A 2YYZA 1CDEA 4NMHA 4JD5A 5E0OA 4MJ3A 4DQVA 1HDEA 2DH6A 1UDXA 1YZTA 1ZH8A 2YN0A 2PVPA 3EEIA 3I6IA 4X6XA 4DV0B 3KT0A 4G9BA 3ZVLA 2QTVB 1NQXA 3W7VA 4GPBA 3H8JA 3R7LA 1XLWA 2OBFA 3MINA 1ZUNA 2OVBA 4IDAA 3T7JA 5HJ5A 1RR6A 4O2BF 2UYCA 2PZ8A 3LCVB 4MHSA 4X92A 4ZYZA 1P1BA 1JYFA 3BXHA 5B1IA 2ZIGA 4BOYA 1KEZA 2CKMA 1FRQA 2B8EA 4N7RA 2P9TA 3R3VA 4N5IX 1NP3A 3OZEA 2R7LA 1WSRA 3VJKA 1NBMA 1J06A 4J9VA 5C8YF 5HR5A 3RBVA 4D9MA 4ZHQB 2G63A 2VP4A 2D62A 4PCAA 3NEYA 3TRIA 4Z7QB 3NIDB 5KYNA 2O2GA 4ETWA 2FAXA 3EGOA 4UZFA 1NBHA 1YJ8A 5ARCA 2OFOA 3WLEA 1CWUA 3DEAA 1FXWF 2P7IA 2VLIA 3EIHA 1ZJJA 2F1MA 1M5TA 2WJPA 4FFWA 4LSGA 1KHHA 1KI6A 1I1QB 4RH3A 5ALLA 1KJYA 5BQPA 2ZRMA 3TRHA 4A3SA 1YNOA 1OV6A 2G25A 2OAEA 1UZAA 1M1YB 5A89A 1NF2A 2JLAA 2VPZA 1O8CA 4R8LA 5DNWA 1QDLB 2H1IA 2FPPB 3UO8B 2P79A 1XNJA 3Q6RA 4URZR 3EFOB 3DQZA 4LK2A 1L6IA 2V6MA 4D45A 3LVRE 2D74A 5JSYA 2OYSA 1BEEA 3ROTA 4TXJA 3VAYA 4MB0A 4CM8B 3NO4A 4CNQA 2XA9A 2AW3A 3GLGE 1U98A 4EHJA 1WBJB 4Q7EA 5LBTA 4E03A 1V6AA 2NQ8A 5CB0A 3OQ6A 2NMVA 4JP1A 2BMAA 3HKCA 3ZDZB 4ND1A 3OESA 3TLGB 4KI0A 4DWOA 1F2TA 4KR9A 4M3NA 3OPVA 5K8TA 3EBLA 2FJ0A 3FZYA 1OILA 1HFKA 4J2OA 1MVNA 5SZJA 4FMPA 3V32A 6GPBA 3IL2A 2QG6A 1I2CA 3KZ1E 2I22A 3ZW8A 2J4FA 4QASA 4G0XA 4OXXA 2AEEA 3AXSA 1DBIA 3M6AA 1HT3A 1NF8A 4EO7A 2ZP1A 1MOQA 1NKTA 1SUCA 1UBTS 1ZIDA 1FP4A 4O2AA 1A4IA 4G26A 4OGFA 3GJSA 1BE0A 1JDJA 3D0QA 3K6KA 1JZSA 5T8KA 4L1KA 4LEIA 3EA0A 3R5FA 4JUCA 4GKVA 3G68A 3BIFA 3VNAA 2OD2A 4L51A 1PDOA 4PBSA 1PEAA 2H29A 1P2GA 4LWZA 4QSMA 1ST3A 2KI5A 4B0PA 1U8YA 2DQYA 3BNWA 1BS2A 1QTRA 4YT2A 4QYWA 4YMGA 2JGEA 1R6XA 2WWFA 3KKOA 1QR6A 3ORFA 5KEIA 2AOTB 2TMYA 2HRBA 4MV3A 2AC4A 2QM0A 4QQKA 2HW8A 1N75A 5K3EA 2O4CA 4RKYA 5GJWC 1YJQA 3RYHB 4CMAA 3U7QA 3OQVA 3ASTA 1TAQA 4M83A 2Y3IA 2J30A 4NFHA 3W8NA 5BUCA 3C1UA 3G89A 3N2EA 4XDHA 4ZYVA 3BTSA 5KDLA 1D9ZA 1K7XB 2P9ZA 4JZKA 4H6XA 5EQDA 5L95A 1KWKA 2HSJA 4YT8A 1C1XA 1J70A 1WDKA 4ISBA 1ZRNA 4QOGA 4B4VA 1Q0RA 1TJYA 1UKCA 3H9JA 4UVIA 4DMCA 6PFKA 4QBKA 4UEWA 3NQ41 1KS2A 4XN0A 1QIMA 1X7YB 2YXEA 4J75A 4BMZA 4CM5A 4I9FA 4GC5A 4E5KA 2JCSA 3D4LA 4GEKA 1KKUA 1T2EA 1JNXX 4ZEOA 2YJ6A 2HOQA 1NMSA 3NDIA 3ZZNA 1H22A 2WKPA 1WPQA 4YMIA 5LQRA 3O2NA 4F9TA 2R6DA 3CEJA 4J0FA 4D4KA 2MSCB 1CZNA 2F1JA 5F76A 4HADA 2EAUA 4XD2A 1EUDA 1LFDB 5JMWA 3RTAA 5B36A 1T26A 3JWJA 3V33A 3WADA 1ZUIA 2QP9X 5KBYA 1VGVA 3UAOA 5CFPA 3AG5A 5AM1A 1DX6A 1I4WA 1JLMA 5ELLA 4NCHA 2P0AA 3PEFA 3TQFA 2WWYA 1DX4A 4JIGA 1P2FA 4K9DA 4LCBA 4QHSA 3VGPA 4A0GA 3E2IA 2PMFA 1OA0A 3GCWA 5DTEA 2WIJA 1J33A 4WWHA 5K4HA 4Q7JB 3F3KA 2VDJA 3UQYS 4MARA 1X7GA 3Q3GE 1PLJA 4EQ6A 2PGOA 3KAJA 1E6CA 3OEHD 2EZUA 2WMOB 3F6CA 4J6FA 1Z56C 2KVOA 3HU2A 3S5UA 3JALB 4MUGA 2BFPA 4P22A 1KBOA 2A4MA 1YB7A 5EP4A 1G60A 4W7SA 1ENYA 4EFKA 4G8DA 2XB6A 1MAHA 3DKRA 4PFJA 2ZB3A 5JBQA 2MMGA 1M54A 1GRNA 3EMVA 3GT7A 1AMOA 2XPCA 2JBHA 4BWGA 3A2NA 2RCNA 3CWQA 3DJYA 3BJRA 3LA6A 1J0DA 2C9OA 3T5GA 2RGCA 3KQHA 4QLBA 5BV1A 3RBXA 3WBJA 3NIFB 3V4PB 4P4NA 4F91B 2GSWA 5KJEA 4DCPA 4MMYB 1Z5PA 3CD6B 3QQ5A 5DYWA 3VR4D 3QYFA 3LFUA 4QDOA 2GK4A 2H16A 1NGSA 1GPH1 4NH0A 1UBSB 1H1DA 2VA8A 1DBSA 2G9UA 2ZGVA 2EX0A 3RGWS 2JHCA 1VBFA 1CY2A 3CVVA 4XFKA 3NEAA 3Q7IA 4MEAA 4X7PA 2BM0A 2GASA 3K9QO 1Q0SA 1Q15A 2VK1A 4RD0A 3TRKA 4BGUA 2ZITA 3W5VA 4YWHA 1EDBA 4EY8A 3VR5A 2G9QA 2ZRQA 3K4QA 4AYTA 1P1CA 2LPMA 4YXWD 1BWQA 4IZIA 2ZBGA 4HX2A 4R54A 1JVBA 2BMEA 3RYTC 3G9TA 4G8CA 1CDDA 2VT7A 2X9VA 4Q9LA 5DYYA 1YZUA 5BYAA 1QRAA 4WADA 1OCEA 3SR0A 5BY2A 3EIWA 3HO8A 5BNFA 3CZ9A 2Q1SA 4G5FA 2W2NA 2PGDA 3TMAA 5L4NA 1VDMA 1SWVA 2X6WA 2P3OA 1NR7A 1SBHA 2IUTA 4NZMA 2OV6A 4YDHB 5CPBA 2QVCA 4BMOB 5L6MB 2NXEA 1Q20A 4JN6B 3N2KB 1G3MA 1R1DA 5E2AA 3U48A 4IOLA 3OIDA 5DM0A 1TCAA 2PRYA 4PNEA 1X94A 3QKTA 3O8OA 1J2RA 4WOPA 1W5AA 4OSOA 5FR2A 2I6SA 2XUIA 4UZEA 3VSEA 4YVFA 3LQFA 4JJFA 1TB4A 5IANA 3JQFC 3UTCA 3J7AC 2YJ5A 4PG6A 3Q41A 2NZUG 4NBUA 3K05A 3QBVA 4MKRA 4KE7A 1QXSA 2K87A 1IHMA 1Q2UA 5FNZA 3DOJA 4IIHA 3VC2A 4ZYUA 4ZVLA 2EF0A 1PR9A 3BD8A 2QENA 1USUA 4RORA 3ZCUA 2A78A 5E1DA 4Z6KA 3ASQA 3FJ1A 1D0VA 2AN3A 3IX7A 3RSLA 4WY8A 4KCGA 3CRZA 2MR6A 2Z9CA 4J76A 2CXRA 5F3RA 1E2FA 2H0RA 3T4UA 4H6PA 2YWCA 1FY2A 3CG4A 1PZMA 1T9DA 4Q03A 2OBSA 2BW0A 3LQ2A 4ZT2A 4B75A 4Y67A 1FQKA 1P3JA 5T3YA 3K70C 1XD2B 3W6OA 1LLFA 2RSLA 3SHWA 4HT3B 4MYSA 2P4SA 2CZQA 2PEZA 5BXQC 3SZGA 2A9QA 1FFWA 3E48A 3JASA 5AI6A 1ISMA 2UVPB 4KNWA 2P67A 1TT5A 4XH9B 3CSSA 2XGJA 1VE7A 5DTJA 4NS4A 1U2DC 1NJ1A 3O95A 4FOSA 1DC8A 3AR7A 5IVKA 4F8JA 1YAJA 3CW2A 2CUNA 2AJCA 1X7HA 5JUWA 1XJWA 1N9ZA 1J0CA 1ZHHA 2P65A 4K1XA 2PS0A 5LNK6 1G3IA 3AMVA 3PSAA 3H5TA 3N0VA 3Q5DA 2AH5A 3FUCA 1P1RA 1UXKA 3KT8A 2V6FA 2ZRAA 1ZMBA 4J0QA 2YNMD 4LZOA 3OPYA 4MEBA 1TECE 2WY2D 4ESOA 1KI8A 1RXCA 2FDXA 5ALMA 4AMZA 4IUYA 4MKGA 5K03A 2AR0A 1JHMA 4F84A 2IZ5A 4G4SP 3ASSA 4O2RA 1L8LA 4LNUB 3AR4A 4FILA 5G02A 1M90D 3UAYA 1A7JA 4JKIA 1KE1A 4G0WA 3B36A 1PT6A 1F2DA 3NT4A 4GO1A 4R05A 2OEPA 4XWAA 4HGZA 1GUYA 2IEIA 4UM5A 5ALVA 1U02A 2AMYA 4PY2A 1N78A 2IPNA 1P4MA 1HMPA 4XR4A 3ZE9A 4KFUA 4PGMA 1R4MA 4TZ6A 1T2DA 4XR9A 3LKDA 4MVJD 1YOVB 3H0KA 4NOKA 4CF4A 4IJUA 4AX4A 2RK3A 3PDWA 1G7RA 1BOFA 1S2NA 1YQEA 3O21A 3LOUA 3OOWA 1U04A 3BA1A 4GKBA 1SD5A 4LZZA 4PYRA 2B8JA 4YNBA 1R37A 4D8TA 2UKDA 5F2EA 3CW9A 1YR3A 4C4OA 3VO9A 4IKPA 4XYGA 1DKPA 3EY4A 3C3CA 1ORHA 2AC2A 4PO3X 2QQFA 1E3JA 3L8ZA 5L3RA 2VDVE 3G7NA 3ZBQA 3MEQA 4JQZA 1KO5A 4XYLA 8LDHA 3QMMA 4G85A 5EXSA 4KRGA 1UJ2A 1BROA 1YI0A 4UUQA 5U9CA 3DKKA 4FXOA 1G4AE 4TWAA 1JILA 4OOEA 2GETA 2ZM5A 2QYTA 1H3FA 2NO0A 4OI4A 2LUOA 4X20B 3WLHA 3R9XA 3V3KA 2W2KA 3UVEA 4OU4A 4LQDA 3D9QX 2ATXA 3PE6A 5EIHA 4CMHA 4QTXA 3RNLA 1DV2A 2W6QA 3MD9A 1ZBQA 2DGDA 3OLVA 3JYPA 4C0HA 1Z7GA 1IN8A 3KQWA 3PT5A 1DXOA 4WBNF 4LY6A 4EYOA 2E4AA 1IU9A 3ZW7A 2I6TA 2QTNA 1FU8A 2Y0BA 4OXNA 2XF2A 5TRTA 3IO5A 4MUJA 2OO5C 1XWWA 5JVDA 1B6GA 1GG2A 2H8GA 4YO7A 3RIMA 3ZHXA 2OBYA 3LPCA 3VPFA 4TMXA 1UBUS 3P9YA 2R8ZA 4FSHA 4CODB 1SCUA 3MAAC 1NVAA 1KE2A 5DASA 1PEDA 1OASA 2NU8A 4DAEA 3VV2A 5JNLA 3CUUA 3ZHVA 1LC3A 1NIPA 3N76A 3F8WA 5B7GA 2GESA 3QNUA 3C1AA 2O3JA 1ZEMA 1TZCA 3WK8A 4KP7A 3K1AB 1VJ5A 2F8LA 1G20E 3AUYA 3VR6A 5GADl 3HJBA 3MJHA 1JDBC 3N53A 1NVMB 1D2GA 1HRDA 1TM2A 1P81A 3L8CA 4GQIA 3TRJA 1RPNA 1P1HA 2OGZA 3KYCA 3UB2A 1G8MA 4NBWA 3L4SO 3PNBA 5INTA 2JRCA 1JJ2B 3HUUA 2HYDA 3NC4A 1T4GA 3M3PA 4N5HX 4RMIA 4D8YA 1VJ1A 4RA9A 3GNQA 3O03A 4LK3A 1H93A 2GX6A 4E5YA 4EZIA 3QPDA 2HH9A 4J0DA 4JVLA 1EVIA 4XCQA 3WK9A 3HMQA 5EZ5A 1KI7A 1N5LA 2OM2A 3GVPA 2AXPA 2Q99A 1M74A 1ICIA 3AJRA 1V71A 1COWA 2EZ8A 3JTMA 3R6DA 4LOAA 5COBA 2BFWA 2KQUA 2X3YA 4KBYA 1OWLA 1PS9A 1LDEA 4A91A 1Z62A 1QK3A 1T6NA 4CUJA 1OB0A 2J0UB 4B6SA 1N5JA 4NIMA 4E5DA 1Z07A 4P08A 1W5TA 2WD7A 3O8LA 2EXXA 3DQPA 4I1IA 4DK1A 4KE6A 3H1BA 4A92A 1KH2A 2BMDA 4HXFB 1RLUA 2CEKA 3P4YA 3FKQA 1HTWA 4Y0VA 1EFKA 4Z4GA 5JJIA 2GZSA 1TGVA 2VJAA 3Q2KA 4M9CA 3L0CA 1KC1A 3AFIA 4YAWA 5DN9A 4EG5A 2JF0A 3VU9B 2A9OA 4QJ4A 2NO7A 2QVZX 4K6KA 5EKUA 5EMJA 3ROKA 5IDWA 2W2QA 1UCFA 4EWLA 2Y1LA 3MGKA 3TPFA 1F3OA 1GP2A 3Q39A 3HP4A 4LZPA 3R74A 3T5DA 5AKYA 4DY4A 3LDHA 2CL7X 4LS3A 4EYGA 1FF9A 5BN4B 2B8TA 1P18A 3ZE7A 5B4VA 1E9DA 1H4VB 4RPJA 4UU0A 2H2IA 3WDSA 1DLJA 3BREA 2JCBA 3NAGA 3AERB 2CLIB 4XFJA 3REOA 5K0FA 3OC0A 4TLDA 4DKJA 1GZ3A 4U7JA 1XMIA 2X7JA 3NG1A 1TKBA 3HYCA 4ZXFA 5LZ5A 2FFAA 4BNMA 3R5HA 1E6EA 1IWBB 1NNI1 4JOCA 1ZCZA 2WIFA 1VL6A 3EMBA 3KD3A 4HDNB 4PLTA 3K73O 1XHFA 4DNFA 5KNDH 3D4IA 3W5HA 4WZKA 2VDKB 5DTRA 2MMCA 1WNTA 4O02B 3B48A 4YRRA 3QELA 3W2IA 1RI4A 3LA8A 3TNLA 4OGWA 1XVUA 3GEEA 1Z5GA 2ZJAA 3BXFA 2YVAA 3N39C 1MIOA 2OZEA 2OFWA 1MJHA 2I3AA 2A59A 1IHYA 3TDMA 3CF2A 4MCJA 4RM0A 4Y9RA 4OYLA 1UD8A 4TL8A 1B14A 2HTFA 5CRIA 5H1YA 2Q7XA 4HAVA 3VNRA 2PRKA 1V3QE 1Q16A 2OGTA 4HAUA 3LBHA 1X15A 1DHTA 5K0NA 1WZIA 5IZCA 4QM6A 3L1JA 2CK3A 1KIMA 1I2MA 1NVXQ 4HAWA 3T9EA 2QT9A 3TQOA 2XVYA 3NWOA 1H0RA 1YJ9B 2ZWMA 2IE0A 4XM2A 2RBGA 1X87A 5TGDA 2G9VA 1J9GA 3G6WA 1K5HA 3MWEA 4OUKX 3VTFA 2GJRA 1JE1A 4YALA 1RSZA 2BHNA 4EPWA 2HPZA 4LYEA 2X4GA 1HYBA 1CD5A 2P9HA 1GGEA 2RKWA 3LUGA 1E79A 1K7YA 3LX6A 5FTWA 2I78A 5ILGA 5FBVB 1NY5A 2QTBA 4QJIA 3U0BA 3HLYA 1PR5A 2EVWX 2B83A 3HKEA 5BSTA 1XJCA 3PA6A 2JRLA 2Y1OA 1N0VC 2OTJB 2VHUA 3F2IA 6Q21A 1XZLA 1KBQA 1GV0A 2WZBA 3E22A 3L0DA 3BD6A 2AD1A 2FWJA 2ZYAA 1PG5A 4H31A 2DFKB 3FCXA 4OQYA 4Q9DA 1TTQB 1INLA 3EEQA 3OZUA 2YWDA 3E3LA 3OUUA 2SICE 3R9WA 4E4TA 1ZW1A 2W6JD 3JY6A 5EG5A 3ZQJA 1KYYA 4UZUA 4C04A 4A6XA 2RHTA 1K92A 1P6QA 1TIKA 3K9HA 2CLMB 2JJYA 4A8JC 3L1KA 3ORQA 4V0MA 1HQKA 3WYDA 1V8FA 3WLAA 1QNFA 2VH5R 3AJEA 1YBHA 4QAJA 4RX1A 3TUJC 3VYSB 1FX0B 4JLOA 5JAIA 4TLMB 1NATA 2VTBA 1I2ZA 2C9CA 3KPYA 4F5DA 3L6RA 3SXPA 4FS3A 4IO0A 4FFNA 4DIBA 3UBTA 3ENKA 1L7NA 4DPKA 4BZXA 3GRYA 5A02A 1WBBA 1W5BA 3MK31 4P32A 3WWYA 3ZN2A 2OBBA 1CLEA 3UB3A 3KB2A 2HT6A 4ACBA 3NS7A 1U3DA 1FXSA 1QQ5A 2WJJA 1EFUA 4DLVA 5HKOA 3VKHA 2H54A 1OE0A 2XQGA 2WM9B 4NWIA 1Z47A 4PGGA 4X1YB 5F7XA 3BE5A 3BWDD 3A6PC 4YRBA 2NACA 4JT4A 4EM6A 3S8YA 5GINE 4WNAB 4L95C 2XQFA 5A7FA 4DUGD 4JI3B 4QPJC 1BXRA 2O5CA 1JR6A 4HQKA 2LV8A 4P6YA 1HUQA 3JQ6A 4NX2A 5EIFA 3TQIA 5ALOA 2R4TA 8ATCA 4DRXB 4TM7A 1YDWA 1PWZA 3U4QB 1MTZA 3CUYA 4OQPA 1GPUA 4F4IA 4NU5A 3FCUB 3Q1LA 3H1FA 4RABA 1XK6A 2OTLB 1U0EA 2RHDA 2PJUA 2AT1A 2X8JB 5HNKA 2X13A 2QPOA 4Z4HA 3T95A 2V7BA 4TS1A 1KP3A 1XK7A 2WU1A 2J9RA 4NICA 4A73A 1T8RA 4E51A 2ID8A 4NXNB 1JPVA 3R5KA 4HEA1 5F2OA 3CHYA 2QRQA 4TTRA 4Z4YA 4PONA 3WNZA 4DRYA 4RTSA 1QRUA 3AEKB 2JEZA 2C4VA 1P5ZB 1P39A 2ZUCA 4GP9A 3BEOA 3TXXA 1DAPA 1TK9A 2ZTHA 4D25A 4RZ2A 1X74A 1ZO8A 2RHHA 3D3JA 4P98A 3RVSA 3W9BA 4EUNA 3TIGA 3NIWA 1STOA 3B2EA 2N47A 2XXAB 3CVXA 1T4CA 4TKVA 3MLBA 3AM4A 3IHTA 5LUBA 3T7SA 2WYUA 4JI6B 3R5SA 4YP1A 4F3TA 2X76A 3EQ7A 5CM8B 4ENQA 3FDXA 4GKAA 2H92A 3RVLA 4YAKA 2GD6A 3EK2A 3LOPA 2VPQA 1OF1A 1NVUQ 1QB8A 4HB0A 4AZVA 1A8QA 3OKAA 4Q3CA 1W88B 3FJYA 3GJZA 1PWYE 2YMPA 2ZRLA 4FT2A 4K8RB 5JI2E 1NQOA 4MKXA 4EGCB 5GJBA 2O8EB 1IN1A 1BA2A 1K2WA 1GU1A